data_4K4I
# 
_entry.id   4K4I 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4K4I         
NDB   NA2435       
RCSB  RCSB078880   
WWPDB D_1000078880 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4K4G . unspecified 
PDB 4K4H . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4K4I 
_pdbx_database_status.recvd_initial_deposition_date   2013-04-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vyas, R.' 1 
'Suo, Z.'  2 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for the binding and incorporation of nucleotide analogs with L-stereochemistry by human DNA polymerase lambda.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            111 
_citation.page_first                E3033 
_citation.page_last                 E3042 
_citation.year                      2014 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25015085 
_citation.pdbx_database_id_DOI      10.1073/pnas.1401286111 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vyas, R.'         1 
primary 'Zahurancik, W.J.' 2 
primary 'Suo, Z.'          3 
# 
_cell.entry_id           4K4I 
_cell.length_a           194.440 
_cell.length_b           97.580 
_cell.length_c           105.150 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4K4I 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase lambda' 38254.574 4   '2.7.7.7, 4.2.99.-' ? ? ? 
2 polymer     syn 
;DNA (5'-D(*CP*GP*GP*CP*GP*GP*TP*AP*CP*TP*G)-3')
;
3390.209  4   ?                   ? ? ? 
3 polymer     syn 
;DNA (5'-D(*CP*AP*GP*TP*AP*C)-3')
;
1793.219  4   ?                   ? ? ? 
4 polymer     syn 
;DNA (5'-D(P*GP*CP*CP*G)-3')
;
1191.818  4   ?                   ? ? ? 
5 non-polymer syn 
;[[(2R,5S)-5-(4-azanyl-5-fluoranyl-2-oxidanylidene-pyrimidin-1-yl)-1,3-oxathiolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate
;
487.186   4   ?                   ? ? ? 
6 non-polymer syn 'CALCIUM ION' 40.078    23  ?                   ? ? ? 
7 non-polymer syn 'ACETATE ION' 59.044    6   ?                   ? ? ? 
8 non-polymer syn 'CACODYLATE ION' 136.989   2   ?                   ? ? ? 
9 water       nat water 18.015    479 ?                   ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pol Lambda, DNA polymerase beta-2, Pol beta2, DNA polymerase kappa' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEACSIPGIGKRMAEKIIEILESGHLR
KLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAA
QAFNSGLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLPGPG
RRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLL
GLPYREPAERDWLEHHHHHH
;
;MSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEACSIPGIGKRMAEKIIEILESGHLR
KLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAA
QAFNSGLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLPGPG
RRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLL
GLPYREPAERDWLEHHHHHH
;
A,E,I,M ? 
2 polydeoxyribonucleotide no no '(DC)(DG)(DG)(DC)(DG)(DG)(DT)(DA)(DC)(DT)(DG)' CGGCGGTACTG B,F,J,N ? 
3 polydeoxyribonucleotide no no '(DC)(DA)(DG)(DT)(DA)(DC)' CAGTAC C,G,K,O ? 
4 polydeoxyribonucleotide no no '(DG)(DC)(DC)(DG)' GCCG D,H,L,P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   SER n 
1 4   GLN n 
1 5   LYS n 
1 6   ALA n 
1 7   THR n 
1 8   ASN n 
1 9   HIS n 
1 10  ASN n 
1 11  LEU n 
1 12  HIS n 
1 13  ILE n 
1 14  THR n 
1 15  GLU n 
1 16  LYS n 
1 17  LEU n 
1 18  GLU n 
1 19  VAL n 
1 20  LEU n 
1 21  ALA n 
1 22  LYS n 
1 23  ALA n 
1 24  TYR n 
1 25  SER n 
1 26  VAL n 
1 27  GLN n 
1 28  GLY n 
1 29  ASP n 
1 30  LYS n 
1 31  TRP n 
1 32  ARG n 
1 33  ALA n 
1 34  LEU n 
1 35  GLY n 
1 36  TYR n 
1 37  ALA n 
1 38  LYS n 
1 39  ALA n 
1 40  ILE n 
1 41  ASN n 
1 42  ALA n 
1 43  LEU n 
1 44  LYS n 
1 45  SER n 
1 46  PHE n 
1 47  HIS n 
1 48  LYS n 
1 49  PRO n 
1 50  VAL n 
1 51  THR n 
1 52  SER n 
1 53  TYR n 
1 54  GLN n 
1 55  GLU n 
1 56  ALA n 
1 57  CYS n 
1 58  SER n 
1 59  ILE n 
1 60  PRO n 
1 61  GLY n 
1 62  ILE n 
1 63  GLY n 
1 64  LYS n 
1 65  ARG n 
1 66  MET n 
1 67  ALA n 
1 68  GLU n 
1 69  LYS n 
1 70  ILE n 
1 71  ILE n 
1 72  GLU n 
1 73  ILE n 
1 74  LEU n 
1 75  GLU n 
1 76  SER n 
1 77  GLY n 
1 78  HIS n 
1 79  LEU n 
1 80  ARG n 
1 81  LYS n 
1 82  LEU n 
1 83  ASP n 
1 84  HIS n 
1 85  ILE n 
1 86  SER n 
1 87  GLU n 
1 88  SER n 
1 89  VAL n 
1 90  PRO n 
1 91  VAL n 
1 92  LEU n 
1 93  GLU n 
1 94  LEU n 
1 95  PHE n 
1 96  SER n 
1 97  ASN n 
1 98  ILE n 
1 99  TRP n 
1 100 GLY n 
1 101 ALA n 
1 102 GLY n 
1 103 THR n 
1 104 LYS n 
1 105 THR n 
1 106 ALA n 
1 107 GLN n 
1 108 MET n 
1 109 TRP n 
1 110 TYR n 
1 111 GLN n 
1 112 GLN n 
1 113 GLY n 
1 114 PHE n 
1 115 ARG n 
1 116 SER n 
1 117 LEU n 
1 118 GLU n 
1 119 ASP n 
1 120 ILE n 
1 121 ARG n 
1 122 SER n 
1 123 GLN n 
1 124 ALA n 
1 125 SER n 
1 126 LEU n 
1 127 THR n 
1 128 THR n 
1 129 GLN n 
1 130 GLN n 
1 131 ALA n 
1 132 ILE n 
1 133 GLY n 
1 134 LEU n 
1 135 LYS n 
1 136 HIS n 
1 137 TYR n 
1 138 SER n 
1 139 ASP n 
1 140 PHE n 
1 141 LEU n 
1 142 GLU n 
1 143 ARG n 
1 144 MET n 
1 145 PRO n 
1 146 ARG n 
1 147 GLU n 
1 148 GLU n 
1 149 ALA n 
1 150 THR n 
1 151 GLU n 
1 152 ILE n 
1 153 GLU n 
1 154 GLN n 
1 155 THR n 
1 156 VAL n 
1 157 GLN n 
1 158 LYS n 
1 159 ALA n 
1 160 ALA n 
1 161 GLN n 
1 162 ALA n 
1 163 PHE n 
1 164 ASN n 
1 165 SER n 
1 166 GLY n 
1 167 LEU n 
1 168 LEU n 
1 169 CYS n 
1 170 VAL n 
1 171 ALA n 
1 172 CYS n 
1 173 GLY n 
1 174 SER n 
1 175 TYR n 
1 176 ARG n 
1 177 ARG n 
1 178 GLY n 
1 179 LYS n 
1 180 ALA n 
1 181 THR n 
1 182 CYS n 
1 183 GLY n 
1 184 ASP n 
1 185 VAL n 
1 186 ASP n 
1 187 VAL n 
1 188 LEU n 
1 189 ILE n 
1 190 THR n 
1 191 HIS n 
1 192 PRO n 
1 193 ASP n 
1 194 GLY n 
1 195 ARG n 
1 196 SER n 
1 197 HIS n 
1 198 ARG n 
1 199 GLY n 
1 200 ILE n 
1 201 PHE n 
1 202 SER n 
1 203 ARG n 
1 204 LEU n 
1 205 LEU n 
1 206 ASP n 
1 207 SER n 
1 208 LEU n 
1 209 ARG n 
1 210 GLN n 
1 211 GLU n 
1 212 GLY n 
1 213 PHE n 
1 214 LEU n 
1 215 THR n 
1 216 ASP n 
1 217 ASP n 
1 218 LEU n 
1 219 VAL n 
1 220 SER n 
1 221 GLN n 
1 222 GLU n 
1 223 GLU n 
1 224 ASN n 
1 225 GLY n 
1 226 GLN n 
1 227 GLN n 
1 228 GLN n 
1 229 LYS n 
1 230 TYR n 
1 231 LEU n 
1 232 GLY n 
1 233 VAL n 
1 234 CYS n 
1 235 ARG n 
1 236 LEU n 
1 237 PRO n 
1 238 GLY n 
1 239 PRO n 
1 240 GLY n 
1 241 ARG n 
1 242 ARG n 
1 243 HIS n 
1 244 ARG n 
1 245 ARG n 
1 246 LEU n 
1 247 ASP n 
1 248 ILE n 
1 249 ILE n 
1 250 VAL n 
1 251 VAL n 
1 252 PRO n 
1 253 TYR n 
1 254 SER n 
1 255 GLU n 
1 256 PHE n 
1 257 ALA n 
1 258 CYS n 
1 259 ALA n 
1 260 LEU n 
1 261 LEU n 
1 262 TYR n 
1 263 PHE n 
1 264 THR n 
1 265 GLY n 
1 266 SER n 
1 267 ALA n 
1 268 HIS n 
1 269 PHE n 
1 270 ASN n 
1 271 ARG n 
1 272 SER n 
1 273 MET n 
1 274 ARG n 
1 275 ALA n 
1 276 LEU n 
1 277 ALA n 
1 278 LYS n 
1 279 THR n 
1 280 LYS n 
1 281 GLY n 
1 282 MET n 
1 283 SER n 
1 284 LEU n 
1 285 SER n 
1 286 GLU n 
1 287 HIS n 
1 288 ALA n 
1 289 LEU n 
1 290 SER n 
1 291 THR n 
1 292 ALA n 
1 293 VAL n 
1 294 VAL n 
1 295 ARG n 
1 296 ASN n 
1 297 THR n 
1 298 HIS n 
1 299 GLY n 
1 300 CYS n 
1 301 LYS n 
1 302 VAL n 
1 303 GLY n 
1 304 PRO n 
1 305 GLY n 
1 306 ARG n 
1 307 VAL n 
1 308 LEU n 
1 309 PRO n 
1 310 THR n 
1 311 PRO n 
1 312 THR n 
1 313 GLU n 
1 314 LYS n 
1 315 ASP n 
1 316 VAL n 
1 317 PHE n 
1 318 ARG n 
1 319 LEU n 
1 320 LEU n 
1 321 GLY n 
1 322 LEU n 
1 323 PRO n 
1 324 TYR n 
1 325 ARG n 
1 326 GLU n 
1 327 PRO n 
1 328 ALA n 
1 329 GLU n 
1 330 ARG n 
1 331 ASP n 
1 332 TRP n 
1 333 LEU n 
1 334 GLU n 
1 335 HIS n 
1 336 HIS n 
1 337 HIS n 
1 338 HIS n 
1 339 HIS n 
1 340 HIS n 
2 1   DC  n 
2 2   DG  n 
2 3   DG  n 
2 4   DC  n 
2 5   DG  n 
2 6   DG  n 
2 7   DT  n 
2 8   DA  n 
2 9   DC  n 
2 10  DT  n 
2 11  DG  n 
3 1   DC  n 
3 2   DA  n 
3 3   DG  n 
3 4   DT  n 
3 5   DA  n 
3 6   DC  n 
4 1   DG  n 
4 2   DC  n 
4 3   DC  n 
4 4   DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 POLL 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOLL_HUMAN Q9UGP5 1 
;SSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEACSIPGIGKRMAEKIIEILESGHLRK
LDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQ
AFNSGLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLPGPGR
RHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLG
LPYREPAERDW
;
245 ? 
2 PDB 4K4I        4K4I   2 ? ?   ? 
3 PDB 4K4I        4K4I   3 ? ?   ? 
4 PDB 4K4I        4K4I   4 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4K4I A 2 ? 332 ? Q9UGP5 245 ? 575 ? 245 575 
2  1 4K4I E 2 ? 332 ? Q9UGP5 245 ? 575 ? 245 575 
3  1 4K4I I 2 ? 332 ? Q9UGP5 245 ? 575 ? 245 575 
4  1 4K4I M 2 ? 332 ? Q9UGP5 245 ? 575 ? 245 575 
5  2 4K4I B 1 ? 11  ? 4K4I   1   ? 11  ? 1   11  
6  2 4K4I F 1 ? 11  ? 4K4I   1   ? 11  ? 1   11  
7  2 4K4I J 1 ? 11  ? 4K4I   1   ? 11  ? 1   11  
8  2 4K4I N 1 ? 11  ? 4K4I   1   ? 11  ? 1   11  
9  3 4K4I C 1 ? 6   ? 4K4I   1   ? 6   ? 1   6   
10 3 4K4I G 1 ? 6   ? 4K4I   1   ? 6   ? 1   6   
11 3 4K4I K 1 ? 6   ? 4K4I   1   ? 6   ? 1   6   
12 3 4K4I O 1 ? 6   ? 4K4I   1   ? 6   ? 1   6   
13 4 4K4I D 1 ? 4   ? 4K4I   1   ? 4   ? 1   4   
14 4 4K4I H 1 ? 4   ? 4K4I   1   ? 4   ? 1   4   
15 4 4K4I L 1 ? 4   ? 4K4I   1   ? 4   ? 1   4   
16 4 4K4I P 1 ? 4   ? 4K4I   1   ? 4   ? 1   4   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4K4I MET A 1   ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 244 1  
1 4K4I LEU A 333 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 576 2  
1 4K4I GLU A 334 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 577 3  
1 4K4I HIS A 335 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 578 4  
1 4K4I HIS A 336 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 579 5  
1 4K4I HIS A 337 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 580 6  
1 4K4I HIS A 338 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 581 7  
1 4K4I HIS A 339 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 582 8  
1 4K4I HIS A 340 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 583 9  
2 4K4I MET E 1   ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 244 10 
2 4K4I LEU E 333 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 576 11 
2 4K4I GLU E 334 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 577 12 
2 4K4I HIS E 335 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 578 13 
2 4K4I HIS E 336 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 579 14 
2 4K4I HIS E 337 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 580 15 
2 4K4I HIS E 338 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 581 16 
2 4K4I HIS E 339 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 582 17 
2 4K4I HIS E 340 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 583 18 
3 4K4I MET I 1   ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 244 19 
3 4K4I LEU I 333 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 576 20 
3 4K4I GLU I 334 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 577 21 
3 4K4I HIS I 335 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 578 22 
3 4K4I HIS I 336 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 579 23 
3 4K4I HIS I 337 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 580 24 
3 4K4I HIS I 338 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 581 25 
3 4K4I HIS I 339 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 582 26 
3 4K4I HIS I 340 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 583 27 
4 4K4I MET M 1   ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 244 28 
4 4K4I LEU M 333 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 576 29 
4 4K4I GLU M 334 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 577 30 
4 4K4I HIS M 335 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 578 31 
4 4K4I HIS M 336 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 579 32 
4 4K4I HIS M 337 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 580 33 
4 4K4I HIS M 338 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 581 34 
4 4K4I HIS M 339 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 582 35 
4 4K4I HIS M 340 ? UNP Q9UGP5 ? ? 'EXPRESSION TAG' 583 36 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1RY non-polymer         . 
;[[(2R,5S)-5-(4-azanyl-5-fluoranyl-2-oxidanylidene-pyrimidin-1-yl)-1,3-oxathiolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate
;
?                'C8 H13 F N3 O12 P3 S' 487.186 
ACT non-polymer         . 'ACETATE ION' ?                'C2 H3 O2 -1'          59.044  
ALA 'L-peptide linking' y ALANINE ?                'C3 H7 N O2'           89.093  
ARG 'L-peptide linking' y ARGININE ?                'C6 H15 N4 O2 1'       175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                'C4 H8 N2 O3'          132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                'C4 H7 N O4'           133.103 
CA  non-polymer         . 'CALCIUM ION' ?                'Ca 2'                 40.078  
CAC non-polymer         . 'CACODYLATE ION' dimethylarsinate 'C2 H6 As O2 -1'       136.989 
CYS 'L-peptide linking' y CYSTEINE ?                'C3 H7 N O2 S'         121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                'C10 H14 N5 O6 P'      331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ?                'C9 H14 N3 O7 P'       307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                'C10 H14 N5 O7 P'      347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ?                'C10 H15 N2 O8 P'      322.208 
GLN 'L-peptide linking' y GLUTAMINE ?                'C5 H10 N2 O3'         146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                'C5 H9 N O4'           147.129 
GLY 'peptide linking'   y GLYCINE ?                'C2 H5 N O2'           75.067  
HIS 'L-peptide linking' y HISTIDINE ?                'C6 H10 N3 O2 1'       156.162 
HOH non-polymer         . WATER ?                'H2 O'                 18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                'C6 H13 N O2'          131.173 
LEU 'L-peptide linking' y LEUCINE ?                'C6 H13 N O2'          131.173 
LYS 'L-peptide linking' y LYSINE ?                'C6 H15 N2 O2 1'       147.195 
MET 'L-peptide linking' y METHIONINE ?                'C5 H11 N O2 S'        149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?                'C9 H11 N O2'          165.189 
PRO 'L-peptide linking' y PROLINE ?                'C5 H9 N O2'           115.130 
SER 'L-peptide linking' y SERINE ?                'C3 H7 N O3'           105.093 
THR 'L-peptide linking' y THREONINE ?                'C4 H9 N O3'           119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                'C11 H12 N2 O2'        204.225 
TYR 'L-peptide linking' y TYROSINE ?                'C9 H11 N O3'          181.189 
VAL 'L-peptide linking' y VALINE ?                'C5 H11 N O2'          117.146 
# 
_exptl.entry_id          4K4I 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.79 
_exptl_crystal.density_percent_sol   55.98 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'0.1 M SODIUM CACODYLATE, 0.2 M CALCIUM ACETATE, 4% PEG 8000, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX225HE' 
_diffrn_detector.pdbx_collection_date   2013-02-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Kohzu HLD-4 Double Crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97931 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 31-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   31-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97931 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4K4I 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             45.03 
_reflns.d_resolution_high            2.25 
_reflns.number_obs                   95547 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.25 
_reflns_shell.d_res_low              2.29 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4K4I 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     90697 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.03 
_refine.ls_d_res_high                            2.25 
_refine.ls_percent_reflns_obs                    99.94 
_refine.ls_R_factor_obs                          0.21535 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21228 
_refine.ls_R_factor_R_free                       0.27444 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  4788 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.935 
_refine.correlation_coeff_Fo_to_Fc_free          0.893 
_refine.B_iso_mean                               37.917 
_refine.aniso_B[1][1]                            0.04 
_refine.aniso_B[2][2]                            -0.01 
_refine.aniso_B[3][3]                            -0.03 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.276 
_refine.pdbx_overall_ESU_R_Free                  0.236 
_refine.overall_SU_ML                            0.168 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             6.861 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10386 
_refine_hist.pdbx_number_atoms_nucleic_acid   1708 
_refine_hist.pdbx_number_atoms_ligand         169 
_refine_hist.number_atoms_solvent             479 
_refine_hist.number_atoms_total               12742 
_refine_hist.d_res_high                       2.25 
_refine_hist.d_res_low                        45.03 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.016  0.018  ? 12776 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 11227 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.777  1.834  ? 17486 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.139  3.000  ? 25843 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.638  5.000  ? 1319  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.002 22.857 ? 497   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.780 15.000 ? 1875  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       16.308 15.000 ? 100   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.107  0.200  ? 1825  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.008  0.020  ? 13124 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 3014  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.250 
_refine_ls_shell.d_res_low                        2.308 
_refine_ls_shell.number_reflns_R_work             6598 
_refine_ls_shell.R_factor_R_work                  0.277 
_refine_ls_shell.percent_reflns_obs               99.96 
_refine_ls_shell.R_factor_R_free                  0.359 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             357 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  4K4I 
_struct.title                     'Ternary crystal structures of a human DNA POLYMERASE LAMBDA IN COMPLEX WITH DNA AND (-)FTC-TP.' 
_struct.pdbx_descriptor           'DNA polymerase lambda (E.C.2.7.7.7, 4.2.99.-)/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4K4I 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'DNA POLYMERASE, DNA REPAIR, PHOSPHORYL TRANSFER REACTION, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 4 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 3 ? 
H  N N 4 ? 
I  N N 1 ? 
J  N N 2 ? 
K  N N 3 ? 
L  N N 4 ? 
M  N N 1 ? 
N  N N 2 ? 
O  N N 3 ? 
P  N N 4 ? 
Q  N N 5 ? 
R  N N 6 ? 
S  N N 6 ? 
T  N N 6 ? 
U  N N 6 ? 
V  N N 6 ? 
W  N N 6 ? 
X  N N 7 ? 
Y  N N 6 ? 
Z  N N 7 ? 
AA N N 5 ? 
BA N N 6 ? 
CA N N 6 ? 
DA N N 6 ? 
EA N N 6 ? 
FA N N 6 ? 
GA N N 8 ? 
HA N N 7 ? 
IA N N 6 ? 
JA N N 7 ? 
KA N N 5 ? 
LA N N 6 ? 
MA N N 6 ? 
NA N N 6 ? 
OA N N 7 ? 
PA N N 6 ? 
QA N N 6 ? 
RA N N 5 ? 
SA N N 6 ? 
TA N N 6 ? 
UA N N 6 ? 
VA N N 6 ? 
WA N N 8 ? 
XA N N 7 ? 
YA N N 6 ? 
ZA N N 9 ? 
AB N N 9 ? 
BB N N 9 ? 
CB N N 9 ? 
DB N N 9 ? 
EB N N 9 ? 
FB N N 9 ? 
GB N N 9 ? 
HB N N 9 ? 
IB N N 9 ? 
JB N N 9 ? 
KB N N 9 ? 
LB N N 9 ? 
MB N N 9 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 10  ? GLN A 27  ? ASN A 253 GLN A 270 1 ? 18 
HELX_P HELX_P2  2  ASP A 29  ? PHE A 46  ? ASP A 272 PHE A 289 1 ? 18 
HELX_P HELX_P3  3  SER A 52  ? ILE A 59  ? SER A 295 ILE A 302 1 ? 8  
HELX_P HELX_P4  4  GLY A 63  ? GLY A 77  ? GLY A 306 GLY A 320 1 ? 15 
HELX_P HELX_P5  5  LEU A 79  ? HIS A 84  ? LEU A 322 HIS A 327 5 ? 6  
HELX_P HELX_P6  6  SER A 88  ? ASN A 97  ? SER A 331 ASN A 340 1 ? 10 
HELX_P HELX_P7  7  GLY A 102 ? GLN A 112 ? GLY A 345 GLN A 355 1 ? 11 
HELX_P HELX_P8  8  SER A 116 ? ALA A 124 ? SER A 359 ALA A 367 1 ? 9  
HELX_P HELX_P9  9  THR A 127 ? HIS A 136 ? THR A 370 HIS A 379 1 ? 10 
HELX_P HELX_P10 10 HIS A 136 ? GLU A 142 ? HIS A 379 GLU A 385 1 ? 7  
HELX_P HELX_P11 11 ARG A 146 ? ALA A 162 ? ARG A 389 ALA A 405 1 ? 17 
HELX_P HELX_P12 12 CYS A 172 ? ARG A 177 ? CYS A 415 ARG A 420 1 ? 6  
HELX_P HELX_P13 13 GLY A 199 ? GLU A 211 ? GLY A 442 GLU A 454 1 ? 13 
HELX_P HELX_P14 14 PRO A 252 ? SER A 254 ? PRO A 495 SER A 497 5 ? 3  
HELX_P HELX_P15 15 GLU A 255 ? GLY A 265 ? GLU A 498 GLY A 508 1 ? 11 
HELX_P HELX_P16 16 SER A 266 ? LYS A 280 ? SER A 509 LYS A 523 1 ? 15 
HELX_P HELX_P17 17 THR A 312 ? LEU A 320 ? THR A 555 LEU A 563 1 ? 9  
HELX_P HELX_P18 18 GLU A 326 ? ARG A 330 ? GLU A 569 ARG A 573 5 ? 5  
HELX_P HELX_P19 19 ASN E 10  ? GLN E 27  ? ASN E 253 GLN E 270 1 ? 18 
HELX_P HELX_P20 20 ASP E 29  ? PHE E 46  ? ASP E 272 PHE E 289 1 ? 18 
HELX_P HELX_P21 21 SER E 52  ? SER E 58  ? SER E 295 SER E 301 1 ? 7  
HELX_P HELX_P22 22 GLY E 63  ? GLY E 77  ? GLY E 306 GLY E 320 1 ? 15 
HELX_P HELX_P23 23 LEU E 79  ? ILE E 85  ? LEU E 322 ILE E 328 5 ? 7  
HELX_P HELX_P24 24 SER E 88  ? ASN E 97  ? SER E 331 ASN E 340 1 ? 10 
HELX_P HELX_P25 25 GLY E 102 ? GLN E 112 ? GLY E 345 GLN E 355 1 ? 11 
HELX_P HELX_P26 26 SER E 116 ? ALA E 124 ? SER E 359 ALA E 367 1 ? 9  
HELX_P HELX_P27 27 THR E 127 ? HIS E 136 ? THR E 370 HIS E 379 1 ? 10 
HELX_P HELX_P28 28 HIS E 136 ? GLU E 142 ? HIS E 379 GLU E 385 1 ? 7  
HELX_P HELX_P29 29 ARG E 146 ? ALA E 162 ? ARG E 389 ALA E 405 1 ? 17 
HELX_P HELX_P30 30 CYS E 172 ? ARG E 177 ? CYS E 415 ARG E 420 1 ? 6  
HELX_P HELX_P31 31 ILE E 200 ? GLU E 211 ? ILE E 443 GLU E 454 1 ? 12 
HELX_P HELX_P32 32 PRO E 252 ? SER E 254 ? PRO E 495 SER E 497 5 ? 3  
HELX_P HELX_P33 33 GLU E 255 ? GLY E 265 ? GLU E 498 GLY E 508 1 ? 11 
HELX_P HELX_P34 34 SER E 266 ? LYS E 280 ? SER E 509 LYS E 523 1 ? 15 
HELX_P HELX_P35 35 THR E 312 ? LEU E 320 ? THR E 555 LEU E 563 1 ? 9  
HELX_P HELX_P36 36 GLU E 326 ? ARG E 330 ? GLU E 569 ARG E 573 5 ? 5  
HELX_P HELX_P37 37 ASN I 10  ? GLN I 27  ? ASN I 253 GLN I 270 1 ? 18 
HELX_P HELX_P38 38 ASP I 29  ? PHE I 46  ? ASP I 272 PHE I 289 1 ? 18 
HELX_P HELX_P39 39 SER I 52  ? ILE I 59  ? SER I 295 ILE I 302 1 ? 8  
HELX_P HELX_P40 40 GLY I 63  ? GLY I 77  ? GLY I 306 GLY I 320 1 ? 15 
HELX_P HELX_P41 41 LEU I 79  ? ILE I 85  ? LEU I 322 ILE I 328 5 ? 7  
HELX_P HELX_P42 42 SER I 88  ? ASN I 97  ? SER I 331 ASN I 340 1 ? 10 
HELX_P HELX_P43 43 GLY I 102 ? GLN I 112 ? GLY I 345 GLN I 355 1 ? 11 
HELX_P HELX_P44 44 SER I 116 ? ALA I 124 ? SER I 359 ALA I 367 1 ? 9  
HELX_P HELX_P45 45 THR I 127 ? HIS I 136 ? THR I 370 HIS I 379 1 ? 10 
HELX_P HELX_P46 46 HIS I 136 ? GLU I 142 ? HIS I 379 GLU I 385 1 ? 7  
HELX_P HELX_P47 47 ARG I 146 ? ASN I 164 ? ARG I 389 ASN I 407 1 ? 19 
HELX_P HELX_P48 48 CYS I 172 ? ARG I 177 ? CYS I 415 ARG I 420 1 ? 6  
HELX_P HELX_P49 49 GLY I 199 ? GLU I 211 ? GLY I 442 GLU I 454 1 ? 13 
HELX_P HELX_P50 50 PRO I 252 ? SER I 254 ? PRO I 495 SER I 497 5 ? 3  
HELX_P HELX_P51 51 GLU I 255 ? GLY I 265 ? GLU I 498 GLY I 508 1 ? 11 
HELX_P HELX_P52 52 SER I 266 ? THR I 279 ? SER I 509 THR I 522 1 ? 14 
HELX_P HELX_P53 53 THR I 312 ? LEU I 319 ? THR I 555 LEU I 562 1 ? 8  
HELX_P HELX_P54 54 GLU I 326 ? ARG I 330 ? GLU I 569 ARG I 573 5 ? 5  
HELX_P HELX_P55 55 ASN M 10  ? GLY M 28  ? ASN M 253 GLY M 271 1 ? 19 
HELX_P HELX_P56 56 ASP M 29  ? SER M 45  ? ASP M 272 SER M 288 1 ? 17 
HELX_P HELX_P57 57 SER M 52  ? SER M 58  ? SER M 295 SER M 301 1 ? 7  
HELX_P HELX_P58 58 GLY M 63  ? GLY M 77  ? GLY M 306 GLY M 320 1 ? 15 
HELX_P HELX_P59 59 LEU M 79  ? ILE M 85  ? LEU M 322 ILE M 328 5 ? 7  
HELX_P HELX_P60 60 SER M 88  ? ASN M 97  ? SER M 331 ASN M 340 1 ? 10 
HELX_P HELX_P61 61 GLY M 102 ? GLY M 113 ? GLY M 345 GLY M 356 1 ? 12 
HELX_P HELX_P62 62 SER M 116 ? ALA M 124 ? SER M 359 ALA M 367 1 ? 9  
HELX_P HELX_P63 63 THR M 127 ? HIS M 136 ? THR M 370 HIS M 379 1 ? 10 
HELX_P HELX_P64 64 HIS M 136 ? GLU M 142 ? HIS M 379 GLU M 385 1 ? 7  
HELX_P HELX_P65 65 ARG M 146 ? ALA M 162 ? ARG M 389 ALA M 405 1 ? 17 
HELX_P HELX_P66 66 CYS M 172 ? ARG M 177 ? CYS M 415 ARG M 420 1 ? 6  
HELX_P HELX_P67 67 GLY M 199 ? GLU M 211 ? GLY M 442 GLU M 454 1 ? 13 
HELX_P HELX_P68 68 PRO M 252 ? SER M 254 ? PRO M 495 SER M 497 5 ? 3  
HELX_P HELX_P69 69 GLU M 255 ? GLY M 265 ? GLU M 498 GLY M 508 1 ? 11 
HELX_P HELX_P70 70 SER M 266 ? LYS M 280 ? SER M 509 LYS M 523 1 ? 15 
HELX_P HELX_P71 71 THR M 312 ? GLY M 321 ? THR M 555 GLY M 564 1 ? 10 
HELX_P HELX_P72 72 GLU M 326 ? ARG M 330 ? GLU M 569 ARG M 573 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? E  ASP 184 OD1   ? ? ? 1_555 BA CA  . CA ? ? E ASP 427 E CA  602 1_555 ? ? ? ? ? ? ?            2.258 ? 
metalc2   metalc ? ? A  ALA 101 O     ? ? ? 1_555 R  CA  . CA ? ? A ALA 344 A CA  602 1_555 ? ? ? ? ? ? ?            2.271 ? 
metalc3   metalc ? ? A  ASP 186 OD1   ? ? ? 1_555 V  CA  . CA ? ? A ASP 429 A CA  606 1_555 ? ? ? ? ? ? ?            2.287 ? 
metalc4   metalc ? ? AA 1RY .   OAE   ? ? ? 1_555 BA CA  . CA ? ? E 1RY 601 E CA  602 1_555 ? ? ? ? ? ? ?            2.288 ? 
metalc5   metalc ? ? A  ASP 186 OD2   ? ? ? 1_555 U  CA  . CA ? ? A ASP 429 A CA  605 1_555 ? ? ? ? ? ? ?            2.293 ? 
metalc6   metalc ? ? AA 1RY .   OAD   ? ? ? 1_555 BA CA  . CA ? ? E 1RY 601 E CA  602 1_555 ? ? ? ? ? ? ?            2.297 ? 
metalc7   metalc ? ? A  ASP 184 OD1   ? ? ? 1_555 U  CA  . CA ? ? A ASP 427 A CA  605 1_555 ? ? ? ? ? ? ?            2.298 ? 
metalc8   metalc ? ? E  SER 96  O     ? ? ? 1_555 EA CA  . CA ? ? E SER 339 E CA  605 1_555 ? ? ? ? ? ? ?            2.307 ? 
metalc9   metalc ? ? J  DC  4   OP2   ? ? ? 1_555 PA CA  . CA ? ? J DC  4   J CA  101 1_555 ? ? ? ? ? ? ?            2.308 ? 
metalc10  metalc ? ? Q  1RY .   OAE   ? ? ? 1_555 U  CA  . CA ? ? A 1RY 601 A CA  605 1_555 ? ? ? ? ? ? ?            2.309 ? 
metalc11  metalc ? ? E  CYS 169 O     ? ? ? 1_555 FA CA  . CA ? ? E CYS 412 E CA  606 1_555 ? ? ? ? ? ? ?            2.310 ? 
metalc12  metalc ? ? A  SER 220 O     ? ? ? 1_555 T  CA  . CA ? ? A SER 463 A CA  604 1_555 ? ? ? ? ? ? ?            2.310 ? 
metalc13  metalc ? ? A  GLN 157 OE1   ? ? ? 1_555 W  CA  . CA ? ? A GLN 400 A CA  607 1_555 ? ? ? ? ? ? ?            2.315 ? 
metalc14  metalc ? ? E  ASP 186 OD1   ? ? ? 1_555 CA CA  . CA ? ? E ASP 429 E CA  603 1_555 ? ? ? ? ? ? ?            2.318 ? 
metalc15  metalc ? ? I  ASP 184 OD1   ? ? ? 1_555 NA CA  . CA ? ? I ASP 427 I CA  604 1_555 ? ? ? ? ? ? ?            2.318 ? 
metalc16  metalc ? ? I  ASP 184 OD2   ? ? ? 1_555 MA CA  . CA ? ? I ASP 427 I CA  603 1_555 ? ? ? ? ? ? ?            2.320 ? 
metalc17  metalc ? ? M  ALA 101 O     ? ? ? 1_555 TA CA  . CA ? ? M ALA 344 M CA  603 1_555 ? ? ? ? ? ? ?            2.320 ? 
metalc18  metalc ? ? M  ASP 186 OD1   ? ? ? 1_555 UA CA  . CA ? ? M ASP 429 M CA  604 1_555 ? ? ? ? ? ? ?            2.326 ? 
metalc19  metalc ? ? M  CYS 57  O     ? ? ? 1_555 SA CA  . CA ? ? M CYS 300 M CA  602 1_555 ? ? ? ? ? ? ?            2.330 ? 
metalc20  metalc ? ? M  ILE 98  O     ? ? ? 1_555 TA CA  . CA ? ? M ILE 341 M CA  603 1_555 ? ? ? ? ? ? ?            2.334 ? 
metalc21  metalc ? ? M  ILE 59  O     ? ? ? 1_555 SA CA  . CA ? ? M ILE 302 M CA  602 1_555 ? ? ? ? ? ? ?            2.334 ? 
metalc22  metalc ? ? G  DA  5   OP1   ? ? ? 1_555 EA CA  . CA ? ? G DA  5   E CA  605 1_555 ? ? ? ? ? ? ?            2.335 ? 
metalc23  metalc ? ? KA 1RY .   OAI   ? ? ? 1_555 NA CA  . CA ? ? I 1RY 601 I CA  604 1_555 ? ? ? ? ? ? ?            2.336 ? 
metalc24  metalc ? ? A  CYS 169 O     ? ? ? 1_555 W  CA  . CA ? ? A CYS 412 A CA  607 1_555 ? ? ? ? ? ? ?            2.336 ? 
metalc25  metalc ? ? Q  1RY .   OAD   ? ? ? 1_555 U  CA  . CA ? ? A 1RY 601 A CA  605 1_555 ? ? ? ? ? ? ?            2.337 ? 
metalc26  metalc ? ? E  ALA 101 O     ? ? ? 1_555 EA CA  . CA ? ? E ALA 344 E CA  605 1_555 ? ? ? ? ? ? ?            2.339 ? 
metalc27  metalc ? ? E  GLN 157 OE1   ? ? ? 1_555 FA CA  . CA ? ? E GLN 400 E CA  606 1_555 ? ? ? ? ? ? ?            2.339 ? 
metalc28  metalc ? ? I  SER 96  O     ? ? ? 1_555 LA CA  . CA ? ? I SER 339 I CA  602 1_555 ? ? ? ? ? ? ?            2.343 ? 
metalc29  metalc ? ? E  GLU 153 OE2   ? ? ? 1_555 FA CA  . CA ? ? E GLU 396 E CA  606 1_555 ? ? ? ? ? ? ?            2.343 ? 
metalc30  metalc ? ? E  ASP 184 OD2   ? ? ? 1_555 CA CA  . CA ? ? E ASP 427 E CA  603 1_555 ? ? ? ? ? ? ?            2.343 ? 
metalc31  metalc ? ? E  ASP 186 OD2   ? ? ? 1_555 BA CA  . CA ? ? E ASP 429 E CA  602 1_555 ? ? ? ? ? ? ?            2.343 ? 
metalc32  metalc ? ? A  ILE 62  O     ? ? ? 1_555 S  CA  . CA ? ? A ILE 305 A CA  603 1_555 ? ? ? ? ? ? ?            2.345 ? 
metalc33  metalc ? ? I  ALA 101 O     ? ? ? 1_555 LA CA  . CA ? ? I ALA 344 I CA  602 1_555 ? ? ? ? ? ? ?            2.346 ? 
metalc34  metalc ? ? A  GLU 153 OE2   ? ? ? 1_555 W  CA  . CA ? ? A GLU 396 A CA  607 1_555 ? ? ? ? ? ? ?            2.346 ? 
metalc35  metalc ? ? AA 1RY .   OAF   ? ? ? 1_555 BA CA  . CA ? ? E 1RY 601 E CA  602 1_555 ? ? ? ? ? ? ?            2.347 ? 
metalc36  metalc ? ? Q  1RY .   OAF   ? ? ? 1_555 U  CA  . CA ? ? A 1RY 601 A CA  605 1_555 ? ? ? ? ? ? ?            2.348 ? 
metalc37  metalc ? ? M  SER 96  O     ? ? ? 1_555 TA CA  . CA ? ? M SER 339 M CA  603 1_555 ? ? ? ? ? ? ?            2.349 ? 
metalc38  metalc ? ? KA 1RY .   OAF   ? ? ? 1_555 NA CA  . CA ? ? I 1RY 601 I CA  604 1_555 ? ? ? ? ? ? ?            2.350 ? 
metalc39  metalc ? ? K  DA  5   OP1   ? ? ? 1_555 LA CA  . CA ? ? K DA  5   I CA  602 1_555 ? ? ? ? ? ? ?            2.352 ? 
metalc40  metalc ? ? M  ASP 186 OD2   ? ? ? 1_555 UA CA  . CA ? ? M ASP 429 M CA  604 1_555 ? ? ? ? ? ? ?            2.354 ? 
metalc41  metalc ? ? A  ILE 59  O     ? ? ? 1_555 S  CA  . CA ? ? A ILE 302 A CA  603 1_555 ? ? ? ? ? ? ?            2.354 ? 
metalc42  metalc ? ? P  DC  3   OP1   ? ? ? 1_555 SA CA  . CA ? ? P DC  3   M CA  602 1_555 ? ? ? ? ? ? ?            2.357 ? 
metalc43  metalc ? ? M  ASP 184 OD2   ? ? ? 1_555 UA CA  . CA ? ? M ASP 427 M CA  604 1_555 ? ? ? ? ? ? ?            2.361 ? 
metalc44  metalc ? ? J  DG  6   OP2   ? ? ? 1_555 PA CA  . CA ? ? J DG  6   J CA  101 1_555 ? ? ? ? ? ? ?            2.364 ? 
metalc45  metalc ? ? M  ILE 62  O     ? ? ? 1_555 SA CA  . CA ? ? M ILE 305 M CA  602 1_555 ? ? ? ? ? ? ?            2.367 ? 
metalc46  metalc ? ? A  ASP 184 OD2   ? ? ? 1_555 V  CA  . CA ? ? A ASP 427 A CA  606 1_555 ? ? ? ? ? ? ?            2.368 ? 
metalc47  metalc ? ? I  ASP 186 OD1   ? ? ? 1_555 MA CA  . CA ? ? I ASP 429 I CA  603 1_555 ? ? ? ? ? ? ?            2.369 ? 
metalc48  metalc ? ? C  DA  5   OP1   ? ? ? 1_555 R  CA  . CA ? ? C DA  5   A CA  602 1_555 ? ? ? ? ? ? ?            2.371 ? 
metalc49  metalc ? ? C  DC  6   "O3'" ? ? ? 1_555 V  CA  . CA ? ? C DC  6   A CA  606 1_555 ? ? ? ? ? ? ?            2.374 ? 
metalc50  metalc ? ? I  ASP 186 OD2   ? ? ? 1_555 MA CA  . CA ? ? I ASP 429 I CA  603 1_555 ? ? ? ? ? ? ?            2.378 ? 
metalc51  metalc ? ? I  ASP 184 OD1   ? ? ? 1_555 MA CA  . CA ? ? I ASP 427 I CA  603 1_555 ? ? ? ? ? ? ?            2.380 ? 
metalc52  metalc ? ? A  CYS 57  O     ? ? ? 1_555 S  CA  . CA ? ? A CYS 300 A CA  603 1_555 ? ? ? ? ? ? ?            2.386 ? 
metalc53  metalc ? ? I  ILE 98  O     ? ? ? 1_555 LA CA  . CA ? ? I ILE 341 I CA  602 1_555 ? ? ? ? ? ? ?            2.389 ? 
metalc54  metalc ? ? E  ILE 98  O     ? ? ? 1_555 EA CA  . CA ? ? E ILE 341 E CA  605 1_555 ? ? ? ? ? ? ?            2.393 ? 
metalc55  metalc ? ? M  ASP 184 OD1   ? ? ? 1_555 VA CA  . CA ? ? M ASP 427 M CA  605 1_555 ? ? ? ? ? ? ?            2.396 ? 
metalc56  metalc ? ? O  DA  5   OP1   ? ? ? 1_555 TA CA  . CA ? ? O DA  5   M CA  603 1_555 ? ? ? ? ? ? ?            2.398 ? 
metalc57  metalc ? ? A  SER 96  O     ? ? ? 1_555 R  CA  . CA ? ? A SER 339 A CA  602 1_555 ? ? ? ? ? ? ?            2.399 ? 
metalc58  metalc ? ? M  ASP 184 OD1   ? ? ? 1_555 UA CA  . CA ? ? M ASP 427 M CA  604 1_555 ? ? ? ? ? ? ?            2.404 ? 
metalc59  metalc ? ? A  ILE 98  O     ? ? ? 1_555 R  CA  . CA ? ? A ILE 341 A CA  602 1_555 ? ? ? ? ? ? ?            2.412 ? 
metalc60  metalc ? ? E  ASP 247 OD2   ? ? ? 1_555 CA CA  . CA ? ? E ASP 490 E CA  603 1_555 ? ? ? ? ? ? ?            2.415 ? 
metalc61  metalc ? ? M  ASP 186 OD2   ? ? ? 1_555 VA CA  . CA ? ? M ASP 429 M CA  605 1_555 ? ? ? ? ? ? ?            2.421 ? 
metalc62  metalc ? ? A  ASP 247 OD2   ? ? ? 1_555 V  CA  . CA ? ? A ASP 490 A CA  606 1_555 ? ? ? ? ? ? ?            2.422 ? 
metalc63  metalc ? ? A  ASP 184 O     ? ? ? 1_555 U  CA  . CA ? ? A ASP 427 A CA  605 1_555 ? ? ? ? ? ? ?            2.429 ? 
metalc64  metalc ? ? D  DC  3   OP1   ? ? ? 1_555 S  CA  . CA ? ? D DC  3   A CA  603 1_555 ? ? ? ? ? ? ?            2.430 ? 
metalc65  metalc ? ? Q  1RY .   OAD   ? ? ? 1_555 V  CA  . CA ? ? A 1RY 601 A CA  606 1_555 ? ? ? ? ? ? ?            2.435 ? 
metalc66  metalc ? ? AA 1RY .   OAD   ? ? ? 1_555 CA CA  . CA ? ? E 1RY 601 E CA  603 1_555 ? ? ? ? ? ? ?            2.441 ? 
metalc67  metalc ? ? A  ASP 184 OD1   ? ? ? 1_555 V  CA  . CA ? ? A ASP 427 A CA  606 1_555 ? ? ? ? ? ? ?            2.445 ? 
metalc68  metalc ? ? RA 1RY .   OAQ   ? ? ? 1_555 VA CA  . CA ? ? M 1RY 601 M CA  605 1_555 ? ? ? ? ? ? ?            2.471 ? 
metalc69  metalc ? ? E  ASP 184 OD1   ? ? ? 1_555 CA CA  . CA ? ? E ASP 427 E CA  603 1_555 ? ? ? ? ? ? ?            3.162 ? 
metalc70  metalc ? ? DA CA  .   CA    ? ? ? 1_555 CB HOH . O  ? ? E CA  604 E HOH 778 1_555 ? ? ? ? ? ? ?            2.255 ? 
metalc71  metalc ? ? BA CA  .   CA    ? ? ? 1_555 CB HOH . O  ? ? E CA  602 E HOH 752 1_555 ? ? ? ? ? ? ?            2.294 ? 
metalc72  metalc ? ? Y  CA  .   CA    ? ? ? 1_555 AB HOH . O  ? ? B CA  101 B HOH 212 1_555 ? ? ? ? ? ? ?            2.298 ? 
metalc73  metalc ? ? MA CA  .   CA    ? ? ? 1_555 GB HOH . O  ? ? I CA  603 I HOH 756 1_555 ? ? ? ? ? ? ?            2.299 ? 
metalc74  metalc ? ? DA CA  .   CA    ? ? ? 1_555 CB HOH . O  ? ? E CA  604 E HOH 754 1_555 ? ? ? ? ? ? ?            2.304 ? 
metalc75  metalc ? ? TA CA  .   CA    ? ? ? 1_555 LB HOH . O  ? ? M CA  603 O HOH 101 1_555 ? ? ? ? ? ? ?            2.306 ? 
metalc76  metalc ? ? Y  CA  .   CA    ? ? ? 1_555 AB HOH . O  ? ? B CA  101 B HOH 213 1_555 ? ? ? ? ? ? ?            2.307 ? 
metalc77  metalc ? ? T  CA  .   CA    ? ? ? 1_555 ZA HOH . O  ? ? A CA  604 A HOH 796 1_555 ? ? ? ? ? ? ?            2.308 ? 
metalc78  metalc ? ? IA CA  .   CA    ? ? ? 1_555 DB HOH . O  ? ? F CA  101 F HOH 207 1_555 ? ? ? ? ? ? ?            2.309 ? 
metalc79  metalc ? ? UA CA  .   CA    ? ? ? 1_555 JB HOH . O  ? ? M CA  604 M HOH 787 1_555 ? ? ? ? ? ? ?            2.311 ? 
metalc80  metalc ? ? YA CA  .   CA    ? ? ? 1_555 KB HOH . O  ? ? N CA  101 N HOH 208 1_555 ? ? ? ? ? ? ?            2.311 ? 
metalc81  metalc ? ? LA CA  .   CA    ? ? ? 1_555 GB HOH . O  ? ? I CA  602 I HOH 714 1_555 ? ? ? ? ? ? ?            2.311 ? 
metalc82  metalc ? ? VA CA  .   CA    ? ? ? 1_555 JB HOH . O  ? ? M CA  605 M HOH 786 1_555 ? ? ? ? ? ? ?            2.312 ? 
metalc83  metalc ? ? T  CA  .   CA    ? ? ? 1_555 ZA HOH . O  ? ? A CA  604 A HOH 827 1_555 ? ? ? ? ? ? ?            2.313 ? 
metalc84  metalc ? ? IA CA  .   CA    ? ? ? 1_555 DB HOH . O  ? ? F CA  101 F HOH 205 1_555 ? ? ? ? ? ? ?            2.315 ? 
metalc85  metalc ? ? YA CA  .   CA    ? ? ? 1_555 JB HOH . O  ? ? N CA  101 M HOH 824 1_555 ? ? ? ? ? ? ?            2.319 ? 
metalc86  metalc ? ? S  CA  .   CA    ? ? ? 1_555 ZA HOH . O  ? ? A CA  603 A HOH 822 1_555 ? ? ? ? ? ? ?            2.321 ? 
metalc87  metalc ? ? FA CA  .   CA    ? ? ? 1_555 CB HOH . O  ? ? E CA  606 E HOH 771 1_555 ? ? ? ? ? ? ?            2.327 ? 
metalc88  metalc ? ? IA CA  .   CA    ? ? ? 1_555 DB HOH . O  ? ? F CA  101 F HOH 206 1_555 ? ? ? ? ? ? ?            2.329 ? 
metalc89  metalc ? ? U  CA  .   CA    ? ? ? 1_555 ZA HOH . O  ? ? A CA  605 A HOH 702 1_555 ? ? ? ? ? ? ?            2.332 ? 
metalc90  metalc ? ? R  CA  .   CA    ? ? ? 1_555 BB HOH . O  ? ? A CA  602 C HOH 103 1_555 ? ? ? ? ? ? ?            2.333 ? 
metalc91  metalc ? ? MA CA  .   CA    ? ? ? 1_555 GB HOH . O  ? ? I CA  603 I HOH 751 1_555 ? ? ? ? ? ? ?            2.336 ? 
metalc92  metalc ? ? T  CA  .   CA    ? ? ? 1_555 ZA HOH . O  ? ? A CA  604 A HOH 777 1_555 ? ? ? ? ? ? ?            2.338 ? 
metalc93  metalc ? ? LA CA  .   CA    ? ? ? 1_555 IB HOH . O  ? ? I CA  602 K HOH 201 1_555 ? ? ? ? ? ? ?            2.340 ? 
metalc94  metalc ? ? QA CA  .   CA    ? ? ? 1_555 HB HOH . O  ? ? K CA  101 J HOH 202 1_555 ? ? ? ? ? ? ?            2.345 ? 
metalc95  metalc ? ? NA CA  .   CA    ? ? ? 1_555 GB HOH . O  ? ? I CA  604 I HOH 724 1_555 ? ? ? ? ? ? ?            2.345 ? 
metalc96  metalc ? ? NA CA  .   CA    ? ? ? 1_555 GB HOH . O  ? ? I CA  604 I HOH 752 1_555 ? ? ? ? ? ? ?            2.346 ? 
metalc97  metalc ? ? MA CA  .   CA    ? ? ? 1_555 GB HOH . O  ? ? I CA  603 I HOH 752 1_555 ? ? ? ? ? ? ?            2.358 ? 
metalc98  metalc ? ? IA CA  .   CA    ? ? ? 1_555 DB HOH . O  ? ? F CA  101 F HOH 203 1_555 ? ? ? ? ? ? ?            2.361 ? 
metalc99  metalc ? ? T  CA  .   CA    ? ? ? 1_555 ZA HOH . O  ? ? A CA  604 A HOH 757 1_555 ? ? ? ? ? ? ?            2.361 ? 
metalc100 metalc ? ? EA CA  .   CA    ? ? ? 1_555 CB HOH . O  ? ? E CA  605 E HOH 726 1_555 ? ? ? ? ? ? ?            2.371 ? 
metalc101 metalc ? ? EA CA  .   CA    ? ? ? 1_555 EB HOH . O  ? ? E CA  605 G HOH 101 1_555 ? ? ? ? ? ? ?            2.383 ? 
metalc102 metalc ? ? R  CA  .   CA    ? ? ? 1_555 ZA HOH . O  ? ? A CA  602 A HOH 828 1_555 ? ? ? ? ? ? ?            2.395 ? 
metalc103 metalc ? ? Y  CA  .   CA    ? ? ? 1_555 AB HOH . O  ? ? B CA  101 B HOH 220 1_555 ? ? ? ? ? ? ?            2.802 ? 
hydrog1   hydrog ? ? B  DC  1   N3    ? ? ? 1_555 D  DG  4 N1 ? ? B DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2   hydrog ? ? B  DC  1   N4    ? ? ? 1_555 D  DG  4 O6 ? ? B DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3   hydrog ? ? B  DC  1   O2    ? ? ? 1_555 D  DG  4 N2 ? ? B DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4   hydrog ? ? B  DG  2   N1    ? ? ? 1_555 D  DC  3 N3 ? ? B DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5   hydrog ? ? B  DG  2   N2    ? ? ? 1_555 D  DC  3 O2 ? ? B DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6   hydrog ? ? B  DG  2   O6    ? ? ? 1_555 D  DC  3 N4 ? ? B DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7   hydrog ? ? B  DG  3   N1    ? ? ? 1_555 D  DC  2 N3 ? ? B DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8   hydrog ? ? B  DG  3   N2    ? ? ? 1_555 D  DC  2 O2 ? ? B DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9   hydrog ? ? B  DG  3   O6    ? ? ? 1_555 D  DC  2 N4 ? ? B DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10  hydrog ? ? B  DC  4   N3    ? ? ? 1_555 D  DG  1 N1 ? ? B DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11  hydrog ? ? B  DC  4   N4    ? ? ? 1_555 D  DG  1 O6 ? ? B DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12  hydrog ? ? B  DC  4   O2    ? ? ? 1_555 D  DG  1 N2 ? ? B DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13  hydrog ? ? B  DG  6   N1    ? ? ? 1_555 C  DC  6 N3 ? ? B DG  6   C DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14  hydrog ? ? B  DG  6   N2    ? ? ? 1_555 C  DC  6 O2 ? ? B DG  6   C DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15  hydrog ? ? B  DG  6   O6    ? ? ? 1_555 C  DC  6 N4 ? ? B DG  6   C DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16  hydrog ? ? B  DT  7   N3    ? ? ? 1_555 C  DA  5 N1 ? ? B DT  7   C DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17  hydrog ? ? B  DT  7   O4    ? ? ? 1_555 C  DA  5 N6 ? ? B DT  7   C DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18  hydrog ? ? B  DA  8   N1    ? ? ? 1_555 C  DT  4 N3 ? ? B DA  8   C DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19  hydrog ? ? B  DA  8   N6    ? ? ? 1_555 C  DT  4 O4 ? ? B DA  8   C DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20  hydrog ? ? B  DC  9   N3    ? ? ? 1_555 C  DG  3 N1 ? ? B DC  9   C DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21  hydrog ? ? B  DC  9   N4    ? ? ? 1_555 C  DG  3 O6 ? ? B DC  9   C DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22  hydrog ? ? B  DC  9   O2    ? ? ? 1_555 C  DG  3 N2 ? ? B DC  9   C DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23  hydrog ? ? B  DT  10  N3    ? ? ? 1_555 C  DA  2 N1 ? ? B DT  10  C DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24  hydrog ? ? B  DT  10  O4    ? ? ? 1_555 C  DA  2 N6 ? ? B DT  10  C DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25  hydrog ? ? B  DG  11  N1    ? ? ? 1_555 C  DC  1 N3 ? ? B DG  11  C DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26  hydrog ? ? B  DG  11  N2    ? ? ? 1_555 C  DC  1 O2 ? ? B DG  11  C DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27  hydrog ? ? B  DG  11  O6    ? ? ? 1_555 C  DC  1 N4 ? ? B DG  11  C DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28  hydrog ? ? F  DC  1   N3    ? ? ? 1_555 H  DG  4 N1 ? ? F DC  1   H DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29  hydrog ? ? F  DC  1   N4    ? ? ? 1_555 H  DG  4 O6 ? ? F DC  1   H DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30  hydrog ? ? F  DC  1   O2    ? ? ? 1_555 H  DG  4 N2 ? ? F DC  1   H DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31  hydrog ? ? F  DG  2   N1    ? ? ? 1_555 H  DC  3 N3 ? ? F DG  2   H DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32  hydrog ? ? F  DG  2   N2    ? ? ? 1_555 H  DC  3 O2 ? ? F DG  2   H DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33  hydrog ? ? F  DG  2   O6    ? ? ? 1_555 H  DC  3 N4 ? ? F DG  2   H DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34  hydrog ? ? F  DG  3   N1    ? ? ? 1_555 H  DC  2 N3 ? ? F DG  3   H DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35  hydrog ? ? F  DG  3   N2    ? ? ? 1_555 H  DC  2 O2 ? ? F DG  3   H DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36  hydrog ? ? F  DG  3   O6    ? ? ? 1_555 H  DC  2 N4 ? ? F DG  3   H DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37  hydrog ? ? F  DC  4   N3    ? ? ? 1_555 H  DG  1 N1 ? ? F DC  4   H DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38  hydrog ? ? F  DC  4   N4    ? ? ? 1_555 H  DG  1 O6 ? ? F DC  4   H DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39  hydrog ? ? F  DC  4   O2    ? ? ? 1_555 H  DG  1 N2 ? ? F DC  4   H DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40  hydrog ? ? F  DG  6   N1    ? ? ? 1_555 G  DC  6 N3 ? ? F DG  6   G DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41  hydrog ? ? F  DG  6   N2    ? ? ? 1_555 G  DC  6 O2 ? ? F DG  6   G DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42  hydrog ? ? F  DG  6   O6    ? ? ? 1_555 G  DC  6 N4 ? ? F DG  6   G DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43  hydrog ? ? F  DT  7   N3    ? ? ? 1_555 G  DA  5 N1 ? ? F DT  7   G DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44  hydrog ? ? F  DT  7   O4    ? ? ? 1_555 G  DA  5 N6 ? ? F DT  7   G DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45  hydrog ? ? F  DA  8   N1    ? ? ? 1_555 G  DT  4 N3 ? ? F DA  8   G DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46  hydrog ? ? F  DA  8   N6    ? ? ? 1_555 G  DT  4 O4 ? ? F DA  8   G DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47  hydrog ? ? F  DC  9   N3    ? ? ? 1_555 G  DG  3 N1 ? ? F DC  9   G DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48  hydrog ? ? F  DC  9   N4    ? ? ? 1_555 G  DG  3 O6 ? ? F DC  9   G DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49  hydrog ? ? F  DC  9   O2    ? ? ? 1_555 G  DG  3 N2 ? ? F DC  9   G DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50  hydrog ? ? F  DT  10  N3    ? ? ? 1_555 G  DA  2 N1 ? ? F DT  10  G DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51  hydrog ? ? F  DT  10  O4    ? ? ? 1_555 G  DA  2 N6 ? ? F DT  10  G DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52  hydrog ? ? F  DG  11  N1    ? ? ? 1_555 G  DC  1 N3 ? ? F DG  11  G DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53  hydrog ? ? F  DG  11  N2    ? ? ? 1_555 G  DC  1 O2 ? ? F DG  11  G DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54  hydrog ? ? F  DG  11  O6    ? ? ? 1_555 G  DC  1 N4 ? ? F DG  11  G DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55  hydrog ? ? J  DC  1   N3    ? ? ? 1_555 L  DG  4 N1 ? ? J DC  1   L DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56  hydrog ? ? J  DC  1   N4    ? ? ? 1_555 L  DG  4 O6 ? ? J DC  1   L DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57  hydrog ? ? J  DC  1   O2    ? ? ? 1_555 L  DG  4 N2 ? ? J DC  1   L DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58  hydrog ? ? J  DG  2   N1    ? ? ? 1_555 L  DC  3 N3 ? ? J DG  2   L DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59  hydrog ? ? J  DG  2   N2    ? ? ? 1_555 L  DC  3 O2 ? ? J DG  2   L DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60  hydrog ? ? J  DG  2   O6    ? ? ? 1_555 L  DC  3 N4 ? ? J DG  2   L DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61  hydrog ? ? J  DG  3   N1    ? ? ? 1_555 L  DC  2 N3 ? ? J DG  3   L DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62  hydrog ? ? J  DG  3   N2    ? ? ? 1_555 L  DC  2 O2 ? ? J DG  3   L DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63  hydrog ? ? J  DG  3   O6    ? ? ? 1_555 L  DC  2 N4 ? ? J DG  3   L DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64  hydrog ? ? J  DC  4   N3    ? ? ? 1_555 L  DG  1 N1 ? ? J DC  4   L DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65  hydrog ? ? J  DC  4   N4    ? ? ? 1_555 L  DG  1 O6 ? ? J DC  4   L DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66  hydrog ? ? J  DC  4   O2    ? ? ? 1_555 L  DG  1 N2 ? ? J DC  4   L DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67  hydrog ? ? J  DG  6   N1    ? ? ? 1_555 K  DC  6 N3 ? ? J DG  6   K DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68  hydrog ? ? J  DG  6   N2    ? ? ? 1_555 K  DC  6 O2 ? ? J DG  6   K DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69  hydrog ? ? J  DG  6   O6    ? ? ? 1_555 K  DC  6 N4 ? ? J DG  6   K DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70  hydrog ? ? J  DT  7   N3    ? ? ? 1_555 K  DA  5 N1 ? ? J DT  7   K DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71  hydrog ? ? J  DT  7   O4    ? ? ? 1_555 K  DA  5 N6 ? ? J DT  7   K DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72  hydrog ? ? J  DA  8   N1    ? ? ? 1_555 K  DT  4 N3 ? ? J DA  8   K DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73  hydrog ? ? J  DA  8   N6    ? ? ? 1_555 K  DT  4 O4 ? ? J DA  8   K DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74  hydrog ? ? J  DC  9   N3    ? ? ? 1_555 K  DG  3 N1 ? ? J DC  9   K DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75  hydrog ? ? J  DC  9   N4    ? ? ? 1_555 K  DG  3 O6 ? ? J DC  9   K DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76  hydrog ? ? J  DC  9   O2    ? ? ? 1_555 K  DG  3 N2 ? ? J DC  9   K DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77  hydrog ? ? J  DT  10  N3    ? ? ? 1_555 K  DA  2 N1 ? ? J DT  10  K DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78  hydrog ? ? J  DT  10  O4    ? ? ? 1_555 K  DA  2 N6 ? ? J DT  10  K DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79  hydrog ? ? N  DC  1   N3    ? ? ? 1_555 P  DG  4 N1 ? ? N DC  1   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80  hydrog ? ? N  DC  1   N4    ? ? ? 1_555 P  DG  4 O6 ? ? N DC  1   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81  hydrog ? ? N  DC  1   O2    ? ? ? 1_555 P  DG  4 N2 ? ? N DC  1   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82  hydrog ? ? N  DG  2   N1    ? ? ? 1_555 P  DC  3 N3 ? ? N DG  2   P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83  hydrog ? ? N  DG  2   N2    ? ? ? 1_555 P  DC  3 O2 ? ? N DG  2   P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84  hydrog ? ? N  DG  2   O6    ? ? ? 1_555 P  DC  3 N4 ? ? N DG  2   P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85  hydrog ? ? N  DG  3   N1    ? ? ? 1_555 P  DC  2 N3 ? ? N DG  3   P DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86  hydrog ? ? N  DG  3   N2    ? ? ? 1_555 P  DC  2 O2 ? ? N DG  3   P DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87  hydrog ? ? N  DG  3   O6    ? ? ? 1_555 P  DC  2 N4 ? ? N DG  3   P DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog88  hydrog ? ? N  DC  4   N3    ? ? ? 1_555 P  DG  1 N1 ? ? N DC  4   P DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog89  hydrog ? ? N  DC  4   N4    ? ? ? 1_555 P  DG  1 O6 ? ? N DC  4   P DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90  hydrog ? ? N  DC  4   O2    ? ? ? 1_555 P  DG  1 N2 ? ? N DC  4   P DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog91  hydrog ? ? N  DG  6   N1    ? ? ? 1_555 O  DC  6 N3 ? ? N DG  6   O DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog92  hydrog ? ? N  DG  6   N2    ? ? ? 1_555 O  DC  6 O2 ? ? N DG  6   O DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog93  hydrog ? ? N  DG  6   O6    ? ? ? 1_555 O  DC  6 N4 ? ? N DG  6   O DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog94  hydrog ? ? N  DT  7   N3    ? ? ? 1_555 O  DA  5 N1 ? ? N DT  7   O DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog95  hydrog ? ? N  DT  7   O4    ? ? ? 1_555 O  DA  5 N6 ? ? N DT  7   O DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog96  hydrog ? ? N  DA  8   N1    ? ? ? 1_555 O  DT  4 N3 ? ? N DA  8   O DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog97  hydrog ? ? N  DA  8   N6    ? ? ? 1_555 O  DT  4 O4 ? ? N DA  8   O DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog98  hydrog ? ? N  DC  9   N3    ? ? ? 1_555 O  DG  3 N1 ? ? N DC  9   O DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog99  hydrog ? ? N  DC  9   N4    ? ? ? 1_555 O  DG  3 O6 ? ? N DC  9   O DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog100 hydrog ? ? N  DC  9   O2    ? ? ? 1_555 O  DG  3 N2 ? ? N DC  9   O DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog101 hydrog ? ? N  DT  10  N3    ? ? ? 1_555 O  DA  2 N1 ? ? N DT  10  O DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog102 hydrog ? ? N  DT  10  O4    ? ? ? 1_555 O  DA  2 N6 ? ? N DT  10  O DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog103 hydrog ? ? N  DG  11  N1    ? ? ? 1_555 O  DC  1 N3 ? ? N DG  11  O DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog104 hydrog ? ? N  DG  11  N2    ? ? ? 1_555 O  DC  1 O2 ? ? N DG  11  O DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog105 hydrog ? ? N  DG  11  O6    ? ? ? 1_555 O  DC  1 N4 ? ? N DG  11  O DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 265 A . ? GLY 508 A SER 266 A ? SER 509 A 1 0.65  
2 GLY 265 E . ? GLY 508 E SER 266 E ? SER 509 E 1 18.28 
3 GLY 265 I . ? GLY 508 I SER 266 I ? SER 509 I 1 1.15  
4 GLY 265 M . ? GLY 508 M SER 266 M ? SER 509 M 1 1.57  
5 ALA 292 M . ? ALA 535 M VAL 293 M ? VAL 536 M 1 1.01  
6 VAL 293 M . ? VAL 536 M VAL 294 M ? VAL 537 M 1 3.72  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 3 ? 
D ? 2 ? 
E ? 5 ? 
F ? 2 ? 
G ? 2 ? 
H ? 5 ? 
I ? 3 ? 
J ? 2 ? 
K ? 5 ? 
L ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? parallel      
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? parallel      
K 3 4 ? anti-parallel 
K 4 5 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 144 ? PRO A 145 ? MET A 387 PRO A 388 
A 2 THR A 181 ? CYS A 182 ? THR A 424 CYS A 425 
B 1 LEU A 168 ? ALA A 171 ? LEU A 411 ALA A 414 
B 2 VAL A 185 ? THR A 190 ? VAL A 428 THR A 433 
B 3 HIS A 243 ? VAL A 250 ? HIS A 486 VAL A 493 
B 4 LYS A 229 ? ARG A 235 ? LYS A 472 ARG A 478 
B 5 LEU A 214 ? VAL A 219 ? LEU A 457 VAL A 462 
C 1 SER A 283 ? LEU A 284 ? SER A 526 LEU A 527 
C 2 LEU A 289 ? SER A 290 ? LEU A 532 SER A 533 
C 3 VAL A 307 ? LEU A 308 ? VAL A 550 LEU A 551 
D 1 MET E 144 ? PRO E 145 ? MET E 387 PRO E 388 
D 2 THR E 181 ? CYS E 182 ? THR E 424 CYS E 425 
E 1 LEU E 168 ? ALA E 171 ? LEU E 411 ALA E 414 
E 2 VAL E 185 ? THR E 190 ? VAL E 428 THR E 433 
E 3 ARG E 244 ? VAL E 250 ? ARG E 487 VAL E 493 
E 4 GLN E 228 ? CYS E 234 ? GLN E 471 CYS E 477 
E 5 LEU E 214 ? GLN E 221 ? LEU E 457 GLN E 464 
F 1 SER E 283 ? LEU E 284 ? SER E 526 LEU E 527 
F 2 LEU E 289 ? SER E 290 ? LEU E 532 SER E 533 
G 1 MET I 144 ? PRO I 145 ? MET I 387 PRO I 388 
G 2 THR I 181 ? CYS I 182 ? THR I 424 CYS I 425 
H 1 LEU I 168 ? ALA I 171 ? LEU I 411 ALA I 414 
H 2 VAL I 185 ? THR I 190 ? VAL I 428 THR I 433 
H 3 HIS I 243 ? VAL I 250 ? HIS I 486 VAL I 493 
H 4 GLN I 227 ? ARG I 235 ? GLN I 470 ARG I 478 
H 5 LEU I 214 ? ASN I 224 ? LEU I 457 ASN I 467 
I 1 MET I 282 ? LEU I 284 ? MET I 525 LEU I 527 
I 2 LEU I 289 ? THR I 291 ? LEU I 532 THR I 534 
I 3 VAL I 307 ? LEU I 308 ? VAL I 550 LEU I 551 
J 1 MET M 144 ? PRO M 145 ? MET M 387 PRO M 388 
J 2 THR M 181 ? CYS M 182 ? THR M 424 CYS M 425 
K 1 LEU M 168 ? ALA M 171 ? LEU M 411 ALA M 414 
K 2 VAL M 185 ? THR M 190 ? VAL M 428 THR M 433 
K 3 HIS M 243 ? VAL M 250 ? HIS M 486 VAL M 493 
K 4 GLN M 227 ? ARG M 235 ? GLN M 470 ARG M 478 
K 5 LEU M 214 ? ASN M 224 ? LEU M 457 ASN M 467 
L 1 MET M 282 ? LEU M 284 ? MET M 525 LEU M 527 
L 2 LEU M 289 ? THR M 291 ? LEU M 532 THR M 534 
L 3 VAL M 307 ? LEU M 308 ? VAL M 550 LEU M 551 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N MET A 144 ? N MET A 387 O CYS A 182 ? O CYS A 425 
B 1 2 N VAL A 170 ? N VAL A 413 O LEU A 188 ? O LEU A 431 
B 2 3 N VAL A 187 ? N VAL A 430 O ASP A 247 ? O ASP A 490 
B 3 4 O ARG A 244 ? O ARG A 487 N CYS A 234 ? N CYS A 477 
B 4 5 O LEU A 231 ? O LEU A 474 N VAL A 219 ? N VAL A 462 
C 1 2 N SER A 283 ? N SER A 526 O SER A 290 ? O SER A 533 
C 2 3 N LEU A 289 ? N LEU A 532 O LEU A 308 ? O LEU A 551 
D 1 2 N MET E 144 ? N MET E 387 O CYS E 182 ? O CYS E 425 
E 1 2 N LEU E 168 ? N LEU E 411 O THR E 190 ? O THR E 433 
E 2 3 N VAL E 187 ? N VAL E 430 O ASP E 247 ? O ASP E 490 
E 3 4 O ILE E 248 ? O ILE E 491 N TYR E 230 ? N TYR E 473 
E 4 5 O LYS E 229 ? O LYS E 472 N GLN E 221 ? N GLN E 464 
F 1 2 N SER E 283 ? N SER E 526 O SER E 290 ? O SER E 533 
G 1 2 N MET I 144 ? N MET I 387 O CYS I 182 ? O CYS I 425 
H 1 2 N VAL I 170 ? N VAL I 413 O LEU I 188 ? O LEU I 431 
H 2 3 N VAL I 187 ? N VAL I 430 O ASP I 247 ? O ASP I 490 
H 3 4 O LEU I 246 ? O LEU I 489 N GLY I 232 ? N GLY I 475 
H 4 5 O LEU I 231 ? O LEU I 474 N LEU I 218 ? N LEU I 461 
I 1 2 N SER I 283 ? N SER I 526 O SER I 290 ? O SER I 533 
I 2 3 N LEU I 289 ? N LEU I 532 O LEU I 308 ? O LEU I 551 
J 1 2 N MET M 144 ? N MET M 387 O CYS M 182 ? O CYS M 425 
K 1 2 N VAL M 170 ? N VAL M 413 O LEU M 188 ? O LEU M 431 
K 2 3 N ILE M 189 ? N ILE M 432 O ILE M 249 ? O ILE M 492 
K 3 4 O ILE M 248 ? O ILE M 491 N TYR M 230 ? N TYR M 473 
K 4 5 O LEU M 231 ? O LEU M 474 N VAL M 219 ? N VAL M 462 
L 1 2 N SER M 283 ? N SER M 526 O SER M 290 ? O SER M 533 
L 2 3 N LEU M 289 ? N LEU M 532 O LEU M 308 ? O LEU M 551 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE 1RY A 601' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 602'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 603'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 604'  
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 605'  
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 606'  
AC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA A 607'  
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ACT A 608' 
AC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA B 101'  
BC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE ACT B 102' 
BC2 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE 1RY E 601' 
BC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA E 602'  
BC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA E 603'  
BC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CA E 604'  
BC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA E 605'  
BC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA E 606'  
BC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CAC E 607' 
BC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE ACT E 608' 
CC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA F 101'  
CC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE ACT F 102' 
CC3 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE 1RY I 601' 
CC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA I 602'  
CC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA I 603'  
CC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA I 604'  
CC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE ACT I 605' 
CC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CA J 101'  
CC9 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CA K 101'  
DC1 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE 1RY M 601' 
DC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA M 602'  
DC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA M 603'  
DC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA M 604'  
DC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA M 605'  
DC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CAC M 606' 
DC7 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE ACT M 607' 
DC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CA N 101'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 22 ARG A  143 ? ARG A 386 . ? 1_555 ? 
2   AC1 22 GLY A  173 ? GLY A 416 . ? 1_555 ? 
3   AC1 22 SER A  174 ? SER A 417 . ? 1_555 ? 
4   AC1 22 ARG A  177 ? ARG A 420 . ? 1_555 ? 
5   AC1 22 CYS A  182 ? CYS A 425 . ? 1_555 ? 
6   AC1 22 GLY A  183 ? GLY A 426 . ? 1_555 ? 
7   AC1 22 ASP A  184 ? ASP A 427 . ? 1_555 ? 
8   AC1 22 ASP A  186 ? ASP A 429 . ? 1_555 ? 
9   AC1 22 TYR A  262 ? TYR A 505 . ? 1_555 ? 
10  AC1 22 PHE A  263 ? PHE A 506 . ? 1_555 ? 
11  AC1 22 ALA A  267 ? ALA A 510 . ? 1_555 ? 
12  AC1 22 ASN A  270 ? ASN A 513 . ? 1_555 ? 
13  AC1 22 CA  U  .   ? CA  A 605 . ? 1_555 ? 
14  AC1 22 CA  V  .   ? CA  A 606 . ? 1_555 ? 
15  AC1 22 HOH ZA .   ? HOH A 702 . ? 1_555 ? 
16  AC1 22 HOH ZA .   ? HOH A 717 . ? 1_555 ? 
17  AC1 22 HOH ZA .   ? HOH A 720 . ? 1_555 ? 
18  AC1 22 HOH ZA .   ? HOH A 736 . ? 1_555 ? 
19  AC1 22 HOH ZA .   ? HOH A 773 . ? 1_555 ? 
20  AC1 22 HOH ZA .   ? HOH A 786 . ? 1_555 ? 
21  AC1 22 DG  B  5   ? DG  B 5   . ? 1_555 ? 
22  AC1 22 DC  C  6   ? DC  C 6   . ? 1_555 ? 
23  AC2 6  SER A  96  ? SER A 339 . ? 1_555 ? 
24  AC2 6  ILE A  98  ? ILE A 341 . ? 1_555 ? 
25  AC2 6  ALA A  101 ? ALA A 344 . ? 1_555 ? 
26  AC2 6  HOH ZA .   ? HOH A 828 . ? 1_555 ? 
27  AC2 6  DA  C  5   ? DA  C 5   . ? 1_555 ? 
28  AC2 6  HOH BB .   ? HOH C 103 . ? 1_555 ? 
29  AC3 6  CYS A  57  ? CYS A 300 . ? 1_555 ? 
30  AC3 6  ILE A  59  ? ILE A 302 . ? 1_555 ? 
31  AC3 6  ILE A  62  ? ILE A 305 . ? 1_555 ? 
32  AC3 6  HOH ZA .   ? HOH A 822 . ? 1_555 ? 
33  AC3 6  DC  D  3   ? DC  D 3   . ? 1_555 ? 
34  AC3 6  LYS M  64  ? LYS M 307 . ? 2_555 ? 
35  AC4 6  SER A  220 ? SER A 463 . ? 1_555 ? 
36  AC4 6  HOH ZA .   ? HOH A 757 . ? 1_555 ? 
37  AC4 6  HOH ZA .   ? HOH A 777 . ? 1_555 ? 
38  AC4 6  HOH ZA .   ? HOH A 796 . ? 1_555 ? 
39  AC4 6  HOH ZA .   ? HOH A 827 . ? 1_555 ? 
40  AC4 6  DT  B  10  ? DT  B 10  . ? 1_555 ? 
41  AC5 4  ASP A  184 ? ASP A 427 . ? 1_555 ? 
42  AC5 4  ASP A  186 ? ASP A 429 . ? 1_555 ? 
43  AC5 4  1RY Q  .   ? 1RY A 601 . ? 1_555 ? 
44  AC5 4  HOH ZA .   ? HOH A 702 . ? 1_555 ? 
45  AC6 5  ASP A  184 ? ASP A 427 . ? 1_555 ? 
46  AC6 5  ASP A  186 ? ASP A 429 . ? 1_555 ? 
47  AC6 5  ASP A  247 ? ASP A 490 . ? 1_555 ? 
48  AC6 5  1RY Q  .   ? 1RY A 601 . ? 1_555 ? 
49  AC6 5  DC  C  6   ? DC  C 6   . ? 1_555 ? 
50  AC7 3  GLU A  153 ? GLU A 396 . ? 1_555 ? 
51  AC7 3  GLN A  157 ? GLN A 400 . ? 1_555 ? 
52  AC7 3  CYS A  169 ? CYS A 412 . ? 1_555 ? 
53  AC8 5  LEU A  260 ? LEU A 503 . ? 1_555 ? 
54  AC8 5  THR A  312 ? THR A 555 . ? 1_555 ? 
55  AC8 5  GLU A  313 ? GLU A 556 . ? 1_555 ? 
56  AC8 5  HOH ZA .   ? HOH A 794 . ? 1_555 ? 
57  AC8 5  HOH ZA .   ? HOH A 799 . ? 1_555 ? 
58  AC9 3  HOH AB .   ? HOH B 212 . ? 1_555 ? 
59  AC9 3  HOH AB .   ? HOH B 213 . ? 1_555 ? 
60  AC9 3  HOH AB .   ? HOH B 220 . ? 1_555 ? 
61  BC1 3  DG  B  2   ? DG  B 2   . ? 1_555 ? 
62  BC1 3  DG  B  3   ? DG  B 3   . ? 1_555 ? 
63  BC1 3  DC  N  1   ? DC  N 1   . ? 2_555 ? 
64  BC2 21 ARG E  143 ? ARG E 386 . ? 1_555 ? 
65  BC2 21 GLY E  173 ? GLY E 416 . ? 1_555 ? 
66  BC2 21 SER E  174 ? SER E 417 . ? 1_555 ? 
67  BC2 21 ARG E  177 ? ARG E 420 . ? 1_555 ? 
68  BC2 21 CYS E  182 ? CYS E 425 . ? 1_555 ? 
69  BC2 21 GLY E  183 ? GLY E 426 . ? 1_555 ? 
70  BC2 21 ASP E  184 ? ASP E 427 . ? 1_555 ? 
71  BC2 21 ASP E  186 ? ASP E 429 . ? 1_555 ? 
72  BC2 21 TYR E  262 ? TYR E 505 . ? 1_555 ? 
73  BC2 21 PHE E  263 ? PHE E 506 . ? 1_555 ? 
74  BC2 21 ASN E  270 ? ASN E 513 . ? 1_555 ? 
75  BC2 21 CA  BA .   ? CA  E 602 . ? 1_555 ? 
76  BC2 21 CA  CA .   ? CA  E 603 . ? 1_555 ? 
77  BC2 21 HOH CB .   ? HOH E 733 . ? 1_555 ? 
78  BC2 21 HOH CB .   ? HOH E 752 . ? 1_555 ? 
79  BC2 21 HOH CB .   ? HOH E 753 . ? 1_555 ? 
80  BC2 21 HOH CB .   ? HOH E 754 . ? 1_555 ? 
81  BC2 21 HOH CB .   ? HOH E 761 . ? 1_555 ? 
82  BC2 21 HOH CB .   ? HOH E 778 . ? 1_555 ? 
83  BC2 21 DG  F  5   ? DG  F 5   . ? 1_555 ? 
84  BC2 21 DC  G  6   ? DC  G 6   . ? 1_555 ? 
85  BC3 4  ASP E  184 ? ASP E 427 . ? 1_555 ? 
86  BC3 4  ASP E  186 ? ASP E 429 . ? 1_555 ? 
87  BC3 4  1RY AA .   ? 1RY E 601 . ? 1_555 ? 
88  BC3 4  HOH CB .   ? HOH E 752 . ? 1_555 ? 
89  BC4 4  ASP E  184 ? ASP E 427 . ? 1_555 ? 
90  BC4 4  ASP E  186 ? ASP E 429 . ? 1_555 ? 
91  BC4 4  ASP E  247 ? ASP E 490 . ? 1_555 ? 
92  BC4 4  1RY AA .   ? 1RY E 601 . ? 1_555 ? 
93  BC5 2  HOH CB .   ? HOH E 754 . ? 1_555 ? 
94  BC5 2  HOH CB .   ? HOH E 778 . ? 1_555 ? 
95  BC6 6  SER E  96  ? SER E 339 . ? 1_555 ? 
96  BC6 6  ILE E  98  ? ILE E 341 . ? 1_555 ? 
97  BC6 6  ALA E  101 ? ALA E 344 . ? 1_555 ? 
98  BC6 6  HOH CB .   ? HOH E 726 . ? 1_555 ? 
99  BC6 6  DA  G  5   ? DA  G 5   . ? 1_555 ? 
100 BC6 6  HOH EB .   ? HOH G 101 . ? 1_555 ? 
101 BC7 4  GLU E  153 ? GLU E 396 . ? 1_555 ? 
102 BC7 4  GLN E  157 ? GLN E 400 . ? 1_555 ? 
103 BC7 4  CYS E  169 ? CYS E 412 . ? 1_555 ? 
104 BC7 4  HOH CB .   ? HOH E 771 . ? 1_555 ? 
105 BC8 5  SER E  220 ? SER E 463 . ? 1_555 ? 
106 BC8 5  GLU E  222 ? GLU E 465 . ? 1_555 ? 
107 BC8 5  HOH CB .   ? HOH E 763 . ? 1_555 ? 
108 BC8 5  HOH DB .   ? HOH F 209 . ? 1_555 ? 
109 BC8 5  ARG I  198 ? ARG I 441 . ? 1_555 ? 
110 BC9 3  THR E  312 ? THR E 555 . ? 1_555 ? 
111 BC9 3  GLU E  313 ? GLU E 556 . ? 1_555 ? 
112 BC9 3  HOH CB .   ? HOH E 777 . ? 1_555 ? 
113 CC1 4  HOH DB .   ? HOH F 203 . ? 1_555 ? 
114 CC1 4  HOH DB .   ? HOH F 205 . ? 1_555 ? 
115 CC1 4  HOH DB .   ? HOH F 206 . ? 1_555 ? 
116 CC1 4  HOH DB .   ? HOH F 207 . ? 1_555 ? 
117 CC2 2  DG  F  2   ? DG  F 2   . ? 1_555 ? 
118 CC2 2  DG  F  3   ? DG  F 3   . ? 1_555 ? 
119 CC3 18 ARG I  143 ? ARG I 386 . ? 1_555 ? 
120 CC3 18 GLY I  173 ? GLY I 416 . ? 1_555 ? 
121 CC3 18 SER I  174 ? SER I 417 . ? 1_555 ? 
122 CC3 18 ARG I  177 ? ARG I 420 . ? 1_555 ? 
123 CC3 18 GLY I  183 ? GLY I 426 . ? 1_555 ? 
124 CC3 18 ASP I  184 ? ASP I 427 . ? 1_555 ? 
125 CC3 18 TYR I  262 ? TYR I 505 . ? 1_555 ? 
126 CC3 18 SER I  266 ? SER I 509 . ? 1_555 ? 
127 CC3 18 ALA I  267 ? ALA I 510 . ? 1_555 ? 
128 CC3 18 ASN I  270 ? ASN I 513 . ? 1_555 ? 
129 CC3 18 ARG I  271 ? ARG I 514 . ? 1_555 ? 
130 CC3 18 ARG I  274 ? ARG I 517 . ? 1_555 ? 
131 CC3 18 CA  NA .   ? CA  I 604 . ? 1_555 ? 
132 CC3 18 HOH GB .   ? HOH I 752 . ? 1_555 ? 
133 CC3 18 HOH GB .   ? HOH I 763 . ? 1_555 ? 
134 CC3 18 HOH GB .   ? HOH I 767 . ? 1_555 ? 
135 CC3 18 DG  J  5   ? DG  J 5   . ? 1_555 ? 
136 CC3 18 DC  K  6   ? DC  K 6   . ? 1_555 ? 
137 CC4 6  SER I  96  ? SER I 339 . ? 1_555 ? 
138 CC4 6  ILE I  98  ? ILE I 341 . ? 1_555 ? 
139 CC4 6  ALA I  101 ? ALA I 344 . ? 1_555 ? 
140 CC4 6  HOH GB .   ? HOH I 714 . ? 1_555 ? 
141 CC4 6  DA  K  5   ? DA  K 5   . ? 1_555 ? 
142 CC4 6  HOH IB .   ? HOH K 201 . ? 1_555 ? 
143 CC5 6  ASP I  184 ? ASP I 427 . ? 1_555 ? 
144 CC5 6  ASP I  186 ? ASP I 429 . ? 1_555 ? 
145 CC5 6  CA  NA .   ? CA  I 604 . ? 1_555 ? 
146 CC5 6  HOH GB .   ? HOH I 751 . ? 1_555 ? 
147 CC5 6  HOH GB .   ? HOH I 752 . ? 1_555 ? 
148 CC5 6  HOH GB .   ? HOH I 756 . ? 1_555 ? 
149 CC6 5  ASP I  184 ? ASP I 427 . ? 1_555 ? 
150 CC6 5  1RY KA .   ? 1RY I 601 . ? 1_555 ? 
151 CC6 5  CA  MA .   ? CA  I 603 . ? 1_555 ? 
152 CC6 5  HOH GB .   ? HOH I 724 . ? 1_555 ? 
153 CC6 5  HOH GB .   ? HOH I 752 . ? 1_555 ? 
154 CC7 2  THR I  312 ? THR I 555 . ? 1_555 ? 
155 CC7 2  GLU I  313 ? GLU I 556 . ? 1_555 ? 
156 CC8 2  DC  J  4   ? DC  J 4   . ? 1_555 ? 
157 CC8 2  DG  J  6   ? DG  J 6   . ? 1_555 ? 
158 CC9 1  HOH HB .   ? HOH J 202 . ? 1_555 ? 
159 DC1 16 ARG M  143 ? ARG M 386 . ? 1_555 ? 
160 DC1 16 GLY M  173 ? GLY M 416 . ? 1_555 ? 
161 DC1 16 SER M  174 ? SER M 417 . ? 1_555 ? 
162 DC1 16 ARG M  177 ? ARG M 420 . ? 1_555 ? 
163 DC1 16 GLY M  183 ? GLY M 426 . ? 1_555 ? 
164 DC1 16 TYR M  262 ? TYR M 505 . ? 1_555 ? 
165 DC1 16 SER M  266 ? SER M 509 . ? 1_555 ? 
166 DC1 16 ALA M  267 ? ALA M 510 . ? 1_555 ? 
167 DC1 16 ASN M  270 ? ASN M 513 . ? 1_555 ? 
168 DC1 16 ARG M  274 ? ARG M 517 . ? 1_555 ? 
169 DC1 16 CA  VA .   ? CA  M 605 . ? 1_555 ? 
170 DC1 16 HOH JB .   ? HOH M 786 . ? 1_555 ? 
171 DC1 16 HOH JB .   ? HOH M 801 . ? 1_555 ? 
172 DC1 16 HOH JB .   ? HOH M 802 . ? 1_555 ? 
173 DC1 16 DG  N  5   ? DG  N 5   . ? 1_555 ? 
174 DC1 16 DC  O  6   ? DC  O 6   . ? 1_555 ? 
175 DC2 5  CYS M  57  ? CYS M 300 . ? 1_555 ? 
176 DC2 5  ILE M  59  ? ILE M 302 . ? 1_555 ? 
177 DC2 5  PRO M  60  ? PRO M 303 . ? 1_555 ? 
178 DC2 5  ILE M  62  ? ILE M 305 . ? 1_555 ? 
179 DC2 5  DC  P  3   ? DC  P 3   . ? 1_555 ? 
180 DC3 5  SER M  96  ? SER M 339 . ? 1_555 ? 
181 DC3 5  ILE M  98  ? ILE M 341 . ? 1_555 ? 
182 DC3 5  ALA M  101 ? ALA M 344 . ? 1_555 ? 
183 DC3 5  DA  O  5   ? DA  O 5   . ? 1_555 ? 
184 DC3 5  HOH LB .   ? HOH O 101 . ? 1_555 ? 
185 DC4 4  ASP M  184 ? ASP M 427 . ? 1_555 ? 
186 DC4 4  ASP M  186 ? ASP M 429 . ? 1_555 ? 
187 DC4 4  CA  VA .   ? CA  M 605 . ? 1_555 ? 
188 DC4 4  HOH JB .   ? HOH M 787 . ? 1_555 ? 
189 DC5 5  ASP M  184 ? ASP M 427 . ? 1_555 ? 
190 DC5 5  ASP M  186 ? ASP M 429 . ? 1_555 ? 
191 DC5 5  1RY RA .   ? 1RY M 601 . ? 1_555 ? 
192 DC5 5  CA  UA .   ? CA  M 604 . ? 1_555 ? 
193 DC5 5  HOH JB .   ? HOH M 786 . ? 1_555 ? 
194 DC6 4  GLU M  75  ? GLU M 318 . ? 1_555 ? 
195 DC6 4  HOH JB .   ? HOH M 800 . ? 1_555 ? 
196 DC6 4  HOH JB .   ? HOH M 812 . ? 1_555 ? 
197 DC6 4  HOH JB .   ? HOH M 814 . ? 1_555 ? 
198 DC7 1  HIS M  47  ? HIS M 290 . ? 1_555 ? 
199 DC8 2  HOH JB .   ? HOH M 824 . ? 1_555 ? 
200 DC8 2  HOH KB .   ? HOH N 208 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4K4I 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4K4I 
_atom_sites.fract_transf_matrix[1][1]   0.005143 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010248 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009510 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
AS 
C  
CA 
F  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . THR A  1 7   ? -25.198 44.097  14.797  1.00 55.51  ? 250 THR A N     1 
ATOM   2     C  CA    . THR A  1 7   ? -24.884 42.734  15.275  1.00 60.12  ? 250 THR A CA    1 
ATOM   3     C  C     . THR A  1 7   ? -23.791 42.108  14.392  1.00 63.36  ? 250 THR A C     1 
ATOM   4     O  O     . THR A  1 7   ? -22.757 41.674  14.910  1.00 69.66  ? 250 THR A O     1 
ATOM   5     C  CB    . THR A  1 7   ? -26.151 41.845  15.400  1.00 61.75  ? 250 THR A CB    1 
ATOM   6     O  OG1   . THR A  1 7   ? -25.895 40.771  16.319  1.00 62.22  ? 250 THR A OG1   1 
ATOM   7     C  CG2   . THR A  1 7   ? -26.636 41.277  14.027  1.00 61.83  ? 250 THR A CG2   1 
ATOM   8     N  N     . ASN A  1 8   ? -23.985 42.093  13.075  1.00 58.77  ? 251 ASN A N     1 
ATOM   9     C  CA    . ASN A  1 8   ? -22.954 41.619  12.198  1.00 54.24  ? 251 ASN A CA    1 
ATOM   10    C  C     . ASN A  1 8   ? -22.216 42.844  11.701  1.00 53.37  ? 251 ASN A C     1 
ATOM   11    O  O     . ASN A  1 8   ? -22.777 43.647  10.975  1.00 53.38  ? 251 ASN A O     1 
ATOM   12    C  CB    . ASN A  1 8   ? -23.512 40.796  11.050  1.00 51.44  ? 251 ASN A CB    1 
ATOM   13    C  CG    . ASN A  1 8   ? -22.418 40.351  10.082  1.00 54.95  ? 251 ASN A CG    1 
ATOM   14    O  OD1   . ASN A  1 8   ? -21.235 40.646  10.268  1.00 50.89  ? 251 ASN A OD1   1 
ATOM   15    N  ND2   . ASN A  1 8   ? -22.808 39.657  9.037   1.00 56.01  ? 251 ASN A ND2   1 
ATOM   16    N  N     . HIS A  1 9   ? -20.959 42.998  12.113  1.00 49.91  ? 252 HIS A N     1 
ATOM   17    C  CA    . HIS A  1 9   ? -20.216 44.246  11.869  1.00 49.42  ? 252 HIS A CA    1 
ATOM   18    C  C     . HIS A  1 9   ? -19.357 44.132  10.613  1.00 45.27  ? 252 HIS A C     1 
ATOM   19    O  O     . HIS A  1 9   ? -18.733 45.115  10.189  1.00 46.96  ? 252 HIS A O     1 
ATOM   20    C  CB    . HIS A  1 9   ? -19.321 44.598  13.084  1.00 52.14  ? 252 HIS A CB    1 
ATOM   21    C  CG    . HIS A  1 9   ? -20.078 44.845  14.363  1.00 54.08  ? 252 HIS A CG    1 
ATOM   22    N  ND1   . HIS A  1 9   ? -20.619 46.076  14.692  1.00 55.41  ? 252 HIS A ND1   1 
ATOM   23    C  CD2   . HIS A  1 9   ? -20.353 44.027  15.411  1.00 51.91  ? 252 HIS A CD2   1 
ATOM   24    C  CE1   . HIS A  1 9   ? -21.215 45.994  15.870  1.00 50.10  ? 252 HIS A CE1   1 
ATOM   25    N  NE2   . HIS A  1 9   ? -21.066 44.764  16.327  1.00 48.73  ? 252 HIS A NE2   1 
ATOM   26    N  N     . ASN A  1 10  ? -19.310 42.926  10.052  1.00 42.62  ? 253 ASN A N     1 
ATOM   27    C  CA    . ASN A  1 10  ? -18.474 42.566  8.906   1.00 40.62  ? 253 ASN A CA    1 
ATOM   28    C  C     . ASN A  1 10  ? -19.343 42.051  7.731   1.00 44.02  ? 253 ASN A C     1 
ATOM   29    O  O     . ASN A  1 10  ? -18.919 41.182  6.909   1.00 40.58  ? 253 ASN A O     1 
ATOM   30    C  CB    . ASN A  1 10  ? -17.503 41.465  9.342   1.00 38.85  ? 253 ASN A CB    1 
ATOM   31    C  CG    . ASN A  1 10  ? -16.459 41.957  10.336  1.00 41.06  ? 253 ASN A CG    1 
ATOM   32    O  OD1   . ASN A  1 10  ? -16.691 42.014  11.551  1.00 35.42  ? 253 ASN A OD1   1 
ATOM   33    N  ND2   . ASN A  1 10  ? -15.276 42.293  9.809   1.00 36.55  ? 253 ASN A ND2   1 
ATOM   34    N  N     . LEU A  1 11  ? -20.550 42.616  7.649   1.00 48.15  ? 254 LEU A N     1 
ATOM   35    C  CA    . LEU A  1 11  ? -21.601 42.133  6.738   1.00 56.00  ? 254 LEU A CA    1 
ATOM   36    C  C     . LEU A  1 11  ? -21.176 42.104  5.283   1.00 54.60  ? 254 LEU A C     1 
ATOM   37    O  O     . LEU A  1 11  ? -21.536 41.184  4.542   1.00 53.49  ? 254 LEU A O     1 
ATOM   38    C  CB    . LEU A  1 11  ? -22.852 43.006  6.876   1.00 62.24  ? 254 LEU A CB    1 
ATOM   39    C  CG    . LEU A  1 11  ? -24.113 42.620  6.076   1.00 65.01  ? 254 LEU A CG    1 
ATOM   40    C  CD1   . LEU A  1 11  ? -24.330 41.111  5.985   1.00 64.64  ? 254 LEU A CD1   1 
ATOM   41    C  CD2   . LEU A  1 11  ? -25.333 43.296  6.698   1.00 65.53  ? 254 LEU A CD2   1 
ATOM   42    N  N     . HIS A  1 12  ? -20.401 43.112  4.898   1.00 53.39  ? 255 HIS A N     1 
ATOM   43    C  CA    . HIS A  1 12  ? -19.965 43.286  3.533   1.00 58.73  ? 255 HIS A CA    1 
ATOM   44    C  C     . HIS A  1 12  ? -19.012 42.174  3.155   1.00 58.53  ? 255 HIS A C     1 
ATOM   45    O  O     . HIS A  1 12  ? -19.058 41.681  2.033   1.00 56.81  ? 255 HIS A O     1 
ATOM   46    C  CB    . HIS A  1 12  ? -19.278 44.649  3.356   1.00 68.16  ? 255 HIS A CB    1 
ATOM   47    C  CG    . HIS A  1 12  ? -19.159 45.088  1.923   1.00 86.95  ? 255 HIS A CG    1 
ATOM   48    N  ND1   . HIS A  1 12  ? -20.128 45.844  1.289   1.00 98.38  ? 255 HIS A ND1   1 
ATOM   49    C  CD2   . HIS A  1 12  ? -18.188 44.875  0.999   1.00 94.20  ? 255 HIS A CD2   1 
ATOM   50    C  CE1   . HIS A  1 12  ? -19.759 46.074  0.038   1.00 100.67 ? 255 HIS A CE1   1 
ATOM   51    N  NE2   . HIS A  1 12  ? -18.585 45.498  -0.164  1.00 96.00  ? 255 HIS A NE2   1 
ATOM   52    N  N     . ILE A  1 13  ? -18.153 41.798  4.108   1.00 55.11  ? 256 ILE A N     1 
ATOM   53    C  CA    . ILE A  1 13  ? -17.172 40.723  3.938   1.00 48.08  ? 256 ILE A CA    1 
ATOM   54    C  C     . ILE A  1 13  ? -17.842 39.314  3.921   1.00 43.77  ? 256 ILE A C     1 
ATOM   55    O  O     . ILE A  1 13  ? -17.425 38.426  3.187   1.00 36.97  ? 256 ILE A O     1 
ATOM   56    C  CB    . ILE A  1 13  ? -16.081 40.771  5.054   1.00 46.68  ? 256 ILE A CB    1 
ATOM   57    C  CG1   . ILE A  1 13  ? -15.417 42.143  5.114   1.00 48.55  ? 256 ILE A CG1   1 
ATOM   58    C  CG2   . ILE A  1 13  ? -14.972 39.757  4.808   1.00 45.59  ? 256 ILE A CG2   1 
ATOM   59    C  CD1   . ILE A  1 13  ? -14.742 42.441  6.436   1.00 46.21  ? 256 ILE A CD1   1 
ATOM   60    N  N     . THR A  1 14  ? -18.860 39.097  4.731   1.00 42.93  ? 257 THR A N     1 
ATOM   61    C  CA    . THR A  1 14  ? -19.437 37.745  4.850   1.00 42.41  ? 257 THR A CA    1 
ATOM   62    C  C     . THR A  1 14  ? -20.180 37.359  3.554   1.00 49.20  ? 257 THR A C     1 
ATOM   63    O  O     . THR A  1 14  ? -20.045 36.244  2.999   1.00 45.39  ? 257 THR A O     1 
ATOM   64    C  CB    . THR A  1 14  ? -20.392 37.703  6.051   1.00 42.21  ? 257 THR A CB    1 
ATOM   65    O  OG1   . THR A  1 14  ? -21.144 38.921  6.085   1.00 43.29  ? 257 THR A OG1   1 
ATOM   66    C  CG2   . THR A  1 14  ? -19.593 37.616  7.347   1.00 42.76  ? 257 THR A CG2   1 
ATOM   67    N  N     . GLU A  1 15  ? -20.918 38.323  3.025   1.00 50.28  ? 258 GLU A N     1 
ATOM   68    C  CA    . GLU A  1 15  ? -21.667 38.079  1.820   1.00 47.42  ? 258 GLU A CA    1 
ATOM   69    C  C     . GLU A  1 15  ? -20.770 37.590  0.727   1.00 49.15  ? 258 GLU A C     1 
ATOM   70    O  O     . GLU A  1 15  ? -21.113 36.620  0.019   1.00 52.05  ? 258 GLU A O     1 
ATOM   71    C  CB    . GLU A  1 15  ? -22.439 39.315  1.421   1.00 51.46  ? 258 GLU A CB    1 
ATOM   72    C  CG    . GLU A  1 15  ? -23.636 39.480  2.353   1.00 56.50  ? 258 GLU A CG    1 
ATOM   73    C  CD    . GLU A  1 15  ? -24.261 40.853  2.306   1.00 61.07  ? 258 GLU A CD    1 
ATOM   74    O  OE1   . GLU A  1 15  ? -23.659 41.760  1.665   1.00 62.11  ? 258 GLU A OE1   1 
ATOM   75    O  OE2   . GLU A  1 15  ? -25.357 41.004  2.920   1.00 58.54  ? 258 GLU A OE2   1 
ATOM   76    N  N     . LYS A  1 16  ? -19.590 38.190  0.608   1.00 45.24  ? 259 LYS A N     1 
ATOM   77    C  CA    . LYS A  1 16  ? -18.740 37.840  -0.523  1.00 44.02  ? 259 LYS A CA    1 
ATOM   78    C  C     . LYS A  1 16  ? -18.121 36.447  -0.318  1.00 44.09  ? 259 LYS A C     1 
ATOM   79    O  O     . LYS A  1 16  ? -18.058 35.636  -1.224  1.00 39.59  ? 259 LYS A O     1 
ATOM   80    C  CB    . LYS A  1 16  ? -17.719 38.927  -0.758  1.00 49.06  ? 259 LYS A CB    1 
ATOM   81    C  CG    . LYS A  1 16  ? -18.377 40.289  -0.988  1.00 57.44  ? 259 LYS A CG    1 
ATOM   82    C  CD    . LYS A  1 16  ? -17.364 41.370  -1.373  1.00 63.80  ? 259 LYS A CD    1 
ATOM   83    C  CE    . LYS A  1 16  ? -18.033 42.686  -1.751  1.00 68.51  ? 259 LYS A CE    1 
ATOM   84    N  NZ    . LYS A  1 16  ? -18.548 42.683  -3.155  1.00 66.47  ? 259 LYS A NZ    1 
ATOM   85    N  N     . LEU A  1 17  ? -17.743 36.161  0.914   1.00 39.95  ? 260 LEU A N     1 
ATOM   86    C  CA    . LEU A  1 17  ? -17.202 34.871  1.265   1.00 39.19  ? 260 LEU A CA    1 
ATOM   87    C  C     . LEU A  1 17  ? -18.247 33.766  1.156   1.00 34.40  ? 260 LEU A C     1 
ATOM   88    O  O     . LEU A  1 17  ? -17.917 32.631  0.858   1.00 35.68  ? 260 LEU A O     1 
ATOM   89    C  CB    . LEU A  1 17  ? -16.712 34.911  2.718   1.00 39.34  ? 260 LEU A CB    1 
ATOM   90    C  CG    . LEU A  1 17  ? -15.513 35.812  3.023   1.00 38.06  ? 260 LEU A CG    1 
ATOM   91    C  CD1   . LEU A  1 17  ? -15.229 35.741  4.527   1.00 36.67  ? 260 LEU A CD1   1 
ATOM   92    C  CD2   . LEU A  1 17  ? -14.313 35.356  2.202   1.00 35.32  ? 260 LEU A CD2   1 
ATOM   93    N  N     . GLU A  1 18  ? -19.486 34.072  1.481   1.00 35.31  ? 261 GLU A N     1 
ATOM   94    C  CA    . GLU A  1 18  ? -20.556 33.100  1.281   1.00 38.09  ? 261 GLU A CA    1 
ATOM   95    C  C     . GLU A  1 18  ? -20.644 32.674  -0.184  1.00 36.57  ? 261 GLU A C     1 
ATOM   96    O  O     . GLU A  1 18  ? -20.673 31.477  -0.488  1.00 40.64  ? 261 GLU A O     1 
ATOM   97    C  CB    . GLU A  1 18  ? -21.879 33.655  1.786   1.00 41.04  ? 261 GLU A CB    1 
ATOM   98    C  CG    . GLU A  1 18  ? -21.923 33.503  3.289   1.00 43.57  ? 261 GLU A CG    1 
ATOM   99    C  CD    . GLU A  1 18  ? -23.171 34.034  3.966   1.00 47.54  ? 261 GLU A CD    1 
ATOM   100   O  OE1   . GLU A  1 18  ? -23.613 35.158  3.647   1.00 54.57  ? 261 GLU A OE1   1 
ATOM   101   O  OE2   . GLU A  1 18  ? -23.681 33.326  4.865   1.00 50.23  ? 261 GLU A OE2   1 
ATOM   102   N  N     . VAL A  1 19  ? -20.575 33.633  -1.088  1.00 38.32  ? 262 VAL A N     1 
ATOM   103   C  CA    . VAL A  1 19  ? -20.671 33.347  -2.527  1.00 39.52  ? 262 VAL A CA    1 
ATOM   104   C  C     . VAL A  1 19  ? -19.581 32.405  -2.903  1.00 38.93  ? 262 VAL A C     1 
ATOM   105   O  O     . VAL A  1 19  ? -19.795 31.376  -3.540  1.00 40.45  ? 262 VAL A O     1 
ATOM   106   C  CB    . VAL A  1 19  ? -20.573 34.640  -3.386  1.00 44.46  ? 262 VAL A CB    1 
ATOM   107   C  CG1   . VAL A  1 19  ? -20.522 34.312  -4.877  1.00 44.18  ? 262 VAL A CG1   1 
ATOM   108   C  CG2   . VAL A  1 19  ? -21.765 35.544  -3.089  1.00 42.47  ? 262 VAL A CG2   1 
ATOM   109   N  N     . LEU A  1 20  ? -18.393 32.726  -2.446  1.00 40.01  ? 263 LEU A N     1 
ATOM   110   C  CA    . LEU A  1 20  ? -17.262 31.879  -2.680  1.00 35.48  ? 263 LEU A CA    1 
ATOM   111   C  C     . LEU A  1 20  ? -17.403 30.513  -2.044  1.00 36.08  ? 263 LEU A C     1 
ATOM   112   O  O     . LEU A  1 20  ? -16.886 29.477  -2.567  1.00 33.52  ? 263 LEU A O     1 
ATOM   113   C  CB    . LEU A  1 20  ? -16.077 32.576  -2.069  1.00 41.15  ? 263 LEU A CB    1 
ATOM   114   C  CG    . LEU A  1 20  ? -14.777 32.525  -2.833  1.00 46.46  ? 263 LEU A CG    1 
ATOM   115   C  CD1   . LEU A  1 20  ? -14.092 31.226  -2.565  1.00 47.38  ? 263 LEU A CD1   1 
ATOM   116   C  CD2   . LEU A  1 20  ? -15.021 32.715  -4.326  1.00 52.97  ? 263 LEU A CD2   1 
ATOM   117   N  N     . ALA A  1 21  ? -18.035 30.498  -0.874  1.00 32.06  ? 264 ALA A N     1 
ATOM   118   C  CA    . ALA A  1 21  ? -18.178 29.247  -0.113  1.00 33.78  ? 264 ALA A CA    1 
ATOM   119   C  C     . ALA A  1 21  ? -19.105 28.294  -0.870  1.00 33.52  ? 264 ALA A C     1 
ATOM   120   O  O     . ALA A  1 21  ? -18.852 27.097  -0.973  1.00 36.34  ? 264 ALA A O     1 
ATOM   121   C  CB    . ALA A  1 21  ? -18.750 29.539  1.274   1.00 30.48  ? 264 ALA A CB    1 
ATOM   122   N  N     . LYS A  1 22  ? -20.149 28.900  -1.420  1.00 33.94  ? 265 LYS A N     1 
ATOM   123   C  CA    . LYS A  1 22  ? -21.244 28.249  -2.108  1.00 38.75  ? 265 LYS A CA    1 
ATOM   124   C  C     . LYS A  1 22  ? -20.665 27.574  -3.297  1.00 37.95  ? 265 LYS A C     1 
ATOM   125   O  O     . LYS A  1 22  ? -20.912 26.418  -3.569  1.00 39.57  ? 265 LYS A O     1 
ATOM   126   C  CB    . LYS A  1 22  ? -22.213 29.356  -2.539  1.00 44.84  ? 265 LYS A CB    1 
ATOM   127   C  CG    . LYS A  1 22  ? -23.438 28.921  -3.289  1.00 52.39  ? 265 LYS A CG    1 
ATOM   128   C  CD    . LYS A  1 22  ? -24.337 28.077  -2.421  1.00 55.60  ? 265 LYS A CD    1 
ATOM   129   C  CE    . LYS A  1 22  ? -25.133 27.103  -3.261  1.00 59.73  ? 265 LYS A CE    1 
ATOM   130   N  NZ    . LYS A  1 22  ? -25.441 25.852  -2.518  1.00 63.56  ? 265 LYS A NZ    1 
ATOM   131   N  N     . ALA A  1 23  ? -19.773 28.287  -3.953  1.00 37.41  ? 266 ALA A N     1 
ATOM   132   C  CA    . ALA A  1 23  ? -19.157 27.783  -5.140  1.00 31.98  ? 266 ALA A CA    1 
ATOM   133   C  C     . ALA A  1 23  ? -18.337 26.562  -4.910  1.00 33.66  ? 266 ALA A C     1 
ATOM   134   O  O     . ALA A  1 23  ? -18.309 25.696  -5.778  1.00 36.87  ? 266 ALA A O     1 
ATOM   135   C  CB    . ALA A  1 23  ? -18.305 28.865  -5.755  1.00 33.36  ? 266 ALA A CB    1 
ATOM   136   N  N     . TYR A  1 24  ? -17.629 26.480  -3.778  1.00 33.05  ? 267 TYR A N     1 
ATOM   137   C  CA    . TYR A  1 24  ? -16.835 25.277  -3.465  1.00 30.77  ? 267 TYR A CA    1 
ATOM   138   C  C     . TYR A  1 24  ? -17.743 24.119  -3.079  1.00 28.58  ? 267 TYR A C     1 
ATOM   139   O  O     . TYR A  1 24  ? -17.454 22.963  -3.324  1.00 27.88  ? 267 TYR A O     1 
ATOM   140   C  CB    . TYR A  1 24  ? -15.888 25.564  -2.278  1.00 33.72  ? 267 TYR A CB    1 
ATOM   141   C  CG    . TYR A  1 24  ? -14.637 26.359  -2.649  1.00 37.82  ? 267 TYR A CG    1 
ATOM   142   C  CD1   . TYR A  1 24  ? -13.686 25.832  -3.516  1.00 36.56  ? 267 TYR A CD1   1 
ATOM   143   C  CD2   . TYR A  1 24  ? -14.406 27.629  -2.121  1.00 38.85  ? 267 TYR A CD2   1 
ATOM   144   C  CE1   . TYR A  1 24  ? -12.546 26.547  -3.853  1.00 41.95  ? 267 TYR A CE1   1 
ATOM   145   C  CE2   . TYR A  1 24  ? -13.265 28.345  -2.450  1.00 40.66  ? 267 TYR A CE2   1 
ATOM   146   C  CZ    . TYR A  1 24  ? -12.343 27.804  -3.317  1.00 41.08  ? 267 TYR A CZ    1 
ATOM   147   O  OH    . TYR A  1 24  ? -11.217 28.515  -3.615  1.00 43.48  ? 267 TYR A OH    1 
ATOM   148   N  N     . SER A  1 25  ? -18.830 24.474  -2.416  1.00 29.42  ? 268 SER A N     1 
ATOM   149   C  CA    . SER A  1 25  ? -19.834 23.519  -1.974  1.00 32.80  ? 268 SER A CA    1 
ATOM   150   C  C     . SER A  1 25  ? -20.419 22.750  -3.171  1.00 29.97  ? 268 SER A C     1 
ATOM   151   O  O     . SER A  1 25  ? -20.257 21.568  -3.285  1.00 28.81  ? 268 SER A O     1 
ATOM   152   C  CB    . SER A  1 25  ? -20.911 24.292  -1.230  1.00 32.97  ? 268 SER A CB    1 
ATOM   153   O  OG    . SER A  1 25  ? -21.675 23.422  -0.455  1.00 39.84  ? 268 SER A OG    1 
ATOM   154   N  N     . VAL A  1 26  ? -20.973 23.452  -4.143  1.00 34.93  ? 269 VAL A N     1 
ATOM   155   C  CA    . VAL A  1 26  ? -21.531 22.774  -5.345  1.00 32.80  ? 269 VAL A CA    1 
ATOM   156   C  C     . VAL A  1 26  ? -20.531 22.047  -6.216  1.00 36.42  ? 269 VAL A C     1 
ATOM   157   O  O     . VAL A  1 26  ? -20.886 21.096  -6.940  1.00 38.94  ? 269 VAL A O     1 
ATOM   158   C  CB    . VAL A  1 26  ? -22.350 23.709  -6.174  1.00 33.30  ? 269 VAL A CB    1 
ATOM   159   C  CG1   . VAL A  1 26  ? -23.362 24.418  -5.271  1.00 29.29  ? 269 VAL A CG1   1 
ATOM   160   C  CG2   . VAL A  1 26  ? -21.446 24.714  -6.867  1.00 38.10  ? 269 VAL A CG2   1 
ATOM   161   N  N     . GLN A  1 27  ? -19.265 22.420  -6.122  1.00 34.47  ? 270 GLN A N     1 
ATOM   162   C  CA    . GLN A  1 27  ? -18.256 21.713  -6.871  1.00 33.94  ? 270 GLN A CA    1 
ATOM   163   C  C     . GLN A  1 27  ? -17.773 20.519  -6.134  1.00 31.25  ? 270 GLN A C     1 
ATOM   164   O  O     . GLN A  1 27  ? -17.030 19.727  -6.669  1.00 32.42  ? 270 GLN A O     1 
ATOM   165   C  CB    . GLN A  1 27  ? -17.078 22.624  -7.205  1.00 42.03  ? 270 GLN A CB    1 
ATOM   166   C  CG    . GLN A  1 27  ? -17.474 23.801  -8.074  1.00 46.43  ? 270 GLN A CG    1 
ATOM   167   C  CD    . GLN A  1 27  ? -16.303 24.702  -8.419  1.00 48.64  ? 270 GLN A CD    1 
ATOM   168   O  OE1   . GLN A  1 27  ? -16.226 25.821  -7.948  1.00 46.35  ? 270 GLN A OE1   1 
ATOM   169   N  NE2   . GLN A  1 27  ? -15.393 24.207  -9.255  1.00 44.87  ? 270 GLN A NE2   1 
ATOM   170   N  N     . GLY A  1 28  ? -18.209 20.355  -4.902  1.00 34.35  ? 271 GLY A N     1 
ATOM   171   C  CA    . GLY A  1 28  ? -17.901 19.138  -4.178  1.00 35.29  ? 271 GLY A CA    1 
ATOM   172   C  C     . GLY A  1 28  ? -16.660 19.231  -3.309  1.00 34.53  ? 271 GLY A C     1 
ATOM   173   O  O     . GLY A  1 28  ? -16.212 18.233  -2.788  1.00 28.85  ? 271 GLY A O     1 
ATOM   174   N  N     . ASP A  1 29  ? -16.087 20.417  -3.157  1.00 35.84  ? 272 ASP A N     1 
ATOM   175   C  CA    . ASP A  1 29  ? -14.905 20.554  -2.301  1.00 34.11  ? 272 ASP A CA    1 
ATOM   176   C  C     . ASP A  1 29  ? -15.411 20.839  -0.907  1.00 29.67  ? 272 ASP A C     1 
ATOM   177   O  O     . ASP A  1 29  ? -15.541 21.975  -0.484  1.00 27.43  ? 272 ASP A O     1 
ATOM   178   C  CB    . ASP A  1 29  ? -14.030 21.668  -2.839  1.00 38.65  ? 272 ASP A CB    1 
ATOM   179   C  CG    . ASP A  1 29  ? -12.713 21.774  -2.137  1.00 42.37  ? 272 ASP A CG    1 
ATOM   180   O  OD1   . ASP A  1 29  ? -12.465 21.122  -1.086  1.00 45.57  ? 272 ASP A OD1   1 
ATOM   181   O  OD2   . ASP A  1 29  ? -11.907 22.542  -2.675  1.00 49.40  ? 272 ASP A OD2   1 
ATOM   182   N  N     . LYS A  1 30  ? -15.741 19.789  -0.179  1.00 31.80  ? 273 LYS A N     1 
ATOM   183   C  CA    . LYS A  1 30  ? -16.517 19.996  1.017   1.00 29.95  ? 273 LYS A CA    1 
ATOM   184   C  C     . LYS A  1 30  ? -15.692 20.509  2.193   1.00 29.85  ? 273 LYS A C     1 
ATOM   185   O  O     . LYS A  1 30  ? -16.192 21.349  2.940   1.00 25.85  ? 273 LYS A O     1 
ATOM   186   C  CB    . LYS A  1 30  ? -17.297 18.748  1.422   1.00 34.30  ? 273 LYS A CB    1 
ATOM   187   C  CG    . LYS A  1 30  ? -16.535 17.452  1.490   1.00 39.56  ? 273 LYS A CG    1 
ATOM   188   C  CD    . LYS A  1 30  ? -17.316 16.453  2.361   1.00 45.66  ? 273 LYS A CD    1 
ATOM   189   C  CE    . LYS A  1 30  ? -16.737 15.038  2.224   1.00 50.03  ? 273 LYS A CE    1 
ATOM   190   N  NZ    . LYS A  1 30  ? -17.209 14.097  3.293   1.00 50.93  ? 273 LYS A NZ    1 
ATOM   191   N  N     . TRP A  1 31  ? -14.475 19.984  2.398   1.00 29.64  ? 274 TRP A N     1 
ATOM   192   C  CA    . TRP A  1 31  ? -13.648 20.438  3.533   1.00 30.72  ? 274 TRP A CA    1 
ATOM   193   C  C     . TRP A  1 31  ? -13.336 21.893  3.403   1.00 32.85  ? 274 TRP A C     1 
ATOM   194   O  O     . TRP A  1 31  ? -13.427 22.643  4.363   1.00 37.80  ? 274 TRP A O     1 
ATOM   195   C  CB    . TRP A  1 31  ? -12.374 19.649  3.598   1.00 33.44  ? 274 TRP A CB    1 
ATOM   196   C  CG    . TRP A  1 31  ? -12.668 18.216  3.750   1.00 35.51  ? 274 TRP A CG    1 
ATOM   197   C  CD1   . TRP A  1 31  ? -12.148 17.193  3.034   1.00 35.88  ? 274 TRP A CD1   1 
ATOM   198   C  CD2   . TRP A  1 31  ? -13.585 17.639  4.683   1.00 33.52  ? 274 TRP A CD2   1 
ATOM   199   N  NE1   . TRP A  1 31  ? -12.671 16.000  3.476   1.00 37.46  ? 274 TRP A NE1   1 
ATOM   200   C  CE2   . TRP A  1 31  ? -13.556 16.259  4.493   1.00 36.34  ? 274 TRP A CE2   1 
ATOM   201   C  CE3   . TRP A  1 31  ? -14.425 18.161  5.659   1.00 37.98  ? 274 TRP A CE3   1 
ATOM   202   C  CZ2   . TRP A  1 31  ? -14.342 15.400  5.233   1.00 35.17  ? 274 TRP A CZ2   1 
ATOM   203   C  CZ3   . TRP A  1 31  ? -15.203 17.298  6.403   1.00 37.77  ? 274 TRP A CZ3   1 
ATOM   204   C  CH2   . TRP A  1 31  ? -15.165 15.943  6.178   1.00 35.87  ? 274 TRP A CH2   1 
ATOM   205   N  N     . ARG A  1 32  ? -13.031 22.324  2.192   1.00 33.34  ? 275 ARG A N     1 
ATOM   206   C  CA    . ARG A  1 32  ? -12.835 23.740  1.949   1.00 35.91  ? 275 ARG A CA    1 
ATOM   207   C  C     . ARG A  1 32  ? -14.122 24.488  2.247   1.00 36.31  ? 275 ARG A C     1 
ATOM   208   O  O     . ARG A  1 32  ? -14.102 25.513  2.905   1.00 38.12  ? 275 ARG A O     1 
ATOM   209   C  CB    . ARG A  1 32  ? -12.353 23.994  0.513   1.00 36.91  ? 275 ARG A CB    1 
ATOM   210   C  CG    . ARG A  1 32  ? -11.889 25.401  0.259   1.00 43.64  ? 275 ARG A CG    1 
ATOM   211   C  CD    . ARG A  1 32  ? -11.152 25.608  -1.071  1.00 48.02  ? 275 ARG A CD    1 
ATOM   212   N  NE    . ARG A  1 32  ? -9.724  25.411  -0.919  1.00 50.39  ? 275 ARG A NE    1 
ATOM   213   C  CZ    . ARG A  1 32  ? -9.018  24.418  -1.445  1.00 51.10  ? 275 ARG A CZ    1 
ATOM   214   N  NH1   . ARG A  1 32  ? -9.571  23.507  -2.228  1.00 51.17  ? 275 ARG A NH1   1 
ATOM   215   N  NH2   . ARG A  1 32  ? -7.734  24.358  -1.189  1.00 50.01  ? 275 ARG A NH2   1 
ATOM   216   N  N     . ALA A  1 33  ? -15.253 23.977  1.772   1.00 36.42  ? 276 ALA A N     1 
ATOM   217   C  CA    . ALA A  1 33  ? -16.558 24.595  2.097   1.00 34.45  ? 276 ALA A CA    1 
ATOM   218   C  C     . ALA A  1 33  ? -16.834 24.678  3.590   1.00 31.09  ? 276 ALA A C     1 
ATOM   219   O  O     . ALA A  1 33  ? -17.352 25.665  4.082   1.00 30.84  ? 276 ALA A O     1 
ATOM   220   C  CB    . ALA A  1 33  ? -17.681 23.837  1.417   1.00 32.78  ? 276 ALA A CB    1 
ATOM   221   N  N     . LEU A  1 34  ? -16.466 23.629  4.306   1.00 32.19  ? 277 LEU A N     1 
ATOM   222   C  CA    . LEU A  1 34  ? -16.532 23.608  5.767   1.00 35.05  ? 277 LEU A CA    1 
ATOM   223   C  C     . LEU A  1 34  ? -15.690 24.761  6.389   1.00 32.51  ? 277 LEU A C     1 
ATOM   224   O  O     . LEU A  1 34  ? -16.193 25.572  7.175   1.00 35.58  ? 277 LEU A O     1 
ATOM   225   C  CB    . LEU A  1 34  ? -16.027 22.240  6.293   1.00 37.24  ? 277 LEU A CB    1 
ATOM   226   C  CG    . LEU A  1 34  ? -16.252 22.086  7.797   1.00 37.95  ? 277 LEU A CG    1 
ATOM   227   C  CD1   . LEU A  1 34  ? -17.746 22.191  8.062   1.00 40.86  ? 277 LEU A CD1   1 
ATOM   228   C  CD2   . LEU A  1 34  ? -15.687 20.802  8.362   1.00 36.75  ? 277 LEU A CD2   1 
ATOM   229   N  N     . GLY A  1 35  ? -14.434 24.857  5.988   1.00 31.91  ? 278 GLY A N     1 
ATOM   230   C  CA    . GLY A  1 35  ? -13.540 25.955  6.477   1.00 31.63  ? 278 GLY A CA    1 
ATOM   231   C  C     . GLY A  1 35  ? -14.170 27.316  6.293   1.00 30.45  ? 278 GLY A C     1 
ATOM   232   O  O     . GLY A  1 35  ? -14.180 28.139  7.203   1.00 28.40  ? 278 GLY A O     1 
ATOM   233   N  N     . TYR A  1 36  ? -14.797 27.539  5.143   1.00 31.11  ? 279 TYR A N     1 
ATOM   234   C  CA    . TYR A  1 36  ? -15.383 28.851  4.887   1.00 31.40  ? 279 TYR A CA    1 
ATOM   235   C  C     . TYR A  1 36  ? -16.542 29.096  5.792   1.00 33.34  ? 279 TYR A C     1 
ATOM   236   O  O     . TYR A  1 36  ? -16.708 30.200  6.363   1.00 30.18  ? 279 TYR A O     1 
ATOM   237   C  CB    . TYR A  1 36  ? -15.800 28.991  3.417   1.00 33.09  ? 279 TYR A CB    1 
ATOM   238   C  CG    . TYR A  1 36  ? -14.693 29.485  2.500   1.00 31.97  ? 279 TYR A CG    1 
ATOM   239   C  CD1   . TYR A  1 36  ? -13.722 28.628  2.019   1.00 34.39  ? 279 TYR A CD1   1 
ATOM   240   C  CD2   . TYR A  1 36  ? -14.611 30.827  2.131   1.00 33.83  ? 279 TYR A CD2   1 
ATOM   241   C  CE1   . TYR A  1 36  ? -12.686 29.087  1.192   1.00 35.34  ? 279 TYR A CE1   1 
ATOM   242   C  CE2   . TYR A  1 36  ? -13.595 31.299  1.301   1.00 33.91  ? 279 TYR A CE2   1 
ATOM   243   C  CZ    . TYR A  1 36  ? -12.632 30.433  0.825   1.00 36.89  ? 279 TYR A CZ    1 
ATOM   244   O  OH    . TYR A  1 36  ? -11.615 30.893  -0.026  1.00 41.26  ? 279 TYR A OH    1 
ATOM   245   N  N     . ALA A  1 37  ? -17.372 28.068  5.945   1.00 31.96  ? 280 ALA A N     1 
ATOM   246   C  CA    . ALA A  1 37  ? -18.535 28.245  6.791   1.00 33.69  ? 280 ALA A CA    1 
ATOM   247   C  C     . ALA A  1 37  ? -18.153 28.708  8.199   1.00 29.16  ? 280 ALA A C     1 
ATOM   248   O  O     . ALA A  1 37  ? -18.810 29.584  8.786   1.00 24.73  ? 280 ALA A O     1 
ATOM   249   C  CB    . ALA A  1 37  ? -19.342 26.944  6.863   1.00 37.11  ? 280 ALA A CB    1 
ATOM   250   N  N     . LYS A  1 38  ? -17.097 28.116  8.750   1.00 29.55  ? 281 LYS A N     1 
ATOM   251   C  CA    . LYS A  1 38  ? -16.724 28.421  10.135  1.00 31.49  ? 281 LYS A CA    1 
ATOM   252   C  C     . LYS A  1 38  ? -16.126 29.835  10.224  1.00 31.59  ? 281 LYS A C     1 
ATOM   253   O  O     . LYS A  1 38  ? -16.524 30.673  11.058  1.00 32.38  ? 281 LYS A O     1 
ATOM   254   C  CB    . LYS A  1 38  ? -15.794 27.352  10.646  1.00 38.41  ? 281 LYS A CB    1 
ATOM   255   C  CG    . LYS A  1 38  ? -16.481 25.997  10.715  1.00 41.54  ? 281 LYS A CG    1 
ATOM   256   C  CD    . LYS A  1 38  ? -15.521 24.860  10.991  1.00 46.25  ? 281 LYS A CD    1 
ATOM   257   C  CE    . LYS A  1 38  ? -16.290 23.557  11.223  1.00 49.40  ? 281 LYS A CE    1 
ATOM   258   N  NZ    . LYS A  1 38  ? -15.419 22.459  11.742  1.00 51.31  ? 281 LYS A NZ    1 
ATOM   259   N  N     . ALA A  1 39  ? -15.262 30.142  9.274   1.00 30.43  ? 282 ALA A N     1 
ATOM   260   C  CA    . ALA A  1 39  ? -14.709 31.472  9.165   1.00 30.13  ? 282 ALA A CA    1 
ATOM   261   C  C     . ALA A  1 39  ? -15.783 32.500  9.174   1.00 28.75  ? 282 ALA A C     1 
ATOM   262   O  O     . ALA A  1 39  ? -15.760 33.480  9.927   1.00 30.51  ? 282 ALA A O     1 
ATOM   263   C  CB    . ALA A  1 39  ? -13.871 31.556  7.890   1.00 30.37  ? 282 ALA A CB    1 
ATOM   264   N  N     . ILE A  1 40  ? -16.788 32.236  8.375   1.00 32.83  ? 283 ILE A N     1 
ATOM   265   C  CA    . ILE A  1 40  ? -17.889 33.161  8.202   1.00 32.59  ? 283 ILE A CA    1 
ATOM   266   C  C     . ILE A  1 40  ? -18.687 33.346  9.467   1.00 35.71  ? 283 ILE A C     1 
ATOM   267   O  O     . ILE A  1 40  ? -18.956 34.492  9.852   1.00 37.35  ? 283 ILE A O     1 
ATOM   268   C  CB    . ILE A  1 40  ? -18.779 32.694  7.035   1.00 36.45  ? 283 ILE A CB    1 
ATOM   269   C  CG1   . ILE A  1 40  ? -18.024 32.981  5.751   1.00 38.11  ? 283 ILE A CG1   1 
ATOM   270   C  CG2   . ILE A  1 40  ? -20.123 33.417  7.005   1.00 35.77  ? 283 ILE A CG2   1 
ATOM   271   C  CD1   . ILE A  1 40  ? -18.632 32.370  4.518   1.00 39.33  ? 283 ILE A CD1   1 
ATOM   272   N  N     . ASN A  1 41  ? -19.083 32.264  10.134  1.00 34.81  ? 284 ASN A N     1 
ATOM   273   C  CA    . ASN A  1 41  ? -19.794 32.490  11.379  1.00 38.18  ? 284 ASN A CA    1 
ATOM   274   C  C     . ASN A  1 41  ? -18.945 33.310  12.364  1.00 35.54  ? 284 ASN A C     1 
ATOM   275   O  O     . ASN A  1 41  ? -19.446 34.258  12.978  1.00 34.01  ? 284 ASN A O     1 
ATOM   276   C  CB    . ASN A  1 41  ? -20.241 31.217  12.094  1.00 41.69  ? 284 ASN A CB    1 
ATOM   277   C  CG    . ASN A  1 41  ? -21.102 31.545  13.334  1.00 47.95  ? 284 ASN A CG    1 
ATOM   278   O  OD1   . ASN A  1 41  ? -20.749 31.216  14.483  1.00 49.72  ? 284 ASN A OD1   1 
ATOM   279   N  ND2   . ASN A  1 41  ? -22.241 32.231  13.094  1.00 45.75  ? 284 ASN A ND2   1 
ATOM   280   N  N     . ALA A  1 42  ? -17.668 32.946  12.496  1.00 34.64  ? 285 ALA A N     1 
ATOM   281   C  CA    . ALA A  1 42  ? -16.739 33.701  13.371  1.00 34.11  ? 285 ALA A CA    1 
ATOM   282   C  C     . ALA A  1 42  ? -16.749 35.211  13.061  1.00 33.56  ? 285 ALA A C     1 
ATOM   283   O  O     . ALA A  1 42  ? -16.853 36.011  13.969  1.00 34.42  ? 285 ALA A O     1 
ATOM   284   C  CB    . ALA A  1 42  ? -15.319 33.130  13.294  1.00 29.79  ? 285 ALA A CB    1 
ATOM   285   N  N     . LEU A  1 43  ? -16.752 35.593  11.783  1.00 34.82  ? 286 LEU A N     1 
ATOM   286   C  CA    . LEU A  1 43  ? -16.821 37.021  11.438  1.00 34.18  ? 286 LEU A CA    1 
ATOM   287   C  C     . LEU A  1 43  ? -18.090 37.672  11.852  1.00 39.08  ? 286 LEU A C     1 
ATOM   288   O  O     . LEU A  1 43  ? -18.091 38.842  12.313  1.00 42.96  ? 286 LEU A O     1 
ATOM   289   C  CB    . LEU A  1 43  ? -16.654 37.228  9.969   1.00 34.41  ? 286 LEU A CB    1 
ATOM   290   C  CG    . LEU A  1 43  ? -15.253 36.990  9.416   1.00 39.72  ? 286 LEU A CG    1 
ATOM   291   C  CD1   . LEU A  1 43  ? -15.291 37.003  7.898   1.00 39.17  ? 286 LEU A CD1   1 
ATOM   292   C  CD2   . LEU A  1 43  ? -14.274 38.048  9.921   1.00 40.42  ? 286 LEU A CD2   1 
ATOM   293   N  N     . LYS A  1 44  ? -19.181 36.930  11.689  1.00 38.01  ? 287 LYS A N     1 
ATOM   294   C  CA    . LYS A  1 44  ? -20.470 37.417  12.088  1.00 37.89  ? 287 LYS A CA    1 
ATOM   295   C  C     . LYS A  1 44  ? -20.498 37.629  13.598  1.00 34.91  ? 287 LYS A C     1 
ATOM   296   O  O     . LYS A  1 44  ? -21.182 38.499  14.064  1.00 31.43  ? 287 LYS A O     1 
ATOM   297   C  CB    . LYS A  1 44  ? -21.559 36.418  11.674  1.00 42.25  ? 287 LYS A CB    1 
ATOM   298   C  CG    . LYS A  1 44  ? -21.768 36.316  10.163  1.00 44.55  ? 287 LYS A CG    1 
ATOM   299   C  CD    . LYS A  1 44  ? -22.911 35.349  9.838   1.00 45.29  ? 287 LYS A CD    1 
ATOM   300   C  CE    . LYS A  1 44  ? -23.622 35.741  8.558   1.00 46.98  ? 287 LYS A CE    1 
ATOM   301   N  NZ    . LYS A  1 44  ? -22.852 35.257  7.392   1.00 51.94  ? 287 LYS A NZ    1 
ATOM   302   N  N     . SER A  1 45  ? -19.784 36.802  14.361  1.00 39.46  ? 288 SER A N     1 
ATOM   303   C  CA    . SER A  1 45  ? -19.832 36.872  15.835  1.00 42.91  ? 288 SER A CA    1 
ATOM   304   C  C     . SER A  1 45  ? -19.033 38.047  16.386  1.00 41.49  ? 288 SER A C     1 
ATOM   305   O  O     . SER A  1 45  ? -19.221 38.435  17.529  1.00 47.16  ? 288 SER A O     1 
ATOM   306   C  CB    . SER A  1 45  ? -19.256 35.615  16.466  1.00 40.35  ? 288 SER A CB    1 
ATOM   307   O  OG    . SER A  1 45  ? -19.909 34.485  15.973  1.00 53.28  ? 288 SER A OG    1 
ATOM   308   N  N     . PHE A  1 46  ? -18.139 38.600  15.589  1.00 40.46  ? 289 PHE A N     1 
ATOM   309   C  CA    . PHE A  1 46  ? -17.119 39.517  16.124  1.00 39.57  ? 289 PHE A CA    1 
ATOM   310   C  C     . PHE A  1 46  ? -17.640 40.889  16.618  1.00 39.08  ? 289 PHE A C     1 
ATOM   311   O  O     . PHE A  1 46  ? -18.404 41.577  15.961  1.00 35.87  ? 289 PHE A O     1 
ATOM   312   C  CB    . PHE A  1 46  ? -16.028 39.702  15.091  1.00 36.75  ? 289 PHE A CB    1 
ATOM   313   C  CG    . PHE A  1 46  ? -14.693 40.017  15.683  1.00 36.88  ? 289 PHE A CG    1 
ATOM   314   C  CD1   . PHE A  1 46  ? -14.058 39.107  16.502  1.00 35.37  ? 289 PHE A CD1   1 
ATOM   315   C  CD2   . PHE A  1 46  ? -14.069 41.237  15.407  1.00 33.44  ? 289 PHE A CD2   1 
ATOM   316   C  CE1   . PHE A  1 46  ? -12.844 39.425  17.051  1.00 35.54  ? 289 PHE A CE1   1 
ATOM   317   C  CE2   . PHE A  1 46  ? -12.846 41.540  15.924  1.00 34.26  ? 289 PHE A CE2   1 
ATOM   318   C  CZ    . PHE A  1 46  ? -12.237 40.638  16.758  1.00 36.73  ? 289 PHE A CZ    1 
ATOM   319   N  N     . HIS A  1 47  ? -17.165 41.309  17.785  1.00 41.10  ? 290 HIS A N     1 
ATOM   320   C  CA    . HIS A  1 47  ? -17.643 42.548  18.400  1.00 38.91  ? 290 HIS A CA    1 
ATOM   321   C  C     . HIS A  1 47  ? -17.462 43.796  17.535  1.00 35.35  ? 290 HIS A C     1 
ATOM   322   O  O     . HIS A  1 47  ? -18.131 44.766  17.763  1.00 39.39  ? 290 HIS A O     1 
ATOM   323   C  CB    . HIS A  1 47  ? -16.993 42.740  19.773  1.00 37.13  ? 290 HIS A CB    1 
ATOM   324   C  CG    . HIS A  1 47  ? -15.508 42.889  19.715  1.00 39.69  ? 290 HIS A CG    1 
ATOM   325   N  ND1   . HIS A  1 47  ? -14.653 41.812  19.794  1.00 40.08  ? 290 HIS A ND1   1 
ATOM   326   C  CD2   . HIS A  1 47  ? -14.724 43.982  19.563  1.00 39.51  ? 290 HIS A CD2   1 
ATOM   327   C  CE1   . HIS A  1 47  ? -13.405 42.233  19.704  1.00 41.02  ? 290 HIS A CE1   1 
ATOM   328   N  NE2   . HIS A  1 47  ? -13.419 43.545  19.566  1.00 39.27  ? 290 HIS A NE2   1 
ATOM   329   N  N     . LYS A  1 48  ? -16.607 43.765  16.524  1.00 36.84  ? 291 LYS A N     1 
ATOM   330   C  CA    . LYS A  1 48  ? -16.326 44.959  15.702  1.00 35.33  ? 291 LYS A CA    1 
ATOM   331   C  C     . LYS A  1 48  ? -15.925 44.660  14.255  1.00 33.95  ? 291 LYS A C     1 
ATOM   332   O  O     . LYS A  1 48  ? -15.465 43.585  13.934  1.00 32.55  ? 291 LYS A O     1 
ATOM   333   C  CB    . LYS A  1 48  ? -15.174 45.772  16.369  1.00 34.90  ? 291 LYS A CB    1 
ATOM   334   C  CG    . LYS A  1 48  ? -13.823 45.054  16.346  1.00 34.29  ? 291 LYS A CG    1 
ATOM   335   C  CD    . LYS A  1 48  ? -12.703 45.895  16.944  1.00 36.34  ? 291 LYS A CD    1 
ATOM   336   C  CE    . LYS A  1 48  ? -11.991 46.764  15.901  1.00 35.58  ? 291 LYS A CE    1 
ATOM   337   N  NZ    . LYS A  1 48  ? -11.055 45.957  15.051  1.00 35.07  ? 291 LYS A NZ    1 
ATOM   338   N  N     . PRO A  1 49  ? -16.030 45.654  13.370  1.00 37.03  ? 292 PRO A N     1 
ATOM   339   C  CA    . PRO A  1 49  ? -15.376 45.400  12.102  1.00 37.50  ? 292 PRO A CA    1 
ATOM   340   C  C     . PRO A  1 49  ? -13.939 44.968  12.294  1.00 36.21  ? 292 PRO A C     1 
ATOM   341   O  O     . PRO A  1 49  ? -13.259 45.470  13.167  1.00 42.90  ? 292 PRO A O     1 
ATOM   342   C  CB    . PRO A  1 49  ? -15.449 46.768  11.395  1.00 37.74  ? 292 PRO A CB    1 
ATOM   343   C  CG    . PRO A  1 49  ? -16.621 47.445  12.006  1.00 36.08  ? 292 PRO A CG    1 
ATOM   344   C  CD    . PRO A  1 49  ? -16.553 47.031  13.443  1.00 37.19  ? 292 PRO A CD    1 
ATOM   345   N  N     . VAL A  1 50  ? -13.487 44.031  11.499  1.00 33.31  ? 293 VAL A N     1 
ATOM   346   C  CA    . VAL A  1 50  ? -12.120 43.675  11.493  1.00 35.98  ? 293 VAL A CA    1 
ATOM   347   C  C     . VAL A  1 50  ? -11.330 44.811  10.860  1.00 37.01  ? 293 VAL A C     1 
ATOM   348   O  O     . VAL A  1 50  ? -11.755 45.369  9.863   1.00 35.41  ? 293 VAL A O     1 
ATOM   349   C  CB    . VAL A  1 50  ? -11.891 42.382  10.698  1.00 35.51  ? 293 VAL A CB    1 
ATOM   350   C  CG1   . VAL A  1 50  ? -10.392 42.141  10.502  1.00 34.97  ? 293 VAL A CG1   1 
ATOM   351   C  CG2   . VAL A  1 50  ? -12.530 41.201  11.431  1.00 37.49  ? 293 VAL A CG2   1 
ATOM   352   N  N     . THR A  1 51  ? -10.182 45.154  11.433  1.00 37.76  ? 294 THR A N     1 
ATOM   353   C  CA    . THR A  1 51  ? -9.474  46.323  10.947  1.00 38.02  ? 294 THR A CA    1 
ATOM   354   C  C     . THR A  1 51  ? -8.061  46.040  10.526  1.00 38.13  ? 294 THR A C     1 
ATOM   355   O  O     . THR A  1 51  ? -7.417  46.875  9.920   1.00 42.10  ? 294 THR A O     1 
ATOM   356   C  CB    . THR A  1 51  ? -9.565  47.438  11.965  1.00 40.12  ? 294 THR A CB    1 
ATOM   357   O  OG1   . THR A  1 51  ? -9.112  46.971  13.243  1.00 42.30  ? 294 THR A OG1   1 
ATOM   358   C  CG2   . THR A  1 51  ? -11.004 47.874  12.093  1.00 41.01  ? 294 THR A CG2   1 
ATOM   359   N  N     . SER A  1 52  ? -7.596  44.836  10.770  1.00 37.23  ? 295 SER A N     1 
ATOM   360   C  CA    . SER A  1 52  ? -6.252  44.512  10.411  1.00 38.21  ? 295 SER A CA    1 
ATOM   361   C  C     . SER A  1 52  ? -6.179  43.021  10.190  1.00 37.82  ? 295 SER A C     1 
ATOM   362   O  O     . SER A  1 52  ? -7.025  42.241  10.685  1.00 35.98  ? 295 SER A O     1 
ATOM   363   C  CB    . SER A  1 52  ? -5.287  44.926  11.534  1.00 40.34  ? 295 SER A CB    1 
ATOM   364   O  OG    . SER A  1 52  ? -4.945  43.800  12.363  1.00 42.79  ? 295 SER A OG    1 
ATOM   365   N  N     . TYR A  1 53  ? -5.141  42.650  9.473   1.00 32.52  ? 296 TYR A N     1 
ATOM   366   C  CA    . TYR A  1 53  ? -4.868  41.288  9.117   1.00 33.50  ? 296 TYR A CA    1 
ATOM   367   C  C     . TYR A  1 53  ? -4.660  40.513  10.389  1.00 34.48  ? 296 TYR A C     1 
ATOM   368   O  O     . TYR A  1 53  ? -5.328  39.523  10.619  1.00 37.63  ? 296 TYR A O     1 
ATOM   369   C  CB    . TYR A  1 53  ? -3.619  41.277  8.229   1.00 31.50  ? 296 TYR A CB    1 
ATOM   370   C  CG    . TYR A  1 53  ? -3.073  39.945  7.758   1.00 33.36  ? 296 TYR A CG    1 
ATOM   371   C  CD1   . TYR A  1 53  ? -2.178  39.260  8.500   1.00 35.72  ? 296 TYR A CD1   1 
ATOM   372   C  CD2   . TYR A  1 53  ? -3.390  39.432  6.511   1.00 37.30  ? 296 TYR A CD2   1 
ATOM   373   C  CE1   . TYR A  1 53  ? -1.621  38.068  8.054   1.00 36.12  ? 296 TYR A CE1   1 
ATOM   374   C  CE2   . TYR A  1 53  ? -2.851  38.235  6.057   1.00 36.12  ? 296 TYR A CE2   1 
ATOM   375   C  CZ    . TYR A  1 53  ? -1.957  37.555  6.839   1.00 37.50  ? 296 TYR A CZ    1 
ATOM   376   O  OH    . TYR A  1 53  ? -1.385  36.348  6.428   1.00 38.90  ? 296 TYR A OH    1 
ATOM   377   N  N     . GLN A  1 54  ? -3.732  40.992  11.214  1.00 33.05  ? 297 GLN A N     1 
ATOM   378   C  CA    . GLN A  1 54  ? -3.440  40.426  12.519  1.00 29.14  ? 297 GLN A CA    1 
ATOM   379   C  C     . GLN A  1 54  ? -4.688  40.072  13.301  1.00 25.48  ? 297 GLN A C     1 
ATOM   380   O  O     . GLN A  1 54  ? -4.769  38.999  13.819  1.00 26.05  ? 297 GLN A O     1 
ATOM   381   C  CB    . GLN A  1 54  ? -2.650  41.411  13.375  1.00 31.42  ? 297 GLN A CB    1 
ATOM   382   C  CG    . GLN A  1 54  ? -2.290  40.808  14.720  1.00 33.16  ? 297 GLN A CG    1 
ATOM   383   C  CD    . GLN A  1 54  ? -1.097  41.493  15.389  1.00 38.55  ? 297 GLN A CD    1 
ATOM   384   O  OE1   . GLN A  1 54  ? -0.530  42.468  14.880  1.00 41.96  ? 297 GLN A OE1   1 
ATOM   385   N  NE2   . GLN A  1 54  ? -0.726  40.987  16.533  1.00 36.02  ? 297 GLN A NE2   1 
ATOM   386   N  N     . GLU A  1 55  ? -5.617  41.001  13.413  1.00 25.78  ? 298 GLU A N     1 
ATOM   387   C  CA    . GLU A  1 55  ? -6.829  40.832  14.220  1.00 29.01  ? 298 GLU A CA    1 
ATOM   388   C  C     . GLU A  1 55  ? -7.648  39.648  13.650  1.00 31.66  ? 298 GLU A C     1 
ATOM   389   O  O     . GLU A  1 55  ? -8.236  38.860  14.373  1.00 33.19  ? 298 GLU A O     1 
ATOM   390   C  CB    . GLU A  1 55  ? -7.632  42.120  14.187  1.00 30.05  ? 298 GLU A CB    1 
ATOM   391   C  CG    . GLU A  1 55  ? -8.805  42.178  15.145  1.00 30.72  ? 298 GLU A CG    1 
ATOM   392   C  CD    . GLU A  1 55  ? -9.637  43.406  14.949  1.00 32.75  ? 298 GLU A CD    1 
ATOM   393   O  OE1   . GLU A  1 55  ? -9.583  43.967  13.838  1.00 40.44  ? 298 GLU A OE1   1 
ATOM   394   O  OE2   . GLU A  1 55  ? -10.334 43.863  15.900  1.00 35.05  ? 298 GLU A OE2   1 
ATOM   395   N  N     . ALA A  1 56  ? -7.596  39.513  12.340  1.00 32.09  ? 299 ALA A N     1 
ATOM   396   C  CA    . ALA A  1 56  ? -8.325  38.488  11.610  1.00 31.23  ? 299 ALA A CA    1 
ATOM   397   C  C     . ALA A  1 56  ? -7.696  37.132  11.920  1.00 30.84  ? 299 ALA A C     1 
ATOM   398   O  O     . ALA A  1 56  ? -8.379  36.199  12.336  1.00 27.16  ? 299 ALA A O     1 
ATOM   399   C  CB    . ALA A  1 56  ? -8.281  38.800  10.118  1.00 31.19  ? 299 ALA A CB    1 
ATOM   400   N  N     . CYS A  1 57  ? -6.379  37.033  11.784  1.00 30.50  ? 300 CYS A N     1 
ATOM   401   C  CA    . CYS A  1 57  ? -5.710  35.793  12.125  1.00 31.99  ? 300 CYS A CA    1 
ATOM   402   C  C     . CYS A  1 57  ? -5.911  35.336  13.574  1.00 31.01  ? 300 CYS A C     1 
ATOM   403   O  O     . CYS A  1 57  ? -5.991  34.122  13.863  1.00 40.57  ? 300 CYS A O     1 
ATOM   404   C  CB    . CYS A  1 57  ? -4.249  35.909  11.811  1.00 33.30  ? 300 CYS A CB    1 
ATOM   405   S  SG    . CYS A  1 57  ? -3.939  36.086  10.060  1.00 40.35  ? 300 CYS A SG    1 
ATOM   406   N  N     . SER A  1 58  ? -6.076  36.300  14.468  1.00 33.00  ? 301 SER A N     1 
ATOM   407   C  CA    . SER A  1 58  ? -6.303  35.996  15.861  1.00 33.28  ? 301 SER A CA    1 
ATOM   408   C  C     . SER A  1 58  ? -7.625  35.301  16.102  1.00 34.03  ? 301 SER A C     1 
ATOM   409   O  O     . SER A  1 58  ? -7.755  34.623  17.089  1.00 40.22  ? 301 SER A O     1 
ATOM   410   C  CB    . SER A  1 58  ? -6.274  37.249  16.690  1.00 32.05  ? 301 SER A CB    1 
ATOM   411   O  OG    . SER A  1 58  ? -7.493  37.914  16.586  1.00 35.89  ? 301 SER A OG    1 
ATOM   412   N  N     . ILE A  1 59  ? -8.609  35.506  15.229  1.00 32.89  ? 302 ILE A N     1 
ATOM   413   C  CA    . ILE A  1 59  ? -9.923  34.851  15.309  1.00 33.13  ? 302 ILE A CA    1 
ATOM   414   C  C     . ILE A  1 59  ? -9.838  33.341  14.960  1.00 33.52  ? 302 ILE A C     1 
ATOM   415   O  O     . ILE A  1 59  ? -9.278  32.958  13.910  1.00 36.20  ? 302 ILE A O     1 
ATOM   416   C  CB    . ILE A  1 59  ? -10.915 35.551  14.356  1.00 34.52  ? 302 ILE A CB    1 
ATOM   417   C  CG1   . ILE A  1 59  ? -11.183 36.970  14.855  1.00 35.70  ? 302 ILE A CG1   1 
ATOM   418   C  CG2   . ILE A  1 59  ? -12.252 34.831  14.303  1.00 33.70  ? 302 ILE A CG2   1 
ATOM   419   C  CD1   . ILE A  1 59  ? -11.813 37.856  13.797  1.00 36.08  ? 302 ILE A CD1   1 
ATOM   420   N  N     . PRO A  1 60  ? -10.289 32.473  15.882  1.00 29.60  ? 303 PRO A N     1 
ATOM   421   C  CA    . PRO A  1 60  ? -10.367 31.028  15.591  1.00 29.41  ? 303 PRO A CA    1 
ATOM   422   C  C     . PRO A  1 60  ? -11.257 30.744  14.351  1.00 27.58  ? 303 PRO A C     1 
ATOM   423   O  O     . PRO A  1 60  ? -12.316 31.260  14.247  1.00 26.17  ? 303 PRO A O     1 
ATOM   424   C  CB    . PRO A  1 60  ? -11.031 30.459  16.848  1.00 30.41  ? 303 PRO A CB    1 
ATOM   425   C  CG    . PRO A  1 60  ? -10.652 31.425  17.936  1.00 32.07  ? 303 PRO A CG    1 
ATOM   426   C  CD    . PRO A  1 60  ? -10.631 32.787  17.282  1.00 30.52  ? 303 PRO A CD    1 
ATOM   427   N  N     . GLY A  1 61  ? -10.796 29.940  13.425  1.00 29.51  ? 304 GLY A N     1 
ATOM   428   C  CA    . GLY A  1 61  ? -11.481 29.698  12.169  1.00 30.76  ? 304 GLY A CA    1 
ATOM   429   C  C     . GLY A  1 61  ? -11.037 30.655  11.076  1.00 34.36  ? 304 GLY A C     1 
ATOM   430   O  O     . GLY A  1 61  ? -11.507 30.572  9.962   1.00 33.56  ? 304 GLY A O     1 
ATOM   431   N  N     . ILE A  1 62  ? -10.158 31.596  11.392  1.00 35.78  ? 305 ILE A N     1 
ATOM   432   C  CA    . ILE A  1 62  ? -9.589  32.495  10.374  1.00 35.40  ? 305 ILE A CA    1 
ATOM   433   C  C     . ILE A  1 62  ? -8.073  32.391  10.423  1.00 35.32  ? 305 ILE A C     1 
ATOM   434   O  O     . ILE A  1 62  ? -7.462  32.670  11.449  1.00 39.86  ? 305 ILE A O     1 
ATOM   435   C  CB    . ILE A  1 62  ? -10.052 33.927  10.636  1.00 36.52  ? 305 ILE A CB    1 
ATOM   436   C  CG1   . ILE A  1 62  ? -11.537 34.016  10.294  1.00 39.06  ? 305 ILE A CG1   1 
ATOM   437   C  CG2   . ILE A  1 62  ? -9.253  34.932  9.821   1.00 37.71  ? 305 ILE A CG2   1 
ATOM   438   C  CD1   . ILE A  1 62  ? -12.255 35.275  10.725  1.00 38.10  ? 305 ILE A CD1   1 
ATOM   439   N  N     . GLY A  1 63  ? -7.486  31.952  9.321   1.00 33.86  ? 306 GLY A N     1 
ATOM   440   C  CA    . GLY A  1 63  ? -6.033  31.903  9.143   1.00 32.56  ? 306 GLY A CA    1 
ATOM   441   C  C     . GLY A  1 63  ? -5.568  32.788  7.986   1.00 33.06  ? 306 GLY A C     1 
ATOM   442   O  O     . GLY A  1 63  ? -6.273  33.714  7.558   1.00 36.29  ? 306 GLY A O     1 
ATOM   443   N  N     . LYS A  1 64  ? -4.387  32.497  7.472   1.00 35.82  ? 307 LYS A N     1 
ATOM   444   C  CA    . LYS A  1 64  ? -3.677  33.392  6.536   1.00 41.24  ? 307 LYS A CA    1 
ATOM   445   C  C     . LYS A  1 64  ? -4.487  33.680  5.258   1.00 41.82  ? 307 LYS A C     1 
ATOM   446   O  O     . LYS A  1 64  ? -4.891  34.820  4.985   1.00 44.07  ? 307 LYS A O     1 
ATOM   447   C  CB    . LYS A  1 64  ? -2.290  32.771  6.248   1.00 44.77  ? 307 LYS A CB    1 
ATOM   448   C  CG    . LYS A  1 64  ? -1.620  33.190  4.948   1.00 55.32  ? 307 LYS A CG    1 
ATOM   449   C  CD    . LYS A  1 64  ? -0.375  32.339  4.671   1.00 59.46  ? 307 LYS A CD    1 
ATOM   450   C  CE    . LYS A  1 64  ? -0.050  32.266  3.176   1.00 64.46  ? 307 LYS A CE    1 
ATOM   451   N  NZ    . LYS A  1 64  ? -0.132  33.595  2.495   1.00 65.20  ? 307 LYS A NZ    1 
ATOM   452   N  N     . ARG A  1 65  ? -4.784  32.635  4.502   1.00 41.74  ? 308 ARG A N     1 
ATOM   453   C  CA    . ARG A  1 65  ? -5.582  32.792  3.269   1.00 42.17  ? 308 ARG A CA    1 
ATOM   454   C  C     . ARG A  1 65  ? -6.915  33.536  3.482   1.00 40.58  ? 308 ARG A C     1 
ATOM   455   O  O     . ARG A  1 65  ? -7.276  34.454  2.729   1.00 43.88  ? 308 ARG A O     1 
ATOM   456   C  CB    . ARG A  1 65  ? -5.792  31.420  2.652   1.00 47.68  ? 308 ARG A CB    1 
ATOM   457   C  CG    . ARG A  1 65  ? -4.463  30.711  2.389   1.00 50.30  ? 308 ARG A CG    1 
ATOM   458   C  CD    . ARG A  1 65  ? -4.600  29.359  1.728   1.00 55.61  ? 308 ARG A CD    1 
ATOM   459   N  NE    . ARG A  1 65  ? -5.189  29.436  0.385   1.00 67.65  ? 308 ARG A NE    1 
ATOM   460   C  CZ    . ARG A  1 65  ? -4.566  29.854  -0.721  1.00 72.05  ? 308 ARG A CZ    1 
ATOM   461   N  NH1   . ARG A  1 65  ? -3.297  30.266  -0.695  1.00 71.49  ? 308 ARG A NH1   1 
ATOM   462   N  NH2   . ARG A  1 65  ? -5.232  29.863  -1.873  1.00 72.81  ? 308 ARG A NH2   1 
ATOM   463   N  N     . MET A  1 66  ? -7.628  33.217  4.542   1.00 33.94  ? 309 MET A N     1 
ATOM   464   C  CA    . MET A  1 66  ? -8.887  33.898  4.790   1.00 34.14  ? 309 MET A CA    1 
ATOM   465   C  C     . MET A  1 66  ? -8.649  35.342  5.185   1.00 34.01  ? 309 MET A C     1 
ATOM   466   O  O     . MET A  1 66  ? -9.375  36.254  4.770   1.00 38.15  ? 309 MET A O     1 
ATOM   467   C  CB    . MET A  1 66  ? -9.649  33.180  5.895   1.00 38.81  ? 309 MET A CB    1 
ATOM   468   C  CG    . MET A  1 66  ? -11.138 33.460  5.940   1.00 38.92  ? 309 MET A CG    1 
ATOM   469   S  SD    . MET A  1 66  ? -12.124 32.711  4.627   1.00 44.02  ? 309 MET A SD    1 
ATOM   470   C  CE    . MET A  1 66  ? -11.338 31.108  4.471   1.00 46.87  ? 309 MET A CE    1 
ATOM   471   N  N     . ALA A  1 67  ? -7.648  35.574  6.022   1.00 34.24  ? 310 ALA A N     1 
ATOM   472   C  CA    . ALA A  1 67  ? -7.222  36.961  6.333   1.00 32.94  ? 310 ALA A CA    1 
ATOM   473   C  C     . ALA A  1 67  ? -6.918  37.774  5.084   1.00 27.95  ? 310 ALA A C     1 
ATOM   474   O  O     . ALA A  1 67  ? -7.398  38.874  4.929   1.00 29.85  ? 310 ALA A O     1 
ATOM   475   C  CB    . ALA A  1 67  ? -5.979  36.902  7.202   1.00 36.26  ? 310 ALA A CB    1 
ATOM   476   N  N     . GLU A  1 68  ? -6.126  37.226  4.174   1.00 29.64  ? 311 GLU A N     1 
ATOM   477   C  CA    . GLU A  1 68  ? -5.801  37.966  2.921   1.00 33.67  ? 311 GLU A CA    1 
ATOM   478   C  C     . GLU A  1 68  ? -7.028  38.451  2.196   1.00 34.48  ? 311 GLU A C     1 
ATOM   479   O  O     . GLU A  1 68  ? -7.102  39.613  1.793   1.00 38.44  ? 311 GLU A O     1 
ATOM   480   C  CB    . GLU A  1 68  ? -5.002  37.119  1.945   1.00 35.98  ? 311 GLU A CB    1 
ATOM   481   C  CG    . GLU A  1 68  ? -3.548  36.919  2.319   1.00 36.41  ? 311 GLU A CG    1 
ATOM   482   C  CD    . GLU A  1 68  ? -2.920  35.789  1.544   1.00 40.32  ? 311 GLU A CD    1 
ATOM   483   O  OE1   . GLU A  1 68  ? -3.682  35.097  0.857   1.00 46.18  ? 311 GLU A OE1   1 
ATOM   484   O  OE2   . GLU A  1 68  ? -1.681  35.565  1.594   1.00 44.31  ? 311 GLU A OE2   1 
ATOM   485   N  N     . LYS A  1 69  ? -8.009  37.556  2.070   1.00 38.45  ? 312 LYS A N     1 
ATOM   486   C  CA    . LYS A  1 69  ? -9.273  37.868  1.411   1.00 36.83  ? 312 LYS A CA    1 
ATOM   487   C  C     . LYS A  1 69  ? -10.076 38.822  2.239   1.00 36.33  ? 312 LYS A C     1 
ATOM   488   O  O     . LYS A  1 69  ? -10.685 39.738  1.708   1.00 39.37  ? 312 LYS A O     1 
ATOM   489   C  CB    . LYS A  1 69  ? -10.106 36.602  1.165   1.00 37.66  ? 312 LYS A CB    1 
ATOM   490   C  CG    . LYS A  1 69  ? -9.307  35.447  0.587   1.00 42.00  ? 312 LYS A CG    1 
ATOM   491   C  CD    . LYS A  1 69  ? -10.203 34.370  -0.004  1.00 41.55  ? 312 LYS A CD    1 
ATOM   492   C  CE    . LYS A  1 69  ? -9.391  33.414  -0.850  1.00 41.77  ? 312 LYS A CE    1 
ATOM   493   N  NZ    . LYS A  1 69  ? -8.491  32.514  -0.063  1.00 43.17  ? 312 LYS A NZ    1 
ATOM   494   N  N     . ILE A  1 70  ? -10.134 38.602  3.550   1.00 36.44  ? 313 ILE A N     1 
ATOM   495   C  CA    . ILE A  1 70  ? -10.854 39.549  4.374   1.00 36.63  ? 313 ILE A CA    1 
ATOM   496   C  C     . ILE A  1 70  ? -10.259 40.955  4.211   1.00 37.25  ? 313 ILE A C     1 
ATOM   497   O  O     . ILE A  1 70  ? -10.968 41.945  4.082   1.00 33.23  ? 313 ILE A O     1 
ATOM   498   C  CB    . ILE A  1 70  ? -10.751 39.190  5.855   1.00 39.54  ? 313 ILE A CB    1 
ATOM   499   C  CG1   . ILE A  1 70  ? -11.541 37.906  6.152   1.00 44.01  ? 313 ILE A CG1   1 
ATOM   500   C  CG2   . ILE A  1 70  ? -11.301 40.320  6.706   1.00 36.43  ? 313 ILE A CG2   1 
ATOM   501   C  CD1   . ILE A  1 70  ? -11.363 37.346  7.549   1.00 42.60  ? 313 ILE A CD1   1 
ATOM   502   N  N     . ILE A  1 71  ? -8.948  41.063  4.270   1.00 40.16  ? 314 ILE A N     1 
ATOM   503   C  CA    . ILE A  1 71  ? -8.389  42.413  4.267   1.00 46.64  ? 314 ILE A CA    1 
ATOM   504   C  C     . ILE A  1 71  ? -8.562  43.044  2.905   1.00 47.42  ? 314 ILE A C     1 
ATOM   505   O  O     . ILE A  1 71  ? -9.165  44.127  2.771   1.00 45.70  ? 314 ILE A O     1 
ATOM   506   C  CB    . ILE A  1 71  ? -6.926  42.434  4.655   1.00 45.56  ? 314 ILE A CB    1 
ATOM   507   C  CG1   . ILE A  1 71  ? -6.759  41.849  6.060   1.00 45.58  ? 314 ILE A CG1   1 
ATOM   508   C  CG2   . ILE A  1 71  ? -6.444  43.863  4.644   1.00 47.45  ? 314 ILE A CG2   1 
ATOM   509   C  CD1   . ILE A  1 71  ? -7.627  42.486  7.121   1.00 45.24  ? 314 ILE A CD1   1 
ATOM   510   N  N     . GLU A  1 72  ? -8.058  42.350  1.903   1.00 47.02  ? 315 GLU A N     1 
ATOM   511   C  CA    . GLU A  1 72  ? -8.371  42.705  0.535   1.00 51.24  ? 315 GLU A CA    1 
ATOM   512   C  C     . GLU A  1 72  ? -9.773  43.261  0.351   1.00 47.72  ? 315 GLU A C     1 
ATOM   513   O  O     . GLU A  1 72  ? -9.926  44.268  -0.328  1.00 53.56  ? 315 GLU A O     1 
ATOM   514   C  CB    . GLU A  1 72  ? -8.200  41.511  -0.394  1.00 53.83  ? 315 GLU A CB    1 
ATOM   515   C  CG    . GLU A  1 72  ? -8.973  41.673  -1.703  1.00 57.38  ? 315 GLU A CG    1 
ATOM   516   C  CD    . GLU A  1 72  ? -8.599  40.668  -2.787  1.00 57.93  ? 315 GLU A CD    1 
ATOM   517   O  OE1   . GLU A  1 72  ? -7.713  39.832  -2.517  1.00 61.40  ? 315 GLU A OE1   1 
ATOM   518   O  OE2   . GLU A  1 72  ? -9.160  40.733  -3.910  1.00 51.86  ? 315 GLU A OE2   1 
ATOM   519   N  N     . ILE A  1 73  ? -10.804 42.619  0.902   1.00 44.36  ? 316 ILE A N     1 
ATOM   520   C  CA    . ILE A  1 73  ? -12.151 43.191  0.757   1.00 42.24  ? 316 ILE A CA    1 
ATOM   521   C  C     . ILE A  1 73  ? -12.244 44.506  1.479   1.00 42.15  ? 316 ILE A C     1 
ATOM   522   O  O     . ILE A  1 73  ? -12.736 45.470  0.930   1.00 51.58  ? 316 ILE A O     1 
ATOM   523   C  CB    . ILE A  1 73  ? -13.307 42.293  1.269   1.00 42.49  ? 316 ILE A CB    1 
ATOM   524   C  CG1   . ILE A  1 73  ? -13.539 41.111  0.342   1.00 43.38  ? 316 ILE A CG1   1 
ATOM   525   C  CG2   . ILE A  1 73  ? -14.618 43.075  1.349   1.00 41.00  ? 316 ILE A CG2   1 
ATOM   526   C  CD1   . ILE A  1 73  ? -14.312 39.960  0.959   1.00 41.12  ? 316 ILE A CD1   1 
ATOM   527   N  N     . LEU A  1 74  ? -11.845 44.526  2.740   1.00 48.36  ? 317 LEU A N     1 
ATOM   528   C  CA    . LEU A  1 74  ? -11.976 45.717  3.578   1.00 44.95  ? 317 LEU A CA    1 
ATOM   529   C  C     . LEU A  1 74  ? -11.173 46.875  2.971   1.00 44.55  ? 317 LEU A C     1 
ATOM   530   O  O     . LEU A  1 74  ? -11.647 47.988  2.901   1.00 36.96  ? 317 LEU A O     1 
ATOM   531   C  CB    . LEU A  1 74  ? -11.498 45.376  4.987   1.00 47.61  ? 317 LEU A CB    1 
ATOM   532   C  CG    . LEU A  1 74  ? -10.729 46.387  5.834   1.00 41.88  ? 317 LEU A CG    1 
ATOM   533   C  CD1   . LEU A  1 74  ? -11.676 47.106  6.769   1.00 35.12  ? 317 LEU A CD1   1 
ATOM   534   C  CD2   . LEU A  1 74  ? -9.637  45.654  6.605   1.00 45.86  ? 317 LEU A CD2   1 
ATOM   535   N  N     . GLU A  1 75  ? -9.961  46.604  2.495   1.00 54.14  ? 318 GLU A N     1 
ATOM   536   C  CA    . GLU A  1 75  ? -9.112  47.675  1.930   1.00 56.17  ? 318 GLU A CA    1 
ATOM   537   C  C     . GLU A  1 75  ? -9.653  48.100  0.561   1.00 60.38  ? 318 GLU A C     1 
ATOM   538   O  O     . GLU A  1 75  ? -10.017 49.266  0.382   1.00 70.23  ? 318 GLU A O     1 
ATOM   539   C  CB    . GLU A  1 75  ? -7.636  47.224  1.850   1.00 59.27  ? 318 GLU A CB    1 
ATOM   540   C  CG    . GLU A  1 75  ? -6.960  47.015  3.216   1.00 60.92  ? 318 GLU A CG    1 
ATOM   541   C  CD    . GLU A  1 75  ? -6.630  48.326  3.951   1.00 66.32  ? 318 GLU A CD    1 
ATOM   542   O  OE1   . GLU A  1 75  ? -5.919  49.160  3.347   1.00 77.00  ? 318 GLU A OE1   1 
ATOM   543   O  OE2   . GLU A  1 75  ? -7.041  48.540  5.124   1.00 54.51  ? 318 GLU A OE2   1 
ATOM   544   N  N     . SER A  1 76  ? -9.758  47.136  -0.367  1.00 60.34  ? 319 SER A N     1 
ATOM   545   C  CA    . SER A  1 76  ? -10.128 47.374  -1.788  1.00 53.30  ? 319 SER A CA    1 
ATOM   546   C  C     . SER A  1 76  ? -11.613 47.264  -2.142  1.00 51.39  ? 319 SER A C     1 
ATOM   547   O  O     . SER A  1 76  ? -11.961 47.518  -3.274  1.00 51.11  ? 319 SER A O     1 
ATOM   548   C  CB    . SER A  1 76  ? -9.362  46.407  -2.710  1.00 52.78  ? 319 SER A CB    1 
ATOM   549   O  OG    . SER A  1 76  ? -10.049 45.176  -2.870  1.00 48.40  ? 319 SER A OG    1 
ATOM   550   N  N     . GLY A  1 77  ? -12.471 46.827  -1.222  1.00 53.92  ? 320 GLY A N     1 
ATOM   551   C  CA    . GLY A  1 77  ? -13.929 47.030  -1.346  1.00 52.74  ? 320 GLY A CA    1 
ATOM   552   C  C     . GLY A  1 77  ? -14.751 45.959  -2.064  1.00 55.82  ? 320 GLY A C     1 
ATOM   553   O  O     . GLY A  1 77  ? -15.970 45.838  -1.848  1.00 55.78  ? 320 GLY A O     1 
ATOM   554   N  N     . HIS A  1 78  ? -14.120 45.211  -2.953  1.00 53.02  ? 321 HIS A N     1 
ATOM   555   C  CA    . HIS A  1 78  ? -14.783 44.090  -3.594  1.00 56.21  ? 321 HIS A CA    1 
ATOM   556   C  C     . HIS A  1 78  ? -13.781 42.976  -3.436  1.00 50.36  ? 321 HIS A C     1 
ATOM   557   O  O     . HIS A  1 78  ? -12.839 43.171  -2.638  1.00 47.13  ? 321 HIS A O     1 
ATOM   558   C  CB    . HIS A  1 78  ? -15.212 44.452  -5.038  1.00 66.30  ? 321 HIS A CB    1 
ATOM   559   C  CG    . HIS A  1 78  ? -16.386 45.406  -5.074  1.00 76.42  ? 321 HIS A CG    1 
ATOM   560   N  ND1   . HIS A  1 78  ? -16.246 46.775  -4.945  1.00 80.34  ? 321 HIS A ND1   1 
ATOM   561   C  CD2   . HIS A  1 78  ? -17.724 45.180  -5.135  1.00 81.54  ? 321 HIS A CD2   1 
ATOM   562   C  CE1   . HIS A  1 78  ? -17.437 47.351  -4.949  1.00 77.00  ? 321 HIS A CE1   1 
ATOM   563   N  NE2   . HIS A  1 78  ? -18.351 46.404  -5.060  1.00 80.41  ? 321 HIS A NE2   1 
ATOM   564   N  N     . LEU A  1 79  ? -13.982 41.823  -4.097  1.00 44.06  ? 322 LEU A N     1 
ATOM   565   C  CA    . LEU A  1 79  ? -13.058 40.669  -3.972  1.00 41.65  ? 322 LEU A CA    1 
ATOM   566   C  C     . LEU A  1 79  ? -12.758 39.967  -5.293  1.00 50.07  ? 322 LEU A C     1 
ATOM   567   O  O     . LEU A  1 79  ? -13.587 39.248  -5.864  1.00 44.16  ? 322 LEU A O     1 
ATOM   568   C  CB    . LEU A  1 79  ? -13.571 39.639  -2.964  1.00 40.71  ? 322 LEU A CB    1 
ATOM   569   C  CG    . LEU A  1 79  ? -12.889 38.258  -2.955  1.00 42.22  ? 322 LEU A CG    1 
ATOM   570   C  CD1   . LEU A  1 79  ? -11.499 38.333  -2.389  1.00 44.02  ? 322 LEU A CD1   1 
ATOM   571   C  CD2   . LEU A  1 79  ? -13.710 37.232  -2.167  1.00 45.00  ? 322 LEU A CD2   1 
ATOM   572   N  N     . ARG A  1 80  ? -11.517 40.113  -5.718  1.00 56.73  ? 323 ARG A N     1 
ATOM   573   C  CA    . ARG A  1 80  ? -11.081 39.667  -7.015  1.00 62.19  ? 323 ARG A CA    1 
ATOM   574   C  C     . ARG A  1 80  ? -11.682 38.331  -7.397  1.00 61.88  ? 323 ARG A C     1 
ATOM   575   O  O     . ARG A  1 80  ? -12.221 38.171  -8.513  1.00 59.40  ? 323 ARG A O     1 
ATOM   576   C  CB    . ARG A  1 80  ? -9.564  39.550  -7.009  1.00 70.95  ? 323 ARG A CB    1 
ATOM   577   C  CG    . ARG A  1 80  ? -8.897  39.530  -8.372  1.00 72.49  ? 323 ARG A CG    1 
ATOM   578   C  CD    . ARG A  1 80  ? -7.382  39.588  -8.195  1.00 76.55  ? 323 ARG A CD    1 
ATOM   579   N  NE    . ARG A  1 80  ? -6.860  40.863  -7.651  1.00 79.37  ? 323 ARG A NE    1 
ATOM   580   C  CZ    . ARG A  1 80  ? -6.609  41.145  -6.363  1.00 75.85  ? 323 ARG A CZ    1 
ATOM   581   N  NH1   . ARG A  1 80  ? -6.859  40.277  -5.397  1.00 73.95  ? 323 ARG A NH1   1 
ATOM   582   N  NH2   . ARG A  1 80  ? -6.098  42.329  -6.030  1.00 73.01  ? 323 ARG A NH2   1 
ATOM   583   N  N     . LYS A  1 81  ? -11.602 37.380  -6.471  1.00 55.00  ? 324 LYS A N     1 
ATOM   584   C  CA    . LYS A  1 81  ? -11.747 35.972  -6.852  1.00 52.03  ? 324 LYS A CA    1 
ATOM   585   C  C     . LYS A  1 81  ? -13.149 35.575  -7.292  1.00 44.39  ? 324 LYS A C     1 
ATOM   586   O  O     . LYS A  1 81  ? -13.297 34.630  -8.040  1.00 46.90  ? 324 LYS A O     1 
ATOM   587   C  CB    . LYS A  1 81  ? -11.277 35.041  -5.751  1.00 50.80  ? 324 LYS A CB    1 
ATOM   588   C  CG    . LYS A  1 81  ? -11.232 33.597  -6.226  1.00 54.43  ? 324 LYS A CG    1 
ATOM   589   C  CD    . LYS A  1 81  ? -10.431 32.747  -5.269  1.00 56.43  ? 324 LYS A CD    1 
ATOM   590   C  CE    . LYS A  1 81  ? -10.039 31.426  -5.910  1.00 57.46  ? 324 LYS A CE    1 
ATOM   591   N  NZ    . LYS A  1 81  ? -9.253  30.635  -4.921  1.00 57.41  ? 324 LYS A NZ    1 
ATOM   592   N  N     . LEU A  1 82  ? -14.146 36.310  -6.827  1.00 39.42  ? 325 LEU A N     1 
ATOM   593   C  CA    . LEU A  1 82  ? -15.496 36.183  -7.274  1.00 46.68  ? 325 LEU A CA    1 
ATOM   594   C  C     . LEU A  1 82  ? -15.682 36.331  -8.781  1.00 54.18  ? 325 LEU A C     1 
ATOM   595   O  O     . LEU A  1 82  ? -16.813 36.230  -9.264  1.00 56.17  ? 325 LEU A O     1 
ATOM   596   C  CB    . LEU A  1 82  ? -16.340 37.287  -6.633  1.00 48.64  ? 325 LEU A CB    1 
ATOM   597   C  CG    . LEU A  1 82  ? -16.452 37.353  -5.116  1.00 51.84  ? 325 LEU A CG    1 
ATOM   598   C  CD1   . LEU A  1 82  ? -17.794 37.945  -4.690  1.00 49.24  ? 325 LEU A CD1   1 
ATOM   599   C  CD2   . LEU A  1 82  ? -16.283 35.967  -4.507  1.00 56.79  ? 325 LEU A CD2   1 
ATOM   600   N  N     . ASP A  1 83  ? -14.620 36.671  -9.508  1.00 54.54  ? 326 ASP A N     1 
ATOM   601   C  CA    . ASP A  1 83  ? -14.736 36.892  -10.929 1.00 56.42  ? 326 ASP A CA    1 
ATOM   602   C  C     . ASP A  1 83  ? -14.017 35.816  -11.654 1.00 52.26  ? 326 ASP A C     1 
ATOM   603   O  O     . ASP A  1 83  ? -14.084 35.740  -12.846 1.00 60.35  ? 326 ASP A O     1 
ATOM   604   C  CB    . ASP A  1 83  ? -14.244 38.295  -11.300 1.00 58.49  ? 326 ASP A CB    1 
ATOM   605   C  CG    . ASP A  1 83  ? -15.167 39.380  -10.747 1.00 58.06  ? 326 ASP A CG    1 
ATOM   606   O  OD1   . ASP A  1 83  ? -16.163 39.056  -10.068 1.00 62.76  ? 326 ASP A OD1   1 
ATOM   607   O  OD2   . ASP A  1 83  ? -14.914 40.567  -10.968 1.00 69.11  ? 326 ASP A OD2   1 
ATOM   608   N  N     . HIS A  1 84  ? -13.369 34.945  -10.923 1.00 50.83  ? 327 HIS A N     1 
ATOM   609   C  CA    . HIS A  1 84  ? -12.852 33.748  -11.516 1.00 51.50  ? 327 HIS A CA    1 
ATOM   610   C  C     . HIS A  1 84  ? -13.682 32.518  -11.194 1.00 41.30  ? 327 HIS A C     1 
ATOM   611   O  O     . HIS A  1 84  ? -13.311 31.449  -11.556 1.00 38.35  ? 327 HIS A O     1 
ATOM   612   C  CB    . HIS A  1 84  ? -11.415 33.561  -11.071 1.00 60.87  ? 327 HIS A CB    1 
ATOM   613   C  CG    . HIS A  1 84  ? -10.514 34.619  -11.606 1.00 73.60  ? 327 HIS A CG    1 
ATOM   614   N  ND1   . HIS A  1 84  ? -10.647 35.950  -11.260 1.00 73.24  ? 327 HIS A ND1   1 
ATOM   615   C  CD2   . HIS A  1 84  ? -9.509  34.557  -12.508 1.00 73.30  ? 327 HIS A CD2   1 
ATOM   616   C  CE1   . HIS A  1 84  ? -9.733  36.654  -11.899 1.00 69.46  ? 327 HIS A CE1   1 
ATOM   617   N  NE2   . HIS A  1 84  ? -9.033  35.835  -12.664 1.00 72.34  ? 327 HIS A NE2   1 
ATOM   618   N  N     . ILE A  1 85  ? -14.812 32.661  -10.534 1.00 44.12  ? 328 ILE A N     1 
ATOM   619   C  CA    . ILE A  1 85  ? -15.650 31.485  -10.211 1.00 45.99  ? 328 ILE A CA    1 
ATOM   620   C  C     . ILE A  1 85  ? -16.043 30.719  -11.489 1.00 44.44  ? 328 ILE A C     1 
ATOM   621   O  O     . ILE A  1 85  ? -16.629 31.303  -12.395 1.00 39.16  ? 328 ILE A O     1 
ATOM   622   C  CB    . ILE A  1 85  ? -16.906 31.923  -9.423  1.00 46.63  ? 328 ILE A CB    1 
ATOM   623   C  CG1   . ILE A  1 85  ? -16.523 32.205  -7.957  1.00 48.93  ? 328 ILE A CG1   1 
ATOM   624   C  CG2   . ILE A  1 85  ? -17.969 30.851  -9.462  1.00 50.15  ? 328 ILE A CG2   1 
ATOM   625   C  CD1   . ILE A  1 85  ? -17.599 32.919  -7.174  1.00 51.15  ? 328 ILE A CD1   1 
ATOM   626   N  N     . SER A  1 86  ? -15.710 29.436  -11.581 1.00 41.52  ? 329 SER A N     1 
ATOM   627   C  CA    . SER A  1 86  ? -16.091 28.664  -12.777 1.00 44.75  ? 329 SER A CA    1 
ATOM   628   C  C     . SER A  1 86  ? -17.530 28.897  -13.224 1.00 42.21  ? 329 SER A C     1 
ATOM   629   O  O     . SER A  1 86  ? -18.420 29.136  -12.402 1.00 38.72  ? 329 SER A O     1 
ATOM   630   C  CB    . SER A  1 86  ? -15.894 27.175  -12.580 1.00 44.77  ? 329 SER A CB    1 
ATOM   631   O  OG    . SER A  1 86  ? -16.399 26.544  -13.744 1.00 49.36  ? 329 SER A OG    1 
ATOM   632   N  N     . GLU A  1 87  ? -17.765 28.830  -14.530 1.00 44.15  ? 330 GLU A N     1 
ATOM   633   C  CA    . GLU A  1 87  ? -19.100 29.196  -15.075 1.00 46.29  ? 330 GLU A CA    1 
ATOM   634   C  C     . GLU A  1 87  ? -20.152 28.081  -14.837 1.00 39.78  ? 330 GLU A C     1 
ATOM   635   O  O     . GLU A  1 87  ? -21.365 28.312  -14.796 1.00 36.62  ? 330 GLU A O     1 
ATOM   636   C  CB    . GLU A  1 87  ? -19.015 29.510  -16.568 1.00 52.03  ? 330 GLU A CB    1 
ATOM   637   C  CG    . GLU A  1 87  ? -17.864 30.424  -16.994 1.00 57.63  ? 330 GLU A CG    1 
ATOM   638   C  CD    . GLU A  1 87  ? -17.994 30.868  -18.450 1.00 59.67  ? 330 GLU A CD    1 
ATOM   639   O  OE1   . GLU A  1 87  ? -19.031 31.456  -18.832 1.00 59.01  ? 330 GLU A OE1   1 
ATOM   640   O  OE2   . GLU A  1 87  ? -17.058 30.621  -19.225 1.00 61.37  ? 330 GLU A OE2   1 
ATOM   641   N  N     . SER A  1 88  ? -19.648 26.875  -14.646 1.00 37.79  ? 331 SER A N     1 
ATOM   642   C  CA    . SER A  1 88  ? -20.476 25.724  -14.372 1.00 39.97  ? 331 SER A CA    1 
ATOM   643   C  C     . SER A  1 88  ? -21.252 25.939  -13.058 1.00 44.13  ? 331 SER A C     1 
ATOM   644   O  O     . SER A  1 88  ? -22.396 25.510  -12.933 1.00 49.02  ? 331 SER A O     1 
ATOM   645   C  CB    . SER A  1 88  ? -19.599 24.476  -14.361 1.00 38.37  ? 331 SER A CB    1 
ATOM   646   O  OG    . SER A  1 88  ? -18.613 24.553  -13.329 1.00 44.06  ? 331 SER A OG    1 
ATOM   647   N  N     . VAL A  1 89  ? -20.675 26.699  -12.130 1.00 39.12  ? 332 VAL A N     1 
ATOM   648   C  CA    . VAL A  1 89  ? -21.213 26.815  -10.785 1.00 35.14  ? 332 VAL A CA    1 
ATOM   649   C  C     . VAL A  1 89  ? -22.723 27.056  -10.693 1.00 36.58  ? 332 VAL A C     1 
ATOM   650   O  O     . VAL A  1 89  ? -23.412 26.387  -9.924  1.00 35.16  ? 332 VAL A O     1 
ATOM   651   C  CB    . VAL A  1 89  ? -20.397 27.858  -9.941  1.00 33.50  ? 332 VAL A CB    1 
ATOM   652   C  CG1   . VAL A  1 89  ? -21.183 28.409  -8.757  1.00 32.18  ? 332 VAL A CG1   1 
ATOM   653   C  CG2   . VAL A  1 89  ? -19.073 27.245  -9.489  1.00 31.85  ? 332 VAL A CG2   1 
ATOM   654   N  N     . PRO A  1 90  ? -23.253 28.031  -11.411 1.00 37.25  ? 333 PRO A N     1 
ATOM   655   C  CA    . PRO A  1 90  ? -24.697 28.219  -11.176 1.00 36.71  ? 333 PRO A CA    1 
ATOM   656   C  C     . PRO A  1 90  ? -25.563 27.032  -11.711 1.00 35.52  ? 333 PRO A C     1 
ATOM   657   O  O     . PRO A  1 90  ? -26.592 26.727  -11.172 1.00 32.22  ? 333 PRO A O     1 
ATOM   658   C  CB    . PRO A  1 90  ? -25.018 29.533  -11.900 1.00 38.73  ? 333 PRO A CB    1 
ATOM   659   C  CG    . PRO A  1 90  ? -23.803 29.820  -12.725 1.00 40.22  ? 333 PRO A CG    1 
ATOM   660   C  CD    . PRO A  1 90  ? -22.631 29.177  -12.052 1.00 37.54  ? 333 PRO A CD    1 
ATOM   661   N  N     . VAL A  1 91  ? -25.121 26.350  -12.741 1.00 35.62  ? 334 VAL A N     1 
ATOM   662   C  CA    . VAL A  1 91  ? -25.799 25.152  -13.179 1.00 36.11  ? 334 VAL A CA    1 
ATOM   663   C  C     . VAL A  1 91  ? -25.627 24.112  -12.084 1.00 33.67  ? 334 VAL A C     1 
ATOM   664   O  O     . VAL A  1 91  ? -26.583 23.431  -11.695 1.00 34.01  ? 334 VAL A O     1 
ATOM   665   C  CB    . VAL A  1 91  ? -25.190 24.607  -14.473 1.00 39.07  ? 334 VAL A CB    1 
ATOM   666   C  CG1   . VAL A  1 91  ? -25.861 23.311  -14.865 1.00 42.78  ? 334 VAL A CG1   1 
ATOM   667   C  CG2   . VAL A  1 91  ? -25.347 25.620  -15.600 1.00 41.92  ? 334 VAL A CG2   1 
ATOM   668   N  N     . LEU A  1 92  ? -24.418 24.001  -11.561 1.00 30.84  ? 335 LEU A N     1 
ATOM   669   C  CA    . LEU A  1 92  ? -24.182 23.020  -10.541 1.00 29.44  ? 335 LEU A CA    1 
ATOM   670   C  C     . LEU A  1 92  ? -25.046 23.284  -9.306  1.00 26.37  ? 335 LEU A C     1 
ATOM   671   O  O     . LEU A  1 92  ? -25.543 22.374  -8.720  1.00 26.63  ? 335 LEU A O     1 
ATOM   672   C  CB    . LEU A  1 92  ? -22.735 22.930  -10.192 1.00 31.10  ? 335 LEU A CB    1 
ATOM   673   C  CG    . LEU A  1 92  ? -21.849 22.308  -11.238 1.00 32.98  ? 335 LEU A CG    1 
ATOM   674   C  CD1   . LEU A  1 92  ? -20.427 22.294  -10.684 1.00 32.03  ? 335 LEU A CD1   1 
ATOM   675   C  CD2   . LEU A  1 92  ? -22.266 20.905  -11.654 1.00 32.82  ? 335 LEU A CD2   1 
ATOM   676   N  N     . GLU A  1 93  ? -25.282 24.519  -8.954  1.00 27.01  ? 336 GLU A N     1 
ATOM   677   C  CA    . GLU A  1 93  ? -26.055 24.784  -7.790  1.00 26.72  ? 336 GLU A CA    1 
ATOM   678   C  C     . GLU A  1 93  ? -27.456 24.388  -8.190  1.00 31.61  ? 336 GLU A C     1 
ATOM   679   O  O     . GLU A  1 93  ? -28.251 23.912  -7.376  1.00 31.14  ? 336 GLU A O     1 
ATOM   680   C  CB    . GLU A  1 93  ? -25.984 26.263  -7.399  1.00 29.81  ? 336 GLU A CB    1 
ATOM   681   C  CG    . GLU A  1 93  ? -27.187 26.708  -6.560  1.00 34.11  ? 336 GLU A CG    1 
ATOM   682   C  CD    . GLU A  1 93  ? -27.132 28.117  -5.994  1.00 37.89  ? 336 GLU A CD    1 
ATOM   683   O  OE1   . GLU A  1 93  ? -26.054 28.681  -5.822  1.00 40.74  ? 336 GLU A OE1   1 
ATOM   684   O  OE2   . GLU A  1 93  ? -28.212 28.679  -5.701  1.00 46.99  ? 336 GLU A OE2   1 
ATOM   685   N  N     . LEU A  1 94  ? -27.795 24.641  -9.447  1.00 30.05  ? 337 LEU A N     1 
ATOM   686   C  CA    . LEU A  1 94  ? -29.164 24.421  -9.886  1.00 28.46  ? 337 LEU A CA    1 
ATOM   687   C  C     . LEU A  1 94  ? -29.543 22.952  -9.726  1.00 23.25  ? 337 LEU A C     1 
ATOM   688   O  O     . LEU A  1 94  ? -30.527 22.647  -9.146  1.00 26.08  ? 337 LEU A O     1 
ATOM   689   C  CB    . LEU A  1 94  ? -29.290 24.838  -11.366 1.00 30.38  ? 337 LEU A CB    1 
ATOM   690   C  CG    . LEU A  1 94  ? -30.706 24.720  -11.952 1.00 29.23  ? 337 LEU A CG    1 
ATOM   691   C  CD1   . LEU A  1 94  ? -31.681 25.630  -11.294 1.00 26.68  ? 337 LEU A CD1   1 
ATOM   692   C  CD2   . LEU A  1 94  ? -30.664 24.952  -13.458 1.00 31.39  ? 337 LEU A CD2   1 
ATOM   693   N  N     . PHE A  1 95  ? -28.693 22.066  -10.197 1.00 23.05  ? 338 PHE A N     1 
ATOM   694   C  CA    . PHE A  1 95  ? -28.921 20.654  -10.187 1.00 23.65  ? 338 PHE A CA    1 
ATOM   695   C  C     . PHE A  1 95  ? -28.837 20.045  -8.776  1.00 27.36  ? 338 PHE A C     1 
ATOM   696   O  O     . PHE A  1 95  ? -29.713 19.287  -8.402  1.00 29.49  ? 338 PHE A O     1 
ATOM   697   C  CB    . PHE A  1 95  ? -27.925 19.941  -11.058 1.00 23.73  ? 338 PHE A CB    1 
ATOM   698   C  CG    . PHE A  1 95  ? -28.020 20.232  -12.544 1.00 23.47  ? 338 PHE A CG    1 
ATOM   699   C  CD1   . PHE A  1 95  ? -29.061 20.940  -13.106 1.00 23.19  ? 338 PHE A CD1   1 
ATOM   700   C  CD2   . PHE A  1 95  ? -27.030 19.725  -13.383 1.00 25.70  ? 338 PHE A CD2   1 
ATOM   701   C  CE1   . PHE A  1 95  ? -29.082 21.182  -14.487 1.00 24.44  ? 338 PHE A CE1   1 
ATOM   702   C  CE2   . PHE A  1 95  ? -27.034 19.983  -14.741 1.00 27.35  ? 338 PHE A CE2   1 
ATOM   703   C  CZ    . PHE A  1 95  ? -28.083 20.684  -15.289 1.00 25.31  ? 338 PHE A CZ    1 
ATOM   704   N  N     . SER A  1 96  ? -27.814 20.393  -7.998  1.00 25.95  ? 339 SER A N     1 
ATOM   705   C  CA    . SER A  1 96  ? -27.787 20.061  -6.556  1.00 28.03  ? 339 SER A CA    1 
ATOM   706   C  C     . SER A  1 96  ? -28.982 20.568  -5.716  1.00 23.20  ? 339 SER A C     1 
ATOM   707   O  O     . SER A  1 96  ? -29.297 20.029  -4.667  1.00 25.63  ? 339 SER A O     1 
ATOM   708   C  CB    . SER A  1 96  ? -26.454 20.520  -5.952  1.00 27.71  ? 339 SER A CB    1 
ATOM   709   O  OG    . SER A  1 96  ? -25.546 19.515  -6.219  1.00 33.78  ? 339 SER A OG    1 
ATOM   710   N  N     . ASN A  1 97  ? -29.691 21.554  -6.200  1.00 24.80  ? 340 ASN A N     1 
ATOM   711   C  CA    . ASN A  1 97  ? -30.969 21.932  -5.525  1.00 25.99  ? 340 ASN A CA    1 
ATOM   712   C  C     . ASN A  1 97  ? -32.106 20.903  -5.754  1.00 23.62  ? 340 ASN A C     1 
ATOM   713   O  O     . ASN A  1 97  ? -33.186 21.037  -5.194  1.00 22.89  ? 340 ASN A O     1 
ATOM   714   C  CB    . ASN A  1 97  ? -31.461 23.270  -6.036  1.00 28.33  ? 340 ASN A CB    1 
ATOM   715   C  CG    . ASN A  1 97  ? -30.755 24.446  -5.391  1.00 32.96  ? 340 ASN A CG    1 
ATOM   716   O  OD1   . ASN A  1 97  ? -30.556 25.465  -6.038  1.00 37.91  ? 340 ASN A OD1   1 
ATOM   717   N  ND2   . ASN A  1 97  ? -30.403 24.322  -4.120  1.00 29.12  ? 340 ASN A ND2   1 
ATOM   718   N  N     . ILE A  1 98  ? -31.894 19.938  -6.646  1.00 21.67  ? 341 ILE A N     1 
ATOM   719   C  CA    . ILE A  1 98  ? -32.832 18.828  -6.767  1.00 25.35  ? 341 ILE A CA    1 
ATOM   720   C  C     . ILE A  1 98  ? -32.593 17.811  -5.610  1.00 20.66  ? 341 ILE A C     1 
ATOM   721   O  O     . ILE A  1 98  ? -31.511 17.286  -5.432  1.00 22.64  ? 341 ILE A O     1 
ATOM   722   C  CB    . ILE A  1 98  ? -32.647 18.084  -8.074  1.00 25.40  ? 341 ILE A CB    1 
ATOM   723   C  CG1   . ILE A  1 98  ? -32.936 19.010  -9.243  1.00 26.28  ? 341 ILE A CG1   1 
ATOM   724   C  CG2   . ILE A  1 98  ? -33.595 16.864  -8.107  1.00 27.70  ? 341 ILE A CG2   1 
ATOM   725   C  CD1   . ILE A  1 98  ? -32.311 18.467  -10.512 1.00 26.29  ? 341 ILE A CD1   1 
ATOM   726   N  N     . TRP A  1 99  ? -33.639 17.560  -4.866  1.00 19.97  ? 342 TRP A N     1 
ATOM   727   C  CA    . TRP A  1 99  ? -33.567 16.631  -3.710  1.00 18.71  ? 342 TRP A CA    1 
ATOM   728   C  C     . TRP A  1 99  ? -33.198 15.280  -4.239  1.00 19.11  ? 342 TRP A C     1 
ATOM   729   O  O     . TRP A  1 99  ? -33.830 14.760  -5.214  1.00 19.24  ? 342 TRP A O     1 
ATOM   730   C  CB    . TRP A  1 99  ? -34.885 16.589  -2.937  1.00 18.02  ? 342 TRP A CB    1 
ATOM   731   C  CG    . TRP A  1 99  ? -34.709 16.074  -1.526  1.00 20.22  ? 342 TRP A CG    1 
ATOM   732   C  CD1   . TRP A  1 99  ? -34.623 16.813  -0.393  1.00 23.25  ? 342 TRP A CD1   1 
ATOM   733   C  CD2   . TRP A  1 99  ? -34.554 14.729  -1.123  1.00 19.08  ? 342 TRP A CD2   1 
ATOM   734   N  NE1   . TRP A  1 99  ? -34.432 16.017  0.713   1.00 21.24  ? 342 TRP A NE1   1 
ATOM   735   C  CE2   . TRP A  1 99  ? -34.371 14.723  0.283   1.00 21.42  ? 342 TRP A CE2   1 
ATOM   736   C  CE3   . TRP A  1 99  ? -34.510 13.530  -1.799  1.00 19.00  ? 342 TRP A CE3   1 
ATOM   737   C  CZ2   . TRP A  1 99  ? -34.175 13.533  1.018   1.00 19.60  ? 342 TRP A CZ2   1 
ATOM   738   C  CZ3   . TRP A  1 99  ? -34.340 12.341  -1.053  1.00 19.48  ? 342 TRP A CZ3   1 
ATOM   739   C  CH2   . TRP A  1 99  ? -34.158 12.367  0.323   1.00 18.74  ? 342 TRP A CH2   1 
ATOM   740   N  N     . GLY A  1 100 ? -32.143 14.719  -3.672  1.00 18.28  ? 343 GLY A N     1 
ATOM   741   C  CA    . GLY A  1 100 ? -31.655 13.413  -4.105  1.00 17.83  ? 343 GLY A CA    1 
ATOM   742   C  C     . GLY A  1 100 ? -30.521 13.525  -5.084  1.00 18.79  ? 343 GLY A C     1 
ATOM   743   O  O     . GLY A  1 100 ? -29.825 12.545  -5.339  1.00 18.14  ? 343 GLY A O     1 
ATOM   744   N  N     . ALA A  1 101 ? -30.282 14.727  -5.621  1.00 18.26  ? 344 ALA A N     1 
ATOM   745   C  CA    . ALA A  1 101 ? -29.100 14.904  -6.469  1.00 18.26  ? 344 ALA A CA    1 
ATOM   746   C  C     . ALA A  1 101 ? -28.009 15.726  -5.755  1.00 18.86  ? 344 ALA A C     1 
ATOM   747   O  O     . ALA A  1 101 ? -28.253 16.802  -5.276  1.00 20.04  ? 344 ALA A O     1 
ATOM   748   C  CB    . ALA A  1 101 ? -29.527 15.542  -7.800  1.00 17.19  ? 344 ALA A CB    1 
ATOM   749   N  N     . GLY A  1 102 ? -26.819 15.172  -5.646  1.00 20.62  ? 345 GLY A N     1 
ATOM   750   C  CA    . GLY A  1 102 ? -25.754 15.839  -4.988  1.00 23.43  ? 345 GLY A CA    1 
ATOM   751   C  C     . GLY A  1 102 ? -24.733 16.276  -6.006  1.00 26.42  ? 345 GLY A C     1 
ATOM   752   O  O     . GLY A  1 102 ? -25.038 16.389  -7.207  1.00 25.02  ? 345 GLY A O     1 
ATOM   753   N  N     . THR A  1 103 ? -23.521 16.551  -5.540  1.00 25.68  ? 346 THR A N     1 
ATOM   754   C  CA    . THR A  1 103 ? -22.477 17.068  -6.452  1.00 27.31  ? 346 THR A CA    1 
ATOM   755   C  C     . THR A  1 103 ? -22.040 16.076  -7.478  1.00 25.73  ? 346 THR A C     1 
ATOM   756   O  O     . THR A  1 103 ? -21.777 16.451  -8.596  1.00 26.30  ? 346 THR A O     1 
ATOM   757   C  CB    . THR A  1 103 ? -21.229 17.638  -5.712  1.00 27.97  ? 346 THR A CB    1 
ATOM   758   O  OG1   . THR A  1 103 ? -20.529 16.591  -5.028  1.00 32.87  ? 346 THR A OG1   1 
ATOM   759   C  CG2   . THR A  1 103 ? -21.674 18.653  -4.676  1.00 30.31  ? 346 THR A CG2   1 
ATOM   760   N  N     . LYS A  1 104 ? -21.936 14.807  -7.138  1.00 27.37  ? 347 LYS A N     1 
ATOM   761   C  CA    . LYS A  1 104 ? -21.615 13.854  -8.194  1.00 30.15  ? 347 LYS A CA    1 
ATOM   762   C  C     . LYS A  1 104 ? -22.628 13.862  -9.326  1.00 32.77  ? 347 LYS A C     1 
ATOM   763   O  O     . LYS A  1 104 ? -22.264 13.730  -10.486 1.00 38.70  ? 347 LYS A O     1 
ATOM   764   C  CB    . LYS A  1 104 ? -21.498 12.425  -7.676  1.00 32.27  ? 347 LYS A CB    1 
ATOM   765   C  CG    . LYS A  1 104 ? -20.423 12.229  -6.631  1.00 34.34  ? 347 LYS A CG    1 
ATOM   766   C  CD    . LYS A  1 104 ? -19.085 12.764  -7.077  1.00 34.57  ? 347 LYS A CD    1 
ATOM   767   C  CE    . LYS A  1 104 ? -18.106 12.463  -5.958  1.00 38.92  ? 347 LYS A CE    1 
ATOM   768   N  NZ    . LYS A  1 104 ? -16.713 12.520  -6.476  1.00 41.95  ? 347 LYS A NZ    1 
ATOM   769   N  N     . THR A  1 105 ? -23.897 13.995  -9.005  1.00 32.44  ? 348 THR A N     1 
ATOM   770   C  CA    . THR A  1 105 ? -24.938 13.832  -10.019 1.00 30.44  ? 348 THR A CA    1 
ATOM   771   C  C     . THR A  1 105 ? -24.925 15.092  -10.813 1.00 33.28  ? 348 THR A C     1 
ATOM   772   O  O     . THR A  1 105 ? -25.114 15.075  -12.012 1.00 31.31  ? 348 THR A O     1 
ATOM   773   C  CB    . THR A  1 105 ? -26.339 13.707  -9.409  1.00 24.33  ? 348 THR A CB    1 
ATOM   774   O  OG1   . THR A  1 105 ? -26.388 12.500  -8.711  1.00 23.36  ? 348 THR A OG1   1 
ATOM   775   C  CG2   . THR A  1 105 ? -27.393 13.630  -10.434 1.00 24.89  ? 348 THR A CG2   1 
ATOM   776   N  N     . ALA A  1 106 ? -24.755 16.206  -10.132 1.00 33.13  ? 349 ALA A N     1 
ATOM   777   C  CA    . ALA A  1 106 ? -24.769 17.436  -10.842 1.00 32.68  ? 349 ALA A CA    1 
ATOM   778   C  C     . ALA A  1 106 ? -23.547 17.472  -11.771 1.00 32.58  ? 349 ALA A C     1 
ATOM   779   O  O     . ALA A  1 106 ? -23.633 18.003  -12.851 1.00 29.66  ? 349 ALA A O     1 
ATOM   780   C  CB    . ALA A  1 106 ? -24.805 18.608  -9.893  1.00 31.60  ? 349 ALA A CB    1 
ATOM   781   N  N     . GLN A  1 107 ? -22.442 16.846  -11.395 1.00 33.42  ? 350 GLN A N     1 
ATOM   782   C  CA    . GLN A  1 107 ? -21.285 16.889  -12.263 1.00 38.98  ? 350 GLN A CA    1 
ATOM   783   C  C     . GLN A  1 107 ? -21.438 15.969  -13.493 1.00 40.85  ? 350 GLN A C     1 
ATOM   784   O  O     . GLN A  1 107 ? -21.008 16.321  -14.577 1.00 45.46  ? 350 GLN A O     1 
ATOM   785   C  CB    . GLN A  1 107 ? -20.027 16.535  -11.512 1.00 45.61  ? 350 GLN A CB    1 
ATOM   786   C  CG    . GLN A  1 107 ? -18.774 16.906  -12.281 1.00 51.93  ? 350 GLN A CG    1 
ATOM   787   C  CD    . GLN A  1 107 ? -17.573 16.103  -11.847 1.00 66.07  ? 350 GLN A CD    1 
ATOM   788   O  OE1   . GLN A  1 107 ? -17.478 15.666  -10.694 1.00 78.10  ? 350 GLN A OE1   1 
ATOM   789   N  NE2   . GLN A  1 107 ? -16.635 15.906  -12.768 1.00 74.90  ? 350 GLN A NE2   1 
ATOM   790   N  N     . MET A  1 108 ? -22.040 14.805  -13.301 1.00 39.46  ? 351 MET A N     1 
ATOM   791   C  CA    . MET A  1 108 ? -22.398 13.889  -14.365 1.00 37.45  ? 351 MET A CA    1 
ATOM   792   C  C     . MET A  1 108 ? -23.318 14.585  -15.344 1.00 40.16  ? 351 MET A C     1 
ATOM   793   O  O     . MET A  1 108 ? -23.067 14.567  -16.531 1.00 40.90  ? 351 MET A O     1 
ATOM   794   C  CB    . MET A  1 108 ? -23.077 12.646  -13.783 1.00 39.47  ? 351 MET A CB    1 
ATOM   795   C  CG    . MET A  1 108 ? -23.097 11.441  -14.706 1.00 41.32  ? 351 MET A CG    1 
ATOM   796   S  SD    . MET A  1 108 ? -24.371 10.197  -14.324 1.00 44.59  ? 351 MET A SD    1 
ATOM   797   C  CE    . MET A  1 108 ? -25.919 11.099  -14.281 1.00 39.67  ? 351 MET A CE    1 
ATOM   798   N  N     . TRP A  1 109 ? -24.351 15.257  -14.847 1.00 39.57  ? 352 TRP A N     1 
ATOM   799   C  CA    . TRP A  1 109 ? -25.290 15.936  -15.705 1.00 38.30  ? 352 TRP A CA    1 
ATOM   800   C  C     . TRP A  1 109 ? -24.668 17.012  -16.530 1.00 43.07  ? 352 TRP A C     1 
ATOM   801   O  O     . TRP A  1 109 ? -25.101 17.253  -17.681 1.00 44.79  ? 352 TRP A O     1 
ATOM   802   C  CB    . TRP A  1 109 ? -26.483 16.523  -14.919 1.00 36.02  ? 352 TRP A CB    1 
ATOM   803   C  CG    . TRP A  1 109 ? -27.397 15.411  -14.421 1.00 39.05  ? 352 TRP A CG    1 
ATOM   804   C  CD1   . TRP A  1 109 ? -27.412 14.092  -14.855 1.00 36.72  ? 352 TRP A CD1   1 
ATOM   805   C  CD2   . TRP A  1 109 ? -28.399 15.505  -13.408 1.00 31.75  ? 352 TRP A CD2   1 
ATOM   806   N  NE1   . TRP A  1 109 ? -28.375 13.396  -14.180 1.00 36.58  ? 352 TRP A NE1   1 
ATOM   807   C  CE2   . TRP A  1 109 ? -28.997 14.242  -13.291 1.00 35.34  ? 352 TRP A CE2   1 
ATOM   808   C  CE3   . TRP A  1 109 ? -28.845 16.532  -12.594 1.00 31.89  ? 352 TRP A CE3   1 
ATOM   809   C  CZ2   . TRP A  1 109 ? -30.014 13.979  -12.359 1.00 34.37  ? 352 TRP A CZ2   1 
ATOM   810   C  CZ3   . TRP A  1 109 ? -29.862 16.279  -11.682 1.00 35.18  ? 352 TRP A CZ3   1 
ATOM   811   C  CH2   . TRP A  1 109 ? -30.432 15.022  -11.567 1.00 33.49  ? 352 TRP A CH2   1 
ATOM   812   N  N     . TYR A  1 110 ? -23.705 17.699  -15.929 1.00 43.10  ? 353 TYR A N     1 
ATOM   813   C  CA    . TYR A  1 110 ? -23.044 18.794  -16.598 1.00 44.16  ? 353 TYR A CA    1 
ATOM   814   C  C     . TYR A  1 110 ? -22.216 18.263  -17.759 1.00 39.30  ? 353 TYR A C     1 
ATOM   815   O  O     . TYR A  1 110 ? -22.251 18.845  -18.818 1.00 36.72  ? 353 TYR A O     1 
ATOM   816   C  CB    . TYR A  1 110 ? -22.127 19.556  -15.645 1.00 43.66  ? 353 TYR A CB    1 
ATOM   817   C  CG    . TYR A  1 110 ? -21.643 20.880  -16.225 1.00 40.46  ? 353 TYR A CG    1 
ATOM   818   C  CD1   . TYR A  1 110 ? -22.467 22.007  -16.194 1.00 39.25  ? 353 TYR A CD1   1 
ATOM   819   C  CD2   . TYR A  1 110 ? -20.350 21.009  -16.771 1.00 41.57  ? 353 TYR A CD2   1 
ATOM   820   C  CE1   . TYR A  1 110 ? -22.032 23.224  -16.708 1.00 41.67  ? 353 TYR A CE1   1 
ATOM   821   C  CE2   . TYR A  1 110 ? -19.907 22.224  -17.294 1.00 39.01  ? 353 TYR A CE2   1 
ATOM   822   C  CZ    . TYR A  1 110 ? -20.752 23.326  -17.273 1.00 40.06  ? 353 TYR A CZ    1 
ATOM   823   O  OH    . TYR A  1 110 ? -20.339 24.555  -17.787 1.00 44.65  ? 353 TYR A OH    1 
ATOM   824   N  N     . GLN A  1 111 ? -21.517 17.151  -17.500 1.00 38.15  ? 354 GLN A N     1 
ATOM   825   C  CA    . GLN A  1 111 ? -20.604 16.477  -18.426 1.00 42.91  ? 354 GLN A CA    1 
ATOM   826   C  C     . GLN A  1 111 ? -21.271 15.750  -19.596 1.00 46.31  ? 354 GLN A C     1 
ATOM   827   O  O     . GLN A  1 111 ? -20.574 15.235  -20.496 1.00 39.92  ? 354 GLN A O     1 
ATOM   828   C  CB    . GLN A  1 111 ? -19.824 15.444  -17.638 1.00 48.97  ? 354 GLN A CB    1 
ATOM   829   C  CG    . GLN A  1 111 ? -18.611 14.884  -18.336 1.00 58.69  ? 354 GLN A CG    1 
ATOM   830   C  CD    . GLN A  1 111 ? -17.854 13.921  -17.455 1.00 68.92  ? 354 GLN A CD    1 
ATOM   831   O  OE1   . GLN A  1 111 ? -18.160 13.777  -16.259 1.00 69.25  ? 354 GLN A OE1   1 
ATOM   832   N  NE2   . GLN A  1 111 ? -16.852 13.249  -18.038 1.00 71.33  ? 354 GLN A NE2   1 
ATOM   833   N  N     . GLN A  1 112 ? -22.603 15.684  -19.537 1.00 46.70  ? 355 GLN A N     1 
ATOM   834   C  CA    . GLN A  1 112 ? -23.443 15.193  -20.612 1.00 49.67  ? 355 GLN A CA    1 
ATOM   835   C  C     . GLN A  1 112 ? -24.323 16.322  -21.171 1.00 50.46  ? 355 GLN A C     1 
ATOM   836   O  O     . GLN A  1 112 ? -25.171 16.095  -22.015 1.00 55.15  ? 355 GLN A O     1 
ATOM   837   C  CB    . GLN A  1 112 ? -24.241 13.925  -20.197 1.00 48.96  ? 355 GLN A CB    1 
ATOM   838   C  CG    . GLN A  1 112 ? -25.269 14.056  -19.097 1.00 48.72  ? 355 GLN A CG    1 
ATOM   839   C  CD    . GLN A  1 112 ? -25.618 12.733  -18.358 1.00 51.86  ? 355 GLN A CD    1 
ATOM   840   O  OE1   . GLN A  1 112 ? -24.841 11.783  -18.271 1.00 49.27  ? 355 GLN A OE1   1 
ATOM   841   N  NE2   . GLN A  1 112 ? -26.810 12.698  -17.811 1.00 59.48  ? 355 GLN A NE2   1 
ATOM   842   N  N     . GLY A  1 113 ? -24.098 17.553  -20.739 1.00 46.97  ? 356 GLY A N     1 
ATOM   843   C  CA    . GLY A  1 113 ? -24.528 18.679  -21.544 1.00 39.75  ? 356 GLY A CA    1 
ATOM   844   C  C     . GLY A  1 113 ? -25.756 19.380  -21.096 1.00 39.07  ? 356 GLY A C     1 
ATOM   845   O  O     . GLY A  1 113 ? -26.215 20.333  -21.750 1.00 37.77  ? 356 GLY A O     1 
ATOM   846   N  N     . PHE A  1 114 ? -26.303 18.968  -19.964 1.00 39.38  ? 357 PHE A N     1 
ATOM   847   C  CA    . PHE A  1 114 ? -27.537 19.613  -19.478 1.00 36.94  ? 357 PHE A CA    1 
ATOM   848   C  C     . PHE A  1 114 ? -27.199 20.886  -18.751 1.00 33.46  ? 357 PHE A C     1 
ATOM   849   O  O     . PHE A  1 114 ? -26.154 20.987  -18.140 1.00 34.66  ? 357 PHE A O     1 
ATOM   850   C  CB    . PHE A  1 114 ? -28.366 18.640  -18.602 1.00 39.80  ? 357 PHE A CB    1 
ATOM   851   C  CG    . PHE A  1 114 ? -28.574 17.299  -19.248 1.00 44.83  ? 357 PHE A CG    1 
ATOM   852   C  CD1   . PHE A  1 114 ? -28.800 17.201  -20.624 1.00 45.28  ? 357 PHE A CD1   1 
ATOM   853   C  CD2   . PHE A  1 114 ? -28.492 16.128  -18.510 1.00 52.33  ? 357 PHE A CD2   1 
ATOM   854   C  CE1   . PHE A  1 114 ? -28.957 15.971  -21.234 1.00 48.88  ? 357 PHE A CE1   1 
ATOM   855   C  CE2   . PHE A  1 114 ? -28.647 14.885  -19.119 1.00 55.27  ? 357 PHE A CE2   1 
ATOM   856   C  CZ    . PHE A  1 114 ? -28.875 14.806  -20.482 1.00 56.52  ? 357 PHE A CZ    1 
ATOM   857   N  N     . ARG A  1 115 ? -28.091 21.853  -18.803 1.00 30.92  ? 358 ARG A N     1 
ATOM   858   C  CA    . ARG A  1 115 ? -27.789 23.161  -18.299 1.00 31.08  ? 358 ARG A CA    1 
ATOM   859   C  C     . ARG A  1 115 ? -29.010 23.819  -17.744 1.00 30.43  ? 358 ARG A C     1 
ATOM   860   O  O     . ARG A  1 115 ? -28.938 24.914  -17.182 1.00 40.09  ? 358 ARG A O     1 
ATOM   861   C  CB    . ARG A  1 115 ? -27.218 24.051  -19.456 1.00 32.10  ? 358 ARG A CB    1 
ATOM   862   C  CG    . ARG A  1 115 ? -25.910 23.578  -20.099 1.00 32.59  ? 358 ARG A CG    1 
ATOM   863   C  CD    . ARG A  1 115 ? -24.713 23.786  -19.174 1.00 33.49  ? 358 ARG A CD    1 
ATOM   864   N  NE    . ARG A  1 115 ? -23.463 23.433  -19.813 1.00 30.12  ? 358 ARG A NE    1 
ATOM   865   C  CZ    . ARG A  1 115 ? -22.925 22.217  -19.829 1.00 36.22  ? 358 ARG A CZ    1 
ATOM   866   N  NH1   . ARG A  1 115 ? -23.486 21.163  -19.208 1.00 41.38  ? 358 ARG A NH1   1 
ATOM   867   N  NH2   . ARG A  1 115 ? -21.790 22.020  -20.480 1.00 36.22  ? 358 ARG A NH2   1 
ATOM   868   N  N     . SER A  1 116 ? -30.147 23.175  -17.878 1.00 30.46  ? 359 SER A N     1 
ATOM   869   C  CA    . SER A  1 116 ? -31.435 23.688  -17.354 1.00 30.54  ? 359 SER A CA    1 
ATOM   870   C  C     . SER A  1 116 ? -32.200 22.519  -16.731 1.00 30.80  ? 359 SER A C     1 
ATOM   871   O  O     . SER A  1 116 ? -31.849 21.353  -16.900 1.00 25.93  ? 359 SER A O     1 
ATOM   872   C  CB    . SER A  1 116 ? -32.311 24.126  -18.532 1.00 33.78  ? 359 SER A CB    1 
ATOM   873   O  OG    . SER A  1 116 ? -32.337 23.057  -19.495 1.00 30.66  ? 359 SER A OG    1 
ATOM   874   N  N     . LEU A  1 117 ? -33.275 22.850  -16.062 1.00 32.88  ? 360 LEU A N     1 
ATOM   875   C  CA    . LEU A  1 117 ? -34.165 21.856  -15.563 1.00 38.06  ? 360 LEU A CA    1 
ATOM   876   C  C     . LEU A  1 117 ? -34.827 21.058  -16.738 1.00 46.22  ? 360 LEU A C     1 
ATOM   877   O  O     . LEU A  1 117 ? -35.130 19.840  -16.581 1.00 39.63  ? 360 LEU A O     1 
ATOM   878   C  CB    . LEU A  1 117 ? -35.191 22.521  -14.647 1.00 35.48  ? 360 LEU A CB    1 
ATOM   879   C  CG    . LEU A  1 117 ? -34.623 23.041  -13.307 1.00 36.63  ? 360 LEU A CG    1 
ATOM   880   C  CD1   . LEU A  1 117 ? -35.712 23.672  -12.477 1.00 33.12  ? 360 LEU A CD1   1 
ATOM   881   C  CD2   . LEU A  1 117 ? -33.863 21.992  -12.491 1.00 34.63  ? 360 LEU A CD2   1 
ATOM   882   N  N     . GLU A  1 118 ? -35.003 21.719  -17.906 1.00 45.64  ? 361 GLU A N     1 
ATOM   883   C  CA    . GLU A  1 118 ? -35.571 21.057  -19.070 1.00 42.84  ? 361 GLU A CA    1 
ATOM   884   C  C     . GLU A  1 118 ? -34.630 20.016  -19.563 1.00 42.04  ? 361 GLU A C     1 
ATOM   885   O  O     . GLU A  1 118 ? -35.051 18.921  -19.906 1.00 45.97  ? 361 GLU A O     1 
ATOM   886   C  CB    . GLU A  1 118 ? -35.902 22.018  -20.209 1.00 54.51  ? 361 GLU A CB    1 
ATOM   887   C  CG    . GLU A  1 118 ? -37.320 22.590  -20.150 1.00 60.91  ? 361 GLU A CG    1 
ATOM   888   C  CD    . GLU A  1 118 ? -38.406 21.512  -20.202 1.00 66.90  ? 361 GLU A CD    1 
ATOM   889   O  OE1   . GLU A  1 118 ? -38.164 20.422  -20.802 1.00 67.47  ? 361 GLU A OE1   1 
ATOM   890   O  OE2   . GLU A  1 118 ? -39.495 21.759  -19.625 1.00 67.36  ? 361 GLU A OE2   1 
ATOM   891   N  N     . ASP A  1 119 ? -33.348 20.310  -19.605 1.00 37.04  ? 362 ASP A N     1 
ATOM   892   C  CA    . ASP A  1 119 ? -32.447 19.271  -20.068 1.00 42.36  ? 362 ASP A CA    1 
ATOM   893   C  C     . ASP A  1 119 ? -32.613 18.044  -19.142 1.00 45.34  ? 362 ASP A C     1 
ATOM   894   O  O     . ASP A  1 119 ? -32.622 16.903  -19.630 1.00 44.96  ? 362 ASP A O     1 
ATOM   895   C  CB    . ASP A  1 119 ? -30.982 19.736  -20.163 1.00 44.24  ? 362 ASP A CB    1 
ATOM   896   C  CG    . ASP A  1 119 ? -30.754 20.854  -21.216 1.00 48.02  ? 362 ASP A CG    1 
ATOM   897   O  OD1   . ASP A  1 119 ? -30.984 20.621  -22.425 1.00 46.04  ? 362 ASP A OD1   1 
ATOM   898   O  OD2   . ASP A  1 119 ? -30.311 21.963  -20.830 1.00 48.33  ? 362 ASP A OD2   1 
ATOM   899   N  N     . ILE A  1 120 ? -32.813 18.296  -17.836 1.00 42.18  ? 363 ILE A N     1 
ATOM   900   C  CA    . ILE A  1 120 ? -33.008 17.224  -16.853 1.00 39.67  ? 363 ILE A CA    1 
ATOM   901   C  C     . ILE A  1 120 ? -34.326 16.473  -17.071 1.00 33.95  ? 363 ILE A C     1 
ATOM   902   O  O     . ILE A  1 120 ? -34.267 15.313  -17.384 1.00 32.43  ? 363 ILE A O     1 
ATOM   903   C  CB    . ILE A  1 120 ? -32.926 17.697  -15.378 1.00 38.61  ? 363 ILE A CB    1 
ATOM   904   C  CG1   . ILE A  1 120 ? -31.660 18.531  -15.132 1.00 36.02  ? 363 ILE A CG1   1 
ATOM   905   C  CG2   . ILE A  1 120 ? -32.878 16.492  -14.454 1.00 37.50  ? 363 ILE A CG2   1 
ATOM   906   C  CD1   . ILE A  1 120 ? -30.393 17.872  -15.616 1.00 34.04  ? 363 ILE A CD1   1 
ATOM   907   N  N     . ARG A  1 121 ? -35.470 17.129  -16.890 1.00 38.52  ? 364 ARG A N     1 
ATOM   908   C  CA    . ARG A  1 121 ? -36.765 16.583  -17.241 1.00 43.24  ? 364 ARG A CA    1 
ATOM   909   C  C     . ARG A  1 121 ? -36.656 15.743  -18.518 1.00 45.32  ? 364 ARG A C     1 
ATOM   910   O  O     . ARG A  1 121 ? -36.981 14.560  -18.529 1.00 46.67  ? 364 ARG A O     1 
ATOM   911   C  CB    . ARG A  1 121 ? -37.773 17.706  -17.496 1.00 51.20  ? 364 ARG A CB    1 
ATOM   912   C  CG    . ARG A  1 121 ? -38.809 17.960  -16.406 1.00 58.68  ? 364 ARG A CG    1 
ATOM   913   C  CD    . ARG A  1 121 ? -38.962 19.461  -16.072 1.00 64.02  ? 364 ARG A CD    1 
ATOM   914   N  NE    . ARG A  1 121 ? -39.473 19.690  -14.709 1.00 68.92  ? 364 ARG A NE    1 
ATOM   915   C  CZ    . ARG A  1 121 ? -39.467 20.865  -14.061 1.00 73.76  ? 364 ARG A CZ    1 
ATOM   916   N  NH1   . ARG A  1 121 ? -38.977 21.969  -14.634 1.00 70.06  ? 364 ARG A NH1   1 
ATOM   917   N  NH2   . ARG A  1 121 ? -39.955 20.935  -12.815 1.00 72.94  ? 364 ARG A NH2   1 
ATOM   918   N  N     . SER A  1 122 ? -36.129 16.320  -19.590 1.00 44.99  ? 365 SER A N     1 
ATOM   919   C  CA    . SER A  1 122 ? -36.398 15.757  -20.905 1.00 43.66  ? 365 SER A CA    1 
ATOM   920   C  C     . SER A  1 122 ? -35.370 14.747  -21.349 1.00 43.81  ? 365 SER A C     1 
ATOM   921   O  O     . SER A  1 122 ? -35.679 13.913  -22.197 1.00 46.78  ? 365 SER A O     1 
ATOM   922   C  CB    . SER A  1 122 ? -36.632 16.876  -21.934 1.00 43.39  ? 365 SER A CB    1 
ATOM   923   O  OG    . SER A  1 122 ? -35.433 17.464  -22.330 1.00 43.80  ? 365 SER A OG    1 
ATOM   924   N  N     . GLN A  1 123 ? -34.169 14.769  -20.772 1.00 43.28  ? 366 GLN A N     1 
ATOM   925   C  CA    . GLN A  1 123 ? -33.141 13.787  -21.199 1.00 42.30  ? 366 GLN A CA    1 
ATOM   926   C  C     . GLN A  1 123 ? -32.310 13.062  -20.143 1.00 38.47  ? 366 GLN A C     1 
ATOM   927   O  O     . GLN A  1 123 ? -31.552 12.130  -20.469 1.00 35.16  ? 366 GLN A O     1 
ATOM   928   C  CB    . GLN A  1 123 ? -32.142 14.492  -22.116 1.00 46.47  ? 366 GLN A CB    1 
ATOM   929   C  CG    . GLN A  1 123 ? -32.754 15.331  -23.230 1.00 48.43  ? 366 GLN A CG    1 
ATOM   930   C  CD    . GLN A  1 123 ? -31.685 16.141  -23.912 1.00 49.03  ? 366 GLN A CD    1 
ATOM   931   O  OE1   . GLN A  1 123 ? -30.794 15.579  -24.553 1.00 47.89  ? 366 GLN A OE1   1 
ATOM   932   N  NE2   . GLN A  1 123 ? -31.721 17.470  -23.720 1.00 49.22  ? 366 GLN A NE2   1 
ATOM   933   N  N     . ALA A  1 124 ? -32.374 13.513  -18.895 1.00 40.21  ? 367 ALA A N     1 
ATOM   934   C  CA    . ALA A  1 124 ? -31.482 12.974  -17.856 1.00 35.77  ? 367 ALA A CA    1 
ATOM   935   C  C     . ALA A  1 124 ? -32.063 11.691  -17.350 1.00 30.61  ? 367 ALA A C     1 
ATOM   936   O  O     . ALA A  1 124 ? -33.263 11.567  -17.321 1.00 28.05  ? 367 ALA A O     1 
ATOM   937   C  CB    . ALA A  1 124 ? -31.382 13.964  -16.715 1.00 38.08  ? 367 ALA A CB    1 
ATOM   938   N  N     . SER A  1 125 ? -31.211 10.743  -16.963 1.00 29.43  ? 368 SER A N     1 
ATOM   939   C  CA    . SER A  1 125 ? -31.610 9.627   -16.145 1.00 30.60  ? 368 SER A CA    1 
ATOM   940   C  C     . SER A  1 125 ? -31.689 10.122  -14.725 1.00 32.91  ? 368 SER A C     1 
ATOM   941   O  O     . SER A  1 125 ? -30.717 10.709  -14.231 1.00 32.84  ? 368 SER A O     1 
ATOM   942   C  CB    . SER A  1 125 ? -30.591 8.502   -16.182 1.00 31.47  ? 368 SER A CB    1 
ATOM   943   O  OG    . SER A  1 125 ? -30.425 8.052   -17.495 1.00 33.68  ? 368 SER A OG    1 
ATOM   944   N  N     . LEU A  1 126 ? -32.845 9.861   -14.109 1.00 27.61  ? 369 LEU A N     1 
ATOM   945   C  CA    . LEU A  1 126 ? -33.229 10.293  -12.795 1.00 26.97  ? 369 LEU A CA    1 
ATOM   946   C  C     . LEU A  1 126 ? -33.556 9.067   -11.956 1.00 27.77  ? 369 LEU A C     1 
ATOM   947   O  O     . LEU A  1 126 ? -34.219 8.169   -12.440 1.00 22.84  ? 369 LEU A O     1 
ATOM   948   C  CB    . LEU A  1 126 ? -34.519 11.091  -12.864 1.00 25.75  ? 369 LEU A CB    1 
ATOM   949   C  CG    . LEU A  1 126 ? -34.395 12.448  -13.528 1.00 27.54  ? 369 LEU A CG    1 
ATOM   950   C  CD1   . LEU A  1 126 ? -35.755 12.992  -13.932 1.00 30.06  ? 369 LEU A CD1   1 
ATOM   951   C  CD2   . LEU A  1 126 ? -33.732 13.425  -12.564 1.00 28.10  ? 369 LEU A CD2   1 
ATOM   952   N  N     . THR A  1 127 ? -33.145 9.069   -10.676 1.00 24.84  ? 370 THR A N     1 
ATOM   953   C  CA    . THR A  1 127 ? -33.544 8.034   -9.754  1.00 22.00  ? 370 THR A CA    1 
ATOM   954   C  C     . THR A  1 127 ? -34.940 8.445   -9.368  1.00 20.81  ? 370 THR A C     1 
ATOM   955   O  O     . THR A  1 127 ? -35.379 9.576   -9.664  1.00 19.86  ? 370 THR A O     1 
ATOM   956   C  CB    . THR A  1 127 ? -32.715 8.042   -8.454  1.00 20.63  ? 370 THR A CB    1 
ATOM   957   O  OG1   . THR A  1 127 ? -32.864 9.327   -7.880  1.00 20.49  ? 370 THR A OG1   1 
ATOM   958   C  CG2   . THR A  1 127 ? -31.223 7.788   -8.686  1.00 21.43  ? 370 THR A CG2   1 
ATOM   959   N  N     . THR A  1 128 ? -35.585 7.548   -8.627  1.00 19.65  ? 371 THR A N     1 
ATOM   960   C  CA    . THR A  1 128 ? -36.932 7.743   -8.137  1.00 22.81  ? 371 THR A CA    1 
ATOM   961   C  C     . THR A  1 128 ? -37.028 8.995   -7.288  1.00 20.98  ? 371 THR A C     1 
ATOM   962   O  O     . THR A  1 128 ? -37.941 9.783   -7.420  1.00 22.49  ? 371 THR A O     1 
ATOM   963   C  CB    . THR A  1 128 ? -37.407 6.499   -7.316  1.00 22.42  ? 371 THR A CB    1 
ATOM   964   O  OG1   . THR A  1 128 ? -37.355 5.337   -8.170  1.00 22.79  ? 371 THR A OG1   1 
ATOM   965   C  CG2   . THR A  1 128 ? -38.827 6.673   -6.912  1.00 22.74  ? 371 THR A CG2   1 
ATOM   966   N  N     . GLN A  1 129 ? -36.103 9.126   -6.364  1.00 20.49  ? 372 GLN A N     1 
ATOM   967   C  CA    . GLN A  1 129 ? -36.060 10.260  -5.465  1.00 18.97  ? 372 GLN A CA    1 
ATOM   968   C  C     . GLN A  1 129 ? -35.879 11.612  -6.226  1.00 17.66  ? 372 GLN A C     1 
ATOM   969   O  O     . GLN A  1 129 ? -36.591 12.561  -5.968  1.00 16.36  ? 372 GLN A O     1 
ATOM   970   C  CB    . GLN A  1 129 ? -34.922 10.039  -4.454  1.00 20.01  ? 372 GLN A CB    1 
ATOM   971   C  CG    . GLN A  1 129 ? -35.174 8.984   -3.399  1.00 21.22  ? 372 GLN A CG    1 
ATOM   972   C  CD    . GLN A  1 129 ? -33.954 8.716   -2.522  1.00 23.06  ? 372 GLN A CD    1 
ATOM   973   O  OE1   . GLN A  1 129 ? -34.060 8.122   -1.454  1.00 25.88  ? 372 GLN A OE1   1 
ATOM   974   N  NE2   . GLN A  1 129 ? -32.788 9.189   -2.960  1.00 22.19  ? 372 GLN A NE2   1 
ATOM   975   N  N     . GLN A  1 130 ? -34.935 11.640  -7.169  1.00 19.28  ? 373 GLN A N     1 
ATOM   976   C  CA    . GLN A  1 130 ? -34.642 12.793  -8.038  1.00 19.57  ? 373 GLN A CA    1 
ATOM   977   C  C     . GLN A  1 130 ? -35.869 13.205  -8.837  1.00 21.50  ? 373 GLN A C     1 
ATOM   978   O  O     . GLN A  1 130 ? -36.195 14.403  -8.933  1.00 20.23  ? 373 GLN A O     1 
ATOM   979   C  CB    . GLN A  1 130 ? -33.492 12.402  -8.939  1.00 19.77  ? 373 GLN A CB    1 
ATOM   980   C  CG    . GLN A  1 130 ? -32.199 12.374  -8.136  1.00 22.24  ? 373 GLN A CG    1 
ATOM   981   C  CD    . GLN A  1 130 ? -31.035 11.705  -8.818  1.00 24.81  ? 373 GLN A CD    1 
ATOM   982   O  OE1   . GLN A  1 130 ? -29.971 11.480  -8.194  1.00 24.29  ? 373 GLN A OE1   1 
ATOM   983   N  NE2   . GLN A  1 130 ? -31.222 11.313  -10.076 1.00 26.36  ? 373 GLN A NE2   1 
ATOM   984   N  N     . ALA A  1 131 ? -36.603 12.211  -9.354  1.00 19.95  ? 374 ALA A N     1 
ATOM   985   C  CA    . ALA A  1 131 ? -37.864 12.537  -10.077 1.00 21.81  ? 374 ALA A CA    1 
ATOM   986   C  C     . ALA A  1 131 ? -38.826 13.321  -9.224  1.00 19.79  ? 374 ALA A C     1 
ATOM   987   O  O     . ALA A  1 131 ? -39.390 14.336  -9.619  1.00 19.15  ? 374 ALA A O     1 
ATOM   988   C  CB    . ALA A  1 131 ? -38.539 11.264  -10.612 1.00 21.53  ? 374 ALA A CB    1 
ATOM   989   N  N     . ILE A  1 132 ? -38.955 12.899  -7.994  1.00 20.65  ? 375 ILE A N     1 
ATOM   990   C  CA    . ILE A  1 132 ? -39.821 13.607  -7.098  1.00 20.87  ? 375 ILE A CA    1 
ATOM   991   C  C     . ILE A  1 132 ? -39.246 14.957  -6.748  1.00 23.27  ? 375 ILE A C     1 
ATOM   992   O  O     . ILE A  1 132 ? -39.983 15.928  -6.573  1.00 23.98  ? 375 ILE A O     1 
ATOM   993   C  CB    . ILE A  1 132 ? -40.033 12.786  -5.835  1.00 20.84  ? 375 ILE A CB    1 
ATOM   994   C  CG1   . ILE A  1 132 ? -40.896 11.568  -6.134  1.00 22.68  ? 375 ILE A CG1   1 
ATOM   995   C  CG2   . ILE A  1 132 ? -40.676 13.584  -4.720  1.00 19.81  ? 375 ILE A CG2   1 
ATOM   996   C  CD1   . ILE A  1 132 ? -40.707 10.449  -5.061  1.00 23.35  ? 375 ILE A CD1   1 
ATOM   997   N  N     . GLY A  1 133 ? -37.932 15.022  -6.565  1.00 27.36  ? 376 GLY A N     1 
ATOM   998   C  CA    . GLY A  1 133 ? -37.314 16.280  -6.160  1.00 25.17  ? 376 GLY A CA    1 
ATOM   999   C  C     . GLY A  1 133 ? -37.490 17.246  -7.315  1.00 24.56  ? 376 GLY A C     1 
ATOM   1000  O  O     . GLY A  1 133 ? -37.769 18.392  -7.102  1.00 21.41  ? 376 GLY A O     1 
ATOM   1001  N  N     . LEU A  1 134 ? -37.353 16.755  -8.535  1.00 26.24  ? 377 LEU A N     1 
ATOM   1002  C  CA    . LEU A  1 134 ? -37.471 17.605  -9.703  1.00 28.79  ? 377 LEU A CA    1 
ATOM   1003  C  C     . LEU A  1 134 ? -38.870 18.155  -9.876  1.00 29.13  ? 377 LEU A C     1 
ATOM   1004  O  O     . LEU A  1 134 ? -39.032 19.353  -10.113 1.00 33.65  ? 377 LEU A O     1 
ATOM   1005  C  CB    . LEU A  1 134 ? -37.076 16.866  -10.969 1.00 29.96  ? 377 LEU A CB    1 
ATOM   1006  C  CG    . LEU A  1 134 ? -37.243 17.696  -12.238 1.00 30.86  ? 377 LEU A CG    1 
ATOM   1007  C  CD1   . LEU A  1 134 ? -36.321 18.920  -12.279 1.00 31.41  ? 377 LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A  1 134 ? -36.962 16.798  -13.413 1.00 33.81  ? 377 LEU A CD2   1 
ATOM   1009  N  N     . LYS A  1 135 ? -39.882 17.321  -9.701  1.00 27.60  ? 378 LYS A N     1 
ATOM   1010  C  CA    . LYS A  1 135 ? -41.219 17.812  -9.899  1.00 28.32  ? 378 LYS A CA    1 
ATOM   1011  C  C     . LYS A  1 135 ? -41.702 18.753  -8.841  1.00 29.67  ? 378 LYS A C     1 
ATOM   1012  O  O     . LYS A  1 135 ? -42.620 19.531  -9.072  1.00 24.81  ? 378 LYS A O     1 
ATOM   1013  C  CB    . LYS A  1 135 ? -42.217 16.689  -10.104 1.00 31.11  ? 378 LYS A CB    1 
ATOM   1014  C  CG    . LYS A  1 135 ? -42.519 15.867  -8.913  1.00 32.29  ? 378 LYS A CG    1 
ATOM   1015  C  CD    . LYS A  1 135 ? -43.414 14.705  -9.297  1.00 35.50  ? 378 LYS A CD    1 
ATOM   1016  C  CE    . LYS A  1 135 ? -44.206 14.248  -8.076  1.00 38.41  ? 378 LYS A CE    1 
ATOM   1017  N  NZ    . LYS A  1 135 ? -44.468 12.789  -8.094  1.00 42.36  ? 378 LYS A NZ    1 
ATOM   1018  N  N     . HIS A  1 136 ? -41.125 18.665  -7.643  1.00 30.75  ? 379 HIS A N     1 
ATOM   1019  C  CA    . HIS A  1 136 ? -41.438 19.626  -6.611  1.00 26.37  ? 379 HIS A CA    1 
ATOM   1020  C  C     . HIS A  1 136 ? -40.293 20.647  -6.423  1.00 25.54  ? 379 HIS A C     1 
ATOM   1021  O  O     . HIS A  1 136 ? -40.235 21.306  -5.400  1.00 26.15  ? 379 HIS A O     1 
ATOM   1022  C  CB    . HIS A  1 136 ? -41.720 18.912  -5.323  1.00 27.32  ? 379 HIS A CB    1 
ATOM   1023  C  CG    . HIS A  1 136 ? -42.837 17.947  -5.413  1.00 28.79  ? 379 HIS A CG    1 
ATOM   1024  N  ND1   . HIS A  1 136 ? -44.108 18.320  -5.783  1.00 31.51  ? 379 HIS A ND1   1 
ATOM   1025  C  CD2   . HIS A  1 136 ? -42.894 16.629  -5.138  1.00 28.96  ? 379 HIS A CD2   1 
ATOM   1026  C  CE1   . HIS A  1 136 ? -44.899 17.264  -5.733  1.00 29.73  ? 379 HIS A CE1   1 
ATOM   1027  N  NE2   . HIS A  1 136 ? -44.186 16.228  -5.350  1.00 27.77  ? 379 HIS A NE2   1 
ATOM   1028  N  N     . TYR A  1 137 ? -39.441 20.809  -7.425  1.00 28.01  ? 380 TYR A N     1 
ATOM   1029  C  CA    . TYR A  1 137 ? -38.268 21.697  -7.362  1.00 28.51  ? 380 TYR A CA    1 
ATOM   1030  C  C     . TYR A  1 137 ? -38.525 23.048  -6.749  1.00 30.69  ? 380 TYR A C     1 
ATOM   1031  O  O     . TYR A  1 137 ? -37.858 23.430  -5.790  1.00 30.94  ? 380 TYR A O     1 
ATOM   1032  C  CB    . TYR A  1 137 ? -37.668 21.879  -8.722  1.00 28.01  ? 380 TYR A CB    1 
ATOM   1033  C  CG    . TYR A  1 137 ? -36.412 22.744  -8.655  1.00 34.31  ? 380 TYR A CG    1 
ATOM   1034  C  CD1   . TYR A  1 137 ? -36.475 24.150  -8.669  1.00 33.93  ? 380 TYR A CD1   1 
ATOM   1035  C  CD2   . TYR A  1 137 ? -35.166 22.154  -8.566  1.00 35.14  ? 380 TYR A CD2   1 
ATOM   1036  C  CE1   . TYR A  1 137 ? -35.326 24.910  -8.591  1.00 35.83  ? 380 TYR A CE1   1 
ATOM   1037  C  CE2   . TYR A  1 137 ? -34.012 22.903  -8.516  1.00 35.42  ? 380 TYR A CE2   1 
ATOM   1038  C  CZ    . TYR A  1 137 ? -34.086 24.274  -8.516  1.00 37.59  ? 380 TYR A CZ    1 
ATOM   1039  O  OH    . TYR A  1 137 ? -32.889 24.966  -8.445  1.00 37.81  ? 380 TYR A OH    1 
ATOM   1040  N  N     . SER A  1 138 ? -39.525 23.755  -7.269  1.00 32.02  ? 381 SER A N     1 
ATOM   1041  C  CA    . SER A  1 138 ? -39.874 25.060  -6.756  1.00 32.47  ? 381 SER A CA    1 
ATOM   1042  C  C     . SER A  1 138 ? -40.434 24.996  -5.371  1.00 30.20  ? 381 SER A C     1 
ATOM   1043  O  O     . SER A  1 138 ? -40.115 25.822  -4.531  1.00 35.31  ? 381 SER A O     1 
ATOM   1044  C  CB    . SER A  1 138 ? -40.919 25.777  -7.652  1.00 35.81  ? 381 SER A CB    1 
ATOM   1045  O  OG    . SER A  1 138 ? -40.470 25.888  -8.987  1.00 47.02  ? 381 SER A OG    1 
ATOM   1046  N  N     . ASP A  1 139 ? -41.361 24.098  -5.143  1.00 27.80  ? 382 ASP A N     1 
ATOM   1047  C  CA    . ASP A  1 139 ? -42.032 24.048  -3.857  1.00 29.22  ? 382 ASP A CA    1 
ATOM   1048  C  C     . ASP A  1 139 ? -40.986 23.819  -2.757  1.00 30.02  ? 382 ASP A C     1 
ATOM   1049  O  O     . ASP A  1 139 ? -41.020 24.439  -1.718  1.00 31.00  ? 382 ASP A O     1 
ATOM   1050  C  CB    . ASP A  1 139 ? -43.043 22.895  -3.826  1.00 32.97  ? 382 ASP A CB    1 
ATOM   1051  C  CG    . ASP A  1 139 ? -44.429 23.264  -4.400  1.00 35.77  ? 382 ASP A CG    1 
ATOM   1052  O  OD1   . ASP A  1 139 ? -44.567 24.332  -5.018  1.00 38.01  ? 382 ASP A OD1   1 
ATOM   1053  O  OD2   . ASP A  1 139 ? -45.395 22.477  -4.207  1.00 39.06  ? 382 ASP A OD2   1 
ATOM   1054  N  N     . PHE A  1 140 ? -40.073 22.895  -2.996  1.00 27.34  ? 383 PHE A N     1 
ATOM   1055  C  CA    . PHE A  1 140 ? -39.069 22.549  -2.001  1.00 26.15  ? 383 PHE A CA    1 
ATOM   1056  C  C     . PHE A  1 140 ? -38.017 23.619  -1.821  1.00 30.27  ? 383 PHE A C     1 
ATOM   1057  O  O     . PHE A  1 140 ? -37.346 23.608  -0.796  1.00 26.52  ? 383 PHE A O     1 
ATOM   1058  C  CB    . PHE A  1 140 ? -38.385 21.237  -2.371  1.00 25.23  ? 383 PHE A CB    1 
ATOM   1059  C  CG    . PHE A  1 140 ? -39.294 19.998  -2.271  1.00 23.31  ? 383 PHE A CG    1 
ATOM   1060  C  CD1   . PHE A  1 140 ? -40.543 20.070  -1.679  1.00 21.38  ? 383 PHE A CD1   1 
ATOM   1061  C  CD2   . PHE A  1 140 ? -38.845 18.774  -2.719  1.00 21.90  ? 383 PHE A CD2   1 
ATOM   1062  C  CE1   . PHE A  1 140 ? -41.341 18.962  -1.577  1.00 21.87  ? 383 PHE A CE1   1 
ATOM   1063  C  CE2   . PHE A  1 140 ? -39.644 17.630  -2.604  1.00 22.89  ? 383 PHE A CE2   1 
ATOM   1064  C  CZ    . PHE A  1 140 ? -40.892 17.724  -2.033  1.00 20.33  ? 383 PHE A CZ    1 
ATOM   1065  N  N     . LEU A  1 141 ? -37.839 24.503  -2.822  1.00 32.13  ? 384 LEU A N     1 
ATOM   1066  C  CA    . LEU A  1 141 ? -36.963 25.681  -2.671  1.00 32.10  ? 384 LEU A CA    1 
ATOM   1067  C  C     . LEU A  1 141 ? -37.546 26.735  -1.729  1.00 33.24  ? 384 LEU A C     1 
ATOM   1068  O  O     . LEU A  1 141 ? -36.830 27.449  -1.077  1.00 31.21  ? 384 LEU A O     1 
ATOM   1069  C  CB    . LEU A  1 141 ? -36.719 26.317  -4.008  1.00 36.80  ? 384 LEU A CB    1 
ATOM   1070  C  CG    . LEU A  1 141 ? -35.286 26.677  -4.349  1.00 40.30  ? 384 LEU A CG    1 
ATOM   1071  C  CD1   . LEU A  1 141 ? -34.503 25.422  -4.672  1.00 41.48  ? 384 LEU A CD1   1 
ATOM   1072  C  CD2   . LEU A  1 141 ? -35.299 27.635  -5.532  1.00 42.98  ? 384 LEU A CD2   1 
ATOM   1073  N  N     . GLU A  1 142 ? -38.859 26.826  -1.631  1.00 36.99  ? 385 GLU A N     1 
ATOM   1074  C  CA    . GLU A  1 142 ? -39.484 27.873  -0.813  1.00 36.73  ? 385 GLU A CA    1 
ATOM   1075  C  C     . GLU A  1 142 ? -39.527 27.492  0.659   1.00 36.70  ? 385 GLU A C     1 
ATOM   1076  O  O     . GLU A  1 142 ? -39.997 26.445  0.998   1.00 44.83  ? 385 GLU A O     1 
ATOM   1077  C  CB    . GLU A  1 142 ? -40.932 28.133  -1.277  1.00 40.92  ? 385 GLU A CB    1 
ATOM   1078  C  CG    . GLU A  1 142 ? -41.106 28.689  -2.699  1.00 41.20  ? 385 GLU A CG    1 
ATOM   1079  C  CD    . GLU A  1 142 ? -40.240 29.920  -2.981  1.00 45.00  ? 385 GLU A CD    1 
ATOM   1080  O  OE1   . GLU A  1 142 ? -40.194 30.841  -2.124  1.00 48.72  ? 385 GLU A OE1   1 
ATOM   1081  O  OE2   . GLU A  1 142 ? -39.597 29.968  -4.057  1.00 45.26  ? 385 GLU A OE2   1 
ATOM   1082  N  N     . ARG A  1 143 ? -39.032 28.342  1.534   1.00 30.60  ? 386 ARG A N     1 
ATOM   1083  C  CA    . ARG A  1 143 ? -39.209 28.158  2.913   1.00 28.29  ? 386 ARG A CA    1 
ATOM   1084  C  C     . ARG A  1 143 ? -40.625 28.455  3.219   1.00 29.05  ? 386 ARG A C     1 
ATOM   1085  O  O     . ARG A  1 143 ? -41.219 29.242  2.525   1.00 39.14  ? 386 ARG A O     1 
ATOM   1086  C  CB    . ARG A  1 143 ? -38.306 29.112  3.663   1.00 26.88  ? 386 ARG A CB    1 
ATOM   1087  C  CG    . ARG A  1 143 ? -36.853 28.844  3.367   1.00 25.67  ? 386 ARG A CG    1 
ATOM   1088  C  CD    . ARG A  1 143 ? -35.958 29.684  4.252   1.00 23.29  ? 386 ARG A CD    1 
ATOM   1089  N  NE    . ARG A  1 143 ? -36.030 29.350  5.676   1.00 22.43  ? 386 ARG A NE    1 
ATOM   1090  C  CZ    . ARG A  1 143 ? -35.438 28.304  6.279   1.00 20.67  ? 386 ARG A CZ    1 
ATOM   1091  N  NH1   . ARG A  1 143 ? -34.789 27.398  5.626   1.00 20.01  ? 386 ARG A NH1   1 
ATOM   1092  N  NH2   . ARG A  1 143 ? -35.554 28.133  7.570   1.00 21.31  ? 386 ARG A NH2   1 
ATOM   1093  N  N     . MET A  1 144 ? -41.179 27.832  4.251   1.00 26.70  ? 387 MET A N     1 
ATOM   1094  C  CA    . MET A  1 144 ? -42.572 27.990  4.616   1.00 25.53  ? 387 MET A CA    1 
ATOM   1095  C  C     . MET A  1 144 ? -42.599 28.805  5.830   1.00 25.02  ? 387 MET A C     1 
ATOM   1096  O  O     . MET A  1 144 ? -41.647 28.798  6.548   1.00 23.60  ? 387 MET A O     1 
ATOM   1097  C  CB    . MET A  1 144 ? -43.244 26.643  4.940   1.00 26.90  ? 387 MET A CB    1 
ATOM   1098  C  CG    . MET A  1 144 ? -42.919 26.009  6.308   1.00 29.75  ? 387 MET A CG    1 
ATOM   1099  S  SD    . MET A  1 144 ? -43.179 24.231  6.270   1.00 29.58  ? 387 MET A SD    1 
ATOM   1100  C  CE    . MET A  1 144 ? -44.759 24.062  6.901   1.00 34.29  ? 387 MET A CE    1 
ATOM   1101  N  N     . PRO A  1 145 ? -43.710 29.478  6.098   1.00 26.70  ? 388 PRO A N     1 
ATOM   1102  C  CA    . PRO A  1 145 ? -43.790 30.241  7.318   1.00 27.27  ? 388 PRO A CA    1 
ATOM   1103  C  C     . PRO A  1 145 ? -44.022 29.361  8.496   1.00 28.59  ? 388 PRO A C     1 
ATOM   1104  O  O     . PRO A  1 145 ? -44.627 28.301  8.381   1.00 28.10  ? 388 PRO A O     1 
ATOM   1105  C  CB    . PRO A  1 145 ? -45.025 31.146  7.119   1.00 29.35  ? 388 PRO A CB    1 
ATOM   1106  C  CG    . PRO A  1 145 ? -45.806 30.484  6.031   1.00 30.76  ? 388 PRO A CG    1 
ATOM   1107  C  CD    . PRO A  1 145 ? -44.795 29.792  5.162   1.00 28.15  ? 388 PRO A CD    1 
ATOM   1108  N  N     . ARG A  1 146 ? -43.619 29.858  9.643   1.00 27.07  ? 389 ARG A N     1 
ATOM   1109  C  CA    . ARG A  1 146 ? -43.662 29.097  10.826  1.00 31.39  ? 389 ARG A CA    1 
ATOM   1110  C  C     . ARG A  1 146 ? -45.050 28.510  11.088  1.00 34.69  ? 389 ARG A C     1 
ATOM   1111  O  O     . ARG A  1 146 ? -45.192 27.404  11.605  1.00 35.10  ? 389 ARG A O     1 
ATOM   1112  C  CB    . ARG A  1 146 ? -43.199 29.992  11.940  1.00 32.53  ? 389 ARG A CB    1 
ATOM   1113  C  CG    . ARG A  1 146 ? -43.436 29.416  13.295  1.00 30.68  ? 389 ARG A CG    1 
ATOM   1114  C  CD    . ARG A  1 146 ? -42.756 30.269  14.334  1.00 28.62  ? 389 ARG A CD    1 
ATOM   1115  N  NE    . ARG A  1 146 ? -42.824 29.470  15.532  1.00 28.15  ? 389 ARG A NE    1 
ATOM   1116  C  CZ    . ARG A  1 146 ? -41.849 28.655  15.921  1.00 27.87  ? 389 ARG A CZ    1 
ATOM   1117  N  NH1   . ARG A  1 146 ? -40.707 28.546  15.230  1.00 27.24  ? 389 ARG A NH1   1 
ATOM   1118  N  NH2   . ARG A  1 146 ? -42.038 27.918  16.993  1.00 27.01  ? 389 ARG A NH2   1 
ATOM   1119  N  N     . GLU A  1 147 ? -46.075 29.209  10.647  1.00 36.58  ? 390 GLU A N     1 
ATOM   1120  C  CA    . GLU A  1 147 ? -47.447 28.797  10.892  1.00 37.10  ? 390 GLU A CA    1 
ATOM   1121  C  C     . GLU A  1 147 ? -47.894 27.555  10.072  1.00 32.83  ? 390 GLU A C     1 
ATOM   1122  O  O     . GLU A  1 147 ? -48.671 26.723  10.526  1.00 32.53  ? 390 GLU A O     1 
ATOM   1123  C  CB    . GLU A  1 147 ? -48.361 30.011  10.665  1.00 43.51  ? 390 GLU A CB    1 
ATOM   1124  C  CG    . GLU A  1 147 ? -48.133 31.157  11.680  1.00 52.69  ? 390 GLU A CG    1 
ATOM   1125  C  CD    . GLU A  1 147 ? -47.070 32.264  11.331  1.00 55.07  ? 390 GLU A CD    1 
ATOM   1126  O  OE1   . GLU A  1 147 ? -46.004 32.033  10.721  1.00 48.34  ? 390 GLU A OE1   1 
ATOM   1127  O  OE2   . GLU A  1 147 ? -47.288 33.432  11.725  1.00 65.68  ? 390 GLU A OE2   1 
ATOM   1128  N  N     . GLU A  1 148 ? -47.443 27.446  8.840   1.00 30.98  ? 391 GLU A N     1 
ATOM   1129  C  CA    . GLU A  1 148 ? -47.657 26.231  8.050   1.00 30.06  ? 391 GLU A CA    1 
ATOM   1130  C  C     . GLU A  1 148 ? -46.973 25.003  8.794   1.00 28.44  ? 391 GLU A C     1 
ATOM   1131  O  O     . GLU A  1 148 ? -47.571 23.914  8.927   1.00 26.60  ? 391 GLU A O     1 
ATOM   1132  C  CB    . GLU A  1 148 ? -47.102 26.443  6.631   1.00 31.54  ? 391 GLU A CB    1 
ATOM   1133  C  CG    . GLU A  1 148 ? -47.562 25.412  5.606   1.00 33.28  ? 391 GLU A CG    1 
ATOM   1134  C  CD    . GLU A  1 148 ? -47.231 25.760  4.163   1.00 36.55  ? 391 GLU A CD    1 
ATOM   1135  O  OE1   . GLU A  1 148 ? -46.795 26.904  3.858   1.00 40.04  ? 391 GLU A OE1   1 
ATOM   1136  O  OE2   . GLU A  1 148 ? -47.394 24.873  3.288   1.00 36.13  ? 391 GLU A OE2   1 
ATOM   1137  N  N     . ALA A  1 149 ? -45.782 25.225  9.360   1.00 23.02  ? 392 ALA A N     1 
ATOM   1138  C  CA    . ALA A  1 149 ? -45.066 24.154  10.056  1.00 24.22  ? 392 ALA A CA    1 
ATOM   1139  C  C     . ALA A  1 149 ? -45.812 23.654  11.234  1.00 23.65  ? 392 ALA A C     1 
ATOM   1140  O  O     . ALA A  1 149 ? -45.906 22.464  11.466  1.00 25.85  ? 392 ALA A O     1 
ATOM   1141  C  CB    . ALA A  1 149 ? -43.678 24.578  10.458  1.00 22.57  ? 392 ALA A CB    1 
ATOM   1142  N  N     . THR A  1 150 ? -46.369 24.568  11.975  1.00 25.53  ? 393 THR A N     1 
ATOM   1143  C  CA    . THR A  1 150 ? -47.230 24.216  13.091  1.00 26.50  ? 393 THR A CA    1 
ATOM   1144  C  C     . THR A  1 150 ? -48.377 23.298  12.631  1.00 27.13  ? 393 THR A C     1 
ATOM   1145  O  O     . THR A  1 150 ? -48.596 22.310  13.276  1.00 31.09  ? 393 THR A O     1 
ATOM   1146  C  CB    . THR A  1 150 ? -47.779 25.507  13.756  1.00 28.37  ? 393 THR A CB    1 
ATOM   1147  O  OG1   . THR A  1 150 ? -46.690 26.328  14.174  1.00 28.34  ? 393 THR A OG1   1 
ATOM   1148  C  CG2   . THR A  1 150 ? -48.592 25.214  14.970  1.00 30.16  ? 393 THR A CG2   1 
ATOM   1149  N  N     . GLU A  1 151 ? -49.091 23.600  11.534  1.00 27.75  ? 394 GLU A N     1 
ATOM   1150  C  CA    . GLU A  1 151 ? -50.231 22.753  11.090  1.00 28.35  ? 394 GLU A CA    1 
ATOM   1151  C  C     . GLU A  1 151 ? -49.745 21.404  10.553  1.00 27.21  ? 394 GLU A C     1 
ATOM   1152  O  O     . GLU A  1 151 ? -50.447 20.363  10.642  1.00 24.60  ? 394 GLU A O     1 
ATOM   1153  C  CB    . GLU A  1 151 ? -51.031 23.383  9.952   1.00 34.48  ? 394 GLU A CB    1 
ATOM   1154  C  CG    . GLU A  1 151 ? -51.713 24.740  10.175  1.00 42.43  ? 394 GLU A CG    1 
ATOM   1155  C  CD    . GLU A  1 151 ? -52.405 25.268  8.886   1.00 49.19  ? 394 GLU A CD    1 
ATOM   1156  O  OE1   . GLU A  1 151 ? -53.437 24.664  8.480   1.00 57.62  ? 394 GLU A OE1   1 
ATOM   1157  O  OE2   . GLU A  1 151 ? -51.913 26.257  8.250   1.00 47.38  ? 394 GLU A OE2   1 
ATOM   1158  N  N     . ILE A  1 152 ? -48.554 21.399  9.963   1.00 25.26  ? 395 ILE A N     1 
ATOM   1159  C  CA    . ILE A  1 152 ? -48.016 20.141  9.461   1.00 26.28  ? 395 ILE A CA    1 
ATOM   1160  C  C     . ILE A  1 152 ? -47.819 19.208  10.638  1.00 24.81  ? 395 ILE A C     1 
ATOM   1161  O  O     . ILE A  1 152 ? -48.324 18.082  10.641  1.00 25.58  ? 395 ILE A O     1 
ATOM   1162  C  CB    . ILE A  1 152 ? -46.766 20.411  8.631   1.00 26.96  ? 395 ILE A CB    1 
ATOM   1163  C  CG1   . ILE A  1 152 ? -47.234 21.029  7.314   1.00 25.28  ? 395 ILE A CG1   1 
ATOM   1164  C  CG2   . ILE A  1 152 ? -45.960 19.158  8.390   1.00 25.91  ? 395 ILE A CG2   1 
ATOM   1165  C  CD1   . ILE A  1 152 ? -46.171 21.246  6.289   1.00 26.32  ? 395 ILE A CD1   1 
ATOM   1166  N  N     . GLU A  1 153 ? -47.205 19.742  11.673  1.00 25.54  ? 396 GLU A N     1 
ATOM   1167  C  CA    . GLU A  1 153 ? -46.875 19.029  12.865  1.00 26.51  ? 396 GLU A CA    1 
ATOM   1168  C  C     . GLU A  1 153 ? -48.108 18.558  13.613  1.00 27.88  ? 396 GLU A C     1 
ATOM   1169  O  O     . GLU A  1 153 ? -48.122 17.463  14.211  1.00 27.91  ? 396 GLU A O     1 
ATOM   1170  C  CB    . GLU A  1 153 ? -46.087 19.972  13.804  1.00 29.57  ? 396 GLU A CB    1 
ATOM   1171  C  CG    . GLU A  1 153 ? -45.565 19.296  15.086  1.00 33.21  ? 396 GLU A CG    1 
ATOM   1172  C  CD    . GLU A  1 153 ? -46.555 19.192  16.237  1.00 38.80  ? 396 GLU A CD    1 
ATOM   1173  O  OE1   . GLU A  1 153 ? -47.582 19.908  16.197  1.00 51.11  ? 396 GLU A OE1   1 
ATOM   1174  O  OE2   . GLU A  1 153 ? -46.311 18.397  17.203  1.00 43.22  ? 396 GLU A OE2   1 
ATOM   1175  N  N     . GLN A  1 154 ? -49.107 19.413  13.662  1.00 26.65  ? 397 GLN A N     1 
ATOM   1176  C  CA    . GLN A  1 154 ? -50.358 19.066  14.313  1.00 31.62  ? 397 GLN A CA    1 
ATOM   1177  C  C     . GLN A  1 154 ? -51.055 17.922  13.554  1.00 25.78  ? 397 GLN A C     1 
ATOM   1178  O  O     . GLN A  1 154 ? -51.573 17.011  14.137  1.00 27.82  ? 397 GLN A O     1 
ATOM   1179  C  CB    . GLN A  1 154 ? -51.292 20.284  14.346  1.00 37.09  ? 397 GLN A CB    1 
ATOM   1180  C  CG    . GLN A  1 154 ? -50.814 21.437  15.195  1.00 41.50  ? 397 GLN A CG    1 
ATOM   1181  C  CD    . GLN A  1 154 ? -50.807 21.115  16.678  1.00 55.81  ? 397 GLN A CD    1 
ATOM   1182  O  OE1   . GLN A  1 154 ? -49.916 21.552  17.417  1.00 60.27  ? 397 GLN A OE1   1 
ATOM   1183  N  NE2   . GLN A  1 154 ? -51.803 20.348  17.128  1.00 59.76  ? 397 GLN A NE2   1 
ATOM   1184  N  N     . THR A  1 155 ? -51.064 18.003  12.253  1.00 23.98  ? 398 THR A N     1 
ATOM   1185  C  CA    . THR A  1 155 ? -51.618 16.944  11.419  1.00 24.70  ? 398 THR A CA    1 
ATOM   1186  C  C     . THR A  1 155 ? -50.963 15.617  11.810  1.00 27.77  ? 398 THR A C     1 
ATOM   1187  O  O     . THR A  1 155 ? -51.670 14.634  12.049  1.00 30.52  ? 398 THR A O     1 
ATOM   1188  C  CB    . THR A  1 155 ? -51.360 17.264  9.968   1.00 24.21  ? 398 THR A CB    1 
ATOM   1189  O  OG1   . THR A  1 155 ? -51.811 18.591  9.727   1.00 26.65  ? 398 THR A OG1   1 
ATOM   1190  C  CG2   . THR A  1 155 ? -52.074 16.321  9.014   1.00 25.26  ? 398 THR A CG2   1 
ATOM   1191  N  N     . VAL A  1 156 ? -49.641 15.615  12.019  1.00 25.84  ? 399 VAL A N     1 
ATOM   1192  C  CA    . VAL A  1 156 ? -48.921 14.360  12.294  1.00 23.54  ? 399 VAL A CA    1 
ATOM   1193  C  C     . VAL A  1 156 ? -49.276 13.895  13.690  1.00 23.78  ? 399 VAL A C     1 
ATOM   1194  O  O     . VAL A  1 156 ? -49.549 12.723  13.940  1.00 24.45  ? 399 VAL A O     1 
ATOM   1195  C  CB    . VAL A  1 156 ? -47.393 14.542  12.167  1.00 23.28  ? 399 VAL A CB    1 
ATOM   1196  C  CG1   . VAL A  1 156 ? -46.679 13.347  12.684  1.00 23.83  ? 399 VAL A CG1   1 
ATOM   1197  C  CG2   . VAL A  1 156 ? -47.021 14.784  10.710  1.00 24.06  ? 399 VAL A CG2   1 
ATOM   1198  N  N     . GLN A  1 157 ? -49.317 14.838  14.598  1.00 26.82  ? 400 GLN A N     1 
ATOM   1199  C  CA    . GLN A  1 157 ? -49.586 14.567  16.004  1.00 28.16  ? 400 GLN A CA    1 
ATOM   1200  C  C     . GLN A  1 157 ? -50.984 14.011  16.275  1.00 30.75  ? 400 GLN A C     1 
ATOM   1201  O  O     . GLN A  1 157 ? -51.168 13.122  17.087  1.00 33.52  ? 400 GLN A O     1 
ATOM   1202  C  CB    . GLN A  1 157 ? -49.372 15.852  16.813  1.00 32.12  ? 400 GLN A CB    1 
ATOM   1203  C  CG    . GLN A  1 157 ? -49.913 15.730  18.209  1.00 35.63  ? 400 GLN A CG    1 
ATOM   1204  C  CD    . GLN A  1 157 ? -49.435 16.791  19.130  1.00 37.90  ? 400 GLN A CD    1 
ATOM   1205  O  OE1   . GLN A  1 157 ? -48.298 17.205  19.093  1.00 45.70  ? 400 GLN A OE1   1 
ATOM   1206  N  NE2   . GLN A  1 157 ? -50.298 17.192  20.022  1.00 45.22  ? 400 GLN A NE2   1 
ATOM   1207  N  N     . LYS A  1 158 ? -51.970 14.566  15.613  1.00 32.79  ? 401 LYS A N     1 
ATOM   1208  C  CA    . LYS A  1 158 ? -53.332 14.089  15.715  1.00 32.82  ? 401 LYS A CA    1 
ATOM   1209  C  C     . LYS A  1 158 ? -53.498 12.679  15.133  1.00 30.88  ? 401 LYS A C     1 
ATOM   1210  O  O     . LYS A  1 158 ? -54.180 11.830  15.701  1.00 26.01  ? 401 LYS A O     1 
ATOM   1211  C  CB    . LYS A  1 158 ? -54.206 15.061  14.928  1.00 38.47  ? 401 LYS A CB    1 
ATOM   1212  C  CG    . LYS A  1 158 ? -55.689 14.754  14.950  1.00 46.34  ? 401 LYS A CG    1 
ATOM   1213  C  CD    . LYS A  1 158 ? -56.448 15.902  14.284  1.00 49.46  ? 401 LYS A CD    1 
ATOM   1214  C  CE    . LYS A  1 158 ? -57.810 15.465  13.747  1.00 48.53  ? 401 LYS A CE    1 
ATOM   1215  N  NZ    . LYS A  1 158 ? -58.227 16.335  12.597  1.00 50.55  ? 401 LYS A NZ    1 
ATOM   1216  N  N     . ALA A  1 159 ? -52.902 12.457  13.968  1.00 27.47  ? 402 ALA A N     1 
ATOM   1217  C  CA    . ALA A  1 159 ? -52.931 11.135  13.361  1.00 29.58  ? 402 ALA A CA    1 
ATOM   1218  C  C     . ALA A  1 159 ? -52.247 10.115  14.319  1.00 29.87  ? 402 ALA A C     1 
ATOM   1219  O  O     . ALA A  1 159 ? -52.809 9.049   14.590  1.00 29.94  ? 402 ALA A O     1 
ATOM   1220  C  CB    . ALA A  1 159 ? -52.307 11.156  11.960  1.00 30.48  ? 402 ALA A CB    1 
ATOM   1221  N  N     . ALA A  1 160 ? -51.149 10.517  14.962  1.00 29.89  ? 403 ALA A N     1 
ATOM   1222  C  CA    . ALA A  1 160 ? -50.480 9.645   15.919  1.00 29.83  ? 403 ALA A CA    1 
ATOM   1223  C  C     . ALA A  1 160 ? -51.287 9.446   17.170  1.00 30.88  ? 403 ALA A C     1 
ATOM   1224  O  O     . ALA A  1 160 ? -51.555 8.327   17.564  1.00 31.95  ? 403 ALA A O     1 
ATOM   1225  C  CB    . ALA A  1 160 ? -49.100 10.172  16.272  1.00 30.55  ? 403 ALA A CB    1 
ATOM   1226  N  N     . GLN A  1 161 ? -51.684 10.533  17.790  1.00 32.66  ? 404 GLN A N     1 
ATOM   1227  C  CA    . GLN A  1 161 ? -52.450 10.452  19.026  1.00 33.42  ? 404 GLN A CA    1 
ATOM   1228  C  C     . GLN A  1 161 ? -53.809 9.769   18.886  1.00 32.53  ? 404 GLN A C     1 
ATOM   1229  O  O     . GLN A  1 161 ? -54.328 9.260   19.848  1.00 40.89  ? 404 GLN A O     1 
ATOM   1230  C  CB    . GLN A  1 161 ? -52.584 11.839  19.646  1.00 32.89  ? 404 GLN A CB    1 
ATOM   1231  C  CG    . GLN A  1 161 ? -51.259 12.289  20.203  1.00 34.27  ? 404 GLN A CG    1 
ATOM   1232  C  CD    . GLN A  1 161 ? -51.334 13.603  20.923  1.00 38.06  ? 404 GLN A CD    1 
ATOM   1233  O  OE1   . GLN A  1 161 ? -50.467 13.929  21.718  1.00 40.96  ? 404 GLN A OE1   1 
ATOM   1234  N  NE2   . GLN A  1 161 ? -52.355 14.377  20.630  1.00 40.00  ? 404 GLN A NE2   1 
ATOM   1235  N  N     . ALA A  1 162 ? -54.361 9.720   17.689  1.00 36.60  ? 405 ALA A N     1 
ATOM   1236  C  CA    . ALA A  1 162 ? -55.488 8.830   17.415  1.00 36.31  ? 405 ALA A CA    1 
ATOM   1237  C  C     . ALA A  1 162 ? -55.157 7.342   17.590  1.00 40.59  ? 405 ALA A C     1 
ATOM   1238  O  O     . ALA A  1 162 ? -56.057 6.550   17.785  1.00 47.25  ? 405 ALA A O     1 
ATOM   1239  C  CB    . ALA A  1 162 ? -56.030 9.042   16.008  1.00 33.14  ? 405 ALA A CB    1 
ATOM   1240  N  N     . PHE A  1 163 ? -53.910 6.922   17.471  1.00 42.35  ? 406 PHE A N     1 
ATOM   1241  C  CA    . PHE A  1 163 ? -53.610 5.493   17.700  1.00 40.98  ? 406 PHE A CA    1 
ATOM   1242  C  C     . PHE A  1 163 ? -53.259 5.289   19.126  1.00 40.33  ? 406 PHE A C     1 
ATOM   1243  O  O     . PHE A  1 163 ? -53.564 4.268   19.688  1.00 38.13  ? 406 PHE A O     1 
ATOM   1244  C  CB    . PHE A  1 163 ? -52.441 5.018   16.853  1.00 43.26  ? 406 PHE A CB    1 
ATOM   1245  C  CG    . PHE A  1 163 ? -52.754 5.023   15.416  1.00 50.72  ? 406 PHE A CG    1 
ATOM   1246  C  CD1   . PHE A  1 163 ? -53.819 4.259   14.937  1.00 58.21  ? 406 PHE A CD1   1 
ATOM   1247  C  CD2   . PHE A  1 163 ? -52.041 5.809   14.543  1.00 52.44  ? 406 PHE A CD2   1 
ATOM   1248  C  CE1   . PHE A  1 163 ? -54.155 4.251   13.591  1.00 58.46  ? 406 PHE A CE1   1 
ATOM   1249  C  CE2   . PHE A  1 163 ? -52.369 5.811   13.201  1.00 61.17  ? 406 PHE A CE2   1 
ATOM   1250  C  CZ    . PHE A  1 163 ? -53.429 5.031   12.722  1.00 62.36  ? 406 PHE A CZ    1 
ATOM   1251  N  N     . ASN A  1 164 ? -52.557 6.252   19.706  1.00 40.96  ? 407 ASN A N     1 
ATOM   1252  C  CA    . ASN A  1 164 ? -52.198 6.157   21.081  1.00 37.91  ? 407 ASN A CA    1 
ATOM   1253  C  C     . ASN A  1 164 ? -51.965 7.530   21.643  1.00 40.40  ? 407 ASN A C     1 
ATOM   1254  O  O     . ASN A  1 164 ? -51.003 8.223   21.272  1.00 41.99  ? 407 ASN A O     1 
ATOM   1255  C  CB    . ASN A  1 164 ? -50.978 5.292   21.238  1.00 38.00  ? 407 ASN A CB    1 
ATOM   1256  C  CG    . ASN A  1 164 ? -50.549 5.214   22.666  1.00 37.07  ? 407 ASN A CG    1 
ATOM   1257  O  OD1   . ASN A  1 164 ? -50.662 6.182   23.419  1.00 33.94  ? 407 ASN A OD1   1 
ATOM   1258  N  ND2   . ASN A  1 164 ? -50.037 4.081   23.046  1.00 38.51  ? 407 ASN A ND2   1 
ATOM   1259  N  N     . SER A  1 165 ? -52.855 7.914   22.550  1.00 37.85  ? 408 SER A N     1 
ATOM   1260  C  CA    . SER A  1 165 ? -52.928 9.279   23.040  1.00 39.21  ? 408 SER A CA    1 
ATOM   1261  C  C     . SER A  1 165 ? -51.720 9.651   23.882  1.00 34.72  ? 408 SER A C     1 
ATOM   1262  O  O     . SER A  1 165 ? -51.410 10.815  23.992  1.00 37.70  ? 408 SER A O     1 
ATOM   1263  C  CB    . SER A  1 165 ? -54.197 9.488   23.855  1.00 39.63  ? 408 SER A CB    1 
ATOM   1264  O  OG    . SER A  1 165 ? -54.237 8.539   24.926  1.00 48.15  ? 408 SER A OG    1 
ATOM   1265  N  N     . GLY A  1 166 ? -51.021 8.671   24.444  1.00 33.76  ? 409 GLY A N     1 
ATOM   1266  C  CA    . GLY A  1 166 ? -49.767 8.916   25.180  1.00 31.12  ? 409 GLY A CA    1 
ATOM   1267  C  C     . GLY A  1 166 ? -48.540 9.212   24.297  1.00 29.39  ? 409 GLY A C     1 
ATOM   1268  O  O     . GLY A  1 166 ? -47.494 9.574   24.802  1.00 26.77  ? 409 GLY A O     1 
ATOM   1269  N  N     . LEU A  1 167 ? -48.667 9.085   22.978  1.00 29.38  ? 410 LEU A N     1 
ATOM   1270  C  CA    . LEU A  1 167 ? -47.552 9.452   22.101  1.00 28.30  ? 410 LEU A CA    1 
ATOM   1271  C  C     . LEU A  1 167 ? -47.175 10.912  22.266  1.00 31.05  ? 410 LEU A C     1 
ATOM   1272  O  O     . LEU A  1 167 ? -48.036 11.786  22.278  1.00 32.15  ? 410 LEU A O     1 
ATOM   1273  C  CB    . LEU A  1 167 ? -47.897 9.177   20.672  1.00 26.96  ? 410 LEU A CB    1 
ATOM   1274  C  CG    . LEU A  1 167 ? -47.810 7.700   20.334  1.00 28.09  ? 410 LEU A CG    1 
ATOM   1275  C  CD1   . LEU A  1 167 ? -48.229 7.488   18.901  1.00 27.33  ? 410 LEU A CD1   1 
ATOM   1276  C  CD2   . LEU A  1 167 ? -46.398 7.116   20.510  1.00 28.71  ? 410 LEU A CD2   1 
ATOM   1277  N  N     . LEU A  1 168 ? -45.882 11.160  22.413  1.00 31.44  ? 411 LEU A N     1 
ATOM   1278  C  CA    . LEU A  1 168 ? -45.346 12.501  22.398  1.00 33.52  ? 411 LEU A CA    1 
ATOM   1279  C  C     . LEU A  1 168 ? -44.835 12.833  21.010  1.00 33.27  ? 411 LEU A C     1 
ATOM   1280  O  O     . LEU A  1 168 ? -44.000 12.065  20.481  1.00 29.87  ? 411 LEU A O     1 
ATOM   1281  C  CB    . LEU A  1 168 ? -44.174 12.594  23.343  1.00 36.95  ? 411 LEU A CB    1 
ATOM   1282  C  CG    . LEU A  1 168 ? -44.424 13.073  24.754  1.00 42.69  ? 411 LEU A CG    1 
ATOM   1283  C  CD1   . LEU A  1 168 ? -45.690 12.515  25.369  1.00 45.89  ? 411 LEU A CD1   1 
ATOM   1284  C  CD2   . LEU A  1 168 ? -43.194 12.725  25.575  1.00 43.18  ? 411 LEU A CD2   1 
ATOM   1285  N  N     . CYS A  1 169 ? -45.323 13.956  20.447  1.00 29.49  ? 412 CYS A N     1 
ATOM   1286  C  CA    . CYS A  1 169 ? -44.894 14.499  19.150  1.00 30.84  ? 412 CYS A CA    1 
ATOM   1287  C  C     . CYS A  1 169 ? -44.382 15.903  19.254  1.00 28.85  ? 412 CYS A C     1 
ATOM   1288  O  O     . CYS A  1 169 ? -45.063 16.776  19.720  1.00 34.39  ? 412 CYS A O     1 
ATOM   1289  C  CB    . CYS A  1 169 ? -46.026 14.513  18.136  1.00 33.78  ? 412 CYS A CB    1 
ATOM   1290  S  SG    . CYS A  1 169 ? -46.795 12.892  17.978  1.00 43.42  ? 412 CYS A SG    1 
ATOM   1291  N  N     . VAL A  1 170 ? -43.182 16.127  18.763  1.00 27.18  ? 413 VAL A N     1 
ATOM   1292  C  CA    . VAL A  1 170 ? -42.612 17.461  18.806  1.00 26.75  ? 413 VAL A CA    1 
ATOM   1293  C  C     . VAL A  1 170 ? -41.923 17.833  17.521  1.00 23.96  ? 413 VAL A C     1 
ATOM   1294  O  O     . VAL A  1 170 ? -41.180 17.056  16.895  1.00 23.81  ? 413 VAL A O     1 
ATOM   1295  C  CB    . VAL A  1 170 ? -41.648 17.603  20.007  1.00 28.64  ? 413 VAL A CB    1 
ATOM   1296  C  CG1   . VAL A  1 170 ? -40.601 16.546  19.975  1.00 31.52  ? 413 VAL A CG1   1 
ATOM   1297  C  CG2   . VAL A  1 170 ? -40.965 18.945  20.027  1.00 30.46  ? 413 VAL A CG2   1 
ATOM   1298  N  N     . ALA A  1 171 ? -42.110 19.063  17.144  1.00 24.11  ? 414 ALA A N     1 
ATOM   1299  C  CA    . ALA A  1 171 ? -41.523 19.546  15.933  1.00 23.95  ? 414 ALA A CA    1 
ATOM   1300  C  C     . ALA A  1 171 ? -40.173 20.058  16.339  1.00 26.11  ? 414 ALA A C     1 
ATOM   1301  O  O     . ALA A  1 171 ? -40.082 20.760  17.336  1.00 28.50  ? 414 ALA A O     1 
ATOM   1302  C  CB    . ALA A  1 171 ? -42.391 20.658  15.365  1.00 26.13  ? 414 ALA A CB    1 
ATOM   1303  N  N     . CYS A  1 172 ? -39.117 19.694  15.587  1.00 24.27  ? 415 CYS A N     1 
ATOM   1304  C  CA    . CYS A  1 172 ? -37.770 20.090  15.927  1.00 22.69  ? 415 CYS A CA    1 
ATOM   1305  C  C     . CYS A  1 172 ? -37.162 20.981  14.838  1.00 21.15  ? 415 CYS A C     1 
ATOM   1306  O  O     . CYS A  1 172 ? -37.841 21.839  14.325  1.00 19.13  ? 415 CYS A O     1 
ATOM   1307  C  CB    . CYS A  1 172 ? -36.895 18.877  16.238  1.00 22.36  ? 415 CYS A CB    1 
ATOM   1308  S  SG    . CYS A  1 172 ? -37.656 17.754  17.411  1.00 21.82  ? 415 CYS A SG    1 
ATOM   1309  N  N     . GLY A  1 173 ? -35.880 20.832  14.550  1.00 19.62  ? 416 GLY A N     1 
ATOM   1310  C  CA    . GLY A  1 173 ? -35.246 21.651  13.496  1.00 20.23  ? 416 GLY A CA    1 
ATOM   1311  C  C     . GLY A  1 173 ? -35.343 23.144  13.780  1.00 20.98  ? 416 GLY A C     1 
ATOM   1312  O  O     . GLY A  1 173 ? -35.472 23.568  14.936  1.00 19.64  ? 416 GLY A O     1 
ATOM   1313  N  N     . SER A  1 174 ? -35.327 23.941  12.716  1.00 21.79  ? 417 SER A N     1 
ATOM   1314  C  CA    . SER A  1 174 ? -35.478 25.389  12.825  1.00 21.58  ? 417 SER A CA    1 
ATOM   1315  C  C     . SER A  1 174 ? -36.745 25.778  13.544  1.00 23.30  ? 417 SER A C     1 
ATOM   1316  O  O     . SER A  1 174 ? -36.819 26.840  14.131  1.00 27.46  ? 417 SER A O     1 
ATOM   1317  C  CB    . SER A  1 174 ? -35.446 26.038  11.440  1.00 22.67  ? 417 SER A CB    1 
ATOM   1318  O  OG    . SER A  1 174 ? -36.386 25.463  10.537  1.00 22.71  ? 417 SER A OG    1 
ATOM   1319  N  N     . TYR A  1 175 ? -37.759 24.928  13.552  1.00 23.60  ? 418 TYR A N     1 
ATOM   1320  C  CA    . TYR A  1 175 ? -38.969 25.304  14.230  1.00 23.01  ? 418 TYR A CA    1 
ATOM   1321  C  C     . TYR A  1 175 ? -38.711 25.425  15.689  1.00 23.78  ? 418 TYR A C     1 
ATOM   1322  O  O     . TYR A  1 175 ? -39.094 26.382  16.285  1.00 23.98  ? 418 TYR A O     1 
ATOM   1323  C  CB    . TYR A  1 175 ? -40.062 24.267  13.997  1.00 25.31  ? 418 TYR A CB    1 
ATOM   1324  C  CG    . TYR A  1 175 ? -41.419 24.584  14.595  1.00 25.25  ? 418 TYR A CG    1 
ATOM   1325  C  CD1   . TYR A  1 175 ? -42.371 25.304  13.875  1.00 27.31  ? 418 TYR A CD1   1 
ATOM   1326  C  CD2   . TYR A  1 175 ? -41.744 24.166  15.872  1.00 25.60  ? 418 TYR A CD2   1 
ATOM   1327  C  CE1   . TYR A  1 175 ? -43.608 25.591  14.418  1.00 24.70  ? 418 TYR A CE1   1 
ATOM   1328  C  CE2   . TYR A  1 175 ? -42.966 24.454  16.423  1.00 26.30  ? 418 TYR A CE2   1 
ATOM   1329  C  CZ    . TYR A  1 175 ? -43.902 25.163  15.665  1.00 27.02  ? 418 TYR A CZ    1 
ATOM   1330  O  OH    . TYR A  1 175 ? -45.143 25.445  16.211  1.00 30.14  ? 418 TYR A OH    1 
ATOM   1331  N  N     . ARG A  1 176 ? -38.062 24.424  16.263  1.00 22.08  ? 419 ARG A N     1 
ATOM   1332  C  CA    . ARG A  1 176 ? -37.847 24.403  17.682  1.00 20.70  ? 419 ARG A CA    1 
ATOM   1333  C  C     . ARG A  1 176 ? -36.782 25.434  18.005  1.00 20.81  ? 419 ARG A C     1 
ATOM   1334  O  O     . ARG A  1 176 ? -36.741 25.900  19.105  1.00 20.77  ? 419 ARG A O     1 
ATOM   1335  C  CB    . ARG A  1 176 ? -37.430 22.999  18.129  1.00 20.63  ? 419 ARG A CB    1 
ATOM   1336  C  CG    . ARG A  1 176 ? -36.843 22.896  19.533  1.00 20.10  ? 419 ARG A CG    1 
ATOM   1337  C  CD    . ARG A  1 176 ? -37.226 21.589  20.175  1.00 18.28  ? 419 ARG A CD    1 
ATOM   1338  N  NE    . ARG A  1 176 ? -37.000 21.587  21.580  1.00 20.29  ? 419 ARG A NE    1 
ATOM   1339  C  CZ    . ARG A  1 176 ? -35.880 21.201  22.204  1.00 22.29  ? 419 ARG A CZ    1 
ATOM   1340  N  NH1   . ARG A  1 176 ? -34.791 20.757  21.563  1.00 20.75  ? 419 ARG A NH1   1 
ATOM   1341  N  NH2   . ARG A  1 176 ? -35.878 21.231  23.524  1.00 22.39  ? 419 ARG A NH2   1 
ATOM   1342  N  N     . ARG A  1 177 ? -35.911 25.787  17.063  1.00 21.25  ? 420 ARG A N     1 
ATOM   1343  C  CA    . ARG A  1 177 ? -34.958 26.896  17.340  1.00 23.00  ? 420 ARG A CA    1 
ATOM   1344  C  C     . ARG A  1 177 ? -35.622 28.274  17.150  1.00 23.16  ? 420 ARG A C     1 
ATOM   1345  O  O     . ARG A  1 177 ? -34.939 29.231  17.129  1.00 24.72  ? 420 ARG A O     1 
ATOM   1346  C  CB    . ARG A  1 177 ? -33.714 26.814  16.462  1.00 21.28  ? 420 ARG A CB    1 
ATOM   1347  C  CG    . ARG A  1 177 ? -33.049 25.477  16.523  1.00 20.98  ? 420 ARG A CG    1 
ATOM   1348  C  CD    . ARG A  1 177 ? -31.606 25.529  16.161  1.00 21.52  ? 420 ARG A CD    1 
ATOM   1349  N  NE    . ARG A  1 177 ? -31.356 25.990  14.797  1.00 22.06  ? 420 ARG A NE    1 
ATOM   1350  C  CZ    . ARG A  1 177 ? -31.530 25.280  13.696  1.00 21.43  ? 420 ARG A CZ    1 
ATOM   1351  N  NH1   . ARG A  1 177 ? -32.008 24.053  13.730  1.00 22.49  ? 420 ARG A NH1   1 
ATOM   1352  N  NH2   . ARG A  1 177 ? -31.237 25.815  12.522  1.00 21.51  ? 420 ARG A NH2   1 
ATOM   1353  N  N     . GLY A  1 178 ? -36.941 28.334  16.998  1.00 25.87  ? 421 GLY A N     1 
ATOM   1354  C  CA    . GLY A  1 178 ? -37.704 29.589  16.962  1.00 27.14  ? 421 GLY A CA    1 
ATOM   1355  C  C     . GLY A  1 178 ? -37.649 30.424  15.690  1.00 30.11  ? 421 GLY A C     1 
ATOM   1356  O  O     . GLY A  1 178 ? -38.005 31.595  15.715  1.00 33.40  ? 421 GLY A O     1 
ATOM   1357  N  N     . LYS A  1 179 ? -37.234 29.854  14.568  1.00 31.39  ? 422 LYS A N     1 
ATOM   1358  C  CA    . LYS A  1 179 ? -37.198 30.599  13.310  1.00 30.42  ? 422 LYS A CA    1 
ATOM   1359  C  C     . LYS A  1 179 ? -38.596 30.978  12.767  1.00 28.28  ? 422 LYS A C     1 
ATOM   1360  O  O     . LYS A  1 179 ? -39.626 30.390  13.110  1.00 26.72  ? 422 LYS A O     1 
ATOM   1361  C  CB    . LYS A  1 179 ? -36.427 29.820  12.231  1.00 32.16  ? 422 LYS A CB    1 
ATOM   1362  C  CG    . LYS A  1 179 ? -34.922 29.670  12.426  1.00 35.02  ? 422 LYS A CG    1 
ATOM   1363  C  CD    . LYS A  1 179 ? -34.308 30.765  13.305  1.00 39.71  ? 422 LYS A CD    1 
ATOM   1364  C  CE    . LYS A  1 179 ? -32.833 30.990  12.999  1.00 46.18  ? 422 LYS A CE    1 
ATOM   1365  N  NZ    . LYS A  1 179 ? -31.941 30.563  14.109  1.00 49.87  ? 422 LYS A NZ    1 
ATOM   1366  N  N     . ALA A  1 180 ? -38.597 31.924  11.861  1.00 27.69  ? 423 ALA A N     1 
ATOM   1367  C  CA    . ALA A  1 180 ? -39.831 32.493  11.332  1.00 28.16  ? 423 ALA A CA    1 
ATOM   1368  C  C     . ALA A  1 180 ? -40.276 31.694  10.128  1.00 27.94  ? 423 ALA A C     1 
ATOM   1369  O  O     . ALA A  1 180 ? -41.453 31.533  9.876   1.00 32.41  ? 423 ALA A O     1 
ATOM   1370  C  CB    . ALA A  1 180 ? -39.564 33.936  10.910  1.00 29.14  ? 423 ALA A CB    1 
ATOM   1371  N  N     . THR A  1 181 ? -39.327 31.216  9.349   1.00 27.38  ? 424 THR A N     1 
ATOM   1372  C  CA    . THR A  1 181 ? -39.612 30.292  8.285   1.00 24.85  ? 424 THR A CA    1 
ATOM   1373  C  C     . THR A  1 181 ? -38.852 28.994  8.467   1.00 26.12  ? 424 THR A C     1 
ATOM   1374  O  O     . THR A  1 181 ? -37.840 29.013  9.163   1.00 23.00  ? 424 THR A O     1 
ATOM   1375  C  CB    . THR A  1 181 ? -39.208 30.905  6.969   1.00 25.64  ? 424 THR A CB    1 
ATOM   1376  O  OG1   . THR A  1 181 ? -37.800 31.066  6.982   1.00 21.94  ? 424 THR A OG1   1 
ATOM   1377  C  CG2   . THR A  1 181 ? -39.907 32.266  6.818   1.00 29.45  ? 424 THR A CG2   1 
ATOM   1378  N  N     . CYS A  1 182 ? -39.339 27.895  7.839   1.00 25.95  ? 425 CYS A N     1 
ATOM   1379  C  CA    . CYS A  1 182 ? -38.735 26.539  7.931   1.00 25.66  ? 425 CYS A CA    1 
ATOM   1380  C  C     . CYS A  1 182 ? -38.543 26.001  6.571   1.00 24.68  ? 425 CYS A C     1 
ATOM   1381  O  O     . CYS A  1 182 ? -39.421 26.099  5.790   1.00 25.11  ? 425 CYS A O     1 
ATOM   1382  C  CB    . CYS A  1 182 ? -39.592 25.551  8.701   1.00 25.01  ? 425 CYS A CB    1 
ATOM   1383  S  SG    . CYS A  1 182 ? -39.839 26.062  10.423  1.00 34.29  ? 425 CYS A SG    1 
ATOM   1384  N  N     . GLY A  1 183 ? -37.361 25.450  6.283   1.00 25.32  ? 426 GLY A N     1 
ATOM   1385  C  CA    . GLY A  1 183 ? -37.139 24.711  5.040   1.00 25.83  ? 426 GLY A CA    1 
ATOM   1386  C  C     . GLY A  1 183 ? -37.942 23.423  4.930   1.00 23.78  ? 426 GLY A C     1 
ATOM   1387  O  O     . GLY A  1 183 ? -38.386 23.056  3.860   1.00 24.83  ? 426 GLY A O     1 
ATOM   1388  N  N     . ASP A  1 184 ? -38.104 22.747  6.050   1.00 23.61  ? 427 ASP A N     1 
ATOM   1389  C  CA    . ASP A  1 184 ? -38.815 21.499  6.169   1.00 23.39  ? 427 ASP A CA    1 
ATOM   1390  C  C     . ASP A  1 184 ? -39.086 21.221  7.635   1.00 25.41  ? 427 ASP A C     1 
ATOM   1391  O  O     . ASP A  1 184 ? -38.247 21.536  8.548   1.00 26.09  ? 427 ASP A O     1 
ATOM   1392  C  CB    . ASP A  1 184 ? -38.074 20.310  5.549   1.00 25.25  ? 427 ASP A CB    1 
ATOM   1393  C  CG    . ASP A  1 184 ? -36.869 19.740  6.399   1.00 27.79  ? 427 ASP A CG    1 
ATOM   1394  O  OD1   . ASP A  1 184 ? -36.595 19.999  7.574   1.00 24.56  ? 427 ASP A OD1   1 
ATOM   1395  O  OD2   . ASP A  1 184 ? -36.141 18.867  5.859   1.00 35.79  ? 427 ASP A OD2   1 
ATOM   1396  N  N     . VAL A  1 185 ? -40.193 20.507  7.806   1.00 21.60  ? 428 VAL A N     1 
ATOM   1397  C  CA    . VAL A  1 185 ? -40.627 20.103  9.089   1.00 20.98  ? 428 VAL A CA    1 
ATOM   1398  C  C     . VAL A  1 185 ? -40.039 18.766  9.562   1.00 19.08  ? 428 VAL A C     1 
ATOM   1399  O  O     . VAL A  1 185 ? -40.069 17.706  8.832   1.00 16.05  ? 428 VAL A O     1 
ATOM   1400  C  CB    . VAL A  1 185 ? -42.142 20.059  9.104   1.00 21.15  ? 428 VAL A CB    1 
ATOM   1401  C  CG1   . VAL A  1 185 ? -42.622 20.002  10.548  1.00 22.05  ? 428 VAL A CG1   1 
ATOM   1402  C  CG2   . VAL A  1 185 ? -42.689 21.334  8.408   1.00 21.63  ? 428 VAL A CG2   1 
ATOM   1403  N  N     . ASP A  1 186 ? -39.588 18.789  10.813  1.00 18.52  ? 429 ASP A N     1 
ATOM   1404  C  CA    . ASP A  1 186 ? -38.932 17.615  11.448  1.00 20.13  ? 429 ASP A CA    1 
ATOM   1405  C  C     . ASP A  1 186 ? -39.753 17.155  12.665  1.00 19.78  ? 429 ASP A C     1 
ATOM   1406  O  O     . ASP A  1 186 ? -39.810 17.870  13.654  1.00 21.83  ? 429 ASP A O     1 
ATOM   1407  C  CB    . ASP A  1 186 ? -37.519 17.978  11.857  1.00 19.73  ? 429 ASP A CB    1 
ATOM   1408  C  CG    . ASP A  1 186 ? -36.729 18.670  10.731  1.00 23.22  ? 429 ASP A CG    1 
ATOM   1409  O  OD1   . ASP A  1 186 ? -36.145 17.969  9.866   1.00 22.38  ? 429 ASP A OD1   1 
ATOM   1410  O  OD2   . ASP A  1 186 ? -36.691 19.929  10.726  1.00 21.42  ? 429 ASP A OD2   1 
ATOM   1411  N  N     . VAL A  1 187 ? -40.411 16.000  12.605  1.00 19.24  ? 430 VAL A N     1 
ATOM   1412  C  CA    . VAL A  1 187 ? -41.253 15.590  13.744  1.00 17.88  ? 430 VAL A CA    1 
ATOM   1413  C  C     . VAL A  1 187 ? -40.607 14.396  14.469  1.00 17.28  ? 430 VAL A C     1 
ATOM   1414  O  O     . VAL A  1 187 ? -40.270 13.420  13.859  1.00 14.10  ? 430 VAL A O     1 
ATOM   1415  C  CB    . VAL A  1 187 ? -42.666 15.278  13.308  1.00 19.17  ? 430 VAL A CB    1 
ATOM   1416  C  CG1   . VAL A  1 187 ? -43.531 14.843  14.525  1.00 18.88  ? 430 VAL A CG1   1 
ATOM   1417  C  CG2   . VAL A  1 187 ? -43.313 16.499  12.626  1.00 19.54  ? 430 VAL A CG2   1 
ATOM   1418  N  N     . LEU A  1 188 ? -40.453 14.498  15.778  1.00 17.88  ? 431 LEU A N     1 
ATOM   1419  C  CA    . LEU A  1 188 ? -39.877 13.433  16.574  1.00 18.51  ? 431 LEU A CA    1 
ATOM   1420  C  C     . LEU A  1 188 ? -41.033 12.903  17.444  1.00 19.82  ? 431 LEU A C     1 
ATOM   1421  O  O     . LEU A  1 188 ? -41.727 13.704  18.067  1.00 16.94  ? 431 LEU A O     1 
ATOM   1422  C  CB    . LEU A  1 188 ? -38.729 13.931  17.396  1.00 18.19  ? 431 LEU A CB    1 
ATOM   1423  C  CG    . LEU A  1 188 ? -38.099 13.058  18.498  1.00 21.19  ? 431 LEU A CG    1 
ATOM   1424  C  CD1   . LEU A  1 188 ? -37.015 13.871  19.163  1.00 20.86  ? 431 LEU A CD1   1 
ATOM   1425  C  CD2   . LEU A  1 188 ? -39.113 12.798  19.602  1.00 25.76  ? 431 LEU A CD2   1 
ATOM   1426  N  N     . ILE A  1 189 ? -41.236 11.568  17.399  1.00 18.81  ? 432 ILE A N     1 
ATOM   1427  C  CA    . ILE A  1 189 ? -42.309 10.868  18.102  1.00 19.15  ? 432 ILE A CA    1 
ATOM   1428  C  C     . ILE A  1 189 ? -41.689 9.871   19.050  1.00 20.73  ? 432 ILE A C     1 
ATOM   1429  O  O     . ILE A  1 189 ? -40.720 9.169   18.678  1.00 23.44  ? 432 ILE A O     1 
ATOM   1430  C  CB    . ILE A  1 189 ? -43.213 10.120  17.121  1.00 20.64  ? 432 ILE A CB    1 
ATOM   1431  C  CG1   . ILE A  1 189 ? -44.010 11.093  16.288  1.00 20.97  ? 432 ILE A CG1   1 
ATOM   1432  C  CG2   . ILE A  1 189 ? -44.221 9.249   17.848  1.00 21.40  ? 432 ILE A CG2   1 
ATOM   1433  C  CD1   . ILE A  1 189 ? -44.782 10.447  15.169  1.00 23.18  ? 432 ILE A CD1   1 
ATOM   1434  N  N     . THR A  1 190 ? -42.200 9.828   20.286  1.00 21.73  ? 433 THR A N     1 
ATOM   1435  C  CA    . THR A  1 190 ? -41.763 8.871   21.275  1.00 22.13  ? 433 THR A CA    1 
ATOM   1436  C  C     . THR A  1 190 ? -42.982 8.581   22.172  1.00 23.13  ? 433 THR A C     1 
ATOM   1437  O  O     . THR A  1 190 ? -44.045 9.011   21.833  1.00 22.93  ? 433 THR A O     1 
ATOM   1438  C  CB    . THR A  1 190 ? -40.497 9.348   22.055  1.00 20.40  ? 433 THR A CB    1 
ATOM   1439  O  OG1   . THR A  1 190 ? -39.927 8.237   22.720  1.00 22.62  ? 433 THR A OG1   1 
ATOM   1440  C  CG2   . THR A  1 190 ? -40.789 10.418  23.085  1.00 21.13  ? 433 THR A CG2   1 
ATOM   1441  N  N     . HIS A  1 191 ? -42.797 7.790   23.229  1.00 22.21  ? 434 HIS A N     1 
ATOM   1442  C  CA    . HIS A  1 191 ? -43.836 7.473   24.204  1.00 25.32  ? 434 HIS A CA    1 
ATOM   1443  C  C     . HIS A  1 191 ? -43.126 7.186   25.498  1.00 24.58  ? 434 HIS A C     1 
ATOM   1444  O  O     . HIS A  1 191 ? -42.248 6.337   25.497  1.00 24.33  ? 434 HIS A O     1 
ATOM   1445  C  CB    . HIS A  1 191 ? -44.555 6.163   23.854  1.00 28.73  ? 434 HIS A CB    1 
ATOM   1446  C  CG    . HIS A  1 191 ? -45.847 5.997   24.584  1.00 30.44  ? 434 HIS A CG    1 
ATOM   1447  N  ND1   . HIS A  1 191 ? -45.930 6.010   25.958  1.00 32.83  ? 434 HIS A ND1   1 
ATOM   1448  C  CD2   . HIS A  1 191 ? -47.115 5.929   24.129  1.00 30.42  ? 434 HIS A CD2   1 
ATOM   1449  C  CE1   . HIS A  1 191 ? -47.197 5.923   26.317  1.00 32.89  ? 434 HIS A CE1   1 
ATOM   1450  N  NE2   . HIS A  1 191 ? -47.931 5.846   25.224  1.00 33.68  ? 434 HIS A NE2   1 
ATOM   1451  N  N     . PRO A  1 192 ? -43.489 7.860   26.585  1.00 26.24  ? 435 PRO A N     1 
ATOM   1452  C  CA    . PRO A  1 192 ? -42.798 7.718   27.877  1.00 29.02  ? 435 PRO A CA    1 
ATOM   1453  C  C     . PRO A  1 192 ? -42.766 6.328   28.521  1.00 28.65  ? 435 PRO A C     1 
ATOM   1454  O  O     . PRO A  1 192 ? -41.957 6.120   29.388  1.00 33.68  ? 435 PRO A O     1 
ATOM   1455  C  CB    . PRO A  1 192 ? -43.540 8.676   28.820  1.00 30.01  ? 435 PRO A CB    1 
ATOM   1456  C  CG    . PRO A  1 192 ? -44.339 9.596   27.941  1.00 31.35  ? 435 PRO A CG    1 
ATOM   1457  C  CD    . PRO A  1 192 ? -44.413 9.013   26.549  1.00 29.81  ? 435 PRO A CD    1 
ATOM   1458  N  N     . ASP A  1 193 ? -43.597 5.397   28.082  1.00 30.80  ? 436 ASP A N     1 
ATOM   1459  C  CA    . ASP A  1 193 ? -43.674 4.054   28.688  1.00 34.37  ? 436 ASP A CA    1 
ATOM   1460  C  C     . ASP A  1 193 ? -42.621 3.125   28.168  1.00 32.82  ? 436 ASP A C     1 
ATOM   1461  O  O     . ASP A  1 193 ? -42.624 1.951   28.526  1.00 32.49  ? 436 ASP A O     1 
ATOM   1462  C  CB    . ASP A  1 193 ? -45.055 3.397   28.465  1.00 33.50  ? 436 ASP A CB    1 
ATOM   1463  C  CG    . ASP A  1 193 ? -45.292 2.969   27.044  1.00 37.91  ? 436 ASP A CG    1 
ATOM   1464  O  OD1   . ASP A  1 193 ? -44.337 2.839   26.197  1.00 37.26  ? 436 ASP A OD1   1 
ATOM   1465  O  OD2   . ASP A  1 193 ? -46.488 2.790   26.763  1.00 37.92  ? 436 ASP A OD2   1 
ATOM   1466  N  N     . GLY A  1 194 ? -41.769 3.630   27.269  1.00 31.13  ? 437 GLY A N     1 
ATOM   1467  C  CA    . GLY A  1 194 ? -40.641 2.868   26.753  1.00 31.48  ? 437 GLY A CA    1 
ATOM   1468  C  C     . GLY A  1 194 ? -40.975 1.808   25.715  1.00 29.45  ? 437 GLY A C     1 
ATOM   1469  O  O     . GLY A  1 194 ? -40.082 1.219   25.177  1.00 31.52  ? 437 GLY A O     1 
ATOM   1470  N  N     . ARG A  1 195 ? -42.239 1.571   25.404  1.00 30.95  ? 438 ARG A N     1 
ATOM   1471  C  CA    . ARG A  1 195 ? -42.602 0.438   24.545  1.00 30.62  ? 438 ARG A CA    1 
ATOM   1472  C  C     . ARG A  1 195 ? -43.494 0.771   23.383  1.00 30.34  ? 438 ARG A C     1 
ATOM   1473  O  O     . ARG A  1 195 ? -43.379 0.170   22.309  1.00 25.87  ? 438 ARG A O     1 
ATOM   1474  C  CB    . ARG A  1 195 ? -43.416 -0.576  25.356  1.00 39.06  ? 438 ARG A CB    1 
ATOM   1475  C  CG    . ARG A  1 195 ? -42.734 -1.184  26.570  1.00 44.76  ? 438 ARG A CG    1 
ATOM   1476  C  CD    . ARG A  1 195 ? -43.665 -2.168  27.320  1.00 52.05  ? 438 ARG A CD    1 
ATOM   1477  N  NE    . ARG A  1 195 ? -44.203 -1.594  28.578  1.00 57.37  ? 438 ARG A NE    1 
ATOM   1478  C  CZ    . ARG A  1 195 ? -45.473 -1.248  28.811  1.00 61.94  ? 438 ARG A CZ    1 
ATOM   1479  N  NH1   . ARG A  1 195 ? -46.441 -1.428  27.894  1.00 64.17  ? 438 ARG A NH1   1 
ATOM   1480  N  NH2   . ARG A  1 195 ? -45.781 -0.718  29.994  1.00 64.95  ? 438 ARG A NH2   1 
ATOM   1481  N  N     . SER A  1 196 ? -44.443 1.687   23.578  1.00 27.85  ? 439 SER A N     1 
ATOM   1482  C  CA    . SER A  1 196 ? -45.532 1.796   22.588  1.00 26.83  ? 439 SER A CA    1 
ATOM   1483  C  C     . SER A  1 196 ? -45.209 2.691   21.426  1.00 28.62  ? 439 SER A C     1 
ATOM   1484  O  O     . SER A  1 196 ? -46.076 3.000   20.630  1.00 30.21  ? 439 SER A O     1 
ATOM   1485  C  CB    . SER A  1 196 ? -46.804 2.307   23.258  1.00 30.65  ? 439 SER A CB    1 
ATOM   1486  O  OG    . SER A  1 196 ? -46.864 1.828   24.590  1.00 30.41  ? 439 SER A OG    1 
ATOM   1487  N  N     . HIS A  1 197 ? -43.980 3.171   21.347  1.00 28.23  ? 440 HIS A N     1 
ATOM   1488  C  CA    . HIS A  1 197 ? -43.486 3.699   20.104  1.00 28.72  ? 440 HIS A CA    1 
ATOM   1489  C  C     . HIS A  1 197 ? -43.350 2.632   19.025  1.00 28.39  ? 440 HIS A C     1 
ATOM   1490  O  O     . HIS A  1 197 ? -43.346 2.965   17.848  1.00 28.76  ? 440 HIS A O     1 
ATOM   1491  C  CB    . HIS A  1 197 ? -42.127 4.371   20.309  1.00 26.70  ? 440 HIS A CB    1 
ATOM   1492  C  CG    . HIS A  1 197 ? -41.044 3.419   20.630  1.00 28.35  ? 440 HIS A CG    1 
ATOM   1493  N  ND1   . HIS A  1 197 ? -40.907 2.841   21.878  1.00 30.11  ? 440 HIS A ND1   1 
ATOM   1494  C  CD2   . HIS A  1 197 ? -40.048 2.921   19.867  1.00 29.46  ? 440 HIS A CD2   1 
ATOM   1495  C  CE1   . HIS A  1 197 ? -39.855 2.045   21.868  1.00 31.05  ? 440 HIS A CE1   1 
ATOM   1496  N  NE2   . HIS A  1 197 ? -39.315 2.078   20.658  1.00 31.43  ? 440 HIS A NE2   1 
ATOM   1497  N  N     . ARG A  1 198 ? -43.207 1.366   19.415  1.00 31.76  ? 441 ARG A N     1 
ATOM   1498  C  CA    . ARG A  1 198 ? -42.979 0.262   18.448  1.00 32.59  ? 441 ARG A CA    1 
ATOM   1499  C  C     . ARG A  1 198 ? -44.136 0.054   17.451  1.00 28.54  ? 441 ARG A C     1 
ATOM   1500  O  O     . ARG A  1 198 ? -45.283 0.165   17.811  1.00 34.40  ? 441 ARG A O     1 
ATOM   1501  C  CB    . ARG A  1 198 ? -42.561 -1.031  19.174  1.00 31.31  ? 441 ARG A CB    1 
ATOM   1502  C  CG    . ARG A  1 198 ? -41.272 -0.826  19.969  1.00 37.11  ? 441 ARG A CG    1 
ATOM   1503  C  CD    . ARG A  1 198 ? -40.534 -2.110  20.346  1.00 42.21  ? 441 ARG A CD    1 
ATOM   1504  N  NE    . ARG A  1 198 ? -40.418 -2.365  21.779  1.00 46.11  ? 441 ARG A NE    1 
ATOM   1505  C  CZ    . ARG A  1 198 ? -41.328 -2.986  22.539  1.00 52.13  ? 441 ARG A CZ    1 
ATOM   1506  N  NH1   . ARG A  1 198 ? -42.479 -3.398  22.044  1.00 52.90  ? 441 ARG A NH1   1 
ATOM   1507  N  NH2   . ARG A  1 198 ? -41.097 -3.178  23.833  1.00 56.08  ? 441 ARG A NH2   1 
ATOM   1508  N  N     . GLY A  1 199 ? -43.810 -0.163  16.172  1.00 29.16  ? 442 GLY A N     1 
ATOM   1509  C  CA    . GLY A  1 199 ? -44.808 -0.451  15.113  1.00 28.02  ? 442 GLY A CA    1 
ATOM   1510  C  C     . GLY A  1 199 ? -45.685 0.693   14.622  1.00 32.14  ? 442 GLY A C     1 
ATOM   1511  O  O     . GLY A  1 199 ? -46.577 0.511   13.778  1.00 34.60  ? 442 GLY A O     1 
ATOM   1512  N  N     . ILE A  1 200 ? -45.419 1.891   15.126  1.00 30.19  ? 443 ILE A N     1 
ATOM   1513  C  CA    . ILE A  1 200 ? -46.220 3.070   14.852  1.00 30.33  ? 443 ILE A CA    1 
ATOM   1514  C  C     . ILE A  1 200 ? -46.240 3.508   13.394  1.00 30.65  ? 443 ILE A C     1 
ATOM   1515  O  O     . ILE A  1 200 ? -47.242 4.014   12.903  1.00 29.97  ? 443 ILE A O     1 
ATOM   1516  C  CB    . ILE A  1 200 ? -45.656 4.179   15.773  1.00 35.50  ? 443 ILE A CB    1 
ATOM   1517  C  CG1   . ILE A  1 200 ? -46.162 3.930   17.203  1.00 36.30  ? 443 ILE A CG1   1 
ATOM   1518  C  CG2   . ILE A  1 200 ? -45.909 5.580   15.288  1.00 34.18  ? 443 ILE A CG2   1 
ATOM   1519  C  CD1   . ILE A  1 200 ? -47.675 3.900   17.373  1.00 40.13  ? 443 ILE A CD1   1 
ATOM   1520  N  N     . PHE A  1 201 ? -45.145 3.304   12.683  1.00 27.09  ? 444 PHE A N     1 
ATOM   1521  C  CA    . PHE A  1 201 ? -45.008 3.870   11.369  1.00 26.45  ? 444 PHE A CA    1 
ATOM   1522  C  C     . PHE A  1 201 ? -45.988 3.274   10.415  1.00 26.67  ? 444 PHE A C     1 
ATOM   1523  O  O     . PHE A  1 201 ? -46.548 3.942   9.588   1.00 25.52  ? 444 PHE A O     1 
ATOM   1524  C  CB    . PHE A  1 201 ? -43.587 3.647   10.828  1.00 27.00  ? 444 PHE A CB    1 
ATOM   1525  C  CG    . PHE A  1 201 ? -42.650 4.817   11.004  1.00 25.80  ? 444 PHE A CG    1 
ATOM   1526  C  CD1   . PHE A  1 201 ? -42.910 6.037   10.402  1.00 27.26  ? 444 PHE A CD1   1 
ATOM   1527  C  CD2   . PHE A  1 201 ? -41.476 4.677   11.685  1.00 24.18  ? 444 PHE A CD2   1 
ATOM   1528  C  CE1   . PHE A  1 201 ? -42.011 7.094   10.511  1.00 26.60  ? 444 PHE A CE1   1 
ATOM   1529  C  CE2   . PHE A  1 201 ? -40.591 5.721   11.795  1.00 24.51  ? 444 PHE A CE2   1 
ATOM   1530  C  CZ    . PHE A  1 201 ? -40.830 6.928   11.201  1.00 24.33  ? 444 PHE A CZ    1 
ATOM   1531  N  N     . SER A  1 202 ? -46.214 1.995   10.499  1.00 27.27  ? 445 SER A N     1 
ATOM   1532  C  CA    . SER A  1 202 ? -47.188 1.393   9.612   1.00 27.80  ? 445 SER A CA    1 
ATOM   1533  C  C     . SER A  1 202 ? -48.523 2.086   9.675   1.00 26.74  ? 445 SER A C     1 
ATOM   1534  O  O     . SER A  1 202 ? -49.186 2.407   8.682   1.00 25.90  ? 445 SER A O     1 
ATOM   1535  C  CB    . SER A  1 202 ? -47.399 -0.074  10.016  1.00 34.62  ? 445 SER A CB    1 
ATOM   1536  O  OG    . SER A  1 202 ? -48.178 -0.720  9.023   1.00 41.84  ? 445 SER A OG    1 
ATOM   1537  N  N     . ARG A  1 203 ? -48.954 2.320   10.882  1.00 27.85  ? 446 ARG A N     1 
ATOM   1538  C  CA    . ARG A  1 203 ? -50.252 2.843   11.038  1.00 29.08  ? 446 ARG A CA    1 
ATOM   1539  C  C     . ARG A  1 203 ? -50.274 4.339   10.714  1.00 26.81  ? 446 ARG A C     1 
ATOM   1540  O  O     . ARG A  1 203 ? -51.151 4.801   9.996   1.00 27.17  ? 446 ARG A O     1 
ATOM   1541  C  CB    . ARG A  1 203 ? -50.690 2.562   12.444  1.00 34.83  ? 446 ARG A CB    1 
ATOM   1542  C  CG    . ARG A  1 203 ? -51.255 1.156   12.568  1.00 39.71  ? 446 ARG A CG    1 
ATOM   1543  C  CD    . ARG A  1 203 ? -51.631 0.895   14.009  1.00 44.27  ? 446 ARG A CD    1 
ATOM   1544  N  NE    . ARG A  1 203 ? -50.395 0.772   14.761  1.00 51.28  ? 446 ARG A NE    1 
ATOM   1545  C  CZ    . ARG A  1 203 ? -50.302 0.802   16.081  1.00 61.07  ? 446 ARG A CZ    1 
ATOM   1546  N  NH1   . ARG A  1 203 ? -51.399 0.957   16.824  1.00 65.83  ? 446 ARG A NH1   1 
ATOM   1547  N  NH2   . ARG A  1 203 ? -49.098 0.689   16.654  1.00 60.03  ? 446 ARG A NH2   1 
ATOM   1548  N  N     . LEU A  1 204 ? -49.287 5.068   11.219  1.00 22.90  ? 447 LEU A N     1 
ATOM   1549  C  CA    . LEU A  1 204 ? -49.229 6.485   11.058  1.00 21.74  ? 447 LEU A CA    1 
ATOM   1550  C  C     . LEU A  1 204 ? -49.168 6.828   9.574   1.00 22.31  ? 447 LEU A C     1 
ATOM   1551  O  O     . LEU A  1 204 ? -49.975 7.585   9.096   1.00 23.50  ? 447 LEU A O     1 
ATOM   1552  C  CB    . LEU A  1 204 ? -48.021 7.019   11.793  1.00 24.46  ? 447 LEU A CB    1 
ATOM   1553  C  CG    . LEU A  1 204 ? -47.767 8.503   11.657  1.00 24.40  ? 447 LEU A CG    1 
ATOM   1554  C  CD1   . LEU A  1 204 ? -48.961 9.306   12.144  1.00 24.87  ? 447 LEU A CD1   1 
ATOM   1555  C  CD2   . LEU A  1 204 ? -46.554 8.804   12.476  1.00 26.69  ? 447 LEU A CD2   1 
ATOM   1556  N  N     . LEU A  1 205 ? -48.271 6.216   8.821   1.00 20.92  ? 448 LEU A N     1 
ATOM   1557  C  CA    . LEU A  1 205 ? -48.208 6.485   7.383   1.00 22.78  ? 448 LEU A CA    1 
ATOM   1558  C  C     . LEU A  1 205 ? -49.495 6.135   6.645   1.00 27.36  ? 448 LEU A C     1 
ATOM   1559  O  O     . LEU A  1 205 ? -49.933 6.854   5.730   1.00 26.75  ? 448 LEU A O     1 
ATOM   1560  C  CB    . LEU A  1 205 ? -47.075 5.733   6.746   1.00 22.10  ? 448 LEU A CB    1 
ATOM   1561  C  CG    . LEU A  1 205 ? -45.721 6.073   7.336   1.00 22.66  ? 448 LEU A CG    1 
ATOM   1562  C  CD1   . LEU A  1 205 ? -44.685 5.157   6.743   1.00 22.64  ? 448 LEU A CD1   1 
ATOM   1563  C  CD2   . LEU A  1 205 ? -45.367 7.525   7.071   1.00 24.75  ? 448 LEU A CD2   1 
ATOM   1564  N  N     . ASP A  1 206 ? -50.107 5.029   7.022   1.00 29.57  ? 449 ASP A N     1 
ATOM   1565  C  CA    . ASP A  1 206 ? -51.378 4.684   6.411   1.00 34.64  ? 449 ASP A CA    1 
ATOM   1566  C  C     . ASP A  1 206 ? -52.433 5.739   6.707   1.00 30.88  ? 449 ASP A C     1 
ATOM   1567  O  O     . ASP A  1 206 ? -53.129 6.159   5.832   1.00 30.67  ? 449 ASP A O     1 
ATOM   1568  C  CB    . ASP A  1 206 ? -51.924 3.336   6.885   1.00 41.17  ? 449 ASP A CB    1 
ATOM   1569  C  CG    . ASP A  1 206 ? -53.198 2.948   6.123   1.00 46.56  ? 449 ASP A CG    1 
ATOM   1570  O  OD1   . ASP A  1 206 ? -53.082 2.535   4.962   1.00 53.11  ? 449 ASP A OD1   1 
ATOM   1571  O  OD2   . ASP A  1 206 ? -54.318 3.112   6.644   1.00 54.03  ? 449 ASP A OD2   1 
ATOM   1572  N  N     . SER A  1 207 ? -52.538 6.180   7.941   1.00 32.30  ? 450 SER A N     1 
ATOM   1573  C  CA    A SER A  1 207 ? -53.528 7.201   8.259   0.50 34.34  ? 450 SER A CA    1 
ATOM   1574  C  CA    B SER A  1 207 ? -53.498 7.210   8.300   0.50 31.73  ? 450 SER A CA    1 
ATOM   1575  C  C     . SER A  1 207 ? -53.201 8.463   7.465   1.00 34.19  ? 450 SER A C     1 
ATOM   1576  O  O     . SER A  1 207 ? -54.074 9.020   6.835   1.00 36.71  ? 450 SER A O     1 
ATOM   1577  C  CB    A SER A  1 207 ? -53.624 7.486   9.756   0.50 35.27  ? 450 SER A CB    1 
ATOM   1578  C  CB    B SER A  1 207 ? -53.396 7.499   9.794   0.50 30.34  ? 450 SER A CB    1 
ATOM   1579  O  OG    A SER A  1 207 ? -52.343 7.649   10.338  0.50 41.38  ? 450 SER A OG    1 
ATOM   1580  O  OG    B SER A  1 207 ? -54.575 8.044   10.330  0.50 27.65  ? 450 SER A OG    1 
ATOM   1581  N  N     . LEU A  1 208 ? -51.938 8.872   7.423   1.00 33.23  ? 451 LEU A N     1 
ATOM   1582  C  CA    . LEU A  1 208 ? -51.567 10.110  6.742   1.00 29.03  ? 451 LEU A CA    1 
ATOM   1583  C  C     . LEU A  1 208 ? -51.764 10.041  5.253   1.00 29.13  ? 451 LEU A C     1 
ATOM   1584  O  O     . LEU A  1 208 ? -52.044 11.048  4.612   1.00 27.45  ? 451 LEU A O     1 
ATOM   1585  C  CB    . LEU A  1 208 ? -50.143 10.503  7.114   1.00 27.47  ? 451 LEU A CB    1 
ATOM   1586  C  CG    . LEU A  1 208 ? -50.015 10.902  8.580   1.00 27.14  ? 451 LEU A CG    1 
ATOM   1587  C  CD1   . LEU A  1 208 ? -48.563 11.184  8.981   1.00 27.21  ? 451 LEU A CD1   1 
ATOM   1588  C  CD2   . LEU A  1 208 ? -50.891 12.111  8.899   1.00 28.71  ? 451 LEU A CD2   1 
ATOM   1589  N  N     . ARG A  1 209 ? -51.679 8.843   4.692   1.00 33.23  ? 452 ARG A N     1 
ATOM   1590  C  CA    . ARG A  1 209 ? -51.976 8.642   3.251   1.00 34.26  ? 452 ARG A CA    1 
ATOM   1591  C  C     . ARG A  1 209 ? -53.423 8.681   2.883   1.00 35.03  ? 452 ARG A C     1 
ATOM   1592  O  O     . ARG A  1 209 ? -53.768 9.118   1.801   1.00 31.82  ? 452 ARG A O     1 
ATOM   1593  C  CB    . ARG A  1 209 ? -51.523 7.299   2.776   1.00 32.25  ? 452 ARG A CB    1 
ATOM   1594  C  CG    . ARG A  1 209 ? -50.068 7.270   2.532   1.00 31.67  ? 452 ARG A CG    1 
ATOM   1595  C  CD    . ARG A  1 209 ? -49.592 5.841   2.387   1.00 30.44  ? 452 ARG A CD    1 
ATOM   1596  N  NE    . ARG A  1 209 ? -48.146 5.916   2.236   1.00 31.80  ? 452 ARG A NE    1 
ATOM   1597  C  CZ    . ARG A  1 209 ? -47.279 5.081   2.767   1.00 28.94  ? 452 ARG A CZ    1 
ATOM   1598  N  NH1   . ARG A  1 209 ? -47.683 4.054   3.489   1.00 30.46  ? 452 ARG A NH1   1 
ATOM   1599  N  NH2   . ARG A  1 209 ? -46.002 5.309   2.596   1.00 29.64  ? 452 ARG A NH2   1 
ATOM   1600  N  N     . GLN A  1 210 ? -54.259 8.209   3.785   1.00 39.52  ? 453 GLN A N     1 
ATOM   1601  C  CA    . GLN A  1 210 ? -55.658 8.045   3.493   1.00 40.73  ? 453 GLN A CA    1 
ATOM   1602  C  C     . GLN A  1 210 ? -56.300 9.386   3.356   1.00 40.49  ? 453 GLN A C     1 
ATOM   1603  O  O     . GLN A  1 210 ? -57.174 9.550   2.545   1.00 39.79  ? 453 GLN A O     1 
ATOM   1604  C  CB    . GLN A  1 210 ? -56.353 7.239   4.612   1.00 43.08  ? 453 GLN A CB    1 
ATOM   1605  C  CG    . GLN A  1 210 ? -56.043 5.747   4.546   1.00 48.07  ? 453 GLN A CG    1 
ATOM   1606  C  CD    . GLN A  1 210 ? -56.373 5.151   3.179   1.00 53.52  ? 453 GLN A CD    1 
ATOM   1607  O  OE1   . GLN A  1 210 ? -55.482 4.738   2.421   1.00 50.10  ? 453 GLN A OE1   1 
ATOM   1608  N  NE2   . GLN A  1 210 ? -57.665 5.141   2.843   1.00 56.11  ? 453 GLN A NE2   1 
ATOM   1609  N  N     . GLU A  1 211 ? -55.898 10.342  4.190   1.00 41.26  ? 454 GLU A N     1 
ATOM   1610  C  CA    . GLU A  1 211 ? -56.503 11.668  4.147   1.00 40.31  ? 454 GLU A CA    1 
ATOM   1611  C  C     . GLU A  1 211 ? -55.891 12.475  2.986   1.00 39.06  ? 454 GLU A C     1 
ATOM   1612  O  O     . GLU A  1 211 ? -56.332 13.581  2.687   1.00 43.85  ? 454 GLU A O     1 
ATOM   1613  C  CB    . GLU A  1 211 ? -56.365 12.368  5.515   1.00 48.58  ? 454 GLU A CB    1 
ATOM   1614  C  CG    . GLU A  1 211 ? -54.935 12.494  6.062   1.00 52.72  ? 454 GLU A CG    1 
ATOM   1615  C  CD    . GLU A  1 211 ? -54.786 13.337  7.345   1.00 59.51  ? 454 GLU A CD    1 
ATOM   1616  O  OE1   . GLU A  1 211 ? -55.119 12.848  8.452   1.00 69.44  ? 454 GLU A OE1   1 
ATOM   1617  O  OE2   . GLU A  1 211 ? -54.263 14.478  7.273   1.00 63.14  ? 454 GLU A OE2   1 
ATOM   1618  N  N     . GLY A  1 212 ? -54.875 11.910  2.320   1.00 33.58  ? 455 GLY A N     1 
ATOM   1619  C  CA    . GLY A  1 212 ? -54.219 12.539  1.174   1.00 30.78  ? 455 GLY A CA    1 
ATOM   1620  C  C     . GLY A  1 212 ? -53.114 13.533  1.586   1.00 29.02  ? 455 GLY A C     1 
ATOM   1621  O  O     . GLY A  1 212 ? -52.588 14.259  0.748   1.00 26.73  ? 455 GLY A O     1 
ATOM   1622  N  N     . PHE A  1 213 ? -52.777 13.569  2.871   1.00 26.71  ? 456 PHE A N     1 
ATOM   1623  C  CA    . PHE A  1 213 ? -51.728 14.452  3.381   1.00 26.05  ? 456 PHE A CA    1 
ATOM   1624  C  C     . PHE A  1 213 ? -50.293 14.062  2.869   1.00 27.42  ? 456 PHE A C     1 
ATOM   1625  O  O     . PHE A  1 213 ? -49.525 14.941  2.485   1.00 27.44  ? 456 PHE A O     1 
ATOM   1626  C  CB    . PHE A  1 213 ? -51.849 14.522  4.893   1.00 23.98  ? 456 PHE A CB    1 
ATOM   1627  C  CG    . PHE A  1 213 ? -50.762 15.309  5.574   1.00 25.84  ? 456 PHE A CG    1 
ATOM   1628  C  CD1   . PHE A  1 213 ? -50.753 16.703  5.533   1.00 22.80  ? 456 PHE A CD1   1 
ATOM   1629  C  CD2   . PHE A  1 213 ? -49.751 14.643  6.324   1.00 24.15  ? 456 PHE A CD2   1 
ATOM   1630  C  CE1   . PHE A  1 213 ? -49.737 17.427  6.164   1.00 22.92  ? 456 PHE A CE1   1 
ATOM   1631  C  CE2   . PHE A  1 213 ? -48.768 15.372  6.985   1.00 25.01  ? 456 PHE A CE2   1 
ATOM   1632  C  CZ    . PHE A  1 213 ? -48.743 16.763  6.878   1.00 23.36  ? 456 PHE A CZ    1 
ATOM   1633  N  N     . LEU A  1 214 ? -49.927 12.782  2.821   1.00 24.92  ? 457 LEU A N     1 
ATOM   1634  C  CA    . LEU A  1 214 ? -48.612 12.422  2.212   1.00 26.96  ? 457 LEU A CA    1 
ATOM   1635  C  C     . LEU A  1 214 ? -48.807 12.244  0.734   1.00 26.66  ? 457 LEU A C     1 
ATOM   1636  O  O     . LEU A  1 214 ? -49.732 11.569  0.341   1.00 31.03  ? 457 LEU A O     1 
ATOM   1637  C  CB    . LEU A  1 214 ? -48.020 11.112  2.768   1.00 25.66  ? 457 LEU A CB    1 
ATOM   1638  C  CG    . LEU A  1 214 ? -47.778 11.133  4.261   1.00 25.68  ? 457 LEU A CG    1 
ATOM   1639  C  CD1   . LEU A  1 214 ? -47.265 9.792   4.749   1.00 26.71  ? 457 LEU A CD1   1 
ATOM   1640  C  CD2   . LEU A  1 214 ? -46.786 12.232  4.630   1.00 24.75  ? 457 LEU A CD2   1 
ATOM   1641  N  N     . THR A  1 215 ? -47.967 12.852  -0.087  1.00 24.75  ? 458 THR A N     1 
ATOM   1642  C  CA    . THR A  1 215 ? -48.120 12.736  -1.540  1.00 24.55  ? 458 THR A CA    1 
ATOM   1643  C  C     . THR A  1 215 ? -46.974 11.968  -2.209  1.00 23.96  ? 458 THR A C     1 
ATOM   1644  O  O     . THR A  1 215 ? -47.080 11.628  -3.355  1.00 29.55  ? 458 THR A O     1 
ATOM   1645  C  CB    . THR A  1 215 ? -48.139 14.137  -2.143  1.00 23.38  ? 458 THR A CB    1 
ATOM   1646  O  OG1   . THR A  1 215 ? -46.922 14.781  -1.751  1.00 24.16  ? 458 THR A OG1   1 
ATOM   1647  C  CG2   . THR A  1 215 ? -49.300 14.916  -1.563  1.00 23.99  ? 458 THR A CG2   1 
ATOM   1648  N  N     . ASP A  1 216 ? -45.855 11.752  -1.542  1.00 24.08  ? 459 ASP A N     1 
ATOM   1649  C  CA    . ASP A  1 216 ? -44.731 11.008  -2.125  1.00 22.73  ? 459 ASP A CA    1 
ATOM   1650  C  C     . ASP A  1 216 ? -43.805 10.626  -1.005  1.00 22.27  ? 459 ASP A C     1 
ATOM   1651  O  O     . ASP A  1 216 ? -43.707 11.320  0.026   1.00 20.12  ? 459 ASP A O     1 
ATOM   1652  C  CB    . ASP A  1 216 ? -43.917 11.872  -3.098  1.00 26.46  ? 459 ASP A CB    1 
ATOM   1653  C  CG    . ASP A  1 216 ? -44.742 12.435  -4.290  1.00 28.43  ? 459 ASP A CG    1 
ATOM   1654  O  OD1   . ASP A  1 216 ? -44.825 11.732  -5.305  1.00 29.23  ? 459 ASP A OD1   1 
ATOM   1655  O  OD2   . ASP A  1 216 ? -45.274 13.593  -4.217  1.00 32.14  ? 459 ASP A OD2   1 
ATOM   1656  N  N     . ASP A  1 217 ? -43.087 9.532   -1.190  1.00 22.52  ? 460 ASP A N     1 
ATOM   1657  C  CA    . ASP A  1 217 ? -42.149 9.077   -0.184  1.00 23.35  ? 460 ASP A CA    1 
ATOM   1658  C  C     . ASP A  1 217 ? -40.769 9.102   -0.767  1.00 22.27  ? 460 ASP A C     1 
ATOM   1659  O  O     . ASP A  1 217 ? -40.571 8.716   -1.915  1.00 23.54  ? 460 ASP A O     1 
ATOM   1660  C  CB    . ASP A  1 217 ? -42.460 7.651   0.232   1.00 25.83  ? 460 ASP A CB    1 
ATOM   1661  C  CG    . ASP A  1 217 ? -43.860 7.496   0.762   1.00 27.07  ? 460 ASP A CG    1 
ATOM   1662  O  OD1   . ASP A  1 217 ? -44.416 8.467   1.356   1.00 26.42  ? 460 ASP A OD1   1 
ATOM   1663  O  OD2   . ASP A  1 217 ? -44.398 6.380   0.592   1.00 28.07  ? 460 ASP A OD2   1 
ATOM   1664  N  N     . LEU A  1 218 ? -39.796 9.531   0.016   1.00 21.08  ? 461 LEU A N     1 
ATOM   1665  C  CA    . LEU A  1 218 ? -38.419 9.606   -0.513  1.00 20.78  ? 461 LEU A CA    1 
ATOM   1666  C  C     . LEU A  1 218 ? -37.505 8.549   0.030   1.00 18.98  ? 461 LEU A C     1 
ATOM   1667  O  O     . LEU A  1 218 ? -36.742 7.958   -0.703  1.00 17.38  ? 461 LEU A O     1 
ATOM   1668  C  CB    . LEU A  1 218 ? -37.820 10.949  -0.222  1.00 21.11  ? 461 LEU A CB    1 
ATOM   1669  C  CG    . LEU A  1 218 ? -38.527 12.106  -0.974  1.00 23.96  ? 461 LEU A CG    1 
ATOM   1670  C  CD1   . LEU A  1 218 ? -38.269 13.456  -0.263  1.00 23.40  ? 461 LEU A CD1   1 
ATOM   1671  C  CD2   . LEU A  1 218 ? -38.093 12.143  -2.447  1.00 21.28  ? 461 LEU A CD2   1 
ATOM   1672  N  N     . VAL A  1 219 ? -37.500 8.461   1.342   1.00 19.46  ? 462 VAL A N     1 
ATOM   1673  C  CA    . VAL A  1 219 ? -36.773 7.447   2.092   1.00 19.66  ? 462 VAL A CA    1 
ATOM   1674  C  C     . VAL A  1 219 ? -37.738 6.898   3.143   1.00 20.60  ? 462 VAL A C     1 
ATOM   1675  O  O     . VAL A  1 219 ? -38.139 7.598   4.106   1.00 21.71  ? 462 VAL A O     1 
ATOM   1676  C  CB    . VAL A  1 219 ? -35.571 8.052   2.797   1.00 18.30  ? 462 VAL A CB    1 
ATOM   1677  C  CG1   . VAL A  1 219 ? -34.952 7.053   3.768   1.00 17.71  ? 462 VAL A CG1   1 
ATOM   1678  C  CG2   . VAL A  1 219 ? -34.566 8.508   1.761   1.00 18.57  ? 462 VAL A CG2   1 
ATOM   1679  N  N     . SER A  1 220 ? -38.148 5.663   2.947   1.00 20.48  ? 463 SER A N     1 
ATOM   1680  C  CA    . SER A  1 220 ? -39.084 5.034   3.884   1.00 20.71  ? 463 SER A CA    1 
ATOM   1681  C  C     . SER A  1 220 ? -39.023 3.526   3.696   1.00 20.69  ? 463 SER A C     1 
ATOM   1682  O  O     . SER A  1 220 ? -39.655 3.006   2.764   1.00 20.59  ? 463 SER A O     1 
ATOM   1683  C  CB    . SER A  1 220 ? -40.493 5.517   3.608   1.00 18.89  ? 463 SER A CB    1 
ATOM   1684  O  OG    . SER A  1 220 ? -41.419 4.908   4.478   1.00 21.06  ? 463 SER A OG    1 
ATOM   1685  N  N     . GLN A  1 221 ? -38.317 2.830   4.596   1.00 19.90  ? 464 GLN A N     1 
ATOM   1686  C  CA    A GLN A  1 221 ? -38.140 1.373   4.396   0.50 21.57  ? 464 GLN A CA    1 
ATOM   1687  C  CA    B GLN A  1 221 ? -38.108 1.397   4.454   0.50 19.78  ? 464 GLN A CA    1 
ATOM   1688  C  C     . GLN A  1 221 ? -39.206 0.618   5.152   1.00 19.65  ? 464 GLN A C     1 
ATOM   1689  O  O     . GLN A  1 221 ? -39.025 0.180   6.289   1.00 18.45  ? 464 GLN A O     1 
ATOM   1690  C  CB    A GLN A  1 221 ? -36.731 0.856   4.737   0.50 23.88  ? 464 GLN A CB    1 
ATOM   1691  C  CB    B GLN A  1 221 ? -36.736 1.018   5.019   0.50 19.60  ? 464 GLN A CB    1 
ATOM   1692  C  CG    A GLN A  1 221 ? -36.542 -0.652  4.520   0.50 26.21  ? 464 GLN A CG    1 
ATOM   1693  C  CG    B GLN A  1 221 ? -36.324 -0.395  4.691   0.50 19.25  ? 464 GLN A CG    1 
ATOM   1694  C  CD    A GLN A  1 221 ? -36.730 -1.143  3.073   0.50 28.79  ? 464 GLN A CD    1 
ATOM   1695  C  CD    B GLN A  1 221 ? -34.890 -0.675  5.069   0.50 18.74  ? 464 GLN A CD    1 
ATOM   1696  O  OE1   A GLN A  1 221 ? -35.755 -1.474  2.388   0.50 34.58  ? 464 GLN A OE1   1 
ATOM   1697  O  OE1   B GLN A  1 221 ? -34.482 -0.504  6.217   0.50 18.22  ? 464 GLN A OE1   1 
ATOM   1698  N  NE2   A GLN A  1 221 ? -37.971 -1.246  2.623   0.50 28.47  ? 464 GLN A NE2   1 
ATOM   1699  N  NE2   B GLN A  1 221 ? -34.124 -1.101  4.102   0.50 18.48  ? 464 GLN A NE2   1 
ATOM   1700  N  N     . GLU A  1 222 ? -40.312 0.442   4.466   1.00 19.64  ? 465 GLU A N     1 
ATOM   1701  C  CA    . GLU A  1 222 ? -41.537 -0.048  5.081   1.00 21.27  ? 465 GLU A CA    1 
ATOM   1702  C  C     . GLU A  1 222 ? -41.583 -1.542  5.188   1.00 22.00  ? 465 GLU A C     1 
ATOM   1703  O  O     . GLU A  1 222 ? -42.529 -2.080  5.806   1.00 20.96  ? 465 GLU A O     1 
ATOM   1704  C  CB    . GLU A  1 222 ? -42.779 0.550   4.376   1.00 21.91  ? 465 GLU A CB    1 
ATOM   1705  C  CG    . GLU A  1 222 ? -43.058 1.982   4.883   1.00 23.97  ? 465 GLU A CG    1 
ATOM   1706  C  CD    . GLU A  1 222 ? -43.964 2.837   3.944   1.00 29.87  ? 465 GLU A CD    1 
ATOM   1707  O  OE1   . GLU A  1 222 ? -45.135 2.401   3.769   1.00 29.21  ? 465 GLU A OE1   1 
ATOM   1708  O  OE2   . GLU A  1 222 ? -43.506 3.916   3.364   1.00 26.54  ? 465 GLU A OE2   1 
ATOM   1709  N  N     . GLU A  1 223 ? -40.527 -2.189  4.663   1.00 21.48  ? 466 GLU A N     1 
ATOM   1710  C  CA    A GLU A  1 223 ? -40.327 -3.625  4.791   0.70 22.51  ? 466 GLU A CA    1 
ATOM   1711  C  CA    B GLU A  1 223 ? -40.343 -3.618  4.804   0.30 20.42  ? 466 GLU A CA    1 
ATOM   1712  C  C     . GLU A  1 223 ? -39.896 -3.904  6.218   1.00 21.42  ? 466 GLU A C     1 
ATOM   1713  O  O     . GLU A  1 223 ? -40.036 -5.026  6.693   1.00 20.98  ? 466 GLU A O     1 
ATOM   1714  C  CB    A GLU A  1 223 ? -39.319 -4.199  3.727   0.70 25.37  ? 466 GLU A CB    1 
ATOM   1715  C  CB    B GLU A  1 223 ? -39.290 -4.156  3.822   0.30 19.79  ? 466 GLU A CB    1 
ATOM   1716  C  CG    A GLU A  1 223 ? -37.867 -4.446  4.188   0.70 28.71  ? 466 GLU A CG    1 
ATOM   1717  C  CG    B GLU A  1 223 ? -39.590 -3.918  2.347   0.30 18.93  ? 466 GLU A CG    1 
ATOM   1718  C  CD    A GLU A  1 223 ? -36.980 -5.402  3.299   0.70 31.66  ? 466 GLU A CD    1 
ATOM   1719  C  CD    B GLU A  1 223 ? -39.332 -2.477  1.958   0.30 18.62  ? 466 GLU A CD    1 
ATOM   1720  O  OE1   A GLU A  1 223 ? -37.400 -5.894  2.234   0.70 33.34  ? 466 GLU A OE1   1 
ATOM   1721  O  OE1   B GLU A  1 223 ? -38.639 -1.782  2.727   0.30 18.11  ? 466 GLU A OE1   1 
ATOM   1722  O  OE2   A GLU A  1 223 ? -35.830 -5.679  3.675   0.70 30.26  ? 466 GLU A OE2   1 
ATOM   1723  O  OE2   B GLU A  1 223 ? -39.815 -2.034  0.914   0.30 17.76  ? 466 GLU A OE2   1 
ATOM   1724  N  N     . ASN A  1 224 ? -39.371 -2.878  6.901   1.00 19.10  ? 467 ASN A N     1 
ATOM   1725  C  CA    . ASN A  1 224 ? -38.784 -3.050  8.227   1.00 18.94  ? 467 ASN A CA    1 
ATOM   1726  C  C     . ASN A  1 224 ? -39.746 -2.557  9.319   1.00 19.76  ? 467 ASN A C     1 
ATOM   1727  O  O     . ASN A  1 224 ? -40.025 -1.356  9.428   1.00 18.31  ? 467 ASN A O     1 
ATOM   1728  C  CB    . ASN A  1 224 ? -37.485 -2.249  8.347   1.00 18.59  ? 467 ASN A CB    1 
ATOM   1729  C  CG    . ASN A  1 224 ? -36.772 -2.393  9.690   1.00 18.31  ? 467 ASN A CG    1 
ATOM   1730  O  OD1   . ASN A  1 224 ? -37.106 -3.214  10.536  1.00 18.41  ? 467 ASN A OD1   1 
ATOM   1731  N  ND2   . ASN A  1 224 ? -35.774 -1.553  9.889   1.00 17.36  ? 467 ASN A ND2   1 
ATOM   1732  N  N     . GLY A  1 225 ? -40.206 -3.489  10.141  1.00 17.74  ? 468 GLY A N     1 
ATOM   1733  C  CA    . GLY A  1 225 ? -41.056 -3.147  11.269  1.00 17.76  ? 468 GLY A CA    1 
ATOM   1734  C  C     . GLY A  1 225 ? -40.352 -2.266  12.291  1.00 19.23  ? 468 GLY A C     1 
ATOM   1735  O  O     . GLY A  1 225 ? -41.001 -1.595  13.065  1.00 19.47  ? 468 GLY A O     1 
ATOM   1736  N  N     . GLN A  1 226 ? -39.034 -2.262  12.301  1.00 20.65  ? 469 GLN A N     1 
ATOM   1737  C  CA    . GLN A  1 226 ? -38.280 -1.376  13.179  1.00 21.91  ? 469 GLN A CA    1 
ATOM   1738  C  C     . GLN A  1 226 ? -37.794 -0.094  12.469  1.00 22.86  ? 469 GLN A C     1 
ATOM   1739  O  O     . GLN A  1 226 ? -36.840 0.544   12.903  1.00 24.50  ? 469 GLN A O     1 
ATOM   1740  C  CB    . GLN A  1 226 ? -37.074 -2.150  13.756  1.00 22.26  ? 469 GLN A CB    1 
ATOM   1741  C  CG    . GLN A  1 226 ? -37.570 -3.234  14.727  1.00 23.75  ? 469 GLN A CG    1 
ATOM   1742  C  CD    . GLN A  1 226 ? -38.187 -4.399  13.970  1.00 22.59  ? 469 GLN A CD    1 
ATOM   1743  O  OE1   . GLN A  1 226 ? -39.369 -4.707  14.102  1.00 20.79  ? 469 GLN A OE1   1 
ATOM   1744  N  NE2   . GLN A  1 226 ? -37.363 -5.050  13.170  1.00 21.81  ? 469 GLN A NE2   1 
ATOM   1745  N  N     . GLN A  1 227 ? -38.407 0.245   11.335  1.00 23.41  ? 470 GLN A N     1 
ATOM   1746  C  CA    . GLN A  1 227 ? -38.172 1.516   10.668  1.00 20.19  ? 470 GLN A CA    1 
ATOM   1747  C  C     . GLN A  1 227 ? -38.039 2.676   11.720  1.00 21.65  ? 470 GLN A C     1 
ATOM   1748  O  O     . GLN A  1 227 ? -38.818 2.820   12.642  1.00 19.10  ? 470 GLN A O     1 
ATOM   1749  C  CB    . GLN A  1 227 ? -39.333 1.769   9.723   1.00 19.37  ? 470 GLN A CB    1 
ATOM   1750  C  CG    . GLN A  1 227 ? -39.291 3.076   8.984   1.00 19.23  ? 470 GLN A CG    1 
ATOM   1751  C  CD    . GLN A  1 227 ? -40.447 3.241   8.009   1.00 19.15  ? 470 GLN A CD    1 
ATOM   1752  O  OE1   . GLN A  1 227 ? -41.285 2.345   7.798   1.00 17.28  ? 470 GLN A OE1   1 
ATOM   1753  N  NE2   . GLN A  1 227 ? -40.493 4.420   7.389   1.00 20.08  ? 470 GLN A NE2   1 
ATOM   1754  N  N     . GLN A  1 228 ? -37.031 3.501   11.536  1.00 25.95  ? 471 GLN A N     1 
ATOM   1755  C  CA    . GLN A  1 228 ? -36.754 4.620   12.432  1.00 27.51  ? 471 GLN A CA    1 
ATOM   1756  C  C     . GLN A  1 228 ? -37.126 5.915   11.735  1.00 21.88  ? 471 GLN A C     1 
ATOM   1757  O  O     . GLN A  1 228 ? -37.621 6.795   12.360  1.00 21.38  ? 471 GLN A O     1 
ATOM   1758  C  CB    . GLN A  1 228 ? -35.240 4.695   12.760  1.00 30.67  ? 471 GLN A CB    1 
ATOM   1759  C  CG    . GLN A  1 228 ? -34.612 3.546   13.544  1.00 35.51  ? 471 GLN A CG    1 
ATOM   1760  C  CD    . GLN A  1 228 ? -33.071 3.681   13.558  1.00 36.10  ? 471 GLN A CD    1 
ATOM   1761  O  OE1   . GLN A  1 228 ? -32.553 4.687   14.005  1.00 32.88  ? 471 GLN A OE1   1 
ATOM   1762  N  NE2   . GLN A  1 228 ? -32.362 2.707   12.994  1.00 35.37  ? 471 GLN A NE2   1 
ATOM   1763  N  N     . LYS A  1 229 ? -36.875 6.044   10.440  1.00 22.40  ? 472 LYS A N     1 
ATOM   1764  C  CA    . LYS A  1 229 ? -37.196 7.292   9.803   1.00 21.96  ? 472 LYS A CA    1 
ATOM   1765  C  C     . LYS A  1 229 ? -38.010 7.249   8.574   1.00 20.14  ? 472 LYS A C     1 
ATOM   1766  O  O     . LYS A  1 229 ? -38.048 6.246   7.861   1.00 22.54  ? 472 LYS A O     1 
ATOM   1767  C  CB    . LYS A  1 229 ? -35.956 8.106   9.546   1.00 27.94  ? 472 LYS A CB    1 
ATOM   1768  C  CG    . LYS A  1 229 ? -35.034 7.592   8.467   1.00 31.09  ? 472 LYS A CG    1 
ATOM   1769  C  CD    . LYS A  1 229 ? -33.702 8.336   8.646   1.00 31.46  ? 472 LYS A CD    1 
ATOM   1770  C  CE    . LYS A  1 229 ? -32.679 7.896   7.629   1.00 33.39  ? 472 LYS A CE    1 
ATOM   1771  N  NZ    . LYS A  1 229 ? -31.645 8.969   7.451   1.00 34.43  ? 472 LYS A NZ    1 
ATOM   1772  N  N     . TYR A  1 230 ? -38.715 8.370   8.385   1.00 18.15  ? 473 TYR A N     1 
ATOM   1773  C  CA    . TYR A  1 230 ? -39.468 8.677   7.218   1.00 16.95  ? 473 TYR A CA    1 
ATOM   1774  C  C     . TYR A  1 230 ? -39.091 10.070  6.683   1.00 17.71  ? 473 TYR A C     1 
ATOM   1775  O  O     . TYR A  1 230 ? -39.179 11.102  7.399   1.00 16.95  ? 473 TYR A O     1 
ATOM   1776  C  CB    . TYR A  1 230 ? -40.929 8.676   7.532   1.00 17.32  ? 473 TYR A CB    1 
ATOM   1777  C  CG    . TYR A  1 230 ? -41.735 9.084   6.372   1.00 17.38  ? 473 TYR A CG    1 
ATOM   1778  C  CD1   . TYR A  1 230 ? -41.925 8.220   5.321   1.00 19.14  ? 473 TYR A CD1   1 
ATOM   1779  C  CD2   . TYR A  1 230 ? -42.226 10.355  6.270   1.00 16.82  ? 473 TYR A CD2   1 
ATOM   1780  C  CE1   . TYR A  1 230 ? -42.677 8.599   4.207   1.00 20.02  ? 473 TYR A CE1   1 
ATOM   1781  C  CE2   . TYR A  1 230 ? -42.983 10.753  5.190   1.00 17.62  ? 473 TYR A CE2   1 
ATOM   1782  C  CZ    . TYR A  1 230 ? -43.196 9.883   4.147   1.00 18.53  ? 473 TYR A CZ    1 
ATOM   1783  O  OH    . TYR A  1 230 ? -43.916 10.296  3.057   1.00 18.53  ? 473 TYR A OH    1 
ATOM   1784  N  N     . LEU A  1 231 ? -38.671 10.085  5.428   1.00 17.16  ? 474 LEU A N     1 
ATOM   1785  C  CA    . LEU A  1 231 ? -38.468 11.316  4.701   1.00 17.26  ? 474 LEU A CA    1 
ATOM   1786  C  C     . LEU A  1 231 ? -39.393 11.255  3.540   1.00 16.89  ? 474 LEU A C     1 
ATOM   1787  O  O     . LEU A  1 231 ? -39.344 10.316  2.756   1.00 17.80  ? 474 LEU A O     1 
ATOM   1788  C  CB    . LEU A  1 231 ? -37.049 11.495  4.212   1.00 16.40  ? 474 LEU A CB    1 
ATOM   1789  C  CG    . LEU A  1 231 ? -35.877 11.096  5.131   1.00 17.82  ? 474 LEU A CG    1 
ATOM   1790  C  CD1   . LEU A  1 231 ? -34.607 11.550  4.462   1.00 17.38  ? 474 LEU A CD1   1 
ATOM   1791  C  CD2   . LEU A  1 231 ? -35.930 11.700  6.511   1.00 19.84  ? 474 LEU A CD2   1 
ATOM   1792  N  N     . GLY A  1 232 ? -40.303 12.212  3.491   1.00 18.54  ? 475 GLY A N     1 
ATOM   1793  C  CA    . GLY A  1 232 ? -41.214 12.323  2.393   1.00 19.62  ? 475 GLY A CA    1 
ATOM   1794  C  C     . GLY A  1 232 ? -41.782 13.733  2.172   1.00 20.94  ? 475 GLY A C     1 
ATOM   1795  O  O     . GLY A  1 232 ? -41.152 14.749  2.498   1.00 20.26  ? 475 GLY A O     1 
ATOM   1796  N  N     . VAL A  1 233 ? -42.984 13.760  1.624   1.00 20.21  ? 476 VAL A N     1 
ATOM   1797  C  CA    . VAL A  1 233 ? -43.584 14.961  1.065   1.00 21.21  ? 476 VAL A CA    1 
ATOM   1798  C  C     . VAL A  1 233 ? -45.000 15.005  1.540   1.00 20.10  ? 476 VAL A C     1 
ATOM   1799  O  O     . VAL A  1 233 ? -45.747 14.048  1.352   1.00 19.40  ? 476 VAL A O     1 
ATOM   1800  C  CB    . VAL A  1 233 ? -43.631 14.890  -0.477  1.00 19.12  ? 476 VAL A CB    1 
ATOM   1801  C  CG1   . VAL A  1 233 ? -44.135 16.206  -1.055  1.00 20.18  ? 476 VAL A CG1   1 
ATOM   1802  C  CG2   . VAL A  1 233 ? -42.259 14.592  -1.007  1.00 20.44  ? 476 VAL A CG2   1 
ATOM   1803  N  N     . CYS A  1 234 ? -45.384 16.122  2.133   1.00 21.99  ? 477 CYS A N     1 
ATOM   1804  C  CA    . CYS A  1 234 ? -46.757 16.327  2.505   1.00 21.44  ? 477 CYS A CA    1 
ATOM   1805  C  C     . CYS A  1 234 ? -47.367 17.585  1.838   1.00 24.37  ? 477 CYS A C     1 
ATOM   1806  O  O     . CYS A  1 234 ? -46.661 18.412  1.191   1.00 20.52  ? 477 CYS A O     1 
ATOM   1807  C  CB    . CYS A  1 234 ? -46.835 16.405  4.002   1.00 21.21  ? 477 CYS A CB    1 
ATOM   1808  S  SG    . CYS A  1 234 ? -46.188 17.900  4.759   1.00 24.81  ? 477 CYS A SG    1 
ATOM   1809  N  N     . ARG A  1 235 ? -48.689 17.701  1.968   1.00 22.97  ? 478 ARG A N     1 
ATOM   1810  C  CA    . ARG A  1 235 ? -49.393 18.865  1.506   1.00 23.23  ? 478 ARG A CA    1 
ATOM   1811  C  C     . ARG A  1 235 ? -50.669 19.057  2.321   1.00 22.74  ? 478 ARG A C     1 
ATOM   1812  O  O     . ARG A  1 235 ? -51.464 18.133  2.459   1.00 24.21  ? 478 ARG A O     1 
ATOM   1813  C  CB    . ARG A  1 235 ? -49.682 18.761  0.044   1.00 22.43  ? 478 ARG A CB    1 
ATOM   1814  C  CG    . ARG A  1 235 ? -50.360 20.001  -0.461  1.00 24.64  ? 478 ARG A CG    1 
ATOM   1815  C  CD    . ARG A  1 235 ? -50.597 19.929  -1.938  1.00 26.09  ? 478 ARG A CD    1 
ATOM   1816  N  NE    . ARG A  1 235 ? -51.371 18.735  -2.203  1.00 28.37  ? 478 ARG A NE    1 
ATOM   1817  C  CZ    . ARG A  1 235 ? -51.756 18.351  -3.401  1.00 29.41  ? 478 ARG A CZ    1 
ATOM   1818  N  NH1   . ARG A  1 235 ? -51.445 19.085  -4.480  1.00 28.28  ? 478 ARG A NH1   1 
ATOM   1819  N  NH2   . ARG A  1 235 ? -52.440 17.209  -3.504  1.00 29.55  ? 478 ARG A NH2   1 
ATOM   1820  N  N     . LEU A  1 236 ? -50.808 20.247  2.898   1.00 21.09  ? 479 LEU A N     1 
ATOM   1821  C  CA    . LEU A  1 236 ? -51.926 20.542  3.766   1.00 23.66  ? 479 LEU A CA    1 
ATOM   1822  C  C     . LEU A  1 236 ? -53.153 20.654  2.911   1.00 22.60  ? 479 LEU A C     1 
ATOM   1823  O  O     . LEU A  1 236 ? -53.035 20.909  1.736   1.00 20.82  ? 479 LEU A O     1 
ATOM   1824  C  CB    . LEU A  1 236 ? -51.745 21.858  4.510   1.00 22.65  ? 479 LEU A CB    1 
ATOM   1825  C  CG    . LEU A  1 236 ? -50.865 21.806  5.735   1.00 23.60  ? 479 LEU A CG    1 
ATOM   1826  C  CD1   . LEU A  1 236 ? -50.597 23.238  6.140   1.00 23.78  ? 479 LEU A CD1   1 
ATOM   1827  C  CD2   . LEU A  1 236 ? -51.461 21.032  6.902   1.00 24.58  ? 479 LEU A CD2   1 
ATOM   1828  N  N     . PRO A  1 237 ? -54.322 20.438  3.504   1.00 23.71  ? 480 PRO A N     1 
ATOM   1829  C  CA    . PRO A  1 237 ? -55.550 20.426  2.711   1.00 27.96  ? 480 PRO A CA    1 
ATOM   1830  C  C     . PRO A  1 237 ? -55.940 21.873  2.378   1.00 30.81  ? 480 PRO A C     1 
ATOM   1831  O  O     . PRO A  1 237 ? -55.562 22.779  3.103   1.00 33.85  ? 480 PRO A O     1 
ATOM   1832  C  CB    . PRO A  1 237 ? -56.563 19.827  3.673   1.00 29.27  ? 480 PRO A CB    1 
ATOM   1833  C  CG    . PRO A  1 237 ? -56.005 20.012  5.091   1.00 27.87  ? 480 PRO A CG    1 
ATOM   1834  C  CD    . PRO A  1 237 ? -54.557 20.422  4.958   1.00 25.52  ? 480 PRO A CD    1 
ATOM   1835  N  N     . GLY A  1 238 ? -56.663 22.106  1.307   1.00 34.51  ? 481 GLY A N     1 
ATOM   1836  C  CA    . GLY A  1 238 ? -57.081 23.474  0.975   1.00 36.79  ? 481 GLY A CA    1 
ATOM   1837  C  C     . GLY A  1 238 ? -56.461 24.007  -0.291  1.00 34.62  ? 481 GLY A C     1 
ATOM   1838  O  O     . GLY A  1 238 ? -55.475 23.496  -0.765  1.00 37.41  ? 481 GLY A O     1 
ATOM   1839  N  N     . PRO A  1 239 ? -57.072 25.028  -0.880  1.00 35.18  ? 482 PRO A N     1 
ATOM   1840  C  CA    . PRO A  1 239 ? -56.690 25.420  -2.235  1.00 30.15  ? 482 PRO A CA    1 
ATOM   1841  C  C     . PRO A  1 239 ? -55.361 26.067  -2.255  1.00 26.97  ? 482 PRO A C     1 
ATOM   1842  O  O     . PRO A  1 239 ? -55.119 26.887  -1.411  1.00 27.64  ? 482 PRO A O     1 
ATOM   1843  C  CB    . PRO A  1 239 ? -57.704 26.489  -2.568  1.00 32.35  ? 482 PRO A CB    1 
ATOM   1844  C  CG    . PRO A  1 239 ? -58.172 27.019  -1.244  1.00 32.34  ? 482 PRO A CG    1 
ATOM   1845  C  CD    . PRO A  1 239 ? -58.184 25.831  -0.357  1.00 33.51  ? 482 PRO A CD    1 
ATOM   1846  N  N     . GLY A  1 240 ? -54.533 25.719  -3.234  1.00 26.52  ? 483 GLY A N     1 
ATOM   1847  C  CA    . GLY A  1 240 ? -53.280 26.387  -3.500  1.00 29.75  ? 483 GLY A CA    1 
ATOM   1848  C  C     . GLY A  1 240 ? -52.096 26.049  -2.591  1.00 30.96  ? 483 GLY A C     1 
ATOM   1849  O  O     . GLY A  1 240 ? -51.034 26.645  -2.726  1.00 27.87  ? 483 GLY A O     1 
ATOM   1850  N  N     . ARG A  1 241 ? -52.251 25.081  -1.694  1.00 30.77  ? 484 ARG A N     1 
ATOM   1851  C  CA    . ARG A  1 241 ? -51.154 24.703  -0.788  1.00 30.42  ? 484 ARG A CA    1 
ATOM   1852  C  C     . ARG A  1 241 ? -49.944 24.139  -1.522  1.00 29.72  ? 484 ARG A C     1 
ATOM   1853  O  O     . ARG A  1 241 ? -50.080 23.473  -2.523  1.00 25.96  ? 484 ARG A O     1 
ATOM   1854  C  CB    . ARG A  1 241 ? -51.635 23.681  0.212   1.00 32.97  ? 484 ARG A CB    1 
ATOM   1855  C  CG    . ARG A  1 241 ? -52.770 24.179  1.060   1.00 35.86  ? 484 ARG A CG    1 
ATOM   1856  C  CD    . ARG A  1 241 ? -52.269 25.335  1.864   1.00 38.48  ? 484 ARG A CD    1 
ATOM   1857  N  NE    . ARG A  1 241 ? -52.700 25.267  3.248   1.00 39.42  ? 484 ARG A NE    1 
ATOM   1858  C  CZ    . ARG A  1 241 ? -52.076 25.940  4.191   1.00 36.65  ? 484 ARG A CZ    1 
ATOM   1859  N  NH1   . ARG A  1 241 ? -51.039 26.675  3.870   1.00 36.75  ? 484 ARG A NH1   1 
ATOM   1860  N  NH2   . ARG A  1 241 ? -52.483 25.880  5.431   1.00 42.83  ? 484 ARG A NH2   1 
ATOM   1861  N  N     . ARG A  1 242 ? -48.744 24.434  -1.015  1.00 30.16  ? 485 ARG A N     1 
ATOM   1862  C  CA    . ARG A  1 242 ? -47.545 23.840  -1.574  1.00 30.69  ? 485 ARG A CA    1 
ATOM   1863  C  C     . ARG A  1 242 ? -47.294 22.436  -0.967  1.00 27.88  ? 485 ARG A C     1 
ATOM   1864  O  O     . ARG A  1 242 ? -47.679 22.136  0.168   1.00 26.01  ? 485 ARG A O     1 
ATOM   1865  C  CB    . ARG A  1 242 ? -46.347 24.719  -1.277  1.00 32.28  ? 485 ARG A CB    1 
ATOM   1866  C  CG    . ARG A  1 242 ? -46.463 26.150  -1.793  1.00 34.18  ? 485 ARG A CG    1 
ATOM   1867  C  CD    . ARG A  1 242 ? -45.706 26.306  -3.094  1.00 38.39  ? 485 ARG A CD    1 
ATOM   1868  N  NE    . ARG A  1 242 ? -45.169 27.668  -3.372  1.00 38.50  ? 485 ARG A NE    1 
ATOM   1869  C  CZ    . ARG A  1 242 ? -44.329 27.964  -4.373  1.00 33.89  ? 485 ARG A CZ    1 
ATOM   1870  N  NH1   . ARG A  1 242 ? -43.897 27.016  -5.213  1.00 33.55  ? 485 ARG A NH1   1 
ATOM   1871  N  NH2   . ARG A  1 242 ? -43.915 29.213  -4.548  1.00 34.99  ? 485 ARG A NH2   1 
ATOM   1872  N  N     . HIS A  1 243 ? -46.595 21.612  -1.733  1.00 25.79  ? 486 HIS A N     1 
ATOM   1873  C  CA    . HIS A  1 243 ? -45.958 20.431  -1.189  1.00 24.91  ? 486 HIS A CA    1 
ATOM   1874  C  C     . HIS A  1 243 ? -44.742 20.807  -0.326  1.00 24.02  ? 486 HIS A C     1 
ATOM   1875  O  O     . HIS A  1 243 ? -43.896 21.592  -0.734  1.00 24.71  ? 486 HIS A O     1 
ATOM   1876  C  CB    . HIS A  1 243 ? -45.471 19.541  -2.314  1.00 25.83  ? 486 HIS A CB    1 
ATOM   1877  C  CG    . HIS A  1 243 ? -46.560 19.005  -3.193  1.00 29.09  ? 486 HIS A CG    1 
ATOM   1878  N  ND1   . HIS A  1 243 ? -46.999 19.669  -4.332  1.00 28.75  ? 486 HIS A ND1   1 
ATOM   1879  C  CD2   . HIS A  1 243 ? -47.242 17.834  -3.148  1.00 27.79  ? 486 HIS A CD2   1 
ATOM   1880  C  CE1   . HIS A  1 243 ? -47.910 18.932  -4.939  1.00 27.69  ? 486 HIS A CE1   1 
ATOM   1881  N  NE2   . HIS A  1 243 ? -48.070 17.810  -4.252  1.00 29.29  ? 486 HIS A NE2   1 
ATOM   1882  N  N     . ARG A  1 244 ? -44.665 20.233  0.862   1.00 22.56  ? 487 ARG A N     1 
ATOM   1883  C  CA    . ARG A  1 244 ? -43.560 20.452  1.772   1.00 22.73  ? 487 ARG A CA    1 
ATOM   1884  C  C     . ARG A  1 244 ? -42.794 19.177  2.121   1.00 22.51  ? 487 ARG A C     1 
ATOM   1885  O  O     . ARG A  1 244 ? -43.378 18.078  2.164   1.00 20.52  ? 487 ARG A O     1 
ATOM   1886  C  CB    . ARG A  1 244 ? -44.096 21.024  3.057   1.00 23.04  ? 487 ARG A CB    1 
ATOM   1887  C  CG    . ARG A  1 244 ? -44.877 22.289  2.888   1.00 24.18  ? 487 ARG A CG    1 
ATOM   1888  C  CD    . ARG A  1 244 ? -44.040 23.387  2.200   1.00 24.66  ? 487 ARG A CD    1 
ATOM   1889  N  NE    . ARG A  1 244 ? -44.755 24.646  2.368   1.00 25.58  ? 487 ARG A NE    1 
ATOM   1890  C  CZ    . ARG A  1 244 ? -44.424 25.789  1.791   1.00 24.32  ? 487 ARG A CZ    1 
ATOM   1891  N  NH1   . ARG A  1 244 ? -43.356 25.857  1.022   1.00 24.91  ? 487 ARG A NH1   1 
ATOM   1892  N  NH2   . ARG A  1 244 ? -45.166 26.858  2.030   1.00 21.77  ? 487 ARG A NH2   1 
ATOM   1893  N  N     . ARG A  1 245 ? -41.489 19.322  2.375   1.00 20.78  ? 488 ARG A N     1 
ATOM   1894  C  CA    . ARG A  1 245 ? -40.677 18.212  2.958   1.00 20.67  ? 488 ARG A CA    1 
ATOM   1895  C  C     . ARG A  1 245 ? -41.003 17.949  4.434   1.00 19.84  ? 488 ARG A C     1 
ATOM   1896  O  O     . ARG A  1 245 ? -41.101 18.852  5.232   1.00 21.61  ? 488 ARG A O     1 
ATOM   1897  C  CB    . ARG A  1 245 ? -39.180 18.446  2.759   1.00 20.96  ? 488 ARG A CB    1 
ATOM   1898  C  CG    . ARG A  1 245 ? -38.729 18.174  1.334   1.00 19.50  ? 488 ARG A CG    1 
ATOM   1899  C  CD    . ARG A  1 245 ? -38.383 16.708  1.117   1.00 21.37  ? 488 ARG A CD    1 
ATOM   1900  N  NE    . ARG A  1 245 ? -37.242 16.309  1.969   1.00 22.48  ? 488 ARG A NE    1 
ATOM   1901  C  CZ    . ARG A  1 245 ? -37.323 15.612  3.102   1.00 22.73  ? 488 ARG A CZ    1 
ATOM   1902  N  NH1   . ARG A  1 245 ? -38.486 15.169  3.573   1.00 22.53  ? 488 ARG A NH1   1 
ATOM   1903  N  NH2   . ARG A  1 245 ? -36.216 15.367  3.781   1.00 24.23  ? 488 ARG A NH2   1 
ATOM   1904  N  N     . LEU A  1 246 ? -41.261 16.687  4.746   1.00 19.74  ? 489 LEU A N     1 
ATOM   1905  C  CA    . LEU A  1 246 ? -41.552 16.190  6.105   1.00 19.17  ? 489 LEU A CA    1 
ATOM   1906  C  C     . LEU A  1 246 ? -40.650 15.005  6.425   1.00 18.31  ? 489 LEU A C     1 
ATOM   1907  O  O     . LEU A  1 246 ? -40.522 14.075  5.610   1.00 20.95  ? 489 LEU A O     1 
ATOM   1908  C  CB    . LEU A  1 246 ? -42.994 15.713  6.197   1.00 18.98  ? 489 LEU A CB    1 
ATOM   1909  C  CG    . LEU A  1 246 ? -43.512 15.165  7.532   1.00 18.72  ? 489 LEU A CG    1 
ATOM   1910  C  CD1   . LEU A  1 246 ? -43.337 16.167  8.632   1.00 18.74  ? 489 LEU A CD1   1 
ATOM   1911  C  CD2   . LEU A  1 246 ? -44.978 14.798  7.409   1.00 18.73  ? 489 LEU A CD2   1 
ATOM   1912  N  N     . ASP A  1 247 ? -40.020 15.097  7.582   1.00 17.43  ? 490 ASP A N     1 
ATOM   1913  C  CA    . ASP A  1 247 ? -39.169 14.119  8.179   1.00 18.15  ? 490 ASP A CA    1 
ATOM   1914  C  C     . ASP A  1 247 ? -39.841 13.703  9.530   1.00 19.28  ? 490 ASP A C     1 
ATOM   1915  O  O     . ASP A  1 247 ? -40.200 14.530  10.358  1.00 19.67  ? 490 ASP A O     1 
ATOM   1916  C  CB    . ASP A  1 247 ? -37.778 14.667  8.446   1.00 19.18  ? 490 ASP A CB    1 
ATOM   1917  C  CG    . ASP A  1 247 ? -37.019 15.093  7.178   1.00 21.60  ? 490 ASP A CG    1 
ATOM   1918  O  OD1   . ASP A  1 247 ? -37.455 14.616  6.099   1.00 23.10  ? 490 ASP A OD1   1 
ATOM   1919  O  OD2   . ASP A  1 247 ? -36.015 15.919  7.254   1.00 25.22  ? 490 ASP A OD2   1 
ATOM   1920  N  N     . ILE A  1 248 ? -40.035 12.407  9.731   1.00 18.60  ? 491 ILE A N     1 
ATOM   1921  C  CA    . ILE A  1 248 ? -40.551 11.879  10.997  1.00 16.78  ? 491 ILE A CA    1 
ATOM   1922  C  C     . ILE A  1 248 ? -39.548 10.838  11.511  1.00 17.79  ? 491 ILE A C     1 
ATOM   1923  O  O     . ILE A  1 248 ? -39.054 9.981   10.737  1.00 17.73  ? 491 ILE A O     1 
ATOM   1924  C  CB    . ILE A  1 248 ? -41.915 11.234  10.773  1.00 17.40  ? 491 ILE A CB    1 
ATOM   1925  C  CG1   . ILE A  1 248 ? -42.901 12.240  10.177  1.00 18.41  ? 491 ILE A CG1   1 
ATOM   1926  C  CG2   . ILE A  1 248 ? -42.513 10.683  12.044  1.00 17.88  ? 491 ILE A CG2   1 
ATOM   1927  C  CD1   . ILE A  1 248 ? -44.263 11.642  9.865   1.00 19.50  ? 491 ILE A CD1   1 
ATOM   1928  N  N     . ILE A  1 249 ? -39.212 10.941  12.786  1.00 18.46  ? 492 ILE A N     1 
ATOM   1929  C  CA    . ILE A  1 249 ? -38.471 9.911   13.482  1.00 21.68  ? 492 ILE A CA    1 
ATOM   1930  C  C     . ILE A  1 249 ? -39.292 9.424   14.641  1.00 19.49  ? 492 ILE A C     1 
ATOM   1931  O  O     . ILE A  1 249 ? -39.890 10.214  15.343  1.00 17.72  ? 492 ILE A O     1 
ATOM   1932  C  CB    . ILE A  1 249 ? -37.176 10.435  14.099  1.00 25.49  ? 492 ILE A CB    1 
ATOM   1933  C  CG1   . ILE A  1 249 ? -36.361 11.130  13.087  1.00 28.70  ? 492 ILE A CG1   1 
ATOM   1934  C  CG2   . ILE A  1 249 ? -36.358 9.314   14.640  1.00 30.56  ? 492 ILE A CG2   1 
ATOM   1935  C  CD1   . ILE A  1 249 ? -36.080 10.319  11.881  1.00 31.53  ? 492 ILE A CD1   1 
ATOM   1936  N  N     . VAL A  1 250 ? -39.218 8.112   14.872  1.00 18.38  ? 493 VAL A N     1 
ATOM   1937  C  CA    . VAL A  1 250 ? -39.833 7.471   16.018  1.00 17.50  ? 493 VAL A CA    1 
ATOM   1938  C  C     . VAL A  1 250 ? -38.747 6.810   16.823  1.00 16.37  ? 493 VAL A C     1 
ATOM   1939  O  O     . VAL A  1 250 ? -38.021 6.006   16.273  1.00 15.41  ? 493 VAL A O     1 
ATOM   1940  C  CB    . VAL A  1 250 ? -40.848 6.414   15.575  1.00 17.44  ? 493 VAL A CB    1 
ATOM   1941  C  CG1   . VAL A  1 250 ? -41.438 5.730   16.799  1.00 18.56  ? 493 VAL A CG1   1 
ATOM   1942  C  CG2   . VAL A  1 250 ? -41.951 7.084   14.756  1.00 17.53  ? 493 VAL A CG2   1 
ATOM   1943  N  N     . VAL A  1 251 ? -38.626 7.181   18.095  1.00 16.21  ? 494 VAL A N     1 
ATOM   1944  C  CA    . VAL A  1 251 ? -37.533 6.744   18.932  1.00 18.03  ? 494 VAL A CA    1 
ATOM   1945  C  C     . VAL A  1 251 ? -38.019 6.180   20.281  1.00 19.17  ? 494 VAL A C     1 
ATOM   1946  O  O     . VAL A  1 251 ? -39.098 6.528   20.746  1.00 20.64  ? 494 VAL A O     1 
ATOM   1947  C  CB    . VAL A  1 251 ? -36.473 7.849   19.210  1.00 18.34  ? 494 VAL A CB    1 
ATOM   1948  C  CG1   . VAL A  1 251 ? -35.956 8.431   17.902  1.00 19.10  ? 494 VAL A CG1   1 
ATOM   1949  C  CG2   . VAL A  1 251 ? -37.017 8.967   20.101  1.00 17.78  ? 494 VAL A CG2   1 
ATOM   1950  N  N     . PRO A  1 252 ? -37.197 5.310   20.897  1.00 19.63  ? 495 PRO A N     1 
ATOM   1951  C  CA    . PRO A  1 252 ? -37.526 4.834   22.208  1.00 21.50  ? 495 PRO A CA    1 
ATOM   1952  C  C     . PRO A  1 252 ? -37.269 5.952   23.188  1.00 25.50  ? 495 PRO A C     1 
ATOM   1953  O  O     . PRO A  1 252 ? -36.360 6.752   22.988  1.00 23.80  ? 495 PRO A O     1 
ATOM   1954  C  CB    . PRO A  1 252 ? -36.541 3.663   22.448  1.00 21.56  ? 495 PRO A CB    1 
ATOM   1955  C  CG    . PRO A  1 252 ? -35.435 3.865   21.425  1.00 20.88  ? 495 PRO A CG    1 
ATOM   1956  C  CD    . PRO A  1 252 ? -36.093 4.539   20.258  1.00 19.55  ? 495 PRO A CD    1 
ATOM   1957  N  N     . TYR A  1 253 ? -38.071 5.990   24.249  1.00 25.81  ? 496 TYR A N     1 
ATOM   1958  C  CA    . TYR A  1 253 ? -38.019 7.070   25.176  1.00 24.50  ? 496 TYR A CA    1 
ATOM   1959  C  C     . TYR A  1 253 ? -36.652 7.208   25.762  1.00 25.62  ? 496 TYR A C     1 
ATOM   1960  O  O     . TYR A  1 253 ? -36.202 8.298   26.032  1.00 25.01  ? 496 TYR A O     1 
ATOM   1961  C  CB    . TYR A  1 253 ? -39.018 6.813   26.279  1.00 25.56  ? 496 TYR A CB    1 
ATOM   1962  C  CG    . TYR A  1 253 ? -39.259 7.983   27.202  1.00 27.27  ? 496 TYR A CG    1 
ATOM   1963  C  CD1   . TYR A  1 253 ? -39.888 9.145   26.741  1.00 28.19  ? 496 TYR A CD1   1 
ATOM   1964  C  CD2   . TYR A  1 253 ? -38.917 7.911   28.564  1.00 28.38  ? 496 TYR A CD2   1 
ATOM   1965  C  CE1   . TYR A  1 253 ? -40.133 10.226  27.597  1.00 29.35  ? 496 TYR A CE1   1 
ATOM   1966  C  CE2   . TYR A  1 253 ? -39.161 8.978   29.421  1.00 27.10  ? 496 TYR A CE2   1 
ATOM   1967  C  CZ    . TYR A  1 253 ? -39.765 10.118  28.923  1.00 29.79  ? 496 TYR A CZ    1 
ATOM   1968  O  OH    . TYR A  1 253 ? -40.005 11.159  29.747  1.00 35.91  ? 496 TYR A OH    1 
ATOM   1969  N  N     . SER A  1 254 ? -35.973 6.102   25.990  1.00 25.16  ? 497 SER A N     1 
ATOM   1970  C  CA    . SER A  1 254 ? -34.663 6.212   26.580  1.00 26.84  ? 497 SER A CA    1 
ATOM   1971  C  C     . SER A  1 254 ? -33.669 7.013   25.673  1.00 26.14  ? 497 SER A C     1 
ATOM   1972  O  O     . SER A  1 254 ? -32.606 7.486   26.144  1.00 24.77  ? 497 SER A O     1 
ATOM   1973  C  CB    . SER A  1 254 ? -34.113 4.827   26.881  1.00 29.07  ? 497 SER A CB    1 
ATOM   1974  O  OG    . SER A  1 254 ? -33.367 4.325   25.801  1.00 31.07  ? 497 SER A OG    1 
ATOM   1975  N  N     . GLU A  1 255 ? -34.004 7.112   24.381  1.00 24.66  ? 498 GLU A N     1 
ATOM   1976  C  CA    . GLU A  1 255 ? -33.195 7.852   23.423  1.00 23.86  ? 498 GLU A CA    1 
ATOM   1977  C  C     . GLU A  1 255 ? -33.627 9.293   23.267  1.00 21.87  ? 498 GLU A C     1 
ATOM   1978  O  O     . GLU A  1 255 ? -32.937 10.055  22.610  1.00 22.00  ? 498 GLU A O     1 
ATOM   1979  C  CB    . GLU A  1 255 ? -33.179 7.152   22.087  1.00 24.08  ? 498 GLU A CB    1 
ATOM   1980  C  CG    . GLU A  1 255 ? -32.403 5.850   22.193  1.00 28.33  ? 498 GLU A CG    1 
ATOM   1981  C  CD    . GLU A  1 255 ? -32.193 5.142   20.866  1.00 29.27  ? 498 GLU A CD    1 
ATOM   1982  O  OE1   . GLU A  1 255 ? -32.579 5.626   19.776  1.00 29.83  ? 498 GLU A OE1   1 
ATOM   1983  O  OE2   . GLU A  1 255 ? -31.574 4.090   20.912  1.00 31.45  ? 498 GLU A OE2   1 
ATOM   1984  N  N     . PHE A  1 256 ? -34.742 9.664   23.890  1.00 20.77  ? 499 PHE A N     1 
ATOM   1985  C  CA    . PHE A  1 256 ? -35.368 10.945  23.656  1.00 19.59  ? 499 PHE A CA    1 
ATOM   1986  C  C     . PHE A  1 256 ? -34.417 12.140  23.720  1.00 19.32  ? 499 PHE A C     1 
ATOM   1987  O  O     . PHE A  1 256 ? -34.374 12.913  22.826  1.00 19.13  ? 499 PHE A O     1 
ATOM   1988  C  CB    . PHE A  1 256 ? -36.473 11.127  24.645  1.00 21.01  ? 499 PHE A CB    1 
ATOM   1989  C  CG    . PHE A  1 256 ? -37.412 12.306  24.347  1.00 22.09  ? 499 PHE A CG    1 
ATOM   1990  C  CD1   . PHE A  1 256 ? -37.633 12.773  23.059  1.00 22.71  ? 499 PHE A CD1   1 
ATOM   1991  C  CD2   . PHE A  1 256 ? -38.119 12.888  25.382  1.00 23.48  ? 499 PHE A CD2   1 
ATOM   1992  C  CE1   . PHE A  1 256 ? -38.510 13.846  22.814  1.00 23.94  ? 499 PHE A CE1   1 
ATOM   1993  C  CE2   . PHE A  1 256 ? -39.007 13.931  25.157  1.00 25.78  ? 499 PHE A CE2   1 
ATOM   1994  C  CZ    . PHE A  1 256 ? -39.203 14.422  23.854  1.00 23.01  ? 499 PHE A CZ    1 
ATOM   1995  N  N     . ALA A  1 257 ? -33.599 12.254  24.738  1.00 18.44  ? 500 ALA A N     1 
ATOM   1996  C  CA    . ALA A  1 257 ? -32.829 13.424  24.851  1.00 20.64  ? 500 ALA A CA    1 
ATOM   1997  C  C     . ALA A  1 257 ? -31.843 13.517  23.715  1.00 21.73  ? 500 ALA A C     1 
ATOM   1998  O  O     . ALA A  1 257 ? -31.691 14.598  23.134  1.00 22.06  ? 500 ALA A O     1 
ATOM   1999  C  CB    . ALA A  1 257 ? -32.145 13.495  26.193  1.00 19.61  ? 500 ALA A CB    1 
ATOM   2000  N  N     . CYS A  1 258 ? -31.227 12.394  23.321  1.00 21.29  ? 501 CYS A N     1 
ATOM   2001  C  CA    . CYS A  1 258 ? -30.227 12.488  22.306  1.00 20.58  ? 501 CYS A CA    1 
ATOM   2002  C  C     . CYS A  1 258 ? -30.876 12.719  20.947  1.00 21.09  ? 501 CYS A C     1 
ATOM   2003  O  O     . CYS A  1 258 ? -30.300 13.360  20.056  1.00 18.49  ? 501 CYS A O     1 
ATOM   2004  C  CB    . CYS A  1 258 ? -29.296 11.297  22.344  1.00 22.34  ? 501 CYS A CB    1 
ATOM   2005  S  SG    . CYS A  1 258 ? -28.103 11.374  23.743  1.00 24.54  ? 501 CYS A SG    1 
ATOM   2006  N  N     . ALA A  1 259 ? -32.081 12.179  20.791  1.00 19.14  ? 502 ALA A N     1 
ATOM   2007  C  CA    . ALA A  1 259 ? -32.793 12.316  19.569  1.00 20.17  ? 502 ALA A CA    1 
ATOM   2008  C  C     . ALA A  1 259 ? -33.294 13.748  19.427  1.00 19.78  ? 502 ALA A C     1 
ATOM   2009  O  O     . ALA A  1 259 ? -33.176 14.318  18.334  1.00 19.24  ? 502 ALA A O     1 
ATOM   2010  C  CB    . ALA A  1 259 ? -33.956 11.325  19.460  1.00 20.58  ? 502 ALA A CB    1 
ATOM   2011  N  N     . LEU A  1 260 ? -33.798 14.318  20.512  1.00 19.56  ? 503 LEU A N     1 
ATOM   2012  C  CA    . LEU A  1 260 ? -34.209 15.745  20.550  1.00 20.67  ? 503 LEU A CA    1 
ATOM   2013  C  C     . LEU A  1 260 ? -33.055 16.673  20.186  1.00 21.17  ? 503 LEU A C     1 
ATOM   2014  O  O     . LEU A  1 260 ? -33.186 17.578  19.336  1.00 22.94  ? 503 LEU A O     1 
ATOM   2015  C  CB    . LEU A  1 260 ? -34.722 16.082  21.945  1.00 20.09  ? 503 LEU A CB    1 
ATOM   2016  C  CG    . LEU A  1 260 ? -35.532 17.348  22.180  1.00 20.73  ? 503 LEU A CG    1 
ATOM   2017  C  CD1   . LEU A  1 260 ? -36.566 17.618  21.103  1.00 19.66  ? 503 LEU A CD1   1 
ATOM   2018  C  CD2   . LEU A  1 260 ? -36.220 17.275  23.535  1.00 20.66  ? 503 LEU A CD2   1 
ATOM   2019  N  N     . LEU A  1 261 ? -31.904 16.424  20.781  1.00 19.23  ? 504 LEU A N     1 
ATOM   2020  C  CA    . LEU A  1 261 ? -30.750 17.249  20.506  1.00 19.82  ? 504 LEU A CA    1 
ATOM   2021  C  C     . LEU A  1 261 ? -30.372 17.235  19.015  1.00 19.67  ? 504 LEU A C     1 
ATOM   2022  O  O     . LEU A  1 261 ? -30.155 18.302  18.358  1.00 18.39  ? 504 LEU A O     1 
ATOM   2023  C  CB    . LEU A  1 261 ? -29.589 16.746  21.330  1.00 20.91  ? 504 LEU A CB    1 
ATOM   2024  C  CG    . LEU A  1 261 ? -28.360 17.640  21.488  1.00 24.00  ? 504 LEU A CG    1 
ATOM   2025  C  CD1   . LEU A  1 261 ? -28.657 18.999  22.147  1.00 23.09  ? 504 LEU A CD1   1 
ATOM   2026  C  CD2   . LEU A  1 261 ? -27.308 16.887  22.328  1.00 26.60  ? 504 LEU A CD2   1 
ATOM   2027  N  N     . TYR A  1 262 ? -30.285 16.021  18.479  1.00 17.04  ? 505 TYR A N     1 
ATOM   2028  C  CA    . TYR A  1 262 ? -29.906 15.806  17.093  1.00 17.40  ? 505 TYR A CA    1 
ATOM   2029  C  C     . TYR A  1 262 ? -30.917 16.480  16.182  1.00 16.20  ? 505 TYR A C     1 
ATOM   2030  O  O     . TYR A  1 262 ? -30.580 17.198  15.306  1.00 16.27  ? 505 TYR A O     1 
ATOM   2031  C  CB    . TYR A  1 262 ? -29.833 14.289  16.773  1.00 18.56  ? 505 TYR A CB    1 
ATOM   2032  C  CG    . TYR A  1 262 ? -29.992 13.897  15.311  1.00 19.26  ? 505 TYR A CG    1 
ATOM   2033  C  CD1   . TYR A  1 262 ? -28.918 13.911  14.462  1.00 20.35  ? 505 TYR A CD1   1 
ATOM   2034  C  CD2   . TYR A  1 262 ? -31.194 13.440  14.818  1.00 19.04  ? 505 TYR A CD2   1 
ATOM   2035  C  CE1   . TYR A  1 262 ? -29.029 13.524  13.131  1.00 20.27  ? 505 TYR A CE1   1 
ATOM   2036  C  CE2   . TYR A  1 262 ? -31.318 13.049  13.493  1.00 21.54  ? 505 TYR A CE2   1 
ATOM   2037  C  CZ    . TYR A  1 262 ? -30.215 13.091  12.660  1.00 21.78  ? 505 TYR A CZ    1 
ATOM   2038  O  OH    . TYR A  1 262 ? -30.302 12.759  11.323  1.00 26.19  ? 505 TYR A OH    1 
ATOM   2039  N  N     . PHE A  1 263 ? -32.158 16.229  16.412  1.00 15.21  ? 506 PHE A N     1 
ATOM   2040  C  CA    . PHE A  1 263 ? -33.184 16.681  15.519  1.00 17.93  ? 506 PHE A CA    1 
ATOM   2041  C  C     . PHE A  1 263 ? -33.447 18.173  15.630  1.00 17.70  ? 506 PHE A C     1 
ATOM   2042  O  O     . PHE A  1 263 ? -33.902 18.789  14.688  1.00 19.40  ? 506 PHE A O     1 
ATOM   2043  C  CB    . PHE A  1 263 ? -34.463 15.876  15.812  1.00 19.88  ? 506 PHE A CB    1 
ATOM   2044  C  CG    . PHE A  1 263 ? -35.102 15.329  14.600  1.00 22.93  ? 506 PHE A CG    1 
ATOM   2045  C  CD1   . PHE A  1 263 ? -34.332 14.880  13.532  1.00 25.06  ? 506 PHE A CD1   1 
ATOM   2046  C  CD2   . PHE A  1 263 ? -36.516 15.291  14.487  1.00 23.79  ? 506 PHE A CD2   1 
ATOM   2047  C  CE1   . PHE A  1 263 ? -34.957 14.398  12.382  1.00 30.44  ? 506 PHE A CE1   1 
ATOM   2048  C  CE2   . PHE A  1 263 ? -37.132 14.810  13.340  1.00 23.03  ? 506 PHE A CE2   1 
ATOM   2049  C  CZ    . PHE A  1 263 ? -36.363 14.385  12.280  1.00 27.37  ? 506 PHE A CZ    1 
ATOM   2050  N  N     . THR A  1 264 ? -33.156 18.771  16.767  1.00 17.89  ? 507 THR A N     1 
ATOM   2051  C  CA    . THR A  1 264 ? -33.218 20.224  16.889  1.00 19.85  ? 507 THR A CA    1 
ATOM   2052  C  C     . THR A  1 264 ? -32.107 20.882  16.097  1.00 20.68  ? 507 THR A C     1 
ATOM   2053  O  O     . THR A  1 264 ? -32.274 21.956  15.534  1.00 21.68  ? 507 THR A O     1 
ATOM   2054  C  CB    . THR A  1 264 ? -33.151 20.617  18.348  1.00 20.92  ? 507 THR A CB    1 
ATOM   2055  O  OG1   . THR A  1 264 ? -34.288 20.066  19.019  1.00 21.76  ? 507 THR A OG1   1 
ATOM   2056  C  CG2   . THR A  1 264 ? -33.159 22.055  18.519  1.00 22.19  ? 507 THR A CG2   1 
ATOM   2057  N  N     . GLY A  1 265 ? -30.961 20.237  16.033  1.00 19.57  ? 508 GLY A N     1 
ATOM   2058  C  CA    . GLY A  1 265 ? -29.809 20.823  15.381  1.00 18.70  ? 508 GLY A CA    1 
ATOM   2059  C  C     . GLY A  1 265 ? -29.317 22.100  16.021  1.00 17.74  ? 508 GLY A C     1 
ATOM   2060  O  O     . GLY A  1 265 ? -29.503 22.274  17.212  1.00 17.08  ? 508 GLY A O     1 
ATOM   2061  N  N     . SER A  1 266 ? -28.685 22.994  15.262  1.00 16.78  ? 509 SER A N     1 
ATOM   2062  C  CA    . SER A  1 266 ? -28.434 22.855  13.850  1.00 17.59  ? 509 SER A CA    1 
ATOM   2063  C  C     . SER A  1 266 ? -27.400 21.803  13.550  1.00 17.96  ? 509 SER A C     1 
ATOM   2064  O  O     . SER A  1 266 ? -26.657 21.324  14.431  1.00 15.72  ? 509 SER A O     1 
ATOM   2065  C  CB    . SER A  1 266 ? -27.839 24.149  13.300  1.00 20.19  ? 509 SER A CB    1 
ATOM   2066  O  OG    . SER A  1 266 ? -26.493 24.344  13.810  1.00 19.43  ? 509 SER A OG    1 
ATOM   2067  N  N     . ALA A  1 267 ? -27.276 21.543  12.268  1.00 17.55  ? 510 ALA A N     1 
ATOM   2068  C  CA    . ALA A  1 267 ? -26.218 20.679  11.772  1.00 19.53  ? 510 ALA A CA    1 
ATOM   2069  C  C     . ALA A  1 267 ? -24.802 21.034  12.267  1.00 19.75  ? 510 ALA A C     1 
ATOM   2070  O  O     . ALA A  1 267 ? -24.078 20.168  12.822  1.00 20.44  ? 510 ALA A O     1 
ATOM   2071  C  CB    . ALA A  1 267 ? -26.267 20.614  10.254  1.00 20.68  ? 510 ALA A CB    1 
ATOM   2072  N  N     . HIS A  1 268 ? -24.382 22.259  12.065  1.00 20.38  ? 511 HIS A N     1 
ATOM   2073  C  CA    . HIS A  1 268 ? -23.061 22.684  12.607  1.00 22.62  ? 511 HIS A CA    1 
ATOM   2074  C  C     . HIS A  1 268 ? -22.938 22.562  14.110  1.00 19.59  ? 511 HIS A C     1 
ATOM   2075  O  O     . HIS A  1 268 ? -21.917 22.165  14.616  1.00 19.90  ? 511 HIS A O     1 
ATOM   2076  C  CB    . HIS A  1 268 ? -22.783 24.126  12.235  1.00 23.48  ? 511 HIS A CB    1 
ATOM   2077  C  CG    . HIS A  1 268 ? -22.522 24.302  10.799  1.00 25.66  ? 511 HIS A CG    1 
ATOM   2078  N  ND1   . HIS A  1 268 ? -21.480 23.654  10.160  1.00 28.77  ? 511 HIS A ND1   1 
ATOM   2079  C  CD2   . HIS A  1 268 ? -23.138 25.065  9.861   1.00 31.50  ? 511 HIS A CD2   1 
ATOM   2080  C  CE1   . HIS A  1 268 ? -21.479 23.990  8.881   1.00 29.90  ? 511 HIS A CE1   1 
ATOM   2081  N  NE2   . HIS A  1 268 ? -22.483 24.834  8.667   1.00 32.41  ? 511 HIS A NE2   1 
ATOM   2082  N  N     . PHE A  1 269 ? -24.016 22.842  14.813  1.00 18.83  ? 512 PHE A N     1 
ATOM   2083  C  CA    . PHE A  1 269 ? -24.047 22.681  16.236  1.00 18.16  ? 512 PHE A CA    1 
ATOM   2084  C  C     . PHE A  1 269 ? -23.833 21.220  16.571  1.00 18.04  ? 512 PHE A C     1 
ATOM   2085  O  O     . PHE A  1 269 ? -23.048 20.889  17.508  1.00 18.16  ? 512 PHE A O     1 
ATOM   2086  C  CB    . PHE A  1 269 ? -25.377 23.182  16.775  1.00 19.60  ? 512 PHE A CB    1 
ATOM   2087  C  CG    . PHE A  1 269 ? -25.486 23.179  18.295  1.00 19.71  ? 512 PHE A CG    1 
ATOM   2088  C  CD1   . PHE A  1 269 ? -25.012 24.251  19.050  1.00 19.98  ? 512 PHE A CD1   1 
ATOM   2089  C  CD2   . PHE A  1 269 ? -26.078 22.152  18.942  1.00 18.57  ? 512 PHE A CD2   1 
ATOM   2090  C  CE1   . PHE A  1 269 ? -25.091 24.237  20.440  1.00 19.82  ? 512 PHE A CE1   1 
ATOM   2091  C  CE2   . PHE A  1 269 ? -26.188 22.145  20.326  1.00 19.17  ? 512 PHE A CE2   1 
ATOM   2092  C  CZ    . PHE A  1 269 ? -25.669 23.175  21.074  1.00 18.86  ? 512 PHE A CZ    1 
ATOM   2093  N  N     . ASN A  1 270 ? -24.546 20.323  15.886  1.00 17.90  ? 513 ASN A N     1 
ATOM   2094  C  CA    . ASN A  1 270 ? -24.426 18.879  16.215  1.00 17.74  ? 513 ASN A CA    1 
ATOM   2095  C  C     . ASN A  1 270 ? -23.008 18.323  15.899  1.00 18.06  ? 513 ASN A C     1 
ATOM   2096  O  O     . ASN A  1 270 ? -22.463 17.526  16.636  1.00 16.93  ? 513 ASN A O     1 
ATOM   2097  C  CB    . ASN A  1 270 ? -25.426 18.010  15.468  1.00 19.44  ? 513 ASN A CB    1 
ATOM   2098  C  CG    . ASN A  1 270 ? -26.851 18.227  15.858  1.00 21.21  ? 513 ASN A CG    1 
ATOM   2099  O  OD1   . ASN A  1 270 ? -27.176 18.925  16.802  1.00 23.02  ? 513 ASN A OD1   1 
ATOM   2100  N  ND2   . ASN A  1 270 ? -27.731 17.695  15.036  1.00 23.19  ? 513 ASN A ND2   1 
ATOM   2101  N  N     . ARG A  1 271 ? -22.424 18.750  14.792  1.00 19.23  ? 514 ARG A N     1 
ATOM   2102  C  CA    . ARG A  1 271 ? -21.047 18.361  14.463  1.00 23.20  ? 514 ARG A CA    1 
ATOM   2103  C  C     . ARG A  1 271 ? -20.023 18.764  15.537  1.00 21.67  ? 514 ARG A C     1 
ATOM   2104  O  O     . ARG A  1 271 ? -19.146 17.977  15.890  1.00 22.23  ? 514 ARG A O     1 
ATOM   2105  C  CB    . ARG A  1 271 ? -20.568 19.043  13.199  1.00 25.05  ? 514 ARG A CB    1 
ATOM   2106  C  CG    . ARG A  1 271 ? -21.283 18.640  11.957  1.00 29.39  ? 514 ARG A CG    1 
ATOM   2107  C  CD    . ARG A  1 271 ? -20.207 18.639  10.902  1.00 33.55  ? 514 ARG A CD    1 
ATOM   2108  N  NE    . ARG A  1 271 ? -20.688 19.155  9.693   1.00 37.32  ? 514 ARG A NE    1 
ATOM   2109  C  CZ    . ARG A  1 271 ? -20.013 19.076  8.558   1.00 43.77  ? 514 ARG A CZ    1 
ATOM   2110  N  NH1   . ARG A  1 271 ? -18.827 18.483  8.518   1.00 41.73  ? 514 ARG A NH1   1 
ATOM   2111  N  NH2   . ARG A  1 271 ? -20.553 19.583  7.457   1.00 45.10  ? 514 ARG A NH2   1 
ATOM   2112  N  N     . SER A  1 272 ? -20.109 20.005  15.966  1.00 19.51  ? 515 SER A N     1 
ATOM   2113  C  CA    . SER A  1 272 ? -19.231 20.499  16.987  1.00 21.66  ? 515 SER A CA    1 
ATOM   2114  C  C     . SER A  1 272 ? -19.460 19.773  18.310  1.00 21.55  ? 515 SER A C     1 
ATOM   2115  O  O     . SER A  1 272 ? -18.510 19.458  19.004  1.00 24.30  ? 515 SER A O     1 
ATOM   2116  C  CB    . SER A  1 272 ? -19.454 21.994  17.147  1.00 22.30  ? 515 SER A CB    1 
ATOM   2117  O  OG    . SER A  1 272 ? -19.016 22.650  16.006  1.00 22.10  ? 515 SER A OG    1 
ATOM   2118  N  N     . MET A  1 273 ? -20.710 19.500  18.664  1.00 22.28  ? 516 MET A N     1 
ATOM   2119  C  CA    . MET A  1 273 ? -20.983 18.730  19.884  1.00 24.73  ? 516 MET A CA    1 
ATOM   2120  C  C     . MET A  1 273 ? -20.341 17.347  19.815  1.00 22.97  ? 516 MET A C     1 
ATOM   2121  O  O     . MET A  1 273 ? -19.765 16.845  20.773  1.00 20.36  ? 516 MET A O     1 
ATOM   2122  C  CB    . MET A  1 273 ? -22.440 18.502  20.026  1.00 28.55  ? 516 MET A CB    1 
ATOM   2123  C  CG    . MET A  1 273 ? -23.202 19.743  20.331  1.00 35.32  ? 516 MET A CG    1 
ATOM   2124  S  SD    . MET A  1 273 ? -23.206 19.948  22.086  1.00 43.10  ? 516 MET A SD    1 
ATOM   2125  C  CE    . MET A  1 273 ? -24.608 18.941  22.498  1.00 32.24  ? 516 MET A CE    1 
ATOM   2126  N  N     . ARG A  1 274 ? -20.447 16.760  18.643  1.00 21.05  ? 517 ARG A N     1 
ATOM   2127  C  CA    . ARG A  1 274 ? -19.930 15.438  18.412  1.00 21.28  ? 517 ARG A CA    1 
ATOM   2128  C  C     . ARG A  1 274 ? -18.427 15.469  18.426  1.00 19.21  ? 517 ARG A C     1 
ATOM   2129  O  O     . ARG A  1 274 ? -17.819 14.682  19.106  1.00 20.58  ? 517 ARG A O     1 
ATOM   2130  C  CB    . ARG A  1 274 ? -20.513 14.887  17.094  1.00 20.69  ? 517 ARG A CB    1 
ATOM   2131  C  CG    . ARG A  1 274 ? -21.913 14.384  17.276  1.00 18.53  ? 517 ARG A CG    1 
ATOM   2132  C  CD    . ARG A  1 274 ? -22.633 13.975  16.003  1.00 19.71  ? 517 ARG A CD    1 
ATOM   2133  N  NE    . ARG A  1 274 ? -24.074 13.895  16.268  1.00 19.56  ? 517 ARG A NE    1 
ATOM   2134  C  CZ    . ARG A  1 274 ? -24.881 13.012  15.712  1.00 22.44  ? 517 ARG A CZ    1 
ATOM   2135  N  NH1   . ARG A  1 274 ? -24.454 12.144  14.789  1.00 21.28  ? 517 ARG A NH1   1 
ATOM   2136  N  NH2   . ARG A  1 274 ? -26.157 13.021  16.078  1.00 27.72  ? 517 ARG A NH2   1 
ATOM   2137  N  N     . ALA A  1 275 ? -17.805 16.349  17.679  1.00 18.63  ? 518 ALA A N     1 
ATOM   2138  C  CA    . ALA A  1 275 ? -16.333 16.501  17.835  1.00 20.40  ? 518 ALA A CA    1 
ATOM   2139  C  C     . ALA A  1 275 ? -15.908 16.805  19.258  1.00 20.72  ? 518 ALA A C     1 
ATOM   2140  O  O     . ALA A  1 275 ? -14.834 16.423  19.664  1.00 22.30  ? 518 ALA A O     1 
ATOM   2141  C  CB    . ALA A  1 275 ? -15.753 17.589  16.921  1.00 19.98  ? 518 ALA A CB    1 
ATOM   2142  N  N     . LEU A  1 276 ? -16.713 17.501  20.036  1.00 22.36  ? 519 LEU A N     1 
ATOM   2143  C  CA    . LEU A  1 276 ? -16.295 17.717  21.462  1.00 25.03  ? 519 LEU A CA    1 
ATOM   2144  C  C     . LEU A  1 276 ? -16.300 16.413  22.246  1.00 24.67  ? 519 LEU A C     1 
ATOM   2145  O  O     . LEU A  1 276 ? -15.397 16.124  22.986  1.00 26.80  ? 519 LEU A O     1 
ATOM   2146  C  CB    . LEU A  1 276 ? -17.174 18.747  22.153  1.00 23.88  ? 519 LEU A CB    1 
ATOM   2147  C  CG    . LEU A  1 276 ? -16.806 19.157  23.580  1.00 26.33  ? 519 LEU A CG    1 
ATOM   2148  C  CD1   . LEU A  1 276 ? -15.610 20.120  23.639  1.00 26.29  ? 519 LEU A CD1   1 
ATOM   2149  C  CD2   . LEU A  1 276 ? -18.005 19.807  24.200  1.00 24.79  ? 519 LEU A CD2   1 
ATOM   2150  N  N     . ALA A  1 277 ? -17.360 15.637  22.078  1.00 25.20  ? 520 ALA A N     1 
ATOM   2151  C  CA    . ALA A  1 277 ? -17.522 14.372  22.753  1.00 24.96  ? 520 ALA A CA    1 
ATOM   2152  C  C     . ALA A  1 277 ? -16.347 13.483  22.462  1.00 23.97  ? 520 ALA A C     1 
ATOM   2153  O  O     . ALA A  1 277 ? -15.849 12.865  23.355  1.00 25.95  ? 520 ALA A O     1 
ATOM   2154  C  CB    . ALA A  1 277 ? -18.825 13.678  22.336  1.00 26.42  ? 520 ALA A CB    1 
ATOM   2155  N  N     . LYS A  1 278 ? -15.916 13.417  21.219  1.00 26.13  ? 521 LYS A N     1 
ATOM   2156  C  CA    . LYS A  1 278 ? -14.774 12.589  20.848  1.00 29.73  ? 521 LYS A CA    1 
ATOM   2157  C  C     . LYS A  1 278 ? -13.447 13.113  21.495  1.00 31.69  ? 521 LYS A C     1 
ATOM   2158  O  O     . LYS A  1 278 ? -12.635 12.323  21.941  1.00 32.22  ? 521 LYS A O     1 
ATOM   2159  C  CB    . LYS A  1 278 ? -14.643 12.508  19.333  1.00 30.95  ? 521 LYS A CB    1 
ATOM   2160  C  CG    . LYS A  1 278 ? -13.648 11.472  18.833  1.00 32.81  ? 521 LYS A CG    1 
ATOM   2161  C  CD    . LYS A  1 278 ? -13.143 11.783  17.420  1.00 35.85  ? 521 LYS A CD    1 
ATOM   2162  C  CE    . LYS A  1 278 ? -14.240 11.584  16.405  1.00 40.45  ? 521 LYS A CE    1 
ATOM   2163  N  NZ    . LYS A  1 278 ? -13.815 11.895  15.003  1.00 47.15  ? 521 LYS A NZ    1 
ATOM   2164  N  N     . THR A  1 279 ? -13.248 14.423  21.599  1.00 32.15  ? 522 THR A N     1 
ATOM   2165  C  CA    . THR A  1 279 ? -12.061 14.910  22.300  1.00 32.57  ? 522 THR A CA    1 
ATOM   2166  C  C     . THR A  1 279 ? -12.061 14.395  23.713  1.00 34.63  ? 522 THR A C     1 
ATOM   2167  O  O     . THR A  1 279 ? -11.002 14.222  24.255  1.00 40.63  ? 522 THR A O     1 
ATOM   2168  C  CB    . THR A  1 279 ? -11.926 16.433  22.388  1.00 30.19  ? 522 THR A CB    1 
ATOM   2169  O  OG1   . THR A  1 279 ? -13.106 16.964  22.947  1.00 32.56  ? 522 THR A OG1   1 
ATOM   2170  C  CG2   . THR A  1 279 ? -11.626 17.089  21.002  1.00 30.15  ? 522 THR A CG2   1 
ATOM   2171  N  N     . LYS A  1 280 ? -13.225 14.117  24.303  1.00 35.19  ? 523 LYS A N     1 
ATOM   2172  C  CA    . LYS A  1 280 ? -13.280 13.652  25.703  1.00 31.95  ? 523 LYS A CA    1 
ATOM   2173  C  C     . LYS A  1 280 ? -13.513 12.181  25.853  1.00 30.23  ? 523 LYS A C     1 
ATOM   2174  O  O     . LYS A  1 280 ? -14.085 11.763  26.818  1.00 32.65  ? 523 LYS A O     1 
ATOM   2175  C  CB    . LYS A  1 280 ? -14.399 14.351  26.437  1.00 35.78  ? 523 LYS A CB    1 
ATOM   2176  C  CG    . LYS A  1 280 ? -14.272 15.855  26.415  1.00 35.85  ? 523 LYS A CG    1 
ATOM   2177  C  CD    . LYS A  1 280 ? -15.581 16.473  26.817  1.00 38.34  ? 523 LYS A CD    1 
ATOM   2178  C  CE    . LYS A  1 280 ? -15.311 17.874  27.300  1.00 43.03  ? 523 LYS A CE    1 
ATOM   2179  N  NZ    . LYS A  1 280 ? -15.071 17.894  28.772  1.00 51.94  ? 523 LYS A NZ    1 
ATOM   2180  N  N     . GLY A  1 281 ? -13.088 11.391  24.894  1.00 31.60  ? 524 GLY A N     1 
ATOM   2181  C  CA    . GLY A  1 281 ? -13.208 9.967   24.991  1.00 32.16  ? 524 GLY A CA    1 
ATOM   2182  C  C     . GLY A  1 281 ? -14.631 9.464   24.974  1.00 35.32  ? 524 GLY A C     1 
ATOM   2183  O  O     . GLY A  1 281 ? -14.913 8.357   25.449  1.00 33.07  ? 524 GLY A O     1 
ATOM   2184  N  N     . MET A  1 282 ? -15.543 10.255  24.402  1.00 34.36  ? 525 MET A N     1 
ATOM   2185  C  CA    . MET A  1 282 ? -16.920 9.805   24.263  1.00 31.98  ? 525 MET A CA    1 
ATOM   2186  C  C     . MET A  1 282 ? -17.340 9.731   22.803  1.00 29.07  ? 525 MET A C     1 
ATOM   2187  O  O     . MET A  1 282 ? -16.580 10.082  21.895  1.00 27.54  ? 525 MET A O     1 
ATOM   2188  C  CB    . MET A  1 282 ? -17.829 10.726  25.061  1.00 34.07  ? 525 MET A CB    1 
ATOM   2189  C  CG    . MET A  1 282 ? -17.897 10.342  26.515  1.00 36.61  ? 525 MET A CG    1 
ATOM   2190  S  SD    . MET A  1 282 ? -18.728 11.566  27.535  1.00 43.60  ? 525 MET A SD    1 
ATOM   2191  C  CE    . MET A  1 282 ? -17.526 12.880  27.499  1.00 43.65  ? 525 MET A CE    1 
ATOM   2192  N  N     . SER A  1 283 ? -18.567 9.293   22.580  1.00 27.82  ? 526 SER A N     1 
ATOM   2193  C  CA    . SER A  1 283 ? -19.168 9.376   21.245  1.00 25.45  ? 526 SER A CA    1 
ATOM   2194  C  C     . SER A  1 283 ? -20.602 9.766   21.370  1.00 25.90  ? 526 SER A C     1 
ATOM   2195  O  O     . SER A  1 283 ? -21.312 9.136   22.139  1.00 27.95  ? 526 SER A O     1 
ATOM   2196  C  CB    . SER A  1 283 ? -19.091 8.047   20.550  1.00 24.87  ? 526 SER A CB    1 
ATOM   2197  O  OG    . SER A  1 283 ? -19.674 8.180   19.284  1.00 28.09  ? 526 SER A OG    1 
ATOM   2198  N  N     . LEU A  1 284 ? -21.018 10.803  20.608  1.00 25.01  ? 527 LEU A N     1 
ATOM   2199  C  CA    . LEU A  1 284 ? -22.393 11.367  20.638  1.00 23.79  ? 527 LEU A CA    1 
ATOM   2200  C  C     . LEU A  1 284 ? -23.131 11.058  19.330  1.00 22.47  ? 527 LEU A C     1 
ATOM   2201  O  O     . LEU A  1 284 ? -22.697 11.416  18.242  1.00 21.76  ? 527 LEU A O     1 
ATOM   2202  C  CB    . LEU A  1 284 ? -22.425 12.896  20.910  1.00 21.98  ? 527 LEU A CB    1 
ATOM   2203  C  CG    . LEU A  1 284 ? -23.800 13.590  20.802  1.00 20.92  ? 527 LEU A CG    1 
ATOM   2204  C  CD1   . LEU A  1 284 ? -24.793 13.020  21.808  1.00 20.86  ? 527 LEU A CD1   1 
ATOM   2205  C  CD2   . LEU A  1 284 ? -23.647 15.067  21.028  1.00 18.91  ? 527 LEU A CD2   1 
ATOM   2206  N  N     . SER A  1 285 ? -24.242 10.351  19.452  1.00 22.83  ? 528 SER A N     1 
ATOM   2207  C  CA    . SER A  1 285 ? -25.085 10.086  18.302  1.00 23.79  ? 528 SER A CA    1 
ATOM   2208  C  C     . SER A  1 285 ? -26.504 10.455  18.648  1.00 22.83  ? 528 SER A C     1 
ATOM   2209  O  O     . SER A  1 285 ? -26.816 10.789  19.783  1.00 23.73  ? 528 SER A O     1 
ATOM   2210  C  CB    . SER A  1 285 ? -24.976 8.620   17.855  1.00 24.06  ? 528 SER A CB    1 
ATOM   2211  O  OG    . SER A  1 285 ? -25.807 7.752   18.571  1.00 27.80  ? 528 SER A OG    1 
ATOM   2212  N  N     . GLU A  1 286 ? -27.357 10.346  17.644  1.00 24.05  ? 529 GLU A N     1 
ATOM   2213  C  CA    . GLU A  1 286 ? -28.780 10.524  17.786  1.00 23.27  ? 529 GLU A CA    1 
ATOM   2214  C  C     . GLU A  1 286 ? -29.414 9.491   18.711  1.00 24.12  ? 529 GLU A C     1 
ATOM   2215  O  O     . GLU A  1 286 ? -30.506 9.738   19.240  1.00 25.84  ? 529 GLU A O     1 
ATOM   2216  C  CB    . GLU A  1 286 ? -29.439 10.524  16.412  1.00 25.56  ? 529 GLU A CB    1 
ATOM   2217  C  CG    . GLU A  1 286 ? -29.062 9.340   15.510  1.00 29.19  ? 529 GLU A CG    1 
ATOM   2218  C  CD    . GLU A  1 286 ? -28.128 9.721   14.388  1.00 31.81  ? 529 GLU A CD    1 
ATOM   2219  O  OE1   . GLU A  1 286 ? -27.015 10.254  14.619  1.00 37.11  ? 529 GLU A OE1   1 
ATOM   2220  O  OE2   . GLU A  1 286 ? -28.517 9.488   13.225  1.00 39.66  ? 529 GLU A OE2   1 
ATOM   2221  N  N     . HIS A  1 287 ? -28.718 8.364   18.936  1.00 23.84  ? 530 HIS A N     1 
ATOM   2222  C  CA    . HIS A  1 287 ? -29.182 7.304   19.858  1.00 24.24  ? 530 HIS A CA    1 
ATOM   2223  C  C     . HIS A  1 287 ? -28.709 7.517   21.242  1.00 23.23  ? 530 HIS A C     1 
ATOM   2224  O  O     . HIS A  1 287 ? -29.468 7.261   22.171  1.00 25.06  ? 530 HIS A O     1 
ATOM   2225  C  CB    . HIS A  1 287 ? -28.744 5.883   19.430  1.00 21.62  ? 530 HIS A CB    1 
ATOM   2226  C  CG    . HIS A  1 287 ? -29.240 5.489   18.086  1.00 20.50  ? 530 HIS A CG    1 
ATOM   2227  N  ND1   . HIS A  1 287 ? -30.578 5.293   17.820  1.00 21.50  ? 530 HIS A ND1   1 
ATOM   2228  C  CD2   . HIS A  1 287 ? -28.587 5.275   16.918  1.00 20.63  ? 530 HIS A CD2   1 
ATOM   2229  C  CE1   . HIS A  1 287 ? -30.727 4.970   16.544  1.00 19.99  ? 530 HIS A CE1   1 
ATOM   2230  N  NE2   . HIS A  1 287 ? -29.530 4.947   15.973  1.00 21.06  ? 530 HIS A NE2   1 
ATOM   2231  N  N     . ALA A  1 288 ? -27.460 7.947   21.404  1.00 23.49  ? 531 ALA A N     1 
ATOM   2232  C  CA    . ALA A  1 288 ? -26.919 8.043   22.763  1.00 22.35  ? 531 ALA A CA    1 
ATOM   2233  C  C     . ALA A  1 288 ? -25.629 8.782   22.834  1.00 21.37  ? 531 ALA A C     1 
ATOM   2234  O  O     . ALA A  1 288 ? -24.942 9.006   21.829  1.00 21.72  ? 531 ALA A O     1 
ATOM   2235  C  CB    . ALA A  1 288 ? -26.697 6.631   23.323  1.00 24.95  ? 531 ALA A CB    1 
ATOM   2236  N  N     . LEU A  1 289 ? -25.296 9.150   24.059  1.00 22.64  ? 532 LEU A N     1 
ATOM   2237  C  CA    . LEU A  1 289 ? -23.951 9.573   24.410  1.00 25.89  ? 532 LEU A CA    1 
ATOM   2238  C  C     . LEU A  1 289 ? -23.269 8.401   25.109  1.00 26.11  ? 532 LEU A C     1 
ATOM   2239  O  O     . LEU A  1 289 ? -23.793 7.847   26.039  1.00 32.40  ? 532 LEU A O     1 
ATOM   2240  C  CB    . LEU A  1 289 ? -23.990 10.792  25.324  1.00 23.52  ? 532 LEU A CB    1 
ATOM   2241  C  CG    . LEU A  1 289 ? -22.677 11.238  25.904  1.00 24.54  ? 532 LEU A CG    1 
ATOM   2242  C  CD1   . LEU A  1 289 ? -21.831 11.866  24.825  1.00 25.91  ? 532 LEU A CD1   1 
ATOM   2243  C  CD2   . LEU A  1 289 ? -22.961 12.206  27.049  1.00 25.15  ? 532 LEU A CD2   1 
ATOM   2244  N  N     . SER A  1 290 ? -22.081 8.090   24.665  1.00 28.58  ? 533 SER A N     1 
ATOM   2245  C  CA    . SER A  1 290 ? -21.388 6.897   25.071  1.00 32.13  ? 533 SER A CA    1 
ATOM   2246  C  C     . SER A  1 290 ? -19.955 7.218   25.444  1.00 35.58  ? 533 SER A C     1 
ATOM   2247  O  O     . SER A  1 290 ? -19.266 7.909   24.678  1.00 31.77  ? 533 SER A O     1 
ATOM   2248  C  CB    . SER A  1 290 ? -21.391 5.924   23.907  1.00 29.49  ? 533 SER A CB    1 
ATOM   2249  O  OG    . SER A  1 290 ? -22.676 5.410   23.780  1.00 32.40  ? 533 SER A OG    1 
ATOM   2250  N  N     . THR A  1 291 ? -19.524 6.735   26.612  1.00 42.42  ? 534 THR A N     1 
ATOM   2251  C  CA    . THR A  1 291 ? -18.088 6.720   26.981  1.00 49.51  ? 534 THR A CA    1 
ATOM   2252  C  C     . THR A  1 291 ? -17.539 5.532   26.275  1.00 53.03  ? 534 THR A C     1 
ATOM   2253  O  O     . THR A  1 291 ? -17.401 4.478   26.867  1.00 52.48  ? 534 THR A O     1 
ATOM   2254  C  CB    . THR A  1 291 ? -17.767 6.589   28.507  1.00 50.79  ? 534 THR A CB    1 
ATOM   2255  O  OG1   . THR A  1 291 ? -18.961 6.332   29.249  1.00 52.20  ? 534 THR A OG1   1 
ATOM   2256  C  CG2   . THR A  1 291 ? -17.071 7.880   29.084  1.00 50.95  ? 534 THR A CG2   1 
ATOM   2257  N  N     . ALA A  1 292 ? -17.256 5.733   24.993  1.00 58.36  ? 535 ALA A N     1 
ATOM   2258  C  CA    . ALA A  1 292 ? -16.835 4.699   24.079  1.00 67.82  ? 535 ALA A CA    1 
ATOM   2259  C  C     . ALA A  1 292 ? -15.438 5.057   23.637  1.00 72.27  ? 535 ALA A C     1 
ATOM   2260  O  O     . ALA A  1 292 ? -15.075 6.232   23.618  1.00 72.59  ? 535 ALA A O     1 
ATOM   2261  C  CB    . ALA A  1 292 ? -17.773 4.645   22.879  1.00 72.10  ? 535 ALA A CB    1 
ATOM   2262  N  N     . VAL A  1 293 ? -14.642 4.052   23.306  1.00 75.52  ? 536 VAL A N     1 
ATOM   2263  C  CA    . VAL A  1 293 ? -13.292 4.332   22.839  1.00 86.94  ? 536 VAL A CA    1 
ATOM   2264  C  C     . VAL A  1 293 ? -12.675 3.183   22.015  1.00 87.16  ? 536 VAL A C     1 
ATOM   2265  O  O     . VAL A  1 293 ? -13.124 2.024   22.060  1.00 79.46  ? 536 VAL A O     1 
ATOM   2266  C  CB    . VAL A  1 293 ? -12.367 4.823   24.015  1.00 90.68  ? 536 VAL A CB    1 
ATOM   2267  C  CG1   . VAL A  1 293 ? -11.462 3.707   24.562  1.00 88.93  ? 536 VAL A CG1   1 
ATOM   2268  C  CG2   . VAL A  1 293 ? -11.544 6.047   23.594  1.00 86.97  ? 536 VAL A CG2   1 
ATOM   2269  N  N     . VAL A  1 294 ? -11.648 3.572   21.257  1.00 96.84  ? 537 VAL A N     1 
ATOM   2270  C  CA    . VAL A  1 294 ? -10.934 2.726   20.299  1.00 101.73 ? 537 VAL A CA    1 
ATOM   2271  C  C     . VAL A  1 294 ? -9.948  1.797   21.030  1.00 102.52 ? 537 VAL A C     1 
ATOM   2272  O  O     . VAL A  1 294 ? -9.789  1.899   22.246  1.00 92.37  ? 537 VAL A O     1 
ATOM   2273  C  CB    . VAL A  1 294 ? -10.181 3.609   19.240  1.00 103.08 ? 537 VAL A CB    1 
ATOM   2274  C  CG1   . VAL A  1 294 ? -11.134 4.588   18.537  1.00 97.23  ? 537 VAL A CG1   1 
ATOM   2275  C  CG2   . VAL A  1 294 ? -9.002  4.372   19.855  1.00 96.27  ? 537 VAL A CG2   1 
ATOM   2276  N  N     . ARG A  1 295 ? -9.327  0.879   20.285  1.00 105.53 ? 538 ARG A N     1 
ATOM   2277  C  CA    . ARG A  1 295 ? -8.173  0.058   20.740  1.00 105.83 ? 538 ARG A CA    1 
ATOM   2278  C  C     . ARG A  1 295 ? -8.084  -1.144  19.815  1.00 106.00 ? 538 ARG A C     1 
ATOM   2279  O  O     . ARG A  1 295 ? -9.009  -1.950  19.779  1.00 112.40 ? 538 ARG A O     1 
ATOM   2280  C  CB    . ARG A  1 295 ? -8.295  -0.441  22.198  1.00 109.07 ? 538 ARG A CB    1 
ATOM   2281  C  CG    . ARG A  1 295 ? -6.961  -0.719  22.893  1.00 105.33 ? 538 ARG A CG    1 
ATOM   2282  C  CD    . ARG A  1 295 ? -7.127  -1.076  24.376  1.00 106.99 ? 538 ARG A CD    1 
ATOM   2283  N  NE    . ARG A  1 295 ? -6.791  -2.477  24.692  1.00 113.88 ? 538 ARG A NE    1 
ATOM   2284  C  CZ    . ARG A  1 295 ? -7.636  -3.519  24.689  1.00 111.29 ? 538 ARG A CZ    1 
ATOM   2285  N  NH1   . ARG A  1 295 ? -8.919  -3.368  24.382  1.00 112.35 ? 538 ARG A NH1   1 
ATOM   2286  N  NH2   . ARG A  1 295 ? -7.190  -4.739  24.995  1.00 105.43 ? 538 ARG A NH2   1 
ATOM   2287  N  N     . ASN A  1 296 ? -6.988  -1.268  19.070  1.00 106.50 ? 539 ASN A N     1 
ATOM   2288  C  CA    . ASN A  1 296 ? -6.857  -2.339  18.070  1.00 104.67 ? 539 ASN A CA    1 
ATOM   2289  C  C     . ASN A  1 296 ? -5.414  -2.751  17.823  1.00 108.85 ? 539 ASN A C     1 
ATOM   2290  O  O     . ASN A  1 296 ? -4.829  -2.408  16.788  1.00 103.13 ? 539 ASN A O     1 
ATOM   2291  C  CB    . ASN A  1 296 ? -7.501  -1.903  16.747  1.00 101.52 ? 539 ASN A CB    1 
ATOM   2292  C  CG    . ASN A  1 296 ? -7.838  -3.069  15.825  1.00 92.75  ? 539 ASN A CG    1 
ATOM   2293  O  OD1   . ASN A  1 296 ? -7.783  -4.240  16.211  1.00 88.16  ? 539 ASN A OD1   1 
ATOM   2294  N  ND2   . ASN A  1 296 ? -8.210  -2.741  14.592  1.00 86.91  ? 539 ASN A ND2   1 
ATOM   2295  N  N     . THR A  1 297 ? -4.857  -3.474  18.795  1.00 113.87 ? 540 THR A N     1 
ATOM   2296  C  CA    . THR A  1 297 ? -3.570  -4.154  18.665  1.00 120.78 ? 540 THR A CA    1 
ATOM   2297  C  C     . THR A  1 297 ? -2.683  -3.554  17.558  1.00 134.60 ? 540 THR A C     1 
ATOM   2298  O  O     . THR A  1 297 ? -2.625  -4.078  16.436  1.00 141.64 ? 540 THR A O     1 
ATOM   2299  C  CB    . THR A  1 297 ? -3.794  -5.660  18.404  1.00 116.12 ? 540 THR A CB    1 
ATOM   2300  O  OG1   . THR A  1 297 ? -4.636  -5.831  17.255  1.00 110.64 ? 540 THR A OG1   1 
ATOM   2301  C  CG2   . THR A  1 297 ? -4.458  -6.325  19.604  1.00 114.30 ? 540 THR A CG2   1 
ATOM   2302  N  N     . HIS A  1 298 ? -1.997  -2.456  17.883  1.00 136.81 ? 541 HIS A N     1 
ATOM   2303  C  CA    . HIS A  1 298 ? -1.209  -1.698  16.896  1.00 137.74 ? 541 HIS A CA    1 
ATOM   2304  C  C     . HIS A  1 298 ? -2.181  -1.056  15.858  1.00 146.26 ? 541 HIS A C     1 
ATOM   2305  O  O     . HIS A  1 298 ? -2.147  -1.340  14.656  1.00 162.35 ? 541 HIS A O     1 
ATOM   2306  C  CB    . HIS A  1 298 ? -0.042  -2.576  16.333  1.00 129.55 ? 541 HIS A CB    1 
ATOM   2307  C  CG    . HIS A  1 298 ? 0.149   -2.515  14.845  1.00 127.17 ? 541 HIS A CG    1 
ATOM   2308  N  ND1   . HIS A  1 298 ? 1.059   -1.673  14.241  1.00 125.45 ? 541 HIS A ND1   1 
ATOM   2309  C  CD2   . HIS A  1 298 ? -0.424  -3.224  13.843  1.00 120.93 ? 541 HIS A CD2   1 
ATOM   2310  C  CE1   . HIS A  1 298 ? 1.018   -1.842  12.932  1.00 118.67 ? 541 HIS A CE1   1 
ATOM   2311  N  NE2   . HIS A  1 298 ? 0.124   -2.777  12.665  1.00 119.30 ? 541 HIS A NE2   1 
ATOM   2312  N  N     . GLY A  1 299 ? -3.057  -0.182  16.367  1.00 134.28 ? 542 GLY A N     1 
ATOM   2313  C  CA    . GLY A  1 299 ? -4.095  0.475   15.559  1.00 121.08 ? 542 GLY A CA    1 
ATOM   2314  C  C     . GLY A  1 299 ? -5.296  0.856   16.409  1.00 118.28 ? 542 GLY A C     1 
ATOM   2315  O  O     . GLY A  1 299 ? -5.221  0.829   17.635  1.00 118.05 ? 542 GLY A O     1 
ATOM   2316  N  N     . CYS A  1 300 ? -6.407  1.200   15.756  1.00 114.38 ? 543 CYS A N     1 
ATOM   2317  C  CA    . CYS A  1 300 ? -7.657  1.607   16.432  1.00 107.22 ? 543 CYS A CA    1 
ATOM   2318  C  C     . CYS A  1 300 ? -8.881  0.925   15.795  1.00 105.82 ? 543 CYS A C     1 
ATOM   2319  O  O     . CYS A  1 300 ? -8.754  0.292   14.742  1.00 102.22 ? 543 CYS A O     1 
ATOM   2320  C  CB    . CYS A  1 300 ? -7.810  3.130   16.379  1.00 107.03 ? 543 CYS A CB    1 
ATOM   2321  S  SG    . CYS A  1 300 ? -7.550  3.837   14.735  1.00 98.08  ? 543 CYS A SG    1 
ATOM   2322  N  N     . LYS A  1 301 ? -10.057 1.032   16.430  1.00 104.93 ? 544 LYS A N     1 
ATOM   2323  C  CA    . LYS A  1 301 ? -11.263 0.345   15.931  1.00 95.50  ? 544 LYS A CA    1 
ATOM   2324  C  C     . LYS A  1 301 ? -12.595 0.647   16.655  1.00 88.18  ? 544 LYS A C     1 
ATOM   2325  O  O     . LYS A  1 301 ? -12.869 1.765   17.103  1.00 74.60  ? 544 LYS A O     1 
ATOM   2326  C  CB    . LYS A  1 301 ? -11.031 -1.175  15.972  1.00 95.27  ? 544 LYS A CB    1 
ATOM   2327  C  CG    . LYS A  1 301 ? -11.099 -1.798  17.368  1.00 96.03  ? 544 LYS A CG    1 
ATOM   2328  C  CD    . LYS A  1 301 ? -11.921 -3.082  17.374  1.00 91.74  ? 544 LYS A CD    1 
ATOM   2329  C  CE    . LYS A  1 301 ? -11.514 -3.972  18.522  1.00 91.74  ? 544 LYS A CE    1 
ATOM   2330  N  NZ    . LYS A  1 301 ? -10.117 -4.462  18.311  1.00 91.77  ? 544 LYS A NZ    1 
ATOM   2331  N  N     . VAL A  1 302 ? -13.434 -0.385  16.685  1.00 89.02  ? 545 VAL A N     1 
ATOM   2332  C  CA    . VAL A  1 302 ? -14.625 -0.443  17.498  1.00 97.76  ? 545 VAL A CA    1 
ATOM   2333  C  C     . VAL A  1 302 ? -14.343 -0.996  18.925  1.00 98.17  ? 545 VAL A C     1 
ATOM   2334  O  O     . VAL A  1 302 ? -13.908 -2.145  19.107  1.00 93.07  ? 545 VAL A O     1 
ATOM   2335  C  CB    . VAL A  1 302 ? -15.748 -1.233  16.734  1.00 97.43  ? 545 VAL A CB    1 
ATOM   2336  C  CG1   . VAL A  1 302 ? -15.598 -2.757  16.865  1.00 93.81  ? 545 VAL A CG1   1 
ATOM   2337  C  CG2   . VAL A  1 302 ? -17.140 -0.755  17.155  1.00 91.30  ? 545 VAL A CG2   1 
ATOM   2338  N  N     . GLY A  1 303 ? -14.542 -0.126  19.919  1.00 96.55  ? 546 GLY A N     1 
ATOM   2339  C  CA    . GLY A  1 303 ? -14.897 -0.528  21.281  1.00 90.47  ? 546 GLY A CA    1 
ATOM   2340  C  C     . GLY A  1 303 ? -16.208 0.171   21.653  1.00 91.74  ? 546 GLY A C     1 
ATOM   2341  O  O     . GLY A  1 303 ? -16.154 1.238   22.288  1.00 92.99  ? 546 GLY A O     1 
ATOM   2342  N  N     . PRO A  1 304 ? -17.391 -0.406  21.250  1.00 87.03  ? 547 PRO A N     1 
ATOM   2343  C  CA    . PRO A  1 304 ? -18.710 0.230   21.523  1.00 77.64  ? 547 PRO A CA    1 
ATOM   2344  C  C     . PRO A  1 304 ? -18.876 0.285   23.007  1.00 71.49  ? 547 PRO A C     1 
ATOM   2345  O  O     . PRO A  1 304 ? -18.980 -0.756  23.647  1.00 74.18  ? 547 PRO A O     1 
ATOM   2346  C  CB    . PRO A  1 304 ? -19.743 -0.724  20.891  1.00 72.55  ? 547 PRO A CB    1 
ATOM   2347  C  CG    . PRO A  1 304 ? -18.958 -1.745  20.134  1.00 78.77  ? 547 PRO A CG    1 
ATOM   2348  C  CD    . PRO A  1 304 ? -17.563 -1.769  20.704  1.00 83.47  ? 547 PRO A CD    1 
ATOM   2349  N  N     . GLY A  1 305 ? -18.872 1.483   23.563  1.00 60.03  ? 548 GLY A N     1 
ATOM   2350  C  CA    . GLY A  1 305 ? -18.415 1.622   24.930  1.00 54.98  ? 548 GLY A CA    1 
ATOM   2351  C  C     . GLY A  1 305 ? -19.445 1.985   25.955  1.00 46.35  ? 548 GLY A C     1 
ATOM   2352  O  O     . GLY A  1 305 ? -19.134 2.543   26.995  1.00 43.40  ? 548 GLY A O     1 
ATOM   2353  N  N     . ARG A  1 306 ? -20.678 1.666   25.705  1.00 43.45  ? 549 ARG A N     1 
ATOM   2354  C  CA    . ARG A  1 306 ? -21.650 1.784   26.798  1.00 45.42  ? 549 ARG A CA    1 
ATOM   2355  C  C     . ARG A  1 306 ? -22.253 3.171   26.956  1.00 39.89  ? 549 ARG A C     1 
ATOM   2356  O  O     . ARG A  1 306 ? -21.559 4.193   27.064  1.00 37.40  ? 549 ARG A O     1 
ATOM   2357  C  CB    . ARG A  1 306 ? -21.063 1.327   28.138  1.00 42.59  ? 549 ARG A CB    1 
ATOM   2358  C  CG    . ARG A  1 306 ? -22.149 0.906   29.094  1.00 48.99  ? 549 ARG A CG    1 
ATOM   2359  C  CD    . ARG A  1 306 ? -21.620 0.040   30.221  1.00 48.54  ? 549 ARG A CD    1 
ATOM   2360  N  NE    . ARG A  1 306 ? -22.714 -0.589  30.965  1.00 48.52  ? 549 ARG A NE    1 
ATOM   2361  C  CZ    . ARG A  1 306 ? -22.546 -1.321  32.067  1.00 48.23  ? 549 ARG A CZ    1 
ATOM   2362  N  NH1   . ARG A  1 306 ? -21.328 -1.526  32.556  1.00 44.08  ? 549 ARG A NH1   1 
ATOM   2363  N  NH2   . ARG A  1 306 ? -23.599 -1.860  32.673  1.00 51.66  ? 549 ARG A NH2   1 
ATOM   2364  N  N     . VAL A  1 307 ? -23.571 3.172   27.014  1.00 37.36  ? 550 VAL A N     1 
ATOM   2365  C  CA    . VAL A  1 307 ? -24.310 4.380   26.909  1.00 41.04  ? 550 VAL A CA    1 
ATOM   2366  C  C     . VAL A  1 307 ? -24.325 5.019   28.290  1.00 38.39  ? 550 VAL A C     1 
ATOM   2367  O  O     . VAL A  1 307 ? -24.488 4.325   29.270  1.00 40.02  ? 550 VAL A O     1 
ATOM   2368  C  CB    . VAL A  1 307 ? -25.723 4.118   26.283  1.00 40.30  ? 550 VAL A CB    1 
ATOM   2369  C  CG1   . VAL A  1 307 ? -25.611 3.172   25.090  1.00 37.55  ? 550 VAL A CG1   1 
ATOM   2370  C  CG2   . VAL A  1 307 ? -26.694 3.557   27.283  1.00 43.16  ? 550 VAL A CG2   1 
ATOM   2371  N  N     . LEU A  1 308 ? -24.103 6.329   28.369  1.00 36.46  ? 551 LEU A N     1 
ATOM   2372  C  CA    . LEU A  1 308 ? -24.441 7.070   29.565  1.00 33.91  ? 551 LEU A CA    1 
ATOM   2373  C  C     . LEU A  1 308 ? -25.910 7.484   29.516  1.00 36.12  ? 551 LEU A C     1 
ATOM   2374  O  O     . LEU A  1 308 ? -26.330 8.050   28.536  1.00 37.32  ? 551 LEU A O     1 
ATOM   2375  C  CB    . LEU A  1 308 ? -23.582 8.317   29.684  1.00 34.87  ? 551 LEU A CB    1 
ATOM   2376  C  CG    . LEU A  1 308 ? -22.083 8.057   29.823  1.00 39.73  ? 551 LEU A CG    1 
ATOM   2377  C  CD1   . LEU A  1 308 ? -21.355 9.379   29.753  1.00 39.95  ? 551 LEU A CD1   1 
ATOM   2378  C  CD2   . LEU A  1 308 ? -21.726 7.332   31.131  1.00 40.68  ? 551 LEU A CD2   1 
ATOM   2379  N  N     . PRO A  1 309 ? -26.694 7.212   30.568  1.00 36.81  ? 552 PRO A N     1 
ATOM   2380  C  CA    . PRO A  1 309 ? -28.097 7.633   30.575  1.00 38.30  ? 552 PRO A CA    1 
ATOM   2381  C  C     . PRO A  1 309 ? -28.228 9.131   30.637  1.00 36.07  ? 552 PRO A C     1 
ATOM   2382  O  O     . PRO A  1 309 ? -27.546 9.772   31.395  1.00 36.15  ? 552 PRO A O     1 
ATOM   2383  C  CB    . PRO A  1 309 ? -28.648 7.030   31.865  1.00 41.10  ? 552 PRO A CB    1 
ATOM   2384  C  CG    . PRO A  1 309 ? -27.438 6.953   32.753  1.00 45.77  ? 552 PRO A CG    1 
ATOM   2385  C  CD    . PRO A  1 309 ? -26.355 6.487   31.798  1.00 43.52  ? 552 PRO A CD    1 
ATOM   2386  N  N     . THR A  1 310 ? -29.094 9.681   29.800  1.00 33.06  ? 553 THR A N     1 
ATOM   2387  C  CA    . THR A  1 310 ? -29.212 11.115  29.627  1.00 29.27  ? 553 THR A CA    1 
ATOM   2388  C  C     . THR A  1 310 ? -30.682 11.378  29.554  1.00 27.25  ? 553 THR A C     1 
ATOM   2389  O  O     . THR A  1 310 ? -31.264 11.318  28.496  1.00 28.06  ? 553 THR A O     1 
ATOM   2390  C  CB    . THR A  1 310 ? -28.521 11.579  28.314  1.00 28.30  ? 553 THR A CB    1 
ATOM   2391  O  OG1   . THR A  1 310 ? -29.010 10.838  27.197  1.00 26.17  ? 553 THR A OG1   1 
ATOM   2392  C  CG2   . THR A  1 310 ? -27.013 11.406  28.384  1.00 25.97  ? 553 THR A CG2   1 
ATOM   2393  N  N     . PRO A  1 311 ? -31.318 11.575  30.697  1.00 30.13  ? 554 PRO A N     1 
ATOM   2394  C  CA    . PRO A  1 311 ? -32.783 11.637  30.589  1.00 30.50  ? 554 PRO A CA    1 
ATOM   2395  C  C     . PRO A  1 311 ? -33.256 12.912  29.947  1.00 28.17  ? 554 PRO A C     1 
ATOM   2396  O  O     . PRO A  1 311 ? -34.369 12.953  29.483  1.00 28.00  ? 554 PRO A O     1 
ATOM   2397  C  CB    . PRO A  1 311 ? -33.290 11.516  32.043  1.00 29.66  ? 554 PRO A CB    1 
ATOM   2398  C  CG    . PRO A  1 311 ? -32.077 11.566  32.900  1.00 30.62  ? 554 PRO A CG    1 
ATOM   2399  C  CD    . PRO A  1 311 ? -30.881 11.204  32.048  1.00 33.22  ? 554 PRO A CD    1 
ATOM   2400  N  N     . THR A  1 312 ? -32.407 13.925  29.913  1.00 26.88  ? 555 THR A N     1 
ATOM   2401  C  CA    . THR A  1 312 ? -32.763 15.194  29.322  1.00 27.94  ? 555 THR A CA    1 
ATOM   2402  C  C     . THR A  1 312 ? -31.551 15.767  28.620  1.00 26.39  ? 555 THR A C     1 
ATOM   2403  O  O     . THR A  1 312 ? -30.430 15.308  28.807  1.00 27.48  ? 555 THR A O     1 
ATOM   2404  C  CB    . THR A  1 312 ? -33.195 16.208  30.388  1.00 31.60  ? 555 THR A CB    1 
ATOM   2405  O  OG1   . THR A  1 312 ? -32.037 16.682  31.069  1.00 31.55  ? 555 THR A OG1   1 
ATOM   2406  C  CG2   . THR A  1 312 ? -34.126 15.570  31.430  1.00 32.59  ? 555 THR A CG2   1 
ATOM   2407  N  N     . GLU A  1 313 ? -31.797 16.794  27.821  1.00 25.58  ? 556 GLU A N     1 
ATOM   2408  C  CA    . GLU A  1 313 ? -30.773 17.443  27.046  1.00 26.42  ? 556 GLU A CA    1 
ATOM   2409  C  C     . GLU A  1 313 ? -29.722 18.055  27.950  1.00 27.02  ? 556 GLU A C     1 
ATOM   2410  O  O     . GLU A  1 313 ? -28.566 18.051  27.584  1.00 23.97  ? 556 GLU A O     1 
ATOM   2411  C  CB    . GLU A  1 313 ? -31.360 18.534  26.148  1.00 25.30  ? 556 GLU A CB    1 
ATOM   2412  C  CG    . GLU A  1 313 ? -32.202 18.056  24.966  1.00 26.28  ? 556 GLU A CG    1 
ATOM   2413  C  CD    . GLU A  1 313 ? -32.673 19.242  24.113  1.00 27.80  ? 556 GLU A CD    1 
ATOM   2414  O  OE1   . GLU A  1 313 ? -33.181 20.235  24.679  1.00 24.75  ? 556 GLU A OE1   1 
ATOM   2415  O  OE2   . GLU A  1 313 ? -32.442 19.215  22.882  1.00 24.84  ? 556 GLU A OE2   1 
ATOM   2416  N  N     . LYS A  1 314 ? -30.141 18.603  29.093  1.00 27.43  ? 557 LYS A N     1 
ATOM   2417  C  CA    . LYS A  1 314 ? -29.226 19.163  30.142  1.00 28.28  ? 557 LYS A CA    1 
ATOM   2418  C  C     . LYS A  1 314 ? -28.158 18.171  30.565  1.00 26.31  ? 557 LYS A C     1 
ATOM   2419  O  O     . LYS A  1 314 ? -27.008 18.533  30.785  1.00 26.62  ? 557 LYS A O     1 
ATOM   2420  C  CB    . LYS A  1 314 ? -29.997 19.483  31.424  1.00 33.23  ? 557 LYS A CB    1 
ATOM   2421  C  CG    . LYS A  1 314 ? -30.416 20.908  31.641  1.00 39.04  ? 557 LYS A CG    1 
ATOM   2422  C  CD    . LYS A  1 314 ? -31.774 21.208  31.028  1.00 45.59  ? 557 LYS A CD    1 
ATOM   2423  C  CE    . LYS A  1 314 ? -32.196 22.648  31.317  1.00 49.73  ? 557 LYS A CE    1 
ATOM   2424  N  NZ    . LYS A  1 314 ? -33.265 23.081  30.370  1.00 53.84  ? 557 LYS A NZ    1 
ATOM   2425  N  N     . ASP A  1 315 ? -28.555 16.912  30.706  1.00 25.03  ? 558 ASP A N     1 
ATOM   2426  C  CA    . ASP A  1 315 ? -27.603 15.850  31.022  1.00 25.81  ? 558 ASP A CA    1 
ATOM   2427  C  C     . ASP A  1 315 ? -26.511 15.699  29.967  1.00 23.74  ? 558 ASP A C     1 
ATOM   2428  O  O     . ASP A  1 315 ? -25.346 15.503  30.272  1.00 24.93  ? 558 ASP A O     1 
ATOM   2429  C  CB    . ASP A  1 315 ? -28.376 14.523  31.164  1.00 29.50  ? 558 ASP A CB    1 
ATOM   2430  C  CG    . ASP A  1 315 ? -29.372 14.558  32.312  1.00 33.85  ? 558 ASP A CG    1 
ATOM   2431  O  OD1   . ASP A  1 315 ? -28.876 14.850  33.437  1.00 33.78  ? 558 ASP A OD1   1 
ATOM   2432  O  OD2   . ASP A  1 315 ? -30.598 14.291  32.106  1.00 34.30  ? 558 ASP A OD2   1 
ATOM   2433  N  N     . VAL A  1 316 ? -26.882 15.782  28.699  1.00 21.79  ? 559 VAL A N     1 
ATOM   2434  C  CA    . VAL A  1 316 ? -25.899 15.675  27.662  1.00 21.35  ? 559 VAL A CA    1 
ATOM   2435  C  C     . VAL A  1 316 ? -24.902 16.839  27.681  1.00 21.18  ? 559 VAL A C     1 
ATOM   2436  O  O     . VAL A  1 316 ? -23.721 16.654  27.483  1.00 23.36  ? 559 VAL A O     1 
ATOM   2437  C  CB    . VAL A  1 316 ? -26.554 15.506  26.261  1.00 21.08  ? 559 VAL A CB    1 
ATOM   2438  C  CG1   . VAL A  1 316 ? -25.505 15.059  25.262  1.00 21.92  ? 559 VAL A CG1   1 
ATOM   2439  C  CG2   . VAL A  1 316 ? -27.606 14.397  26.311  1.00 20.77  ? 559 VAL A CG2   1 
ATOM   2440  N  N     . PHE A  1 317 ? -25.397 18.043  27.894  1.00 23.37  ? 560 PHE A N     1 
ATOM   2441  C  CA    . PHE A  1 317 ? -24.553 19.236  28.018  1.00 25.26  ? 560 PHE A CA    1 
ATOM   2442  C  C     . PHE A  1 317 ? -23.584 19.083  29.217  1.00 27.71  ? 560 PHE A C     1 
ATOM   2443  O  O     . PHE A  1 317 ? -22.358 19.304  29.076  1.00 27.63  ? 560 PHE A O     1 
ATOM   2444  C  CB    . PHE A  1 317 ? -25.424 20.515  28.105  1.00 22.98  ? 560 PHE A CB    1 
ATOM   2445  C  CG    . PHE A  1 317 ? -26.029 20.950  26.760  1.00 21.70  ? 560 PHE A CG    1 
ATOM   2446  C  CD1   . PHE A  1 317 ? -25.278 21.670  25.857  1.00 21.63  ? 560 PHE A CD1   1 
ATOM   2447  C  CD2   . PHE A  1 317 ? -27.297 20.626  26.416  1.00 20.74  ? 560 PHE A CD2   1 
ATOM   2448  C  CE1   . PHE A  1 317 ? -25.789 22.083  24.671  1.00 21.59  ? 560 PHE A CE1   1 
ATOM   2449  C  CE2   . PHE A  1 317 ? -27.831 21.022  25.225  1.00 20.92  ? 560 PHE A CE2   1 
ATOM   2450  C  CZ    . PHE A  1 317 ? -27.082 21.743  24.341  1.00 21.74  ? 560 PHE A CZ    1 
ATOM   2451  N  N     . ARG A  1 318 ? -24.152 18.708  30.370  1.00 28.10  ? 561 ARG A N     1 
ATOM   2452  C  CA    . ARG A  1 318 ? -23.400 18.540  31.622  1.00 28.04  ? 561 ARG A CA    1 
ATOM   2453  C  C     . ARG A  1 318 ? -22.267 17.571  31.394  1.00 28.78  ? 561 ARG A C     1 
ATOM   2454  O  O     . ARG A  1 318 ? -21.109 17.949  31.545  1.00 29.27  ? 561 ARG A O     1 
ATOM   2455  C  CB    . ARG A  1 318 ? -24.321 18.052  32.744  1.00 30.01  ? 561 ARG A CB    1 
ATOM   2456  C  CG    . ARG A  1 318 ? -23.621 17.743  34.079  1.00 29.98  ? 561 ARG A CG    1 
ATOM   2457  C  CD    . ARG A  1 318 ? -24.654 17.570  35.196  1.00 28.50  ? 561 ARG A CD    1 
ATOM   2458  N  NE    . ARG A  1 318 ? -25.728 16.640  34.871  1.00 31.56  ? 561 ARG A NE    1 
ATOM   2459  C  CZ    . ARG A  1 318 ? -25.583 15.324  34.678  1.00 31.26  ? 561 ARG A CZ    1 
ATOM   2460  N  NH1   . ARG A  1 318 ? -24.408 14.729  34.766  1.00 33.86  ? 561 ARG A NH1   1 
ATOM   2461  N  NH2   . ARG A  1 318 ? -26.630 14.599  34.354  1.00 34.86  ? 561 ARG A NH2   1 
ATOM   2462  N  N     . LEU A  1 319 ? -22.575 16.376  30.886  1.00 28.69  ? 562 LEU A N     1 
ATOM   2463  C  CA    . LEU A  1 319 ? -21.538 15.386  30.620  1.00 26.84  ? 562 LEU A CA    1 
ATOM   2464  C  C     . LEU A  1 319 ? -20.508 15.825  29.583  1.00 28.46  ? 562 LEU A C     1 
ATOM   2465  O  O     . LEU A  1 319 ? -19.475 15.203  29.473  1.00 28.43  ? 562 LEU A O     1 
ATOM   2466  C  CB    . LEU A  1 319 ? -22.143 14.003  30.283  1.00 27.71  ? 562 LEU A CB    1 
ATOM   2467  C  CG    . LEU A  1 319 ? -22.970 13.340  31.397  1.00 28.99  ? 562 LEU A CG    1 
ATOM   2468  C  CD1   . LEU A  1 319 ? -23.970 12.334  30.820  1.00 31.94  ? 562 LEU A CD1   1 
ATOM   2469  C  CD2   . LEU A  1 319 ? -22.102 12.646  32.455  1.00 29.83  ? 562 LEU A CD2   1 
ATOM   2470  N  N     . LEU A  1 320 ? -20.729 16.904  28.835  1.00 28.33  ? 563 LEU A N     1 
ATOM   2471  C  CA    . LEU A  1 320 ? -19.674 17.365  27.946  1.00 26.01  ? 563 LEU A CA    1 
ATOM   2472  C  C     . LEU A  1 320 ? -18.983 18.601  28.491  1.00 26.81  ? 563 LEU A C     1 
ATOM   2473  O  O     . LEU A  1 320 ? -18.198 19.207  27.788  1.00 25.52  ? 563 LEU A O     1 
ATOM   2474  C  CB    . LEU A  1 320 ? -20.249 17.691  26.586  1.00 25.78  ? 563 LEU A CB    1 
ATOM   2475  C  CG    . LEU A  1 320 ? -20.837 16.487  25.869  1.00 26.90  ? 563 LEU A CG    1 
ATOM   2476  C  CD1   . LEU A  1 320 ? -21.503 16.938  24.588  1.00 24.61  ? 563 LEU A CD1   1 
ATOM   2477  C  CD2   . LEU A  1 320 ? -19.770 15.433  25.583  1.00 26.26  ? 563 LEU A CD2   1 
ATOM   2478  N  N     . GLY A  1 321 ? -19.272 18.987  29.728  1.00 26.60  ? 564 GLY A N     1 
ATOM   2479  C  CA    . GLY A  1 321 ? -18.640 20.181  30.301  1.00 26.42  ? 564 GLY A CA    1 
ATOM   2480  C  C     . GLY A  1 321 ? -19.298 21.495  29.910  1.00 26.16  ? 564 GLY A C     1 
ATOM   2481  O  O     . GLY A  1 321 ? -18.766 22.573  30.200  1.00 25.97  ? 564 GLY A O     1 
ATOM   2482  N  N     . LEU A  1 322 ? -20.468 21.442  29.288  1.00 24.27  ? 565 LEU A N     1 
ATOM   2483  C  CA    . LEU A  1 322 ? -21.060 22.657  28.784  1.00 23.99  ? 565 LEU A CA    1 
ATOM   2484  C  C     . LEU A  1 322 ? -22.271 23.014  29.589  1.00 23.57  ? 565 LEU A C     1 
ATOM   2485  O  O     . LEU A  1 322 ? -22.910 22.122  30.205  1.00 25.92  ? 565 LEU A O     1 
ATOM   2486  C  CB    . LEU A  1 322 ? -21.535 22.458  27.322  1.00 24.70  ? 565 LEU A CB    1 
ATOM   2487  C  CG    . LEU A  1 322 ? -20.511 22.067  26.290  1.00 25.92  ? 565 LEU A CG    1 
ATOM   2488  C  CD1   . LEU A  1 322 ? -21.228 21.582  25.034  1.00 27.10  ? 565 LEU A CD1   1 
ATOM   2489  C  CD2   . LEU A  1 322 ? -19.588 23.219  25.972  1.00 24.12  ? 565 LEU A CD2   1 
ATOM   2490  N  N     . PRO A  1 323 ? -22.654 24.294  29.543  1.00 22.70  ? 566 PRO A N     1 
ATOM   2491  C  CA    . PRO A  1 323 ? -23.939 24.730  30.078  1.00 23.52  ? 566 PRO A CA    1 
ATOM   2492  C  C     . PRO A  1 323 ? -25.047 24.458  29.030  1.00 25.09  ? 566 PRO A C     1 
ATOM   2493  O  O     . PRO A  1 323 ? -24.744 24.419  27.848  1.00 26.15  ? 566 PRO A O     1 
ATOM   2494  C  CB    . PRO A  1 323 ? -23.735 26.217  30.244  1.00 22.55  ? 566 PRO A CB    1 
ATOM   2495  C  CG    . PRO A  1 323 ? -22.865 26.579  29.112  1.00 22.91  ? 566 PRO A CG    1 
ATOM   2496  C  CD    . PRO A  1 323 ? -21.886 25.421  29.016  1.00 23.09  ? 566 PRO A CD    1 
ATOM   2497  N  N     . TYR A  1 324 ? -26.279 24.191  29.464  1.00 23.19  ? 567 TYR A N     1 
ATOM   2498  C  CA    . TYR A  1 324 ? -27.428 24.058  28.586  1.00 23.15  ? 567 TYR A CA    1 
ATOM   2499  C  C     . TYR A  1 324 ? -27.532 25.237  27.634  1.00 24.06  ? 567 TYR A C     1 
ATOM   2500  O  O     . TYR A  1 324 ? -27.291 26.366  28.005  1.00 23.75  ? 567 TYR A O     1 
ATOM   2501  C  CB    . TYR A  1 324 ? -28.727 23.934  29.403  1.00 24.23  ? 567 TYR A CB    1 
ATOM   2502  C  CG    . TYR A  1 324 ? -29.983 23.714  28.566  1.00 24.46  ? 567 TYR A CG    1 
ATOM   2503  C  CD1   . TYR A  1 324 ? -30.191 22.526  27.888  1.00 26.41  ? 567 TYR A CD1   1 
ATOM   2504  C  CD2   . TYR A  1 324 ? -30.959 24.709  28.458  1.00 26.02  ? 567 TYR A CD2   1 
ATOM   2505  C  CE1   . TYR A  1 324 ? -31.348 22.306  27.148  1.00 27.15  ? 567 TYR A CE1   1 
ATOM   2506  C  CE2   . TYR A  1 324 ? -32.105 24.526  27.680  1.00 29.35  ? 567 TYR A CE2   1 
ATOM   2507  C  CZ    . TYR A  1 324 ? -32.277 23.328  27.011  1.00 29.98  ? 567 TYR A CZ    1 
ATOM   2508  O  OH    . TYR A  1 324 ? -33.404 23.143  26.266  1.00 33.29  ? 567 TYR A OH    1 
ATOM   2509  N  N     . ARG A  1 325 ? -27.828 24.944  26.384  1.00 23.49  ? 568 ARG A N     1 
ATOM   2510  C  CA    . ARG A  1 325 ? -27.980 25.952  25.389  1.00 23.46  ? 568 ARG A CA    1 
ATOM   2511  C  C     . ARG A  1 325 ? -29.423 25.874  24.970  1.00 26.37  ? 568 ARG A C     1 
ATOM   2512  O  O     . ARG A  1 325 ? -29.933 24.795  24.614  1.00 24.88  ? 568 ARG A O     1 
ATOM   2513  C  CB    . ARG A  1 325 ? -27.105 25.683  24.200  1.00 22.34  ? 568 ARG A CB    1 
ATOM   2514  C  CG    . ARG A  1 325 ? -27.123 26.786  23.166  1.00 25.40  ? 568 ARG A CG    1 
ATOM   2515  C  CD    . ARG A  1 325 ? -26.235 27.967  23.615  1.00 25.58  ? 568 ARG A CD    1 
ATOM   2516  N  NE    . ARG A  1 325 ? -24.825 27.616  23.659  1.00 25.26  ? 568 ARG A NE    1 
ATOM   2517  C  CZ    . ARG A  1 325 ? -23.961 27.743  22.642  1.00 26.29  ? 568 ARG A CZ    1 
ATOM   2518  N  NH1   . ARG A  1 325 ? -24.345 28.207  21.444  1.00 28.17  ? 568 ARG A NH1   1 
ATOM   2519  N  NH2   . ARG A  1 325 ? -22.696 27.398  22.825  1.00 24.85  ? 568 ARG A NH2   1 
ATOM   2520  N  N     . GLU A  1 326 ? -30.076 27.027  25.009  1.00 27.20  ? 569 GLU A N     1 
ATOM   2521  C  CA    . GLU A  1 326 ? -31.469 27.164  24.593  1.00 30.57  ? 569 GLU A CA    1 
ATOM   2522  C  C     . GLU A  1 326 ? -31.567 26.840  23.103  1.00 26.54  ? 569 GLU A C     1 
ATOM   2523  O  O     . GLU A  1 326 ? -30.688 27.250  22.346  1.00 28.59  ? 569 GLU A O     1 
ATOM   2524  C  CB    . GLU A  1 326 ? -31.896 28.621  24.862  1.00 33.07  ? 569 GLU A CB    1 
ATOM   2525  C  CG    . GLU A  1 326 ? -33.165 28.769  25.696  1.00 39.97  ? 569 GLU A CG    1 
ATOM   2526  C  CD    . GLU A  1 326 ? -33.054 28.202  27.090  1.00 41.28  ? 569 GLU A CD    1 
ATOM   2527  O  OE1   . GLU A  1 326 ? -31.987 28.275  27.701  1.00 57.52  ? 569 GLU A OE1   1 
ATOM   2528  O  OE2   . GLU A  1 326 ? -34.036 27.661  27.593  1.00 50.23  ? 569 GLU A OE2   1 
ATOM   2529  N  N     . PRO A  1 327 ? -32.642 26.177  22.648  1.00 22.70  ? 570 PRO A N     1 
ATOM   2530  C  CA    . PRO A  1 327 ? -32.647 25.836  21.204  1.00 20.46  ? 570 PRO A CA    1 
ATOM   2531  C  C     . PRO A  1 327 ? -32.448 27.021  20.292  1.00 21.97  ? 570 PRO A C     1 
ATOM   2532  O  O     . PRO A  1 327 ? -31.720 26.895  19.274  1.00 21.06  ? 570 PRO A O     1 
ATOM   2533  C  CB    . PRO A  1 327 ? -33.999 25.225  20.993  1.00 21.09  ? 570 PRO A CB    1 
ATOM   2534  C  CG    . PRO A  1 327 ? -34.373 24.683  22.323  1.00 22.73  ? 570 PRO A CG    1 
ATOM   2535  C  CD    . PRO A  1 327 ? -33.807 25.603  23.341  1.00 23.12  ? 570 PRO A CD    1 
ATOM   2536  N  N     . ALA A  1 328 ? -33.019 28.191  20.636  1.00 21.19  ? 571 ALA A N     1 
ATOM   2537  C  CA    . ALA A  1 328 ? -32.757 29.383  19.800  1.00 22.97  ? 571 ALA A CA    1 
ATOM   2538  C  C     . ALA A  1 328 ? -31.272 29.752  19.675  1.00 22.70  ? 571 ALA A C     1 
ATOM   2539  O  O     . ALA A  1 328 ? -30.883 30.431  18.736  1.00 20.84  ? 571 ALA A O     1 
ATOM   2540  C  CB    . ALA A  1 328 ? -33.584 30.600  20.297  1.00 25.12  ? 571 ALA A CB    1 
ATOM   2541  N  N     . GLU A  1 329 ? -30.415 29.291  20.585  1.00 22.87  ? 572 GLU A N     1 
ATOM   2542  C  CA    . GLU A  1 329 ? -29.033 29.701  20.527  1.00 22.71  ? 572 GLU A CA    1 
ATOM   2543  C  C     . GLU A  1 329 ? -28.125 28.596  20.017  1.00 21.62  ? 572 GLU A C     1 
ATOM   2544  O  O     . GLU A  1 329 ? -26.908 28.611  20.195  1.00 20.93  ? 572 GLU A O     1 
ATOM   2545  C  CB    . GLU A  1 329 ? -28.615 30.194  21.895  1.00 26.17  ? 572 GLU A CB    1 
ATOM   2546  C  CG    . GLU A  1 329 ? -29.511 31.322  22.426  1.00 31.95  ? 572 GLU A CG    1 
ATOM   2547  C  CD    . GLU A  1 329 ? -29.223 31.634  23.902  1.00 39.21  ? 572 GLU A CD    1 
ATOM   2548  O  OE1   . GLU A  1 329 ? -28.113 31.273  24.345  1.00 45.17  ? 572 GLU A OE1   1 
ATOM   2549  O  OE2   . GLU A  1 329 ? -30.065 32.236  24.628  1.00 48.37  ? 572 GLU A OE2   1 
ATOM   2550  N  N     . ARG A  1 330 ? -28.723 27.643  19.341  1.00 21.00  ? 573 ARG A N     1 
ATOM   2551  C  CA    . ARG A  1 330 ? -28.000 26.518  18.778  1.00 21.47  ? 573 ARG A CA    1 
ATOM   2552  C  C     . ARG A  1 330 ? -27.710 26.601  17.284  1.00 23.11  ? 573 ARG A C     1 
ATOM   2553  O  O     . ARG A  1 330 ? -27.699 25.598  16.560  1.00 21.63  ? 573 ARG A O     1 
ATOM   2554  C  CB    . ARG A  1 330 ? -28.772 25.259  19.063  1.00 21.43  ? 573 ARG A CB    1 
ATOM   2555  C  CG    . ARG A  1 330 ? -28.842 24.949  20.533  1.00 20.68  ? 573 ARG A CG    1 
ATOM   2556  C  CD    . ARG A  1 330 ? -29.586 23.624  20.707  1.00 20.14  ? 573 ARG A CD    1 
ATOM   2557  N  NE    . ARG A  1 330 ? -30.066 23.465  22.065  1.00 18.96  ? 573 ARG A NE    1 
ATOM   2558  C  CZ    . ARG A  1 330 ? -30.765 22.420  22.479  1.00 19.63  ? 573 ARG A CZ    1 
ATOM   2559  N  NH1   . ARG A  1 330 ? -31.041 21.428  21.650  1.00 21.14  ? 573 ARG A NH1   1 
ATOM   2560  N  NH2   . ARG A  1 330 ? -31.208 22.358  23.717  1.00 20.17  ? 573 ARG A NH2   1 
ATOM   2561  N  N     . ASP A  1 331 ? -27.435 27.802  16.820  1.00 28.11  ? 574 ASP A N     1 
ATOM   2562  C  CA    . ASP A  1 331 ? -26.943 27.985  15.455  1.00 30.87  ? 574 ASP A CA    1 
ATOM   2563  C  C     . ASP A  1 331 ? -25.521 27.412  15.302  1.00 29.45  ? 574 ASP A C     1 
ATOM   2564  O  O     . ASP A  1 331 ? -25.225 26.671  14.355  1.00 27.91  ? 574 ASP A O     1 
ATOM   2565  C  CB    . ASP A  1 331 ? -27.033 29.477  15.046  1.00 35.82  ? 574 ASP A CB    1 
ATOM   2566  C  CG    . ASP A  1 331 ? -26.243 30.453  16.035  1.00 47.04  ? 574 ASP A CG    1 
ATOM   2567  O  OD1   . ASP A  1 331 ? -25.963 30.100  17.236  1.00 47.58  ? 574 ASP A OD1   1 
ATOM   2568  O  OD2   . ASP A  1 331 ? -25.909 31.590  15.580  1.00 53.80  ? 574 ASP A OD2   1 
ATOM   2569  N  N     . TRP A  1 332 ? -24.645 27.755  16.233  1.00 28.96  ? 575 TRP A N     1 
ATOM   2570  C  CA    . TRP A  1 332 ? -23.251 27.330  16.186  1.00 30.58  ? 575 TRP A CA    1 
ATOM   2571  C  C     . TRP A  1 332 ? -22.821 27.137  17.596  1.00 28.66  ? 575 TRP A C     1 
ATOM   2572  O  O     . TRP A  1 332 ? -23.239 27.894  18.470  1.00 28.83  ? 575 TRP A O     1 
ATOM   2573  C  CB    . TRP A  1 332 ? -22.328 28.401  15.581  1.00 32.88  ? 575 TRP A CB    1 
ATOM   2574  C  CG    . TRP A  1 332 ? -22.665 28.731  14.235  1.00 34.65  ? 575 TRP A CG    1 
ATOM   2575  C  CD1   . TRP A  1 332 ? -23.659 29.553  13.847  1.00 38.78  ? 575 TRP A CD1   1 
ATOM   2576  C  CD2   . TRP A  1 332 ? -22.025 28.263  13.038  1.00 40.86  ? 575 TRP A CD2   1 
ATOM   2577  N  NE1   . TRP A  1 332 ? -23.723 29.605  12.475  1.00 43.45  ? 575 TRP A NE1   1 
ATOM   2578  C  CE2   . TRP A  1 332 ? -22.721 28.832  11.950  1.00 45.20  ? 575 TRP A CE2   1 
ATOM   2579  C  CE3   . TRP A  1 332 ? -20.917 27.438  12.776  1.00 43.25  ? 575 TRP A CE3   1 
ATOM   2580  C  CZ2   . TRP A  1 332 ? -22.347 28.608  10.615  1.00 46.62  ? 575 TRP A CZ2   1 
ATOM   2581  C  CZ3   . TRP A  1 332 ? -20.564 27.206  11.445  1.00 43.36  ? 575 TRP A CZ3   1 
ATOM   2582  C  CH2   . TRP A  1 332 ? -21.278 27.789  10.393  1.00 45.80  ? 575 TRP A CH2   1 
ATOM   2583  N  N     . LEU A  1 333 ? -21.951 26.164  17.842  1.00 27.57  ? 576 LEU A N     1 
ATOM   2584  C  CA    . LEU A  1 333 ? -21.540 25.920  19.240  1.00 28.11  ? 576 LEU A CA    1 
ATOM   2585  C  C     . LEU A  1 333 ? -20.586 27.023  19.692  1.00 28.04  ? 576 LEU A C     1 
ATOM   2586  O  O     . LEU A  1 333 ? -20.649 27.497  20.816  1.00 26.47  ? 576 LEU A O     1 
ATOM   2587  C  CB    . LEU A  1 333 ? -20.819 24.616  19.368  1.00 27.03  ? 576 LEU A CB    1 
ATOM   2588  C  CG    . LEU A  1 333 ? -20.913 23.716  20.605  1.00 28.82  ? 576 LEU A CG    1 
ATOM   2589  C  CD1   . LEU A  1 333 ? -19.515 23.240  20.951  1.00 29.35  ? 576 LEU A CD1   1 
ATOM   2590  C  CD2   . LEU A  1 333 ? -21.592 24.248  21.847  1.00 29.04  ? 576 LEU A CD2   1 
ATOM   2591  N  N     . GLU A  1 334 ? -19.669 27.381  18.810  1.00 29.62  ? 577 GLU A N     1 
ATOM   2592  C  CA    . GLU A  1 334 ? -18.663 28.366  19.124  1.00 33.12  ? 577 GLU A CA    1 
ATOM   2593  C  C     . GLU A  1 334 ? -19.208 29.836  19.179  1.00 37.19  ? 577 GLU A C     1 
ATOM   2594  O  O     . GLU A  1 334 ? -18.513 30.768  19.547  1.00 40.52  ? 577 GLU A O     1 
ATOM   2595  C  CB    . GLU A  1 334 ? -17.393 28.145  18.255  1.00 36.25  ? 577 GLU A CB    1 
ATOM   2596  C  CG    . GLU A  1 334 ? -17.480 27.486  16.867  1.00 38.16  ? 577 GLU A CG    1 
ATOM   2597  C  CD    . GLU A  1 334 ? -18.169 26.112  16.779  1.00 38.31  ? 577 GLU A CD    1 
ATOM   2598  O  OE1   . GLU A  1 334 ? -17.582 25.037  17.054  1.00 33.33  ? 577 GLU A OE1   1 
ATOM   2599  O  OE2   . GLU A  1 334 ? -19.325 26.134  16.342  1.00 35.28  ? 577 GLU A OE2   1 
ATOM   2600  N  N     . HIS A  1 335 ? -20.481 30.017  18.872  1.00 47.44  ? 578 HIS A N     1 
ATOM   2601  C  CA    . HIS A  1 335 ? -21.143 31.302  19.043  1.00 57.93  ? 578 HIS A CA    1 
ATOM   2602  C  C     . HIS A  1 335 ? -21.802 31.402  20.411  1.00 60.61  ? 578 HIS A C     1 
ATOM   2603  O  O     . HIS A  1 335 ? -22.753 30.669  20.692  1.00 58.50  ? 578 HIS A O     1 
ATOM   2604  C  CB    . HIS A  1 335 ? -22.216 31.530  17.967  1.00 61.50  ? 578 HIS A CB    1 
ATOM   2605  C  CG    . HIS A  1 335 ? -22.846 32.897  18.022  1.00 65.35  ? 578 HIS A CG    1 
ATOM   2606  N  ND1   . HIS A  1 335 ? -22.197 34.004  18.533  1.00 66.72  ? 578 HIS A ND1   1 
ATOM   2607  C  CD2   . HIS A  1 335 ? -24.060 33.333  17.612  1.00 66.19  ? 578 HIS A CD2   1 
ATOM   2608  C  CE1   . HIS A  1 335 ? -22.986 35.058  18.436  1.00 70.46  ? 578 HIS A CE1   1 
ATOM   2609  N  NE2   . HIS A  1 335 ? -24.123 34.677  17.880  1.00 66.74  ? 578 HIS A NE2   1 
ATOM   2610  N  N     . HIS A  1 336 ? -21.310 32.325  21.234  1.00 59.06  ? 579 HIS A N     1 
ATOM   2611  C  CA    . HIS A  1 336 ? -21.862 32.572  22.572  1.00 64.70  ? 579 HIS A CA    1 
ATOM   2612  C  C     . HIS A  1 336 ? -22.605 33.909  22.552  1.00 69.23  ? 579 HIS A C     1 
ATOM   2613  O  O     . HIS A  1 336 ? -22.004 34.964  22.347  1.00 75.07  ? 579 HIS A O     1 
ATOM   2614  C  CB    . HIS A  1 336 ? -20.754 32.571  23.631  1.00 61.85  ? 579 HIS A CB    1 
ATOM   2615  C  CG    . HIS A  1 336 ? -19.698 31.543  23.381  1.00 66.97  ? 579 HIS A CG    1 
ATOM   2616  N  ND1   . HIS A  1 336 ? -19.928 30.190  23.521  1.00 72.31  ? 579 HIS A ND1   1 
ATOM   2617  C  CD2   . HIS A  1 336 ? -18.418 31.664  22.957  1.00 70.52  ? 579 HIS A CD2   1 
ATOM   2618  C  CE1   . HIS A  1 336 ? -18.833 29.520  23.206  1.00 73.21  ? 579 HIS A CE1   1 
ATOM   2619  N  NE2   . HIS A  1 336 ? -17.900 30.393  22.864  1.00 74.45  ? 579 HIS A NE2   1 
ATOM   2620  N  N     . HIS A  1 337 ? -23.916 33.842  22.770  1.00 76.01  ? 580 HIS A N     1 
ATOM   2621  C  CA    . HIS A  1 337 ? -24.830 34.959  22.533  1.00 85.66  ? 580 HIS A CA    1 
ATOM   2622  C  C     . HIS A  1 337 ? -24.847 36.014  23.644  1.00 92.13  ? 580 HIS A C     1 
ATOM   2623  O  O     . HIS A  1 337 ? -25.527 37.038  23.491  1.00 90.52  ? 580 HIS A O     1 
ATOM   2624  C  CB    . HIS A  1 337 ? -26.278 34.426  22.377  1.00 86.10  ? 580 HIS A CB    1 
ATOM   2625  C  CG    . HIS A  1 337 ? -26.557 33.770  21.059  1.00 81.57  ? 580 HIS A CG    1 
ATOM   2626  N  ND1   . HIS A  1 337 ? -25.871 32.657  20.621  1.00 79.50  ? 580 HIS A ND1   1 
ATOM   2627  C  CD2   . HIS A  1 337 ? -27.462 34.060  20.092  1.00 72.90  ? 580 HIS A CD2   1 
ATOM   2628  C  CE1   . HIS A  1 337 ? -26.328 32.304  19.433  1.00 76.34  ? 580 HIS A CE1   1 
ATOM   2629  N  NE2   . HIS A  1 337 ? -27.296 33.135  19.092  1.00 70.20  ? 580 HIS A NE2   1 
ATOM   2630  N  N     . HIS A  1 338 ? -24.119 35.785  24.743  1.00 95.43  ? 581 HIS A N     1 
ATOM   2631  C  CA    . HIS A  1 338 ? -24.502 36.373  26.029  1.00 98.64  ? 581 HIS A CA    1 
ATOM   2632  C  C     . HIS A  1 338 ? -25.893 35.733  26.296  1.00 94.26  ? 581 HIS A C     1 
ATOM   2633  O  O     . HIS A  1 338 ? -25.939 34.531  26.537  1.00 93.94  ? 581 HIS A O     1 
ATOM   2634  C  CB    . HIS A  1 338 ? -24.475 37.918  25.986  1.00 103.47 ? 581 HIS A CB    1 
ATOM   2635  C  CG    . HIS A  1 338 ? -24.591 38.577  27.329  1.00 111.71 ? 581 HIS A CG    1 
ATOM   2636  N  ND1   . HIS A  1 338 ? -23.547 38.627  28.230  1.00 114.30 ? 581 HIS A ND1   1 
ATOM   2637  C  CD2   . HIS A  1 338 ? -25.620 39.239  27.913  1.00 111.72 ? 581 HIS A CD2   1 
ATOM   2638  C  CE1   . HIS A  1 338 ? -23.933 39.274  29.316  1.00 111.74 ? 581 HIS A CE1   1 
ATOM   2639  N  NE2   . HIS A  1 338 ? -25.187 39.655  29.150  1.00 110.67 ? 581 HIS A NE2   1 
ATOM   2640  N  N     . HIS A  1 339 ? -27.005 36.478  26.197  1.00 90.10  ? 582 HIS A N     1 
ATOM   2641  C  CA    . HIS A  1 339 ? -28.370 35.891  26.292  1.00 85.77  ? 582 HIS A CA    1 
ATOM   2642  C  C     . HIS A  1 339 ? -29.429 36.701  25.544  1.00 76.92  ? 582 HIS A C     1 
ATOM   2643  O  O     . HIS A  1 339 ? -29.440 36.744  24.315  1.00 59.81  ? 582 HIS A O     1 
ATOM   2644  C  CB    . HIS A  1 339 ? -28.812 35.705  27.756  1.00 89.69  ? 582 HIS A CB    1 
ATOM   2645  C  CG    . HIS A  1 339 ? -28.549 36.892  28.634  1.00 97.80  ? 582 HIS A CG    1 
ATOM   2646  N  ND1   . HIS A  1 339 ? -27.805 36.811  29.794  1.00 100.05 ? 582 HIS A ND1   1 
ATOM   2647  C  CD2   . HIS A  1 339 ? -28.922 38.190  28.520  1.00 102.08 ? 582 HIS A CD2   1 
ATOM   2648  C  CE1   . HIS A  1 339 ? -27.733 38.004  30.357  1.00 99.60  ? 582 HIS A CE1   1 
ATOM   2649  N  NE2   . HIS A  1 339 ? -28.403 38.859  29.604  1.00 102.18 ? 582 HIS A NE2   1 
ATOM   2650  O  "O5'" . DC  B  2 1   ? 2.180   17.116  3.721   1.00 48.61  ? 1   DC  B "O5'" 1 
ATOM   2651  C  "C5'" . DC  B  2 1   ? 2.774   15.992  4.397   1.00 49.71  ? 1   DC  B "C5'" 1 
ATOM   2652  C  "C4'" . DC  B  2 1   ? 2.000   15.702  5.659   1.00 49.41  ? 1   DC  B "C4'" 1 
ATOM   2653  O  "O4'" . DC  B  2 1   ? 2.104   16.635  6.760   1.00 47.52  ? 1   DC  B "O4'" 1 
ATOM   2654  C  "C3'" . DC  B  2 1   ? 0.563   15.213  5.584   1.00 46.66  ? 1   DC  B "C3'" 1 
ATOM   2655  O  "O3'" . DC  B  2 1   ? 0.547   13.794  5.514   1.00 51.04  ? 1   DC  B "O3'" 1 
ATOM   2656  C  "C2'" . DC  B  2 1   ? -0.030  15.589  6.927   1.00 48.10  ? 1   DC  B "C2'" 1 
ATOM   2657  C  "C1'" . DC  B  2 1   ? 0.952   16.541  7.590   1.00 42.09  ? 1   DC  B "C1'" 1 
ATOM   2658  N  N1    . DC  B  2 1   ? 0.411   17.890  7.773   1.00 37.13  ? 1   DC  B N1    1 
ATOM   2659  C  C2    . DC  B  2 1   ? -0.192  18.217  8.994   1.00 35.64  ? 1   DC  B C2    1 
ATOM   2660  O  O2    . DC  B  2 1   ? -0.251  17.357  9.887   1.00 39.44  ? 1   DC  B O2    1 
ATOM   2661  N  N3    . DC  B  2 1   ? -0.660  19.469  9.184   1.00 34.19  ? 1   DC  B N3    1 
ATOM   2662  C  C4    . DC  B  2 1   ? -0.563  20.373  8.206   1.00 32.41  ? 1   DC  B C4    1 
ATOM   2663  N  N4    . DC  B  2 1   ? -1.028  21.596  8.441   1.00 32.38  ? 1   DC  B N4    1 
ATOM   2664  C  C5    . DC  B  2 1   ? 0.013   20.057  6.942   1.00 35.02  ? 1   DC  B C5    1 
ATOM   2665  C  C6    . DC  B  2 1   ? 0.485   18.815  6.771   1.00 36.72  ? 1   DC  B C6    1 
ATOM   2666  P  P     . DG  B  2 2   ? -0.642  13.093  4.764   1.00 52.63  ? 2   DG  B P     1 
ATOM   2667  O  OP1   . DG  B  2 2   ? -0.166  11.774  4.286   1.00 54.58  ? 2   DG  B OP1   1 
ATOM   2668  O  OP2   . DG  B  2 2   ? -1.203  14.084  3.817   1.00 43.37  ? 2   DG  B OP2   1 
ATOM   2669  O  "O5'" . DG  B  2 2   ? -1.684  12.803  5.932   1.00 44.83  ? 2   DG  B "O5'" 1 
ATOM   2670  C  "C5'" . DG  B  2 2   ? -1.294  12.007  7.053   1.00 44.64  ? 2   DG  B "C5'" 1 
ATOM   2671  C  "C4'" . DG  B  2 2   ? -2.341  12.127  8.130   1.00 46.89  ? 2   DG  B "C4'" 1 
ATOM   2672  O  "O4'" . DG  B  2 2   ? -2.495  13.517  8.501   1.00 48.00  ? 2   DG  B "O4'" 1 
ATOM   2673  C  "C3'" . DG  B  2 2   ? -3.729  11.669  7.693   1.00 47.95  ? 2   DG  B "C3'" 1 
ATOM   2674  O  "O3'" . DG  B  2 2   ? -4.400  11.190  8.858   1.00 57.70  ? 2   DG  B "O3'" 1 
ATOM   2675  C  "C2'" . DG  B  2 2   ? -4.346  12.948  7.161   1.00 45.37  ? 2   DG  B "C2'" 1 
ATOM   2676  C  "C1'" . DG  B  2 2   ? -3.811  13.964  8.155   1.00 44.70  ? 2   DG  B "C1'" 1 
ATOM   2677  N  N9    . DG  B  2 2   ? -3.705  15.337  7.665   1.00 38.65  ? 2   DG  B N9    1 
ATOM   2678  C  C8    . DG  B  2 2   ? -3.251  15.746  6.432   1.00 36.63  ? 2   DG  B C8    1 
ATOM   2679  N  N7    . DG  B  2 2   ? -3.240  17.046  6.295   1.00 35.43  ? 2   DG  B N7    1 
ATOM   2680  C  C5    . DG  B  2 2   ? -3.708  17.525  7.511   1.00 36.04  ? 2   DG  B C5    1 
ATOM   2681  C  C6    . DG  B  2 2   ? -3.923  18.854  7.953   1.00 33.18  ? 2   DG  B C6    1 
ATOM   2682  O  O6    . DG  B  2 2   ? -3.726  19.910  7.346   1.00 35.92  ? 2   DG  B O6    1 
ATOM   2683  N  N1    . DG  B  2 2   ? -4.424  18.887  9.249   1.00 37.44  ? 2   DG  B N1    1 
ATOM   2684  C  C2    . DG  B  2 2   ? -4.682  17.788  10.025  1.00 34.54  ? 2   DG  B C2    1 
ATOM   2685  N  N2    . DG  B  2 2   ? -5.170  18.035  11.248  1.00 33.81  ? 2   DG  B N2    1 
ATOM   2686  N  N3    . DG  B  2 2   ? -4.485  16.540  9.629   1.00 38.93  ? 2   DG  B N3    1 
ATOM   2687  C  C4    . DG  B  2 2   ? -4.008  16.483  8.366   1.00 38.13  ? 2   DG  B C4    1 
ATOM   2688  P  P     . DG  B  2 3   ? -5.892  10.646  8.759   1.00 63.31  ? 3   DG  B P     1 
ATOM   2689  O  OP1   . DG  B  2 3   ? -6.000  9.442   9.626   1.00 68.16  ? 3   DG  B OP1   1 
ATOM   2690  O  OP2   . DG  B  2 3   ? -6.245  10.565  7.322   1.00 58.10  ? 3   DG  B OP2   1 
ATOM   2691  O  "O5'" . DG  B  2 3   ? -6.733  11.813  9.441   1.00 58.43  ? 3   DG  B "O5'" 1 
ATOM   2692  C  "C5'" . DG  B  2 3   ? -6.686  12.011  10.863  1.00 55.00  ? 3   DG  B "C5'" 1 
ATOM   2693  C  "C4'" . DG  B  2 3   ? -7.738  13.013  11.277  1.00 52.67  ? 3   DG  B "C4'" 1 
ATOM   2694  O  "O4'" . DG  B  2 3   ? -7.418  14.333  10.772  1.00 55.47  ? 3   DG  B "O4'" 1 
ATOM   2695  C  "C3'" . DG  B  2 3   ? -9.144  12.703  10.773  1.00 47.90  ? 3   DG  B "C3'" 1 
ATOM   2696  O  "O3'" . DG  B  2 3   ? -10.016 13.020  11.855  1.00 46.06  ? 3   DG  B "O3'" 1 
ATOM   2697  C  "C2'" . DG  B  2 3   ? -9.293  13.614  9.567   1.00 45.63  ? 3   DG  B "C2'" 1 
ATOM   2698  C  "C1'" . DG  B  2 3   ? -8.490  14.838  9.997   1.00 49.20  ? 3   DG  B "C1'" 1 
ATOM   2699  N  N9    . DG  B  2 3   ? -7.923  15.644  8.917   1.00 41.37  ? 3   DG  B N9    1 
ATOM   2700  C  C8    . DG  B  2 3   ? -7.316  15.173  7.778   1.00 41.74  ? 3   DG  B C8    1 
ATOM   2701  N  N7    . DG  B  2 3   ? -6.939  16.125  6.966   1.00 41.12  ? 3   DG  B N7    1 
ATOM   2702  C  C5    . DG  B  2 3   ? -7.311  17.296  7.612   1.00 37.55  ? 3   DG  B C5    1 
ATOM   2703  C  C6    . DG  B  2 3   ? -7.131  18.644  7.233   1.00 34.44  ? 3   DG  B C6    1 
ATOM   2704  O  O6    . DG  B  2 3   ? -6.608  19.093  6.211   1.00 36.18  ? 3   DG  B O6    1 
ATOM   2705  N  N1    . DG  B  2 3   ? -7.632  19.515  8.188   1.00 30.79  ? 3   DG  B N1    1 
ATOM   2706  C  C2    . DG  B  2 3   ? -8.230  19.142  9.357   1.00 32.07  ? 3   DG  B C2    1 
ATOM   2707  N  N2    . DG  B  2 3   ? -8.650  20.142  10.139  1.00 33.49  ? 3   DG  B N2    1 
ATOM   2708  N  N3    . DG  B  2 3   ? -8.401  17.886  9.733   1.00 38.23  ? 3   DG  B N3    1 
ATOM   2709  C  C4    . DG  B  2 3   ? -7.923  17.019  8.816   1.00 41.13  ? 3   DG  B C4    1 
ATOM   2710  P  P     . DC  B  2 4   ? -11.554 12.664  11.750  1.00 45.01  ? 4   DC  B P     1 
ATOM   2711  O  OP1   . DC  B  2 4   ? -12.081 12.424  13.105  1.00 44.23  ? 4   DC  B OP1   1 
ATOM   2712  O  OP2   . DC  B  2 4   ? -11.713 11.673  10.671  1.00 42.49  ? 4   DC  B OP2   1 
ATOM   2713  O  "O5'" . DC  B  2 4   ? -12.202 14.046  11.316  1.00 42.88  ? 4   DC  B "O5'" 1 
ATOM   2714  C  "C5'" . DC  B  2 4   ? -12.134 15.147  12.224  1.00 40.46  ? 4   DC  B "C5'" 1 
ATOM   2715  C  "C4'" . DC  B  2 4   ? -12.754 16.354  11.565  1.00 37.33  ? 4   DC  B "C4'" 1 
ATOM   2716  O  "O4'" . DC  B  2 4   ? -11.835 16.876  10.583  1.00 33.82  ? 4   DC  B "O4'" 1 
ATOM   2717  C  "C3'" . DC  B  2 4   ? -14.066 16.074  10.822  1.00 33.91  ? 4   DC  B "C3'" 1 
ATOM   2718  O  "O3'" . DC  B  2 4   ? -15.107 16.833  11.415  1.00 31.12  ? 4   DC  B "O3'" 1 
ATOM   2719  C  "C2'" . DC  B  2 4   ? -13.830 16.596  9.417   1.00 34.14  ? 4   DC  B "C2'" 1 
ATOM   2720  C  "C1'" . DC  B  2 4   ? -12.592 17.472  9.566   1.00 33.38  ? 4   DC  B "C1'" 1 
ATOM   2721  N  N1    . DC  B  2 4   ? -11.762 17.543  8.350   1.00 27.41  ? 4   DC  B N1    1 
ATOM   2722  C  C2    . DC  B  2 4   ? -11.486 18.796  7.801   1.00 28.45  ? 4   DC  B C2    1 
ATOM   2723  O  O2    . DC  B  2 4   ? -11.877 19.806  8.398   1.00 27.03  ? 4   DC  B O2    1 
ATOM   2724  N  N3    . DC  B  2 4   ? -10.752 18.876  6.665   1.00 25.05  ? 4   DC  B N3    1 
ATOM   2725  C  C4    . DC  B  2 4   ? -10.318 17.759  6.079   1.00 26.65  ? 4   DC  B C4    1 
ATOM   2726  N  N4    . DC  B  2 4   ? -9.601  17.876  4.964   1.00 29.98  ? 4   DC  B N4    1 
ATOM   2727  C  C5    . DC  B  2 4   ? -10.615 16.468  6.603   1.00 26.59  ? 4   DC  B C5    1 
ATOM   2728  C  C6    . DC  B  2 4   ? -11.335 16.408  7.727   1.00 26.02  ? 4   DC  B C6    1 
ATOM   2729  P  P     . DG  B  2 5   ? -16.629 16.629  10.987  1.00 29.16  ? 5   DG  B P     1 
ATOM   2730  O  OP1   . DG  B  2 5   ? -16.693 16.003  9.660   1.00 29.07  ? 5   DG  B OP1   1 
ATOM   2731  O  OP2   . DG  B  2 5   ? -17.300 17.880  11.257  1.00 27.62  ? 5   DG  B OP2   1 
ATOM   2732  O  "O5'" . DG  B  2 5   ? -17.146 15.536  12.028  1.00 24.50  ? 5   DG  B "O5'" 1 
ATOM   2733  C  "C5'" . DG  B  2 5   ? -17.247 15.915  13.409  1.00 22.95  ? 5   DG  B "C5'" 1 
ATOM   2734  C  "C4'" . DG  B  2 5   ? -18.163 14.963  14.144  1.00 21.85  ? 5   DG  B "C4'" 1 
ATOM   2735  O  "O4'" . DG  B  2 5   ? -19.530 15.056  13.648  1.00 17.87  ? 5   DG  B "O4'" 1 
ATOM   2736  C  "C3'" . DG  B  2 5   ? -17.759 13.502  13.995  1.00 20.18  ? 5   DG  B "C3'" 1 
ATOM   2737  O  "O3'" . DG  B  2 5   ? -18.030 12.882  15.235  1.00 21.36  ? 5   DG  B "O3'" 1 
ATOM   2738  C  "C2'" . DG  B  2 5   ? -18.635 13.004  12.849  1.00 20.31  ? 5   DG  B "C2'" 1 
ATOM   2739  C  "C1'" . DG  B  2 5   ? -19.889 13.883  12.925  1.00 19.38  ? 5   DG  B "C1'" 1 
ATOM   2740  N  N9    . DG  B  2 5   ? -20.493 14.346  11.687  1.00 19.12  ? 5   DG  B N9    1 
ATOM   2741  C  C8    . DG  B  2 5   ? -19.866 14.725  10.527  1.00 19.99  ? 5   DG  B C8    1 
ATOM   2742  N  N7    . DG  B  2 5   ? -20.685 15.238  9.649   1.00 20.48  ? 5   DG  B N7    1 
ATOM   2743  C  C5    . DG  B  2 5   ? -21.910 15.256  10.294  1.00 19.91  ? 5   DG  B C5    1 
ATOM   2744  C  C6    . DG  B  2 5   ? -23.170 15.735  9.862   1.00 18.71  ? 5   DG  B C6    1 
ATOM   2745  O  O6    . DG  B  2 5   ? -23.467 16.256  8.792   1.00 17.94  ? 5   DG  B O6    1 
ATOM   2746  N  N1    . DG  B  2 5   ? -24.138 15.576  10.841  1.00 17.87  ? 5   DG  B N1    1 
ATOM   2747  C  C2    . DG  B  2 5   ? -23.925 15.031  12.080  1.00 19.39  ? 5   DG  B C2    1 
ATOM   2748  N  N2    . DG  B  2 5   ? -24.989 14.975  12.897  1.00 20.64  ? 5   DG  B N2    1 
ATOM   2749  N  N3    . DG  B  2 5   ? -22.762 14.566  12.490  1.00 18.49  ? 5   DG  B N3    1 
ATOM   2750  C  C4    . DG  B  2 5   ? -21.803 14.721  11.559  1.00 18.85  ? 5   DG  B C4    1 
ATOM   2751  P  P     . DG  B  2 6   ? -17.648 11.326  15.442  1.00 22.47  ? 6   DG  B P     1 
ATOM   2752  O  OP1   . DG  B  2 6   ? -17.462 11.116  16.897  1.00 18.95  ? 6   DG  B OP1   1 
ATOM   2753  O  OP2   . DG  B  2 6   ? -16.614 10.986  14.417  1.00 21.10  ? 6   DG  B OP2   1 
ATOM   2754  O  "O5'" . DG  B  2 6   ? -18.987 10.542  15.092  1.00 22.73  ? 6   DG  B "O5'" 1 
ATOM   2755  C  "C5'" . DG  B  2 6   ? -20.127 10.705  15.961  1.00 23.26  ? 6   DG  B "C5'" 1 
ATOM   2756  C  "C4'" . DG  B  2 6   ? -21.324 10.014  15.367  1.00 23.03  ? 6   DG  B "C4'" 1 
ATOM   2757  O  "O4'" . DG  B  2 6   ? -21.838 10.749  14.218  1.00 22.46  ? 6   DG  B "O4'" 1 
ATOM   2758  C  "C3'" . DG  B  2 6   ? -21.045 8.588   14.883  1.00 24.13  ? 6   DG  B "C3'" 1 
ATOM   2759  O  "O3'" . DG  B  2 6   ? -22.124 7.874   15.495  1.00 25.62  ? 6   DG  B "O3'" 1 
ATOM   2760  C  "C2'" . DG  B  2 6   ? -21.041 8.729   13.371  1.00 23.10  ? 6   DG  B "C2'" 1 
ATOM   2761  C  "C1'" . DG  B  2 6   ? -22.085 9.820   13.188  1.00 24.19  ? 6   DG  B "C1'" 1 
ATOM   2762  N  N9    . DG  B  2 6   ? -22.045 10.530  11.917  1.00 22.78  ? 6   DG  B N9    1 
ATOM   2763  C  C8    . DG  B  2 6   ? -20.962 10.766  11.110  1.00 21.09  ? 6   DG  B C8    1 
ATOM   2764  N  N7    . DG  B  2 6   ? -21.273 11.395  10.011  1.00 21.20  ? 6   DG  B N7    1 
ATOM   2765  C  C5    . DG  B  2 6   ? -22.639 11.616  10.117  1.00 19.99  ? 6   DG  B C5    1 
ATOM   2766  C  C6    . DG  B  2 6   ? -23.538 12.261  9.230   1.00 20.62  ? 6   DG  B C6    1 
ATOM   2767  O  O6    . DG  B  2 6   ? -23.296 12.797  8.149   1.00 21.85  ? 6   DG  B O6    1 
ATOM   2768  N  N1    . DG  B  2 6   ? -24.845 12.203  9.696   1.00 21.78  ? 6   DG  B N1    1 
ATOM   2769  C  C2    . DG  B  2 6   ? -25.229 11.641  10.890  1.00 20.19  ? 6   DG  B C2    1 
ATOM   2770  N  N2    . DG  B  2 6   ? -26.520 11.728  11.200  1.00 21.76  ? 6   DG  B N2    1 
ATOM   2771  N  N3    . DG  B  2 6   ? -24.393 11.089  11.747  1.00 19.59  ? 6   DG  B N3    1 
ATOM   2772  C  C4    . DG  B  2 6   ? -23.130 11.078  11.282  1.00 20.80  ? 6   DG  B C4    1 
ATOM   2773  P  P     . DT  B  2 7   ? -22.334 6.322   15.278  1.00 23.97  ? 7   DT  B P     1 
ATOM   2774  O  OP1   . DT  B  2 7   ? -22.866 5.777   16.560  1.00 23.54  ? 7   DT  B OP1   1 
ATOM   2775  O  OP2   . DT  B  2 7   ? -21.101 5.788   14.645  1.00 28.28  ? 7   DT  B OP2   1 
ATOM   2776  O  "O5'" . DT  B  2 7   ? -23.568 6.295   14.258  1.00 28.96  ? 7   DT  B "O5'" 1 
ATOM   2777  C  "C5'" . DT  B  2 7   ? -24.803 6.947   14.622  1.00 24.49  ? 7   DT  B "C5'" 1 
ATOM   2778  C  "C4'" . DT  B  2 7   ? -25.737 7.057   13.441  1.00 26.39  ? 7   DT  B "C4'" 1 
ATOM   2779  O  "O4'" . DT  B  2 7   ? -25.144 7.914   12.443  1.00 25.83  ? 7   DT  B "O4'" 1 
ATOM   2780  C  "C3'" . DT  B  2 7   ? -26.053 5.727   12.744  1.00 26.44  ? 7   DT  B "C3'" 1 
ATOM   2781  O  "O3'" . DT  B  2 7   ? -27.391 5.364   13.078  1.00 24.90  ? 7   DT  B "O3'" 1 
ATOM   2782  C  "C2'" . DT  B  2 7   ? -25.796 6.000   11.271  1.00 26.31  ? 7   DT  B "C2'" 1 
ATOM   2783  C  "C1'" . DT  B  2 7   ? -25.660 7.518   11.206  1.00 26.31  ? 7   DT  B "C1'" 1 
ATOM   2784  N  N1    . DT  B  2 7   ? -24.772 8.046   10.147  1.00 26.43  ? 7   DT  B N1    1 
ATOM   2785  C  C2    . DT  B  2 7   ? -25.383 8.800   9.169   1.00 23.23  ? 7   DT  B C2    1 
ATOM   2786  O  O2    . DT  B  2 7   ? -26.577 9.049   9.168   1.00 23.90  ? 7   DT  B O2    1 
ATOM   2787  N  N3    . DT  B  2 7   ? -24.544 9.248   8.186   1.00 25.51  ? 7   DT  B N3    1 
ATOM   2788  C  C4    . DT  B  2 7   ? -23.197 8.982   8.053   1.00 23.27  ? 7   DT  B C4    1 
ATOM   2789  O  O4    . DT  B  2 7   ? -22.583 9.436   7.097   1.00 24.98  ? 7   DT  B O4    1 
ATOM   2790  C  C5    . DT  B  2 7   ? -22.628 8.138   9.082   1.00 23.29  ? 7   DT  B C5    1 
ATOM   2791  C  C7    . DT  B  2 7   ? -21.174 7.794   9.011   1.00 22.46  ? 7   DT  B C7    1 
ATOM   2792  C  C6    . DT  B  2 7   ? -23.432 7.723   10.072  1.00 23.44  ? 7   DT  B C6    1 
ATOM   2793  P  P     . DA  B  2 8   ? -28.072 4.015   12.450  1.00 24.56  ? 8   DA  B P     1 
ATOM   2794  O  OP1   . DA  B  2 8   ? -29.164 3.604   13.406  1.00 24.85  ? 8   DA  B OP1   1 
ATOM   2795  O  OP2   . DA  B  2 8   ? -27.014 3.117   12.064  1.00 28.27  ? 8   DA  B OP2   1 
ATOM   2796  O  "O5'" . DA  B  2 8   ? -28.733 4.544   11.102  1.00 25.32  ? 8   DA  B "O5'" 1 
ATOM   2797  C  "C5'" . DA  B  2 8   ? -29.738 5.566   11.227  1.00 26.04  ? 8   DA  B "C5'" 1 
ATOM   2798  C  "C4'" . DA  B  2 8   ? -30.527 5.703   9.946   1.00 28.90  ? 8   DA  B "C4'" 1 
ATOM   2799  O  "O4'" . DA  B  2 8   ? -29.693 6.335   8.953   1.00 27.45  ? 8   DA  B "O4'" 1 
ATOM   2800  C  "C3'" . DA  B  2 8   ? -31.024 4.397   9.323   1.00 27.79  ? 8   DA  B "C3'" 1 
ATOM   2801  O  "O3'" . DA  B  2 8   ? -32.419 4.665   9.032   1.00 34.11  ? 8   DA  B "O3'" 1 
ATOM   2802  C  "C2'" . DA  B  2 8   ? -30.000 4.127   8.228   1.00 28.33  ? 8   DA  B "C2'" 1 
ATOM   2803  C  "C1'" . DA  B  2 8   ? -29.536 5.530   7.815   1.00 26.58  ? 8   DA  B "C1'" 1 
ATOM   2804  N  N9    . DA  B  2 8   ? -28.171 5.747   7.329   1.00 21.68  ? 8   DA  B N9    1 
ATOM   2805  C  C8    . DA  B  2 8   ? -26.996 5.345   7.902   1.00 23.18  ? 8   DA  B C8    1 
ATOM   2806  N  N7    . DA  B  2 8   ? -25.928 5.742   7.254   1.00 23.93  ? 8   DA  B N7    1 
ATOM   2807  C  C5    . DA  B  2 8   ? -26.436 6.483   6.196   1.00 23.19  ? 8   DA  B C5    1 
ATOM   2808  C  C6    . DA  B  2 8   ? -25.818 7.214   5.163   1.00 24.01  ? 8   DA  B C6    1 
ATOM   2809  N  N6    . DA  B  2 8   ? -24.499 7.296   4.997   1.00 22.84  ? 8   DA  B N6    1 
ATOM   2810  N  N1    . DA  B  2 8   ? -26.615 7.876   4.296   1.00 24.33  ? 8   DA  B N1    1 
ATOM   2811  C  C2    . DA  B  2 8   ? -27.940 7.790   4.455   1.00 23.52  ? 8   DA  B C2    1 
ATOM   2812  N  N3    . DA  B  2 8   ? -28.635 7.154   5.393   1.00 25.29  ? 8   DA  B N3    1 
ATOM   2813  C  C4    . DA  B  2 8   ? -27.815 6.518   6.248   1.00 22.82  ? 8   DA  B C4    1 
ATOM   2814  P  P     . DC  B  2 9   ? -33.430 3.499   8.542   1.00 32.51  ? 9   DC  B P     1 
ATOM   2815  O  OP1   . DC  B  2 9   ? -34.848 3.727   9.071   1.00 31.13  ? 9   DC  B OP1   1 
ATOM   2816  O  OP2   . DC  B  2 9   ? -32.725 2.197   8.657   1.00 28.60  ? 9   DC  B OP2   1 
ATOM   2817  O  "O5'" . DC  B  2 9   ? -33.655 3.828   6.993   1.00 27.90  ? 9   DC  B "O5'" 1 
ATOM   2818  C  "C5'" . DC  B  2 9   ? -33.033 3.068   5.934   1.00 25.56  ? 9   DC  B "C5'" 1 
ATOM   2819  C  "C4'" . DC  B  2 9   ? -33.177 3.861   4.660   1.00 23.23  ? 9   DC  B "C4'" 1 
ATOM   2820  O  "O4'" . DC  B  2 9   ? -31.956 4.592   4.473   1.00 19.93  ? 9   DC  B "O4'" 1 
ATOM   2821  C  "C3'" . DC  B  2 9   ? -33.447 3.091   3.358   1.00 22.96  ? 9   DC  B "C3'" 1 
ATOM   2822  O  "O3'" . DC  B  2 9   ? -34.516 3.741   2.658   1.00 23.95  ? 9   DC  B "O3'" 1 
ATOM   2823  C  "C2'" . DC  B  2 9   ? -32.119 3.148   2.631   1.00 21.45  ? 9   DC  B "C2'" 1 
ATOM   2824  C  "C1'" . DC  B  2 9   ? -31.456 4.409   3.174   1.00 20.75  ? 9   DC  B "C1'" 1 
ATOM   2825  N  N1    . DC  B  2 9   ? -30.002 4.328   3.288   1.00 20.77  ? 9   DC  B N1    1 
ATOM   2826  C  C2    . DC  B  2 9   ? -29.200 4.999   2.360   1.00 21.90  ? 9   DC  B C2    1 
ATOM   2827  O  O2    . DC  B  2 9   ? -29.744 5.604   1.420   1.00 25.83  ? 9   DC  B O2    1 
ATOM   2828  N  N3    . DC  B  2 9   ? -27.855 4.949   2.494   1.00 21.12  ? 9   DC  B N3    1 
ATOM   2829  C  C4    . DC  B  2 9   ? -27.311 4.240   3.489   1.00 20.52  ? 9   DC  B C4    1 
ATOM   2830  N  N4    . DC  B  2 9   ? -25.986 4.172   3.554   1.00 21.10  ? 9   DC  B N4    1 
ATOM   2831  C  C5    . DC  B  2 9   ? -28.105 3.538   4.437   1.00 19.82  ? 9   DC  B C5    1 
ATOM   2832  C  C6    . DC  B  2 9   ? -29.433 3.630   4.318   1.00 20.14  ? 9   DC  B C6    1 
ATOM   2833  P  P     . DT  B  2 10  ? -35.291 3.037   1.452   1.00 26.65  ? 10  DT  B P     1 
ATOM   2834  O  OP1   . DT  B  2 10  ? -36.544 3.823   1.211   1.00 27.79  ? 10  DT  B OP1   1 
ATOM   2835  O  OP2   . DT  B  2 10  ? -35.311 1.606   1.682   1.00 28.40  ? 10  DT  B OP2   1 
ATOM   2836  O  "O5'" . DT  B  2 10  ? -34.290 3.173   0.231   1.00 23.69  ? 10  DT  B "O5'" 1 
ATOM   2837  C  "C5'" . DT  B  2 10  ? -34.210 4.403   -0.483  1.00 22.96  ? 10  DT  B "C5'" 1 
ATOM   2838  C  "C4'" . DT  B  2 10  ? -33.151 4.322   -1.552  1.00 23.40  ? 10  DT  B "C4'" 1 
ATOM   2839  O  "O4'" . DT  B  2 10  ? -31.833 4.143   -0.975  1.00 21.77  ? 10  DT  B "O4'" 1 
ATOM   2840  C  "C3'" . DT  B  2 10  ? -33.356 3.163   -2.523  1.00 25.34  ? 10  DT  B "C3'" 1 
ATOM   2841  O  "O3'" . DT  B  2 10  ? -33.528 3.800   -3.782  1.00 28.07  ? 10  DT  B "O3'" 1 
ATOM   2842  C  "C2'" . DT  B  2 10  ? -32.085 2.318   -2.386  1.00 24.33  ? 10  DT  B "C2'" 1 
ATOM   2843  C  "C1'" . DT  B  2 10  ? -31.072 3.317   -1.835  1.00 23.02  ? 10  DT  B "C1'" 1 
ATOM   2844  N  N1    . DT  B  2 10  ? -29.929 2.805   -1.044  1.00 22.27  ? 10  DT  B N1    1 
ATOM   2845  C  C2    . DT  B  2 10  ? -28.682 3.292   -1.350  1.00 20.52  ? 10  DT  B C2    1 
ATOM   2846  O  O2    . DT  B  2 10  ? -28.475 4.022   -2.295  1.00 24.78  ? 10  DT  B O2    1 
ATOM   2847  N  N3    . DT  B  2 10  ? -27.669 2.830   -0.545  1.00 19.86  ? 10  DT  B N3    1 
ATOM   2848  C  C4    . DT  B  2 10  ? -27.792 2.000   0.547   1.00 20.70  ? 10  DT  B C4    1 
ATOM   2849  O  O4    . DT  B  2 10  ? -26.807 1.741   1.237   1.00 21.57  ? 10  DT  B O4    1 
ATOM   2850  C  C5    . DT  B  2 10  ? -29.130 1.519   0.808   1.00 21.66  ? 10  DT  B C5    1 
ATOM   2851  C  C7    . DT  B  2 10  ? -29.356 0.630   1.990   1.00 21.07  ? 10  DT  B C7    1 
ATOM   2852  C  C6    . DT  B  2 10  ? -30.126 1.977   0.040   1.00 20.68  ? 10  DT  B C6    1 
ATOM   2853  P  P     . DG  B  2 11  ? -34.061 2.958   -5.060  1.00 32.97  ? 11  DG  B P     1 
ATOM   2854  O  OP1   . DG  B  2 11  ? -34.689 3.953   -5.982  1.00 33.53  ? 11  DG  B OP1   1 
ATOM   2855  O  OP2   . DG  B  2 11  ? -34.799 1.771   -4.566  1.00 30.41  ? 11  DG  B OP2   1 
ATOM   2856  O  "O5'" . DG  B  2 11  ? -32.729 2.429   -5.760  1.00 30.89  ? 11  DG  B "O5'" 1 
ATOM   2857  C  "C5'" . DG  B  2 11  ? -31.793 3.354   -6.356  1.00 32.66  ? 11  DG  B "C5'" 1 
ATOM   2858  C  "C4'" . DG  B  2 11  ? -30.500 2.653   -6.691  1.00 34.20  ? 11  DG  B "C4'" 1 
ATOM   2859  O  "O4'" . DG  B  2 11  ? -29.743 2.366   -5.480  1.00 33.89  ? 11  DG  B "O4'" 1 
ATOM   2860  C  "C3'" . DG  B  2 11  ? -30.654 1.310   -7.424  1.00 35.49  ? 11  DG  B "C3'" 1 
ATOM   2861  O  "O3'" . DG  B  2 11  ? -29.670 1.253   -8.478  1.00 38.41  ? 11  DG  B "O3'" 1 
ATOM   2862  C  "C2'" . DG  B  2 11  ? -30.313 0.285   -6.355  1.00 33.41  ? 11  DG  B "C2'" 1 
ATOM   2863  C  "C1'" . DG  B  2 11  ? -29.229 1.051   -5.608  1.00 31.51  ? 11  DG  B "C1'" 1 
ATOM   2864  N  N9    . DG  B  2 11  ? -28.870 0.551   -4.286  1.00 29.34  ? 11  DG  B N9    1 
ATOM   2865  C  C8    . DG  B  2 11  ? -29.692 -0.090  -3.391  1.00 29.99  ? 11  DG  B C8    1 
ATOM   2866  N  N7    . DG  B  2 11  ? -29.077 -0.444  -2.297  1.00 31.05  ? 11  DG  B N7    1 
ATOM   2867  C  C5    . DG  B  2 11  ? -27.765 -0.046  -2.495  1.00 24.06  ? 11  DG  B C5    1 
ATOM   2868  C  C6    . DG  B  2 11  ? -26.632 -0.179  -1.660  1.00 25.75  ? 11  DG  B C6    1 
ATOM   2869  O  O6    . DG  B  2 11  ? -26.557 -0.693  -0.539  1.00 25.72  ? 11  DG  B O6    1 
ATOM   2870  N  N1    . DG  B  2 11  ? -25.496 0.358   -2.251  1.00 26.49  ? 11  DG  B N1    1 
ATOM   2871  C  C2    . DG  B  2 11  ? -25.464 0.972   -3.480  1.00 28.10  ? 11  DG  B C2    1 
ATOM   2872  N  N2    . DG  B  2 11  ? -24.280 1.449   -3.874  1.00 31.30  ? 11  DG  B N2    1 
ATOM   2873  N  N3    . DG  B  2 11  ? -26.517 1.120   -4.257  1.00 28.26  ? 11  DG  B N3    1 
ATOM   2874  C  C4    . DG  B  2 11  ? -27.628 0.601   -3.704  1.00 27.38  ? 11  DG  B C4    1 
ATOM   2875  O  "O5'" . DC  C  3 1   ? -17.041 -2.191  -0.366  1.00 61.11  ? 1   DC  C "O5'" 1 
ATOM   2876  C  "C5'" . DC  C  3 1   ? -16.321 -1.336  -1.293  1.00 52.92  ? 1   DC  C "C5'" 1 
ATOM   2877  C  "C4'" . DC  C  3 1   ? -17.268 -0.364  -1.965  1.00 51.54  ? 1   DC  C "C4'" 1 
ATOM   2878  O  "O4'" . DC  C  3 1   ? -18.661 -0.749  -2.051  1.00 40.19  ? 1   DC  C "O4'" 1 
ATOM   2879  C  "C3'" . DC  C  3 1   ? -17.182 1.148   -1.748  1.00 45.54  ? 1   DC  C "C3'" 1 
ATOM   2880  O  "O3'" . DC  C  3 1   ? -16.562 1.854   -2.827  1.00 52.11  ? 1   DC  C "O3'" 1 
ATOM   2881  C  "C2'" . DC  C  3 1   ? -18.632 1.588   -1.640  1.00 44.26  ? 1   DC  C "C2'" 1 
ATOM   2882  C  "C1'" . DC  C  3 1   ? -19.474 0.406   -2.112  1.00 39.44  ? 1   DC  C "C1'" 1 
ATOM   2883  N  N1    . DC  C  3 1   ? -20.646 0.179   -1.262  1.00 30.79  ? 1   DC  C N1    1 
ATOM   2884  C  C2    . DC  C  3 1   ? -21.898 0.377   -1.814  1.00 30.61  ? 1   DC  C C2    1 
ATOM   2885  O  O2    . DC  C  3 1   ? -21.978 0.694   -3.003  1.00 35.35  ? 1   DC  C O2    1 
ATOM   2886  N  N3    . DC  C  3 1   ? -22.998 0.214   -1.045  1.00 30.37  ? 1   DC  C N3    1 
ATOM   2887  C  C4    . DC  C  3 1   ? -22.871 -0.151  0.232   1.00 25.66  ? 1   DC  C C4    1 
ATOM   2888  N  N4    . DC  C  3 1   ? -23.987 -0.353  0.934   1.00 24.91  ? 1   DC  C N4    1 
ATOM   2889  C  C5    . DC  C  3 1   ? -21.599 -0.372  0.824   1.00 27.47  ? 1   DC  C C5    1 
ATOM   2890  C  C6    . DC  C  3 1   ? -20.518 -0.189  0.049   1.00 30.25  ? 1   DC  C C6    1 
ATOM   2891  P  P     . DA  C  3 2   ? -16.255 3.441   -2.677  1.00 57.19  ? 2   DA  C P     1 
ATOM   2892  O  OP1   . DA  C  3 2   ? -15.142 3.782   -3.592  1.00 67.21  ? 2   DA  C OP1   1 
ATOM   2893  O  OP2   . DA  C  3 2   ? -16.139 3.768   -1.233  1.00 56.99  ? 2   DA  C OP2   1 
ATOM   2894  O  "O5'" . DA  C  3 2   ? -17.559 4.102   -3.303  1.00 53.33  ? 2   DA  C "O5'" 1 
ATOM   2895  C  "C5'" . DA  C  3 2   ? -18.017 3.672   -4.597  1.00 43.43  ? 2   DA  C "C5'" 1 
ATOM   2896  C  "C4'" . DA  C  3 2   ? -19.099 4.601   -5.089  1.00 42.84  ? 2   DA  C "C4'" 1 
ATOM   2897  O  "O4'" . DA  C  3 2   ? -20.383 4.245   -4.513  1.00 38.74  ? 2   DA  C "O4'" 1 
ATOM   2898  C  "C3'" . DA  C  3 2   ? -18.884 6.067   -4.742  1.00 39.71  ? 2   DA  C "C3'" 1 
ATOM   2899  O  "O3'" . DA  C  3 2   ? -19.389 6.804   -5.860  1.00 39.02  ? 2   DA  C "O3'" 1 
ATOM   2900  C  "C2'" . DA  C  3 2   ? -19.668 6.229   -3.451  1.00 38.92  ? 2   DA  C "C2'" 1 
ATOM   2901  C  "C1'" . DA  C  3 2   ? -20.848 5.282   -3.653  1.00 38.19  ? 2   DA  C "C1'" 1 
ATOM   2902  N  N9    . DA  C  3 2   ? -21.401 4.658   -2.441  1.00 29.56  ? 2   DA  C N9    1 
ATOM   2903  C  C8    . DA  C  3 2   ? -20.750 4.240   -1.309  1.00 27.17  ? 2   DA  C C8    1 
ATOM   2904  N  N7    . DA  C  3 2   ? -21.542 3.702   -0.414  1.00 28.16  ? 2   DA  C N7    1 
ATOM   2905  C  C5    . DA  C  3 2   ? -22.801 3.781   -0.993  1.00 25.05  ? 2   DA  C C5    1 
ATOM   2906  C  C6    . DA  C  3 2   ? -24.076 3.404   -0.542  1.00 23.96  ? 2   DA  C C6    1 
ATOM   2907  N  N6    . DA  C  3 2   ? -24.310 2.829   0.638   1.00 22.42  ? 2   DA  C N6    1 
ATOM   2908  N  N1    . DA  C  3 2   ? -25.125 3.654   -1.351  1.00 25.71  ? 2   DA  C N1    1 
ATOM   2909  C  C2    . DA  C  3 2   ? -24.897 4.218   -2.539  1.00 25.26  ? 2   DA  C C2    1 
ATOM   2910  N  N3    . DA  C  3 2   ? -23.750 4.625   -3.068  1.00 28.41  ? 2   DA  C N3    1 
ATOM   2911  C  C4    . DA  C  3 2   ? -22.727 4.361   -2.242  1.00 25.34  ? 2   DA  C C4    1 
ATOM   2912  P  P     . DG  C  3 3   ? -19.325 8.389   -5.893  1.00 39.41  ? 3   DG  C P     1 
ATOM   2913  O  OP1   . DG  C  3 3   ? -19.292 8.798   -7.308  1.00 41.12  ? 3   DG  C OP1   1 
ATOM   2914  O  OP2   . DG  C  3 3   ? -18.312 8.861   -4.918  1.00 36.74  ? 3   DG  C OP2   1 
ATOM   2915  O  "O5'" . DG  C  3 3   ? -20.769 8.819   -5.362  1.00 35.08  ? 3   DG  C "O5'" 1 
ATOM   2916  C  "C5'" . DG  C  3 3   ? -21.939 8.447   -6.134  1.00 30.78  ? 3   DG  C "C5'" 1 
ATOM   2917  C  "C4'" . DG  C  3 3   ? -23.207 8.837   -5.410  1.00 26.83  ? 3   DG  C "C4'" 1 
ATOM   2918  O  "O4'" . DG  C  3 3   ? -23.381 8.013   -4.239  1.00 24.99  ? 3   DG  C "O4'" 1 
ATOM   2919  C  "C3'" . DG  C  3 3   ? -23.220 10.285  -4.914  1.00 25.96  ? 3   DG  C "C3'" 1 
ATOM   2920  O  "O3'" . DG  C  3 3   ? -24.237 10.983  -5.617  1.00 21.41  ? 3   DG  C "O3'" 1 
ATOM   2921  C  "C2'" . DG  C  3 3   ? -23.384 10.163  -3.402  1.00 24.32  ? 3   DG  C "C2'" 1 
ATOM   2922  C  "C1'" . DG  C  3 3   ? -24.011 8.788   -3.263  1.00 23.01  ? 3   DG  C "C1'" 1 
ATOM   2923  N  N9    . DG  C  3 3   ? -23.799 8.138   -1.974  1.00 24.50  ? 3   DG  C N9    1 
ATOM   2924  C  C8    . DG  C  3 3   ? -22.596 7.972   -1.334  1.00 22.42  ? 3   DG  C C8    1 
ATOM   2925  N  N7    . DG  C  3 3   ? -22.708 7.357   -0.187  1.00 25.74  ? 3   DG  C N7    1 
ATOM   2926  C  C5    . DG  C  3 3   ? -24.062 7.072   -0.074  1.00 22.15  ? 3   DG  C C5    1 
ATOM   2927  C  C6    . DG  C  3 3   ? -24.786 6.443   0.972   1.00 20.99  ? 3   DG  C C6    1 
ATOM   2928  O  O6    . DG  C  3 3   ? -24.357 5.958   2.027   1.00 21.86  ? 3   DG  C O6    1 
ATOM   2929  N  N1    . DG  C  3 3   ? -26.152 6.427   0.711   1.00 20.76  ? 3   DG  C N1    1 
ATOM   2930  C  C2    . DG  C  3 3   ? -26.742 6.909   -0.435  1.00 20.91  ? 3   DG  C C2    1 
ATOM   2931  N  N2    . DG  C  3 3   ? -28.075 6.746   -0.534  1.00 20.78  ? 3   DG  C N2    1 
ATOM   2932  N  N3    . DG  C  3 3   ? -26.080 7.507   -1.410  1.00 20.77  ? 3   DG  C N3    1 
ATOM   2933  C  C4    . DG  C  3 3   ? -24.755 7.561   -1.162  1.00 24.02  ? 3   DG  C C4    1 
ATOM   2934  P  P     . DT  C  3 4   ? -24.451 12.486  -5.310  1.00 22.59  ? 4   DT  C P     1 
ATOM   2935  O  OP1   . DT  C  3 4   ? -25.207 13.113  -6.404  1.00 21.12  ? 4   DT  C OP1   1 
ATOM   2936  O  OP2   . DT  C  3 4   ? -23.133 13.042  -4.968  1.00 20.98  ? 4   DT  C OP2   1 
ATOM   2937  O  "O5'" . DT  C  3 4   ? -25.437 12.422  -4.081  1.00 21.26  ? 4   DT  C "O5'" 1 
ATOM   2938  C  "C5'" . DT  C  3 4   ? -26.764 11.885  -4.245  1.00 22.70  ? 4   DT  C "C5'" 1 
ATOM   2939  C  "C4'" . DT  C  3 4   ? -27.501 11.928  -2.931  1.00 21.11  ? 4   DT  C "C4'" 1 
ATOM   2940  O  "O4'" . DT  C  3 4   ? -26.874 10.994  -2.028  1.00 22.58  ? 4   DT  C "O4'" 1 
ATOM   2941  C  "C3'" . DT  C  3 4   ? -27.414 13.289  -2.240  1.00 22.43  ? 4   DT  C "C3'" 1 
ATOM   2942  O  "O3'" . DT  C  3 4   ? -28.625 14.023  -2.438  1.00 20.88  ? 4   DT  C "O3'" 1 
ATOM   2943  C  "C2'" . DT  C  3 4   ? -27.071 12.947  -0.795  1.00 23.80  ? 4   DT  C "C2'" 1 
ATOM   2944  C  "C1'" . DT  C  3 4   ? -27.166 11.427  -0.724  1.00 23.48  ? 4   DT  C "C1'" 1 
ATOM   2945  N  N1    . DT  C  3 4   ? -26.196 10.798  0.195   1.00 24.46  ? 4   DT  C N1    1 
ATOM   2946  C  C2    . DT  C  3 4   ? -26.659 9.971   1.196   1.00 23.29  ? 4   DT  C C2    1 
ATOM   2947  O  O2    . DT  C  3 4   ? -27.837 9.722   1.361   1.00 21.35  ? 4   DT  C O2    1 
ATOM   2948  N  N3    . DT  C  3 4   ? -25.679 9.412   1.976   1.00 25.33  ? 4   DT  C N3    1 
ATOM   2949  C  C4    . DT  C  3 4   ? -24.321 9.640   1.895   1.00 25.67  ? 4   DT  C C4    1 
ATOM   2950  O  O4    . DT  C  3 4   ? -23.570 9.102   2.694   1.00 30.10  ? 4   DT  C O4    1 
ATOM   2951  C  C5    . DT  C  3 4   ? -23.903 10.520  0.824   1.00 26.80  ? 4   DT  C C5    1 
ATOM   2952  C  C7    . DT  C  3 4   ? -22.445 10.803  0.638   1.00 24.87  ? 4   DT  C C7    1 
ATOM   2953  C  C6    . DT  C  3 4   ? -24.850 11.051  0.042   1.00 25.64  ? 4   DT  C C6    1 
ATOM   2954  P  P     . DA  C  3 5   ? -28.870 15.340  -1.654  1.00 18.90  ? 5   DA  C P     1 
ATOM   2955  O  OP1   . DA  C  3 5   ? -29.986 16.068  -2.288  1.00 21.97  ? 5   DA  C OP1   1 
ATOM   2956  O  OP2   . DA  C  3 5   ? -27.570 15.981  -1.473  1.00 22.78  ? 5   DA  C OP2   1 
ATOM   2957  O  "O5'" . DA  C  3 5   ? -29.406 14.888  -0.226  1.00 19.01  ? 5   DA  C "O5'" 1 
ATOM   2958  C  "C5'" . DA  C  3 5   ? -30.531 13.993  -0.119  1.00 17.90  ? 5   DA  C "C5'" 1 
ATOM   2959  C  "C4'" . DA  C  3 5   ? -30.665 13.499  1.294   1.00 18.79  ? 5   DA  C "C4'" 1 
ATOM   2960  O  "O4'" . DA  C  3 5   ? -29.532 12.685  1.655   1.00 19.97  ? 5   DA  C "O4'" 1 
ATOM   2961  C  "C3'" . DA  C  3 5   ? -30.702 14.587  2.354   1.00 19.87  ? 5   DA  C "C3'" 1 
ATOM   2962  O  "O3'" . DA  C  3 5   ? -32.021 15.007  2.675   1.00 20.23  ? 5   DA  C "O3'" 1 
ATOM   2963  C  "C2'" . DA  C  3 5   ? -30.137 13.911  3.586   1.00 20.49  ? 5   DA  C "C2'" 1 
ATOM   2964  C  "C1'" . DA  C  3 5   ? -29.419 12.682  3.069   1.00 20.69  ? 5   DA  C "C1'" 1 
ATOM   2965  N  N9    . DA  C  3 5   ? -28.003 12.607  3.398   1.00 20.00  ? 5   DA  C N9    1 
ATOM   2966  C  C8    . DA  C  3 5   ? -26.947 13.192  2.758   1.00 18.67  ? 5   DA  C C8    1 
ATOM   2967  N  N7    . DA  C  3 5   ? -25.782 12.863  3.253   1.00 19.95  ? 5   DA  C N7    1 
ATOM   2968  C  C5    . DA  C  3 5   ? -26.090 11.961  4.258   1.00 18.81  ? 5   DA  C C5    1 
ATOM   2969  C  C6    . DA  C  3 5   ? -25.294 11.270  5.180   1.00 18.45  ? 5   DA  C C6    1 
ATOM   2970  N  N6    . DA  C  3 5   ? -23.963 11.327  5.195   1.00 17.69  ? 5   DA  C N6    1 
ATOM   2971  N  N1    . DA  C  3 5   ? -25.915 10.496  6.090   1.00 18.10  ? 5   DA  C N1    1 
ATOM   2972  C  C2    . DA  C  3 5   ? -27.249 10.432  6.069   1.00 20.74  ? 5   DA  C C2    1 
ATOM   2973  N  N3    . DA  C  3 5   ? -28.110 11.056  5.264   1.00 19.45  ? 5   DA  C N3    1 
ATOM   2974  C  C4    . DA  C  3 5   ? -27.455 11.793  4.357   1.00 19.46  ? 5   DA  C C4    1 
ATOM   2975  P  P     . DC  C  3 6   ? -32.206 16.284  3.587   1.00 20.23  ? 6   DC  C P     1 
ATOM   2976  O  OP1   . DC  C  3 6   ? -33.580 16.757  3.410   1.00 22.39  ? 6   DC  C OP1   1 
ATOM   2977  O  OP2   . DC  C  3 6   ? -31.069 17.180  3.328   1.00 20.12  ? 6   DC  C OP2   1 
ATOM   2978  O  "O5'" . DC  C  3 6   ? -32.022 15.667  5.029   1.00 19.77  ? 6   DC  C "O5'" 1 
ATOM   2979  C  "C5'" . DC  C  3 6   ? -33.031 14.859  5.543   1.00 21.81  ? 6   DC  C "C5'" 1 
ATOM   2980  C  "C4'" . DC  C  3 6   ? -32.622 14.435  6.924   1.00 24.41  ? 6   DC  C "C4'" 1 
ATOM   2981  O  "O4'" . DC  C  3 6   ? -31.370 13.738  6.824   1.00 24.92  ? 6   DC  C "O4'" 1 
ATOM   2982  C  "C3'" . DC  C  3 6   ? -32.326 15.601  7.842   1.00 27.57  ? 6   DC  C "C3'" 1 
ATOM   2983  O  "O3'" . DC  C  3 6   ? -33.538 16.333  8.206   1.00 33.64  ? 6   DC  C "O3'" 1 
ATOM   2984  C  "C2'" . DC  C  3 6   ? -31.382 14.963  8.854   1.00 26.16  ? 6   DC  C "C2'" 1 
ATOM   2985  C  "C1'" . DC  C  3 6   ? -30.650 13.880  8.047   1.00 24.69  ? 6   DC  C "C1'" 1 
ATOM   2986  N  N1    . DC  C  3 6   ? -29.227 14.084  7.693   1.00 23.71  ? 6   DC  C N1    1 
ATOM   2987  C  C2    . DC  C  3 6   ? -28.233 13.400  8.403   1.00 23.56  ? 6   DC  C C2    1 
ATOM   2988  O  O2    . DC  C  3 6   ? -28.557 12.716  9.386   1.00 27.89  ? 6   DC  C O2    1 
ATOM   2989  N  N3    . DC  C  3 6   ? -26.942 13.547  8.038   1.00 23.91  ? 6   DC  C N3    1 
ATOM   2990  C  C4    . DC  C  3 6   ? -26.629 14.305  6.987   1.00 22.73  ? 6   DC  C C4    1 
ATOM   2991  N  N4    . DC  C  3 6   ? -25.342 14.421  6.665   1.00 21.89  ? 6   DC  C N4    1 
ATOM   2992  C  C5    . DC  C  3 6   ? -27.623 14.988  6.225   1.00 21.82  ? 6   DC  C C5    1 
ATOM   2993  C  C6    . DC  C  3 6   ? -28.896 14.850  6.610   1.00 22.75  ? 6   DC  C C6    1 
ATOM   2994  O  OP3   . DG  D  4 1   ? -7.945  30.337  -0.481  1.00 49.47  ? 1   DG  D OP3   1 
ATOM   2995  P  P     . DG  D  4 1   ? -8.878  29.191  -0.681  1.00 43.73  ? 1   DG  D P     1 
ATOM   2996  O  OP1   . DG  D  4 1   ? -10.056 29.608  -1.479  1.00 38.66  ? 1   DG  D OP1   1 
ATOM   2997  O  OP2   . DG  D  4 1   ? -8.102  27.985  -1.022  1.00 34.59  ? 1   DG  D OP2   1 
ATOM   2998  O  "O5'" . DG  D  4 1   ? -9.483  28.994  0.774   1.00 43.35  ? 1   DG  D "O5'" 1 
ATOM   2999  C  "C5'" . DG  D  4 1   ? -8.685  28.434  1.801   1.00 35.93  ? 1   DG  D "C5'" 1 
ATOM   3000  C  "C4'" . DG  D  4 1   ? -9.588  28.206  2.983   1.00 37.82  ? 1   DG  D "C4'" 1 
ATOM   3001  O  "O4'" . DG  D  4 1   ? -10.341 26.988  2.791   1.00 37.96  ? 1   DG  D "O4'" 1 
ATOM   3002  C  "C3'" . DG  D  4 1   ? -8.857  28.030  4.301   1.00 36.22  ? 1   DG  D "C3'" 1 
ATOM   3003  O  "O3'" . DG  D  4 1   ? -8.710  29.321  4.899   1.00 34.64  ? 1   DG  D "O3'" 1 
ATOM   3004  C  "C2'" . DG  D  4 1   ? -9.787  27.120  5.083   1.00 37.50  ? 1   DG  D "C2'" 1 
ATOM   3005  C  "C1'" . DG  D  4 1   ? -10.442 26.268  4.006   1.00 35.75  ? 1   DG  D "C1'" 1 
ATOM   3006  N  N9    . DG  D  4 1   ? -9.856  24.955  3.782   1.00 33.44  ? 1   DG  D N9    1 
ATOM   3007  C  C8    . DG  D  4 1   ? -9.086  24.563  2.710   1.00 32.98  ? 1   DG  D C8    1 
ATOM   3008  N  N7    . DG  D  4 1   ? -8.744  23.304  2.759   1.00 29.50  ? 1   DG  D N7    1 
ATOM   3009  C  C5    . DG  D  4 1   ? -9.360  22.830  3.908   1.00 29.38  ? 1   DG  D C5    1 
ATOM   3010  C  C6    . DG  D  4 1   ? -9.379  21.539  4.457   1.00 25.79  ? 1   DG  D C6    1 
ATOM   3011  O  O6    . DG  D  4 1   ? -8.819  20.534  4.048   1.00 27.58  ? 1   DG  D O6    1 
ATOM   3012  N  N1    . DG  D  4 1   ? -10.083 21.499  5.656   1.00 28.55  ? 1   DG  D N1    1 
ATOM   3013  C  C2    . DG  D  4 1   ? -10.757 22.558  6.206   1.00 30.97  ? 1   DG  D C2    1 
ATOM   3014  N  N2    . DG  D  4 1   ? -11.418 22.312  7.343   1.00 32.33  ? 1   DG  D N2    1 
ATOM   3015  N  N3    . DG  D  4 1   ? -10.758 23.776  5.693   1.00 32.44  ? 1   DG  D N3    1 
ATOM   3016  C  C4    . DG  D  4 1   ? -10.040 23.839  4.555   1.00 28.73  ? 1   DG  D C4    1 
ATOM   3017  P  P     . DC  D  4 2   ? -7.535  29.550  5.980   1.00 34.27  ? 2   DC  D P     1 
ATOM   3018  O  OP1   . DC  D  4 2   ? -7.532  31.003  6.323   1.00 35.28  ? 2   DC  D OP1   1 
ATOM   3019  O  OP2   . DC  D  4 2   ? -6.324  28.927  5.457   1.00 29.24  ? 2   DC  D OP2   1 
ATOM   3020  O  "O5'" . DC  D  4 2   ? -8.004  28.632  7.192   1.00 27.03  ? 2   DC  D "O5'" 1 
ATOM   3021  C  "C5'" . DC  D  4 2   ? -9.155  28.983  7.953   1.00 31.41  ? 2   DC  D "C5'" 1 
ATOM   3022  C  "C4'" . DC  D  4 2   ? -9.334  28.013  9.093   1.00 33.37  ? 2   DC  D "C4'" 1 
ATOM   3023  O  "O4'" . DC  D  4 2   ? -9.410  26.670  8.553   1.00 34.62  ? 2   DC  D "O4'" 1 
ATOM   3024  C  "C3'" . DC  D  4 2   ? -8.173  28.027  10.084  1.00 33.88  ? 2   DC  D "C3'" 1 
ATOM   3025  O  "O3'" . DC  D  4 2   ? -8.566  28.141  11.456  1.00 37.81  ? 2   DC  D "O3'" 1 
ATOM   3026  C  "C2'" . DC  D  4 2   ? -7.458  26.719  9.829   1.00 35.51  ? 2   DC  D "C2'" 1 
ATOM   3027  C  "C1'" . DC  D  4 2   ? -8.538  25.822  9.260   1.00 35.92  ? 2   DC  D "C1'" 1 
ATOM   3028  N  N1    . DC  D  4 2   ? -8.004  24.845  8.305   1.00 34.59  ? 2   DC  D N1    1 
ATOM   3029  C  C2    . DC  D  4 2   ? -8.013  23.498  8.657   1.00 31.87  ? 2   DC  D C2    1 
ATOM   3030  O  O2    . DC  D  4 2   ? -8.517  23.169  9.736   1.00 34.50  ? 2   DC  D O2    1 
ATOM   3031  N  N3    . DC  D  4 2   ? -7.517  22.585  7.793   1.00 30.80  ? 2   DC  D N3    1 
ATOM   3032  C  C4    . DC  D  4 2   ? -6.975  22.984  6.641   1.00 31.43  ? 2   DC  D C4    1 
ATOM   3033  N  N4    . DC  D  4 2   ? -6.499  22.050  5.819   1.00 30.58  ? 2   DC  D N4    1 
ATOM   3034  C  C5    . DC  D  4 2   ? -6.894  24.362  6.284   1.00 33.77  ? 2   DC  D C5    1 
ATOM   3035  C  C6    . DC  D  4 2   ? -7.412  25.251  7.142   1.00 35.00  ? 2   DC  D C6    1 
ATOM   3036  P  P     . DC  D  4 3   ? -7.425  28.382  12.592  1.00 35.61  ? 3   DC  D P     1 
ATOM   3037  O  OP1   . DC  D  4 3   ? -7.705  29.699  13.318  1.00 39.53  ? 3   DC  D OP1   1 
ATOM   3038  O  OP2   . DC  D  4 3   ? -6.121  28.193  11.928  1.00 35.41  ? 3   DC  D OP2   1 
ATOM   3039  O  "O5'" . DC  D  4 3   ? -7.481  27.031  13.433  1.00 35.45  ? 3   DC  D "O5'" 1 
ATOM   3040  C  "C5'" . DC  D  4 3   ? -8.680  26.273  13.715  1.00 35.95  ? 3   DC  D "C5'" 1 
ATOM   3041  C  "C4'" . DC  D  4 3   ? -8.284  24.869  14.107  1.00 37.52  ? 3   DC  D "C4'" 1 
ATOM   3042  O  "O4'" . DC  D  4 3   ? -7.865  24.163  12.920  1.00 37.48  ? 3   DC  D "O4'" 1 
ATOM   3043  C  "C3'" . DC  D  4 3   ? -7.089  24.795  15.070  1.00 41.96  ? 3   DC  D "C3'" 1 
ATOM   3044  O  "O3'" . DC  D  4 3   ? -7.303  23.953  16.189  1.00 43.86  ? 3   DC  D "O3'" 1 
ATOM   3045  C  "C2'" . DC  D  4 3   ? -5.989  24.117  14.278  1.00 39.76  ? 3   DC  D "C2'" 1 
ATOM   3046  C  "C1'" . DC  D  4 3   ? -6.749  23.349  13.222  1.00 37.39  ? 3   DC  D "C1'" 1 
ATOM   3047  N  N1    . DC  D  4 3   ? -5.987  23.182  11.981  1.00 35.77  ? 3   DC  D N1    1 
ATOM   3048  C  C2    . DC  D  4 3   ? -5.615  21.903  11.560  1.00 36.99  ? 3   DC  D C2    1 
ATOM   3049  O  O2    . DC  D  4 3   ? -5.933  20.925  12.256  1.00 39.72  ? 3   DC  D O2    1 
ATOM   3050  N  N3    . DC  D  4 3   ? -4.930  21.763  10.401  1.00 33.42  ? 3   DC  D N3    1 
ATOM   3051  C  C4    . DC  D  4 3   ? -4.635  22.840  9.670   1.00 33.13  ? 3   DC  D C4    1 
ATOM   3052  N  N4    . DC  D  4 3   ? -3.977  22.657  8.525   1.00 36.26  ? 3   DC  D N4    1 
ATOM   3053  C  C5    . DC  D  4 3   ? -4.978  24.156  10.092  1.00 34.16  ? 3   DC  D C5    1 
ATOM   3054  C  C6    . DC  D  4 3   ? -5.658  24.279  11.235  1.00 34.95  ? 3   DC  D C6    1 
ATOM   3055  P  P     . DG  D  4 4   ? -6.474  24.193  17.515  1.00 45.47  ? 4   DG  D P     1 
ATOM   3056  O  OP1   . DG  D  4 4   ? -7.458  24.563  18.563  1.00 49.47  ? 4   DG  D OP1   1 
ATOM   3057  O  OP2   . DG  D  4 4   ? -5.375  25.137  17.241  1.00 39.12  ? 4   DG  D OP2   1 
ATOM   3058  O  "O5'" . DG  D  4 4   ? -5.806  22.769  17.748  1.00 34.78  ? 4   DG  D "O5'" 1 
ATOM   3059  C  "C5'" . DG  D  4 4   ? -6.555  21.552  17.650  1.00 38.53  ? 4   DG  D "C5'" 1 
ATOM   3060  C  "C4'" . DG  D  4 4   ? -5.632  20.354  17.682  1.00 39.82  ? 4   DG  D "C4'" 1 
ATOM   3061  O  "O4'" . DG  D  4 4   ? -5.012  20.154  16.390  1.00 38.92  ? 4   DG  D "O4'" 1 
ATOM   3062  C  "C3'" . DG  D  4 4   ? -4.474  20.460  18.671  1.00 40.79  ? 4   DG  D "C3'" 1 
ATOM   3063  O  "O3'" . DG  D  4 4   ? -4.154  19.144  19.129  1.00 45.45  ? 4   DG  D "O3'" 1 
ATOM   3064  C  "C2'" . DG  D  4 4   ? -3.356  21.041  17.826  1.00 41.24  ? 4   DG  D "C2'" 1 
ATOM   3065  C  "C1'" . DG  D  4 4   ? -3.605  20.368  16.481  1.00 40.58  ? 4   DG  D "C1'" 1 
ATOM   3066  N  N9    . DG  D  4 4   ? -3.196  21.143  15.317  1.00 38.31  ? 4   DG  D N9    1 
ATOM   3067  C  C8    . DG  D  4 4   ? -3.157  22.511  15.193  1.00 42.09  ? 4   DG  D C8    1 
ATOM   3068  N  N7    . DG  D  4 4   ? -2.759  22.908  14.014  1.00 41.93  ? 4   DG  D N7    1 
ATOM   3069  C  C5    . DG  D  4 4   ? -2.532  21.731  13.314  1.00 37.97  ? 4   DG  D C5    1 
ATOM   3070  C  C6    . DG  D  4 4   ? -2.092  21.524  11.980  1.00 36.55  ? 4   DG  D C6    1 
ATOM   3071  O  O6    . DG  D  4 4   ? -1.802  22.371  11.121  1.00 35.43  ? 4   DG  D O6    1 
ATOM   3072  N  N1    . DG  D  4 4   ? -1.980  20.170  11.683  1.00 33.96  ? 4   DG  D N1    1 
ATOM   3073  C  C2    . DG  D  4 4   ? -2.285  19.144  12.546  1.00 35.69  ? 4   DG  D C2    1 
ATOM   3074  N  N2    . DG  D  4 4   ? -2.128  17.896  12.067  1.00 31.78  ? 4   DG  D N2    1 
ATOM   3075  N  N3    . DG  D  4 4   ? -2.698  19.324  13.791  1.00 36.69  ? 4   DG  D N3    1 
ATOM   3076  C  C4    . DG  D  4 4   ? -2.801  20.632  14.104  1.00 38.39  ? 4   DG  D C4    1 
ATOM   3077  N  N     . ALA E  1 6   ? -8.560  44.159  -31.902 1.00 57.45  ? 249 ALA E N     1 
ATOM   3078  C  CA    . ALA E  1 6   ? -7.474  43.595  -32.780 1.00 58.72  ? 249 ALA E CA    1 
ATOM   3079  C  C     . ALA E  1 6   ? -7.614  44.047  -34.238 1.00 59.36  ? 249 ALA E C     1 
ATOM   3080  O  O     . ALA E  1 6   ? -8.657  43.838  -34.873 1.00 58.87  ? 249 ALA E O     1 
ATOM   3081  C  CB    . ALA E  1 6   ? -7.452  42.074  -32.720 1.00 59.84  ? 249 ALA E CB    1 
ATOM   3082  N  N     . THR E  1 7   ? -6.550  44.648  -34.766 1.00 53.22  ? 250 THR E N     1 
ATOM   3083  C  CA    . THR E  1 7   ? -6.555  45.168  -36.138 1.00 55.36  ? 250 THR E CA    1 
ATOM   3084  C  C     . THR E  1 7   ? -5.311  44.650  -36.905 1.00 48.47  ? 250 THR E C     1 
ATOM   3085  O  O     . THR E  1 7   ? -4.506  43.909  -36.327 1.00 41.00  ? 250 THR E O     1 
ATOM   3086  C  CB    . THR E  1 7   ? -6.675  46.718  -36.152 1.00 55.03  ? 250 THR E CB    1 
ATOM   3087  O  OG1   . THR E  1 7   ? -6.588  47.192  -37.499 1.00 67.31  ? 250 THR E OG1   1 
ATOM   3088  C  CG2   . THR E  1 7   ? -5.590  47.366  -35.327 1.00 54.91  ? 250 THR E CG2   1 
ATOM   3089  N  N     . ASN E  1 8   ? -5.180  45.023  -38.191 1.00 42.21  ? 251 ASN E N     1 
ATOM   3090  C  CA    . ASN E  1 8   ? -4.108  44.529  -39.048 1.00 34.13  ? 251 ASN E CA    1 
ATOM   3091  C  C     . ASN E  1 8   ? -3.027  45.554  -39.242 1.00 32.79  ? 251 ASN E C     1 
ATOM   3092  O  O     . ASN E  1 8   ? -3.194  46.471  -40.013 1.00 29.01  ? 251 ASN E O     1 
ATOM   3093  C  CB    . ASN E  1 8   ? -4.617  44.139  -40.427 1.00 31.91  ? 251 ASN E CB    1 
ATOM   3094  C  CG    . ASN E  1 8   ? -3.500  43.605  -41.332 1.00 32.52  ? 251 ASN E CG    1 
ATOM   3095  O  OD1   . ASN E  1 8   ? -2.302  43.642  -41.002 1.00 25.93  ? 251 ASN E OD1   1 
ATOM   3096  N  ND2   . ASN E  1 8   ? -3.887  43.120  -42.470 1.00 34.78  ? 251 ASN E ND2   1 
ATOM   3097  N  N     . HIS E  1 9   ? -1.856  45.323  -38.646 1.00 33.30  ? 252 HIS E N     1 
ATOM   3098  C  CA    . HIS E  1 9   ? -0.747  46.280  -38.728 1.00 31.98  ? 252 HIS E CA    1 
ATOM   3099  C  C     . HIS E  1 9   ? 0.167   46.102  -39.926 1.00 29.67  ? 252 HIS E C     1 
ATOM   3100  O  O     . HIS E  1 9   ? 1.078   46.892  -40.116 1.00 30.32  ? 252 HIS E O     1 
ATOM   3101  C  CB    . HIS E  1 9   ? 0.113   46.149  -37.517 1.00 32.50  ? 252 HIS E CB    1 
ATOM   3102  C  CG    . HIS E  1 9   ? -0.618  46.354  -36.253 1.00 35.11  ? 252 HIS E CG    1 
ATOM   3103  N  ND1   . HIS E  1 9   ? -1.565  45.468  -35.790 1.00 37.86  ? 252 HIS E ND1   1 
ATOM   3104  C  CD2   . HIS E  1 9   ? -0.522  47.331  -35.326 1.00 32.09  ? 252 HIS E CD2   1 
ATOM   3105  C  CE1   . HIS E  1 9   ? -2.020  45.896  -34.627 1.00 36.52  ? 252 HIS E CE1   1 
ATOM   3106  N  NE2   . HIS E  1 9   ? -1.402  47.021  -34.327 1.00 34.71  ? 252 HIS E NE2   1 
ATOM   3107  N  N     . ASN E  1 10  ? -0.078  45.054  -40.702 1.00 27.05  ? 253 ASN E N     1 
ATOM   3108  C  CA    . ASN E  1 10  ? 0.760   44.673  -41.831 1.00 25.75  ? 253 ASN E CA    1 
ATOM   3109  C  C     . ASN E  1 10  ? 0.021   44.516  -43.150 1.00 25.51  ? 253 ASN E C     1 
ATOM   3110  O  O     . ASN E  1 10  ? 0.402   43.693  -44.022 1.00 22.84  ? 253 ASN E O     1 
ATOM   3111  C  CB    . ASN E  1 10  ? 1.441   43.359  -41.485 1.00 24.40  ? 253 ASN E CB    1 
ATOM   3112  C  CG    . ASN E  1 10  ? 2.297   43.485  -40.270 1.00 24.60  ? 253 ASN E CG    1 
ATOM   3113  O  OD1   . ASN E  1 10  ? 3.404   44.009  -40.350 1.00 20.87  ? 253 ASN E OD1   1 
ATOM   3114  N  ND2   . ASN E  1 10  ? 1.774   43.040  -39.114 1.00 24.32  ? 253 ASN E ND2   1 
ATOM   3115  N  N     . LEU E  1 11  ? -0.996  45.348  -43.311 1.00 26.83  ? 254 LEU E N     1 
ATOM   3116  C  CA    . LEU E  1 11  ? -1.790  45.382  -44.524 1.00 29.05  ? 254 LEU E CA    1 
ATOM   3117  C  C     . LEU E  1 11  ? -0.955  45.642  -45.772 1.00 27.01  ? 254 LEU E C     1 
ATOM   3118  O  O     . LEU E  1 11  ? -1.187  45.100  -46.817 1.00 29.51  ? 254 LEU E O     1 
ATOM   3119  C  CB    . LEU E  1 11  ? -2.922  46.430  -44.366 1.00 32.22  ? 254 LEU E CB    1 
ATOM   3120  C  CG    . LEU E  1 11  ? -4.230  46.019  -45.073 1.00 41.94  ? 254 LEU E CG    1 
ATOM   3121  C  CD1   . LEU E  1 11  ? -5.480  46.371  -44.253 1.00 43.59  ? 254 LEU E CD1   1 
ATOM   3122  C  CD2   . LEU E  1 11  ? -4.327  46.586  -46.496 1.00 42.03  ? 254 LEU E CD2   1 
ATOM   3123  N  N     . HIS E  1 12  ? 0.028   46.492  -45.668 1.00 26.89  ? 255 HIS E N     1 
ATOM   3124  C  CA    . HIS E  1 12  ? 0.897   46.735  -46.793 1.00 27.03  ? 255 HIS E CA    1 
ATOM   3125  C  C     . HIS E  1 12  ? 1.699   45.520  -47.271 1.00 25.29  ? 255 HIS E C     1 
ATOM   3126  O  O     . HIS E  1 12  ? 2.050   45.455  -48.432 1.00 28.08  ? 255 HIS E O     1 
ATOM   3127  C  CB    . HIS E  1 12  ? 1.833   47.909  -46.499 1.00 28.46  ? 255 HIS E CB    1 
ATOM   3128  C  CG    . HIS E  1 12  ? 2.871   47.607  -45.477 1.00 30.00  ? 255 HIS E CG    1 
ATOM   3129  N  ND1   . HIS E  1 12  ? 2.569   47.441  -44.140 1.00 32.23  ? 255 HIS E ND1   1 
ATOM   3130  C  CD2   . HIS E  1 12  ? 4.203   47.414  -45.594 1.00 28.21  ? 255 HIS E CD2   1 
ATOM   3131  C  CE1   . HIS E  1 12  ? 3.677   47.194  -43.471 1.00 31.50  ? 255 HIS E CE1   1 
ATOM   3132  N  NE2   . HIS E  1 12  ? 4.677   47.152  -44.333 1.00 31.95  ? 255 HIS E NE2   1 
ATOM   3133  N  N     . ILE E  1 13  ? 1.951   44.571  -46.385 1.00 23.54  ? 256 ILE E N     1 
ATOM   3134  C  CA    . ILE E  1 13  ? 2.551   43.245  -46.743 1.00 22.36  ? 256 ILE E CA    1 
ATOM   3135  C  C     . ILE E  1 13  ? 1.487   42.262  -47.209 1.00 21.84  ? 256 ILE E C     1 
ATOM   3136  O  O     . ILE E  1 13  ? 1.583   41.696  -48.317 1.00 18.06  ? 256 ILE E O     1 
ATOM   3137  C  CB    . ILE E  1 13  ? 3.277   42.637  -45.538 1.00 21.20  ? 256 ILE E CB    1 
ATOM   3138  C  CG1   . ILE E  1 13  ? 4.410   43.600  -45.118 1.00 21.11  ? 256 ILE E CG1   1 
ATOM   3139  C  CG2   . ILE E  1 13  ? 3.822   41.272  -45.854 1.00 21.61  ? 256 ILE E CG2   1 
ATOM   3140  C  CD1   . ILE E  1 13  ? 4.840   43.431  -43.677 1.00 22.08  ? 256 ILE E CD1   1 
ATOM   3141  N  N     . THR E  1 14  ? 0.442   42.131  -46.395 1.00 22.88  ? 257 THR E N     1 
ATOM   3142  C  CA    . THR E  1 14  ? -0.603  41.169  -46.675 1.00 24.63  ? 257 THR E CA    1 
ATOM   3143  C  C     . THR E  1 14  ? -1.363  41.375  -47.987 1.00 27.55  ? 257 THR E C     1 
ATOM   3144  O  O     . THR E  1 14  ? -1.699  40.381  -48.654 1.00 29.04  ? 257 THR E O     1 
ATOM   3145  C  CB    . THR E  1 14  ? -1.560  41.004  -45.500 1.00 25.82  ? 257 THR E CB    1 
ATOM   3146  O  OG1   . THR E  1 14  ? -2.123  42.245  -45.131 1.00 26.07  ? 257 THR E OG1   1 
ATOM   3147  C  CG2   . THR E  1 14  ? -0.816  40.498  -44.330 1.00 28.81  ? 257 THR E CG2   1 
ATOM   3148  N  N     . GLU E  1 15  ? -1.579  42.618  -48.410 1.00 27.75  ? 258 GLU E N     1 
ATOM   3149  C  CA    . GLU E  1 15  ? -2.310  42.842  -49.663 1.00 30.67  ? 258 GLU E CA    1 
ATOM   3150  C  C     . GLU E  1 15  ? -1.487  42.359  -50.844 1.00 30.06  ? 258 GLU E C     1 
ATOM   3151  O  O     . GLU E  1 15  ? -2.023  41.868  -51.824 1.00 33.83  ? 258 GLU E O     1 
ATOM   3152  C  CB    . GLU E  1 15  ? -2.738  44.335  -49.846 1.00 33.30  ? 258 GLU E CB    1 
ATOM   3153  C  CG    . GLU E  1 15  ? -1.589  45.357  -50.107 1.00 40.69  ? 258 GLU E CG    1 
ATOM   3154  C  CD    . GLU E  1 15  ? -1.969  46.868  -49.958 1.00 47.03  ? 258 GLU E CD    1 
ATOM   3155  O  OE1   . GLU E  1 15  ? -3.106  47.242  -50.324 1.00 57.81  ? 258 GLU E OE1   1 
ATOM   3156  O  OE2   . GLU E  1 15  ? -1.142  47.715  -49.502 1.00 49.85  ? 258 GLU E OE2   1 
ATOM   3157  N  N     . LYS E  1 16  ? -0.176  42.527  -50.777 1.00 28.83  ? 259 LYS E N     1 
ATOM   3158  C  CA    . LYS E  1 16  ? 0.724   42.021  -51.829 1.00 27.98  ? 259 LYS E CA    1 
ATOM   3159  C  C     . LYS E  1 16  ? 0.792   40.495  -51.851 1.00 27.14  ? 259 LYS E C     1 
ATOM   3160  O  O     . LYS E  1 16  ? 0.644   39.856  -52.908 1.00 24.49  ? 259 LYS E O     1 
ATOM   3161  C  CB    . LYS E  1 16  ? 2.111   42.630  -51.680 1.00 29.96  ? 259 LYS E CB    1 
ATOM   3162  C  CG    . LYS E  1 16  ? 2.066   44.162  -51.647 1.00 34.19  ? 259 LYS E CG    1 
ATOM   3163  C  CD    . LYS E  1 16  ? 3.439   44.790  -51.876 1.00 37.49  ? 259 LYS E CD    1 
ATOM   3164  C  CE    . LYS E  1 16  ? 3.314   46.247  -52.303 1.00 36.30  ? 259 LYS E CE    1 
ATOM   3165  N  NZ    . LYS E  1 16  ? 2.752   47.056  -51.184 1.00 38.58  ? 259 LYS E NZ    1 
ATOM   3166  N  N     . LEU E  1 17  ? 0.988   39.899  -50.679 1.00 26.39  ? 260 LEU E N     1 
ATOM   3167  C  CA    . LEU E  1 17  ? 1.085   38.443  -50.602 1.00 24.25  ? 260 LEU E CA    1 
ATOM   3168  C  C     . LEU E  1 17  ? -0.190  37.805  -51.119 1.00 25.14  ? 260 LEU E C     1 
ATOM   3169  O  O     . LEU E  1 17  ? -0.122  36.743  -51.752 1.00 26.68  ? 260 LEU E O     1 
ATOM   3170  C  CB    . LEU E  1 17  ? 1.393   37.965  -49.190 1.00 21.91  ? 260 LEU E CB    1 
ATOM   3171  C  CG    . LEU E  1 17  ? 2.746   38.372  -48.643 1.00 21.66  ? 260 LEU E CG    1 
ATOM   3172  C  CD1   . LEU E  1 17  ? 2.954   37.914  -47.216 1.00 22.08  ? 260 LEU E CD1   1 
ATOM   3173  C  CD2   . LEU E  1 17  ? 3.826   37.784  -49.536 1.00 21.01  ? 260 LEU E CD2   1 
ATOM   3174  N  N     . GLU E  1 18  ? -1.341  38.459  -50.897 1.00 29.52  ? 261 GLU E N     1 
ATOM   3175  C  CA    . GLU E  1 18  ? -2.645  37.879  -51.264 1.00 28.36  ? 261 GLU E CA    1 
ATOM   3176  C  C     . GLU E  1 18  ? -2.752  37.749  -52.759 1.00 26.52  ? 261 GLU E C     1 
ATOM   3177  O  O     . GLU E  1 18  ? -3.299  36.778  -53.245 1.00 27.99  ? 261 GLU E O     1 
ATOM   3178  C  CB    . GLU E  1 18  ? -3.833  38.653  -50.675 1.00 33.09  ? 261 GLU E CB    1 
ATOM   3179  C  CG    . GLU E  1 18  ? -4.422  37.966  -49.427 1.00 38.41  ? 261 GLU E CG    1 
ATOM   3180  C  CD    . GLU E  1 18  ? -5.415  38.851  -48.686 1.00 46.85  ? 261 GLU E CD    1 
ATOM   3181  O  OE1   . GLU E  1 18  ? -6.001  39.718  -49.374 1.00 58.01  ? 261 GLU E OE1   1 
ATOM   3182  O  OE2   . GLU E  1 18  ? -5.636  38.691  -47.440 1.00 45.00  ? 261 GLU E OE2   1 
ATOM   3183  N  N     . VAL E  1 19  ? -2.212  38.696  -53.499 1.00 25.41  ? 262 VAL E N     1 
ATOM   3184  C  CA    . VAL E  1 19  ? -2.215  38.591  -54.947 1.00 26.25  ? 262 VAL E CA    1 
ATOM   3185  C  C     . VAL E  1 19  ? -1.489  37.330  -55.376 1.00 27.29  ? 262 VAL E C     1 
ATOM   3186  O  O     . VAL E  1 19  ? -1.925  36.599  -56.275 1.00 29.42  ? 262 VAL E O     1 
ATOM   3187  C  CB    . VAL E  1 19  ? -1.540  39.821  -55.592 1.00 26.25  ? 262 VAL E CB    1 
ATOM   3188  C  CG1   . VAL E  1 19  ? -1.378  39.645  -57.121 1.00 26.34  ? 262 VAL E CG1   1 
ATOM   3189  C  CG2   . VAL E  1 19  ? -2.334  41.076  -55.281 1.00 27.30  ? 262 VAL E CG2   1 
ATOM   3190  N  N     . LEU E  1 20  ? -0.362  37.063  -54.748 1.00 27.90  ? 263 LEU E N     1 
ATOM   3191  C  CA    . LEU E  1 20  ? 0.436   35.871  -55.080 1.00 27.44  ? 263 LEU E CA    1 
ATOM   3192  C  C     . LEU E  1 20  ? -0.262  34.570  -54.627 1.00 27.40  ? 263 LEU E C     1 
ATOM   3193  O  O     . LEU E  1 20  ? -0.280  33.566  -55.340 1.00 29.45  ? 263 LEU E O     1 
ATOM   3194  C  CB    . LEU E  1 20  ? 1.766   36.040  -54.382 1.00 34.21  ? 263 LEU E CB    1 
ATOM   3195  C  CG    . LEU E  1 20  ? 3.060   35.478  -54.934 1.00 37.47  ? 263 LEU E CG    1 
ATOM   3196  C  CD1   . LEU E  1 20  ? 3.188   35.829  -56.393 1.00 37.81  ? 263 LEU E CD1   1 
ATOM   3197  C  CD2   . LEU E  1 20  ? 4.228   36.030  -54.125 1.00 35.24  ? 263 LEU E CD2   1 
ATOM   3198  N  N     . ALA E  1 21  ? -0.869  34.587  -53.445 1.00 24.52  ? 264 ALA E N     1 
ATOM   3199  C  CA    . ALA E  1 21  ? -1.648  33.445  -52.982 1.00 25.22  ? 264 ALA E CA    1 
ATOM   3200  C  C     . ALA E  1 21  ? -2.796  33.167  -53.943 1.00 28.95  ? 264 ALA E C     1 
ATOM   3201  O  O     . ALA E  1 21  ? -3.138  32.029  -54.206 1.00 26.98  ? 264 ALA E O     1 
ATOM   3202  C  CB    . ALA E  1 21  ? -2.180  33.709  -51.605 1.00 23.24  ? 264 ALA E CB    1 
ATOM   3203  N  N     . LYS E  1 22  ? -3.381  34.220  -54.502 1.00 30.03  ? 265 LYS E N     1 
ATOM   3204  C  CA    . LYS E  1 22  ? -4.496  34.028  -55.401 1.00 29.65  ? 265 LYS E CA    1 
ATOM   3205  C  C     . LYS E  1 22  ? -4.015  33.446  -56.726 1.00 30.14  ? 265 LYS E C     1 
ATOM   3206  O  O     . LYS E  1 22  ? -4.691  32.655  -57.376 1.00 30.41  ? 265 LYS E O     1 
ATOM   3207  C  CB    . LYS E  1 22  ? -5.221  35.359  -55.622 1.00 32.23  ? 265 LYS E CB    1 
ATOM   3208  C  CG    . LYS E  1 22  ? -6.381  35.240  -56.601 1.00 35.70  ? 265 LYS E CG    1 
ATOM   3209  C  CD    . LYS E  1 22  ? -7.360  34.116  -56.185 1.00 36.82  ? 265 LYS E CD    1 
ATOM   3210  C  CE    . LYS E  1 22  ? -8.784  34.403  -56.690 1.00 40.10  ? 265 LYS E CE    1 
ATOM   3211  N  NZ    . LYS E  1 22  ? -9.841  33.488  -56.176 1.00 41.88  ? 265 LYS E NZ    1 
ATOM   3212  N  N     . ALA E  1 23  ? -2.846  33.866  -57.149 1.00 30.11  ? 266 ALA E N     1 
ATOM   3213  C  CA    . ALA E  1 23  ? -2.328  33.402  -58.413 1.00 31.72  ? 266 ALA E CA    1 
ATOM   3214  C  C     . ALA E  1 23  ? -1.988  31.885  -58.359 1.00 31.58  ? 266 ALA E C     1 
ATOM   3215  O  O     . ALA E  1 23  ? -2.341  31.122  -59.249 1.00 32.51  ? 266 ALA E O     1 
ATOM   3216  C  CB    . ALA E  1 23  ? -1.127  34.247  -58.796 1.00 32.19  ? 266 ALA E CB    1 
ATOM   3217  N  N     . TYR E  1 24  ? -1.329  31.448  -57.303 1.00 29.66  ? 267 TYR E N     1 
ATOM   3218  C  CA    . TYR E  1 24  ? -1.112  30.042  -57.119 1.00 31.44  ? 267 TYR E CA    1 
ATOM   3219  C  C     . TYR E  1 24  ? -2.428  29.296  -56.915 1.00 31.25  ? 267 TYR E C     1 
ATOM   3220  O  O     . TYR E  1 24  ? -2.583  28.214  -57.388 1.00 29.79  ? 267 TYR E O     1 
ATOM   3221  C  CB    . TYR E  1 24  ? -0.254  29.789  -55.910 1.00 31.10  ? 267 TYR E CB    1 
ATOM   3222  C  CG    . TYR E  1 24  ? 1.170   30.220  -56.076 1.00 32.93  ? 267 TYR E CG    1 
ATOM   3223  C  CD1   . TYR E  1 24  ? 1.985   29.669  -57.082 1.00 32.28  ? 267 TYR E CD1   1 
ATOM   3224  C  CD2   . TYR E  1 24  ? 1.753   31.098  -55.168 1.00 31.09  ? 267 TYR E CD2   1 
ATOM   3225  C  CE1   . TYR E  1 24  ? 3.319   30.030  -57.195 1.00 33.55  ? 267 TYR E CE1   1 
ATOM   3226  C  CE2   . TYR E  1 24  ? 3.085   31.464  -55.274 1.00 31.94  ? 267 TYR E CE2   1 
ATOM   3227  C  CZ    . TYR E  1 24  ? 3.857   30.938  -56.278 1.00 33.98  ? 267 TYR E CZ    1 
ATOM   3228  O  OH    . TYR E  1 24  ? 5.154   31.316  -56.347 1.00 38.05  ? 267 TYR E OH    1 
ATOM   3229  N  N     . SER E  1 25  ? -3.371  29.873  -56.194 1.00 31.16  ? 268 SER E N     1 
ATOM   3230  C  CA    . SER E  1 25  ? -4.635  29.202  -56.028 1.00 30.59  ? 268 SER E CA    1 
ATOM   3231  C  C     . SER E  1 25  ? -5.333  28.950  -57.362 1.00 32.78  ? 268 SER E C     1 
ATOM   3232  O  O     . SER E  1 25  ? -5.576  27.812  -57.714 1.00 30.45  ? 268 SER E O     1 
ATOM   3233  C  CB    . SER E  1 25  ? -5.528  30.011  -55.163 1.00 32.23  ? 268 SER E CB    1 
ATOM   3234  O  OG    . SER E  1 25  ? -6.578  29.183  -54.824 1.00 39.13  ? 268 SER E OG    1 
ATOM   3235  N  N     . VAL E  1 26  ? -5.598  29.992  -58.154 1.00 33.11  ? 269 VAL E N     1 
ATOM   3236  C  CA    . VAL E  1 26  ? -6.334  29.770  -59.432 1.00 31.60  ? 269 VAL E CA    1 
ATOM   3237  C  C     . VAL E  1 26  ? -5.609  28.853  -60.415 1.00 34.15  ? 269 VAL E C     1 
ATOM   3238  O  O     . VAL E  1 26  ? -6.263  28.264  -61.287 1.00 38.96  ? 269 VAL E O     1 
ATOM   3239  C  CB    . VAL E  1 26  ? -6.683  31.061  -60.203 1.00 29.32  ? 269 VAL E CB    1 
ATOM   3240  C  CG1   . VAL E  1 26  ? -7.580  31.992  -59.388 1.00 29.51  ? 269 VAL E CG1   1 
ATOM   3241  C  CG2   . VAL E  1 26  ? -5.433  31.748  -60.699 1.00 30.69  ? 269 VAL E CG2   1 
ATOM   3242  N  N     . GLN E  1 27  ? -4.283  28.729  -60.262 1.00 33.80  ? 270 GLN E N     1 
ATOM   3243  C  CA    . GLN E  1 27  ? -3.442  27.834  -61.069 1.00 32.86  ? 270 GLN E CA    1 
ATOM   3244  C  C     . GLN E  1 27  ? -3.386  26.421  -60.539 1.00 33.19  ? 270 GLN E C     1 
ATOM   3245  O  O     . GLN E  1 27  ? -2.598  25.602  -61.021 1.00 35.80  ? 270 GLN E O     1 
ATOM   3246  C  CB    . GLN E  1 27  ? -1.980  28.364  -61.131 1.00 35.07  ? 270 GLN E CB    1 
ATOM   3247  C  CG    . GLN E  1 27  ? -1.751  29.410  -62.193 1.00 35.26  ? 270 GLN E CG    1 
ATOM   3248  C  CD    . GLN E  1 27  ? -0.359  30.055  -62.139 1.00 42.60  ? 270 GLN E CD    1 
ATOM   3249  O  OE1   . GLN E  1 27  ? 0.314   30.171  -63.164 1.00 46.10  ? 270 GLN E OE1   1 
ATOM   3250  N  NE2   . GLN E  1 27  ? 0.059   30.505  -60.958 1.00 44.69  ? 270 GLN E NE2   1 
ATOM   3251  N  N     . GLY E  1 28  ? -4.156  26.121  -59.514 1.00 33.26  ? 271 GLY E N     1 
ATOM   3252  C  CA    . GLY E  1 28  ? -4.214  24.746  -59.043 1.00 35.59  ? 271 GLY E CA    1 
ATOM   3253  C  C     . GLY E  1 28  ? -3.185  24.420  -57.964 1.00 38.74  ? 271 GLY E C     1 
ATOM   3254  O  O     . GLY E  1 28  ? -3.279  23.370  -57.352 1.00 34.68  ? 271 GLY E O     1 
ATOM   3255  N  N     . ASP E  1 29  ? -2.232  25.311  -57.665 1.00 39.18  ? 272 ASP E N     1 
ATOM   3256  C  CA    . ASP E  1 29  ? -1.159  24.948  -56.716 1.00 35.68  ? 272 ASP E CA    1 
ATOM   3257  C  C     . ASP E  1 29  ? -1.629  25.154  -55.314 1.00 33.57  ? 272 ASP E C     1 
ATOM   3258  O  O     . ASP E  1 29  ? -1.275  26.118  -54.651 1.00 33.63  ? 272 ASP E O     1 
ATOM   3259  C  CB    . ASP E  1 29  ? 0.124   25.702  -57.004 1.00 35.14  ? 272 ASP E CB    1 
ATOM   3260  C  CG    . ASP E  1 29  ? 1.297   25.128  -56.267 1.00 37.18  ? 272 ASP E CG    1 
ATOM   3261  O  OD1   . ASP E  1 29  ? 1.114   24.171  -55.452 1.00 37.15  ? 272 ASP E OD1   1 
ATOM   3262  O  OD2   . ASP E  1 29  ? 2.397   25.656  -56.484 1.00 36.69  ? 272 ASP E OD2   1 
ATOM   3263  N  N     . LYS E  1 30  ? -2.458  24.226  -54.844 1.00 35.62  ? 273 LYS E N     1 
ATOM   3264  C  CA    . LYS E  1 30  ? -3.298  24.490  -53.643 1.00 33.31  ? 273 LYS E CA    1 
ATOM   3265  C  C     . LYS E  1 30  ? -2.484  24.512  -52.370 1.00 30.16  ? 273 LYS E C     1 
ATOM   3266  O  O     . LYS E  1 30  ? -2.821  25.205  -51.432 1.00 33.53  ? 273 LYS E O     1 
ATOM   3267  C  CB    . LYS E  1 30  ? -4.430  23.446  -53.501 1.00 38.20  ? 273 LYS E CB    1 
ATOM   3268  C  CG    . LYS E  1 30  ? -3.916  22.002  -53.671 1.00 44.76  ? 273 LYS E CG    1 
ATOM   3269  C  CD    . LYS E  1 30  ? -4.996  20.949  -53.656 1.00 50.14  ? 273 LYS E CD    1 
ATOM   3270  C  CE    . LYS E  1 30  ? -5.610  20.791  -52.278 1.00 53.93  ? 273 LYS E CE    1 
ATOM   3271  N  NZ    . LYS E  1 30  ? -6.586  19.662  -52.321 1.00 55.34  ? 273 LYS E NZ    1 
ATOM   3272  N  N     . TRP E  1 31  ? -1.440  23.723  -52.271 1.00 30.59  ? 274 TRP E N     1 
ATOM   3273  C  CA    . TRP E  1 31  ? -0.802  23.612  -50.933 1.00 32.38  ? 274 TRP E CA    1 
ATOM   3274  C  C     . TRP E  1 31  ? 0.097   24.788  -50.733 1.00 27.22  ? 274 TRP E C     1 
ATOM   3275  O  O     . TRP E  1 31  ? 0.112   25.353  -49.694 1.00 29.06  ? 274 TRP E O     1 
ATOM   3276  C  CB    . TRP E  1 31  ? -0.051  22.305  -50.712 1.00 32.91  ? 274 TRP E CB    1 
ATOM   3277  C  CG    . TRP E  1 31  ? -0.897  21.069  -50.796 1.00 32.80  ? 274 TRP E CG    1 
ATOM   3278  C  CD1   . TRP E  1 31  ? -0.685  19.996  -51.638 1.00 35.68  ? 274 TRP E CD1   1 
ATOM   3279  C  CD2   . TRP E  1 31  ? -2.049  20.738  -50.025 1.00 31.88  ? 274 TRP E CD2   1 
ATOM   3280  N  NE1   . TRP E  1 31  ? -1.626  19.046  -51.428 1.00 33.73  ? 274 TRP E NE1   1 
ATOM   3281  C  CE2   . TRP E  1 31  ? -2.475  19.465  -50.441 1.00 33.47  ? 274 TRP E CE2   1 
ATOM   3282  C  CE3   . TRP E  1 31  ? -2.753  21.377  -49.012 1.00 34.13  ? 274 TRP E CE3   1 
ATOM   3283  C  CZ2   . TRP E  1 31  ? -3.604  18.832  -49.902 1.00 35.84  ? 274 TRP E CZ2   1 
ATOM   3284  C  CZ3   . TRP E  1 31  ? -3.875  20.733  -48.460 1.00 38.12  ? 274 TRP E CZ3   1 
ATOM   3285  C  CH2   . TRP E  1 31  ? -4.277  19.468  -48.902 1.00 34.60  ? 274 TRP E CH2   1 
ATOM   3286  N  N     . ARG E  1 32  ? 0.775   25.203  -51.774 1.00 28.39  ? 275 ARG E N     1 
ATOM   3287  C  CA    . ARG E  1 32  ? 1.472   26.475  -51.750 1.00 30.69  ? 275 ARG E CA    1 
ATOM   3288  C  C     . ARG E  1 32  ? 0.519   27.671  -51.370 1.00 32.77  ? 275 ARG E C     1 
ATOM   3289  O  O     . ARG E  1 32  ? 0.856   28.469  -50.486 1.00 35.31  ? 275 ARG E O     1 
ATOM   3290  C  CB    . ARG E  1 32  ? 2.160   26.660  -53.077 1.00 30.15  ? 275 ARG E CB    1 
ATOM   3291  C  CG    . ARG E  1 32  ? 2.883   27.971  -53.187 1.00 36.25  ? 275 ARG E CG    1 
ATOM   3292  C  CD    . ARG E  1 32  ? 4.318   27.780  -53.607 1.00 39.40  ? 275 ARG E CD    1 
ATOM   3293  N  NE    . ARG E  1 32  ? 4.418   27.395  -55.000 1.00 45.85  ? 275 ARG E NE    1 
ATOM   3294  C  CZ    . ARG E  1 32  ? 5.442   26.739  -55.530 1.00 49.16  ? 275 ARG E CZ    1 
ATOM   3295  N  NH1   . ARG E  1 32  ? 6.468   26.338  -54.780 1.00 51.25  ? 275 ARG E NH1   1 
ATOM   3296  N  NH2   . ARG E  1 32  ? 5.424   26.467  -56.823 1.00 52.60  ? 275 ARG E NH2   1 
ATOM   3297  N  N     . ALA E  1 33  ? -0.676  27.747  -51.978 1.00 30.78  ? 276 ALA E N     1 
ATOM   3298  C  CA    . ALA E  1 33  ? -1.677  28.793  -51.644 1.00 30.74  ? 276 ALA E CA    1 
ATOM   3299  C  C     . ALA E  1 33  ? -2.063  28.744  -50.190 1.00 30.74  ? 276 ALA E C     1 
ATOM   3300  O  O     . ALA E  1 33  ? -2.155  29.794  -49.536 1.00 35.46  ? 276 ALA E O     1 
ATOM   3301  C  CB    . ALA E  1 33  ? -2.924  28.670  -52.487 1.00 30.03  ? 276 ALA E CB    1 
ATOM   3302  N  N     . LEU E  1 34  ? -2.274  27.536  -49.674 1.00 28.19  ? 277 LEU E N     1 
ATOM   3303  C  CA    . LEU E  1 34  ? -2.605  27.359  -48.266 1.00 28.42  ? 277 LEU E CA    1 
ATOM   3304  C  C     . LEU E  1 34  ? -1.483  27.891  -47.343 1.00 29.68  ? 277 LEU E C     1 
ATOM   3305  O  O     . LEU E  1 34  ? -1.769  28.548  -46.356 1.00 26.96  ? 277 LEU E O     1 
ATOM   3306  C  CB    . LEU E  1 34  ? -2.872  25.891  -47.957 1.00 30.57  ? 277 LEU E CB    1 
ATOM   3307  C  CG    . LEU E  1 34  ? -3.164  25.533  -46.496 1.00 33.47  ? 277 LEU E CG    1 
ATOM   3308  C  CD1   . LEU E  1 34  ? -4.328  26.333  -45.935 1.00 37.59  ? 277 LEU E CD1   1 
ATOM   3309  C  CD2   . LEU E  1 34  ? -3.471  24.064  -46.366 1.00 32.68  ? 277 LEU E CD2   1 
ATOM   3310  N  N     . GLY E  1 35  ? -0.221  27.613  -47.676 1.00 27.34  ? 278 GLY E N     1 
ATOM   3311  C  CA    . GLY E  1 35  ? 0.875   28.184  -46.922 1.00 26.67  ? 278 GLY E CA    1 
ATOM   3312  C  C     . GLY E  1 35  ? 0.911   29.691  -46.974 1.00 24.24  ? 278 GLY E C     1 
ATOM   3313  O  O     . GLY E  1 35  ? 1.161   30.333  -45.962 1.00 24.83  ? 278 GLY E O     1 
ATOM   3314  N  N     . TYR E  1 36  ? 0.675   30.279  -48.136 1.00 24.35  ? 279 TYR E N     1 
ATOM   3315  C  CA    . TYR E  1 36  ? 0.517   31.738  -48.168 1.00 27.11  ? 279 TYR E CA    1 
ATOM   3316  C  C     . TYR E  1 36  ? -0.620  32.204  -47.262 1.00 28.03  ? 279 TYR E C     1 
ATOM   3317  O  O     . TYR E  1 36  ? -0.490  33.173  -46.491 1.00 27.20  ? 279 TYR E O     1 
ATOM   3318  C  CB    . TYR E  1 36  ? 0.277   32.221  -49.604 1.00 26.75  ? 279 TYR E CB    1 
ATOM   3319  C  CG    . TYR E  1 36  ? 1.544   32.392  -50.360 1.00 26.88  ? 279 TYR E CG    1 
ATOM   3320  C  CD1   . TYR E  1 36  ? 2.227   31.304  -50.874 1.00 27.80  ? 279 TYR E CD1   1 
ATOM   3321  C  CD2   . TYR E  1 36  ? 2.089   33.624  -50.519 1.00 28.73  ? 279 TYR E CD2   1 
ATOM   3322  C  CE1   . TYR E  1 36  ? 3.393   31.463  -51.578 1.00 26.69  ? 279 TYR E CE1   1 
ATOM   3323  C  CE2   . TYR E  1 36  ? 3.269   33.793  -51.176 1.00 28.68  ? 279 TYR E CE2   1 
ATOM   3324  C  CZ    . TYR E  1 36  ? 3.903   32.719  -51.725 1.00 28.30  ? 279 TYR E CZ    1 
ATOM   3325  O  OH    . TYR E  1 36  ? 5.066   32.951  -52.405 1.00 30.63  ? 279 TYR E OH    1 
ATOM   3326  N  N     . ALA E  1 37  ? -1.740  31.494  -47.357 1.00 29.51  ? 280 ALA E N     1 
ATOM   3327  C  CA    . ALA E  1 37  ? -2.930  31.890  -46.641 1.00 29.86  ? 280 ALA E CA    1 
ATOM   3328  C  C     . ALA E  1 37  ? -2.644  31.887  -45.171 1.00 28.37  ? 280 ALA E C     1 
ATOM   3329  O  O     . ALA E  1 37  ? -3.009  32.787  -44.450 1.00 25.21  ? 280 ALA E O     1 
ATOM   3330  C  CB    . ALA E  1 37  ? -4.069  30.922  -46.977 1.00 32.89  ? 280 ALA E CB    1 
ATOM   3331  N  N     . LYS E  1 38  ? -1.973  30.854  -44.711 1.00 28.14  ? 281 LYS E N     1 
ATOM   3332  C  CA    . LYS E  1 38  ? -1.623  30.777  -43.293 1.00 31.32  ? 281 LYS E CA    1 
ATOM   3333  C  C     . LYS E  1 38  ? -0.664  31.910  -42.863 1.00 28.38  ? 281 LYS E C     1 
ATOM   3334  O  O     . LYS E  1 38  ? -0.798  32.472  -41.775 1.00 28.63  ? 281 LYS E O     1 
ATOM   3335  C  CB    . LYS E  1 38  ? -0.941  29.443  -42.987 1.00 34.15  ? 281 LYS E CB    1 
ATOM   3336  C  CG    . LYS E  1 38  ? -1.751  28.196  -43.267 1.00 39.98  ? 281 LYS E CG    1 
ATOM   3337  C  CD    . LYS E  1 38  ? -2.361  27.669  -41.997 1.00 51.86  ? 281 LYS E CD    1 
ATOM   3338  C  CE    . LYS E  1 38  ? -3.283  26.501  -42.265 1.00 55.95  ? 281 LYS E CE    1 
ATOM   3339  N  NZ    . LYS E  1 38  ? -2.475  25.331  -42.692 1.00 61.91  ? 281 LYS E NZ    1 
ATOM   3340  N  N     . ALA E  1 39  ? 0.313   32.220  -43.705 1.00 27.28  ? 282 ALA E N     1 
ATOM   3341  C  CA    . ALA E  1 39  ? 1.263   33.297  -43.425 1.00 26.05  ? 282 ALA E CA    1 
ATOM   3342  C  C     . ALA E  1 39  ? 0.543   34.636  -43.381 1.00 26.40  ? 282 ALA E C     1 
ATOM   3343  O  O     . ALA E  1 39  ? 0.804   35.449  -42.522 1.00 25.08  ? 282 ALA E O     1 
ATOM   3344  C  CB    . ALA E  1 39  ? 2.299   33.362  -44.511 1.00 25.76  ? 282 ALA E CB    1 
ATOM   3345  N  N     . ILE E  1 40  ? -0.327  34.863  -44.365 1.00 26.59  ? 283 ILE E N     1 
ATOM   3346  C  CA    . ILE E  1 40  ? -1.104  36.096  -44.449 1.00 26.93  ? 283 ILE E CA    1 
ATOM   3347  C  C     . ILE E  1 40  ? -1.825  36.274  -43.136 1.00 27.32  ? 283 ILE E C     1 
ATOM   3348  O  O     . ILE E  1 40  ? -1.674  37.270  -42.476 1.00 32.12  ? 283 ILE E O     1 
ATOM   3349  C  CB    . ILE E  1 40  ? -2.067  36.059  -45.659 1.00 26.40  ? 283 ILE E CB    1 
ATOM   3350  C  CG1   . ILE E  1 40  ? -1.243  36.328  -46.908 1.00 25.28  ? 283 ILE E CG1   1 
ATOM   3351  C  CG2   . ILE E  1 40  ? -3.170  37.094  -45.541 1.00 28.61  ? 283 ILE E CG2   1 
ATOM   3352  C  CD1   . ILE E  1 40  ? -1.839  35.875  -48.210 1.00 25.16  ? 283 ILE E CD1   1 
ATOM   3353  N  N     . ASN E  1 41  ? -2.504  35.255  -42.683 1.00 29.95  ? 284 ASN E N     1 
ATOM   3354  C  CA    . ASN E  1 41  ? -3.248  35.349  -41.421 1.00 32.60  ? 284 ASN E CA    1 
ATOM   3355  C  C     . ASN E  1 41  ? -2.407  35.550  -40.213 1.00 30.76  ? 284 ASN E C     1 
ATOM   3356  O  O     . ASN E  1 41  ? -2.807  36.200  -39.273 1.00 31.44  ? 284 ASN E O     1 
ATOM   3357  C  CB    . ASN E  1 41  ? -4.114  34.099  -41.229 1.00 36.13  ? 284 ASN E CB    1 
ATOM   3358  C  CG    . ASN E  1 41  ? -5.421  34.217  -41.951 1.00 38.66  ? 284 ASN E CG    1 
ATOM   3359  O  OD1   . ASN E  1 41  ? -6.046  35.285  -41.914 1.00 45.89  ? 284 ASN E OD1   1 
ATOM   3360  N  ND2   . ASN E  1 41  ? -5.863  33.139  -42.601 1.00 40.08  ? 284 ASN E ND2   1 
ATOM   3361  N  N     . ALA E  1 42  ? -1.217  35.002  -40.223 1.00 31.33  ? 285 ALA E N     1 
ATOM   3362  C  CA    . ALA E  1 42  ? -0.347  35.202  -39.088 1.00 29.26  ? 285 ALA E CA    1 
ATOM   3363  C  C     . ALA E  1 42  ? 0.073   36.649  -39.092 1.00 28.88  ? 285 ALA E C     1 
ATOM   3364  O  O     . ALA E  1 42  ? 0.088   37.280  -38.055 1.00 32.20  ? 285 ALA E O     1 
ATOM   3365  C  CB    . ALA E  1 42  ? 0.842   34.266  -39.132 1.00 28.97  ? 285 ALA E CB    1 
ATOM   3366  N  N     . LEU E  1 43  ? 0.395   37.210  -40.250 1.00 28.27  ? 286 LEU E N     1 
ATOM   3367  C  CA    . LEU E  1 43  ? 0.728   38.616  -40.268 1.00 26.64  ? 286 LEU E CA    1 
ATOM   3368  C  C     . LEU E  1 43  ? -0.444  39.475  -39.787 1.00 28.23  ? 286 LEU E C     1 
ATOM   3369  O  O     . LEU E  1 43  ? -0.231  40.506  -39.156 1.00 25.07  ? 286 LEU E O     1 
ATOM   3370  C  CB    . LEU E  1 43  ? 1.141   39.043  -41.664 1.00 27.10  ? 286 LEU E CB    1 
ATOM   3371  C  CG    . LEU E  1 43  ? 2.499   38.468  -42.078 1.00 27.43  ? 286 LEU E CG    1 
ATOM   3372  C  CD1   . LEU E  1 43  ? 2.691   38.562  -43.586 1.00 28.98  ? 286 LEU E CD1   1 
ATOM   3373  C  CD2   . LEU E  1 43  ? 3.587   39.223  -41.321 1.00 27.17  ? 286 LEU E CD2   1 
ATOM   3374  N  N     . LYS E  1 44  ? -1.675  39.079  -40.137 1.00 29.35  ? 287 LYS E N     1 
ATOM   3375  C  CA    . LYS E  1 44  ? -2.849  39.871  -39.776 1.00 31.84  ? 287 LYS E CA    1 
ATOM   3376  C  C     . LYS E  1 44  ? -3.025  39.896  -38.290 1.00 33.01  ? 287 LYS E C     1 
ATOM   3377  O  O     . LYS E  1 44  ? -3.475  40.875  -37.740 1.00 34.70  ? 287 LYS E O     1 
ATOM   3378  C  CB    . LYS E  1 44  ? -4.119  39.325  -40.394 1.00 32.13  ? 287 LYS E CB    1 
ATOM   3379  C  CG    . LYS E  1 44  ? -4.111  39.343  -41.888 1.00 33.35  ? 287 LYS E CG    1 
ATOM   3380  C  CD    . LYS E  1 44  ? -5.503  39.139  -42.465 1.00 32.16  ? 287 LYS E CD    1 
ATOM   3381  C  CE    . LYS E  1 44  ? -5.437  39.667  -43.890 1.00 33.86  ? 287 LYS E CE    1 
ATOM   3382  N  NZ    . LYS E  1 44  ? -6.655  39.342  -44.653 1.00 35.63  ? 287 LYS E NZ    1 
ATOM   3383  N  N     . SER E  1 45  ? -2.650  38.815  -37.633 1.00 34.30  ? 288 SER E N     1 
ATOM   3384  C  CA    . SER E  1 45  ? -2.879  38.724  -36.239 1.00 35.96  ? 288 SER E CA    1 
ATOM   3385  C  C     . SER E  1 45  ? -1.688  39.202  -35.468 1.00 35.81  ? 288 SER E C     1 
ATOM   3386  O  O     . SER E  1 45  ? -1.781  39.347  -34.266 1.00 36.27  ? 288 SER E O     1 
ATOM   3387  C  CB    . SER E  1 45  ? -3.219  37.293  -35.859 1.00 40.09  ? 288 SER E CB    1 
ATOM   3388  O  OG    . SER E  1 45  ? -2.056  36.539  -35.687 1.00 46.50  ? 288 SER E OG    1 
ATOM   3389  N  N     . PHE E  1 46  ? -0.565  39.476  -36.119 1.00 37.09  ? 289 PHE E N     1 
ATOM   3390  C  CA    . PHE E  1 46  ? 0.606   39.924  -35.338 1.00 36.31  ? 289 PHE E CA    1 
ATOM   3391  C  C     . PHE E  1 46  ? 0.269   41.240  -34.657 1.00 37.33  ? 289 PHE E C     1 
ATOM   3392  O  O     . PHE E  1 46  ? -0.504  42.015  -35.210 1.00 32.22  ? 289 PHE E O     1 
ATOM   3393  C  CB    . PHE E  1 46  ? 1.867   40.087  -36.195 1.00 33.43  ? 289 PHE E CB    1 
ATOM   3394  C  CG    . PHE E  1 46  ? 3.154   40.109  -35.396 1.00 30.78  ? 289 PHE E CG    1 
ATOM   3395  C  CD1   . PHE E  1 46  ? 3.502   39.034  -34.532 1.00 35.82  ? 289 PHE E CD1   1 
ATOM   3396  C  CD2   . PHE E  1 46  ? 4.045   41.127  -35.531 1.00 30.23  ? 289 PHE E CD2   1 
ATOM   3397  C  CE1   . PHE E  1 46  ? 4.695   39.015  -33.806 1.00 29.74  ? 289 PHE E CE1   1 
ATOM   3398  C  CE2   . PHE E  1 46  ? 5.251   41.117  -34.829 1.00 30.36  ? 289 PHE E CE2   1 
ATOM   3399  C  CZ    . PHE E  1 46  ? 5.581   40.066  -33.967 1.00 32.61  ? 289 PHE E CZ    1 
ATOM   3400  N  N     . HIS E  1 47  ? 0.851   41.482  -33.465 1.00 38.11  ? 290 HIS E N     1 
ATOM   3401  C  CA    . HIS E  1 47  ? 0.491   42.653  -32.629 1.00 37.87  ? 290 HIS E CA    1 
ATOM   3402  C  C     . HIS E  1 47  ? 1.068   44.018  -33.084 1.00 35.24  ? 290 HIS E C     1 
ATOM   3403  O  O     . HIS E  1 47  ? 0.633   45.043  -32.603 1.00 34.04  ? 290 HIS E O     1 
ATOM   3404  C  CB    . HIS E  1 47  ? 0.870   42.395  -31.161 1.00 41.22  ? 290 HIS E CB    1 
ATOM   3405  C  CG    . HIS E  1 47  ? 2.343   42.220  -30.954 1.00 40.72  ? 290 HIS E CG    1 
ATOM   3406  N  ND1   . HIS E  1 47  ? 3.164   43.247  -30.528 1.00 40.83  ? 290 HIS E ND1   1 
ATOM   3407  C  CD2   . HIS E  1 47  ? 3.150   41.157  -31.184 1.00 37.95  ? 290 HIS E CD2   1 
ATOM   3408  C  CE1   . HIS E  1 47  ? 4.411   42.813  -30.483 1.00 42.41  ? 290 HIS E CE1   1 
ATOM   3409  N  NE2   . HIS E  1 47  ? 4.428   41.546  -30.874 1.00 42.51  ? 290 HIS E NE2   1 
ATOM   3410  N  N     . LYS E  1 48  ? 2.004   44.044  -34.027 1.00 30.94  ? 291 LYS E N     1 
ATOM   3411  C  CA    . LYS E  1 48  ? 2.608   45.301  -34.457 1.00 29.17  ? 291 LYS E CA    1 
ATOM   3412  C  C     . LYS E  1 48  ? 3.059   45.176  -35.913 1.00 29.49  ? 291 LYS E C     1 
ATOM   3413  O  O     . LYS E  1 48  ? 3.111   44.067  -36.432 1.00 28.64  ? 291 LYS E O     1 
ATOM   3414  C  CB    . LYS E  1 48  ? 3.814   45.593  -33.573 1.00 29.28  ? 291 LYS E CB    1 
ATOM   3415  C  CG    . LYS E  1 48  ? 4.983   44.602  -33.765 1.00 34.10  ? 291 LYS E CG    1 
ATOM   3416  C  CD    . LYS E  1 48  ? 6.125   44.746  -32.739 1.00 35.73  ? 291 LYS E CD    1 
ATOM   3417  C  CE    . LYS E  1 48  ? 6.934   46.004  -33.019 1.00 36.96  ? 291 LYS E CE    1 
ATOM   3418  N  NZ    . LYS E  1 48  ? 7.554   45.922  -34.382 1.00 42.07  ? 291 LYS E NZ    1 
ATOM   3419  N  N     . PRO E  1 49  ? 3.426   46.288  -36.560 1.00 27.92  ? 292 PRO E N     1 
ATOM   3420  C  CA    . PRO E  1 49  ? 4.016   46.118  -37.870 1.00 30.34  ? 292 PRO E CA    1 
ATOM   3421  C  C     . PRO E  1 49  ? 5.329   45.343  -37.766 1.00 29.16  ? 292 PRO E C     1 
ATOM   3422  O  O     . PRO E  1 49  ? 6.126   45.617  -36.872 1.00 30.37  ? 292 PRO E O     1 
ATOM   3423  C  CB    . PRO E  1 49  ? 4.263   47.558  -38.363 1.00 29.18  ? 292 PRO E CB    1 
ATOM   3424  C  CG    . PRO E  1 49  ? 3.463   48.427  -37.462 1.00 29.22  ? 292 PRO E CG    1 
ATOM   3425  C  CD    . PRO E  1 49  ? 3.439   47.697  -36.149 1.00 29.39  ? 292 PRO E CD    1 
ATOM   3426  N  N     . VAL E  1 50  ? 5.515   44.349  -38.640 1.00 27.09  ? 293 VAL E N     1 
ATOM   3427  C  CA    . VAL E  1 50  ? 6.820   43.635  -38.744 1.00 26.17  ? 293 VAL E CA    1 
ATOM   3428  C  C     . VAL E  1 50  ? 7.861   44.604  -39.362 1.00 27.84  ? 293 VAL E C     1 
ATOM   3429  O  O     . VAL E  1 50  ? 7.631   45.216  -40.396 1.00 27.87  ? 293 VAL E O     1 
ATOM   3430  C  CB    . VAL E  1 50  ? 6.738   42.387  -39.656 1.00 25.21  ? 293 VAL E CB    1 
ATOM   3431  C  CG1   . VAL E  1 50  ? 8.103   41.701  -39.768 1.00 25.02  ? 293 VAL E CG1   1 
ATOM   3432  C  CG2   . VAL E  1 50  ? 5.705   41.398  -39.140 1.00 24.60  ? 293 VAL E CG2   1 
ATOM   3433  N  N     . THR E  1 51  ? 9.017   44.715  -38.736 1.00 29.99  ? 294 THR E N     1 
ATOM   3434  C  CA    . THR E  1 51  ? 10.055  45.619  -39.185 1.00 34.18  ? 294 THR E CA    1 
ATOM   3435  C  C     . THR E  1 51  ? 11.375  44.922  -39.529 1.00 33.65  ? 294 THR E C     1 
ATOM   3436  O  O     . THR E  1 51  ? 12.267  45.591  -39.995 1.00 34.72  ? 294 THR E O     1 
ATOM   3437  C  CB    . THR E  1 51  ? 10.366  46.637  -38.096 1.00 34.87  ? 294 THR E CB    1 
ATOM   3438  O  OG1   . THR E  1 51  ? 10.662  45.910  -36.895 1.00 38.82  ? 294 THR E OG1   1 
ATOM   3439  C  CG2   . THR E  1 51  ? 9.135   47.605  -37.871 1.00 37.59  ? 294 THR E CG2   1 
ATOM   3440  N  N     . SER E  1 52  ? 11.519  43.615  -39.325 1.00 32.58  ? 295 SER E N     1 
ATOM   3441  C  CA    . SER E  1 52  ? 12.772  42.935  -39.735 1.00 32.83  ? 295 SER E CA    1 
ATOM   3442  C  C     . SER E  1 52  ? 12.583  41.522  -40.159 1.00 32.40  ? 295 SER E C     1 
ATOM   3443  O  O     . SER E  1 52  ? 11.534  40.906  -39.894 1.00 32.71  ? 295 SER E O     1 
ATOM   3444  C  CB    . SER E  1 52  ? 13.759  42.903  -38.579 1.00 33.55  ? 295 SER E CB    1 
ATOM   3445  O  OG    . SER E  1 52  ? 13.238  42.101  -37.545 1.00 34.30  ? 295 SER E OG    1 
ATOM   3446  N  N     . TYR E  1 53  ? 13.634  40.977  -40.761 1.00 30.27  ? 296 TYR E N     1 
ATOM   3447  C  CA    . TYR E  1 53  ? 13.633  39.608  -41.194 1.00 30.27  ? 296 TYR E CA    1 
ATOM   3448  C  C     . TYR E  1 53  ? 13.516  38.653  -40.037 1.00 28.81  ? 296 TYR E C     1 
ATOM   3449  O  O     . TYR E  1 53  ? 12.717  37.721  -40.043 1.00 27.20  ? 296 TYR E O     1 
ATOM   3450  C  CB    . TYR E  1 53  ? 14.900  39.324  -41.982 1.00 31.59  ? 296 TYR E CB    1 
ATOM   3451  C  CG    . TYR E  1 53  ? 15.044  37.907  -42.529 1.00 29.00  ? 296 TYR E CG    1 
ATOM   3452  C  CD1   . TYR E  1 53  ? 15.544  36.879  -41.733 1.00 31.39  ? 296 TYR E CD1   1 
ATOM   3453  C  CD2   . TYR E  1 53  ? 14.734  37.613  -43.855 1.00 31.14  ? 296 TYR E CD2   1 
ATOM   3454  C  CE1   . TYR E  1 53  ? 15.733  35.600  -42.238 1.00 30.12  ? 296 TYR E CE1   1 
ATOM   3455  C  CE2   . TYR E  1 53  ? 14.893  36.337  -44.361 1.00 29.92  ? 296 TYR E CE2   1 
ATOM   3456  C  CZ    . TYR E  1 53  ? 15.423  35.342  -43.542 1.00 31.36  ? 296 TYR E CZ    1 
ATOM   3457  O  OH    . TYR E  1 53  ? 15.623  34.077  -44.037 1.00 36.41  ? 296 TYR E OH    1 
ATOM   3458  N  N     . GLN E  1 54  ? 14.320  38.904  -39.032 1.00 30.90  ? 297 GLN E N     1 
ATOM   3459  C  CA    . GLN E  1 54  ? 14.351  38.065  -37.865 1.00 31.26  ? 297 GLN E CA    1 
ATOM   3460  C  C     . GLN E  1 54  ? 12.995  38.149  -37.156 1.00 32.79  ? 297 GLN E C     1 
ATOM   3461  O  O     . GLN E  1 54  ? 12.441  37.110  -36.748 1.00 33.51  ? 297 GLN E O     1 
ATOM   3462  C  CB    . GLN E  1 54  ? 15.514  38.480  -36.968 1.00 33.04  ? 297 GLN E CB    1 
ATOM   3463  C  CG    . GLN E  1 54  ? 15.594  37.842  -35.588 1.00 34.81  ? 297 GLN E CG    1 
ATOM   3464  C  CD    . GLN E  1 54  ? 16.866  38.264  -34.839 1.00 41.05  ? 297 GLN E CD    1 
ATOM   3465  O  OE1   . GLN E  1 54  ? 17.733  38.957  -35.381 1.00 48.80  ? 297 GLN E OE1   1 
ATOM   3466  N  NE2   . GLN E  1 54  ? 16.988  37.835  -33.603 1.00 41.44  ? 297 GLN E NE2   1 
ATOM   3467  N  N     . GLU E  1 55  ? 12.425  39.348  -37.029 1.00 32.00  ? 298 GLU E N     1 
ATOM   3468  C  CA    . GLU E  1 55  ? 11.081  39.441  -36.454 1.00 29.72  ? 298 GLU E CA    1 
ATOM   3469  C  C     . GLU E  1 55  ? 10.099  38.580  -37.251 1.00 28.42  ? 298 GLU E C     1 
ATOM   3470  O  O     . GLU E  1 55  ? 9.302   37.824  -36.679 1.00 25.58  ? 298 GLU E O     1 
ATOM   3471  C  CB    . GLU E  1 55  ? 10.593  40.855  -36.411 1.00 32.76  ? 298 GLU E CB    1 
ATOM   3472  C  CG    . GLU E  1 55  ? 9.413   41.041  -35.494 1.00 34.38  ? 298 GLU E CG    1 
ATOM   3473  C  CD    . GLU E  1 55  ? 8.971   42.476  -35.410 1.00 39.64  ? 298 GLU E CD    1 
ATOM   3474  O  OE1   . GLU E  1 55  ? 9.271   43.256  -36.342 1.00 39.61  ? 298 GLU E OE1   1 
ATOM   3475  O  OE2   . GLU E  1 55  ? 8.315   42.821  -34.390 1.00 49.56  ? 298 GLU E OE2   1 
ATOM   3476  N  N     . ALA E  1 56  ? 10.178  38.647  -38.565 1.00 26.81  ? 299 ALA E N     1 
ATOM   3477  C  CA    . ALA E  1 56  ? 9.273   37.822  -39.370 1.00 28.73  ? 299 ALA E CA    1 
ATOM   3478  C  C     . ALA E  1 56  ? 9.428   36.329  -39.063 1.00 30.50  ? 299 ALA E C     1 
ATOM   3479  O  O     . ALA E  1 56  ? 8.436   35.614  -38.864 1.00 31.38  ? 299 ALA E O     1 
ATOM   3480  C  CB    . ALA E  1 56  ? 9.465   38.085  -40.851 1.00 26.70  ? 299 ALA E CB    1 
ATOM   3481  N  N     . CYS E  1 57  ? 10.673  35.875  -38.985 1.00 34.30  ? 300 CYS E N     1 
ATOM   3482  C  CA    . CYS E  1 57  ? 10.981  34.451  -38.733 1.00 35.31  ? 300 CYS E CA    1 
ATOM   3483  C  C     . CYS E  1 57  ? 10.509  34.004  -37.374 1.00 32.46  ? 300 CYS E C     1 
ATOM   3484  O  O     . CYS E  1 57  ? 10.187  32.826  -37.185 1.00 33.16  ? 300 CYS E O     1 
ATOM   3485  C  CB    . CYS E  1 57  ? 12.490  34.189  -38.838 1.00 35.07  ? 300 CYS E CB    1 
ATOM   3486  S  SG    . CYS E  1 57  ? 13.103  34.340  -40.522 1.00 33.00  ? 300 CYS E SG    1 
ATOM   3487  N  N     . SER E  1 58  ? 10.446  34.935  -36.436 1.00 30.20  ? 301 SER E N     1 
ATOM   3488  C  CA    . SER E  1 58  ? 9.903   34.632  -35.139 1.00 31.67  ? 301 SER E CA    1 
ATOM   3489  C  C     . SER E  1 58  ? 8.411   34.231  -35.169 1.00 32.06  ? 301 SER E C     1 
ATOM   3490  O  O     . SER E  1 58  ? 7.927   33.728  -34.153 1.00 31.37  ? 301 SER E O     1 
ATOM   3491  C  CB    . SER E  1 58  ? 10.111  35.800  -34.151 1.00 33.12  ? 301 SER E CB    1 
ATOM   3492  O  OG    . SER E  1 58  ? 9.133   36.820  -34.328 1.00 38.91  ? 301 SER E OG    1 
ATOM   3493  N  N     . ILE E  1 59  ? 7.701   34.373  -36.308 1.00 30.13  ? 302 ILE E N     1 
ATOM   3494  C  CA    . ILE E  1 59  ? 6.219   34.161  -36.345 1.00 27.65  ? 302 ILE E CA    1 
ATOM   3495  C  C     . ILE E  1 59  ? 5.784   32.806  -36.956 1.00 28.10  ? 302 ILE E C     1 
ATOM   3496  O  O     . ILE E  1 59  ? 6.074   32.485  -38.136 1.00 24.27  ? 302 ILE E O     1 
ATOM   3497  C  CB    . ILE E  1 59  ? 5.486   35.321  -37.078 1.00 26.64  ? 302 ILE E CB    1 
ATOM   3498  C  CG1   . ILE E  1 59  ? 5.926   36.686  -36.576 1.00 26.01  ? 302 ILE E CG1   1 
ATOM   3499  C  CG2   . ILE E  1 59  ? 3.986   35.266  -36.908 1.00 29.18  ? 302 ILE E CG2   1 
ATOM   3500  C  CD1   . ILE E  1 59  ? 5.461   37.843  -37.466 1.00 25.74  ? 302 ILE E CD1   1 
ATOM   3501  N  N     . PRO E  1 60  ? 5.058   31.994  -36.149 1.00 30.39  ? 303 PRO E N     1 
ATOM   3502  C  CA    . PRO E  1 60  ? 4.621   30.692  -36.616 1.00 32.13  ? 303 PRO E CA    1 
ATOM   3503  C  C     . PRO E  1 60  ? 3.865   30.930  -37.871 1.00 32.30  ? 303 PRO E C     1 
ATOM   3504  O  O     . PRO E  1 60  ? 3.078   31.860  -37.916 1.00 31.25  ? 303 PRO E O     1 
ATOM   3505  C  CB    . PRO E  1 60  ? 3.655   30.223  -35.542 1.00 32.94  ? 303 PRO E CB    1 
ATOM   3506  C  CG    . PRO E  1 60  ? 4.076   30.949  -34.315 1.00 32.29  ? 303 PRO E CG    1 
ATOM   3507  C  CD    . PRO E  1 60  ? 4.624   32.268  -34.768 1.00 31.23  ? 303 PRO E CD    1 
ATOM   3508  N  N     . GLY E  1 61  ? 4.143   30.140  -38.889 1.00 31.62  ? 304 GLY E N     1 
ATOM   3509  C  CA    . GLY E  1 61  ? 3.542   30.334  -40.186 1.00 30.30  ? 304 GLY E CA    1 
ATOM   3510  C  C     . GLY E  1 61  ? 4.431   31.098  -41.152 1.00 28.98  ? 304 GLY E C     1 
ATOM   3511  O  O     . GLY E  1 61  ? 4.205   31.069  -42.360 1.00 28.83  ? 304 GLY E O     1 
ATOM   3512  N  N     . ILE E  1 62  ? 5.444   31.782  -40.635 1.00 28.38  ? 305 ILE E N     1 
ATOM   3513  C  CA    . ILE E  1 62  ? 6.424   32.391  -41.503 1.00 29.90  ? 305 ILE E CA    1 
ATOM   3514  C  C     . ILE E  1 62  ? 7.758   31.677  -41.374 1.00 28.52  ? 305 ILE E C     1 
ATOM   3515  O  O     . ILE E  1 62  ? 8.311   31.502  -40.286 1.00 29.51  ? 305 ILE E O     1 
ATOM   3516  C  CB    . ILE E  1 62  ? 6.550   33.895  -41.199 1.00 32.39  ? 305 ILE E CB    1 
ATOM   3517  C  CG1   . ILE E  1 62  ? 5.165   34.550  -41.435 1.00 36.75  ? 305 ILE E CG1   1 
ATOM   3518  C  CG2   . ILE E  1 62  ? 7.582   34.577  -42.123 1.00 30.67  ? 305 ILE E CG2   1 
ATOM   3519  C  CD1   . ILE E  1 62  ? 5.063   35.929  -40.853 1.00 40.38  ? 305 ILE E CD1   1 
ATOM   3520  N  N     . GLY E  1 63  ? 8.268   31.300  -42.524 1.00 33.79  ? 306 GLY E N     1 
ATOM   3521  C  CA    . GLY E  1 63  ? 9.603   30.719  -42.653 1.00 32.60  ? 306 GLY E CA    1 
ATOM   3522  C  C     . GLY E  1 63  ? 10.506  31.634  -43.430 1.00 30.63  ? 306 GLY E C     1 
ATOM   3523  O  O     . GLY E  1 63  ? 10.120  32.760  -43.785 1.00 30.52  ? 306 GLY E O     1 
ATOM   3524  N  N     . LYS E  1 64  ? 11.700  31.114  -43.699 1.00 32.75  ? 307 LYS E N     1 
ATOM   3525  C  CA    . LYS E  1 64  ? 12.751  31.803  -44.430 1.00 37.35  ? 307 LYS E CA    1 
ATOM   3526  C  C     . LYS E  1 64  ? 12.238  32.489  -45.669 1.00 36.14  ? 307 LYS E C     1 
ATOM   3527  O  O     . LYS E  1 64  ? 12.570  33.656  -45.912 1.00 35.76  ? 307 LYS E O     1 
ATOM   3528  C  CB    . LYS E  1 64  ? 13.880  30.850  -44.837 1.00 39.49  ? 307 LYS E CB    1 
ATOM   3529  C  CG    . LYS E  1 64  ? 14.718  31.400  -46.006 1.00 50.72  ? 307 LYS E CG    1 
ATOM   3530  C  CD    . LYS E  1 64  ? 15.779  30.439  -46.554 1.00 57.00  ? 307 LYS E CD    1 
ATOM   3531  C  CE    . LYS E  1 64  ? 17.191  30.984  -46.358 1.00 65.61  ? 307 LYS E CE    1 
ATOM   3532  N  NZ    . LYS E  1 64  ? 18.230  29.922  -46.509 1.00 71.57  ? 307 LYS E NZ    1 
ATOM   3533  N  N     . ARG E  1 65  ? 11.459  31.762  -46.460 1.00 32.72  ? 308 ARG E N     1 
ATOM   3534  C  CA    . ARG E  1 65  ? 11.065  32.264  -47.776 1.00 32.36  ? 308 ARG E CA    1 
ATOM   3535  C  C     . ARG E  1 65  ? 9.998   33.358  -47.702 1.00 32.19  ? 308 ARG E C     1 
ATOM   3536  O  O     . ARG E  1 65  ? 10.022  34.303  -48.492 1.00 32.86  ? 308 ARG E O     1 
ATOM   3537  C  CB    . ARG E  1 65  ? 10.567  31.123  -48.589 1.00 35.97  ? 308 ARG E CB    1 
ATOM   3538  C  CG    . ARG E  1 65  ? 11.586  29.992  -48.644 1.00 44.13  ? 308 ARG E CG    1 
ATOM   3539  C  CD    . ARG E  1 65  ? 12.259  29.978  -49.980 1.00 48.56  ? 308 ARG E CD    1 
ATOM   3540  N  NE    . ARG E  1 65  ? 11.321  29.398  -50.927 1.00 54.61  ? 308 ARG E NE    1 
ATOM   3541  C  CZ    . ARG E  1 65  ? 11.259  29.707  -52.217 1.00 58.34  ? 308 ARG E CZ    1 
ATOM   3542  N  NH1   . ARG E  1 65  ? 12.077  30.620  -52.752 1.00 52.80  ? 308 ARG E NH1   1 
ATOM   3543  N  NH2   . ARG E  1 65  ? 10.354  29.093  -52.978 1.00 60.80  ? 308 ARG E NH2   1 
ATOM   3544  N  N     . MET E  1 66  ? 9.057   33.227  -46.781 1.00 28.30  ? 309 MET E N     1 
ATOM   3545  C  CA    . MET E  1 66  ? 8.045   34.274  -46.606 1.00 29.73  ? 309 MET E CA    1 
ATOM   3546  C  C     . MET E  1 66  ? 8.762   35.517  -46.021 1.00 30.26  ? 309 MET E C     1 
ATOM   3547  O  O     . MET E  1 66  ? 8.566   36.651  -46.457 1.00 27.96  ? 309 MET E O     1 
ATOM   3548  C  CB    . MET E  1 66  ? 6.923   33.759  -45.705 1.00 30.26  ? 309 MET E CB    1 
ATOM   3549  C  CG    . MET E  1 66  ? 5.526   34.306  -45.979 1.00 32.82  ? 309 MET E CG    1 
ATOM   3550  S  SD    . MET E  1 66  ? 4.944   34.081  -47.670 1.00 32.84  ? 309 MET E SD    1 
ATOM   3551  C  CE    . MET E  1 66  ? 4.217   32.476  -47.617 1.00 35.57  ? 309 MET E CE    1 
ATOM   3552  N  N     . ALA E  1 67  ? 9.683   35.286  -45.097 1.00 30.11  ? 310 ALA E N     1 
ATOM   3553  C  CA    . ALA E  1 67  ? 10.467  36.393  -44.545 1.00 29.77  ? 310 ALA E CA    1 
ATOM   3554  C  C     . ALA E  1 67  ? 11.266  37.139  -45.611 1.00 30.03  ? 310 ALA E C     1 
ATOM   3555  O  O     . ALA E  1 67  ? 11.290  38.379  -45.597 1.00 30.47  ? 310 ALA E O     1 
ATOM   3556  C  CB    . ALA E  1 67  ? 11.355  35.910  -43.403 1.00 28.12  ? 310 ALA E CB    1 
ATOM   3557  N  N     . GLU E  1 68  ? 11.832  36.421  -46.583 1.00 31.52  ? 311 GLU E N     1 
ATOM   3558  C  CA    . GLU E  1 68  ? 12.537  37.074  -47.705 1.00 34.30  ? 311 GLU E CA    1 
ATOM   3559  C  C     . GLU E  1 68  ? 11.590  38.025  -48.440 1.00 32.38  ? 311 GLU E C     1 
ATOM   3560  O  O     . GLU E  1 68  ? 11.962  39.125  -48.859 1.00 33.57  ? 311 GLU E O     1 
ATOM   3561  C  CB    . GLU E  1 68  ? 13.103  36.042  -48.716 1.00 37.38  ? 311 GLU E CB    1 
ATOM   3562  C  CG    . GLU E  1 68  ? 14.411  35.388  -48.279 1.00 46.79  ? 311 GLU E CG    1 
ATOM   3563  C  CD    . GLU E  1 68  ? 14.880  34.150  -49.105 1.00 54.43  ? 311 GLU E CD    1 
ATOM   3564  O  OE1   . GLU E  1 68  ? 14.072  33.482  -49.798 1.00 53.58  ? 311 GLU E OE1   1 
ATOM   3565  O  OE2   . GLU E  1 68  ? 16.097  33.814  -49.041 1.00 60.81  ? 311 GLU E OE2   1 
ATOM   3566  N  N     . LYS E  1 69  ? 10.350  37.610  -48.621 1.00 34.37  ? 312 LYS E N     1 
ATOM   3567  C  CA    . LYS E  1 69  ? 9.433   38.433  -49.422 1.00 32.01  ? 312 LYS E CA    1 
ATOM   3568  C  C     . LYS E  1 69  ? 9.018   39.612  -48.621 1.00 27.26  ? 312 LYS E C     1 
ATOM   3569  O  O     . LYS E  1 69  ? 8.902   40.691  -49.128 1.00 26.92  ? 312 LYS E O     1 
ATOM   3570  C  CB    . LYS E  1 69  ? 8.210   37.675  -49.851 1.00 33.30  ? 312 LYS E CB    1 
ATOM   3571  C  CG    . LYS E  1 69  ? 8.520   36.438  -50.671 1.00 36.09  ? 312 LYS E CG    1 
ATOM   3572  C  CD    . LYS E  1 69  ? 7.311   35.483  -50.606 1.00 40.99  ? 312 LYS E CD    1 
ATOM   3573  C  CE    . LYS E  1 69  ? 7.679   34.003  -50.774 1.00 43.06  ? 312 LYS E CE    1 
ATOM   3574  N  NZ    . LYS E  1 69  ? 8.468   33.832  -52.024 1.00 38.50  ? 312 LYS E NZ    1 
ATOM   3575  N  N     . ILE E  1 70  ? 8.843   39.391  -47.344 1.00 25.45  ? 313 ILE E N     1 
ATOM   3576  C  CA    . ILE E  1 70  ? 8.415   40.455  -46.447 1.00 27.58  ? 313 ILE E CA    1 
ATOM   3577  C  C     . ILE E  1 70  ? 9.481   41.562  -46.334 1.00 28.74  ? 313 ILE E C     1 
ATOM   3578  O  O     . ILE E  1 70  ? 9.133   42.742  -46.450 1.00 25.65  ? 313 ILE E O     1 
ATOM   3579  C  CB    . ILE E  1 70  ? 8.115   39.840  -45.102 1.00 26.95  ? 313 ILE E CB    1 
ATOM   3580  C  CG1   . ILE E  1 70  ? 6.865   38.994  -45.244 1.00 29.77  ? 313 ILE E CG1   1 
ATOM   3581  C  CG2   . ILE E  1 70  ? 7.931   40.875  -44.019 1.00 30.01  ? 313 ILE E CG2   1 
ATOM   3582  C  CD1   . ILE E  1 70  ? 6.655   38.070  -44.081 1.00 30.69  ? 313 ILE E CD1   1 
ATOM   3583  N  N     . ILE E  1 71  ? 10.755  41.165  -46.144 1.00 29.02  ? 314 ILE E N     1 
ATOM   3584  C  CA    . ILE E  1 71  ? 11.903  42.111  -46.102 1.00 30.95  ? 314 ILE E CA    1 
ATOM   3585  C  C     . ILE E  1 71  ? 12.055  42.854  -47.426 1.00 30.14  ? 314 ILE E C     1 
ATOM   3586  O  O     . ILE E  1 71  ? 12.314  44.048  -47.430 1.00 31.83  ? 314 ILE E O     1 
ATOM   3587  C  CB    . ILE E  1 71  ? 13.254  41.404  -45.682 1.00 33.18  ? 314 ILE E CB    1 
ATOM   3588  C  CG1   . ILE E  1 71  ? 14.120  42.344  -44.879 1.00 35.42  ? 314 ILE E CG1   1 
ATOM   3589  C  CG2   . ILE E  1 71  ? 14.033  40.805  -46.870 1.00 33.12  ? 314 ILE E CG2   1 
ATOM   3590  C  CD1   . ILE E  1 71  ? 13.535  42.635  -43.505 1.00 39.85  ? 314 ILE E CD1   1 
ATOM   3591  N  N     . GLU E  1 72  ? 11.864  42.172  -48.554 1.00 29.23  ? 315 GLU E N     1 
ATOM   3592  C  CA    . GLU E  1 72  ? 11.837  42.889  -49.830 1.00 30.82  ? 315 GLU E CA    1 
ATOM   3593  C  C     . GLU E  1 72  ? 10.741  43.962  -49.888 1.00 29.10  ? 315 GLU E C     1 
ATOM   3594  O  O     . GLU E  1 72  ? 10.985  45.102  -50.277 1.00 28.02  ? 315 GLU E O     1 
ATOM   3595  C  CB    . GLU E  1 72  ? 11.686  41.931  -51.004 1.00 31.39  ? 315 GLU E CB    1 
ATOM   3596  C  CG    . GLU E  1 72  ? 11.769  42.631  -52.351 1.00 34.67  ? 315 GLU E CG    1 
ATOM   3597  C  CD    . GLU E  1 72  ? 11.397  41.740  -53.552 1.00 35.80  ? 315 GLU E CD    1 
ATOM   3598  O  OE1   . GLU E  1 72  ? 11.339  40.523  -53.402 1.00 42.08  ? 315 GLU E OE1   1 
ATOM   3599  O  OE2   . GLU E  1 72  ? 11.171  42.265  -54.652 1.00 33.41  ? 315 GLU E OE2   1 
ATOM   3600  N  N     . ILE E  1 73  ? 9.533   43.614  -49.482 1.00 29.86  ? 316 ILE E N     1 
ATOM   3601  C  CA    . ILE E  1 73  ? 8.440   44.614  -49.464 1.00 29.37  ? 316 ILE E CA    1 
ATOM   3602  C  C     . ILE E  1 73  ? 8.805   45.806  -48.560 1.00 28.28  ? 316 ILE E C     1 
ATOM   3603  O  O     . ILE E  1 73  ? 8.678   46.958  -48.986 1.00 28.20  ? 316 ILE E O     1 
ATOM   3604  C  CB    . ILE E  1 73  ? 7.115   43.986  -49.003 1.00 27.29  ? 316 ILE E CB    1 
ATOM   3605  C  CG1   . ILE E  1 73  ? 6.576   43.060  -50.087 1.00 27.53  ? 316 ILE E CG1   1 
ATOM   3606  C  CG2   . ILE E  1 73  ? 6.081   45.060  -48.636 1.00 29.07  ? 316 ILE E CG2   1 
ATOM   3607  C  CD1   . ILE E  1 73  ? 5.774   41.915  -49.516 1.00 26.17  ? 316 ILE E CD1   1 
ATOM   3608  N  N     . LEU E  1 74  ? 9.232   45.514  -47.334 1.00 27.36  ? 317 LEU E N     1 
ATOM   3609  C  CA    . LEU E  1 74  ? 9.689   46.530  -46.354 1.00 29.82  ? 317 LEU E CA    1 
ATOM   3610  C  C     . LEU E  1 74  ? 10.762  47.462  -46.869 1.00 31.81  ? 317 LEU E C     1 
ATOM   3611  O  O     . LEU E  1 74  ? 10.717  48.668  -46.608 1.00 30.28  ? 317 LEU E O     1 
ATOM   3612  C  CB    . LEU E  1 74  ? 10.310  45.846  -45.122 1.00 31.70  ? 317 LEU E CB    1 
ATOM   3613  C  CG    . LEU E  1 74  ? 9.319   45.139  -44.201 1.00 35.91  ? 317 LEU E CG    1 
ATOM   3614  C  CD1   . LEU E  1 74  ? 10.019  44.546  -42.979 1.00 32.88  ? 317 LEU E CD1   1 
ATOM   3615  C  CD2   . LEU E  1 74  ? 8.189   46.107  -43.790 1.00 36.35  ? 317 LEU E CD2   1 
ATOM   3616  N  N     . GLU E  1 75  ? 11.748  46.898  -47.569 1.00 33.29  ? 318 GLU E N     1 
ATOM   3617  C  CA    . GLU E  1 75  ? 12.881  47.696  -48.069 1.00 37.87  ? 318 GLU E CA    1 
ATOM   3618  C  C     . GLU E  1 75  ? 12.573  48.445  -49.335 1.00 38.01  ? 318 GLU E C     1 
ATOM   3619  O  O     . GLU E  1 75  ? 13.116  49.510  -49.559 1.00 43.58  ? 318 GLU E O     1 
ATOM   3620  C  CB    . GLU E  1 75  ? 14.132  46.820  -48.266 1.00 37.32  ? 318 GLU E CB    1 
ATOM   3621  C  CG    . GLU E  1 75  ? 14.748  46.522  -46.912 1.00 40.70  ? 318 GLU E CG    1 
ATOM   3622  C  CD    . GLU E  1 75  ? 15.844  45.464  -46.908 1.00 45.66  ? 318 GLU E CD    1 
ATOM   3623  O  OE1   . GLU E  1 75  ? 16.028  44.728  -47.900 1.00 49.43  ? 318 GLU E OE1   1 
ATOM   3624  O  OE2   . GLU E  1 75  ? 16.533  45.373  -45.871 1.00 47.74  ? 318 GLU E OE2   1 
ATOM   3625  N  N     . SER E  1 76  ? 11.692  47.917  -50.170 1.00 36.83  ? 319 SER E N     1 
ATOM   3626  C  CA    . SER E  1 76  ? 11.507  48.501  -51.510 1.00 33.39  ? 319 SER E CA    1 
ATOM   3627  C  C     . SER E  1 76  ? 10.107  49.057  -51.768 1.00 32.52  ? 319 SER E C     1 
ATOM   3628  O  O     . SER E  1 76  ? 9.912   49.809  -52.696 1.00 32.29  ? 319 SER E O     1 
ATOM   3629  C  CB    . SER E  1 76  ? 11.860  47.465  -52.587 1.00 33.25  ? 319 SER E CB    1 
ATOM   3630  O  OG    . SER E  1 76  ? 10.878  46.431  -52.694 1.00 30.97  ? 319 SER E OG    1 
ATOM   3631  N  N     . GLY E  1 77  ? 9.130   48.665  -50.970 1.00 34.33  ? 320 GLY E N     1 
ATOM   3632  C  CA    . GLY E  1 77  ? 7.739   48.955  -51.287 1.00 33.70  ? 320 GLY E CA    1 
ATOM   3633  C  C     . GLY E  1 77  ? 7.156   48.072  -52.375 1.00 36.62  ? 320 GLY E C     1 
ATOM   3634  O  O     . GLY E  1 77  ? 6.014   48.289  -52.794 1.00 38.99  ? 320 GLY E O     1 
ATOM   3635  N  N     . HIS E  1 78  ? 7.891   47.052  -52.831 1.00 36.84  ? 321 HIS E N     1 
ATOM   3636  C  CA    . HIS E  1 78  ? 7.366   46.164  -53.862 1.00 37.34  ? 321 HIS E CA    1 
ATOM   3637  C  C     . HIS E  1 78  ? 7.766   44.707  -53.679 1.00 37.92  ? 321 HIS E C     1 
ATOM   3638  O  O     . HIS E  1 78  ? 8.619   44.338  -52.861 1.00 30.27  ? 321 HIS E O     1 
ATOM   3639  C  CB    . HIS E  1 78  ? 7.771   46.634  -55.285 1.00 45.44  ? 321 HIS E CB    1 
ATOM   3640  C  CG    . HIS E  1 78  ? 7.501   48.090  -55.555 1.00 54.54  ? 321 HIS E CG    1 
ATOM   3641  N  ND1   . HIS E  1 78  ? 6.231   48.636  -55.530 1.00 60.99  ? 321 HIS E ND1   1 
ATOM   3642  C  CD2   . HIS E  1 78  ? 8.342   49.115  -55.850 1.00 62.72  ? 321 HIS E CD2   1 
ATOM   3643  C  CE1   . HIS E  1 78  ? 6.301   49.931  -55.789 1.00 60.42  ? 321 HIS E CE1   1 
ATOM   3644  N  NE2   . HIS E  1 78  ? 7.571   50.246  -55.992 1.00 64.39  ? 321 HIS E NE2   1 
ATOM   3645  N  N     . LEU E  1 79  ? 7.089   43.863  -54.440 1.00 39.23  ? 322 LEU E N     1 
ATOM   3646  C  CA    . LEU E  1 79  ? 7.445   42.473  -54.527 1.00 39.38  ? 322 LEU E CA    1 
ATOM   3647  C  C     . LEU E  1 79  ? 7.622   42.182  -55.996 1.00 41.61  ? 322 LEU E C     1 
ATOM   3648  O  O     . LEU E  1 79  ? 6.637   42.141  -56.741 1.00 40.92  ? 322 LEU E O     1 
ATOM   3649  C  CB    . LEU E  1 79  ? 6.351   41.631  -53.928 1.00 37.20  ? 322 LEU E CB    1 
ATOM   3650  C  CG    . LEU E  1 79  ? 6.652   40.142  -53.841 1.00 37.77  ? 322 LEU E CG    1 
ATOM   3651  C  CD1   . LEU E  1 79  ? 8.019   39.810  -53.246 1.00 39.13  ? 322 LEU E CD1   1 
ATOM   3652  C  CD2   . LEU E  1 79  ? 5.530   39.490  -53.037 1.00 38.89  ? 322 LEU E CD2   1 
ATOM   3653  N  N     . ARG E  1 80  ? 8.874   42.013  -56.418 1.00 40.84  ? 323 ARG E N     1 
ATOM   3654  C  CA    . ARG E  1 80  ? 9.184   41.956  -57.841 1.00 44.75  ? 323 ARG E CA    1 
ATOM   3655  C  C     . ARG E  1 80  ? 8.436   40.812  -58.499 1.00 37.22  ? 323 ARG E C     1 
ATOM   3656  O  O     . ARG E  1 80  ? 7.899   40.950  -59.588 1.00 31.65  ? 323 ARG E O     1 
ATOM   3657  C  CB    . ARG E  1 80  ? 10.677  41.783  -58.068 1.00 51.79  ? 323 ARG E CB    1 
ATOM   3658  C  CG    . ARG E  1 80  ? 11.492  43.086  -58.077 1.00 63.01  ? 323 ARG E CG    1 
ATOM   3659  C  CD    . ARG E  1 80  ? 12.983  42.846  -58.359 1.00 68.27  ? 323 ARG E CD    1 
ATOM   3660  N  NE    . ARG E  1 80  ? 13.209  41.478  -58.862 1.00 79.96  ? 323 ARG E NE    1 
ATOM   3661  C  CZ    . ARG E  1 80  ? 12.860  41.015  -60.073 1.00 82.02  ? 323 ARG E CZ    1 
ATOM   3662  N  NH1   . ARG E  1 80  ? 12.262  41.795  -60.971 1.00 88.95  ? 323 ARG E NH1   1 
ATOM   3663  N  NH2   . ARG E  1 80  ? 13.097  39.744  -60.386 1.00 79.24  ? 323 ARG E NH2   1 
ATOM   3664  N  N     . LYS E  1 81  ? 8.406   39.699  -57.795 1.00 32.20  ? 324 LYS E N     1 
ATOM   3665  C  CA    . LYS E  1 81  ? 7.709   38.496  -58.212 1.00 35.35  ? 324 LYS E CA    1 
ATOM   3666  C  C     . LYS E  1 81  ? 6.275   38.740  -58.759 1.00 36.21  ? 324 LYS E C     1 
ATOM   3667  O  O     . LYS E  1 81  ? 5.828   38.029  -59.668 1.00 35.42  ? 324 LYS E O     1 
ATOM   3668  C  CB    . LYS E  1 81  ? 7.740   37.554  -57.017 1.00 36.14  ? 324 LYS E CB    1 
ATOM   3669  C  CG    . LYS E  1 81  ? 6.982   36.267  -57.146 1.00 41.11  ? 324 LYS E CG    1 
ATOM   3670  C  CD    . LYS E  1 81  ? 7.603   35.365  -58.172 1.00 48.66  ? 324 LYS E CD    1 
ATOM   3671  C  CE    . LYS E  1 81  ? 6.536   34.488  -58.814 1.00 55.09  ? 324 LYS E CE    1 
ATOM   3672  N  NZ    . LYS E  1 81  ? 7.178   33.598  -59.817 1.00 62.02  ? 324 LYS E NZ    1 
ATOM   3673  N  N     . LEU E  1 82  ? 5.582   39.768  -58.244 1.00 37.98  ? 325 LEU E N     1 
ATOM   3674  C  CA    . LEU E  1 82  ? 4.248   40.143  -58.745 1.00 40.46  ? 325 LEU E CA    1 
ATOM   3675  C  C     . LEU E  1 82  ? 4.293   40.615  -60.186 1.00 41.50  ? 325 LEU E C     1 
ATOM   3676  O  O     . LEU E  1 82  ? 3.291   40.585  -60.890 1.00 43.61  ? 325 LEU E O     1 
ATOM   3677  C  CB    . LEU E  1 82  ? 3.582   41.224  -57.871 1.00 40.33  ? 325 LEU E CB    1 
ATOM   3678  C  CG    . LEU E  1 82  ? 3.254   40.830  -56.422 1.00 41.66  ? 325 LEU E CG    1 
ATOM   3679  C  CD1   . LEU E  1 82  ? 2.755   41.996  -55.591 1.00 39.15  ? 325 LEU E CD1   1 
ATOM   3680  C  CD2   . LEU E  1 82  ? 2.228   39.721  -56.411 1.00 43.62  ? 325 LEU E CD2   1 
ATOM   3681  N  N     . ASP E  1 83  ? 5.462   41.028  -60.639 1.00 42.21  ? 326 ASP E N     1 
ATOM   3682  C  CA    . ASP E  1 83  ? 5.621   41.402  -62.042 1.00 42.49  ? 326 ASP E CA    1 
ATOM   3683  C  C     . ASP E  1 83  ? 5.790   40.208  -62.939 1.00 38.21  ? 326 ASP E C     1 
ATOM   3684  O  O     . ASP E  1 83  ? 5.917   40.367  -64.135 1.00 37.12  ? 326 ASP E O     1 
ATOM   3685  C  CB    . ASP E  1 83  ? 6.794   42.366  -62.198 1.00 42.45  ? 326 ASP E CB    1 
ATOM   3686  C  CG    . ASP E  1 83  ? 6.609   43.596  -61.359 1.00 46.86  ? 326 ASP E CG    1 
ATOM   3687  O  OD1   . ASP E  1 83  ? 5.462   44.103  -61.342 1.00 50.89  ? 326 ASP E OD1   1 
ATOM   3688  O  OD2   . ASP E  1 83  ? 7.572   44.035  -60.677 1.00 50.42  ? 326 ASP E OD2   1 
ATOM   3689  N  N     . HIS E  1 84  ? 5.812   39.018  -62.367 1.00 39.98  ? 327 HIS E N     1 
ATOM   3690  C  CA    . HIS E  1 84  ? 6.142   37.812  -63.122 1.00 41.61  ? 327 HIS E CA    1 
ATOM   3691  C  C     . HIS E  1 84  ? 5.078   36.749  -63.056 1.00 41.30  ? 327 HIS E C     1 
ATOM   3692  O  O     . HIS E  1 84  ? 5.306   35.637  -63.489 1.00 45.24  ? 327 HIS E O     1 
ATOM   3693  C  CB    . HIS E  1 84  ? 7.509   37.271  -62.686 1.00 43.63  ? 327 HIS E CB    1 
ATOM   3694  C  CG    . HIS E  1 84  ? 8.621   38.171  -63.088 1.00 49.38  ? 327 HIS E CG    1 
ATOM   3695  N  ND1   . HIS E  1 84  ? 8.884   39.355  -62.432 1.00 55.60  ? 327 HIS E ND1   1 
ATOM   3696  C  CD2   . HIS E  1 84  ? 9.464   38.128  -64.144 1.00 53.20  ? 327 HIS E CD2   1 
ATOM   3697  C  CE1   . HIS E  1 84  ? 9.878   39.980  -63.034 1.00 56.16  ? 327 HIS E CE1   1 
ATOM   3698  N  NE2   . HIS E  1 84  ? 10.251  39.252  -64.073 1.00 57.73  ? 327 HIS E NE2   1 
ATOM   3699  N  N     . ILE E  1 85  ? 3.900   37.114  -62.576 1.00 40.85  ? 328 ILE E N     1 
ATOM   3700  C  CA    . ILE E  1 85  ? 2.724   36.267  -62.673 1.00 42.36  ? 328 ILE E CA    1 
ATOM   3701  C  C     . ILE E  1 85  ? 2.367   35.955  -64.150 1.00 39.36  ? 328 ILE E C     1 
ATOM   3702  O  O     . ILE E  1 85  ? 2.266   36.860  -65.019 1.00 33.35  ? 328 ILE E O     1 
ATOM   3703  C  CB    . ILE E  1 85  ? 1.480   36.959  -62.038 1.00 44.68  ? 328 ILE E CB    1 
ATOM   3704  C  CG1   . ILE E  1 85  ? 1.757   37.441  -60.626 1.00 45.37  ? 328 ILE E CG1   1 
ATOM   3705  C  CG2   . ILE E  1 85  ? 0.293   36.023  -62.016 1.00 44.47  ? 328 ILE E CG2   1 
ATOM   3706  C  CD1   . ILE E  1 85  ? 2.323   36.359  -59.756 1.00 46.99  ? 328 ILE E CD1   1 
ATOM   3707  N  N     . SER E  1 86  ? 2.120   34.680  -64.419 1.00 36.21  ? 329 SER E N     1 
ATOM   3708  C  CA    . SER E  1 86  ? 1.609   34.272  -65.720 1.00 36.52  ? 329 SER E CA    1 
ATOM   3709  C  C     . SER E  1 86  ? 0.473   35.194  -66.195 1.00 35.16  ? 329 SER E C     1 
ATOM   3710  O  O     . SER E  1 86  ? -0.310  35.719  -65.402 1.00 36.47  ? 329 SER E O     1 
ATOM   3711  C  CB    . SER E  1 86  ? 1.201   32.791  -65.671 1.00 38.88  ? 329 SER E CB    1 
ATOM   3712  O  OG    . SER E  1 86  ? 0.619   32.340  -66.901 1.00 39.64  ? 329 SER E OG    1 
ATOM   3713  N  N     . GLU E  1 87  ? 0.416   35.416  -67.494 1.00 35.43  ? 330 GLU E N     1 
ATOM   3714  C  CA    . GLU E  1 87  ? -0.607  36.259  -68.126 1.00 41.21  ? 330 GLU E CA    1 
ATOM   3715  C  C     . GLU E  1 87  ? -1.998  35.616  -68.082 1.00 35.44  ? 330 GLU E C     1 
ATOM   3716  O  O     . GLU E  1 87  ? -3.019  36.291  -68.214 1.00 32.16  ? 330 GLU E O     1 
ATOM   3717  C  CB    . GLU E  1 87  ? -0.250  36.500  -69.602 1.00 51.31  ? 330 GLU E CB    1 
ATOM   3718  C  CG    . GLU E  1 87  ? 0.857   37.521  -69.856 1.00 61.09  ? 330 GLU E CG    1 
ATOM   3719  C  CD    . GLU E  1 87  ? 0.350   38.953  -69.749 1.00 66.12  ? 330 GLU E CD    1 
ATOM   3720  O  OE1   . GLU E  1 87  ? -0.304  39.285  -68.728 1.00 72.99  ? 330 GLU E OE1   1 
ATOM   3721  O  OE2   . GLU E  1 87  ? 0.598   39.741  -70.686 1.00 60.48  ? 330 GLU E OE2   1 
ATOM   3722  N  N     . SER E  1 88  ? -1.996  34.300  -67.967 1.00 28.89  ? 331 SER E N     1 
ATOM   3723  C  CA    . SER E  1 88  ? -3.190  33.538  -67.833 1.00 29.87  ? 331 SER E CA    1 
ATOM   3724  C  C     . SER E  1 88  ? -3.923  33.784  -66.542 1.00 29.57  ? 331 SER E C     1 
ATOM   3725  O  O     . SER E  1 88  ? -5.129  33.590  -66.481 1.00 29.71  ? 331 SER E O     1 
ATOM   3726  C  CB    . SER E  1 88  ? -2.883  32.051  -67.898 1.00 27.91  ? 331 SER E CB    1 
ATOM   3727  O  OG    . SER E  1 88  ? -2.040  31.700  -66.854 1.00 31.74  ? 331 SER E OG    1 
ATOM   3728  N  N     . VAL E  1 89  ? -3.202  34.161  -65.495 1.00 28.68  ? 332 VAL E N     1 
ATOM   3729  C  CA    . VAL E  1 89  ? -3.781  34.164  -64.170 1.00 27.25  ? 332 VAL E CA    1 
ATOM   3730  C  C     . VAL E  1 89  ? -5.094  34.952  -64.142 1.00 27.64  ? 332 VAL E C     1 
ATOM   3731  O  O     . VAL E  1 89  ? -6.105  34.441  -63.668 1.00 27.91  ? 332 VAL E O     1 
ATOM   3732  C  CB    . VAL E  1 89  ? -2.761  34.589  -63.096 1.00 27.73  ? 332 VAL E CB    1 
ATOM   3733  C  CG1   . VAL E  1 89  ? -3.415  35.325  -61.927 1.00 29.96  ? 332 VAL E CG1   1 
ATOM   3734  C  CG2   . VAL E  1 89  ? -2.036  33.358  -62.590 1.00 28.14  ? 332 VAL E CG2   1 
ATOM   3735  N  N     . PRO E  1 90  ? -5.098  36.161  -64.676 1.00 27.04  ? 333 PRO E N     1 
ATOM   3736  C  CA    . PRO E  1 90  ? -6.340  36.941  -64.586 1.00 28.85  ? 333 PRO E CA    1 
ATOM   3737  C  C     . PRO E  1 90  ? -7.547  36.298  -65.278 1.00 29.79  ? 333 PRO E C     1 
ATOM   3738  O  O     . PRO E  1 90  ? -8.679  36.475  -64.843 1.00 29.10  ? 333 PRO E O     1 
ATOM   3739  C  CB    . PRO E  1 90  ? -5.998  38.257  -65.282 1.00 29.40  ? 333 PRO E CB    1 
ATOM   3740  C  CG    . PRO E  1 90  ? -4.510  38.356  -65.248 1.00 30.97  ? 333 PRO E CG    1 
ATOM   3741  C  CD    . PRO E  1 90  ? -3.959  36.951  -65.169 1.00 30.40  ? 333 PRO E CD    1 
ATOM   3742  N  N     . VAL E  1 91  ? -7.300  35.578  -66.356 1.00 29.57  ? 334 VAL E N     1 
ATOM   3743  C  CA    . VAL E  1 91  ? -8.344  34.867  -67.049 1.00 30.40  ? 334 VAL E CA    1 
ATOM   3744  C  C     . VAL E  1 91  ? -8.815  33.713  -66.205 1.00 29.81  ? 334 VAL E C     1 
ATOM   3745  O  O     . VAL E  1 91  ? -10.007 33.484  -66.070 1.00 31.96  ? 334 VAL E O     1 
ATOM   3746  C  CB    . VAL E  1 91  ? -7.865  34.353  -68.414 1.00 30.75  ? 334 VAL E CB    1 
ATOM   3747  C  CG1   . VAL E  1 91  ? -8.859  33.358  -68.996 1.00 34.85  ? 334 VAL E CG1   1 
ATOM   3748  C  CG2   . VAL E  1 91  ? -7.712  35.514  -69.350 1.00 30.31  ? 334 VAL E CG2   1 
ATOM   3749  N  N     . LEU E  1 92  ? -7.878  32.984  -65.632 1.00 27.58  ? 335 LEU E N     1 
ATOM   3750  C  CA    . LEU E  1 92  ? -8.235  31.905  -64.756 1.00 25.71  ? 335 LEU E CA    1 
ATOM   3751  C  C     . LEU E  1 92  ? -9.059  32.381  -63.573 1.00 25.78  ? 335 LEU E C     1 
ATOM   3752  O  O     . LEU E  1 92  ? -9.984  31.728  -63.160 1.00 21.45  ? 335 LEU E O     1 
ATOM   3753  C  CB    . LEU E  1 92  ? -6.986  31.215  -64.281 1.00 26.99  ? 335 LEU E CB    1 
ATOM   3754  C  CG    . LEU E  1 92  ? -6.236  30.484  -65.420 1.00 26.70  ? 335 LEU E CG    1 
ATOM   3755  C  CD1   . LEU E  1 92  ? -4.919  29.968  -64.889 1.00 26.26  ? 335 LEU E CD1   1 
ATOM   3756  C  CD2   . LEU E  1 92  ? -7.058  29.318  -65.985 1.00 26.18  ? 335 LEU E CD2   1 
ATOM   3757  N  N     . GLU E  1 93  ? -8.738  33.552  -63.051 1.00 27.39  ? 336 GLU E N     1 
ATOM   3758  C  CA    . GLU E  1 93  ? -9.505  34.116  -61.961 1.00 29.30  ? 336 GLU E CA    1 
ATOM   3759  C  C     . GLU E  1 93  ? -10.897 34.483  -62.486 1.00 30.06  ? 336 GLU E C     1 
ATOM   3760  O  O     . GLU E  1 93  ? -11.920 34.200  -61.851 1.00 32.20  ? 336 GLU E O     1 
ATOM   3761  C  CB    . GLU E  1 93  ? -8.814  35.360  -61.451 1.00 32.70  ? 336 GLU E CB    1 
ATOM   3762  C  CG    . GLU E  1 93  ? -9.649  36.149  -60.466 1.00 39.79  ? 336 GLU E CG    1 
ATOM   3763  C  CD    . GLU E  1 93  ? -8.806  37.091  -59.631 1.00 40.94  ? 336 GLU E CD    1 
ATOM   3764  O  OE1   . GLU E  1 93  ? -7.693  37.432  -60.055 1.00 46.83  ? 336 GLU E OE1   1 
ATOM   3765  O  OE2   . GLU E  1 93  ? -9.252  37.472  -58.536 1.00 53.61  ? 336 GLU E OE2   1 
ATOM   3766  N  N     . LEU E  1 94  ? -10.940 35.103  -63.654 1.00 27.49  ? 337 LEU E N     1 
ATOM   3767  C  CA    . LEU E  1 94  ? -12.226 35.449  -64.251 1.00 27.93  ? 337 LEU E CA    1 
ATOM   3768  C  C     . LEU E  1 94  ? -13.129 34.222  -64.323 1.00 28.24  ? 337 LEU E C     1 
ATOM   3769  O  O     . LEU E  1 94  ? -14.296 34.258  -63.904 1.00 28.53  ? 337 LEU E O     1 
ATOM   3770  C  CB    . LEU E  1 94  ? -12.022 36.037  -65.650 1.00 29.10  ? 337 LEU E CB    1 
ATOM   3771  C  CG    . LEU E  1 94  ? -13.213 36.450  -66.517 1.00 29.37  ? 337 LEU E CG    1 
ATOM   3772  C  CD1   . LEU E  1 94  ? -13.886 37.695  -65.943 1.00 30.74  ? 337 LEU E CD1   1 
ATOM   3773  C  CD2   . LEU E  1 94  ? -12.718 36.734  -67.927 1.00 29.76  ? 337 LEU E CD2   1 
ATOM   3774  N  N     . PHE E  1 95  ? -12.601 33.117  -64.840 1.00 28.32  ? 338 PHE E N     1 
ATOM   3775  C  CA    . PHE E  1 95  ? -13.457 31.966  -65.024 1.00 27.62  ? 338 PHE E CA    1 
ATOM   3776  C  C     . PHE E  1 95  ? -13.862 31.340  -63.695 1.00 26.65  ? 338 PHE E C     1 
ATOM   3777  O  O     . PHE E  1 95  ? -15.000 30.926  -63.555 1.00 29.32  ? 338 PHE E O     1 
ATOM   3778  C  CB    . PHE E  1 95  ? -12.839 30.919  -65.913 1.00 26.39  ? 338 PHE E CB    1 
ATOM   3779  C  CG    . PHE E  1 95  ? -12.632 31.342  -67.325 1.00 27.21  ? 338 PHE E CG    1 
ATOM   3780  C  CD1   . PHE E  1 95  ? -13.191 32.485  -67.834 1.00 26.41  ? 338 PHE E CD1   1 
ATOM   3781  C  CD2   . PHE E  1 95  ? -11.853 30.553  -68.172 1.00 26.10  ? 338 PHE E CD2   1 
ATOM   3782  C  CE1   . PHE E  1 95  ? -12.975 32.840  -69.156 1.00 26.49  ? 338 PHE E CE1   1 
ATOM   3783  C  CE2   . PHE E  1 95  ? -11.652 30.909  -69.494 1.00 26.91  ? 338 PHE E CE2   1 
ATOM   3784  C  CZ    . PHE E  1 95  ? -12.204 32.053  -69.985 1.00 24.92  ? 338 PHE E CZ    1 
ATOM   3785  N  N     . SER E  1 96  ? -12.964 31.232  -62.727 1.00 25.85  ? 339 SER E N     1 
ATOM   3786  C  CA    . SER E  1 96  ? -13.330 30.560  -61.477 1.00 26.45  ? 339 SER E CA    1 
ATOM   3787  C  C     . SER E  1 96  ? -14.137 31.483  -60.563 1.00 24.64  ? 339 SER E C     1 
ATOM   3788  O  O     . SER E  1 96  ? -14.713 31.041  -59.603 1.00 25.20  ? 339 SER E O     1 
ATOM   3789  C  CB    . SER E  1 96  ? -12.112 30.014  -60.734 1.00 28.12  ? 339 SER E CB    1 
ATOM   3790  O  OG    . SER E  1 96  ? -11.280 31.111  -60.425 1.00 31.59  ? 339 SER E OG    1 
ATOM   3791  N  N     . ASN E  1 97  ? -14.250 32.753  -60.890 1.00 25.88  ? 340 ASN E N     1 
ATOM   3792  C  CA    . ASN E  1 97  ? -15.276 33.564  -60.248 1.00 25.63  ? 340 ASN E CA    1 
ATOM   3793  C  C     . ASN E  1 97  ? -16.689 33.199  -60.671 1.00 26.34  ? 340 ASN E C     1 
ATOM   3794  O  O     . ASN E  1 97  ? -17.646 33.834  -60.175 1.00 26.58  ? 340 ASN E O     1 
ATOM   3795  C  CB    . ASN E  1 97  ? -15.103 35.042  -60.585 1.00 27.75  ? 340 ASN E CB    1 
ATOM   3796  C  CG    . ASN E  1 97  ? -13.973 35.688  -59.854 1.00 25.94  ? 340 ASN E CG    1 
ATOM   3797  O  OD1   . ASN E  1 97  ? -13.516 35.192  -58.873 1.00 27.70  ? 340 ASN E OD1   1 
ATOM   3798  N  ND2   . ASN E  1 97  ? -13.536 36.817  -60.342 1.00 27.80  ? 340 ASN E ND2   1 
ATOM   3799  N  N     . ILE E  1 98  ? -16.860 32.273  -61.629 1.00 23.78  ? 341 ILE E N     1 
ATOM   3800  C  CA    . ILE E  1 98  ? -18.195 31.730  -61.916 1.00 22.95  ? 341 ILE E CA    1 
ATOM   3801  C  C     . ILE E  1 98  ? -18.466 30.660  -60.882 1.00 23.66  ? 341 ILE E C     1 
ATOM   3802  O  O     . ILE E  1 98  ? -17.644 29.758  -60.645 1.00 25.67  ? 341 ILE E O     1 
ATOM   3803  C  CB    . ILE E  1 98  ? -18.294 31.088  -63.307 1.00 24.25  ? 341 ILE E CB    1 
ATOM   3804  C  CG1   . ILE E  1 98  ? -18.053 32.131  -64.426 1.00 23.63  ? 341 ILE E CG1   1 
ATOM   3805  C  CG2   . ILE E  1 98  ? -19.644 30.404  -63.546 1.00 24.50  ? 341 ILE E CG2   1 
ATOM   3806  C  CD1   . ILE E  1 98  ? -17.679 31.469  -65.719 1.00 23.56  ? 341 ILE E CD1   1 
ATOM   3807  N  N     . TRP E  1 99  ? -19.626 30.769  -60.248 1.00 25.08  ? 342 TRP E N     1 
ATOM   3808  C  CA    . TRP E  1 99  ? -19.982 29.864  -59.188 1.00 24.42  ? 342 TRP E CA    1 
ATOM   3809  C  C     . TRP E  1 99  ? -20.197 28.498  -59.831 1.00 23.76  ? 342 TRP E C     1 
ATOM   3810  O  O     . TRP E  1 99  ? -20.985 28.315  -60.759 1.00 23.25  ? 342 TRP E O     1 
ATOM   3811  C  CB    . TRP E  1 99  ? -21.228 30.326  -58.446 1.00 25.32  ? 342 TRP E CB    1 
ATOM   3812  C  CG    . TRP E  1 99  ? -21.423 29.638  -57.114 1.00 29.25  ? 342 TRP E CG    1 
ATOM   3813  C  CD1   . TRP E  1 99  ? -21.149 30.155  -55.891 1.00 30.09  ? 342 TRP E CD1   1 
ATOM   3814  C  CD2   . TRP E  1 99  ? -21.913 28.307  -56.884 1.00 29.84  ? 342 TRP E CD2   1 
ATOM   3815  N  NE1   . TRP E  1 99  ? -21.436 29.239  -54.917 1.00 32.37  ? 342 TRP E NE1   1 
ATOM   3816  C  CE2   . TRP E  1 99  ? -21.893 28.092  -55.502 1.00 31.33  ? 342 TRP E CE2   1 
ATOM   3817  C  CE3   . TRP E  1 99  ? -22.363 27.276  -57.712 1.00 29.73  ? 342 TRP E CE3   1 
ATOM   3818  C  CZ2   . TRP E  1 99  ? -22.301 26.899  -54.935 1.00 29.89  ? 342 TRP E CZ2   1 
ATOM   3819  C  CZ3   . TRP E  1 99  ? -22.751 26.088  -57.132 1.00 28.15  ? 342 TRP E CZ3   1 
ATOM   3820  C  CH2   . TRP E  1 99  ? -22.726 25.917  -55.768 1.00 27.16  ? 342 TRP E CH2   1 
ATOM   3821  N  N     . GLY E  1 100 ? -19.457 27.529  -59.343 1.00 23.07  ? 343 GLY E N     1 
ATOM   3822  C  CA    . GLY E  1 100 ? -19.615 26.158  -59.814 1.00 23.46  ? 343 GLY E CA    1 
ATOM   3823  C  C     . GLY E  1 100 ? -18.454 25.776  -60.701 1.00 21.81  ? 343 GLY E C     1 
ATOM   3824  O  O     . GLY E  1 100 ? -18.301 24.587  -61.006 1.00 19.96  ? 343 GLY E O     1 
ATOM   3825  N  N     . ALA E  1 101 ? -17.653 26.778  -61.110 1.00 21.48  ? 344 ALA E N     1 
ATOM   3826  C  CA    . ALA E  1 101 ? -16.437 26.579  -61.929 1.00 22.99  ? 344 ALA E CA    1 
ATOM   3827  C  C     . ALA E  1 101 ? -15.204 26.755  -61.031 1.00 24.56  ? 344 ALA E C     1 
ATOM   3828  O  O     . ALA E  1 101 ? -15.094 27.754  -60.369 1.00 25.69  ? 344 ALA E O     1 
ATOM   3829  C  CB    . ALA E  1 101 ? -16.385 27.591  -63.064 1.00 22.00  ? 344 ALA E CB    1 
ATOM   3830  N  N     . GLY E  1 102 ? -14.289 25.787  -61.035 1.00 27.23  ? 345 GLY E N     1 
ATOM   3831  C  CA    . GLY E  1 102 ? -13.113 25.811  -60.160 1.00 28.32  ? 345 GLY E CA    1 
ATOM   3832  C  C     . GLY E  1 102 ? -11.865 25.874  -61.008 1.00 30.14  ? 345 GLY E C     1 
ATOM   3833  O  O     . GLY E  1 102 ? -11.945 26.204  -62.188 1.00 31.11  ? 345 GLY E O     1 
ATOM   3834  N  N     . THR E  1 103 ? -10.716 25.548  -60.434 1.00 30.19  ? 346 THR E N     1 
ATOM   3835  C  CA    . THR E  1 103 ? -9.470  25.644  -61.172 1.00 31.60  ? 346 THR E CA    1 
ATOM   3836  C  C     . THR E  1 103 ? -9.459  24.676  -62.339 1.00 29.41  ? 346 THR E C     1 
ATOM   3837  O  O     . THR E  1 103 ? -8.913  25.008  -63.399 1.00 28.62  ? 346 THR E O     1 
ATOM   3838  C  CB    . THR E  1 103 ? -8.208  25.393  -60.308 1.00 33.44  ? 346 THR E CB    1 
ATOM   3839  O  OG1   . THR E  1 103 ? -8.333  24.133  -59.643 1.00 32.33  ? 346 THR E OG1   1 
ATOM   3840  C  CG2   . THR E  1 103 ? -8.086  26.442  -59.265 1.00 35.65  ? 346 THR E CG2   1 
ATOM   3841  N  N     . LYS E  1 104 ? -10.052 23.505  -62.176 1.00 28.62  ? 347 LYS E N     1 
ATOM   3842  C  CA    . LYS E  1 104 ? -10.006 22.534  -63.292 1.00 33.90  ? 347 LYS E CA    1 
ATOM   3843  C  C     . LYS E  1 104 ? -10.799 23.029  -64.500 1.00 32.60  ? 347 LYS E C     1 
ATOM   3844  O  O     . LYS E  1 104 ? -10.263 23.130  -65.623 1.00 35.36  ? 347 LYS E O     1 
ATOM   3845  C  CB    . LYS E  1 104 ? -10.549 21.159  -62.887 1.00 36.10  ? 347 LYS E CB    1 
ATOM   3846  C  CG    . LYS E  1 104 ? -9.787  20.473  -61.760 1.00 38.88  ? 347 LYS E CG    1 
ATOM   3847  C  CD    . LYS E  1 104 ? -8.366  20.153  -62.160 1.00 42.54  ? 347 LYS E CD    1 
ATOM   3848  C  CE    . LYS E  1 104 ? -7.665  19.428  -61.022 1.00 47.45  ? 347 LYS E CE    1 
ATOM   3849  N  NZ    . LYS E  1 104 ? -6.229  19.335  -61.351 1.00 49.41  ? 347 LYS E NZ    1 
ATOM   3850  N  N     . THR E  1 105 ? -12.069 23.337  -64.256 1.00 28.89  ? 348 THR E N     1 
ATOM   3851  C  CA    . THR E  1 105 ? -12.911 23.881  -65.285 1.00 26.63  ? 348 THR E CA    1 
ATOM   3852  C  C     . THR E  1 105 ? -12.245 25.060  -65.915 1.00 26.72  ? 348 THR E C     1 
ATOM   3853  O  O     . THR E  1 105 ? -12.146 25.140  -67.154 1.00 24.93  ? 348 THR E O     1 
ATOM   3854  C  CB    . THR E  1 105 ? -14.288 24.259  -64.744 1.00 27.73  ? 348 THR E CB    1 
ATOM   3855  O  OG1   . THR E  1 105 ? -14.892 23.081  -64.197 1.00 28.50  ? 348 THR E OG1   1 
ATOM   3856  C  CG2   . THR E  1 105 ? -15.221 24.847  -65.873 1.00 27.68  ? 348 THR E CG2   1 
ATOM   3857  N  N     . ALA E  1 106 ? -11.753 25.984  -65.106 1.00 27.15  ? 349 ALA E N     1 
ATOM   3858  C  CA    . ALA E  1 106 ? -11.136 27.205  -65.682 1.00 29.43  ? 349 ALA E CA    1 
ATOM   3859  C  C     . ALA E  1 106 ? -9.912  26.909  -66.560 1.00 29.38  ? 349 ALA E C     1 
ATOM   3860  O  O     . ALA E  1 106 ? -9.727  27.513  -67.642 1.00 25.82  ? 349 ALA E O     1 
ATOM   3861  C  CB    . ALA E  1 106 ? -10.749 28.185  -64.576 1.00 34.41  ? 349 ALA E CB    1 
ATOM   3862  N  N     . GLN E  1 107 ? -9.075  25.985  -66.102 1.00 31.04  ? 350 GLN E N     1 
ATOM   3863  C  CA    . GLN E  1 107 ? -7.914  25.555  -66.887 1.00 36.82  ? 350 GLN E CA    1 
ATOM   3864  C  C     . GLN E  1 107 ? -8.391  24.946  -68.193 1.00 35.65  ? 350 GLN E C     1 
ATOM   3865  O  O     . GLN E  1 107 ? -8.009  25.417  -69.258 1.00 34.78  ? 350 GLN E O     1 
ATOM   3866  C  CB    . GLN E  1 107 ? -7.000  24.575  -66.115 1.00 40.04  ? 350 GLN E CB    1 
ATOM   3867  C  CG    . GLN E  1 107 ? -5.724  25.232  -65.591 1.00 46.72  ? 350 GLN E CG    1 
ATOM   3868  C  CD    . GLN E  1 107 ? -5.286  24.771  -64.190 1.00 52.41  ? 350 GLN E CD    1 
ATOM   3869  O  OE1   . GLN E  1 107 ? -5.883  23.883  -63.552 1.00 55.25  ? 350 GLN E OE1   1 
ATOM   3870  N  NE2   . GLN E  1 107 ? -4.234  25.403  -63.698 1.00 58.77  ? 350 GLN E NE2   1 
ATOM   3871  N  N     . MET E  1 108 ? -9.263  23.939  -68.117 1.00 35.86  ? 351 MET E N     1 
ATOM   3872  C  CA    . MET E  1 108 ? -9.832  23.348  -69.353 1.00 34.22  ? 351 MET E CA    1 
ATOM   3873  C  C     . MET E  1 108 ? -10.313 24.439  -70.333 1.00 34.54  ? 351 MET E C     1 
ATOM   3874  O  O     . MET E  1 108 ? -9.937  24.462  -71.531 1.00 34.94  ? 351 MET E O     1 
ATOM   3875  C  CB    . MET E  1 108 ? -10.932 22.375  -69.000 1.00 34.81  ? 351 MET E CB    1 
ATOM   3876  C  CG    . MET E  1 108 ? -11.574 21.707  -70.203 1.00 42.54  ? 351 MET E CG    1 
ATOM   3877  S  SD    . MET E  1 108 ? -13.196 20.997  -69.828 1.00 48.93  ? 351 MET E SD    1 
ATOM   3878  C  CE    . MET E  1 108 ? -14.262 22.442  -69.754 1.00 49.35  ? 351 MET E CE    1 
ATOM   3879  N  N     . TRP E  1 109 ? -11.080 25.398  -69.835 1.00 31.05  ? 352 TRP E N     1 
ATOM   3880  C  CA    . TRP E  1 109 ? -11.548 26.438  -70.727 1.00 32.10  ? 352 TRP E CA    1 
ATOM   3881  C  C     . TRP E  1 109 ? -10.429 27.261  -71.322 1.00 32.28  ? 352 TRP E C     1 
ATOM   3882  O  O     . TRP E  1 109 ? -10.502 27.676  -72.483 1.00 35.82  ? 352 TRP E O     1 
ATOM   3883  C  CB    . TRP E  1 109 ? -12.546 27.369  -70.025 1.00 31.07  ? 352 TRP E CB    1 
ATOM   3884  C  CG    . TRP E  1 109 ? -13.855 26.717  -69.760 1.00 29.87  ? 352 TRP E CG    1 
ATOM   3885  C  CD1   . TRP E  1 109 ? -14.406 25.652  -70.417 1.00 29.14  ? 352 TRP E CD1   1 
ATOM   3886  C  CD2   . TRP E  1 109 ? -14.788 27.108  -68.759 1.00 28.95  ? 352 TRP E CD2   1 
ATOM   3887  N  NE1   . TRP E  1 109 ? -15.633 25.359  -69.880 1.00 31.77  ? 352 TRP E NE1   1 
ATOM   3888  C  CE2   . TRP E  1 109 ? -15.900 26.249  -68.873 1.00 27.96  ? 352 TRP E CE2   1 
ATOM   3889  C  CE3   . TRP E  1 109 ? -14.794 28.133  -67.786 1.00 29.88  ? 352 TRP E CE3   1 
ATOM   3890  C  CZ2   . TRP E  1 109 ? -16.999 26.345  -68.044 1.00 29.50  ? 352 TRP E CZ2   1 
ATOM   3891  C  CZ3   . TRP E  1 109 ? -15.873 28.243  -66.955 1.00 32.65  ? 352 TRP E CZ3   1 
ATOM   3892  C  CH2   . TRP E  1 109 ? -16.978 27.343  -67.074 1.00 31.23  ? 352 TRP E CH2   1 
ATOM   3893  N  N     . TYR E  1 110 ? -9.425  27.535  -70.505 1.00 31.53  ? 353 TYR E N     1 
ATOM   3894  C  CA    . TYR E  1 110 ? -8.301  28.323  -70.935 1.00 30.10  ? 353 TYR E CA    1 
ATOM   3895  C  C     . TYR E  1 110 ? -7.608  27.599  -72.062 1.00 30.06  ? 353 TYR E C     1 
ATOM   3896  O  O     . TYR E  1 110 ? -7.159  28.225  -73.025 1.00 29.40  ? 353 TYR E O     1 
ATOM   3897  C  CB    . TYR E  1 110 ? -7.271  28.512  -69.829 1.00 29.31  ? 353 TYR E CB    1 
ATOM   3898  C  CG    . TYR E  1 110 ? -6.230  29.549  -70.201 1.00 31.56  ? 353 TYR E CG    1 
ATOM   3899  C  CD1   . TYR E  1 110 ? -6.484  30.869  -69.994 1.00 29.94  ? 353 TYR E CD1   1 
ATOM   3900  C  CD2   . TYR E  1 110 ? -4.984  29.194  -70.790 1.00 30.55  ? 353 TYR E CD2   1 
ATOM   3901  C  CE1   . TYR E  1 110 ? -5.550  31.839  -70.309 1.00 33.11  ? 353 TYR E CE1   1 
ATOM   3902  C  CE2   . TYR E  1 110 ? -4.051  30.177  -71.120 1.00 29.55  ? 353 TYR E CE2   1 
ATOM   3903  C  CZ    . TYR E  1 110 ? -4.350  31.497  -70.873 1.00 31.94  ? 353 TYR E CZ    1 
ATOM   3904  O  OH    . TYR E  1 110 ? -3.508  32.539  -71.184 1.00 36.91  ? 353 TYR E OH    1 
ATOM   3905  N  N     . GLN E  1 111 ? -7.522  26.287  -71.910 1.00 33.15  ? 354 GLN E N     1 
ATOM   3906  C  CA    . GLN E  1 111 ? -6.790  25.434  -72.844 1.00 37.26  ? 354 GLN E CA    1 
ATOM   3907  C  C     . GLN E  1 111 ? -7.520  25.254  -74.149 1.00 38.18  ? 354 GLN E C     1 
ATOM   3908  O  O     . GLN E  1 111 ? -6.889  25.056  -75.147 1.00 34.20  ? 354 GLN E O     1 
ATOM   3909  C  CB    . GLN E  1 111 ? -6.449  24.094  -72.220 1.00 42.90  ? 354 GLN E CB    1 
ATOM   3910  C  CG    . GLN E  1 111 ? -5.310  24.260  -71.211 1.00 50.77  ? 354 GLN E CG    1 
ATOM   3911  C  CD    . GLN E  1 111 ? -5.048  23.045  -70.336 1.00 58.35  ? 354 GLN E CD    1 
ATOM   3912  O  OE1   . GLN E  1 111 ? -5.816  22.074  -70.319 1.00 67.65  ? 354 GLN E OE1   1 
ATOM   3913  N  NE2   . GLN E  1 111 ? -3.950  23.104  -69.582 1.00 62.56  ? 354 GLN E NE2   1 
ATOM   3914  N  N     . GLN E  1 112 ? -8.843  25.387  -74.153 1.00 37.61  ? 355 GLN E N     1 
ATOM   3915  C  CA    . GLN E  1 112 ? -9.575  25.462  -75.422 1.00 35.83  ? 355 GLN E CA    1 
ATOM   3916  C  C     . GLN E  1 112 ? -9.445  26.832  -76.028 1.00 34.42  ? 355 GLN E C     1 
ATOM   3917  O  O     . GLN E  1 112 ? -10.004 27.099  -77.079 1.00 36.39  ? 355 GLN E O     1 
ATOM   3918  C  CB    . GLN E  1 112 ? -11.040 25.178  -75.213 1.00 35.22  ? 355 GLN E CB    1 
ATOM   3919  C  CG    . GLN E  1 112 ? -11.336 23.769  -74.729 1.00 36.28  ? 355 GLN E CG    1 
ATOM   3920  C  CD    . GLN E  1 112 ? -12.809 23.629  -74.438 1.00 38.91  ? 355 GLN E CD    1 
ATOM   3921  O  OE1   . GLN E  1 112 ? -13.217 23.256  -73.338 1.00 41.24  ? 355 GLN E OE1   1 
ATOM   3922  N  NE2   . GLN E  1 112 ? -13.620 23.984  -75.421 1.00 36.63  ? 355 GLN E NE2   1 
ATOM   3923  N  N     . GLY E  1 113 ? -8.731  27.729  -75.363 1.00 33.82  ? 356 GLY E N     1 
ATOM   3924  C  CA    . GLY E  1 113 ? -8.484  29.036  -75.946 1.00 29.70  ? 356 GLY E CA    1 
ATOM   3925  C  C     . GLY E  1 113 ? -9.522  30.041  -75.549 1.00 27.80  ? 356 GLY E C     1 
ATOM   3926  O  O     . GLY E  1 113 ? -9.540  31.110  -76.086 1.00 30.78  ? 356 GLY E O     1 
ATOM   3927  N  N     . PHE E  1 114 ? -10.369 29.746  -74.572 1.00 28.74  ? 357 PHE E N     1 
ATOM   3928  C  CA    . PHE E  1 114 ? -11.350 30.777  -74.128 1.00 28.88  ? 357 PHE E CA    1 
ATOM   3929  C  C     . PHE E  1 114 ? -10.661 31.849  -73.295 1.00 27.98  ? 357 PHE E C     1 
ATOM   3930  O  O     . PHE E  1 114 ? -9.740  31.538  -72.540 1.00 27.29  ? 357 PHE E O     1 
ATOM   3931  C  CB    . PHE E  1 114 ? -12.515 30.135  -73.369 1.00 27.05  ? 357 PHE E CB    1 
ATOM   3932  C  CG    . PHE E  1 114 ? -13.230 29.074  -74.164 1.00 29.43  ? 357 PHE E CG    1 
ATOM   3933  C  CD1   . PHE E  1 114 ? -13.445 29.232  -75.546 1.00 31.66  ? 357 PHE E CD1   1 
ATOM   3934  C  CD2   . PHE E  1 114 ? -13.684 27.917  -73.557 1.00 31.53  ? 357 PHE E CD2   1 
ATOM   3935  C  CE1   . PHE E  1 114 ? -14.091 28.249  -76.293 1.00 33.45  ? 357 PHE E CE1   1 
ATOM   3936  C  CE2   . PHE E  1 114 ? -14.349 26.927  -74.301 1.00 37.87  ? 357 PHE E CE2   1 
ATOM   3937  C  CZ    . PHE E  1 114 ? -14.548 27.094  -75.677 1.00 34.63  ? 357 PHE E CZ    1 
ATOM   3938  N  N     . ARG E  1 115 ? -11.085 33.095  -73.467 1.00 28.14  ? 358 ARG E N     1 
ATOM   3939  C  CA    . ARG E  1 115 ? -10.457 34.247  -72.816 1.00 32.79  ? 358 ARG E CA    1 
ATOM   3940  C  C     . ARG E  1 115 ? -11.423 35.227  -72.147 1.00 32.27  ? 358 ARG E C     1 
ATOM   3941  O  O     . ARG E  1 115 ? -10.999 36.051  -71.356 1.00 35.88  ? 358 ARG E O     1 
ATOM   3942  C  CB    . ARG E  1 115 ? -9.613  35.038  -73.837 1.00 32.80  ? 358 ARG E CB    1 
ATOM   3943  C  CG    . ARG E  1 115 ? -8.427  34.248  -74.378 1.00 30.71  ? 358 ARG E CG    1 
ATOM   3944  C  CD    . ARG E  1 115 ? -7.337  34.200  -73.341 1.00 31.13  ? 358 ARG E CD    1 
ATOM   3945  N  NE    . ARG E  1 115 ? -6.235  33.332  -73.733 1.00 33.10  ? 358 ARG E NE    1 
ATOM   3946  C  CZ    . ARG E  1 115 ? -6.236  32.009  -73.690 1.00 31.95  ? 358 ARG E CZ    1 
ATOM   3947  N  NH1   . ARG E  1 115 ? -7.294  31.314  -73.291 1.00 37.05  ? 358 ARG E NH1   1 
ATOM   3948  N  NH2   . ARG E  1 115 ? -5.152  31.354  -74.042 1.00 33.18  ? 358 ARG E NH2   1 
ATOM   3949  N  N     . SER E  1 116 ? -12.700 35.148  -72.454 1.00 31.13  ? 359 SER E N     1 
ATOM   3950  C  CA    . SER E  1 116 ? -13.666 36.092  -71.904 1.00 32.81  ? 359 SER E CA    1 
ATOM   3951  C  C     . SER E  1 116 ? -14.913 35.350  -71.447 1.00 32.02  ? 359 SER E C     1 
ATOM   3952  O  O     . SER E  1 116 ? -15.158 34.154  -71.816 1.00 34.65  ? 359 SER E O     1 
ATOM   3953  C  CB    . SER E  1 116 ? -14.095 37.072  -72.993 1.00 35.30  ? 359 SER E CB    1 
ATOM   3954  O  OG    . SER E  1 116 ? -14.839 36.357  -73.984 1.00 37.85  ? 359 SER E OG    1 
ATOM   3955  N  N     . LEU E  1 117 ? -15.734 36.053  -70.689 1.00 28.97  ? 360 LEU E N     1 
ATOM   3956  C  CA    . LEU E  1 117 ? -16.998 35.478  -70.299 1.00 30.41  ? 360 LEU E CA    1 
ATOM   3957  C  C     . LEU E  1 117 ? -17.883 35.202  -71.534 1.00 31.52  ? 360 LEU E C     1 
ATOM   3958  O  O     . LEU E  1 117 ? -18.618 34.199  -71.588 1.00 28.36  ? 360 LEU E O     1 
ATOM   3959  C  CB    . LEU E  1 117 ? -17.678 36.396  -69.292 1.00 33.00  ? 360 LEU E CB    1 
ATOM   3960  C  CG    . LEU E  1 117 ? -16.987 36.529  -67.922 1.00 30.18  ? 360 LEU E CG    1 
ATOM   3961  C  CD1   . LEU E  1 117 ? -17.780 37.478  -67.049 1.00 31.87  ? 360 LEU E CD1   1 
ATOM   3962  C  CD2   . LEU E  1 117 ? -16.865 35.176  -67.242 1.00 31.14  ? 360 LEU E CD2   1 
ATOM   3963  N  N     . GLU E  1 118 ? -17.752 36.053  -72.543 1.00 32.37  ? 361 GLU E N     1 
ATOM   3964  C  CA    . GLU E  1 118 ? -18.457 35.858  -73.784 1.00 37.06  ? 361 GLU E CA    1 
ATOM   3965  C  C     . GLU E  1 118 ? -18.100 34.556  -74.478 1.00 34.77  ? 361 GLU E C     1 
ATOM   3966  O  O     . GLU E  1 118 ? -18.976 33.840  -74.971 1.00 34.66  ? 361 GLU E O     1 
ATOM   3967  C  CB    . GLU E  1 118 ? -18.269 37.053  -74.745 1.00 42.34  ? 361 GLU E CB    1 
ATOM   3968  C  CG    . GLU E  1 118 ? -19.569 37.821  -74.934 1.00 50.37  ? 361 GLU E CG    1 
ATOM   3969  C  CD    . GLU E  1 118 ? -20.765 36.888  -75.234 1.00 55.77  ? 361 GLU E CD    1 
ATOM   3970  O  OE1   . GLU E  1 118 ? -20.652 36.078  -76.175 1.00 62.46  ? 361 GLU E OE1   1 
ATOM   3971  O  OE2   . GLU E  1 118 ? -21.811 36.934  -74.526 1.00 53.63  ? 361 GLU E OE2   1 
ATOM   3972  N  N     . ASP E  1 119 ? -16.817 34.253  -74.541 1.00 32.14  ? 362 ASP E N     1 
ATOM   3973  C  CA    . ASP E  1 119 ? -16.376 32.976  -75.043 1.00 30.82  ? 362 ASP E CA    1 
ATOM   3974  C  C     . ASP E  1 119 ? -17.102 31.825  -74.327 1.00 31.48  ? 362 ASP E C     1 
ATOM   3975  O  O     . ASP E  1 119 ? -17.583 30.876  -74.943 1.00 33.05  ? 362 ASP E O     1 
ATOM   3976  C  CB    . ASP E  1 119 ? -14.862 32.838  -74.837 1.00 32.24  ? 362 ASP E CB    1 
ATOM   3977  C  CG    . ASP E  1 119 ? -14.040 33.725  -75.801 1.00 35.42  ? 362 ASP E CG    1 
ATOM   3978  O  OD1   . ASP E  1 119 ? -14.592 34.134  -76.852 1.00 33.61  ? 362 ASP E OD1   1 
ATOM   3979  O  OD2   . ASP E  1 119 ? -12.836 33.994  -75.507 1.00 33.81  ? 362 ASP E OD2   1 
ATOM   3980  N  N     . ILE E  1 120 ? -17.183 31.898  -73.010 1.00 30.79  ? 363 ILE E N     1 
ATOM   3981  C  CA    . ILE E  1 120 ? -17.778 30.796  -72.270 1.00 29.35  ? 363 ILE E CA    1 
ATOM   3982  C  C     . ILE E  1 120 ? -19.275 30.699  -72.642 1.00 28.38  ? 363 ILE E C     1 
ATOM   3983  O  O     . ILE E  1 120 ? -19.807 29.622  -72.884 1.00 32.02  ? 363 ILE E O     1 
ATOM   3984  C  CB    . ILE E  1 120 ? -17.677 30.979  -70.742 1.00 31.62  ? 363 ILE E CB    1 
ATOM   3985  C  CG1   . ILE E  1 120 ? -16.261 31.404  -70.274 1.00 32.96  ? 363 ILE E CG1   1 
ATOM   3986  C  CG2   . ILE E  1 120 ? -18.213 29.720  -70.033 1.00 32.02  ? 363 ILE E CG2   1 
ATOM   3987  C  CD1   . ILE E  1 120 ? -15.111 30.451  -70.584 1.00 33.03  ? 363 ILE E CD1   1 
ATOM   3988  N  N     . ARG E  1 121 ? -19.939 31.828  -72.655 1.00 27.35  ? 364 ARG E N     1 
ATOM   3989  C  CA    . ARG E  1 121 ? -21.369 31.874  -72.915 1.00 32.48  ? 364 ARG E CA    1 
ATOM   3990  C  C     . ARG E  1 121 ? -21.751 31.232  -74.251 1.00 30.37  ? 364 ARG E C     1 
ATOM   3991  O  O     . ARG E  1 121 ? -22.609 30.370  -74.296 1.00 25.55  ? 364 ARG E O     1 
ATOM   3992  C  CB    . ARG E  1 121 ? -21.855 33.315  -72.886 1.00 36.77  ? 364 ARG E CB    1 
ATOM   3993  C  CG    . ARG E  1 121 ? -23.162 33.520  -72.138 1.00 44.57  ? 364 ARG E CG    1 
ATOM   3994  C  CD    . ARG E  1 121 ? -23.508 35.004  -72.027 1.00 47.58  ? 364 ARG E CD    1 
ATOM   3995  N  NE    . ARG E  1 121 ? -22.416 35.868  -71.499 1.00 50.58  ? 364 ARG E NE    1 
ATOM   3996  C  CZ    . ARG E  1 121 ? -22.424 36.462  -70.304 1.00 49.78  ? 364 ARG E CZ    1 
ATOM   3997  N  NH1   . ARG E  1 121 ? -23.443 36.277  -69.471 1.00 49.81  ? 364 ARG E NH1   1 
ATOM   3998  N  NH2   . ARG E  1 121 ? -21.412 37.248  -69.936 1.00 49.38  ? 364 ARG E NH2   1 
ATOM   3999  N  N     . SER E  1 122 ? -21.019 31.586  -75.302 1.00 29.60  ? 365 SER E N     1 
ATOM   4000  C  CA    . SER E  1 122 ? -21.304 31.168  -76.655 1.00 28.20  ? 365 SER E CA    1 
ATOM   4001  C  C     . SER E  1 122 ? -20.671 29.823  -77.062 1.00 31.13  ? 365 SER E C     1 
ATOM   4002  O  O     . SER E  1 122 ? -21.081 29.258  -78.069 1.00 32.05  ? 365 SER E O     1 
ATOM   4003  C  CB    . SER E  1 122 ? -20.748 32.227  -77.596 1.00 28.01  ? 365 SER E CB    1 
ATOM   4004  O  OG    . SER E  1 122 ? -19.331 32.268  -77.467 1.00 34.40  ? 365 SER E OG    1 
ATOM   4005  N  N     . GLN E  1 123 ? -19.664 29.330  -76.343 1.00 29.97  ? 366 GLN E N     1 
ATOM   4006  C  CA    . GLN E  1 123 ? -18.912 28.174  -76.831 1.00 32.25  ? 366 GLN E CA    1 
ATOM   4007  C  C     . GLN E  1 123 ? -18.748 27.046  -75.841 1.00 30.98  ? 366 GLN E C     1 
ATOM   4008  O  O     . GLN E  1 123 ? -18.363 25.986  -76.213 1.00 31.65  ? 366 GLN E O     1 
ATOM   4009  C  CB    . GLN E  1 123 ? -17.507 28.610  -77.297 1.00 35.80  ? 366 GLN E CB    1 
ATOM   4010  C  CG    . GLN E  1 123 ? -17.521 29.517  -78.543 1.00 38.72  ? 366 GLN E CG    1 
ATOM   4011  C  CD    . GLN E  1 123 ? -16.152 30.140  -78.853 1.00 39.78  ? 366 GLN E CD    1 
ATOM   4012  O  OE1   . GLN E  1 123 ? -15.225 29.448  -79.281 1.00 36.79  ? 366 GLN E OE1   1 
ATOM   4013  N  NE2   . GLN E  1 123 ? -16.035 31.463  -78.649 1.00 38.01  ? 366 GLN E NE2   1 
ATOM   4014  N  N     . ALA E  1 124 ? -19.004 27.278  -74.566 1.00 34.34  ? 367 ALA E N     1 
ATOM   4015  C  CA    . ALA E  1 124 ? -18.665 26.276  -73.567 1.00 31.92  ? 367 ALA E CA    1 
ATOM   4016  C  C     . ALA E  1 124 ? -19.935 25.756  -72.974 1.00 27.35  ? 367 ALA E C     1 
ATOM   4017  O  O     . ALA E  1 124 ? -20.835 26.520  -72.644 1.00 25.75  ? 367 ALA E O     1 
ATOM   4018  C  CB    . ALA E  1 124 ? -17.791 26.884  -72.479 1.00 35.69  ? 367 ALA E CB    1 
ATOM   4019  N  N     . SER E  1 125 ? -19.992 24.444  -72.889 1.00 24.62  ? 368 SER E N     1 
ATOM   4020  C  CA    . SER E  1 125 ? -21.034 23.728  -72.168 1.00 27.57  ? 368 SER E CA    1 
ATOM   4021  C  C     . SER E  1 125 ? -21.006 24.041  -70.654 1.00 26.56  ? 368 SER E C     1 
ATOM   4022  O  O     . SER E  1 125 ? -19.962 23.968  -70.008 1.00 26.06  ? 368 SER E O     1 
ATOM   4023  C  CB    . SER E  1 125 ? -20.778 22.225  -72.336 1.00 28.00  ? 368 SER E CB    1 
ATOM   4024  O  OG    . SER E  1 125 ? -21.849 21.488  -71.785 1.00 32.12  ? 368 SER E OG    1 
ATOM   4025  N  N     . LEU E  1 126 ? -22.153 24.341  -70.087 1.00 27.27  ? 369 LEU E N     1 
ATOM   4026  C  CA    . LEU E  1 126 ? -22.237 24.655  -68.661 1.00 25.09  ? 369 LEU E CA    1 
ATOM   4027  C  C     . LEU E  1 126 ? -23.149 23.685  -67.937 1.00 24.77  ? 369 LEU E C     1 
ATOM   4028  O  O     . LEU E  1 126 ? -24.255 23.409  -68.369 1.00 26.22  ? 369 LEU E O     1 
ATOM   4029  C  CB    . LEU E  1 126 ? -22.753 26.094  -68.485 1.00 23.93  ? 369 LEU E CB    1 
ATOM   4030  C  CG    . LEU E  1 126 ? -21.941 27.242  -69.111 1.00 25.12  ? 369 LEU E CG    1 
ATOM   4031  C  CD1   . LEU E  1 126 ? -22.528 28.585  -68.742 1.00 26.93  ? 369 LEU E CD1   1 
ATOM   4032  C  CD2   . LEU E  1 126 ? -20.511 27.194  -68.634 1.00 26.63  ? 369 LEU E CD2   1 
ATOM   4033  N  N     . THR E  1 127 ? -22.731 23.230  -66.774 1.00 25.44  ? 370 THR E N     1 
ATOM   4034  C  CA    . THR E  1 127 ? -23.721 22.724  -65.821 1.00 26.75  ? 370 THR E CA    1 
ATOM   4035  C  C     . THR E  1 127 ? -24.807 23.765  -65.437 1.00 25.41  ? 370 THR E C     1 
ATOM   4036  O  O     . THR E  1 127 ? -24.677 24.970  -65.636 1.00 26.13  ? 370 THR E O     1 
ATOM   4037  C  CB    . THR E  1 127 ? -23.052 22.281  -64.513 1.00 27.70  ? 370 THR E CB    1 
ATOM   4038  O  OG1   . THR E  1 127 ? -22.568 23.438  -63.824 1.00 29.49  ? 370 THR E OG1   1 
ATOM   4039  C  CG2   . THR E  1 127 ? -21.909 21.330  -64.790 1.00 26.67  ? 370 THR E CG2   1 
ATOM   4040  N  N     . THR E  1 128 ? -25.864 23.258  -64.839 1.00 28.17  ? 371 THR E N     1 
ATOM   4041  C  CA    . THR E  1 128 ? -27.001 24.042  -64.423 1.00 30.42  ? 371 THR E CA    1 
ATOM   4042  C  C     . THR E  1 128 ? -26.559 25.079  -63.408 1.00 30.24  ? 371 THR E C     1 
ATOM   4043  O  O     . THR E  1 128 ? -27.035 26.226  -63.436 1.00 32.95  ? 371 THR E O     1 
ATOM   4044  C  CB    . THR E  1 128 ? -28.058 23.102  -63.784 1.00 32.84  ? 371 THR E CB    1 
ATOM   4045  O  OG1   . THR E  1 128 ? -28.457 22.144  -64.764 1.00 35.00  ? 371 THR E OG1   1 
ATOM   4046  C  CG2   . THR E  1 128 ? -29.287 23.838  -63.350 1.00 33.53  ? 371 THR E CG2   1 
ATOM   4047  N  N     . GLN E  1 129 ? -25.670 24.642  -62.508 1.00 28.51  ? 372 GLN E N     1 
ATOM   4048  C  CA    . GLN E  1 129 ? -25.111 25.473  -61.481 1.00 28.12  ? 372 GLN E CA    1 
ATOM   4049  C  C     . GLN E  1 129 ? -24.301 26.593  -62.124 1.00 28.46  ? 372 GLN E C     1 
ATOM   4050  O  O     . GLN E  1 129 ? -24.450 27.740  -61.716 1.00 26.18  ? 372 GLN E O     1 
ATOM   4051  C  CB    . GLN E  1 129 ? -24.241 24.653  -60.534 1.00 27.67  ? 372 GLN E CB    1 
ATOM   4052  C  CG    . GLN E  1 129 ? -25.029 23.724  -59.606 1.00 30.06  ? 372 GLN E CG    1 
ATOM   4053  C  CD    . GLN E  1 129 ? -24.120 22.897  -58.674 1.00 31.09  ? 372 GLN E CD    1 
ATOM   4054  O  OE1   . GLN E  1 129 ? -22.917 22.773  -58.919 1.00 34.57  ? 372 GLN E OE1   1 
ATOM   4055  N  NE2   . GLN E  1 129 ? -24.686 22.334  -57.610 1.00 29.28  ? 372 GLN E NE2   1 
ATOM   4056  N  N     . GLN E  1 130 ? -23.474 26.268  -63.130 1.00 25.96  ? 373 GLN E N     1 
ATOM   4057  C  CA    . GLN E  1 130 ? -22.559 27.263  -63.711 1.00 24.85  ? 373 GLN E CA    1 
ATOM   4058  C  C     . GLN E  1 130 ? -23.291 28.236  -64.568 1.00 24.64  ? 373 GLN E C     1 
ATOM   4059  O  O     . GLN E  1 130 ? -22.966 29.419  -64.588 1.00 25.58  ? 373 GLN E O     1 
ATOM   4060  C  CB    . GLN E  1 130 ? -21.501 26.597  -64.534 1.00 25.10  ? 373 GLN E CB    1 
ATOM   4061  C  CG    . GLN E  1 130 ? -20.656 25.577  -63.764 1.00 27.67  ? 373 GLN E CG    1 
ATOM   4062  C  CD    . GLN E  1 130 ? -19.822 24.678  -64.695 1.00 25.65  ? 373 GLN E CD    1 
ATOM   4063  O  OE1   . GLN E  1 130 ? -20.224 24.402  -65.786 1.00 28.87  ? 373 GLN E OE1   1 
ATOM   4064  N  NE2   . GLN E  1 130 ? -18.693 24.229  -64.239 1.00 24.44  ? 373 GLN E NE2   1 
ATOM   4065  N  N     . ALA E  1 131 ? -24.322 27.742  -65.251 1.00 25.39  ? 374 ALA E N     1 
ATOM   4066  C  CA    . ALA E  1 131 ? -25.222 28.619  -65.974 1.00 27.45  ? 374 ALA E CA    1 
ATOM   4067  C  C     . ALA E  1 131 ? -25.759 29.689  -65.041 1.00 24.21  ? 374 ALA E C     1 
ATOM   4068  O  O     . ALA E  1 131 ? -25.813 30.887  -65.380 1.00 24.85  ? 374 ALA E O     1 
ATOM   4069  C  CB    . ALA E  1 131 ? -26.391 27.806  -66.573 1.00 27.82  ? 374 ALA E CB    1 
ATOM   4070  N  N     . ILE E  1 132 ? -26.167 29.245  -63.855 1.00 22.01  ? 375 ILE E N     1 
ATOM   4071  C  CA    . ILE E  1 132 ? -26.718 30.169  -62.846 1.00 21.44  ? 375 ILE E CA    1 
ATOM   4072  C  C     . ILE E  1 132 ? -25.662 31.155  -62.366 1.00 22.12  ? 375 ILE E C     1 
ATOM   4073  O  O     . ILE E  1 132 ? -25.935 32.342  -62.229 1.00 22.08  ? 375 ILE E O     1 
ATOM   4074  C  CB    . ILE E  1 132 ? -27.373 29.394  -61.670 1.00 19.08  ? 375 ILE E CB    1 
ATOM   4075  C  CG1   . ILE E  1 132 ? -28.713 28.838  -62.173 1.00 19.44  ? 375 ILE E CG1   1 
ATOM   4076  C  CG2   . ILE E  1 132 ? -27.616 30.307  -60.483 1.00 18.56  ? 375 ILE E CG2   1 
ATOM   4077  C  CD1   . ILE E  1 132 ? -29.216 27.628  -61.429 1.00 20.62  ? 375 ILE E CD1   1 
ATOM   4078  N  N     . GLY E  1 133 ? -24.462 30.654  -62.121 1.00 22.07  ? 376 GLY E N     1 
ATOM   4079  C  CA    . GLY E  1 133 ? -23.360 31.513  -61.711 1.00 24.40  ? 376 GLY E CA    1 
ATOM   4080  C  C     . GLY E  1 133 ? -22.935 32.515  -62.764 1.00 25.35  ? 376 GLY E C     1 
ATOM   4081  O  O     . GLY E  1 133 ? -22.615 33.706  -62.452 1.00 21.64  ? 376 GLY E O     1 
ATOM   4082  N  N     . LEU E  1 134 ? -22.991 32.076  -64.025 1.00 26.17  ? 377 LEU E N     1 
ATOM   4083  C  CA    . LEU E  1 134 ? -22.609 32.992  -65.114 1.00 26.85  ? 377 LEU E CA    1 
ATOM   4084  C  C     . LEU E  1 134 ? -23.676 34.071  -65.261 1.00 24.88  ? 377 LEU E C     1 
ATOM   4085  O  O     . LEU E  1 134 ? -23.398 35.241  -65.323 1.00 23.50  ? 377 LEU E O     1 
ATOM   4086  C  CB    . LEU E  1 134 ? -22.363 32.197  -66.414 1.00 27.57  ? 377 LEU E CB    1 
ATOM   4087  C  CG    . LEU E  1 134 ? -21.916 33.015  -67.638 1.00 28.68  ? 377 LEU E CG    1 
ATOM   4088  C  CD1   . LEU E  1 134 ? -20.730 33.875  -67.289 1.00 30.42  ? 377 LEU E CD1   1 
ATOM   4089  C  CD2   . LEU E  1 134 ? -21.572 32.139  -68.841 1.00 29.60  ? 377 LEU E CD2   1 
ATOM   4090  N  N     . LYS E  1 135 ? -24.934 33.658  -65.271 1.00 27.71  ? 378 LYS E N     1 
ATOM   4091  C  CA    . LYS E  1 135 ? -26.067 34.588  -65.376 1.00 29.72  ? 378 LYS E CA    1 
ATOM   4092  C  C     . LYS E  1 135 ? -25.980 35.676  -64.296 1.00 28.07  ? 378 LYS E C     1 
ATOM   4093  O  O     . LYS E  1 135 ? -26.297 36.807  -64.543 1.00 25.78  ? 378 LYS E O     1 
ATOM   4094  C  CB    . LYS E  1 135 ? -27.382 33.777  -65.250 1.00 33.76  ? 378 LYS E CB    1 
ATOM   4095  C  CG    . LYS E  1 135 ? -28.646 34.586  -65.161 1.00 36.52  ? 378 LYS E CG    1 
ATOM   4096  C  CD    . LYS E  1 135 ? -29.890 33.710  -65.167 1.00 39.85  ? 378 LYS E CD    1 
ATOM   4097  C  CE    . LYS E  1 135 ? -30.141 33.030  -63.811 1.00 42.18  ? 378 LYS E CE    1 
ATOM   4098  N  NZ    . LYS E  1 135 ? -31.062 31.838  -63.900 1.00 40.85  ? 378 LYS E NZ    1 
ATOM   4099  N  N     . HIS E  1 136 ? -25.521 35.352  -63.089 1.00 25.75  ? 379 HIS E N     1 
ATOM   4100  C  CA    . HIS E  1 136 ? -25.504 36.374  -62.050 1.00 24.23  ? 379 HIS E CA    1 
ATOM   4101  C  C     . HIS E  1 136 ? -24.125 36.798  -61.697 1.00 23.47  ? 379 HIS E C     1 
ATOM   4102  O  O     . HIS E  1 136 ? -23.865 37.209  -60.537 1.00 24.59  ? 379 HIS E O     1 
ATOM   4103  C  CB    . HIS E  1 136 ? -26.111 35.776  -60.818 1.00 25.08  ? 379 HIS E CB    1 
ATOM   4104  C  CG    . HIS E  1 136 ? -27.539 35.443  -60.970 1.00 25.50  ? 379 HIS E CG    1 
ATOM   4105  N  ND1   . HIS E  1 136 ? -28.484 36.400  -61.234 1.00 27.87  ? 379 HIS E ND1   1 
ATOM   4106  C  CD2   . HIS E  1 136 ? -28.201 34.284  -60.819 1.00 24.60  ? 379 HIS E CD2   1 
ATOM   4107  C  CE1   . HIS E  1 136 ? -29.673 35.833  -61.278 1.00 27.32  ? 379 HIS E CE1   1 
ATOM   4108  N  NE2   . HIS E  1 136 ? -29.528 34.556  -60.996 1.00 26.59  ? 379 HIS E NE2   1 
ATOM   4109  N  N     . TYR E  1 137 ? -23.221 36.670  -62.662 1.00 25.49  ? 380 TYR E N     1 
ATOM   4110  C  CA    . TYR E  1 137 ? -21.804 36.762  -62.382 1.00 25.68  ? 380 TYR E CA    1 
ATOM   4111  C  C     . TYR E  1 137 ? -21.469 38.055  -61.692 1.00 26.18  ? 380 TYR E C     1 
ATOM   4112  O  O     . TYR E  1 137 ? -20.713 38.048  -60.688 1.00 23.87  ? 380 TYR E O     1 
ATOM   4113  C  CB    . TYR E  1 137 ? -20.975 36.629  -63.657 1.00 25.78  ? 380 TYR E CB    1 
ATOM   4114  C  CG    . TYR E  1 137 ? -19.478 36.869  -63.500 1.00 26.99  ? 380 TYR E CG    1 
ATOM   4115  C  CD1   . TYR E  1 137 ? -18.936 38.170  -63.445 1.00 25.84  ? 380 TYR E CD1   1 
ATOM   4116  C  CD2   . TYR E  1 137 ? -18.601 35.789  -63.447 1.00 28.32  ? 380 TYR E CD2   1 
ATOM   4117  C  CE1   . TYR E  1 137 ? -17.546 38.357  -63.312 1.00 27.64  ? 380 TYR E CE1   1 
ATOM   4118  C  CE2   . TYR E  1 137 ? -17.211 35.958  -63.342 1.00 28.48  ? 380 TYR E CE2   1 
ATOM   4119  C  CZ    . TYR E  1 137 ? -16.686 37.227  -63.258 1.00 29.13  ? 380 TYR E CZ    1 
ATOM   4120  O  OH    . TYR E  1 137 ? -15.316 37.318  -63.175 1.00 30.21  ? 380 TYR E OH    1 
ATOM   4121  N  N     . SER E  1 138 ? -22.020 39.158  -62.207 1.00 27.90  ? 381 SER E N     1 
ATOM   4122  C  CA    . SER E  1 138 ? -21.692 40.494  -61.639 1.00 31.70  ? 381 SER E CA    1 
ATOM   4123  C  C     . SER E  1 138 ? -22.294 40.733  -60.259 1.00 27.89  ? 381 SER E C     1 
ATOM   4124  O  O     . SER E  1 138 ? -21.625 41.237  -59.375 1.00 36.34  ? 381 SER E O     1 
ATOM   4125  C  CB    . SER E  1 138 ? -22.129 41.605  -62.577 1.00 33.27  ? 381 SER E CB    1 
ATOM   4126  O  OG    . SER E  1 138 ? -21.355 41.500  -63.746 1.00 44.42  ? 381 SER E OG    1 
ATOM   4127  N  N     . ASP E  1 139 ? -23.553 40.386  -60.079 1.00 26.16  ? 382 ASP E N     1 
ATOM   4128  C  CA    . ASP E  1 139 ? -24.170 40.455  -58.748 1.00 28.08  ? 382 ASP E CA    1 
ATOM   4129  C  C     . ASP E  1 139 ? -23.385 39.657  -57.692 1.00 26.32  ? 382 ASP E C     1 
ATOM   4130  O  O     . ASP E  1 139 ? -23.117 40.155  -56.628 1.00 29.82  ? 382 ASP E O     1 
ATOM   4131  C  CB    . ASP E  1 139 ? -25.610 39.940  -58.774 1.00 27.74  ? 382 ASP E CB    1 
ATOM   4132  C  CG    . ASP E  1 139 ? -26.586 40.946  -59.378 1.00 29.33  ? 382 ASP E CG    1 
ATOM   4133  O  OD1   . ASP E  1 139 ? -26.169 42.082  -59.617 1.00 24.26  ? 382 ASP E OD1   1 
ATOM   4134  O  OD2   . ASP E  1 139 ? -27.772 40.597  -59.572 1.00 27.88  ? 382 ASP E OD2   1 
ATOM   4135  N  N     . PHE E  1 140 ? -22.981 38.449  -58.023 1.00 26.55  ? 383 PHE E N     1 
ATOM   4136  C  CA    . PHE E  1 140 ? -22.363 37.556  -57.033 1.00 26.01  ? 383 PHE E CA    1 
ATOM   4137  C  C     . PHE E  1 140 ? -21.011 38.073  -56.585 1.00 29.49  ? 383 PHE E C     1 
ATOM   4138  O  O     . PHE E  1 140 ? -20.563 37.718  -55.503 1.00 29.19  ? 383 PHE E O     1 
ATOM   4139  C  CB    . PHE E  1 140 ? -22.257 36.142  -57.611 1.00 23.30  ? 383 PHE E CB    1 
ATOM   4140  C  CG    . PHE E  1 140 ? -23.549 35.381  -57.593 1.00 23.66  ? 383 PHE E CG    1 
ATOM   4141  C  CD1   . PHE E  1 140 ? -24.736 35.962  -57.149 1.00 24.69  ? 383 PHE E CD1   1 
ATOM   4142  C  CD2   . PHE E  1 140 ? -23.586 34.091  -58.005 1.00 23.70  ? 383 PHE E CD2   1 
ATOM   4143  C  CE1   . PHE E  1 140 ? -25.922 35.254  -57.098 1.00 24.04  ? 383 PHE E CE1   1 
ATOM   4144  C  CE2   . PHE E  1 140 ? -24.753 33.366  -57.923 1.00 24.48  ? 383 PHE E CE2   1 
ATOM   4145  C  CZ    . PHE E  1 140 ? -25.934 33.938  -57.466 1.00 24.70  ? 383 PHE E CZ    1 
ATOM   4146  N  N     . LEU E  1 141 ? -20.391 38.937  -57.391 1.00 30.96  ? 384 LEU E N     1 
ATOM   4147  C  CA    . LEU E  1 141 ? -19.069 39.471  -57.091 1.00 32.45  ? 384 LEU E CA    1 
ATOM   4148  C  C     . LEU E  1 141 ? -19.198 40.744  -56.280 1.00 33.77  ? 384 LEU E C     1 
ATOM   4149  O  O     . LEU E  1 141 ? -18.237 41.219  -55.755 1.00 35.37  ? 384 LEU E O     1 
ATOM   4150  C  CB    . LEU E  1 141 ? -18.332 39.783  -58.370 1.00 32.39  ? 384 LEU E CB    1 
ATOM   4151  C  CG    . LEU E  1 141 ? -16.928 39.291  -58.558 1.00 32.86  ? 384 LEU E CG    1 
ATOM   4152  C  CD1   . LEU E  1 141 ? -16.725 37.858  -58.114 1.00 36.08  ? 384 LEU E CD1   1 
ATOM   4153  C  CD2   . LEU E  1 141 ? -16.585 39.441  -60.021 1.00 33.24  ? 384 LEU E CD2   1 
ATOM   4154  N  N     . GLU E  1 142 ? -20.385 41.301  -56.162 1.00 34.67  ? 385 GLU E N     1 
ATOM   4155  C  CA    . GLU E  1 142 ? -20.560 42.429  -55.257 1.00 36.44  ? 385 GLU E CA    1 
ATOM   4156  C  C     . GLU E  1 142 ? -20.728 41.915  -53.810 1.00 32.81  ? 385 GLU E C     1 
ATOM   4157  O  O     . GLU E  1 142 ? -21.301 40.888  -53.611 1.00 36.68  ? 385 GLU E O     1 
ATOM   4158  C  CB    . GLU E  1 142 ? -21.788 43.259  -55.672 1.00 40.18  ? 385 GLU E CB    1 
ATOM   4159  C  CG    . GLU E  1 142 ? -21.633 44.040  -56.968 1.00 42.76  ? 385 GLU E CG    1 
ATOM   4160  C  CD    . GLU E  1 142 ? -20.379 44.912  -56.979 1.00 49.81  ? 385 GLU E CD    1 
ATOM   4161  O  OE1   . GLU E  1 142 ? -20.216 45.725  -56.025 1.00 50.48  ? 385 GLU E OE1   1 
ATOM   4162  O  OE2   . GLU E  1 142 ? -19.539 44.773  -57.926 1.00 56.25  ? 385 GLU E OE2   1 
ATOM   4163  N  N     . ARG E  1 143 ? -20.185 42.613  -52.829 1.00 31.92  ? 386 ARG E N     1 
ATOM   4164  C  CA    . ARG E  1 143 ? -20.481 42.400  -51.426 1.00 32.78  ? 386 ARG E CA    1 
ATOM   4165  C  C     . ARG E  1 143 ? -21.671 43.271  -51.181 1.00 33.03  ? 386 ARG E C     1 
ATOM   4166  O  O     . ARG E  1 143 ? -21.923 44.162  -51.946 1.00 36.35  ? 386 ARG E O     1 
ATOM   4167  C  CB    . ARG E  1 143 ? -19.297 42.820  -50.548 1.00 31.19  ? 386 ARG E CB    1 
ATOM   4168  C  CG    . ARG E  1 143 ? -18.107 41.939  -50.820 1.00 31.34  ? 386 ARG E CG    1 
ATOM   4169  C  CD    . ARG E  1 143 ? -16.933 42.164  -49.885 1.00 29.42  ? 386 ARG E CD    1 
ATOM   4170  N  NE    . ARG E  1 143 ? -17.264 41.940  -48.467 1.00 32.73  ? 386 ARG E NE    1 
ATOM   4171  C  CZ    . ARG E  1 143 ? -17.438 40.760  -47.882 1.00 28.72  ? 386 ARG E CZ    1 
ATOM   4172  N  NH1   . ARG E  1 143 ? -17.324 39.654  -48.566 1.00 29.55  ? 386 ARG E NH1   1 
ATOM   4173  N  NH2   . ARG E  1 143 ? -17.720 40.690  -46.596 1.00 30.38  ? 386 ARG E NH2   1 
ATOM   4174  N  N     . MET E  1 144 ? -22.471 42.963  -50.174 1.00 35.00  ? 387 MET E N     1 
ATOM   4175  C  CA    . MET E  1 144 ? -23.737 43.657  -49.963 1.00 32.79  ? 387 MET E CA    1 
ATOM   4176  C  C     . MET E  1 144 ? -23.640 44.379  -48.642 1.00 31.32  ? 387 MET E C     1 
ATOM   4177  O  O     . MET E  1 144 ? -22.970 43.931  -47.780 1.00 31.34  ? 387 MET E O     1 
ATOM   4178  C  CB    . MET E  1 144 ? -24.913 42.652  -49.914 1.00 34.04  ? 387 MET E CB    1 
ATOM   4179  C  CG    . MET E  1 144 ? -25.146 41.875  -48.597 1.00 33.86  ? 387 MET E CG    1 
ATOM   4180  S  SD    . MET E  1 144 ? -26.395 40.543  -48.625 1.00 34.55  ? 387 MET E SD    1 
ATOM   4181  C  CE    . MET E  1 144 ? -25.488 39.339  -49.576 1.00 33.07  ? 387 MET E CE    1 
ATOM   4182  N  N     . PRO E  1 145 ? -24.369 45.463  -48.461 1.00 34.59  ? 388 PRO E N     1 
ATOM   4183  C  CA    . PRO E  1 145 ? -24.330 46.064  -47.135 1.00 37.36  ? 388 PRO E CA    1 
ATOM   4184  C  C     . PRO E  1 145 ? -25.024 45.227  -46.052 1.00 40.43  ? 388 PRO E C     1 
ATOM   4185  O  O     . PRO E  1 145 ? -25.983 44.506  -46.320 1.00 44.72  ? 388 PRO E O     1 
ATOM   4186  C  CB    . PRO E  1 145 ? -25.054 47.413  -47.323 1.00 38.06  ? 388 PRO E CB    1 
ATOM   4187  C  CG    . PRO E  1 145 ? -25.825 47.280  -48.599 1.00 36.58  ? 388 PRO E CG    1 
ATOM   4188  C  CD    . PRO E  1 145 ? -25.141 46.246  -49.438 1.00 33.65  ? 388 PRO E CD    1 
ATOM   4189  N  N     . ARG E  1 146 ? -24.526 45.362  -44.832 1.00 39.62  ? 389 ARG E N     1 
ATOM   4190  C  CA    . ARG E  1 146 ? -24.999 44.633  -43.658 1.00 42.24  ? 389 ARG E CA    1 
ATOM   4191  C  C     . ARG E  1 146 ? -26.524 44.595  -43.458 1.00 42.32  ? 389 ARG E C     1 
ATOM   4192  O  O     . ARG E  1 146 ? -27.095 43.583  -43.043 1.00 47.20  ? 389 ARG E O     1 
ATOM   4193  C  CB    . ARG E  1 146 ? -24.377 45.288  -42.429 1.00 44.22  ? 389 ARG E CB    1 
ATOM   4194  C  CG    . ARG E  1 146 ? -24.187 44.331  -41.308 1.00 45.20  ? 389 ARG E CG    1 
ATOM   4195  C  CD    . ARG E  1 146 ? -23.775 45.005  -40.019 1.00 42.97  ? 389 ARG E CD    1 
ATOM   4196  N  NE    . ARG E  1 146 ? -24.252 44.117  -38.989 1.00 39.56  ? 389 ARG E NE    1 
ATOM   4197  C  CZ    . ARG E  1 146 ? -23.720 42.935  -38.715 1.00 41.29  ? 389 ARG E CZ    1 
ATOM   4198  N  NH1   . ARG E  1 146 ? -22.639 42.472  -39.347 1.00 36.37  ? 389 ARG E NH1   1 
ATOM   4199  N  NH2   . ARG E  1 146 ? -24.284 42.195  -37.781 1.00 44.54  ? 389 ARG E NH2   1 
ATOM   4200  N  N     . GLU E  1 147 ? -27.154 45.718  -43.737 1.00 42.62  ? 390 GLU E N     1 
ATOM   4201  C  CA    . GLU E  1 147 ? -28.583 45.879  -43.637 1.00 43.16  ? 390 GLU E CA    1 
ATOM   4202  C  C     . GLU E  1 147 ? -29.360 45.076  -44.672 1.00 39.00  ? 390 GLU E C     1 
ATOM   4203  O  O     . GLU E  1 147 ? -30.453 44.591  -44.365 1.00 36.86  ? 390 GLU E O     1 
ATOM   4204  C  CB    . GLU E  1 147 ? -28.960 47.350  -43.801 1.00 49.73  ? 390 GLU E CB    1 
ATOM   4205  C  CG    . GLU E  1 147 ? -28.203 48.287  -42.877 1.00 57.87  ? 390 GLU E CG    1 
ATOM   4206  C  CD    . GLU E  1 147 ? -26.905 48.810  -43.488 1.00 65.01  ? 390 GLU E CD    1 
ATOM   4207  O  OE1   . GLU E  1 147 ? -26.931 49.250  -44.665 1.00 69.82  ? 390 GLU E OE1   1 
ATOM   4208  O  OE2   . GLU E  1 147 ? -25.857 48.778  -42.794 1.00 70.60  ? 390 GLU E OE2   1 
ATOM   4209  N  N     . GLU E  1 148 ? -28.826 44.940  -45.892 1.00 36.52  ? 391 GLU E N     1 
ATOM   4210  C  CA    . GLU E  1 148 ? -29.403 43.994  -46.871 1.00 32.28  ? 391 GLU E CA    1 
ATOM   4211  C  C     . GLU E  1 148 ? -29.379 42.550  -46.336 1.00 33.12  ? 391 GLU E C     1 
ATOM   4212  O  O     . GLU E  1 148 ? -30.390 41.795  -46.385 1.00 30.93  ? 391 GLU E O     1 
ATOM   4213  C  CB    . GLU E  1 148 ? -28.704 44.081  -48.226 1.00 35.31  ? 391 GLU E CB    1 
ATOM   4214  C  CG    . GLU E  1 148 ? -29.462 43.336  -49.326 1.00 36.71  ? 391 GLU E CG    1 
ATOM   4215  C  CD    . GLU E  1 148 ? -28.948 43.601  -50.722 1.00 39.44  ? 391 GLU E CD    1 
ATOM   4216  O  OE1   . GLU E  1 148 ? -28.041 44.465  -50.886 1.00 38.98  ? 391 GLU E OE1   1 
ATOM   4217  O  OE2   . GLU E  1 148 ? -29.454 42.929  -51.663 1.00 36.98  ? 391 GLU E OE2   1 
ATOM   4218  N  N     . ALA E  1 149 ? -28.255 42.156  -45.769 1.00 31.11  ? 392 ALA E N     1 
ATOM   4219  C  CA    . ALA E  1 149 ? -28.224 40.864  -45.139 1.00 31.14  ? 392 ALA E CA    1 
ATOM   4220  C  C     . ALA E  1 149 ? -29.301 40.731  -44.039 1.00 32.75  ? 392 ALA E C     1 
ATOM   4221  O  O     . ALA E  1 149 ? -29.896 39.665  -43.854 1.00 34.10  ? 392 ALA E O     1 
ATOM   4222  C  CB    . ALA E  1 149 ? -26.844 40.571  -44.598 1.00 30.43  ? 392 ALA E CB    1 
ATOM   4223  N  N     . THR E  1 150 ? -29.577 41.795  -43.314 1.00 32.92  ? 393 THR E N     1 
ATOM   4224  C  CA    . THR E  1 150 ? -30.557 41.685  -42.233 1.00 34.35  ? 393 THR E CA    1 
ATOM   4225  C  C     . THR E  1 150 ? -31.937 41.383  -42.809 1.00 32.68  ? 393 THR E C     1 
ATOM   4226  O  O     . THR E  1 150 ? -32.651 40.506  -42.362 1.00 34.05  ? 393 THR E O     1 
ATOM   4227  C  CB    . THR E  1 150 ? -30.594 42.968  -41.402 1.00 34.82  ? 393 THR E CB    1 
ATOM   4228  O  OG1   . THR E  1 150 ? -29.344 43.106  -40.714 1.00 35.39  ? 393 THR E OG1   1 
ATOM   4229  C  CG2   . THR E  1 150 ? -31.769 42.943  -40.363 1.00 33.80  ? 393 THR E CG2   1 
ATOM   4230  N  N     . GLU E  1 151 ? -32.251 42.073  -43.867 1.00 30.88  ? 394 GLU E N     1 
ATOM   4231  C  CA    . GLU E  1 151 ? -33.524 41.952  -44.499 1.00 34.18  ? 394 GLU E CA    1 
ATOM   4232  C  C     . GLU E  1 151 ? -33.717 40.577  -45.100 1.00 34.14  ? 394 GLU E C     1 
ATOM   4233  O  O     . GLU E  1 151 ? -34.821 40.072  -45.189 1.00 40.56  ? 394 GLU E O     1 
ATOM   4234  C  CB    . GLU E  1 151 ? -33.582 43.014  -45.568 1.00 39.49  ? 394 GLU E CB    1 
ATOM   4235  C  CG    . GLU E  1 151 ? -34.946 43.602  -45.796 1.00 47.55  ? 394 GLU E CG    1 
ATOM   4236  C  CD    . GLU E  1 151 ? -34.891 44.921  -46.558 1.00 52.27  ? 394 GLU E CD    1 
ATOM   4237  O  OE1   . GLU E  1 151 ? -33.778 45.465  -46.825 1.00 50.14  ? 394 GLU E OE1   1 
ATOM   4238  O  OE2   . GLU E  1 151 ? -35.994 45.397  -46.894 1.00 60.51  ? 394 GLU E OE2   1 
ATOM   4239  N  N     . ILE E  1 152 ? -32.619 39.949  -45.472 1.00 32.07  ? 395 ILE E N     1 
ATOM   4240  C  CA    . ILE E  1 152 ? -32.645 38.645  -46.042 1.00 29.84  ? 395 ILE E CA    1 
ATOM   4241  C  C     . ILE E  1 152 ? -32.894 37.639  -44.963 1.00 30.11  ? 395 ILE E C     1 
ATOM   4242  O  O     . ILE E  1 152 ? -33.736 36.764  -45.122 1.00 29.84  ? 395 ILE E O     1 
ATOM   4243  C  CB    . ILE E  1 152 ? -31.337 38.338  -46.837 1.00 29.98  ? 395 ILE E CB    1 
ATOM   4244  C  CG1   . ILE E  1 152 ? -31.454 38.917  -48.247 1.00 31.83  ? 395 ILE E CG1   1 
ATOM   4245  C  CG2   . ILE E  1 152 ? -31.083 36.843  -46.953 1.00 29.12  ? 395 ILE E CG2   1 
ATOM   4246  C  CD1   . ILE E  1 152 ? -30.142 39.198  -48.967 1.00 32.70  ? 395 ILE E CD1   1 
ATOM   4247  N  N     . GLU E  1 153 ? -32.163 37.746  -43.870 1.00 31.11  ? 396 GLU E N     1 
ATOM   4248  C  CA    . GLU E  1 153 ? -32.374 36.867  -42.726 1.00 32.55  ? 396 GLU E CA    1 
ATOM   4249  C  C     . GLU E  1 153 ? -33.809 37.017  -42.202 1.00 30.96  ? 396 GLU E C     1 
ATOM   4250  O  O     . GLU E  1 153 ? -34.459 36.049  -41.890 1.00 33.51  ? 396 GLU E O     1 
ATOM   4251  C  CB    . GLU E  1 153 ? -31.376 37.212  -41.626 1.00 35.78  ? 396 GLU E CB    1 
ATOM   4252  C  CG    . GLU E  1 153 ? -31.505 36.364  -40.376 1.00 42.02  ? 396 GLU E CG    1 
ATOM   4253  C  CD    . GLU E  1 153 ? -32.502 36.896  -39.348 1.00 46.36  ? 396 GLU E CD    1 
ATOM   4254  O  OE1   . GLU E  1 153 ? -32.967 38.071  -39.479 1.00 48.02  ? 396 GLU E OE1   1 
ATOM   4255  O  OE2   . GLU E  1 153 ? -32.808 36.112  -38.411 1.00 51.88  ? 396 GLU E OE2   1 
ATOM   4256  N  N     . GLN E  1 154 ? -34.298 38.230  -42.102 1.00 30.43  ? 397 GLN E N     1 
ATOM   4257  C  CA    . GLN E  1 154 ? -35.697 38.459  -41.667 1.00 34.51  ? 397 GLN E CA    1 
ATOM   4258  C  C     . GLN E  1 154 ? -36.728 37.780  -42.595 1.00 36.91  ? 397 GLN E C     1 
ATOM   4259  O  O     . GLN E  1 154 ? -37.645 37.102  -42.127 1.00 34.19  ? 397 GLN E O     1 
ATOM   4260  C  CB    . GLN E  1 154 ? -35.961 39.945  -41.625 1.00 35.32  ? 397 GLN E CB    1 
ATOM   4261  C  CG    . GLN E  1 154 ? -35.285 40.543  -40.407 1.00 44.35  ? 397 GLN E CG    1 
ATOM   4262  C  CD    . GLN E  1 154 ? -36.041 40.230  -39.121 1.00 52.33  ? 397 GLN E CD    1 
ATOM   4263  O  OE1   . GLN E  1 154 ? -35.741 39.240  -38.418 1.00 52.32  ? 397 GLN E OE1   1 
ATOM   4264  N  NE2   . GLN E  1 154 ? -37.069 41.050  -38.829 1.00 52.73  ? 397 GLN E NE2   1 
ATOM   4265  N  N     . THR E  1 155 ? -36.560 37.974  -43.904 1.00 33.50  ? 398 THR E N     1 
ATOM   4266  C  CA    . THR E  1 155 ? -37.375 37.271  -44.882 1.00 32.60  ? 398 THR E CA    1 
ATOM   4267  C  C     . THR E  1 155 ? -37.381 35.801  -44.573 1.00 31.35  ? 398 THR E C     1 
ATOM   4268  O  O     . THR E  1 155 ? -38.419 35.217  -44.486 1.00 32.90  ? 398 THR E O     1 
ATOM   4269  C  CB    . THR E  1 155 ? -36.859 37.481  -46.302 1.00 32.53  ? 398 THR E CB    1 
ATOM   4270  O  OG1   . THR E  1 155 ? -36.664 38.888  -46.530 1.00 29.36  ? 398 THR E OG1   1 
ATOM   4271  C  CG2   . THR E  1 155 ? -37.841 36.920  -47.317 1.00 34.72  ? 398 THR E CG2   1 
ATOM   4272  N  N     . VAL E  1 156 ? -36.232 35.204  -44.332 1.00 31.14  ? 399 VAL E N     1 
ATOM   4273  C  CA    . VAL E  1 156 ? -36.232 33.778  -44.102 1.00 33.45  ? 399 VAL E CA    1 
ATOM   4274  C  C     . VAL E  1 156 ? -36.861 33.460  -42.732 1.00 38.45  ? 399 VAL E C     1 
ATOM   4275  O  O     . VAL E  1 156 ? -37.492 32.398  -42.547 1.00 34.03  ? 399 VAL E O     1 
ATOM   4276  C  CB    . VAL E  1 156 ? -34.823 33.191  -44.155 1.00 31.00  ? 399 VAL E CB    1 
ATOM   4277  C  CG1   . VAL E  1 156 ? -34.805 31.724  -43.715 1.00 28.78  ? 399 VAL E CG1   1 
ATOM   4278  C  CG2   . VAL E  1 156 ? -34.290 33.318  -45.566 1.00 33.56  ? 399 VAL E CG2   1 
ATOM   4279  N  N     . GLN E  1 157 ? -36.646 34.360  -41.777 1.00 40.35  ? 400 GLN E N     1 
ATOM   4280  C  CA    . GLN E  1 157 ? -37.187 34.181  -40.437 1.00 45.12  ? 400 GLN E CA    1 
ATOM   4281  C  C     . GLN E  1 157 ? -38.708 34.173  -40.436 1.00 38.69  ? 400 GLN E C     1 
ATOM   4282  O  O     . GLN E  1 157 ? -39.280 33.221  -39.950 1.00 31.80  ? 400 GLN E O     1 
ATOM   4283  C  CB    . GLN E  1 157 ? -36.706 35.272  -39.487 1.00 51.11  ? 400 GLN E CB    1 
ATOM   4284  C  CG    . GLN E  1 157 ? -36.846 34.861  -38.027 1.00 53.81  ? 400 GLN E CG    1 
ATOM   4285  C  CD    . GLN E  1 157 ? -36.070 35.777  -37.140 1.00 57.71  ? 400 GLN E CD    1 
ATOM   4286  O  OE1   . GLN E  1 157 ? -35.095 35.366  -36.488 1.00 56.90  ? 400 GLN E OE1   1 
ATOM   4287  N  NE2   . GLN E  1 157 ? -36.453 37.062  -37.151 1.00 59.66  ? 400 GLN E NE2   1 
ATOM   4288  N  N     . LYS E  1 158 ? -39.335 35.208  -41.008 1.00 41.32  ? 401 LYS E N     1 
ATOM   4289  C  CA    . LYS E  1 158 ? -40.808 35.257  -41.165 1.00 41.98  ? 401 LYS E CA    1 
ATOM   4290  C  C     . LYS E  1 158 ? -41.313 33.974  -41.778 1.00 43.76  ? 401 LYS E C     1 
ATOM   4291  O  O     . LYS E  1 158 ? -42.104 33.266  -41.175 1.00 50.43  ? 401 LYS E O     1 
ATOM   4292  C  CB    . LYS E  1 158 ? -41.254 36.424  -42.028 1.00 43.74  ? 401 LYS E CB    1 
ATOM   4293  C  CG    . LYS E  1 158 ? -41.533 37.699  -41.245 1.00 51.01  ? 401 LYS E CG    1 
ATOM   4294  C  CD    . LYS E  1 158 ? -40.423 38.050  -40.253 1.00 55.56  ? 401 LYS E CD    1 
ATOM   4295  C  CE    . LYS E  1 158 ? -40.289 39.546  -40.017 1.00 57.39  ? 401 LYS E CE    1 
ATOM   4296  N  NZ    . LYS E  1 158 ? -39.834 40.273  -41.241 1.00 60.27  ? 401 LYS E NZ    1 
ATOM   4297  N  N     . ALA E  1 159 ? -40.803 33.612  -42.940 1.00 42.19  ? 402 ALA E N     1 
ATOM   4298  C  CA    . ALA E  1 159 ? -41.355 32.438  -43.620 1.00 43.00  ? 402 ALA E CA    1 
ATOM   4299  C  C     . ALA E  1 159 ? -41.229 31.176  -42.761 1.00 42.71  ? 402 ALA E C     1 
ATOM   4300  O  O     . ALA E  1 159 ? -42.089 30.285  -42.816 1.00 42.83  ? 402 ALA E O     1 
ATOM   4301  C  CB    . ALA E  1 159 ? -40.743 32.253  -45.010 1.00 40.22  ? 402 ALA E CB    1 
ATOM   4302  N  N     . ALA E  1 160 ? -40.174 31.096  -41.956 1.00 39.12  ? 403 ALA E N     1 
ATOM   4303  C  CA    . ALA E  1 160 ? -39.973 29.935  -41.106 1.00 38.97  ? 403 ALA E CA    1 
ATOM   4304  C  C     . ALA E  1 160 ? -40.862 29.997  -39.828 1.00 42.43  ? 403 ALA E C     1 
ATOM   4305  O  O     . ALA E  1 160 ? -41.218 28.974  -39.265 1.00 38.79  ? 403 ALA E O     1 
ATOM   4306  C  CB    . ALA E  1 160 ? -38.518 29.833  -40.719 1.00 41.67  ? 403 ALA E CB    1 
ATOM   4307  N  N     . GLN E  1 161 ? -41.180 31.217  -39.409 1.00 43.05  ? 404 GLN E N     1 
ATOM   4308  C  CA    . GLN E  1 161 ? -41.963 31.499  -38.221 1.00 50.12  ? 404 GLN E CA    1 
ATOM   4309  C  C     . GLN E  1 161 ? -43.403 31.008  -38.465 1.00 50.34  ? 404 GLN E C     1 
ATOM   4310  O  O     . GLN E  1 161 ? -43.910 30.162  -37.726 1.00 50.18  ? 404 GLN E O     1 
ATOM   4311  C  CB    . GLN E  1 161 ? -41.918 33.008  -37.912 1.00 47.18  ? 404 GLN E CB    1 
ATOM   4312  C  CG    . GLN E  1 161 ? -41.613 33.350  -36.465 1.00 49.76  ? 404 GLN E CG    1 
ATOM   4313  C  CD    . GLN E  1 161 ? -40.163 33.118  -36.038 1.00 49.09  ? 404 GLN E CD    1 
ATOM   4314  O  OE1   . GLN E  1 161 ? -39.408 34.073  -35.739 1.00 40.83  ? 404 GLN E OE1   1 
ATOM   4315  N  NE2   . GLN E  1 161 ? -39.783 31.848  -35.949 1.00 49.65  ? 404 GLN E NE2   1 
ATOM   4316  N  N     . ALA E  1 162 ? -44.023 31.482  -39.539 1.00 48.65  ? 405 ALA E N     1 
ATOM   4317  C  CA    . ALA E  1 162 ? -45.289 30.901  -40.016 1.00 51.82  ? 405 ALA E CA    1 
ATOM   4318  C  C     . ALA E  1 162 ? -45.452 29.370  -39.927 1.00 51.13  ? 405 ALA E C     1 
ATOM   4319  O  O     . ALA E  1 162 ? -46.568 28.931  -39.848 1.00 53.30  ? 405 ALA E O     1 
ATOM   4320  C  CB    . ALA E  1 162 ? -45.571 31.329  -41.449 1.00 51.13  ? 405 ALA E CB    1 
ATOM   4321  N  N     . PHE E  1 163 ? -44.406 28.546  -39.988 1.00 51.38  ? 406 PHE E N     1 
ATOM   4322  C  CA    . PHE E  1 163 ? -44.610 27.103  -39.714 1.00 48.63  ? 406 PHE E CA    1 
ATOM   4323  C  C     . PHE E  1 163 ? -44.466 26.761  -38.237 1.00 52.07  ? 406 PHE E C     1 
ATOM   4324  O  O     . PHE E  1 163 ? -44.905 25.694  -37.799 1.00 43.58  ? 406 PHE E O     1 
ATOM   4325  C  CB    . PHE E  1 163 ? -43.647 26.207  -40.496 1.00 47.79  ? 406 PHE E CB    1 
ATOM   4326  C  CG    . PHE E  1 163 ? -43.789 26.328  -41.976 1.00 53.56  ? 406 PHE E CG    1 
ATOM   4327  C  CD1   . PHE E  1 163 ? -44.988 25.959  -42.604 1.00 52.52  ? 406 PHE E CD1   1 
ATOM   4328  C  CD2   . PHE E  1 163 ? -42.749 26.833  -42.752 1.00 50.55  ? 406 PHE E CD2   1 
ATOM   4329  C  CE1   . PHE E  1 163 ? -45.139 26.084  -43.974 1.00 50.85  ? 406 PHE E CE1   1 
ATOM   4330  C  CE2   . PHE E  1 163 ? -42.901 26.953  -44.128 1.00 50.47  ? 406 PHE E CE2   1 
ATOM   4331  C  CZ    . PHE E  1 163 ? -44.092 26.588  -44.736 1.00 50.23  ? 406 PHE E CZ    1 
ATOM   4332  N  N     . ASN E  1 164 ? -43.809 27.635  -37.475 1.00 52.03  ? 407 ASN E N     1 
ATOM   4333  C  CA    . ASN E  1 164 ? -43.537 27.345  -36.072 1.00 50.26  ? 407 ASN E CA    1 
ATOM   4334  C  C     . ASN E  1 164 ? -42.795 28.474  -35.404 1.00 48.65  ? 407 ASN E C     1 
ATOM   4335  O  O     . ASN E  1 164 ? -41.670 28.789  -35.752 1.00 52.63  ? 407 ASN E O     1 
ATOM   4336  C  CB    . ASN E  1 164 ? -42.746 26.049  -35.929 1.00 46.91  ? 407 ASN E CB    1 
ATOM   4337  C  CG    . ASN E  1 164 ? -42.405 25.735  -34.492 1.00 46.97  ? 407 ASN E CG    1 
ATOM   4338  O  OD1   . ASN E  1 164 ? -42.203 26.638  -33.654 1.00 46.75  ? 407 ASN E OD1   1 
ATOM   4339  N  ND2   . ASN E  1 164 ? -42.327 24.447  -34.194 1.00 43.95  ? 407 ASN E ND2   1 
ATOM   4340  N  N     . SER E  1 165 ? -43.450 29.037  -34.411 1.00 50.27  ? 408 SER E N     1 
ATOM   4341  C  CA    . SER E  1 165 ? -43.007 30.213  -33.716 1.00 50.48  ? 408 SER E CA    1 
ATOM   4342  C  C     . SER E  1 165 ? -41.758 30.042  -32.915 1.00 42.92  ? 408 SER E C     1 
ATOM   4343  O  O     . SER E  1 165 ? -41.125 31.020  -32.625 1.00 49.08  ? 408 SER E O     1 
ATOM   4344  C  CB    . SER E  1 165 ? -44.095 30.656  -32.739 1.00 53.03  ? 408 SER E CB    1 
ATOM   4345  O  OG    . SER E  1 165 ? -45.094 31.351  -33.441 1.00 55.56  ? 408 SER E OG    1 
ATOM   4346  N  N     . GLY E  1 166 ? -41.448 28.830  -32.495 1.00 40.16  ? 409 GLY E N     1 
ATOM   4347  C  CA    . GLY E  1 166 ? -40.291 28.605  -31.637 1.00 42.77  ? 409 GLY E CA    1 
ATOM   4348  C  C     . GLY E  1 166 ? -38.990 28.295  -32.376 1.00 46.60  ? 409 GLY E C     1 
ATOM   4349  O  O     . GLY E  1 166 ? -37.988 27.949  -31.727 1.00 52.88  ? 409 GLY E O     1 
ATOM   4350  N  N     . LEU E  1 167 ? -38.987 28.407  -33.714 1.00 43.46  ? 410 LEU E N     1 
ATOM   4351  C  CA    . LEU E  1 167 ? -37.762 28.167  -34.507 1.00 42.24  ? 410 LEU E CA    1 
ATOM   4352  C  C     . LEU E  1 167 ? -36.759 29.300  -34.329 1.00 39.86  ? 410 LEU E C     1 
ATOM   4353  O  O     . LEU E  1 167 ? -37.145 30.467  -34.339 1.00 37.90  ? 410 LEU E O     1 
ATOM   4354  C  CB    . LEU E  1 167 ? -38.081 28.042  -35.990 1.00 39.84  ? 410 LEU E CB    1 
ATOM   4355  C  CG    . LEU E  1 167 ? -38.644 26.695  -36.456 1.00 38.12  ? 410 LEU E CG    1 
ATOM   4356  C  CD1   . LEU E  1 167 ? -39.143 26.841  -37.883 1.00 37.66  ? 410 LEU E CD1   1 
ATOM   4357  C  CD2   . LEU E  1 167 ? -37.663 25.548  -36.311 1.00 35.51  ? 410 LEU E CD2   1 
ATOM   4358  N  N     . LEU E  1 168 ? -35.482 28.945  -34.165 1.00 45.38  ? 411 LEU E N     1 
ATOM   4359  C  CA    . LEU E  1 168 ? -34.392 29.947  -34.122 1.00 47.38  ? 411 LEU E CA    1 
ATOM   4360  C  C     . LEU E  1 168 ? -33.757 30.063  -35.500 1.00 43.65  ? 411 LEU E C     1 
ATOM   4361  O  O     . LEU E  1 168 ? -33.332 29.061  -36.061 1.00 42.54  ? 411 LEU E O     1 
ATOM   4362  C  CB    . LEU E  1 168 ? -33.330 29.542  -33.109 1.00 50.20  ? 411 LEU E CB    1 
ATOM   4363  C  CG    . LEU E  1 168 ? -33.506 30.063  -31.676 1.00 57.59  ? 411 LEU E CG    1 
ATOM   4364  C  CD1   . LEU E  1 168 ? -34.970 30.183  -31.239 1.00 57.32  ? 411 LEU E CD1   1 
ATOM   4365  C  CD2   . LEU E  1 168 ? -32.704 29.208  -30.693 1.00 57.78  ? 411 LEU E CD2   1 
ATOM   4366  N  N     . CYS E  1 169 ? -33.724 31.280  -36.027 1.00 43.64  ? 412 CYS E N     1 
ATOM   4367  C  CA    . CYS E  1 169 ? -33.001 31.609  -37.250 1.00 46.09  ? 412 CYS E CA    1 
ATOM   4368  C  C     . CYS E  1 169 ? -31.970 32.663  -36.953 1.00 43.27  ? 412 CYS E C     1 
ATOM   4369  O  O     . CYS E  1 169 ? -32.296 33.703  -36.425 1.00 45.10  ? 412 CYS E O     1 
ATOM   4370  C  CB    . CYS E  1 169 ? -33.936 32.190  -38.308 1.00 47.12  ? 412 CYS E CB    1 
ATOM   4371  S  SG    . CYS E  1 169 ? -35.399 31.169  -38.472 1.00 53.14  ? 412 CYS E SG    1 
ATOM   4372  N  N     . VAL E  1 170 ? -30.738 32.435  -37.358 1.00 37.47  ? 413 VAL E N     1 
ATOM   4373  C  CA    . VAL E  1 170 ? -29.730 33.440  -37.120 1.00 34.11  ? 413 VAL E CA    1 
ATOM   4374  C  C     . VAL E  1 170 ? -28.713 33.481  -38.283 1.00 30.58  ? 413 VAL E C     1 
ATOM   4375  O  O     . VAL E  1 170 ? -28.243 32.442  -38.780 1.00 27.21  ? 413 VAL E O     1 
ATOM   4376  C  CB    . VAL E  1 170 ? -29.111 33.211  -35.730 1.00 35.74  ? 413 VAL E CB    1 
ATOM   4377  C  CG1   . VAL E  1 170 ? -29.046 31.719  -35.424 1.00 37.97  ? 413 VAL E CG1   1 
ATOM   4378  C  CG2   . VAL E  1 170 ? -27.732 33.825  -35.629 1.00 34.35  ? 413 VAL E CG2   1 
ATOM   4379  N  N     . ALA E  1 171 ? -28.416 34.698  -38.734 1.00 28.84  ? 414 ALA E N     1 
ATOM   4380  C  CA    . ALA E  1 171 ? -27.457 34.894  -39.824 1.00 30.87  ? 414 ALA E CA    1 
ATOM   4381  C  C     . ALA E  1 171 ? -26.083 34.749  -39.253 1.00 28.33  ? 414 ALA E C     1 
ATOM   4382  O  O     . ALA E  1 171 ? -25.813 35.290  -38.219 1.00 29.42  ? 414 ALA E O     1 
ATOM   4383  C  CB    . ALA E  1 171 ? -27.643 36.256  -40.462 1.00 32.81  ? 414 ALA E CB    1 
ATOM   4384  N  N     . CYS E  1 172 ? -25.258 33.905  -39.854 1.00 28.71  ? 415 CYS E N     1 
ATOM   4385  C  CA    . CYS E  1 172 ? -23.918 33.630  -39.344 1.00 25.13  ? 415 CYS E CA    1 
ATOM   4386  C  C     . CYS E  1 172 ? -22.880 34.293  -40.261 1.00 25.79  ? 415 CYS E C     1 
ATOM   4387  O  O     . CYS E  1 172 ? -23.095 35.447  -40.678 1.00 21.02  ? 415 CYS E O     1 
ATOM   4388  C  CB    . CYS E  1 172 ? -23.696 32.140  -39.168 1.00 28.07  ? 415 CYS E CB    1 
ATOM   4389  S  SG    . CYS E  1 172 ? -24.964 31.325  -38.121 1.00 33.71  ? 415 CYS E SG    1 
ATOM   4390  N  N     . GLY E  1 173 ? -21.759 33.602  -40.542 1.00 24.80  ? 416 GLY E N     1 
ATOM   4391  C  CA    . GLY E  1 173 ? -20.619 34.182  -41.249 1.00 25.70  ? 416 GLY E CA    1 
ATOM   4392  C  C     . GLY E  1 173 ? -20.247 35.601  -40.861 1.00 28.10  ? 416 GLY E C     1 
ATOM   4393  O  O     . GLY E  1 173 ? -20.369 36.039  -39.712 1.00 26.43  ? 416 GLY E O     1 
ATOM   4394  N  N     . SER E  1 174 ? -19.872 36.363  -41.876 1.00 32.77  ? 417 SER E N     1 
ATOM   4395  C  CA    . SER E  1 174 ? -19.364 37.689  -41.682 1.00 32.28  ? 417 SER E CA    1 
ATOM   4396  C  C     . SER E  1 174 ? -20.378 38.574  -41.049 1.00 35.34  ? 417 SER E C     1 
ATOM   4397  O  O     . SER E  1 174 ? -20.016 39.604  -40.422 1.00 37.42  ? 417 SER E O     1 
ATOM   4398  C  CB    . SER E  1 174 ? -18.892 38.278  -43.009 1.00 33.61  ? 417 SER E CB    1 
ATOM   4399  O  OG    . SER E  1 174 ? -19.959 38.472  -43.927 1.00 30.59  ? 417 SER E OG    1 
ATOM   4400  N  N     . TYR E  1 175 ? -21.649 38.213  -41.185 1.00 33.35  ? 418 TYR E N     1 
ATOM   4401  C  CA    . TYR E  1 175 ? -22.711 39.049  -40.577 1.00 31.97  ? 418 TYR E CA    1 
ATOM   4402  C  C     . TYR E  1 175 ? -22.564 38.914  -39.085 1.00 30.36  ? 418 TYR E C     1 
ATOM   4403  O  O     . TYR E  1 175 ? -22.435 39.867  -38.361 1.00 32.85  ? 418 TYR E O     1 
ATOM   4404  C  CB    . TYR E  1 175 ? -24.099 38.617  -41.027 1.00 31.16  ? 418 TYR E CB    1 
ATOM   4405  C  CG    . TYR E  1 175 ? -25.231 39.431  -40.437 1.00 31.53  ? 418 TYR E CG    1 
ATOM   4406  C  CD1   . TYR E  1 175 ? -25.711 40.538  -41.094 1.00 31.40  ? 418 TYR E CD1   1 
ATOM   4407  C  CD2   . TYR E  1 175 ? -25.842 39.060  -39.208 1.00 32.33  ? 418 TYR E CD2   1 
ATOM   4408  C  CE1   . TYR E  1 175 ? -26.762 41.264  -40.585 1.00 36.37  ? 418 TYR E CE1   1 
ATOM   4409  C  CE2   . TYR E  1 175 ? -26.893 39.790  -38.681 1.00 31.41  ? 418 TYR E CE2   1 
ATOM   4410  C  CZ    . TYR E  1 175 ? -27.346 40.880  -39.373 1.00 33.32  ? 418 TYR E CZ    1 
ATOM   4411  O  OH    . TYR E  1 175 ? -28.371 41.634  -38.881 1.00 37.08  ? 418 TYR E OH    1 
ATOM   4412  N  N     . ARG E  1 176 ? -22.528 37.701  -38.629 1.00 34.14  ? 419 ARG E N     1 
ATOM   4413  C  CA    . ARG E  1 176 ? -22.368 37.490  -37.215 1.00 38.53  ? 419 ARG E CA    1 
ATOM   4414  C  C     . ARG E  1 176 ? -21.013 38.016  -36.673 1.00 42.06  ? 419 ARG E C     1 
ATOM   4415  O  O     . ARG E  1 176 ? -20.941 38.474  -35.526 1.00 38.91  ? 419 ARG E O     1 
ATOM   4416  C  CB    . ARG E  1 176 ? -22.580 36.020  -36.857 1.00 33.84  ? 419 ARG E CB    1 
ATOM   4417  C  CG    . ARG E  1 176 ? -22.683 35.820  -35.356 1.00 34.60  ? 419 ARG E CG    1 
ATOM   4418  C  CD    . ARG E  1 176 ? -23.639 34.703  -34.984 1.00 35.90  ? 419 ARG E CD    1 
ATOM   4419  N  NE    . ARG E  1 176 ? -23.529 34.429  -33.552 1.00 38.35  ? 419 ARG E NE    1 
ATOM   4420  C  CZ    . ARG E  1 176 ? -22.762 33.497  -32.997 1.00 35.10  ? 419 ARG E CZ    1 
ATOM   4421  N  NH1   . ARG E  1 176 ? -22.031 32.649  -33.718 1.00 33.99  ? 419 ARG E NH1   1 
ATOM   4422  N  NH2   . ARG E  1 176 ? -22.766 33.379  -31.676 1.00 38.04  ? 419 ARG E NH2   1 
ATOM   4423  N  N     . ARG E  1 177 ? -19.959 37.983  -37.499 1.00 42.27  ? 420 ARG E N     1 
ATOM   4424  C  CA    . ARG E  1 177 ? -18.634 38.480  -37.061 1.00 36.48  ? 420 ARG E CA    1 
ATOM   4425  C  C     . ARG E  1 177 ? -18.544 40.004  -37.057 1.00 35.17  ? 420 ARG E C     1 
ATOM   4426  O  O     . ARG E  1 177 ? -17.494 40.565  -36.812 1.00 45.84  ? 420 ARG E O     1 
ATOM   4427  C  CB    . ARG E  1 177 ? -17.521 37.830  -37.869 1.00 34.36  ? 420 ARG E CB    1 
ATOM   4428  C  CG    . ARG E  1 177 ? -17.522 36.314  -37.681 1.00 35.02  ? 420 ARG E CG    1 
ATOM   4429  C  CD    . ARG E  1 177 ? -16.167 35.733  -37.958 1.00 36.45  ? 420 ARG E CD    1 
ATOM   4430  N  NE    . ARG E  1 177 ? -15.663 36.322  -39.193 1.00 40.08  ? 420 ARG E NE    1 
ATOM   4431  C  CZ    . ARG E  1 177 ? -15.783 35.775  -40.401 1.00 41.13  ? 420 ARG E CZ    1 
ATOM   4432  N  NH1   . ARG E  1 177 ? -16.333 34.588  -40.586 1.00 40.27  ? 420 ARG E NH1   1 
ATOM   4433  N  NH2   . ARG E  1 177 ? -15.292 36.405  -41.438 1.00 39.54  ? 420 ARG E NH2   1 
ATOM   4434  N  N     . GLY E  1 178 ? -19.663 40.661  -37.311 1.00 34.99  ? 421 GLY E N     1 
ATOM   4435  C  CA    . GLY E  1 178 ? -19.803 42.070  -37.110 1.00 34.44  ? 421 GLY E CA    1 
ATOM   4436  C  C     . GLY E  1 178 ? -19.373 42.880  -38.299 1.00 40.21  ? 421 GLY E C     1 
ATOM   4437  O  O     . GLY E  1 178 ? -19.343 44.105  -38.203 1.00 40.95  ? 421 GLY E O     1 
ATOM   4438  N  N     . LYS E  1 179 ? -19.077 42.226  -39.430 1.00 39.49  ? 422 LYS E N     1 
ATOM   4439  C  CA    . LYS E  1 179 ? -18.565 42.924  -40.617 1.00 36.69  ? 422 LYS E CA    1 
ATOM   4440  C  C     . LYS E  1 179 ? -19.636 43.791  -41.275 1.00 35.76  ? 422 LYS E C     1 
ATOM   4441  O  O     . LYS E  1 179 ? -20.821 43.554  -41.144 1.00 38.68  ? 422 LYS E O     1 
ATOM   4442  C  CB    . LYS E  1 179 ? -17.974 41.971  -41.654 1.00 36.26  ? 422 LYS E CB    1 
ATOM   4443  C  CG    . LYS E  1 179 ? -16.880 41.062  -41.150 1.00 41.19  ? 422 LYS E CG    1 
ATOM   4444  C  CD    . LYS E  1 179 ? -15.726 41.821  -40.513 1.00 42.44  ? 422 LYS E CD    1 
ATOM   4445  C  CE    . LYS E  1 179 ? -14.393 41.104  -40.692 1.00 45.74  ? 422 LYS E CE    1 
ATOM   4446  N  NZ    . LYS E  1 179 ? -13.853 40.422  -39.483 1.00 44.48  ? 422 LYS E NZ    1 
ATOM   4447  N  N     . ALA E  1 180 ? -19.194 44.789  -42.021 1.00 34.58  ? 423 ALA E N     1 
ATOM   4448  C  CA    . ALA E  1 180 ? -20.089 45.843  -42.489 1.00 31.57  ? 423 ALA E CA    1 
ATOM   4449  C  C     . ALA E  1 180 ? -20.687 45.498  -43.843 1.00 31.25  ? 423 ALA E C     1 
ATOM   4450  O  O     . ALA E  1 180 ? -21.660 46.106  -44.275 1.00 31.16  ? 423 ALA E O     1 
ATOM   4451  C  CB    . ALA E  1 180 ? -19.299 47.160  -42.595 1.00 32.36  ? 423 ALA E CB    1 
ATOM   4452  N  N     . THR E  1 181 ? -20.061 44.570  -44.549 1.00 29.32  ? 424 THR E N     1 
ATOM   4453  C  CA    . THR E  1 181 ? -20.552 44.165  -45.827 1.00 30.04  ? 424 THR E CA    1 
ATOM   4454  C  C     . THR E  1 181 ? -20.409 42.669  -45.801 1.00 32.00  ? 424 THR E C     1 
ATOM   4455  O  O     . THR E  1 181 ? -19.578 42.149  -45.056 1.00 29.07  ? 424 THR E O     1 
ATOM   4456  C  CB    . THR E  1 181 ? -19.676 44.703  -46.959 1.00 32.50  ? 424 THR E CB    1 
ATOM   4457  O  OG1   . THR E  1 181 ? -18.409 44.032  -46.925 1.00 31.52  ? 424 THR E OG1   1 
ATOM   4458  C  CG2   . THR E  1 181 ? -19.438 46.198  -46.773 1.00 33.30  ? 424 THR E CG2   1 
ATOM   4459  N  N     . CYS E  1 182 ? -21.216 41.972  -46.606 1.00 30.83  ? 425 CYS E N     1 
ATOM   4460  C  CA    . CYS E  1 182 ? -21.221 40.500  -46.629 1.00 28.17  ? 425 CYS E CA    1 
ATOM   4461  C  C     . CYS E  1 182 ? -21.201 40.000  -48.038 1.00 23.95  ? 425 CYS E C     1 
ATOM   4462  O  O     . CYS E  1 182 ? -21.918 40.511  -48.875 1.00 22.65  ? 425 CYS E O     1 
ATOM   4463  C  CB    . CYS E  1 182 ? -22.493 39.960  -45.936 1.00 29.26  ? 425 CYS E CB    1 
ATOM   4464  S  SG    . CYS E  1 182 ? -22.705 40.512  -44.227 1.00 37.49  ? 425 CYS E SG    1 
ATOM   4465  N  N     . GLY E  1 183 ? -20.394 38.987  -48.275 1.00 24.54  ? 426 GLY E N     1 
ATOM   4466  C  CA    . GLY E  1 183 ? -20.295 38.304  -49.573 1.00 23.38  ? 426 GLY E CA    1 
ATOM   4467  C  C     . GLY E  1 183 ? -21.545 37.482  -49.889 1.00 24.55  ? 426 GLY E C     1 
ATOM   4468  O  O     . GLY E  1 183 ? -21.948 37.404  -51.035 1.00 23.44  ? 426 GLY E O     1 
ATOM   4469  N  N     . ASP E  1 184 ? -22.137 36.870  -48.872 1.00 23.49  ? 427 ASP E N     1 
ATOM   4470  C  CA    . ASP E  1 184 ? -23.345 36.078  -48.997 1.00 27.22  ? 427 ASP E CA    1 
ATOM   4471  C  C     . ASP E  1 184 ? -23.944 35.954  -47.570 1.00 28.48  ? 427 ASP E C     1 
ATOM   4472  O  O     . ASP E  1 184 ? -23.291 36.342  -46.585 1.00 32.58  ? 427 ASP E O     1 
ATOM   4473  C  CB    . ASP E  1 184 ? -23.052 34.709  -49.614 1.00 29.21  ? 427 ASP E CB    1 
ATOM   4474  C  CG    . ASP E  1 184 ? -22.272 33.796  -48.663 1.00 29.80  ? 427 ASP E CG    1 
ATOM   4475  O  OD1   . ASP E  1 184 ? -22.188 34.137  -47.522 1.00 30.45  ? 427 ASP E OD1   1 
ATOM   4476  O  OD2   . ASP E  1 184 ? -21.779 32.724  -49.010 1.00 42.64  ? 427 ASP E OD2   1 
ATOM   4477  N  N     . VAL E  1 185 ? -25.176 35.459  -47.468 1.00 27.57  ? 428 VAL E N     1 
ATOM   4478  C  CA    . VAL E  1 185 ? -25.849 35.307  -46.183 1.00 26.00  ? 428 VAL E CA    1 
ATOM   4479  C  C     . VAL E  1 185 ? -25.997 33.851  -45.903 1.00 24.92  ? 428 VAL E C     1 
ATOM   4480  O  O     . VAL E  1 185 ? -26.430 33.117  -46.778 1.00 23.01  ? 428 VAL E O     1 
ATOM   4481  C  CB    . VAL E  1 185 ? -27.233 35.907  -46.208 1.00 28.64  ? 428 VAL E CB    1 
ATOM   4482  C  CG1   . VAL E  1 185 ? -27.795 35.906  -44.792 1.00 34.36  ? 428 VAL E CG1   1 
ATOM   4483  C  CG2   . VAL E  1 185 ? -27.203 37.316  -46.749 1.00 27.42  ? 428 VAL E CG2   1 
ATOM   4484  N  N     . ASP E  1 186 ? -25.639 33.464  -44.679 1.00 28.04  ? 429 ASP E N     1 
ATOM   4485  C  CA    . ASP E  1 186 ? -25.648 32.090  -44.166 1.00 30.38  ? 429 ASP E CA    1 
ATOM   4486  C  C     . ASP E  1 186 ? -26.686 32.001  -43.031 1.00 33.74  ? 429 ASP E C     1 
ATOM   4487  O  O     . ASP E  1 186 ? -26.399 32.400  -41.917 1.00 32.09  ? 429 ASP E O     1 
ATOM   4488  C  CB    . ASP E  1 186 ? -24.252 31.741  -43.594 1.00 34.14  ? 429 ASP E CB    1 
ATOM   4489  C  CG    . ASP E  1 186 ? -23.075 32.081  -44.575 1.00 38.59  ? 429 ASP E CG    1 
ATOM   4490  O  OD1   . ASP E  1 186 ? -22.809 31.229  -45.448 1.00 38.34  ? 429 ASP E OD1   1 
ATOM   4491  O  OD2   . ASP E  1 186 ? -22.429 33.183  -44.458 1.00 36.87  ? 429 ASP E OD2   1 
ATOM   4492  N  N     . VAL E  1 187 ? -27.890 31.502  -43.294 1.00 34.24  ? 430 VAL E N     1 
ATOM   4493  C  CA    . VAL E  1 187 ? -28.912 31.490  -42.244 1.00 32.25  ? 430 VAL E CA    1 
ATOM   4494  C  C     . VAL E  1 187 ? -28.983 30.134  -41.578 1.00 29.81  ? 430 VAL E C     1 
ATOM   4495  O  O     . VAL E  1 187 ? -29.168 29.127  -42.243 1.00 30.08  ? 430 VAL E O     1 
ATOM   4496  C  CB    . VAL E  1 187 ? -30.299 31.831  -42.759 1.00 35.35  ? 430 VAL E CB    1 
ATOM   4497  C  CG1   . VAL E  1 187 ? -31.289 31.815  -41.603 1.00 39.55  ? 430 VAL E CG1   1 
ATOM   4498  C  CG2   . VAL E  1 187 ? -30.342 33.192  -43.401 1.00 34.54  ? 430 VAL E CG2   1 
ATOM   4499  N  N     . LEU E  1 188 ? -28.838 30.099  -40.254 1.00 31.62  ? 431 LEU E N     1 
ATOM   4500  C  CA    . LEU E  1 188 ? -28.900 28.826  -39.503 1.00 31.26  ? 431 LEU E CA    1 
ATOM   4501  C  C     . LEU E  1 188 ? -30.230 28.718  -38.806 1.00 30.50  ? 431 LEU E C     1 
ATOM   4502  O  O     . LEU E  1 188 ? -30.683 29.697  -38.253 1.00 27.41  ? 431 LEU E O     1 
ATOM   4503  C  CB    . LEU E  1 188 ? -27.782 28.725  -38.474 1.00 30.45  ? 431 LEU E CB    1 
ATOM   4504  C  CG    . LEU E  1 188 ? -27.602 27.492  -37.600 1.00 33.06  ? 431 LEU E CG    1 
ATOM   4505  C  CD1   . LEU E  1 188 ? -27.368 26.192  -38.334 1.00 32.63  ? 431 LEU E CD1   1 
ATOM   4506  C  CD2   . LEU E  1 188 ? -26.382 27.746  -36.735 1.00 36.47  ? 431 LEU E CD2   1 
ATOM   4507  N  N     . ILE E  1 189 ? -30.839 27.530  -38.857 1.00 29.51  ? 432 ILE E N     1 
ATOM   4508  C  CA    . ILE E  1 189 ? -32.143 27.338  -38.219 1.00 33.51  ? 432 ILE E CA    1 
ATOM   4509  C  C     . ILE E  1 189 ? -32.160 26.091  -37.362 1.00 32.22  ? 432 ILE E C     1 
ATOM   4510  O  O     . ILE E  1 189 ? -31.593 25.047  -37.733 1.00 31.16  ? 432 ILE E O     1 
ATOM   4511  C  CB    . ILE E  1 189 ? -33.246 27.193  -39.248 1.00 34.36  ? 432 ILE E CB    1 
ATOM   4512  C  CG1   . ILE E  1 189 ? -33.625 28.550  -39.784 1.00 30.17  ? 432 ILE E CG1   1 
ATOM   4513  C  CG2   . ILE E  1 189 ? -34.482 26.553  -38.638 1.00 36.79  ? 432 ILE E CG2   1 
ATOM   4514  C  CD1   . ILE E  1 189 ? -34.087 28.446  -41.217 1.00 30.72  ? 432 ILE E CD1   1 
ATOM   4515  N  N     . THR E  1 190 ? -32.775 26.241  -36.192 1.00 35.29  ? 433 THR E N     1 
ATOM   4516  C  CA    . THR E  1 190 ? -33.108 25.093  -35.337 1.00 38.29  ? 433 THR E CA    1 
ATOM   4517  C  C     . THR E  1 190 ? -34.349 25.376  -34.427 1.00 36.97  ? 433 THR E C     1 
ATOM   4518  O  O     . THR E  1 190 ? -34.990 26.463  -34.482 1.00 32.67  ? 433 THR E O     1 
ATOM   4519  C  CB    . THR E  1 190 ? -31.875 24.693  -34.492 1.00 40.69  ? 433 THR E CB    1 
ATOM   4520  O  OG1   . THR E  1 190 ? -32.126 23.488  -33.747 1.00 44.97  ? 433 THR E OG1   1 
ATOM   4521  C  CG2   . THR E  1 190 ? -31.472 25.858  -33.548 1.00 41.97  ? 433 THR E CG2   1 
ATOM   4522  N  N     . HIS E  1 191 ? -34.690 24.359  -33.636 1.00 39.58  ? 434 HIS E N     1 
ATOM   4523  C  CA    . HIS E  1 191 ? -35.714 24.457  -32.597 1.00 42.56  ? 434 HIS E CA    1 
ATOM   4524  C  C     . HIS E  1 191 ? -35.074 23.901  -31.319 1.00 39.30  ? 434 HIS E C     1 
ATOM   4525  O  O     . HIS E  1 191 ? -34.494 22.811  -31.350 1.00 39.36  ? 434 HIS E O     1 
ATOM   4526  C  CB    . HIS E  1 191 ? -36.981 23.647  -32.949 1.00 44.17  ? 434 HIS E CB    1 
ATOM   4527  C  CG    . HIS E  1 191 ? -38.234 24.197  -32.328 1.00 43.90  ? 434 HIS E CG    1 
ATOM   4528  N  ND1   . HIS E  1 191 ? -38.423 24.262  -30.964 1.00 45.58  ? 434 HIS E ND1   1 
ATOM   4529  C  CD2   . HIS E  1 191 ? -39.350 24.720  -32.883 1.00 45.56  ? 434 HIS E CD2   1 
ATOM   4530  C  CE1   . HIS E  1 191 ? -39.588 24.823  -30.704 1.00 44.80  ? 434 HIS E CE1   1 
ATOM   4531  N  NE2   . HIS E  1 191 ? -40.176 25.104  -31.852 1.00 49.30  ? 434 HIS E NE2   1 
ATOM   4532  N  N     . PRO E  1 192 ? -35.152 24.649  -30.222 1.00 38.28  ? 435 PRO E N     1 
ATOM   4533  C  CA    . PRO E  1 192 ? -34.726 24.186  -28.868 1.00 45.18  ? 435 PRO E CA    1 
ATOM   4534  C  C     . PRO E  1 192 ? -35.328 22.839  -28.425 1.00 46.33  ? 435 PRO E C     1 
ATOM   4535  O  O     . PRO E  1 192 ? -34.700 22.053  -27.726 1.00 46.40  ? 435 PRO E O     1 
ATOM   4536  C  CB    . PRO E  1 192 ? -35.282 25.262  -27.938 1.00 38.55  ? 435 PRO E CB    1 
ATOM   4537  C  CG    . PRO E  1 192 ? -35.435 26.465  -28.801 1.00 39.45  ? 435 PRO E CG    1 
ATOM   4538  C  CD    . PRO E  1 192 ? -35.766 25.988  -30.186 1.00 38.34  ? 435 PRO E CD    1 
ATOM   4539  N  N     . ASP E  1 193 ? -36.554 22.595  -28.843 1.00 45.66  ? 436 ASP E N     1 
ATOM   4540  C  CA    . ASP E  1 193 ? -37.289 21.436  -28.398 1.00 50.05  ? 436 ASP E CA    1 
ATOM   4541  C  C     . ASP E  1 193 ? -36.591 20.152  -28.809 1.00 51.47  ? 436 ASP E C     1 
ATOM   4542  O  O     . ASP E  1 193 ? -36.915 19.090  -28.293 1.00 53.20  ? 436 ASP E O     1 
ATOM   4543  C  CB    . ASP E  1 193 ? -38.728 21.507  -28.938 1.00 52.05  ? 436 ASP E CB    1 
ATOM   4544  C  CG    . ASP E  1 193 ? -38.907 20.799  -30.274 1.00 52.97  ? 436 ASP E CG    1 
ATOM   4545  O  OD1   . ASP E  1 193 ? -37.927 20.556  -31.041 1.00 46.42  ? 436 ASP E OD1   1 
ATOM   4546  O  OD2   . ASP E  1 193 ? -40.078 20.478  -30.551 1.00 51.50  ? 436 ASP E OD2   1 
ATOM   4547  N  N     . GLY E  1 194 ? -35.642 20.250  -29.749 1.00 45.14  ? 437 GLY E N     1 
ATOM   4548  C  CA    . GLY E  1 194 ? -34.759 19.146  -30.103 1.00 42.19  ? 437 GLY E CA    1 
ATOM   4549  C  C     . GLY E  1 194 ? -35.336 18.257  -31.200 1.00 42.94  ? 437 GLY E C     1 
ATOM   4550  O  O     . GLY E  1 194 ? -34.717 17.259  -31.570 1.00 40.39  ? 437 GLY E O     1 
ATOM   4551  N  N     . ARG E  1 195 ? -36.507 18.614  -31.726 1.00 42.66  ? 438 ARG E N     1 
ATOM   4552  C  CA    . ARG E  1 195 ? -37.269 17.723  -32.626 1.00 47.21  ? 438 ARG E CA    1 
ATOM   4553  C  C     . ARG E  1 195 ? -38.037 18.420  -33.724 1.00 41.24  ? 438 ARG E C     1 
ATOM   4554  O  O     . ARG E  1 195 ? -38.260 17.851  -34.773 1.00 47.38  ? 438 ARG E O     1 
ATOM   4555  C  CB    . ARG E  1 195 ? -38.339 16.975  -31.815 1.00 58.27  ? 438 ARG E CB    1 
ATOM   4556  C  CG    . ARG E  1 195 ? -37.861 15.862  -30.880 1.00 62.80  ? 438 ARG E CG    1 
ATOM   4557  C  CD    . ARG E  1 195 ? -39.039 15.318  -30.055 1.00 67.47  ? 438 ARG E CD    1 
ATOM   4558  N  NE    . ARG E  1 195 ? -39.901 16.388  -29.510 1.00 69.15  ? 438 ARG E NE    1 
ATOM   4559  C  CZ    . ARG E  1 195 ? -41.136 16.695  -29.930 1.00 71.85  ? 438 ARG E CZ    1 
ATOM   4560  N  NH1   . ARG E  1 195 ? -41.724 16.016  -30.922 1.00 70.64  ? 438 ARG E NH1   1 
ATOM   4561  N  NH2   . ARG E  1 195 ? -41.804 17.698  -29.349 1.00 67.84  ? 438 ARG E NH2   1 
ATOM   4562  N  N     . SER E  1 196 ? -38.477 19.639  -33.440 1.00 43.81  ? 439 SER E N     1 
ATOM   4563  C  CA    . SER E  1 196 ? -39.420 20.386  -34.246 1.00 43.20  ? 439 SER E CA    1 
ATOM   4564  C  C     . SER E  1 196 ? -38.723 21.189  -35.363 1.00 46.85  ? 439 SER E C     1 
ATOM   4565  O  O     . SER E  1 196 ? -39.273 22.126  -35.927 1.00 46.08  ? 439 SER E O     1 
ATOM   4566  C  CB    . SER E  1 196 ? -40.174 21.319  -33.291 1.00 45.85  ? 439 SER E CB    1 
ATOM   4567  O  OG    . SER E  1 196 ? -40.993 22.291  -33.931 1.00 49.91  ? 439 SER E OG    1 
ATOM   4568  N  N     . HIS E  1 197 ? -37.486 20.834  -35.654 1.00 47.01  ? 440 HIS E N     1 
ATOM   4569  C  CA    . HIS E  1 197 ? -36.760 21.403  -36.780 1.00 47.37  ? 440 HIS E CA    1 
ATOM   4570  C  C     . HIS E  1 197 ? -37.035 20.492  -37.967 1.00 47.88  ? 440 HIS E C     1 
ATOM   4571  O  O     . HIS E  1 197 ? -36.881 20.907  -39.119 1.00 46.20  ? 440 HIS E O     1 
ATOM   4572  C  CB    . HIS E  1 197 ? -35.256 21.437  -36.468 1.00 46.06  ? 440 HIS E CB    1 
ATOM   4573  C  CG    . HIS E  1 197 ? -34.666 20.078  -36.242 1.00 43.36  ? 440 HIS E CG    1 
ATOM   4574  N  ND1   . HIS E  1 197 ? -34.753 19.423  -35.033 1.00 42.79  ? 440 HIS E ND1   1 
ATOM   4575  C  CD2   . HIS E  1 197 ? -34.050 19.223  -37.089 1.00 44.55  ? 440 HIS E CD2   1 
ATOM   4576  C  CE1   . HIS E  1 197 ? -34.183 18.235  -35.141 1.00 43.67  ? 440 HIS E CE1   1 
ATOM   4577  N  NE2   . HIS E  1 197 ? -33.742 18.091  -36.377 1.00 44.96  ? 440 HIS E NE2   1 
ATOM   4578  N  N     . ARG E  1 198 ? -37.451 19.250  -37.678 1.00 48.71  ? 441 ARG E N     1 
ATOM   4579  C  CA    . ARG E  1 198 ? -37.668 18.255  -38.725 1.00 51.49  ? 441 ARG E CA    1 
ATOM   4580  C  C     . ARG E  1 198 ? -38.830 18.653  -39.620 1.00 44.49  ? 441 ARG E C     1 
ATOM   4581  O  O     . ARG E  1 198 ? -39.808 19.226  -39.146 1.00 42.93  ? 441 ARG E O     1 
ATOM   4582  C  CB    . ARG E  1 198 ? -37.932 16.877  -38.134 1.00 50.87  ? 441 ARG E CB    1 
ATOM   4583  C  CG    . ARG E  1 198 ? -36.735 16.267  -37.423 1.00 55.17  ? 441 ARG E CG    1 
ATOM   4584  C  CD    . ARG E  1 198 ? -37.209 15.532  -36.179 1.00 54.20  ? 441 ARG E CD    1 
ATOM   4585  N  NE    . ARG E  1 198 ? -36.741 14.157  -36.085 1.00 52.03  ? 441 ARG E NE    1 
ATOM   4586  C  CZ    . ARG E  1 198 ? -37.289 13.252  -35.271 1.00 56.50  ? 441 ARG E CZ    1 
ATOM   4587  N  NH1   . ARG E  1 198 ? -38.362 13.559  -34.515 1.00 52.92  ? 441 ARG E NH1   1 
ATOM   4588  N  NH2   . ARG E  1 198 ? -36.783 12.016  -35.225 1.00 55.94  ? 441 ARG E NH2   1 
ATOM   4589  N  N     . GLY E  1 199 ? -38.687 18.380  -40.917 1.00 42.57  ? 442 GLY E N     1 
ATOM   4590  C  CA    . GLY E  1 199 ? -39.766 18.574  -41.873 1.00 43.90  ? 442 GLY E CA    1 
ATOM   4591  C  C     . GLY E  1 199 ? -40.180 20.017  -42.077 1.00 46.81  ? 442 GLY E C     1 
ATOM   4592  O  O     . GLY E  1 199 ? -41.255 20.298  -42.624 1.00 50.78  ? 442 GLY E O     1 
ATOM   4593  N  N     . ILE E  1 200 ? -39.332 20.935  -41.641 1.00 44.21  ? 443 ILE E N     1 
ATOM   4594  C  CA    . ILE E  1 200 ? -39.467 22.348  -41.992 1.00 45.98  ? 443 ILE E CA    1 
ATOM   4595  C  C     . ILE E  1 200 ? -38.826 22.637  -43.352 1.00 42.66  ? 443 ILE E C     1 
ATOM   4596  O  O     . ILE E  1 200 ? -39.347 23.413  -44.178 1.00 37.92  ? 443 ILE E O     1 
ATOM   4597  C  CB    . ILE E  1 200 ? -38.795 23.196  -40.901 1.00 50.43  ? 443 ILE E CB    1 
ATOM   4598  C  CG1   . ILE E  1 200 ? -39.625 23.105  -39.607 1.00 52.77  ? 443 ILE E CG1   1 
ATOM   4599  C  CG2   . ILE E  1 200 ? -38.604 24.641  -41.333 1.00 45.75  ? 443 ILE E CG2   1 
ATOM   4600  C  CD1   . ILE E  1 200 ? -41.095 23.431  -39.775 1.00 50.50  ? 443 ILE E CD1   1 
ATOM   4601  N  N     . PHE E  1 201 ? -37.727 21.941  -43.603 1.00 47.18  ? 444 PHE E N     1 
ATOM   4602  C  CA    . PHE E  1 201 ? -36.828 22.319  -44.663 1.00 44.64  ? 444 PHE E CA    1 
ATOM   4603  C  C     . PHE E  1 201 ? -37.486 22.514  -46.030 1.00 43.13  ? 444 PHE E C     1 
ATOM   4604  O  O     . PHE E  1 201 ? -37.378 23.601  -46.599 1.00 36.66  ? 444 PHE E O     1 
ATOM   4605  C  CB    . PHE E  1 201 ? -35.658 21.362  -44.775 1.00 42.99  ? 444 PHE E CB    1 
ATOM   4606  C  CG    . PHE E  1 201 ? -34.426 22.008  -45.325 1.00 51.08  ? 444 PHE E CG    1 
ATOM   4607  C  CD1   . PHE E  1 201 ? -34.255 23.395  -45.299 1.00 55.63  ? 444 PHE E CD1   1 
ATOM   4608  C  CD2   . PHE E  1 201 ? -33.414 21.255  -45.833 1.00 54.69  ? 444 PHE E CD2   1 
ATOM   4609  C  CE1   . PHE E  1 201 ? -33.093 23.990  -45.783 1.00 54.14  ? 444 PHE E CE1   1 
ATOM   4610  C  CE2   . PHE E  1 201 ? -32.247 21.855  -46.311 1.00 57.26  ? 444 PHE E CE2   1 
ATOM   4611  C  CZ    . PHE E  1 201 ? -32.090 23.218  -46.273 1.00 51.22  ? 444 PHE E CZ    1 
ATOM   4612  N  N     . SER E  1 202 ? -38.176 21.477  -46.527 1.00 40.75  ? 445 SER E N     1 
ATOM   4613  C  CA    . SER E  1 202 ? -38.822 21.515  -47.866 1.00 39.70  ? 445 SER E CA    1 
ATOM   4614  C  C     . SER E  1 202 ? -39.938 22.497  -47.889 1.00 34.09  ? 445 SER E C     1 
ATOM   4615  O  O     . SER E  1 202 ? -40.064 23.248  -48.820 1.00 32.27  ? 445 SER E O     1 
ATOM   4616  C  CB    . SER E  1 202 ? -39.373 20.155  -48.273 1.00 42.65  ? 445 SER E CB    1 
ATOM   4617  O  OG    . SER E  1 202 ? -38.412 19.172  -48.011 1.00 50.72  ? 445 SER E OG    1 
ATOM   4618  N  N     . ARG E  1 203 ? -40.710 22.539  -46.819 1.00 34.90  ? 446 ARG E N     1 
ATOM   4619  C  CA    . ARG E  1 203 ? -41.818 23.466  -46.762 1.00 38.75  ? 446 ARG E CA    1 
ATOM   4620  C  C     . ARG E  1 203 ? -41.342 24.891  -46.725 1.00 35.92  ? 446 ARG E C     1 
ATOM   4621  O  O     . ARG E  1 203 ? -42.051 25.809  -47.146 1.00 39.84  ? 446 ARG E O     1 
ATOM   4622  C  CB    . ARG E  1 203 ? -42.657 23.239  -45.506 1.00 44.80  ? 446 ARG E CB    1 
ATOM   4623  C  CG    . ARG E  1 203 ? -43.098 21.801  -45.257 1.00 49.40  ? 446 ARG E CG    1 
ATOM   4624  C  CD    . ARG E  1 203 ? -44.302 21.783  -44.329 1.00 51.32  ? 446 ARG E CD    1 
ATOM   4625  N  NE    . ARG E  1 203 ? -43.957 21.525  -42.941 1.00 52.89  ? 446 ARG E NE    1 
ATOM   4626  C  CZ    . ARG E  1 203 ? -44.609 22.023  -41.891 1.00 57.79  ? 446 ARG E CZ    1 
ATOM   4627  N  NH1   . ARG E  1 203 ? -45.633 22.883  -42.032 1.00 59.91  ? 446 ARG E NH1   1 
ATOM   4628  N  NH2   . ARG E  1 203 ? -44.205 21.682  -40.673 1.00 56.02  ? 446 ARG E NH2   1 
ATOM   4629  N  N     . LEU E  1 204 ? -40.175 25.117  -46.143 1.00 36.04  ? 447 LEU E N     1 
ATOM   4630  C  CA    . LEU E  1 204 ? -39.646 26.498  -46.091 1.00 32.58  ? 447 LEU E CA    1 
ATOM   4631  C  C     . LEU E  1 204 ? -39.135 26.891  -47.456 1.00 27.57  ? 447 LEU E C     1 
ATOM   4632  O  O     . LEU E  1 204 ? -39.542 27.874  -48.009 1.00 24.45  ? 447 LEU E O     1 
ATOM   4633  C  CB    . LEU E  1 204 ? -38.546 26.604  -45.056 1.00 34.05  ? 447 LEU E CB    1 
ATOM   4634  C  CG    . LEU E  1 204 ? -37.730 27.899  -44.992 1.00 34.47  ? 447 LEU E CG    1 
ATOM   4635  C  CD1   . LEU E  1 204 ? -38.504 29.176  -44.656 1.00 32.74  ? 447 LEU E CD1   1 
ATOM   4636  C  CD2   . LEU E  1 204 ? -36.588 27.637  -44.000 1.00 34.67  ? 447 LEU E CD2   1 
ATOM   4637  N  N     . LEU E  1 205 ? -38.260 26.088  -48.027 1.00 27.14  ? 448 LEU E N     1 
ATOM   4638  C  CA    . LEU E  1 205 ? -37.799 26.365  -49.368 1.00 28.24  ? 448 LEU E CA    1 
ATOM   4639  C  C     . LEU E  1 205 ? -38.990 26.605  -50.298 1.00 33.29  ? 448 LEU E C     1 
ATOM   4640  O  O     . LEU E  1 205 ? -39.007 27.582  -51.089 1.00 34.31  ? 448 LEU E O     1 
ATOM   4641  C  CB    . LEU E  1 205 ? -36.958 25.207  -49.866 1.00 27.48  ? 448 LEU E CB    1 
ATOM   4642  C  CG    . LEU E  1 205 ? -35.679 25.018  -49.062 1.00 29.06  ? 448 LEU E CG    1 
ATOM   4643  C  CD1   . LEU E  1 205 ? -34.910 23.832  -49.625 1.00 30.45  ? 448 LEU E CD1   1 
ATOM   4644  C  CD2   . LEU E  1 205 ? -34.813 26.287  -49.003 1.00 28.74  ? 448 LEU E CD2   1 
ATOM   4645  N  N     . ASP E  1 206 ? -40.016 25.766  -50.167 1.00 35.63  ? 449 ASP E N     1 
ATOM   4646  C  CA    . ASP E  1 206 ? -41.259 25.933  -50.978 1.00 41.21  ? 449 ASP E CA    1 
ATOM   4647  C  C     . ASP E  1 206 ? -42.018 27.211  -50.735 1.00 36.88  ? 449 ASP E C     1 
ATOM   4648  O  O     . ASP E  1 206 ? -42.401 27.910  -51.685 1.00 34.02  ? 449 ASP E O     1 
ATOM   4649  C  CB    . ASP E  1 206 ? -42.177 24.728  -50.820 1.00 43.62  ? 449 ASP E CB    1 
ATOM   4650  C  CG    . ASP E  1 206 ? -41.692 23.570  -51.630 1.00 51.39  ? 449 ASP E CG    1 
ATOM   4651  O  OD1   . ASP E  1 206 ? -41.174 23.835  -52.740 1.00 55.73  ? 449 ASP E OD1   1 
ATOM   4652  O  OD2   . ASP E  1 206 ? -41.789 22.403  -51.176 1.00 62.51  ? 449 ASP E OD2   1 
ATOM   4653  N  N     . SER E  1 207 ? -42.193 27.554  -49.472 1.00 37.96  ? 450 SER E N     1 
ATOM   4654  C  CA    . SER E  1 207 ? -42.763 28.853  -49.143 1.00 38.28  ? 450 SER E CA    1 
ATOM   4655  C  C     . SER E  1 207 ? -42.004 29.959  -49.846 1.00 36.63  ? 450 SER E C     1 
ATOM   4656  O  O     . SER E  1 207 ? -42.598 30.872  -50.403 1.00 32.38  ? 450 SER E O     1 
ATOM   4657  C  CB    . SER E  1 207 ? -42.701 29.087  -47.635 1.00 42.66  ? 450 SER E CB    1 
ATOM   4658  O  OG    . SER E  1 207 ? -43.339 30.315  -47.275 1.00 43.33  ? 450 SER E OG    1 
ATOM   4659  N  N     . LEU E  1 208 ? -40.674 29.883  -49.827 1.00 38.01  ? 451 LEU E N     1 
ATOM   4660  C  CA    . LEU E  1 208 ? -39.870 31.029  -50.319 1.00 36.67  ? 451 LEU E CA    1 
ATOM   4661  C  C     . LEU E  1 208 ? -39.756 31.085  -51.829 1.00 34.40  ? 451 LEU E C     1 
ATOM   4662  O  O     . LEU E  1 208 ? -39.690 32.176  -52.392 1.00 30.39  ? 451 LEU E O     1 
ATOM   4663  C  CB    . LEU E  1 208 ? -38.484 31.061  -49.674 1.00 36.23  ? 451 LEU E CB    1 
ATOM   4664  C  CG    . LEU E  1 208 ? -38.429 31.429  -48.180 1.00 37.64  ? 451 LEU E CG    1 
ATOM   4665  C  CD1   . LEU E  1 208 ? -37.017 31.289  -47.638 1.00 35.54  ? 451 LEU E CD1   1 
ATOM   4666  C  CD2   . LEU E  1 208 ? -38.957 32.834  -47.972 1.00 37.36  ? 451 LEU E CD2   1 
ATOM   4667  N  N     . ARG E  1 209 ? -39.711 29.918  -52.483 1.00 36.00  ? 452 ARG E N     1 
ATOM   4668  C  CA    . ARG E  1 209 ? -39.813 29.872  -53.937 1.00 36.48  ? 452 ARG E CA    1 
ATOM   4669  C  C     . ARG E  1 209 ? -41.153 30.423  -54.323 1.00 41.74  ? 452 ARG E C     1 
ATOM   4670  O  O     . ARG E  1 209 ? -41.250 31.290  -55.188 1.00 38.86  ? 452 ARG E O     1 
ATOM   4671  C  CB    . ARG E  1 209 ? -39.815 28.477  -54.489 1.00 38.83  ? 452 ARG E CB    1 
ATOM   4672  C  CG    . ARG E  1 209 ? -38.483 27.825  -54.625 1.00 40.98  ? 452 ARG E CG    1 
ATOM   4673  C  CD    . ARG E  1 209 ? -38.645 26.421  -55.145 1.00 37.49  ? 452 ARG E CD    1 
ATOM   4674  N  NE    . ARG E  1 209 ? -37.435 25.714  -54.853 1.00 37.83  ? 452 ARG E NE    1 
ATOM   4675  C  CZ    . ARG E  1 209 ? -37.290 24.826  -53.879 1.00 41.85  ? 452 ARG E CZ    1 
ATOM   4676  N  NH1   . ARG E  1 209 ? -38.303 24.450  -53.124 1.00 43.33  ? 452 ARG E NH1   1 
ATOM   4677  N  NH2   . ARG E  1 209 ? -36.121 24.255  -53.684 1.00 42.41  ? 452 ARG E NH2   1 
ATOM   4678  N  N     . GLN E  1 210 ? -42.196 29.921  -53.662 1.00 45.80  ? 453 GLN E N     1 
ATOM   4679  C  CA    . GLN E  1 210 ? -43.552 30.330  -54.015 1.00 49.82  ? 453 GLN E CA    1 
ATOM   4680  C  C     . GLN E  1 210 ? -43.789 31.806  -53.830 1.00 43.64  ? 453 GLN E C     1 
ATOM   4681  O  O     . GLN E  1 210 ? -44.634 32.338  -54.514 1.00 45.96  ? 453 GLN E O     1 
ATOM   4682  C  CB    . GLN E  1 210 ? -44.628 29.462  -53.333 1.00 55.91  ? 453 GLN E CB    1 
ATOM   4683  C  CG    . GLN E  1 210 ? -44.675 28.043  -53.946 1.00 62.44  ? 453 GLN E CG    1 
ATOM   4684  C  CD    . GLN E  1 210 ? -45.426 27.023  -53.097 1.00 67.65  ? 453 GLN E CD    1 
ATOM   4685  O  OE1   . GLN E  1 210 ? -44.890 25.951  -52.771 1.00 67.37  ? 453 GLN E OE1   1 
ATOM   4686  N  NE2   . GLN E  1 210 ? -46.670 27.350  -52.731 1.00 69.68  ? 453 GLN E NE2   1 
ATOM   4687  N  N     . GLU E  1 211 ? -43.033 32.495  -52.975 1.00 44.06  ? 454 GLU E N     1 
ATOM   4688  C  CA    . GLU E  1 211 ? -43.214 33.958  -52.871 1.00 45.66  ? 454 GLU E CA    1 
ATOM   4689  C  C     . GLU E  1 211 ? -42.252 34.692  -53.819 1.00 42.96  ? 454 GLU E C     1 
ATOM   4690  O  O     . GLU E  1 211 ? -42.271 35.917  -53.905 1.00 42.84  ? 454 GLU E O     1 
ATOM   4691  C  CB    . GLU E  1 211 ? -43.104 34.458  -51.415 1.00 53.52  ? 454 GLU E CB    1 
ATOM   4692  C  CG    . GLU E  1 211 ? -41.683 34.738  -50.919 1.00 64.01  ? 454 GLU E CG    1 
ATOM   4693  C  CD    . GLU E  1 211 ? -41.595 34.998  -49.405 1.00 70.63  ? 454 GLU E CD    1 
ATOM   4694  O  OE1   . GLU E  1 211 ? -42.046 34.119  -48.632 1.00 77.18  ? 454 GLU E OE1   1 
ATOM   4695  O  OE2   . GLU E  1 211 ? -41.062 36.066  -48.984 1.00 62.81  ? 454 GLU E OE2   1 
ATOM   4696  N  N     . GLY E  1 212 ? -41.425 33.937  -54.541 1.00 39.15  ? 455 GLY E N     1 
ATOM   4697  C  CA    . GLY E  1 212 ? -40.499 34.507  -55.513 1.00 37.19  ? 455 GLY E CA    1 
ATOM   4698  C  C     . GLY E  1 212 ? -39.179 35.032  -54.945 1.00 36.88  ? 455 GLY E C     1 
ATOM   4699  O  O     . GLY E  1 212 ? -38.443 35.725  -55.641 1.00 36.62  ? 455 GLY E O     1 
ATOM   4700  N  N     . PHE E  1 213 ? -38.868 34.706  -53.691 1.00 34.73  ? 456 PHE E N     1 
ATOM   4701  C  CA    . PHE E  1 213 ? -37.680 35.244  -53.030 1.00 31.20  ? 456 PHE E CA    1 
ATOM   4702  C  C     . PHE E  1 213 ? -36.497 34.437  -53.538 1.00 31.83  ? 456 PHE E C     1 
ATOM   4703  O  O     . PHE E  1 213 ? -35.463 34.987  -53.924 1.00 37.99  ? 456 PHE E O     1 
ATOM   4704  C  CB    . PHE E  1 213 ? -37.823 35.106  -51.514 1.00 31.58  ? 456 PHE E CB    1 
ATOM   4705  C  CG    . PHE E  1 213 ? -36.629 35.560  -50.726 1.00 29.12  ? 456 PHE E CG    1 
ATOM   4706  C  CD1   . PHE E  1 213 ? -36.167 36.840  -50.824 1.00 29.82  ? 456 PHE E CD1   1 
ATOM   4707  C  CD2   . PHE E  1 213 ? -35.988 34.693  -49.848 1.00 30.83  ? 456 PHE E CD2   1 
ATOM   4708  C  CE1   . PHE E  1 213 ? -35.061 37.257  -50.080 1.00 28.56  ? 456 PHE E CE1   1 
ATOM   4709  C  CE2   . PHE E  1 213 ? -34.908 35.120  -49.087 1.00 28.77  ? 456 PHE E CE2   1 
ATOM   4710  C  CZ    . PHE E  1 213 ? -34.441 36.405  -49.216 1.00 26.51  ? 456 PHE E CZ    1 
ATOM   4711  N  N     . LEU E  1 214 ? -36.682 33.135  -53.568 1.00 29.44  ? 457 LEU E N     1 
ATOM   4712  C  CA    . LEU E  1 214 ? -35.707 32.245  -54.082 1.00 28.95  ? 457 LEU E CA    1 
ATOM   4713  C  C     . LEU E  1 214 ? -35.836 32.171  -55.576 1.00 30.64  ? 457 LEU E C     1 
ATOM   4714  O  O     . LEU E  1 214 ? -36.777 31.575  -56.070 1.00 33.85  ? 457 LEU E O     1 
ATOM   4715  C  CB    . LEU E  1 214 ? -35.948 30.867  -53.499 1.00 29.10  ? 457 LEU E CB    1 
ATOM   4716  C  CG    . LEU E  1 214 ? -35.772 30.714  -51.999 1.00 30.85  ? 457 LEU E CG    1 
ATOM   4717  C  CD1   . LEU E  1 214 ? -35.752 29.214  -51.701 1.00 33.05  ? 457 LEU E CD1   1 
ATOM   4718  C  CD2   . LEU E  1 214 ? -34.488 31.327  -51.483 1.00 29.76  ? 457 LEU E CD2   1 
ATOM   4719  N  N     . THR E  1 215 ? -34.888 32.768  -56.293 1.00 33.99  ? 458 THR E N     1 
ATOM   4720  C  CA    . THR E  1 215 ? -34.884 32.810  -57.770 1.00 30.70  ? 458 THR E CA    1 
ATOM   4721  C  C     . THR E  1 215 ? -34.208 31.620  -58.402 1.00 29.74  ? 458 THR E C     1 
ATOM   4722  O  O     . THR E  1 215 ? -34.492 31.312  -59.542 1.00 35.79  ? 458 THR E O     1 
ATOM   4723  C  CB    . THR E  1 215 ? -34.118 33.997  -58.307 1.00 30.52  ? 458 THR E CB    1 
ATOM   4724  O  OG1   . THR E  1 215 ? -32.747 33.832  -57.987 1.00 30.52  ? 458 THR E OG1   1 
ATOM   4725  C  CG2   . THR E  1 215 ? -34.585 35.287  -57.686 1.00 30.64  ? 458 THR E CG2   1 
ATOM   4726  N  N     . ASP E  1 216 ? -33.287 30.963  -57.716 1.00 28.00  ? 459 ASP E N     1 
ATOM   4727  C  CA    . ASP E  1 216 ? -32.576 29.826  -58.320 1.00 28.62  ? 459 ASP E CA    1 
ATOM   4728  C  C     . ASP E  1 216 ? -32.044 28.917  -57.211 1.00 29.73  ? 459 ASP E C     1 
ATOM   4729  O  O     . ASP E  1 216 ? -31.619 29.386  -56.154 1.00 27.47  ? 459 ASP E O     1 
ATOM   4730  C  CB    . ASP E  1 216 ? -31.364 30.274  -59.170 1.00 31.43  ? 459 ASP E CB    1 
ATOM   4731  C  CG    . ASP E  1 216 ? -31.719 31.304  -60.267 1.00 32.19  ? 459 ASP E CG    1 
ATOM   4732  O  OD1   . ASP E  1 216 ? -32.045 30.865  -61.395 1.00 29.07  ? 459 ASP E OD1   1 
ATOM   4733  O  OD2   . ASP E  1 216 ? -31.646 32.550  -59.987 1.00 29.33  ? 459 ASP E OD2   1 
ATOM   4734  N  N     . ASP E  1 217 ? -32.060 27.620  -57.465 1.00 28.81  ? 460 ASP E N     1 
ATOM   4735  C  CA    . ASP E  1 217 ? -31.463 26.665  -56.565 1.00 30.29  ? 460 ASP E CA    1 
ATOM   4736  C  C     . ASP E  1 217 ? -30.150 26.145  -57.114 1.00 28.82  ? 460 ASP E C     1 
ATOM   4737  O  O     . ASP E  1 217 ? -30.003 25.976  -58.297 1.00 27.91  ? 460 ASP E O     1 
ATOM   4738  C  CB    . ASP E  1 217 ? -32.402 25.490  -56.388 1.00 32.01  ? 460 ASP E CB    1 
ATOM   4739  C  CG    . ASP E  1 217 ? -33.733 25.894  -55.837 1.00 34.85  ? 460 ASP E CG    1 
ATOM   4740  O  OD1   . ASP E  1 217 ? -33.892 27.007  -55.263 1.00 32.80  ? 460 ASP E OD1   1 
ATOM   4741  O  OD2   . ASP E  1 217 ? -34.634 25.054  -55.973 1.00 39.78  ? 460 ASP E OD2   1 
ATOM   4742  N  N     . LEU E  1 218 ? -29.208 25.849  -56.231 1.00 28.29  ? 461 LEU E N     1 
ATOM   4743  C  CA    . LEU E  1 218 ? -27.904 25.357  -56.621 1.00 27.38  ? 461 LEU E CA    1 
ATOM   4744  C  C     . LEU E  1 218 ? -27.582 23.990  -56.009 1.00 28.16  ? 461 LEU E C     1 
ATOM   4745  O  O     . LEU E  1 218 ? -27.091 23.103  -56.687 1.00 25.34  ? 461 LEU E O     1 
ATOM   4746  C  CB    . LEU E  1 218 ? -26.851 26.360  -56.131 1.00 26.42  ? 461 LEU E CB    1 
ATOM   4747  C  CG    . LEU E  1 218 ? -26.690 27.695  -56.819 1.00 27.62  ? 461 LEU E CG    1 
ATOM   4748  C  CD1   . LEU E  1 218 ? -25.690 28.553  -56.059 1.00 28.74  ? 461 LEU E CD1   1 
ATOM   4749  C  CD2   . LEU E  1 218 ? -26.181 27.492  -58.243 1.00 29.21  ? 461 LEU E CD2   1 
ATOM   4750  N  N     . VAL E  1 219 ? -27.813 23.843  -54.710 1.00 28.48  ? 462 VAL E N     1 
ATOM   4751  C  CA    . VAL E  1 219 ? -27.523 22.585  -54.042 1.00 33.84  ? 462 VAL E CA    1 
ATOM   4752  C  C     . VAL E  1 219 ? -28.572 22.339  -52.977 1.00 38.62  ? 462 VAL E C     1 
ATOM   4753  O  O     . VAL E  1 219 ? -28.980 23.275  -52.277 1.00 38.75  ? 462 VAL E O     1 
ATOM   4754  C  CB    . VAL E  1 219 ? -26.156 22.594  -53.313 1.00 32.81  ? 462 VAL E CB    1 
ATOM   4755  C  CG1   . VAL E  1 219 ? -25.985 21.311  -52.505 1.00 35.60  ? 462 VAL E CG1   1 
ATOM   4756  C  CG2   . VAL E  1 219 ? -24.981 22.749  -54.287 1.00 30.78  ? 462 VAL E CG2   1 
ATOM   4757  N  N     . SER E  1 220 ? -28.948 21.067  -52.827 1.00 45.46  ? 463 SER E N     1 
ATOM   4758  C  CA    . SER E  1 220 ? -29.702 20.571  -51.654 1.00 45.23  ? 463 SER E CA    1 
ATOM   4759  C  C     . SER E  1 220 ? -29.003 19.332  -50.942 1.00 43.53  ? 463 SER E C     1 
ATOM   4760  O  O     . SER E  1 220 ? -28.956 18.233  -51.496 1.00 41.30  ? 463 SER E O     1 
ATOM   4761  C  CB    . SER E  1 220 ? -31.135 20.257  -52.099 1.00 43.70  ? 463 SER E CB    1 
ATOM   4762  O  OG    . SER E  1 220 ? -31.268 18.888  -52.413 1.00 49.49  ? 463 SER E OG    1 
ATOM   4763  N  N     . GLN E  1 221 ? -28.417 19.533  -49.751 1.00 46.84  ? 464 GLN E N     1 
ATOM   4764  C  CA    . GLN E  1 221 ? -27.944 18.421  -48.882 1.00 47.05  ? 464 GLN E CA    1 
ATOM   4765  C  C     . GLN E  1 221 ? -29.003 18.222  -47.836 1.00 50.34  ? 464 GLN E C     1 
ATOM   4766  O  O     . GLN E  1 221 ? -28.827 18.622  -46.689 1.00 54.19  ? 464 GLN E O     1 
ATOM   4767  C  CB    . GLN E  1 221 ? -26.657 18.738  -48.149 1.00 44.06  ? 464 GLN E CB    1 
ATOM   4768  C  CG    . GLN E  1 221 ? -25.460 19.064  -49.009 1.00 50.95  ? 464 GLN E CG    1 
ATOM   4769  C  CD    . GLN E  1 221 ? -24.306 19.632  -48.175 1.00 53.61  ? 464 GLN E CD    1 
ATOM   4770  O  OE1   . GLN E  1 221 ? -24.339 19.602  -46.950 1.00 54.23  ? 464 GLN E OE1   1 
ATOM   4771  N  NE2   . GLN E  1 221 ? -23.294 20.155  -48.839 1.00 53.43  ? 464 GLN E NE2   1 
ATOM   4772  N  N     . GLU E  1 222 ? -30.132 17.647  -48.219 1.00 60.38  ? 465 GLU E N     1 
ATOM   4773  C  CA    . GLU E  1 222 ? -31.265 17.580  -47.298 1.00 71.98  ? 465 GLU E CA    1 
ATOM   4774  C  C     . GLU E  1 222 ? -31.103 16.329  -46.420 1.00 81.88  ? 465 GLU E C     1 
ATOM   4775  O  O     . GLU E  1 222 ? -32.068 15.881  -45.792 1.00 85.61  ? 465 GLU E O     1 
ATOM   4776  C  CB    . GLU E  1 222 ? -32.632 17.642  -48.034 1.00 69.82  ? 465 GLU E CB    1 
ATOM   4777  C  CG    . GLU E  1 222 ? -32.756 18.702  -49.163 1.00 71.24  ? 465 GLU E CG    1 
ATOM   4778  C  CD    . GLU E  1 222 ? -33.035 20.166  -48.725 1.00 68.66  ? 465 GLU E CD    1 
ATOM   4779  O  OE1   . GLU E  1 222 ? -33.958 20.396  -47.915 1.00 60.17  ? 465 GLU E OE1   1 
ATOM   4780  O  OE2   . GLU E  1 222 ? -32.365 21.118  -49.228 1.00 68.16  ? 465 GLU E OE2   1 
ATOM   4781  N  N     . GLU E  1 223 ? -29.863 15.810  -46.358 1.00 89.22  ? 466 GLU E N     1 
ATOM   4782  C  CA    . GLU E  1 223 ? -29.534 14.548  -45.680 1.00 87.91  ? 466 GLU E CA    1 
ATOM   4783  C  C     . GLU E  1 223 ? -28.040 14.435  -45.315 1.00 84.84  ? 466 GLU E C     1 
ATOM   4784  O  O     . GLU E  1 223 ? -27.298 13.679  -45.952 1.00 76.09  ? 466 GLU E O     1 
ATOM   4785  C  CB    . GLU E  1 223 ? -29.953 13.355  -46.564 1.00 88.42  ? 466 GLU E CB    1 
ATOM   4786  C  CG    . GLU E  1 223 ? -31.371 12.857  -46.310 1.00 88.64  ? 466 GLU E CG    1 
ATOM   4787  C  CD    . GLU E  1 223 ? -32.136 12.499  -47.575 1.00 89.15  ? 466 GLU E CD    1 
ATOM   4788  O  OE1   . GLU E  1 223 ? -31.927 11.383  -48.114 1.00 79.20  ? 466 GLU E OE1   1 
ATOM   4789  O  OE2   . GLU E  1 223 ? -32.968 13.336  -48.007 1.00 88.97  ? 466 GLU E OE2   1 
ATOM   4790  N  N     . ASN E  1 224 ? -27.608 15.176  -44.287 1.00 85.39  ? 467 ASN E N     1 
ATOM   4791  C  CA    . ASN E  1 224 ? -26.231 15.045  -43.747 1.00 81.42  ? 467 ASN E CA    1 
ATOM   4792  C  C     . ASN E  1 224 ? -26.097 15.103  -42.207 1.00 80.58  ? 467 ASN E C     1 
ATOM   4793  O  O     . ASN E  1 224 ? -25.591 16.061  -41.649 1.00 67.39  ? 467 ASN E O     1 
ATOM   4794  C  CB    . ASN E  1 224 ? -25.268 16.028  -44.437 1.00 85.32  ? 467 ASN E CB    1 
ATOM   4795  C  CG    . ASN E  1 224 ? -25.167 17.388  -43.750 1.00 85.17  ? 467 ASN E CG    1 
ATOM   4796  O  OD1   . ASN E  1 224 ? -24.190 17.664  -43.049 1.00 85.79  ? 467 ASN E OD1   1 
ATOM   4797  N  ND2   . ASN E  1 224 ? -26.148 18.259  -43.992 1.00 81.21  ? 467 ASN E ND2   1 
ATOM   4798  N  N     . GLY E  1 225 ? -26.530 14.035  -41.538 1.00 81.21  ? 468 GLY E N     1 
ATOM   4799  C  CA    . GLY E  1 225 ? -26.447 13.931  -40.085 1.00 75.90  ? 468 GLY E CA    1 
ATOM   4800  C  C     . GLY E  1 225 ? -27.599 14.657  -39.434 1.00 72.23  ? 468 GLY E C     1 
ATOM   4801  O  O     . GLY E  1 225 ? -27.410 15.370  -38.444 1.00 72.90  ? 468 GLY E O     1 
ATOM   4802  N  N     . GLN E  1 226 ? -28.793 14.487  -40.005 1.00 72.23  ? 469 GLN E N     1 
ATOM   4803  C  CA    . GLN E  1 226 ? -29.990 15.224  -39.570 1.00 74.76  ? 469 GLN E CA    1 
ATOM   4804  C  C     . GLN E  1 226 ? -29.815 16.758  -39.810 1.00 68.95  ? 469 GLN E C     1 
ATOM   4805  O  O     . GLN E  1 226 ? -30.753 17.529  -39.597 1.00 69.79  ? 469 GLN E O     1 
ATOM   4806  C  CB    . GLN E  1 226 ? -30.357 14.868  -38.094 1.00 79.92  ? 469 GLN E CB    1 
ATOM   4807  C  CG    . GLN E  1 226 ? -31.855 14.871  -37.714 1.00 81.71  ? 469 GLN E CG    1 
ATOM   4808  C  CD    . GLN E  1 226 ? -32.553 13.492  -37.719 1.00 87.51  ? 469 GLN E CD    1 
ATOM   4809  O  OE1   . GLN E  1 226 ? -32.016 12.482  -38.186 1.00 81.85  ? 469 GLN E OE1   1 
ATOM   4810  N  NE2   . GLN E  1 226 ? -33.773 13.461  -37.190 1.00 90.63  ? 469 GLN E NE2   1 
ATOM   4811  N  N     . GLN E  1 227 ? -28.630 17.191  -40.271 1.00 63.23  ? 470 GLN E N     1 
ATOM   4812  C  CA    . GLN E  1 227 ? -28.458 18.548  -40.833 1.00 61.66  ? 470 GLN E CA    1 
ATOM   4813  C  C     . GLN E  1 227 ? -28.780 18.579  -42.326 1.00 57.59  ? 470 GLN E C     1 
ATOM   4814  O  O     . GLN E  1 227 ? -28.278 17.775  -43.119 1.00 55.94  ? 470 GLN E O     1 
ATOM   4815  C  CB    . GLN E  1 227 ? -27.040 19.078  -40.682 1.00 61.03  ? 470 GLN E CB    1 
ATOM   4816  C  CG    . GLN E  1 227 ? -26.613 19.354  -39.254 1.00 64.02  ? 470 GLN E CG    1 
ATOM   4817  C  CD    . GLN E  1 227 ? -25.389 20.262  -39.179 1.00 59.81  ? 470 GLN E CD    1 
ATOM   4818  O  OE1   . GLN E  1 227 ? -24.899 20.767  -40.214 1.00 49.85  ? 470 GLN E OE1   1 
ATOM   4819  N  NE2   . GLN E  1 227 ? -24.894 20.484  -37.949 1.00 57.71  ? 470 GLN E NE2   1 
ATOM   4820  N  N     . GLN E  1 228 ? -29.581 19.555  -42.705 1.00 52.51  ? 471 GLN E N     1 
ATOM   4821  C  CA    . GLN E  1 228 ? -29.955 19.745  -44.086 1.00 51.40  ? 471 GLN E CA    1 
ATOM   4822  C  C     . GLN E  1 228 ? -29.462 21.148  -44.532 1.00 46.08  ? 471 GLN E C     1 
ATOM   4823  O  O     . GLN E  1 228 ? -29.606 22.143  -43.792 1.00 41.18  ? 471 GLN E O     1 
ATOM   4824  C  CB    . GLN E  1 228 ? -31.486 19.588  -44.208 1.00 48.45  ? 471 GLN E CB    1 
ATOM   4825  C  CG    . GLN E  1 228 ? -32.051 18.377  -43.447 1.00 49.92  ? 471 GLN E CG    1 
ATOM   4826  C  CD    . GLN E  1 228 ? -33.546 18.467  -43.225 1.00 47.75  ? 471 GLN E CD    1 
ATOM   4827  O  OE1   . GLN E  1 228 ? -34.315 17.783  -43.886 1.00 50.21  ? 471 GLN E OE1   1 
ATOM   4828  N  NE2   . GLN E  1 228 ? -33.968 19.356  -42.327 1.00 48.68  ? 471 GLN E NE2   1 
ATOM   4829  N  N     . LYS E  1 229 ? -28.900 21.213  -45.745 1.00 45.90  ? 472 LYS E N     1 
ATOM   4830  C  CA    . LYS E  1 229 ? -28.321 22.465  -46.294 1.00 40.81  ? 472 LYS E CA    1 
ATOM   4831  C  C     . LYS E  1 229 ? -28.886 22.847  -47.646 1.00 34.48  ? 472 LYS E C     1 
ATOM   4832  O  O     . LYS E  1 229 ? -28.912 22.018  -48.554 1.00 31.30  ? 472 LYS E O     1 
ATOM   4833  C  CB    . LYS E  1 229 ? -26.825 22.254  -46.462 1.00 45.53  ? 472 LYS E CB    1 
ATOM   4834  C  CG    . LYS E  1 229 ? -25.965 23.501  -46.358 1.00 48.56  ? 472 LYS E CG    1 
ATOM   4835  C  CD    . LYS E  1 229 ? -24.508 23.052  -46.451 1.00 52.87  ? 472 LYS E CD    1 
ATOM   4836  C  CE    . LYS E  1 229 ? -23.509 24.152  -46.109 1.00 55.18  ? 472 LYS E CE    1 
ATOM   4837  N  NZ    . LYS E  1 229 ? -22.127 23.582  -46.054 1.00 56.71  ? 472 LYS E NZ    1 
ATOM   4838  N  N     . TYR E  1 230 ? -29.313 24.108  -47.785 1.00 30.64  ? 473 TYR E N     1 
ATOM   4839  C  CA    . TYR E  1 230 ? -29.683 24.678  -49.077 1.00 26.25  ? 473 TYR E CA    1 
ATOM   4840  C  C     . TYR E  1 230 ? -28.766 25.818  -49.466 1.00 25.05  ? 473 TYR E C     1 
ATOM   4841  O  O     . TYR E  1 230 ? -28.641 26.806  -48.716 1.00 24.83  ? 473 TYR E O     1 
ATOM   4842  C  CB    . TYR E  1 230 ? -31.096 25.231  -49.028 1.00 26.54  ? 473 TYR E CB    1 
ATOM   4843  C  CG    . TYR E  1 230 ? -31.521 26.078  -50.233 1.00 25.72  ? 473 TYR E CG    1 
ATOM   4844  C  CD1   . TYR E  1 230 ? -31.254 27.439  -50.294 1.00 24.15  ? 473 TYR E CD1   1 
ATOM   4845  C  CD2   . TYR E  1 230 ? -32.187 25.484  -51.336 1.00 25.41  ? 473 TYR E CD2   1 
ATOM   4846  C  CE1   . TYR E  1 230 ? -31.664 28.198  -51.379 1.00 23.35  ? 473 TYR E CE1   1 
ATOM   4847  C  CE2   . TYR E  1 230 ? -32.584 26.240  -52.412 1.00 23.79  ? 473 TYR E CE2   1 
ATOM   4848  C  CZ    . TYR E  1 230 ? -32.345 27.587  -52.426 1.00 24.85  ? 473 TYR E CZ    1 
ATOM   4849  O  OH    . TYR E  1 230 ? -32.727 28.313  -53.528 1.00 28.92  ? 473 TYR E OH    1 
ATOM   4850  N  N     . LEU E  1 231 ? -28.166 25.686  -50.650 1.00 22.88  ? 474 LEU E N     1 
ATOM   4851  C  CA    . LEU E  1 231 ? -27.412 26.760  -51.319 1.00 22.76  ? 474 LEU E CA    1 
ATOM   4852  C  C     . LEU E  1 231 ? -28.160 27.230  -52.572 1.00 21.63  ? 474 LEU E C     1 
ATOM   4853  O  O     . LEU E  1 231 ? -28.444 26.453  -53.456 1.00 22.26  ? 474 LEU E O     1 
ATOM   4854  C  CB    . LEU E  1 231 ? -26.042 26.280  -51.774 1.00 22.29  ? 474 LEU E CB    1 
ATOM   4855  C  CG    . LEU E  1 231 ? -25.214 25.490  -50.796 1.00 25.25  ? 474 LEU E CG    1 
ATOM   4856  C  CD1   . LEU E  1 231 ? -23.885 25.127  -51.442 1.00 24.62  ? 474 LEU E CD1   1 
ATOM   4857  C  CD2   . LEU E  1 231 ? -25.015 26.213  -49.481 1.00 25.90  ? 474 LEU E CD2   1 
ATOM   4858  N  N     . GLY E  1 232 ? -28.430 28.518  -52.660 1.00 22.34  ? 475 GLY E N     1 
ATOM   4859  C  CA    . GLY E  1 232 ? -29.172 29.069  -53.775 1.00 20.65  ? 475 GLY E CA    1 
ATOM   4860  C  C     . GLY E  1 232 ? -29.020 30.556  -53.862 1.00 20.91  ? 475 GLY E C     1 
ATOM   4861  O  O     . GLY E  1 232 ? -28.045 31.156  -53.368 1.00 22.10  ? 475 GLY E O     1 
ATOM   4862  N  N     . VAL E  1 233 ? -30.009 31.176  -54.483 1.00 20.80  ? 476 VAL E N     1 
ATOM   4863  C  CA    . VAL E  1 233 ? -29.924 32.544  -54.905 1.00 20.50  ? 476 VAL E CA    1 
ATOM   4864  C  C     . VAL E  1 233 ? -31.221 33.193  -54.543 1.00 23.87  ? 476 VAL E C     1 
ATOM   4865  O  O     . VAL E  1 233 ? -32.294 32.580  -54.735 1.00 23.28  ? 476 VAL E O     1 
ATOM   4866  C  CB    . VAL E  1 233 ? -29.803 32.591  -56.436 1.00 18.38  ? 476 VAL E CB    1 
ATOM   4867  C  CG1   . VAL E  1 233 ? -29.573 34.022  -56.916 1.00 17.31  ? 476 VAL E CG1   1 
ATOM   4868  C  CG2   . VAL E  1 233 ? -28.711 31.633  -56.839 1.00 17.27  ? 476 VAL E CG2   1 
ATOM   4869  N  N     . CYS E  1 234 ? -31.136 34.417  -54.030 1.00 21.77  ? 477 CYS E N     1 
ATOM   4870  C  CA    . CYS E  1 234 ? -32.313 35.064  -53.592 1.00 24.67  ? 477 CYS E CA    1 
ATOM   4871  C  C     . CYS E  1 234 ? -32.241 36.503  -54.084 1.00 28.14  ? 477 CYS E C     1 
ATOM   4872  O  O     . CYS E  1 234 ? -31.196 36.939  -54.616 1.00 24.17  ? 477 CYS E O     1 
ATOM   4873  C  CB    . CYS E  1 234 ? -32.453 34.955  -52.073 1.00 26.01  ? 477 CYS E CB    1 
ATOM   4874  S  SG    . CYS E  1 234 ? -31.482 36.146  -51.102 1.00 28.45  ? 477 CYS E SG    1 
ATOM   4875  N  N     . ARG E  1 235 ? -33.378 37.191  -53.989 1.00 27.95  ? 478 ARG E N     1 
ATOM   4876  C  CA    . ARG E  1 235 ? -33.466 38.602  -54.395 1.00 30.67  ? 478 ARG E CA    1 
ATOM   4877  C  C     . ARG E  1 235 ? -34.581 39.243  -53.607 1.00 31.52  ? 478 ARG E C     1 
ATOM   4878  O  O     . ARG E  1 235 ? -35.711 38.768  -53.612 1.00 29.10  ? 478 ARG E O     1 
ATOM   4879  C  CB    . ARG E  1 235 ? -33.736 38.764  -55.894 1.00 35.13  ? 478 ARG E CB    1 
ATOM   4880  C  CG    . ARG E  1 235 ? -33.617 40.204  -56.356 1.00 40.91  ? 478 ARG E CG    1 
ATOM   4881  C  CD    . ARG E  1 235 ? -33.839 40.430  -57.844 1.00 49.94  ? 478 ARG E CD    1 
ATOM   4882  N  NE    . ARG E  1 235 ? -35.258 40.448  -58.215 1.00 54.37  ? 478 ARG E NE    1 
ATOM   4883  C  CZ    . ARG E  1 235 ? -35.941 39.419  -58.737 1.00 61.95  ? 478 ARG E CZ    1 
ATOM   4884  N  NH1   . ARG E  1 235 ? -35.359 38.256  -58.975 1.00 63.19  ? 478 ARG E NH1   1 
ATOM   4885  N  NH2   . ARG E  1 235 ? -37.230 39.551  -59.025 1.00 61.09  ? 478 ARG E NH2   1 
ATOM   4886  N  N     . LEU E  1 236 ? -34.254 40.294  -52.874 1.00 34.35  ? 479 LEU E N     1 
ATOM   4887  C  CA    . LEU E  1 236 ? -35.268 41.026  -52.143 1.00 34.07  ? 479 LEU E CA    1 
ATOM   4888  C  C     . LEU E  1 236 ? -36.248 41.648  -53.121 1.00 35.86  ? 479 LEU E C     1 
ATOM   4889  O  O     . LEU E  1 236 ? -35.888 41.930  -54.289 1.00 30.54  ? 479 LEU E O     1 
ATOM   4890  C  CB    . LEU E  1 236 ? -34.634 42.082  -51.250 1.00 37.53  ? 479 LEU E CB    1 
ATOM   4891  C  CG    . LEU E  1 236 ? -33.883 41.510  -50.038 1.00 39.73  ? 479 LEU E CG    1 
ATOM   4892  C  CD1   . LEU E  1 236 ? -33.055 42.594  -49.395 1.00 42.19  ? 479 LEU E CD1   1 
ATOM   4893  C  CD2   . LEU E  1 236 ? -34.842 40.915  -49.012 1.00 40.19  ? 479 LEU E CD2   1 
ATOM   4894  N  N     . PRO E  1 237 ? -37.512 41.821  -52.679 1.00 37.97  ? 480 PRO E N     1 
ATOM   4895  C  CA    . PRO E  1 237 ? -38.536 42.335  -53.606 1.00 39.88  ? 480 PRO E CA    1 
ATOM   4896  C  C     . PRO E  1 237 ? -38.386 43.814  -53.952 1.00 38.97  ? 480 PRO E C     1 
ATOM   4897  O  O     . PRO E  1 237 ? -37.874 44.608  -53.169 1.00 38.48  ? 480 PRO E O     1 
ATOM   4898  C  CB    . PRO E  1 237 ? -39.845 42.113  -52.861 1.00 39.91  ? 480 PRO E CB    1 
ATOM   4899  C  CG    . PRO E  1 237 ? -39.481 41.962  -51.439 1.00 40.48  ? 480 PRO E CG    1 
ATOM   4900  C  CD    . PRO E  1 237 ? -38.084 41.400  -51.393 1.00 37.96  ? 480 PRO E CD    1 
ATOM   4901  N  N     . GLY E  1 238 ? -38.833 44.147  -55.148 1.00 40.53  ? 481 GLY E N     1 
ATOM   4902  C  CA    . GLY E  1 238 ? -38.952 45.523  -55.586 1.00 42.08  ? 481 GLY E CA    1 
ATOM   4903  C  C     . GLY E  1 238 ? -37.843 45.858  -56.546 1.00 41.46  ? 481 GLY E C     1 
ATOM   4904  O  O     . GLY E  1 238 ? -37.021 45.014  -56.871 1.00 42.67  ? 481 GLY E O     1 
ATOM   4905  N  N     . PRO E  1 239 ? -37.826 47.092  -57.022 1.00 40.14  ? 482 PRO E N     1 
ATOM   4906  C  CA    . PRO E  1 239 ? -36.793 47.483  -57.982 1.00 39.65  ? 482 PRO E CA    1 
ATOM   4907  C  C     . PRO E  1 239 ? -35.449 47.741  -57.283 1.00 37.43  ? 482 PRO E C     1 
ATOM   4908  O  O     . PRO E  1 239 ? -35.400 47.781  -56.063 1.00 36.73  ? 482 PRO E O     1 
ATOM   4909  C  CB    . PRO E  1 239 ? -37.374 48.747  -58.620 1.00 40.44  ? 482 PRO E CB    1 
ATOM   4910  C  CG    . PRO E  1 239 ? -38.282 49.341  -57.560 1.00 40.18  ? 482 PRO E CG    1 
ATOM   4911  C  CD    . PRO E  1 239 ? -38.793 48.173  -56.732 1.00 40.10  ? 482 PRO E CD    1 
ATOM   4912  N  N     . GLY E  1 240 ? -34.378 47.867  -58.062 1.00 40.74  ? 483 GLY E N     1 
ATOM   4913  C  CA    . GLY E  1 240 ? -33.020 48.164  -57.549 1.00 41.88  ? 483 GLY E CA    1 
ATOM   4914  C  C     . GLY E  1 240 ? -32.331 47.061  -56.744 1.00 43.73  ? 483 GLY E C     1 
ATOM   4915  O  O     . GLY E  1 240 ? -31.453 47.342  -55.935 1.00 50.69  ? 483 GLY E O     1 
ATOM   4916  N  N     . ARG E  1 241 ? -32.722 45.809  -56.931 1.00 41.34  ? 484 ARG E N     1 
ATOM   4917  C  CA    . ARG E  1 241 ? -32.184 44.755  -56.095 1.00 39.32  ? 484 ARG E CA    1 
ATOM   4918  C  C     . ARG E  1 241 ? -31.355 43.777  -56.876 1.00 37.41  ? 484 ARG E C     1 
ATOM   4919  O  O     . ARG E  1 241 ? -31.698 43.373  -57.991 1.00 35.51  ? 484 ARG E O     1 
ATOM   4920  C  CB    . ARG E  1 241 ? -33.290 44.019  -55.351 1.00 44.67  ? 484 ARG E CB    1 
ATOM   4921  C  CG    . ARG E  1 241 ? -34.183 44.917  -54.488 1.00 43.33  ? 484 ARG E CG    1 
ATOM   4922  C  CD    . ARG E  1 241 ? -33.409 45.686  -53.447 1.00 41.91  ? 484 ARG E CD    1 
ATOM   4923  N  NE    . ARG E  1 241 ? -34.188 45.746  -52.212 1.00 43.28  ? 484 ARG E NE    1 
ATOM   4924  C  CZ    . ARG E  1 241 ? -33.668 45.820  -50.994 1.00 43.08  ? 484 ARG E CZ    1 
ATOM   4925  N  NH1   . ARG E  1 241 ? -32.353 45.847  -50.833 1.00 45.72  ? 484 ARG E NH1   1 
ATOM   4926  N  NH2   . ARG E  1 241 ? -34.464 45.844  -49.934 1.00 43.14  ? 484 ARG E NH2   1 
ATOM   4927  N  N     . ARG E  1 242 ? -30.241 43.395  -56.264 1.00 38.59  ? 485 ARG E N     1 
ATOM   4928  C  CA    . ARG E  1 242 ? -29.266 42.515  -56.866 1.00 34.75  ? 485 ARG E CA    1 
ATOM   4929  C  C     . ARG E  1 242 ? -29.566 41.128  -56.380 1.00 32.78  ? 485 ARG E C     1 
ATOM   4930  O  O     . ARG E  1 242 ? -30.074 40.967  -55.293 1.00 32.88  ? 485 ARG E O     1 
ATOM   4931  C  CB    . ARG E  1 242 ? -27.884 42.956  -56.426 1.00 39.28  ? 485 ARG E CB    1 
ATOM   4932  C  CG    . ARG E  1 242 ? -27.392 44.239  -57.111 1.00 41.23  ? 485 ARG E CG    1 
ATOM   4933  C  CD    . ARG E  1 242 ? -25.938 44.504  -56.732 1.00 46.08  ? 485 ARG E CD    1 
ATOM   4934  N  NE    . ARG E  1 242 ? -25.303 45.633  -57.416 1.00 48.93  ? 485 ARG E NE    1 
ATOM   4935  C  CZ    . ARG E  1 242 ? -24.644 45.584  -58.582 1.00 48.77  ? 485 ARG E CZ    1 
ATOM   4936  N  NH1   . ARG E  1 242 ? -24.511 44.460  -59.279 1.00 53.35  ? 485 ARG E NH1   1 
ATOM   4937  N  NH2   . ARG E  1 242 ? -24.102 46.690  -59.066 1.00 53.14  ? 485 ARG E NH2   1 
ATOM   4938  N  N     . HIS E  1 243 ? -29.286 40.116  -57.192 1.00 31.39  ? 486 HIS E N     1 
ATOM   4939  C  CA    . HIS E  1 243 ? -29.392 38.740  -56.754 1.00 27.92  ? 486 HIS E CA    1 
ATOM   4940  C  C     . HIS E  1 243 ? -28.265 38.398  -55.770 1.00 26.31  ? 486 HIS E C     1 
ATOM   4941  O  O     . HIS E  1 243 ? -27.146 38.808  -55.984 1.00 25.98  ? 486 HIS E O     1 
ATOM   4942  C  CB    . HIS E  1 243 ? -29.339 37.825  -57.956 1.00 32.28  ? 486 HIS E CB    1 
ATOM   4943  C  CG    . HIS E  1 243 ? -30.557 37.890  -58.833 1.00 36.02  ? 486 HIS E CG    1 
ATOM   4944  N  ND1   . HIS E  1 243 ? -30.768 38.898  -59.755 1.00 38.97  ? 486 HIS E ND1   1 
ATOM   4945  C  CD2   . HIS E  1 243 ? -31.621 37.053  -58.942 1.00 36.91  ? 486 HIS E CD2   1 
ATOM   4946  C  CE1   . HIS E  1 243 ? -31.897 38.670  -60.398 1.00 37.22  ? 486 HIS E CE1   1 
ATOM   4947  N  NE2   . HIS E  1 243 ? -32.435 37.563  -59.919 1.00 37.76  ? 486 HIS E NE2   1 
ATOM   4948  N  N     . ARG E  1 244 ? -28.563 37.696  -54.674 1.00 23.48  ? 487 ARG E N     1 
ATOM   4949  C  CA    . ARG E  1 244 ? -27.551 37.340  -53.698 1.00 24.53  ? 487 ARG E CA    1 
ATOM   4950  C  C     . ARG E  1 244 ? -27.502 35.864  -53.398 1.00 24.29  ? 487 ARG E C     1 
ATOM   4951  O  O     . ARG E  1 244 ? -28.529 35.223  -53.385 1.00 24.76  ? 487 ARG E O     1 
ATOM   4952  C  CB    . ARG E  1 244 ? -27.841 38.038  -52.388 1.00 25.99  ? 487 ARG E CB    1 
ATOM   4953  C  CG    . ARG E  1 244 ? -28.101 39.511  -52.529 1.00 26.87  ? 487 ARG E CG    1 
ATOM   4954  C  CD    . ARG E  1 244 ? -26.860 40.230  -53.033 1.00 28.11  ? 487 ARG E CD    1 
ATOM   4955  N  NE    . ARG E  1 244 ? -27.012 41.649  -52.779 1.00 28.90  ? 487 ARG E NE    1 
ATOM   4956  C  CZ    . ARG E  1 244 ? -26.118 42.562  -53.095 1.00 26.76  ? 487 ARG E CZ    1 
ATOM   4957  N  NH1   . ARG E  1 244 ? -25.027 42.207  -53.743 1.00 28.67  ? 487 ARG E NH1   1 
ATOM   4958  N  NH2   . ARG E  1 244 ? -26.334 43.822  -52.769 1.00 24.02  ? 487 ARG E NH2   1 
ATOM   4959  N  N     . ARG E  1 245 ? -26.308 35.333  -53.108 1.00 23.60  ? 488 ARG E N     1 
ATOM   4960  C  CA    . ARG E  1 245 ? -26.175 33.968  -52.641 1.00 22.29  ? 488 ARG E CA    1 
ATOM   4961  C  C     . ARG E  1 245 ? -26.701 33.773  -51.201 1.00 22.43  ? 488 ARG E C     1 
ATOM   4962  O  O     . ARG E  1 245 ? -26.423 34.559  -50.290 1.00 23.26  ? 488 ARG E O     1 
ATOM   4963  C  CB    . ARG E  1 245 ? -24.737 33.497  -52.763 1.00 23.07  ? 488 ARG E CB    1 
ATOM   4964  C  CG    . ARG E  1 245 ? -24.364 33.169  -54.213 1.00 23.79  ? 488 ARG E CG    1 
ATOM   4965  C  CD    . ARG E  1 245 ? -24.580 31.686  -54.540 1.00 25.87  ? 488 ARG E CD    1 
ATOM   4966  N  NE    . ARG E  1 245 ? -23.820 30.824  -53.631 1.00 25.14  ? 488 ARG E NE    1 
ATOM   4967  C  CZ    . ARG E  1 245 ? -24.309 30.216  -52.540 1.00 25.05  ? 488 ARG E CZ    1 
ATOM   4968  N  NH1   . ARG E  1 245 ? -25.608 30.285  -52.175 1.00 25.48  ? 488 ARG E NH1   1 
ATOM   4969  N  NH2   . ARG E  1 245 ? -23.488 29.509  -51.809 1.00 22.83  ? 488 ARG E NH2   1 
ATOM   4970  N  N     . LEU E  1 246 ? -27.550 32.777  -51.037 1.00 22.01  ? 489 LEU E N     1 
ATOM   4971  C  CA    . LEU E  1 246 ? -28.118 32.462  -49.715 1.00 23.13  ? 489 LEU E CA    1 
ATOM   4972  C  C     . LEU E  1 246 ? -27.911 30.986  -49.425 1.00 22.64  ? 489 LEU E C     1 
ATOM   4973  O  O     . LEU E  1 246 ? -28.194 30.125  -50.273 1.00 23.82  ? 489 LEU E O     1 
ATOM   4974  C  CB    . LEU E  1 246 ? -29.614 32.838  -49.636 1.00 24.74  ? 489 LEU E CB    1 
ATOM   4975  C  CG    . LEU E  1 246 ? -30.475 32.288  -48.458 1.00 23.25  ? 489 LEU E CG    1 
ATOM   4976  C  CD1   . LEU E  1 246 ? -29.974 32.930  -47.185 1.00 22.88  ? 489 LEU E CD1   1 
ATOM   4977  C  CD2   . LEU E  1 246 ? -31.952 32.606  -48.657 1.00 24.82  ? 489 LEU E CD2   1 
ATOM   4978  N  N     . ASP E  1 247 ? -27.407 30.714  -48.228 1.00 24.09  ? 490 ASP E N     1 
ATOM   4979  C  CA    . ASP E  1 247 ? -27.246 29.376  -47.704 1.00 27.54  ? 490 ASP E CA    1 
ATOM   4980  C  C     . ASP E  1 247 ? -28.271 29.326  -46.526 1.00 31.05  ? 490 ASP E C     1 
ATOM   4981  O  O     . ASP E  1 247 ? -28.386 30.285  -45.771 1.00 31.68  ? 490 ASP E O     1 
ATOM   4982  C  CB    . ASP E  1 247 ? -25.782 29.127  -47.275 1.00 29.53  ? 490 ASP E CB    1 
ATOM   4983  C  CG    . ASP E  1 247 ? -24.727 29.382  -48.451 1.00 36.20  ? 490 ASP E CG    1 
ATOM   4984  O  OD1   . ASP E  1 247 ? -25.191 29.152  -49.602 1.00 32.68  ? 490 ASP E OD1   1 
ATOM   4985  O  OD2   . ASP E  1 247 ? -23.493 29.849  -48.238 1.00 44.90  ? 490 ASP E OD2   1 
ATOM   4986  N  N     . ILE E  1 248 ? -29.082 28.269  -46.453 1.00 33.35  ? 491 ILE E N     1 
ATOM   4987  C  CA    . ILE E  1 248 ? -30.014 28.022  -45.320 1.00 32.84  ? 491 ILE E CA    1 
ATOM   4988  C  C     . ILE E  1 248 ? -29.672 26.628  -44.817 1.00 34.80  ? 491 ILE E C     1 
ATOM   4989  O  O     . ILE E  1 248 ? -29.511 25.672  -45.622 1.00 39.89  ? 491 ILE E O     1 
ATOM   4990  C  CB    . ILE E  1 248 ? -31.503 28.072  -45.720 1.00 30.25  ? 491 ILE E CB    1 
ATOM   4991  C  CG1   . ILE E  1 248 ? -31.896 29.423  -46.256 1.00 28.41  ? 491 ILE E CG1   1 
ATOM   4992  C  CG2   . ILE E  1 248 ? -32.445 27.832  -44.545 1.00 31.49  ? 491 ILE E CG2   1 
ATOM   4993  C  CD1   . ILE E  1 248 ? -33.135 29.364  -47.151 1.00 27.92  ? 491 ILE E CD1   1 
ATOM   4994  N  N     . ILE E  1 249 ? -29.483 26.529  -43.501 1.00 33.55  ? 492 ILE E N     1 
ATOM   4995  C  CA    . ILE E  1 249 ? -29.121 25.271  -42.860 1.00 32.87  ? 492 ILE E CA    1 
ATOM   4996  C  C     . ILE E  1 249 ? -30.060 25.011  -41.667 1.00 28.56  ? 492 ILE E C     1 
ATOM   4997  O  O     . ILE E  1 249 ? -30.383 25.904  -40.904 1.00 26.05  ? 492 ILE E O     1 
ATOM   4998  C  CB    . ILE E  1 249 ? -27.638 25.215  -42.480 1.00 38.56  ? 492 ILE E CB    1 
ATOM   4999  C  CG1   . ILE E  1 249 ? -27.311 23.905  -41.771 1.00 45.51  ? 492 ILE E CG1   1 
ATOM   5000  C  CG2   . ILE E  1 249 ? -27.295 26.339  -41.529 1.00 43.44  ? 492 ILE E CG2   1 
ATOM   5001  C  CD1   . ILE E  1 249 ? -26.202 23.073  -42.390 1.00 53.18  ? 492 ILE E CD1   1 
ATOM   5002  N  N     . VAL E  1 250 ? -30.541 23.786  -41.584 1.00 29.14  ? 493 VAL E N     1 
ATOM   5003  C  CA    . VAL E  1 250 ? -31.458 23.343  -40.517 1.00 27.63  ? 493 VAL E CA    1 
ATOM   5004  C  C     . VAL E  1 250 ? -30.754 22.228  -39.774 1.00 27.64  ? 493 VAL E C     1 
ATOM   5005  O  O     . VAL E  1 250 ? -30.279 21.263  -40.366 1.00 25.20  ? 493 VAL E O     1 
ATOM   5006  C  CB    . VAL E  1 250 ? -32.781 22.838  -41.097 1.00 29.37  ? 493 VAL E CB    1 
ATOM   5007  C  CG1   . VAL E  1 250 ? -33.759 22.399  -39.982 1.00 32.16  ? 493 VAL E CG1   1 
ATOM   5008  C  CG2   . VAL E  1 250 ? -33.464 23.939  -41.902 1.00 29.45  ? 493 VAL E CG2   1 
ATOM   5009  N  N     . VAL E  1 251 ? -30.648 22.385  -38.467 1.00 30.67  ? 494 VAL E N     1 
ATOM   5010  C  CA    . VAL E  1 251 ? -29.892 21.436  -37.656 1.00 29.69  ? 494 VAL E CA    1 
ATOM   5011  C  C     . VAL E  1 251 ? -30.629 21.159  -36.324 1.00 31.79  ? 494 VAL E C     1 
ATOM   5012  O  O     . VAL E  1 251 ? -31.272 22.062  -35.789 1.00 31.75  ? 494 VAL E O     1 
ATOM   5013  C  CB    . VAL E  1 251 ? -28.546 22.060  -37.311 1.00 30.79  ? 494 VAL E CB    1 
ATOM   5014  C  CG1   . VAL E  1 251 ? -27.826 22.544  -38.587 1.00 31.83  ? 494 VAL E CG1   1 
ATOM   5015  C  CG2   . VAL E  1 251 ? -28.763 23.264  -36.405 1.00 29.44  ? 494 VAL E CG2   1 
ATOM   5016  N  N     . PRO E  1 252 ? -30.480 19.937  -35.765 1.00 36.18  ? 495 PRO E N     1 
ATOM   5017  C  CA    . PRO E  1 252 ? -30.987 19.656  -34.412 1.00 40.71  ? 495 PRO E CA    1 
ATOM   5018  C  C     . PRO E  1 252 ? -30.241 20.502  -33.412 1.00 43.54  ? 495 PRO E C     1 
ATOM   5019  O  O     . PRO E  1 252 ? -29.043 20.708  -33.594 1.00 40.64  ? 495 PRO E O     1 
ATOM   5020  C  CB    . PRO E  1 252 ? -30.633 18.178  -34.184 1.00 41.84  ? 495 PRO E CB    1 
ATOM   5021  C  CG    . PRO E  1 252 ? -29.559 17.841  -35.146 1.00 41.66  ? 495 PRO E CG    1 
ATOM   5022  C  CD    . PRO E  1 252 ? -29.533 18.901  -36.231 1.00 38.42  ? 495 PRO E CD    1 
ATOM   5023  N  N     . TYR E  1 253 ? -30.942 20.995  -32.398 1.00 42.21  ? 496 TYR E N     1 
ATOM   5024  C  CA    . TYR E  1 253 ? -30.346 21.736  -31.294 1.00 44.49  ? 496 TYR E CA    1 
ATOM   5025  C  C     . TYR E  1 253 ? -29.100 21.107  -30.675 1.00 46.68  ? 496 TYR E C     1 
ATOM   5026  O  O     . TYR E  1 253 ? -28.232 21.819  -30.237 1.00 52.50  ? 496 TYR E O     1 
ATOM   5027  C  CB    . TYR E  1 253 ? -31.359 21.886  -30.195 1.00 45.93  ? 496 TYR E CB    1 
ATOM   5028  C  CG    . TYR E  1 253 ? -31.246 23.131  -29.379 1.00 44.64  ? 496 TYR E CG    1 
ATOM   5029  C  CD1   . TYR E  1 253 ? -31.426 24.375  -29.967 1.00 44.72  ? 496 TYR E CD1   1 
ATOM   5030  C  CD2   . TYR E  1 253 ? -31.045 23.071  -28.002 1.00 44.43  ? 496 TYR E CD2   1 
ATOM   5031  C  CE1   . TYR E  1 253 ? -31.372 25.530  -29.220 1.00 43.13  ? 496 TYR E CE1   1 
ATOM   5032  C  CE2   . TYR E  1 253 ? -31.018 24.224  -27.240 1.00 44.40  ? 496 TYR E CE2   1 
ATOM   5033  C  CZ    . TYR E  1 253 ? -31.166 25.453  -27.853 1.00 46.35  ? 496 TYR E CZ    1 
ATOM   5034  O  OH    . TYR E  1 253 ? -31.145 26.626  -27.115 1.00 46.37  ? 496 TYR E OH    1 
ATOM   5035  N  N     . SER E  1 254 ? -29.020 19.780  -30.646 1.00 46.31  ? 497 SER E N     1 
ATOM   5036  C  CA    . SER E  1 254 ? -27.868 19.056  -30.065 1.00 46.52  ? 497 SER E CA    1 
ATOM   5037  C  C     . SER E  1 254 ? -26.556 19.146  -30.872 1.00 50.90  ? 497 SER E C     1 
ATOM   5038  O  O     . SER E  1 254 ? -25.462 18.777  -30.373 1.00 41.02  ? 497 SER E O     1 
ATOM   5039  C  CB    . SER E  1 254 ? -28.213 17.572  -29.834 1.00 42.11  ? 497 SER E CB    1 
ATOM   5040  O  OG    . SER E  1 254 ? -28.226 16.790  -31.019 1.00 39.72  ? 497 SER E OG    1 
ATOM   5041  N  N     . GLU E  1 255 ? -26.682 19.591  -32.130 1.00 48.46  ? 498 GLU E N     1 
ATOM   5042  C  CA    . GLU E  1 255 ? -25.543 19.961  -32.955 1.00 40.92  ? 498 GLU E CA    1 
ATOM   5043  C  C     . GLU E  1 255 ? -25.471 21.503  -33.079 1.00 37.57  ? 498 GLU E C     1 
ATOM   5044  O  O     . GLU E  1 255 ? -24.587 22.032  -33.752 1.00 42.03  ? 498 GLU E O     1 
ATOM   5045  C  CB    . GLU E  1 255 ? -25.664 19.288  -34.333 1.00 44.93  ? 498 GLU E CB    1 
ATOM   5046  C  CG    . GLU E  1 255 ? -25.579 17.763  -34.338 1.00 47.15  ? 498 GLU E CG    1 
ATOM   5047  C  CD    . GLU E  1 255 ? -25.630 17.200  -35.748 1.00 51.57  ? 498 GLU E CD    1 
ATOM   5048  O  OE1   . GLU E  1 255 ? -25.906 17.988  -36.653 1.00 58.79  ? 498 GLU E OE1   1 
ATOM   5049  O  OE2   . GLU E  1 255 ? -25.402 15.997  -35.980 1.00 50.21  ? 498 GLU E OE2   1 
ATOM   5050  N  N     . PHE E  1 256 ? -26.362 22.240  -32.409 1.00 32.04  ? 499 PHE E N     1 
ATOM   5051  C  CA    . PHE E  1 256 ? -26.473 23.662  -32.681 1.00 33.22  ? 499 PHE E CA    1 
ATOM   5052  C  C     . PHE E  1 256 ? -25.173 24.432  -32.478 1.00 41.04  ? 499 PHE E C     1 
ATOM   5053  O  O     . PHE E  1 256 ? -24.998 25.535  -33.050 1.00 42.57  ? 499 PHE E O     1 
ATOM   5054  C  CB    . PHE E  1 256 ? -27.520 24.274  -31.779 1.00 30.87  ? 499 PHE E CB    1 
ATOM   5055  C  CG    . PHE E  1 256 ? -27.798 25.739  -32.021 1.00 32.13  ? 499 PHE E CG    1 
ATOM   5056  C  CD1   . PHE E  1 256 ? -28.040 26.230  -33.286 1.00 32.21  ? 499 PHE E CD1   1 
ATOM   5057  C  CD2   . PHE E  1 256 ? -27.927 26.628  -30.948 1.00 34.12  ? 499 PHE E CD2   1 
ATOM   5058  C  CE1   . PHE E  1 256 ? -28.359 27.559  -33.504 1.00 29.94  ? 499 PHE E CE1   1 
ATOM   5059  C  CE2   . PHE E  1 256 ? -28.239 27.976  -31.173 1.00 32.15  ? 499 PHE E CE2   1 
ATOM   5060  C  CZ    . PHE E  1 256 ? -28.442 28.435  -32.457 1.00 31.69  ? 499 PHE E CZ    1 
ATOM   5061  N  N     . ALA E  1 257 ? -24.312 23.915  -31.603 1.00 41.46  ? 500 ALA E N     1 
ATOM   5062  C  CA    . ALA E  1 257 ? -23.227 24.724  -31.107 1.00 45.91  ? 500 ALA E CA    1 
ATOM   5063  C  C     . ALA E  1 257 ? -22.097 24.667  -32.089 1.00 40.14  ? 500 ALA E C     1 
ATOM   5064  O  O     . ALA E  1 257 ? -21.664 25.694  -32.524 1.00 40.15  ? 500 ALA E O     1 
ATOM   5065  C  CB    . ALA E  1 257 ? -22.771 24.256  -29.733 1.00 50.56  ? 500 ALA E CB    1 
ATOM   5066  N  N     . CYS E  1 258 ? -21.651 23.453  -32.413 1.00 39.04  ? 501 CYS E N     1 
ATOM   5067  C  CA    . CYS E  1 258 ? -20.691 23.180  -33.459 1.00 40.03  ? 501 CYS E CA    1 
ATOM   5068  C  C     . CYS E  1 258 ? -21.100 23.661  -34.870 1.00 40.67  ? 501 CYS E C     1 
ATOM   5069  O  O     . CYS E  1 258 ? -20.228 23.826  -35.723 1.00 35.04  ? 501 CYS E O     1 
ATOM   5070  C  CB    . CYS E  1 258 ? -20.431 21.673  -33.541 1.00 46.43  ? 501 CYS E CB    1 
ATOM   5071  S  SG    . CYS E  1 258 ? -19.717 20.948  -32.040 1.00 50.34  ? 501 CYS E SG    1 
ATOM   5072  N  N     . ALA E  1 259 ? -22.404 23.816  -35.114 1.00 39.36  ? 502 ALA E N     1 
ATOM   5073  C  CA    . ALA E  1 259 ? -22.943 24.236  -36.412 1.00 36.96  ? 502 ALA E CA    1 
ATOM   5074  C  C     . ALA E  1 259 ? -22.889 25.742  -36.423 1.00 34.85  ? 502 ALA E C     1 
ATOM   5075  O  O     . ALA E  1 259 ? -22.464 26.358  -37.387 1.00 30.88  ? 502 ALA E O     1 
ATOM   5076  C  CB    . ALA E  1 259 ? -24.396 23.756  -36.586 1.00 36.73  ? 502 ALA E CB    1 
ATOM   5077  N  N     . LEU E  1 260 ? -23.293 26.351  -35.321 1.00 31.56  ? 503 LEU E N     1 
ATOM   5078  C  CA    . LEU E  1 260 ? -23.156 27.806  -35.216 1.00 35.68  ? 503 LEU E CA    1 
ATOM   5079  C  C     . LEU E  1 260 ? -21.706 28.192  -35.408 1.00 37.08  ? 503 LEU E C     1 
ATOM   5080  O  O     . LEU E  1 260 ? -21.381 29.198  -36.032 1.00 40.13  ? 503 LEU E O     1 
ATOM   5081  C  CB    . LEU E  1 260 ? -23.461 28.276  -33.817 1.00 35.74  ? 503 LEU E CB    1 
ATOM   5082  C  CG    . LEU E  1 260 ? -24.460 29.374  -33.614 1.00 36.85  ? 503 LEU E CG    1 
ATOM   5083  C  CD1   . LEU E  1 260 ? -24.362 29.733  -32.132 1.00 38.01  ? 503 LEU E CD1   1 
ATOM   5084  C  CD2   . LEU E  1 260 ? -24.230 30.576  -34.503 1.00 38.77  ? 503 LEU E CD2   1 
ATOM   5085  N  N     . LEU E  1 261 ? -20.838 27.410  -34.794 1.00 33.94  ? 504 LEU E N     1 
ATOM   5086  C  CA    . LEU E  1 261 ? -19.453 27.810  -34.686 1.00 41.59  ? 504 LEU E CA    1 
ATOM   5087  C  C     . LEU E  1 261 ? -18.906 27.738  -36.108 1.00 36.08  ? 504 LEU E C     1 
ATOM   5088  O  O     . LEU E  1 261 ? -18.400 28.705  -36.601 1.00 36.47  ? 504 LEU E O     1 
ATOM   5089  C  CB    . LEU E  1 261 ? -18.731 26.883  -33.699 1.00 41.88  ? 504 LEU E CB    1 
ATOM   5090  C  CG    . LEU E  1 261 ? -17.260 27.002  -33.256 1.00 49.08  ? 504 LEU E CG    1 
ATOM   5091  C  CD1   . LEU E  1 261 ? -16.327 26.552  -34.368 1.00 56.02  ? 504 LEU E CD1   1 
ATOM   5092  C  CD2   . LEU E  1 261 ? -16.905 28.395  -32.729 1.00 47.01  ? 504 LEU E CD2   1 
ATOM   5093  N  N     . TYR E  1 262 ? -19.084 26.582  -36.743 1.00 35.79  ? 505 TYR E N     1 
ATOM   5094  C  CA    . TYR E  1 262 ? -18.794 26.353  -38.156 1.00 35.49  ? 505 TYR E CA    1 
ATOM   5095  C  C     . TYR E  1 262 ? -19.284 27.446  -39.090 1.00 31.94  ? 505 TYR E C     1 
ATOM   5096  O  O     . TYR E  1 262 ? -18.518 27.966  -39.887 1.00 33.02  ? 505 TYR E O     1 
ATOM   5097  C  CB    . TYR E  1 262 ? -19.383 25.019  -38.560 1.00 35.94  ? 505 TYR E CB    1 
ATOM   5098  C  CG    . TYR E  1 262 ? -19.336 24.714  -40.037 1.00 38.98  ? 505 TYR E CG    1 
ATOM   5099  C  CD1   . TYR E  1 262 ? -18.123 24.461  -40.683 1.00 39.30  ? 505 TYR E CD1   1 
ATOM   5100  C  CD2   . TYR E  1 262 ? -20.489 24.623  -40.772 1.00 36.76  ? 505 TYR E CD2   1 
ATOM   5101  C  CE1   . TYR E  1 262 ? -18.072 24.139  -42.025 1.00 38.89  ? 505 TYR E CE1   1 
ATOM   5102  C  CE2   . TYR E  1 262 ? -20.445 24.298  -42.125 1.00 41.56  ? 505 TYR E CE2   1 
ATOM   5103  C  CZ    . TYR E  1 262 ? -19.226 24.053  -42.735 1.00 43.51  ? 505 TYR E CZ    1 
ATOM   5104  O  OH    . TYR E  1 262 ? -19.183 23.748  -44.084 1.00 49.61  ? 505 TYR E OH    1 
ATOM   5105  N  N     . PHE E  1 263 ? -20.532 27.846  -38.964 1.00 31.51  ? 506 PHE E N     1 
ATOM   5106  C  CA    . PHE E  1 263 ? -21.092 28.804  -39.923 1.00 30.70  ? 506 PHE E CA    1 
ATOM   5107  C  C     . PHE E  1 263 ? -20.788 30.214  -39.658 1.00 30.59  ? 506 PHE E C     1 
ATOM   5108  O  O     . PHE E  1 263 ? -20.878 31.050  -40.560 1.00 28.31  ? 506 PHE E O     1 
ATOM   5109  C  CB    . PHE E  1 263 ? -22.590 28.633  -40.036 1.00 35.17  ? 506 PHE E CB    1 
ATOM   5110  C  CG    . PHE E  1 263 ? -22.933 27.442  -40.823 1.00 37.90  ? 506 PHE E CG    1 
ATOM   5111  C  CD1   . PHE E  1 263 ? -22.637 27.413  -42.184 1.00 36.24  ? 506 PHE E CD1   1 
ATOM   5112  C  CD2   . PHE E  1 263 ? -23.439 26.302  -40.214 1.00 41.67  ? 506 PHE E CD2   1 
ATOM   5113  C  CE1   . PHE E  1 263 ? -22.903 26.289  -42.946 1.00 40.11  ? 506 PHE E CE1   1 
ATOM   5114  C  CE2   . PHE E  1 263 ? -23.723 25.167  -40.971 1.00 43.25  ? 506 PHE E CE2   1 
ATOM   5115  C  CZ    . PHE E  1 263 ? -23.439 25.160  -42.346 1.00 41.73  ? 506 PHE E CZ    1 
ATOM   5116  N  N     . THR E  1 264 ? -20.425 30.504  -38.415 1.00 31.52  ? 507 THR E N     1 
ATOM   5117  C  CA    . THR E  1 264 ? -19.923 31.816  -38.088 1.00 30.30  ? 507 THR E CA    1 
ATOM   5118  C  C     . THR E  1 264 ? -18.506 31.973  -38.711 1.00 31.47  ? 507 THR E C     1 
ATOM   5119  O  O     . THR E  1 264 ? -18.149 33.059  -39.157 1.00 27.67  ? 507 THR E O     1 
ATOM   5120  C  CB    . THR E  1 264 ? -19.946 32.069  -36.562 1.00 33.91  ? 507 THR E CB    1 
ATOM   5121  O  OG1   . THR E  1 264 ? -21.229 31.674  -36.020 1.00 31.90  ? 507 THR E OG1   1 
ATOM   5122  C  CG2   . THR E  1 264 ? -19.699 33.584  -36.251 1.00 30.19  ? 507 THR E CG2   1 
ATOM   5123  N  N     . GLY E  1 265 ? -17.728 30.897  -38.768 1.00 29.49  ? 508 GLY E N     1 
ATOM   5124  C  CA    . GLY E  1 265 ? -16.381 30.978  -39.306 1.00 32.55  ? 508 GLY E CA    1 
ATOM   5125  C  C     . GLY E  1 265 ? -15.439 31.857  -38.492 1.00 34.94  ? 508 GLY E C     1 
ATOM   5126  O  O     . GLY E  1 265 ? -15.783 32.226  -37.365 1.00 30.95  ? 508 GLY E O     1 
ATOM   5127  N  N     . SER E  1 266 ? -14.283 32.271  -39.045 1.00 35.68  ? 509 SER E N     1 
ATOM   5128  C  CA    . SER E  1 266 ? -13.990 32.282  -40.470 1.00 36.11  ? 509 SER E CA    1 
ATOM   5129  C  C     . SER E  1 266 ? -13.623 30.921  -40.904 1.00 40.30  ? 509 SER E C     1 
ATOM   5130  O  O     . SER E  1 266 ? -13.330 30.047  -40.072 1.00 45.07  ? 509 SER E O     1 
ATOM   5131  C  CB    . SER E  1 266 ? -12.774 33.183  -40.770 1.00 37.82  ? 509 SER E CB    1 
ATOM   5132  O  OG    . SER E  1 266 ? -11.554 32.477  -40.458 1.00 39.17  ? 509 SER E OG    1 
ATOM   5133  N  N     . ALA E  1 267 ? -13.552 30.751  -42.217 1.00 38.15  ? 510 ALA E N     1 
ATOM   5134  C  CA    . ALA E  1 267 ? -13.075 29.510  -42.756 1.00 38.38  ? 510 ALA E CA    1 
ATOM   5135  C  C     . ALA E  1 267 ? -11.711 29.141  -42.160 1.00 39.37  ? 510 ALA E C     1 
ATOM   5136  O  O     . ALA E  1 267 ? -11.478 27.957  -41.861 1.00 38.09  ? 510 ALA E O     1 
ATOM   5137  C  CB    . ALA E  1 267 ? -13.009 29.565  -44.278 1.00 36.05  ? 510 ALA E CB    1 
ATOM   5138  N  N     . HIS E  1 268 ? -10.797 30.098  -42.009 1.00 40.39  ? 511 HIS E N     1 
ATOM   5139  C  CA    . HIS E  1 268 ? -9.425  29.686  -41.616 1.00 47.03  ? 511 HIS E CA    1 
ATOM   5140  C  C     . HIS E  1 268 ? -9.407  29.377  -40.132 1.00 45.93  ? 511 HIS E C     1 
ATOM   5141  O  O     . HIS E  1 268 ? -8.830  28.355  -39.728 1.00 39.48  ? 511 HIS E O     1 
ATOM   5142  C  CB    . HIS E  1 268 ? -8.328  30.664  -42.047 1.00 50.02  ? 511 HIS E CB    1 
ATOM   5143  C  CG    . HIS E  1 268 ? -7.831  30.397  -43.436 1.00 58.10  ? 511 HIS E CG    1 
ATOM   5144  N  ND1   . HIS E  1 268 ? -8.124  31.221  -44.506 1.00 61.01  ? 511 HIS E ND1   1 
ATOM   5145  C  CD2   . HIS E  1 268 ? -7.123  29.355  -43.943 1.00 58.38  ? 511 HIS E CD2   1 
ATOM   5146  C  CE1   . HIS E  1 268 ? -7.591  30.712  -45.606 1.00 62.68  ? 511 HIS E CE1   1 
ATOM   5147  N  NE2   . HIS E  1 268 ? -6.982  29.580  -45.291 1.00 62.46  ? 511 HIS E NE2   1 
ATOM   5148  N  N     . PHE E  1 269 ? -10.096 30.223  -39.367 1.00 42.35  ? 512 PHE E N     1 
ATOM   5149  C  CA    . PHE E  1 269 ? -10.495 29.896  -38.005 1.00 48.80  ? 512 PHE E CA    1 
ATOM   5150  C  C     . PHE E  1 269 ? -10.936 28.410  -37.844 1.00 49.76  ? 512 PHE E C     1 
ATOM   5151  O  O     . PHE E  1 269 ? -10.339 27.660  -37.095 1.00 49.39  ? 512 PHE E O     1 
ATOM   5152  C  CB    . PHE E  1 269 ? -11.584 30.850  -37.555 1.00 48.15  ? 512 PHE E CB    1 
ATOM   5153  C  CG    . PHE E  1 269 ? -11.847 30.792  -36.097 1.00 57.05  ? 512 PHE E CG    1 
ATOM   5154  C  CD1   . PHE E  1 269 ? -11.083 31.528  -35.219 1.00 60.92  ? 512 PHE E CD1   1 
ATOM   5155  C  CD2   . PHE E  1 269 ? -12.844 29.975  -35.589 1.00 61.91  ? 512 PHE E CD2   1 
ATOM   5156  C  CE1   . PHE E  1 269 ? -11.303 31.464  -33.858 1.00 60.26  ? 512 PHE E CE1   1 
ATOM   5157  C  CE2   . PHE E  1 269 ? -13.065 29.892  -34.221 1.00 62.06  ? 512 PHE E CE2   1 
ATOM   5158  C  CZ    . PHE E  1 269 ? -12.294 30.643  -33.355 1.00 62.60  ? 512 PHE E CZ    1 
ATOM   5159  N  N     . ASN E  1 270 ? -11.936 27.957  -38.580 1.00 47.86  ? 513 ASN E N     1 
ATOM   5160  C  CA    . ASN E  1 270 ? -12.355 26.567  -38.465 1.00 48.52  ? 513 ASN E CA    1 
ATOM   5161  C  C     . ASN E  1 270 ? -11.310 25.514  -38.811 1.00 51.42  ? 513 ASN E C     1 
ATOM   5162  O  O     . ASN E  1 270 ? -11.359 24.390  -38.294 1.00 50.21  ? 513 ASN E O     1 
ATOM   5163  C  CB    . ASN E  1 270 ? -13.576 26.297  -39.342 1.00 49.79  ? 513 ASN E CB    1 
ATOM   5164  C  CG    . ASN E  1 270 ? -14.746 27.162  -38.973 1.00 46.24  ? 513 ASN E CG    1 
ATOM   5165  O  OD1   . ASN E  1 270 ? -14.721 27.845  -37.959 1.00 45.92  ? 513 ASN E OD1   1 
ATOM   5166  N  ND2   . ASN E  1 270 ? -15.772 27.167  -39.823 1.00 45.32  ? 513 ASN E ND2   1 
ATOM   5167  N  N     . ARG E  1 271 ? -10.420 25.834  -39.738 1.00 53.42  ? 514 ARG E N     1 
ATOM   5168  C  CA    . ARG E  1 271 ? -9.366  24.901  -40.127 1.00 52.36  ? 514 ARG E CA    1 
ATOM   5169  C  C     . ARG E  1 271 ? -8.361  24.766  -39.027 1.00 49.63  ? 514 ARG E C     1 
ATOM   5170  O  O     . ARG E  1 271 ? -7.782  23.693  -38.846 1.00 47.18  ? 514 ARG E O     1 
ATOM   5171  C  CB    . ARG E  1 271 ? -8.606  25.360  -41.350 1.00 54.12  ? 514 ARG E CB    1 
ATOM   5172  C  CG    . ARG E  1 271 ? -9.249  24.984  -42.672 1.00 59.68  ? 514 ARG E CG    1 
ATOM   5173  C  CD    . ARG E  1 271 ? -8.150  24.740  -43.700 1.00 59.53  ? 514 ARG E CD    1 
ATOM   5174  N  NE    . ARG E  1 271 ? -8.349  25.469  -44.935 1.00 58.31  ? 514 ARG E NE    1 
ATOM   5175  C  CZ    . ARG E  1 271 ? -7.951  25.039  -46.136 1.00 63.05  ? 514 ARG E CZ    1 
ATOM   5176  N  NH1   . ARG E  1 271 ? -7.325  23.855  -46.294 1.00 53.53  ? 514 ARG E NH1   1 
ATOM   5177  N  NH2   . ARG E  1 271 ? -8.201  25.797  -47.209 1.00 62.57  ? 514 ARG E NH2   1 
ATOM   5178  N  N     . SER E  1 272 ? -8.123  25.860  -38.318 1.00 44.62  ? 515 SER E N     1 
ATOM   5179  C  CA    . SER E  1 272 ? -7.185  25.813  -37.240 1.00 51.31  ? 515 SER E CA    1 
ATOM   5180  C  C     . SER E  1 272 ? -7.737  24.840  -36.166 1.00 53.62  ? 515 SER E C     1 
ATOM   5181  O  O     . SER E  1 272 ? -7.088  23.850  -35.800 1.00 48.21  ? 515 SER E O     1 
ATOM   5182  C  CB    . SER E  1 272 ? -6.898  27.226  -36.703 1.00 52.91  ? 515 SER E CB    1 
ATOM   5183  O  OG    . SER E  1 272 ? -6.230  28.019  -37.681 1.00 50.07  ? 515 SER E OG    1 
ATOM   5184  N  N     . MET E  1 273 ? -8.970  25.092  -35.734 1.00 55.58  ? 516 MET E N     1 
ATOM   5185  C  CA    . MET E  1 273 ? -9.638  24.269  -34.720 1.00 49.17  ? 516 MET E CA    1 
ATOM   5186  C  C     . MET E  1 273 ? -9.536  22.790  -35.120 1.00 50.99  ? 516 MET E C     1 
ATOM   5187  O  O     . MET E  1 273 ? -8.844  21.964  -34.468 1.00 40.55  ? 516 MET E O     1 
ATOM   5188  C  CB    . MET E  1 273 ? -11.067 24.717  -34.623 1.00 50.39  ? 516 MET E CB    1 
ATOM   5189  C  CG    . MET E  1 273 ? -11.204 26.223  -34.416 1.00 53.21  ? 516 MET E CG    1 
ATOM   5190  S  SD    . MET E  1 273 ? -11.394 26.761  -32.717 1.00 57.11  ? 516 MET E SD    1 
ATOM   5191  C  CE    . MET E  1 273 ? -12.894 25.882  -32.256 1.00 56.34  ? 516 MET E CE    1 
ATOM   5192  N  N     . ARG E  1 274 ? -10.129 22.470  -36.260 1.00 47.51  ? 517 ARG E N     1 
ATOM   5193  C  CA    . ARG E  1 274 ? -10.162 21.084  -36.701 1.00 57.61  ? 517 ARG E CA    1 
ATOM   5194  C  C     . ARG E  1 274 ? -8.780  20.413  -36.612 1.00 59.47  ? 517 ARG E C     1 
ATOM   5195  O  O     . ARG E  1 274 ? -8.683  19.227  -36.245 1.00 53.72  ? 517 ARG E O     1 
ATOM   5196  C  CB    . ARG E  1 274 ? -10.783 20.974  -38.101 1.00 55.54  ? 517 ARG E CB    1 
ATOM   5197  C  CG    . ARG E  1 274 ? -12.251 21.329  -38.058 1.00 54.27  ? 517 ARG E CG    1 
ATOM   5198  C  CD    . ARG E  1 274 ? -12.962 21.137  -39.376 1.00 56.93  ? 517 ARG E CD    1 
ATOM   5199  N  NE    . ARG E  1 274 ? -14.362 21.516  -39.209 1.00 56.13  ? 517 ARG E NE    1 
ATOM   5200  C  CZ    . ARG E  1 274 ? -15.360 21.140  -40.007 1.00 55.45  ? 517 ARG E CZ    1 
ATOM   5201  N  NH1   . ARG E  1 274 ? -15.157 20.377  -41.094 1.00 52.74  ? 517 ARG E NH1   1 
ATOM   5202  N  NH2   . ARG E  1 274 ? -16.582 21.548  -39.700 1.00 54.56  ? 517 ARG E NH2   1 
ATOM   5203  N  N     . ALA E  1 275 ? -7.734  21.193  -36.905 1.00 59.90  ? 518 ALA E N     1 
ATOM   5204  C  CA    . ALA E  1 275 ? -6.349  20.735  -36.847 1.00 58.65  ? 518 ALA E CA    1 
ATOM   5205  C  C     . ALA E  1 275 ? -5.836  20.562  -35.407 1.00 62.33  ? 518 ALA E C     1 
ATOM   5206  O  O     . ALA E  1 275 ? -5.187  19.549  -35.084 1.00 63.71  ? 518 ALA E O     1 
ATOM   5207  C  CB    . ALA E  1 275 ? -5.462  21.688  -37.611 1.00 59.58  ? 518 ALA E CB    1 
ATOM   5208  N  N     . LEU E  1 276 ? -6.129  21.549  -34.562 1.00 54.18  ? 519 LEU E N     1 
ATOM   5209  C  CA    . LEU E  1 276 ? -5.866  21.480  -33.120 1.00 50.37  ? 519 LEU E CA    1 
ATOM   5210  C  C     . LEU E  1 276 ? -6.510  20.223  -32.446 1.00 53.73  ? 519 LEU E C     1 
ATOM   5211  O  O     . LEU E  1 276 ? -5.840  19.485  -31.703 1.00 53.56  ? 519 LEU E O     1 
ATOM   5212  C  CB    . LEU E  1 276 ? -6.366  22.787  -32.490 1.00 49.95  ? 519 LEU E CB    1 
ATOM   5213  C  CG    . LEU E  1 276 ? -6.151  23.011  -31.000 1.00 50.66  ? 519 LEU E CG    1 
ATOM   5214  C  CD1   . LEU E  1 276 ? -6.315  24.485  -30.678 1.00 52.47  ? 519 LEU E CD1   1 
ATOM   5215  C  CD2   . LEU E  1 276 ? -7.127  22.195  -30.183 1.00 52.86  ? 519 LEU E CD2   1 
ATOM   5216  N  N     . ALA E  1 277 ? -7.793  19.985  -32.722 1.00 49.31  ? 520 ALA E N     1 
ATOM   5217  C  CA    . ALA E  1 277 ? -8.500  18.785  -32.245 1.00 54.16  ? 520 ALA E CA    1 
ATOM   5218  C  C     . ALA E  1 277 ? -7.852  17.498  -32.693 1.00 58.59  ? 520 ALA E C     1 
ATOM   5219  O  O     . ALA E  1 277 ? -7.773  16.537  -31.930 1.00 71.53  ? 520 ALA E O     1 
ATOM   5220  C  CB    . ALA E  1 277 ? -9.950  18.773  -32.714 1.00 52.90  ? 520 ALA E CB    1 
ATOM   5221  N  N     . LYS E  1 278 ? -7.419  17.454  -33.941 1.00 58.31  ? 521 LYS E N     1 
ATOM   5222  C  CA    . LYS E  1 278 ? -6.846  16.234  -34.474 1.00 59.77  ? 521 LYS E CA    1 
ATOM   5223  C  C     . LYS E  1 278 ? -5.539  15.871  -33.751 1.00 64.21  ? 521 LYS E C     1 
ATOM   5224  O  O     . LYS E  1 278 ? -5.259  14.670  -33.511 1.00 57.22  ? 521 LYS E O     1 
ATOM   5225  C  CB    . LYS E  1 278 ? -6.623  16.355  -35.974 1.00 64.85  ? 521 LYS E CB    1 
ATOM   5226  C  CG    . LYS E  1 278 ? -6.649  15.015  -36.685 1.00 67.87  ? 521 LYS E CG    1 
ATOM   5227  C  CD    . LYS E  1 278 ? -6.543  15.186  -38.187 1.00 69.33  ? 521 LYS E CD    1 
ATOM   5228  C  CE    . LYS E  1 278 ? -5.194  15.766  -38.568 1.00 72.16  ? 521 LYS E CE    1 
ATOM   5229  N  NZ    . LYS E  1 278 ? -4.635  14.948  -39.658 1.00 74.31  ? 521 LYS E NZ    1 
ATOM   5230  N  N     . THR E  1 279 ? -4.772  16.915  -33.391 1.00 66.86  ? 522 THR E N     1 
ATOM   5231  C  CA    . THR E  1 279 ? -3.560  16.779  -32.562 1.00 63.63  ? 522 THR E CA    1 
ATOM   5232  C  C     . THR E  1 279 ? -3.878  16.068  -31.236 1.00 64.96  ? 522 THR E C     1 
ATOM   5233  O  O     . THR E  1 279 ? -3.080  15.243  -30.779 1.00 67.27  ? 522 THR E O     1 
ATOM   5234  C  CB    . THR E  1 279 ? -2.824  18.144  -32.285 1.00 61.16  ? 522 THR E CB    1 
ATOM   5235  O  OG1   . THR E  1 279 ? -3.586  18.988  -31.395 1.00 56.02  ? 522 THR E OG1   1 
ATOM   5236  C  CG2   . THR E  1 279 ? -2.508  18.897  -33.602 1.00 58.26  ? 522 THR E CG2   1 
ATOM   5237  N  N     . LYS E  1 280 ? -5.051  16.362  -30.663 1.00 59.41  ? 523 LYS E N     1 
ATOM   5238  C  CA    . LYS E  1 280 ? -5.463  15.850  -29.347 1.00 53.40  ? 523 LYS E CA    1 
ATOM   5239  C  C     . LYS E  1 280 ? -6.347  14.609  -29.422 1.00 52.08  ? 523 LYS E C     1 
ATOM   5240  O  O     . LYS E  1 280 ? -7.279  14.494  -28.642 1.00 52.40  ? 523 LYS E O     1 
ATOM   5241  C  CB    . LYS E  1 280 ? -6.247  16.938  -28.613 1.00 51.70  ? 523 LYS E CB    1 
ATOM   5242  C  CG    . LYS E  1 280 ? -5.540  18.273  -28.599 1.00 51.79  ? 523 LYS E CG    1 
ATOM   5243  C  CD    . LYS E  1 280 ? -6.290  19.267  -27.755 1.00 52.39  ? 523 LYS E CD    1 
ATOM   5244  C  CE    . LYS E  1 280 ? -5.417  20.476  -27.483 1.00 57.31  ? 523 LYS E CE    1 
ATOM   5245  N  NZ    . LYS E  1 280 ? -5.942  21.255  -26.329 1.00 57.00  ? 523 LYS E NZ    1 
ATOM   5246  N  N     . GLY E  1 281 ? -6.071  13.693  -30.362 1.00 56.58  ? 524 GLY E N     1 
ATOM   5247  C  CA    . GLY E  1 281 ? -6.910  12.490  -30.607 1.00 56.01  ? 524 GLY E CA    1 
ATOM   5248  C  C     . GLY E  1 281 ? -8.411  12.716  -30.785 1.00 57.65  ? 524 GLY E C     1 
ATOM   5249  O  O     . GLY E  1 281 ? -9.210  11.766  -30.738 1.00 54.00  ? 524 GLY E O     1 
ATOM   5250  N  N     . MET E  1 282 ? -8.778  13.982  -30.984 1.00 61.14  ? 525 MET E N     1 
ATOM   5251  C  CA    . MET E  1 282 ? -10.171 14.426  -31.078 1.00 64.47  ? 525 MET E CA    1 
ATOM   5252  C  C     . MET E  1 282 ? -10.498 14.670  -32.559 1.00 65.26  ? 525 MET E C     1 
ATOM   5253  O  O     . MET E  1 282 ? -9.655  14.445  -33.439 1.00 59.05  ? 525 MET E O     1 
ATOM   5254  C  CB    . MET E  1 282 ? -10.385 15.730  -30.276 1.00 60.79  ? 525 MET E CB    1 
ATOM   5255  C  CG    . MET E  1 282 ? -10.053 15.623  -28.804 1.00 58.89  ? 525 MET E CG    1 
ATOM   5256  S  SD    . MET E  1 282 ? -10.748 16.954  -27.803 1.00 64.29  ? 525 MET E SD    1 
ATOM   5257  C  CE    . MET E  1 282 ? -9.315  18.006  -27.728 1.00 69.86  ? 525 MET E CE    1 
ATOM   5258  N  N     . SER E  1 283 ? -11.721 15.116  -32.838 1.00 66.30  ? 526 SER E N     1 
ATOM   5259  C  CA    . SER E  1 283 ? -12.145 15.360  -34.220 1.00 58.45  ? 526 SER E CA    1 
ATOM   5260  C  C     . SER E  1 283 ? -13.333 16.271  -34.260 1.00 51.34  ? 526 SER E C     1 
ATOM   5261  O  O     . SER E  1 283 ? -14.373 15.959  -33.703 1.00 53.93  ? 526 SER E O     1 
ATOM   5262  C  CB    . SER E  1 283 ? -12.498 14.054  -34.914 1.00 57.66  ? 526 SER E CB    1 
ATOM   5263  O  OG    . SER E  1 283 ? -12.555 14.262  -36.310 1.00 60.75  ? 526 SER E OG    1 
ATOM   5264  N  N     . LEU E  1 284 ? -13.174 17.416  -34.906 1.00 51.43  ? 527 LEU E N     1 
ATOM   5265  C  CA    . LEU E  1 284 ? -14.226 18.418  -34.919 1.00 46.77  ? 527 LEU E CA    1 
ATOM   5266  C  C     . LEU E  1 284 ? -14.789 18.647  -36.335 1.00 52.88  ? 527 LEU E C     1 
ATOM   5267  O  O     . LEU E  1 284 ? -14.044 18.738  -37.372 1.00 48.46  ? 527 LEU E O     1 
ATOM   5268  C  CB    . LEU E  1 284 ? -13.731 19.715  -34.303 1.00 43.32  ? 527 LEU E CB    1 
ATOM   5269  C  CG    . LEU E  1 284 ? -14.662 20.894  -34.464 1.00 46.48  ? 527 LEU E CG    1 
ATOM   5270  C  CD1   . LEU E  1 284 ? -15.978 20.643  -33.742 1.00 53.49  ? 527 LEU E CD1   1 
ATOM   5271  C  CD2   . LEU E  1 284 ? -13.990 22.145  -33.936 1.00 43.50  ? 527 LEU E CD2   1 
ATOM   5272  N  N     . SER E  1 285 ? -16.125 18.706  -36.342 1.00 51.56  ? 528 SER E N     1 
ATOM   5273  C  CA    . SER E  1 285 ? -16.942 18.814  -37.536 1.00 46.38  ? 528 SER E CA    1 
ATOM   5274  C  C     . SER E  1 285 ? -18.136 19.680  -37.198 1.00 42.04  ? 528 SER E C     1 
ATOM   5275  O  O     . SER E  1 285 ? -18.257 20.134  -36.067 1.00 41.06  ? 528 SER E O     1 
ATOM   5276  C  CB    . SER E  1 285 ? -17.331 17.410  -38.078 1.00 50.69  ? 528 SER E CB    1 
ATOM   5277  O  OG    . SER E  1 285 ? -18.433 16.790  -37.413 1.00 49.34  ? 528 SER E OG    1 
ATOM   5278  N  N     . GLU E  1 286 ? -18.972 19.968  -38.198 1.00 39.21  ? 529 GLU E N     1 
ATOM   5279  C  CA    . GLU E  1 286 ? -20.116 20.877  -38.014 1.00 41.01  ? 529 GLU E CA    1 
ATOM   5280  C  C     . GLU E  1 286 ? -21.221 20.207  -37.199 1.00 37.75  ? 529 GLU E C     1 
ATOM   5281  O  O     . GLU E  1 286 ? -22.117 20.890  -36.734 1.00 39.55  ? 529 GLU E O     1 
ATOM   5282  C  CB    . GLU E  1 286 ? -20.694 21.377  -39.361 1.00 43.30  ? 529 GLU E CB    1 
ATOM   5283  C  CG    . GLU E  1 286 ? -20.889 20.322  -40.449 1.00 42.96  ? 529 GLU E CG    1 
ATOM   5284  C  CD    . GLU E  1 286 ? -19.669 20.094  -41.359 1.00 48.23  ? 529 GLU E CD    1 
ATOM   5285  O  OE1   . GLU E  1 286 ? -18.556 19.751  -40.899 1.00 54.14  ? 529 GLU E OE1   1 
ATOM   5286  O  OE2   . GLU E  1 286 ? -19.811 20.219  -42.596 1.00 57.17  ? 529 GLU E OE2   1 
ATOM   5287  N  N     . HIS E  1 287 ? -21.141 18.881  -37.043 1.00 41.33  ? 530 HIS E N     1 
ATOM   5288  C  CA    . HIS E  1 287 ? -22.077 18.118  -36.193 1.00 46.57  ? 530 HIS E CA    1 
ATOM   5289  C  C     . HIS E  1 287 ? -21.740 18.189  -34.710 1.00 50.53  ? 530 HIS E C     1 
ATOM   5290  O  O     . HIS E  1 287 ? -22.590 18.576  -33.906 1.00 50.36  ? 530 HIS E O     1 
ATOM   5291  C  CB    . HIS E  1 287 ? -22.109 16.679  -36.632 1.00 43.67  ? 530 HIS E CB    1 
ATOM   5292  C  CG    . HIS E  1 287 ? -22.534 16.527  -38.042 1.00 48.34  ? 530 HIS E CG    1 
ATOM   5293  N  ND1   . HIS E  1 287 ? -23.633 17.184  -38.544 1.00 50.53  ? 530 HIS E ND1   1 
ATOM   5294  C  CD2   . HIS E  1 287 ? -21.999 15.836  -39.073 1.00 50.57  ? 530 HIS E CD2   1 
ATOM   5295  C  CE1   . HIS E  1 287 ? -23.764 16.887  -39.824 1.00 52.29  ? 530 HIS E CE1   1 
ATOM   5296  N  NE2   . HIS E  1 287 ? -22.787 16.072  -40.170 1.00 48.63  ? 530 HIS E NE2   1 
ATOM   5297  N  N     . ALA E  1 288 ? -20.504 17.806  -34.363 1.00 58.65  ? 531 ALA E N     1 
ATOM   5298  C  CA    . ALA E  1 288 ? -19.959 18.046  -33.020 1.00 61.02  ? 531 ALA E CA    1 
ATOM   5299  C  C     . ALA E  1 288 ? -18.483 17.631  -32.816 1.00 64.86  ? 531 ALA E C     1 
ATOM   5300  O  O     . ALA E  1 288 ? -17.826 17.054  -33.686 1.00 54.50  ? 531 ALA E O     1 
ATOM   5301  C  CB    . ALA E  1 288 ? -20.851 17.427  -31.936 1.00 58.66  ? 531 ALA E CB    1 
ATOM   5302  N  N     . LEU E  1 289 ? -17.984 17.992  -31.640 1.00 67.81  ? 532 LEU E N     1 
ATOM   5303  C  CA    . LEU E  1 289 ? -16.683 17.583  -31.159 1.00 60.56  ? 532 LEU E CA    1 
ATOM   5304  C  C     . LEU E  1 289 ? -16.724 16.130  -30.704 1.00 59.50  ? 532 LEU E C     1 
ATOM   5305  O  O     . LEU E  1 289 ? -17.728 15.701  -30.147 1.00 61.90  ? 532 LEU E O     1 
ATOM   5306  C  CB    . LEU E  1 289 ? -16.352 18.482  -29.985 1.00 61.67  ? 532 LEU E CB    1 
ATOM   5307  C  CG    . LEU E  1 289 ? -14.928 18.433  -29.446 1.00 64.82  ? 532 LEU E CG    1 
ATOM   5308  C  CD1   . LEU E  1 289 ? -13.900 18.407  -30.580 1.00 63.82  ? 532 LEU E CD1   1 
ATOM   5309  C  CD2   . LEU E  1 289 ? -14.739 19.629  -28.508 1.00 60.29  ? 532 LEU E CD2   1 
ATOM   5310  N  N     . SER E  1 290 ? -15.663 15.366  -30.951 1.00 57.77  ? 533 SER E N     1 
ATOM   5311  C  CA    . SER E  1 290 ? -15.589 13.996  -30.456 1.00 60.03  ? 533 SER E CA    1 
ATOM   5312  C  C     . SER E  1 290 ? -14.161 13.552  -30.081 1.00 66.78  ? 533 SER E C     1 
ATOM   5313  O  O     . SER E  1 290 ? -13.185 14.079  -30.612 1.00 61.78  ? 533 SER E O     1 
ATOM   5314  C  CB    . SER E  1 290 ? -16.171 13.055  -31.497 1.00 59.08  ? 533 SER E CB    1 
ATOM   5315  O  OG    . SER E  1 290 ? -15.195 12.686  -32.437 1.00 61.62  ? 533 SER E OG    1 
ATOM   5316  N  N     . THR E  1 291 ? -14.064 12.565  -29.181 1.00 77.35  ? 534 THR E N     1 
ATOM   5317  C  CA    . THR E  1 291 ? -12.773 12.013  -28.690 1.00 79.00  ? 534 THR E CA    1 
ATOM   5318  C  C     . THR E  1 291 ? -12.455 10.630  -29.305 1.00 86.20  ? 534 THR E C     1 
ATOM   5319  O  O     . THR E  1 291 ? -13.163 10.174  -30.198 1.00 91.15  ? 534 THR E O     1 
ATOM   5320  C  CB    . THR E  1 291 ? -12.771 11.876  -27.148 1.00 73.93  ? 534 THR E CB    1 
ATOM   5321  O  OG1   . THR E  1 291 ? -13.858 12.622  -26.597 1.00 71.97  ? 534 THR E OG1   1 
ATOM   5322  C  CG2   . THR E  1 291 ? -11.439 12.375  -26.546 1.00 69.24  ? 534 THR E CG2   1 
ATOM   5323  N  N     . ALA E  1 292 ? -11.389 9.980   -28.821 1.00 87.98  ? 535 ALA E N     1 
ATOM   5324  C  CA    . ALA E  1 292 ? -10.879 8.695   -29.345 1.00 81.18  ? 535 ALA E CA    1 
ATOM   5325  C  C     . ALA E  1 292 ? -10.636 8.725   -30.864 1.00 78.89  ? 535 ALA E C     1 
ATOM   5326  O  O     . ALA E  1 292 ? -9.639  9.259   -31.325 1.00 80.67  ? 535 ALA E O     1 
ATOM   5327  C  CB    . ALA E  1 292 ? -11.797 7.548   -28.942 1.00 78.76  ? 535 ALA E CB    1 
ATOM   5328  N  N     . VAL E  1 293 ? -11.556 8.150   -31.625 1.00 83.44  ? 536 VAL E N     1 
ATOM   5329  C  CA    . VAL E  1 293 ? -11.541 8.137   -33.095 1.00 84.95  ? 536 VAL E CA    1 
ATOM   5330  C  C     . VAL E  1 293 ? -10.521 7.123   -33.653 1.00 88.22  ? 536 VAL E C     1 
ATOM   5331  O  O     . VAL E  1 293 ? -10.853 6.373   -34.572 1.00 85.03  ? 536 VAL E O     1 
ATOM   5332  C  CB    . VAL E  1 293 ? -11.420 9.556   -33.751 1.00 77.16  ? 536 VAL E CB    1 
ATOM   5333  C  CG1   . VAL E  1 293 ? -12.063 10.645  -32.890 1.00 73.32  ? 536 VAL E CG1   1 
ATOM   5334  C  CG2   . VAL E  1 293 ? -9.992  9.920   -34.077 1.00 74.04  ? 536 VAL E CG2   1 
ATOM   5335  N  N     . VAL E  1 294 ? -9.313  7.102   -33.073 1.00 88.95  ? 537 VAL E N     1 
ATOM   5336  C  CA    . VAL E  1 294 ? -8.190  6.220   -33.474 1.00 90.63  ? 537 VAL E CA    1 
ATOM   5337  C  C     . VAL E  1 294 ? -8.014  6.031   -35.005 1.00 90.17  ? 537 VAL E C     1 
ATOM   5338  O  O     . VAL E  1 294 ? -8.593  5.141   -35.630 1.00 96.43  ? 537 VAL E O     1 
ATOM   5339  C  CB    . VAL E  1 294 ? -8.176  4.870   -32.680 1.00 87.60  ? 537 VAL E CB    1 
ATOM   5340  C  CG1   . VAL E  1 294 ? -9.508  4.127   -32.772 1.00 84.94  ? 537 VAL E CG1   1 
ATOM   5341  C  CG2   . VAL E  1 294 ? -7.006  3.991   -33.112 1.00 85.14  ? 537 VAL E CG2   1 
ATOM   5342  N  N     . ARG E  1 295 ? -7.190  6.889   -35.589 1.00 85.58  ? 538 ARG E N     1 
ATOM   5343  C  CA    . ARG E  1 295 ? -6.886  6.824   -37.002 1.00 83.52  ? 538 ARG E CA    1 
ATOM   5344  C  C     . ARG E  1 295 ? -5.883  5.711   -37.227 1.00 92.72  ? 538 ARG E C     1 
ATOM   5345  O  O     . ARG E  1 295 ? -4.674  5.915   -37.126 1.00 89.30  ? 538 ARG E O     1 
ATOM   5346  C  CB    . ARG E  1 295 ? -6.374  8.179   -37.498 1.00 80.58  ? 538 ARG E CB    1 
ATOM   5347  C  CG    . ARG E  1 295 ? -7.419  9.284   -37.352 1.00 80.01  ? 538 ARG E CG    1 
ATOM   5348  C  CD    . ARG E  1 295 ? -6.871  10.701  -37.501 1.00 77.74  ? 538 ARG E CD    1 
ATOM   5349  N  NE    . ARG E  1 295 ? -7.784  11.699  -36.925 1.00 79.47  ? 538 ARG E NE    1 
ATOM   5350  C  CZ    . ARG E  1 295 ? -7.971  11.916  -35.614 1.00 82.53  ? 538 ARG E CZ    1 
ATOM   5351  N  NH1   . ARG E  1 295 ? -7.327  11.200  -34.697 1.00 81.34  ? 538 ARG E NH1   1 
ATOM   5352  N  NH2   . ARG E  1 295 ? -8.827  12.849  -35.201 1.00 80.28  ? 538 ARG E NH2   1 
ATOM   5353  N  N     . ASN E  1 296 ? -6.423  4.524   -37.499 1.00 103.29 ? 539 ASN E N     1 
ATOM   5354  C  CA    . ASN E  1 296 ? -5.644  3.310   -37.722 1.00 110.04 ? 539 ASN E CA    1 
ATOM   5355  C  C     . ASN E  1 296 ? -6.292  2.495   -38.838 1.00 119.62 ? 539 ASN E C     1 
ATOM   5356  O  O     . ASN E  1 296 ? -6.842  1.410   -38.614 1.00 126.60 ? 539 ASN E O     1 
ATOM   5357  C  CB    . ASN E  1 296 ? -5.533  2.486   -36.418 1.00 111.11 ? 539 ASN E CB    1 
ATOM   5358  C  CG    . ASN E  1 296 ? -4.585  1.281   -36.532 1.00 104.83 ? 539 ASN E CG    1 
ATOM   5359  O  OD1   . ASN E  1 296 ? -4.081  0.947   -37.610 1.00 98.91  ? 539 ASN E OD1   1 
ATOM   5360  N  ND2   . ASN E  1 296 ? -4.345  0.620   -35.399 1.00 97.82  ? 539 ASN E ND2   1 
ATOM   5361  N  N     . THR E  1 297 ? -6.271  3.062   -40.038 1.00 122.71 ? 540 THR E N     1 
ATOM   5362  C  CA    . THR E  1 297 ? -6.399  2.280   -41.269 1.00 127.26 ? 540 THR E CA    1 
ATOM   5363  C  C     . THR E  1 297 ? -5.410  2.895   -42.261 1.00 133.06 ? 540 THR E C     1 
ATOM   5364  O  O     . THR E  1 297 ? -5.802  3.553   -43.233 1.00 139.36 ? 540 THR E O     1 
ATOM   5365  C  CB    . THR E  1 297 ? -7.848  2.212   -41.818 1.00 124.34 ? 540 THR E CB    1 
ATOM   5366  O  OG1   . THR E  1 297 ? -7.882  1.381   -42.987 1.00 125.66 ? 540 THR E OG1   1 
ATOM   5367  C  CG2   . THR E  1 297 ? -8.391  3.578   -42.181 1.00 119.43 ? 540 THR E CG2   1 
ATOM   5368  N  N     . HIS E  1 298 ? -4.122  2.649   -41.984 1.00 127.07 ? 541 HIS E N     1 
ATOM   5369  C  CA    . HIS E  1 298 ? -2.991  3.419   -42.534 1.00 116.17 ? 541 HIS E CA    1 
ATOM   5370  C  C     . HIS E  1 298 ? -3.080  4.875   -42.021 1.00 109.57 ? 541 HIS E C     1 
ATOM   5371  O  O     . HIS E  1 298 ? -2.859  5.837   -42.763 1.00 97.33  ? 541 HIS E O     1 
ATOM   5372  C  CB    . HIS E  1 298 ? -2.916  3.324   -44.074 1.00 107.73 ? 541 HIS E CB    1 
ATOM   5373  C  CG    . HIS E  1 298 ? -2.611  1.945   -44.580 1.00 103.19 ? 541 HIS E CG    1 
ATOM   5374  N  ND1   . HIS E  1 298 ? -1.944  1.719   -45.765 1.00 100.68 ? 541 HIS E ND1   1 
ATOM   5375  C  CD2   . HIS E  1 298 ? -2.861  0.722   -44.052 1.00 98.84  ? 541 HIS E CD2   1 
ATOM   5376  C  CE1   . HIS E  1 298 ? -1.810  0.418   -45.953 1.00 96.42  ? 541 HIS E CE1   1 
ATOM   5377  N  NE2   . HIS E  1 298 ? -2.356  -0.209  -44.927 1.00 92.04  ? 541 HIS E NE2   1 
ATOM   5378  N  N     . GLY E  1 299 ? -3.416  5.004   -40.735 1.00 100.06 ? 542 GLY E N     1 
ATOM   5379  C  CA    . GLY E  1 299 ? -3.548  6.292   -40.068 1.00 92.13  ? 542 GLY E CA    1 
ATOM   5380  C  C     . GLY E  1 299 ? -4.491  7.301   -40.706 1.00 88.14  ? 542 GLY E C     1 
ATOM   5381  O  O     . GLY E  1 299 ? -4.051  8.383   -41.080 1.00 70.38  ? 542 GLY E O     1 
ATOM   5382  N  N     . CYS E  1 300 ? -5.779  6.966   -40.839 1.00 92.68  ? 543 CYS E N     1 
ATOM   5383  C  CA    . CYS E  1 300 ? -6.793  7.958   -41.296 1.00 90.49  ? 543 CYS E CA    1 
ATOM   5384  C  C     . CYS E  1 300 ? -8.117  7.932   -40.510 1.00 89.81  ? 543 CYS E C     1 
ATOM   5385  O  O     . CYS E  1 300 ? -8.659  9.006   -40.268 1.00 97.04  ? 543 CYS E O     1 
ATOM   5386  C  CB    . CYS E  1 300 ? -7.039  7.933   -42.831 1.00 88.37  ? 543 CYS E CB    1 
ATOM   5387  S  SG    . CYS E  1 300 ? -7.499  6.353   -43.585 1.00 88.89  ? 543 CYS E SG    1 
ATOM   5388  N  N     . LYS E  1 301 ? -8.633  6.753   -40.124 1.00 84.12  ? 544 LYS E N     1 
ATOM   5389  C  CA    . LYS E  1 301 ? -9.767  6.633   -39.158 1.00 78.78  ? 544 LYS E CA    1 
ATOM   5390  C  C     . LYS E  1 301 ? -10.297 5.217   -39.011 1.00 80.29  ? 544 LYS E C     1 
ATOM   5391  O  O     . LYS E  1 301 ? -10.096 4.377   -39.876 1.00 90.27  ? 544 LYS E O     1 
ATOM   5392  C  CB    . LYS E  1 301 ? -10.967 7.531   -39.513 1.00 73.59  ? 544 LYS E CB    1 
ATOM   5393  C  CG    . LYS E  1 301 ? -11.570 8.256   -38.303 1.00 74.02  ? 544 LYS E CG    1 
ATOM   5394  C  CD    . LYS E  1 301 ? -12.356 9.509   -38.696 1.00 72.41  ? 544 LYS E CD    1 
ATOM   5395  C  CE    . LYS E  1 301 ? -11.438 10.678  -39.057 1.00 70.90  ? 544 LYS E CE    1 
ATOM   5396  N  NZ    . LYS E  1 301 ? -12.029 11.636  -40.043 1.00 63.98  ? 544 LYS E NZ    1 
ATOM   5397  N  N     . VAL E  1 302 ? -10.969 4.971   -37.894 1.00 79.88  ? 545 VAL E N     1 
ATOM   5398  C  CA    . VAL E  1 302 ? -11.830 3.793   -37.705 1.00 80.37  ? 545 VAL E CA    1 
ATOM   5399  C  C     . VAL E  1 302 ? -12.595 4.010   -36.400 1.00 82.93  ? 545 VAL E C     1 
ATOM   5400  O  O     . VAL E  1 302 ? -11.998 3.988   -35.327 1.00 87.94  ? 545 VAL E O     1 
ATOM   5401  C  CB    . VAL E  1 302 ? -11.065 2.439   -37.617 1.00 81.41  ? 545 VAL E CB    1 
ATOM   5402  C  CG1   . VAL E  1 302 ? -10.924 1.766   -38.990 1.00 83.12  ? 545 VAL E CG1   1 
ATOM   5403  C  CG2   . VAL E  1 302 ? -9.711  2.592   -36.915 1.00 80.96  ? 545 VAL E CG2   1 
ATOM   5404  N  N     . GLY E  1 303 ? -13.899 4.250   -36.489 1.00 78.26  ? 546 GLY E N     1 
ATOM   5405  C  CA    . GLY E  1 303 ? -14.716 4.467   -35.296 1.00 79.62  ? 546 GLY E CA    1 
ATOM   5406  C  C     . GLY E  1 303 ? -14.856 5.936   -34.913 1.00 79.52  ? 546 GLY E C     1 
ATOM   5407  O  O     . GLY E  1 303 ? -13.856 6.594   -34.621 1.00 76.09  ? 546 GLY E O     1 
ATOM   5408  N  N     . PRO E  1 304 ? -16.104 6.453   -34.891 1.00 76.84  ? 547 PRO E N     1 
ATOM   5409  C  CA    . PRO E  1 304 ? -16.411 7.855   -34.539 1.00 72.26  ? 547 PRO E CA    1 
ATOM   5410  C  C     . PRO E  1 304 ? -15.841 8.293   -33.201 1.00 70.36  ? 547 PRO E C     1 
ATOM   5411  O  O     . PRO E  1 304 ? -15.593 9.473   -33.000 1.00 69.94  ? 547 PRO E O     1 
ATOM   5412  C  CB    . PRO E  1 304 ? -17.941 7.878   -34.458 1.00 76.27  ? 547 PRO E CB    1 
ATOM   5413  C  CG    . PRO E  1 304 ? -18.404 6.721   -35.285 1.00 78.31  ? 547 PRO E CG    1 
ATOM   5414  C  CD    . PRO E  1 304 ? -17.329 5.676   -35.176 1.00 77.74  ? 547 PRO E CD    1 
ATOM   5415  N  N     . GLY E  1 305 ? -15.692 7.342   -32.284 1.00 70.49  ? 548 GLY E N     1 
ATOM   5416  C  CA    . GLY E  1 305 ? -15.025 7.570   -31.018 1.00 67.51  ? 548 GLY E CA    1 
ATOM   5417  C  C     . GLY E  1 305 ? -15.787 8.398   -30.006 1.00 66.60  ? 548 GLY E C     1 
ATOM   5418  O  O     . GLY E  1 305 ? -15.184 9.005   -29.129 1.00 80.66  ? 548 GLY E O     1 
ATOM   5419  N  N     . ARG E  1 306 ? -17.106 8.431   -30.120 1.00 67.32  ? 549 ARG E N     1 
ATOM   5420  C  CA    . ARG E  1 306 ? -17.979 9.116   -29.155 1.00 64.49  ? 549 ARG E CA    1 
ATOM   5421  C  C     . ARG E  1 306 ? -17.730 10.622  -29.018 1.00 55.67  ? 549 ARG E C     1 
ATOM   5422  O  O     . ARG E  1 306 ? -16.584 11.087  -28.992 1.00 43.83  ? 549 ARG E O     1 
ATOM   5423  C  CB    . ARG E  1 306 ? -17.955 8.409   -27.775 1.00 69.13  ? 549 ARG E CB    1 
ATOM   5424  C  CG    . ARG E  1 306 ? -17.129 9.070   -26.673 1.00 72.09  ? 549 ARG E CG    1 
ATOM   5425  C  CD    . ARG E  1 306 ? -17.100 8.246   -25.379 1.00 74.48  ? 549 ARG E CD    1 
ATOM   5426  N  NE    . ARG E  1 306 ? -15.797 8.357   -24.708 1.00 73.38  ? 549 ARG E NE    1 
ATOM   5427  C  CZ    . ARG E  1 306 ? -15.360 9.427   -24.039 1.00 71.39  ? 549 ARG E CZ    1 
ATOM   5428  N  NH1   . ARG E  1 306 ? -16.111 10.518  -23.902 1.00 76.55  ? 549 ARG E NH1   1 
ATOM   5429  N  NH2   . ARG E  1 306 ? -14.150 9.407   -23.502 1.00 65.31  ? 549 ARG E NH2   1 
ATOM   5430  N  N     . VAL E  1 307 ? -18.844 11.337  -28.838 1.00 54.77  ? 550 VAL E N     1 
ATOM   5431  C  CA    . VAL E  1 307 ? -18.926 12.792  -28.938 1.00 58.05  ? 550 VAL E CA    1 
ATOM   5432  C  C     . VAL E  1 307 ? -18.345 13.527  -27.742 1.00 57.62  ? 550 VAL E C     1 
ATOM   5433  O  O     . VAL E  1 307 ? -17.391 13.036  -27.157 1.00 72.73  ? 550 VAL E O     1 
ATOM   5434  C  CB    . VAL E  1 307 ? -20.392 13.247  -29.139 1.00 60.16  ? 550 VAL E CB    1 
ATOM   5435  C  CG1   . VAL E  1 307 ? -20.932 12.680  -30.438 1.00 62.24  ? 550 VAL E CG1   1 
ATOM   5436  C  CG2   . VAL E  1 307 ? -21.240 12.881  -27.914 1.00 64.15  ? 550 VAL E CG2   1 
ATOM   5437  N  N     . LEU E  1 308 ? -18.890 14.718  -27.421 1.00 56.92  ? 551 LEU E N     1 
ATOM   5438  C  CA    . LEU E  1 308 ? -18.596 15.437  -26.203 1.00 55.24  ? 551 LEU E CA    1 
ATOM   5439  C  C     . LEU E  1 308 ? -19.623 16.536  -25.970 1.00 58.25  ? 551 LEU E C     1 
ATOM   5440  O  O     . LEU E  1 308 ? -19.393 17.702  -26.262 1.00 60.38  ? 551 LEU E O     1 
ATOM   5441  C  CB    . LEU E  1 308 ? -17.192 16.035  -26.257 1.00 59.40  ? 551 LEU E CB    1 
ATOM   5442  C  CG    . LEU E  1 308 ? -16.017 15.127  -25.871 1.00 62.61  ? 551 LEU E CG    1 
ATOM   5443  C  CD1   . LEU E  1 308 ? -14.676 15.846  -26.019 1.00 64.01  ? 551 LEU E CD1   1 
ATOM   5444  C  CD2   . LEU E  1 308 ? -16.197 14.586  -24.451 1.00 57.26  ? 551 LEU E CD2   1 
ATOM   5445  N  N     . PRO E  1 309 ? -20.757 16.184  -25.380 1.00 56.56  ? 552 PRO E N     1 
ATOM   5446  C  CA    . PRO E  1 309 ? -21.883 17.115  -25.424 1.00 50.91  ? 552 PRO E CA    1 
ATOM   5447  C  C     . PRO E  1 309 ? -21.464 18.558  -25.325 1.00 50.57  ? 552 PRO E C     1 
ATOM   5448  O  O     . PRO E  1 309 ? -20.984 18.996  -24.314 1.00 56.72  ? 552 PRO E O     1 
ATOM   5449  C  CB    . PRO E  1 309 ? -22.736 16.695  -24.234 1.00 52.07  ? 552 PRO E CB    1 
ATOM   5450  C  CG    . PRO E  1 309 ? -22.434 15.241  -24.090 1.00 50.69  ? 552 PRO E CG    1 
ATOM   5451  C  CD    . PRO E  1 309 ? -20.980 15.082  -24.430 1.00 51.27  ? 552 PRO E CD    1 
ATOM   5452  N  N     . THR E  1 310 ? -21.670 19.291  -26.398 1.00 50.86  ? 553 THR E N     1 
ATOM   5453  C  CA    . THR E  1 310 ? -21.252 20.673  -26.518 1.00 48.03  ? 553 THR E CA    1 
ATOM   5454  C  C     . THR E  1 310 ? -22.473 21.546  -26.702 1.00 46.76  ? 553 THR E C     1 
ATOM   5455  O  O     . THR E  1 310 ? -22.788 21.925  -27.824 1.00 56.59  ? 553 THR E O     1 
ATOM   5456  C  CB    . THR E  1 310 ? -20.304 20.812  -27.740 1.00 48.57  ? 553 THR E CB    1 
ATOM   5457  O  OG1   . THR E  1 310 ? -20.827 20.098  -28.879 1.00 37.73  ? 553 THR E OG1   1 
ATOM   5458  C  CG2   . THR E  1 310 ? -18.933 20.206  -27.426 1.00 46.19  ? 553 THR E CG2   1 
ATOM   5459  N  N     . PRO E  1 311 ? -23.185 21.859  -25.622 1.00 40.43  ? 554 PRO E N     1 
ATOM   5460  C  CA    . PRO E  1 311 ? -24.433 22.631  -25.745 1.00 41.85  ? 554 PRO E CA    1 
ATOM   5461  C  C     . PRO E  1 311 ? -24.293 24.118  -25.996 1.00 42.37  ? 554 PRO E C     1 
ATOM   5462  O  O     . PRO E  1 311 ? -25.303 24.797  -26.157 1.00 45.06  ? 554 PRO E O     1 
ATOM   5463  C  CB    . PRO E  1 311 ? -25.085 22.424  -24.381 1.00 41.21  ? 554 PRO E CB    1 
ATOM   5464  C  CG    . PRO E  1 311 ? -23.932 22.282  -23.462 1.00 39.85  ? 554 PRO E CG    1 
ATOM   5465  C  CD    . PRO E  1 311 ? -22.968 21.418  -24.240 1.00 42.95  ? 554 PRO E CD    1 
ATOM   5466  N  N     . THR E  1 312 ? -23.076 24.643  -25.955 1.00 47.69  ? 555 THR E N     1 
ATOM   5467  C  CA    . THR E  1 312 ? -22.796 26.077  -26.289 1.00 48.82  ? 555 THR E CA    1 
ATOM   5468  C  C     . THR E  1 312 ? -21.418 26.147  -26.932 1.00 45.19  ? 555 THR E C     1 
ATOM   5469  O  O     . THR E  1 312 ? -20.678 25.175  -26.854 1.00 44.65  ? 555 THR E O     1 
ATOM   5470  C  CB    . THR E  1 312 ? -22.757 27.033  -25.074 1.00 53.27  ? 555 THR E CB    1 
ATOM   5471  O  OG1   . THR E  1 312 ? -21.891 26.498  -24.054 1.00 52.02  ? 555 THR E OG1   1 
ATOM   5472  C  CG2   . THR E  1 312 ? -24.124 27.285  -24.529 1.00 53.08  ? 555 THR E CG2   1 
ATOM   5473  N  N     . GLU E  1 313 ? -21.074 27.278  -27.555 1.00 48.28  ? 556 GLU E N     1 
ATOM   5474  C  CA    . GLU E  1 313 ? -19.763 27.439  -28.266 1.00 48.97  ? 556 GLU E CA    1 
ATOM   5475  C  C     . GLU E  1 313 ? -18.581 27.281  -27.282 1.00 46.65  ? 556 GLU E C     1 
ATOM   5476  O  O     . GLU E  1 313 ? -17.637 26.462  -27.468 1.00 41.61  ? 556 GLU E O     1 
ATOM   5477  C  CB    . GLU E  1 313 ? -19.662 28.829  -28.974 1.00 48.80  ? 556 GLU E CB    1 
ATOM   5478  C  CG    . GLU E  1 313 ? -20.909 29.345  -29.705 1.00 47.13  ? 556 GLU E CG    1 
ATOM   5479  C  CD    . GLU E  1 313 ? -20.616 30.049  -31.033 1.00 47.28  ? 556 GLU E CD    1 
ATOM   5480  O  OE1   . GLU E  1 313 ? -20.079 29.376  -31.960 1.00 43.26  ? 556 GLU E OE1   1 
ATOM   5481  O  OE2   . GLU E  1 313 ? -20.948 31.266  -31.159 1.00 43.83  ? 556 GLU E OE2   1 
ATOM   5482  N  N     . LYS E  1 314 ? -18.627 28.096  -26.234 1.00 48.05  ? 557 LYS E N     1 
ATOM   5483  C  CA    . LYS E  1 314 ? -17.833 27.802  -25.033 1.00 48.84  ? 557 LYS E CA    1 
ATOM   5484  C  C     . LYS E  1 314 ? -18.326 26.437  -24.538 1.00 48.46  ? 557 LYS E C     1 
ATOM   5485  O  O     . LYS E  1 314 ? -19.511 26.250  -24.260 1.00 48.71  ? 557 LYS E O     1 
ATOM   5486  C  CB    . LYS E  1 314 ? -17.985 28.891  -23.997 1.00 45.97  ? 557 LYS E CB    1 
ATOM   5487  C  CG    . LYS E  1 314 ? -19.384 29.105  -23.471 1.00 49.95  ? 557 LYS E CG    1 
ATOM   5488  C  CD    . LYS E  1 314 ? -19.572 30.487  -22.853 1.00 50.60  ? 557 LYS E CD    1 
ATOM   5489  C  CE    . LYS E  1 314 ? -19.736 31.575  -23.904 1.00 58.69  ? 557 LYS E CE    1 
ATOM   5490  N  NZ    . LYS E  1 314 ? -19.912 32.924  -23.289 1.00 64.55  ? 557 LYS E NZ    1 
ATOM   5491  N  N     . ASP E  1 315 ? -17.405 25.494  -24.507 1.00 46.45  ? 558 ASP E N     1 
ATOM   5492  C  CA    . ASP E  1 315 ? -17.635 24.081  -24.211 1.00 48.23  ? 558 ASP E CA    1 
ATOM   5493  C  C     . ASP E  1 315 ? -16.715 23.461  -25.181 1.00 53.71  ? 558 ASP E C     1 
ATOM   5494  O  O     . ASP E  1 315 ? -15.862 22.660  -24.830 1.00 56.23  ? 558 ASP E O     1 
ATOM   5495  C  CB    . ASP E  1 315 ? -19.028 23.541  -24.525 1.00 51.65  ? 558 ASP E CB    1 
ATOM   5496  C  CG    . ASP E  1 315 ? -19.998 23.676  -23.367 1.00 49.67  ? 558 ASP E CG    1 
ATOM   5497  O  OD1   . ASP E  1 315 ? -19.613 23.330  -22.229 1.00 53.52  ? 558 ASP E OD1   1 
ATOM   5498  O  OD2   . ASP E  1 315 ? -21.142 24.124  -23.593 1.00 43.15  ? 558 ASP E OD2   1 
ATOM   5499  N  N     . VAL E  1 316 ? -16.906 23.869  -26.433 1.00 56.03  ? 559 VAL E N     1 
ATOM   5500  C  CA    . VAL E  1 316 ? -16.036 23.454  -27.518 1.00 54.98  ? 559 VAL E CA    1 
ATOM   5501  C  C     . VAL E  1 316 ? -14.659 24.067  -27.305 1.00 50.42  ? 559 VAL E C     1 
ATOM   5502  O  O     . VAL E  1 316 ? -13.637 23.421  -27.562 1.00 48.48  ? 559 VAL E O     1 
ATOM   5503  C  CB    . VAL E  1 316 ? -16.568 23.923  -28.899 1.00 55.14  ? 559 VAL E CB    1 
ATOM   5504  C  CG1   . VAL E  1 316 ? -15.764 23.247  -30.013 1.00 53.44  ? 559 VAL E CG1   1 
ATOM   5505  C  CG2   . VAL E  1 316 ? -18.069 23.651  -29.022 1.00 55.23  ? 559 VAL E CG2   1 
ATOM   5506  N  N     . PHE E  1 317 ? -14.655 25.324  -26.868 1.00 46.40  ? 560 PHE E N     1 
ATOM   5507  C  CA    . PHE E  1 317 ? -13.417 26.027  -26.625 1.00 53.12  ? 560 PHE E CA    1 
ATOM   5508  C  C     . PHE E  1 317 ? -12.744 25.365  -25.396 1.00 48.77  ? 560 PHE E C     1 
ATOM   5509  O  O     . PHE E  1 317 ? -11.601 24.878  -25.456 1.00 42.76  ? 560 PHE E O     1 
ATOM   5510  C  CB    . PHE E  1 317 ? -13.711 27.526  -26.423 1.00 56.28  ? 560 PHE E CB    1 
ATOM   5511  C  CG    . PHE E  1 317 ? -13.851 28.323  -27.720 1.00 58.07  ? 560 PHE E CG    1 
ATOM   5512  C  CD1   . PHE E  1 317 ? -12.739 28.616  -28.505 1.00 61.15  ? 560 PHE E CD1   1 
ATOM   5513  C  CD2   . PHE E  1 317 ? -15.080 28.807  -28.131 1.00 58.66  ? 560 PHE E CD2   1 
ATOM   5514  C  CE1   . PHE E  1 317 ? -12.856 29.372  -29.672 1.00 61.83  ? 560 PHE E CE1   1 
ATOM   5515  C  CE2   . PHE E  1 317 ? -15.206 29.570  -29.293 1.00 62.69  ? 560 PHE E CE2   1 
ATOM   5516  C  CZ    . PHE E  1 317 ? -14.092 29.848  -30.071 1.00 61.55  ? 560 PHE E CZ    1 
ATOM   5517  N  N     . ARG E  1 318 ? -13.512 25.270  -24.314 1.00 51.21  ? 561 ARG E N     1 
ATOM   5518  C  CA    . ARG E  1 318 ? -13.024 24.634  -23.120 1.00 46.27  ? 561 ARG E CA    1 
ATOM   5519  C  C     . ARG E  1 318 ? -12.417 23.278  -23.475 1.00 47.33  ? 561 ARG E C     1 
ATOM   5520  O  O     . ARG E  1 318 ? -11.237 23.048  -23.242 1.00 48.47  ? 561 ARG E O     1 
ATOM   5521  C  CB    . ARG E  1 318 ? -14.112 24.579  -22.058 1.00 49.34  ? 561 ARG E CB    1 
ATOM   5522  C  CG    . ARG E  1 318 ? -14.574 23.202  -21.604 1.00 54.41  ? 561 ARG E CG    1 
ATOM   5523  C  CD    . ARG E  1 318 ? -15.072 23.243  -20.164 1.00 56.19  ? 561 ARG E CD    1 
ATOM   5524  N  NE    . ARG E  1 318 ? -16.267 24.084  -20.002 1.00 61.65  ? 561 ARG E NE    1 
ATOM   5525  C  CZ    . ARG E  1 318 ? -17.530 23.659  -20.113 1.00 57.82  ? 561 ARG E CZ    1 
ATOM   5526  N  NH1   . ARG E  1 318 ? -17.802 22.385  -20.390 1.00 54.89  ? 561 ARG E NH1   1 
ATOM   5527  N  NH2   . ARG E  1 318 ? -18.538 24.517  -19.950 1.00 58.69  ? 561 ARG E NH2   1 
ATOM   5528  N  N     . LEU E  1 319 ? -13.175 22.408  -24.123 1.00 49.24  ? 562 LEU E N     1 
ATOM   5529  C  CA    . LEU E  1 319 ? -12.720 21.012  -24.331 1.00 52.40  ? 562 LEU E CA    1 
ATOM   5530  C  C     . LEU E  1 319 ? -11.540 20.836  -25.246 1.00 57.30  ? 562 LEU E C     1 
ATOM   5531  O  O     . LEU E  1 319 ? -11.000 19.728  -25.353 1.00 61.77  ? 562 LEU E O     1 
ATOM   5532  C  CB    . LEU E  1 319 ? -13.844 20.139  -24.876 1.00 53.90  ? 562 LEU E CB    1 
ATOM   5533  C  CG    . LEU E  1 319 ? -14.866 19.596  -23.880 1.00 56.50  ? 562 LEU E CG    1 
ATOM   5534  C  CD1   . LEU E  1 319 ? -16.070 19.090  -24.670 1.00 59.89  ? 562 LEU E CD1   1 
ATOM   5535  C  CD2   . LEU E  1 319 ? -14.264 18.493  -23.000 1.00 54.43  ? 562 LEU E CD2   1 
ATOM   5536  N  N     . LEU E  1 320 ? -11.187 21.910  -25.952 1.00 68.51  ? 563 LEU E N     1 
ATOM   5537  C  CA    . LEU E  1 320 ? -9.962  21.973  -26.745 1.00 67.27  ? 563 LEU E CA    1 
ATOM   5538  C  C     . LEU E  1 320 ? -8.883  22.782  -26.004 1.00 69.59  ? 563 LEU E C     1 
ATOM   5539  O  O     . LEU E  1 320 ? -7.760  22.938  -26.500 1.00 65.86  ? 563 LEU E O     1 
ATOM   5540  C  CB    . LEU E  1 320 ? -10.266 22.568  -28.131 1.00 68.77  ? 563 LEU E CB    1 
ATOM   5541  C  CG    . LEU E  1 320 ? -11.077 21.645  -29.061 1.00 66.46  ? 563 LEU E CG    1 
ATOM   5542  C  CD1   . LEU E  1 320 ? -11.805 22.426  -30.153 1.00 64.35  ? 563 LEU E CD1   1 
ATOM   5543  C  CD2   . LEU E  1 320 ? -10.209 20.534  -29.664 1.00 63.82  ? 563 LEU E CD2   1 
ATOM   5544  N  N     . GLY E  1 321 ? -9.218  23.272  -24.808 1.00 69.91  ? 564 GLY E N     1 
ATOM   5545  C  CA    . GLY E  1 321 ? -8.248  23.959  -23.963 1.00 68.15  ? 564 GLY E CA    1 
ATOM   5546  C  C     . GLY E  1 321 ? -7.914  25.319  -24.530 1.00 64.06  ? 564 GLY E C     1 
ATOM   5547  O  O     . GLY E  1 321 ? -6.757  25.764  -24.501 1.00 56.97  ? 564 GLY E O     1 
ATOM   5548  N  N     . LEU E  1 322 ? -8.939  25.972  -25.061 1.00 59.22  ? 565 LEU E N     1 
ATOM   5549  C  CA    . LEU E  1 322 ? -8.780  27.301  -25.598 1.00 57.91  ? 565 LEU E CA    1 
ATOM   5550  C  C     . LEU E  1 322 ? -9.675  28.217  -24.824 1.00 51.99  ? 565 LEU E C     1 
ATOM   5551  O  O     . LEU E  1 322 ? -10.757 27.806  -24.436 1.00 54.32  ? 565 LEU E O     1 
ATOM   5552  C  CB    . LEU E  1 322 ? -9.182  27.351  -27.071 1.00 60.16  ? 565 LEU E CB    1 
ATOM   5553  C  CG    . LEU E  1 322 ? -8.308  26.605  -28.083 1.00 60.81  ? 565 LEU E CG    1 
ATOM   5554  C  CD1   . LEU E  1 322 ? -9.097  26.393  -29.353 1.00 60.43  ? 565 LEU E CD1   1 
ATOM   5555  C  CD2   . LEU E  1 322 ? -7.019  27.345  -28.385 1.00 63.87  ? 565 LEU E CD2   1 
ATOM   5556  N  N     . PRO E  1 323 ? -9.237  29.474  -24.632 1.00 50.65  ? 566 PRO E N     1 
ATOM   5557  C  CA    . PRO E  1 323 ? -10.133 30.467  -24.081 1.00 49.36  ? 566 PRO E CA    1 
ATOM   5558  C  C     . PRO E  1 323 ? -11.197 30.735  -25.112 1.00 53.44  ? 566 PRO E C     1 
ATOM   5559  O  O     . PRO E  1 323 ? -10.984 30.452  -26.310 1.00 49.71  ? 566 PRO E O     1 
ATOM   5560  C  CB    . PRO E  1 323 ? -9.249  31.711  -23.948 1.00 50.76  ? 566 PRO E CB    1 
ATOM   5561  C  CG    . PRO E  1 323 ? -8.221  31.564  -25.035 1.00 47.41  ? 566 PRO E CG    1 
ATOM   5562  C  CD    . PRO E  1 323 ? -8.011  30.090  -25.211 1.00 49.47  ? 566 PRO E CD    1 
ATOM   5563  N  N     . TYR E  1 324 ? -12.308 31.296  -24.644 1.00 52.16  ? 567 TYR E N     1 
ATOM   5564  C  CA    . TYR E  1 324 ? -13.426 31.643  -25.493 1.00 55.99  ? 567 TYR E CA    1 
ATOM   5565  C  C     . TYR E  1 324 ? -12.971 32.763  -26.441 1.00 56.47  ? 567 TYR E C     1 
ATOM   5566  O  O     . TYR E  1 324 ? -12.107 33.535  -26.089 1.00 48.48  ? 567 TYR E O     1 
ATOM   5567  C  CB    . TYR E  1 324 ? -14.648 32.074  -24.638 1.00 50.99  ? 567 TYR E CB    1 
ATOM   5568  C  CG    . TYR E  1 324 ? -15.883 32.481  -25.445 1.00 53.84  ? 567 TYR E CG    1 
ATOM   5569  C  CD1   . TYR E  1 324 ? -16.453 31.621  -26.415 1.00 52.96  ? 567 TYR E CD1   1 
ATOM   5570  C  CD2   . TYR E  1 324 ? -16.497 33.722  -25.234 1.00 52.51  ? 567 TYR E CD2   1 
ATOM   5571  C  CE1   . TYR E  1 324 ? -17.583 32.009  -27.152 1.00 47.10  ? 567 TYR E CE1   1 
ATOM   5572  C  CE2   . TYR E  1 324 ? -17.608 34.108  -25.969 1.00 49.62  ? 567 TYR E CE2   1 
ATOM   5573  C  CZ    . TYR E  1 324 ? -18.154 33.251  -26.926 1.00 49.73  ? 567 TYR E CZ    1 
ATOM   5574  O  OH    . TYR E  1 324 ? -19.273 33.677  -27.650 1.00 47.90  ? 567 TYR E OH    1 
ATOM   5575  N  N     . ARG E  1 325 ? -13.523 32.791  -27.659 1.00 57.87  ? 568 ARG E N     1 
ATOM   5576  C  CA    . ARG E  1 325 ? -13.456 33.974  -28.521 1.00 56.06  ? 568 ARG E CA    1 
ATOM   5577  C  C     . ARG E  1 325 ? -14.839 34.346  -29.090 1.00 52.99  ? 568 ARG E C     1 
ATOM   5578  O  O     . ARG E  1 325 ? -15.558 33.536  -29.685 1.00 43.91  ? 568 ARG E O     1 
ATOM   5579  C  CB    . ARG E  1 325 ? -12.421 33.778  -29.621 1.00 60.46  ? 568 ARG E CB    1 
ATOM   5580  C  CG    . ARG E  1 325 ? -11.011 34.132  -29.168 1.00 67.06  ? 568 ARG E CG    1 
ATOM   5581  C  CD    . ARG E  1 325 ? -9.973  33.328  -29.916 1.00 76.93  ? 568 ARG E CD    1 
ATOM   5582  N  NE    . ARG E  1 325 ? -9.664  33.892  -31.235 1.00 90.67  ? 568 ARG E NE    1 
ATOM   5583  C  CZ    . ARG E  1 325 ? -8.652  34.721  -31.506 1.00 98.26  ? 568 ARG E CZ    1 
ATOM   5584  N  NH1   . ARG E  1 325 ? -7.814  35.132  -30.555 1.00 103.30 ? 568 ARG E NH1   1 
ATOM   5585  N  NH2   . ARG E  1 325 ? -8.480  35.154  -32.751 1.00 104.70 ? 568 ARG E NH2   1 
ATOM   5586  N  N     . GLU E  1 326 ? -15.207 35.588  -28.861 1.00 49.06  ? 569 GLU E N     1 
ATOM   5587  C  CA    . GLU E  1 326 ? -16.401 36.149  -29.411 1.00 50.33  ? 569 GLU E CA    1 
ATOM   5588  C  C     . GLU E  1 326 ? -16.404 35.941  -30.972 1.00 56.24  ? 569 GLU E C     1 
ATOM   5589  O  O     . GLU E  1 326 ? -15.359 35.627  -31.568 1.00 47.55  ? 569 GLU E O     1 
ATOM   5590  C  CB    . GLU E  1 326 ? -16.427 37.627  -28.995 1.00 50.51  ? 569 GLU E CB    1 
ATOM   5591  C  CG    . GLU E  1 326 ? -17.773 38.298  -28.898 1.00 57.23  ? 569 GLU E CG    1 
ATOM   5592  C  CD    . GLU E  1 326 ? -18.634 37.843  -27.728 1.00 64.09  ? 569 GLU E CD    1 
ATOM   5593  O  OE1   . GLU E  1 326 ? -18.400 36.745  -27.163 1.00 69.13  ? 569 GLU E OE1   1 
ATOM   5594  O  OE2   . GLU E  1 326 ? -19.579 38.594  -27.394 1.00 62.62  ? 569 GLU E OE2   1 
ATOM   5595  N  N     . PRO E  1 327 ? -17.591 36.039  -31.625 1.00 52.08  ? 570 PRO E N     1 
ATOM   5596  C  CA    . PRO E  1 327 ? -17.691 36.018  -33.082 1.00 48.22  ? 570 PRO E CA    1 
ATOM   5597  C  C     . PRO E  1 327 ? -16.760 36.998  -33.810 1.00 42.98  ? 570 PRO E C     1 
ATOM   5598  O  O     . PRO E  1 327 ? -15.968 36.561  -34.622 1.00 36.92  ? 570 PRO E O     1 
ATOM   5599  C  CB    . PRO E  1 327 ? -19.163 36.382  -33.343 1.00 52.40  ? 570 PRO E CB    1 
ATOM   5600  C  CG    . PRO E  1 327 ? -19.886 36.132  -32.050 1.00 58.48  ? 570 PRO E CG    1 
ATOM   5601  C  CD    . PRO E  1 327 ? -18.882 35.678  -31.018 1.00 54.20  ? 570 PRO E CD    1 
ATOM   5602  N  N     . ALA E  1 328 ? -16.854 38.283  -33.489 1.00 42.61  ? 571 ALA E N     1 
ATOM   5603  C  CA    . ALA E  1 328 ? -16.026 39.369  -34.081 1.00 43.89  ? 571 ALA E CA    1 
ATOM   5604  C  C     . ALA E  1 328 ? -14.519 39.219  -33.957 1.00 43.57  ? 571 ALA E C     1 
ATOM   5605  O  O     . ALA E  1 328 ? -13.818 40.052  -34.474 1.00 51.80  ? 571 ALA E O     1 
ATOM   5606  C  CB    . ALA E  1 328 ? -16.389 40.719  -33.476 1.00 38.78  ? 571 ALA E CB    1 
ATOM   5607  N  N     . GLU E  1 329 ? -14.026 38.211  -33.257 1.00 42.72  ? 572 GLU E N     1 
ATOM   5608  C  CA    . GLU E  1 329 ? -12.601 38.016  -33.103 1.00 47.70  ? 572 GLU E CA    1 
ATOM   5609  C  C     . GLU E  1 329 ? -12.298 36.610  -33.552 1.00 47.28  ? 572 GLU E C     1 
ATOM   5610  O  O     . GLU E  1 329 ? -11.434 35.928  -32.977 1.00 47.01  ? 572 GLU E O     1 
ATOM   5611  C  CB    . GLU E  1 329 ? -12.149 38.277  -31.642 1.00 54.77  ? 572 GLU E CB    1 
ATOM   5612  C  CG    . GLU E  1 329 ? -12.758 37.324  -30.608 1.00 66.76  ? 572 GLU E CG    1 
ATOM   5613  C  CD    . GLU E  1 329 ? -12.305 37.532  -29.147 1.00 75.73  ? 572 GLU E CD    1 
ATOM   5614  O  OE1   . GLU E  1 329 ? -11.099 37.801  -28.894 1.00 85.56  ? 572 GLU E OE1   1 
ATOM   5615  O  OE2   . GLU E  1 329 ? -13.174 37.381  -28.243 1.00 63.85  ? 572 GLU E OE2   1 
ATOM   5616  N  N     . ARG E  1 330 ? -13.007 36.179  -34.601 1.00 47.97  ? 573 ARG E N     1 
ATOM   5617  C  CA    . ARG E  1 330 ? -12.795 34.847  -35.187 1.00 46.67  ? 573 ARG E CA    1 
ATOM   5618  C  C     . ARG E  1 330 ? -12.391 34.858  -36.651 1.00 45.64  ? 573 ARG E C     1 
ATOM   5619  O  O     . ARG E  1 330 ? -12.700 33.901  -37.400 1.00 44.96  ? 573 ARG E O     1 
ATOM   5620  C  CB    . ARG E  1 330 ? -14.035 33.980  -35.011 1.00 45.30  ? 573 ARG E CB    1 
ATOM   5621  C  CG    . ARG E  1 330 ? -14.253 33.532  -33.579 1.00 45.99  ? 573 ARG E CG    1 
ATOM   5622  C  CD    . ARG E  1 330 ? -15.439 32.604  -33.514 1.00 44.10  ? 573 ARG E CD    1 
ATOM   5623  N  NE    . ARG E  1 330 ? -16.148 32.686  -32.252 1.00 45.86  ? 573 ARG E NE    1 
ATOM   5624  C  CZ    . ARG E  1 330 ? -17.369 32.198  -32.050 1.00 45.87  ? 573 ARG E CZ    1 
ATOM   5625  N  NH1   . ARG E  1 330 ? -18.048 31.615  -33.048 1.00 46.67  ? 573 ARG E NH1   1 
ATOM   5626  N  NH2   . ARG E  1 330 ? -17.919 32.324  -30.855 1.00 44.87  ? 573 ARG E NH2   1 
ATOM   5627  N  N     . ASP E  1 331 ? -11.664 35.899  -37.063 1.00 48.34  ? 574 ASP E N     1 
ATOM   5628  C  CA    . ASP E  1 331 ? -11.013 35.876  -38.377 1.00 46.36  ? 574 ASP E CA    1 
ATOM   5629  C  C     . ASP E  1 331 ? -9.861  34.880  -38.464 1.00 51.28  ? 574 ASP E C     1 
ATOM   5630  O  O     . ASP E  1 331 ? -9.675  34.210  -39.480 1.00 55.23  ? 574 ASP E O     1 
ATOM   5631  C  CB    . ASP E  1 331 ? -10.562 37.248  -38.747 1.00 45.08  ? 574 ASP E CB    1 
ATOM   5632  C  CG    . ASP E  1 331 ? -11.718 38.146  -39.065 1.00 45.11  ? 574 ASP E CG    1 
ATOM   5633  O  OD1   . ASP E  1 331 ? -12.694 37.708  -39.707 1.00 44.25  ? 574 ASP E OD1   1 
ATOM   5634  O  OD2   . ASP E  1 331 ? -11.671 39.297  -38.668 1.00 43.52  ? 574 ASP E OD2   1 
ATOM   5635  N  N     . TRP E  1 332 ? -9.126  34.742  -37.379 1.00 55.96  ? 575 TRP E N     1 
ATOM   5636  C  CA    . TRP E  1 332 ? -7.966  33.851  -37.346 1.00 59.48  ? 575 TRP E CA    1 
ATOM   5637  C  C     . TRP E  1 332 ? -7.958  33.289  -35.928 1.00 60.06  ? 575 TRP E C     1 
ATOM   5638  O  O     . TRP E  1 332 ? -8.570  33.880  -35.030 1.00 56.01  ? 575 TRP E O     1 
ATOM   5639  C  CB    . TRP E  1 332 ? -6.688  34.647  -37.690 1.00 56.48  ? 575 TRP E CB    1 
ATOM   5640  C  CG    . TRP E  1 332 ? -6.596  35.996  -36.949 1.00 53.77  ? 575 TRP E CG    1 
ATOM   5641  C  CD1   . TRP E  1 332 ? -6.228  36.194  -35.630 1.00 52.18  ? 575 TRP E CD1   1 
ATOM   5642  C  CD2   . TRP E  1 332 ? -6.892  37.313  -37.467 1.00 56.00  ? 575 TRP E CD2   1 
ATOM   5643  N  NE1   . TRP E  1 332 ? -6.266  37.535  -35.311 1.00 49.09  ? 575 TRP E NE1   1 
ATOM   5644  C  CE2   . TRP E  1 332 ? -6.673  38.246  -36.406 1.00 48.30  ? 575 TRP E CE2   1 
ATOM   5645  C  CE3   . TRP E  1 332 ? -7.321  37.798  -38.715 1.00 58.13  ? 575 TRP E CE3   1 
ATOM   5646  C  CZ2   . TRP E  1 332 ? -6.869  39.623  -36.555 1.00 49.33  ? 575 TRP E CZ2   1 
ATOM   5647  C  CZ3   . TRP E  1 332 ? -7.529  39.196  -38.860 1.00 54.03  ? 575 TRP E CZ3   1 
ATOM   5648  C  CH2   . TRP E  1 332 ? -7.287  40.082  -37.783 1.00 54.16  ? 575 TRP E CH2   1 
ATOM   5649  N  N     . LEU E  1 333 ? -7.313  32.141  -35.720 1.00 73.88  ? 576 LEU E N     1 
ATOM   5650  C  CA    . LEU E  1 333 ? -7.217  31.541  -34.366 1.00 72.88  ? 576 LEU E CA    1 
ATOM   5651  C  C     . LEU E  1 333 ? -5.910  31.923  -33.644 1.00 71.19  ? 576 LEU E C     1 
ATOM   5652  O  O     . LEU E  1 333 ? -5.043  31.092  -33.377 1.00 69.00  ? 576 LEU E O     1 
ATOM   5653  C  CB    . LEU E  1 333 ? -7.397  30.018  -34.443 1.00 69.93  ? 576 LEU E CB    1 
ATOM   5654  C  CG    . LEU E  1 333 ? -7.852  29.270  -33.168 1.00 66.56  ? 576 LEU E CG    1 
ATOM   5655  C  CD1   . LEU E  1 333 ? -6.761  28.394  -32.579 1.00 67.78  ? 576 LEU E CD1   1 
ATOM   5656  C  CD2   . LEU E  1 333 ? -8.407  30.189  -32.091 1.00 67.21  ? 576 LEU E CD2   1 
ATOM   5657  N  N     . GLU E  1 334 ? -5.793  33.206  -33.330 1.00 74.25  ? 577 GLU E N     1 
ATOM   5658  C  CA    . GLU E  1 334 ? -4.540  33.791  -32.881 1.00 75.16  ? 577 GLU E CA    1 
ATOM   5659  C  C     . GLU E  1 334 ? -4.919  35.140  -32.230 1.00 71.43  ? 577 GLU E C     1 
ATOM   5660  O  O     . GLU E  1 334 ? -4.087  35.996  -31.918 1.00 65.62  ? 577 GLU E O     1 
ATOM   5661  C  CB    . GLU E  1 334 ? -3.559  33.939  -34.090 1.00 76.20  ? 577 GLU E CB    1 
ATOM   5662  C  CG    . GLU E  1 334 ? -3.605  32.791  -35.140 1.00 74.03  ? 577 GLU E CG    1 
ATOM   5663  C  CD    . GLU E  1 334 ? -2.852  33.038  -36.461 1.00 71.25  ? 577 GLU E CD    1 
ATOM   5664  O  OE1   . GLU E  1 334 ? -1.660  33.386  -36.429 1.00 69.27  ? 577 GLU E OE1   1 
ATOM   5665  O  OE2   . GLU E  1 334 ? -3.444  32.834  -37.553 1.00 63.10  ? 577 GLU E OE2   1 
ATOM   5666  O  "O5'" . DC  F  2 1   ? 11.607  13.629  -49.093 1.00 50.55  ? 1   DC  F "O5'" 1 
ATOM   5667  C  "C5'" . DC  F  2 1   ? 11.583  12.307  -48.519 1.00 46.24  ? 1   DC  F "C5'" 1 
ATOM   5668  C  "C4'" . DC  F  2 1   ? 10.652  12.246  -47.329 1.00 46.87  ? 1   DC  F "C4'" 1 
ATOM   5669  O  "O4'" . DC  F  2 1   ? 10.990  13.222  -46.320 1.00 44.25  ? 1   DC  F "O4'" 1 
ATOM   5670  C  "C3'" . DC  F  2 1   ? 9.199   12.525  -47.663 1.00 48.42  ? 1   DC  F "C3'" 1 
ATOM   5671  O  "O3'" . DC  F  2 1   ? 8.603   11.312  -48.107 1.00 49.94  ? 1   DC  F "O3'" 1 
ATOM   5672  C  "C2'" . DC  F  2 1   ? 8.625   13.003  -46.341 1.00 48.39  ? 1   DC  F "C2'" 1 
ATOM   5673  C  "C1'" . DC  F  2 1   ? 9.817   13.621  -45.609 1.00 43.80  ? 1   DC  F "C1'" 1 
ATOM   5674  N  N1    . DC  F  2 1   ? 9.854   15.094  -45.496 1.00 40.01  ? 1   DC  F N1    1 
ATOM   5675  C  C2    . DC  F  2 1   ? 9.339   15.730  -44.354 1.00 38.22  ? 1   DC  F C2    1 
ATOM   5676  O  O2    . DC  F  2 1   ? 8.747   15.056  -43.494 1.00 36.31  ? 1   DC  F O2    1 
ATOM   5677  N  N3    . DC  F  2 1   ? 9.455   17.070  -44.240 1.00 37.51  ? 1   DC  F N3    1 
ATOM   5678  C  C4    . DC  F  2 1   ? 10.068  17.771  -45.193 1.00 37.04  ? 1   DC  F C4    1 
ATOM   5679  N  N4    . DC  F  2 1   ? 10.186  19.086  -45.018 1.00 39.12  ? 1   DC  F N4    1 
ATOM   5680  C  C5    . DC  F  2 1   ? 10.591  17.155  -46.366 1.00 41.19  ? 1   DC  F C5    1 
ATOM   5681  C  C6    . DC  F  2 1   ? 10.480  15.824  -46.466 1.00 42.31  ? 1   DC  F C6    1 
ATOM   5682  P  P     . DG  F  2 2   ? 7.227   11.361  -48.897 1.00 53.19  ? 2   DG  F P     1 
ATOM   5683  O  OP1   . DG  F  2 2   ? 6.953   9.979   -49.401 1.00 60.93  ? 2   DG  F OP1   1 
ATOM   5684  O  OP2   . DG  F  2 2   ? 7.264   12.523  -49.822 1.00 52.02  ? 2   DG  F OP2   1 
ATOM   5685  O  "O5'" . DG  F  2 2   ? 6.168   11.649  -47.755 1.00 45.64  ? 2   DG  F "O5'" 1 
ATOM   5686  C  "C5'" . DG  F  2 2   ? 6.043   10.729  -46.671 1.00 43.65  ? 2   DG  F "C5'" 1 
ATOM   5687  C  "C4'" . DG  F  2 2   ? 5.028   11.279  -45.708 1.00 39.91  ? 2   DG  F "C4'" 1 
ATOM   5688  O  "O4'" . DG  F  2 2   ? 5.481   12.583  -45.281 1.00 40.32  ? 2   DG  F "O4'" 1 
ATOM   5689  C  "C3'" . DG  F  2 2   ? 3.652   11.504  -46.335 1.00 42.54  ? 2   DG  F "C3'" 1 
ATOM   5690  O  "O3'" . DG  F  2 2   ? 2.695   11.240  -45.306 1.00 44.53  ? 2   DG  F "O3'" 1 
ATOM   5691  C  "C2'" . DG  F  2 2   ? 3.717   12.959  -46.768 1.00 41.77  ? 2   DG  F "C2'" 1 
ATOM   5692  C  "C1'" . DG  F  2 2   ? 4.505   13.570  -45.616 1.00 41.02  ? 2   DG  F "C1'" 1 
ATOM   5693  N  N9    . DG  F  2 2   ? 5.197   14.823  -45.931 1.00 36.56  ? 2   DG  F N9    1 
ATOM   5694  C  C8    . DG  F  2 2   ? 5.802   15.138  -47.124 1.00 35.26  ? 2   DG  F C8    1 
ATOM   5695  N  N7    . DG  F  2 2   ? 6.317   16.338  -47.136 1.00 37.22  ? 2   DG  F N7    1 
ATOM   5696  C  C5    . DG  F  2 2   ? 6.043   16.845  -45.873 1.00 31.52  ? 2   DG  F C5    1 
ATOM   5697  C  C6    . DG  F  2 2   ? 6.376   18.102  -45.292 1.00 33.78  ? 2   DG  F C6    1 
ATOM   5698  O  O6    . DG  F  2 2   ? 6.992   19.046  -45.794 1.00 37.88  ? 2   DG  F O6    1 
ATOM   5699  N  N1    . DG  F  2 2   ? 5.872   18.221  -44.004 1.00 35.57  ? 2   DG  F N1    1 
ATOM   5700  C  C2    . DG  F  2 2   ? 5.168   17.249  -43.342 1.00 35.61  ? 2   DG  F C2    1 
ATOM   5701  N  N2    . DG  F  2 2   ? 4.796   17.553  -42.090 1.00 38.01  ? 2   DG  F N2    1 
ATOM   5702  N  N3    . DG  F  2 2   ? 4.862   16.065  -43.863 1.00 34.07  ? 2   DG  F N3    1 
ATOM   5703  C  C4    . DG  F  2 2   ? 5.333   15.932  -45.123 1.00 33.29  ? 2   DG  F C4    1 
ATOM   5704  P  P     . DG  F  2 3   ? 1.127   11.463  -45.528 1.00 54.15  ? 3   DG  F P     1 
ATOM   5705  O  OP1   . DG  F  2 3   ? 0.381   10.456  -44.708 1.00 54.09  ? 3   DG  F OP1   1 
ATOM   5706  O  OP2   . DG  F  2 3   ? 0.879   11.576  -46.979 1.00 48.96  ? 3   DG  F OP2   1 
ATOM   5707  O  "O5'" . DG  F  2 3   ? 0.852   12.830  -44.761 1.00 47.84  ? 3   DG  F "O5'" 1 
ATOM   5708  C  "C5'" . DG  F  2 3   ? 0.787   12.844  -43.329 1.00 48.84  ? 3   DG  F "C5'" 1 
ATOM   5709  C  "C4'" . DG  F  2 3   ? 0.314   14.199  -42.866 1.00 48.84  ? 3   DG  F "C4'" 1 
ATOM   5710  O  "O4'" . DG  F  2 3   ? 1.255   15.229  -43.282 1.00 46.46  ? 3   DG  F "O4'" 1 
ATOM   5711  C  "C3'" . DG  F  2 3   ? -1.038  14.596  -43.459 1.00 46.43  ? 3   DG  F "C3'" 1 
ATOM   5712  O  "O3'" . DG  F  2 3   ? -1.857  15.219  -42.461 1.00 48.18  ? 3   DG  F "O3'" 1 
ATOM   5713  C  "C2'" . DG  F  2 3   ? -0.670  15.572  -44.565 1.00 43.51  ? 3   DG  F "C2'" 1 
ATOM   5714  C  "C1'" . DG  F  2 3   ? 0.547   16.258  -43.975 1.00 41.60  ? 3   DG  F "C1'" 1 
ATOM   5715  N  N9    . DG  F  2 3   ? 1.454   16.841  -44.954 1.00 35.30  ? 3   DG  F N9    1 
ATOM   5716  C  C8    . DG  F  2 3   ? 1.903   16.251  -46.110 1.00 35.22  ? 3   DG  F C8    1 
ATOM   5717  N  N7    . DG  F  2 3   ? 2.722   17.008  -46.787 1.00 38.62  ? 3   DG  F N7    1 
ATOM   5718  C  C5    . DG  F  2 3   ? 2.828   18.165  -46.027 1.00 35.06  ? 3   DG  F C5    1 
ATOM   5719  C  C6    . DG  F  2 3   ? 3.588   19.345  -46.251 1.00 30.91  ? 3   DG  F C6    1 
ATOM   5720  O  O6    . DG  F  2 3   ? 4.322   19.617  -47.211 1.00 32.01  ? 3   DG  F O6    1 
ATOM   5721  N  N1    . DG  F  2 3   ? 3.378   20.286  -45.248 1.00 29.41  ? 3   DG  F N1    1 
ATOM   5722  C  C2    . DG  F  2 3   ? 2.588   20.095  -44.138 1.00 31.07  ? 3   DG  F C2    1 
ATOM   5723  N  N2    . DG  F  2 3   ? 2.542   21.108  -43.260 1.00 27.75  ? 3   DG  F N2    1 
ATOM   5724  N  N3    . DG  F  2 3   ? 1.867   19.001  -43.921 1.00 35.25  ? 3   DG  F N3    1 
ATOM   5725  C  C4    . DG  F  2 3   ? 2.037   18.084  -44.900 1.00 34.90  ? 3   DG  F C4    1 
ATOM   5726  P  P     . DC  F  2 4   ? -3.378  15.541  -42.800 1.00 44.52  ? 4   DC  F P     1 
ATOM   5727  O  OP1   . DC  F  2 4   ? -4.154  15.530  -41.539 1.00 41.38  ? 4   DC  F OP1   1 
ATOM   5728  O  OP2   . DC  F  2 4   ? -3.765  14.755  -44.012 1.00 43.37  ? 4   DC  F OP2   1 
ATOM   5729  O  "O5'" . DC  F  2 4   ? -3.341  17.074  -43.205 1.00 43.66  ? 4   DC  F "O5'" 1 
ATOM   5730  C  "C5'" . DC  F  2 4   ? -2.987  18.042  -42.228 1.00 39.40  ? 4   DC  F "C5'" 1 
ATOM   5731  C  "C4'" . DC  F  2 4   ? -2.772  19.354  -42.932 1.00 40.12  ? 4   DC  F "C4'" 1 
ATOM   5732  O  "O4'" . DC  F  2 4   ? -1.660  19.241  -43.848 1.00 38.02  ? 4   DC  F "O4'" 1 
ATOM   5733  C  "C3'" . DC  F  2 4   ? -3.973  19.804  -43.780 1.00 39.08  ? 4   DC  F "C3'" 1 
ATOM   5734  O  "O3'" . DC  F  2 4   ? -4.460  21.045  -43.286 1.00 38.90  ? 4   DC  F "O3'" 1 
ATOM   5735  C  "C2'" . DC  F  2 4   ? -3.382  20.052  -45.154 1.00 37.14  ? 4   DC  F "C2'" 1 
ATOM   5736  C  "C1'" . DC  F  2 4   ? -1.922  20.219  -44.810 1.00 37.22  ? 4   DC  F "C1'" 1 
ATOM   5737  N  N1    . DC  F  2 4   ? -1.002  20.046  -45.923 1.00 33.40  ? 4   DC  F N1    1 
ATOM   5738  C  C2    . DC  F  2 4   ? -0.087  21.070  -46.160 1.00 32.54  ? 4   DC  F C2    1 
ATOM   5739  O  O2    . DC  F  2 4   ? -0.045  22.020  -45.371 1.00 30.79  ? 4   DC  F O2    1 
ATOM   5740  N  N3    . DC  F  2 4   ? 0.735   20.992  -47.229 1.00 31.12  ? 4   DC  F N3    1 
ATOM   5741  C  C4    . DC  F  2 4   ? 0.668   19.938  -48.041 1.00 29.49  ? 4   DC  F C4    1 
ATOM   5742  N  N4    . DC  F  2 4   ? 1.515   19.889  -49.068 1.00 30.91  ? 4   DC  F N4    1 
ATOM   5743  C  C5    . DC  F  2 4   ? -0.282  18.892  -47.842 1.00 28.92  ? 4   DC  F C5    1 
ATOM   5744  C  C6    . DC  F  2 4   ? -1.093  18.989  -46.781 1.00 30.55  ? 4   DC  F C6    1 
ATOM   5745  P  P     . DG  F  2 5   ? -5.893  21.626  -43.765 1.00 41.57  ? 5   DG  F P     1 
ATOM   5746  O  OP1   . DG  F  2 5   ? -6.057  21.429  -45.227 1.00 34.48  ? 5   DG  F OP1   1 
ATOM   5747  O  OP2   . DG  F  2 5   ? -5.956  23.007  -43.214 1.00 42.04  ? 5   DG  F OP2   1 
ATOM   5748  O  "O5'" . DG  F  2 5   ? -6.924  20.683  -42.984 1.00 36.58  ? 5   DG  F "O5'" 1 
ATOM   5749  C  "C5'" . DG  F  2 5   ? -6.991  20.822  -41.562 1.00 38.57  ? 5   DG  F "C5'" 1 
ATOM   5750  C  "C4'" . DG  F  2 5   ? -8.237  20.185  -41.004 1.00 40.11  ? 5   DG  F "C4'" 1 
ATOM   5751  O  "O4'" . DG  F  2 5   ? -9.415  20.894  -41.433 1.00 39.30  ? 5   DG  F "O4'" 1 
ATOM   5752  C  "C3'" . DG  F  2 5   ? -8.462  18.736  -41.410 1.00 41.08  ? 5   DG  F "C3'" 1 
ATOM   5753  O  "O3'" . DG  F  2 5   ? -9.125  18.162  -40.295 1.00 42.79  ? 5   DG  F "O3'" 1 
ATOM   5754  C  "C2'" . DG  F  2 5   ? -9.332  18.849  -42.645 1.00 41.00  ? 5   DG  F "C2'" 1 
ATOM   5755  C  "C1'" . DG  F  2 5   ? -10.152 20.106  -42.371 1.00 43.10  ? 5   DG  F "C1'" 1 
ATOM   5756  N  N9    . DG  F  2 5   ? -10.393 20.951  -43.534 1.00 40.82  ? 5   DG  F N9    1 
ATOM   5757  C  C8    . DG  F  2 5   ? -9.595  21.092  -44.644 1.00 41.36  ? 5   DG  F C8    1 
ATOM   5758  N  N7    . DG  F  2 5   ? -10.038 21.991  -45.479 1.00 42.92  ? 5   DG  F N7    1 
ATOM   5759  C  C5    . DG  F  2 5   ? -11.185 22.485  -44.874 1.00 39.62  ? 5   DG  F C5    1 
ATOM   5760  C  C6    . DG  F  2 5   ? -12.095 23.479  -45.308 1.00 37.67  ? 5   DG  F C6    1 
ATOM   5761  O  O6    . DG  F  2 5   ? -12.069 24.145  -46.342 1.00 35.33  ? 5   DG  F O6    1 
ATOM   5762  N  N1    . DG  F  2 5   ? -13.119 23.671  -44.390 1.00 43.86  ? 5   DG  F N1    1 
ATOM   5763  C  C2    . DG  F  2 5   ? -13.256 22.991  -43.207 1.00 45.72  ? 5   DG  F C2    1 
ATOM   5764  N  N2    . DG  F  2 5   ? -14.318 23.324  -42.460 1.00 52.06  ? 5   DG  F N2    1 
ATOM   5765  N  N3    . DG  F  2 5   ? -12.424 22.048  -42.796 1.00 37.39  ? 5   DG  F N3    1 
ATOM   5766  C  C4    . DG  F  2 5   ? -11.419 21.848  -43.674 1.00 36.31  ? 5   DG  F C4    1 
ATOM   5767  P  P     . DG  F  2 6   ? -9.545  16.613  -40.285 1.00 49.14  ? 6   DG  F P     1 
ATOM   5768  O  OP1   . DG  F  2 6   ? -9.588  16.187  -38.858 1.00 44.02  ? 6   DG  F OP1   1 
ATOM   5769  O  OP2   . DG  F  2 6   ? -8.777  15.859  -41.327 1.00 40.54  ? 6   DG  F OP2   1 
ATOM   5770  O  "O5'" . DG  F  2 6   ? -11.040 16.671  -40.799 1.00 42.98  ? 6   DG  F "O5'" 1 
ATOM   5771  C  "C5'" . DG  F  2 6   ? -12.026 17.319  -40.004 1.00 42.34  ? 6   DG  F "C5'" 1 
ATOM   5772  C  "C4'" . DG  F  2 6   ? -13.332 17.172  -40.735 1.00 45.91  ? 6   DG  F "C4'" 1 
ATOM   5773  O  "O4'" . DG  F  2 6   ? -13.351 18.073  -41.871 1.00 43.22  ? 6   DG  F "O4'" 1 
ATOM   5774  C  "C3'" . DG  F  2 6   ? -13.552 15.757  -41.296 1.00 46.98  ? 6   DG  F "C3'" 1 
ATOM   5775  O  "O3'" . DG  F  2 6   ? -14.820 15.394  -40.758 1.00 49.35  ? 6   DG  F "O3'" 1 
ATOM   5776  C  "C2'" . DG  F  2 6   ? -13.433 15.928  -42.806 1.00 45.33  ? 6   DG  F "C2'" 1 
ATOM   5777  C  "C1'" . DG  F  2 6   ? -13.874 17.374  -42.986 1.00 47.73  ? 6   DG  F "C1'" 1 
ATOM   5778  N  N9    . DG  F  2 6   ? -13.437 18.069  -44.190 1.00 42.38  ? 6   DG  F N9    1 
ATOM   5779  C  C8    . DG  F  2 6   ? -12.310 17.842  -44.942 1.00 43.88  ? 6   DG  F C8    1 
ATOM   5780  N  N7    . DG  F  2 6   ? -12.196 18.663  -45.951 1.00 42.74  ? 6   DG  F N7    1 
ATOM   5781  C  C5    . DG  F  2 6   ? -13.319 19.478  -45.861 1.00 42.94  ? 6   DG  F C5    1 
ATOM   5782  C  C6    . DG  F  2 6   ? -13.742 20.564  -46.679 1.00 43.04  ? 6   DG  F C6    1 
ATOM   5783  O  O6    . DG  F  2 6   ? -13.187 21.043  -47.676 1.00 46.58  ? 6   DG  F O6    1 
ATOM   5784  N  N1    . DG  F  2 6   ? -14.930 21.119  -46.218 1.00 39.69  ? 6   DG  F N1    1 
ATOM   5785  C  C2    . DG  F  2 6   ? -15.623 20.690  -45.115 1.00 44.32  ? 6   DG  F C2    1 
ATOM   5786  N  N2    . DG  F  2 6   ? -16.752 21.351  -44.834 1.00 40.84  ? 6   DG  F N2    1 
ATOM   5787  N  N3    . DG  F  2 6   ? -15.230 19.696  -44.332 1.00 43.44  ? 6   DG  F N3    1 
ATOM   5788  C  C4    . DG  F  2 6   ? -14.085 19.132  -44.770 1.00 39.82  ? 6   DG  F C4    1 
ATOM   5789  P  P     . DT  F  2 7   ? -15.593 14.108  -41.231 1.00 52.66  ? 7   DT  F P     1 
ATOM   5790  O  OP1   . DT  F  2 7   ? -16.388 13.658  -40.080 1.00 50.97  ? 7   DT  F OP1   1 
ATOM   5791  O  OP2   . DT  F  2 7   ? -14.644 13.209  -41.944 1.00 42.74  ? 7   DT  F OP2   1 
ATOM   5792  O  "O5'" . DT  F  2 7   ? -16.689 14.691  -42.235 1.00 59.95  ? 7   DT  F "O5'" 1 
ATOM   5793  C  "C5'" . DT  F  2 7   ? -17.420 15.907  -41.935 1.00 60.34  ? 7   DT  F "C5'" 1 
ATOM   5794  C  "C4'" . DT  F  2 7   ? -18.236 16.316  -43.139 1.00 64.50  ? 7   DT  F "C4'" 1 
ATOM   5795  O  "O4'" . DT  F  2 7   ? -17.425 17.040  -44.106 1.00 58.61  ? 7   DT  F "O4'" 1 
ATOM   5796  C  "C3'" . DT  F  2 7   ? -18.861 15.128  -43.891 1.00 64.21  ? 7   DT  F "C3'" 1 
ATOM   5797  O  "O3'" . DT  F  2 7   ? -20.283 15.313  -43.884 1.00 68.14  ? 7   DT  F "O3'" 1 
ATOM   5798  C  "C2'" . DT  F  2 7   ? -18.167 15.138  -45.243 1.00 60.41  ? 7   DT  F "C2'" 1 
ATOM   5799  C  "C1'" . DT  F  2 7   ? -17.799 16.604  -45.396 1.00 56.62  ? 7   DT  F "C1'" 1 
ATOM   5800  N  N1    . DT  F  2 7   ? -16.692 16.893  -46.338 1.00 55.01  ? 7   DT  F N1    1 
ATOM   5801  C  C2    . DT  F  2 7   ? -16.875 17.933  -47.226 1.00 48.73  ? 7   DT  F C2    1 
ATOM   5802  O  O2    . DT  F  2 7   ? -17.874 18.632  -47.239 1.00 47.74  ? 7   DT  F O2    1 
ATOM   5803  N  N3    . DT  F  2 7   ? -15.846 18.116  -48.111 1.00 43.81  ? 7   DT  F N3    1 
ATOM   5804  C  C4    . DT  F  2 7   ? -14.685 17.371  -48.208 1.00 40.80  ? 7   DT  F C4    1 
ATOM   5805  O  O4    . DT  F  2 7   ? -13.837 17.663  -49.047 1.00 39.52  ? 7   DT  F O4    1 
ATOM   5806  C  C5    . DT  F  2 7   ? -14.570 16.282  -47.269 1.00 41.66  ? 7   DT  F C5    1 
ATOM   5807  C  C7    . DT  F  2 7   ? -13.336 15.436  -47.293 1.00 38.86  ? 7   DT  F C7    1 
ATOM   5808  C  C6    . DT  F  2 7   ? -15.571 16.092  -46.397 1.00 45.45  ? 7   DT  F C6    1 
ATOM   5809  P  P     . DA  F  2 8   ? -21.300 14.323  -44.680 1.00 73.94  ? 8   DA  F P     1 
ATOM   5810  O  OP1   . DA  F  2 8   ? -22.546 14.248  -43.878 1.00 65.52  ? 8   DA  F OP1   1 
ATOM   5811  O  OP2   . DA  F  2 8   ? -20.585 13.087  -45.165 1.00 49.13  ? 8   DA  F OP2   1 
ATOM   5812  O  "O5'" . DA  F  2 8   ? -21.693 15.210  -45.935 1.00 70.93  ? 8   DA  F "O5'" 1 
ATOM   5813  C  "C5'" . DA  F  2 8   ? -22.068 16.581  -45.719 1.00 74.70  ? 8   DA  F "C5'" 1 
ATOM   5814  C  "C4'" . DA  F  2 8   ? -23.011 17.014  -46.813 1.00 68.98  ? 8   DA  F "C4'" 1 
ATOM   5815  O  "O4'" . DA  F  2 8   ? -22.224 17.628  -47.853 1.00 58.41  ? 8   DA  F "O4'" 1 
ATOM   5816  C  "C3'" . DA  F  2 8   ? -23.763 15.864  -47.487 1.00 65.90  ? 8   DA  F "C3'" 1 
ATOM   5817  O  "O3'" . DA  F  2 8   ? -25.071 16.260  -47.913 1.00 69.38  ? 8   DA  F "O3'" 1 
ATOM   5818  C  "C2'" . DA  F  2 8   ? -22.829 15.446  -48.606 1.00 59.56  ? 8   DA  F "C2'" 1 
ATOM   5819  C  "C1'" . DA  F  2 8   ? -22.093 16.727  -48.944 1.00 56.25  ? 8   DA  F "C1'" 1 
ATOM   5820  N  N9    . DA  F  2 8   ? -20.678 16.517  -49.198 1.00 50.85  ? 8   DA  F N9    1 
ATOM   5821  C  C8    . DA  F  2 8   ? -19.800 15.607  -48.661 1.00 51.56  ? 8   DA  F C8    1 
ATOM   5822  N  N7    . DA  F  2 8   ? -18.598 15.664  -49.182 1.00 48.02  ? 8   DA  F N7    1 
ATOM   5823  C  C5    . DA  F  2 8   ? -18.700 16.661  -50.146 1.00 45.49  ? 8   DA  F C5    1 
ATOM   5824  C  C6    . DA  F  2 8   ? -17.775 17.200  -51.055 1.00 42.83  ? 8   DA  F C6    1 
ATOM   5825  N  N6    . DA  F  2 8   ? -16.507 16.805  -51.139 1.00 41.77  ? 8   DA  F N6    1 
ATOM   5826  N  N1    . DA  F  2 8   ? -18.197 18.202  -51.864 1.00 41.37  ? 8   DA  F N1    1 
ATOM   5827  C  C2    . DA  F  2 8   ? -19.465 18.608  -51.771 1.00 38.15  ? 8   DA  F C2    1 
ATOM   5828  N  N3    . DA  F  2 8   ? -20.429 18.177  -50.961 1.00 42.49  ? 8   DA  F N3    1 
ATOM   5829  C  C4    . DA  F  2 8   ? -19.977 17.189  -50.168 1.00 47.56  ? 8   DA  F C4    1 
ATOM   5830  P  P     . DC  F  2 9   ? -25.918 15.356  -48.943 1.00 65.43  ? 9   DC  F P     1 
ATOM   5831  O  OP1   . DC  F  2 9   ? -27.345 15.379  -48.478 1.00 59.69  ? 9   DC  F OP1   1 
ATOM   5832  O  OP2   . DC  F  2 9   ? -25.227 14.051  -49.131 1.00 60.94  ? 9   DC  F OP2   1 
ATOM   5833  O  "O5'" . DC  F  2 9   ? -25.571 16.085  -50.317 1.00 58.32  ? 9   DC  F "O5'" 1 
ATOM   5834  C  "C5'" . DC  F  2 9   ? -26.450 16.115  -51.431 1.00 51.94  ? 9   DC  F "C5'" 1 
ATOM   5835  C  "C4'" . DC  F  2 9   ? -26.131 17.311  -52.295 1.00 47.10  ? 9   DC  F "C4'" 1 
ATOM   5836  O  "O4'" . DC  F  2 9   ? -24.711 17.583  -52.307 1.00 43.93  ? 9   DC  F "O4'" 1 
ATOM   5837  C  "C3'" . DC  F  2 9   ? -26.535 17.125  -53.748 1.00 42.69  ? 9   DC  F "C3'" 1 
ATOM   5838  O  "O3'" . DC  F  2 9   ? -27.102 18.355  -54.176 1.00 46.69  ? 9   DC  F "O3'" 1 
ATOM   5839  C  "C2'" . DC  F  2 9   ? -25.243 16.694  -54.415 1.00 43.26  ? 9   DC  F "C2'" 1 
ATOM   5840  C  "C1'" . DC  F  2 9   ? -24.171 17.390  -53.597 1.00 41.75  ? 9   DC  F "C1'" 1 
ATOM   5841  N  N1    . DC  F  2 9   ? -22.916 16.649  -53.444 1.00 42.78  ? 9   DC  F N1    1 
ATOM   5842  C  C2    . DC  F  2 9   ? -21.837 16.967  -54.275 1.00 48.29  ? 9   DC  F C2    1 
ATOM   5843  O  O2    . DC  F  2 9   ? -21.994 17.819  -55.157 1.00 49.89  ? 9   DC  F O2    1 
ATOM   5844  N  N3    . DC  F  2 9   ? -20.667 16.305  -54.125 1.00 41.00  ? 9   DC  F N3    1 
ATOM   5845  C  C4    . DC  F  2 9   ? -20.545 15.378  -53.173 1.00 42.71  ? 9   DC  F C4    1 
ATOM   5846  N  N4    . DC  F  2 9   ? -19.372 14.746  -53.060 1.00 41.95  ? 9   DC  F N4    1 
ATOM   5847  C  C5    . DC  F  2 9   ? -21.617 15.059  -52.291 1.00 39.37  ? 9   DC  F C5    1 
ATOM   5848  C  C6    . DC  F  2 9   ? -22.775 15.709  -52.463 1.00 43.61  ? 9   DC  F C6    1 
ATOM   5849  P  P     . DT  F  2 10  ? -28.162 18.362  -55.366 1.00 47.45  ? 10  DT  F P     1 
ATOM   5850  O  OP1   . DT  F  2 10  ? -28.802 19.710  -55.390 1.00 40.35  ? 10  DT  F OP1   1 
ATOM   5851  O  OP2   . DT  F  2 10  ? -29.005 17.156  -55.219 1.00 55.73  ? 10  DT  F OP2   1 
ATOM   5852  O  "O5'" . DT  F  2 10  ? -27.248 18.089  -56.637 1.00 38.02  ? 10  DT  F "O5'" 1 
ATOM   5853  C  "C5'" . DT  F  2 10  ? -26.326 19.098  -57.059 1.00 39.65  ? 10  DT  F "C5'" 1 
ATOM   5854  C  "C4'" . DT  F  2 10  ? -25.394 18.585  -58.130 1.00 42.44  ? 10  DT  F "C4'" 1 
ATOM   5855  O  "O4'" . DT  F  2 10  ? -24.347 17.793  -57.553 1.00 39.47  ? 10  DT  F "O4'" 1 
ATOM   5856  C  "C3'" . DT  F  2 10  ? -26.024 17.727  -59.230 1.00 45.00  ? 10  DT  F "C3'" 1 
ATOM   5857  O  "O3'" . DT  F  2 10  ? -25.793 18.470  -60.432 1.00 55.70  ? 10  DT  F "O3'" 1 
ATOM   5858  C  "C2'" . DT  F  2 10  ? -25.236 16.427  -59.180 1.00 47.23  ? 10  DT  F "C2'" 1 
ATOM   5859  C  "C1'" . DT  F  2 10  ? -23.943 16.845  -58.502 1.00 44.85  ? 10  DT  F "C1'" 1 
ATOM   5860  N  N1    . DT  F  2 10  ? -23.182 15.802  -57.782 1.00 45.22  ? 10  DT  F N1    1 
ATOM   5861  C  C2    . DT  F  2 10  ? -21.836 15.680  -58.043 1.00 47.31  ? 10  DT  F C2    1 
ATOM   5862  O  O2    . DT  F  2 10  ? -21.263 16.334  -58.897 1.00 49.42  ? 10  DT  F O2    1 
ATOM   5863  N  N3    . DT  F  2 10  ? -21.191 14.719  -57.298 1.00 49.15  ? 10  DT  F N3    1 
ATOM   5864  C  C4    . DT  F  2 10  ? -21.745 13.911  -56.321 1.00 50.98  ? 10  DT  F C4    1 
ATOM   5865  O  O4    . DT  F  2 10  ? -21.040 13.099  -55.726 1.00 54.40  ? 10  DT  F O4    1 
ATOM   5866  C  C5    . DT  F  2 10  ? -23.155 14.114  -56.080 1.00 49.99  ? 10  DT  F C5    1 
ATOM   5867  C  C7    . DT  F  2 10  ? -23.839 13.284  -55.040 1.00 55.35  ? 10  DT  F C7    1 
ATOM   5868  C  C6    . DT  F  2 10  ? -23.795 15.033  -56.815 1.00 50.88  ? 10  DT  F C6    1 
ATOM   5869  P  P     . DG  F  2 11  ? -26.662 18.229  -61.768 1.00 59.03  ? 11  DG  F P     1 
ATOM   5870  O  OP1   . DG  F  2 11  ? -26.763 19.537  -62.481 1.00 60.18  ? 11  DG  F OP1   1 
ATOM   5871  O  OP2   . DG  F  2 11  ? -27.904 17.518  -61.386 1.00 53.90  ? 11  DG  F OP2   1 
ATOM   5872  O  "O5'" . DG  F  2 11  ? -25.674 17.314  -62.626 1.00 60.60  ? 11  DG  F "O5'" 1 
ATOM   5873  C  "C5'" . DG  F  2 11  ? -24.397 17.843  -63.061 1.00 64.62  ? 11  DG  F "C5'" 1 
ATOM   5874  C  "C4'" . DG  F  2 11  ? -23.532 16.786  -63.718 1.00 70.00  ? 11  DG  F "C4'" 1 
ATOM   5875  O  "O4'" . DG  F  2 11  ? -22.974 15.887  -62.727 1.00 71.27  ? 11  DG  F "O4'" 1 
ATOM   5876  C  "C3'" . DG  F  2 11  ? -24.236 15.889  -64.738 1.00 71.69  ? 11  DG  F "C3'" 1 
ATOM   5877  O  "O3'" . DG  F  2 11  ? -23.339 15.573  -65.806 1.00 63.34  ? 11  DG  F "O3'" 1 
ATOM   5878  C  "C2'" . DG  F  2 11  ? -24.575 14.650  -63.930 1.00 69.12  ? 11  DG  F "C2'" 1 
ATOM   5879  C  "C1'" . DG  F  2 11  ? -23.358 14.551  -63.025 1.00 67.95  ? 11  DG  F "C1'" 1 
ATOM   5880  N  N9    . DG  F  2 11  ? -23.572 13.860  -61.761 1.00 64.09  ? 11  DG  F N9    1 
ATOM   5881  C  C8    . DG  F  2 11  ? -24.753 13.703  -61.071 1.00 63.08  ? 11  DG  F C8    1 
ATOM   5882  N  N7    . DG  F  2 11  ? -24.610 13.025  -59.964 1.00 56.38  ? 11  DG  F N7    1 
ATOM   5883  C  C5    . DG  F  2 11  ? -23.256 12.717  -59.921 1.00 47.95  ? 11  DG  F C5    1 
ATOM   5884  C  C6    . DG  F  2 11  ? -22.512 11.993  -58.960 1.00 53.63  ? 11  DG  F C6    1 
ATOM   5885  O  O6    . DG  F  2 11  ? -22.909 11.475  -57.908 1.00 60.60  ? 11  DG  F O6    1 
ATOM   5886  N  N1    . DG  F  2 11  ? -21.168 11.911  -59.311 1.00 53.83  ? 11  DG  F N1    1 
ATOM   5887  C  C2    . DG  F  2 11  ? -20.614 12.444  -60.447 1.00 49.93  ? 11  DG  F C2    1 
ATOM   5888  N  N2    . DG  F  2 11  ? -19.296 12.265  -60.600 1.00 48.95  ? 11  DG  F N2    1 
ATOM   5889  N  N3    . DG  F  2 11  ? -21.297 13.124  -61.352 1.00 52.93  ? 11  DG  F N3    1 
ATOM   5890  C  C4    . DG  F  2 11  ? -22.602 13.228  -61.021 1.00 52.63  ? 11  DG  F C4    1 
ATOM   5891  O  "O5'" . DC  G  3 1   ? -14.306 5.216   -57.358 1.00 81.43  ? 1   DC  G "O5'" 1 
ATOM   5892  C  "C5'" . DC  G  3 1   ? -13.719 5.541   -58.642 1.00 80.92  ? 1   DC  G "C5'" 1 
ATOM   5893  C  "C4'" . DC  G  3 1   ? -13.803 7.027   -58.914 1.00 75.77  ? 1   DC  G "C4'" 1 
ATOM   5894  O  "O4'" . DC  G  3 1   ? -15.101 7.600   -59.197 1.00 74.19  ? 1   DC  G "O4'" 1 
ATOM   5895  C  "C3'" . DC  G  3 1   ? -12.992 8.055   -58.128 1.00 73.96  ? 1   DC  G "C3'" 1 
ATOM   5896  O  "O3'" . DC  G  3 1   ? -12.090 8.747   -58.999 1.00 81.13  ? 1   DC  G "O3'" 1 
ATOM   5897  C  "C2'" . DC  G  3 1   ? -14.065 8.965   -57.558 1.00 69.73  ? 1   DC  G "C2'" 1 
ATOM   5898  C  "C1'" . DC  G  3 1   ? -15.190 8.884   -58.590 1.00 67.25  ? 1   DC  G "C1'" 1 
ATOM   5899  N  N1    . DC  G  3 1   ? -16.553 9.047   -58.045 1.00 59.65  ? 1   DC  G N1    1 
ATOM   5900  C  C2    . DC  G  3 1   ? -17.490 9.777   -58.787 1.00 61.83  ? 1   DC  G C2    1 
ATOM   5901  O  O2    . DC  G  3 1   ? -17.155 10.238  -59.889 1.00 70.48  ? 1   DC  G O2    1 
ATOM   5902  N  N3    . DC  G  3 1   ? -18.734 9.957   -58.289 1.00 56.10  ? 1   DC  G N3    1 
ATOM   5903  C  C4    . DC  G  3 1   ? -19.051 9.457   -57.093 1.00 61.36  ? 1   DC  G C4    1 
ATOM   5904  N  N4    . DC  G  3 1   ? -20.286 9.668   -56.633 1.00 63.22  ? 1   DC  G N4    1 
ATOM   5905  C  C5    . DC  G  3 1   ? -18.113 8.719   -56.312 1.00 59.31  ? 1   DC  G C5    1 
ATOM   5906  C  C6    . DC  G  3 1   ? -16.888 8.541   -56.820 1.00 57.99  ? 1   DC  G C6    1 
ATOM   5907  P  P     . DA  G  3 2   ? -11.131 9.907   -58.421 1.00 84.18  ? 2   DA  G P     1 
ATOM   5908  O  OP1   . DA  G  3 2   ? -9.752  9.722   -58.959 1.00 75.90  ? 2   DA  G OP1   1 
ATOM   5909  O  OP2   . DA  G  3 2   ? -11.355 9.993   -56.956 1.00 86.41  ? 2   DA  G OP2   1 
ATOM   5910  O  "O5'" . DA  G  3 2   ? -11.689 11.210  -59.142 1.00 79.92  ? 2   DA  G "O5'" 1 
ATOM   5911  C  "C5'" . DA  G  3 2   ? -11.398 11.463  -60.527 1.00 69.36  ? 2   DA  G "C5'" 1 
ATOM   5912  C  "C4'" . DA  G  3 2   ? -12.062 12.750  -60.956 1.00 65.37  ? 2   DA  G "C4'" 1 
ATOM   5913  O  "O4'" . DA  G  3 2   ? -13.424 12.795  -60.468 1.00 57.44  ? 2   DA  G "O4'" 1 
ATOM   5914  C  "C3'" . DA  G  3 2   ? -11.396 14.021  -60.427 1.00 63.71  ? 2   DA  G "C3'" 1 
ATOM   5915  O  "O3'" . DA  G  3 2   ? -11.510 14.989  -61.469 1.00 59.23  ? 2   DA  G "O3'" 1 
ATOM   5916  C  "C2'" . DA  G  3 2   ? -12.209 14.349  -59.185 1.00 58.23  ? 2   DA  G "C2'" 1 
ATOM   5917  C  "C1'" . DA  G  3 2   ? -13.599 13.911  -59.602 1.00 51.14  ? 2   DA  G "C1'" 1 
ATOM   5918  N  N9    . DA  G  3 2   ? -14.481 13.490  -58.525 1.00 46.23  ? 2   DA  G N9    1 
ATOM   5919  C  C8    . DA  G  3 2   ? -14.204 12.663  -57.469 1.00 43.37  ? 2   DA  G C8    1 
ATOM   5920  N  N7    . DA  G  3 2   ? -15.235 12.435  -56.693 1.00 42.46  ? 2   DA  G N7    1 
ATOM   5921  C  C5    . DA  G  3 2   ? -16.259 13.167  -57.275 1.00 42.04  ? 2   DA  G C5    1 
ATOM   5922  C  C6    . DA  G  3 2   ? -17.613 13.339  -56.935 1.00 42.94  ? 2   DA  G C6    1 
ATOM   5923  N  N6    . DA  G  3 2   ? -18.187 12.781  -55.870 1.00 44.85  ? 2   DA  G N6    1 
ATOM   5924  N  N1    . DA  G  3 2   ? -18.359 14.148  -57.716 1.00 45.77  ? 2   DA  G N1    1 
ATOM   5925  C  C2    . DA  G  3 2   ? -17.785 14.709  -58.787 1.00 48.03  ? 2   DA  G C2    1 
ATOM   5926  N  N3    . DA  G  3 2   ? -16.527 14.612  -59.217 1.00 47.72  ? 2   DA  G N3    1 
ATOM   5927  C  C4    . DA  G  3 2   ? -15.811 13.812  -58.410 1.00 43.78  ? 2   DA  G C4    1 
ATOM   5928  P  P     . DG  G  3 3   ? -10.653 16.332  -61.456 1.00 68.97  ? 3   DG  G P     1 
ATOM   5929  O  OP1   . DG  G  3 3   ? -10.239 16.611  -62.854 1.00 64.05  ? 3   DG  G OP1   1 
ATOM   5930  O  OP2   . DG  G  3 3   ? -9.632  16.264  -60.369 1.00 68.92  ? 3   DG  G OP2   1 
ATOM   5931  O  "O5'" . DG  G  3 3   ? -11.748 17.421  -61.077 1.00 60.76  ? 3   DG  G "O5'" 1 
ATOM   5932  C  "C5'" . DG  G  3 3   ? -13.030 17.388  -61.712 1.00 46.41  ? 3   DG  G "C5'" 1 
ATOM   5933  C  "C4'" . DG  G  3 3   ? -13.895 18.505  -61.188 1.00 40.78  ? 3   DG  G "C4'" 1 
ATOM   5934  O  "O4'" . DG  G  3 3   ? -14.782 17.982  -60.189 1.00 36.18  ? 3   DG  G "O4'" 1 
ATOM   5935  C  "C3'" . DG  G  3 3   ? -13.162 19.679  -60.534 1.00 38.11  ? 3   DG  G "C3'" 1 
ATOM   5936  O  "O3'" . DG  G  3 3   ? -13.817 20.835  -61.065 1.00 32.60  ? 3   DG  G "O3'" 1 
ATOM   5937  C  "C2'" . DG  G  3 3   ? -13.339 19.416  -59.048 1.00 33.83  ? 3   DG  G "C2'" 1 
ATOM   5938  C  "C1'" . DG  G  3 3   ? -14.709 18.764  -59.010 1.00 32.83  ? 3   DG  G "C1'" 1 
ATOM   5939  N  N9    . DG  G  3 3   ? -14.962 17.884  -57.872 1.00 32.74  ? 3   DG  G N9    1 
ATOM   5940  C  C8    . DG  G  3 3   ? -14.056 17.054  -57.259 1.00 33.91  ? 3   DG  G C8    1 
ATOM   5941  N  N7    . DG  G  3 3   ? -14.569 16.385  -56.261 1.00 36.38  ? 3   DG  G N7    1 
ATOM   5942  C  C5    . DG  G  3 3   ? -15.898 16.776  -56.230 1.00 32.46  ? 3   DG  G C5    1 
ATOM   5943  C  C6    . DG  G  3 3   ? -16.954 16.373  -55.373 1.00 38.10  ? 3   DG  G C6    1 
ATOM   5944  O  O6    . DG  G  3 3   ? -16.924 15.566  -54.438 1.00 47.37  ? 3   DG  G O6    1 
ATOM   5945  N  N1    . DG  G  3 3   ? -18.145 17.017  -55.689 1.00 34.19  ? 3   DG  G N1    1 
ATOM   5946  C  C2    . DG  G  3 3   ? -18.303 17.918  -56.711 1.00 31.34  ? 3   DG  G C2    1 
ATOM   5947  N  N2    . DG  G  3 3   ? -19.531 18.439  -56.853 1.00 30.81  ? 3   DG  G N2    1 
ATOM   5948  N  N3    . DG  G  3 3   ? -17.326 18.302  -57.519 1.00 32.64  ? 3   DG  G N3    1 
ATOM   5949  C  C4    . DG  G  3 3   ? -16.159 17.699  -57.220 1.00 32.11  ? 3   DG  G C4    1 
ATOM   5950  P  P     . DT  G  3 4   ? -13.367 22.283  -60.699 1.00 30.01  ? 4   DT  G P     1 
ATOM   5951  O  OP1   . DT  G  3 4   ? -13.720 23.177  -61.824 1.00 27.07  ? 4   DT  G OP1   1 
ATOM   5952  O  OP2   . DT  G  3 4   ? -11.947 22.239  -60.253 1.00 31.29  ? 4   DT  G OP2   1 
ATOM   5953  O  "O5'" . DT  G  3 4   ? -14.378 22.615  -59.527 1.00 30.12  ? 4   DT  G "O5'" 1 
ATOM   5954  C  "C5'" . DT  G  3 4   ? -15.793 22.525  -59.780 1.00 30.99  ? 4   DT  G "C5'" 1 
ATOM   5955  C  "C4'" . DT  G  3 4   ? -16.581 22.836  -58.531 1.00 28.47  ? 4   DT  G "C4'" 1 
ATOM   5956  O  "O4'" . DT  G  3 4   ? -16.549 21.672  -57.703 1.00 31.40  ? 4   DT  G "O4'" 1 
ATOM   5957  C  "C3'" . DT  G  3 4   ? -16.069 23.989  -57.651 1.00 28.95  ? 4   DT  G "C3'" 1 
ATOM   5958  O  "O3'" . DT  G  3 4   ? -16.936 25.116  -57.785 1.00 23.01  ? 4   DT  G "O3'" 1 
ATOM   5959  C  "C2'" . DT  G  3 4   ? -16.104 23.433  -56.231 1.00 30.12  ? 4   DT  G "C2'" 1 
ATOM   5960  C  "C1'" . DT  G  3 4   ? -16.763 22.062  -56.361 1.00 31.09  ? 4   DT  G "C1'" 1 
ATOM   5961  N  N1    . DT  G  3 4   ? -16.189 21.002  -55.496 1.00 32.76  ? 4   DT  G N1    1 
ATOM   5962  C  C2    . DT  G  3 4   ? -17.025 20.367  -54.609 1.00 32.20  ? 4   DT  G C2    1 
ATOM   5963  O  O2    . DT  G  3 4   ? -18.208 20.643  -54.493 1.00 34.41  ? 4   DT  G O2    1 
ATOM   5964  N  N3    . DT  G  3 4   ? -16.425 19.389  -53.860 1.00 32.15  ? 4   DT  G N3    1 
ATOM   5965  C  C4    . DT  G  3 4   ? -15.092 19.018  -53.883 1.00 34.46  ? 4   DT  G C4    1 
ATOM   5966  O  O4    . DT  G  3 4   ? -14.689 18.148  -53.126 1.00 37.31  ? 4   DT  G O4    1 
ATOM   5967  C  C5    . DT  G  3 4   ? -14.271 19.723  -54.834 1.00 35.55  ? 4   DT  G C5    1 
ATOM   5968  C  C7    . DT  G  3 4   ? -12.815 19.387  -54.926 1.00 33.95  ? 4   DT  G C7    1 
ATOM   5969  C  C6    . DT  G  3 4   ? -14.861 20.645  -55.610 1.00 32.96  ? 4   DT  G C6    1 
ATOM   5970  P  P     . DA  G  3 5   ? -16.591 26.499  -57.058 1.00 25.24  ? 5   DA  G P     1 
ATOM   5971  O  OP1   . DA  G  3 5   ? -17.234 27.602  -57.820 1.00 26.99  ? 5   DA  G OP1   1 
ATOM   5972  O  OP2   . DA  G  3 5   ? -15.162 26.595  -56.848 1.00 25.12  ? 5   DA  G OP2   1 
ATOM   5973  O  "O5'" . DA  G  3 5   ? -17.345 26.327  -55.665 1.00 23.33  ? 5   DA  G "O5'" 1 
ATOM   5974  C  "C5'" . DA  G  3 5   ? -18.709 25.881  -55.654 1.00 25.70  ? 5   DA  G "C5'" 1 
ATOM   5975  C  "C4'" . DA  G  3 5   ? -19.147 25.529  -54.256 1.00 29.21  ? 5   DA  G "C4'" 1 
ATOM   5976  O  "O4'" . DA  G  3 5   ? -18.561 24.259  -53.919 1.00 30.55  ? 5   DA  G "O4'" 1 
ATOM   5977  C  "C3'" . DA  G  3 5   ? -18.708 26.504  -53.157 1.00 27.96  ? 5   DA  G "C3'" 1 
ATOM   5978  O  "O3'" . DA  G  3 5   ? -19.821 27.264  -52.711 1.00 28.57  ? 5   DA  G "O3'" 1 
ATOM   5979  C  "C2'" . DA  G  3 5   ? -18.285 25.607  -52.013 1.00 29.19  ? 5   DA  G "C2'" 1 
ATOM   5980  C  "C1'" . DA  G  3 5   ? -18.367 24.183  -52.530 1.00 28.59  ? 5   DA  G "C1'" 1 
ATOM   5981  N  N9    . DA  G  3 5   ? -17.144 23.415  -52.295 1.00 28.85  ? 5   DA  G N9    1 
ATOM   5982  C  C8    . DA  G  3 5   ? -15.893 23.591  -52.831 1.00 27.60  ? 5   DA  G C8    1 
ATOM   5983  N  N7    . DA  G  3 5   ? -15.017 22.699  -52.430 1.00 30.40  ? 5   DA  G N7    1 
ATOM   5984  C  C5    . DA  G  3 5   ? -15.735 21.898  -51.552 1.00 27.21  ? 5   DA  G C5    1 
ATOM   5985  C  C6    . DA  G  3 5   ? -15.365 20.803  -50.751 1.00 30.22  ? 5   DA  G C6    1 
ATOM   5986  N  N6    . DA  G  3 5   ? -14.136 20.282  -50.728 1.00 30.64  ? 5   DA  G N6    1 
ATOM   5987  N  N1    . DA  G  3 5   ? -16.322 20.231  -49.989 1.00 27.76  ? 5   DA  G N1    1 
ATOM   5988  C  C2    . DA  G  3 5   ? -17.556 20.759  -50.006 1.00 27.00  ? 5   DA  G C2    1 
ATOM   5989  N  N3    . DA  G  3 5   ? -18.016 21.802  -50.695 1.00 26.75  ? 5   DA  G N3    1 
ATOM   5990  C  C4    . DA  G  3 5   ? -17.045 22.328  -51.459 1.00 26.67  ? 5   DA  G C4    1 
ATOM   5991  P  P     . DC  G  3 6   ? -19.619 28.569  -51.801 1.00 27.66  ? 6   DC  G P     1 
ATOM   5992  O  OP1   . DC  G  3 6   ? -20.730 29.485  -52.127 1.00 27.89  ? 6   DC  G OP1   1 
ATOM   5993  O  OP2   . DC  G  3 6   ? -18.250 29.046  -51.974 1.00 30.60  ? 6   DC  G OP2   1 
ATOM   5994  O  "O5'" . DC  G  3 6   ? -19.728 28.003  -50.327 1.00 29.93  ? 6   DC  G "O5'" 1 
ATOM   5995  C  "C5'" . DC  G  3 6   ? -20.992 27.582  -49.814 1.00 31.19  ? 6   DC  G "C5'" 1 
ATOM   5996  C  "C4'" . DC  G  3 6   ? -20.853 26.556  -48.711 1.00 31.77  ? 6   DC  G "C4'" 1 
ATOM   5997  O  "O4'" . DC  G  3 6   ? -19.811 25.581  -48.961 1.00 34.34  ? 6   DC  G "O4'" 1 
ATOM   5998  C  "C3'" . DC  G  3 6   ? -20.563 27.133  -47.329 1.00 32.77  ? 6   DC  G "C3'" 1 
ATOM   5999  O  "O3'" . DC  G  3 6   ? -21.442 26.468  -46.419 1.00 44.01  ? 6   DC  G "O3'" 1 
ATOM   6000  C  "C2'" . DC  G  3 6   ? -19.135 26.708  -47.050 1.00 32.76  ? 6   DC  G "C2'" 1 
ATOM   6001  C  "C1'" . DC  G  3 6   ? -19.100 25.370  -47.744 1.00 31.76  ? 6   DC  G "C1'" 1 
ATOM   6002  N  N1    . DC  G  3 6   ? -17.749 24.904  -48.081 1.00 31.31  ? 6   DC  G N1    1 
ATOM   6003  C  C2    . DC  G  3 6   ? -17.259 23.741  -47.485 1.00 29.74  ? 6   DC  G C2    1 
ATOM   6004  O  O2    . DC  G  3 6   ? -17.988 23.111  -46.719 1.00 34.11  ? 6   DC  G O2    1 
ATOM   6005  N  N3    . DC  G  3 6   ? -16.036 23.290  -47.821 1.00 28.90  ? 6   DC  G N3    1 
ATOM   6006  C  C4    . DC  G  3 6   ? -15.289 23.979  -48.682 1.00 31.34  ? 6   DC  G C4    1 
ATOM   6007  N  N4    . DC  G  3 6   ? -14.074 23.514  -48.960 1.00 35.87  ? 6   DC  G N4    1 
ATOM   6008  C  C5    . DC  G  3 6   ? -15.751 25.182  -49.287 1.00 29.78  ? 6   DC  G C5    1 
ATOM   6009  C  C6    . DC  G  3 6   ? -16.977 25.602  -48.964 1.00 31.20  ? 6   DC  G C6    1 
ATOM   6010  O  OP3   . DG  H  4 1   ? 8.490   31.034  -52.337 1.00 43.77  ? 1   DG  H OP3   1 
ATOM   6011  P  P     . DG  H  4 1   ? 7.343   30.318  -52.929 1.00 42.97  ? 1   DG  H P     1 
ATOM   6012  O  OP1   . DG  H  4 1   ? 6.527   31.249  -53.781 1.00 35.44  ? 1   DG  H OP1   1 
ATOM   6013  O  OP2   . DG  H  4 1   ? 7.747   28.997  -53.444 1.00 47.67  ? 1   DG  H OP2   1 
ATOM   6014  O  "O5'" . DG  H  4 1   ? 6.466   29.946  -51.668 1.00 37.31  ? 1   DG  H "O5'" 1 
ATOM   6015  C  "C5'" . DG  H  4 1   ? 7.009   29.331  -50.504 1.00 32.79  ? 1   DG  H "C5'" 1 
ATOM   6016  C  "C4'" . DG  H  4 1   ? 5.888   29.373  -49.497 1.00 31.51  ? 1   DG  H "C4'" 1 
ATOM   6017  O  "O4'" . DG  H  4 1   ? 4.761   28.660  -50.036 1.00 29.68  ? 1   DG  H "O4'" 1 
ATOM   6018  C  "C3'" . DG  H  4 1   ? 6.163   28.753  -48.142 1.00 30.54  ? 1   DG  H "C3'" 1 
ATOM   6019  O  "O3'" . DG  H  4 1   ? 6.674   29.776  -47.288 1.00 29.83  ? 1   DG  H "O3'" 1 
ATOM   6020  C  "C2'" . DG  H  4 1   ? 4.798   28.255  -47.707 1.00 29.80  ? 1   DG  H "C2'" 1 
ATOM   6021  C  "C1'" . DG  H  4 1   ? 4.129   27.888  -49.018 1.00 31.16  ? 1   DG  H "C1'" 1 
ATOM   6022  N  N9    . DG  H  4 1   ? 4.197   26.475  -49.409 1.00 30.80  ? 1   DG  H N9    1 
ATOM   6023  C  C8    . DG  H  4 1   ? 4.891   25.917  -50.456 1.00 28.46  ? 1   DG  H C8    1 
ATOM   6024  N  N7    . DG  H  4 1   ? 4.715   24.627  -50.555 1.00 30.09  ? 1   DG  H N7    1 
ATOM   6025  C  C5    . DG  H  4 1   ? 3.857   24.317  -49.509 1.00 27.18  ? 1   DG  H C5    1 
ATOM   6026  C  C6    . DG  H  4 1   ? 3.287   23.081  -49.127 1.00 26.50  ? 1   DG  H C6    1 
ATOM   6027  O  O6    . DG  H  4 1   ? 3.466   21.968  -49.622 1.00 31.98  ? 1   DG  H O6    1 
ATOM   6028  N  N1    . DG  H  4 1   ? 2.454   23.220  -48.026 1.00 25.27  ? 1   DG  H N1    1 
ATOM   6029  C  C2    . DG  H  4 1   ? 2.207   24.399  -47.370 1.00 25.49  ? 1   DG  H C2    1 
ATOM   6030  N  N2    . DG  H  4 1   ? 1.376   24.335  -46.336 1.00 24.34  ? 1   DG  H N2    1 
ATOM   6031  N  N3    . DG  H  4 1   ? 2.735   25.558  -47.712 1.00 28.34  ? 1   DG  H N3    1 
ATOM   6032  C  C4    . DG  H  4 1   ? 3.522   25.449  -48.801 1.00 27.01  ? 1   DG  H C4    1 
ATOM   6033  P  P     . DC  H  4 2   ? 7.728   29.387  -46.191 1.00 26.87  ? 2   DC  H P     1 
ATOM   6034  O  OP1   . DC  H  4 2   ? 8.207   30.652  -45.531 1.00 28.55  ? 2   DC  H OP1   1 
ATOM   6035  O  OP2   . DC  H  4 2   ? 8.678   28.432  -46.813 1.00 26.83  ? 2   DC  H OP2   1 
ATOM   6036  O  "O5'" . DC  H  4 2   ? 6.849   28.587  -45.141 1.00 25.59  ? 2   DC  H "O5'" 1 
ATOM   6037  C  "C5'" . DC  H  4 2   ? 5.795   29.266  -44.502 1.00 28.09  ? 2   DC  H "C5'" 1 
ATOM   6038  C  "C4'" . DC  H  4 2   ? 5.255   28.407  -43.394 1.00 27.95  ? 2   DC  H "C4'" 1 
ATOM   6039  O  "O4'" . DC  H  4 2   ? 4.630   27.234  -43.973 1.00 27.95  ? 2   DC  H "O4'" 1 
ATOM   6040  C  "C3'" . DC  H  4 2   ? 6.328   27.925  -42.426 1.00 28.86  ? 2   DC  H "C3'" 1 
ATOM   6041  O  "O3'" . DC  H  4 2   ? 5.852   28.102  -41.096 1.00 28.43  ? 2   DC  H "O3'" 1 
ATOM   6042  C  "C2'" . DC  H  4 2   ? 6.501   26.460  -42.774 1.00 31.25  ? 2   DC  H "C2'" 1 
ATOM   6043  C  "C1'" . DC  H  4 2   ? 5.158   26.052  -43.399 1.00 30.01  ? 2   DC  H "C1'" 1 
ATOM   6044  N  N1    . DC  H  4 2   ? 5.330   25.070  -44.485 1.00 26.74  ? 2   DC  H N1    1 
ATOM   6045  C  C2    . DC  H  4 2   ? 4.687   23.828  -44.416 1.00 27.23  ? 2   DC  H C2    1 
ATOM   6046  O  O2    . DC  H  4 2   ? 3.986   23.565  -43.428 1.00 27.52  ? 2   DC  H O2    1 
ATOM   6047  N  N3    . DC  H  4 2   ? 4.873   22.934  -45.411 1.00 27.61  ? 2   DC  H N3    1 
ATOM   6048  C  C4    . DC  H  4 2   ? 5.641   23.248  -46.456 1.00 27.19  ? 2   DC  H C4    1 
ATOM   6049  N  N4    . DC  H  4 2   ? 5.795   22.334  -47.416 1.00 31.45  ? 2   DC  H N4    1 
ATOM   6050  C  C5    . DC  H  4 2   ? 6.301   24.506  -46.555 1.00 28.93  ? 2   DC  H C5    1 
ATOM   6051  C  C6    . DC  H  4 2   ? 6.111   25.382  -45.561 1.00 27.93  ? 2   DC  H C6    1 
ATOM   6052  P  P     . DC  H  4 3   ? 6.716   27.584  -39.888 1.00 29.27  ? 3   DC  H P     1 
ATOM   6053  O  OP1   . DC  H  4 3   ? 6.549   28.555  -38.772 1.00 32.41  ? 3   DC  H OP1   1 
ATOM   6054  O  OP2   . DC  H  4 3   ? 8.034   27.263  -40.407 1.00 29.78  ? 3   DC  H OP2   1 
ATOM   6055  O  "O5'" . DC  H  4 3   ? 6.036   26.209  -39.463 1.00 30.92  ? 3   DC  H "O5'" 1 
ATOM   6056  C  "C5'" . DC  H  4 3   ? 4.609   26.079  -39.254 1.00 34.77  ? 3   DC  H "C5'" 1 
ATOM   6057  C  "C4'" . DC  H  4 3   ? 4.263   24.637  -38.966 1.00 35.62  ? 3   DC  H "C4'" 1 
ATOM   6058  O  "O4'" . DC  H  4 3   ? 4.390   23.882  -40.181 1.00 35.04  ? 3   DC  H "O4'" 1 
ATOM   6059  C  "C3'" . DC  H  4 3   ? 5.211   23.993  -37.948 1.00 42.78  ? 3   DC  H "C3'" 1 
ATOM   6060  O  "O3'" . DC  H  4 3   ? 4.605   23.531  -36.740 1.00 47.11  ? 3   DC  H "O3'" 1 
ATOM   6061  C  "C2'" . DC  H  4 3   ? 5.845   22.815  -38.666 1.00 42.24  ? 3   DC  H "C2'" 1 
ATOM   6062  C  "C1'" . DC  H  4 3   ? 5.030   22.638  -39.924 1.00 38.68  ? 3   DC  H "C1'" 1 
ATOM   6063  N  N1    . DC  H  4 3   ? 5.838   22.307  -41.099 1.00 30.65  ? 3   DC  H N1    1 
ATOM   6064  C  C2    . DC  H  4 3   ? 5.665   21.066  -41.699 1.00 28.41  ? 3   DC  H C2    1 
ATOM   6065  O  O2    . DC  H  4 3   ? 4.852   20.273  -41.198 1.00 26.89  ? 3   DC  H O2    1 
ATOM   6066  N  N3    . DC  H  4 3   ? 6.357   20.772  -42.829 1.00 28.24  ? 3   DC  H N3    1 
ATOM   6067  C  C4    . DC  H  4 3   ? 7.209   21.667  -43.339 1.00 29.34  ? 3   DC  H C4    1 
ATOM   6068  N  N4    . DC  H  4 3   ? 7.881   21.336  -44.448 1.00 28.23  ? 3   DC  H N4    1 
ATOM   6069  C  C5    . DC  H  4 3   ? 7.428   22.934  -42.722 1.00 28.07  ? 3   DC  H C5    1 
ATOM   6070  C  C6    . DC  H  4 3   ? 6.716   23.215  -41.625 1.00 30.59  ? 3   DC  H C6    1 
ATOM   6071  P  P     . DG  H  4 4   ? 5.550   23.266  -35.482 1.00 46.51  ? 4   DG  H P     1 
ATOM   6072  O  OP1   . DG  H  4 4   ? 4.868   23.800  -34.290 1.00 44.78  ? 4   DG  H OP1   1 
ATOM   6073  O  OP2   . DG  H  4 4   ? 6.919   23.725  -35.826 1.00 39.61  ? 4   DG  H OP2   1 
ATOM   6074  O  "O5'" . DG  H  4 4   ? 5.578   21.677  -35.417 1.00 44.76  ? 4   DG  H "O5'" 1 
ATOM   6075  C  "C5'" . DG  H  4 4   ? 4.365   20.928  -35.575 1.00 40.41  ? 4   DG  H "C5'" 1 
ATOM   6076  C  "C4'" . DG  H  4 4   ? 4.698   19.462  -35.719 1.00 39.60  ? 4   DG  H "C4'" 1 
ATOM   6077  O  "O4'" . DG  H  4 4   ? 5.305   19.231  -37.010 1.00 38.22  ? 4   DG  H "O4'" 1 
ATOM   6078  C  "C3'" . DG  H  4 4   ? 5.701   18.938  -34.689 1.00 38.44  ? 4   DG  H "C3'" 1 
ATOM   6079  O  "O3'" . DG  H  4 4   ? 5.360   17.586  -34.394 1.00 42.58  ? 4   DG  H "O3'" 1 
ATOM   6080  C  "C2'" . DG  H  4 4   ? 7.032   19.060  -35.410 1.00 36.95  ? 4   DG  H "C2'" 1 
ATOM   6081  C  "C1'" . DG  H  4 4   ? 6.630   18.727  -36.838 1.00 35.86  ? 4   DG  H "C1'" 1 
ATOM   6082  N  N9    . DG  H  4 4   ? 7.458   19.318  -37.872 1.00 30.44  ? 4   DG  H N9    1 
ATOM   6083  C  C8    . DG  H  4 4   ? 8.078   20.545  -37.860 1.00 30.86  ? 4   DG  H C8    1 
ATOM   6084  N  N7    . DG  H  4 4   ? 8.721   20.806  -38.969 1.00 30.86  ? 4   DG  H N7    1 
ATOM   6085  C  C5    . DG  H  4 4   ? 8.529   19.673  -39.750 1.00 31.61  ? 4   DG  H C5    1 
ATOM   6086  C  C6    . DG  H  4 4   ? 8.997   19.363  -41.053 1.00 32.26  ? 4   DG  H C6    1 
ATOM   6087  O  O6    . DG  H  4 4   ? 9.704   20.048  -41.803 1.00 38.65  ? 4   DG  H O6    1 
ATOM   6088  N  N1    . DG  H  4 4   ? 8.556   18.112  -41.470 1.00 31.32  ? 4   DG  H N1    1 
ATOM   6089  C  C2    . DG  H  4 4   ? 7.801   17.249  -40.711 1.00 35.09  ? 4   DG  H C2    1 
ATOM   6090  N  N2    . DG  H  4 4   ? 7.483   16.082  -41.284 1.00 39.96  ? 4   DG  H N2    1 
ATOM   6091  N  N3    . DG  H  4 4   ? 7.325   17.541  -39.514 1.00 32.90  ? 4   DG  H N3    1 
ATOM   6092  C  C4    . DG  H  4 4   ? 7.725   18.760  -39.097 1.00 32.59  ? 4   DG  H C4    1 
ATOM   6093  N  N     . THR I  1 7   ? -41.078 -30.934 -44.432 1.00 58.32  ? 250 THR I N     1 
ATOM   6094  C  CA    . THR I  1 7   ? -40.875 -31.368 -43.010 1.00 62.62  ? 250 THR I CA    1 
ATOM   6095  C  C     . THR I  1 7   ? -39.393 -31.464 -42.550 1.00 65.92  ? 250 THR I C     1 
ATOM   6096  O  O     . THR I  1 7   ? -38.450 -31.185 -43.298 1.00 63.89  ? 250 THR I O     1 
ATOM   6097  C  CB    . THR I  1 7   ? -41.551 -32.739 -42.749 1.00 66.13  ? 250 THR I CB    1 
ATOM   6098  O  OG1   . THR I  1 7   ? -40.971 -33.740 -43.600 1.00 66.12  ? 250 THR I OG1   1 
ATOM   6099  C  CG2   . THR I  1 7   ? -43.056 -32.647 -42.978 1.00 66.63  ? 250 THR I CG2   1 
ATOM   6100  N  N     . ASN I  1 8   ? -39.208 -31.898 -41.308 1.00 62.39  ? 251 ASN I N     1 
ATOM   6101  C  CA    . ASN I  1 8   ? -37.912 -31.930 -40.690 1.00 56.47  ? 251 ASN I CA    1 
ATOM   6102  C  C     . ASN I  1 8   ? -37.546 -33.358 -40.302 1.00 59.55  ? 251 ASN I C     1 
ATOM   6103  O  O     . ASN I  1 8   ? -38.100 -33.952 -39.359 1.00 54.54  ? 251 ASN I O     1 
ATOM   6104  C  CB    . ASN I  1 8   ? -37.918 -30.979 -39.480 1.00 57.37  ? 251 ASN I CB    1 
ATOM   6105  C  CG    . ASN I  1 8   ? -36.740 -31.177 -38.552 1.00 51.78  ? 251 ASN I CG    1 
ATOM   6106  O  OD1   . ASN I  1 8   ? -35.774 -31.852 -38.888 1.00 51.06  ? 251 ASN I OD1   1 
ATOM   6107  N  ND2   . ASN I  1 8   ? -36.824 -30.587 -37.364 1.00 51.92  ? 251 ASN I ND2   1 
ATOM   6108  N  N     . HIS I  1 9   ? -36.546 -33.886 -40.993 1.00 56.48  ? 252 HIS I N     1 
ATOM   6109  C  CA    . HIS I  1 9   ? -36.192 -35.273 -40.827 1.00 55.62  ? 252 HIS I CA    1 
ATOM   6110  C  C     . HIS I  1 9   ? -35.250 -35.476 -39.672 1.00 54.43  ? 252 HIS I C     1 
ATOM   6111  O  O     . HIS I  1 9   ? -34.827 -36.594 -39.377 1.00 54.00  ? 252 HIS I O     1 
ATOM   6112  C  CB    . HIS I  1 9   ? -35.558 -35.765 -42.106 1.00 58.07  ? 252 HIS I CB    1 
ATOM   6113  C  CG    . HIS I  1 9   ? -36.478 -35.712 -43.279 1.00 59.53  ? 252 HIS I CG    1 
ATOM   6114  N  ND1   . HIS I  1 9   ? -37.517 -36.605 -43.445 1.00 60.40  ? 252 HIS I ND1   1 
ATOM   6115  C  CD2   . HIS I  1 9   ? -36.524 -34.871 -44.338 1.00 57.02  ? 252 HIS I CD2   1 
ATOM   6116  C  CE1   . HIS I  1 9   ? -38.150 -36.327 -44.570 1.00 62.19  ? 252 HIS I CE1   1 
ATOM   6117  N  NE2   . HIS I  1 9   ? -37.569 -35.279 -45.130 1.00 59.74  ? 252 HIS I NE2   1 
ATOM   6118  N  N     . ASN I  1 10  ? -34.949 -34.386 -38.997 1.00 51.87  ? 253 ASN I N     1 
ATOM   6119  C  CA    . ASN I  1 10  ? -33.978 -34.370 -37.957 1.00 48.17  ? 253 ASN I CA    1 
ATOM   6120  C  C     . ASN I  1 10  ? -34.562 -33.716 -36.723 1.00 55.27  ? 253 ASN I C     1 
ATOM   6121  O  O     . ASN I  1 10  ? -33.855 -33.011 -35.987 1.00 60.89  ? 253 ASN I O     1 
ATOM   6122  C  CB    . ASN I  1 10  ? -32.786 -33.556 -38.478 1.00 48.60  ? 253 ASN I CB    1 
ATOM   6123  C  CG    . ASN I  1 10  ? -32.018 -34.279 -39.558 1.00 42.60  ? 253 ASN I CG    1 
ATOM   6124  O  OD1   . ASN I  1 10  ? -31.974 -33.883 -40.736 1.00 43.03  ? 253 ASN I OD1   1 
ATOM   6125  N  ND2   . ASN I  1 10  ? -31.411 -35.364 -39.151 1.00 39.26  ? 253 ASN I ND2   1 
ATOM   6126  N  N     . LEU I  1 11  ? -35.848 -33.951 -36.472 1.00 55.16  ? 254 LEU I N     1 
ATOM   6127  C  CA    . LEU I  1 11  ? -36.517 -33.274 -35.374 1.00 53.37  ? 254 LEU I CA    1 
ATOM   6128  C  C     . LEU I  1 11  ? -35.757 -33.443 -34.071 1.00 53.24  ? 254 LEU I C     1 
ATOM   6129  O  O     . LEU I  1 11  ? -35.425 -32.451 -33.423 1.00 56.05  ? 254 LEU I O     1 
ATOM   6130  C  CB    . LEU I  1 11  ? -37.968 -33.727 -35.207 1.00 58.44  ? 254 LEU I CB    1 
ATOM   6131  C  CG    . LEU I  1 11  ? -38.985 -32.573 -35.019 1.00 64.52  ? 254 LEU I CG    1 
ATOM   6132  C  CD1   . LEU I  1 11  ? -40.417 -33.102 -34.949 1.00 61.14  ? 254 LEU I CD1   1 
ATOM   6133  C  CD2   . LEU I  1 11  ? -38.677 -31.718 -33.795 1.00 62.95  ? 254 LEU I CD2   1 
ATOM   6134  N  N     . HIS I  1 12  ? -35.450 -34.677 -33.695 1.00 54.42  ? 255 HIS I N     1 
ATOM   6135  C  CA    . HIS I  1 12  ? -34.851 -34.926 -32.380 1.00 69.14  ? 255 HIS I CA    1 
ATOM   6136  C  C     . HIS I  1 12  ? -33.469 -34.290 -32.176 1.00 64.90  ? 255 HIS I C     1 
ATOM   6137  O  O     . HIS I  1 12  ? -32.983 -34.243 -31.046 1.00 61.34  ? 255 HIS I O     1 
ATOM   6138  C  CB    . HIS I  1 12  ? -34.834 -36.430 -32.015 1.00 78.51  ? 255 HIS I CB    1 
ATOM   6139  C  CG    . HIS I  1 12  ? -35.934 -36.824 -31.061 1.00 98.61  ? 255 HIS I CG    1 
ATOM   6140  N  ND1   . HIS I  1 12  ? -36.096 -36.235 -29.820 1.00 103.85 ? 255 HIS I ND1   1 
ATOM   6141  C  CD2   . HIS I  1 12  ? -36.933 -37.736 -31.172 1.00 105.62 ? 255 HIS I CD2   1 
ATOM   6142  C  CE1   . HIS I  1 12  ? -37.141 -36.769 -29.209 1.00 102.20 ? 255 HIS I CE1   1 
ATOM   6143  N  NE2   . HIS I  1 12  ? -37.666 -37.684 -30.007 1.00 104.28 ? 255 HIS I NE2   1 
ATOM   6144  N  N     . ILE I  1 13  ? -32.864 -33.794 -33.259 1.00 55.94  ? 256 ILE I N     1 
ATOM   6145  C  CA    . ILE I  1 13  ? -31.631 -33.024 -33.190 1.00 53.09  ? 256 ILE I CA    1 
ATOM   6146  C  C     . ILE I  1 13  ? -31.969 -31.544 -32.950 1.00 44.45  ? 256 ILE I C     1 
ATOM   6147  O  O     . ILE I  1 13  ? -31.519 -30.949 -31.974 1.00 35.22  ? 256 ILE I O     1 
ATOM   6148  C  CB    . ILE I  1 13  ? -30.798 -33.199 -34.491 1.00 54.08  ? 256 ILE I CB    1 
ATOM   6149  C  CG1   . ILE I  1 13  ? -30.094 -34.557 -34.494 1.00 55.92  ? 256 ILE I CG1   1 
ATOM   6150  C  CG2   . ILE I  1 13  ? -29.744 -32.112 -34.667 1.00 54.63  ? 256 ILE I CG2   1 
ATOM   6151  C  CD1   . ILE I  1 13  ? -29.706 -35.003 -35.885 1.00 56.12  ? 256 ILE I CD1   1 
ATOM   6152  N  N     . THR I  1 14  ? -32.767 -30.980 -33.848 1.00 42.40  ? 257 THR I N     1 
ATOM   6153  C  CA    . THR I  1 14  ? -33.077 -29.558 -33.841 1.00 42.70  ? 257 THR I CA    1 
ATOM   6154  C  C     . THR I  1 14  ? -33.733 -29.053 -32.559 1.00 42.55  ? 257 THR I C     1 
ATOM   6155  O  O     . THR I  1 14  ? -33.279 -28.059 -32.030 1.00 45.19  ? 257 THR I O     1 
ATOM   6156  C  CB    . THR I  1 14  ? -33.907 -29.196 -35.045 1.00 45.25  ? 257 THR I CB    1 
ATOM   6157  O  OG1   . THR I  1 14  ? -35.161 -29.892 -34.962 1.00 54.47  ? 257 THR I OG1   1 
ATOM   6158  C  CG2   . THR I  1 14  ? -33.128 -29.625 -36.321 1.00 50.38  ? 257 THR I CG2   1 
ATOM   6159  N  N     . GLU I  1 15  ? -34.748 -29.748 -32.049 1.00 47.85  ? 258 GLU I N     1 
ATOM   6160  C  CA    . GLU I  1 15  ? -35.345 -29.471 -30.719 1.00 47.79  ? 258 GLU I CA    1 
ATOM   6161  C  C     . GLU I  1 15  ? -34.270 -29.127 -29.733 1.00 46.04  ? 258 GLU I C     1 
ATOM   6162  O  O     . GLU I  1 15  ? -34.285 -28.086 -29.097 1.00 43.97  ? 258 GLU I O     1 
ATOM   6163  C  CB    . GLU I  1 15  ? -36.031 -30.716 -30.123 1.00 52.65  ? 258 GLU I CB    1 
ATOM   6164  C  CG    . GLU I  1 15  ? -37.315 -31.234 -30.776 1.00 56.76  ? 258 GLU I CG    1 
ATOM   6165  C  CD    . GLU I  1 15  ? -37.921 -32.433 -30.014 1.00 58.70  ? 258 GLU I CD    1 
ATOM   6166  O  OE1   . GLU I  1 15  ? -37.165 -33.219 -29.373 1.00 56.98  ? 258 GLU I OE1   1 
ATOM   6167  O  OE2   . GLU I  1 15  ? -39.160 -32.582 -30.049 1.00 56.37  ? 258 GLU I OE2   1 
ATOM   6168  N  N     . LYS I  1 16  ? -33.310 -30.029 -29.616 1.00 45.37  ? 259 LYS I N     1 
ATOM   6169  C  CA    . LYS I  1 16  ? -32.272 -29.907 -28.596 1.00 43.72  ? 259 LYS I CA    1 
ATOM   6170  C  C     . LYS I  1 16  ? -31.262 -28.778 -28.881 1.00 43.51  ? 259 LYS I C     1 
ATOM   6171  O  O     . LYS I  1 16  ? -30.747 -28.128 -27.970 1.00 44.62  ? 259 LYS I O     1 
ATOM   6172  C  CB    . LYS I  1 16  ? -31.538 -31.218 -28.508 1.00 46.22  ? 259 LYS I CB    1 
ATOM   6173  C  CG    . LYS I  1 16  ? -32.484 -32.368 -28.265 1.00 51.44  ? 259 LYS I CG    1 
ATOM   6174  C  CD    . LYS I  1 16  ? -31.811 -33.487 -27.503 1.00 55.89  ? 259 LYS I CD    1 
ATOM   6175  C  CE    . LYS I  1 16  ? -32.789 -34.620 -27.259 1.00 56.94  ? 259 LYS I CE    1 
ATOM   6176  N  NZ    . LYS I  1 16  ? -32.041 -35.725 -26.624 1.00 62.91  ? 259 LYS I NZ    1 
ATOM   6177  N  N     . LEU I  1 17  ? -30.978 -28.565 -30.156 1.00 39.66  ? 260 LEU I N     1 
ATOM   6178  C  CA    . LEU I  1 17  ? -30.060 -27.541 -30.566 1.00 35.35  ? 260 LEU I CA    1 
ATOM   6179  C  C     . LEU I  1 17  ? -30.739 -26.178 -30.283 1.00 35.05  ? 260 LEU I C     1 
ATOM   6180  O  O     . LEU I  1 17  ? -30.062 -25.215 -29.913 1.00 33.10  ? 260 LEU I O     1 
ATOM   6181  C  CB    . LEU I  1 17  ? -29.660 -27.732 -32.049 1.00 33.19  ? 260 LEU I CB    1 
ATOM   6182  C  CG    . LEU I  1 17  ? -28.245 -28.191 -32.498 1.00 33.32  ? 260 LEU I CG    1 
ATOM   6183  C  CD1   . LEU I  1 17  ? -27.439 -28.987 -31.473 1.00 31.77  ? 260 LEU I CD1   1 
ATOM   6184  C  CD2   . LEU I  1 17  ? -28.253 -28.929 -33.844 1.00 32.08  ? 260 LEU I CD2   1 
ATOM   6185  N  N     . GLU I  1 18  ? -32.068 -26.115 -30.414 1.00 36.96  ? 261 GLU I N     1 
ATOM   6186  C  CA    . GLU I  1 18  ? -32.818 -24.869 -30.183 1.00 34.66  ? 261 GLU I CA    1 
ATOM   6187  C  C     . GLU I  1 18  ? -32.735 -24.456 -28.725 1.00 32.82  ? 261 GLU I C     1 
ATOM   6188  O  O     . GLU I  1 18  ? -32.559 -23.293 -28.404 1.00 36.72  ? 261 GLU I O     1 
ATOM   6189  C  CB    . GLU I  1 18  ? -34.264 -25.001 -30.622 1.00 38.00  ? 261 GLU I CB    1 
ATOM   6190  C  CG    . GLU I  1 18  ? -34.506 -24.508 -32.044 1.00 42.63  ? 261 GLU I CG    1 
ATOM   6191  C  CD    . GLU I  1 18  ? -35.775 -25.072 -32.697 1.00 49.25  ? 261 GLU I CD    1 
ATOM   6192  O  OE1   . GLU I  1 18  ? -36.683 -25.568 -31.974 1.00 60.78  ? 261 GLU I OE1   1 
ATOM   6193  O  OE2   . GLU I  1 18  ? -35.870 -25.032 -33.946 1.00 47.30  ? 261 GLU I OE2   1 
ATOM   6194  N  N     . VAL I  1 19  ? -32.800 -25.415 -27.835 1.00 34.09  ? 262 VAL I N     1 
ATOM   6195  C  CA    . VAL I  1 19  ? -32.814 -25.109 -26.430 1.00 36.62  ? 262 VAL I CA    1 
ATOM   6196  C  C     . VAL I  1 19  ? -31.498 -24.447 -26.103 1.00 36.78  ? 262 VAL I C     1 
ATOM   6197  O  O     . VAL I  1 19  ? -31.473 -23.441 -25.454 1.00 40.11  ? 262 VAL I O     1 
ATOM   6198  C  CB    . VAL I  1 19  ? -33.014 -26.363 -25.557 1.00 38.59  ? 262 VAL I CB    1 
ATOM   6199  C  CG1   . VAL I  1 19  ? -32.836 -26.020 -24.089 1.00 38.34  ? 262 VAL I CG1   1 
ATOM   6200  C  CG2   . VAL I  1 19  ? -34.403 -26.956 -25.776 1.00 40.47  ? 262 VAL I CG2   1 
ATOM   6201  N  N     . LEU I  1 20  ? -30.419 -24.984 -26.626 1.00 34.83  ? 263 LEU I N     1 
ATOM   6202  C  CA    . LEU I  1 20  ? -29.085 -24.464 -26.335 1.00 36.57  ? 263 LEU I CA    1 
ATOM   6203  C  C     . LEU I  1 20  ? -28.858 -23.103 -26.991 1.00 34.37  ? 263 LEU I C     1 
ATOM   6204  O  O     . LEU I  1 20  ? -28.376 -22.190 -26.345 1.00 33.06  ? 263 LEU I O     1 
ATOM   6205  C  CB    . LEU I  1 20  ? -28.055 -25.474 -26.794 1.00 34.62  ? 263 LEU I CB    1 
ATOM   6206  C  CG    . LEU I  1 20  ? -26.591 -25.149 -26.656 1.00 36.77  ? 263 LEU I CG    1 
ATOM   6207  C  CD1   . LEU I  1 20  ? -26.156 -24.953 -25.219 1.00 35.69  ? 263 LEU I CD1   1 
ATOM   6208  C  CD2   . LEU I  1 20  ? -25.813 -26.300 -27.325 1.00 35.94  ? 263 LEU I CD2   1 
ATOM   6209  N  N     . ALA I  1 21  ? -29.280 -22.957 -28.248 1.00 33.48  ? 264 ALA I N     1 
ATOM   6210  C  CA    . ALA I  1 21  ? -29.237 -21.670 -28.933 1.00 34.22  ? 264 ALA I CA    1 
ATOM   6211  C  C     . ALA I  1 21  ? -29.973 -20.596 -28.149 1.00 35.97  ? 264 ALA I C     1 
ATOM   6212  O  O     . ALA I  1 21  ? -29.530 -19.463 -28.064 1.00 39.29  ? 264 ALA I O     1 
ATOM   6213  C  CB    . ALA I  1 21  ? -29.845 -21.786 -30.298 1.00 32.17  ? 264 ALA I CB    1 
ATOM   6214  N  N     . LYS I  1 22  ? -31.084 -20.977 -27.556 1.00 36.07  ? 265 LYS I N     1 
ATOM   6215  C  CA    . LYS I  1 22  ? -31.890 -20.055 -26.796 1.00 39.03  ? 265 LYS I CA    1 
ATOM   6216  C  C     . LYS I  1 22  ? -31.092 -19.606 -25.561 1.00 34.96  ? 265 LYS I C     1 
ATOM   6217  O  O     . LYS I  1 22  ? -31.076 -18.435 -25.203 1.00 33.50  ? 265 LYS I O     1 
ATOM   6218  C  CB    . LYS I  1 22  ? -33.246 -20.721 -26.399 1.00 41.50  ? 265 LYS I CB    1 
ATOM   6219  C  CG    . LYS I  1 22  ? -34.429 -19.748 -26.394 1.00 49.59  ? 265 LYS I CG    1 
ATOM   6220  C  CD    . LYS I  1 22  ? -34.703 -19.171 -27.792 1.00 51.64  ? 265 LYS I CD    1 
ATOM   6221  C  CE    . LYS I  1 22  ? -35.902 -18.212 -27.846 1.00 58.94  ? 265 LYS I CE    1 
ATOM   6222  N  NZ    . LYS I  1 22  ? -35.772 -16.934 -27.051 1.00 57.31  ? 265 LYS I NZ    1 
ATOM   6223  N  N     . ALA I  1 23  ? -30.420 -20.535 -24.902 1.00 33.75  ? 266 ALA I N     1 
ATOM   6224  C  CA    . ALA I  1 23  ? -29.657 -20.172 -23.705 1.00 30.83  ? 266 ALA I CA    1 
ATOM   6225  C  C     . ALA I  1 23  ? -28.544 -19.176 -23.962 1.00 32.15  ? 266 ALA I C     1 
ATOM   6226  O  O     . ALA I  1 23  ? -28.272 -18.282 -23.156 1.00 35.93  ? 266 ALA I O     1 
ATOM   6227  C  CB    . ALA I  1 23  ? -29.098 -21.399 -23.088 1.00 30.98  ? 266 ALA I CB    1 
ATOM   6228  N  N     . TYR I  1 24  ? -27.890 -19.325 -25.093 1.00 32.62  ? 267 TYR I N     1 
ATOM   6229  C  CA    . TYR I  1 24  ? -26.856 -18.413 -25.463 1.00 30.72  ? 267 TYR I CA    1 
ATOM   6230  C  C     . TYR I  1 24  ? -27.414 -17.068 -25.781 1.00 29.86  ? 267 TYR I C     1 
ATOM   6231  O  O     . TYR I  1 24  ? -26.815 -16.030 -25.479 1.00 33.36  ? 267 TYR I O     1 
ATOM   6232  C  CB    . TYR I  1 24  ? -26.181 -18.931 -26.725 1.00 32.55  ? 267 TYR I CB    1 
ATOM   6233  C  CG    . TYR I  1 24  ? -25.206 -20.020 -26.463 1.00 32.00  ? 267 TYR I CG    1 
ATOM   6234  C  CD1   . TYR I  1 24  ? -24.169 -19.836 -25.545 1.00 31.74  ? 267 TYR I CD1   1 
ATOM   6235  C  CD2   . TYR I  1 24  ? -25.297 -21.240 -27.153 1.00 30.48  ? 267 TYR I CD2   1 
ATOM   6236  C  CE1   . TYR I  1 24  ? -23.248 -20.847 -25.331 1.00 34.52  ? 267 TYR I CE1   1 
ATOM   6237  C  CE2   . TYR I  1 24  ? -24.410 -22.249 -26.932 1.00 30.51  ? 267 TYR I CE2   1 
ATOM   6238  C  CZ    . TYR I  1 24  ? -23.391 -22.057 -26.029 1.00 32.61  ? 267 TYR I CZ    1 
ATOM   6239  O  OH    . TYR I  1 24  ? -22.474 -23.052 -25.831 1.00 37.75  ? 267 TYR I OH    1 
ATOM   6240  N  N     . SER I  1 25  ? -28.535 -17.088 -26.473 1.00 30.61  ? 268 SER I N     1 
ATOM   6241  C  CA    . SER I  1 25  ? -29.210 -15.863 -26.908 1.00 30.04  ? 268 SER I CA    1 
ATOM   6242  C  C     . SER I  1 25  ? -29.592 -14.993 -25.739 1.00 29.98  ? 268 SER I C     1 
ATOM   6243  O  O     . SER I  1 25  ? -29.230 -13.831 -25.674 1.00 29.07  ? 268 SER I O     1 
ATOM   6244  C  CB    . SER I  1 25  ? -30.456 -16.225 -27.667 1.00 30.98  ? 268 SER I CB    1 
ATOM   6245  O  OG    . SER I  1 25  ? -31.006 -15.053 -28.158 1.00 32.36  ? 268 SER I OG    1 
ATOM   6246  N  N     . VAL I  1 26  ? -30.281 -15.571 -24.763 1.00 30.53  ? 269 VAL I N     1 
ATOM   6247  C  CA    . VAL I  1 26  ? -30.731 -14.763 -23.637 1.00 30.15  ? 269 VAL I CA    1 
ATOM   6248  C  C     . VAL I  1 26  ? -29.624 -14.428 -22.674 1.00 31.17  ? 269 VAL I C     1 
ATOM   6249  O  O     . VAL I  1 26  ? -29.770 -13.486 -21.932 1.00 28.46  ? 269 VAL I O     1 
ATOM   6250  C  CB    . VAL I  1 26  ? -31.904 -15.379 -22.864 1.00 28.69  ? 269 VAL I CB    1 
ATOM   6251  C  CG1   . VAL I  1 26  ? -33.021 -15.742 -23.825 1.00 30.90  ? 269 VAL I CG1   1 
ATOM   6252  C  CG2   . VAL I  1 26  ? -31.462 -16.549 -22.039 1.00 29.65  ? 269 VAL I CG2   1 
ATOM   6253  N  N     . GLN I  1 27  ? -28.515 -15.176 -22.682 1.00 31.09  ? 270 GLN I N     1 
ATOM   6254  C  CA    . GLN I  1 27  ? -27.342 -14.754 -21.917 1.00 29.07  ? 270 GLN I CA    1 
ATOM   6255  C  C     . GLN I  1 27  ? -26.500 -13.710 -22.673 1.00 30.28  ? 270 GLN I C     1 
ATOM   6256  O  O     . GLN I  1 27  ? -25.490 -13.210 -22.144 1.00 34.34  ? 270 GLN I O     1 
ATOM   6257  C  CB    . GLN I  1 27  ? -26.478 -15.959 -21.563 1.00 31.68  ? 270 GLN I CB    1 
ATOM   6258  C  CG    . GLN I  1 27  ? -27.012 -16.794 -20.410 1.00 32.53  ? 270 GLN I CG    1 
ATOM   6259  C  CD    . GLN I  1 27  ? -26.550 -18.259 -20.438 1.00 35.28  ? 270 GLN I CD    1 
ATOM   6260  O  OE1   . GLN I  1 27  ? -26.793 -19.027 -19.511 1.00 39.62  ? 270 GLN I OE1   1 
ATOM   6261  N  NE2   . GLN I  1 27  ? -25.944 -18.655 -21.520 1.00 35.01  ? 270 GLN I NE2   1 
ATOM   6262  N  N     . GLY I  1 28  ? -26.890 -13.354 -23.897 1.00 30.77  ? 271 GLY I N     1 
ATOM   6263  C  CA    . GLY I  1 28  ? -26.224 -12.242 -24.608 1.00 28.41  ? 271 GLY I CA    1 
ATOM   6264  C  C     . GLY I  1 28  ? -25.127 -12.631 -25.584 1.00 30.97  ? 271 GLY I C     1 
ATOM   6265  O  O     . GLY I  1 28  ? -24.559 -11.773 -26.266 1.00 35.81  ? 271 GLY I O     1 
ATOM   6266  N  N     . ASP I  1 29  ? -24.822 -13.915 -25.676 1.00 34.80  ? 272 ASP I N     1 
ATOM   6267  C  CA    . ASP I  1 29  ? -23.845 -14.407 -26.668 1.00 35.38  ? 272 ASP I CA    1 
ATOM   6268  C  C     . ASP I  1 29  ? -24.454 -14.502 -28.071 1.00 29.16  ? 272 ASP I C     1 
ATOM   6269  O  O     . ASP I  1 29  ? -24.685 -15.576 -28.590 1.00 31.15  ? 272 ASP I O     1 
ATOM   6270  C  CB    . ASP I  1 29  ? -23.342 -15.767 -26.195 1.00 38.44  ? 272 ASP I CB    1 
ATOM   6271  C  CG    . ASP I  1 29  ? -22.078 -16.197 -26.910 1.00 41.68  ? 272 ASP I CG    1 
ATOM   6272  O  OD1   . ASP I  1 29  ? -21.716 -15.604 -27.956 1.00 45.69  ? 272 ASP I OD1   1 
ATOM   6273  O  OD2   . ASP I  1 29  ? -21.460 -17.148 -26.410 1.00 44.28  ? 272 ASP I OD2   1 
ATOM   6274  N  N     . LYS I  1 30  ? -24.710 -13.370 -28.683 1.00 29.62  ? 273 LYS I N     1 
ATOM   6275  C  CA    . LYS I  1 30  ? -25.590 -13.284 -29.844 1.00 31.84  ? 273 LYS I CA    1 
ATOM   6276  C  C     . LYS I  1 30  ? -25.022 -13.929 -31.086 1.00 34.08  ? 273 LYS I C     1 
ATOM   6277  O  O     . LYS I  1 30  ? -25.785 -14.542 -31.875 1.00 31.84  ? 273 LYS I O     1 
ATOM   6278  C  CB    . LYS I  1 30  ? -25.901 -11.823 -30.180 1.00 34.78  ? 273 LYS I CB    1 
ATOM   6279  C  CG    . LYS I  1 30  ? -24.693 -10.872 -30.158 1.00 41.84  ? 273 LYS I CG    1 
ATOM   6280  C  CD    . LYS I  1 30  ? -24.994 -9.519  -30.811 1.00 47.82  ? 273 LYS I CD    1 
ATOM   6281  C  CE    . LYS I  1 30  ? -24.326 -8.364  -30.060 1.00 53.31  ? 273 LYS I CE    1 
ATOM   6282  N  NZ    . LYS I  1 30  ? -22.837 -8.351  -30.181 1.00 61.15  ? 273 LYS I NZ    1 
ATOM   6283  N  N     . TRP I  1 31  ? -23.707 -13.757 -31.283 1.00 31.16  ? 274 TRP I N     1 
ATOM   6284  C  CA    . TRP I  1 31  ? -23.034 -14.292 -32.457 1.00 32.21  ? 274 TRP I CA    1 
ATOM   6285  C  C     . TRP I  1 31  ? -23.064 -15.837 -32.467 1.00 30.17  ? 274 TRP I C     1 
ATOM   6286  O  O     . TRP I  1 31  ? -23.453 -16.460 -33.446 1.00 29.73  ? 274 TRP I O     1 
ATOM   6287  C  CB    . TRP I  1 31  ? -21.597 -13.737 -32.558 1.00 36.16  ? 274 TRP I CB    1 
ATOM   6288  C  CG    . TRP I  1 31  ? -21.587 -12.285 -32.767 1.00 36.41  ? 274 TRP I CG    1 
ATOM   6289  C  CD1   . TRP I  1 31  ? -20.939 -11.367 -32.021 1.00 37.94  ? 274 TRP I CD1   1 
ATOM   6290  C  CD2   . TRP I  1 31  ? -22.348 -11.550 -33.741 1.00 37.73  ? 274 TRP I CD2   1 
ATOM   6291  N  NE1   . TRP I  1 31  ? -21.223 -10.104 -32.479 1.00 35.12  ? 274 TRP I NE1   1 
ATOM   6292  C  CE2   . TRP I  1 31  ? -22.081 -10.196 -33.537 1.00 35.73  ? 274 TRP I CE2   1 
ATOM   6293  C  CE3   . TRP I  1 31  ? -23.220 -11.912 -34.770 1.00 40.29  ? 274 TRP I CE3   1 
ATOM   6294  C  CZ2   . TRP I  1 31  ? -22.658 -9.195  -34.317 1.00 41.13  ? 274 TRP I CZ2   1 
ATOM   6295  C  CZ3   . TRP I  1 31  ? -23.785 -10.909 -35.559 1.00 43.49  ? 274 TRP I CZ3   1 
ATOM   6296  C  CH2   . TRP I  1 31  ? -23.503 -9.573  -35.324 1.00 40.41  ? 274 TRP I CH2   1 
ATOM   6297  N  N     . ARG I  1 32  ? -22.754 -16.450 -31.343 1.00 30.19  ? 275 ARG I N     1 
ATOM   6298  C  CA    . ARG I  1 32  ? -22.855 -17.895 -31.261 1.00 30.50  ? 275 ARG I CA    1 
ATOM   6299  C  C     . ARG I  1 32  ? -24.290 -18.323 -31.476 1.00 32.33  ? 275 ARG I C     1 
ATOM   6300  O  O     . ARG I  1 32  ? -24.551 -19.285 -32.224 1.00 32.09  ? 275 ARG I O     1 
ATOM   6301  C  CB    . ARG I  1 32  ? -22.374 -18.378 -29.915 1.00 34.07  ? 275 ARG I CB    1 
ATOM   6302  C  CG    . ARG I  1 32  ? -22.893 -19.745 -29.568 1.00 38.95  ? 275 ARG I CG    1 
ATOM   6303  C  CD    . ARG I  1 32  ? -22.092 -20.396 -28.446 1.00 44.65  ? 275 ARG I CD    1 
ATOM   6304  N  NE    . ARG I  1 32  ? -20.680 -20.469 -28.762 1.00 49.92  ? 275 ARG I NE    1 
ATOM   6305  C  CZ    . ARG I  1 32  ? -19.728 -19.719 -28.222 1.00 55.89  ? 275 ARG I CZ    1 
ATOM   6306  N  NH1   . ARG I  1 32  ? -20.001 -18.808 -27.299 1.00 59.20  ? 275 ARG I NH1   1 
ATOM   6307  N  NH2   . ARG I  1 32  ? -18.478 -19.896 -28.619 1.00 59.88  ? 275 ARG I NH2   1 
ATOM   6308  N  N     . ALA I  1 33  ? -25.228 -17.608 -30.844 1.00 30.12  ? 276 ALA I N     1 
ATOM   6309  C  CA    . ALA I  1 33  ? -26.648 -17.935 -31.000 1.00 31.62  ? 276 ALA I CA    1 
ATOM   6310  C  C     . ALA I  1 33  ? -27.050 -17.969 -32.460 1.00 31.37  ? 276 ALA I C     1 
ATOM   6311  O  O     . ALA I  1 33  ? -27.735 -18.882 -32.910 1.00 29.08  ? 276 ALA I O     1 
ATOM   6312  C  CB    . ALA I  1 33  ? -27.521 -16.946 -30.245 1.00 33.87  ? 276 ALA I CB    1 
ATOM   6313  N  N     . LEU I  1 34  ? -26.595 -16.968 -33.198 1.00 33.34  ? 277 LEU I N     1 
ATOM   6314  C  CA    . LEU I  1 34  ? -26.884 -16.896 -34.612 1.00 36.43  ? 277 LEU I CA    1 
ATOM   6315  C  C     . LEU I  1 34  ? -26.258 -18.096 -35.351 1.00 36.12  ? 277 LEU I C     1 
ATOM   6316  O  O     . LEU I  1 34  ? -26.876 -18.709 -36.241 1.00 34.29  ? 277 LEU I O     1 
ATOM   6317  C  CB    . LEU I  1 34  ? -26.340 -15.577 -35.140 1.00 42.59  ? 277 LEU I CB    1 
ATOM   6318  C  CG    . LEU I  1 34  ? -26.362 -15.352 -36.647 1.00 51.58  ? 277 LEU I CG    1 
ATOM   6319  C  CD1   . LEU I  1 34  ? -27.780 -15.554 -37.190 1.00 59.24  ? 277 LEU I CD1   1 
ATOM   6320  C  CD2   . LEU I  1 34  ? -25.805 -13.980 -37.011 1.00 51.85  ? 277 LEU I CD2   1 
ATOM   6321  N  N     . GLY I  1 35  ? -25.036 -18.447 -34.971 1.00 35.78  ? 278 GLY I N     1 
ATOM   6322  C  CA    . GLY I  1 35  ? -24.366 -19.592 -35.610 1.00 34.02  ? 278 GLY I CA    1 
ATOM   6323  C  C     . GLY I  1 35  ? -25.138 -20.873 -35.385 1.00 31.65  ? 278 GLY I C     1 
ATOM   6324  O  O     . GLY I  1 35  ? -25.185 -21.745 -36.234 1.00 29.29  ? 278 GLY I O     1 
ATOM   6325  N  N     . TYR I  1 36  ? -25.794 -20.954 -34.240 1.00 29.22  ? 279 TYR I N     1 
ATOM   6326  C  CA    . TYR I  1 36  ? -26.656 -22.051 -33.975 1.00 28.84  ? 279 TYR I CA    1 
ATOM   6327  C  C     . TYR I  1 36  ? -27.942 -21.998 -34.770 1.00 33.13  ? 279 TYR I C     1 
ATOM   6328  O  O     . TYR I  1 36  ? -28.473 -23.026 -35.226 1.00 33.95  ? 279 TYR I O     1 
ATOM   6329  C  CB    . TYR I  1 36  ? -27.015 -22.080 -32.505 1.00 30.68  ? 279 TYR I CB    1 
ATOM   6330  C  CG    . TYR I  1 36  ? -26.056 -22.849 -31.677 1.00 31.60  ? 279 TYR I CG    1 
ATOM   6331  C  CD1   . TYR I  1 36  ? -24.876 -22.274 -31.225 1.00 30.97  ? 279 TYR I CD1   1 
ATOM   6332  C  CD2   . TYR I  1 36  ? -26.343 -24.159 -31.311 1.00 35.87  ? 279 TYR I CD2   1 
ATOM   6333  C  CE1   . TYR I  1 36  ? -23.999 -22.988 -30.437 1.00 32.75  ? 279 TYR I CE1   1 
ATOM   6334  C  CE2   . TYR I  1 36  ? -25.476 -24.881 -30.527 1.00 36.99  ? 279 TYR I CE2   1 
ATOM   6335  C  CZ    . TYR I  1 36  ? -24.295 -24.298 -30.112 1.00 34.89  ? 279 TYR I CZ    1 
ATOM   6336  O  OH    . TYR I  1 36  ? -23.451 -25.037 -29.325 1.00 39.60  ? 279 TYR I OH    1 
ATOM   6337  N  N     . ALA I  1 37  ? -28.514 -20.820 -34.884 1.00 34.21  ? 280 ALA I N     1 
ATOM   6338  C  CA    . ALA I  1 37  ? -29.769 -20.750 -35.586 1.00 34.37  ? 280 ALA I CA    1 
ATOM   6339  C  C     . ALA I  1 37  ? -29.523 -21.180 -37.047 1.00 34.28  ? 280 ALA I C     1 
ATOM   6340  O  O     . ALA I  1 37  ? -30.360 -21.872 -37.651 1.00 32.08  ? 280 ALA I O     1 
ATOM   6341  C  CB    . ALA I  1 37  ? -30.330 -19.344 -35.497 1.00 34.41  ? 280 ALA I CB    1 
ATOM   6342  N  N     . LYS I  1 38  ? -28.361 -20.805 -37.585 1.00 34.05  ? 281 LYS I N     1 
ATOM   6343  C  CA    . LYS I  1 38  ? -28.063 -21.077 -38.989 1.00 36.58  ? 281 LYS I CA    1 
ATOM   6344  C  C     . LYS I  1 38  ? -27.892 -22.587 -39.205 1.00 34.15  ? 281 LYS I C     1 
ATOM   6345  O  O     . LYS I  1 38  ? -28.319 -23.137 -40.197 1.00 33.83  ? 281 LYS I O     1 
ATOM   6346  C  CB    . LYS I  1 38  ? -26.810 -20.307 -39.451 1.00 40.03  ? 281 LYS I CB    1 
ATOM   6347  C  CG    . LYS I  1 38  ? -26.841 -19.968 -40.941 1.00 51.86  ? 281 LYS I CG    1 
ATOM   6348  C  CD    . LYS I  1 38  ? -25.455 -19.926 -41.640 1.00 56.01  ? 281 LYS I CD    1 
ATOM   6349  C  CE    . LYS I  1 38  ? -25.478 -20.645 -43.008 1.00 59.75  ? 281 LYS I CE    1 
ATOM   6350  N  NZ    . LYS I  1 38  ? -24.134 -20.838 -43.655 1.00 58.96  ? 281 LYS I NZ    1 
ATOM   6351  N  N     . ALA I  1 39  ? -27.280 -23.264 -38.262 1.00 32.38  ? 282 ALA I N     1 
ATOM   6352  C  CA    . ALA I  1 39  ? -27.061 -24.695 -38.433 1.00 33.80  ? 282 ALA I CA    1 
ATOM   6353  C  C     . ALA I  1 39  ? -28.383 -25.412 -38.247 1.00 35.88  ? 282 ALA I C     1 
ATOM   6354  O  O     . ALA I  1 39  ? -28.660 -26.386 -38.941 1.00 39.59  ? 282 ALA I O     1 
ATOM   6355  C  CB    . ALA I  1 39  ? -26.056 -25.206 -37.435 1.00 31.60  ? 282 ALA I CB    1 
ATOM   6356  N  N     . ILE I  1 40  ? -29.187 -24.936 -37.300 1.00 35.83  ? 283 ILE I N     1 
ATOM   6357  C  CA    . ILE I  1 40  ? -30.528 -25.472 -37.135 1.00 38.21  ? 283 ILE I CA    1 
ATOM   6358  C  C     . ILE I  1 40  ? -31.381 -25.369 -38.416 1.00 38.96  ? 283 ILE I C     1 
ATOM   6359  O  O     . ILE I  1 40  ? -32.035 -26.344 -38.806 1.00 40.22  ? 283 ILE I O     1 
ATOM   6360  C  CB    . ILE I  1 40  ? -31.223 -24.874 -35.910 1.00 38.57  ? 283 ILE I CB    1 
ATOM   6361  C  CG1   . ILE I  1 40  ? -30.530 -25.401 -34.661 1.00 40.29  ? 283 ILE I CG1   1 
ATOM   6362  C  CG2   . ILE I  1 40  ? -32.679 -25.309 -35.841 1.00 37.94  ? 283 ILE I CG2   1 
ATOM   6363  C  CD1   . ILE I  1 40  ? -30.895 -24.685 -33.386 1.00 41.54  ? 283 ILE I CD1   1 
ATOM   6364  N  N     . ASN I  1 41  ? -31.340 -24.251 -39.107 1.00 36.61  ? 284 ASN I N     1 
ATOM   6365  C  CA    . ASN I  1 41  ? -32.077 -24.194 -40.339 1.00 43.85  ? 284 ASN I CA    1 
ATOM   6366  C  C     . ASN I  1 41  ? -31.674 -25.318 -41.276 1.00 44.83  ? 284 ASN I C     1 
ATOM   6367  O  O     . ASN I  1 41  ? -32.498 -26.212 -41.595 1.00 44.09  ? 284 ASN I O     1 
ATOM   6368  C  CB    . ASN I  1 41  ? -31.878 -22.889 -41.086 1.00 48.02  ? 284 ASN I CB    1 
ATOM   6369  C  CG    . ASN I  1 41  ? -32.479 -22.948 -42.483 1.00 54.66  ? 284 ASN I CG    1 
ATOM   6370  O  OD1   . ASN I  1 41  ? -31.787 -22.804 -43.509 1.00 62.94  ? 284 ASN I OD1   1 
ATOM   6371  N  ND2   . ASN I  1 41  ? -33.782 -23.192 -42.530 1.00 55.38  ? 284 ASN I ND2   1 
ATOM   6372  N  N     . ALA I  1 42  ? -30.403 -25.268 -41.689 1.00 40.78  ? 285 ALA I N     1 
ATOM   6373  C  CA    . ALA I  1 42  ? -29.802 -26.285 -42.575 1.00 40.68  ? 285 ALA I CA    1 
ATOM   6374  C  C     . ALA I  1 42  ? -30.206 -27.719 -42.204 1.00 41.77  ? 285 ALA I C     1 
ATOM   6375  O  O     . ALA I  1 42  ? -30.555 -28.508 -43.056 1.00 45.27  ? 285 ALA I O     1 
ATOM   6376  C  CB    . ALA I  1 42  ? -28.287 -26.133 -42.608 1.00 41.98  ? 285 ALA I CB    1 
ATOM   6377  N  N     . LEU I  1 43  ? -30.223 -28.035 -40.924 1.00 46.07  ? 286 LEU I N     1 
ATOM   6378  C  CA    . LEU I  1 43  ? -30.638 -29.369 -40.486 1.00 46.26  ? 286 LEU I CA    1 
ATOM   6379  C  C     . LEU I  1 43  ? -32.097 -29.687 -40.677 1.00 51.47  ? 286 LEU I C     1 
ATOM   6380  O  O     . LEU I  1 43  ? -32.449 -30.868 -40.809 1.00 53.83  ? 286 LEU I O     1 
ATOM   6381  C  CB    . LEU I  1 43  ? -30.392 -29.517 -39.018 1.00 42.93  ? 286 LEU I CB    1 
ATOM   6382  C  CG    . LEU I  1 43  ? -29.033 -29.998 -38.640 1.00 47.60  ? 286 LEU I CG    1 
ATOM   6383  C  CD1   . LEU I  1 43  ? -28.733 -29.621 -37.196 1.00 51.52  ? 286 LEU I CD1   1 
ATOM   6384  C  CD2   . LEU I  1 43  ? -29.016 -31.511 -38.836 1.00 50.12  ? 286 LEU I CD2   1 
ATOM   6385  N  N     . LYS I  1 44  ? -32.937 -28.651 -40.577 1.00 54.59  ? 287 LYS I N     1 
ATOM   6386  C  CA    . LYS I  1 44  ? -34.403 -28.795 -40.640 1.00 54.70  ? 287 LYS I CA    1 
ATOM   6387  C  C     . LYS I  1 44  ? -34.803 -29.026 -42.078 1.00 55.72  ? 287 LYS I C     1 
ATOM   6388  O  O     . LYS I  1 44  ? -35.757 -29.756 -42.355 1.00 52.59  ? 287 LYS I O     1 
ATOM   6389  C  CB    . LYS I  1 44  ? -35.121 -27.519 -40.167 1.00 54.17  ? 287 LYS I CB    1 
ATOM   6390  C  CG    . LYS I  1 44  ? -35.494 -27.515 -38.712 1.00 52.23  ? 287 LYS I CG    1 
ATOM   6391  C  CD    . LYS I  1 44  ? -35.858 -26.109 -38.275 1.00 53.31  ? 287 LYS I CD    1 
ATOM   6392  C  CE    . LYS I  1 44  ? -36.517 -26.135 -36.898 1.00 54.07  ? 287 LYS I CE    1 
ATOM   6393  N  NZ    . LYS I  1 44  ? -36.698 -24.780 -36.307 1.00 52.63  ? 287 LYS I NZ    1 
ATOM   6394  N  N     . SER I  1 45  ? -34.084 -28.340 -42.967 1.00 52.19  ? 288 SER I N     1 
ATOM   6395  C  CA    . SER I  1 45  ? -34.249 -28.448 -44.397 1.00 56.26  ? 288 SER I CA    1 
ATOM   6396  C  C     . SER I  1 45  ? -33.481 -29.613 -45.098 1.00 54.50  ? 288 SER I C     1 
ATOM   6397  O  O     . SER I  1 45  ? -33.833 -29.957 -46.218 1.00 58.47  ? 288 SER I O     1 
ATOM   6398  C  CB    . SER I  1 45  ? -33.858 -27.111 -45.026 1.00 58.69  ? 288 SER I CB    1 
ATOM   6399  O  OG    . SER I  1 45  ? -32.822 -26.507 -44.283 1.00 61.18  ? 288 SER I OG    1 
ATOM   6400  N  N     . PHE I  1 46  ? -32.471 -30.228 -44.474 1.00 50.70  ? 289 PHE I N     1 
ATOM   6401  C  CA    . PHE I  1 46  ? -31.751 -31.330 -45.147 1.00 50.40  ? 289 PHE I CA    1 
ATOM   6402  C  C     . PHE I  1 46  ? -32.766 -32.368 -45.604 1.00 53.41  ? 289 PHE I C     1 
ATOM   6403  O  O     . PHE I  1 46  ? -33.736 -32.611 -44.897 1.00 59.05  ? 289 PHE I O     1 
ATOM   6404  C  CB    . PHE I  1 46  ? -30.696 -31.997 -44.245 1.00 46.29  ? 289 PHE I CB    1 
ATOM   6405  C  CG    . PHE I  1 46  ? -29.707 -32.861 -44.999 1.00 41.50  ? 289 PHE I CG    1 
ATOM   6406  C  CD1   . PHE I  1 46  ? -29.034 -32.372 -46.104 1.00 39.19  ? 289 PHE I CD1   1 
ATOM   6407  C  CD2   . PHE I  1 46  ? -29.449 -34.165 -44.593 1.00 44.93  ? 289 PHE I CD2   1 
ATOM   6408  C  CE1   . PHE I  1 46  ? -28.135 -33.150 -46.798 1.00 39.07  ? 289 PHE I CE1   1 
ATOM   6409  C  CE2   . PHE I  1 46  ? -28.535 -34.960 -45.278 1.00 41.09  ? 289 PHE I CE2   1 
ATOM   6410  C  CZ    . PHE I  1 46  ? -27.874 -34.446 -46.381 1.00 41.92  ? 289 PHE I CZ    1 
ATOM   6411  N  N     . HIS I  1 47  ? -32.552 -32.968 -46.779 1.00 56.38  ? 290 HIS I N     1 
ATOM   6412  C  CA    . HIS I  1 47  ? -33.587 -33.811 -47.427 1.00 53.49  ? 290 HIS I CA    1 
ATOM   6413  C  C     . HIS I  1 47  ? -33.867 -35.150 -46.731 1.00 53.45  ? 290 HIS I C     1 
ATOM   6414  O  O     . HIS I  1 47  ? -34.735 -35.917 -47.184 1.00 54.06  ? 290 HIS I O     1 
ATOM   6415  C  CB    . HIS I  1 47  ? -33.253 -34.052 -48.908 1.00 54.57  ? 290 HIS I CB    1 
ATOM   6416  C  CG    . HIS I  1 47  ? -32.013 -34.868 -49.134 1.00 61.11  ? 290 HIS I CG    1 
ATOM   6417  N  ND1   . HIS I  1 47  ? -30.848 -34.326 -49.640 1.00 66.03  ? 290 HIS I ND1   1 
ATOM   6418  C  CD2   . HIS I  1 47  ? -31.760 -36.182 -48.936 1.00 55.38  ? 290 HIS I CD2   1 
ATOM   6419  C  CE1   . HIS I  1 47  ? -29.930 -35.271 -49.730 1.00 60.53  ? 290 HIS I CE1   1 
ATOM   6420  N  NE2   . HIS I  1 47  ? -30.457 -36.403 -49.303 1.00 58.90  ? 290 HIS I NE2   1 
ATOM   6421  N  N     . LYS I  1 48  ? -33.164 -35.430 -45.630 1.00 47.55  ? 291 LYS I N     1 
ATOM   6422  C  CA    . LYS I  1 48  ? -33.340 -36.700 -44.940 1.00 46.13  ? 291 LYS I CA    1 
ATOM   6423  C  C     . LYS I  1 48  ? -32.710 -36.671 -43.569 1.00 44.20  ? 291 LYS I C     1 
ATOM   6424  O  O     . LYS I  1 48  ? -32.001 -35.746 -43.242 1.00 44.46  ? 291 LYS I O     1 
ATOM   6425  C  CB    . LYS I  1 48  ? -32.679 -37.802 -45.753 1.00 47.47  ? 291 LYS I CB    1 
ATOM   6426  C  CG    . LYS I  1 48  ? -31.188 -37.610 -45.994 1.00 51.24  ? 291 LYS I CG    1 
ATOM   6427  C  CD    . LYS I  1 48  ? -30.685 -38.742 -46.878 1.00 56.37  ? 291 LYS I CD    1 
ATOM   6428  C  CE    . LYS I  1 48  ? -29.290 -39.201 -46.530 1.00 54.57  ? 291 LYS I CE    1 
ATOM   6429  N  NZ    . LYS I  1 48  ? -29.202 -39.779 -45.151 1.00 54.08  ? 291 LYS I NZ    1 
ATOM   6430  N  N     . PRO I  1 49  ? -32.953 -37.711 -42.764 1.00 46.75  ? 292 PRO I N     1 
ATOM   6431  C  CA    . PRO I  1 49  ? -32.195 -37.786 -41.536 1.00 47.56  ? 292 PRO I CA    1 
ATOM   6432  C  C     . PRO I  1 49  ? -30.690 -37.798 -41.835 1.00 53.57  ? 292 PRO I C     1 
ATOM   6433  O  O     . PRO I  1 49  ? -30.243 -38.511 -42.738 1.00 53.19  ? 292 PRO I O     1 
ATOM   6434  C  CB    . PRO I  1 49  ? -32.622 -39.131 -40.937 1.00 48.82  ? 292 PRO I CB    1 
ATOM   6435  C  CG    . PRO I  1 49  ? -33.948 -39.427 -41.546 1.00 48.35  ? 292 PRO I CG    1 
ATOM   6436  C  CD    . PRO I  1 49  ? -33.924 -38.812 -42.905 1.00 45.95  ? 292 PRO I CD    1 
ATOM   6437  N  N     . VAL I  1 50  ? -29.922 -36.994 -41.110 1.00 52.80  ? 293 VAL I N     1 
ATOM   6438  C  CA    . VAL I  1 50  ? -28.476 -37.132 -41.137 1.00 49.18  ? 293 VAL I CA    1 
ATOM   6439  C  C     . VAL I  1 50  ? -28.153 -38.298 -40.209 1.00 50.89  ? 293 VAL I C     1 
ATOM   6440  O  O     . VAL I  1 50  ? -28.680 -38.391 -39.097 1.00 48.98  ? 293 VAL I O     1 
ATOM   6441  C  CB    . VAL I  1 50  ? -27.674 -35.851 -40.746 1.00 45.74  ? 293 VAL I CB    1 
ATOM   6442  C  CG1   . VAL I  1 50  ? -28.329 -34.570 -41.256 1.00 43.22  ? 293 VAL I CG1   1 
ATOM   6443  C  CG2   . VAL I  1 50  ? -27.435 -35.784 -39.261 1.00 50.64  ? 293 VAL I CG2   1 
ATOM   6444  N  N     . THR I  1 51  ? -27.282 -39.184 -40.678 1.00 48.35  ? 294 THR I N     1 
ATOM   6445  C  CA    . THR I  1 51  ? -27.000 -40.417 -39.967 1.00 52.91  ? 294 THR I CA    1 
ATOM   6446  C  C     . THR I  1 51  ? -25.539 -40.569 -39.542 1.00 50.64  ? 294 THR I C     1 
ATOM   6447  O  O     . THR I  1 51  ? -25.209 -41.486 -38.805 1.00 51.87  ? 294 THR I O     1 
ATOM   6448  C  CB    . THR I  1 51  ? -27.418 -41.614 -40.842 1.00 57.12  ? 294 THR I CB    1 
ATOM   6449  O  OG1   . THR I  1 51  ? -26.987 -41.388 -42.195 1.00 54.28  ? 294 THR I OG1   1 
ATOM   6450  C  CG2   . THR I  1 51  ? -28.954 -41.770 -40.813 1.00 55.46  ? 294 THR I CG2   1 
ATOM   6451  N  N     . SER I  1 52  ? -24.682 -39.664 -39.993 1.00 49.39  ? 295 SER I N     1 
ATOM   6452  C  CA    . SER I  1 52  ? -23.268 -39.736 -39.687 1.00 47.52  ? 295 SER I CA    1 
ATOM   6453  C  C     . SER I  1 52  ? -22.620 -38.366 -39.550 1.00 43.50  ? 295 SER I C     1 
ATOM   6454  O  O     . SER I  1 52  ? -23.119 -37.351 -40.047 1.00 38.46  ? 295 SER I O     1 
ATOM   6455  C  CB    . SER I  1 52  ? -22.531 -40.482 -40.801 1.00 42.30  ? 295 SER I CB    1 
ATOM   6456  O  OG    . SER I  1 52  ? -22.363 -39.611 -41.895 1.00 42.13  ? 295 SER I OG    1 
ATOM   6457  N  N     . TYR I  1 53  ? -21.441 -38.400 -38.934 1.00 43.60  ? 296 TYR I N     1 
ATOM   6458  C  CA    . TYR I  1 53  ? -20.611 -37.235 -38.721 1.00 38.58  ? 296 TYR I CA    1 
ATOM   6459  C  C     . TYR I  1 53  ? -20.207 -36.650 -40.062 1.00 41.17  ? 296 TYR I C     1 
ATOM   6460  O  O     . TYR I  1 53  ? -20.200 -35.394 -40.250 1.00 33.87  ? 296 TYR I O     1 
ATOM   6461  C  CB    . TYR I  1 53  ? -19.384 -37.611 -37.871 1.00 38.62  ? 296 TYR I CB    1 
ATOM   6462  C  CG    . TYR I  1 53  ? -18.437 -36.455 -37.671 1.00 39.33  ? 296 TYR I CG    1 
ATOM   6463  C  CD1   . TYR I  1 53  ? -17.563 -36.105 -38.653 1.00 39.36  ? 296 TYR I CD1   1 
ATOM   6464  C  CD2   . TYR I  1 53  ? -18.450 -35.698 -36.521 1.00 39.59  ? 296 TYR I CD2   1 
ATOM   6465  C  CE1   . TYR I  1 53  ? -16.701 -35.050 -38.494 1.00 41.52  ? 296 TYR I CE1   1 
ATOM   6466  C  CE2   . TYR I  1 53  ? -17.585 -34.628 -36.357 1.00 40.42  ? 296 TYR I CE2   1 
ATOM   6467  C  CZ    . TYR I  1 53  ? -16.707 -34.324 -37.343 1.00 37.23  ? 296 TYR I CZ    1 
ATOM   6468  O  OH    . TYR I  1 53  ? -15.850 -33.266 -37.248 1.00 33.39  ? 296 TYR I OH    1 
ATOM   6469  N  N     . GLN I  1 54  ? -19.889 -37.554 -40.998 1.00 39.91  ? 297 GLN I N     1 
ATOM   6470  C  CA    . GLN I  1 54  ? -19.367 -37.156 -42.299 1.00 40.45  ? 297 GLN I CA    1 
ATOM   6471  C  C     . GLN I  1 54  ? -20.468 -36.539 -43.125 1.00 38.13  ? 297 GLN I C     1 
ATOM   6472  O  O     . GLN I  1 54  ? -20.265 -35.578 -43.847 1.00 33.16  ? 297 GLN I O     1 
ATOM   6473  C  CB    . GLN I  1 54  ? -18.763 -38.352 -43.051 1.00 42.60  ? 297 GLN I CB    1 
ATOM   6474  C  CG    . GLN I  1 54  ? -18.306 -37.992 -44.456 1.00 42.90  ? 297 GLN I CG    1 
ATOM   6475  C  CD    . GLN I  1 54  ? -17.546 -39.114 -45.161 1.00 47.43  ? 297 GLN I CD    1 
ATOM   6476  O  OE1   . GLN I  1 54  ? -17.422 -40.247 -44.670 1.00 48.41  ? 297 GLN I OE1   1 
ATOM   6477  N  NE2   . GLN I  1 54  ? -17.015 -38.785 -46.321 1.00 47.90  ? 297 GLN I NE2   1 
ATOM   6478  N  N     . GLU I  1 55  ? -21.652 -37.118 -43.035 1.00 38.61  ? 298 GLU I N     1 
ATOM   6479  C  CA    . GLU I  1 55  ? -22.810 -36.467 -43.632 1.00 38.27  ? 298 GLU I CA    1 
ATOM   6480  C  C     . GLU I  1 55  ? -23.073 -35.063 -43.049 1.00 31.75  ? 298 GLU I C     1 
ATOM   6481  O  O     . GLU I  1 55  ? -23.265 -34.063 -43.764 1.00 33.65  ? 298 GLU I O     1 
ATOM   6482  C  CB    . GLU I  1 55  ? -24.029 -37.333 -43.400 1.00 42.95  ? 298 GLU I CB    1 
ATOM   6483  C  CG    . GLU I  1 55  ? -25.126 -37.054 -44.408 1.00 41.59  ? 298 GLU I CG    1 
ATOM   6484  C  CD    . GLU I  1 55  ? -26.272 -37.991 -44.199 1.00 42.10  ? 298 GLU I CD    1 
ATOM   6485  O  OE1   . GLU I  1 55  ? -26.322 -38.617 -43.108 1.00 44.32  ? 298 GLU I OE1   1 
ATOM   6486  O  OE2   . GLU I  1 55  ? -27.100 -38.097 -45.126 1.00 42.37  ? 298 GLU I OE2   1 
ATOM   6487  N  N     . ALA I  1 56  ? -23.116 -34.990 -41.735 1.00 29.86  ? 299 ALA I N     1 
ATOM   6488  C  CA    . ALA I  1 56  ? -23.368 -33.706 -41.101 1.00 29.13  ? 299 ALA I CA    1 
ATOM   6489  C  C     . ALA I  1 56  ? -22.416 -32.610 -41.612 1.00 32.41  ? 299 ALA I C     1 
ATOM   6490  O  O     . ALA I  1 56  ? -22.858 -31.494 -41.924 1.00 34.00  ? 299 ALA I O     1 
ATOM   6491  C  CB    . ALA I  1 56  ? -23.296 -33.863 -39.609 1.00 29.00  ? 299 ALA I CB    1 
ATOM   6492  N  N     . CYS I  1 57  ? -21.127 -32.941 -41.774 1.00 33.17  ? 300 CYS I N     1 
ATOM   6493  C  CA    . CYS I  1 57  ? -20.134 -31.975 -42.277 1.00 34.78  ? 300 CYS I CA    1 
ATOM   6494  C  C     . CYS I  1 57  ? -20.335 -31.672 -43.750 1.00 38.29  ? 300 CYS I C     1 
ATOM   6495  O  O     . CYS I  1 57  ? -19.737 -30.729 -44.300 1.00 38.34  ? 300 CYS I O     1 
ATOM   6496  C  CB    . CYS I  1 57  ? -18.699 -32.507 -42.079 1.00 37.28  ? 300 CYS I CB    1 
ATOM   6497  S  SG    . CYS I  1 57  ? -18.259 -32.818 -40.348 1.00 38.87  ? 300 CYS I SG    1 
ATOM   6498  N  N     . SER I  1 58  ? -21.115 -32.512 -44.402 1.00 35.90  ? 301 SER I N     1 
ATOM   6499  C  CA    . SER I  1 58  ? -21.551 -32.241 -45.744 1.00 44.51  ? 301 SER I CA    1 
ATOM   6500  C  C     . SER I  1 58  ? -22.269 -30.881 -45.923 1.00 45.87  ? 301 SER I C     1 
ATOM   6501  O  O     . SER I  1 58  ? -22.218 -30.259 -46.996 1.00 48.38  ? 301 SER I O     1 
ATOM   6502  C  CB    . SER I  1 58  ? -22.526 -33.337 -46.167 1.00 45.10  ? 301 SER I CB    1 
ATOM   6503  O  OG    . SER I  1 58  ? -23.032 -32.989 -47.433 1.00 55.91  ? 301 SER I OG    1 
ATOM   6504  N  N     . ILE I  1 59  ? -22.955 -30.445 -44.882 1.00 42.89  ? 302 ILE I N     1 
ATOM   6505  C  CA    . ILE I  1 59  ? -23.979 -29.432 -45.015 1.00 42.21  ? 302 ILE I CA    1 
ATOM   6506  C  C     . ILE I  1 59  ? -23.411 -28.059 -44.726 1.00 40.66  ? 302 ILE I C     1 
ATOM   6507  O  O     . ILE I  1 59  ? -22.842 -27.834 -43.641 1.00 36.50  ? 302 ILE I O     1 
ATOM   6508  C  CB    . ILE I  1 59  ? -25.114 -29.708 -44.041 1.00 39.53  ? 302 ILE I CB    1 
ATOM   6509  C  CG1   . ILE I  1 59  ? -25.699 -31.073 -44.347 1.00 40.04  ? 302 ILE I CG1   1 
ATOM   6510  C  CG2   . ILE I  1 59  ? -26.171 -28.621 -44.166 1.00 43.29  ? 302 ILE I CG2   1 
ATOM   6511  C  CD1   . ILE I  1 59  ? -26.200 -31.838 -43.157 1.00 38.43  ? 302 ILE I CD1   1 
ATOM   6512  N  N     . PRO I  1 60  ? -23.580 -27.131 -45.676 1.00 35.98  ? 303 PRO I N     1 
ATOM   6513  C  CA    . PRO I  1 60  ? -23.053 -25.812 -45.426 1.00 37.10  ? 303 PRO I CA    1 
ATOM   6514  C  C     . PRO I  1 60  ? -23.758 -25.272 -44.211 1.00 37.76  ? 303 PRO I C     1 
ATOM   6515  O  O     . PRO I  1 60  ? -24.877 -25.648 -43.947 1.00 41.13  ? 303 PRO I O     1 
ATOM   6516  C  CB    . PRO I  1 60  ? -23.417 -25.005 -46.673 1.00 39.29  ? 303 PRO I CB    1 
ATOM   6517  C  CG    . PRO I  1 60  ? -24.018 -25.961 -47.642 1.00 40.53  ? 303 PRO I CG    1 
ATOM   6518  C  CD    . PRO I  1 60  ? -24.414 -27.199 -46.878 1.00 41.63  ? 303 PRO I CD    1 
ATOM   6519  N  N     . GLY I  1 61  ? -23.093 -24.420 -43.462 1.00 39.71  ? 304 GLY I N     1 
ATOM   6520  C  CA    . GLY I  1 61  ? -23.603 -23.993 -42.174 1.00 40.15  ? 304 GLY I CA    1 
ATOM   6521  C  C     . GLY I  1 61  ? -23.324 -24.970 -41.048 1.00 40.02  ? 304 GLY I C     1 
ATOM   6522  O  O     . GLY I  1 61  ? -23.430 -24.580 -39.883 1.00 37.06  ? 304 GLY I O     1 
ATOM   6523  N  N     . ILE I  1 62  ? -22.986 -26.228 -41.365 1.00 36.52  ? 305 ILE I N     1 
ATOM   6524  C  CA    . ILE I  1 62  ? -22.551 -27.180 -40.314 1.00 38.29  ? 305 ILE I CA    1 
ATOM   6525  C  C     . ILE I  1 62  ? -21.021 -27.438 -40.306 1.00 40.10  ? 305 ILE I C     1 
ATOM   6526  O  O     . ILE I  1 62  ? -20.445 -28.018 -41.245 1.00 34.28  ? 305 ILE I O     1 
ATOM   6527  C  CB    . ILE I  1 62  ? -23.348 -28.508 -40.362 1.00 37.47  ? 305 ILE I CB    1 
ATOM   6528  C  CG1   . ILE I  1 62  ? -24.825 -28.246 -39.986 1.00 39.88  ? 305 ILE I CG1   1 
ATOM   6529  C  CG2   . ILE I  1 62  ? -22.743 -29.543 -39.414 1.00 36.03  ? 305 ILE I CG2   1 
ATOM   6530  C  CD1   . ILE I  1 62  ? -25.802 -29.290 -40.513 1.00 43.45  ? 305 ILE I CD1   1 
ATOM   6531  N  N     . GLY I  1 63  ? -20.397 -27.023 -39.208 1.00 43.65  ? 306 GLY I N     1 
ATOM   6532  C  CA    . GLY I  1 63  ? -18.973 -27.217 -38.973 1.00 41.33  ? 306 GLY I CA    1 
ATOM   6533  C  C     . GLY I  1 63  ? -18.637 -28.355 -38.036 1.00 43.89  ? 306 GLY I C     1 
ATOM   6534  O  O     . GLY I  1 63  ? -19.499 -29.075 -37.505 1.00 39.67  ? 306 GLY I O     1 
ATOM   6535  N  N     . LYS I  1 64  ? -17.337 -28.511 -37.855 1.00 48.31  ? 307 LYS I N     1 
ATOM   6536  C  CA    . LYS I  1 64  ? -16.756 -29.568 -37.053 1.00 47.86  ? 307 LYS I CA    1 
ATOM   6537  C  C     . LYS I  1 64  ? -17.406 -29.645 -35.665 1.00 42.57  ? 307 LYS I C     1 
ATOM   6538  O  O     . LYS I  1 64  ? -17.738 -30.725 -35.181 1.00 38.30  ? 307 LYS I O     1 
ATOM   6539  C  CB    . LYS I  1 64  ? -15.250 -29.298 -36.964 1.00 53.17  ? 307 LYS I CB    1 
ATOM   6540  C  CG    . LYS I  1 64  ? -14.393 -30.405 -36.376 1.00 61.56  ? 307 LYS I CG    1 
ATOM   6541  C  CD    . LYS I  1 64  ? -12.909 -30.260 -36.763 1.00 66.57  ? 307 LYS I CD    1 
ATOM   6542  C  CE    . LYS I  1 64  ? -12.669 -30.395 -38.270 1.00 67.55  ? 307 LYS I CE    1 
ATOM   6543  N  NZ    . LYS I  1 64  ? -11.229 -30.644 -38.637 1.00 71.48  ? 307 LYS I NZ    1 
ATOM   6544  N  N     . ARG I  1 65  ? -17.614 -28.494 -35.041 1.00 39.65  ? 308 ARG I N     1 
ATOM   6545  C  CA    . ARG I  1 65  ? -18.167 -28.459 -33.703 1.00 38.92  ? 308 ARG I CA    1 
ATOM   6546  C  C     . ARG I  1 65  ? -19.643 -28.806 -33.719 1.00 36.60  ? 308 ARG I C     1 
ATOM   6547  O  O     . ARG I  1 65  ? -20.129 -29.577 -32.921 1.00 33.64  ? 308 ARG I O     1 
ATOM   6548  C  CB    . ARG I  1 65  ? -17.956 -27.072 -33.099 1.00 47.12  ? 308 ARG I CB    1 
ATOM   6549  C  CG    . ARG I  1 65  ? -16.506 -26.567 -33.175 1.00 52.43  ? 308 ARG I CG    1 
ATOM   6550  C  CD    . ARG I  1 65  ? -16.177 -25.479 -32.147 1.00 58.64  ? 308 ARG I CD    1 
ATOM   6551  N  NE    . ARG I  1 65  ? -16.747 -25.773 -30.810 1.00 67.67  ? 308 ARG I NE    1 
ATOM   6552  C  CZ    . ARG I  1 65  ? -16.269 -26.676 -29.944 1.00 62.49  ? 308 ARG I CZ    1 
ATOM   6553  N  NH1   . ARG I  1 65  ? -15.183 -27.386 -30.231 1.00 64.33  ? 308 ARG I NH1   1 
ATOM   6554  N  NH2   . ARG I  1 65  ? -16.868 -26.863 -28.769 1.00 55.86  ? 308 ARG I NH2   1 
ATOM   6555  N  N     . MET I  1 66  ? -20.378 -28.219 -34.641 1.00 36.36  ? 309 MET I N     1 
ATOM   6556  C  CA    . MET I  1 66  ? -21.786 -28.568 -34.761 1.00 37.75  ? 309 MET I CA    1 
ATOM   6557  C  C     . MET I  1 66  ? -22.021 -30.060 -35.130 1.00 35.40  ? 309 MET I C     1 
ATOM   6558  O  O     . MET I  1 66  ? -22.891 -30.722 -34.582 1.00 38.35  ? 309 MET I O     1 
ATOM   6559  C  CB    . MET I  1 66  ? -22.472 -27.604 -35.745 1.00 38.60  ? 309 MET I CB    1 
ATOM   6560  C  CG    . MET I  1 66  ? -23.960 -27.463 -35.503 1.00 42.92  ? 309 MET I CG    1 
ATOM   6561  S  SD    . MET I  1 66  ? -24.448 -26.855 -33.864 1.00 43.57  ? 309 MET I SD    1 
ATOM   6562  C  CE    . MET I  1 66  ? -23.954 -25.151 -34.090 1.00 42.24  ? 309 MET I CE    1 
ATOM   6563  N  N     . ALA I  1 67  ? -21.227 -30.614 -36.031 1.00 33.04  ? 310 ALA I N     1 
ATOM   6564  C  CA    . ALA I  1 67  ? -21.363 -32.043 -36.342 1.00 33.73  ? 310 ALA I CA    1 
ATOM   6565  C  C     . ALA I  1 67  ? -21.041 -32.908 -35.119 1.00 35.60  ? 310 ALA I C     1 
ATOM   6566  O  O     . ALA I  1 67  ? -21.653 -33.953 -34.913 1.00 37.97  ? 310 ALA I O     1 
ATOM   6567  C  CB    . ALA I  1 67  ? -20.483 -32.430 -37.527 1.00 32.72  ? 310 ALA I CB    1 
ATOM   6568  N  N     . GLU I  1 68  ? -20.126 -32.429 -34.275 1.00 39.80  ? 311 GLU I N     1 
ATOM   6569  C  CA    . GLU I  1 68  ? -19.762 -33.139 -33.051 1.00 42.99  ? 311 GLU I CA    1 
ATOM   6570  C  C     . GLU I  1 68  ? -20.948 -33.302 -32.122 1.00 43.76  ? 311 GLU I C     1 
ATOM   6571  O  O     . GLU I  1 68  ? -21.032 -34.275 -31.409 1.00 46.10  ? 311 GLU I O     1 
ATOM   6572  C  CB    . GLU I  1 68  ? -18.661 -32.397 -32.310 1.00 44.11  ? 311 GLU I CB    1 
ATOM   6573  C  CG    . GLU I  1 68  ? -17.652 -33.316 -31.631 1.00 52.85  ? 311 GLU I CG    1 
ATOM   6574  C  CD    . GLU I  1 68  ? -16.209 -32.785 -31.638 1.00 60.70  ? 311 GLU I CD    1 
ATOM   6575  O  OE1   . GLU I  1 68  ? -15.824 -31.931 -32.488 1.00 59.10  ? 311 GLU I OE1   1 
ATOM   6576  O  OE2   . GLU I  1 68  ? -15.430 -33.252 -30.777 1.00 68.46  ? 311 GLU I OE2   1 
ATOM   6577  N  N     . LYS I  1 69  ? -21.857 -32.330 -32.119 1.00 40.51  ? 312 LYS I N     1 
ATOM   6578  C  CA    . LYS I  1 69  ? -22.970 -32.380 -31.208 1.00 39.64  ? 312 LYS I CA    1 
ATOM   6579  C  C     . LYS I  1 69  ? -24.059 -33.197 -31.839 1.00 35.96  ? 312 LYS I C     1 
ATOM   6580  O  O     . LYS I  1 69  ? -24.740 -33.932 -31.154 1.00 34.38  ? 312 LYS I O     1 
ATOM   6581  C  CB    . LYS I  1 69  ? -23.449 -30.977 -30.862 1.00 43.01  ? 312 LYS I CB    1 
ATOM   6582  C  CG    . LYS I  1 69  ? -22.338 -30.111 -30.264 1.00 46.00  ? 312 LYS I CG    1 
ATOM   6583  C  CD    . LYS I  1 69  ? -22.799 -28.676 -30.050 1.00 48.38  ? 312 LYS I CD    1 
ATOM   6584  C  CE    . LYS I  1 69  ? -21.632 -27.778 -29.671 1.00 49.47  ? 312 LYS I CE    1 
ATOM   6585  N  NZ    . LYS I  1 69  ? -21.064 -27.064 -30.867 1.00 51.58  ? 312 LYS I NZ    1 
ATOM   6586  N  N     . ILE I  1 70  ? -24.168 -33.119 -33.158 1.00 37.75  ? 313 ILE I N     1 
ATOM   6587  C  CA    . ILE I  1 70  ? -25.147 -33.916 -33.894 1.00 39.30  ? 313 ILE I CA    1 
ATOM   6588  C  C     . ILE I  1 70  ? -24.958 -35.409 -33.752 1.00 43.35  ? 313 ILE I C     1 
ATOM   6589  O  O     . ILE I  1 70  ? -25.931 -36.136 -33.602 1.00 41.03  ? 313 ILE I O     1 
ATOM   6590  C  CB    . ILE I  1 70  ? -25.115 -33.593 -35.384 1.00 37.29  ? 313 ILE I CB    1 
ATOM   6591  C  CG1   . ILE I  1 70  ? -25.768 -32.236 -35.601 1.00 35.14  ? 313 ILE I CG1   1 
ATOM   6592  C  CG2   . ILE I  1 70  ? -25.783 -34.700 -36.216 1.00 37.47  ? 313 ILE I CG2   1 
ATOM   6593  C  CD1   . ILE I  1 70  ? -25.588 -31.742 -36.997 1.00 34.29  ? 313 ILE I CD1   1 
ATOM   6594  N  N     . ILE I  1 71  ? -23.723 -35.881 -33.857 1.00 48.53  ? 314 ILE I N     1 
ATOM   6595  C  CA    . ILE I  1 71  ? -23.507 -37.328 -33.735 1.00 52.28  ? 314 ILE I CA    1 
ATOM   6596  C  C     . ILE I  1 71  ? -23.620 -37.765 -32.288 1.00 53.11  ? 314 ILE I C     1 
ATOM   6597  O  O     . ILE I  1 71  ? -23.994 -38.914 -32.028 1.00 54.47  ? 314 ILE I O     1 
ATOM   6598  C  CB    . ILE I  1 71  ? -22.183 -37.826 -34.358 1.00 53.49  ? 314 ILE I CB    1 
ATOM   6599  C  CG1   . ILE I  1 71  ? -20.967 -37.076 -33.793 1.00 56.52  ? 314 ILE I CG1   1 
ATOM   6600  C  CG2   . ILE I  1 71  ? -22.259 -37.660 -35.871 1.00 56.42  ? 314 ILE I CG2   1 
ATOM   6601  C  CD1   . ILE I  1 71  ? -20.354 -37.620 -32.518 1.00 57.82  ? 314 ILE I CD1   1 
ATOM   6602  N  N     . GLU I  1 72  ? -23.313 -36.863 -31.348 1.00 48.16  ? 315 GLU I N     1 
ATOM   6603  C  CA    . GLU I  1 72  ? -23.558 -37.176 -29.951 1.00 47.85  ? 315 GLU I CA    1 
ATOM   6604  C  C     . GLU I  1 72  ? -25.049 -37.400 -29.742 1.00 45.67  ? 315 GLU I C     1 
ATOM   6605  O  O     . GLU I  1 72  ? -25.438 -38.267 -28.987 1.00 54.60  ? 315 GLU I O     1 
ATOM   6606  C  CB    . GLU I  1 72  ? -23.053 -36.107 -28.989 1.00 51.84  ? 315 GLU I CB    1 
ATOM   6607  C  CG    . GLU I  1 72  ? -22.890 -36.651 -27.567 1.00 55.33  ? 315 GLU I CG    1 
ATOM   6608  C  CD    . GLU I  1 72  ? -23.404 -35.728 -26.463 1.00 57.62  ? 315 GLU I CD    1 
ATOM   6609  O  OE1   . GLU I  1 72  ? -22.894 -34.596 -26.327 1.00 52.71  ? 315 GLU I OE1   1 
ATOM   6610  O  OE2   . GLU I  1 72  ? -24.298 -36.170 -25.700 1.00 67.68  ? 315 GLU I OE2   1 
ATOM   6611  N  N     . ILE I  1 73  ? -25.903 -36.667 -30.427 1.00 42.60  ? 316 ILE I N     1 
ATOM   6612  C  CA    . ILE I  1 73  ? -27.302 -36.915 -30.234 1.00 42.17  ? 316 ILE I CA    1 
ATOM   6613  C  C     . ILE I  1 73  ? -27.669 -38.240 -30.885 1.00 45.45  ? 316 ILE I C     1 
ATOM   6614  O  O     . ILE I  1 73  ? -28.355 -39.048 -30.283 1.00 51.53  ? 316 ILE I O     1 
ATOM   6615  C  CB    . ILE I  1 73  ? -28.174 -35.761 -30.760 1.00 45.74  ? 316 ILE I CB    1 
ATOM   6616  C  CG1   . ILE I  1 73  ? -27.881 -34.472 -29.972 1.00 43.86  ? 316 ILE I CG1   1 
ATOM   6617  C  CG2   . ILE I  1 73  ? -29.649 -36.108 -30.608 1.00 47.53  ? 316 ILE I CG2   1 
ATOM   6618  C  CD1   . ILE I  1 73  ? -28.285 -33.211 -30.696 1.00 41.20  ? 316 ILE I CD1   1 
ATOM   6619  N  N     . LEU I  1 74  ? -27.214 -38.476 -32.106 1.00 45.87  ? 317 LEU I N     1 
ATOM   6620  C  CA    . LEU I  1 74  ? -27.506 -39.751 -32.783 1.00 49.22  ? 317 LEU I CA    1 
ATOM   6621  C  C     . LEU I  1 74  ? -27.247 -40.993 -31.952 1.00 49.42  ? 317 LEU I C     1 
ATOM   6622  O  O     . LEU I  1 74  ? -28.092 -41.867 -31.870 1.00 57.24  ? 317 LEU I O     1 
ATOM   6623  C  CB    . LEU I  1 74  ? -26.681 -39.867 -34.055 1.00 52.30  ? 317 LEU I CB    1 
ATOM   6624  C  CG    . LEU I  1 74  ? -27.346 -39.535 -35.381 1.00 51.96  ? 317 LEU I CG    1 
ATOM   6625  C  CD1   . LEU I  1 74  ? -28.419 -38.476 -35.222 1.00 54.94  ? 317 LEU I CD1   1 
ATOM   6626  C  CD2   . LEU I  1 74  ? -26.243 -39.089 -36.327 1.00 51.86  ? 317 LEU I CD2   1 
ATOM   6627  N  N     . GLU I  1 75  ? -26.078 -41.058 -31.336 1.00 53.21  ? 318 GLU I N     1 
ATOM   6628  C  CA    . GLU I  1 75  ? -25.617 -42.259 -30.665 1.00 54.98  ? 318 GLU I CA    1 
ATOM   6629  C  C     . GLU I  1 75  ? -26.120 -42.426 -29.240 1.00 59.23  ? 318 GLU I C     1 
ATOM   6630  O  O     . GLU I  1 75  ? -26.376 -43.554 -28.809 1.00 69.74  ? 318 GLU I O     1 
ATOM   6631  C  CB    . GLU I  1 75  ? -24.100 -42.254 -30.617 1.00 55.89  ? 318 GLU I CB    1 
ATOM   6632  C  CG    . GLU I  1 75  ? -23.463 -42.052 -31.975 1.00 57.54  ? 318 GLU I CG    1 
ATOM   6633  C  CD    . GLU I  1 75  ? -21.955 -42.075 -31.922 1.00 58.38  ? 318 GLU I CD    1 
ATOM   6634  O  OE1   . GLU I  1 75  ? -21.368 -41.672 -30.895 1.00 61.09  ? 318 GLU I OE1   1 
ATOM   6635  O  OE2   . GLU I  1 75  ? -21.354 -42.498 -32.918 1.00 61.32  ? 318 GLU I OE2   1 
ATOM   6636  N  N     . SER I  1 76  ? -26.210 -41.324 -28.495 1.00 62.33  ? 319 SER I N     1 
ATOM   6637  C  CA    . SER I  1 76  ? -26.639 -41.359 -27.082 1.00 60.82  ? 319 SER I CA    1 
ATOM   6638  C  C     . SER I  1 76  ? -28.087 -40.903 -26.898 1.00 60.15  ? 319 SER I C     1 
ATOM   6639  O  O     . SER I  1 76  ? -28.670 -41.114 -25.846 1.00 59.95  ? 319 SER I O     1 
ATOM   6640  C  CB    . SER I  1 76  ? -25.684 -40.556 -26.172 1.00 59.47  ? 319 SER I CB    1 
ATOM   6641  O  OG    . SER I  1 76  ? -25.895 -39.143 -26.229 1.00 64.17  ? 319 SER I OG    1 
ATOM   6642  N  N     . GLY I  1 77  ? -28.670 -40.284 -27.920 1.00 67.54  ? 320 GLY I N     1 
ATOM   6643  C  CA    . GLY I  1 77  ? -30.030 -39.732 -27.817 1.00 62.76  ? 320 GLY I CA    1 
ATOM   6644  C  C     . GLY I  1 77  ? -30.109 -38.386 -27.110 1.00 61.39  ? 320 GLY I C     1 
ATOM   6645  O  O     . GLY I  1 77  ? -31.086 -37.664 -27.282 1.00 56.43  ? 320 GLY I O     1 
ATOM   6646  N  N     . HIS I  1 78  ? -29.079 -38.044 -26.330 1.00 61.47  ? 321 HIS I N     1 
ATOM   6647  C  CA    . HIS I  1 78  ? -29.098 -36.881 -25.432 1.00 63.33  ? 321 HIS I CA    1 
ATOM   6648  C  C     . HIS I  1 78  ? -28.068 -35.834 -25.886 1.00 57.95  ? 321 HIS I C     1 
ATOM   6649  O  O     . HIS I  1 78  ? -27.349 -36.050 -26.872 1.00 52.10  ? 321 HIS I O     1 
ATOM   6650  C  CB    . HIS I  1 78  ? -28.795 -37.319 -23.986 1.00 68.64  ? 321 HIS I CB    1 
ATOM   6651  C  CG    . HIS I  1 78  ? -29.801 -38.277 -23.403 1.00 79.21  ? 321 HIS I CG    1 
ATOM   6652  N  ND1   . HIS I  1 78  ? -30.281 -39.386 -24.081 1.00 81.77  ? 321 HIS I ND1   1 
ATOM   6653  C  CD2   . HIS I  1 78  ? -30.391 -38.308 -22.182 1.00 79.70  ? 321 HIS I CD2   1 
ATOM   6654  C  CE1   . HIS I  1 78  ? -31.131 -40.043 -23.313 1.00 76.29  ? 321 HIS I CE1   1 
ATOM   6655  N  NE2   . HIS I  1 78  ? -31.209 -39.414 -22.153 1.00 79.39  ? 321 HIS I NE2   1 
ATOM   6656  N  N     . LEU I  1 79  ? -27.988 -34.711 -25.163 1.00 56.56  ? 322 LEU I N     1 
ATOM   6657  C  CA    . LEU I  1 79  ? -26.897 -33.743 -25.360 1.00 53.21  ? 322 LEU I CA    1 
ATOM   6658  C  C     . LEU I  1 79  ? -26.417 -33.203 -24.031 1.00 52.20  ? 322 LEU I C     1 
ATOM   6659  O  O     . LEU I  1 79  ? -27.175 -32.635 -23.268 1.00 61.93  ? 322 LEU I O     1 
ATOM   6660  C  CB    . LEU I  1 79  ? -27.306 -32.617 -26.314 1.00 51.55  ? 322 LEU I CB    1 
ATOM   6661  C  CG    . LEU I  1 79  ? -26.173 -31.642 -26.728 1.00 48.77  ? 322 LEU I CG    1 
ATOM   6662  C  CD1   . LEU I  1 79  ? -25.155 -32.244 -27.686 1.00 44.61  ? 322 LEU I CD1   1 
ATOM   6663  C  CD2   . LEU I  1 79  ? -26.762 -30.386 -27.351 1.00 47.84  ? 322 LEU I CD2   1 
ATOM   6664  N  N     . ARG I  1 80  ? -25.139 -33.394 -23.752 1.00 55.09  ? 323 ARG I N     1 
ATOM   6665  C  CA    . ARG I  1 80  ? -24.649 -33.256 -22.394 1.00 58.95  ? 323 ARG I CA    1 
ATOM   6666  C  C     . ARG I  1 80  ? -24.551 -31.791 -21.974 1.00 59.80  ? 323 ARG I C     1 
ATOM   6667  O  O     . ARG I  1 80  ? -24.766 -31.471 -20.799 1.00 64.31  ? 323 ARG I O     1 
ATOM   6668  C  CB    . ARG I  1 80  ? -23.302 -33.997 -22.203 1.00 61.46  ? 323 ARG I CB    1 
ATOM   6669  C  CG    . ARG I  1 80  ? -23.406 -35.524 -22.316 1.00 64.77  ? 323 ARG I CG    1 
ATOM   6670  C  CD    . ARG I  1 80  ? -22.048 -36.239 -22.309 1.00 68.00  ? 323 ARG I CD    1 
ATOM   6671  N  NE    . ARG I  1 80  ? -21.310 -36.110 -21.031 1.00 72.06  ? 323 ARG I NE    1 
ATOM   6672  C  CZ    . ARG I  1 80  ? -21.528 -36.822 -19.908 1.00 70.87  ? 323 ARG I CZ    1 
ATOM   6673  N  NH1   . ARG I  1 80  ? -22.490 -37.751 -19.841 1.00 71.42  ? 323 ARG I NH1   1 
ATOM   6674  N  NH2   . ARG I  1 80  ? -20.783 -36.596 -18.825 1.00 64.70  ? 323 ARG I NH2   1 
ATOM   6675  N  N     . LYS I  1 81  ? -24.242 -30.901 -22.916 1.00 56.27  ? 324 LYS I N     1 
ATOM   6676  C  CA    . LYS I  1 81  ? -24.188 -29.466 -22.612 1.00 58.05  ? 324 LYS I CA    1 
ATOM   6677  C  C     . LYS I  1 81  ? -25.545 -28.909 -22.166 1.00 56.48  ? 324 LYS I C     1 
ATOM   6678  O  O     . LYS I  1 81  ? -25.568 -27.934 -21.415 1.00 60.00  ? 324 LYS I O     1 
ATOM   6679  C  CB    . LYS I  1 81  ? -23.605 -28.666 -23.790 1.00 61.95  ? 324 LYS I CB    1 
ATOM   6680  C  CG    . LYS I  1 81  ? -23.561 -27.133 -23.640 1.00 69.31  ? 324 LYS I CG    1 
ATOM   6681  C  CD    . LYS I  1 81  ? -22.961 -26.611 -22.324 1.00 73.49  ? 324 LYS I CD    1 
ATOM   6682  C  CE    . LYS I  1 81  ? -21.510 -27.021 -22.130 1.00 72.86  ? 324 LYS I CE    1 
ATOM   6683  N  NZ    . LYS I  1 81  ? -20.682 -26.662 -23.310 1.00 72.21  ? 324 LYS I NZ    1 
ATOM   6684  N  N     . LEU I  1 82  ? -26.660 -29.523 -22.590 1.00 52.68  ? 325 LEU I N     1 
ATOM   6685  C  CA    . LEU I  1 82  ? -27.988 -29.096 -22.132 1.00 50.19  ? 325 LEU I CA    1 
ATOM   6686  C  C     . LEU I  1 82  ? -28.149 -29.184 -20.627 1.00 56.34  ? 325 LEU I C     1 
ATOM   6687  O  O     . LEU I  1 82  ? -28.753 -28.313 -19.995 1.00 61.61  ? 325 LEU I O     1 
ATOM   6688  C  CB    . LEU I  1 82  ? -29.099 -29.908 -22.780 1.00 50.15  ? 325 LEU I CB    1 
ATOM   6689  C  CG    . LEU I  1 82  ? -29.304 -29.736 -24.279 1.00 49.80  ? 325 LEU I CG    1 
ATOM   6690  C  CD1   . LEU I  1 82  ? -30.556 -30.470 -24.726 1.00 52.31  ? 325 LEU I CD1   1 
ATOM   6691  C  CD2   . LEU I  1 82  ? -29.397 -28.271 -24.673 1.00 52.28  ? 325 LEU I CD2   1 
ATOM   6692  N  N     . ASP I  1 83  ? -27.574 -30.221 -20.047 1.00 57.56  ? 326 ASP I N     1 
ATOM   6693  C  CA    . ASP I  1 83  ? -27.689 -30.465 -18.616 1.00 60.10  ? 326 ASP I CA    1 
ATOM   6694  C  C     . ASP I  1 83  ? -26.811 -29.526 -17.792 1.00 53.90  ? 326 ASP I C     1 
ATOM   6695  O  O     . ASP I  1 83  ? -26.798 -29.606 -16.571 1.00 60.59  ? 326 ASP I O     1 
ATOM   6696  C  CB    . ASP I  1 83  ? -27.364 -31.942 -18.334 1.00 62.69  ? 326 ASP I CB    1 
ATOM   6697  C  CG    . ASP I  1 83  ? -28.171 -32.884 -19.236 1.00 66.33  ? 326 ASP I CG    1 
ATOM   6698  O  OD1   . ASP I  1 83  ? -29.423 -32.846 -19.181 1.00 70.68  ? 326 ASP I OD1   1 
ATOM   6699  O  OD2   . ASP I  1 83  ? -27.565 -33.628 -20.037 1.00 71.85  ? 326 ASP I OD2   1 
ATOM   6700  N  N     . HIS I  1 84  ? -26.083 -28.645 -18.462 1.00 45.61  ? 327 HIS I N     1 
ATOM   6701  C  CA    . HIS I  1 84  ? -25.209 -27.684 -17.805 1.00 47.32  ? 327 HIS I CA    1 
ATOM   6702  C  C     . HIS I  1 84  ? -25.607 -26.222 -18.050 1.00 42.15  ? 327 HIS I C     1 
ATOM   6703  O  O     . HIS I  1 84  ? -24.831 -25.291 -17.808 1.00 42.38  ? 327 HIS I O     1 
ATOM   6704  C  CB    . HIS I  1 84  ? -23.782 -27.937 -18.271 1.00 52.19  ? 327 HIS I CB    1 
ATOM   6705  C  CG    . HIS I  1 84  ? -23.203 -29.198 -17.718 1.00 63.50  ? 327 HIS I CG    1 
ATOM   6706  N  ND1   . HIS I  1 84  ? -23.722 -30.445 -18.005 1.00 65.40  ? 327 HIS I ND1   1 
ATOM   6707  C  CD2   . HIS I  1 84  ? -22.169 -29.404 -16.867 1.00 69.24  ? 327 HIS I CD2   1 
ATOM   6708  C  CE1   . HIS I  1 84  ? -23.023 -31.364 -17.368 1.00 68.80  ? 327 HIS I CE1   1 
ATOM   6709  N  NE2   . HIS I  1 84  ? -22.071 -30.760 -16.676 1.00 73.11  ? 327 HIS I NE2   1 
ATOM   6710  N  N     . ILE I  1 85  ? -26.826 -26.027 -18.519 1.00 37.89  ? 328 ILE I N     1 
ATOM   6711  C  CA    . ILE I  1 85  ? -27.378 -24.704 -18.732 1.00 44.08  ? 328 ILE I CA    1 
ATOM   6712  C  C     . ILE I  1 85  ? -27.837 -24.039 -17.414 1.00 39.66  ? 328 ILE I C     1 
ATOM   6713  O  O     . ILE I  1 85  ? -28.594 -24.609 -16.654 1.00 36.13  ? 328 ILE I O     1 
ATOM   6714  C  CB    . ILE I  1 85  ? -28.551 -24.833 -19.733 1.00 50.63  ? 328 ILE I CB    1 
ATOM   6715  C  CG1   . ILE I  1 85  ? -27.979 -24.980 -21.160 1.00 47.53  ? 328 ILE I CG1   1 
ATOM   6716  C  CG2   . ILE I  1 85  ? -29.540 -23.671 -19.610 1.00 52.96  ? 328 ILE I CG2   1 
ATOM   6717  C  CD1   . ILE I  1 85  ? -29.046 -25.116 -22.229 1.00 47.69  ? 328 ILE I CD1   1 
ATOM   6718  N  N     . SER I  1 86  ? -27.389 -22.819 -17.161 1.00 42.73  ? 329 SER I N     1 
ATOM   6719  C  CA    . SER I  1 86  ? -27.794 -22.089 -15.957 1.00 37.83  ? 329 SER I CA    1 
ATOM   6720  C  C     . SER I  1 86  ? -29.289 -22.084 -15.725 1.00 36.38  ? 329 SER I C     1 
ATOM   6721  O  O     . SER I  1 86  ? -30.083 -21.997 -16.669 1.00 35.51  ? 329 SER I O     1 
ATOM   6722  C  CB    . SER I  1 86  ? -27.332 -20.656 -16.036 1.00 41.83  ? 329 SER I CB    1 
ATOM   6723  O  OG    . SER I  1 86  ? -27.771 -19.979 -14.864 1.00 47.70  ? 329 SER I OG    1 
ATOM   6724  N  N     . GLU I  1 87  ? -29.682 -22.148 -14.465 1.00 36.01  ? 330 GLU I N     1 
ATOM   6725  C  CA    . GLU I  1 87  ? -31.091 -22.191 -14.119 1.00 40.06  ? 330 GLU I CA    1 
ATOM   6726  C  C     . GLU I  1 87  ? -31.739 -20.817 -14.221 1.00 32.48  ? 330 GLU I C     1 
ATOM   6727  O  O     . GLU I  1 87  ? -32.934 -20.711 -14.104 1.00 35.48  ? 330 GLU I O     1 
ATOM   6728  C  CB    . GLU I  1 87  ? -31.300 -22.710 -12.705 1.00 47.63  ? 330 GLU I CB    1 
ATOM   6729  C  CG    . GLU I  1 87  ? -31.146 -24.212 -12.569 1.00 56.53  ? 330 GLU I CG    1 
ATOM   6730  C  CD    . GLU I  1 87  ? -31.177 -24.668 -11.110 1.00 65.73  ? 330 GLU I CD    1 
ATOM   6731  O  OE1   . GLU I  1 87  ? -31.994 -24.135 -10.312 1.00 67.66  ? 330 GLU I OE1   1 
ATOM   6732  O  OE2   . GLU I  1 87  ? -30.369 -25.559 -10.755 1.00 74.16  ? 330 GLU I OE2   1 
ATOM   6733  N  N     . SER I  1 88  ? -30.949 -19.783 -14.439 1.00 28.60  ? 331 SER I N     1 
ATOM   6734  C  CA    . SER I  1 88  ? -31.483 -18.444 -14.624 1.00 28.47  ? 331 SER I CA    1 
ATOM   6735  C  C     . SER I  1 88  ? -32.155 -18.240 -16.005 1.00 28.06  ? 331 SER I C     1 
ATOM   6736  O  O     . SER I  1 88  ? -32.969 -17.348 -16.156 1.00 27.82  ? 331 SER I O     1 
ATOM   6737  C  CB    . SER I  1 88  ? -30.377 -17.434 -14.438 1.00 25.96  ? 331 SER I CB    1 
ATOM   6738  O  OG    . SER I  1 88  ? -29.350 -17.698 -15.369 1.00 26.83  ? 331 SER I OG    1 
ATOM   6739  N  N     . VAL I  1 89  ? -31.835 -19.082 -16.977 1.00 25.75  ? 332 VAL I N     1 
ATOM   6740  C  CA    . VAL I  1 89  ? -32.197 -18.834 -18.360 1.00 26.15  ? 332 VAL I CA    1 
ATOM   6741  C  C     . VAL I  1 89  ? -33.693 -18.596 -18.563 1.00 25.45  ? 332 VAL I C     1 
ATOM   6742  O  O     . VAL I  1 89  ? -34.076 -17.794 -19.390 1.00 26.31  ? 332 VAL I O     1 
ATOM   6743  C  CB    . VAL I  1 89  ? -31.722 -20.023 -19.242 1.00 29.01  ? 332 VAL I CB    1 
ATOM   6744  C  CG1   . VAL I  1 89  ? -32.565 -20.206 -20.511 1.00 28.25  ? 332 VAL I CG1   1 
ATOM   6745  C  CG2   . VAL I  1 89  ? -30.246 -19.862 -19.575 1.00 30.81  ? 332 VAL I CG2   1 
ATOM   6746  N  N     . PRO I  1 90  ? -34.550 -19.354 -17.885 1.00 24.14  ? 333 PRO I N     1 
ATOM   6747  C  CA    . PRO I  1 90  ? -35.979 -19.097 -18.121 1.00 23.77  ? 333 PRO I CA    1 
ATOM   6748  C  C     . PRO I  1 90  ? -36.445 -17.719 -17.619 1.00 25.55  ? 333 PRO I C     1 
ATOM   6749  O  O     . PRO I  1 90  ? -37.353 -17.092 -18.186 1.00 26.21  ? 333 PRO I O     1 
ATOM   6750  C  CB    . PRO I  1 90  ? -36.682 -20.191 -17.335 1.00 23.68  ? 333 PRO I CB    1 
ATOM   6751  C  CG    . PRO I  1 90  ? -35.677 -21.291 -17.200 1.00 23.85  ? 333 PRO I CG    1 
ATOM   6752  C  CD    . PRO I  1 90  ? -34.283 -20.702 -17.349 1.00 24.16  ? 333 PRO I CD    1 
ATOM   6753  N  N     . VAL I  1 91  ? -35.809 -17.241 -16.568 1.00 25.12  ? 334 VAL I N     1 
ATOM   6754  C  CA    . VAL I  1 91  ? -36.119 -15.946 -16.032 1.00 23.93  ? 334 VAL I CA    1 
ATOM   6755  C  C     . VAL I  1 91  ? -35.566 -14.868 -16.957 1.00 22.84  ? 334 VAL I C     1 
ATOM   6756  O  O     . VAL I  1 91  ? -36.250 -13.902 -17.235 1.00 23.57  ? 334 VAL I O     1 
ATOM   6757  C  CB    . VAL I  1 91  ? -35.614 -15.784 -14.596 1.00 24.11  ? 334 VAL I CB    1 
ATOM   6758  C  CG1   . VAL I  1 91  ? -35.818 -14.335 -14.127 1.00 25.90  ? 334 VAL I CG1   1 
ATOM   6759  C  CG2   . VAL I  1 91  ? -36.415 -16.707 -13.688 1.00 23.50  ? 334 VAL I CG2   1 
ATOM   6760  N  N     . LEU I  1 92  ? -34.366 -15.066 -17.471 1.00 20.33  ? 335 LEU I N     1 
ATOM   6761  C  CA    . LEU I  1 92  ? -33.779 -14.090 -18.348 1.00 21.10  ? 335 LEU I CA    1 
ATOM   6762  C  C     . LEU I  1 92  ? -34.614 -13.994 -19.616 1.00 21.74  ? 335 LEU I C     1 
ATOM   6763  O  O     . LEU I  1 92  ? -34.751 -12.912 -20.161 1.00 21.16  ? 335 LEU I O     1 
ATOM   6764  C  CB    . LEU I  1 92  ? -32.346 -14.453 -18.705 1.00 21.88  ? 335 LEU I CB    1 
ATOM   6765  C  CG    . LEU I  1 92  ? -31.377 -14.524 -17.509 1.00 23.50  ? 335 LEU I CG    1 
ATOM   6766  C  CD1   . LEU I  1 92  ? -29.960 -14.918 -17.945 1.00 23.02  ? 335 LEU I CD1   1 
ATOM   6767  C  CD2   . LEU I  1 92  ? -31.337 -13.178 -16.779 1.00 24.32  ? 335 LEU I CD2   1 
ATOM   6768  N  N     . GLU I  1 93  ? -35.196 -15.105 -20.064 1.00 21.84  ? 336 GLU I N     1 
ATOM   6769  C  CA    . GLU I  1 93  ? -36.016 -15.104 -21.259 1.00 21.45  ? 336 GLU I CA    1 
ATOM   6770  C  C     . GLU I  1 93  ? -37.303 -14.427 -20.937 1.00 20.03  ? 336 GLU I C     1 
ATOM   6771  O  O     . GLU I  1 93  ? -37.824 -13.699 -21.720 1.00 19.14  ? 336 GLU I O     1 
ATOM   6772  C  CB    . GLU I  1 93  ? -36.319 -16.530 -21.719 1.00 26.30  ? 336 GLU I CB    1 
ATOM   6773  C  CG    . GLU I  1 93  ? -37.362 -16.667 -22.843 1.00 29.84  ? 336 GLU I CG    1 
ATOM   6774  C  CD    . GLU I  1 93  ? -37.236 -17.974 -23.668 1.00 37.06  ? 336 GLU I CD    1 
ATOM   6775  O  OE1   . GLU I  1 93  ? -37.426 -19.074 -23.104 1.00 37.92  ? 336 GLU I OE1   1 
ATOM   6776  O  OE2   . GLU I  1 93  ? -36.964 -17.914 -24.910 1.00 39.43  ? 336 GLU I OE2   1 
ATOM   6777  N  N     . LEU I  1 94  ? -37.839 -14.681 -19.764 1.00 21.07  ? 337 LEU I N     1 
ATOM   6778  C  CA    . LEU I  1 94  ? -39.080 -14.040 -19.373 1.00 21.05  ? 337 LEU I CA    1 
ATOM   6779  C  C     . LEU I  1 94  ? -38.935 -12.532 -19.466 1.00 20.14  ? 337 LEU I C     1 
ATOM   6780  O  O     . LEU I  1 94  ? -39.799 -11.862 -20.000 1.00 20.14  ? 337 LEU I O     1 
ATOM   6781  C  CB    . LEU I  1 94  ? -39.389 -14.394 -17.928 1.00 22.36  ? 337 LEU I CB    1 
ATOM   6782  C  CG    . LEU I  1 94  ? -40.653 -13.845 -17.292 1.00 23.83  ? 337 LEU I CG    1 
ATOM   6783  C  CD1   . LEU I  1 94  ? -41.879 -14.418 -17.954 1.00 24.00  ? 337 LEU I CD1   1 
ATOM   6784  C  CD2   . LEU I  1 94  ? -40.708 -14.202 -15.804 1.00 26.84  ? 337 LEU I CD2   1 
ATOM   6785  N  N     . PHE I  1 95  ? -37.843 -12.020 -18.896 1.00 18.67  ? 338 PHE I N     1 
ATOM   6786  C  CA    . PHE I  1 95  ? -37.613 -10.599 -18.793 1.00 18.70  ? 338 PHE I CA    1 
ATOM   6787  C  C     . PHE I  1 95  ? -37.288 -9.987  -20.155 1.00 20.19  ? 338 PHE I C     1 
ATOM   6788  O  O     . PHE I  1 95  ? -37.759 -8.910  -20.453 1.00 20.41  ? 338 PHE I O     1 
ATOM   6789  C  CB    . PHE I  1 95  ? -36.442 -10.325 -17.844 1.00 18.73  ? 338 PHE I CB    1 
ATOM   6790  C  CG    . PHE I  1 95  ? -36.732 -10.607 -16.391 1.00 18.88  ? 338 PHE I CG    1 
ATOM   6791  C  CD1   . PHE I  1 95  ? -37.994 -10.821 -15.935 1.00 18.90  ? 338 PHE I CD1   1 
ATOM   6792  C  CD2   . PHE I  1 95  ? -35.701 -10.624 -15.467 1.00 18.56  ? 338 PHE I CD2   1 
ATOM   6793  C  CE1   . PHE I  1 95  ? -38.217 -11.079 -14.565 1.00 20.60  ? 338 PHE I CE1   1 
ATOM   6794  C  CE2   . PHE I  1 95  ? -35.916 -10.862 -14.119 1.00 18.21  ? 338 PHE I CE2   1 
ATOM   6795  C  CZ    . PHE I  1 95  ? -37.189 -11.072 -13.655 1.00 17.95  ? 338 PHE I CZ    1 
ATOM   6796  N  N     . SER I  1 96  ? -36.473 -10.659 -20.976 1.00 19.96  ? 339 SER I N     1 
ATOM   6797  C  CA    . SER I  1 96  ? -36.141 -10.126 -22.311 1.00 20.92  ? 339 SER I CA    1 
ATOM   6798  C  C     . SER I  1 96  ? -37.284 -10.290 -23.348 1.00 20.34  ? 339 SER I C     1 
ATOM   6799  O  O     . SER I  1 96  ? -37.259 -9.684  -24.361 1.00 20.97  ? 339 SER I O     1 
ATOM   6800  C  CB    . SER I  1 96  ? -34.830 -10.711 -22.807 1.00 21.63  ? 339 SER I CB    1 
ATOM   6801  O  OG    . SER I  1 96  ? -34.894 -12.121 -22.858 1.00 25.59  ? 339 SER I OG    1 
ATOM   6802  N  N     . ASN I  1 97  ? -38.325 -11.038 -23.004 1.00 19.53  ? 340 ASN I N     1 
ATOM   6803  C  CA    . ASN I  1 97  ? -39.537 -10.999 -23.740 1.00 21.88  ? 340 ASN I CA    1 
ATOM   6804  C  C     . ASN I  1 97  ? -40.276 -9.680  -23.608 1.00 21.62  ? 340 ASN I C     1 
ATOM   6805  O  O     . ASN I  1 97  ? -41.203 -9.448  -24.346 1.00 26.90  ? 340 ASN I O     1 
ATOM   6806  C  CB    . ASN I  1 97  ? -40.482 -12.110 -23.288 1.00 23.03  ? 340 ASN I CB    1 
ATOM   6807  C  CG    . ASN I  1 97  ? -40.112 -13.448 -23.874 1.00 23.74  ? 340 ASN I CG    1 
ATOM   6808  O  OD1   . ASN I  1 97  ? -39.386 -13.519 -24.832 1.00 20.10  ? 340 ASN I OD1   1 
ATOM   6809  N  ND2   . ASN I  1 97  ? -40.626 -14.513 -23.279 1.00 25.70  ? 340 ASN I ND2   1 
ATOM   6810  N  N     . ILE I  1 98  ? -39.904 -8.839  -22.665 1.00 21.47  ? 341 ILE I N     1 
ATOM   6811  C  CA    . ILE I  1 98  ? -40.426 -7.467  -22.612 1.00 20.07  ? 341 ILE I CA    1 
ATOM   6812  C  C     . ILE I  1 98  ? -39.742 -6.606  -23.710 1.00 20.80  ? 341 ILE I C     1 
ATOM   6813  O  O     . ILE I  1 98  ? -38.503 -6.596  -23.826 1.00 25.05  ? 341 ILE I O     1 
ATOM   6814  C  CB    . ILE I  1 98  ? -40.183 -6.832  -21.250 1.00 20.60  ? 341 ILE I CB    1 
ATOM   6815  C  CG1   . ILE I  1 98  ? -40.801 -7.678  -20.123 1.00 20.77  ? 341 ILE I CG1   1 
ATOM   6816  C  CG2   . ILE I  1 98  ? -40.727 -5.399  -21.226 1.00 21.97  ? 341 ILE I CG2   1 
ATOM   6817  C  CD1   . ILE I  1 98  ? -40.361 -7.265  -18.710 1.00 20.42  ? 341 ILE I CD1   1 
ATOM   6818  N  N     . TRP I  1 99  ? -40.571 -5.938  -24.523 1.00 19.39  ? 342 TRP I N     1 
ATOM   6819  C  CA    . TRP I  1 99  ? -40.134 -5.078  -25.586 1.00 19.73  ? 342 TRP I CA    1 
ATOM   6820  C  C     . TRP I  1 99  ? -39.469 -3.906  -24.956 1.00 20.11  ? 342 TRP I C     1 
ATOM   6821  O  O     . TRP I  1 99  ? -40.038 -3.195  -24.115 1.00 21.08  ? 342 TRP I O     1 
ATOM   6822  C  CB    . TRP I  1 99  ? -41.309 -4.572  -26.435 1.00 20.42  ? 342 TRP I CB    1 
ATOM   6823  C  CG    . TRP I  1 99  ? -40.863 -4.097  -27.744 1.00 21.35  ? 342 TRP I CG    1 
ATOM   6824  C  CD1   . TRP I  1 99  ? -40.924 -4.772  -28.932 1.00 21.07  ? 342 TRP I CD1   1 
ATOM   6825  C  CD2   . TRP I  1 99  ? -40.268 -2.834  -28.039 1.00 22.43  ? 342 TRP I CD2   1 
ATOM   6826  N  NE1   . TRP I  1 99  ? -40.390 -4.018  -29.940 1.00 22.18  ? 342 TRP I NE1   1 
ATOM   6827  C  CE2   . TRP I  1 99  ? -39.978 -2.823  -29.427 1.00 21.99  ? 342 TRP I CE2   1 
ATOM   6828  C  CE3   . TRP I  1 99  ? -39.942 -1.731  -27.280 1.00 21.68  ? 342 TRP I CE3   1 
ATOM   6829  C  CZ2   . TRP I  1 99  ? -39.368 -1.735  -30.064 1.00 25.61  ? 342 TRP I CZ2   1 
ATOM   6830  C  CZ3   . TRP I  1 99  ? -39.311 -0.628  -27.925 1.00 24.71  ? 342 TRP I CZ3   1 
ATOM   6831  C  CH2   . TRP I  1 99  ? -39.040 -0.647  -29.299 1.00 23.42  ? 342 TRP I CH2   1 
ATOM   6832  N  N     . GLY I  1 100 ? -38.237 -3.724  -25.339 1.00 20.45  ? 343 GLY I N     1 
ATOM   6833  C  CA    . GLY I  1 100 ? -37.400 -2.725  -24.710 1.00 21.04  ? 343 GLY I CA    1 
ATOM   6834  C  C     . GLY I  1 100 ? -36.391 -3.272  -23.724 1.00 21.14  ? 343 GLY I C     1 
ATOM   6835  O  O     . GLY I  1 100 ? -35.504 -2.544  -23.379 1.00 24.05  ? 343 GLY I O     1 
ATOM   6836  N  N     . ALA I  1 101 ? -36.519 -4.523  -23.259 1.00 20.60  ? 344 ALA I N     1 
ATOM   6837  C  CA    . ALA I  1 101 ? -35.547 -5.079  -22.338 1.00 21.10  ? 344 ALA I CA    1 
ATOM   6838  C  C     . ALA I  1 101 ? -34.811 -6.198  -23.030 1.00 21.36  ? 344 ALA I C     1 
ATOM   6839  O  O     . ALA I  1 101 ? -35.442 -7.148  -23.528 1.00 22.61  ? 344 ALA I O     1 
ATOM   6840  C  CB    . ALA I  1 101 ? -36.228 -5.588  -21.078 1.00 22.55  ? 344 ALA I CB    1 
ATOM   6841  N  N     . GLY I  1 102 ? -33.480 -6.060  -23.079 1.00 20.58  ? 345 GLY I N     1 
ATOM   6842  C  CA    . GLY I  1 102 ? -32.580 -7.057  -23.714 1.00 19.31  ? 345 GLY I CA    1 
ATOM   6843  C  C     . GLY I  1 102 ? -31.858 -7.820  -22.618 1.00 20.92  ? 345 GLY I C     1 
ATOM   6844  O  O     . GLY I  1 102 ? -32.266 -7.791  -21.398 1.00 20.20  ? 345 GLY I O     1 
ATOM   6845  N  N     . THR I  1 103 ? -30.767 -8.435  -23.021 1.00 19.51  ? 346 THR I N     1 
ATOM   6846  C  CA    . THR I  1 103 ? -29.968 -9.309  -22.175 1.00 21.44  ? 346 THR I CA    1 
ATOM   6847  C  C     . THR I  1 103 ? -29.303 -8.575  -21.008 1.00 22.02  ? 346 THR I C     1 
ATOM   6848  O  O     . THR I  1 103 ? -29.270 -9.123  -19.930 1.00 19.65  ? 346 THR I O     1 
ATOM   6849  C  CB    . THR I  1 103 ? -28.887 -10.054 -23.010 1.00 22.03  ? 346 THR I CB    1 
ATOM   6850  O  OG1   . THR I  1 103 ? -28.139 -10.954 -22.164 1.00 27.80  ? 346 THR I OG1   1 
ATOM   6851  C  CG2   . THR I  1 103 ? -27.912 -9.119  -23.573 1.00 21.34  ? 346 THR I CG2   1 
ATOM   6852  N  N     . LYS I  1 104 ? -28.805 -7.344  -21.190 1.00 22.38  ? 347 LYS I N     1 
ATOM   6853  C  CA    . LYS I  1 104 ? -28.242 -6.597  -20.031 1.00 24.03  ? 347 LYS I CA    1 
ATOM   6854  C  C     . LYS I  1 104 ? -29.258 -6.270  -18.920 1.00 22.87  ? 347 LYS I C     1 
ATOM   6855  O  O     . LYS I  1 104 ? -28.968 -6.373  -17.715 1.00 20.60  ? 347 LYS I O     1 
ATOM   6856  C  CB    . LYS I  1 104 ? -27.626 -5.272  -20.440 1.00 25.86  ? 347 LYS I CB    1 
ATOM   6857  C  CG    . LYS I  1 104 ? -26.190 -5.338  -20.858 1.00 30.82  ? 347 LYS I CG    1 
ATOM   6858  C  CD    . LYS I  1 104 ? -26.011 -5.604  -22.327 1.00 34.81  ? 347 LYS I CD    1 
ATOM   6859  C  CE    . LYS I  1 104 ? -24.525 -5.579  -22.666 1.00 39.98  ? 347 LYS I CE    1 
ATOM   6860  N  NZ    . LYS I  1 104 ? -23.764 -6.602  -21.877 1.00 43.42  ? 347 LYS I NZ    1 
ATOM   6861  N  N     . THR I  1 105 ? -30.417 -5.780  -19.337 1.00 22.56  ? 348 THR I N     1 
ATOM   6862  C  CA    . THR I  1 105 ? -31.469 -5.386  -18.426 1.00 20.78  ? 348 THR I CA    1 
ATOM   6863  C  C     . THR I  1 105 ? -32.028 -6.606  -17.741 1.00 20.68  ? 348 THR I C     1 
ATOM   6864  O  O     . THR I  1 105 ? -32.255 -6.588  -16.546 1.00 21.15  ? 348 THR I O     1 
ATOM   6865  C  CB    . THR I  1 105 ? -32.563 -4.707  -19.217 1.00 22.21  ? 348 THR I CB    1 
ATOM   6866  O  OG1   . THR I  1 105 ? -32.025 -3.532  -19.802 1.00 19.32  ? 348 THR I OG1   1 
ATOM   6867  C  CG2   . THR I  1 105 ? -33.716 -4.352  -18.390 1.00 22.81  ? 348 THR I CG2   1 
ATOM   6868  N  N     . ALA I  1 106 ? -32.245 -7.674  -18.486 1.00 20.70  ? 349 ALA I N     1 
ATOM   6869  C  CA    . ALA I  1 106 ? -32.625 -8.961  -17.886 1.00 20.81  ? 349 ALA I CA    1 
ATOM   6870  C  C     . ALA I  1 106 ? -31.660 -9.393  -16.782 1.00 21.15  ? 349 ALA I C     1 
ATOM   6871  O  O     . ALA I  1 106 ? -32.073 -9.735  -15.683 1.00 22.94  ? 349 ALA I O     1 
ATOM   6872  C  CB    . ALA I  1 106 ? -32.706 -10.031 -18.947 1.00 18.99  ? 349 ALA I CB    1 
ATOM   6873  N  N     . GLN I  1 107 ? -30.382 -9.345  -17.074 1.00 21.56  ? 350 GLN I N     1 
ATOM   6874  C  CA    . GLN I  1 107 ? -29.329 -9.729  -16.114 1.00 23.70  ? 350 GLN I CA    1 
ATOM   6875  C  C     . GLN I  1 107 ? -29.261 -8.808  -14.918 1.00 22.77  ? 350 GLN I C     1 
ATOM   6876  O  O     . GLN I  1 107 ? -29.041 -9.262  -13.788 1.00 21.09  ? 350 GLN I O     1 
ATOM   6877  C  CB    . GLN I  1 107 ? -27.957 -9.780  -16.817 1.00 26.77  ? 350 GLN I CB    1 
ATOM   6878  C  CG    . GLN I  1 107 ? -27.565 -11.185 -17.269 1.00 34.71  ? 350 GLN I CG    1 
ATOM   6879  C  CD    . GLN I  1 107 ? -26.650 -11.255 -18.501 1.00 40.46  ? 350 GLN I CD    1 
ATOM   6880  O  OE1   . GLN I  1 107 ? -26.218 -10.234 -19.093 1.00 45.65  ? 350 GLN I OE1   1 
ATOM   6881  N  NE2   . GLN I  1 107 ? -26.346 -12.482 -18.899 1.00 47.28  ? 350 GLN I NE2   1 
ATOM   6882  N  N     . MET I  1 108 ? -29.435 -7.503  -15.128 1.00 22.06  ? 351 MET I N     1 
ATOM   6883  C  CA    . MET I  1 108 ? -29.511 -6.594  -13.958 1.00 21.76  ? 351 MET I CA    1 
ATOM   6884  C  C     . MET I  1 108 ? -30.724 -6.887  -13.077 1.00 20.82  ? 351 MET I C     1 
ATOM   6885  O  O     . MET I  1 108 ? -30.653 -6.901  -11.817 1.00 20.73  ? 351 MET I O     1 
ATOM   6886  C  CB    . MET I  1 108 ? -29.471 -5.136  -14.390 1.00 24.07  ? 351 MET I CB    1 
ATOM   6887  C  CG    . MET I  1 108 ? -29.883 -4.101  -13.335 1.00 26.68  ? 351 MET I CG    1 
ATOM   6888  S  SD    . MET I  1 108 ? -30.008 -2.445  -14.096 1.00 36.65  ? 351 MET I SD    1 
ATOM   6889  C  CE    . MET I  1 108 ? -31.680 -2.264  -14.710 1.00 33.04  ? 351 MET I CE    1 
ATOM   6890  N  N     . TRP I  1 109 ? -31.864 -7.130  -13.695 1.00 18.73  ? 352 TRP I N     1 
ATOM   6891  C  CA    . TRP I  1 109 ? -33.025 -7.390  -12.891 1.00 19.13  ? 352 TRP I CA    1 
ATOM   6892  C  C     . TRP I  1 109 ? -32.812 -8.693  -12.094 1.00 18.60  ? 352 TRP I C     1 
ATOM   6893  O  O     . TRP I  1 109 ? -33.073 -8.723  -10.912 1.00 18.94  ? 352 TRP I O     1 
ATOM   6894  C  CB    . TRP I  1 109 ? -34.294 -7.429  -13.720 1.00 20.23  ? 352 TRP I CB    1 
ATOM   6895  C  CG    . TRP I  1 109 ? -34.763 -6.116  -14.207 1.00 20.08  ? 352 TRP I CG    1 
ATOM   6896  C  CD1   . TRP I  1 109 ? -34.536 -4.898  -13.653 1.00 20.17  ? 352 TRP I CD1   1 
ATOM   6897  C  CD2   . TRP I  1 109 ? -35.586 -5.888  -15.344 1.00 20.06  ? 352 TRP I CD2   1 
ATOM   6898  N  NE1   . TRP I  1 109 ? -35.140 -3.927  -14.376 1.00 21.10  ? 352 TRP I NE1   1 
ATOM   6899  C  CE2   . TRP I  1 109 ? -35.816 -4.513  -15.418 1.00 20.32  ? 352 TRP I CE2   1 
ATOM   6900  C  CE3   . TRP I  1 109 ? -36.113 -6.713  -16.334 1.00 19.45  ? 352 TRP I CE3   1 
ATOM   6901  C  CZ2   . TRP I  1 109 ? -36.574 -3.952  -16.404 1.00 19.11  ? 352 TRP I CZ2   1 
ATOM   6902  C  CZ3   . TRP I  1 109 ? -36.898 -6.150  -17.311 1.00 20.08  ? 352 TRP I CZ3   1 
ATOM   6903  C  CH2   . TRP I  1 109 ? -37.098 -4.783  -17.354 1.00 20.94  ? 352 TRP I CH2   1 
ATOM   6904  N  N     . TYR I  1 110 ? -32.296 -9.726  -12.734 1.00 18.56  ? 353 TYR I N     1 
ATOM   6905  C  CA    . TYR I  1 110 ? -31.964 -10.962 -12.041 1.00 19.01  ? 353 TYR I CA    1 
ATOM   6906  C  C     . TYR I  1 110 ? -30.990 -10.745 -10.884 1.00 20.51  ? 353 TYR I C     1 
ATOM   6907  O  O     . TYR I  1 110 ? -31.194 -11.276 -9.788  1.00 19.07  ? 353 TYR I O     1 
ATOM   6908  C  CB    . TYR I  1 110 ? -31.428 -12.017 -13.031 1.00 20.49  ? 353 TYR I CB    1 
ATOM   6909  C  CG    . TYR I  1 110 ? -31.266 -13.436 -12.475 1.00 19.39  ? 353 TYR I CG    1 
ATOM   6910  C  CD1   . TYR I  1 110 ? -30.079 -13.786 -11.864 1.00 22.58  ? 353 TYR I CD1   1 
ATOM   6911  C  CD2   . TYR I  1 110 ? -32.271 -14.407 -12.566 1.00 19.76  ? 353 TYR I CD2   1 
ATOM   6912  C  CE1   . TYR I  1 110 ? -29.865 -15.055 -11.353 1.00 24.93  ? 353 TYR I CE1   1 
ATOM   6913  C  CE2   . TYR I  1 110 ? -32.074 -15.724 -12.048 1.00 22.38  ? 353 TYR I CE2   1 
ATOM   6914  C  CZ    . TYR I  1 110 ? -30.864 -16.017 -11.428 1.00 24.25  ? 353 TYR I CZ    1 
ATOM   6915  O  OH    . TYR I  1 110 ? -30.494 -17.232 -10.886 1.00 32.59  ? 353 TYR I OH    1 
ATOM   6916  N  N     . GLN I  1 111 ? -29.950 -9.954  -11.104 1.00 23.40  ? 354 GLN I N     1 
ATOM   6917  C  CA    . GLN I  1 111 ? -28.982 -9.732  -10.060 1.00 25.69  ? 354 GLN I CA    1 
ATOM   6918  C  C     . GLN I  1 111 ? -29.646 -8.955  -8.894  1.00 25.19  ? 354 GLN I C     1 
ATOM   6919  O  O     . GLN I  1 111 ? -29.265 -9.119  -7.722  1.00 23.69  ? 354 GLN I O     1 
ATOM   6920  C  CB    . GLN I  1 111 ? -27.731 -9.018  -10.589 1.00 26.40  ? 354 GLN I CB    1 
ATOM   6921  C  CG    . GLN I  1 111 ? -26.598 -8.974  -9.583  1.00 30.24  ? 354 GLN I CG    1 
ATOM   6922  C  CD    . GLN I  1 111 ? -26.764 -7.870  -8.507  1.00 33.95  ? 354 GLN I CD    1 
ATOM   6923  O  OE1   . GLN I  1 111 ? -26.184 -7.927  -7.386  1.00 34.48  ? 354 GLN I OE1   1 
ATOM   6924  N  NE2   . GLN I  1 111 ? -27.556 -6.856  -8.840  1.00 33.85  ? 354 GLN I NE2   1 
ATOM   6925  N  N     . GLN I  1 112 ? -30.637 -8.145  -9.202  1.00 23.08  ? 355 GLN I N     1 
ATOM   6926  C  CA    . GLN I  1 112 ? -31.372 -7.455  -8.130  1.00 24.88  ? 355 GLN I CA    1 
ATOM   6927  C  C     . GLN I  1 112 ? -32.358 -8.329  -7.414  1.00 21.92  ? 355 GLN I C     1 
ATOM   6928  O  O     . GLN I  1 112 ? -33.073 -7.865  -6.523  1.00 18.75  ? 355 GLN I O     1 
ATOM   6929  C  CB    . GLN I  1 112 ? -32.117 -6.237  -8.661  1.00 27.01  ? 355 GLN I CB    1 
ATOM   6930  C  CG    . GLN I  1 112 ? -31.231 -5.061  -9.018  1.00 27.79  ? 355 GLN I CG    1 
ATOM   6931  C  CD    . GLN I  1 112 ? -32.070 -4.014  -9.719  1.00 34.04  ? 355 GLN I CD    1 
ATOM   6932  O  OE1   . GLN I  1 112 ? -32.480 -3.005  -9.113  1.00 44.13  ? 355 GLN I OE1   1 
ATOM   6933  N  NE2   . GLN I  1 112 ? -32.440 -4.297  -10.944 1.00 30.41  ? 355 GLN I NE2   1 
ATOM   6934  N  N     . GLY I  1 113 ? -32.417 -9.608  -7.791  1.00 23.17  ? 356 GLY I N     1 
ATOM   6935  C  CA    . GLY I  1 113 ? -33.262 -10.557 -7.092  1.00 20.86  ? 356 GLY I CA    1 
ATOM   6936  C  C     . GLY I  1 113 ? -34.632 -10.766 -7.716  1.00 22.68  ? 356 GLY I C     1 
ATOM   6937  O  O     . GLY I  1 113 ? -35.450 -11.532 -7.186  1.00 21.09  ? 356 GLY I O     1 
ATOM   6938  N  N     . PHE I  1 114 ? -34.929 -10.142 -8.853  1.00 23.28  ? 357 PHE I N     1 
ATOM   6939  C  CA    . PHE I  1 114 ? -36.315 -10.243 -9.383  1.00 21.58  ? 357 PHE I CA    1 
ATOM   6940  C  C     . PHE I  1 114 ? -36.440 -11.520 -10.158 1.00 23.88  ? 357 PHE I C     1 
ATOM   6941  O  O     . PHE I  1 114 ? -35.536 -11.879 -10.903 1.00 24.65  ? 357 PHE I O     1 
ATOM   6942  C  CB    . PHE I  1 114 ? -36.682 -9.062  -10.286 1.00 21.51  ? 357 PHE I CB    1 
ATOM   6943  C  CG    . PHE I  1 114 ? -36.417 -7.706  -9.684  1.00 21.32  ? 357 PHE I CG    1 
ATOM   6944  C  CD1   . PHE I  1 114 ? -36.675 -7.466  -8.351  1.00 23.67  ? 357 PHE I CD1   1 
ATOM   6945  C  CD2   . PHE I  1 114 ? -35.909 -6.692  -10.442 1.00 21.53  ? 357 PHE I CD2   1 
ATOM   6946  C  CE1   . PHE I  1 114 ? -36.437 -6.224  -7.798  1.00 24.28  ? 357 PHE I CE1   1 
ATOM   6947  C  CE2   . PHE I  1 114 ? -35.673 -5.440  -9.913  1.00 22.12  ? 357 PHE I CE2   1 
ATOM   6948  C  CZ    . PHE I  1 114 ? -35.920 -5.211  -8.594  1.00 23.63  ? 357 PHE I CZ    1 
ATOM   6949  N  N     . ARG I  1 115 ? -37.570 -12.199 -9.999  1.00 25.79  ? 358 ARG I N     1 
ATOM   6950  C  CA    . ARG I  1 115 ? -37.785 -13.491 -10.630 1.00 26.14  ? 358 ARG I CA    1 
ATOM   6951  C  C     . ARG I  1 115 ? -39.108 -13.543 -11.381 1.00 29.10  ? 358 ARG I C     1 
ATOM   6952  O  O     . ARG I  1 115 ? -39.386 -14.510 -12.066 1.00 35.82  ? 358 ARG I O     1 
ATOM   6953  C  CB    . ARG I  1 115 ? -37.761 -14.625 -9.578  1.00 25.07  ? 358 ARG I CB    1 
ATOM   6954  C  CG    . ARG I  1 115 ? -36.443 -14.743 -8.844  1.00 23.04  ? 358 ARG I CG    1 
ATOM   6955  C  CD    . ARG I  1 115 ? -35.351 -15.176 -9.799  1.00 22.26  ? 358 ARG I CD    1 
ATOM   6956  N  NE    . ARG I  1 115 ? -34.058 -15.320 -9.159  1.00 22.66  ? 358 ARG I NE    1 
ATOM   6957  C  CZ    . ARG I  1 115 ? -33.146 -14.349 -9.000  1.00 21.86  ? 358 ARG I CZ    1 
ATOM   6958  N  NH1   . ARG I  1 115 ? -33.338 -13.109 -9.431  1.00 22.02  ? 358 ARG I NH1   1 
ATOM   6959  N  NH2   . ARG I  1 115 ? -31.997 -14.643 -8.425  1.00 20.81  ? 358 ARG I NH2   1 
ATOM   6960  N  N     . SER I  1 116 ? -39.935 -12.515 -11.281 1.00 28.38  ? 359 SER I N     1 
ATOM   6961  C  CA    . SER I  1 116 ? -41.213 -12.617 -11.940 1.00 26.97  ? 359 SER I CA    1 
ATOM   6962  C  C     . SER I  1 116 ? -41.609 -11.287 -12.503 1.00 24.01  ? 359 SER I C     1 
ATOM   6963  O  O     . SER I  1 116 ? -41.004 -10.288 -12.186 1.00 22.09  ? 359 SER I O     1 
ATOM   6964  C  CB    . SER I  1 116 ? -42.274 -13.101 -10.936 1.00 27.73  ? 359 SER I CB    1 
ATOM   6965  O  OG    . SER I  1 116 ? -42.632 -12.060 -10.081 1.00 23.26  ? 359 SER I OG    1 
ATOM   6966  N  N     . LEU I  1 117 ? -42.625 -11.279 -13.353 1.00 25.18  ? 360 LEU I N     1 
ATOM   6967  C  CA    . LEU I  1 117 ? -43.112 -10.020 -13.897 1.00 26.27  ? 360 LEU I CA    1 
ATOM   6968  C  C     . LEU I  1 117 ? -43.739 -9.212  -12.804 1.00 26.73  ? 360 LEU I C     1 
ATOM   6969  O  O     . LEU I  1 117 ? -43.604 -8.002  -12.817 1.00 25.71  ? 360 LEU I O     1 
ATOM   6970  C  CB    . LEU I  1 117 ? -44.088 -10.218 -15.032 1.00 27.41  ? 360 LEU I CB    1 
ATOM   6971  C  CG    . LEU I  1 117 ? -43.481 -10.957 -16.219 1.00 29.12  ? 360 LEU I CG    1 
ATOM   6972  C  CD1   . LEU I  1 117 ? -44.608 -11.181 -17.215 1.00 32.54  ? 360 LEU I CD1   1 
ATOM   6973  C  CD2   . LEU I  1 117 ? -42.334 -10.176 -16.836 1.00 27.72  ? 360 LEU I CD2   1 
ATOM   6974  N  N     . GLU I  1 118 ? -44.363 -9.864  -11.822 1.00 29.15  ? 361 GLU I N     1 
ATOM   6975  C  CA    . GLU I  1 118 ? -44.874 -9.118  -10.701 1.00 31.39  ? 361 GLU I CA    1 
ATOM   6976  C  C     . GLU I  1 118 ? -43.765 -8.351  -9.990  1.00 30.39  ? 361 GLU I C     1 
ATOM   6977  O  O     . GLU I  1 118 ? -43.945 -7.188  -9.639  1.00 29.71  ? 361 GLU I O     1 
ATOM   6978  C  CB    . GLU I  1 118 ? -45.644 -10.016 -9.707  1.00 37.16  ? 361 GLU I CB    1 
ATOM   6979  C  CG    . GLU I  1 118 ? -46.395 -9.225  -8.614  1.00 37.68  ? 361 GLU I CG    1 
ATOM   6980  C  CD    . GLU I  1 118 ? -47.187 -7.998  -9.122  1.00 42.89  ? 361 GLU I CD    1 
ATOM   6981  O  OE1   . GLU I  1 118 ? -47.774 -8.021  -10.243 1.00 51.31  ? 361 GLU I OE1   1 
ATOM   6982  O  OE2   . GLU I  1 118 ? -47.226 -6.973  -8.397  1.00 47.34  ? 361 GLU I OE2   1 
ATOM   6983  N  N     . ASP I  1 119 ? -42.608 -8.974  -9.820  1.00 27.46  ? 362 ASP I N     1 
ATOM   6984  C  CA    . ASP I  1 119 ? -41.513 -8.284  -9.152  1.00 26.29  ? 362 ASP I CA    1 
ATOM   6985  C  C     . ASP I  1 119 ? -41.074 -7.131  -9.998  1.00 25.22  ? 362 ASP I C     1 
ATOM   6986  O  O     . ASP I  1 119 ? -40.639 -6.138  -9.476  1.00 23.13  ? 362 ASP I O     1 
ATOM   6987  C  CB    . ASP I  1 119 ? -40.246 -9.142  -9.010  1.00 27.46  ? 362 ASP I CB    1 
ATOM   6988  C  CG    . ASP I  1 119 ? -40.386 -10.294 -8.056  1.00 29.48  ? 362 ASP I CG    1 
ATOM   6989  O  OD1   . ASP I  1 119 ? -41.009 -10.131 -6.972  1.00 33.23  ? 362 ASP I OD1   1 
ATOM   6990  O  OD2   . ASP I  1 119 ? -39.821 -11.370 -8.402  1.00 28.83  ? 362 ASP I OD2   1 
ATOM   6991  N  N     . ILE I  1 120 ? -41.081 -7.306  -11.319 1.00 23.75  ? 363 ILE I N     1 
ATOM   6992  C  CA    . ILE I  1 120 ? -40.630 -6.247  -12.176 1.00 23.76  ? 363 ILE I CA    1 
ATOM   6993  C  C     . ILE I  1 120 ? -41.594 -5.069  -12.038 1.00 24.86  ? 363 ILE I C     1 
ATOM   6994  O  O     . ILE I  1 120 ? -41.165 -3.955  -11.803 1.00 23.34  ? 363 ILE I O     1 
ATOM   6995  C  CB    . ILE I  1 120 ? -40.522 -6.693  -13.654 1.00 21.93  ? 363 ILE I CB    1 
ATOM   6996  C  CG1   . ILE I  1 120 ? -39.460 -7.790  -13.811 1.00 22.14  ? 363 ILE I CG1   1 
ATOM   6997  C  CG2   . ILE I  1 120 ? -40.258 -5.503  -14.578 1.00 20.57  ? 363 ILE I CG2   1 
ATOM   6998  C  CD1   . ILE I  1 120 ? -38.020 -7.438  -13.418 1.00 21.20  ? 363 ILE I CD1   1 
ATOM   6999  N  N     . ARG I  1 121 ? -42.889 -5.342  -12.204 1.00 29.34  ? 364 ARG I N     1 
ATOM   7000  C  CA    . ARG I  1 121 ? -43.938 -4.321  -12.124 1.00 33.49  ? 364 ARG I CA    1 
ATOM   7001  C  C     . ARG I  1 121 ? -43.840 -3.496  -10.831 1.00 34.02  ? 364 ARG I C     1 
ATOM   7002  O  O     . ARG I  1 121 ? -43.866 -2.287  -10.888 1.00 31.16  ? 364 ARG I O     1 
ATOM   7003  C  CB    . ARG I  1 121 ? -45.305 -5.001  -12.222 1.00 41.39  ? 364 ARG I CB    1 
ATOM   7004  C  CG    . ARG I  1 121 ? -46.464 -4.102  -12.610 1.00 49.86  ? 364 ARG I CG    1 
ATOM   7005  C  CD    . ARG I  1 121 ? -47.775 -4.864  -12.748 1.00 57.19  ? 364 ARG I CD    1 
ATOM   7006  N  NE    . ARG I  1 121 ? -47.613 -6.257  -13.211 1.00 64.16  ? 364 ARG I NE    1 
ATOM   7007  C  CZ    . ARG I  1 121 ? -47.435 -6.642  -14.480 1.00 63.09  ? 364 ARG I CZ    1 
ATOM   7008  N  NH1   . ARG I  1 121 ? -47.362 -5.753  -15.465 1.00 68.12  ? 364 ARG I NH1   1 
ATOM   7009  N  NH2   . ARG I  1 121 ? -47.325 -7.933  -14.773 1.00 58.44  ? 364 ARG I NH2   1 
ATOM   7010  N  N     . SER I  1 122 ? -43.632 -4.154  -9.682  1.00 37.37  ? 365 SER I N     1 
ATOM   7011  C  CA    . SER I  1 122 ? -43.708 -3.489  -8.352  1.00 33.36  ? 365 SER I CA    1 
ATOM   7012  C  C     . SER I  1 122 ? -42.396 -2.865  -7.878  1.00 33.42  ? 365 SER I C     1 
ATOM   7013  O  O     . SER I  1 122 ? -42.399 -1.893  -7.130  1.00 37.10  ? 365 SER I O     1 
ATOM   7014  C  CB    . SER I  1 122 ? -44.135 -4.505  -7.335  1.00 35.46  ? 365 SER I CB    1 
ATOM   7015  O  OG    . SER I  1 122 ? -43.319 -5.654  -7.467  1.00 37.11  ? 365 SER I OG    1 
ATOM   7016  N  N     . GLN I  1 123 ? -41.273 -3.390  -8.331  1.00 31.70  ? 366 GLN I N     1 
ATOM   7017  C  CA    . GLN I  1 123 ? -39.992 -2.975  -7.811  1.00 32.80  ? 366 GLN I CA    1 
ATOM   7018  C  C     . GLN I  1 123 ? -38.976 -2.514  -8.839  1.00 32.17  ? 366 GLN I C     1 
ATOM   7019  O  O     . GLN I  1 123 ? -38.041 -1.796  -8.490  1.00 32.21  ? 366 GLN I O     1 
ATOM   7020  C  CB    . GLN I  1 123 ? -39.365 -4.130  -7.019  1.00 34.02  ? 366 GLN I CB    1 
ATOM   7021  C  CG    . GLN I  1 123 ? -40.185 -4.599  -5.848  1.00 38.00  ? 366 GLN I CG    1 
ATOM   7022  C  CD    . GLN I  1 123 ? -39.829 -6.004  -5.429  1.00 39.93  ? 366 GLN I CD    1 
ATOM   7023  O  OE1   . GLN I  1 123 ? -38.756 -6.258  -4.901  1.00 36.41  ? 366 GLN I OE1   1 
ATOM   7024  N  NE2   . GLN I  1 123 ? -40.749 -6.920  -5.639  1.00 47.00  ? 366 GLN I NE2   1 
ATOM   7025  N  N     . ALA I  1 124 ? -39.102 -2.935  -10.096 1.00 31.79  ? 367 ALA I N     1 
ATOM   7026  C  CA    . ALA I  1 124 ? -38.048 -2.623  -11.071 1.00 30.95  ? 367 ALA I CA    1 
ATOM   7027  C  C     . ALA I  1 124 ? -38.019 -1.161  -11.546 1.00 28.27  ? 367 ALA I C     1 
ATOM   7028  O  O     . ALA I  1 124 ? -39.036 -0.554  -11.664 1.00 28.13  ? 367 ALA I O     1 
ATOM   7029  C  CB    . ALA I  1 124 ? -38.189 -3.554  -12.277 1.00 34.40  ? 367 ALA I CB    1 
ATOM   7030  N  N     . SER I  1 125 ? -36.846 -0.637  -11.867 1.00 29.65  ? 368 SER I N     1 
ATOM   7031  C  CA    . SER I  1 125 ? -36.748 0.604   -12.605 1.00 32.67  ? 368 SER I CA    1 
ATOM   7032  C  C     . SER I  1 125 ? -36.997 0.362   -14.118 1.00 32.49  ? 368 SER I C     1 
ATOM   7033  O  O     . SER I  1 125 ? -36.214 -0.350  -14.768 1.00 32.42  ? 368 SER I O     1 
ATOM   7034  C  CB    . SER I  1 125 ? -35.361 1.178   -12.383 1.00 37.77  ? 368 SER I CB    1 
ATOM   7035  O  OG    . SER I  1 125 ? -35.021 2.086   -13.410 1.00 43.30  ? 368 SER I OG    1 
ATOM   7036  N  N     . LEU I  1 126 ? -38.071 0.948   -14.663 1.00 29.64  ? 369 LEU I N     1 
ATOM   7037  C  CA    . LEU I  1 126 ? -38.508 0.696   -16.047 1.00 31.79  ? 369 LEU I CA    1 
ATOM   7038  C  C     . LEU I  1 126 ? -38.410 1.916   -16.961 1.00 30.44  ? 369 LEU I C     1 
ATOM   7039  O  O     . LEU I  1 126 ? -38.875 2.966   -16.584 1.00 30.23  ? 369 LEU I O     1 
ATOM   7040  C  CB    . LEU I  1 126 ? -39.967 0.295   -16.023 1.00 31.50  ? 369 LEU I CB    1 
ATOM   7041  C  CG    . LEU I  1 126 ? -40.227 -1.063  -15.452 1.00 30.64  ? 369 LEU I CG    1 
ATOM   7042  C  CD1   . LEU I  1 126 ? -41.661 -1.159  -15.021 1.00 29.36  ? 369 LEU I CD1   1 
ATOM   7043  C  CD2   . LEU I  1 126 ? -39.924 -2.080  -16.531 1.00 32.62  ? 369 LEU I CD2   1 
ATOM   7044  N  N     . THR I  1 127 ? -37.816 1.780   -18.153 1.00 31.45  ? 370 THR I N     1 
ATOM   7045  C  CA    . THR I  1 127 ? -37.871 2.872   -19.159 1.00 30.15  ? 370 THR I CA    1 
ATOM   7046  C  C     . THR I  1 127 ? -39.290 3.047   -19.629 1.00 28.00  ? 370 THR I C     1 
ATOM   7047  O  O     . THR I  1 127 ? -40.180 2.256   -19.315 1.00 29.26  ? 370 THR I O     1 
ATOM   7048  C  CB    . THR I  1 127 ? -36.941 2.647   -20.369 1.00 30.64  ? 370 THR I CB    1 
ATOM   7049  O  OG1   . THR I  1 127 ? -37.252 1.416   -21.030 1.00 24.94  ? 370 THR I OG1   1 
ATOM   7050  C  CG2   . THR I  1 127 ? -35.532 2.590   -19.913 1.00 30.43  ? 370 THR I CG2   1 
ATOM   7051  N  N     . THR I  1 128 ? -39.542 4.123   -20.335 1.00 30.16  ? 371 THR I N     1 
ATOM   7052  C  CA    . THR I  1 128 ? -40.889 4.343   -20.918 1.00 32.01  ? 371 THR I CA    1 
ATOM   7053  C  C     . THR I  1 128 ? -41.259 3.199   -21.851 1.00 26.90  ? 371 THR I C     1 
ATOM   7054  O  O     . THR I  1 128 ? -42.321 2.659   -21.789 1.00 27.21  ? 371 THR I O     1 
ATOM   7055  C  CB    . THR I  1 128 ? -40.894 5.638   -21.728 1.00 35.88  ? 371 THR I CB    1 
ATOM   7056  O  OG1   . THR I  1 128 ? -40.455 6.695   -20.874 1.00 37.24  ? 371 THR I OG1   1 
ATOM   7057  C  CG2   . THR I  1 128 ? -42.293 5.972   -22.249 1.00 40.29  ? 371 THR I CG2   1 
ATOM   7058  N  N     . GLN I  1 129 ? -40.348 2.825   -22.734 1.00 27.86  ? 372 GLN I N     1 
ATOM   7059  C  CA    . GLN I  1 129 ? -40.636 1.741   -23.681 1.00 24.68  ? 372 GLN I CA    1 
ATOM   7060  C  C     . GLN I  1 129 ? -40.933 0.446   -22.926 1.00 26.53  ? 372 GLN I C     1 
ATOM   7061  O  O     . GLN I  1 129 ? -41.931 -0.219  -23.176 1.00 27.61  ? 372 GLN I O     1 
ATOM   7062  C  CB    . GLN I  1 129 ? -39.455 1.588   -24.641 1.00 23.99  ? 372 GLN I CB    1 
ATOM   7063  C  CG    . GLN I  1 129 ? -39.442 2.702   -25.684 1.00 22.77  ? 372 GLN I CG    1 
ATOM   7064  C  CD    . GLN I  1 129 ? -38.148 2.767   -26.427 1.00 23.75  ? 372 GLN I CD    1 
ATOM   7065  O  OE1   . GLN I  1 129 ? -37.960 3.558   -27.379 1.00 29.27  ? 372 GLN I OE1   1 
ATOM   7066  N  NE2   . GLN I  1 129 ? -37.251 1.909   -26.053 1.00 22.26  ? 372 GLN I NE2   1 
ATOM   7067  N  N     . GLN I  1 130 ? -40.083 0.130   -21.947 1.00 26.78  ? 373 GLN I N     1 
ATOM   7068  C  CA    . GLN I  1 130 ? -40.232 -1.091  -21.159 1.00 24.10  ? 373 GLN I CA    1 
ATOM   7069  C  C     . GLN I  1 130 ? -41.498 -1.188  -20.438 1.00 23.06  ? 373 GLN I C     1 
ATOM   7070  O  O     . GLN I  1 130 ? -42.043 -2.263  -20.334 1.00 21.43  ? 373 GLN I O     1 
ATOM   7071  C  CB    . GLN I  1 130 ? -39.113 -1.201  -20.141 1.00 23.32  ? 373 GLN I CB    1 
ATOM   7072  C  CG    . GLN I  1 130 ? -37.804 -1.539  -20.814 1.00 22.92  ? 373 GLN I CG    1 
ATOM   7073  C  CD    . GLN I  1 130 ? -36.617 -1.215  -19.937 1.00 21.91  ? 373 GLN I CD    1 
ATOM   7074  O  OE1   . GLN I  1 130 ? -36.756 -0.861  -18.762 1.00 23.18  ? 373 GLN I OE1   1 
ATOM   7075  N  NE2   . GLN I  1 130 ? -35.462 -1.369  -20.487 1.00 19.15  ? 373 GLN I NE2   1 
ATOM   7076  N  N     . ALA I  1 131 ? -41.947 -0.076  -19.860 1.00 24.92  ? 374 ALA I N     1 
ATOM   7077  C  CA    . ALA I  1 131 ? -43.228 -0.098  -19.116 1.00 25.64  ? 374 ALA I CA    1 
ATOM   7078  C  C     . ALA I  1 131 ? -44.362 -0.433  -20.059 1.00 25.78  ? 374 ALA I C     1 
ATOM   7079  O  O     . ALA I  1 131 ? -45.317 -1.141  -19.713 1.00 31.82  ? 374 ALA I O     1 
ATOM   7080  C  CB    . ALA I  1 131 ? -43.490 1.241   -18.424 1.00 24.96  ? 374 ALA I CB    1 
ATOM   7081  N  N     . ILE I  1 132 ? -44.275 0.103   -21.253 1.00 27.68  ? 375 ILE I N     1 
ATOM   7082  C  CA    . ILE I  1 132 ? -45.277 -0.178  -22.298 1.00 28.16  ? 375 ILE I CA    1 
ATOM   7083  C  C     . ILE I  1 132 ? -45.249 -1.677  -22.683 1.00 26.66  ? 375 ILE I C     1 
ATOM   7084  O  O     . ILE I  1 132 ? -46.273 -2.314  -22.718 1.00 24.70  ? 375 ILE I O     1 
ATOM   7085  C  CB    . ILE I  1 132 ? -45.030 0.706   -23.547 1.00 27.90  ? 375 ILE I CB    1 
ATOM   7086  C  CG1   . ILE I  1 132 ? -45.439 2.148   -23.224 1.00 28.96  ? 375 ILE I CG1   1 
ATOM   7087  C  CG2   . ILE I  1 132 ? -45.861 0.159   -24.700 1.00 31.06  ? 375 ILE I CG2   1 
ATOM   7088  C  CD1   . ILE I  1 132 ? -44.980 3.221   -24.195 1.00 30.73  ? 375 ILE I CD1   1 
ATOM   7089  N  N     . GLY I  1 133 ? -44.047 -2.216  -22.933 1.00 25.74  ? 376 GLY I N     1 
ATOM   7090  C  CA    . GLY I  1 133 ? -43.863 -3.621  -23.208 1.00 23.52  ? 376 GLY I CA    1 
ATOM   7091  C  C     . GLY I  1 133 ? -44.392 -4.493  -22.103 1.00 24.72  ? 376 GLY I C     1 
ATOM   7092  O  O     . GLY I  1 133 ? -44.914 -5.603  -22.330 1.00 20.66  ? 376 GLY I O     1 
ATOM   7093  N  N     . LEU I  1 134 ? -44.220 -4.044  -20.860 1.00 28.09  ? 377 LEU I N     1 
ATOM   7094  C  CA    . LEU I  1 134 ? -44.600 -4.897  -19.726 1.00 25.45  ? 377 LEU I CA    1 
ATOM   7095  C  C     . LEU I  1 134 ? -46.099 -4.837  -19.549 1.00 28.24  ? 377 LEU I C     1 
ATOM   7096  O  O     . LEU I  1 134 ? -46.736 -5.825  -19.269 1.00 27.66  ? 377 LEU I O     1 
ATOM   7097  C  CB    . LEU I  1 134 ? -43.888 -4.428  -18.473 1.00 26.91  ? 377 LEU I CB    1 
ATOM   7098  C  CG    . LEU I  1 134 ? -44.301 -5.028  -17.147 1.00 26.78  ? 377 LEU I CG    1 
ATOM   7099  C  CD1   . LEU I  1 134 ? -43.936 -6.471  -17.094 1.00 25.89  ? 377 LEU I CD1   1 
ATOM   7100  C  CD2   . LEU I  1 134 ? -43.594 -4.250  -16.054 1.00 29.75  ? 377 LEU I CD2   1 
ATOM   7101  N  N     . LYS I  1 135 ? -46.687 -3.661  -19.712 1.00 29.11  ? 378 LYS I N     1 
ATOM   7102  C  CA    . LYS I  1 135 ? -48.122 -3.591  -19.527 1.00 31.47  ? 378 LYS I CA    1 
ATOM   7103  C  C     . LYS I  1 135 ? -48.817 -4.430  -20.633 1.00 29.61  ? 378 LYS I C     1 
ATOM   7104  O  O     . LYS I  1 135 ? -49.931 -4.910  -20.441 1.00 24.16  ? 378 LYS I O     1 
ATOM   7105  C  CB    . LYS I  1 135 ? -48.548 -2.136  -19.540 1.00 34.84  ? 378 LYS I CB    1 
ATOM   7106  C  CG    . LYS I  1 135 ? -49.987 -1.880  -19.943 1.00 39.70  ? 378 LYS I CG    1 
ATOM   7107  C  CD    . LYS I  1 135 ? -50.291 -0.384  -20.004 1.00 41.82  ? 378 LYS I CD    1 
ATOM   7108  C  CE    . LYS I  1 135 ? -49.263 0.408   -20.811 1.00 43.96  ? 378 LYS I CE    1 
ATOM   7109  N  NZ    . LYS I  1 135 ? -49.849 1.634   -21.453 1.00 49.32  ? 378 LYS I NZ    1 
ATOM   7110  N  N     . HIS I  1 136 ? -48.142 -4.612  -21.772 1.00 26.84  ? 379 HIS I N     1 
ATOM   7111  C  CA    . HIS I  1 136 ? -48.711 -5.392  -22.878 1.00 28.05  ? 379 HIS I CA    1 
ATOM   7112  C  C     . HIS I  1 136 ? -48.027 -6.758  -23.051 1.00 26.72  ? 379 HIS I C     1 
ATOM   7113  O  O     . HIS I  1 136 ? -48.076 -7.382  -24.123 1.00 26.43  ? 379 HIS I O     1 
ATOM   7114  C  CB    . HIS I  1 136 ? -48.663 -4.569  -24.177 1.00 29.47  ? 379 HIS I CB    1 
ATOM   7115  C  CG    . HIS I  1 136 ? -49.531 -3.344  -24.144 1.00 30.43  ? 379 HIS I CG    1 
ATOM   7116  N  ND1   . HIS I  1 136 ? -50.869 -3.386  -23.794 1.00 31.24  ? 379 HIS I ND1   1 
ATOM   7117  C  CD2   . HIS I  1 136 ? -49.253 -2.043  -24.394 1.00 31.23  ? 379 HIS I CD2   1 
ATOM   7118  C  CE1   . HIS I  1 136 ? -51.374 -2.162  -23.825 1.00 31.47  ? 379 HIS I CE1   1 
ATOM   7119  N  NE2   . HIS I  1 136 ? -50.419 -1.327  -24.193 1.00 32.50  ? 379 HIS I NE2   1 
ATOM   7120  N  N     . TYR I  1 137 ? -47.449 -7.275  -21.978 1.00 27.38  ? 380 TYR I N     1 
ATOM   7121  C  CA    . TYR I  1 137 ? -46.606 -8.467  -22.120 1.00 28.24  ? 380 TYR I CA    1 
ATOM   7122  C  C     . TYR I  1 137 ? -47.348 -9.547  -22.888 1.00 26.68  ? 380 TYR I C     1 
ATOM   7123  O  O     . TYR I  1 137 ? -46.940 -9.908  -23.993 1.00 26.01  ? 380 TYR I O     1 
ATOM   7124  C  CB    . TYR I  1 137 ? -46.149 -8.956  -20.767 1.00 27.47  ? 380 TYR I CB    1 
ATOM   7125  C  CG    . TYR I  1 137 ? -45.218 -10.116 -20.827 1.00 28.10  ? 380 TYR I CG    1 
ATOM   7126  C  CD1   . TYR I  1 137 ? -45.704 -11.422 -20.806 1.00 28.56  ? 380 TYR I CD1   1 
ATOM   7127  C  CD2   . TYR I  1 137 ? -43.852 -9.925  -20.889 1.00 27.36  ? 380 TYR I CD2   1 
ATOM   7128  C  CE1   . TYR I  1 137 ? -44.856 -12.524 -20.861 1.00 30.57  ? 380 TYR I CE1   1 
ATOM   7129  C  CE2   . TYR I  1 137 ? -42.991 -11.010 -20.920 1.00 28.25  ? 380 TYR I CE2   1 
ATOM   7130  C  CZ    . TYR I  1 137 ? -43.487 -12.312 -20.924 1.00 30.85  ? 380 TYR I CZ    1 
ATOM   7131  O  OH    . TYR I  1 137 ? -42.625 -13.412 -20.955 1.00 32.77  ? 380 TYR I OH    1 
ATOM   7132  N  N     . SER I  1 138 ? -48.452 -10.020 -22.326 1.00 27.68  ? 381 SER I N     1 
ATOM   7133  C  CA    . SER I  1 138 ? -49.226 -11.149 -22.927 1.00 30.98  ? 381 SER I CA    1 
ATOM   7134  C  C     . SER I  1 138 ? -49.670 -10.901 -24.342 1.00 27.47  ? 381 SER I C     1 
ATOM   7135  O  O     . SER I  1 138 ? -49.482 -11.732 -25.221 1.00 26.12  ? 381 SER I O     1 
ATOM   7136  C  CB    . SER I  1 138 ? -50.475 -11.473 -22.108 1.00 32.52  ? 381 SER I CB    1 
ATOM   7137  O  OG    . SER I  1 138 ? -50.091 -11.575 -20.775 1.00 37.60  ? 381 SER I OG    1 
ATOM   7138  N  N     . ASP I  1 139 ? -50.264 -9.743  -24.569 1.00 25.86  ? 382 ASP I N     1 
ATOM   7139  C  CA    . ASP I  1 139 ? -50.718 -9.434  -25.900 1.00 25.16  ? 382 ASP I CA    1 
ATOM   7140  C  C     . ASP I  1 139 ? -49.574 -9.534  -26.898 1.00 25.61  ? 382 ASP I C     1 
ATOM   7141  O  O     . ASP I  1 139 ? -49.791 -10.037 -28.026 1.00 24.02  ? 382 ASP I O     1 
ATOM   7142  C  CB    . ASP I  1 139 ? -51.304 -8.041  -25.975 1.00 28.56  ? 382 ASP I CB    1 
ATOM   7143  C  CG    . ASP I  1 139 ? -52.720 -7.941  -25.380 1.00 33.96  ? 382 ASP I CG    1 
ATOM   7144  O  OD1   . ASP I  1 139 ? -53.242 -8.978  -24.934 1.00 36.79  ? 382 ASP I OD1   1 
ATOM   7145  O  OD2   . ASP I  1 139 ? -53.286 -6.816  -25.356 1.00 31.02  ? 382 ASP I OD2   1 
ATOM   7146  N  N     . PHE I  1 140 ? -48.399 -9.007  -26.515 1.00 23.56  ? 383 PHE I N     1 
ATOM   7147  C  CA    . PHE I  1 140 ? -47.278 -8.841  -27.464 1.00 24.24  ? 383 PHE I CA    1 
ATOM   7148  C  C     . PHE I  1 140 ? -46.536 -10.133 -27.653 1.00 24.94  ? 383 PHE I C     1 
ATOM   7149  O  O     . PHE I  1 140 ? -45.884 -10.310 -28.652 1.00 26.03  ? 383 PHE I O     1 
ATOM   7150  C  CB    . PHE I  1 140 ? -46.257 -7.825  -27.003 1.00 22.42  ? 383 PHE I CB    1 
ATOM   7151  C  CG    . PHE I  1 140 ? -46.672 -6.429  -27.164 1.00 24.18  ? 383 PHE I CG    1 
ATOM   7152  C  CD1   . PHE I  1 140 ? -47.903 -6.088  -27.673 1.00 26.83  ? 383 PHE I CD1   1 
ATOM   7153  C  CD2   . PHE I  1 140 ? -45.843 -5.441  -26.764 1.00 25.32  ? 383 PHE I CD2   1 
ATOM   7154  C  CE1   . PHE I  1 140 ? -48.275 -4.759  -27.794 1.00 25.84  ? 383 PHE I CE1   1 
ATOM   7155  C  CE2   . PHE I  1 140 ? -46.195 -4.103  -26.881 1.00 26.80  ? 383 PHE I CE2   1 
ATOM   7156  C  CZ    . PHE I  1 140 ? -47.425 -3.768  -27.370 1.00 27.19  ? 383 PHE I CZ    1 
ATOM   7157  N  N     . LEU I  1 141 ? -46.605 -11.012 -26.673 1.00 27.01  ? 384 LEU I N     1 
ATOM   7158  C  CA    . LEU I  1 141 ? -46.054 -12.333 -26.830 1.00 31.65  ? 384 LEU I CA    1 
ATOM   7159  C  C     . LEU I  1 141 ? -46.864 -13.204 -27.807 1.00 34.10  ? 384 LEU I C     1 
ATOM   7160  O  O     . LEU I  1 141 ? -46.310 -14.050 -28.460 1.00 32.65  ? 384 LEU I O     1 
ATOM   7161  C  CB    . LEU I  1 141 ? -45.990 -13.002 -25.474 1.00 33.75  ? 384 LEU I CB    1 
ATOM   7162  C  CG    . LEU I  1 141 ? -45.050 -14.178 -25.402 1.00 35.69  ? 384 LEU I CG    1 
ATOM   7163  C  CD1   . LEU I  1 141 ? -43.596 -13.778 -25.651 1.00 34.14  ? 384 LEU I CD1   1 
ATOM   7164  C  CD2   . LEU I  1 141 ? -45.253 -14.783 -24.042 1.00 37.19  ? 384 LEU I CD2   1 
ATOM   7165  N  N     . GLU I  1 142 ? -48.178 -12.988 -27.896 1.00 35.64  ? 385 GLU I N     1 
ATOM   7166  C  CA    . GLU I  1 142 ? -49.044 -13.828 -28.714 1.00 36.57  ? 385 GLU I CA    1 
ATOM   7167  C  C     . GLU I  1 142 ? -48.897 -13.373 -30.159 1.00 35.01  ? 385 GLU I C     1 
ATOM   7168  O  O     . GLU I  1 142 ? -48.852 -12.170 -30.437 1.00 40.43  ? 385 GLU I O     1 
ATOM   7169  C  CB    . GLU I  1 142 ? -50.477 -13.636 -28.228 1.00 41.31  ? 385 GLU I CB    1 
ATOM   7170  C  CG    . GLU I  1 142 ? -51.531 -14.531 -28.847 1.00 48.80  ? 385 GLU I CG    1 
ATOM   7171  C  CD    . GLU I  1 142 ? -52.791 -13.740 -29.237 1.00 55.47  ? 385 GLU I CD    1 
ATOM   7172  O  OE1   . GLU I  1 142 ? -53.264 -12.917 -28.403 1.00 55.24  ? 385 GLU I OE1   1 
ATOM   7173  O  OE2   . GLU I  1 142 ? -53.277 -13.903 -30.398 1.00 52.92  ? 385 GLU I OE2   1 
ATOM   7174  N  N     . ARG I  1 143 ? -48.755 -14.312 -31.070 1.00 32.07  ? 386 ARG I N     1 
ATOM   7175  C  CA    . ARG I  1 143 ? -48.760 -14.012 -32.505 1.00 32.16  ? 386 ARG I CA    1 
ATOM   7176  C  C     . ARG I  1 143 ? -50.199 -13.870 -32.945 1.00 33.45  ? 386 ARG I C     1 
ATOM   7177  O  O     . ARG I  1 143 ? -51.095 -14.488 -32.407 1.00 36.98  ? 386 ARG I O     1 
ATOM   7178  C  CB    . ARG I  1 143 ? -48.082 -15.116 -33.310 1.00 32.04  ? 386 ARG I CB    1 
ATOM   7179  C  CG    . ARG I  1 143 ? -46.605 -15.305 -32.997 1.00 31.15  ? 386 ARG I CG    1 
ATOM   7180  C  CD    . ARG I  1 143 ? -45.999 -16.398 -33.879 1.00 30.83  ? 386 ARG I CD    1 
ATOM   7181  N  NE    . ARG I  1 143 ? -45.962 -15.989 -35.287 1.00 30.67  ? 386 ARG I NE    1 
ATOM   7182  C  CZ    . ARG I  1 143 ? -45.015 -15.219 -35.812 1.00 29.08  ? 386 ARG I CZ    1 
ATOM   7183  N  NH1   . ARG I  1 143 ? -44.028 -14.755 -35.057 1.00 32.19  ? 386 ARG I NH1   1 
ATOM   7184  N  NH2   . ARG I  1 143 ? -45.060 -14.874 -37.075 1.00 27.43  ? 386 ARG I NH2   1 
ATOM   7185  N  N     . MET I  1 144 ? -50.441 -12.997 -33.892 1.00 35.97  ? 387 MET I N     1 
ATOM   7186  C  CA    . MET I  1 144 ? -51.803 -12.697 -34.278 1.00 33.32  ? 387 MET I CA    1 
ATOM   7187  C  C     . MET I  1 144 ? -52.133 -13.448 -35.531 1.00 34.37  ? 387 MET I C     1 
ATOM   7188  O  O     . MET I  1 144 ? -51.249 -13.736 -36.339 1.00 34.41  ? 387 MET I O     1 
ATOM   7189  C  CB    . MET I  1 144 ? -51.977 -11.192 -34.541 1.00 35.38  ? 387 MET I CB    1 
ATOM   7190  C  CG    . MET I  1 144 ? -51.350 -10.679 -35.840 1.00 34.12  ? 387 MET I CG    1 
ATOM   7191  S  SD    . MET I  1 144 ? -51.403 -8.896  -36.018 1.00 34.52  ? 387 MET I SD    1 
ATOM   7192  C  CE    . MET I  1 144 ? -49.991 -8.405  -35.051 1.00 31.66  ? 387 MET I CE    1 
ATOM   7193  N  N     . PRO I  1 145 ? -53.422 -13.749 -35.710 1.00 36.39  ? 388 PRO I N     1 
ATOM   7194  C  CA    . PRO I  1 145 ? -53.894 -14.379 -36.922 1.00 35.40  ? 388 PRO I CA    1 
ATOM   7195  C  C     . PRO I  1 145 ? -53.652 -13.444 -38.084 1.00 35.23  ? 388 PRO I C     1 
ATOM   7196  O  O     . PRO I  1 145 ? -53.806 -12.242 -37.937 1.00 39.95  ? 388 PRO I O     1 
ATOM   7197  C  CB    . PRO I  1 145 ? -55.416 -14.551 -36.680 1.00 33.11  ? 388 PRO I CB    1 
ATOM   7198  C  CG    . PRO I  1 145 ? -55.658 -14.336 -35.229 1.00 32.79  ? 388 PRO I CG    1 
ATOM   7199  C  CD    . PRO I  1 145 ? -54.463 -13.637 -34.660 1.00 35.06  ? 388 PRO I CD    1 
ATOM   7200  N  N     . ARG I  1 146 ? -53.330 -13.978 -39.248 1.00 33.91  ? 389 ARG I N     1 
ATOM   7201  C  CA    . ARG I  1 146 ? -53.004 -13.096 -40.344 1.00 33.67  ? 389 ARG I CA    1 
ATOM   7202  C  C     . ARG I  1 146 ? -54.186 -12.218 -40.809 1.00 36.37  ? 389 ARG I C     1 
ATOM   7203  O  O     . ARG I  1 146 ? -53.956 -11.153 -41.411 1.00 35.14  ? 389 ARG I O     1 
ATOM   7204  C  CB    . ARG I  1 146 ? -52.296 -13.833 -41.485 1.00 31.37  ? 389 ARG I CB    1 
ATOM   7205  C  CG    . ARG I  1 146 ? -53.168 -14.217 -42.656 1.00 31.45  ? 389 ARG I CG    1 
ATOM   7206  C  CD    . ARG I  1 146 ? -52.423 -14.962 -43.730 1.00 30.06  ? 389 ARG I CD    1 
ATOM   7207  N  NE    . ARG I  1 146 ? -52.067 -14.051 -44.813 1.00 28.42  ? 389 ARG I NE    1 
ATOM   7208  C  CZ    . ARG I  1 146 ? -50.855 -13.561 -45.070 1.00 30.90  ? 389 ARG I CZ    1 
ATOM   7209  N  NH1   . ARG I  1 146 ? -49.767 -13.905 -44.344 1.00 27.87  ? 389 ARG I NH1   1 
ATOM   7210  N  NH2   . ARG I  1 146 ? -50.731 -12.685 -46.075 1.00 29.62  ? 389 ARG I NH2   1 
ATOM   7211  N  N     . GLU I  1 147 ? -55.425 -12.624 -40.505 1.00 40.35  ? 390 GLU I N     1 
ATOM   7212  C  CA    . GLU I  1 147 ? -56.601 -11.804 -40.853 1.00 43.90  ? 390 GLU I CA    1 
ATOM   7213  C  C     . GLU I  1 147 ? -56.593 -10.512 -40.087 1.00 40.23  ? 390 GLU I C     1 
ATOM   7214  O  O     . GLU I  1 147 ? -56.936 -9.469  -40.639 1.00 40.41  ? 390 GLU I O     1 
ATOM   7215  C  CB    . GLU I  1 147 ? -57.928 -12.510 -40.563 1.00 50.31  ? 390 GLU I CB    1 
ATOM   7216  C  CG    . GLU I  1 147 ? -58.532 -13.209 -41.779 1.00 59.47  ? 390 GLU I CG    1 
ATOM   7217  C  CD    . GLU I  1 147 ? -59.675 -14.174 -41.403 1.00 72.95  ? 390 GLU I CD    1 
ATOM   7218  O  OE1   . GLU I  1 147 ? -60.631 -13.745 -40.701 1.00 77.86  ? 390 GLU I OE1   1 
ATOM   7219  O  OE2   . GLU I  1 147 ? -59.625 -15.366 -41.807 1.00 72.42  ? 390 GLU I OE2   1 
ATOM   7220  N  N     . GLU I  1 148 ? -56.208 -10.586 -38.814 1.00 35.61  ? 391 GLU I N     1 
ATOM   7221  C  CA    . GLU I  1 148 ? -56.085 -9.383  -37.965 1.00 34.54  ? 391 GLU I CA    1 
ATOM   7222  C  C     . GLU I  1 148 ? -55.030 -8.391  -38.460 1.00 31.76  ? 391 GLU I C     1 
ATOM   7223  O  O     . GLU I  1 148 ? -55.214 -7.156  -38.363 1.00 32.38  ? 391 GLU I O     1 
ATOM   7224  C  CB    . GLU I  1 148 ? -55.752 -9.772  -36.527 1.00 35.43  ? 391 GLU I CB    1 
ATOM   7225  C  CG    . GLU I  1 148 ? -55.935 -8.619  -35.552 1.00 34.31  ? 391 GLU I CG    1 
ATOM   7226  C  CD    . GLU I  1 148 ? -55.586 -8.966  -34.129 1.00 34.97  ? 391 GLU I CD    1 
ATOM   7227  O  OE1   . GLU I  1 148 ? -55.389 -10.165 -33.844 1.00 39.11  ? 391 GLU I OE1   1 
ATOM   7228  O  OE2   . GLU I  1 148 ? -55.538 -8.051  -33.276 1.00 37.22  ? 391 GLU I OE2   1 
ATOM   7229  N  N     . ALA I  1 149 ? -53.919 -8.946  -38.940 1.00 29.28  ? 392 ALA I N     1 
ATOM   7230  C  CA    . ALA I  1 149 ? -52.850 -8.178  -39.557 1.00 25.83  ? 392 ALA I CA    1 
ATOM   7231  C  C     . ALA I  1 149 ? -53.363 -7.548  -40.818 1.00 28.23  ? 392 ALA I C     1 
ATOM   7232  O  O     . ALA I  1 149 ? -53.008 -6.410  -41.134 1.00 32.90  ? 392 ALA I O     1 
ATOM   7233  C  CB    . ALA I  1 149 ? -51.669 -9.083  -39.895 1.00 25.25  ? 392 ALA I CB    1 
ATOM   7234  N  N     . THR I  1 150 ? -54.151 -8.297  -41.579 1.00 28.00  ? 393 THR I N     1 
ATOM   7235  C  CA    . THR I  1 150 ? -54.853 -7.708  -42.716 1.00 30.83  ? 393 THR I CA    1 
ATOM   7236  C  C     . THR I  1 150 ? -55.753 -6.560  -42.323 1.00 30.24  ? 393 THR I C     1 
ATOM   7237  O  O     . THR I  1 150 ? -55.751 -5.527  -42.995 1.00 29.81  ? 393 THR I O     1 
ATOM   7238  C  CB    . THR I  1 150 ? -55.740 -8.707  -43.474 1.00 32.58  ? 393 THR I CB    1 
ATOM   7239  O  OG1   . THR I  1 150 ? -54.920 -9.775  -43.938 1.00 34.43  ? 393 THR I OG1   1 
ATOM   7240  C  CG2   . THR I  1 150 ? -56.397 -7.986  -44.710 1.00 32.84  ? 393 THR I CG2   1 
ATOM   7241  N  N     . GLU I  1 151 ? -56.515 -6.736  -41.246 1.00 32.73  ? 394 GLU I N     1 
ATOM   7242  C  CA    . GLU I  1 151 ? -57.361 -5.631  -40.732 1.00 33.66  ? 394 GLU I CA    1 
ATOM   7243  C  C     . GLU I  1 151 ? -56.494 -4.453  -40.319 1.00 33.08  ? 394 GLU I C     1 
ATOM   7244  O  O     . GLU I  1 151 ? -56.805 -3.305  -40.600 1.00 28.90  ? 394 GLU I O     1 
ATOM   7245  C  CB    . GLU I  1 151 ? -58.237 -6.060  -39.562 1.00 36.95  ? 394 GLU I CB    1 
ATOM   7246  C  CG    . GLU I  1 151 ? -59.153 -7.267  -39.821 1.00 42.15  ? 394 GLU I CG    1 
ATOM   7247  C  CD    . GLU I  1 151 ? -59.977 -7.664  -38.589 1.00 46.59  ? 394 GLU I CD    1 
ATOM   7248  O  OE1   . GLU I  1 151 ? -60.597 -6.775  -37.986 1.00 50.06  ? 394 GLU I OE1   1 
ATOM   7249  O  OE2   . GLU I  1 151 ? -60.028 -8.852  -38.205 1.00 49.77  ? 394 GLU I OE2   1 
ATOM   7250  N  N     . ILE I  1 152 ? -55.352 -4.729  -39.690 1.00 35.61  ? 395 ILE I N     1 
ATOM   7251  C  CA    . ILE I  1 152 ? -54.457 -3.622  -39.296 1.00 29.40  ? 395 ILE I CA    1 
ATOM   7252  C  C     . ILE I  1 152 ? -53.913 -2.896  -40.528 1.00 27.63  ? 395 ILE I C     1 
ATOM   7253  O  O     . ILE I  1 152 ? -53.832 -1.664  -40.514 1.00 27.63  ? 395 ILE I O     1 
ATOM   7254  C  CB    . ILE I  1 152 ? -53.345 -4.105  -38.361 1.00 30.33  ? 395 ILE I CB    1 
ATOM   7255  C  CG1   . ILE I  1 152 ? -53.926 -4.390  -36.997 1.00 34.04  ? 395 ILE I CG1   1 
ATOM   7256  C  CG2   . ILE I  1 152 ? -52.256 -3.069  -38.211 1.00 30.58  ? 395 ILE I CG2   1 
ATOM   7257  C  CD1   . ILE I  1 152 ? -53.059 -5.289  -36.154 1.00 37.11  ? 395 ILE I CD1   1 
ATOM   7258  N  N     . GLU I  1 153 ? -53.523 -3.624  -41.571 1.00 25.09  ? 396 GLU I N     1 
ATOM   7259  C  CA    . GLU I  1 153 ? -53.079 -2.961  -42.773 1.00 28.47  ? 396 GLU I CA    1 
ATOM   7260  C  C     . GLU I  1 153 ? -54.213 -2.126  -43.399 1.00 29.10  ? 396 GLU I C     1 
ATOM   7261  O  O     . GLU I  1 153 ? -53.990 -0.993  -43.838 1.00 28.67  ? 396 GLU I O     1 
ATOM   7262  C  CB    . GLU I  1 153 ? -52.534 -3.956  -43.795 1.00 32.19  ? 396 GLU I CB    1 
ATOM   7263  C  CG    . GLU I  1 153 ? -52.248 -3.444  -45.223 1.00 35.30  ? 396 GLU I CG    1 
ATOM   7264  C  CD    . GLU I  1 153 ? -52.032 -4.635  -46.205 1.00 38.48  ? 396 GLU I CD    1 
ATOM   7265  O  OE1   . GLU I  1 153 ? -53.016 -5.381  -46.424 1.00 36.21  ? 396 GLU I OE1   1 
ATOM   7266  O  OE2   . GLU I  1 153 ? -50.887 -4.859  -46.727 1.00 39.19  ? 396 GLU I OE2   1 
ATOM   7267  N  N     . GLN I  1 154 ? -55.406 -2.670  -43.472 1.00 28.64  ? 397 GLN I N     1 
ATOM   7268  C  CA    . GLN I  1 154 ? -56.523 -1.904  -44.024 1.00 32.10  ? 397 GLN I CA    1 
ATOM   7269  C  C     . GLN I  1 154 ? -56.750 -0.564  -43.278 1.00 31.43  ? 397 GLN I C     1 
ATOM   7270  O  O     . GLN I  1 154 ? -56.858 0.491   -43.921 1.00 27.99  ? 397 GLN I O     1 
ATOM   7271  C  CB    . GLN I  1 154 ? -57.768 -2.798  -44.092 1.00 34.02  ? 397 GLN I CB    1 
ATOM   7272  C  CG    . GLN I  1 154 ? -57.587 -3.832  -45.204 1.00 36.74  ? 397 GLN I CG    1 
ATOM   7273  C  CD    . GLN I  1 154 ? -58.715 -4.857  -45.326 1.00 42.25  ? 397 GLN I CD    1 
ATOM   7274  O  OE1   . GLN I  1 154 ? -58.785 -5.599  -46.307 1.00 42.04  ? 397 GLN I OE1   1 
ATOM   7275  N  NE2   . GLN I  1 154 ? -59.558 -4.941  -44.311 1.00 46.71  ? 397 GLN I NE2   1 
ATOM   7276  N  N     . THR I  1 155 ? -56.681 -0.604  -41.945 1.00 29.58  ? 398 THR I N     1 
ATOM   7277  C  CA    . THR I  1 155 ? -56.853 0.594   -41.125 1.00 29.40  ? 398 THR I CA    1 
ATOM   7278  C  C     . THR I  1 155 ? -55.844 1.666   -41.462 1.00 29.66  ? 398 THR I C     1 
ATOM   7279  O  O     . THR I  1 155 ? -56.152 2.867   -41.628 1.00 33.38  ? 398 THR I O     1 
ATOM   7280  C  CB    . THR I  1 155 ? -56.701 0.231   -39.666 1.00 30.91  ? 398 THR I CB    1 
ATOM   7281  O  OG1   . THR I  1 155 ? -57.629 -0.805  -39.360 1.00 30.59  ? 398 THR I OG1   1 
ATOM   7282  C  CG2   . THR I  1 155 ? -56.970 1.457   -38.756 1.00 31.62  ? 398 THR I CG2   1 
ATOM   7283  N  N     . VAL I  1 156 ? -54.608 1.245   -41.591 1.00 31.21  ? 399 VAL I N     1 
ATOM   7284  C  CA    . VAL I  1 156 ? -53.578 2.188   -41.979 1.00 31.79  ? 399 VAL I CA    1 
ATOM   7285  C  C     . VAL I  1 156 ? -53.825 2.689   -43.395 1.00 33.37  ? 399 VAL I C     1 
ATOM   7286  O  O     . VAL I  1 156 ? -53.641 3.876   -43.660 1.00 34.13  ? 399 VAL I O     1 
ATOM   7287  C  CB    . VAL I  1 156 ? -52.188 1.568   -41.862 1.00 30.08  ? 399 VAL I CB    1 
ATOM   7288  C  CG1   . VAL I  1 156 ? -51.113 2.529   -42.354 1.00 30.01  ? 399 VAL I CG1   1 
ATOM   7289  C  CG2   . VAL I  1 156 ? -51.941 1.144   -40.418 1.00 29.75  ? 399 VAL I CG2   1 
ATOM   7290  N  N     . GLN I  1 157 ? -54.241 1.783   -44.281 1.00 33.82  ? 400 GLN I N     1 
ATOM   7291  C  CA    . GLN I  1 157 ? -54.415 2.072   -45.712 1.00 37.14  ? 400 GLN I CA    1 
ATOM   7292  C  C     . GLN I  1 157 ? -55.535 3.115   -45.906 1.00 38.88  ? 400 GLN I C     1 
ATOM   7293  O  O     . GLN I  1 157 ? -55.334 4.138   -46.566 1.00 37.63  ? 400 GLN I O     1 
ATOM   7294  C  CB    . GLN I  1 157 ? -54.782 0.772   -46.441 1.00 41.53  ? 400 GLN I CB    1 
ATOM   7295  C  CG    . GLN I  1 157 ? -54.303 0.575   -47.878 1.00 45.84  ? 400 GLN I CG    1 
ATOM   7296  C  CD    . GLN I  1 157 ? -54.181 -0.924  -48.237 1.00 48.04  ? 400 GLN I CD    1 
ATOM   7297  O  OE1   . GLN I  1 157 ? -53.356 -1.301  -49.057 1.00 53.96  ? 400 GLN I OE1   1 
ATOM   7298  N  NE2   . GLN I  1 157 ? -54.992 -1.773  -47.606 1.00 45.30  ? 400 GLN I NE2   1 
ATOM   7299  N  N     . LYS I  1 158 ? -56.698 2.859   -45.304 1.00 38.69  ? 401 LYS I N     1 
ATOM   7300  C  CA    . LYS I  1 158 ? -57.822 3.820   -45.293 1.00 39.39  ? 401 LYS I CA    1 
ATOM   7301  C  C     . LYS I  1 158 ? -57.397 5.238   -44.825 1.00 35.60  ? 401 LYS I C     1 
ATOM   7302  O  O     . LYS I  1 158 ? -57.577 6.223   -45.537 1.00 35.27  ? 401 LYS I O     1 
ATOM   7303  C  CB    . LYS I  1 158 ? -58.897 3.258   -44.391 1.00 41.68  ? 401 LYS I CB    1 
ATOM   7304  C  CG    . LYS I  1 158 ? -60.061 4.179   -44.071 1.00 44.21  ? 401 LYS I CG    1 
ATOM   7305  C  CD    . LYS I  1 158 ? -61.140 3.327   -43.421 1.00 48.19  ? 401 LYS I CD    1 
ATOM   7306  C  CE    . LYS I  1 158 ? -62.016 4.100   -42.445 1.00 54.19  ? 401 LYS I CE    1 
ATOM   7307  N  NZ    . LYS I  1 158 ? -63.018 4.884   -43.189 1.00 54.10  ? 401 LYS I NZ    1 
ATOM   7308  N  N     . ALA I  1 159 ? -56.758 5.315   -43.666 1.00 33.76  ? 402 ALA I N     1 
ATOM   7309  C  CA    . ALA I  1 159 ? -56.276 6.599   -43.166 1.00 35.58  ? 402 ALA I CA    1 
ATOM   7310  C  C     . ALA I  1 159 ? -55.337 7.267   -44.143 1.00 37.44  ? 402 ALA I C     1 
ATOM   7311  O  O     . ALA I  1 159 ? -55.482 8.458   -44.392 1.00 41.14  ? 402 ALA I O     1 
ATOM   7312  C  CB    . ALA I  1 159 ? -55.602 6.458   -41.799 1.00 38.28  ? 402 ALA I CB    1 
ATOM   7313  N  N     . ALA I  1 160 ? -54.388 6.517   -44.702 1.00 33.85  ? 403 ALA I N     1 
ATOM   7314  C  CA    . ALA I  1 160 ? -53.446 7.089   -45.653 1.00 36.38  ? 403 ALA I CA    1 
ATOM   7315  C  C     . ALA I  1 160 ? -54.093 7.573   -46.914 1.00 38.22  ? 403 ALA I C     1 
ATOM   7316  O  O     . ALA I  1 160 ? -53.699 8.619   -47.440 1.00 34.50  ? 403 ALA I O     1 
ATOM   7317  C  CB    . ALA I  1 160 ? -52.373 6.080   -46.056 1.00 40.14  ? 403 ALA I CB    1 
ATOM   7318  N  N     . GLN I  1 161 ? -55.017 6.771   -47.439 1.00 41.80  ? 404 GLN I N     1 
ATOM   7319  C  CA    . GLN I  1 161 ? -55.615 7.053   -48.748 1.00 46.38  ? 404 GLN I CA    1 
ATOM   7320  C  C     . GLN I  1 161 ? -56.496 8.290   -48.721 1.00 47.34  ? 404 GLN I C     1 
ATOM   7321  O  O     . GLN I  1 161 ? -56.619 8.970   -49.742 1.00 47.97  ? 404 GLN I O     1 
ATOM   7322  C  CB    . GLN I  1 161 ? -56.394 5.856   -49.257 1.00 45.56  ? 404 GLN I CB    1 
ATOM   7323  C  CG    . GLN I  1 161 ? -55.508 4.937   -50.084 1.00 51.28  ? 404 GLN I CG    1 
ATOM   7324  C  CD    . GLN I  1 161 ? -55.998 3.501   -50.100 1.00 54.39  ? 404 GLN I CD    1 
ATOM   7325  O  OE1   . GLN I  1 161 ? -57.032 3.173   -49.520 1.00 59.19  ? 404 GLN I OE1   1 
ATOM   7326  N  NE2   . GLN I  1 161 ? -55.245 2.634   -50.760 1.00 59.73  ? 404 GLN I NE2   1 
ATOM   7327  N  N     . ALA I  1 162 ? -57.083 8.563   -47.549 1.00 46.63  ? 405 ALA I N     1 
ATOM   7328  C  CA    . ALA I  1 162 ? -57.806 9.805   -47.291 1.00 43.50  ? 405 ALA I CA    1 
ATOM   7329  C  C     . ALA I  1 162 ? -56.934 11.031  -47.616 1.00 49.44  ? 405 ALA I C     1 
ATOM   7330  O  O     . ALA I  1 162 ? -57.443 12.063  -48.059 1.00 47.98  ? 405 ALA I O     1 
ATOM   7331  C  CB    . ALA I  1 162 ? -58.277 9.861   -45.847 1.00 38.02  ? 405 ALA I CB    1 
ATOM   7332  N  N     . PHE I  1 163 ? -55.625 10.930  -47.425 1.00 45.31  ? 406 PHE I N     1 
ATOM   7333  C  CA    . PHE I  1 163 ? -54.766 12.078  -47.726 1.00 46.22  ? 406 PHE I CA    1 
ATOM   7334  C  C     . PHE I  1 163 ? -54.381 12.146  -49.194 1.00 46.79  ? 406 PHE I C     1 
ATOM   7335  O  O     . PHE I  1 163 ? -54.039 13.227  -49.710 1.00 39.63  ? 406 PHE I O     1 
ATOM   7336  C  CB    . PHE I  1 163 ? -53.510 12.055  -46.857 1.00 51.52  ? 406 PHE I CB    1 
ATOM   7337  C  CG    . PHE I  1 163 ? -53.781 12.326  -45.396 1.00 56.10  ? 406 PHE I CG    1 
ATOM   7338  C  CD1   . PHE I  1 163 ? -54.200 13.593  -44.972 1.00 58.61  ? 406 PHE I CD1   1 
ATOM   7339  C  CD2   . PHE I  1 163 ? -53.600 11.335  -44.440 1.00 56.64  ? 406 PHE I CD2   1 
ATOM   7340  C  CE1   . PHE I  1 163 ? -54.430 13.862  -43.630 1.00 54.86  ? 406 PHE I CE1   1 
ATOM   7341  C  CE2   . PHE I  1 163 ? -53.834 11.597  -43.101 1.00 53.81  ? 406 PHE I CE2   1 
ATOM   7342  C  CZ    . PHE I  1 163 ? -54.255 12.855  -42.698 1.00 56.79  ? 406 PHE I CZ    1 
ATOM   7343  N  N     . ASN I  1 164 ? -54.437 10.987  -49.859 1.00 42.74  ? 407 ASN I N     1 
ATOM   7344  C  CA    . ASN I  1 164 ? -53.996 10.842  -51.228 1.00 40.17  ? 407 ASN I CA    1 
ATOM   7345  C  C     . ASN I  1 164 ? -54.174 9.406   -51.669 1.00 44.78  ? 407 ASN I C     1 
ATOM   7346  O  O     . ASN I  1 164 ? -53.537 8.484   -51.136 1.00 45.77  ? 407 ASN I O     1 
ATOM   7347  C  CB    . ASN I  1 164 ? -52.544 11.215  -51.371 1.00 36.94  ? 407 ASN I CB    1 
ATOM   7348  C  CG    . ASN I  1 164 ? -52.060 11.074  -52.801 1.00 39.44  ? 407 ASN I CG    1 
ATOM   7349  O  OD1   . ASN I  1 164 ? -52.484 10.175  -53.548 1.00 36.16  ? 407 ASN I OD1   1 
ATOM   7350  N  ND2   . ASN I  1 164 ? -51.154 11.962  -53.187 1.00 37.35  ? 407 ASN I ND2   1 
ATOM   7351  N  N     . SER I  1 165 ? -55.028 9.199   -52.657 1.00 45.06  ? 408 SER I N     1 
ATOM   7352  C  CA    . SER I  1 165 ? -55.539 7.870   -52.873 1.00 45.05  ? 408 SER I CA    1 
ATOM   7353  C  C     . SER I  1 165 ? -54.611 7.067   -53.768 1.00 38.04  ? 408 SER I C     1 
ATOM   7354  O  O     . SER I  1 165 ? -54.911 5.934   -54.042 1.00 44.07  ? 408 SER I O     1 
ATOM   7355  C  CB    . SER I  1 165 ? -56.956 7.939   -53.447 1.00 50.41  ? 408 SER I CB    1 
ATOM   7356  O  OG    . SER I  1 165 ? -56.899 8.484   -54.750 1.00 49.55  ? 408 SER I OG    1 
ATOM   7357  N  N     . GLY I  1 166 ? -53.509 7.647   -54.233 1.00 36.07  ? 409 GLY I N     1 
ATOM   7358  C  CA    . GLY I  1 166 ? -52.452 6.905   -54.956 1.00 38.99  ? 409 GLY I CA    1 
ATOM   7359  C  C     . GLY I  1 166 ? -51.254 6.429   -54.092 1.00 43.11  ? 409 GLY I C     1 
ATOM   7360  O  O     . GLY I  1 166 ? -50.257 5.936   -54.601 1.00 42.72  ? 409 GLY I O     1 
ATOM   7361  N  N     . LEU I  1 167 ? -51.336 6.630   -52.785 1.00 41.15  ? 410 LEU I N     1 
ATOM   7362  C  CA    . LEU I  1 167 ? -50.375 6.069   -51.848 1.00 39.77  ? 410 LEU I CA    1 
ATOM   7363  C  C     . LEU I  1 167 ? -50.518 4.559   -51.797 1.00 39.03  ? 410 LEU I C     1 
ATOM   7364  O  O     . LEU I  1 167 ? -51.642 4.074   -51.663 1.00 42.41  ? 410 LEU I O     1 
ATOM   7365  C  CB    . LEU I  1 167 ? -50.654 6.614   -50.444 1.00 37.44  ? 410 LEU I CB    1 
ATOM   7366  C  CG    . LEU I  1 167 ? -50.309 8.086   -50.279 1.00 37.07  ? 410 LEU I CG    1 
ATOM   7367  C  CD1   . LEU I  1 167 ? -50.943 8.655   -49.032 1.00 35.66  ? 410 LEU I CD1   1 
ATOM   7368  C  CD2   . LEU I  1 167 ? -48.799 8.279   -50.312 1.00 36.13  ? 410 LEU I CD2   1 
ATOM   7369  N  N     . LEU I  1 168 ? -49.391 3.842   -51.899 1.00 36.30  ? 411 LEU I N     1 
ATOM   7370  C  CA    . LEU I  1 168 ? -49.348 2.378   -51.714 1.00 34.59  ? 411 LEU I CA    1 
ATOM   7371  C  C     . LEU I  1 168 ? -48.954 2.087   -50.295 1.00 31.59  ? 411 LEU I C     1 
ATOM   7372  O  O     . LEU I  1 168 ? -47.994 2.623   -49.802 1.00 31.46  ? 411 LEU I O     1 
ATOM   7373  C  CB    . LEU I  1 168 ? -48.317 1.723   -52.646 1.00 37.24  ? 411 LEU I CB    1 
ATOM   7374  C  CG    . LEU I  1 168 ? -48.367 2.268   -54.089 1.00 41.23  ? 411 LEU I CG    1 
ATOM   7375  C  CD1   . LEU I  1 168 ? -47.193 1.799   -54.944 1.00 40.03  ? 411 LEU I CD1   1 
ATOM   7376  C  CD2   . LEU I  1 168 ? -49.715 1.901   -54.721 1.00 41.72  ? 411 LEU I CD2   1 
ATOM   7377  N  N     . CYS I  1 169 ? -49.718 1.227   -49.651 1.00 34.19  ? 412 CYS I N     1 
ATOM   7378  C  CA    . CYS I  1 169 ? -49.428 0.675   -48.350 1.00 32.93  ? 412 CYS I CA    1 
ATOM   7379  C  C     . CYS I  1 169 ? -49.310 -0.862  -48.395 1.00 32.75  ? 412 CYS I C     1 
ATOM   7380  O  O     . CYS I  1 169 ? -50.263 -1.537  -48.740 1.00 35.01  ? 412 CYS I O     1 
ATOM   7381  C  CB    . CYS I  1 169 ? -50.558 1.031   -47.405 1.00 32.99  ? 412 CYS I CB    1 
ATOM   7382  S  SG    . CYS I  1 169 ? -50.862 2.805   -47.384 1.00 40.77  ? 412 CYS I SG    1 
ATOM   7383  N  N     . VAL I  1 170 ? -48.166 -1.405  -47.987 1.00 31.90  ? 413 VAL I N     1 
ATOM   7384  C  CA    . VAL I  1 170 ? -47.988 -2.849  -47.896 1.00 30.47  ? 413 VAL I CA    1 
ATOM   7385  C  C     . VAL I  1 170 ? -47.493 -3.347  -46.539 1.00 25.27  ? 413 VAL I C     1 
ATOM   7386  O  O     . VAL I  1 170 ? -46.481 -2.918  -46.031 1.00 23.95  ? 413 VAL I O     1 
ATOM   7387  C  CB    . VAL I  1 170 ? -47.074 -3.378  -49.022 1.00 32.58  ? 413 VAL I CB    1 
ATOM   7388  C  CG1   . VAL I  1 170 ? -47.406 -2.679  -50.330 1.00 34.91  ? 413 VAL I CG1   1 
ATOM   7389  C  CG2   . VAL I  1 170 ? -45.648 -3.115  -48.726 1.00 40.37  ? 413 VAL I CG2   1 
ATOM   7390  N  N     . ALA I  1 171 ? -48.225 -4.279  -45.960 1.00 21.29  ? 414 ALA I N     1 
ATOM   7391  C  CA    . ALA I  1 171 ? -47.740 -4.967  -44.791 1.00 21.48  ? 414 ALA I CA    1 
ATOM   7392  C  C     . ALA I  1 171 ? -46.595 -5.857  -45.232 1.00 22.96  ? 414 ALA I C     1 
ATOM   7393  O  O     . ALA I  1 171 ? -46.721 -6.563  -46.207 1.00 23.28  ? 414 ALA I O     1 
ATOM   7394  C  CB    . ALA I  1 171 ? -48.856 -5.798  -44.191 1.00 22.27  ? 414 ALA I CB    1 
ATOM   7395  N  N     . CYS I  1 172 ? -45.464 -5.785  -44.538 1.00 26.39  ? 415 CYS I N     1 
ATOM   7396  C  CA    . CYS I  1 172 ? -44.269 -6.564  -44.866 1.00 24.85  ? 415 CYS I CA    1 
ATOM   7397  C  C     . CYS I  1 172 ? -44.061 -7.653  -43.855 1.00 23.42  ? 415 CYS I C     1 
ATOM   7398  O  O     . CYS I  1 172 ? -45.015 -8.257  -43.381 1.00 24.32  ? 415 CYS I O     1 
ATOM   7399  C  CB    . CYS I  1 172 ? -43.055 -5.667  -44.935 1.00 23.58  ? 415 CYS I CB    1 
ATOM   7400  S  SG    . CYS I  1 172 ? -43.204 -4.477  -46.237 1.00 30.67  ? 415 CYS I SG    1 
ATOM   7401  N  N     . GLY I  1 173 ? -42.793 -7.917  -43.514 1.00 26.47  ? 416 GLY I N     1 
ATOM   7402  C  CA    . GLY I  1 173 ? -42.487 -8.928  -42.530 1.00 25.21  ? 416 GLY I CA    1 
ATOM   7403  C  C     . GLY I  1 173 ? -43.100 -10.279 -42.867 1.00 24.91  ? 416 GLY I C     1 
ATOM   7404  O  O     . GLY I  1 173 ? -43.304 -10.635 -44.047 1.00 22.83  ? 416 GLY I O     1 
ATOM   7405  N  N     . SER I  1 174 ? -43.371 -11.025 -41.807 1.00 24.32  ? 417 SER I N     1 
ATOM   7406  C  CA    . SER I  1 174 ? -43.923 -12.366 -41.888 1.00 26.56  ? 417 SER I CA    1 
ATOM   7407  C  C     . SER I  1 174 ? -45.306 -12.443 -42.556 1.00 27.32  ? 417 SER I C     1 
ATOM   7408  O  O     . SER I  1 174 ? -45.640 -13.465 -43.138 1.00 29.17  ? 417 SER I O     1 
ATOM   7409  C  CB    . SER I  1 174 ? -43.971 -12.984 -40.504 1.00 24.60  ? 417 SER I CB    1 
ATOM   7410  O  OG    . SER I  1 174 ? -44.880 -12.275 -39.694 1.00 28.25  ? 417 SER I OG    1 
ATOM   7411  N  N     . TYR I  1 175 ? -46.077 -11.356 -42.524 1.00 29.18  ? 418 TYR I N     1 
ATOM   7412  C  CA    . TYR I  1 175 ? -47.359 -11.283 -43.266 1.00 26.98  ? 418 TYR I CA    1 
ATOM   7413  C  C     . TYR I  1 175 ? -47.119 -11.414 -44.749 1.00 25.14  ? 418 TYR I C     1 
ATOM   7414  O  O     . TYR I  1 175 ? -47.835 -12.143 -45.463 1.00 26.14  ? 418 TYR I O     1 
ATOM   7415  C  CB    . TYR I  1 175 ? -48.024 -9.922  -43.054 1.00 26.56  ? 418 TYR I CB    1 
ATOM   7416  C  CG    . TYR I  1 175 ? -49.329 -9.736  -43.771 1.00 27.82  ? 418 TYR I CG    1 
ATOM   7417  C  CD1   . TYR I  1 175 ? -50.500 -10.226 -43.199 1.00 32.15  ? 418 TYR I CD1   1 
ATOM   7418  C  CD2   . TYR I  1 175 ? -49.432 -9.049  -44.965 1.00 27.15  ? 418 TYR I CD2   1 
ATOM   7419  C  CE1   . TYR I  1 175 ? -51.704 -10.051 -43.791 1.00 32.63  ? 418 TYR I CE1   1 
ATOM   7420  C  CE2   . TYR I  1 175 ? -50.672 -8.877  -45.587 1.00 27.93  ? 418 TYR I CE2   1 
ATOM   7421  C  CZ    . TYR I  1 175 ? -51.789 -9.382  -44.964 1.00 31.07  ? 418 TYR I CZ    1 
ATOM   7422  O  OH    . TYR I  1 175 ? -53.048 -9.299  -45.420 1.00 29.50  ? 418 TYR I OH    1 
ATOM   7423  N  N     . ARG I  1 176 ? -46.155 -10.630 -45.219 1.00 23.64  ? 419 ARG I N     1 
ATOM   7424  C  CA    . ARG I  1 176 ? -45.887 -10.580 -46.589 1.00 26.43  ? 419 ARG I CA    1 
ATOM   7425  C  C     . ARG I  1 176 ? -45.159 -11.852 -47.020 1.00 28.86  ? 419 ARG I C     1 
ATOM   7426  O  O     . ARG I  1 176 ? -45.202 -12.165 -48.188 1.00 26.78  ? 419 ARG I O     1 
ATOM   7427  C  CB    . ARG I  1 176 ? -45.067 -9.371  -46.971 1.00 29.19  ? 419 ARG I CB    1 
ATOM   7428  C  CG    . ARG I  1 176 ? -44.853 -9.258  -48.477 1.00 27.44  ? 419 ARG I CG    1 
ATOM   7429  C  CD    . ARG I  1 176 ? -44.284 -7.930  -48.848 1.00 26.69  ? 419 ARG I CD    1 
ATOM   7430  N  NE    . ARG I  1 176 ? -44.033 -7.864  -50.280 1.00 26.82  ? 419 ARG I NE    1 
ATOM   7431  C  CZ    . ARG I  1 176 ? -42.868 -7.925  -50.904 1.00 32.05  ? 419 ARG I CZ    1 
ATOM   7432  N  NH1   . ARG I  1 176 ? -41.676 -8.048  -50.269 1.00 28.77  ? 419 ARG I NH1   1 
ATOM   7433  N  NH2   . ARG I  1 176 ? -42.901 -7.818  -52.225 1.00 32.72  ? 419 ARG I NH2   1 
ATOM   7434  N  N     . ARG I  1 177 ? -44.509 -12.553 -46.085 1.00 27.18  ? 420 ARG I N     1 
ATOM   7435  C  CA    . ARG I  1 177 ? -43.891 -13.846 -46.391 1.00 28.61  ? 420 ARG I CA    1 
ATOM   7436  C  C     . ARG I  1 177 ? -44.916 -15.000 -46.276 1.00 30.88  ? 420 ARG I C     1 
ATOM   7437  O  O     . ARG I  1 177 ? -44.556 -16.155 -46.364 1.00 25.19  ? 420 ARG I O     1 
ATOM   7438  C  CB    . ARG I  1 177 ? -42.679 -14.146 -45.482 1.00 26.28  ? 420 ARG I CB    1 
ATOM   7439  C  CG    . ARG I  1 177 ? -41.523 -13.226 -45.681 1.00 24.68  ? 420 ARG I CG    1 
ATOM   7440  C  CD    . ARG I  1 177 ? -40.193 -13.836 -45.290 1.00 26.40  ? 420 ARG I CD    1 
ATOM   7441  N  NE    . ARG I  1 177 ? -40.205 -14.411 -43.966 1.00 25.84  ? 420 ARG I NE    1 
ATOM   7442  C  CZ    . ARG I  1 177 ? -40.218 -13.710 -42.838 1.00 26.32  ? 420 ARG I CZ    1 
ATOM   7443  N  NH1   . ARG I  1 177 ? -40.244 -12.370 -42.814 1.00 27.19  ? 420 ARG I NH1   1 
ATOM   7444  N  NH2   . ARG I  1 177 ? -40.232 -14.357 -41.712 1.00 25.86  ? 420 ARG I NH2   1 
ATOM   7445  N  N     . GLY I  1 178 ? -46.185 -14.687 -46.046 1.00 32.85  ? 421 GLY I N     1 
ATOM   7446  C  CA    . GLY I  1 178 ? -47.211 -15.685 -46.201 1.00 31.43  ? 421 GLY I CA    1 
ATOM   7447  C  C     . GLY I  1 178 ? -47.602 -16.392 -44.940 1.00 35.04  ? 421 GLY I C     1 
ATOM   7448  O  O     . GLY I  1 178 ? -48.487 -17.200 -44.977 1.00 36.19  ? 421 GLY I O     1 
ATOM   7449  N  N     . LYS I  1 179 ? -47.037 -16.038 -43.797 1.00 35.63  ? 422 LYS I N     1 
ATOM   7450  C  CA    . LYS I  1 179 ? -47.353 -16.764 -42.580 1.00 35.14  ? 422 LYS I CA    1 
ATOM   7451  C  C     . LYS I  1 179 ? -48.805 -16.604 -42.143 1.00 33.28  ? 422 LYS I C     1 
ATOM   7452  O  O     . LYS I  1 179 ? -49.464 -15.647 -42.456 1.00 33.76  ? 422 LYS I O     1 
ATOM   7453  C  CB    . LYS I  1 179 ? -46.423 -16.365 -41.440 1.00 35.83  ? 422 LYS I CB    1 
ATOM   7454  C  CG    . LYS I  1 179 ? -44.958 -16.317 -41.815 1.00 41.18  ? 422 LYS I CG    1 
ATOM   7455  C  CD    . LYS I  1 179 ? -44.523 -17.644 -42.374 1.00 44.26  ? 422 LYS I CD    1 
ATOM   7456  C  CE    . LYS I  1 179 ? -43.050 -17.638 -42.696 1.00 50.46  ? 422 LYS I CE    1 
ATOM   7457  N  NZ    . LYS I  1 179 ? -42.646 -18.959 -43.268 1.00 54.99  ? 422 LYS I NZ    1 
ATOM   7458  N  N     . ALA I  1 180 ? -49.270 -17.559 -41.371 1.00 34.71  ? 423 ALA I N     1 
ATOM   7459  C  CA    . ALA I  1 180 ? -50.666 -17.625 -40.994 1.00 38.93  ? 423 ALA I CA    1 
ATOM   7460  C  C     . ALA I  1 180 ? -50.844 -16.993 -39.637 1.00 36.37  ? 423 ALA I C     1 
ATOM   7461  O  O     . ALA I  1 180 ? -51.969 -16.649 -39.256 1.00 36.35  ? 423 ALA I O     1 
ATOM   7462  C  CB    . ALA I  1 180 ? -51.149 -19.082 -40.969 1.00 40.92  ? 423 ALA I CB    1 
ATOM   7463  N  N     . THR I  1 181 ? -49.749 -16.828 -38.906 1.00 34.73  ? 424 THR I N     1 
ATOM   7464  C  CA    . THR I  1 181 ? -49.760 -15.921 -37.774 1.00 36.51  ? 424 THR I CA    1 
ATOM   7465  C  C     . THR I  1 181 ? -48.584 -14.968 -37.869 1.00 34.76  ? 424 THR I C     1 
ATOM   7466  O  O     . THR I  1 181 ? -47.613 -15.281 -38.528 1.00 36.36  ? 424 THR I O     1 
ATOM   7467  C  CB    . THR I  1 181 ? -49.731 -16.657 -36.435 1.00 38.17  ? 424 THR I CB    1 
ATOM   7468  O  OG1   . THR I  1 181 ? -48.488 -17.360 -36.343 1.00 39.79  ? 424 THR I OG1   1 
ATOM   7469  C  CG2   . THR I  1 181 ? -50.937 -17.599 -36.333 1.00 37.93  ? 424 THR I CG2   1 
ATOM   7470  N  N     . CYS I  1 182 ? -48.698 -13.813 -37.205 1.00 32.31  ? 425 CYS I N     1 
ATOM   7471  C  CA    . CYS I  1 182 ? -47.695 -12.742 -37.270 1.00 31.59  ? 425 CYS I CA    1 
ATOM   7472  C  C     . CYS I  1 182 ? -47.385 -12.214 -35.909 1.00 32.21  ? 425 CYS I C     1 
ATOM   7473  O  O     . CYS I  1 182 ? -48.286 -12.061 -35.056 1.00 32.48  ? 425 CYS I O     1 
ATOM   7474  C  CB    . CYS I  1 182 ? -48.201 -11.557 -38.074 1.00 33.51  ? 425 CYS I CB    1 
ATOM   7475  S  SG    . CYS I  1 182 ? -48.561 -11.940 -39.789 1.00 39.98  ? 425 CYS I SG    1 
ATOM   7476  N  N     . GLY I  1 183 ? -46.108 -11.883 -35.726 1.00 30.72  ? 426 GLY I N     1 
ATOM   7477  C  CA    . GLY I  1 183 ? -45.597 -11.359 -34.491 1.00 29.23  ? 426 GLY I CA    1 
ATOM   7478  C  C     . GLY I  1 183 ? -45.954 -9.911  -34.302 1.00 30.05  ? 426 GLY I C     1 
ATOM   7479  O  O     . GLY I  1 183 ? -46.315 -9.497  -33.226 1.00 28.26  ? 426 GLY I O     1 
ATOM   7480  N  N     . ASP I  1 184 ? -45.807 -9.139  -35.367 1.00 32.60  ? 427 ASP I N     1 
ATOM   7481  C  CA    . ASP I  1 184 ? -46.125 -7.755  -35.372 1.00 30.92  ? 427 ASP I CA    1 
ATOM   7482  C  C     . ASP I  1 184 ? -46.475 -7.348  -36.799 1.00 32.21  ? 427 ASP I C     1 
ATOM   7483  O  O     . ASP I  1 184 ? -46.431 -8.168  -37.703 1.00 32.14  ? 427 ASP I O     1 
ATOM   7484  C  CB    . ASP I  1 184 ? -44.996 -6.933  -34.761 1.00 33.57  ? 427 ASP I CB    1 
ATOM   7485  C  CG    . ASP I  1 184 ? -43.705 -6.842  -35.619 1.00 36.04  ? 427 ASP I CG    1 
ATOM   7486  O  OD1   . ASP I  1 184 ? -43.619 -7.121  -36.813 1.00 43.30  ? 427 ASP I OD1   1 
ATOM   7487  O  OD2   . ASP I  1 184 ? -42.685 -6.399  -35.045 1.00 43.08  ? 427 ASP I OD2   1 
ATOM   7488  N  N     . VAL I  1 185 ? -46.875 -6.103  -36.994 1.00 30.54  ? 428 VAL I N     1 
ATOM   7489  C  CA    . VAL I  1 185 ? -47.208 -5.641  -38.322 1.00 28.27  ? 428 VAL I CA    1 
ATOM   7490  C  C     . VAL I  1 185 ? -46.350 -4.442  -38.687 1.00 28.24  ? 428 VAL I C     1 
ATOM   7491  O  O     . VAL I  1 185 ? -46.208 -3.493  -37.901 1.00 26.32  ? 428 VAL I O     1 
ATOM   7492  C  CB    . VAL I  1 185 ? -48.664 -5.262  -38.417 1.00 29.11  ? 428 VAL I CB    1 
ATOM   7493  C  CG1   . VAL I  1 185 ? -48.999 -4.821  -39.839 1.00 31.69  ? 428 VAL I CG1   1 
ATOM   7494  C  CG2   . VAL I  1 185 ? -49.530 -6.437  -37.964 1.00 30.50  ? 428 VAL I CG2   1 
ATOM   7495  N  N     . ASP I  1 186 ? -45.771 -4.480  -39.882 1.00 26.42  ? 429 ASP I N     1 
ATOM   7496  C  CA    . ASP I  1 186 ? -44.908 -3.384  -40.318 1.00 29.66  ? 429 ASP I CA    1 
ATOM   7497  C  C     . ASP I  1 186 ? -45.544 -2.942  -41.658 1.00 30.02  ? 429 ASP I C     1 
ATOM   7498  O  O     . ASP I  1 186 ? -45.544 -3.697  -42.622 1.00 35.23  ? 429 ASP I O     1 
ATOM   7499  C  CB    . ASP I  1 186 ? -43.385 -3.818  -40.454 1.00 33.49  ? 429 ASP I CB    1 
ATOM   7500  C  CG    . ASP I  1 186 ? -42.714 -4.423  -39.099 1.00 35.61  ? 429 ASP I CG    1 
ATOM   7501  O  OD1   . ASP I  1 186 ? -43.296 -4.584  -37.985 1.00 41.11  ? 429 ASP I OD1   1 
ATOM   7502  O  OD2   . ASP I  1 186 ? -41.507 -4.751  -39.102 1.00 48.59  ? 429 ASP I OD2   1 
ATOM   7503  N  N     . VAL I  1 187 ? -46.085 -1.726  -41.717 1.00 27.25  ? 430 VAL I N     1 
ATOM   7504  C  CA    . VAL I  1 187 ? -46.703 -1.184  -42.940 1.00 25.83  ? 430 VAL I CA    1 
ATOM   7505  C  C     . VAL I  1 187 ? -45.832 -0.178  -43.623 1.00 24.79  ? 430 VAL I C     1 
ATOM   7506  O  O     . VAL I  1 187 ? -45.541 0.903   -43.064 1.00 24.89  ? 430 VAL I O     1 
ATOM   7507  C  CB    . VAL I  1 187 ? -48.045 -0.467  -42.630 1.00 26.15  ? 430 VAL I CB    1 
ATOM   7508  C  CG1   . VAL I  1 187 ? -48.655 0.085   -43.903 1.00 27.52  ? 430 VAL I CG1   1 
ATOM   7509  C  CG2   . VAL I  1 187 ? -48.986 -1.420  -41.946 1.00 25.79  ? 430 VAL I CG2   1 
ATOM   7510  N  N     . LEU I  1 188 ? -45.459 -0.515  -44.857 1.00 23.26  ? 431 LEU I N     1 
ATOM   7511  C  CA    . LEU I  1 188 ? -44.622 0.296   -45.688 1.00 22.90  ? 431 LEU I CA    1 
ATOM   7512  C  C     . LEU I  1 188 ? -45.484 1.065   -46.670 1.00 25.07  ? 431 LEU I C     1 
ATOM   7513  O  O     . LEU I  1 188 ? -46.385 0.494   -47.263 1.00 27.03  ? 431 LEU I O     1 
ATOM   7514  C  CB    . LEU I  1 188 ? -43.676 -0.613  -46.452 1.00 23.77  ? 431 LEU I CB    1 
ATOM   7515  C  CG    . LEU I  1 188 ? -42.743 0.046   -47.427 1.00 22.95  ? 431 LEU I CG    1 
ATOM   7516  C  CD1   . LEU I  1 188 ? -41.923 1.124   -46.730 1.00 25.52  ? 431 LEU I CD1   1 
ATOM   7517  C  CD2   . LEU I  1 188 ? -41.837 -1.032  -47.965 1.00 23.74  ? 431 LEU I CD2   1 
ATOM   7518  N  N     . ILE I  1 189 ? -45.146 2.339   -46.859 1.00 25.35  ? 432 ILE I N     1 
ATOM   7519  C  CA    . ILE I  1 189 ? -45.943 3.332   -47.565 1.00 28.36  ? 432 ILE I CA    1 
ATOM   7520  C  C     . ILE I  1 189 ? -45.058 4.216   -48.432 1.00 28.95  ? 432 ILE I C     1 
ATOM   7521  O  O     . ILE I  1 189 ? -43.959 4.604   -48.021 1.00 26.08  ? 432 ILE I O     1 
ATOM   7522  C  CB    . ILE I  1 189 ? -46.651 4.298   -46.614 1.00 28.50  ? 432 ILE I CB    1 
ATOM   7523  C  CG1   . ILE I  1 189 ? -47.602 3.546   -45.728 1.00 28.32  ? 432 ILE I CG1   1 
ATOM   7524  C  CG2   . ILE I  1 189 ? -47.478 5.294   -47.403 1.00 30.85  ? 432 ILE I CG2   1 
ATOM   7525  C  CD1   . ILE I  1 189 ? -48.290 4.432   -44.713 1.00 29.07  ? 432 ILE I CD1   1 
ATOM   7526  N  N     . THR I  1 190 ? -45.547 4.503   -49.633 1.00 29.38  ? 433 THR I N     1 
ATOM   7527  C  CA    . THR I  1 190 ? -44.830 5.328   -50.597 1.00 32.36  ? 433 THR I CA    1 
ATOM   7528  C  C     . THR I  1 190 ? -45.830 5.918   -51.609 1.00 35.51  ? 433 THR I C     1 
ATOM   7529  O  O     . THR I  1 190 ? -47.044 5.645   -51.518 1.00 34.76  ? 433 THR I O     1 
ATOM   7530  C  CB    . THR I  1 190 ? -43.754 4.510   -51.320 1.00 27.75  ? 433 THR I CB    1 
ATOM   7531  O  OG1   . THR I  1 190 ? -42.923 5.359   -52.070 1.00 30.01  ? 433 THR I OG1   1 
ATOM   7532  C  CG2   . THR I  1 190 ? -44.340 3.524   -52.251 1.00 32.50  ? 433 THR I CG2   1 
ATOM   7533  N  N     . HIS I  1 191 ? -45.318 6.689   -52.571 1.00 37.59  ? 434 HIS I N     1 
ATOM   7534  C  CA    . HIS I  1 191 ? -46.130 7.149   -53.730 1.00 42.05  ? 434 HIS I CA    1 
ATOM   7535  C  C     . HIS I  1 191 ? -45.326 7.036   -55.028 1.00 41.52  ? 434 HIS I C     1 
ATOM   7536  O  O     . HIS I  1 191 ? -44.200 7.555   -55.066 1.00 43.01  ? 434 HIS I O     1 
ATOM   7537  C  CB    . HIS I  1 191 ? -46.621 8.604   -53.559 1.00 44.12  ? 434 HIS I CB    1 
ATOM   7538  C  CG    . HIS I  1 191 ? -47.902 8.903   -54.306 1.00 47.46  ? 434 HIS I CG    1 
ATOM   7539  N  ND1   . HIS I  1 191 ? -47.954 9.068   -55.669 1.00 44.98  ? 434 HIS I ND1   1 
ATOM   7540  C  CD2   . HIS I  1 191 ? -49.180 9.025   -53.872 1.00 52.05  ? 434 HIS I CD2   1 
ATOM   7541  C  CE1   . HIS I  1 191 ? -49.200 9.269   -56.044 1.00 46.57  ? 434 HIS I CE1   1 
ATOM   7542  N  NE2   . HIS I  1 191 ? -49.965 9.259   -54.971 1.00 48.94  ? 434 HIS I NE2   1 
ATOM   7543  N  N     . PRO I  1 192 ? -45.890 6.368   -56.085 1.00 40.68  ? 435 PRO I N     1 
ATOM   7544  C  CA    . PRO I  1 192 ? -45.207 6.215   -57.388 1.00 41.46  ? 435 PRO I CA    1 
ATOM   7545  C  C     . PRO I  1 192 ? -44.780 7.517   -58.005 1.00 40.90  ? 435 PRO I C     1 
ATOM   7546  O  O     . PRO I  1 192 ? -43.805 7.554   -58.748 1.00 45.15  ? 435 PRO I O     1 
ATOM   7547  C  CB    . PRO I  1 192 ? -46.261 5.554   -58.291 1.00 39.20  ? 435 PRO I CB    1 
ATOM   7548  C  CG    . PRO I  1 192 ? -47.179 4.866   -57.384 1.00 40.44  ? 435 PRO I CG    1 
ATOM   7549  C  CD    . PRO I  1 192 ? -47.204 5.702   -56.106 1.00 41.63  ? 435 PRO I CD    1 
ATOM   7550  N  N     . ASP I  1 193 ? -45.477 8.601   -57.707 1.00 46.77  ? 436 ASP I N     1 
ATOM   7551  C  CA    . ASP I  1 193 ? -45.107 9.884   -58.337 1.00 50.76  ? 436 ASP I CA    1 
ATOM   7552  C  C     . ASP I  1 193 ? -43.724 10.327  -57.911 1.00 47.00  ? 436 ASP I C     1 
ATOM   7553  O  O     . ASP I  1 193 ? -43.117 11.129  -58.585 1.00 48.13  ? 436 ASP I O     1 
ATOM   7554  C  CB    . ASP I  1 193 ? -46.173 10.988  -58.163 1.00 48.86  ? 436 ASP I CB    1 
ATOM   7555  C  CG    . ASP I  1 193 ? -46.178 11.609  -56.798 1.00 53.22  ? 436 ASP I CG    1 
ATOM   7556  O  OD1   . ASP I  1 193 ? -45.117 11.624  -56.109 1.00 56.15  ? 436 ASP I OD1   1 
ATOM   7557  O  OD2   . ASP I  1 193 ? -47.271 12.106  -56.430 1.00 47.95  ? 436 ASP I OD2   1 
ATOM   7558  N  N     . GLY I  1 194 ? -43.232 9.785   -56.798 1.00 51.22  ? 437 GLY I N     1 
ATOM   7559  C  CA    . GLY I  1 194 ? -41.895 10.095  -56.294 1.00 45.02  ? 437 GLY I CA    1 
ATOM   7560  C  C     . GLY I  1 194 ? -41.766 11.250  -55.301 1.00 46.34  ? 437 GLY I C     1 
ATOM   7561  O  O     . GLY I  1 194 ? -40.646 11.542  -54.881 1.00 47.44  ? 437 GLY I O     1 
ATOM   7562  N  N     . ARG I  1 195 ? -42.859 11.940  -54.942 1.00 47.46  ? 438 ARG I N     1 
ATOM   7563  C  CA    . ARG I  1 195 ? -42.760 13.086  -53.982 1.00 52.01  ? 438 ARG I CA    1 
ATOM   7564  C  C     . ARG I  1 195 ? -43.958 13.279  -53.062 1.00 47.83  ? 438 ARG I C     1 
ATOM   7565  O  O     . ARG I  1 195 ? -43.867 13.997  -52.079 1.00 48.60  ? 438 ARG I O     1 
ATOM   7566  C  CB    . ARG I  1 195 ? -42.552 14.444  -54.707 1.00 63.75  ? 438 ARG I CB    1 
ATOM   7567  C  CG    . ARG I  1 195 ? -41.449 14.505  -55.760 1.00 70.87  ? 438 ARG I CG    1 
ATOM   7568  C  CD    . ARG I  1 195 ? -41.595 15.713  -56.689 1.00 79.26  ? 438 ARG I CD    1 
ATOM   7569  N  NE    . ARG I  1 195 ? -41.035 15.452  -58.032 1.00 84.31  ? 438 ARG I NE    1 
ATOM   7570  C  CZ    . ARG I  1 195 ? -39.732 15.420  -58.345 1.00 78.11  ? 438 ARG I CZ    1 
ATOM   7571  N  NH1   . ARG I  1 195 ? -38.799 15.625  -57.425 1.00 80.88  ? 438 ARG I NH1   1 
ATOM   7572  N  NH2   . ARG I  1 195 ? -39.350 15.170  -59.591 1.00 77.44  ? 438 ARG I NH2   1 
ATOM   7573  N  N     . SER I  1 196 ? -45.082 12.677  -53.412 1.00 41.69  ? 439 SER I N     1 
ATOM   7574  C  CA    . SER I  1 196 ? -46.341 12.901  -52.738 1.00 47.11  ? 439 SER I CA    1 
ATOM   7575  C  C     . SER I  1 196 ? -46.441 12.173  -51.365 1.00 47.81  ? 439 SER I C     1 
ATOM   7576  O  O     . SER I  1 196 ? -47.388 12.366  -50.589 1.00 47.95  ? 439 SER I O     1 
ATOM   7577  C  CB    . SER I  1 196 ? -47.447 12.456  -53.709 1.00 46.26  ? 439 SER I CB    1 
ATOM   7578  O  OG    . SER I  1 196 ? -48.726 12.730  -53.227 1.00 44.97  ? 439 SER I OG    1 
ATOM   7579  N  N     . HIS I  1 197 ? -45.456 11.324  -51.093 1.00 47.65  ? 440 HIS I N     1 
ATOM   7580  C  CA    . HIS I  1 197 ? -45.277 10.715  -49.779 1.00 45.74  ? 440 HIS I CA    1 
ATOM   7581  C  C     . HIS I  1 197 ? -44.820 11.739  -48.760 1.00 45.77  ? 440 HIS I C     1 
ATOM   7582  O  O     . HIS I  1 197 ? -44.940 11.470  -47.586 1.00 42.49  ? 440 HIS I O     1 
ATOM   7583  C  CB    . HIS I  1 197 ? -44.214 9.625   -49.839 1.00 41.84  ? 440 HIS I CB    1 
ATOM   7584  C  CG    . HIS I  1 197 ? -42.850 10.152  -50.155 1.00 41.71  ? 440 HIS I CG    1 
ATOM   7585  N  ND1   . HIS I  1 197 ? -42.456 10.478  -51.437 1.00 47.09  ? 440 HIS I ND1   1 
ATOM   7586  C  CD2   . HIS I  1 197 ? -41.805 10.459  -49.353 1.00 39.12  ? 440 HIS I CD2   1 
ATOM   7587  C  CE1   . HIS I  1 197 ? -41.225 10.955  -51.411 1.00 42.72  ? 440 HIS I CE1   1 
ATOM   7588  N  NE2   . HIS I  1 197 ? -40.805 10.945  -50.158 1.00 43.57  ? 440 HIS I NE2   1 
ATOM   7589  N  N     . ARG I  1 198 ? -44.239 12.865  -49.188 1.00 44.19  ? 441 ARG I N     1 
ATOM   7590  C  CA    . ARG I  1 198 ? -43.786 13.881  -48.235 1.00 44.55  ? 441 ARG I CA    1 
ATOM   7591  C  C     . ARG I  1 198 ? -45.000 14.405  -47.500 1.00 43.82  ? 441 ARG I C     1 
ATOM   7592  O  O     . ARG I  1 198 ? -46.086 14.446  -48.044 1.00 50.68  ? 441 ARG I O     1 
ATOM   7593  C  CB    . ARG I  1 198 ? -43.106 15.054  -48.926 1.00 51.57  ? 441 ARG I CB    1 
ATOM   7594  C  CG    . ARG I  1 198 ? -41.672 14.860  -49.378 1.00 59.67  ? 441 ARG I CG    1 
ATOM   7595  C  CD    . ARG I  1 198 ? -41.139 16.163  -49.997 1.00 67.94  ? 441 ARG I CD    1 
ATOM   7596  N  NE    . ARG I  1 198 ? -39.849 16.011  -50.694 1.00 78.92  ? 441 ARG I NE    1 
ATOM   7597  C  CZ    . ARG I  1 198 ? -38.630 16.074  -50.131 1.00 80.06  ? 441 ARG I CZ    1 
ATOM   7598  N  NH1   . ARG I  1 198 ? -38.483 16.272  -48.823 1.00 81.99  ? 441 ARG I NH1   1 
ATOM   7599  N  NH2   . ARG I  1 198 ? -37.533 15.923  -50.886 1.00 74.12  ? 441 ARG I NH2   1 
ATOM   7600  N  N     . GLY I  1 199 ? -44.821 14.772  -46.246 1.00 44.41  ? 442 GLY I N     1 
ATOM   7601  C  CA    . GLY I  1 199 ? -45.909 15.312  -45.419 1.00 44.35  ? 442 GLY I CA    1 
ATOM   7602  C  C     . GLY I  1 199 ? -46.880 14.341  -44.795 1.00 43.34  ? 442 GLY I C     1 
ATOM   7603  O  O     . GLY I  1 199 ? -47.598 14.676  -43.847 1.00 43.63  ? 442 GLY I O     1 
ATOM   7604  N  N     . ILE I  1 200 ? -46.899 13.116  -45.288 1.00 39.96  ? 443 ILE I N     1 
ATOM   7605  C  CA    . ILE I  1 200 ? -47.959 12.203  -44.877 1.00 39.76  ? 443 ILE I CA    1 
ATOM   7606  C  C     . ILE I  1 200 ? -47.727 11.695  -43.465 1.00 35.68  ? 443 ILE I C     1 
ATOM   7607  O  O     . ILE I  1 200 ? -48.683 11.509  -42.708 1.00 30.39  ? 443 ILE I O     1 
ATOM   7608  C  CB    . ILE I  1 200 ? -48.064 10.995  -45.826 1.00 43.51  ? 443 ILE I CB    1 
ATOM   7609  C  CG1   . ILE I  1 200 ? -48.221 11.465  -47.288 1.00 47.31  ? 443 ILE I CG1   1 
ATOM   7610  C  CG2   . ILE I  1 200 ? -49.205 10.093  -45.377 1.00 45.32  ? 443 ILE I CG2   1 
ATOM   7611  C  CD1   . ILE I  1 200 ? -49.414 12.356  -47.530 1.00 46.18  ? 443 ILE I CD1   1 
ATOM   7612  N  N     . PHE I  1 201 ? -46.451 11.458  -43.134 1.00 34.60  ? 444 PHE I N     1 
ATOM   7613  C  CA    . PHE I  1 201 ? -46.090 10.779  -41.875 1.00 35.72  ? 444 PHE I CA    1 
ATOM   7614  C  C     . PHE I  1 201 ? -46.849 11.327  -40.673 1.00 32.67  ? 444 PHE I C     1 
ATOM   7615  O  O     . PHE I  1 201 ? -47.643 10.608  -40.080 1.00 29.39  ? 444 PHE I O     1 
ATOM   7616  C  CB    . PHE I  1 201 ? -44.599 10.860  -41.630 1.00 39.30  ? 444 PHE I CB    1 
ATOM   7617  C  CG    . PHE I  1 201 ? -44.130 10.024  -40.478 1.00 38.04  ? 444 PHE I CG    1 
ATOM   7618  C  CD1   . PHE I  1 201 ? -44.113 8.648   -40.570 1.00 35.87  ? 444 PHE I CD1   1 
ATOM   7619  C  CD2   . PHE I  1 201 ? -43.671 10.621  -39.320 1.00 35.39  ? 444 PHE I CD2   1 
ATOM   7620  C  CE1   . PHE I  1 201 ? -43.671 7.875   -39.514 1.00 35.36  ? 444 PHE I CE1   1 
ATOM   7621  C  CE2   . PHE I  1 201 ? -43.211 9.845   -38.270 1.00 35.78  ? 444 PHE I CE2   1 
ATOM   7622  C  CZ    . PHE I  1 201 ? -43.211 8.478   -38.364 1.00 33.90  ? 444 PHE I CZ    1 
ATOM   7623  N  N     . SER I  1 202 ? -46.671 12.613  -40.355 1.00 33.36  ? 445 SER I N     1 
ATOM   7624  C  CA    . SER I  1 202 ? -47.275 13.158  -39.133 1.00 33.79  ? 445 SER I CA    1 
ATOM   7625  C  C     . SER I  1 202 ? -48.773 13.182  -39.176 1.00 33.41  ? 445 SER I C     1 
ATOM   7626  O  O     . SER I  1 202 ? -49.475 12.916  -38.165 1.00 32.96  ? 445 SER I O     1 
ATOM   7627  C  CB    . SER I  1 202 ? -46.751 14.547  -38.862 1.00 35.89  ? 445 SER I CB    1 
ATOM   7628  O  OG    . SER I  1 202 ? -45.435 14.617  -39.353 1.00 40.85  ? 445 SER I OG    1 
ATOM   7629  N  N     . ARG I  1 203 ? -49.283 13.492  -40.346 1.00 36.34  ? 446 ARG I N     1 
ATOM   7630  C  CA    . ARG I  1 203 ? -50.707 13.686  -40.469 1.00 38.83  ? 446 ARG I CA    1 
ATOM   7631  C  C     . ARG I  1 203 ? -51.399 12.350  -40.296 1.00 36.74  ? 446 ARG I C     1 
ATOM   7632  O  O     . ARG I  1 203 ? -52.372 12.228  -39.537 1.00 33.30  ? 446 ARG I O     1 
ATOM   7633  C  CB    . ARG I  1 203 ? -51.013 14.293  -41.820 1.00 43.69  ? 446 ARG I CB    1 
ATOM   7634  C  CG    . ARG I  1 203 ? -50.385 15.660  -41.999 1.00 48.24  ? 446 ARG I CG    1 
ATOM   7635  C  CD    . ARG I  1 203 ? -51.088 16.418  -43.097 1.00 53.84  ? 446 ARG I CD    1 
ATOM   7636  N  NE    . ARG I  1 203 ? -50.714 15.942  -44.427 1.00 56.48  ? 446 ARG I NE    1 
ATOM   7637  C  CZ    . ARG I  1 203 ? -51.539 15.882  -45.477 1.00 59.40  ? 446 ARG I CZ    1 
ATOM   7638  N  NH1   . ARG I  1 203 ? -52.828 16.220  -45.373 1.00 59.91  ? 446 ARG I NH1   1 
ATOM   7639  N  NH2   . ARG I  1 203 ? -51.076 15.449  -46.646 1.00 60.95  ? 446 ARG I NH2   1 
ATOM   7640  N  N     . LEU I  1 204 ? -50.864 11.338  -40.986 1.00 32.92  ? 447 LEU I N     1 
ATOM   7641  C  CA    . LEU I  1 204 ? -51.353 9.950   -40.834 1.00 33.11  ? 447 LEU I CA    1 
ATOM   7642  C  C     . LEU I  1 204 ? -51.376 9.503   -39.378 1.00 31.06  ? 447 LEU I C     1 
ATOM   7643  O  O     . LEU I  1 204 ? -52.367 8.924   -38.895 1.00 27.42  ? 447 LEU I O     1 
ATOM   7644  C  CB    . LEU I  1 204 ? -50.452 9.012   -41.651 1.00 33.11  ? 447 LEU I CB    1 
ATOM   7645  C  CG    . LEU I  1 204 ? -50.653 7.515   -41.515 1.00 31.90  ? 447 LEU I CG    1 
ATOM   7646  C  CD1   . LEU I  1 204 ? -52.060 7.070   -41.753 1.00 33.42  ? 447 LEU I CD1   1 
ATOM   7647  C  CD2   . LEU I  1 204 ? -49.752 6.792   -42.486 1.00 34.06  ? 447 LEU I CD2   1 
ATOM   7648  N  N     . LEU I  1 205 ? -50.280 9.781   -38.667 1.00 32.53  ? 448 LEU I N     1 
ATOM   7649  C  CA    . LEU I  1 205 ? -50.209 9.387   -37.273 1.00 33.39  ? 448 LEU I CA    1 
ATOM   7650  C  C     . LEU I  1 205 ? -51.285 10.144  -36.448 1.00 36.43  ? 448 LEU I C     1 
ATOM   7651  O  O     . LEU I  1 205 ? -51.952 9.559   -35.605 1.00 34.19  ? 448 LEU I O     1 
ATOM   7652  C  CB    . LEU I  1 205 ? -48.817 9.666   -36.725 1.00 35.36  ? 448 LEU I CB    1 
ATOM   7653  C  CG    . LEU I  1 205 ? -47.617 8.920   -37.324 1.00 38.83  ? 448 LEU I CG    1 
ATOM   7654  C  CD1   . LEU I  1 205 ? -46.355 9.369   -36.582 1.00 40.72  ? 448 LEU I CD1   1 
ATOM   7655  C  CD2   . LEU I  1 205 ? -47.753 7.398   -37.296 1.00 37.91  ? 448 LEU I CD2   1 
ATOM   7656  N  N     . ASP I  1 206 ? -51.439 11.446  -36.681 1.00 40.72  ? 449 ASP I N     1 
ATOM   7657  C  CA    . ASP I  1 206 ? -52.463 12.235  -35.967 1.00 43.28  ? 449 ASP I CA    1 
ATOM   7658  C  C     . ASP I  1 206 ? -53.831 11.661  -36.226 1.00 42.09  ? 449 ASP I C     1 
ATOM   7659  O  O     . ASP I  1 206 ? -54.607 11.380  -35.304 1.00 43.58  ? 449 ASP I O     1 
ATOM   7660  C  CB    . ASP I  1 206 ? -52.421 13.698  -36.404 1.00 42.30  ? 449 ASP I CB    1 
ATOM   7661  C  CG    . ASP I  1 206 ? -51.186 14.419  -35.865 1.00 52.13  ? 449 ASP I CG    1 
ATOM   7662  O  OD1   . ASP I  1 206 ? -50.653 14.015  -34.783 1.00 53.42  ? 449 ASP I OD1   1 
ATOM   7663  O  OD2   . ASP I  1 206 ? -50.723 15.385  -36.527 1.00 58.24  ? 449 ASP I OD2   1 
ATOM   7664  N  N     . SER I  1 207 ? -54.093 11.455  -37.501 1.00 38.60  ? 450 SER I N     1 
ATOM   7665  C  CA    . SER I  1 207 ? -55.296 10.765  -37.926 1.00 37.82  ? 450 SER I CA    1 
ATOM   7666  C  C     . SER I  1 207 ? -55.515 9.469   -37.164 1.00 38.13  ? 450 SER I C     1 
ATOM   7667  O  O     . SER I  1 207 ? -56.539 9.298   -36.532 1.00 39.44  ? 450 SER I O     1 
ATOM   7668  C  CB    . SER I  1 207 ? -55.246 10.515  -39.429 1.00 34.84  ? 450 SER I CB    1 
ATOM   7669  O  OG    . SER I  1 207 ? -56.448 9.917   -39.800 1.00 36.52  ? 450 SER I OG    1 
ATOM   7670  N  N     . LEU I  1 208 ? -54.556 8.553   -37.208 1.00 37.75  ? 451 LEU I N     1 
ATOM   7671  C  CA    . LEU I  1 208 ? -54.712 7.299   -36.445 1.00 36.98  ? 451 LEU I CA    1 
ATOM   7672  C  C     . LEU I  1 208 ? -54.797 7.466   -34.913 1.00 35.04  ? 451 LEU I C     1 
ATOM   7673  O  O     . LEU I  1 208 ? -55.444 6.670   -34.223 1.00 32.79  ? 451 LEU I O     1 
ATOM   7674  C  CB    . LEU I  1 208 ? -53.571 6.326   -36.769 1.00 36.67  ? 451 LEU I CB    1 
ATOM   7675  C  CG    . LEU I  1 208 ? -53.486 5.859   -38.232 1.00 36.53  ? 451 LEU I CG    1 
ATOM   7676  C  CD1   . LEU I  1 208 ? -52.125 5.237   -38.497 1.00 38.25  ? 451 LEU I CD1   1 
ATOM   7677  C  CD2   . LEU I  1 208 ? -54.607 4.904   -38.607 1.00 36.33  ? 451 LEU I CD2   1 
ATOM   7678  N  N     . ARG I  1 209 ? -54.101 8.450   -34.372 1.00 34.05  ? 452 ARG I N     1 
ATOM   7679  C  CA    . ARG I  1 209 ? -54.286 8.788   -32.955 1.00 38.53  ? 452 ARG I CA    1 
ATOM   7680  C  C     . ARG I  1 209 ? -55.754 9.162   -32.698 1.00 43.77  ? 452 ARG I C     1 
ATOM   7681  O  O     . ARG I  1 209 ? -56.435 8.534   -31.864 1.00 41.43  ? 452 ARG I O     1 
ATOM   7682  C  CB    . ARG I  1 209 ? -53.371 9.952   -32.553 1.00 36.57  ? 452 ARG I CB    1 
ATOM   7683  C  CG    . ARG I  1 209 ? -51.987 9.490   -32.155 1.00 35.58  ? 452 ARG I CG    1 
ATOM   7684  C  CD    . ARG I  1 209 ? -50.961 10.578  -32.117 1.00 35.06  ? 452 ARG I CD    1 
ATOM   7685  N  NE    . ARG I  1 209 ? -49.642 9.990   -31.986 1.00 30.87  ? 452 ARG I NE    1 
ATOM   7686  C  CZ    . ARG I  1 209 ? -48.549 10.462  -32.576 1.00 33.04  ? 452 ARG I CZ    1 
ATOM   7687  N  NH1   . ARG I  1 209 ? -48.604 11.557  -33.346 1.00 36.37  ? 452 ARG I NH1   1 
ATOM   7688  N  NH2   . ARG I  1 209 ? -47.391 9.841   -32.410 1.00 29.99  ? 452 ARG I NH2   1 
ATOM   7689  N  N     . GLN I  1 210 ? -56.277 10.133  -33.448 1.00 46.67  ? 453 GLN I N     1 
ATOM   7690  C  CA    . GLN I  1 210 ? -57.541 10.724  -33.003 1.00 49.88  ? 453 GLN I CA    1 
ATOM   7691  C  C     . GLN I  1 210 ? -58.703 9.785   -33.139 1.00 49.62  ? 453 GLN I C     1 
ATOM   7692  O  O     . GLN I  1 210 ? -59.651 9.901   -32.398 1.00 48.74  ? 453 GLN I O     1 
ATOM   7693  C  CB    . GLN I  1 210 ? -57.823 12.080  -33.620 1.00 53.07  ? 453 GLN I CB    1 
ATOM   7694  C  CG    . GLN I  1 210 ? -58.072 12.095  -35.096 1.00 54.58  ? 453 GLN I CG    1 
ATOM   7695  C  CD    . GLN I  1 210 ? -57.831 13.475  -35.662 1.00 60.63  ? 453 GLN I CD    1 
ATOM   7696  O  OE1   . GLN I  1 210 ? -56.948 14.229  -35.199 1.00 56.82  ? 453 GLN I OE1   1 
ATOM   7697  N  NE2   . GLN I  1 210 ? -58.609 13.820  -36.676 1.00 66.48  ? 453 GLN I NE2   1 
ATOM   7698  N  N     . GLU I  1 211 ? -58.592 8.780   -33.999 1.00 54.61  ? 454 GLU I N     1 
ATOM   7699  C  CA    . GLU I  1 211 ? -59.583 7.687   -33.992 1.00 49.84  ? 454 GLU I CA    1 
ATOM   7700  C  C     . GLU I  1 211 ? -59.357 6.722   -32.826 1.00 40.34  ? 454 GLU I C     1 
ATOM   7701  O  O     . GLU I  1 211 ? -60.106 5.786   -32.702 1.00 38.98  ? 454 GLU I O     1 
ATOM   7702  C  CB    . GLU I  1 211 ? -59.541 6.868   -35.285 1.00 57.75  ? 454 GLU I CB    1 
ATOM   7703  C  CG    . GLU I  1 211 ? -59.378 7.660   -36.575 1.00 69.13  ? 454 GLU I CG    1 
ATOM   7704  C  CD    . GLU I  1 211 ? -60.662 8.295   -37.112 1.00 77.76  ? 454 GLU I CD    1 
ATOM   7705  O  OE1   . GLU I  1 211 ? -61.722 8.308   -36.415 1.00 81.88  ? 454 GLU I OE1   1 
ATOM   7706  O  OE2   . GLU I  1 211 ? -60.584 8.792   -38.264 1.00 70.27  ? 454 GLU I OE2   1 
ATOM   7707  N  N     . GLY I  1 212 ? -58.327 6.924   -31.988 1.00 35.75  ? 455 GLY I N     1 
ATOM   7708  C  CA    . GLY I  1 212 ? -57.967 5.938   -30.946 1.00 35.83  ? 455 GLY I CA    1 
ATOM   7709  C  C     . GLY I  1 212 ? -57.275 4.621   -31.385 1.00 33.11  ? 455 GLY I C     1 
ATOM   7710  O  O     . GLY I  1 212 ? -57.196 3.677   -30.622 1.00 35.06  ? 455 GLY I O     1 
ATOM   7711  N  N     . PHE I  1 213 ? -56.736 4.559   -32.598 1.00 35.73  ? 456 PHE I N     1 
ATOM   7712  C  CA    . PHE I  1 213 ? -56.163 3.288   -33.149 1.00 33.18  ? 456 PHE I CA    1 
ATOM   7713  C  C     . PHE I  1 213 ? -54.813 3.018   -32.517 1.00 29.88  ? 456 PHE I C     1 
ATOM   7714  O  O     . PHE I  1 213 ? -54.570 1.929   -32.028 1.00 29.73  ? 456 PHE I O     1 
ATOM   7715  C  CB    . PHE I  1 213 ? -56.009 3.347   -34.682 1.00 30.75  ? 456 PHE I CB    1 
ATOM   7716  C  CG    . PHE I  1 213 ? -55.458 2.086   -35.295 1.00 29.14  ? 456 PHE I CG    1 
ATOM   7717  C  CD1   . PHE I  1 213 ? -56.096 0.869   -35.103 1.00 29.80  ? 456 PHE I CD1   1 
ATOM   7718  C  CD2   . PHE I  1 213 ? -54.296 2.118   -36.068 1.00 28.20  ? 456 PHE I CD2   1 
ATOM   7719  C  CE1   . PHE I  1 213 ? -55.582 -0.301  -35.675 1.00 31.44  ? 456 PHE I CE1   1 
ATOM   7720  C  CE2   . PHE I  1 213 ? -53.799 0.951   -36.656 1.00 27.35  ? 456 PHE I CE2   1 
ATOM   7721  C  CZ    . PHE I  1 213 ? -54.440 -0.253  -36.444 1.00 26.01  ? 456 PHE I CZ    1 
ATOM   7722  N  N     . LEU I  1 214 ? -53.971 4.036   -32.516 1.00 29.58  ? 457 LEU I N     1 
ATOM   7723  C  CA    . LEU I  1 214 ? -52.718 4.007   -31.797 1.00 31.10  ? 457 LEU I CA    1 
ATOM   7724  C  C     . LEU I  1 214 ? -52.868 4.322   -30.322 1.00 34.60  ? 457 LEU I C     1 
ATOM   7725  O  O     . LEU I  1 214 ? -53.139 5.455   -29.972 1.00 41.76  ? 457 LEU I O     1 
ATOM   7726  C  CB    . LEU I  1 214 ? -51.779 5.029   -32.382 1.00 29.01  ? 457 LEU I CB    1 
ATOM   7727  C  CG    . LEU I  1 214 ? -51.561 4.878   -33.871 1.00 30.99  ? 457 LEU I CG    1 
ATOM   7728  C  CD1   . LEU I  1 214 ? -50.729 6.031   -34.405 1.00 31.68  ? 457 LEU I CD1   1 
ATOM   7729  C  CD2   . LEU I  1 214 ? -50.876 3.554   -34.146 1.00 32.00  ? 457 LEU I CD2   1 
ATOM   7730  N  N     . THR I  1 215 ? -52.608 3.343   -29.466 1.00 34.57  ? 458 THR I N     1 
ATOM   7731  C  CA    . THR I  1 215 ? -52.802 3.469   -28.011 1.00 33.70  ? 458 THR I CA    1 
ATOM   7732  C  C     . THR I  1 215 ? -51.570 3.909   -27.242 1.00 35.27  ? 458 THR I C     1 
ATOM   7733  O  O     . THR I  1 215 ? -51.696 4.321   -26.099 1.00 37.16  ? 458 THR I O     1 
ATOM   7734  C  CB    . THR I  1 215 ? -53.278 2.125   -27.403 1.00 34.87  ? 458 THR I CB    1 
ATOM   7735  O  OG1   . THR I  1 215 ? -52.290 1.108   -27.630 1.00 36.13  ? 458 THR I OG1   1 
ATOM   7736  C  CG2   . THR I  1 215 ? -54.605 1.661   -28.019 1.00 31.77  ? 458 THR I CG2   1 
ATOM   7737  N  N     . ASP I  1 216 ? -50.376 3.824   -27.844 1.00 36.86  ? 459 ASP I N     1 
ATOM   7738  C  CA    . ASP I  1 216 ? -49.116 4.116   -27.163 1.00 30.65  ? 459 ASP I CA    1 
ATOM   7739  C  C     . ASP I  1 216 ? -48.063 4.254   -28.246 1.00 32.08  ? 459 ASP I C     1 
ATOM   7740  O  O     . ASP I  1 216 ? -48.164 3.560   -29.266 1.00 32.93  ? 459 ASP I O     1 
ATOM   7741  C  CB    . ASP I  1 216 ? -48.648 2.913   -26.298 1.00 35.05  ? 459 ASP I CB    1 
ATOM   7742  C  CG    . ASP I  1 216 ? -49.548 2.594   -25.076 1.00 36.82  ? 459 ASP I CG    1 
ATOM   7743  O  OD1   . ASP I  1 216 ? -49.444 3.326   -24.081 1.00 30.55  ? 459 ASP I OD1   1 
ATOM   7744  O  OD2   . ASP I  1 216 ? -50.309 1.571   -25.100 1.00 42.83  ? 459 ASP I OD2   1 
ATOM   7745  N  N     . ASP I  1 217 ? -47.019 5.043   -28.018 1.00 26.84  ? 460 ASP I N     1 
ATOM   7746  C  CA    . ASP I  1 217 ? -45.890 5.141   -28.954 1.00 31.21  ? 460 ASP I CA    1 
ATOM   7747  C  C     . ASP I  1 217 ? -44.651 4.582   -28.274 1.00 32.36  ? 460 ASP I C     1 
ATOM   7748  O  O     . ASP I  1 217 ? -44.512 4.742   -27.078 1.00 35.72  ? 460 ASP I O     1 
ATOM   7749  C  CB    . ASP I  1 217 ? -45.543 6.602   -29.262 1.00 32.53  ? 460 ASP I CB    1 
ATOM   7750  C  CG    . ASP I  1 217 ? -46.599 7.310   -30.068 1.00 33.05  ? 460 ASP I CG    1 
ATOM   7751  O  OD1   . ASP I  1 217 ? -47.718 6.773   -30.247 1.00 36.50  ? 460 ASP I OD1   1 
ATOM   7752  O  OD2   . ASP I  1 217 ? -46.283 8.399   -30.559 1.00 31.92  ? 460 ASP I OD2   1 
ATOM   7753  N  N     . LEU I  1 218 ? -43.764 3.946   -29.019 1.00 29.87  ? 461 LEU I N     1 
ATOM   7754  C  CA    . LEU I  1 218 ? -42.481 3.510   -28.467 1.00 27.45  ? 461 LEU I CA    1 
ATOM   7755  C  C     . LEU I  1 218 ? -41.418 4.394   -29.012 1.00 27.58  ? 461 LEU I C     1 
ATOM   7756  O  O     . LEU I  1 218 ? -40.513 4.767   -28.289 1.00 24.48  ? 461 LEU I O     1 
ATOM   7757  C  CB    . LEU I  1 218 ? -42.173 2.040   -28.848 1.00 27.34  ? 461 LEU I CB    1 
ATOM   7758  C  CG    . LEU I  1 218 ? -43.132 1.034   -28.173 1.00 26.33  ? 461 LEU I CG    1 
ATOM   7759  C  CD1   . LEU I  1 218 ? -43.134 -0.264  -28.945 1.00 26.04  ? 461 LEU I CD1   1 
ATOM   7760  C  CD2   . LEU I  1 218 ? -42.769 0.766   -26.722 1.00 25.89  ? 461 LEU I CD2   1 
ATOM   7761  N  N     . VAL I  1 219 ? -41.488 4.660   -30.314 1.00 26.37  ? 462 VAL I N     1 
ATOM   7762  C  CA    . VAL I  1 219 ? -40.683 5.707   -30.934 1.00 27.43  ? 462 VAL I CA    1 
ATOM   7763  C  C     . VAL I  1 219 ? -41.607 6.469   -31.870 1.00 29.00  ? 462 VAL I C     1 
ATOM   7764  O  O     . VAL I  1 219 ? -41.970 5.971   -32.946 1.00 23.85  ? 462 VAL I O     1 
ATOM   7765  C  CB    . VAL I  1 219 ? -39.494 5.160   -31.718 1.00 29.48  ? 462 VAL I CB    1 
ATOM   7766  C  CG1   . VAL I  1 219 ? -38.723 6.308   -32.349 1.00 30.60  ? 462 VAL I CG1   1 
ATOM   7767  C  CG2   . VAL I  1 219 ? -38.543 4.395   -30.785 1.00 29.70  ? 462 VAL I CG2   1 
ATOM   7768  N  N     . SER I  1 220 ? -42.010 7.664   -31.438 1.00 26.30  ? 463 SER I N     1 
ATOM   7769  C  CA    . SER I  1 220 ? -42.982 8.453   -32.205 1.00 27.59  ? 463 SER I CA    1 
ATOM   7770  C  C     . SER I  1 220 ? -42.475 8.837   -33.573 1.00 24.38  ? 463 SER I C     1 
ATOM   7771  O  O     . SER I  1 220 ? -43.215 8.844   -34.533 1.00 26.29  ? 463 SER I O     1 
ATOM   7772  C  CB    . SER I  1 220 ? -43.450 9.662   -31.376 1.00 25.81  ? 463 SER I CB    1 
ATOM   7773  O  OG    . SER I  1 220 ? -44.059 9.151   -30.178 1.00 24.47  ? 463 SER I OG    1 
ATOM   7774  N  N     . GLN I  1 221 ? -41.200 9.110   -33.696 1.00 27.45  ? 464 GLN I N     1 
ATOM   7775  C  CA    . GLN I  1 221 ? -40.691 9.385   -35.002 1.00 30.34  ? 464 GLN I CA    1 
ATOM   7776  C  C     . GLN I  1 221 ? -39.223 9.195   -35.024 1.00 31.80  ? 464 GLN I C     1 
ATOM   7777  O  O     . GLN I  1 221 ? -38.493 9.645   -34.144 1.00 34.20  ? 464 GLN I O     1 
ATOM   7778  C  CB    . GLN I  1 221 ? -41.021 10.804  -35.408 1.00 34.78  ? 464 GLN I CB    1 
ATOM   7779  C  CG    . GLN I  1 221 ? -40.418 11.259  -36.736 1.00 37.59  ? 464 GLN I CG    1 
ATOM   7780  C  CD    . GLN I  1 221 ? -41.006 12.600  -37.186 1.00 41.96  ? 464 GLN I CD    1 
ATOM   7781  O  OE1   . GLN I  1 221 ? -41.710 13.272  -36.413 1.00 40.88  ? 464 GLN I OE1   1 
ATOM   7782  N  NE2   . GLN I  1 221 ? -40.711 12.999  -38.418 1.00 44.42  ? 464 GLN I NE2   1 
ATOM   7783  N  N     . GLU I  1 222 ? -38.791 8.579   -36.095 1.00 30.09  ? 465 GLU I N     1 
ATOM   7784  C  CA    . GLU I  1 222 ? -37.415 8.298   -36.284 1.00 31.89  ? 465 GLU I CA    1 
ATOM   7785  C  C     . GLU I  1 222 ? -37.113 8.539   -37.738 1.00 31.61  ? 465 GLU I C     1 
ATOM   7786  O  O     . GLU I  1 222 ? -37.876 8.089   -38.615 1.00 29.56  ? 465 GLU I O     1 
ATOM   7787  C  CB    . GLU I  1 222 ? -37.264 6.835   -35.979 1.00 34.02  ? 465 GLU I CB    1 
ATOM   7788  C  CG    . GLU I  1 222 ? -35.897 6.259   -36.127 1.00 35.41  ? 465 GLU I CG    1 
ATOM   7789  C  CD    . GLU I  1 222 ? -35.821 4.923   -35.409 1.00 36.02  ? 465 GLU I CD    1 
ATOM   7790  O  OE1   . GLU I  1 222 ? -36.283 4.848   -34.257 1.00 41.45  ? 465 GLU I OE1   1 
ATOM   7791  O  OE2   . GLU I  1 222 ? -35.335 3.958   -35.986 1.00 33.02  ? 465 GLU I OE2   1 
ATOM   7792  N  N     . GLU I  1 223 ? -36.008 9.206   -38.018 1.00 31.75  ? 466 GLU I N     1 
ATOM   7793  C  CA    . GLU I  1 223 ? -35.696 9.522   -39.388 1.00 32.28  ? 466 GLU I CA    1 
ATOM   7794  C  C     . GLU I  1 223 ? -34.372 8.947   -39.785 1.00 31.33  ? 466 GLU I C     1 
ATOM   7795  O  O     . GLU I  1 223 ? -33.387 9.141   -39.129 1.00 31.26  ? 466 GLU I O     1 
ATOM   7796  C  CB    . GLU I  1 223 ? -35.770 11.027  -39.628 1.00 35.20  ? 466 GLU I CB    1 
ATOM   7797  C  CG    . GLU I  1 223 ? -37.228 11.469  -39.549 1.00 42.39  ? 466 GLU I CG    1 
ATOM   7798  C  CD    . GLU I  1 223 ? -37.475 12.948  -39.827 1.00 49.82  ? 466 GLU I CD    1 
ATOM   7799  O  OE1   . GLU I  1 223 ? -36.487 13.745  -39.830 1.00 45.33  ? 466 GLU I OE1   1 
ATOM   7800  O  OE2   . GLU I  1 223 ? -38.692 13.282  -40.011 1.00 52.70  ? 466 GLU I OE2   1 
ATOM   7801  N  N     . ASN I  1 224 ? -34.388 8.211   -40.880 1.00 31.41  ? 467 ASN I N     1 
ATOM   7802  C  CA    . ASN I  1 224 ? -33.209 7.627   -41.440 1.00 30.10  ? 467 ASN I CA    1 
ATOM   7803  C  C     . ASN I  1 224 ? -33.172 7.977   -42.918 1.00 29.57  ? 467 ASN I C     1 
ATOM   7804  O  O     . ASN I  1 224 ? -33.898 7.380   -43.710 1.00 26.02  ? 467 ASN I O     1 
ATOM   7805  C  CB    . ASN I  1 224 ? -33.213 6.125   -41.272 1.00 30.25  ? 467 ASN I CB    1 
ATOM   7806  C  CG    . ASN I  1 224 ? -31.901 5.524   -41.671 1.00 32.60  ? 467 ASN I CG    1 
ATOM   7807  O  OD1   . ASN I  1 224 ? -31.222 6.034   -42.539 1.00 35.89  ? 467 ASN I OD1   1 
ATOM   7808  N  ND2   . ASN I  1 224 ? -31.512 4.464   -41.017 1.00 39.21  ? 467 ASN I ND2   1 
ATOM   7809  N  N     . GLY I  1 225 ? -32.308 8.935   -43.255 1.00 31.28  ? 468 GLY I N     1 
ATOM   7810  C  CA    . GLY I  1 225 ? -32.330 9.582   -44.554 1.00 39.39  ? 468 GLY I CA    1 
ATOM   7811  C  C     . GLY I  1 225 ? -33.749 10.047  -44.855 1.00 38.74  ? 468 GLY I C     1 
ATOM   7812  O  O     . GLY I  1 225 ? -34.367 10.728  -44.045 1.00 40.45  ? 468 GLY I O     1 
ATOM   7813  N  N     . GLN I  1 226 ? -34.278 9.644   -46.001 1.00 39.98  ? 469 GLN I N     1 
ATOM   7814  C  CA    . GLN I  1 226 ? -35.598 10.098  -46.429 1.00 41.51  ? 469 GLN I CA    1 
ATOM   7815  C  C     . GLN I  1 226 ? -36.727 9.311   -45.745 1.00 40.30  ? 469 GLN I C     1 
ATOM   7816  O  O     . GLN I  1 226 ? -37.868 9.735   -45.772 1.00 39.80  ? 469 GLN I O     1 
ATOM   7817  C  CB    . GLN I  1 226 ? -35.722 10.015  -47.960 1.00 47.22  ? 469 GLN I CB    1 
ATOM   7818  C  CG    . GLN I  1 226 ? -34.936 11.090  -48.711 1.00 55.42  ? 469 GLN I CG    1 
ATOM   7819  C  CD    . GLN I  1 226 ? -35.642 11.597  -49.978 1.00 66.38  ? 469 GLN I CD    1 
ATOM   7820  O  OE1   . GLN I  1 226 ? -36.737 12.188  -49.912 1.00 72.93  ? 469 GLN I OE1   1 
ATOM   7821  N  NE2   . GLN I  1 226 ? -35.018 11.373  -51.138 1.00 67.40  ? 469 GLN I NE2   1 
ATOM   7822  N  N     . GLN I  1 227 ? -36.404 8.192   -45.091 1.00 36.04  ? 470 GLN I N     1 
ATOM   7823  C  CA    . GLN I  1 227 ? -37.437 7.304   -44.534 1.00 30.75  ? 470 GLN I CA    1 
ATOM   7824  C  C     . GLN I  1 227 ? -37.790 7.814   -43.177 1.00 31.32  ? 470 GLN I C     1 
ATOM   7825  O  O     . GLN I  1 227 ? -36.907 8.334   -42.452 1.00 38.33  ? 470 GLN I O     1 
ATOM   7826  C  CB    . GLN I  1 227 ? -36.945 5.844   -44.491 1.00 31.17  ? 470 GLN I CB    1 
ATOM   7827  C  CG    . GLN I  1 227 ? -36.474 5.398   -45.867 1.00 30.70  ? 470 GLN I CG    1 
ATOM   7828  C  CD    . GLN I  1 227 ? -36.123 3.936   -46.015 1.00 31.21  ? 470 GLN I CD    1 
ATOM   7829  O  OE1   . GLN I  1 227 ? -35.696 3.482   -47.104 1.00 29.40  ? 470 GLN I OE1   1 
ATOM   7830  N  NE2   . GLN I  1 227 ? -36.296 3.185   -44.959 1.00 29.87  ? 470 GLN I NE2   1 
ATOM   7831  N  N     . GLN I  1 228 ? -39.071 7.749   -42.846 1.00 24.85  ? 471 GLN I N     1 
ATOM   7832  C  CA    . GLN I  1 228 ? -39.561 8.128   -41.537 1.00 25.64  ? 471 GLN I CA    1 
ATOM   7833  C  C     . GLN I  1 228 ? -40.280 6.920   -40.972 1.00 25.47  ? 471 GLN I C     1 
ATOM   7834  O  O     . GLN I  1 228 ? -41.076 6.275   -41.657 1.00 30.31  ? 471 GLN I O     1 
ATOM   7835  C  CB    . GLN I  1 228 ? -40.594 9.283   -41.639 1.00 25.93  ? 471 GLN I CB    1 
ATOM   7836  C  CG    . GLN I  1 228 ? -40.084 10.497  -42.428 1.00 28.09  ? 471 GLN I CG    1 
ATOM   7837  C  CD    . GLN I  1 228 ? -41.179 11.482  -42.798 1.00 30.26  ? 471 GLN I CD    1 
ATOM   7838  O  OE1   . GLN I  1 228 ? -41.432 12.474  -42.070 1.00 36.07  ? 471 GLN I OE1   1 
ATOM   7839  N  NE2   . GLN I  1 228 ? -41.896 11.176  -43.877 1.00 29.26  ? 471 GLN I NE2   1 
ATOM   7840  N  N     . LYS I  1 229 ? -40.096 6.672   -39.693 1.00 25.64  ? 472 LYS I N     1 
ATOM   7841  C  CA    . LYS I  1 229 ? -40.561 5.413   -39.088 1.00 24.37  ? 472 LYS I CA    1 
ATOM   7842  C  C     . LYS I  1 229 ? -41.111 5.714   -37.772 1.00 21.61  ? 472 LYS I C     1 
ATOM   7843  O  O     . LYS I  1 229 ? -40.495 6.465   -37.016 1.00 23.62  ? 472 LYS I O     1 
ATOM   7844  C  CB    . LYS I  1 229 ? -39.409 4.418   -38.917 1.00 23.42  ? 472 LYS I CB    1 
ATOM   7845  C  CG    . LYS I  1 229 ? -39.766 3.189   -38.126 1.00 26.13  ? 472 LYS I CG    1 
ATOM   7846  C  CD    . LYS I  1 229 ? -38.848 2.010   -38.439 1.00 27.56  ? 472 LYS I CD    1 
ATOM   7847  C  CE    . LYS I  1 229 ? -37.416 2.210   -37.947 1.00 29.48  ? 472 LYS I CE    1 
ATOM   7848  N  NZ    . LYS I  1 229 ? -36.645 0.919   -38.101 1.00 31.84  ? 472 LYS I NZ    1 
ATOM   7849  N  N     . TYR I  1 230 ? -42.274 5.128   -37.536 1.00 19.90  ? 473 TYR I N     1 
ATOM   7850  C  CA    . TYR I  1 230 ? -42.988 5.144   -36.301 1.00 20.36  ? 473 TYR I CA    1 
ATOM   7851  C  C     . TYR I  1 230 ? -42.967 3.714   -35.806 1.00 21.70  ? 473 TYR I C     1 
ATOM   7852  O  O     . TYR I  1 230 ? -43.230 2.802   -36.599 1.00 23.56  ? 473 TYR I O     1 
ATOM   7853  C  CB    . TYR I  1 230 ? -44.464 5.459   -36.605 1.00 21.22  ? 473 TYR I CB    1 
ATOM   7854  C  CG    . TYR I  1 230 ? -45.382 5.234   -35.461 1.00 19.91  ? 473 TYR I CG    1 
ATOM   7855  C  CD1   . TYR I  1 230 ? -45.533 6.195   -34.478 1.00 21.86  ? 473 TYR I CD1   1 
ATOM   7856  C  CD2   . TYR I  1 230 ? -46.107 4.058   -35.349 1.00 20.73  ? 473 TYR I CD2   1 
ATOM   7857  C  CE1   . TYR I  1 230 ? -46.377 5.988   -33.371 1.00 22.07  ? 473 TYR I CE1   1 
ATOM   7858  C  CE2   . TYR I  1 230 ? -46.945 3.824   -34.261 1.00 21.01  ? 473 TYR I CE2   1 
ATOM   7859  C  CZ    . TYR I  1 230 ? -47.089 4.781   -33.282 1.00 22.43  ? 473 TYR I CZ    1 
ATOM   7860  O  OH    . TYR I  1 230 ? -47.938 4.528   -32.209 1.00 24.80  ? 473 TYR I OH    1 
ATOM   7861  N  N     . LEU I  1 231 ? -42.766 3.542   -34.512 1.00 20.02  ? 474 LEU I N     1 
ATOM   7862  C  CA    . LEU I  1 231 ? -42.892 2.272   -33.818 1.00 20.59  ? 474 LEU I CA    1 
ATOM   7863  C  C     . LEU I  1 231 ? -43.841 2.450   -32.677 1.00 19.86  ? 474 LEU I C     1 
ATOM   7864  O  O     . LEU I  1 231 ? -43.591 3.287   -31.797 1.00 23.93  ? 474 LEU I O     1 
ATOM   7865  C  CB    . LEU I  1 231 ? -41.553 1.896   -33.177 1.00 20.16  ? 474 LEU I CB    1 
ATOM   7866  C  CG    . LEU I  1 231 ? -40.296 1.841   -34.020 1.00 21.13  ? 474 LEU I CG    1 
ATOM   7867  C  CD1   . LEU I  1 231 ? -39.156 1.178   -33.253 1.00 20.39  ? 474 LEU I CD1   1 
ATOM   7868  C  CD2   . LEU I  1 231 ? -40.584 1.004   -35.205 1.00 21.98  ? 474 LEU I CD2   1 
ATOM   7869  N  N     . GLY I  1 232 ? -44.894 1.654   -32.630 1.00 19.93  ? 475 GLY I N     1 
ATOM   7870  C  CA    . GLY I  1 232 ? -45.891 1.803   -31.566 1.00 20.63  ? 475 GLY I CA    1 
ATOM   7871  C  C     . GLY I  1 232 ? -46.809 0.614   -31.392 1.00 22.30  ? 475 GLY I C     1 
ATOM   7872  O  O     . GLY I  1 232 ? -46.447 -0.531  -31.788 1.00 21.39  ? 475 GLY I O     1 
ATOM   7873  N  N     . VAL I  1 233 ? -48.008 0.906   -30.852 1.00 21.58  ? 476 VAL I N     1 
ATOM   7874  C  CA    . VAL I  1 233 ? -48.993 -0.079  -30.361 1.00 21.56  ? 476 VAL I CA    1 
ATOM   7875  C  C     . VAL I  1 233 ? -50.335 0.356   -30.896 1.00 23.97  ? 476 VAL I C     1 
ATOM   7876  O  O     . VAL I  1 233 ? -50.673 1.524   -30.818 1.00 22.01  ? 476 VAL I O     1 
ATOM   7877  C  CB    . VAL I  1 233 ? -49.113 -0.065  -28.840 1.00 19.16  ? 476 VAL I CB    1 
ATOM   7878  C  CG1   . VAL I  1 233 ? -50.043 -1.138  -28.312 1.00 19.59  ? 476 VAL I CG1   1 
ATOM   7879  C  CG2   . VAL I  1 233 ? -47.785 -0.201  -28.189 1.00 20.94  ? 476 VAL I CG2   1 
ATOM   7880  N  N     . CYS I  1 234 ? -51.100 -0.584  -31.430 1.00 28.69  ? 477 CYS I N     1 
ATOM   7881  C  CA    . CYS I  1 234 ? -52.403 -0.284  -32.002 1.00 28.15  ? 477 CYS I CA    1 
ATOM   7882  C  C     . CYS I  1 234 ? -53.349 -1.319  -31.435 1.00 28.27  ? 477 CYS I C     1 
ATOM   7883  O  O     . CYS I  1 234 ? -52.934 -2.277  -30.830 1.00 24.89  ? 477 CYS I O     1 
ATOM   7884  C  CB    . CYS I  1 234 ? -52.369 -0.357  -33.537 1.00 29.15  ? 477 CYS I CB    1 
ATOM   7885  S  SG    . CYS I  1 234 ? -52.250 -2.073  -34.154 1.00 28.72  ? 477 CYS I SG    1 
ATOM   7886  N  N     . ARG I  1 235 ? -54.636 -1.069  -31.556 1.00 32.30  ? 478 ARG I N     1 
ATOM   7887  C  CA    . ARG I  1 235 ? -55.631 -2.044  -31.180 1.00 34.20  ? 478 ARG I CA    1 
ATOM   7888  C  C     . ARG I  1 235 ? -56.841 -1.798  -32.040 1.00 34.63  ? 478 ARG I C     1 
ATOM   7889  O  O     . ARG I  1 235 ? -57.284 -0.678  -32.152 1.00 35.64  ? 478 ARG I O     1 
ATOM   7890  C  CB    . ARG I  1 235 ? -56.045 -1.952  -29.707 1.00 36.77  ? 478 ARG I CB    1 
ATOM   7891  C  CG    . ARG I  1 235 ? -57.175 -2.955  -29.439 1.00 34.36  ? 478 ARG I CG    1 
ATOM   7892  C  CD    . ARG I  1 235 ? -57.651 -3.012  -28.019 1.00 36.43  ? 478 ARG I CD    1 
ATOM   7893  N  NE    . ARG I  1 235 ? -58.031 -1.695  -27.569 1.00 39.97  ? 478 ARG I NE    1 
ATOM   7894  C  CZ    . ARG I  1 235 ? -58.365 -1.411  -26.316 1.00 47.94  ? 478 ARG I CZ    1 
ATOM   7895  N  NH1   . ARG I  1 235 ? -58.360 -2.359  -25.358 1.00 47.48  ? 478 ARG I NH1   1 
ATOM   7896  N  NH2   . ARG I  1 235 ? -58.692 -0.158  -26.017 1.00 52.02  ? 478 ARG I NH2   1 
ATOM   7897  N  N     . LEU I  1 236 ? -57.357 -2.837  -32.675 1.00 36.29  ? 479 LEU I N     1 
ATOM   7898  C  CA    . LEU I  1 236 ? -58.462 -2.668  -33.580 1.00 35.06  ? 479 LEU I CA    1 
ATOM   7899  C  C     . LEU I  1 236 ? -59.702 -2.408  -32.738 1.00 39.22  ? 479 LEU I C     1 
ATOM   7900  O  O     . LEU I  1 236 ? -59.781 -2.857  -31.582 1.00 36.00  ? 479 LEU I O     1 
ATOM   7901  C  CB    . LEU I  1 236 ? -58.619 -3.901  -34.448 1.00 34.51  ? 479 LEU I CB    1 
ATOM   7902  C  CG    . LEU I  1 236 ? -57.661 -4.070  -35.621 1.00 33.94  ? 479 LEU I CG    1 
ATOM   7903  C  CD1   . LEU I  1 236 ? -57.710 -5.508  -36.104 1.00 33.77  ? 479 LEU I CD1   1 
ATOM   7904  C  CD2   . LEU I  1 236 ? -57.967 -3.158  -36.766 1.00 34.32  ? 479 LEU I CD2   1 
ATOM   7905  N  N     . PRO I  1 237 ? -60.681 -1.680  -33.303 1.00 49.17  ? 480 PRO I N     1 
ATOM   7906  C  CA    . PRO I  1 237 ? -61.783 -1.141  -32.487 1.00 48.44  ? 480 PRO I CA    1 
ATOM   7907  C  C     . PRO I  1 237 ? -62.718 -2.258  -32.133 1.00 51.10  ? 480 PRO I C     1 
ATOM   7908  O  O     . PRO I  1 237 ? -62.743 -3.266  -32.837 1.00 49.76  ? 480 PRO I O     1 
ATOM   7909  C  CB    . PRO I  1 237 ? -62.461 -0.155  -33.422 1.00 46.34  ? 480 PRO I CB    1 
ATOM   7910  C  CG    . PRO I  1 237 ? -62.263 -0.750  -34.776 1.00 51.07  ? 480 PRO I CG    1 
ATOM   7911  C  CD    . PRO I  1 237 ? -60.977 -1.567  -34.744 1.00 53.18  ? 480 PRO I CD    1 
ATOM   7912  N  N     . GLY I  1 238 ? -63.447 -2.090  -31.034 1.00 54.70  ? 481 GLY I N     1 
ATOM   7913  C  CA    . GLY I  1 238 ? -64.337 -3.130  -30.534 1.00 58.56  ? 481 GLY I CA    1 
ATOM   7914  C  C     . GLY I  1 238 ? -63.724 -4.004  -29.454 1.00 59.62  ? 481 GLY I C     1 
ATOM   7915  O  O     . GLY I  1 238 ? -62.589 -3.759  -29.010 1.00 58.76  ? 481 GLY I O     1 
ATOM   7916  N  N     . PRO I  1 239 ? -64.485 -5.029  -29.013 1.00 66.26  ? 482 PRO I N     1 
ATOM   7917  C  CA    . PRO I  1 239 ? -64.150 -5.870  -27.856 1.00 63.18  ? 482 PRO I CA    1 
ATOM   7918  C  C     . PRO I  1 239 ? -63.476 -7.155  -28.273 1.00 61.24  ? 482 PRO I C     1 
ATOM   7919  O  O     . PRO I  1 239 ? -63.600 -7.553  -29.419 1.00 58.12  ? 482 PRO I O     1 
ATOM   7920  C  CB    . PRO I  1 239 ? -65.526 -6.199  -27.284 1.00 62.69  ? 482 PRO I CB    1 
ATOM   7921  C  CG    . PRO I  1 239 ? -66.387 -6.324  -28.508 1.00 62.76  ? 482 PRO I CG    1 
ATOM   7922  C  CD    . PRO I  1 239 ? -65.828 -5.370  -29.538 1.00 64.04  ? 482 PRO I CD    1 
ATOM   7923  N  N     . GLY I  1 240 ? -62.795 -7.808  -27.336 1.00 64.88  ? 483 GLY I N     1 
ATOM   7924  C  CA    . GLY I  1 240 ? -62.028 -9.024  -27.635 1.00 61.79  ? 483 GLY I CA    1 
ATOM   7925  C  C     . GLY I  1 240 ? -60.682 -8.767  -28.299 1.00 55.22  ? 483 GLY I C     1 
ATOM   7926  O  O     . GLY I  1 240 ? -59.952 -9.705  -28.632 1.00 58.88  ? 483 GLY I O     1 
ATOM   7927  N  N     . ARG I  1 241 ? -60.339 -7.497  -28.456 1.00 43.53  ? 484 ARG I N     1 
ATOM   7928  C  CA    . ARG I  1 241 ? -59.198 -7.111  -29.252 1.00 40.23  ? 484 ARG I CA    1 
ATOM   7929  C  C     . ARG I  1 241 ? -57.973 -6.851  -28.423 1.00 40.16  ? 484 ARG I C     1 
ATOM   7930  O  O     . ARG I  1 241 ? -58.031 -6.165  -27.407 1.00 41.82  ? 484 ARG I O     1 
ATOM   7931  C  CB    . ARG I  1 241 ? -59.502 -5.804  -29.969 1.00 38.40  ? 484 ARG I CB    1 
ATOM   7932  C  CG    . ARG I  1 241 ? -60.594 -5.941  -30.974 1.00 36.72  ? 484 ARG I CG    1 
ATOM   7933  C  CD    . ARG I  1 241 ? -60.261 -7.105  -31.828 1.00 37.47  ? 484 ARG I CD    1 
ATOM   7934  N  NE    . ARG I  1 241 ? -60.739 -6.907  -33.173 1.00 42.60  ? 484 ARG I NE    1 
ATOM   7935  C  CZ    . ARG I  1 241 ? -60.360 -7.661  -34.196 1.00 42.05  ? 484 ARG I CZ    1 
ATOM   7936  N  NH1   . ARG I  1 241 ? -59.465 -8.644  -34.024 1.00 43.36  ? 484 ARG I NH1   1 
ATOM   7937  N  NH2   . ARG I  1 241 ? -60.879 -7.424  -35.382 1.00 39.06  ? 484 ARG I NH2   1 
ATOM   7938  N  N     . ARG I  1 242 ? -56.845 -7.317  -28.919 1.00 38.40  ? 485 ARG I N     1 
ATOM   7939  C  CA    . ARG I  1 242 ? -55.612 -7.165  -28.213 1.00 38.04  ? 485 ARG I CA    1 
ATOM   7940  C  C     . ARG I  1 242 ? -54.792 -6.019  -28.766 1.00 37.50  ? 485 ARG I C     1 
ATOM   7941  O  O     . ARG I  1 242 ? -54.990 -5.554  -29.891 1.00 38.56  ? 485 ARG I O     1 
ATOM   7942  C  CB    . ARG I  1 242 ? -54.861 -8.480  -28.268 1.00 41.91  ? 485 ARG I CB    1 
ATOM   7943  C  CG    . ARG I  1 242 ? -55.723 -9.637  -27.782 1.00 42.64  ? 485 ARG I CG    1 
ATOM   7944  C  CD    . ARG I  1 242 ? -54.935 -10.594 -26.913 1.00 48.65  ? 485 ARG I CD    1 
ATOM   7945  N  NE    . ARG I  1 242 ? -55.439 -11.957 -27.018 1.00 56.94  ? 485 ARG I NE    1 
ATOM   7946  C  CZ    . ARG I  1 242 ? -54.931 -13.001 -26.374 1.00 60.86  ? 485 ARG I CZ    1 
ATOM   7947  N  NH1   . ARG I  1 242 ? -53.873 -12.854 -25.566 1.00 59.68  ? 485 ARG I NH1   1 
ATOM   7948  N  NH2   . ARG I  1 242 ? -55.475 -14.201 -26.567 1.00 62.23  ? 485 ARG I NH2   1 
ATOM   7949  N  N     . HIS I  1 243 ? -53.880 -5.534  -27.939 1.00 36.39  ? 486 HIS I N     1 
ATOM   7950  C  CA    . HIS I  1 243 ? -52.876 -4.603  -28.382 1.00 33.94  ? 486 HIS I CA    1 
ATOM   7951  C  C     . HIS I  1 243 ? -51.796 -5.339  -29.196 1.00 32.02  ? 486 HIS I C     1 
ATOM   7952  O  O     . HIS I  1 243 ? -51.357 -6.417  -28.830 1.00 30.08  ? 486 HIS I O     1 
ATOM   7953  C  CB    . HIS I  1 243 ? -52.288 -3.874  -27.210 1.00 36.14  ? 486 HIS I CB    1 
ATOM   7954  C  CG    . HIS I  1 243 ? -53.280 -3.038  -26.474 1.00 35.65  ? 486 HIS I CG    1 
ATOM   7955  N  ND1   . HIS I  1 243 ? -54.129 -3.563  -25.521 1.00 35.68  ? 486 HIS I ND1   1 
ATOM   7956  C  CD2   . HIS I  1 243 ? -53.553 -1.717  -26.544 1.00 37.33  ? 486 HIS I CD2   1 
ATOM   7957  C  CE1   . HIS I  1 243 ? -54.889 -2.596  -25.045 1.00 37.40  ? 486 HIS I CE1   1 
ATOM   7958  N  NE2   . HIS I  1 243 ? -54.554 -1.467  -25.644 1.00 37.94  ? 486 HIS I NE2   1 
ATOM   7959  N  N     . ARG I  1 244 ? -51.449 -4.768  -30.349 1.00 27.26  ? 487 ARG I N     1 
ATOM   7960  C  CA    . ARG I  1 244 ? -50.406 -5.309  -31.165 1.00 28.17  ? 487 ARG I CA    1 
ATOM   7961  C  C     . ARG I  1 244 ? -49.375 -4.259  -31.442 1.00 25.44  ? 487 ARG I C     1 
ATOM   7962  O  O     . ARG I  1 244 ? -49.696 -3.044  -31.495 1.00 25.92  ? 487 ARG I O     1 
ATOM   7963  C  CB    . ARG I  1 244 ? -50.954 -5.756  -32.509 1.00 30.07  ? 487 ARG I CB    1 
ATOM   7964  C  CG    . ARG I  1 244 ? -52.149 -6.674  -32.461 1.00 30.79  ? 487 ARG I CG    1 
ATOM   7965  C  CD    . ARG I  1 244 ? -51.840 -7.942  -31.709 1.00 32.36  ? 487 ARG I CD    1 
ATOM   7966  N  NE    . ARG I  1 244 ? -52.903 -8.926  -31.908 1.00 35.74  ? 487 ARG I NE    1 
ATOM   7967  C  CZ    . ARG I  1 244 ? -52.988 -10.079 -31.253 1.00 35.21  ? 487 ARG I CZ    1 
ATOM   7968  N  NH1   . ARG I  1 244 ? -52.092 -10.388 -30.337 1.00 34.80  ? 487 ARG I NH1   1 
ATOM   7969  N  NH2   . ARG I  1 244 ? -53.990 -10.909 -31.504 1.00 37.91  ? 487 ARG I NH2   1 
ATOM   7970  N  N     . ARG I  1 245 ? -48.148 -4.738  -31.641 1.00 22.43  ? 488 ARG I N     1 
ATOM   7971  C  CA    . ARG I  1 245 ? -47.054 -3.907  -32.159 1.00 22.32  ? 488 ARG I CA    1 
ATOM   7972  C  C     . ARG I  1 245 ? -47.254 -3.555  -33.641 1.00 20.37  ? 488 ARG I C     1 
ATOM   7973  O  O     . ARG I  1 245 ? -47.485 -4.405  -34.454 1.00 21.77  ? 488 ARG I O     1 
ATOM   7974  C  CB    . ARG I  1 245 ? -45.700 -4.567  -31.940 1.00 21.33  ? 488 ARG I CB    1 
ATOM   7975  C  CG    . ARG I  1 245 ? -45.183 -4.507  -30.512 1.00 22.93  ? 488 ARG I CG    1 
ATOM   7976  C  CD    . ARG I  1 245 ? -44.330 -3.271  -30.259 1.00 22.95  ? 488 ARG I CD    1 
ATOM   7977  N  NE    . ARG I  1 245 ? -43.146 -3.221  -31.127 1.00 23.49  ? 488 ARG I NE    1 
ATOM   7978  C  CZ    . ARG I  1 245 ? -43.043 -2.464  -32.218 1.00 23.94  ? 488 ARG I CZ    1 
ATOM   7979  N  NH1   . ARG I  1 245 ? -44.042 -1.670  -32.624 1.00 22.54  ? 488 ARG I NH1   1 
ATOM   7980  N  NH2   . ARG I  1 245 ? -41.948 -2.526  -32.929 1.00 23.12  ? 488 ARG I NH2   1 
ATOM   7981  N  N     . LEU I  1 246 ? -47.118 -2.281  -33.961 1.00 21.39  ? 489 LEU I N     1 
ATOM   7982  C  CA    . LEU I  1 246 ? -47.302 -1.766  -35.291 1.00 23.01  ? 489 LEU I CA    1 
ATOM   7983  C  C     . LEU I  1 246 ? -46.157 -0.823  -35.567 1.00 21.95  ? 489 LEU I C     1 
ATOM   7984  O  O     . LEU I  1 246 ? -45.866 0.099   -34.730 1.00 23.27  ? 489 LEU I O     1 
ATOM   7985  C  CB    . LEU I  1 246 ? -48.604 -0.948  -35.374 1.00 25.69  ? 489 LEU I CB    1 
ATOM   7986  C  CG    . LEU I  1 246 ? -48.786 -0.138  -36.676 1.00 27.39  ? 489 LEU I CG    1 
ATOM   7987  C  CD1   . LEU I  1 246 ? -48.775 -1.088  -37.884 1.00 28.58  ? 489 LEU I CD1   1 
ATOM   7988  C  CD2   . LEU I  1 246 ? -50.093 0.651   -36.647 1.00 27.11  ? 489 LEU I CD2   1 
ATOM   7989  N  N     . ASP I  1 247 ? -45.512 -1.030  -36.705 1.00 19.69  ? 490 ASP I N     1 
ATOM   7990  C  CA    . ASP I  1 247 ? -44.582 -0.052  -37.243 1.00 21.92  ? 490 ASP I CA    1 
ATOM   7991  C  C     . ASP I  1 247 ? -45.178 0.539   -38.537 1.00 22.52  ? 490 ASP I C     1 
ATOM   7992  O  O     . ASP I  1 247 ? -45.888 -0.165  -39.297 1.00 22.51  ? 490 ASP I O     1 
ATOM   7993  C  CB    . ASP I  1 247 ? -43.219 -0.630  -37.569 1.00 23.95  ? 490 ASP I CB    1 
ATOM   7994  C  CG    . ASP I  1 247 ? -42.476 -1.168  -36.374 1.00 28.83  ? 490 ASP I CG    1 
ATOM   7995  O  OD1   . ASP I  1 247 ? -42.987 -1.047  -35.223 1.00 32.87  ? 490 ASP I OD1   1 
ATOM   7996  O  OD2   . ASP I  1 247 ? -41.330 -1.715  -36.592 1.00 31.58  ? 490 ASP I OD2   1 
ATOM   7997  N  N     . ILE I  1 248 ? -44.881 1.810   -38.787 1.00 21.40  ? 491 ILE I N     1 
ATOM   7998  C  CA    . ILE I  1 248 ? -45.271 2.438   -40.038 1.00 22.01  ? 491 ILE I CA    1 
ATOM   7999  C  C     . ILE I  1 248 ? -44.052 3.159   -40.624 1.00 22.40  ? 491 ILE I C     1 
ATOM   8000  O  O     . ILE I  1 248 ? -43.404 3.927   -39.915 1.00 25.98  ? 491 ILE I O     1 
ATOM   8001  C  CB    . ILE I  1 248 ? -46.410 3.414   -39.770 1.00 23.38  ? 491 ILE I CB    1 
ATOM   8002  C  CG1   . ILE I  1 248 ? -47.664 2.631   -39.312 1.00 24.28  ? 491 ILE I CG1   1 
ATOM   8003  C  CG2   . ILE I  1 248 ? -46.665 4.266   -41.015 1.00 24.40  ? 491 ILE I CG2   1 
ATOM   8004  C  CD1   . ILE I  1 248 ? -48.820 3.497   -38.854 1.00 24.73  ? 491 ILE I CD1   1 
ATOM   8005  N  N     . ILE I  1 249 ? -43.710 2.902   -41.881 1.00 21.04  ? 492 ILE I N     1 
ATOM   8006  C  CA    . ILE I  1 249 ? -42.513 3.487   -42.491 1.00 22.51  ? 492 ILE I CA    1 
ATOM   8007  C  C     . ILE I  1 249 ? -42.912 4.159   -43.817 1.00 25.32  ? 492 ILE I C     1 
ATOM   8008  O  O     . ILE I  1 249 ? -43.487 3.510   -44.712 1.00 24.55  ? 492 ILE I O     1 
ATOM   8009  C  CB    . ILE I  1 249 ? -41.443 2.404   -42.799 1.00 24.08  ? 492 ILE I CB    1 
ATOM   8010  C  CG1   . ILE I  1 249 ? -41.124 1.535   -41.573 1.00 23.69  ? 492 ILE I CG1   1 
ATOM   8011  C  CG2   . ILE I  1 249 ? -40.134 3.016   -43.270 1.00 25.20  ? 492 ILE I CG2   1 
ATOM   8012  C  CD1   . ILE I  1 249 ? -41.738 0.141   -41.626 1.00 23.77  ? 492 ILE I CD1   1 
ATOM   8013  N  N     . VAL I  1 250 ? -42.611 5.449   -43.950 1.00 26.81  ? 493 VAL I N     1 
ATOM   8014  C  CA    . VAL I  1 250 ? -42.912 6.191   -45.182 1.00 24.84  ? 493 VAL I CA    1 
ATOM   8015  C  C     . VAL I  1 250 ? -41.593 6.397   -45.886 1.00 27.23  ? 493 VAL I C     1 
ATOM   8016  O  O     . VAL I  1 250 ? -40.645 6.891   -45.286 1.00 26.50  ? 493 VAL I O     1 
ATOM   8017  C  CB    . VAL I  1 250 ? -43.629 7.529   -44.904 1.00 26.17  ? 493 VAL I CB    1 
ATOM   8018  C  CG1   . VAL I  1 250 ? -44.050 8.242   -46.195 1.00 26.77  ? 493 VAL I CG1   1 
ATOM   8019  C  CG2   . VAL I  1 250 ? -44.859 7.293   -44.071 1.00 24.30  ? 493 VAL I CG2   1 
ATOM   8020  N  N     . VAL I  1 251 ? -41.529 5.981   -47.150 1.00 28.68  ? 494 VAL I N     1 
ATOM   8021  C  CA    . VAL I  1 251 ? -40.333 6.091   -47.950 1.00 33.52  ? 494 VAL I CA    1 
ATOM   8022  C  C     . VAL I  1 251 ? -40.591 6.634   -49.381 1.00 40.09  ? 494 VAL I C     1 
ATOM   8023  O  O     . VAL I  1 251 ? -41.680 6.462   -49.981 1.00 37.18  ? 494 VAL I O     1 
ATOM   8024  C  CB    . VAL I  1 251 ? -39.600 4.751   -48.042 1.00 34.13  ? 494 VAL I CB    1 
ATOM   8025  C  CG1   . VAL I  1 251 ? -39.577 4.071   -46.665 1.00 35.06  ? 494 VAL I CG1   1 
ATOM   8026  C  CG2   . VAL I  1 251 ? -40.259 3.834   -49.046 1.00 33.75  ? 494 VAL I CG2   1 
ATOM   8027  N  N     . PRO I  1 252 ? -39.578 7.306   -49.928 1.00 39.32  ? 495 PRO I N     1 
ATOM   8028  C  CA    . PRO I  1 252 ? -39.636 7.693   -51.340 1.00 42.48  ? 495 PRO I CA    1 
ATOM   8029  C  C     . PRO I  1 252 ? -39.735 6.500   -52.281 1.00 38.71  ? 495 PRO I C     1 
ATOM   8030  O  O     . PRO I  1 252 ? -39.211 5.398   -51.990 1.00 40.26  ? 495 PRO I O     1 
ATOM   8031  C  CB    . PRO I  1 252 ? -38.318 8.425   -51.553 1.00 44.00  ? 495 PRO I CB    1 
ATOM   8032  C  CG    . PRO I  1 252 ? -37.408 7.860   -50.490 1.00 45.30  ? 495 PRO I CG    1 
ATOM   8033  C  CD    . PRO I  1 252 ? -38.290 7.639   -49.307 1.00 40.33  ? 495 PRO I CD    1 
ATOM   8034  N  N     . TYR I  1 253 ? -40.413 6.716   -53.398 1.00 35.64  ? 496 TYR I N     1 
ATOM   8035  C  CA    . TYR I  1 253 ? -40.561 5.683   -54.413 1.00 33.52  ? 496 TYR I CA    1 
ATOM   8036  C  C     . TYR I  1 253 ? -39.261 5.085   -54.859 1.00 30.65  ? 496 TYR I C     1 
ATOM   8037  O  O     . TYR I  1 253 ? -39.183 3.873   -55.017 1.00 30.73  ? 496 TYR I O     1 
ATOM   8038  C  CB    . TYR I  1 253 ? -41.273 6.180   -55.656 1.00 35.63  ? 496 TYR I CB    1 
ATOM   8039  C  CG    . TYR I  1 253 ? -41.931 5.058   -56.406 1.00 40.10  ? 496 TYR I CG    1 
ATOM   8040  C  CD1   . TYR I  1 253 ? -42.747 4.134   -55.736 1.00 41.39  ? 496 TYR I CD1   1 
ATOM   8041  C  CD2   . TYR I  1 253 ? -41.763 4.911   -57.783 1.00 39.82  ? 496 TYR I CD2   1 
ATOM   8042  C  CE1   . TYR I  1 253 ? -43.346 3.097   -56.408 1.00 41.21  ? 496 TYR I CE1   1 
ATOM   8043  C  CE2   . TYR I  1 253 ? -42.359 3.875   -58.450 1.00 38.19  ? 496 TYR I CE2   1 
ATOM   8044  C  CZ    . TYR I  1 253 ? -43.151 2.989   -57.762 1.00 40.41  ? 496 TYR I CZ    1 
ATOM   8045  O  OH    . TYR I  1 253 ? -43.763 1.972   -58.420 1.00 40.93  ? 496 TYR I OH    1 
ATOM   8046  N  N     . SER I  1 254 ? -38.237 5.893   -55.039 1.00 29.52  ? 497 SER I N     1 
ATOM   8047  C  CA    . SER I  1 254 ? -36.928 5.350   -55.475 1.00 37.22  ? 497 SER I CA    1 
ATOM   8048  C  C     . SER I  1 254 ? -36.342 4.255   -54.536 1.00 36.95  ? 497 SER I C     1 
ATOM   8049  O  O     . SER I  1 254 ? -35.562 3.426   -54.972 1.00 36.57  ? 497 SER I O     1 
ATOM   8050  C  CB    . SER I  1 254 ? -35.878 6.458   -55.593 1.00 36.87  ? 497 SER I CB    1 
ATOM   8051  O  OG    . SER I  1 254 ? -35.304 6.718   -54.315 1.00 41.94  ? 497 SER I OG    1 
ATOM   8052  N  N     . GLU I  1 255 ? -36.707 4.274   -53.258 1.00 38.58  ? 498 GLU I N     1 
ATOM   8053  C  CA    . GLU I  1 255 ? -36.188 3.315   -52.263 1.00 38.02  ? 498 GLU I CA    1 
ATOM   8054  C  C     . GLU I  1 255 ? -37.119 2.094   -52.021 1.00 38.97  ? 498 GLU I C     1 
ATOM   8055  O  O     . GLU I  1 255 ? -36.786 1.148   -51.293 1.00 34.29  ? 498 GLU I O     1 
ATOM   8056  C  CB    . GLU I  1 255 ? -35.963 4.091   -50.956 1.00 42.63  ? 498 GLU I CB    1 
ATOM   8057  C  CG    . GLU I  1 255 ? -34.982 5.250   -51.141 1.00 45.01  ? 498 GLU I CG    1 
ATOM   8058  C  CD    . GLU I  1 255 ? -34.343 5.775   -49.859 1.00 47.59  ? 498 GLU I CD    1 
ATOM   8059  O  OE1   . GLU I  1 255 ? -34.597 5.201   -48.756 1.00 45.72  ? 498 GLU I OE1   1 
ATOM   8060  O  OE2   . GLU I  1 255 ? -33.574 6.778   -49.972 1.00 44.04  ? 498 GLU I OE2   1 
ATOM   8061  N  N     . PHE I  1 256 ? -38.282 2.125   -52.660 1.00 36.06  ? 499 PHE I N     1 
ATOM   8062  C  CA    . PHE I  1 256 ? -39.367 1.225   -52.335 1.00 34.60  ? 499 PHE I CA    1 
ATOM   8063  C  C     . PHE I  1 256 ? -38.918 -0.228  -52.449 1.00 34.75  ? 499 PHE I C     1 
ATOM   8064  O  O     . PHE I  1 256 ? -39.243 -1.074  -51.616 1.00 32.23  ? 499 PHE I O     1 
ATOM   8065  C  CB    . PHE I  1 256 ? -40.533 1.515   -53.270 1.00 33.80  ? 499 PHE I CB    1 
ATOM   8066  C  CG    . PHE I  1 256 ? -41.796 0.777   -52.947 1.00 34.41  ? 499 PHE I CG    1 
ATOM   8067  C  CD1   . PHE I  1 256 ? -42.246 0.648   -51.635 1.00 36.05  ? 499 PHE I CD1   1 
ATOM   8068  C  CD2   . PHE I  1 256 ? -42.587 0.294   -53.967 1.00 35.47  ? 499 PHE I CD2   1 
ATOM   8069  C  CE1   . PHE I  1 256 ? -43.449 0.013   -51.345 1.00 38.36  ? 499 PHE I CE1   1 
ATOM   8070  C  CE2   . PHE I  1 256 ? -43.801 -0.337  -53.692 1.00 39.00  ? 499 PHE I CE2   1 
ATOM   8071  C  CZ    . PHE I  1 256 ? -44.235 -0.483  -52.385 1.00 39.49  ? 499 PHE I CZ    1 
ATOM   8072  N  N     . ALA I  1 257 ? -38.151 -0.523  -53.475 1.00 35.21  ? 500 ALA I N     1 
ATOM   8073  C  CA    . ALA I  1 257 ? -37.713 -1.898  -53.677 1.00 32.82  ? 500 ALA I CA    1 
ATOM   8074  C  C     . ALA I  1 257 ? -36.837 -2.383  -52.529 1.00 31.98  ? 500 ALA I C     1 
ATOM   8075  O  O     . ALA I  1 257 ? -36.990 -3.490  -52.043 1.00 31.97  ? 500 ALA I O     1 
ATOM   8076  C  CB    . ALA I  1 257 ? -36.923 -2.008  -54.967 1.00 33.86  ? 500 ALA I CB    1 
ATOM   8077  N  N     . CYS I  1 258 ? -35.888 -1.557  -52.137 1.00 28.51  ? 501 CYS I N     1 
ATOM   8078  C  CA    . CYS I  1 258 ? -34.940 -1.975  -51.156 1.00 29.94  ? 501 CYS I CA    1 
ATOM   8079  C  C     . CYS I  1 258 ? -35.589 -1.999  -49.782 1.00 27.89  ? 501 CYS I C     1 
ATOM   8080  O  O     . CYS I  1 258 ? -35.277 -2.849  -48.960 1.00 26.05  ? 501 CYS I O     1 
ATOM   8081  C  CB    . CYS I  1 258 ? -33.716 -1.067  -51.221 1.00 34.61  ? 501 CYS I CB    1 
ATOM   8082  S  SG    . CYS I  1 258 ? -32.705 -1.553  -52.658 1.00 34.00  ? 501 CYS I SG    1 
ATOM   8083  N  N     . ALA I  1 259 ? -36.569 -1.138  -49.586 1.00 25.90  ? 502 ALA I N     1 
ATOM   8084  C  CA    . ALA I  1 259 ? -37.322 -1.108  -48.340 1.00 27.34  ? 502 ALA I CA    1 
ATOM   8085  C  C     . ALA I  1 259 ? -38.258 -2.291  -48.180 1.00 26.17  ? 502 ALA I C     1 
ATOM   8086  O  O     . ALA I  1 259 ? -38.378 -2.853  -47.115 1.00 24.34  ? 502 ALA I O     1 
ATOM   8087  C  CB    . ALA I  1 259 ? -38.100 0.183   -48.261 1.00 27.97  ? 502 ALA I CB    1 
ATOM   8088  N  N     . LEU I  1 260 ? -38.889 -2.691  -49.262 1.00 27.19  ? 503 LEU I N     1 
ATOM   8089  C  CA    . LEU I  1 260 ? -39.780 -3.855  -49.228 1.00 30.13  ? 503 LEU I CA    1 
ATOM   8090  C  C     . LEU I  1 260 ? -38.968 -5.055  -48.838 1.00 28.73  ? 503 LEU I C     1 
ATOM   8091  O  O     . LEU I  1 260 ? -39.429 -5.967  -48.187 1.00 26.19  ? 503 LEU I O     1 
ATOM   8092  C  CB    . LEU I  1 260 ? -40.290 -4.162  -50.638 1.00 33.41  ? 503 LEU I CB    1 
ATOM   8093  C  CG    . LEU I  1 260 ? -41.669 -3.974  -51.240 1.00 37.50  ? 503 LEU I CG    1 
ATOM   8094  C  CD1   . LEU I  1 260 ? -42.797 -3.950  -50.212 1.00 38.34  ? 503 LEU I CD1   1 
ATOM   8095  C  CD2   . LEU I  1 260 ? -41.653 -2.740  -52.104 1.00 39.04  ? 503 LEU I CD2   1 
ATOM   8096  N  N     . LEU I  1 261 ? -37.770 -5.108  -49.402 1.00 32.89  ? 504 LEU I N     1 
ATOM   8097  C  CA    . LEU I  1 261 ? -36.877 -6.223  -49.225 1.00 33.28  ? 504 LEU I CA    1 
ATOM   8098  C  C     . LEU I  1 261 ? -36.452 -6.351  -47.753 1.00 30.19  ? 504 LEU I C     1 
ATOM   8099  O  O     . LEU I  1 261 ? -36.597 -7.402  -47.113 1.00 29.74  ? 504 LEU I O     1 
ATOM   8100  C  CB    . LEU I  1 261 ? -35.669 -5.960  -50.109 1.00 35.33  ? 504 LEU I CB    1 
ATOM   8101  C  CG    . LEU I  1 261 ? -34.756 -7.101  -50.500 1.00 39.02  ? 504 LEU I CG    1 
ATOM   8102  C  CD1   . LEU I  1 261 ? -35.490 -8.340  -50.974 1.00 37.56  ? 504 LEU I CD1   1 
ATOM   8103  C  CD2   . LEU I  1 261 ? -33.887 -6.555  -51.627 1.00 45.51  ? 504 LEU I CD2   1 
ATOM   8104  N  N     . TYR I  1 262 ? -35.964 -5.240  -47.225 1.00 25.64  ? 505 TYR I N     1 
ATOM   8105  C  CA    . TYR I  1 262 ? -35.454 -5.162  -45.864 1.00 22.78  ? 505 TYR I CA    1 
ATOM   8106  C  C     . TYR I  1 262 ? -36.581 -5.473  -44.905 1.00 20.40  ? 505 TYR I C     1 
ATOM   8107  O  O     . TYR I  1 262 ? -36.523 -6.421  -44.131 1.00 18.96  ? 505 TYR I O     1 
ATOM   8108  C  CB    . TYR I  1 262 ? -34.902 -3.785  -45.637 1.00 22.77  ? 505 TYR I CB    1 
ATOM   8109  C  CG    . TYR I  1 262 ? -34.371 -3.590  -44.252 1.00 25.82  ? 505 TYR I CG    1 
ATOM   8110  C  CD1   . TYR I  1 262 ? -33.112 -4.048  -43.900 1.00 25.86  ? 505 TYR I CD1   1 
ATOM   8111  C  CD2   . TYR I  1 262 ? -35.103 -2.908  -43.299 1.00 24.37  ? 505 TYR I CD2   1 
ATOM   8112  C  CE1   . TYR I  1 262 ? -32.636 -3.837  -42.609 1.00 27.70  ? 505 TYR I CE1   1 
ATOM   8113  C  CE2   . TYR I  1 262 ? -34.631 -2.683  -42.028 1.00 24.81  ? 505 TYR I CE2   1 
ATOM   8114  C  CZ    . TYR I  1 262 ? -33.399 -3.144  -41.686 1.00 25.21  ? 505 TYR I CZ    1 
ATOM   8115  O  OH    . TYR I  1 262 ? -32.956 -2.987  -40.409 1.00 27.45  ? 505 TYR I OH    1 
ATOM   8116  N  N     . PHE I  1 263 ? -37.681 -4.774  -45.042 1.00 19.63  ? 506 PHE I N     1 
ATOM   8117  C  CA    . PHE I  1 263 ? -38.805 -5.027  -44.135 1.00 19.55  ? 506 PHE I CA    1 
ATOM   8118  C  C     . PHE I  1 263 ? -39.530 -6.329  -44.380 1.00 19.22  ? 506 PHE I C     1 
ATOM   8119  O  O     . PHE I  1 263 ? -40.212 -6.813  -43.505 1.00 19.67  ? 506 PHE I O     1 
ATOM   8120  C  CB    . PHE I  1 263 ? -39.743 -3.790  -44.114 1.00 21.56  ? 506 PHE I CB    1 
ATOM   8121  C  CG    . PHE I  1 263 ? -39.054 -2.579  -43.563 1.00 22.51  ? 506 PHE I CG    1 
ATOM   8122  C  CD1   . PHE I  1 263 ? -38.678 -2.552  -42.215 1.00 24.39  ? 506 PHE I CD1   1 
ATOM   8123  C  CD2   . PHE I  1 263 ? -38.702 -1.525  -44.380 1.00 23.48  ? 506 PHE I CD2   1 
ATOM   8124  C  CE1   . PHE I  1 263 ? -37.994 -1.446  -41.683 1.00 27.73  ? 506 PHE I CE1   1 
ATOM   8125  C  CE2   . PHE I  1 263 ? -38.013 -0.433  -43.877 1.00 27.13  ? 506 PHE I CE2   1 
ATOM   8126  C  CZ    . PHE I  1 263 ? -37.649 -0.384  -42.510 1.00 26.08  ? 506 PHE I CZ    1 
ATOM   8127  N  N     . THR I  1 264 ? -39.370 -6.963  -45.545 1.00 19.24  ? 507 THR I N     1 
ATOM   8128  C  CA    . THR I  1 264 ? -39.980 -8.276  -45.707 1.00 19.44  ? 507 THR I CA    1 
ATOM   8129  C  C     . THR I  1 264 ? -39.135 -9.313  -44.960 1.00 20.08  ? 507 THR I C     1 
ATOM   8130  O  O     . THR I  1 264 ? -39.657 -10.219 -44.337 1.00 20.96  ? 507 THR I O     1 
ATOM   8131  C  CB    . THR I  1 264 ? -40.190 -8.630  -47.196 1.00 21.15  ? 507 THR I CB    1 
ATOM   8132  O  OG1   . THR I  1 264 ? -41.109 -7.684  -47.776 1.00 20.17  ? 507 THR I OG1   1 
ATOM   8133  C  CG2   . THR I  1 264 ? -40.787 -9.966  -47.320 1.00 22.35  ? 507 THR I CG2   1 
ATOM   8134  N  N     . GLY I  1 265 ? -37.824 -9.144  -44.957 1.00 21.82  ? 508 GLY I N     1 
ATOM   8135  C  CA    . GLY I  1 265 ? -36.962 -10.083 -44.224 1.00 22.76  ? 508 GLY I CA    1 
ATOM   8136  C  C     . GLY I  1 265 ? -36.927 -11.430 -44.933 1.00 21.48  ? 508 GLY I C     1 
ATOM   8137  O  O     . GLY I  1 265 ? -37.125 -11.484 -46.139 1.00 20.68  ? 508 GLY I O     1 
ATOM   8138  N  N     . SER I  1 266 ? -36.735 -12.526 -44.211 1.00 23.16  ? 509 SER I N     1 
ATOM   8139  C  CA    . SER I  1 266 ? -36.574 -12.568 -42.772 1.00 23.76  ? 509 SER I CA    1 
ATOM   8140  C  C     . SER I  1 266 ? -35.278 -11.887 -42.475 1.00 23.09  ? 509 SER I C     1 
ATOM   8141  O  O     . SER I  1 266 ? -34.571 -11.491 -43.386 1.00 23.48  ? 509 SER I O     1 
ATOM   8142  C  CB    . SER I  1 266 ? -36.487 -13.990 -42.249 1.00 24.77  ? 509 SER I CB    1 
ATOM   8143  O  OG    . SER I  1 266 ? -35.170 -14.497 -42.466 1.00 27.15  ? 509 SER I OG    1 
ATOM   8144  N  N     . ALA I  1 267 ? -34.985 -11.726 -41.204 1.00 22.85  ? 510 ALA I N     1 
ATOM   8145  C  CA    . ALA I  1 267 ? -33.726 -11.093 -40.809 1.00 27.19  ? 510 ALA I CA    1 
ATOM   8146  C  C     . ALA I  1 267 ? -32.506 -11.932 -41.271 1.00 28.69  ? 510 ALA I C     1 
ATOM   8147  O  O     . ALA I  1 267 ? -31.472 -11.377 -41.615 1.00 27.16  ? 510 ALA I O     1 
ATOM   8148  C  CB    . ALA I  1 267 ? -33.694 -10.893 -39.301 1.00 26.55  ? 510 ALA I CB    1 
ATOM   8149  N  N     . HIS I  1 268 ? -32.638 -13.255 -41.294 1.00 31.77  ? 511 HIS I N     1 
ATOM   8150  C  CA    . HIS I  1 268 ? -31.524 -14.111 -41.773 1.00 35.87  ? 511 HIS I CA    1 
ATOM   8151  C  C     . HIS I  1 268 ? -31.301 -13.925 -43.255 1.00 33.99  ? 511 HIS I C     1 
ATOM   8152  O  O     . HIS I  1 268 ? -30.177 -13.833 -43.748 1.00 34.64  ? 511 HIS I O     1 
ATOM   8153  C  CB    . HIS I  1 268 ? -31.840 -15.565 -41.533 1.00 35.54  ? 511 HIS I CB    1 
ATOM   8154  C  CG    . HIS I  1 268 ? -32.072 -15.887 -40.103 1.00 36.08  ? 511 HIS I CG    1 
ATOM   8155  N  ND1   . HIS I  1 268 ? -31.107 -15.693 -39.140 1.00 40.82  ? 511 HIS I ND1   1 
ATOM   8156  C  CD2   . HIS I  1 268 ? -33.146 -16.418 -39.470 1.00 37.88  ? 511 HIS I CD2   1 
ATOM   8157  C  CE1   . HIS I  1 268 ? -31.581 -16.076 -37.967 1.00 40.52  ? 511 HIS I CE1   1 
ATOM   8158  N  NE2   . HIS I  1 268 ? -32.817 -16.515 -38.139 1.00 41.21  ? 511 HIS I NE2   1 
ATOM   8159  N  N     . PHE I  1 269 ? -32.406 -13.862 -43.966 1.00 30.78  ? 512 PHE I N     1 
ATOM   8160  C  CA    . PHE I  1 269 ? -32.343 -13.690 -45.362 1.00 31.01  ? 512 PHE I CA    1 
ATOM   8161  C  C     . PHE I  1 269 ? -31.658 -12.358 -45.642 1.00 33.37  ? 512 PHE I C     1 
ATOM   8162  O  O     . PHE I  1 269 ? -30.835 -12.259 -46.554 1.00 34.21  ? 512 PHE I O     1 
ATOM   8163  C  CB    . PHE I  1 269 ? -33.761 -13.693 -45.937 1.00 31.47  ? 512 PHE I CB    1 
ATOM   8164  C  CG    . PHE I  1 269 ? -33.801 -13.771 -47.426 1.00 32.52  ? 512 PHE I CG    1 
ATOM   8165  C  CD1   . PHE I  1 269 ? -33.716 -12.626 -48.192 1.00 35.63  ? 512 PHE I CD1   1 
ATOM   8166  C  CD2   . PHE I  1 269 ? -33.948 -14.995 -48.062 1.00 32.03  ? 512 PHE I CD2   1 
ATOM   8167  C  CE1   . PHE I  1 269 ? -33.755 -12.703 -49.580 1.00 38.98  ? 512 PHE I CE1   1 
ATOM   8168  C  CE2   . PHE I  1 269 ? -34.008 -15.089 -49.437 1.00 34.18  ? 512 PHE I CE2   1 
ATOM   8169  C  CZ    . PHE I  1 269 ? -33.894 -13.943 -50.202 1.00 39.15  ? 512 PHE I CZ    1 
ATOM   8170  N  N     . ASN I  1 270 ? -31.993 -11.309 -44.888 1.00 32.82  ? 513 ASN I N     1 
ATOM   8171  C  CA    . ASN I  1 270 ? -31.329 -10.029 -45.144 1.00 30.45  ? 513 ASN I CA    1 
ATOM   8172  C  C     . ASN I  1 270 ? -29.837 -10.172 -44.830 1.00 31.45  ? 513 ASN I C     1 
ATOM   8173  O  O     . ASN I  1 270 ? -29.001 -9.563  -45.506 1.00 28.98  ? 513 ASN I O     1 
ATOM   8174  C  CB    . ASN I  1 270 ? -31.884 -8.861  -44.314 1.00 31.29  ? 513 ASN I CB    1 
ATOM   8175  C  CG    . ASN I  1 270 ? -33.324 -8.522  -44.622 1.00 31.95  ? 513 ASN I CG    1 
ATOM   8176  O  OD1   . ASN I  1 270 ? -33.887 -8.967  -45.589 1.00 37.05  ? 513 ASN I OD1   1 
ATOM   8177  N  ND2   . ASN I  1 270 ? -33.920 -7.726  -43.778 1.00 30.56  ? 513 ASN I ND2   1 
ATOM   8178  N  N     . ARG I  1 271 ? -29.498 -10.940 -43.796 1.00 31.36  ? 514 ARG I N     1 
ATOM   8179  C  CA    . ARG I  1 271 ? -28.094 -11.048 -43.389 1.00 36.95  ? 514 ARG I CA    1 
ATOM   8180  C  C     . ARG I  1 271 ? -27.333 -11.707 -44.519 1.00 37.33  ? 514 ARG I C     1 
ATOM   8181  O  O     . ARG I  1 271 ? -26.285 -11.233 -44.932 1.00 33.94  ? 514 ARG I O     1 
ATOM   8182  C  CB    . ARG I  1 271 ? -27.912 -11.846 -42.083 1.00 36.82  ? 514 ARG I CB    1 
ATOM   8183  C  CG    . ARG I  1 271 ? -27.592 -10.988 -40.878 1.00 37.91  ? 514 ARG I CG    1 
ATOM   8184  C  CD    . ARG I  1 271 ? -27.157 -11.811 -39.671 1.00 39.65  ? 514 ARG I CD    1 
ATOM   8185  N  NE    . ARG I  1 271 ? -28.276 -12.588 -39.146 1.00 41.20  ? 514 ARG I NE    1 
ATOM   8186  C  CZ    . ARG I  1 271 ? -29.233 -12.089 -38.371 1.00 43.40  ? 514 ARG I CZ    1 
ATOM   8187  N  NH1   . ARG I  1 271 ? -29.199 -10.823 -37.995 1.00 42.28  ? 514 ARG I NH1   1 
ATOM   8188  N  NH2   . ARG I  1 271 ? -30.220 -12.864 -37.953 1.00 45.95  ? 514 ARG I NH2   1 
ATOM   8189  N  N     . SER I  1 272 ? -27.918 -12.772 -45.042 1.00 38.86  ? 515 SER I N     1 
ATOM   8190  C  CA    . SER I  1 272 ? -27.275 -13.522 -46.119 1.00 43.29  ? 515 SER I CA    1 
ATOM   8191  C  C     . SER I  1 272 ? -27.141 -12.682 -47.376 1.00 45.03  ? 515 SER I C     1 
ATOM   8192  O  O     . SER I  1 272 ? -26.244 -12.905 -48.166 1.00 50.41  ? 515 SER I O     1 
ATOM   8193  C  CB    . SER I  1 272 ? -28.059 -14.803 -46.427 1.00 39.98  ? 515 SER I CB    1 
ATOM   8194  O  OG    . SER I  1 272 ? -28.139 -15.616 -45.275 1.00 42.53  ? 515 SER I OG    1 
ATOM   8195  N  N     . MET I  1 273 ? -28.030 -11.714 -47.559 1.00 44.65  ? 516 MET I N     1 
ATOM   8196  C  CA    . MET I  1 273 ? -27.988 -10.870 -48.745 1.00 45.87  ? 516 MET I CA    1 
ATOM   8197  C  C     . MET I  1 273 ? -26.943 -9.796  -48.621 1.00 42.62  ? 516 MET I C     1 
ATOM   8198  O  O     . MET I  1 273 ? -26.262 -9.471  -49.582 1.00 47.15  ? 516 MET I O     1 
ATOM   8199  C  CB    . MET I  1 273 ? -29.331 -10.204 -48.958 1.00 48.07  ? 516 MET I CB    1 
ATOM   8200  C  CG    . MET I  1 273 ? -30.446 -11.198 -49.155 1.00 50.61  ? 516 MET I CG    1 
ATOM   8201  S  SD    . MET I  1 273 ? -30.704 -11.538 -50.890 1.00 54.88  ? 516 MET I SD    1 
ATOM   8202  C  CE    . MET I  1 273 ? -31.532 -10.028 -51.408 1.00 46.59  ? 516 MET I CE    1 
ATOM   8203  N  N     . ARG I  1 274 ? -26.847 -9.205  -47.439 1.00 41.48  ? 517 ARG I N     1 
ATOM   8204  C  CA    . ARG I  1 274 ? -25.801 -8.237  -47.185 1.00 38.77  ? 517 ARG I CA    1 
ATOM   8205  C  C     . ARG I  1 274 ? -24.446 -8.914  -47.331 1.00 42.02  ? 517 ARG I C     1 
ATOM   8206  O  O     . ARG I  1 274 ? -23.519 -8.320  -47.829 1.00 36.90  ? 517 ARG I O     1 
ATOM   8207  C  CB    . ARG I  1 274 ? -25.898 -7.676  -45.774 1.00 36.02  ? 517 ARG I CB    1 
ATOM   8208  C  CG    . ARG I  1 274 ? -27.012 -6.658  -45.590 1.00 33.21  ? 517 ARG I CG    1 
ATOM   8209  C  CD    . ARG I  1 274 ? -26.852 -5.854  -44.305 1.00 31.44  ? 517 ARG I CD    1 
ATOM   8210  N  NE    . ARG I  1 274 ? -27.144 -6.642  -43.097 1.00 33.85  ? 517 ARG I NE    1 
ATOM   8211  C  CZ    . ARG I  1 274 ? -28.365 -6.797  -42.564 1.00 34.53  ? 517 ARG I CZ    1 
ATOM   8212  N  NH1   . ARG I  1 274 ? -29.445 -6.239  -43.100 1.00 31.01  ? 517 ARG I NH1   1 
ATOM   8213  N  NH2   . ARG I  1 274 ? -28.528 -7.536  -41.490 1.00 34.52  ? 517 ARG I NH2   1 
ATOM   8214  N  N     . ALA I  1 275 ? -24.327 -10.144 -46.841 1.00 43.95  ? 518 ALA I N     1 
ATOM   8215  C  CA    . ALA I  1 275 ? -23.072 -10.878 -46.952 1.00 49.05  ? 518 ALA I CA    1 
ATOM   8216  C  C     . ALA I  1 275 ? -22.703 -11.020 -48.424 1.00 47.82  ? 518 ALA I C     1 
ATOM   8217  O  O     . ALA I  1 275 ? -21.633 -10.614 -48.847 1.00 49.20  ? 518 ALA I O     1 
ATOM   8218  C  CB    . ALA I  1 275 ? -23.178 -12.259 -46.293 1.00 47.35  ? 518 ALA I CB    1 
ATOM   8219  N  N     . LEU I  1 276 ? -23.618 -11.586 -49.194 1.00 48.78  ? 519 LEU I N     1 
ATOM   8220  C  CA    . LEU I  1 276 ? -23.455 -11.689 -50.630 1.00 46.72  ? 519 LEU I CA    1 
ATOM   8221  C  C     . LEU I  1 276 ? -23.023 -10.367 -51.278 1.00 48.22  ? 519 LEU I C     1 
ATOM   8222  O  O     . LEU I  1 276 ? -21.984 -10.313 -51.936 1.00 50.22  ? 519 LEU I O     1 
ATOM   8223  C  CB    . LEU I  1 276 ? -24.740 -12.180 -51.229 1.00 48.35  ? 519 LEU I CB    1 
ATOM   8224  C  CG    . LEU I  1 276 ? -24.609 -13.071 -52.442 1.00 55.11  ? 519 LEU I CG    1 
ATOM   8225  C  CD1   . LEU I  1 276 ? -25.981 -13.238 -53.071 1.00 54.84  ? 519 LEU I CD1   1 
ATOM   8226  C  CD2   . LEU I  1 276 ? -23.640 -12.485 -53.448 1.00 56.84  ? 519 LEU I CD2   1 
ATOM   8227  N  N     . ALA I  1 277 ? -23.797 -9.300  -51.091 1.00 46.18  ? 520 ALA I N     1 
ATOM   8228  C  CA    . ALA I  1 277 ? -23.473 -8.008  -51.702 1.00 43.89  ? 520 ALA I CA    1 
ATOM   8229  C  C     . ALA I  1 277 ? -22.050 -7.532  -51.391 1.00 44.96  ? 520 ALA I C     1 
ATOM   8230  O  O     . ALA I  1 277 ? -21.385 -6.827  -52.184 1.00 42.85  ? 520 ALA I O     1 
ATOM   8231  C  CB    . ALA I  1 277 ? -24.443 -6.968  -51.214 1.00 45.96  ? 520 ALA I CB    1 
ATOM   8232  N  N     . LYS I  1 278 ? -21.615 -7.856  -50.193 1.00 40.89  ? 521 LYS I N     1 
ATOM   8233  C  CA    . LYS I  1 278 ? -20.297 -7.492  -49.731 1.00 44.23  ? 521 LYS I CA    1 
ATOM   8234  C  C     . LYS I  1 278 ? -19.242 -8.224  -50.584 1.00 47.51  ? 521 LYS I C     1 
ATOM   8235  O  O     . LYS I  1 278 ? -18.255 -7.636  -51.036 1.00 46.81  ? 521 LYS I O     1 
ATOM   8236  C  CB    . LYS I  1 278 ? -20.201 -7.905  -48.274 1.00 44.96  ? 521 LYS I CB    1 
ATOM   8237  C  CG    . LYS I  1 278 ? -18.935 -7.485  -47.579 1.00 47.15  ? 521 LYS I CG    1 
ATOM   8238  C  CD    . LYS I  1 278 ? -18.823 -8.185  -46.239 1.00 46.96  ? 521 LYS I CD    1 
ATOM   8239  C  CE    . LYS I  1 278 ? -17.643 -7.589  -45.482 1.00 49.99  ? 521 LYS I CE    1 
ATOM   8240  N  NZ    . LYS I  1 278 ? -17.262 -8.424  -44.320 1.00 51.21  ? 521 LYS I NZ    1 
ATOM   8241  N  N     . THR I  1 279 ? -19.491 -9.513  -50.831 1.00 49.17  ? 522 THR I N     1 
ATOM   8242  C  CA    . THR I  1 279 ? -18.612 -10.316 -51.649 1.00 50.44  ? 522 THR I CA    1 
ATOM   8243  C  C     . THR I  1 279 ? -18.723 -9.919  -53.100 1.00 52.37  ? 522 THR I C     1 
ATOM   8244  O  O     . THR I  1 279 ? -18.240 -10.625 -53.960 1.00 60.36  ? 522 THR I O     1 
ATOM   8245  C  CB    . THR I  1 279 ? -18.924 -11.823 -51.595 1.00 48.21  ? 522 THR I CB    1 
ATOM   8246  O  OG1   . THR I  1 279 ? -20.186 -12.074 -52.225 1.00 48.52  ? 522 THR I OG1   1 
ATOM   8247  C  CG2   . THR I  1 279 ? -18.925 -12.361 -50.173 1.00 46.71  ? 522 THR I CG2   1 
ATOM   8248  N  N     . LYS I  1 280 ? -19.378 -8.820  -53.402 1.00 50.94  ? 523 LYS I N     1 
ATOM   8249  C  CA    . LYS I  1 280 ? -19.368 -8.365  -54.773 1.00 50.62  ? 523 LYS I CA    1 
ATOM   8250  C  C     . LYS I  1 280 ? -19.063 -6.885  -54.831 1.00 45.01  ? 523 LYS I C     1 
ATOM   8251  O  O     . LYS I  1 280 ? -19.405 -6.223  -55.784 1.00 46.93  ? 523 LYS I O     1 
ATOM   8252  C  CB    . LYS I  1 280 ? -20.704 -8.698  -55.435 1.00 47.84  ? 523 LYS I CB    1 
ATOM   8253  C  CG    . LYS I  1 280 ? -20.988 -10.183 -55.443 1.00 52.43  ? 523 LYS I CG    1 
ATOM   8254  C  CD    . LYS I  1 280 ? -22.050 -10.559 -56.466 1.00 57.21  ? 523 LYS I CD    1 
ATOM   8255  C  CE    . LYS I  1 280 ? -21.864 -11.998 -56.935 1.00 63.36  ? 523 LYS I CE    1 
ATOM   8256  N  NZ    . LYS I  1 280 ? -22.807 -12.372 -58.027 1.00 65.18  ? 523 LYS I NZ    1 
ATOM   8257  N  N     . GLY I  1 281 ? -18.414 -6.370  -53.800 1.00 47.26  ? 524 GLY I N     1 
ATOM   8258  C  CA    . GLY I  1 281 ? -18.080 -4.955  -53.766 1.00 47.18  ? 524 GLY I CA    1 
ATOM   8259  C  C     . GLY I  1 281 ? -19.257 -4.026  -53.522 1.00 51.67  ? 524 GLY I C     1 
ATOM   8260  O  O     . GLY I  1 281 ? -19.169 -2.820  -53.809 1.00 52.39  ? 524 GLY I O     1 
ATOM   8261  N  N     . MET I  1 282 ? -20.347 -4.562  -52.968 1.00 54.27  ? 525 MET I N     1 
ATOM   8262  C  CA    . MET I  1 282 ? -21.577 -3.775  -52.807 1.00 56.25  ? 525 MET I CA    1 
ATOM   8263  C  C     . MET I  1 282 ? -22.112 -3.805  -51.382 1.00 54.02  ? 525 MET I C     1 
ATOM   8264  O  O     . MET I  1 282 ? -21.826 -4.743  -50.629 1.00 50.93  ? 525 MET I O     1 
ATOM   8265  C  CB    . MET I  1 282 ? -22.671 -4.287  -53.743 1.00 57.69  ? 525 MET I CB    1 
ATOM   8266  C  CG    . MET I  1 282 ? -22.382 -4.077  -55.221 1.00 57.69  ? 525 MET I CG    1 
ATOM   8267  S  SD    . MET I  1 282 ? -23.585 -4.906  -56.283 1.00 57.07  ? 525 MET I SD    1 
ATOM   8268  C  CE    . MET I  1 282 ? -23.069 -6.621  -56.306 1.00 59.70  ? 525 MET I CE    1 
ATOM   8269  N  N     . SER I  1 283 ? -22.893 -2.766  -51.051 1.00 46.73  ? 526 SER I N     1 
ATOM   8270  C  CA    . SER I  1 283 ? -23.650 -2.671  -49.795 1.00 43.34  ? 526 SER I CA    1 
ATOM   8271  C  C     . SER I  1 283 ? -25.168 -2.575  -50.042 1.00 41.61  ? 526 SER I C     1 
ATOM   8272  O  O     . SER I  1 283 ? -25.646 -1.785  -50.883 1.00 43.45  ? 526 SER I O     1 
ATOM   8273  C  CB    . SER I  1 283 ? -23.211 -1.456  -48.992 1.00 43.03  ? 526 SER I CB    1 
ATOM   8274  O  OG    . SER I  1 283 ? -23.417 -0.242  -49.710 1.00 44.76  ? 526 SER I OG    1 
ATOM   8275  N  N     . LEU I  1 284 ? -25.917 -3.361  -49.285 1.00 33.99  ? 527 LEU I N     1 
ATOM   8276  C  CA    . LEU I  1 284 ? -27.346 -3.384  -49.391 1.00 33.65  ? 527 LEU I CA    1 
ATOM   8277  C  C     . LEU I  1 284 ? -27.942 -2.979  -48.070 1.00 32.51  ? 527 LEU I C     1 
ATOM   8278  O  O     . LEU I  1 284 ? -27.695 -3.647  -47.028 1.00 27.23  ? 527 LEU I O     1 
ATOM   8279  C  CB    . LEU I  1 284 ? -27.824 -4.788  -49.738 1.00 34.13  ? 527 LEU I CB    1 
ATOM   8280  C  CG    . LEU I  1 284 ? -29.350 -4.903  -49.788 1.00 33.92  ? 527 LEU I CG    1 
ATOM   8281  C  CD1   . LEU I  1 284 ? -29.893 -4.363  -51.117 1.00 34.28  ? 527 LEU I CD1   1 
ATOM   8282  C  CD2   . LEU I  1 284 ? -29.745 -6.362  -49.571 1.00 31.38  ? 527 LEU I CD2   1 
ATOM   8283  N  N     . SER I  1 285 ? -28.737 -1.909  -48.140 1.00 32.71  ? 528 SER I N     1 
ATOM   8284  C  CA    . SER I  1 285 ? -29.409 -1.307  -47.003 1.00 35.38  ? 528 SER I CA    1 
ATOM   8285  C  C     . SER I  1 285 ? -30.912 -1.183  -47.287 1.00 36.56  ? 528 SER I C     1 
ATOM   8286  O  O     . SER I  1 285 ? -31.408 -1.633  -48.318 1.00 36.04  ? 528 SER I O     1 
ATOM   8287  C  CB    . SER I  1 285 ? -28.804 0.068   -46.691 1.00 36.08  ? 528 SER I CB    1 
ATOM   8288  O  OG    . SER I  1 285 ? -29.222 1.055   -47.616 1.00 38.99  ? 528 SER I OG    1 
ATOM   8289  N  N     . GLU I  1 286 ? -31.634 -0.571  -46.358 1.00 38.57  ? 529 GLU I N     1 
ATOM   8290  C  CA    . GLU I  1 286 ? -33.082 -0.419  -46.495 1.00 39.57  ? 529 GLU I CA    1 
ATOM   8291  C  C     . GLU I  1 286 ? -33.391 0.692   -47.457 1.00 36.54  ? 529 GLU I C     1 
ATOM   8292  O  O     . GLU I  1 286 ? -34.533 0.822   -47.881 1.00 36.88  ? 529 GLU I O     1 
ATOM   8293  C  CB    . GLU I  1 286 ? -33.749 -0.139  -45.147 1.00 40.96  ? 529 GLU I CB    1 
ATOM   8294  C  CG    . GLU I  1 286 ? -33.279 1.118   -44.460 1.00 41.46  ? 529 GLU I CG    1 
ATOM   8295  C  CD    . GLU I  1 286 ? -32.126 0.887   -43.486 1.00 43.66  ? 529 GLU I CD    1 
ATOM   8296  O  OE1   . GLU I  1 286 ? -31.368 -0.080  -43.572 1.00 42.79  ? 529 GLU I OE1   1 
ATOM   8297  O  OE2   . GLU I  1 286 ? -31.949 1.733   -42.626 1.00 52.97  ? 529 GLU I OE2   1 
ATOM   8298  N  N     . HIS I  1 287 ? -32.368 1.485   -47.762 1.00 34.31  ? 530 HIS I N     1 
ATOM   8299  C  CA    . HIS I  1 287 ? -32.420 2.545   -48.770 1.00 38.40  ? 530 HIS I CA    1 
ATOM   8300  C  C     . HIS I  1 287 ? -32.058 2.100   -50.194 1.00 38.89  ? 530 HIS I C     1 
ATOM   8301  O  O     . HIS I  1 287 ? -32.653 2.590   -51.155 1.00 38.61  ? 530 HIS I O     1 
ATOM   8302  C  CB    . HIS I  1 287 ? -31.413 3.652   -48.440 1.00 36.05  ? 530 HIS I CB    1 
ATOM   8303  C  CG    . HIS I  1 287 ? -31.588 4.237   -47.095 1.00 37.42  ? 530 HIS I CG    1 
ATOM   8304  N  ND1   . HIS I  1 287 ? -32.673 5.024   -46.763 1.00 43.30  ? 530 HIS I ND1   1 
ATOM   8305  C  CD2   . HIS I  1 287 ? -30.820 4.161   -45.991 1.00 38.77  ? 530 HIS I CD2   1 
ATOM   8306  C  CE1   . HIS I  1 287 ? -32.570 5.399   -45.502 1.00 40.06  ? 530 HIS I CE1   1 
ATOM   8307  N  NE2   . HIS I  1 287 ? -31.449 4.898   -45.013 1.00 41.37  ? 530 HIS I NE2   1 
ATOM   8308  N  N     . ALA I  1 288 ? -31.057 1.225   -50.329 1.00 38.85  ? 531 ALA I N     1 
ATOM   8309  C  CA    . ALA I  1 288 ? -30.391 1.023   -51.620 1.00 38.80  ? 531 ALA I CA    1 
ATOM   8310  C  C     . ALA I  1 288 ? -29.360 -0.086  -51.662 1.00 36.40  ? 531 ALA I C     1 
ATOM   8311  O  O     . ALA I  1 288 ? -28.731 -0.408  -50.667 1.00 37.30  ? 531 ALA I O     1 
ATOM   8312  C  CB    . ALA I  1 288 ? -29.685 2.316   -52.025 1.00 39.30  ? 531 ALA I CB    1 
ATOM   8313  N  N     . LEU I  1 289 ? -29.149 -0.595  -52.866 1.00 36.95  ? 532 LEU I N     1 
ATOM   8314  C  CA    . LEU I  1 289 ? -28.011 -1.441  -53.198 1.00 38.35  ? 532 LEU I CA    1 
ATOM   8315  C  C     . LEU I  1 289 ? -26.999 -0.581  -53.891 1.00 38.50  ? 532 LEU I C     1 
ATOM   8316  O  O     . LEU I  1 289 ? -27.242 -0.154  -55.001 1.00 39.93  ? 532 LEU I O     1 
ATOM   8317  C  CB    . LEU I  1 289 ? -28.423 -2.570  -54.143 1.00 39.37  ? 532 LEU I CB    1 
ATOM   8318  C  CG    . LEU I  1 289 ? -27.278 -3.459  -54.606 1.00 38.63  ? 532 LEU I CG    1 
ATOM   8319  C  CD1   . LEU I  1 289 ? -26.650 -4.159  -53.434 1.00 38.46  ? 532 LEU I CD1   1 
ATOM   8320  C  CD2   . LEU I  1 289 ? -27.737 -4.454  -55.652 1.00 39.77  ? 532 LEU I CD2   1 
ATOM   8321  N  N     . SER I  1 290 ? -25.871 -0.326  -53.238 1.00 43.06  ? 533 SER I N     1 
ATOM   8322  C  CA    . SER I  1 290 ? -24.865 0.610   -53.743 1.00 43.55  ? 533 SER I CA    1 
ATOM   8323  C  C     . SER I  1 290 ? -23.539 -0.091  -54.012 1.00 45.63  ? 533 SER I C     1 
ATOM   8324  O  O     . SER I  1 290 ? -23.277 -1.170  -53.461 1.00 45.97  ? 533 SER I O     1 
ATOM   8325  C  CB    . SER I  1 290 ? -24.674 1.717   -52.723 1.00 42.45  ? 533 SER I CB    1 
ATOM   8326  O  OG    . SER I  1 290 ? -25.937 2.231   -52.374 1.00 38.87  ? 533 SER I OG    1 
ATOM   8327  N  N     . THR I  1 291 ? -22.713 0.506   -54.862 1.00 45.81  ? 534 THR I N     1 
ATOM   8328  C  CA    . THR I  1 291 ? -21.318 0.034   -55.020 1.00 51.41  ? 534 THR I CA    1 
ATOM   8329  C  C     . THR I  1 291 ? -20.521 0.586   -53.871 1.00 50.21  ? 534 THR I C     1 
ATOM   8330  O  O     . THR I  1 291 ? -20.941 1.550   -53.269 1.00 54.98  ? 534 THR I O     1 
ATOM   8331  C  CB    . THR I  1 291 ? -20.631 0.478   -56.347 1.00 49.56  ? 534 THR I CB    1 
ATOM   8332  O  OG1   . THR I  1 291 ? -20.878 1.876   -56.587 1.00 49.15  ? 534 THR I OG1   1 
ATOM   8333  C  CG2   . THR I  1 291 ? -21.102 -0.372  -57.521 1.00 46.34  ? 534 THR I CG2   1 
ATOM   8334  N  N     . ALA I  1 292 ? -19.352 0.003   -53.630 1.00 56.76  ? 535 ALA I N     1 
ATOM   8335  C  CA    . ALA I  1 292 ? -18.581 0.206   -52.399 1.00 62.18  ? 535 ALA I CA    1 
ATOM   8336  C  C     . ALA I  1 292 ? -18.087 1.628   -52.198 1.00 64.93  ? 535 ALA I C     1 
ATOM   8337  O  O     . ALA I  1 292 ? -18.007 2.420   -53.141 1.00 61.56  ? 535 ALA I O     1 
ATOM   8338  C  CB    . ALA I  1 292 ? -17.406 -0.763  -52.336 1.00 62.91  ? 535 ALA I CB    1 
ATOM   8339  N  N     . VAL I  1 293 ? -17.767 1.933   -50.943 1.00 65.63  ? 536 VAL I N     1 
ATOM   8340  C  CA    . VAL I  1 293 ? -17.388 3.287   -50.542 1.00 67.90  ? 536 VAL I CA    1 
ATOM   8341  C  C     . VAL I  1 293 ? -16.116 3.764   -51.213 1.00 69.10  ? 536 VAL I C     1 
ATOM   8342  O  O     . VAL I  1 293 ? -15.240 2.969   -51.553 1.00 65.81  ? 536 VAL I O     1 
ATOM   8343  C  CB    . VAL I  1 293 ? -17.168 3.417   -49.016 1.00 64.52  ? 536 VAL I CB    1 
ATOM   8344  C  CG1   . VAL I  1 293 ? -18.457 3.170   -48.257 1.00 65.72  ? 536 VAL I CG1   1 
ATOM   8345  C  CG2   . VAL I  1 293 ? -16.085 2.468   -48.543 1.00 66.12  ? 536 VAL I CG2   1 
ATOM   8346  N  N     . VAL I  1 294 ? -16.017 5.083   -51.353 1.00 79.81  ? 537 VAL I N     1 
ATOM   8347  C  CA    . VAL I  1 294 ? -14.802 5.731   -51.873 1.00 82.20  ? 537 VAL I CA    1 
ATOM   8348  C  C     . VAL I  1 294 ? -14.014 6.457   -50.767 1.00 79.45  ? 537 VAL I C     1 
ATOM   8349  O  O     . VAL I  1 294 ? -12.798 6.257   -50.642 1.00 75.54  ? 537 VAL I O     1 
ATOM   8350  C  CB    . VAL I  1 294 ? -15.111 6.690   -53.062 1.00 83.48  ? 537 VAL I CB    1 
ATOM   8351  C  CG1   . VAL I  1 294 ? -14.911 5.969   -54.393 1.00 85.28  ? 537 VAL I CG1   1 
ATOM   8352  C  CG2   . VAL I  1 294 ? -16.516 7.281   -52.975 1.00 80.72  ? 537 VAL I CG2   1 
ATOM   8353  N  N     . ARG I  1 295 ? -14.725 7.225   -49.934 1.00 79.67  ? 538 ARG I N     1 
ATOM   8354  C  CA    . ARG I  1 295 ? -14.119 8.152   -48.957 1.00 81.61  ? 538 ARG I CA    1 
ATOM   8355  C  C     . ARG I  1 295 ? -13.599 7.585   -47.605 1.00 80.18  ? 538 ARG I C     1 
ATOM   8356  O  O     . ARG I  1 295 ? -13.589 8.302   -46.597 1.00 65.38  ? 538 ARG I O     1 
ATOM   8357  C  CB    . ARG I  1 295 ? -15.126 9.258   -48.642 1.00 80.01  ? 538 ARG I CB    1 
ATOM   8358  C  CG    . ARG I  1 295 ? -14.492 10.598  -48.331 1.00 82.62  ? 538 ARG I CG    1 
ATOM   8359  C  CD    . ARG I  1 295 ? -14.917 11.614  -49.367 1.00 92.38  ? 538 ARG I CD    1 
ATOM   8360  N  NE    . ARG I  1 295 ? -16.367 11.838  -49.316 1.00 104.85 ? 538 ARG I NE    1 
ATOM   8361  C  CZ    . ARG I  1 295 ? -17.060 12.666  -50.105 1.00 112.01 ? 538 ARG I CZ    1 
ATOM   8362  N  NH1   . ARG I  1 295 ? -16.464 13.393  -51.051 1.00 116.12 ? 538 ARG I NH1   1 
ATOM   8363  N  NH2   . ARG I  1 295 ? -18.377 12.769  -49.944 1.00 113.32 ? 538 ARG I NH2   1 
ATOM   8364  N  N     . ASN I  1 296 ? -13.146 6.332   -47.590 1.00 82.16  ? 539 ASN I N     1 
ATOM   8365  C  CA    . ASN I  1 296 ? -12.477 5.765   -46.411 1.00 87.88  ? 539 ASN I CA    1 
ATOM   8366  C  C     . ASN I  1 296 ? -11.179 6.481   -46.111 1.00 89.87  ? 539 ASN I C     1 
ATOM   8367  O  O     . ASN I  1 296 ? -11.112 7.294   -45.200 1.00 90.05  ? 539 ASN I O     1 
ATOM   8368  C  CB    . ASN I  1 296 ? -12.129 4.278   -46.599 1.00 90.48  ? 539 ASN I CB    1 
ATOM   8369  C  CG    . ASN I  1 296 ? -13.339 3.414   -46.761 1.00 96.66  ? 539 ASN I CG    1 
ATOM   8370  O  OD1   . ASN I  1 296 ? -14.469 3.889   -46.626 1.00 105.29 ? 539 ASN I OD1   1 
ATOM   8371  N  ND2   . ASN I  1 296 ? -13.119 2.131   -47.063 1.00 91.74  ? 539 ASN I ND2   1 
ATOM   8372  N  N     . THR I  1 297 ? -10.154 6.175   -46.910 1.00 94.11  ? 540 THR I N     1 
ATOM   8373  C  CA    . THR I  1 297 ? -8.765  6.417   -46.535 1.00 93.28  ? 540 THR I CA    1 
ATOM   8374  C  C     . THR I  1 297 ? -8.144  7.483   -47.421 1.00 92.02  ? 540 THR I C     1 
ATOM   8375  O  O     . THR I  1 297 ? -8.124  8.650   -47.053 1.00 88.73  ? 540 THR I O     1 
ATOM   8376  C  CB    . THR I  1 297 ? -7.901  5.120   -46.601 1.00 96.29  ? 540 THR I CB    1 
ATOM   8377  O  OG1   . THR I  1 297 ? -7.096  5.106   -47.795 1.00 94.15  ? 540 THR I OG1   1 
ATOM   8378  C  CG2   . THR I  1 297 ? -8.774  3.849   -46.499 1.00 89.22  ? 540 THR I CG2   1 
ATOM   8379  N  N     . PRO I  1 304 ? -18.629 7.334   -50.171 1.00 57.52  ? 547 PRO I N     1 
ATOM   8380  C  CA    . PRO I  1 304 ? -20.061 7.092   -50.008 1.00 59.17  ? 547 PRO I CA    1 
ATOM   8381  C  C     . PRO I  1 304 ? -20.688 6.159   -51.029 1.00 59.82  ? 547 PRO I C     1 
ATOM   8382  O  O     . PRO I  1 304 ? -21.789 5.704   -50.797 1.00 68.69  ? 547 PRO I O     1 
ATOM   8383  C  CB    . PRO I  1 304 ? -20.662 8.497   -50.109 1.00 57.35  ? 547 PRO I CB    1 
ATOM   8384  C  CG    . PRO I  1 304 ? -19.619 9.337   -49.431 1.00 58.59  ? 547 PRO I CG    1 
ATOM   8385  C  CD    . PRO I  1 304 ? -18.269 8.641   -49.598 1.00 58.78  ? 547 PRO I CD    1 
ATOM   8386  N  N     . GLY I  1 305 ? -20.016 5.860   -52.137 1.00 60.72  ? 548 GLY I N     1 
ATOM   8387  C  CA    . GLY I  1 305 ? -20.477 4.781   -53.020 1.00 58.94  ? 548 GLY I CA    1 
ATOM   8388  C  C     . GLY I  1 305 ? -21.714 5.206   -53.779 1.00 60.06  ? 548 GLY I C     1 
ATOM   8389  O  O     . GLY I  1 305 ? -22.419 6.119   -53.363 1.00 62.97  ? 548 GLY I O     1 
ATOM   8390  N  N     . ARG I  1 306 ? -21.992 4.569   -54.903 1.00 60.25  ? 549 ARG I N     1 
ATOM   8391  C  CA    . ARG I  1 306 ? -23.105 5.038   -55.723 1.00 59.63  ? 549 ARG I CA    1 
ATOM   8392  C  C     . ARG I  1 306 ? -24.223 4.016   -55.775 1.00 51.48  ? 549 ARG I C     1 
ATOM   8393  O  O     . ARG I  1 306 ? -24.012 2.815   -55.628 1.00 46.06  ? 549 ARG I O     1 
ATOM   8394  C  CB    . ARG I  1 306 ? -22.636 5.437   -57.128 1.00 67.83  ? 549 ARG I CB    1 
ATOM   8395  C  CG    . ARG I  1 306 ? -22.521 6.950   -57.352 1.00 72.35  ? 549 ARG I CG    1 
ATOM   8396  C  CD    . ARG I  1 306 ? -21.843 7.292   -58.688 1.00 75.33  ? 549 ARG I CD    1 
ATOM   8397  N  NE    . ARG I  1 306 ? -22.595 8.284   -59.472 1.00 76.58  ? 549 ARG I NE    1 
ATOM   8398  C  CZ    . ARG I  1 306 ? -22.215 8.773   -60.656 1.00 72.59  ? 549 ARG I CZ    1 
ATOM   8399  N  NH1   . ARG I  1 306 ? -21.067 8.395   -61.220 1.00 70.69  ? 549 ARG I NH1   1 
ATOM   8400  N  NH2   . ARG I  1 306 ? -22.982 9.665   -61.274 1.00 68.94  ? 549 ARG I NH2   1 
ATOM   8401  N  N     . VAL I  1 307 ? -25.417 4.533   -55.991 1.00 45.90  ? 550 VAL I N     1 
ATOM   8402  C  CA    . VAL I  1 307 ? -26.626 3.788   -55.826 1.00 44.83  ? 550 VAL I CA    1 
ATOM   8403  C  C     . VAL I  1 307 ? -27.013 3.097   -57.122 1.00 46.74  ? 550 VAL I C     1 
ATOM   8404  O  O     . VAL I  1 307 ? -27.393 3.726   -58.089 1.00 52.51  ? 550 VAL I O     1 
ATOM   8405  C  CB    . VAL I  1 307 ? -27.767 4.744   -55.426 1.00 44.90  ? 550 VAL I CB    1 
ATOM   8406  C  CG1   . VAL I  1 307 ? -29.098 3.995   -55.339 1.00 46.23  ? 550 VAL I CG1   1 
ATOM   8407  C  CG2   . VAL I  1 307 ? -27.414 5.474   -54.144 1.00 43.23  ? 550 VAL I CG2   1 
ATOM   8408  N  N     . LEU I  1 308 ? -26.958 1.784   -57.137 1.00 51.79  ? 551 LEU I N     1 
ATOM   8409  C  CA    . LEU I  1 308 ? -27.452 1.065   -58.280 1.00 54.79  ? 551 LEU I CA    1 
ATOM   8410  C  C     . LEU I  1 308 ? -28.975 1.201   -58.248 1.00 57.69  ? 551 LEU I C     1 
ATOM   8411  O  O     . LEU I  1 308 ? -29.618 0.786   -57.290 1.00 60.74  ? 551 LEU I O     1 
ATOM   8412  C  CB    . LEU I  1 308 ? -27.013 -0.404  -58.255 1.00 54.64  ? 551 LEU I CB    1 
ATOM   8413  C  CG    . LEU I  1 308 ? -25.502 -0.615  -58.130 1.00 54.88  ? 551 LEU I CG    1 
ATOM   8414  C  CD1   . LEU I  1 308 ? -25.187 -2.094  -57.979 1.00 53.76  ? 551 LEU I CD1   1 
ATOM   8415  C  CD2   . LEU I  1 308 ? -24.780 0.011   -59.319 1.00 53.59  ? 551 LEU I CD2   1 
ATOM   8416  N  N     . PRO I  1 309 ? -29.558 1.790   -59.296 1.00 59.48  ? 552 PRO I N     1 
ATOM   8417  C  CA    . PRO I  1 309 ? -30.993 2.008   -59.241 1.00 57.01  ? 552 PRO I CA    1 
ATOM   8418  C  C     . PRO I  1 309 ? -31.712 0.670   -59.279 1.00 53.07  ? 552 PRO I C     1 
ATOM   8419  O  O     . PRO I  1 309 ? -31.248 -0.246  -59.963 1.00 51.44  ? 552 PRO I O     1 
ATOM   8420  C  CB    . PRO I  1 309 ? -31.253 2.802   -60.511 1.00 63.39  ? 552 PRO I CB    1 
ATOM   8421  C  CG    . PRO I  1 309 ? -30.221 2.277   -61.476 1.00 63.59  ? 552 PRO I CG    1 
ATOM   8422  C  CD    . PRO I  1 309 ? -29.004 2.011   -60.645 1.00 60.23  ? 552 PRO I CD    1 
ATOM   8423  N  N     . THR I  1 310 ? -32.820 0.546   -58.550 1.00 47.50  ? 553 THR I N     1 
ATOM   8424  C  CA    . THR I  1 310 ? -33.521 -0.738  -58.459 1.00 48.43  ? 553 THR I CA    1 
ATOM   8425  C  C     . THR I  1 310 ? -35.046 -0.523  -58.408 1.00 52.48  ? 553 THR I C     1 
ATOM   8426  O  O     . THR I  1 310 ? -35.676 -0.614  -57.334 1.00 46.52  ? 553 THR I O     1 
ATOM   8427  C  CB    . THR I  1 310 ? -33.056 -1.599  -57.233 1.00 46.79  ? 553 THR I CB    1 
ATOM   8428  O  OG1   . THR I  1 310 ? -32.986 -0.799  -56.062 1.00 38.94  ? 553 THR I OG1   1 
ATOM   8429  C  CG2   . THR I  1 310 ? -31.689 -2.215  -57.441 1.00 49.60  ? 553 THR I CG2   1 
ATOM   8430  N  N     . PRO I  1 311 ? -35.651 -0.256  -59.573 1.00 53.01  ? 554 PRO I N     1 
ATOM   8431  C  CA    . PRO I  1 311 ? -37.103 -0.114  -59.619 1.00 48.97  ? 554 PRO I CA    1 
ATOM   8432  C  C     . PRO I  1 311 ? -37.831 -1.235  -58.906 1.00 42.88  ? 554 PRO I C     1 
ATOM   8433  O  O     . PRO I  1 311 ? -38.851 -0.970  -58.307 1.00 41.56  ? 554 PRO I O     1 
ATOM   8434  C  CB    . PRO I  1 311 ? -37.417 -0.162  -61.127 1.00 51.91  ? 554 PRO I CB    1 
ATOM   8435  C  CG    . PRO I  1 311 ? -36.187 0.415   -61.753 1.00 54.34  ? 554 PRO I CG    1 
ATOM   8436  C  CD    . PRO I  1 311 ? -35.030 -0.059  -60.899 1.00 54.74  ? 554 PRO I CD    1 
ATOM   8437  N  N     . THR I  1 312 ? -37.356 -2.481  -58.991 1.00 41.14  ? 555 THR I N     1 
ATOM   8438  C  CA    . THR I  1 312 ? -38.038 -3.604  -58.303 1.00 40.58  ? 555 THR I CA    1 
ATOM   8439  C  C     . THR I  1 312 ? -37.120 -4.525  -57.493 1.00 39.14  ? 555 THR I C     1 
ATOM   8440  O  O     . THR I  1 312 ? -35.909 -4.593  -57.703 1.00 40.87  ? 555 THR I O     1 
ATOM   8441  C  CB    . THR I  1 312 ? -38.789 -4.549  -59.273 1.00 41.50  ? 555 THR I CB    1 
ATOM   8442  O  OG1   . THR I  1 312 ? -37.845 -5.171  -60.127 1.00 44.97  ? 555 THR I OG1   1 
ATOM   8443  C  CG2   . THR I  1 312 ? -39.841 -3.836  -60.122 1.00 43.03  ? 555 THR I CG2   1 
ATOM   8444  N  N     . GLU I  1 313 ? -37.750 -5.309  -56.628 1.00 37.17  ? 556 GLU I N     1 
ATOM   8445  C  CA    . GLU I  1 313 ? -37.068 -6.337  -55.881 1.00 35.36  ? 556 GLU I CA    1 
ATOM   8446  C  C     . GLU I  1 313 ? -36.262 -7.254  -56.813 1.00 39.83  ? 556 GLU I C     1 
ATOM   8447  O  O     . GLU I  1 313 ? -35.092 -7.560  -56.552 1.00 39.46  ? 556 GLU I O     1 
ATOM   8448  C  CB    . GLU I  1 313 ? -38.085 -7.127  -55.069 1.00 33.89  ? 556 GLU I CB    1 
ATOM   8449  C  CG    . GLU I  1 313 ? -38.576 -6.426  -53.781 1.00 34.55  ? 556 GLU I CG    1 
ATOM   8450  C  CD    . GLU I  1 313 ? -39.295 -7.387  -52.831 1.00 33.58  ? 556 GLU I CD    1 
ATOM   8451  O  OE1   . GLU I  1 313 ? -40.106 -8.267  -53.273 1.00 28.30  ? 556 GLU I OE1   1 
ATOM   8452  O  OE2   . GLU I  1 313 ? -39.021 -7.299  -51.617 1.00 30.78  ? 556 GLU I OE2   1 
ATOM   8453  N  N     . LYS I  1 314 ? -36.886 -7.706  -57.900 1.00 44.37  ? 557 LYS I N     1 
ATOM   8454  C  CA    . LYS I  1 314 ? -36.223 -8.601  -58.888 1.00 41.57  ? 557 LYS I CA    1 
ATOM   8455  C  C     . LYS I  1 314 ? -34.865 -8.105  -59.330 1.00 39.30  ? 557 LYS I C     1 
ATOM   8456  O  O     . LYS I  1 314 ? -33.927 -8.870  -59.419 1.00 38.51  ? 557 LYS I O     1 
ATOM   8457  C  CB    . LYS I  1 314 ? -37.093 -8.760  -60.121 1.00 46.88  ? 557 LYS I CB    1 
ATOM   8458  C  CG    . LYS I  1 314 ? -38.104 -9.879  -59.971 1.00 49.92  ? 557 LYS I CG    1 
ATOM   8459  C  CD    . LYS I  1 314 ? -39.346 -9.674  -60.814 1.00 53.20  ? 557 LYS I CD    1 
ATOM   8460  C  CE    . LYS I  1 314 ? -40.553 -10.242 -60.083 1.00 56.63  ? 557 LYS I CE    1 
ATOM   8461  N  NZ    . LYS I  1 314 ? -41.749 -10.310 -60.961 1.00 57.28  ? 557 LYS I NZ    1 
ATOM   8462  N  N     . ASP I  1 315 ? -34.775 -6.810  -59.582 1.00 36.00  ? 558 ASP I N     1 
ATOM   8463  C  CA    . ASP I  1 315 ? -33.523 -6.176  -59.932 1.00 36.10  ? 558 ASP I CA    1 
ATOM   8464  C  C     . ASP I  1 315 ? -32.464 -6.325  -58.879 1.00 38.82  ? 558 ASP I C     1 
ATOM   8465  O  O     . ASP I  1 315 ? -31.286 -6.465  -59.213 1.00 37.16  ? 558 ASP I O     1 
ATOM   8466  C  CB    . ASP I  1 315 ? -33.758 -4.694  -60.189 1.00 37.59  ? 558 ASP I CB    1 
ATOM   8467  C  CG    . ASP I  1 315 ? -34.801 -4.469  -61.283 1.00 40.72  ? 558 ASP I CG    1 
ATOM   8468  O  OD1   . ASP I  1 315 ? -34.524 -4.805  -62.463 1.00 42.79  ? 558 ASP I OD1   1 
ATOM   8469  O  OD2   . ASP I  1 315 ? -35.904 -4.012  -60.959 1.00 43.18  ? 558 ASP I OD2   1 
ATOM   8470  N  N     . VAL I  1 316 ? -32.861 -6.261  -57.602 1.00 40.10  ? 559 VAL I N     1 
ATOM   8471  C  CA    . VAL I  1 316 ? -31.877 -6.390  -56.531 1.00 38.67  ? 559 VAL I CA    1 
ATOM   8472  C  C     . VAL I  1 316 ? -31.276 -7.785  -56.623 1.00 37.37  ? 559 VAL I C     1 
ATOM   8473  O  O     . VAL I  1 316 ? -30.073 -7.922  -56.595 1.00 36.27  ? 559 VAL I O     1 
ATOM   8474  C  CB    . VAL I  1 316 ? -32.438 -6.128  -55.105 1.00 34.65  ? 559 VAL I CB    1 
ATOM   8475  C  CG1   . VAL I  1 316 ? -31.366 -6.383  -54.062 1.00 35.68  ? 559 VAL I CG1   1 
ATOM   8476  C  CG2   . VAL I  1 316 ? -32.900 -4.687  -54.973 1.00 37.55  ? 559 VAL I CG2   1 
ATOM   8477  N  N     . PHE I  1 317 ? -32.141 -8.792  -56.762 1.00 39.32  ? 560 PHE I N     1 
ATOM   8478  C  CA    . PHE I  1 317 ? -31.730 -10.196 -56.837 1.00 40.96  ? 560 PHE I CA    1 
ATOM   8479  C  C     . PHE I  1 317 ? -30.840 -10.455 -58.039 1.00 48.00  ? 560 PHE I C     1 
ATOM   8480  O  O     . PHE I  1 317 ? -29.868 -11.221 -57.958 1.00 44.18  ? 560 PHE I O     1 
ATOM   8481  C  CB    . PHE I  1 317 ? -32.949 -11.097 -56.928 1.00 40.16  ? 560 PHE I CB    1 
ATOM   8482  C  CG    . PHE I  1 317 ? -33.620 -11.355 -55.604 1.00 40.72  ? 560 PHE I CG    1 
ATOM   8483  C  CD1   . PHE I  1 317 ? -33.108 -12.293 -54.739 1.00 43.29  ? 560 PHE I CD1   1 
ATOM   8484  C  CD2   . PHE I  1 317 ? -34.779 -10.693 -55.251 1.00 39.03  ? 560 PHE I CD2   1 
ATOM   8485  C  CE1   . PHE I  1 317 ? -33.722 -12.561 -53.533 1.00 46.03  ? 560 PHE I CE1   1 
ATOM   8486  C  CE2   . PHE I  1 317 ? -35.380 -10.947 -54.057 1.00 36.43  ? 560 PHE I CE2   1 
ATOM   8487  C  CZ    . PHE I  1 317 ? -34.863 -11.871 -53.194 1.00 42.41  ? 560 PHE I CZ    1 
ATOM   8488  N  N     . ARG I  1 318 ? -31.208 -9.794  -59.140 1.00 53.67  ? 561 ARG I N     1 
ATOM   8489  C  CA    . ARG I  1 318 ? -30.494 -9.868  -60.397 1.00 52.96  ? 561 ARG I CA    1 
ATOM   8490  C  C     . ARG I  1 318 ? -29.091 -9.351  -60.206 1.00 49.75  ? 561 ARG I C     1 
ATOM   8491  O  O     . ARG I  1 318 ? -28.155 -10.065 -60.494 1.00 47.47  ? 561 ARG I O     1 
ATOM   8492  C  CB    . ARG I  1 318 ? -31.213 -9.069  -61.511 1.00 54.68  ? 561 ARG I CB    1 
ATOM   8493  C  CG    . ARG I  1 318 ? -30.634 -9.316  -62.921 1.00 58.76  ? 561 ARG I CG    1 
ATOM   8494  C  CD    . ARG I  1 318 ? -31.387 -8.653  -64.087 1.00 54.50  ? 561 ARG I CD    1 
ATOM   8495  N  NE    . ARG I  1 318 ? -31.974 -7.352  -63.756 1.00 55.09  ? 561 ARG I NE    1 
ATOM   8496  C  CZ    . ARG I  1 318 ? -31.300 -6.224  -63.540 1.00 53.89  ? 561 ARG I CZ    1 
ATOM   8497  N  NH1   . ARG I  1 318 ? -29.985 -6.188  -63.597 1.00 51.19  ? 561 ARG I NH1   1 
ATOM   8498  N  NH2   . ARG I  1 318 ? -31.963 -5.116  -63.249 1.00 56.62  ? 561 ARG I NH2   1 
ATOM   8499  N  N     . LEU I  1 319 ? -28.937 -8.135  -59.691 1.00 48.18  ? 562 LEU I N     1 
ATOM   8500  C  CA    . LEU I  1 319 ? -27.600 -7.553  -59.555 1.00 48.17  ? 562 LEU I CA    1 
ATOM   8501  C  C     . LEU I  1 319 ? -26.684 -8.319  -58.593 1.00 50.52  ? 562 LEU I C     1 
ATOM   8502  O  O     . LEU I  1 319 ? -25.498 -8.005  -58.487 1.00 53.70  ? 562 LEU I O     1 
ATOM   8503  C  CB    . LEU I  1 319 ? -27.667 -6.107  -59.105 1.00 45.53  ? 562 LEU I CB    1 
ATOM   8504  C  CG    . LEU I  1 319 ? -28.316 -5.118  -60.048 1.00 48.01  ? 562 LEU I CG    1 
ATOM   8505  C  CD1   . LEU I  1 319 ? -28.670 -3.837  -59.302 1.00 46.81  ? 562 LEU I CD1   1 
ATOM   8506  C  CD2   . LEU I  1 319 ? -27.419 -4.837  -61.240 1.00 45.78  ? 562 LEU I CD2   1 
ATOM   8507  N  N     . LEU I  1 320 ? -27.228 -9.298  -57.882 1.00 51.09  ? 563 LEU I N     1 
ATOM   8508  C  CA    . LEU I  1 320 ? -26.438 -10.101 -56.970 1.00 52.41  ? 563 LEU I CA    1 
ATOM   8509  C  C     . LEU I  1 320 ? -26.245 -11.488 -57.510 1.00 49.91  ? 563 LEU I C     1 
ATOM   8510  O  O     . LEU I  1 320 ? -25.688 -12.353 -56.839 1.00 54.16  ? 563 LEU I O     1 
ATOM   8511  C  CB    . LEU I  1 320 ? -27.143 -10.183 -55.614 1.00 56.74  ? 563 LEU I CB    1 
ATOM   8512  C  CG    . LEU I  1 320 ? -27.301 -8.844  -54.875 1.00 58.95  ? 563 LEU I CG    1 
ATOM   8513  C  CD1   . LEU I  1 320 ? -28.211 -9.012  -53.670 1.00 58.39  ? 563 LEU I CD1   1 
ATOM   8514  C  CD2   . LEU I  1 320 ? -25.948 -8.287  -54.446 1.00 59.84  ? 563 LEU I CD2   1 
ATOM   8515  N  N     . GLY I  1 321 ? -26.727 -11.731 -58.712 1.00 43.63  ? 564 GLY I N     1 
ATOM   8516  C  CA    . GLY I  1 321 ? -26.519 -13.021 -59.308 1.00 41.96  ? 564 GLY I CA    1 
ATOM   8517  C  C     . GLY I  1 321 ? -27.413 -14.082 -58.726 1.00 45.88  ? 564 GLY I C     1 
ATOM   8518  O  O     . GLY I  1 321 ? -27.089 -15.254 -58.777 1.00 47.75  ? 564 GLY I O     1 
ATOM   8519  N  N     . LEU I  1 322 ? -28.579 -13.703 -58.224 1.00 45.58  ? 565 LEU I N     1 
ATOM   8520  C  CA    . LEU I  1 322 ? -29.478 -14.681 -57.653 1.00 43.35  ? 565 LEU I CA    1 
ATOM   8521  C  C     . LEU I  1 322 ? -30.745 -14.703 -58.465 1.00 40.08  ? 565 LEU I C     1 
ATOM   8522  O  O     . LEU I  1 322 ? -31.140 -13.673 -58.982 1.00 44.60  ? 565 LEU I O     1 
ATOM   8523  C  CB    . LEU I  1 322 ? -29.853 -14.239 -56.238 1.00 48.10  ? 565 LEU I CB    1 
ATOM   8524  C  CG    . LEU I  1 322 ? -28.957 -14.652 -55.098 1.00 53.36  ? 565 LEU I CG    1 
ATOM   8525  C  CD1   . LEU I  1 322 ? -29.217 -13.723 -53.918 1.00 54.71  ? 565 LEU I CD1   1 
ATOM   8526  C  CD2   . LEU I  1 322 ? -29.198 -16.129 -54.745 1.00 55.83  ? 565 LEU I CD2   1 
ATOM   8527  N  N     . PRO I  1 323 ? -31.404 -15.857 -58.547 1.00 36.97  ? 566 PRO I N     1 
ATOM   8528  C  CA    . PRO I  1 323 ? -32.802 -15.837 -58.947 1.00 37.64  ? 566 PRO I CA    1 
ATOM   8529  C  C     . PRO I  1 323 ? -33.711 -15.096 -57.911 1.00 39.30  ? 566 PRO I C     1 
ATOM   8530  O  O     . PRO I  1 323 ? -33.487 -15.205 -56.708 1.00 39.54  ? 566 PRO I O     1 
ATOM   8531  C  CB    . PRO I  1 323 ? -33.182 -17.339 -59.010 1.00 34.01  ? 566 PRO I CB    1 
ATOM   8532  C  CG    . PRO I  1 323 ? -32.255 -18.013 -58.072 1.00 36.82  ? 566 PRO I CG    1 
ATOM   8533  C  CD    . PRO I  1 323 ? -30.968 -17.205 -58.124 1.00 38.77  ? 566 PRO I CD    1 
ATOM   8534  N  N     . TYR I  1 324 ? -34.726 -14.378 -58.382 1.00 34.56  ? 567 TYR I N     1 
ATOM   8535  C  CA    . TYR I  1 324 ? -35.735 -13.803 -57.504 1.00 40.03  ? 567 TYR I CA    1 
ATOM   8536  C  C     . TYR I  1 324 ? -36.286 -14.850 -56.544 1.00 42.08  ? 567 TYR I C     1 
ATOM   8537  O  O     . TYR I  1 324 ? -36.576 -15.973 -56.973 1.00 40.46  ? 567 TYR I O     1 
ATOM   8538  C  CB    . TYR I  1 324 ? -36.896 -13.266 -58.342 1.00 36.97  ? 567 TYR I CB    1 
ATOM   8539  C  CG    . TYR I  1 324 ? -38.032 -12.674 -57.548 1.00 39.00  ? 567 TYR I CG    1 
ATOM   8540  C  CD1   . TYR I  1 324 ? -37.928 -11.425 -56.965 1.00 39.06  ? 567 TYR I CD1   1 
ATOM   8541  C  CD2   . TYR I  1 324 ? -39.232 -13.359 -57.394 1.00 42.91  ? 567 TYR I CD2   1 
ATOM   8542  C  CE1   . TYR I  1 324 ? -38.989 -10.877 -56.248 1.00 39.06  ? 567 TYR I CE1   1 
ATOM   8543  C  CE2   . TYR I  1 324 ? -40.305 -12.808 -56.691 1.00 41.18  ? 567 TYR I CE2   1 
ATOM   8544  C  CZ    . TYR I  1 324 ? -40.164 -11.572 -56.120 1.00 39.77  ? 567 TYR I CZ    1 
ATOM   8545  O  OH    . TYR I  1 324 ? -41.210 -11.047 -55.434 1.00 46.37  ? 567 TYR I OH    1 
ATOM   8546  N  N     . ARG I  1 325 ? -36.447 -14.487 -55.271 1.00 43.93  ? 568 ARG I N     1 
ATOM   8547  C  CA    . ARG I  1 325 ? -37.149 -15.356 -54.309 1.00 49.72  ? 568 ARG I CA    1 
ATOM   8548  C  C     . ARG I  1 325 ? -38.452 -14.683 -53.979 1.00 45.42  ? 568 ARG I C     1 
ATOM   8549  O  O     . ARG I  1 325 ? -38.500 -13.488 -53.701 1.00 40.53  ? 568 ARG I O     1 
ATOM   8550  C  CB    . ARG I  1 325 ? -36.382 -15.579 -52.995 1.00 52.51  ? 568 ARG I CB    1 
ATOM   8551  C  CG    . ARG I  1 325 ? -35.020 -16.242 -53.121 1.00 63.33  ? 568 ARG I CG    1 
ATOM   8552  C  CD    . ARG I  1 325 ? -35.100 -17.767 -53.081 1.00 69.48  ? 568 ARG I CD    1 
ATOM   8553  N  NE    . ARG I  1 325 ? -35.465 -18.303 -51.759 1.00 76.69  ? 568 ARG I NE    1 
ATOM   8554  C  CZ    . ARG I  1 325 ? -34.675 -19.028 -50.957 1.00 74.66  ? 568 ARG I CZ    1 
ATOM   8555  N  NH1   . ARG I  1 325 ? -33.426 -19.333 -51.295 1.00 76.46  ? 568 ARG I NH1   1 
ATOM   8556  N  NH2   . ARG I  1 325 ? -35.146 -19.473 -49.799 1.00 72.55  ? 568 ARG I NH2   1 
ATOM   8557  N  N     . GLU I  1 326 ? -39.491 -15.485 -54.021 1.00 45.38  ? 569 GLU I N     1 
ATOM   8558  C  CA    . GLU I  1 326 ? -40.833 -15.087 -53.665 1.00 47.56  ? 569 GLU I CA    1 
ATOM   8559  C  C     . GLU I  1 326 ? -40.846 -14.877 -52.170 1.00 40.52  ? 569 GLU I C     1 
ATOM   8560  O  O     . GLU I  1 326 ? -40.291 -15.714 -51.441 1.00 35.05  ? 569 GLU I O     1 
ATOM   8561  C  CB    . GLU I  1 326 ? -41.816 -16.240 -53.986 1.00 53.88  ? 569 GLU I CB    1 
ATOM   8562  C  CG    . GLU I  1 326 ? -43.220 -15.800 -54.342 1.00 64.46  ? 569 GLU I CG    1 
ATOM   8563  C  CD    . GLU I  1 326 ? -43.215 -14.918 -55.576 1.00 67.92  ? 569 GLU I CD    1 
ATOM   8564  O  OE1   . GLU I  1 326 ? -42.845 -15.439 -56.655 1.00 65.81  ? 569 GLU I OE1   1 
ATOM   8565  O  OE2   . GLU I  1 326 ? -43.529 -13.707 -55.454 1.00 73.58  ? 569 GLU I OE2   1 
ATOM   8566  N  N     . PRO I  1 327 ? -41.534 -13.822 -51.691 1.00 34.00  ? 570 PRO I N     1 
ATOM   8567  C  CA    . PRO I  1 327 ? -41.534 -13.526 -50.260 1.00 30.84  ? 570 PRO I CA    1 
ATOM   8568  C  C     . PRO I  1 327 ? -41.716 -14.730 -49.378 1.00 31.41  ? 570 PRO I C     1 
ATOM   8569  O  O     . PRO I  1 327 ? -40.986 -14.905 -48.349 1.00 29.28  ? 570 PRO I O     1 
ATOM   8570  C  CB    . PRO I  1 327 ? -42.704 -12.566 -50.128 1.00 33.57  ? 570 PRO I CB    1 
ATOM   8571  C  CG    . PRO I  1 327 ? -42.652 -11.784 -51.404 1.00 32.91  ? 570 PRO I CG    1 
ATOM   8572  C  CD    . PRO I  1 327 ? -42.277 -12.802 -52.454 1.00 35.12  ? 570 PRO I CD    1 
ATOM   8573  N  N     . ALA I  1 328 ? -42.621 -15.606 -49.808 1.00 31.86  ? 571 ALA I N     1 
ATOM   8574  C  CA    . ALA I  1 328 ? -42.928 -16.828 -49.070 1.00 34.80  ? 571 ALA I CA    1 
ATOM   8575  C  C     . ALA I  1 328 ? -41.722 -17.757 -48.863 1.00 35.86  ? 571 ALA I C     1 
ATOM   8576  O  O     . ALA I  1 328 ? -41.749 -18.668 -48.017 1.00 39.10  ? 571 ALA I O     1 
ATOM   8577  C  CB    . ALA I  1 328 ? -44.089 -17.568 -49.734 1.00 33.78  ? 571 ALA I CB    1 
ATOM   8578  N  N     . GLU I  1 329 ? -40.652 -17.494 -49.581 1.00 37.48  ? 572 GLU I N     1 
ATOM   8579  C  CA    . GLU I  1 329 ? -39.487 -18.346 -49.538 1.00 44.11  ? 572 GLU I CA    1 
ATOM   8580  C  C     . GLU I  1 329 ? -38.284 -17.686 -48.908 1.00 41.71  ? 572 GLU I C     1 
ATOM   8581  O  O     . GLU I  1 329 ? -37.234 -18.303 -48.846 1.00 42.30  ? 572 GLU I O     1 
ATOM   8582  C  CB    . GLU I  1 329 ? -39.137 -18.775 -50.962 1.00 50.69  ? 572 GLU I CB    1 
ATOM   8583  C  CG    . GLU I  1 329 ? -40.216 -19.631 -51.623 1.00 56.37  ? 572 GLU I CG    1 
ATOM   8584  C  CD    . GLU I  1 329 ? -39.815 -20.061 -53.028 1.00 66.88  ? 572 GLU I CD    1 
ATOM   8585  O  OE1   . GLU I  1 329 ? -39.833 -19.213 -53.965 1.00 73.06  ? 572 GLU I OE1   1 
ATOM   8586  O  OE2   . GLU I  1 329 ? -39.455 -21.246 -53.183 1.00 68.16  ? 572 GLU I OE2   1 
ATOM   8587  N  N     . ARG I  1 330 ? -38.429 -16.458 -48.409 1.00 40.18  ? 573 ARG I N     1 
ATOM   8588  C  CA    . ARG I  1 330 ? -37.278 -15.731 -47.838 1.00 34.91  ? 573 ARG I CA    1 
ATOM   8589  C  C     . ARG I  1 330 ? -37.055 -15.954 -46.353 1.00 34.12  ? 573 ARG I C     1 
ATOM   8590  O  O     . ARG I  1 330 ? -36.615 -15.054 -45.627 1.00 33.26  ? 573 ARG I O     1 
ATOM   8591  C  CB    . ARG I  1 330 ? -37.382 -14.235 -48.111 1.00 33.74  ? 573 ARG I CB    1 
ATOM   8592  C  CG    . ARG I  1 330 ? -37.685 -13.902 -49.559 1.00 33.83  ? 573 ARG I CG    1 
ATOM   8593  C  CD    . ARG I  1 330 ? -37.651 -12.403 -49.818 1.00 34.37  ? 573 ARG I CD    1 
ATOM   8594  N  NE    . ARG I  1 330 ? -38.161 -12.136 -51.151 1.00 36.58  ? 573 ARG I NE    1 
ATOM   8595  C  CZ    . ARG I  1 330 ? -38.602 -10.960 -51.587 1.00 34.04  ? 573 ARG I CZ    1 
ATOM   8596  N  NH1   . ARG I  1 330 ? -38.599 -9.922  -50.784 1.00 34.22  ? 573 ARG I NH1   1 
ATOM   8597  N  NH2   . ARG I  1 330 ? -39.071 -10.838 -52.821 1.00 31.11  ? 573 ARG I NH2   1 
ATOM   8598  N  N     . ASP I  1 331 ? -37.312 -17.155 -45.880 1.00 37.69  ? 574 ASP I N     1 
ATOM   8599  C  CA    . ASP I  1 331 ? -37.045 -17.433 -44.483 1.00 39.56  ? 574 ASP I CA    1 
ATOM   8600  C  C     . ASP I  1 331 ? -35.578 -17.650 -44.265 1.00 40.17  ? 574 ASP I C     1 
ATOM   8601  O  O     . ASP I  1 331 ? -35.012 -17.114 -43.319 1.00 35.84  ? 574 ASP I O     1 
ATOM   8602  C  CB    . ASP I  1 331 ? -37.952 -18.541 -43.967 1.00 41.09  ? 574 ASP I CB    1 
ATOM   8603  C  CG    . ASP I  1 331 ? -39.410 -18.052 -43.851 1.00 45.43  ? 574 ASP I CG    1 
ATOM   8604  O  OD1   . ASP I  1 331 ? -39.734 -16.988 -44.435 1.00 50.81  ? 574 ASP I OD1   1 
ATOM   8605  O  OD2   . ASP I  1 331 ? -40.233 -18.696 -43.191 1.00 43.00  ? 574 ASP I OD2   1 
ATOM   8606  N  N     . TRP I  1 332 ? -34.947 -18.371 -45.184 1.00 48.60  ? 575 TRP I N     1 
ATOM   8607  C  CA    . TRP I  1 332 ? -33.490 -18.534 -45.171 1.00 49.05  ? 575 TRP I CA    1 
ATOM   8608  C  C     . TRP I  1 332 ? -32.958 -18.503 -46.607 1.00 46.00  ? 575 TRP I C     1 
ATOM   8609  O  O     . TRP I  1 332 ? -33.542 -19.134 -47.463 1.00 44.54  ? 575 TRP I O     1 
ATOM   8610  C  CB    . TRP I  1 332 ? -33.168 -19.868 -44.517 1.00 52.98  ? 575 TRP I CB    1 
ATOM   8611  C  CG    . TRP I  1 332 ? -33.469 -19.918 -43.028 1.00 54.73  ? 575 TRP I CG    1 
ATOM   8612  C  CD1   . TRP I  1 332 ? -34.677 -20.240 -42.426 1.00 50.98  ? 575 TRP I CD1   1 
ATOM   8613  C  CD2   . TRP I  1 332 ? -32.532 -19.672 -41.948 1.00 52.16  ? 575 TRP I CD2   1 
ATOM   8614  N  NE1   . TRP I  1 332 ? -34.535 -20.196 -41.046 1.00 52.81  ? 575 TRP I NE1   1 
ATOM   8615  C  CE2   . TRP I  1 332 ? -33.238 -19.849 -40.732 1.00 50.97  ? 575 TRP I CE2   1 
ATOM   8616  C  CE3   . TRP I  1 332 ? -31.161 -19.329 -41.898 1.00 52.77  ? 575 TRP I CE3   1 
ATOM   8617  C  CZ2   . TRP I  1 332 ? -32.630 -19.698 -39.500 1.00 47.03  ? 575 TRP I CZ2   1 
ATOM   8618  C  CZ3   . TRP I  1 332 ? -30.573 -19.153 -40.680 1.00 50.39  ? 575 TRP I CZ3   1 
ATOM   8619  C  CH2   . TRP I  1 332 ? -31.305 -19.343 -39.491 1.00 50.23  ? 575 TRP I CH2   1 
ATOM   8620  N  N     . LEU I  1 333 ? -31.884 -17.766 -46.886 1.00 49.94  ? 576 LEU I N     1 
ATOM   8621  C  CA    . LEU I  1 333 ? -31.374 -17.694 -48.267 1.00 54.36  ? 576 LEU I CA    1 
ATOM   8622  C  C     . LEU I  1 333 ? -30.747 -19.001 -48.707 1.00 59.58  ? 576 LEU I C     1 
ATOM   8623  O  O     . LEU I  1 333 ? -30.961 -19.438 -49.829 1.00 53.62  ? 576 LEU I O     1 
ATOM   8624  C  CB    . LEU I  1 333 ? -30.320 -16.602 -48.440 1.00 57.87  ? 576 LEU I CB    1 
ATOM   8625  C  CG    . LEU I  1 333 ? -29.679 -16.478 -49.848 1.00 58.99  ? 576 LEU I CG    1 
ATOM   8626  C  CD1   . LEU I  1 333 ? -30.709 -15.987 -50.849 1.00 63.14  ? 576 LEU I CD1   1 
ATOM   8627  C  CD2   . LEU I  1 333 ? -28.472 -15.550 -49.895 1.00 55.79  ? 576 LEU I CD2   1 
ATOM   8628  N  N     . GLU I  1 334 ? -29.948 -19.593 -47.818 1.00 68.26  ? 577 GLU I N     1 
ATOM   8629  C  CA    . GLU I  1 334 ? -29.124 -20.763 -48.136 1.00 66.24  ? 577 GLU I CA    1 
ATOM   8630  C  C     . GLU I  1 334 ? -30.026 -21.984 -48.258 1.00 67.61  ? 577 GLU I C     1 
ATOM   8631  O  O     . GLU I  1 334 ? -29.690 -22.925 -48.959 1.00 68.27  ? 577 GLU I O     1 
ATOM   8632  C  CB    . GLU I  1 334 ? -28.011 -20.973 -47.079 1.00 70.29  ? 577 GLU I CB    1 
ATOM   8633  C  CG    . GLU I  1 334 ? -26.980 -19.822 -46.927 1.00 69.64  ? 577 GLU I CG    1 
ATOM   8634  C  CD    . GLU I  1 334 ? -27.351 -18.731 -45.891 1.00 64.91  ? 577 GLU I CD    1 
ATOM   8635  O  OE1   . GLU I  1 334 ? -28.418 -18.824 -45.239 1.00 63.98  ? 577 GLU I OE1   1 
ATOM   8636  O  OE2   . GLU I  1 334 ? -26.579 -17.756 -45.731 1.00 50.77  ? 577 GLU I OE2   1 
ATOM   8637  N  N     . HIS I  1 335 ? -31.180 -21.946 -47.595 1.00 71.69  ? 578 HIS I N     1 
ATOM   8638  C  CA    . HIS I  1 335 ? -32.204 -22.987 -47.721 1.00 84.84  ? 578 HIS I CA    1 
ATOM   8639  C  C     . HIS I  1 335 ? -32.821 -22.968 -49.132 1.00 91.21  ? 578 HIS I C     1 
ATOM   8640  O  O     . HIS I  1 335 ? -33.163 -21.896 -49.652 1.00 95.06  ? 578 HIS I O     1 
ATOM   8641  C  CB    . HIS I  1 335 ? -33.288 -22.806 -46.630 1.00 95.11  ? 578 HIS I CB    1 
ATOM   8642  C  CG    . HIS I  1 335 ? -34.519 -23.648 -46.825 1.00 102.26 ? 578 HIS I CG    1 
ATOM   8643  N  ND1   . HIS I  1 335 ? -34.472 -24.974 -47.207 1.00 105.07 ? 578 HIS I ND1   1 
ATOM   8644  C  CD2   . HIS I  1 335 ? -35.831 -23.353 -46.670 1.00 103.51 ? 578 HIS I CD2   1 
ATOM   8645  C  CE1   . HIS I  1 335 ? -35.700 -25.454 -47.292 1.00 98.36  ? 578 HIS I CE1   1 
ATOM   8646  N  NE2   . HIS I  1 335 ? -36.543 -24.490 -46.972 1.00 102.70 ? 578 HIS I NE2   1 
ATOM   8647  N  N     . HIS I  1 336 ? -32.956 -24.158 -49.734 1.00 93.13  ? 579 HIS I N     1 
ATOM   8648  C  CA    . HIS I  1 336 ? -33.368 -24.339 -51.144 1.00 94.18  ? 579 HIS I CA    1 
ATOM   8649  C  C     . HIS I  1 336 ? -32.191 -24.041 -52.103 1.00 91.85  ? 579 HIS I C     1 
ATOM   8650  O  O     . HIS I  1 336 ? -31.858 -24.859 -52.972 1.00 77.21  ? 579 HIS I O     1 
ATOM   8651  C  CB    . HIS I  1 336 ? -34.612 -23.505 -51.488 1.00 91.84  ? 579 HIS I CB    1 
ATOM   8652  C  CG    . HIS I  1 336 ? -35.684 -24.294 -52.160 1.00 87.66  ? 579 HIS I CG    1 
ATOM   8653  N  ND1   . HIS I  1 336 ? -36.513 -25.152 -51.469 1.00 86.47  ? 579 HIS I ND1   1 
ATOM   8654  C  CD2   . HIS I  1 336 ? -36.057 -24.369 -53.458 1.00 87.58  ? 579 HIS I CD2   1 
ATOM   8655  C  CE1   . HIS I  1 336 ? -37.354 -25.722 -52.313 1.00 85.85  ? 579 HIS I CE1   1 
ATOM   8656  N  NE2   . HIS I  1 336 ? -37.101 -25.262 -53.525 1.00 89.75  ? 579 HIS I NE2   1 
ATOM   8657  N  N     . HIS I  1 337 ? -31.591 -22.859 -51.921 1.00 92.43  ? 580 HIS I N     1 
ATOM   8658  C  CA    . HIS I  1 337 ? -30.277 -22.471 -52.471 1.00 88.17  ? 580 HIS I CA    1 
ATOM   8659  C  C     . HIS I  1 337 ? -29.296 -23.637 -52.321 1.00 79.25  ? 580 HIS I C     1 
ATOM   8660  O  O     . HIS I  1 337 ? -28.399 -23.614 -51.481 1.00 77.52  ? 580 HIS I O     1 
ATOM   8661  C  CB    . HIS I  1 337 ? -29.787 -21.196 -51.724 1.00 90.95  ? 580 HIS I CB    1 
ATOM   8662  C  CG    . HIS I  1 337 ? -28.697 -20.402 -52.403 1.00 94.26  ? 580 HIS I CG    1 
ATOM   8663  N  ND1   . HIS I  1 337 ? -28.727 -20.054 -53.740 1.00 93.99  ? 580 HIS I ND1   1 
ATOM   8664  C  CD2   . HIS I  1 337 ? -27.591 -19.804 -51.891 1.00 94.62  ? 580 HIS I CD2   1 
ATOM   8665  C  CE1   . HIS I  1 337 ? -27.661 -19.328 -54.033 1.00 88.97  ? 580 HIS I CE1   1 
ATOM   8666  N  NE2   . HIS I  1 337 ? -26.958 -19.159 -52.928 1.00 93.00  ? 580 HIS I NE2   1 
ATOM   8667  O  "O5'" . DC  J  2 1   ? -6.712  -15.094 -33.967 1.00 47.18  ? 1   DC  J "O5'" 1 
ATOM   8668  C  "C5'" . DC  J  2 1   ? -5.812  -14.591 -34.955 1.00 48.68  ? 1   DC  J "C5'" 1 
ATOM   8669  C  "C4'" . DC  J  2 1   ? -6.530  -13.580 -35.815 1.00 49.23  ? 1   DC  J "C4'" 1 
ATOM   8670  O  "O4'" . DC  J  2 1   ? -7.251  -14.247 -36.878 1.00 47.53  ? 1   DC  J "O4'" 1 
ATOM   8671  C  "C3'" . DC  J  2 1   ? -7.562  -12.741 -35.068 1.00 49.33  ? 1   DC  J "C3'" 1 
ATOM   8672  O  "O3'" . DC  J  2 1   ? -7.435  -11.397 -35.530 1.00 47.77  ? 1   DC  J "O3'" 1 
ATOM   8673  C  "C2'" . DC  J  2 1   ? -8.880  -13.407 -35.421 1.00 45.30  ? 1   DC  J "C2'" 1 
ATOM   8674  C  "C1'" . DC  J  2 1   ? -8.625  -13.925 -36.827 1.00 42.33  ? 1   DC  J "C1'" 1 
ATOM   8675  N  N1    . DC  J  2 1   ? -9.354  -15.141 -37.173 1.00 38.27  ? 1   DC  J N1    1 
ATOM   8676  C  C2    . DC  J  2 1   ? -9.980  -15.225 -38.417 1.00 36.45  ? 1   DC  J C2    1 
ATOM   8677  O  O2    . DC  J  2 1   ? -9.958  -14.240 -39.167 1.00 40.12  ? 1   DC  J O2    1 
ATOM   8678  N  N3    . DC  J  2 1   ? -10.618 -16.366 -38.759 1.00 32.83  ? 1   DC  J N3    1 
ATOM   8679  C  C4    . DC  J  2 1   ? -10.635 -17.400 -37.917 1.00 32.25  ? 1   DC  J C4    1 
ATOM   8680  N  N4    . DC  J  2 1   ? -11.292 -18.494 -38.291 1.00 37.04  ? 1   DC  J N4    1 
ATOM   8681  C  C5    . DC  J  2 1   ? -10.013 -17.340 -36.638 1.00 35.35  ? 1   DC  J C5    1 
ATOM   8682  C  C6    . DC  J  2 1   ? -9.377  -16.207 -36.314 1.00 39.05  ? 1   DC  J C6    1 
ATOM   8683  P  P     . DG  J  2 2   ? -8.190  -10.204 -34.766 1.00 55.60  ? 2   DG  J P     1 
ATOM   8684  O  OP1   . DG  J  2 2   ? -7.434  -8.940  -35.009 1.00 54.50  ? 2   DG  J OP1   1 
ATOM   8685  O  OP2   . DG  J  2 2   ? -8.536  -10.640 -33.397 1.00 52.41  ? 2   DG  J OP2   1 
ATOM   8686  O  "O5'" . DG  J  2 2   ? -9.498  -10.045 -35.632 1.00 43.44  ? 2   DG  J "O5'" 1 
ATOM   8687  C  "C5'" . DG  J  2 2   ? -9.366  -9.661  -37.004 1.00 38.60  ? 2   DG  J "C5'" 1 
ATOM   8688  C  "C4'" . DG  J  2 2   ? -10.750 -9.609  -37.591 1.00 39.03  ? 2   DG  J "C4'" 1 
ATOM   8689  O  "O4'" . DG  J  2 2   ? -11.244 -10.958 -37.749 1.00 36.01  ? 2   DG  J "O4'" 1 
ATOM   8690  C  "C3'" . DG  J  2 2   ? -11.758 -8.925  -36.676 1.00 37.68  ? 2   DG  J "C3'" 1 
ATOM   8691  O  "O3'" . DG  J  2 2   ? -12.722 -8.453  -37.590 1.00 45.60  ? 2   DG  J "O3'" 1 
ATOM   8692  C  "C2'" . DG  J  2 2   ? -12.326 -10.083 -35.882 1.00 35.47  ? 2   DG  J "C2'" 1 
ATOM   8693  C  "C1'" . DG  J  2 2   ? -12.438 -11.094 -37.005 1.00 35.77  ? 2   DG  J "C1'" 1 
ATOM   8694  N  N9    . DG  J  2 2   ? -12.599 -12.501 -36.655 1.00 31.30  ? 2   DG  J N9    1 
ATOM   8695  C  C8    . DG  J  2 2   ? -12.330 -13.115 -35.457 1.00 27.87  ? 2   DG  J C8    1 
ATOM   8696  N  N7    . DG  J  2 2   ? -12.611 -14.391 -35.462 1.00 30.33  ? 2   DG  J N7    1 
ATOM   8697  C  C5    . DG  J  2 2   ? -13.127 -14.623 -36.729 1.00 27.43  ? 2   DG  J C5    1 
ATOM   8698  C  C6    . DG  J  2 2   ? -13.592 -15.819 -37.326 1.00 27.23  ? 2   DG  J C6    1 
ATOM   8699  O  O6    . DG  J  2 2   ? -13.658 -16.949 -36.838 1.00 29.54  ? 2   DG  J O6    1 
ATOM   8700  N  N1    . DG  J  2 2   ? -14.002 -15.611 -38.636 1.00 28.48  ? 2   DG  J N1    1 
ATOM   8701  C  C2    . DG  J  2 2   ? -14.005 -14.401 -39.280 1.00 29.07  ? 2   DG  J C2    1 
ATOM   8702  N  N2    . DG  J  2 2   ? -14.486 -14.400 -40.534 1.00 29.05  ? 2   DG  J N2    1 
ATOM   8703  N  N3    . DG  J  2 2   ? -13.542 -13.283 -38.748 1.00 27.83  ? 2   DG  J N3    1 
ATOM   8704  C  C4    . DG  J  2 2   ? -13.124 -13.467 -37.478 1.00 28.21  ? 2   DG  J C4    1 
ATOM   8705  P  P     . DG  J  2 3   ? -13.535 -7.145  -37.288 1.00 46.86  ? 3   DG  J P     1 
ATOM   8706  O  OP1   . DG  J  2 3   ? -12.704 -5.995  -37.732 1.00 43.14  ? 3   DG  J OP1   1 
ATOM   8707  O  OP2   . DG  J  2 3   ? -14.052 -7.258  -35.892 1.00 43.01  ? 3   DG  J OP2   1 
ATOM   8708  O  "O5'" . DG  J  2 3   ? -14.723 -7.253  -38.339 1.00 46.62  ? 3   DG  J "O5'" 1 
ATOM   8709  C  "C5'" . DG  J  2 3   ? -14.472 -7.558  -39.722 1.00 42.80  ? 3   DG  J "C5'" 1 
ATOM   8710  C  "C4'" . DG  J  2 3   ? -15.644 -8.337  -40.271 1.00 40.41  ? 3   DG  J "C4'" 1 
ATOM   8711  O  "O4'" . DG  J  2 3   ? -15.580 -9.720  -39.852 1.00 39.46  ? 3   DG  J "O4'" 1 
ATOM   8712  C  "C3'" . DG  J  2 3   ? -17.020 -7.817  -39.845 1.00 38.07  ? 3   DG  J "C3'" 1 
ATOM   8713  O  "O3'" . DG  J  2 3   ? -17.792 -7.779  -41.045 1.00 40.49  ? 3   DG  J "O3'" 1 
ATOM   8714  C  "C2'" . DG  J  2 3   ? -17.527 -8.866  -38.873 1.00 35.94  ? 3   DG  J "C2'" 1 
ATOM   8715  C  "C1'" . DG  J  2 3   ? -16.842 -10.139 -39.354 1.00 34.00  ? 3   DG  J "C1'" 1 
ATOM   8716  N  N9    . DG  J  2 3   ? -16.593 -11.118 -38.303 1.00 28.97  ? 3   DG  J N9    1 
ATOM   8717  C  C8    . DG  J  2 3   ? -15.918 -10.908 -37.123 1.00 28.49  ? 3   DG  J C8    1 
ATOM   8718  N  N7    . DG  J  2 3   ? -15.850 -11.977 -36.375 1.00 28.69  ? 3   DG  J N7    1 
ATOM   8719  C  C5    . DG  J  2 3   ? -16.525 -12.947 -37.101 1.00 29.22  ? 3   DG  J C5    1 
ATOM   8720  C  C6    . DG  J  2 3   ? -16.756 -14.315 -36.814 1.00 30.75  ? 3   DG  J C6    1 
ATOM   8721  O  O6    . DG  J  2 3   ? -16.423 -14.965 -35.812 1.00 33.96  ? 3   DG  J O6    1 
ATOM   8722  N  N1    . DG  J  2 3   ? -17.475 -14.933 -37.827 1.00 29.17  ? 3   DG  J N1    1 
ATOM   8723  C  C2    . DG  J  2 3   ? -17.921 -14.318 -38.965 1.00 29.19  ? 3   DG  J C2    1 
ATOM   8724  N  N2    . DG  J  2 3   ? -18.595 -15.095 -39.826 1.00 31.82  ? 3   DG  J N2    1 
ATOM   8725  N  N3    . DG  J  2 3   ? -17.705 -13.048 -39.253 1.00 26.28  ? 3   DG  J N3    1 
ATOM   8726  C  C4    . DG  J  2 3   ? -16.978 -12.435 -38.300 1.00 28.61  ? 3   DG  J C4    1 
ATOM   8727  P  P     . DC  J  2 4   ? -19.184 -7.035  -41.110 1.00 38.68  ? 4   DC  J P     1 
ATOM   8728  O  OP1   . DC  J  2 4   ? -19.475 -6.790  -42.562 1.00 36.39  ? 4   DC  J OP1   1 
ATOM   8729  O  OP2   . DC  J  2 4   ? -19.165 -5.918  -40.141 1.00 36.71  ? 4   DC  J OP2   1 
ATOM   8730  O  "O5'" . DC  J  2 4   ? -20.190 -8.155  -40.588 1.00 36.68  ? 4   DC  J "O5'" 1 
ATOM   8731  C  "C5'" . DC  J  2 4   ? -20.318 -9.361  -41.329 1.00 38.40  ? 4   DC  J "C5'" 1 
ATOM   8732  C  "C4'" . DC  J  2 4   ? -21.238 -10.332 -40.632 1.00 41.87  ? 4   DC  J "C4'" 1 
ATOM   8733  O  "O4'" . DC  J  2 4   ? -20.476 -11.089 -39.674 1.00 38.61  ? 4   DC  J "O4'" 1 
ATOM   8734  C  "C3'" . DC  J  2 4   ? -22.402 -9.736  -39.831 1.00 39.73  ? 4   DC  J "C3'" 1 
ATOM   8735  O  "O3'" . DC  J  2 4   ? -23.583 -9.634  -40.651 1.00 39.17  ? 4   DC  J "O3'" 1 
ATOM   8736  C  "C2'" . DC  J  2 4   ? -22.553 -10.706 -38.661 1.00 37.45  ? 4   DC  J "C2'" 1 
ATOM   8737  C  "C1'" . DC  J  2 4   ? -21.396 -11.701 -38.799 1.00 32.45  ? 4   DC  J "C1'" 1 
ATOM   8738  N  N1    . DC  J  2 4   ? -20.671 -11.999 -37.564 1.00 29.90  ? 4   DC  J N1    1 
ATOM   8739  C  C2    . DC  J  2 4   ? -20.603 -13.321 -37.110 1.00 28.07  ? 4   DC  J C2    1 
ATOM   8740  O  O2    . DC  J  2 4   ? -21.200 -14.197 -37.732 1.00 27.38  ? 4   DC  J O2    1 
ATOM   8741  N  N3    . DC  J  2 4   ? -19.899 -13.601 -35.992 1.00 30.27  ? 4   DC  J N3    1 
ATOM   8742  C  C4    . DC  J  2 4   ? -19.278 -12.619 -35.333 1.00 29.43  ? 4   DC  J C4    1 
ATOM   8743  N  N4    . DC  J  2 4   ? -18.620 -12.935 -34.217 1.00 28.31  ? 4   DC  J N4    1 
ATOM   8744  C  C5    . DC  J  2 4   ? -19.314 -11.268 -35.785 1.00 28.01  ? 4   DC  J C5    1 
ATOM   8745  C  C6    . DC  J  2 4   ? -19.997 -11.011 -36.907 1.00 28.29  ? 4   DC  J C6    1 
ATOM   8746  P  P     . DG  J  2 5   ? -24.595 -8.367  -40.519 1.00 38.56  ? 5   DG  J P     1 
ATOM   8747  O  OP1   . DG  J  2 5   ? -25.041 -8.268  -39.103 1.00 40.41  ? 5   DG  J OP1   1 
ATOM   8748  O  OP2   . DG  J  2 5   ? -25.569 -8.448  -41.617 1.00 33.94  ? 5   DG  J OP2   1 
ATOM   8749  O  "O5'" . DG  J  2 5   ? -23.663 -7.109  -40.776 1.00 36.25  ? 5   DG  J "O5'" 1 
ATOM   8750  C  "C5'" . DG  J  2 5   ? -23.149 -6.873  -42.088 1.00 36.62  ? 5   DG  J "C5'" 1 
ATOM   8751  C  "C4'" . DG  J  2 5   ? -23.136 -5.387  -42.356 1.00 37.47  ? 5   DG  J "C4'" 1 
ATOM   8752  O  "O4'" . DG  J  2 5   ? -24.483 -4.867  -42.372 1.00 34.89  ? 5   DG  J "O4'" 1 
ATOM   8753  C  "C3'" . DG  J  2 5   ? -22.394 -4.536  -41.331 1.00 36.29  ? 5   DG  J "C3'" 1 
ATOM   8754  O  "O3'" . DG  J  2 5   ? -21.939 -3.400  -42.066 1.00 38.17  ? 5   DG  J "O3'" 1 
ATOM   8755  C  "C2'" . DG  J  2 5   ? -23.492 -4.155  -40.364 1.00 34.80  ? 5   DG  J "C2'" 1 
ATOM   8756  C  "C1'" . DG  J  2 5   ? -24.657 -3.942  -41.311 1.00 34.88  ? 5   DG  J "C1'" 1 
ATOM   8757  N  N9    . DG  J  2 5   ? -25.979 -4.174  -40.744 1.00 35.49  ? 5   DG  J N9    1 
ATOM   8758  C  C8    . DG  J  2 5   ? -26.335 -5.103  -39.795 1.00 35.70  ? 5   DG  J C8    1 
ATOM   8759  N  N7    . DG  J  2 5   ? -27.609 -5.075  -39.504 1.00 34.19  ? 5   DG  J N7    1 
ATOM   8760  C  C5    . DG  J  2 5   ? -28.124 -4.078  -40.319 1.00 31.65  ? 5   DG  J C5    1 
ATOM   8761  C  C6    . DG  J  2 5   ? -29.455 -3.624  -40.478 1.00 29.81  ? 5   DG  J C6    1 
ATOM   8762  O  O6    . DG  J  2 5   ? -30.475 -4.006  -39.891 1.00 32.27  ? 5   DG  J O6    1 
ATOM   8763  N  N1    . DG  J  2 5   ? -29.537 -2.601  -41.417 1.00 28.33  ? 5   DG  J N1    1 
ATOM   8764  C  C2    . DG  J  2 5   ? -28.482 -2.106  -42.137 1.00 30.28  ? 5   DG  J C2    1 
ATOM   8765  N  N2    . DG  J  2 5   ? -28.768 -1.126  -42.994 1.00 32.13  ? 5   DG  J N2    1 
ATOM   8766  N  N3    . DG  J  2 5   ? -27.240 -2.554  -42.034 1.00 29.81  ? 5   DG  J N3    1 
ATOM   8767  C  C4    . DG  J  2 5   ? -27.134 -3.527  -41.105 1.00 31.92  ? 5   DG  J C4    1 
ATOM   8768  P  P     . DG  J  2 6   ? -21.150 -2.195  -41.370 1.00 38.68  ? 6   DG  J P     1 
ATOM   8769  O  OP1   . DG  J  2 6   ? -20.221 -1.630  -42.402 1.00 36.12  ? 6   DG  J OP1   1 
ATOM   8770  O  OP2   . DG  J  2 6   ? -20.658 -2.649  -40.051 1.00 39.33  ? 6   DG  J OP2   1 
ATOM   8771  O  "O5'" . DG  J  2 6   ? -22.272 -1.087  -41.251 1.00 36.28  ? 6   DG  J "O5'" 1 
ATOM   8772  C  "C5'" . DG  J  2 6   ? -22.979 -0.700  -42.420 1.00 33.44  ? 6   DG  J "C5'" 1 
ATOM   8773  C  "C4'" . DG  J  2 6   ? -24.067 0.268   -42.037 1.00 35.79  ? 6   DG  J "C4'" 1 
ATOM   8774  O  "O4'" . DG  J  2 6   ? -25.072 -0.392  -41.230 1.00 34.95  ? 6   DG  J "O4'" 1 
ATOM   8775  C  "C3'" . DG  J  2 6   ? -23.543 1.431   -41.199 1.00 37.46  ? 6   DG  J "C3'" 1 
ATOM   8776  O  "O3'" . DG  J  2 6   ? -24.057 2.607   -41.810 1.00 39.84  ? 6   DG  J "O3'" 1 
ATOM   8777  C  "C2'" . DG  J  2 6   ? -23.994 1.103   -39.786 1.00 35.56  ? 6   DG  J "C2'" 1 
ATOM   8778  C  "C1'" . DG  J  2 6   ? -25.263 0.314   -40.014 1.00 35.11  ? 6   DG  J "C1'" 1 
ATOM   8779  N  N9    . DG  J  2 6   ? -25.608 -0.666  -38.983 1.00 37.56  ? 6   DG  J N9    1 
ATOM   8780  C  C8    . DG  J  2 6   ? -24.760 -1.516  -38.313 1.00 37.98  ? 6   DG  J C8    1 
ATOM   8781  N  N7    . DG  J  2 6   ? -25.386 -2.319  -37.492 1.00 42.59  ? 6   DG  J N7    1 
ATOM   8782  C  C5    . DG  J  2 6   ? -26.727 -1.985  -37.638 1.00 36.98  ? 6   DG  J C5    1 
ATOM   8783  C  C6    . DG  J  2 6   ? -27.886 -2.527  -37.018 1.00 34.58  ? 6   DG  J C6    1 
ATOM   8784  O  O6    . DG  J  2 6   ? -27.962 -3.419  -36.176 1.00 40.94  ? 6   DG  J O6    1 
ATOM   8785  N  N1    . DG  J  2 6   ? -29.046 -1.905  -37.464 1.00 36.51  ? 6   DG  J N1    1 
ATOM   8786  C  C2    . DG  J  2 6   ? -29.092 -0.897  -38.393 1.00 35.07  ? 6   DG  J C2    1 
ATOM   8787  N  N2    . DG  J  2 6   ? -30.304 -0.426  -38.688 1.00 31.37  ? 6   DG  J N2    1 
ATOM   8788  N  N3    . DG  J  2 6   ? -28.025 -0.403  -39.002 1.00 37.14  ? 6   DG  J N3    1 
ATOM   8789  C  C4    . DG  J  2 6   ? -26.882 -0.980  -38.568 1.00 34.84  ? 6   DG  J C4    1 
ATOM   8790  P  P     . DT  J  2 7   ? -23.947 4.002   -41.075 1.00 44.83  ? 7   DT  J P     1 
ATOM   8791  O  OP1   . DT  J  2 7   ? -24.065 5.060   -42.107 1.00 42.26  ? 7   DT  J OP1   1 
ATOM   8792  O  OP2   . DT  J  2 7   ? -22.808 3.938   -40.121 1.00 48.65  ? 7   DT  J OP2   1 
ATOM   8793  O  "O5'" . DT  J  2 7   ? -25.302 4.089   -40.240 1.00 40.48  ? 7   DT  J "O5'" 1 
ATOM   8794  C  "C5'" . DT  J  2 7   ? -26.533 4.058   -40.972 1.00 38.03  ? 7   DT  J "C5'" 1 
ATOM   8795  C  "C4'" . DT  J  2 7   ? -27.701 4.145   -40.029 1.00 38.66  ? 7   DT  J "C4'" 1 
ATOM   8796  O  "O4'" . DT  J  2 7   ? -27.682 2.983   -39.174 1.00 36.07  ? 7   DT  J "O4'" 1 
ATOM   8797  C  "C3'" . DT  J  2 7   ? -27.675 5.369   -39.104 1.00 42.36  ? 7   DT  J "C3'" 1 
ATOM   8798  O  "O3'" . DT  J  2 7   ? -28.717 6.295   -39.448 1.00 42.59  ? 7   DT  J "O3'" 1 
ATOM   8799  C  "C2'" . DT  J  2 7   ? -27.829 4.792   -37.702 1.00 39.95  ? 7   DT  J "C2'" 1 
ATOM   8800  C  "C1'" . DT  J  2 7   ? -28.257 3.348   -37.940 1.00 39.35  ? 7   DT  J "C1'" 1 
ATOM   8801  N  N1    . DT  J  2 7   ? -27.783 2.391   -36.928 1.00 36.55  ? 7   DT  J N1    1 
ATOM   8802  C  C2    . DT  J  2 7   ? -28.721 1.682   -36.211 1.00 34.96  ? 7   DT  J C2    1 
ATOM   8803  O  O2    . DT  J  2 7   ? -29.923 1.841   -36.340 1.00 38.88  ? 7   DT  J O2    1 
ATOM   8804  N  N3    . DT  J  2 7   ? -28.199 0.817   -35.289 1.00 34.31  ? 7   DT  J N3    1 
ATOM   8805  C  C4    . DT  J  2 7   ? -26.864 0.579   -35.031 1.00 33.97  ? 7   DT  J C4    1 
ATOM   8806  O  O4    . DT  J  2 7   ? -26.547 -0.247  -34.185 1.00 36.58  ? 7   DT  J O4    1 
ATOM   8807  C  C5    . DT  J  2 7   ? -25.934 1.359   -35.812 1.00 33.77  ? 7   DT  J C5    1 
ATOM   8808  C  C7    . DT  J  2 7   ? -24.466 1.185   -35.578 1.00 33.82  ? 7   DT  J C7    1 
ATOM   8809  C  C6    . DT  J  2 7   ? -26.434 2.214   -36.713 1.00 33.40  ? 7   DT  J C6    1 
ATOM   8810  P  P     . DA  J  2 8   ? -28.951 7.601   -38.563 1.00 43.65  ? 8   DA  J P     1 
ATOM   8811  O  OP1   . DA  J  2 8   ? -29.515 8.646   -39.434 1.00 50.24  ? 8   DA  J OP1   1 
ATOM   8812  O  OP2   . DA  J  2 8   ? -27.727 7.850   -37.768 1.00 43.02  ? 8   DA  J OP2   1 
ATOM   8813  O  "O5'" . DA  J  2 8   ? -30.052 7.174   -37.496 1.00 40.73  ? 8   DA  J "O5'" 1 
ATOM   8814  C  "C5'" . DA  J  2 8   ? -31.342 6.709   -37.931 1.00 40.41  ? 8   DA  J "C5'" 1 
ATOM   8815  C  "C4'" . DA  J  2 8   ? -32.305 6.736   -36.771 1.00 37.32  ? 8   DA  J "C4'" 1 
ATOM   8816  O  "O4'" . DA  J  2 8   ? -32.016 5.631   -35.876 1.00 34.94  ? 8   DA  J "O4'" 1 
ATOM   8817  C  "C3'" . DA  J  2 8   ? -32.209 7.994   -35.923 1.00 32.88  ? 8   DA  J "C3'" 1 
ATOM   8818  O  "O3'" . DA  J  2 8   ? -33.488 8.258   -35.405 1.00 30.38  ? 8   DA  J "O3'" 1 
ATOM   8819  C  "C2'" . DA  J  2 8   ? -31.293 7.577   -34.788 1.00 36.91  ? 8   DA  J "C2'" 1 
ATOM   8820  C  "C1'" . DA  J  2 8   ? -31.639 6.113   -34.599 1.00 34.90  ? 8   DA  J "C1'" 1 
ATOM   8821  N  N9    . DA  J  2 8   ? -30.530 5.287   -34.138 1.00 34.98  ? 8   DA  J N9    1 
ATOM   8822  C  C8    . DA  J  2 8   ? -29.206 5.408   -34.484 1.00 32.07  ? 8   DA  J C8    1 
ATOM   8823  N  N7    . DA  J  2 8   ? -28.442 4.471   -33.984 1.00 27.99  ? 8   DA  J N7    1 
ATOM   8824  C  C5    . DA  J  2 8   ? -29.313 3.692   -33.239 1.00 30.64  ? 8   DA  J C5    1 
ATOM   8825  C  C6    . DA  J  2 8   ? -29.105 2.586   -32.406 1.00 27.75  ? 8   DA  J C6    1 
ATOM   8826  N  N6    . DA  J  2 8   ? -27.913 2.020   -32.220 1.00 24.74  ? 8   DA  J N6    1 
ATOM   8827  N  N1    . DA  J  2 8   ? -30.181 2.063   -31.777 1.00 29.02  ? 8   DA  J N1    1 
ATOM   8828  C  C2    . DA  J  2 8   ? -31.379 2.630   -31.976 1.00 31.34  ? 8   DA  J C2    1 
ATOM   8829  N  N3    . DA  J  2 8   ? -31.696 3.689   -32.716 1.00 31.51  ? 8   DA  J N3    1 
ATOM   8830  C  C4    . DA  J  2 8   ? -30.605 4.181   -33.327 1.00 32.05  ? 8   DA  J C4    1 
ATOM   8831  P  P     . DC  J  2 9   ? -33.817 9.676   -34.803 1.00 32.01  ? 9   DC  J P     1 
ATOM   8832  O  OP1   . DC  J  2 9   ? -34.977 10.231  -35.510 1.00 34.57  ? 9   DC  J OP1   1 
ATOM   8833  O  OP2   . DC  J  2 9   ? -32.543 10.424  -34.715 1.00 36.45  ? 9   DC  J OP2   1 
ATOM   8834  O  "O5'" . DC  J  2 9   ? -34.249 9.412   -33.303 1.00 33.23  ? 9   DC  J "O5'" 1 
ATOM   8835  C  "C5'" . DC  J  2 9   ? -35.494 8.820   -33.003 1.00 35.62  ? 9   DC  J "C5'" 1 
ATOM   8836  C  "C4'" . DC  J  2 9   ? -35.296 7.754   -31.950 1.00 31.50  ? 9   DC  J "C4'" 1 
ATOM   8837  O  "O4'" . DC  J  2 9   ? -34.031 7.102   -32.099 1.00 30.49  ? 9   DC  J "O4'" 1 
ATOM   8838  C  "C3'" . DC  J  2 9   ? -35.278 8.224   -30.506 1.00 32.16  ? 9   DC  J "C3'" 1 
ATOM   8839  O  "O3'" . DC  J  2 9   ? -36.565 8.342   -29.935 1.00 35.78  ? 9   DC  J "O3'" 1 
ATOM   8840  C  "C2'" . DC  J  2 9   ? -34.573 7.091   -29.781 1.00 34.29  ? 9   DC  J "C2'" 1 
ATOM   8841  C  "C1'" . DC  J  2 9   ? -33.833 6.360   -30.886 1.00 29.89  ? 9   DC  J "C1'" 1 
ATOM   8842  N  N1    . DC  J  2 9   ? -32.400 6.229   -30.675 1.00 31.25  ? 9   DC  J N1    1 
ATOM   8843  C  C2    . DC  J  2 9   ? -31.926 5.182   -29.884 1.00 32.88  ? 9   DC  J C2    1 
ATOM   8844  O  O2    . DC  J  2 9   ? -32.739 4.441   -29.323 1.00 33.43  ? 9   DC  J O2    1 
ATOM   8845  N  N3    . DC  J  2 9   ? -30.595 4.999   -29.759 1.00 33.53  ? 9   DC  J N3    1 
ATOM   8846  C  C4    . DC  J  2 9   ? -29.749 5.812   -30.394 1.00 30.07  ? 9   DC  J C4    1 
ATOM   8847  N  N4    . DC  J  2 9   ? -28.451 5.591   -30.247 1.00 29.90  ? 9   DC  J N4    1 
ATOM   8848  C  C5    . DC  J  2 9   ? -30.203 6.893   -31.195 1.00 28.40  ? 9   DC  J C5    1 
ATOM   8849  C  C6    . DC  J  2 9   ? -31.524 7.063   -31.310 1.00 32.43  ? 9   DC  J C6    1 
ATOM   8850  P  P     . DT  J  2 10  ? -36.736 9.279   -28.695 1.00 36.94  ? 10  DT  J P     1 
ATOM   8851  O  OP1   . DT  J  2 10  ? -38.178 9.621   -28.563 1.00 34.51  ? 10  DT  J OP1   1 
ATOM   8852  O  OP2   . DT  J  2 10  ? -35.705 10.342  -28.830 1.00 35.58  ? 10  DT  J OP2   1 
ATOM   8853  O  "O5'" . DT  J  2 10  ? -36.359 8.316   -27.501 1.00 38.42  ? 10  DT  J "O5'" 1 
ATOM   8854  C  "C5'" . DT  J  2 10  ? -37.266 7.289   -27.136 1.00 42.09  ? 10  DT  J "C5'" 1 
ATOM   8855  C  "C4'" . DT  J  2 10  ? -36.687 6.592   -25.935 1.00 43.06  ? 10  DT  J "C4'" 1 
ATOM   8856  O  "O4'" . DT  J  2 10  ? -35.313 6.246   -26.227 1.00 39.29  ? 10  DT  J "O4'" 1 
ATOM   8857  C  "C3'" . DT  J  2 10  ? -36.658 7.480   -24.685 1.00 41.72  ? 10  DT  J "C3'" 1 
ATOM   8858  O  "O3'" . DT  J  2 10  ? -37.123 6.680   -23.608 1.00 44.76  ? 10  DT  J "O3'" 1 
ATOM   8859  C  "C2'" . DT  J  2 10  ? -35.213 7.943   -24.599 1.00 40.81  ? 10  DT  J "C2'" 1 
ATOM   8860  C  "C1'" . DT  J  2 10  ? -34.466 6.771   -25.200 1.00 42.15  ? 10  DT  J "C1'" 1 
ATOM   8861  N  N1    . DT  J  2 10  ? -33.180 7.088   -25.819 1.00 42.72  ? 10  DT  J N1    1 
ATOM   8862  C  C2    . DT  J  2 10  ? -32.180 6.161   -25.681 1.00 42.86  ? 10  DT  J C2    1 
ATOM   8863  O  O2    . DT  J  2 10  ? -32.285 5.176   -24.974 1.00 47.56  ? 10  DT  J O2    1 
ATOM   8864  N  N3    . DT  J  2 10  ? -31.016 6.470   -26.340 1.00 44.99  ? 10  DT  J N3    1 
ATOM   8865  C  C4    . DT  J  2 10  ? -30.781 7.565   -27.149 1.00 43.22  ? 10  DT  J C4    1 
ATOM   8866  O  O4    . DT  J  2 10  ? -29.684 7.702   -27.684 1.00 48.03  ? 10  DT  J O4    1 
ATOM   8867  C  C5    . DT  J  2 10  ? -31.894 8.473   -27.293 1.00 42.94  ? 10  DT  J C5    1 
ATOM   8868  C  C7    . DT  J  2 10  ? -31.737 9.690   -28.149 1.00 47.59  ? 10  DT  J C7    1 
ATOM   8869  C  C6    . DT  J  2 10  ? -33.029 8.185   -26.641 1.00 48.02  ? 10  DT  J C6    1 
ATOM   8870  P  P     . DG  J  2 11  ? -37.247 7.273   -22.123 1.00 50.02  ? 11  DG  J P     1 
ATOM   8871  O  OP1   . DG  J  2 11  ? -38.106 6.350   -21.382 1.00 40.07  ? 11  DG  J OP1   1 
ATOM   8872  O  OP2   . DG  J  2 11  ? -37.702 8.692   -22.217 1.00 45.91  ? 11  DG  J OP2   1 
ATOM   8873  O  "O5'" . DG  J  2 11  ? -35.731 7.231   -21.646 1.00 36.79  ? 11  DG  J "O5'" 1 
ATOM   8874  C  "C5'" . DG  J  2 11  ? -35.213 6.052   -21.038 1.00 40.89  ? 11  DG  J "C5'" 1 
ATOM   8875  C  "C4'" . DG  J  2 11  ? -33.860 6.360   -20.453 1.00 42.88  ? 11  DG  J "C4'" 1 
ATOM   8876  O  "O4'" . DG  J  2 11  ? -33.021 6.856   -21.518 1.00 44.07  ? 11  DG  J "O4'" 1 
ATOM   8877  C  "C3'" . DG  J  2 11  ? -33.860 7.450   -19.368 1.00 51.21  ? 11  DG  J "C3'" 1 
ATOM   8878  O  "O3'" . DG  J  2 11  ? -32.976 7.142   -18.286 1.00 62.03  ? 11  DG  J "O3'" 1 
ATOM   8879  C  "C2'" . DG  J  2 11  ? -33.259 8.656   -20.066 1.00 52.67  ? 11  DG  J "C2'" 1 
ATOM   8880  C  "C1'" . DG  J  2 11  ? -32.309 7.972   -21.023 1.00 45.63  ? 11  DG  J "C1'" 1 
ATOM   8881  N  N9    . DG  J  2 11  ? -31.894 8.763   -22.166 1.00 44.05  ? 11  DG  J N9    1 
ATOM   8882  C  C8    . DG  J  2 11  ? -32.584 9.767   -22.806 1.00 42.35  ? 11  DG  J C8    1 
ATOM   8883  N  N7    . DG  J  2 11  ? -31.933 10.267  -23.820 1.00 39.90  ? 11  DG  J N7    1 
ATOM   8884  C  C5    . DG  J  2 11  ? -30.752 9.531   -23.866 1.00 40.60  ? 11  DG  J C5    1 
ATOM   8885  C  C6    . DG  J  2 11  ? -29.654 9.615   -24.754 1.00 40.36  ? 11  DG  J C6    1 
ATOM   8886  O  O6    . DG  J  2 11  ? -29.495 10.388  -25.709 1.00 44.10  ? 11  DG  J O6    1 
ATOM   8887  N  N1    . DG  J  2 11  ? -28.664 8.687   -24.434 1.00 37.67  ? 11  DG  J N1    1 
ATOM   8888  C  C2    . DG  J  2 11  ? -28.725 7.794   -23.392 1.00 33.72  ? 11  DG  J C2    1 
ATOM   8889  N  N2    . DG  J  2 11  ? -27.668 6.983   -23.238 1.00 32.72  ? 11  DG  J N2    1 
ATOM   8890  N  N3    . DG  J  2 11  ? -29.747 7.703   -22.561 1.00 35.03  ? 11  DG  J N3    1 
ATOM   8891  C  C4    . DG  J  2 11  ? -30.715 8.601   -22.852 1.00 37.90  ? 11  DG  J C4    1 
ATOM   8892  O  "O5'" . DC  K  3 1   ? -22.100 10.793  -23.993 1.00 79.35  ? 1   DC  K "O5'" 1 
ATOM   8893  C  "C5'" . DC  K  3 1   ? -21.633 10.355  -22.701 1.00 82.26  ? 1   DC  K "C5'" 1 
ATOM   8894  C  "C4'" . DC  K  3 1   ? -22.445 9.176   -22.210 1.00 78.92  ? 1   DC  K "C4'" 1 
ATOM   8895  O  "O4'" . DC  K  3 1   ? -23.545 9.407   -21.297 1.00 77.56  ? 1   DC  K "O4'" 1 
ATOM   8896  C  "C3'" . DC  K  3 1   ? -22.785 7.956   -23.066 1.00 75.66  ? 1   DC  K "C3'" 1 
ATOM   8897  O  "O3'" . DC  K  3 1   ? -22.058 6.852   -22.504 1.00 81.31  ? 1   DC  K "O3'" 1 
ATOM   8898  C  "C2'" . DC  K  3 1   ? -24.288 7.813   -22.869 1.00 72.08  ? 1   DC  K "C2'" 1 
ATOM   8899  C  "C1'" . DC  K  3 1   ? -24.480 8.346   -21.447 1.00 70.67  ? 1   DC  K "C1'" 1 
ATOM   8900  N  N1    . DC  K  3 1   ? -25.816 8.871   -21.098 1.00 65.01  ? 1   DC  K N1    1 
ATOM   8901  C  C2    . DC  K  3 1   ? -26.584 8.187   -20.140 1.00 63.72  ? 1   DC  K C2    1 
ATOM   8902  O  O2    . DC  K  3 1   ? -26.134 7.143   -19.640 1.00 60.73  ? 1   DC  K O2    1 
ATOM   8903  N  N3    . DC  K  3 1   ? -27.803 8.676   -19.797 1.00 58.23  ? 1   DC  K N3    1 
ATOM   8904  C  C4    . DC  K  3 1   ? -28.246 9.810   -20.347 1.00 57.22  ? 1   DC  K C4    1 
ATOM   8905  N  N4    . DC  K  3 1   ? -29.451 10.252  -19.979 1.00 54.50  ? 1   DC  K N4    1 
ATOM   8906  C  C5    . DC  K  3 1   ? -27.480 10.529  -21.317 1.00 59.40  ? 1   DC  K C5    1 
ATOM   8907  C  C6    . DC  K  3 1   ? -26.279 10.033  -21.653 1.00 60.87  ? 1   DC  K C6    1 
ATOM   8908  P  P     . DA  K  3 2   ? -21.695 5.550   -23.370 1.00 84.23  ? 2   DA  K P     1 
ATOM   8909  O  OP1   . DA  K  3 2   ? -20.327 5.114   -22.998 1.00 84.08  ? 2   DA  K OP1   1 
ATOM   8910  O  OP2   . DA  K  3 2   ? -21.999 5.840   -24.804 1.00 80.32  ? 2   DA  K OP2   1 
ATOM   8911  O  "O5'" . DA  K  3 2   ? -22.665 4.450   -22.739 1.00 85.09  ? 2   DA  K "O5'" 1 
ATOM   8912  C  "C5'" . DA  K  3 2   ? -22.201 3.109   -22.448 1.00 79.80  ? 2   DA  K "C5'" 1 
ATOM   8913  C  "C4'" . DA  K  3 2   ? -23.337 2.233   -21.965 1.00 72.15  ? 2   DA  K "C4'" 1 
ATOM   8914  O  "O4'" . DA  K  3 2   ? -24.617 2.801   -22.338 1.00 60.79  ? 2   DA  K "O4'" 1 
ATOM   8915  C  "C3'" . DA  K  3 2   ? -23.353 0.830   -22.565 1.00 67.38  ? 2   DA  K "C3'" 1 
ATOM   8916  O  "O3'" . DA  K  3 2   ? -24.045 -0.021  -21.637 1.00 60.10  ? 2   DA  K "O3'" 1 
ATOM   8917  C  "C2'" . DA  K  3 2   ? -24.077 1.060   -23.878 1.00 61.10  ? 2   DA  K "C2'" 1 
ATOM   8918  C  "C1'" . DA  K  3 2   ? -25.098 2.154   -23.514 1.00 61.75  ? 2   DA  K "C1'" 1 
ATOM   8919  N  N9    . DA  K  3 2   ? -25.324 3.188   -24.523 1.00 56.22  ? 2   DA  K N9    1 
ATOM   8920  C  C8    . DA  K  3 2   ? -24.403 3.799   -25.336 1.00 55.67  ? 2   DA  K C8    1 
ATOM   8921  N  N7    . DA  K  3 2   ? -24.914 4.720   -26.116 1.00 59.56  ? 2   DA  K N7    1 
ATOM   8922  C  C5    . DA  K  3 2   ? -26.265 4.710   -25.802 1.00 53.20  ? 2   DA  K C5    1 
ATOM   8923  C  C6    . DA  K  3 2   ? -27.352 5.458   -26.282 1.00 52.40  ? 2   DA  K C6    1 
ATOM   8924  N  N6    . DA  K  3 2   ? -27.249 6.397   -27.222 1.00 55.44  ? 2   DA  K N6    1 
ATOM   8925  N  N1    . DA  K  3 2   ? -28.571 5.199   -25.762 1.00 55.92  ? 2   DA  K N1    1 
ATOM   8926  C  C2    . DA  K  3 2   ? -28.675 4.263   -24.810 1.00 56.50  ? 2   DA  K C2    1 
ATOM   8927  N  N3    . DA  K  3 2   ? -27.725 3.499   -24.272 1.00 53.33  ? 2   DA  K N3    1 
ATOM   8928  C  C4    . DA  K  3 2   ? -26.529 3.778   -24.815 1.00 55.39  ? 2   DA  K C4    1 
ATOM   8929  P  P     . DG  K  3 3   ? -24.263 -1.562  -21.943 1.00 58.52  ? 3   DG  K P     1 
ATOM   8930  O  OP1   . DG  K  3 3   ? -24.304 -2.273  -20.643 1.00 56.94  ? 3   DG  K OP1   1 
ATOM   8931  O  OP2   . DG  K  3 3   ? -23.303 -1.991  -22.994 1.00 54.40  ? 3   DG  K OP2   1 
ATOM   8932  O  "O5'" . DG  K  3 3   ? -25.765 -1.591  -22.484 1.00 51.77  ? 3   DG  K "O5'" 1 
ATOM   8933  C  "C5'" . DG  K  3 3   ? -26.812 -0.925  -21.727 1.00 37.93  ? 3   DG  K "C5'" 1 
ATOM   8934  C  "C4'" . DG  K  3 3   ? -28.177 -1.170  -22.326 1.00 32.97  ? 3   DG  K "C4'" 1 
ATOM   8935  O  "O4'" . DG  K  3 3   ? -28.451 -0.159  -23.322 1.00 31.16  ? 3   DG  K "O4'" 1 
ATOM   8936  C  "C3'" . DG  K  3 3   ? -28.395 -2.531  -23.009 1.00 28.23  ? 3   DG  K "C3'" 1 
ATOM   8937  O  "O3'" . DG  K  3 3   ? -29.661 -3.018  -22.542 1.00 23.41  ? 3   DG  K "O3'" 1 
ATOM   8938  C  "C2'" . DG  K  3 3   ? -28.305 -2.197  -24.483 1.00 26.93  ? 3   DG  K "C2'" 1 
ATOM   8939  C  "C1'" . DG  K  3 3   ? -28.775 -0.752  -24.555 1.00 26.80  ? 3   DG  K "C1'" 1 
ATOM   8940  N  N9    . DG  K  3 3   ? -28.157 0.037   -25.621 1.00 28.68  ? 3   DG  K N9    1 
ATOM   8941  C  C8    . DG  K  3 3   ? -26.865 -0.050  -26.086 1.00 29.49  ? 3   DG  K C8    1 
ATOM   8942  N  N7    . DG  K  3 3   ? -26.624 0.763   -27.080 1.00 31.57  ? 3   DG  K N7    1 
ATOM   8943  C  C5    . DG  K  3 3   ? -27.833 1.413   -27.295 1.00 28.35  ? 3   DG  K C5    1 
ATOM   8944  C  C6    . DG  K  3 3   ? -28.192 2.403   -28.252 1.00 27.65  ? 3   DG  K C6    1 
ATOM   8945  O  O6    . DG  K  3 3   ? -27.484 2.939   -29.109 1.00 32.73  ? 3   DG  K O6    1 
ATOM   8946  N  N1    . DG  K  3 3   ? -29.524 2.769   -28.133 1.00 22.98  ? 3   DG  K N1    1 
ATOM   8947  C  C2    . DG  K  3 3   ? -30.401 2.257   -27.206 1.00 22.83  ? 3   DG  K C2    1 
ATOM   8948  N  N2    . DG  K  3 3   ? -31.649 2.734   -27.242 1.00 20.02  ? 3   DG  K N2    1 
ATOM   8949  N  N3    . DG  K  3 3   ? -30.072 1.360   -26.295 1.00 23.27  ? 3   DG  K N3    1 
ATOM   8950  C  C4    . DG  K  3 3   ? -28.790 0.970   -26.409 1.00 24.39  ? 3   DG  K C4    1 
ATOM   8951  P  P     . DT  K  3 4   ? -30.316 -4.353  -23.043 1.00 23.56  ? 4   DT  K P     1 
ATOM   8952  O  OP1   . DT  K  3 4   ? -31.363 -4.741  -22.018 1.00 19.98  ? 4   DT  K OP1   1 
ATOM   8953  O  OP2   . DT  K  3 4   ? -29.298 -5.303  -23.472 1.00 20.15  ? 4   DT  K OP2   1 
ATOM   8954  O  "O5'" . DT  K  3 4   ? -31.140 -3.874  -24.320 1.00 24.13  ? 4   DT  K "O5'" 1 
ATOM   8955  C  "C5'" . DT  K  3 4   ? -32.241 -2.946  -24.215 1.00 20.83  ? 4   DT  K "C5'" 1 
ATOM   8956  C  "C4'" . DT  K  3 4   ? -32.745 -2.618  -25.607 1.00 21.16  ? 4   DT  K "C4'" 1 
ATOM   8957  O  "O4'" . DT  K  3 4   ? -31.728 -1.915  -26.350 1.00 21.28  ? 4   DT  K "O4'" 1 
ATOM   8958  C  "C3'" . DT  K  3 4   ? -33.094 -3.823  -26.482 1.00 18.59  ? 4   DT  K "C3'" 1 
ATOM   8959  O  "O3'" . DT  K  3 4   ? -34.497 -4.063  -26.401 1.00 18.78  ? 4   DT  K "O3'" 1 
ATOM   8960  C  "C2'" . DT  K  3 4   ? -32.572 -3.446  -27.857 1.00 19.22  ? 4   DT  K "C2'" 1 
ATOM   8961  C  "C1'" . DT  K  3 4   ? -32.097 -2.023  -27.712 1.00 20.66  ? 4   DT  K "C1'" 1 
ATOM   8962  N  N1    . DT  K  3 4   ? -30.918 -1.633  -28.516 1.00 23.74  ? 4   DT  K N1    1 
ATOM   8963  C  C2    . DT  K  3 4   ? -30.995 -0.562  -29.382 1.00 26.42  ? 4   DT  K C2    1 
ATOM   8964  O  O2    . DT  K  3 4   ? -32.031 0.048   -29.602 1.00 24.20  ? 4   DT  K O2    1 
ATOM   8965  N  N3    . DT  K  3 4   ? -29.804 -0.231  -29.984 1.00 26.92  ? 4   DT  K N3    1 
ATOM   8966  C  C4    . DT  K  3 4   ? -28.586 -0.869  -29.827 1.00 27.26  ? 4   DT  K C4    1 
ATOM   8967  O  O4    . DT  K  3 4   ? -27.609 -0.491  -30.462 1.00 29.04  ? 4   DT  K O4    1 
ATOM   8968  C  C5    . DT  K  3 4   ? -28.581 -1.969  -28.893 1.00 25.42  ? 4   DT  K C5    1 
ATOM   8969  C  C7    . DT  K  3 4   ? -27.301 -2.705  -28.641 1.00 24.71  ? 4   DT  K C7    1 
ATOM   8970  C  C6    . DT  K  3 4   ? -29.725 -2.274  -28.278 1.00 23.29  ? 4   DT  K C6    1 
ATOM   8971  P  P     . DA  K  3 5   ? -35.193 -5.280  -27.205 1.00 19.79  ? 5   DA  K P     1 
ATOM   8972  O  OP1   . DA  K  3 5   ? -36.492 -5.599  -26.523 1.00 20.16  ? 5   DA  K OP1   1 
ATOM   8973  O  OP2   . DA  K  3 5   ? -34.183 -6.333  -27.504 1.00 16.80  ? 5   DA  K OP2   1 
ATOM   8974  O  "O5'" . DA  K  3 5   ? -35.434 -4.614  -28.633 1.00 19.43  ? 5   DA  K "O5'" 1 
ATOM   8975  C  "C5'" . DA  K  3 5   ? -36.238 -3.465  -28.788 1.00 19.45  ? 5   DA  K "C5'" 1 
ATOM   8976  C  "C4'" . DA  K  3 5   ? -36.066 -2.964  -30.200 1.00 19.87  ? 5   DA  K "C4'" 1 
ATOM   8977  O  "O4'" . DA  K  3 5   ? -34.683 -2.594  -30.391 1.00 19.21  ? 5   DA  K "O4'" 1 
ATOM   8978  C  "C3'" . DA  K  3 5   ? -36.386 -4.000  -31.280 1.00 20.87  ? 5   DA  K "C3'" 1 
ATOM   8979  O  "O3'" . DA  K  3 5   ? -37.571 -3.573  -31.938 1.00 24.49  ? 5   DA  K "O3'" 1 
ATOM   8980  C  "C2'" . DA  K  3 5   ? -35.205 -3.949  -32.234 1.00 21.23  ? 5   DA  K "C2'" 1 
ATOM   8981  C  "C1'" . DA  K  3 5   ? -34.390 -2.751  -31.762 1.00 21.53  ? 5   DA  K "C1'" 1 
ATOM   8982  N  N9    . DA  K  3 5   ? -32.948 -2.902  -31.886 1.00 23.18  ? 5   DA  K N9    1 
ATOM   8983  C  C8    . DA  K  3 5   ? -32.115 -3.818  -31.306 1.00 22.96  ? 5   DA  K C8    1 
ATOM   8984  N  N7    . DA  K  3 5   ? -30.849 -3.637  -31.599 1.00 27.85  ? 5   DA  K N7    1 
ATOM   8985  C  C5    . DA  K  3 5   ? -30.850 -2.498  -32.392 1.00 27.20  ? 5   DA  K C5    1 
ATOM   8986  C  C6    . DA  K  3 5   ? -29.825 -1.792  -33.040 1.00 30.21  ? 5   DA  K C6    1 
ATOM   8987  N  N6    . DA  K  3 5   ? -28.537 -2.116  -32.963 1.00 31.63  ? 5   DA  K N6    1 
ATOM   8988  N  N1    . DA  K  3 5   ? -30.168 -0.703  -33.757 1.00 29.95  ? 5   DA  K N1    1 
ATOM   8989  C  C2    . DA  K  3 5   ? -31.455 -0.373  -33.840 1.00 28.96  ? 5   DA  K C2    1 
ATOM   8990  N  N3    . DA  K  3 5   ? -32.508 -0.959  -33.285 1.00 29.09  ? 5   DA  K N3    1 
ATOM   8991  C  C4    . DA  K  3 5   ? -32.133 -2.031  -32.569 1.00 26.13  ? 5   DA  K C4    1 
ATOM   8992  P  P     . DC  K  3 6   ? -38.225 -4.442  -33.112 1.00 22.97  ? 6   DC  K P     1 
ATOM   8993  O  OP1   . DC  K  3 6   ? -39.698 -4.380  -32.914 1.00 25.99  ? 6   DC  K OP1   1 
ATOM   8994  O  OP2   . DC  K  3 6   ? -37.564 -5.755  -33.165 1.00 23.77  ? 6   DC  K OP2   1 
ATOM   8995  O  "O5'" . DC  K  3 6   ? -37.713 -3.702  -34.418 1.00 24.34  ? 6   DC  K "O5'" 1 
ATOM   8996  C  "C5'" . DC  K  3 6   ? -37.906 -2.296  -34.502 1.00 25.70  ? 6   DC  K "C5'" 1 
ATOM   8997  C  "C4'" . DC  K  3 6   ? -37.250 -1.731  -35.735 1.00 25.59  ? 6   DC  K "C4'" 1 
ATOM   8998  O  "O4'" . DC  K  3 6   ? -35.813 -1.753  -35.565 1.00 25.45  ? 6   DC  K "O4'" 1 
ATOM   8999  C  "C3'" . DC  K  3 6   ? -37.565 -2.487  -37.028 1.00 25.76  ? 6   DC  K "C3'" 1 
ATOM   9000  O  "O3'" . DC  K  3 6   ? -38.040 -1.576  -38.035 1.00 29.03  ? 6   DC  K "O3'" 1 
ATOM   9001  C  "C2'" . DC  K  3 6   ? -36.236 -3.115  -37.422 1.00 26.30  ? 6   DC  K "C2'" 1 
ATOM   9002  C  "C1'" . DC  K  3 6   ? -35.192 -2.226  -36.749 1.00 25.60  ? 6   DC  K "C1'" 1 
ATOM   9003  N  N1    . DC  K  3 6   ? -33.945 -2.907  -36.361 1.00 24.02  ? 6   DC  K N1    1 
ATOM   9004  C  C2    . DC  K  3 6   ? -32.707 -2.361  -36.736 1.00 26.04  ? 6   DC  K C2    1 
ATOM   9005  O  O2    . DC  K  3 6   ? -32.686 -1.310  -37.400 1.00 27.48  ? 6   DC  K O2    1 
ATOM   9006  N  N3    . DC  K  3 6   ? -31.566 -2.999  -36.378 1.00 24.22  ? 6   DC  K N3    1 
ATOM   9007  C  C4    . DC  K  3 6   ? -31.627 -4.091  -35.610 1.00 24.74  ? 6   DC  K C4    1 
ATOM   9008  N  N4    . DC  K  3 6   ? -30.480 -4.678  -35.259 1.00 22.77  ? 6   DC  K N4    1 
ATOM   9009  C  C5    . DC  K  3 6   ? -32.870 -4.643  -35.185 1.00 26.32  ? 6   DC  K C5    1 
ATOM   9010  C  C6    . DC  K  3 6   ? -33.994 -4.046  -35.609 1.00 25.17  ? 6   DC  K C6    1 
ATOM   9011  O  OP3   . DG  L  4 1   ? -21.007 -24.079 -28.207 1.00 40.42  ? 1   DG  L OP3   1 
ATOM   9012  P  P     . DG  L  4 1   ? -19.892 -24.167 -29.206 1.00 62.14  ? 1   DG  L P     1 
ATOM   9013  O  OP1   . DG  L  4 1   ? -18.797 -23.151 -29.140 1.00 57.34  ? 1   DG  L OP1   1 
ATOM   9014  O  OP2   . DG  L  4 1   ? -19.525 -25.603 -29.366 1.00 62.10  ? 1   DG  L OP2   1 
ATOM   9015  O  "O5'" . DG  L  4 1   ? -20.656 -23.766 -30.535 1.00 49.47  ? 1   DG  L "O5'" 1 
ATOM   9016  C  "C5'" . DG  L  4 1   ? -19.960 -23.586 -31.751 1.00 39.59  ? 1   DG  L "C5'" 1 
ATOM   9017  C  "C4'" . DG  L  4 1   ? -20.971 -23.107 -32.757 1.00 37.24  ? 1   DG  L "C4'" 1 
ATOM   9018  O  "O4'" . DG  L  4 1   ? -21.455 -21.805 -32.353 1.00 33.51  ? 1   DG  L "O4'" 1 
ATOM   9019  C  "C3'" . DG  L  4 1   ? -20.372 -22.917 -34.138 1.00 34.95  ? 1   DG  L "C3'" 1 
ATOM   9020  O  "O3'" . DG  L  4 1   ? -20.575 -24.112 -34.857 1.00 37.25  ? 1   DG  L "O3'" 1 
ATOM   9021  C  "C2'" . DG  L  4 1   ? -21.146 -21.752 -34.708 1.00 34.96  ? 1   DG  L "C2'" 1 
ATOM   9022  C  "C1'" . DG  L  4 1   ? -21.453 -20.923 -33.480 1.00 32.30  ? 1   DG  L "C1'" 1 
ATOM   9023  N  N9    . DG  L  4 1   ? -20.525 -19.834 -33.211 1.00 28.80  ? 1   DG  L N9    1 
ATOM   9024  C  C8    . DG  L  4 1   ? -19.660 -19.701 -32.155 1.00 26.27  ? 1   DG  L C8    1 
ATOM   9025  N  N7    . DG  L  4 1   ? -19.036 -18.555 -32.147 1.00 26.87  ? 1   DG  L N7    1 
ATOM   9026  C  C5    . DG  L  4 1   ? -19.545 -17.880 -33.245 1.00 26.16  ? 1   DG  L C5    1 
ATOM   9027  C  C6    . DG  L  4 1   ? -19.283 -16.574 -33.720 1.00 29.02  ? 1   DG  L C6    1 
ATOM   9028  O  O6    . DG  L  4 1   ? -18.476 -15.748 -33.287 1.00 32.91  ? 1   DG  L O6    1 
ATOM   9029  N  N1    . DG  L  4 1   ? -20.016 -16.289 -34.867 1.00 28.97  ? 1   DG  L N1    1 
ATOM   9030  C  C2    . DG  L  4 1   ? -20.911 -17.144 -35.464 1.00 29.82  ? 1   DG  L C2    1 
ATOM   9031  N  N2    . DG  L  4 1   ? -21.544 -16.677 -36.550 1.00 27.96  ? 1   DG  L N2    1 
ATOM   9032  N  N3    . DG  L  4 1   ? -21.193 -18.351 -35.007 1.00 26.60  ? 1   DG  L N3    1 
ATOM   9033  C  C4    . DG  L  4 1   ? -20.477 -18.650 -33.903 1.00 27.42  ? 1   DG  L C4    1 
ATOM   9034  P  P     . DC  L  4 2   ? -19.533 -24.513 -35.981 1.00 40.83  ? 2   DC  L P     1 
ATOM   9035  O  OP1   . DC  L  4 2   ? -19.964 -25.827 -36.559 1.00 43.10  ? 2   DC  L OP1   1 
ATOM   9036  O  OP2   . DC  L  4 2   ? -18.166 -24.340 -35.421 1.00 39.64  ? 2   DC  L OP2   1 
ATOM   9037  O  "O5'" . DC  L  4 2   ? -19.846 -23.462 -37.120 1.00 34.35  ? 2   DC  L "O5'" 1 
ATOM   9038  C  "C5'" . DC  L  4 2   ? -21.174 -23.438 -37.668 1.00 38.66  ? 2   DC  L "C5'" 1 
ATOM   9039  C  "C4'" . DC  L  4 2   ? -21.195 -22.430 -38.782 1.00 39.73  ? 2   DC  L "C4'" 1 
ATOM   9040  O  "O4'" . DC  L  4 2   ? -20.830 -21.157 -38.196 1.00 40.02  ? 2   DC  L "O4'" 1 
ATOM   9041  C  "C3'" . DC  L  4 2   ? -20.135 -22.756 -39.838 1.00 43.44  ? 2   DC  L "C3'" 1 
ATOM   9042  O  "O3'" . DC  L  4 2   ? -20.617 -22.743 -41.191 1.00 54.67  ? 2   DC  L "O3'" 1 
ATOM   9043  C  "C2'" . DC  L  4 2   ? -19.034 -21.735 -39.584 1.00 44.89  ? 2   DC  L "C2'" 1 
ATOM   9044  C  "C1'" . DC  L  4 2   ? -19.760 -20.570 -38.923 1.00 40.82  ? 2   DC  L "C1'" 1 
ATOM   9045  N  N1    . DC  L  4 2   ? -18.939 -19.787 -37.971 1.00 35.32  ? 2   DC  L N1    1 
ATOM   9046  C  C2    . DC  L  4 2   ? -18.701 -18.442 -38.235 1.00 31.89  ? 2   DC  L C2    1 
ATOM   9047  O  O2    . DC  L  4 2   ? -19.197 -17.938 -39.250 1.00 31.28  ? 2   DC  L O2    1 
ATOM   9048  N  N3    . DC  L  4 2   ? -17.968 -17.714 -37.361 1.00 32.76  ? 2   DC  L N3    1 
ATOM   9049  C  C4    . DC  L  4 2   ? -17.489 -18.287 -36.253 1.00 31.96  ? 2   DC  L C4    1 
ATOM   9050  N  N4    . DC  L  4 2   ? -16.772 -17.531 -35.414 1.00 33.23  ? 2   DC  L N4    1 
ATOM   9051  C  C5    . DC  L  4 2   ? -17.685 -19.668 -35.978 1.00 32.09  ? 2   DC  L C5    1 
ATOM   9052  C  C6    . DC  L  4 2   ? -18.424 -20.371 -36.846 1.00 36.99  ? 2   DC  L C6    1 
ATOM   9053  P  P     . DC  L  4 3   ? -19.592 -23.093 -42.387 1.00 53.32  ? 3   DC  L P     1 
ATOM   9054  O  OP1   . DC  L  4 3   ? -20.361 -23.682 -43.515 1.00 56.14  ? 3   DC  L OP1   1 
ATOM   9055  O  OP2   . DC  L  4 3   ? -18.467 -23.855 -41.775 1.00 45.38  ? 3   DC  L OP2   1 
ATOM   9056  O  "O5'" . DC  L  4 3   ? -19.075 -21.651 -42.836 1.00 47.78  ? 3   DC  L "O5'" 1 
ATOM   9057  C  "C5'" . DC  L  4 3   ? -19.961 -20.636 -43.344 1.00 48.82  ? 3   DC  L "C5'" 1 
ATOM   9058  C  "C4'" . DC  L  4 3   ? -19.155 -19.418 -43.744 1.00 50.83  ? 3   DC  L "C4'" 1 
ATOM   9059  O  "O4'" . DC  L  4 3   ? -18.458 -18.870 -42.597 1.00 49.11  ? 3   DC  L "O4'" 1 
ATOM   9060  C  "C3'" . DC  L  4 3   ? -18.057 -19.694 -44.770 1.00 52.10  ? 3   DC  L "C3'" 1 
ATOM   9061  O  "O3'" . DC  L  4 3   ? -17.846 -18.526 -45.557 1.00 53.54  ? 3   DC  L "O3'" 1 
ATOM   9062  C  "C2'" . DC  L  4 3   ? -16.825 -19.924 -43.909 1.00 48.80  ? 3   DC  L "C2'" 1 
ATOM   9063  C  "C1'" . DC  L  4 3   ? -17.053 -18.865 -42.855 1.00 46.38  ? 3   DC  L "C1'" 1 
ATOM   9064  N  N1    . DC  L  4 3   ? -16.365 -19.013 -41.569 1.00 41.04  ? 3   DC  L N1    1 
ATOM   9065  C  C2    . DC  L  4 3   ? -15.755 -17.888 -41.023 1.00 35.08  ? 3   DC  L C2    1 
ATOM   9066  O  O2    . DC  L  4 3   ? -15.765 -16.827 -41.668 1.00 40.17  ? 3   DC  L O2    1 
ATOM   9067  N  N3    . DC  L  4 3   ? -15.163 -17.977 -39.819 1.00 31.29  ? 3   DC  L N3    1 
ATOM   9068  C  C4    . DC  L  4 3   ? -15.187 -19.128 -39.145 1.00 33.02  ? 3   DC  L C4    1 
ATOM   9069  N  N4    . DC  L  4 3   ? -14.590 -19.163 -37.948 1.00 28.01  ? 3   DC  L N4    1 
ATOM   9070  C  C5    . DC  L  4 3   ? -15.803 -20.296 -39.676 1.00 35.97  ? 3   DC  L C5    1 
ATOM   9071  C  C6    . DC  L  4 3   ? -16.365 -20.197 -40.888 1.00 41.79  ? 3   DC  L C6    1 
ATOM   9072  P  P     . DG  L  4 4   ? -17.316 -18.685 -47.039 1.00 49.68  ? 4   DG  L P     1 
ATOM   9073  O  OP1   . DG  L  4 4   ? -18.490 -18.566 -47.939 1.00 52.51  ? 4   DG  L OP1   1 
ATOM   9074  O  OP2   . DG  L  4 4   ? -16.459 -19.904 -47.056 1.00 43.75  ? 4   DG  L OP2   1 
ATOM   9075  O  "O5'" . DG  L  4 4   ? -16.486 -17.343 -47.269 1.00 49.46  ? 4   DG  L "O5'" 1 
ATOM   9076  C  "C5'" . DG  L  4 4   ? -17.098 -16.037 -47.104 1.00 50.59  ? 4   DG  L "C5'" 1 
ATOM   9077  C  "C4'" . DG  L  4 4   ? -16.048 -14.949 -47.023 1.00 49.60  ? 4   DG  L "C4'" 1 
ATOM   9078  O  "O4'" . DG  L  4 4   ? -15.327 -15.037 -45.769 1.00 51.86  ? 4   DG  L "O4'" 1 
ATOM   9079  C  "C3'" . DG  L  4 4   ? -14.975 -15.011 -48.103 1.00 51.23  ? 4   DG  L "C3'" 1 
ATOM   9080  O  "O3'" . DG  L  4 4   ? -14.537 -13.695 -48.457 1.00 52.42  ? 4   DG  L "O3'" 1 
ATOM   9081  C  "C2'" . DG  L  4 4   ? -13.880 -15.841 -47.451 1.00 49.73  ? 4   DG  L "C2'" 1 
ATOM   9082  C  "C1'" . DG  L  4 4   ? -13.974 -15.431 -45.989 1.00 49.13  ? 4   DG  L "C1'" 1 
ATOM   9083  N  N9    . DG  L  4 4   ? -13.639 -16.461 -45.005 1.00 44.59  ? 4   DG  L N9    1 
ATOM   9084  C  C8    . DG  L  4 4   ? -13.903 -17.809 -45.067 1.00 41.30  ? 4   DG  L C8    1 
ATOM   9085  N  N7    . DG  L  4 4   ? -13.493 -18.460 -44.010 1.00 42.07  ? 4   DG  L N7    1 
ATOM   9086  C  C5    . DG  L  4 4   ? -12.932 -17.482 -43.199 1.00 38.83  ? 4   DG  L C5    1 
ATOM   9087  C  C6    . DG  L  4 4   ? -12.314 -17.584 -41.916 1.00 39.67  ? 4   DG  L C6    1 
ATOM   9088  O  O6    . DG  L  4 4   ? -12.152 -18.586 -41.208 1.00 38.01  ? 4   DG  L O6    1 
ATOM   9089  N  N1    . DG  L  4 4   ? -11.882 -16.345 -41.460 1.00 41.74  ? 4   DG  L N1    1 
ATOM   9090  C  C2    . DG  L  4 4   ? -12.006 -15.163 -42.148 1.00 41.24  ? 4   DG  L C2    1 
ATOM   9091  N  N2    . DG  L  4 4   ? -11.521 -14.077 -41.538 1.00 42.48  ? 4   DG  L N2    1 
ATOM   9092  N  N3    . DG  L  4 4   ? -12.579 -15.052 -43.337 1.00 42.68  ? 4   DG  L N3    1 
ATOM   9093  C  C4    . DG  L  4 4   ? -13.002 -16.246 -43.806 1.00 40.63  ? 4   DG  L C4    1 
ATOM   9094  N  N     . ALA M  1 6   ? -26.050 -41.568 6.522   1.00 81.59  ? 249 ALA M N     1 
ATOM   9095  C  CA    . ALA M  1 6   ? -25.776 -41.177 7.926   1.00 81.60  ? 249 ALA M CA    1 
ATOM   9096  C  C     . ALA M  1 6   ? -25.622 -42.447 8.746   1.00 85.06  ? 249 ALA M C     1 
ATOM   9097  O  O     . ALA M  1 6   ? -26.557 -42.855 9.443   1.00 96.25  ? 249 ALA M O     1 
ATOM   9098  C  CB    . ALA M  1 6   ? -26.900 -40.297 8.482   1.00 80.67  ? 249 ALA M CB    1 
ATOM   9099  N  N     . THR M  1 7   ? -24.447 -43.074 8.640   1.00 79.60  ? 250 THR M N     1 
ATOM   9100  C  CA    . THR M  1 7   ? -24.106 -44.262 9.441   1.00 74.56  ? 250 THR M CA    1 
ATOM   9101  C  C     . THR M  1 7   ? -23.120 -43.866 10.590  1.00 71.01  ? 250 THR M C     1 
ATOM   9102  O  O     . THR M  1 7   ? -23.529 -43.728 11.756  1.00 72.91  ? 250 THR M O     1 
ATOM   9103  C  CB    . THR M  1 7   ? -23.554 -45.422 8.541   1.00 68.10  ? 250 THR M CB    1 
ATOM   9104  O  OG1   . THR M  1 7   ? -23.675 -45.069 7.161   1.00 60.49  ? 250 THR M OG1   1 
ATOM   9105  C  CG2   . THR M  1 7   ? -24.315 -46.740 8.775   1.00 64.82  ? 250 THR M CG2   1 
ATOM   9106  N  N     . ASN M  1 8   ? -21.847 -43.660 10.242  1.00 60.83  ? 251 ASN M N     1 
ATOM   9107  C  CA    . ASN M  1 8   ? -20.727 -43.437 11.200  1.00 48.27  ? 251 ASN M CA    1 
ATOM   9108  C  C     . ASN M  1 8   ? -19.843 -44.652 11.350  1.00 47.41  ? 251 ASN M C     1 
ATOM   9109  O  O     . ASN M  1 8   ? -19.977 -45.423 12.293  1.00 55.00  ? 251 ASN M O     1 
ATOM   9110  C  CB    . ASN M  1 8   ? -21.150 -42.960 12.596  1.00 43.52  ? 251 ASN M CB    1 
ATOM   9111  C  CG    . ASN M  1 8   ? -19.951 -42.482 13.422  1.00 36.98  ? 251 ASN M CG    1 
ATOM   9112  O  OD1   . ASN M  1 8   ? -18.818 -42.661 13.025  1.00 37.87  ? 251 ASN M OD1   1 
ATOM   9113  N  ND2   . ASN M  1 8   ? -20.204 -41.895 14.546  1.00 34.24  ? 251 ASN M ND2   1 
ATOM   9114  N  N     . HIS M  1 9   ? -18.921 -44.803 10.418  1.00 46.30  ? 252 HIS M N     1 
ATOM   9115  C  CA    . HIS M  1 9   ? -17.914 -45.823 10.507  1.00 48.61  ? 252 HIS M CA    1 
ATOM   9116  C  C     . HIS M  1 9   ? -16.900 -45.593 11.666  1.00 43.43  ? 252 HIS M C     1 
ATOM   9117  O  O     . HIS M  1 9   ? -15.998 -46.416 11.841  1.00 44.56  ? 252 HIS M O     1 
ATOM   9118  C  CB    . HIS M  1 9   ? -17.122 -45.887 9.193   1.00 57.06  ? 252 HIS M CB    1 
ATOM   9119  C  CG    . HIS M  1 9   ? -17.951 -46.131 7.974   1.00 64.48  ? 252 HIS M CG    1 
ATOM   9120  N  ND1   . HIS M  1 9   ? -18.622 -45.125 7.308   1.00 70.26  ? 252 HIS M ND1   1 
ATOM   9121  C  CD2   . HIS M  1 9   ? -18.181 -47.264 7.273   1.00 64.78  ? 252 HIS M CD2   1 
ATOM   9122  C  CE1   . HIS M  1 9   ? -19.244 -45.633 6.259   1.00 68.99  ? 252 HIS M CE1   1 
ATOM   9123  N  NE2   . HIS M  1 9   ? -18.988 -46.928 6.213   1.00 66.51  ? 252 HIS M NE2   1 
ATOM   9124  N  N     . ASN M  1 10  ? -17.017 -44.506 12.438  1.00 37.25  ? 253 ASN M N     1 
ATOM   9125  C  CA    . ASN M  1 10  ? -15.996 -44.200 13.485  1.00 37.18  ? 253 ASN M CA    1 
ATOM   9126  C  C     . ASN M  1 10  ? -16.558 -43.958 14.856  1.00 34.60  ? 253 ASN M C     1 
ATOM   9127  O  O     . ASN M  1 10  ? -15.954 -43.205 15.644  1.00 38.21  ? 253 ASN M O     1 
ATOM   9128  C  CB    . ASN M  1 10  ? -15.148 -42.986 13.107  1.00 37.98  ? 253 ASN M CB    1 
ATOM   9129  C  CG    . ASN M  1 10  ? -14.450 -43.157 11.794  1.00 38.09  ? 253 ASN M CG    1 
ATOM   9130  O  OD1   . ASN M  1 10  ? -13.350 -43.701 11.694  1.00 40.83  ? 253 ASN M OD1   1 
ATOM   9131  N  ND2   . ASN M  1 10  ? -15.101 -42.702 10.754  1.00 45.18  ? 253 ASN M ND2   1 
ATOM   9132  N  N     . LEU M  1 11  ? -17.719 -44.569 15.142  1.00 31.23  ? 254 LEU M N     1 
ATOM   9133  C  CA    . LEU M  1 11  ? -18.380 -44.412 16.442  1.00 34.16  ? 254 LEU M CA    1 
ATOM   9134  C  C     . LEU M  1 11  ? -17.471 -44.785 17.618  1.00 31.32  ? 254 LEU M C     1 
ATOM   9135  O  O     . LEU M  1 11  ? -17.546 -44.190 18.697  1.00 33.63  ? 254 LEU M O     1 
ATOM   9136  C  CB    . LEU M  1 11  ? -19.653 -45.268 16.504  1.00 35.49  ? 254 LEU M CB    1 
ATOM   9137  C  CG    . LEU M  1 11  ? -20.288 -45.332 17.891  1.00 38.70  ? 254 LEU M CG    1 
ATOM   9138  C  CD1   . LEU M  1 11  ? -20.752 -43.950 18.320  1.00 40.06  ? 254 LEU M CD1   1 
ATOM   9139  C  CD2   . LEU M  1 11  ? -21.443 -46.339 17.913  1.00 40.72  ? 254 LEU M CD2   1 
ATOM   9140  N  N     . HIS M  1 12  ? -16.627 -45.772 17.401  1.00 30.23  ? 255 HIS M N     1 
ATOM   9141  C  CA    . HIS M  1 12  ? -15.691 -46.226 18.439  1.00 36.42  ? 255 HIS M CA    1 
ATOM   9142  C  C     . HIS M  1 12  ? -14.693 -45.132 18.831  1.00 34.85  ? 255 HIS M C     1 
ATOM   9143  O  O     . HIS M  1 12  ? -14.123 -45.179 19.895  1.00 33.95  ? 255 HIS M O     1 
ATOM   9144  C  CB    . HIS M  1 12  ? -14.958 -47.497 17.996  1.00 33.42  ? 255 HIS M CB    1 
ATOM   9145  C  CG    . HIS M  1 12  ? -14.428 -47.428 16.606  1.00 35.21  ? 255 HIS M CG    1 
ATOM   9146  N  ND1   . HIS M  1 12  ? -13.077 -47.307 16.335  1.00 37.21  ? 255 HIS M ND1   1 
ATOM   9147  C  CD2   . HIS M  1 12  ? -15.050 -47.460 15.404  1.00 36.53  ? 255 HIS M CD2   1 
ATOM   9148  C  CE1   . HIS M  1 12  ? -12.891 -47.289 15.028  1.00 36.04  ? 255 HIS M CE1   1 
ATOM   9149  N  NE2   . HIS M  1 12  ? -14.071 -47.397 14.438  1.00 36.88  ? 255 HIS M NE2   1 
ATOM   9150  N  N     . ILE M  1 13  ? -14.514 -44.150 17.953  1.00 34.24  ? 256 ILE M N     1 
ATOM   9151  C  CA    . ILE M  1 13  ? -13.676 -42.995 18.214  1.00 35.65  ? 256 ILE M CA    1 
ATOM   9152  C  C     . ILE M  1 13  ? -14.505 -41.809 18.719  1.00 36.11  ? 256 ILE M C     1 
ATOM   9153  O  O     . ILE M  1 13  ? -14.167 -41.164 19.725  1.00 34.73  ? 256 ILE M O     1 
ATOM   9154  C  CB    . ILE M  1 13  ? -12.927 -42.616 16.924  1.00 35.63  ? 256 ILE M CB    1 
ATOM   9155  C  CG1   . ILE M  1 13  ? -12.132 -43.794 16.455  1.00 34.91  ? 256 ILE M CG1   1 
ATOM   9156  C  CG2   . ILE M  1 13  ? -12.000 -41.437 17.147  1.00 32.00  ? 256 ILE M CG2   1 
ATOM   9157  C  CD1   . ILE M  1 13  ? -11.435 -43.508 15.163  1.00 40.26  ? 256 ILE M CD1   1 
ATOM   9158  N  N     . THR M  1 14  ? -15.626 -41.541 18.062  1.00 37.11  ? 257 THR M N     1 
ATOM   9159  C  CA    . THR M  1 14  ? -16.427 -40.391 18.457  1.00 35.46  ? 257 THR M CA    1 
ATOM   9160  C  C     . THR M  1 14  ? -16.914 -40.504 19.870  1.00 33.55  ? 257 THR M C     1 
ATOM   9161  O  O     . THR M  1 14  ? -16.918 -39.541 20.627  1.00 32.59  ? 257 THR M O     1 
ATOM   9162  C  CB    . THR M  1 14  ? -17.652 -40.162 17.539  1.00 38.51  ? 257 THR M CB    1 
ATOM   9163  O  OG1   . THR M  1 14  ? -18.794 -40.938 17.966  1.00 42.32  ? 257 THR M OG1   1 
ATOM   9164  C  CG2   . THR M  1 14  ? -17.326 -40.479 16.095  1.00 42.73  ? 257 THR M CG2   1 
ATOM   9165  N  N     . GLU M  1 15  ? -17.366 -41.676 20.266  1.00 33.86  ? 258 GLU M N     1 
ATOM   9166  C  CA    . GLU M  1 15  ? -17.913 -41.733 21.623  1.00 36.84  ? 258 GLU M CA    1 
ATOM   9167  C  C     . GLU M  1 15  ? -16.899 -41.314 22.687  1.00 36.20  ? 258 GLU M C     1 
ATOM   9168  O  O     . GLU M  1 15  ? -17.295 -40.831 23.757  1.00 42.95  ? 258 GLU M O     1 
ATOM   9169  C  CB    . GLU M  1 15  ? -18.571 -43.086 21.958  1.00 37.48  ? 258 GLU M CB    1 
ATOM   9170  C  CG    . GLU M  1 15  ? -17.686 -44.315 21.855  1.00 42.08  ? 258 GLU M CG    1 
ATOM   9171  C  CD    . GLU M  1 15  ? -18.475 -45.630 21.681  1.00 49.17  ? 258 GLU M CD    1 
ATOM   9172  O  OE1   . GLU M  1 15  ? -19.730 -45.622 21.559  1.00 52.75  ? 258 GLU M OE1   1 
ATOM   9173  O  OE2   . GLU M  1 15  ? -17.827 -46.700 21.675  1.00 50.92  ? 258 GLU M OE2   1 
ATOM   9174  N  N     . LYS M  1 16  ? -15.604 -41.480 22.434  1.00 36.37  ? 259 LYS M N     1 
ATOM   9175  C  CA    . LYS M  1 16  ? -14.639 -41.144 23.507  1.00 34.84  ? 259 LYS M CA    1 
ATOM   9176  C  C     . LYS M  1 16  ? -14.272 -39.695 23.417  1.00 30.39  ? 259 LYS M C     1 
ATOM   9177  O  O     . LYS M  1 16  ? -14.123 -39.050 24.429  1.00 28.38  ? 259 LYS M O     1 
ATOM   9178  C  CB    . LYS M  1 16  ? -13.386 -42.015 23.491  1.00 39.31  ? 259 LYS M CB    1 
ATOM   9179  C  CG    . LYS M  1 16  ? -13.624 -43.470 23.102  1.00 45.81  ? 259 LYS M CG    1 
ATOM   9180  C  CD    . LYS M  1 16  ? -12.961 -44.459 24.045  1.00 50.15  ? 259 LYS M CD    1 
ATOM   9181  C  CE    . LYS M  1 16  ? -13.733 -44.590 25.358  1.00 52.53  ? 259 LYS M CE    1 
ATOM   9182  N  NZ    . LYS M  1 16  ? -13.728 -45.971 25.916  1.00 51.97  ? 259 LYS M NZ    1 
ATOM   9183  N  N     . LEU M  1 17  ? -14.121 -39.172 22.203  1.00 29.33  ? 260 LEU M N     1 
ATOM   9184  C  CA    . LEU M  1 17  ? -13.833 -37.731 22.021  1.00 29.54  ? 260 LEU M CA    1 
ATOM   9185  C  C     . LEU M  1 17  ? -14.906 -36.785 22.529  1.00 29.73  ? 260 LEU M C     1 
ATOM   9186  O  O     . LEU M  1 17  ? -14.601 -35.679 23.050  1.00 28.28  ? 260 LEU M O     1 
ATOM   9187  C  CB    . LEU M  1 17  ? -13.592 -37.418 20.562  1.00 28.50  ? 260 LEU M CB    1 
ATOM   9188  C  CG    . LEU M  1 17  ? -12.336 -37.998 19.938  1.00 26.20  ? 260 LEU M CG    1 
ATOM   9189  C  CD1   . LEU M  1 17  ? -12.228 -37.460 18.538  1.00 24.54  ? 260 LEU M CD1   1 
ATOM   9190  C  CD2   . LEU M  1 17  ? -11.125 -37.631 20.810  1.00 26.73  ? 260 LEU M CD2   1 
ATOM   9191  N  N     . GLU M  1 18  ? -16.141 -37.234 22.415  1.00 30.41  ? 261 GLU M N     1 
ATOM   9192  C  CA    . GLU M  1 18  ? -17.274 -36.503 22.938  1.00 34.57  ? 261 GLU M CA    1 
ATOM   9193  C  C     . GLU M  1 18  ? -17.193 -36.308 24.406  1.00 34.96  ? 261 GLU M C     1 
ATOM   9194  O  O     . GLU M  1 18  ? -17.564 -35.249 24.926  1.00 35.45  ? 261 GLU M O     1 
ATOM   9195  C  CB    . GLU M  1 18  ? -18.556 -37.257 22.615  1.00 41.17  ? 261 GLU M CB    1 
ATOM   9196  C  CG    . GLU M  1 18  ? -18.954 -37.119 21.149  1.00 43.97  ? 261 GLU M CG    1 
ATOM   9197  C  CD    . GLU M  1 18  ? -20.374 -37.603 20.874  1.00 53.74  ? 261 GLU M CD    1 
ATOM   9198  O  OE1   . GLU M  1 18  ? -21.219 -37.537 21.804  1.00 57.15  ? 261 GLU M OE1   1 
ATOM   9199  O  OE2   . GLU M  1 18  ? -20.650 -38.036 19.722  1.00 56.59  ? 261 GLU M OE2   1 
ATOM   9200  N  N     . VAL M  1 19  ? -16.696 -37.318 25.111  1.00 32.09  ? 262 VAL M N     1 
ATOM   9201  C  CA    . VAL M  1 19  ? -16.564 -37.163 26.540  1.00 28.89  ? 262 VAL M CA    1 
ATOM   9202  C  C     . VAL M  1 19  ? -15.553 -36.084 26.828  1.00 28.75  ? 262 VAL M C     1 
ATOM   9203  O  O     . VAL M  1 19  ? -15.748 -35.251 27.688  1.00 29.83  ? 262 VAL M O     1 
ATOM   9204  C  CB    . VAL M  1 19  ? -16.114 -38.477 27.236  1.00 29.62  ? 262 VAL M CB    1 
ATOM   9205  C  CG1   . VAL M  1 19  ? -15.894 -38.215 28.715  1.00 28.37  ? 262 VAL M CG1   1 
ATOM   9206  C  CG2   . VAL M  1 19  ? -17.119 -39.609 27.023  1.00 29.40  ? 262 VAL M CG2   1 
ATOM   9207  N  N     . LEU M  1 20  ? -14.436 -36.107 26.138  1.00 28.97  ? 263 LEU M N     1 
ATOM   9208  C  CA    . LEU M  1 20  ? -13.424 -35.068 26.347  1.00 31.78  ? 263 LEU M CA    1 
ATOM   9209  C  C     . LEU M  1 20  ? -13.919 -33.672 25.942  1.00 31.57  ? 263 LEU M C     1 
ATOM   9210  O  O     . LEU M  1 20  ? -13.657 -32.649 26.603  1.00 32.36  ? 263 LEU M O     1 
ATOM   9211  C  CB    . LEU M  1 20  ? -12.161 -35.454 25.545  1.00 35.04  ? 263 LEU M CB    1 
ATOM   9212  C  CG    . LEU M  1 20  ? -10.841 -34.746 25.843  1.00 36.38  ? 263 LEU M CG    1 
ATOM   9213  C  CD1   . LEU M  1 20  ? -10.586 -34.643 27.328  1.00 40.27  ? 263 LEU M CD1   1 
ATOM   9214  C  CD2   . LEU M  1 20  ? -9.675  -35.489 25.208  1.00 36.58  ? 263 LEU M CD2   1 
ATOM   9215  N  N     . ALA M  1 21  ? -14.628 -33.617 24.829  1.00 34.29  ? 264 ALA M N     1 
ATOM   9216  C  CA    . ALA M  1 21  ? -15.098 -32.340 24.293  1.00 35.21  ? 264 ALA M CA    1 
ATOM   9217  C  C     . ALA M  1 21  ? -15.970 -31.676 25.349  1.00 38.05  ? 264 ALA M C     1 
ATOM   9218  O  O     . ALA M  1 21  ? -15.764 -30.529 25.748  1.00 38.82  ? 264 ALA M O     1 
ATOM   9219  C  CB    . ALA M  1 21  ? -15.859 -32.593 23.006  1.00 33.60  ? 264 ALA M CB    1 
ATOM   9220  N  N     . LYS M  1 22  ? -16.903 -32.463 25.859  1.00 39.77  ? 265 LYS M N     1 
ATOM   9221  C  CA    . LYS M  1 22  ? -17.781 -32.017 26.891  1.00 40.96  ? 265 LYS M CA    1 
ATOM   9222  C  C     . LYS M  1 22  ? -17.038 -31.564 28.114  1.00 40.23  ? 265 LYS M C     1 
ATOM   9223  O  O     . LYS M  1 22  ? -17.477 -30.664 28.801  1.00 41.93  ? 265 LYS M O     1 
ATOM   9224  C  CB    . LYS M  1 22  ? -18.722 -33.158 27.282  1.00 46.22  ? 265 LYS M CB    1 
ATOM   9225  C  CG    . LYS M  1 22  ? -19.905 -32.722 28.131  1.00 49.06  ? 265 LYS M CG    1 
ATOM   9226  C  CD    . LYS M  1 22  ? -21.039 -32.295 27.222  1.00 55.54  ? 265 LYS M CD    1 
ATOM   9227  C  CE    . LYS M  1 22  ? -22.137 -31.574 28.001  1.00 62.10  ? 265 LYS M CE    1 
ATOM   9228  N  NZ    . LYS M  1 22  ? -23.086 -30.845 27.110  1.00 61.51  ? 265 LYS M NZ    1 
ATOM   9229  N  N     . ALA M  1 23  ? -15.943 -32.232 28.443  1.00 39.28  ? 266 ALA M N     1 
ATOM   9230  C  CA    . ALA M  1 23  ? -15.217 -31.878 29.633  1.00 37.16  ? 266 ALA M CA    1 
ATOM   9231  C  C     . ALA M  1 23  ? -14.627 -30.490 29.463  1.00 37.61  ? 266 ALA M C     1 
ATOM   9232  O  O     . ALA M  1 23  ? -14.666 -29.659 30.369  1.00 41.09  ? 266 ALA M O     1 
ATOM   9233  C  CB    . ALA M  1 23  ? -14.120 -32.892 29.898  1.00 38.36  ? 266 ALA M CB    1 
ATOM   9234  N  N     . TYR M  1 24  ? -14.069 -30.248 28.287  1.00 36.73  ? 267 TYR M N     1 
ATOM   9235  C  CA    . TYR M  1 24  ? -13.519 -28.952 27.983  1.00 38.44  ? 267 TYR M CA    1 
ATOM   9236  C  C     . TYR M  1 24  ? -14.594 -27.864 27.896  1.00 38.70  ? 267 TYR M C     1 
ATOM   9237  O  O     . TYR M  1 24  ? -14.399 -26.742 28.341  1.00 36.71  ? 267 TYR M O     1 
ATOM   9238  C  CB    . TYR M  1 24  ? -12.787 -29.008 26.656  1.00 40.03  ? 267 TYR M CB    1 
ATOM   9239  C  CG    . TYR M  1 24  ? -11.419 -29.638 26.706  1.00 37.96  ? 267 TYR M CG    1 
ATOM   9240  C  CD1   . TYR M  1 24  ? -10.467 -29.233 27.644  1.00 36.90  ? 267 TYR M CD1   1 
ATOM   9241  C  CD2   . TYR M  1 24  ? -11.049 -30.593 25.759  1.00 37.80  ? 267 TYR M CD2   1 
ATOM   9242  C  CE1   . TYR M  1 24  ? -9.197  -29.788 27.648  1.00 39.08  ? 267 TYR M CE1   1 
ATOM   9243  C  CE2   . TYR M  1 24  ? -9.782  -31.160 25.762  1.00 36.68  ? 267 TYR M CE2   1 
ATOM   9244  C  CZ    . TYR M  1 24  ? -8.862  -30.742 26.696  1.00 36.18  ? 267 TYR M CZ    1 
ATOM   9245  O  OH    . TYR M  1 24  ? -7.630  -31.299 26.671  1.00 36.10  ? 267 TYR M OH    1 
ATOM   9246  N  N     . SER M  1 25  ? -15.731 -28.190 27.317  1.00 40.59  ? 268 SER M N     1 
ATOM   9247  C  CA    . SER M  1 25  ? -16.774 -27.189 27.191  1.00 38.88  ? 268 SER M CA    1 
ATOM   9248  C  C     . SER M  1 25  ? -17.205 -26.679 28.566  1.00 42.64  ? 268 SER M C     1 
ATOM   9249  O  O     . SER M  1 25  ? -17.052 -25.495 28.871  1.00 46.30  ? 268 SER M O     1 
ATOM   9250  C  CB    . SER M  1 25  ? -17.936 -27.755 26.442  1.00 36.76  ? 268 SER M CB    1 
ATOM   9251  O  OG    . SER M  1 25  ? -19.057 -27.119 26.954  1.00 43.11  ? 268 SER M OG    1 
ATOM   9252  N  N     . VAL M  1 26  ? -17.655 -27.571 29.444  1.00 45.02  ? 269 VAL M N     1 
ATOM   9253  C  CA    . VAL M  1 26  ? -18.165 -27.135 30.760  1.00 41.69  ? 269 VAL M CA    1 
ATOM   9254  C  C     . VAL M  1 26  ? -17.092 -26.482 31.629  1.00 42.74  ? 269 VAL M C     1 
ATOM   9255  O  O     . VAL M  1 26  ? -17.398 -25.714 32.543  1.00 41.86  ? 269 VAL M O     1 
ATOM   9256  C  CB    . VAL M  1 26  ? -18.876 -28.286 31.548  1.00 44.50  ? 269 VAL M CB    1 
ATOM   9257  C  CG1   . VAL M  1 26  ? -20.028 -28.914 30.752  1.00 37.33  ? 269 VAL M CG1   1 
ATOM   9258  C  CG2   . VAL M  1 26  ? -17.896 -29.376 31.984  1.00 49.33  ? 269 VAL M CG2   1 
ATOM   9259  N  N     . GLN M  1 27  ? -15.821 -26.764 31.364  1.00 44.68  ? 270 GLN M N     1 
ATOM   9260  C  CA    . GLN M  1 27  ? -14.749 -26.090 32.118  1.00 47.56  ? 270 GLN M CA    1 
ATOM   9261  C  C     . GLN M  1 27  ? -14.442 -24.725 31.521  1.00 46.17  ? 270 GLN M C     1 
ATOM   9262  O  O     . GLN M  1 27  ? -13.728 -23.914 32.118  1.00 40.24  ? 270 GLN M O     1 
ATOM   9263  C  CB    . GLN M  1 27  ? -13.498 -26.957 32.176  1.00 52.32  ? 270 GLN M CB    1 
ATOM   9264  C  CG    . GLN M  1 27  ? -13.658 -28.116 33.145  1.00 57.63  ? 270 GLN M CG    1 
ATOM   9265  C  CD    . GLN M  1 27  ? -12.445 -29.018 33.185  1.00 56.04  ? 270 GLN M CD    1 
ATOM   9266  O  OE1   . GLN M  1 27  ? -11.714 -29.016 34.155  1.00 58.89  ? 270 GLN M OE1   1 
ATOM   9267  N  NE2   . GLN M  1 27  ? -12.221 -29.774 32.127  1.00 58.60  ? 270 GLN M NE2   1 
ATOM   9268  N  N     . GLY M  1 28  ? -15.013 -24.484 30.345  1.00 49.01  ? 271 GLY M N     1 
ATOM   9269  C  CA    . GLY M  1 28  ? -15.047 -23.159 29.764  1.00 51.41  ? 271 GLY M CA    1 
ATOM   9270  C  C     . GLY M  1 28  ? -13.982 -22.924 28.717  1.00 53.37  ? 271 GLY M C     1 
ATOM   9271  O  O     . GLY M  1 28  ? -13.726 -21.775 28.360  1.00 55.35  ? 271 GLY M O     1 
ATOM   9272  N  N     . ASP M  1 29  ? -13.360 -23.996 28.217  1.00 49.43  ? 272 ASP M N     1 
ATOM   9273  C  CA    . ASP M  1 29  ? -12.390 -23.876 27.139  1.00 47.55  ? 272 ASP M CA    1 
ATOM   9274  C  C     . ASP M  1 29  ? -13.117 -24.074 25.810  1.00 42.34  ? 272 ASP M C     1 
ATOM   9275  O  O     . ASP M  1 29  ? -13.034 -25.124 25.167  1.00 44.11  ? 272 ASP M O     1 
ATOM   9276  C  CB    . ASP M  1 29  ? -11.251 -24.874 27.340  1.00 49.66  ? 272 ASP M CB    1 
ATOM   9277  C  CG    . ASP M  1 29  ? -10.092 -24.631 26.395  1.00 56.40  ? 272 ASP M CG    1 
ATOM   9278  O  OD1   . ASP M  1 29  ? -10.236 -23.830 25.416  1.00 59.48  ? 272 ASP M OD1   1 
ATOM   9279  O  OD2   . ASP M  1 29  ? -9.032  -25.263 26.620  1.00 58.91  ? 272 ASP M OD2   1 
ATOM   9280  N  N     . LYS M  1 30  ? -13.828 -23.037 25.381  1.00 44.05  ? 273 LYS M N     1 
ATOM   9281  C  CA    . LYS M  1 30  ? -14.797 -23.192 24.288  1.00 40.12  ? 273 LYS M CA    1 
ATOM   9282  C  C     . LYS M  1 30  ? -14.180 -23.290 22.930  1.00 36.83  ? 273 LYS M C     1 
ATOM   9283  O  O     . LYS M  1 30  ? -14.768 -23.926 22.048  1.00 39.50  ? 273 LYS M O     1 
ATOM   9284  C  CB    . LYS M  1 30  ? -15.832 -22.059 24.282  1.00 50.63  ? 273 LYS M CB    1 
ATOM   9285  C  CG    . LYS M  1 30  ? -15.422 -20.742 23.642  1.00 55.45  ? 273 LYS M CG    1 
ATOM   9286  C  CD    . LYS M  1 30  ? -16.664 -19.908 23.327  1.00 59.20  ? 273 LYS M CD    1 
ATOM   9287  C  CE    . LYS M  1 30  ? -16.394 -18.852 22.275  1.00 59.41  ? 273 LYS M CE    1 
ATOM   9288  N  NZ    . LYS M  1 30  ? -15.501 -17.816 22.855  1.00 63.66  ? 273 LYS M NZ    1 
ATOM   9289  N  N     . TRP M  1 31  ? -13.024 -22.654 22.708  1.00 36.31  ? 274 TRP M N     1 
ATOM   9290  C  CA    . TRP M  1 31  ? -12.412 -22.758 21.372  1.00 34.51  ? 274 TRP M CA    1 
ATOM   9291  C  C     . TRP M  1 31  ? -11.863 -24.163 21.211  1.00 32.50  ? 274 TRP M C     1 
ATOM   9292  O  O     . TRP M  1 31  ? -12.137 -24.844 20.220  1.00 29.62  ? 274 TRP M O     1 
ATOM   9293  C  CB    . TRP M  1 31  ? -11.356 -21.678 21.166  1.00 36.67  ? 274 TRP M CB    1 
ATOM   9294  C  CG    . TRP M  1 31  ? -11.952 -20.319 21.090  1.00 35.67  ? 274 TRP M CG    1 
ATOM   9295  C  CD1   . TRP M  1 31  ? -11.730 -19.271 21.933  1.00 37.78  ? 274 TRP M CD1   1 
ATOM   9296  C  CD2   . TRP M  1 31  ? -12.904 -19.867 20.122  1.00 33.04  ? 274 TRP M CD2   1 
ATOM   9297  N  NE1   . TRP M  1 31  ? -12.497 -18.179 21.539  1.00 37.32  ? 274 TRP M NE1   1 
ATOM   9298  C  CE2   . TRP M  1 31  ? -13.228 -18.530 20.437  1.00 36.36  ? 274 TRP M CE2   1 
ATOM   9299  C  CE3   . TRP M  1 31  ? -13.522 -20.470 19.026  1.00 33.74  ? 274 TRP M CE3   1 
ATOM   9300  C  CZ2   . TRP M  1 31  ? -14.154 -17.784 19.685  1.00 37.62  ? 274 TRP M CZ2   1 
ATOM   9301  C  CZ3   . TRP M  1 31  ? -14.429 -19.750 18.294  1.00 35.95  ? 274 TRP M CZ3   1 
ATOM   9302  C  CH2   . TRP M  1 31  ? -14.753 -18.418 18.630  1.00 35.77  ? 274 TRP M CH2   1 
ATOM   9303  N  N     . ARG M  1 32  ? -11.142 -24.647 22.223  1.00 34.24  ? 275 ARG M N     1 
ATOM   9304  C  CA    . ARG M  1 32  ? -10.758 -26.077 22.239  1.00 35.65  ? 275 ARG M CA    1 
ATOM   9305  C  C     . ARG M  1 32  ? -11.943 -27.010 22.042  1.00 29.28  ? 275 ARG M C     1 
ATOM   9306  O  O     . ARG M  1 32  ? -11.926 -27.901 21.213  1.00 28.83  ? 275 ARG M O     1 
ATOM   9307  C  CB    . ARG M  1 32  ? -10.043 -26.421 23.546  1.00 39.50  ? 275 ARG M CB    1 
ATOM   9308  C  CG    . ARG M  1 32  ? -9.801  -27.890 23.714  1.00 43.51  ? 275 ARG M CG    1 
ATOM   9309  C  CD    . ARG M  1 32  ? -8.689  -28.122 24.707  1.00 47.98  ? 275 ARG M CD    1 
ATOM   9310  N  NE    . ARG M  1 32  ? -7.429  -27.933 24.038  1.00 51.73  ? 275 ARG M NE    1 
ATOM   9311  C  CZ    . ARG M  1 32  ? -6.579  -26.958 24.286  1.00 54.90  ? 275 ARG M CZ    1 
ATOM   9312  N  NH1   . ARG M  1 32  ? -6.821  -26.080 25.248  1.00 57.91  ? 275 ARG M NH1   1 
ATOM   9313  N  NH2   . ARG M  1 32  ? -5.465  -26.883 23.569  1.00 54.79  ? 275 ARG M NH2   1 
ATOM   9314  N  N     . ALA M  1 33  ? -12.977 -26.782 22.809  1.00 31.78  ? 276 ALA M N     1 
ATOM   9315  C  CA    . ALA M  1 33  ? -14.179 -27.604 22.715  1.00 36.69  ? 276 ALA M CA    1 
ATOM   9316  C  C     . ALA M  1 33  ? -14.767 -27.523 21.308  1.00 37.13  ? 276 ALA M C     1 
ATOM   9317  O  O     . ALA M  1 33  ? -15.193 -28.525 20.697  1.00 38.68  ? 276 ALA M O     1 
ATOM   9318  C  CB    . ALA M  1 33  ? -15.193 -27.119 23.737  1.00 38.20  ? 276 ALA M CB    1 
ATOM   9319  N  N     . LEU M  1 34  ? -14.763 -26.328 20.743  1.00 35.53  ? 277 LEU M N     1 
ATOM   9320  C  CA    . LEU M  1 34  ? -15.297 -26.211 19.384  1.00 36.78  ? 277 LEU M CA    1 
ATOM   9321  C  C     . LEU M  1 34  ? -14.481 -27.039 18.397  1.00 31.83  ? 277 LEU M C     1 
ATOM   9322  O  O     . LEU M  1 34  ? -15.024 -27.679 17.506  1.00 33.23  ? 277 LEU M O     1 
ATOM   9323  C  CB    . LEU M  1 34  ? -15.381 -24.735 18.961  1.00 39.26  ? 277 LEU M CB    1 
ATOM   9324  C  CG    . LEU M  1 34  ? -15.359 -24.378 17.465  1.00 44.92  ? 277 LEU M CG    1 
ATOM   9325  C  CD1   . LEU M  1 34  ? -16.303 -25.194 16.556  1.00 44.30  ? 277 LEU M CD1   1 
ATOM   9326  C  CD2   . LEU M  1 34  ? -15.686 -22.887 17.395  1.00 48.51  ? 277 LEU M CD2   1 
ATOM   9327  N  N     . GLY M  1 35  ? -13.158 -27.042 18.527  1.00 32.91  ? 278 GLY M N     1 
ATOM   9328  C  CA    . GLY M  1 35  ? -12.343 -27.875 17.609  1.00 29.75  ? 278 GLY M CA    1 
ATOM   9329  C  C     . GLY M  1 35  ? -12.640 -29.345 17.796  1.00 29.42  ? 278 GLY M C     1 
ATOM   9330  O  O     . GLY M  1 35  ? -12.558 -30.146 16.847  1.00 29.99  ? 278 GLY M O     1 
ATOM   9331  N  N     . TYR M  1 36  ? -12.967 -29.733 19.026  1.00 30.65  ? 279 TYR M N     1 
ATOM   9332  C  CA    . TYR M  1 36  ? -13.380 -31.126 19.234  1.00 32.69  ? 279 TYR M CA    1 
ATOM   9333  C  C     . TYR M  1 36  ? -14.737 -31.357 18.561  1.00 33.42  ? 279 TYR M C     1 
ATOM   9334  O  O     . TYR M  1 36  ? -14.873 -32.235 17.715  1.00 30.99  ? 279 TYR M O     1 
ATOM   9335  C  CB    . TYR M  1 36  ? -13.448 -31.433 20.730  1.00 35.48  ? 279 TYR M CB    1 
ATOM   9336  C  CG    . TYR M  1 36  ? -12.116 -31.907 21.299  1.00 32.52  ? 279 TYR M CG    1 
ATOM   9337  C  CD1   . TYR M  1 36  ? -11.120 -31.004 21.612  1.00 31.31  ? 279 TYR M CD1   1 
ATOM   9338  C  CD2   . TYR M  1 36  ? -11.880 -33.247 21.548  1.00 29.96  ? 279 TYR M CD2   1 
ATOM   9339  C  CE1   . TYR M  1 36  ? -9.911  -31.419 22.118  1.00 32.82  ? 279 TYR M CE1   1 
ATOM   9340  C  CE2   . TYR M  1 36  ? -10.662 -33.666 22.068  1.00 32.96  ? 279 TYR M CE2   1 
ATOM   9341  C  CZ    . TYR M  1 36  ? -9.679  -32.737 22.335  1.00 32.10  ? 279 TYR M CZ    1 
ATOM   9342  O  OH    . TYR M  1 36  ? -8.482  -33.109 22.882  1.00 36.48  ? 279 TYR M OH    1 
ATOM   9343  N  N     . ALA M  1 37  ? -15.729 -30.531 18.921  1.00 38.25  ? 280 ALA M N     1 
ATOM   9344  C  CA    . ALA M  1 37  ? -17.091 -30.620 18.309  1.00 41.06  ? 280 ALA M CA    1 
ATOM   9345  C  C     . ALA M  1 37  ? -16.962 -30.718 16.821  1.00 38.89  ? 280 ALA M C     1 
ATOM   9346  O  O     . ALA M  1 37  ? -17.562 -31.586 16.189  1.00 42.11  ? 280 ALA M O     1 
ATOM   9347  C  CB    . ALA M  1 37  ? -17.962 -29.416 18.683  1.00 37.74  ? 280 ALA M CB    1 
ATOM   9348  N  N     . LYS M  1 38  ? -16.081 -29.878 16.281  1.00 43.16  ? 281 LYS M N     1 
ATOM   9349  C  CA    . LYS M  1 38  ? -15.871 -29.815 14.842  1.00 42.98  ? 281 LYS M CA    1 
ATOM   9350  C  C     . LYS M  1 38  ? -15.321 -31.111 14.350  1.00 39.38  ? 281 LYS M C     1 
ATOM   9351  O  O     . LYS M  1 38  ? -15.862 -31.654 13.396  1.00 44.02  ? 281 LYS M O     1 
ATOM   9352  C  CB    . LYS M  1 38  ? -14.965 -28.639 14.457  1.00 45.00  ? 281 LYS M CB    1 
ATOM   9353  C  CG    . LYS M  1 38  ? -15.241 -28.028 13.081  1.00 45.83  ? 281 LYS M CG    1 
ATOM   9354  C  CD    . LYS M  1 38  ? -14.132 -27.036 12.679  1.00 50.44  ? 281 LYS M CD    1 
ATOM   9355  C  CE    . LYS M  1 38  ? -14.313 -26.322 11.330  1.00 49.76  ? 281 LYS M CE    1 
ATOM   9356  N  NZ    . LYS M  1 38  ? -14.942 -27.171 10.271  1.00 48.93  ? 281 LYS M NZ    1 
ATOM   9357  N  N     . ALA M  1 39  ? -14.266 -31.648 14.989  1.00 39.79  ? 282 ALA M N     1 
ATOM   9358  C  CA    . ALA M  1 39  ? -13.596 -32.876 14.466  1.00 34.46  ? 282 ALA M CA    1 
ATOM   9359  C  C     . ALA M  1 39  ? -14.487 -34.130 14.506  1.00 36.25  ? 282 ALA M C     1 
ATOM   9360  O  O     . ALA M  1 39  ? -14.338 -35.036 13.693  1.00 34.76  ? 282 ALA M O     1 
ATOM   9361  C  CB    . ALA M  1 39  ? -12.320 -33.145 15.226  1.00 36.38  ? 282 ALA M CB    1 
ATOM   9362  N  N     . ILE M  1 40  ? -15.382 -34.215 15.474  1.00 39.02  ? 283 ILE M N     1 
ATOM   9363  C  CA    . ILE M  1 40  ? -16.289 -35.358 15.494  1.00 47.92  ? 283 ILE M CA    1 
ATOM   9364  C  C     . ILE M  1 40  ? -17.027 -35.536 14.124  1.00 52.49  ? 283 ILE M C     1 
ATOM   9365  O  O     . ILE M  1 40  ? -17.339 -36.659 13.706  1.00 54.36  ? 283 ILE M O     1 
ATOM   9366  C  CB    . ILE M  1 40  ? -17.362 -35.286 16.612  1.00 50.79  ? 283 ILE M CB    1 
ATOM   9367  C  CG1   . ILE M  1 40  ? -16.908 -34.606 17.914  1.00 46.68  ? 283 ILE M CG1   1 
ATOM   9368  C  CG2   . ILE M  1 40  ? -17.832 -36.689 16.941  1.00 55.38  ? 283 ILE M CG2   1 
ATOM   9369  C  CD1   . ILE M  1 40  ? -15.945 -35.382 18.796  1.00 44.71  ? 283 ILE M CD1   1 
ATOM   9370  N  N     . ASN M  1 41  ? -17.284 -34.438 13.406  1.00 52.50  ? 284 ASN M N     1 
ATOM   9371  C  CA    . ASN M  1 41  ? -18.069 -34.505 12.169  1.00 39.96  ? 284 ASN M CA    1 
ATOM   9372  C  C     . ASN M  1 41  ? -17.237 -35.050 10.999  1.00 45.00  ? 284 ASN M C     1 
ATOM   9373  O  O     . ASN M  1 41  ? -17.622 -36.013 10.275  1.00 38.35  ? 284 ASN M O     1 
ATOM   9374  C  CB    . ASN M  1 41  ? -18.637 -33.155 11.883  1.00 42.57  ? 284 ASN M CB    1 
ATOM   9375  C  CG    . ASN M  1 41  ? -19.536 -32.648 13.022  1.00 46.36  ? 284 ASN M CG    1 
ATOM   9376  O  OD1   . ASN M  1 41  ? -19.362 -33.060 14.171  1.00 52.89  ? 284 ASN M OD1   1 
ATOM   9377  N  ND2   . ASN M  1 41  ? -20.495 -31.764 12.708  1.00 40.11  ? 284 ASN M ND2   1 
ATOM   9378  N  N     . ALA M  1 42  ? -16.068 -34.472 10.800  1.00 43.23  ? 285 ALA M N     1 
ATOM   9379  C  CA    . ALA M  1 42  ? -15.219 -35.037 9.786   1.00 51.21  ? 285 ALA M CA    1 
ATOM   9380  C  C     . ALA M  1 42  ? -15.131 -36.574 10.033  1.00 55.99  ? 285 ALA M C     1 
ATOM   9381  O  O     . ALA M  1 42  ? -15.034 -37.374 9.099   1.00 59.46  ? 285 ALA M O     1 
ATOM   9382  C  CB    . ALA M  1 42  ? -13.848 -34.376 9.809   1.00 52.98  ? 285 ALA M CB    1 
ATOM   9383  N  N     . LEU M  1 43  ? -15.179 -36.966 11.304  1.00 51.98  ? 286 LEU M N     1 
ATOM   9384  C  CA    . LEU M  1 43  ? -15.127 -38.361 11.692  1.00 46.65  ? 286 LEU M CA    1 
ATOM   9385  C  C     . LEU M  1 43  ? -16.445 -39.066 11.383  1.00 45.76  ? 286 LEU M C     1 
ATOM   9386  O  O     . LEU M  1 43  ? -16.481 -40.009 10.594  1.00 42.34  ? 286 LEU M O     1 
ATOM   9387  C  CB    . LEU M  1 43  ? -14.826 -38.450 13.200  1.00 44.28  ? 286 LEU M CB    1 
ATOM   9388  C  CG    . LEU M  1 43  ? -13.440 -38.967 13.581  1.00 42.29  ? 286 LEU M CG    1 
ATOM   9389  C  CD1   . LEU M  1 43  ? -12.444 -39.072 12.438  1.00 37.50  ? 286 LEU M CD1   1 
ATOM   9390  C  CD2   . LEU M  1 43  ? -12.912 -38.135 14.735  1.00 41.91  ? 286 LEU M CD2   1 
ATOM   9391  N  N     . LYS M  1 44  ? -17.501 -38.618 12.048  1.00 40.25  ? 287 LYS M N     1 
ATOM   9392  C  CA    . LYS M  1 44  ? -18.823 -39.082 11.789  1.00 48.89  ? 287 LYS M CA    1 
ATOM   9393  C  C     . LYS M  1 44  ? -18.993 -39.506 10.340  1.00 55.54  ? 287 LYS M C     1 
ATOM   9394  O  O     . LYS M  1 44  ? -19.135 -40.719 10.058  1.00 50.26  ? 287 LYS M O     1 
ATOM   9395  C  CB    . LYS M  1 44  ? -19.822 -37.980 12.092  1.00 47.89  ? 287 LYS M CB    1 
ATOM   9396  C  CG    . LYS M  1 44  ? -20.878 -38.404 13.064  1.00 45.69  ? 287 LYS M CG    1 
ATOM   9397  C  CD    . LYS M  1 44  ? -20.576 -37.921 14.458  1.00 47.16  ? 287 LYS M CD    1 
ATOM   9398  C  CE    . LYS M  1 44  ? -21.872 -37.718 15.232  1.00 47.21  ? 287 LYS M CE    1 
ATOM   9399  N  NZ    . LYS M  1 44  ? -21.621 -37.624 16.685  1.00 50.80  ? 287 LYS M NZ    1 
ATOM   9400  N  N     . SER M  1 45  ? -18.983 -38.528 9.419   1.00 49.90  ? 288 SER M N     1 
ATOM   9401  C  CA    . SER M  1 45  ? -19.041 -38.878 8.014   1.00 49.61  ? 288 SER M CA    1 
ATOM   9402  C  C     . SER M  1 45  ? -17.634 -39.119 7.549   1.00 48.96  ? 288 SER M C     1 
ATOM   9403  O  O     . SER M  1 45  ? -16.691 -38.575 8.100   1.00 50.75  ? 288 SER M O     1 
ATOM   9404  C  CB    . SER M  1 45  ? -19.638 -37.767 7.166   1.00 46.65  ? 288 SER M CB    1 
ATOM   9405  O  OG    . SER M  1 45  ? -18.696 -36.727 7.027   1.00 52.66  ? 288 SER M OG    1 
ATOM   9406  N  N     . PHE M  1 46  ? -17.492 -39.896 6.500   1.00 42.49  ? 289 PHE M N     1 
ATOM   9407  C  CA    . PHE M  1 46  ? -16.182 -40.202 5.985   1.00 50.24  ? 289 PHE M CA    1 
ATOM   9408  C  C     . PHE M  1 46  ? -16.427 -41.562 5.383   1.00 52.42  ? 289 PHE M C     1 
ATOM   9409  O  O     . PHE M  1 46  ? -16.901 -42.489 6.064   1.00 49.51  ? 289 PHE M O     1 
ATOM   9410  C  CB    . PHE M  1 46  ? -15.030 -40.204 7.052   1.00 48.93  ? 289 PHE M CB    1 
ATOM   9411  C  CG    . PHE M  1 46  ? -13.653 -40.300 6.441   1.00 50.12  ? 289 PHE M CG    1 
ATOM   9412  C  CD1   . PHE M  1 46  ? -13.167 -39.265 5.656   1.00 48.88  ? 289 PHE M CD1   1 
ATOM   9413  C  CD2   . PHE M  1 46  ? -12.879 -41.430 6.589   1.00 50.17  ? 289 PHE M CD2   1 
ATOM   9414  C  CE1   . PHE M  1 46  ? -11.930 -39.347 5.056   1.00 47.87  ? 289 PHE M CE1   1 
ATOM   9415  C  CE2   . PHE M  1 46  ? -11.625 -41.519 6.001   1.00 53.26  ? 289 PHE M CE2   1 
ATOM   9416  C  CZ    . PHE M  1 46  ? -11.153 -40.476 5.234   1.00 55.11  ? 289 PHE M CZ    1 
ATOM   9417  N  N     . HIS M  1 47  ? -16.176 -41.662 4.085   1.00 51.87  ? 290 HIS M N     1 
ATOM   9418  C  CA    . HIS M  1 47  ? -16.630 -42.803 3.328   1.00 50.98  ? 290 HIS M CA    1 
ATOM   9419  C  C     . HIS M  1 47  ? -16.222 -44.170 3.914   1.00 58.33  ? 290 HIS M C     1 
ATOM   9420  O  O     . HIS M  1 47  ? -16.438 -45.213 3.284   1.00 62.61  ? 290 HIS M O     1 
ATOM   9421  C  CB    . HIS M  1 47  ? -16.080 -42.686 1.938   1.00 48.45  ? 290 HIS M CB    1 
ATOM   9422  C  CG    . HIS M  1 47  ? -14.589 -42.775 1.873   1.00 49.31  ? 290 HIS M CG    1 
ATOM   9423  N  ND1   . HIS M  1 47  ? -13.765 -41.731 2.238   1.00 46.61  ? 290 HIS M ND1   1 
ATOM   9424  C  CD2   . HIS M  1 47  ? -13.774 -43.774 1.456   1.00 49.67  ? 290 HIS M CD2   1 
ATOM   9425  C  CE1   . HIS M  1 47  ? -12.505 -42.086 2.050   1.00 49.54  ? 290 HIS M CE1   1 
ATOM   9426  N  NE2   . HIS M  1 47  ? -12.482 -43.323 1.584   1.00 51.62  ? 290 HIS M NE2   1 
ATOM   9427  N  N     . LYS M  1 48  ? -15.688 -44.168 5.136   1.00 54.46  ? 291 LYS M N     1 
ATOM   9428  C  CA    . LYS M  1 48  ? -14.695 -45.132 5.546   1.00 49.25  ? 291 LYS M CA    1 
ATOM   9429  C  C     . LYS M  1 48  ? -14.512 -44.948 7.065   1.00 57.08  ? 291 LYS M C     1 
ATOM   9430  O  O     . LYS M  1 48  ? -14.822 -43.875 7.608   1.00 61.47  ? 291 LYS M O     1 
ATOM   9431  C  CB    . LYS M  1 48  ? -13.396 -44.796 4.819   1.00 47.58  ? 291 LYS M CB    1 
ATOM   9432  C  CG    . LYS M  1 48  ? -12.524 -45.958 4.438   1.00 45.24  ? 291 LYS M CG    1 
ATOM   9433  C  CD    . LYS M  1 48  ? -11.099 -45.740 4.906   1.00 44.11  ? 291 LYS M CD    1 
ATOM   9434  C  CE    . LYS M  1 48  ? -10.173 -46.804 4.293   1.00 46.52  ? 291 LYS M CE    1 
ATOM   9435  N  NZ    . LYS M  1 48  ? -8.846  -46.975 4.970   1.00 43.95  ? 291 LYS M NZ    1 
ATOM   9436  N  N     . PRO M  1 49  ? -14.077 -45.998 7.776   1.00 56.75  ? 292 PRO M N     1 
ATOM   9437  C  CA    . PRO M  1 49  ? -13.595 -45.727 9.123   1.00 55.74  ? 292 PRO M CA    1 
ATOM   9438  C  C     . PRO M  1 49  ? -12.107 -45.392 9.000   1.00 50.69  ? 292 PRO M C     1 
ATOM   9439  O  O     . PRO M  1 49  ? -11.379 -46.034 8.208   1.00 47.47  ? 292 PRO M O     1 
ATOM   9440  C  CB    . PRO M  1 49  ? -13.809 -47.067 9.849   1.00 56.06  ? 292 PRO M CB    1 
ATOM   9441  C  CG    . PRO M  1 49  ? -13.669 -48.106 8.778   1.00 55.97  ? 292 PRO M CG    1 
ATOM   9442  C  CD    . PRO M  1 49  ? -14.204 -47.451 7.516   1.00 58.83  ? 292 PRO M CD    1 
ATOM   9443  N  N     . VAL M  1 50  ? -11.623 -44.422 9.761   1.00 47.52  ? 293 VAL M N     1 
ATOM   9444  C  CA    . VAL M  1 50  ? -10.226 -44.042 9.521   1.00 43.38  ? 293 VAL M CA    1 
ATOM   9445  C  C     . VAL M  1 50  ? -9.310  -45.095 10.093  1.00 41.33  ? 293 VAL M C     1 
ATOM   9446  O  O     . VAL M  1 50  ? -9.502  -45.524 11.210  1.00 42.35  ? 293 VAL M O     1 
ATOM   9447  C  CB    . VAL M  1 50  ? -9.862  -42.590 9.937   1.00 43.79  ? 293 VAL M CB    1 
ATOM   9448  C  CG1   . VAL M  1 50  ? -10.882 -41.967 10.875  1.00 43.47  ? 293 VAL M CG1   1 
ATOM   9449  C  CG2   . VAL M  1 50  ? -8.432  -42.503 10.465  1.00 44.65  ? 293 VAL M CG2   1 
ATOM   9450  N  N     . THR M  1 51  ? -8.323  -45.498 9.297   1.00 40.45  ? 294 THR M N     1 
ATOM   9451  C  CA    . THR M  1 51  ? -7.382  -46.533 9.649   1.00 43.26  ? 294 THR M CA    1 
ATOM   9452  C  C     . THR M  1 51  ? -5.900  -46.109 9.711   1.00 43.32  ? 294 THR M C     1 
ATOM   9453  O  O     . THR M  1 51  ? -5.024  -46.960 9.855   1.00 47.76  ? 294 THR M O     1 
ATOM   9454  C  CB    . THR M  1 51  ? -7.481  -47.669 8.595   1.00 47.26  ? 294 THR M CB    1 
ATOM   9455  O  OG1   . THR M  1 51  ? -6.874  -47.244 7.371   1.00 43.69  ? 294 THR M OG1   1 
ATOM   9456  C  CG2   . THR M  1 51  ? -8.972  -48.061 8.323   1.00 47.04  ? 294 THR M CG2   1 
ATOM   9457  N  N     . SER M  1 52  ? -5.578  -44.836 9.503   1.00 43.17  ? 295 SER M N     1 
ATOM   9458  C  CA    . SER M  1 52  ? -4.160  -44.427 9.590   1.00 41.10  ? 295 SER M CA    1 
ATOM   9459  C  C     . SER M  1 52  ? -4.022  -42.999 10.058  1.00 34.06  ? 295 SER M C     1 
ATOM   9460  O  O     . SER M  1 52  ? -4.949  -42.223 9.995   1.00 33.10  ? 295 SER M O     1 
ATOM   9461  C  CB    . SER M  1 52  ? -3.403  -44.647 8.272   1.00 41.77  ? 295 SER M CB    1 
ATOM   9462  O  OG    . SER M  1 52  ? -3.602  -43.551 7.386   1.00 39.92  ? 295 SER M OG    1 
ATOM   9463  N  N     . TYR M  1 53  ? -2.850  -42.668 10.581  1.00 37.11  ? 296 TYR M N     1 
ATOM   9464  C  CA    . TYR M  1 53  ? -2.604  -41.299 11.106  1.00 35.39  ? 296 TYR M CA    1 
ATOM   9465  C  C     . TYR M  1 53  ? -2.567  -40.312 9.947   1.00 31.69  ? 296 TYR M C     1 
ATOM   9466  O  O     . TYR M  1 53  ? -3.249  -39.287 9.970   1.00 27.42  ? 296 TYR M O     1 
ATOM   9467  C  CB    . TYR M  1 53  ? -1.299  -41.300 11.880  1.00 38.85  ? 296 TYR M CB    1 
ATOM   9468  C  CG    . TYR M  1 53  ? -0.787  -39.962 12.278  1.00 41.87  ? 296 TYR M CG    1 
ATOM   9469  C  CD1   . TYR M  1 53  ? 0.051   -39.239 11.435  1.00 45.03  ? 296 TYR M CD1   1 
ATOM   9470  C  CD2   . TYR M  1 53  ? -1.079  -39.442 13.518  1.00 42.43  ? 296 TYR M CD2   1 
ATOM   9471  C  CE1   . TYR M  1 53  ? 0.564   -38.005 11.818  1.00 45.55  ? 296 TYR M CE1   1 
ATOM   9472  C  CE2   . TYR M  1 53  ? -0.576  -38.224 13.916  1.00 46.81  ? 296 TYR M CE2   1 
ATOM   9473  C  CZ    . TYR M  1 53  ? 0.239   -37.503 13.063  1.00 47.76  ? 296 TYR M CZ    1 
ATOM   9474  O  OH    . TYR M  1 53  ? 0.710   -36.282 13.476  1.00 49.07  ? 296 TYR M OH    1 
ATOM   9475  N  N     . GLN M  1 54  ? -1.839  -40.669 8.900   1.00 34.97  ? 297 GLN M N     1 
ATOM   9476  C  CA    . GLN M  1 54  ? -1.818  -39.850 7.667   1.00 45.78  ? 297 GLN M CA    1 
ATOM   9477  C  C     . GLN M  1 54  ? -3.189  -39.628 7.128   1.00 45.24  ? 297 GLN M C     1 
ATOM   9478  O  O     . GLN M  1 54  ? -3.625  -38.505 6.844   1.00 52.88  ? 297 GLN M O     1 
ATOM   9479  C  CB    . GLN M  1 54  ? -0.999  -40.534 6.588   1.00 51.82  ? 297 GLN M CB    1 
ATOM   9480  C  CG    . GLN M  1 54  ? -0.899  -39.751 5.291   1.00 52.73  ? 297 GLN M CG    1 
ATOM   9481  C  CD    . GLN M  1 54  ? 0.263   -40.244 4.484   1.00 53.31  ? 297 GLN M CD    1 
ATOM   9482  O  OE1   . GLN M  1 54  ? 0.679   -41.381 4.645   1.00 62.97  ? 297 GLN M OE1   1 
ATOM   9483  N  NE2   . GLN M  1 54  ? 0.817   -39.395 3.632   1.00 59.67  ? 297 GLN M NE2   1 
ATOM   9484  N  N     . GLU M  1 55  ? -3.909  -40.723 7.028   1.00 47.84  ? 298 GLU M N     1 
ATOM   9485  C  CA    . GLU M  1 55  ? -5.253  -40.652 6.555   1.00 47.18  ? 298 GLU M CA    1 
ATOM   9486  C  C     . GLU M  1 55  ? -6.063  -39.728 7.425   1.00 41.02  ? 298 GLU M C     1 
ATOM   9487  O  O     . GLU M  1 55  ? -6.813  -38.890 6.937   1.00 40.33  ? 298 GLU M O     1 
ATOM   9488  C  CB    . GLU M  1 55  ? -5.843  -42.054 6.529   1.00 52.99  ? 298 GLU M CB    1 
ATOM   9489  C  CG    . GLU M  1 55  ? -7.248  -42.134 5.995   1.00 55.81  ? 298 GLU M CG    1 
ATOM   9490  C  CD    . GLU M  1 55  ? -7.649  -43.579 5.739   1.00 62.27  ? 298 GLU M CD    1 
ATOM   9491  O  OE1   . GLU M  1 55  ? -7.001  -44.490 6.316   1.00 57.99  ? 298 GLU M OE1   1 
ATOM   9492  O  OE2   . GLU M  1 55  ? -8.598  -43.791 4.953   1.00 59.96  ? 298 GLU M OE2   1 
ATOM   9493  N  N     . ALA M  1 56  ? -5.949  -39.873 8.738   1.00 45.17  ? 299 ALA M N     1 
ATOM   9494  C  CA    . ALA M  1 56  ? -6.687  -38.953 9.628   1.00 42.79  ? 299 ALA M CA    1 
ATOM   9495  C  C     . ALA M  1 56  ? -6.304  -37.464 9.458   1.00 41.72  ? 299 ALA M C     1 
ATOM   9496  O  O     . ALA M  1 56  ? -7.170  -36.579 9.573   1.00 45.50  ? 299 ALA M O     1 
ATOM   9497  C  CB    . ALA M  1 56  ? -6.493  -39.357 11.067  1.00 42.71  ? 299 ALA M CB    1 
ATOM   9498  N  N     . CYS M  1 57  ? -5.012  -37.191 9.255   1.00 39.45  ? 300 CYS M N     1 
ATOM   9499  C  CA    . CYS M  1 57  ? -4.526  -35.787 9.153   1.00 46.29  ? 300 CYS M CA    1 
ATOM   9500  C  C     . CYS M  1 57  ? -5.044  -35.140 7.908   1.00 43.18  ? 300 CYS M C     1 
ATOM   9501  O  O     . CYS M  1 57  ? -5.516  -33.995 7.930   1.00 41.88  ? 300 CYS M O     1 
ATOM   9502  C  CB    . CYS M  1 57  ? -3.008  -35.715 9.106   1.00 43.29  ? 300 CYS M CB    1 
ATOM   9503  S  SG    . CYS M  1 57  ? -2.273  -35.883 10.735  1.00 47.48  ? 300 CYS M SG    1 
ATOM   9504  N  N     . SER M  1 58  ? -4.968  -35.925 6.835   1.00 47.13  ? 301 SER M N     1 
ATOM   9505  C  CA    . SER M  1 58  ? -5.467  -35.527 5.542   1.00 49.16  ? 301 SER M CA    1 
ATOM   9506  C  C     . SER M  1 58  ? -6.968  -35.363 5.547   1.00 45.86  ? 301 SER M C     1 
ATOM   9507  O  O     . SER M  1 58  ? -7.563  -35.529 4.529   1.00 50.17  ? 301 SER M O     1 
ATOM   9508  C  CB    . SER M  1 58  ? -5.051  -36.550 4.471   1.00 49.20  ? 301 SER M CB    1 
ATOM   9509  O  OG    . SER M  1 58  ? -5.675  -37.812 4.664   1.00 53.20  ? 301 SER M OG    1 
ATOM   9510  N  N     . ILE M  1 59  ? -7.591  -35.048 6.681   1.00 45.78  ? 302 ILE M N     1 
ATOM   9511  C  CA    . ILE M  1 59  ? -8.978  -34.644 6.658   1.00 43.14  ? 302 ILE M CA    1 
ATOM   9512  C  C     . ILE M  1 59  ? -9.261  -33.428 7.527   1.00 51.47  ? 302 ILE M C     1 
ATOM   9513  O  O     . ILE M  1 59  ? -8.707  -33.287 8.601   1.00 60.69  ? 302 ILE M O     1 
ATOM   9514  C  CB    . ILE M  1 59  ? -9.900  -35.842 6.940   1.00 47.12  ? 302 ILE M CB    1 
ATOM   9515  C  CG1   . ILE M  1 59  ? -10.787 -35.649 8.152   1.00 43.06  ? 302 ILE M CG1   1 
ATOM   9516  C  CG2   . ILE M  1 59  ? -9.130  -37.194 6.962   1.00 47.27  ? 302 ILE M CG2   1 
ATOM   9517  C  CD1   . ILE M  1 59  ? -11.625 -36.908 8.350   1.00 49.55  ? 302 ILE M CD1   1 
ATOM   9518  N  N     . PRO M  1 60  ? -10.147 -32.535 7.061   1.00 53.53  ? 303 PRO M N     1 
ATOM   9519  C  CA    . PRO M  1 60  ? -10.098 -31.192 7.542   1.00 50.65  ? 303 PRO M CA    1 
ATOM   9520  C  C     . PRO M  1 60  ? -10.875 -30.991 8.800   1.00 46.46  ? 303 PRO M C     1 
ATOM   9521  O  O     . PRO M  1 60  ? -12.028 -31.364 8.868   1.00 47.94  ? 303 PRO M O     1 
ATOM   9522  C  CB    . PRO M  1 60  ? -10.743 -30.399 6.402   1.00 57.20  ? 303 PRO M CB    1 
ATOM   9523  C  CG    . PRO M  1 60  ? -11.658 -31.373 5.719   1.00 58.30  ? 303 PRO M CG    1 
ATOM   9524  C  CD    . PRO M  1 60  ? -11.343 -32.747 6.230   1.00 55.67  ? 303 PRO M CD    1 
ATOM   9525  N  N     . GLY M  1 61  ? -10.250 -30.309 9.756   1.00 45.32  ? 304 GLY M N     1 
ATOM   9526  C  CA    . GLY M  1 61  ? -10.759 -30.170 11.123  1.00 41.33  ? 304 GLY M CA    1 
ATOM   9527  C  C     . GLY M  1 61  ? -10.067 -31.140 12.079  1.00 39.20  ? 304 GLY M C     1 
ATOM   9528  O  O     . GLY M  1 61  ? -10.320 -31.088 13.275  1.00 40.63  ? 304 GLY M O     1 
ATOM   9529  N  N     . ILE M  1 62  ? -9.235  -32.026 11.531  1.00 37.59  ? 305 ILE M N     1 
ATOM   9530  C  CA    . ILE M  1 62  ? -8.375  -32.950 12.289  1.00 39.26  ? 305 ILE M CA    1 
ATOM   9531  C  C     . ILE M  1 62  ? -6.903  -32.771 11.957  1.00 31.87  ? 305 ILE M C     1 
ATOM   9532  O  O     . ILE M  1 62  ? -6.519  -32.931 10.825  1.00 37.48  ? 305 ILE M O     1 
ATOM   9533  C  CB    . ILE M  1 62  ? -8.728  -34.430 12.006  1.00 37.34  ? 305 ILE M CB    1 
ATOM   9534  C  CG1   . ILE M  1 62  ? -10.093 -34.760 12.628  1.00 39.08  ? 305 ILE M CG1   1 
ATOM   9535  C  CG2   . ILE M  1 62  ? -7.650  -35.372 12.542  1.00 35.42  ? 305 ILE M CG2   1 
ATOM   9536  C  CD1   . ILE M  1 62  ? -10.797 -35.899 11.934  1.00 36.18  ? 305 ILE M CD1   1 
ATOM   9537  N  N     . GLY M  1 63  ? -6.103  -32.493 12.986  1.00 33.15  ? 306 GLY M N     1 
ATOM   9538  C  CA    . GLY M  1 63  ? -4.669  -32.177 12.858  1.00 31.09  ? 306 GLY M CA    1 
ATOM   9539  C  C     . GLY M  1 63  ? -3.859  -33.200 13.662  1.00 34.77  ? 306 GLY M C     1 
ATOM   9540  O  O     . GLY M  1 63  ? -4.363  -34.280 14.002  1.00 34.51  ? 306 GLY M O     1 
ATOM   9541  N  N     . LYS M  1 64  ? -2.610  -32.870 13.957  1.00 30.36  ? 307 LYS M N     1 
ATOM   9542  C  CA    . LYS M  1 64  ? -1.749  -33.742 14.706  1.00 34.15  ? 307 LYS M CA    1 
ATOM   9543  C  C     . LYS M  1 64  ? -2.369  -34.204 16.032  1.00 34.66  ? 307 LYS M C     1 
ATOM   9544  O  O     . LYS M  1 64  ? -2.482  -35.394 16.302  1.00 39.58  ? 307 LYS M O     1 
ATOM   9545  C  CB    . LYS M  1 64  ? -0.408  -33.068 14.964  1.00 36.31  ? 307 LYS M CB    1 
ATOM   9546  C  CG    . LYS M  1 64  ? 0.393   -33.802 16.047  1.00 45.79  ? 307 LYS M CG    1 
ATOM   9547  C  CD    . LYS M  1 64  ? 1.828   -33.312 16.281  1.00 46.25  ? 307 LYS M CD    1 
ATOM   9548  C  CE    . LYS M  1 64  ? 2.632   -33.293 14.996  1.00 47.98  ? 307 LYS M CE    1 
ATOM   9549  N  NZ    . LYS M  1 64  ? 3.899   -32.580 15.268  1.00 50.45  ? 307 LYS M NZ    1 
ATOM   9550  N  N     . ARG M  1 65  ? -2.744  -33.261 16.864  1.00 35.79  ? 308 ARG M N     1 
ATOM   9551  C  CA    . ARG M  1 65  ? -3.220  -33.588 18.185  1.00 40.22  ? 308 ARG M CA    1 
ATOM   9552  C  C     . ARG M  1 65  ? -4.347  -34.587 18.067  1.00 39.38  ? 308 ARG M C     1 
ATOM   9553  O  O     . ARG M  1 65  ? -4.317  -35.663 18.669  1.00 39.07  ? 308 ARG M O     1 
ATOM   9554  C  CB    . ARG M  1 65  ? -3.748  -32.354 18.904  1.00 45.30  ? 308 ARG M CB    1 
ATOM   9555  C  CG    . ARG M  1 65  ? -2.820  -31.151 18.902  1.00 52.20  ? 308 ARG M CG    1 
ATOM   9556  C  CD    . ARG M  1 65  ? -1.412  -31.452 19.388  1.00 56.66  ? 308 ARG M CD    1 
ATOM   9557  N  NE    . ARG M  1 65  ? -1.399  -32.285 20.581  1.00 64.80  ? 308 ARG M NE    1 
ATOM   9558  C  CZ    . ARG M  1 65  ? -1.904  -31.933 21.766  1.00 68.35  ? 308 ARG M CZ    1 
ATOM   9559  N  NH1   . ARG M  1 65  ? -2.504  -30.748 21.945  1.00 68.88  ? 308 ARG M NH1   1 
ATOM   9560  N  NH2   . ARG M  1 65  ? -1.835  -32.794 22.781  1.00 62.88  ? 308 ARG M NH2   1 
ATOM   9561  N  N     . MET M  1 66  ? -5.348  -34.220 17.281  1.00 37.51  ? 309 MET M N     1 
ATOM   9562  C  CA    . MET M  1 66  ? -6.582  -35.001 17.207  1.00 36.53  ? 309 MET M CA    1 
ATOM   9563  C  C     . MET M  1 66  ? -6.319  -36.351 16.628  1.00 33.57  ? 309 MET M C     1 
ATOM   9564  O  O     . MET M  1 66  ? -6.920  -37.339 17.024  1.00 37.39  ? 309 MET M O     1 
ATOM   9565  C  CB    . MET M  1 66  ? -7.644  -34.277 16.393  1.00 37.97  ? 309 MET M CB    1 
ATOM   9566  C  CG    . MET M  1 66  ? -9.054  -34.776 16.656  1.00 38.55  ? 309 MET M CG    1 
ATOM   9567  S  SD    . MET M  1 66  ? -9.658  -34.409 18.308  1.00 41.84  ? 309 MET M SD    1 
ATOM   9568  C  CE    . MET M  1 66  ? -9.785  -32.634 18.417  1.00 37.64  ? 309 MET M CE    1 
ATOM   9569  N  N     . ALA M  1 67  ? -5.395  -36.406 15.700  1.00 30.97  ? 310 ALA M N     1 
ATOM   9570  C  CA    . ALA M  1 67  ? -5.012  -37.650 15.128  1.00 32.61  ? 310 ALA M CA    1 
ATOM   9571  C  C     . ALA M  1 67  ? -4.286  -38.586 16.116  1.00 35.95  ? 310 ALA M C     1 
ATOM   9572  O  O     . ALA M  1 67  ? -4.467  -39.789 16.081  1.00 39.04  ? 310 ALA M O     1 
ATOM   9573  C  CB    . ALA M  1 67  ? -4.104  -37.352 13.968  1.00 35.22  ? 310 ALA M CB    1 
ATOM   9574  N  N     . GLU M  1 68  ? -3.409  -38.047 16.950  1.00 32.45  ? 311 GLU M N     1 
ATOM   9575  C  CA    . GLU M  1 68  ? -2.741  -38.882 17.944  1.00 33.46  ? 311 GLU M CA    1 
ATOM   9576  C  C     . GLU M  1 68  ? -3.748  -39.593 18.827  1.00 31.45  ? 311 GLU M C     1 
ATOM   9577  O  O     . GLU M  1 68  ? -3.528  -40.709 19.247  1.00 30.90  ? 311 GLU M O     1 
ATOM   9578  C  CB    . GLU M  1 68  ? -1.856  -38.042 18.836  1.00 32.18  ? 311 GLU M CB    1 
ATOM   9579  C  CG    . GLU M  1 68  ? -0.585  -37.682 18.146  1.00 38.77  ? 311 GLU M CG    1 
ATOM   9580  C  CD    . GLU M  1 68  ? 0.150   -36.526 18.799  1.00 43.04  ? 311 GLU M CD    1 
ATOM   9581  O  OE1   . GLU M  1 68  ? -0.416  -35.851 19.677  1.00 45.96  ? 311 GLU M OE1   1 
ATOM   9582  O  OE2   . GLU M  1 68  ? 1.312   -36.288 18.405  1.00 49.41  ? 311 GLU M OE2   1 
ATOM   9583  N  N     . LYS M  1 69  ? -4.849  -38.920 19.112  1.00 29.59  ? 312 LYS M N     1 
ATOM   9584  C  CA    . LYS M  1 69  ? -5.918  -39.497 19.897  1.00 28.75  ? 312 LYS M CA    1 
ATOM   9585  C  C     . LYS M  1 69  ? -6.613  -40.558 19.104  1.00 31.91  ? 312 LYS M C     1 
ATOM   9586  O  O     . LYS M  1 69  ? -6.943  -41.636 19.632  1.00 30.02  ? 312 LYS M O     1 
ATOM   9587  C  CB    . LYS M  1 69  ? -6.865  -38.383 20.333  1.00 29.30  ? 312 LYS M CB    1 
ATOM   9588  C  CG    . LYS M  1 69  ? -6.155  -37.485 21.309  1.00 30.13  ? 312 LYS M CG    1 
ATOM   9589  C  CD    . LYS M  1 69  ? -7.054  -36.555 22.075  1.00 34.60  ? 312 LYS M CD    1 
ATOM   9590  C  CE    . LYS M  1 69  ? -6.221  -35.594 22.932  1.00 33.03  ? 312 LYS M CE    1 
ATOM   9591  N  NZ    . LYS M  1 69  ? -5.477  -34.636 22.071  1.00 32.80  ? 312 LYS M NZ    1 
ATOM   9592  N  N     . ILE M  1 70  ? -6.756  -40.337 17.804  1.00 31.63  ? 313 ILE M N     1 
ATOM   9593  C  CA    . ILE M  1 70  ? -7.393  -41.362 17.018  1.00 33.03  ? 313 ILE M CA    1 
ATOM   9594  C  C     . ILE M  1 70  ? -6.589  -42.620 17.047  1.00 33.48  ? 313 ILE M C     1 
ATOM   9595  O  O     . ILE M  1 70  ? -7.158  -43.718 17.192  1.00 34.31  ? 313 ILE M O     1 
ATOM   9596  C  CB    . ILE M  1 70  ? -7.685  -40.933 15.584  1.00 33.20  ? 313 ILE M CB    1 
ATOM   9597  C  CG1   . ILE M  1 70  ? -8.876  -39.988 15.602  1.00 33.27  ? 313 ILE M CG1   1 
ATOM   9598  C  CG2   . ILE M  1 70  ? -7.976  -42.146 14.700  1.00 34.22  ? 313 ILE M CG2   1 
ATOM   9599  C  CD1   . ILE M  1 70  ? -9.009  -39.177 14.332  1.00 37.01  ? 313 ILE M CD1   1 
ATOM   9600  N  N     . ILE M  1 71  ? -5.283  -42.469 16.891  1.00 32.79  ? 314 ILE M N     1 
ATOM   9601  C  CA    . ILE M  1 71  ? -4.424  -43.629 16.817  1.00 33.12  ? 314 ILE M CA    1 
ATOM   9602  C  C     . ILE M  1 71  ? -4.340  -44.267 18.195  1.00 31.39  ? 314 ILE M C     1 
ATOM   9603  O  O     . ILE M  1 71  ? -4.283  -45.478 18.301  1.00 35.34  ? 314 ILE M O     1 
ATOM   9604  C  CB    . ILE M  1 71  ? -3.026  -43.323 16.202  1.00 31.96  ? 314 ILE M CB    1 
ATOM   9605  C  CG1   . ILE M  1 71  ? -3.045  -43.526 14.689  1.00 34.86  ? 314 ILE M CG1   1 
ATOM   9606  C  CG2   . ILE M  1 71  ? -1.968  -44.306 16.658  1.00 33.67  ? 314 ILE M CG2   1 
ATOM   9607  C  CD1   . ILE M  1 71  ? -4.252  -42.949 13.999  1.00 35.55  ? 314 ILE M CD1   1 
ATOM   9608  N  N     . GLU M  1 72  ? -4.335  -43.492 19.252  1.00 28.74  ? 315 GLU M N     1 
ATOM   9609  C  CA    . GLU M  1 72  ? -4.308  -44.138 20.543  1.00 29.56  ? 315 GLU M CA    1 
ATOM   9610  C  C     . GLU M  1 72  ? -5.564  -45.048 20.706  1.00 30.37  ? 315 GLU M C     1 
ATOM   9611  O  O     . GLU M  1 72  ? -5.467  -46.190 21.173  1.00 27.24  ? 315 GLU M O     1 
ATOM   9612  C  CB    . GLU M  1 72  ? -4.247  -43.118 21.655  1.00 31.87  ? 315 GLU M CB    1 
ATOM   9613  C  CG    . GLU M  1 72  ? -4.308  -43.802 23.034  1.00 34.07  ? 315 GLU M CG    1 
ATOM   9614  C  CD    . GLU M  1 72  ? -4.252  -42.841 24.202  1.00 33.94  ? 315 GLU M CD    1 
ATOM   9615  O  OE1   . GLU M  1 72  ? -3.986  -41.648 24.009  1.00 39.29  ? 315 GLU M OE1   1 
ATOM   9616  O  OE2   . GLU M  1 72  ? -4.438  -43.293 25.343  1.00 36.84  ? 315 GLU M OE2   1 
ATOM   9617  N  N     . ILE M  1 73  ? -6.741  -44.545 20.324  1.00 28.93  ? 316 ILE M N     1 
ATOM   9618  C  CA    . ILE M  1 73  ? -7.960  -45.337 20.428  1.00 28.68  ? 316 ILE M CA    1 
ATOM   9619  C  C     . ILE M  1 73  ? -7.876  -46.579 19.590  1.00 29.66  ? 316 ILE M C     1 
ATOM   9620  O  O     . ILE M  1 73  ? -8.082  -47.692 20.079  1.00 28.03  ? 316 ILE M O     1 
ATOM   9621  C  CB    . ILE M  1 73  ? -9.213  -44.572 20.029  1.00 29.37  ? 316 ILE M CB    1 
ATOM   9622  C  CG1   . ILE M  1 73  ? -9.533  -43.584 21.120  1.00 26.69  ? 316 ILE M CG1   1 
ATOM   9623  C  CG2   . ILE M  1 73  ? -10.380 -45.555 19.823  1.00 32.39  ? 316 ILE M CG2   1 
ATOM   9624  C  CD1   . ILE M  1 73  ? -10.352 -42.424 20.648  1.00 29.82  ? 316 ILE M CD1   1 
ATOM   9625  N  N     . LEU M  1 74  ? -7.536  -46.408 18.329  1.00 30.87  ? 317 LEU M N     1 
ATOM   9626  C  CA    . LEU M  1 74  ? -7.355  -47.559 17.474  1.00 32.06  ? 317 LEU M CA    1 
ATOM   9627  C  C     . LEU M  1 74  ? -6.455  -48.593 18.083  1.00 32.86  ? 317 LEU M C     1 
ATOM   9628  O  O     . LEU M  1 74  ? -6.710  -49.781 17.944  1.00 38.04  ? 317 LEU M O     1 
ATOM   9629  C  CB    . LEU M  1 74  ? -6.767  -47.138 16.118  1.00 34.59  ? 317 LEU M CB    1 
ATOM   9630  C  CG    . LEU M  1 74  ? -7.707  -47.070 14.927  1.00 32.84  ? 317 LEU M CG    1 
ATOM   9631  C  CD1   . LEU M  1 74  ? -9.113  -46.634 15.291  1.00 35.70  ? 317 LEU M CD1   1 
ATOM   9632  C  CD2   . LEU M  1 74  ? -7.103  -46.164 13.882  1.00 32.91  ? 317 LEU M CD2   1 
ATOM   9633  N  N     . GLU M  1 75  ? -5.348  -48.154 18.664  1.00 31.89  ? 318 GLU M N     1 
ATOM   9634  C  CA    . GLU M  1 75  ? -4.379  -49.065 19.271  1.00 32.46  ? 318 GLU M CA    1 
ATOM   9635  C  C     . GLU M  1 75  ? -4.838  -49.726 20.541  1.00 32.16  ? 318 GLU M C     1 
ATOM   9636  O  O     . GLU M  1 75  ? -4.665  -50.917 20.714  1.00 34.76  ? 318 GLU M O     1 
ATOM   9637  C  CB    . GLU M  1 75  ? -3.143  -48.307 19.707  1.00 31.92  ? 318 GLU M CB    1 
ATOM   9638  C  CG    . GLU M  1 75  ? -2.185  -48.039 18.586  1.00 34.45  ? 318 GLU M CG    1 
ATOM   9639  C  CD    . GLU M  1 75  ? -1.043  -47.162 19.056  1.00 32.42  ? 318 GLU M CD    1 
ATOM   9640  O  OE1   . GLU M  1 75  ? -1.048  -46.765 20.232  1.00 35.16  ? 318 GLU M OE1   1 
ATOM   9641  O  OE2   . GLU M  1 75  ? -0.144  -46.887 18.268  1.00 32.95  ? 318 GLU M OE2   1 
ATOM   9642  N  N     . SER M  1 76  ? -5.283  -48.916 21.481  1.00 31.03  ? 319 SER M N     1 
ATOM   9643  C  CA    . SER M  1 76  ? -5.546  -49.365 22.814  1.00 30.05  ? 319 SER M CA    1 
ATOM   9644  C  C     . SER M  1 76  ? -7.029  -49.603 23.145  1.00 33.98  ? 319 SER M C     1 
ATOM   9645  O  O     . SER M  1 76  ? -7.328  -50.172 24.183  1.00 38.51  ? 319 SER M O     1 
ATOM   9646  C  CB    . SER M  1 76  ? -5.077  -48.305 23.763  1.00 28.22  ? 319 SER M CB    1 
ATOM   9647  O  OG    . SER M  1 76  ? -5.870  -47.147 23.617  1.00 27.63  ? 319 SER M OG    1 
ATOM   9648  N  N     . GLY M  1 77  ? -7.940  -49.125 22.310  1.00 32.49  ? 320 GLY M N     1 
ATOM   9649  C  CA    . GLY M  1 77  ? -9.358  -49.059 22.654  1.00 33.11  ? 320 GLY M CA    1 
ATOM   9650  C  C     . GLY M  1 77  ? -9.685  -48.040 23.721  1.00 34.65  ? 320 GLY M C     1 
ATOM   9651  O  O     . GLY M  1 77  ? -10.799 -47.987 24.235  1.00 33.78  ? 320 GLY M O     1 
ATOM   9652  N  N     . HIS M  1 78  ? -8.710  -47.233 24.092  1.00 34.96  ? 321 HIS M N     1 
ATOM   9653  C  CA    . HIS M  1 78  ? -8.946  -46.281 25.133  1.00 37.87  ? 321 HIS M CA    1 
ATOM   9654  C  C     . HIS M  1 78  ? -8.214  -44.961 24.868  1.00 37.98  ? 321 HIS M C     1 
ATOM   9655  O  O     . HIS M  1 78  ? -7.408  -44.842 23.937  1.00 31.48  ? 321 HIS M O     1 
ATOM   9656  C  CB    . HIS M  1 78  ? -8.580  -46.893 26.515  1.00 43.89  ? 321 HIS M CB    1 
ATOM   9657  C  CG    . HIS M  1 78  ? -9.041  -46.064 27.681  1.00 46.58  ? 321 HIS M CG    1 
ATOM   9658  N  ND1   . HIS M  1 78  ? -10.293 -45.471 27.730  1.00 47.99  ? 321 HIS M ND1   1 
ATOM   9659  C  CD2   . HIS M  1 78  ? -8.401  -45.694 28.820  1.00 50.67  ? 321 HIS M CD2   1 
ATOM   9660  C  CE1   . HIS M  1 78  ? -10.404 -44.778 28.852  1.00 48.40  ? 321 HIS M CE1   1 
ATOM   9661  N  NE2   . HIS M  1 78  ? -9.270  -44.898 29.531  1.00 49.95  ? 321 HIS M NE2   1 
ATOM   9662  N  N     . LEU M  1 79  ? -8.554  -43.972 25.687  1.00 36.53  ? 322 LEU M N     1 
ATOM   9663  C  CA    . LEU M  1 79  ? -7.937  -42.668 25.695  1.00 37.27  ? 322 LEU M CA    1 
ATOM   9664  C  C     . LEU M  1 79  ? -7.639  -42.410 27.163  1.00 36.79  ? 322 LEU M C     1 
ATOM   9665  O  O     . LEU M  1 79  ? -8.560  -42.193 27.979  1.00 40.12  ? 322 LEU M O     1 
ATOM   9666  C  CB    . LEU M  1 79  ? -8.949  -41.664 25.175  1.00 36.99  ? 322 LEU M CB    1 
ATOM   9667  C  CG    . LEU M  1 79  ? -8.554  -40.386 24.482  1.00 42.22  ? 322 LEU M CG    1 
ATOM   9668  C  CD1   . LEU M  1 79  ? -7.941  -40.740 23.152  1.00 44.30  ? 322 LEU M CD1   1 
ATOM   9669  C  CD2   . LEU M  1 79  ? -9.813  -39.550 24.262  1.00 43.86  ? 322 LEU M CD2   1 
ATOM   9670  N  N     . ARG M  1 80  ? -6.365  -42.426 27.515  1.00 39.11  ? 323 ARG M N     1 
ATOM   9671  C  CA    . ARG M  1 80  ? -5.981  -42.266 28.906  1.00 43.60  ? 323 ARG M CA    1 
ATOM   9672  C  C     . ARG M  1 80  ? -6.442  -40.925 29.416  1.00 42.89  ? 323 ARG M C     1 
ATOM   9673  O  O     . ARG M  1 80  ? -6.555  -40.746 30.605  1.00 41.04  ? 323 ARG M O     1 
ATOM   9674  C  CB    . ARG M  1 80  ? -4.473  -42.339 29.108  1.00 48.34  ? 323 ARG M CB    1 
ATOM   9675  C  CG    . ARG M  1 80  ? -3.828  -43.645 28.652  1.00 58.36  ? 323 ARG M CG    1 
ATOM   9676  C  CD    . ARG M  1 80  ? -2.351  -43.438 28.284  1.00 65.35  ? 323 ARG M CD    1 
ATOM   9677  N  NE    . ARG M  1 80  ? -2.169  -42.391 27.260  1.00 69.11  ? 323 ARG M NE    1 
ATOM   9678  C  CZ    . ARG M  1 80  ? -1.007  -41.824 26.926  1.00 65.47  ? 323 ARG M CZ    1 
ATOM   9679  N  NH1   . ARG M  1 80  ? 0.121   -42.187 27.518  1.00 70.14  ? 323 ARG M NH1   1 
ATOM   9680  N  NH2   . ARG M  1 80  ? -0.976  -40.878 25.998  1.00 64.54  ? 323 ARG M NH2   1 
ATOM   9681  N  N     . LYS M  1 81  ? -6.673  -39.953 28.546  1.00 40.84  ? 324 LYS M N     1 
ATOM   9682  C  CA    . LYS M  1 81  ? -6.964  -38.623 29.065  1.00 42.38  ? 324 LYS M CA    1 
ATOM   9683  C  C     . LYS M  1 81  ? -8.359  -38.600 29.765  1.00 37.41  ? 324 LYS M C     1 
ATOM   9684  O  O     . LYS M  1 81  ? -8.626  -37.753 30.611  1.00 29.71  ? 324 LYS M O     1 
ATOM   9685  C  CB    . LYS M  1 81  ? -6.847  -37.582 27.972  1.00 45.17  ? 324 LYS M CB    1 
ATOM   9686  C  CG    . LYS M  1 81  ? -6.224  -36.292 28.452  1.00 52.83  ? 324 LYS M CG    1 
ATOM   9687  C  CD    . LYS M  1 81  ? -6.012  -35.380 27.261  1.00 60.94  ? 324 LYS M CD    1 
ATOM   9688  C  CE    . LYS M  1 81  ? -5.325  -34.081 27.663  1.00 68.11  ? 324 LYS M CE    1 
ATOM   9689  N  NZ    . LYS M  1 81  ? -5.289  -33.129 26.516  1.00 67.25  ? 324 LYS M NZ    1 
ATOM   9690  N  N     . LEU M  1 82  ? -9.202  -39.571 29.426  1.00 33.57  ? 325 LEU M N     1 
ATOM   9691  C  CA    . LEU M  1 82  ? -10.490 -39.722 30.058  1.00 35.96  ? 325 LEU M CA    1 
ATOM   9692  C  C     . LEU M  1 82  ? -10.383 -40.162 31.530  1.00 37.62  ? 325 LEU M C     1 
ATOM   9693  O  O     . LEU M  1 82  ? -11.349 -40.030 32.294  1.00 45.86  ? 325 LEU M O     1 
ATOM   9694  C  CB    . LEU M  1 82  ? -11.332 -40.747 29.313  1.00 34.55  ? 325 LEU M CB    1 
ATOM   9695  C  CG    . LEU M  1 82  ? -11.683 -40.438 27.875  1.00 38.30  ? 325 LEU M CG    1 
ATOM   9696  C  CD1   . LEU M  1 82  ? -12.377 -41.629 27.197  1.00 38.27  ? 325 LEU M CD1   1 
ATOM   9697  C  CD2   . LEU M  1 82  ? -12.526 -39.176 27.797  1.00 38.03  ? 325 LEU M CD2   1 
ATOM   9698  N  N     . ASP M  1 83  ? -9.233  -40.702 31.907  1.00 31.32  ? 326 ASP M N     1 
ATOM   9699  C  CA    . ASP M  1 83  ? -8.996  -41.168 33.256  1.00 32.30  ? 326 ASP M CA    1 
ATOM   9700  C  C     . ASP M  1 83  ? -8.481  -40.029 34.082  1.00 33.99  ? 326 ASP M C     1 
ATOM   9701  O  O     . ASP M  1 83  ? -8.280  -40.225 35.246  1.00 31.70  ? 326 ASP M O     1 
ATOM   9702  C  CB    . ASP M  1 83  ? -8.001  -42.365 33.301  1.00 29.14  ? 326 ASP M CB    1 
ATOM   9703  C  CG    . ASP M  1 83  ? -8.555  -43.610 32.611  1.00 31.14  ? 326 ASP M CG    1 
ATOM   9704  O  OD1   . ASP M  1 83  ? -9.759  -43.888 32.776  1.00 39.33  ? 326 ASP M OD1   1 
ATOM   9705  O  OD2   . ASP M  1 83  ? -7.834  -44.311 31.864  1.00 34.45  ? 326 ASP M OD2   1 
ATOM   9706  N  N     . HIS M  1 84  ? -8.226  -38.859 33.504  1.00 33.67  ? 327 HIS M N     1 
ATOM   9707  C  CA    . HIS M  1 84  ? -7.733  -37.756 34.313  1.00 39.54  ? 327 HIS M CA    1 
ATOM   9708  C  C     . HIS M  1 84  ? -8.606  -36.512 34.178  1.00 43.50  ? 327 HIS M C     1 
ATOM   9709  O  O     . HIS M  1 84  ? -8.150  -35.401 34.388  1.00 44.28  ? 327 HIS M O     1 
ATOM   9710  C  CB    . HIS M  1 84  ? -6.293  -37.427 33.958  1.00 41.72  ? 327 HIS M CB    1 
ATOM   9711  C  CG    . HIS M  1 84  ? -5.345  -38.560 34.194  1.00 46.72  ? 327 HIS M CG    1 
ATOM   9712  N  ND1   . HIS M  1 84  ? -5.177  -39.592 33.289  1.00 49.40  ? 327 HIS M ND1   1 
ATOM   9713  C  CD2   . HIS M  1 84  ? -4.537  -38.841 35.241  1.00 46.73  ? 327 HIS M CD2   1 
ATOM   9714  C  CE1   . HIS M  1 84  ? -4.299  -40.455 33.766  1.00 52.46  ? 327 HIS M CE1   1 
ATOM   9715  N  NE2   . HIS M  1 84  ? -3.894  -40.020 34.949  1.00 53.00  ? 327 HIS M NE2   1 
ATOM   9716  N  N     . ILE M  1 85  ? -9.878  -36.696 33.870  1.00 46.11  ? 328 ILE M N     1 
ATOM   9717  C  CA    . ILE M  1 85  ? -10.750 -35.550 33.733  1.00 49.51  ? 328 ILE M CA    1 
ATOM   9718  C  C     . ILE M  1 85  ? -11.021 -35.043 35.133  1.00 48.23  ? 328 ILE M C     1 
ATOM   9719  O  O     . ILE M  1 85  ? -11.443 -35.813 35.967  1.00 45.11  ? 328 ILE M O     1 
ATOM   9720  C  CB    . ILE M  1 85  ? -12.071 -35.942 33.046  1.00 53.31  ? 328 ILE M CB    1 
ATOM   9721  C  CG1   . ILE M  1 85  ? -11.863 -36.060 31.533  1.00 56.33  ? 328 ILE M CG1   1 
ATOM   9722  C  CG2   . ILE M  1 85  ? -13.146 -34.910 33.352  1.00 54.20  ? 328 ILE M CG2   1 
ATOM   9723  C  CD1   . ILE M  1 85  ? -13.051 -36.626 30.769  1.00 57.88  ? 328 ILE M CD1   1 
ATOM   9724  N  N     . SER M  1 86  ? -10.791 -33.768 35.406  1.00 49.57  ? 329 SER M N     1 
ATOM   9725  C  CA    . SER M  1 86  ? -11.183 -33.208 36.707  1.00 50.10  ? 329 SER M CA    1 
ATOM   9726  C  C     . SER M  1 86  ? -12.576 -33.634 37.182  1.00 51.72  ? 329 SER M C     1 
ATOM   9727  O  O     . SER M  1 86  ? -13.502 -33.781 36.406  1.00 50.13  ? 329 SER M O     1 
ATOM   9728  C  CB    . SER M  1 86  ? -11.143 -31.692 36.701  1.00 54.34  ? 329 SER M CB    1 
ATOM   9729  O  OG    . SER M  1 86  ? -11.711 -31.215 37.911  1.00 56.65  ? 329 SER M OG    1 
ATOM   9730  N  N     . GLU M  1 87  ? -12.710 -33.802 38.487  1.00 55.10  ? 330 GLU M N     1 
ATOM   9731  C  CA    . GLU M  1 87  ? -13.855 -34.485 39.055  1.00 57.68  ? 330 GLU M CA    1 
ATOM   9732  C  C     . GLU M  1 87  ? -15.035 -33.546 39.235  1.00 56.04  ? 330 GLU M C     1 
ATOM   9733  O  O     . GLU M  1 87  ? -16.154 -33.983 39.460  1.00 53.50  ? 330 GLU M O     1 
ATOM   9734  C  CB    . GLU M  1 87  ? -13.473 -35.087 40.404  1.00 63.40  ? 330 GLU M CB    1 
ATOM   9735  C  CG    . GLU M  1 87  ? -13.803 -36.567 40.532  1.00 69.55  ? 330 GLU M CG    1 
ATOM   9736  C  CD    . GLU M  1 87  ? -13.140 -37.197 41.743  1.00 73.19  ? 330 GLU M CD    1 
ATOM   9737  O  OE1   . GLU M  1 87  ? -12.017 -36.745 42.110  1.00 65.94  ? 330 GLU M OE1   1 
ATOM   9738  O  OE2   . GLU M  1 87  ? -13.750 -38.138 42.313  1.00 67.92  ? 330 GLU M OE2   1 
ATOM   9739  N  N     . SER M  1 88  ? -14.783 -32.249 39.139  1.00 52.22  ? 331 SER M N     1 
ATOM   9740  C  CA    . SER M  1 88  ? -15.863 -31.285 39.195  1.00 50.15  ? 331 SER M CA    1 
ATOM   9741  C  C     . SER M  1 88  ? -16.706 -31.353 37.925  1.00 46.38  ? 331 SER M C     1 
ATOM   9742  O  O     . SER M  1 88  ? -17.788 -30.796 37.877  1.00 46.83  ? 331 SER M O     1 
ATOM   9743  C  CB    . SER M  1 88  ? -15.293 -29.878 39.373  1.00 47.29  ? 331 SER M CB    1 
ATOM   9744  O  OG    . SER M  1 88  ? -14.599 -29.504 38.211  1.00 43.97  ? 331 SER M OG    1 
ATOM   9745  N  N     . VAL M  1 89  ? -16.241 -32.051 36.900  1.00 41.89  ? 332 VAL M N     1 
ATOM   9746  C  CA    . VAL M  1 89  ? -16.914 -31.943 35.596  1.00 41.23  ? 332 VAL M CA    1 
ATOM   9747  C  C     . VAL M  1 89  ? -18.389 -32.270 35.667  1.00 41.08  ? 332 VAL M C     1 
ATOM   9748  O  O     . VAL M  1 89  ? -19.187 -31.536 35.117  1.00 42.88  ? 332 VAL M O     1 
ATOM   9749  C  CB    . VAL M  1 89  ? -16.193 -32.751 34.472  1.00 40.89  ? 332 VAL M CB    1 
ATOM   9750  C  CG1   . VAL M  1 89  ? -17.098 -33.057 33.280  1.00 42.44  ? 332 VAL M CG1   1 
ATOM   9751  C  CG2   . VAL M  1 89  ? -14.968 -31.974 33.983  1.00 45.09  ? 332 VAL M CG2   1 
ATOM   9752  N  N     . PRO M  1 90  ? -18.761 -33.385 36.314  1.00 41.33  ? 333 PRO M N     1 
ATOM   9753  C  CA    . PRO M  1 90  ? -20.186 -33.696 36.234  1.00 42.15  ? 333 PRO M CA    1 
ATOM   9754  C  C     . PRO M  1 90  ? -21.060 -32.602 36.873  1.00 41.04  ? 333 PRO M C     1 
ATOM   9755  O  O     . PRO M  1 90  ? -22.154 -32.342 36.391  1.00 37.88  ? 333 PRO M O     1 
ATOM   9756  C  CB    . PRO M  1 90  ? -20.315 -35.029 36.978  1.00 42.29  ? 333 PRO M CB    1 
ATOM   9757  C  CG    . PRO M  1 90  ? -18.937 -35.603 37.087  1.00 40.02  ? 333 PRO M CG    1 
ATOM   9758  C  CD    . PRO M  1 90  ? -17.979 -34.445 36.984  1.00 42.42  ? 333 PRO M CD    1 
ATOM   9759  N  N     . VAL M  1 91  ? -20.559 -31.962 37.927  1.00 37.62  ? 334 VAL M N     1 
ATOM   9760  C  CA    . VAL M  1 91  ? -21.301 -30.933 38.626  1.00 39.90  ? 334 VAL M CA    1 
ATOM   9761  C  C     . VAL M  1 91  ? -21.473 -29.755 37.666  1.00 40.43  ? 334 VAL M C     1 
ATOM   9762  O  O     . VAL M  1 91  ? -22.596 -29.352 37.350  1.00 38.47  ? 334 VAL M O     1 
ATOM   9763  C  CB    . VAL M  1 91  ? -20.563 -30.486 39.914  1.00 42.05  ? 334 VAL M CB    1 
ATOM   9764  C  CG1   . VAL M  1 91  ? -21.137 -29.194 40.475  1.00 43.93  ? 334 VAL M CG1   1 
ATOM   9765  C  CG2   . VAL M  1 91  ? -20.653 -31.573 40.974  1.00 45.45  ? 334 VAL M CG2   1 
ATOM   9766  N  N     . LEU M  1 92  ? -20.326 -29.255 37.203  1.00 35.40  ? 335 LEU M N     1 
ATOM   9767  C  CA    . LEU M  1 92  ? -20.239 -28.220 36.231  1.00 35.60  ? 335 LEU M CA    1 
ATOM   9768  C  C     . LEU M  1 92  ? -21.119 -28.495 35.033  1.00 34.32  ? 335 LEU M C     1 
ATOM   9769  O  O     . LEU M  1 92  ? -21.743 -27.573 34.532  1.00 34.61  ? 335 LEU M O     1 
ATOM   9770  C  CB    . LEU M  1 92  ? -18.813 -28.022 35.792  1.00 36.86  ? 335 LEU M CB    1 
ATOM   9771  C  CG    . LEU M  1 92  ? -17.886 -27.335 36.776  1.00 36.34  ? 335 LEU M CG    1 
ATOM   9772  C  CD1   . LEU M  1 92  ? -16.507 -27.214 36.127  1.00 36.38  ? 335 LEU M CD1   1 
ATOM   9773  C  CD2   . LEU M  1 92  ? -18.379 -25.961 37.250  1.00 35.40  ? 335 LEU M CD2   1 
ATOM   9774  N  N     . GLU M  1 93  ? -21.242 -29.745 34.622  1.00 32.11  ? 336 GLU M N     1 
ATOM   9775  C  CA    . GLU M  1 93  ? -22.116 -30.075 33.519  1.00 31.63  ? 336 GLU M CA    1 
ATOM   9776  C  C     . GLU M  1 93  ? -23.555 -29.928 33.988  1.00 35.76  ? 336 GLU M C     1 
ATOM   9777  O  O     . GLU M  1 93  ? -24.375 -29.355 33.283  1.00 34.38  ? 336 GLU M O     1 
ATOM   9778  C  CB    . GLU M  1 93  ? -21.871 -31.488 33.046  1.00 33.30  ? 336 GLU M CB    1 
ATOM   9779  C  CG    . GLU M  1 93  ? -22.738 -31.965 31.877  1.00 35.98  ? 336 GLU M CG    1 
ATOM   9780  C  CD    . GLU M  1 93  ? -22.247 -33.298 31.338  1.00 40.66  ? 336 GLU M CD    1 
ATOM   9781  O  OE1   . GLU M  1 93  ? -21.038 -33.578 31.514  1.00 47.62  ? 336 GLU M OE1   1 
ATOM   9782  O  OE2   . GLU M  1 93  ? -23.026 -34.074 30.742  1.00 38.94  ? 336 GLU M OE2   1 
ATOM   9783  N  N     . LEU M  1 94  ? -23.867 -30.457 35.165  1.00 34.55  ? 337 LEU M N     1 
ATOM   9784  C  CA    . LEU M  1 94  ? -25.222 -30.346 35.686  1.00 36.50  ? 337 LEU M CA    1 
ATOM   9785  C  C     . LEU M  1 94  ? -25.666 -28.895 35.657  1.00 32.58  ? 337 LEU M C     1 
ATOM   9786  O  O     . LEU M  1 94  ? -26.727 -28.634 35.200  1.00 31.70  ? 337 LEU M O     1 
ATOM   9787  C  CB    . LEU M  1 94  ? -25.335 -30.877 37.127  1.00 40.36  ? 337 LEU M CB    1 
ATOM   9788  C  CG    . LEU M  1 94  ? -26.736 -31.289 37.581  1.00 44.79  ? 337 LEU M CG    1 
ATOM   9789  C  CD1   . LEU M  1 94  ? -27.301 -32.502 36.844  1.00 45.93  ? 337 LEU M CD1   1 
ATOM   9790  C  CD2   . LEU M  1 94  ? -26.697 -31.564 39.066  1.00 48.93  ? 337 LEU M CD2   1 
ATOM   9791  N  N     . PHE M  1 95  ? -24.820 -27.982 36.139  1.00 30.68  ? 338 PHE M N     1 
ATOM   9792  C  CA    . PHE M  1 95  ? -25.154 -26.597 36.281  1.00 34.56  ? 338 PHE M CA    1 
ATOM   9793  C  C     . PHE M  1 95  ? -25.326 -25.898 34.938  1.00 36.13  ? 338 PHE M C     1 
ATOM   9794  O  O     . PHE M  1 95  ? -26.310 -25.187 34.752  1.00 36.09  ? 338 PHE M O     1 
ATOM   9795  C  CB    . PHE M  1 95  ? -24.107 -25.840 37.141  1.00 35.54  ? 338 PHE M CB    1 
ATOM   9796  C  CG    . PHE M  1 95  ? -24.093 -26.240 38.615  1.00 37.19  ? 338 PHE M CG    1 
ATOM   9797  C  CD1   . PHE M  1 95  ? -25.119 -27.003 39.184  1.00 39.00  ? 338 PHE M CD1   1 
ATOM   9798  C  CD2   . PHE M  1 95  ? -23.058 -25.827 39.438  1.00 39.63  ? 338 PHE M CD2   1 
ATOM   9799  C  CE1   . PHE M  1 95  ? -25.085 -27.362 40.533  1.00 41.95  ? 338 PHE M CE1   1 
ATOM   9800  C  CE2   . PHE M  1 95  ? -23.023 -26.166 40.793  1.00 41.12  ? 338 PHE M CE2   1 
ATOM   9801  C  CZ    . PHE M  1 95  ? -24.040 -26.932 41.342  1.00 40.23  ? 338 PHE M CZ    1 
ATOM   9802  N  N     . SER M  1 96  ? -24.385 -26.124 34.012  1.00 35.05  ? 339 SER M N     1 
ATOM   9803  C  CA    . SER M  1 96  ? -24.403 -25.485 32.690  1.00 33.88  ? 339 SER M CA    1 
ATOM   9804  C  C     . SER M  1 96  ? -25.485 -26.034 31.820  1.00 30.03  ? 339 SER M C     1 
ATOM   9805  O  O     . SER M  1 96  ? -25.854 -25.424 30.856  1.00 33.09  ? 339 SER M O     1 
ATOM   9806  C  CB    . SER M  1 96  ? -23.044 -25.562 31.995  1.00 37.26  ? 339 SER M CB    1 
ATOM   9807  O  OG    . SER M  1 96  ? -22.534 -26.900 31.938  1.00 36.33  ? 339 SER M OG    1 
ATOM   9808  N  N     . ASN M  1 97  ? -26.069 -27.152 32.205  1.00 28.70  ? 340 ASN M N     1 
ATOM   9809  C  CA    . ASN M  1 97  ? -27.261 -27.637 31.515  1.00 29.20  ? 340 ASN M CA    1 
ATOM   9810  C  C     . ASN M  1 97  ? -28.541 -26.838 31.811  1.00 27.22  ? 340 ASN M C     1 
ATOM   9811  O  O     . ASN M  1 97  ? -29.626 -27.099 31.228  1.00 25.55  ? 340 ASN M O     1 
ATOM   9812  C  CB    . ASN M  1 97  ? -27.500 -29.108 31.869  1.00 32.44  ? 340 ASN M CB    1 
ATOM   9813  C  CG    . ASN M  1 97  ? -26.587 -30.054 31.090  1.00 35.89  ? 340 ASN M CG    1 
ATOM   9814  O  OD1   . ASN M  1 97  ? -25.965 -29.688 30.095  1.00 41.98  ? 340 ASN M OD1   1 
ATOM   9815  N  ND2   . ASN M  1 97  ? -26.493 -31.256 31.562  1.00 37.31  ? 340 ASN M ND2   1 
ATOM   9816  N  N     . ILE M  1 98  ? -28.437 -25.943 32.774  1.00 25.10  ? 341 ILE M N     1 
ATOM   9817  C  CA    . ILE M  1 98  ? -29.501 -24.978 33.015  1.00 28.58  ? 341 ILE M CA    1 
ATOM   9818  C  C     . ILE M  1 98  ? -29.464 -23.942 31.909  1.00 26.42  ? 341 ILE M C     1 
ATOM   9819  O  O     . ILE M  1 98  ? -28.422 -23.339 31.670  1.00 28.85  ? 341 ILE M O     1 
ATOM   9820  C  CB    . ILE M  1 98  ? -29.323 -24.282 34.348  1.00 28.89  ? 341 ILE M CB    1 
ATOM   9821  C  CG1   . ILE M  1 98  ? -29.379 -25.294 35.492  1.00 29.93  ? 341 ILE M CG1   1 
ATOM   9822  C  CG2   . ILE M  1 98  ? -30.464 -23.315 34.606  1.00 30.64  ? 341 ILE M CG2   1 
ATOM   9823  C  CD1   . ILE M  1 98  ? -28.829 -24.713 36.764  1.00 31.92  ? 341 ILE M CD1   1 
ATOM   9824  N  N     . TRP M  1 99  ? -30.578 -23.764 31.210  1.00 28.12  ? 342 TRP M N     1 
ATOM   9825  C  CA    . TRP M  1 99  ? -30.662 -22.676 30.204  1.00 29.09  ? 342 TRP M CA    1 
ATOM   9826  C  C     . TRP M  1 99  ? -30.447 -21.316 30.864  1.00 26.90  ? 342 TRP M C     1 
ATOM   9827  O  O     . TRP M  1 99  ? -31.070 -20.976 31.847  1.00 28.47  ? 342 TRP M O     1 
ATOM   9828  C  CB    . TRP M  1 99  ? -31.996 -22.695 29.468  1.00 31.12  ? 342 TRP M CB    1 
ATOM   9829  C  CG    . TRP M  1 99  ? -31.985 -21.933 28.140  1.00 28.85  ? 342 TRP M CG    1 
ATOM   9830  C  CD1   . TRP M  1 99  ? -31.914 -22.482 26.899  1.00 28.59  ? 342 TRP M CD1   1 
ATOM   9831  C  CD2   . TRP M  1 99  ? -32.028 -20.518 27.948  1.00 27.91  ? 342 TRP M CD2   1 
ATOM   9832  N  NE1   . TRP M  1 99  ? -31.904 -21.503 25.943  1.00 31.55  ? 342 TRP M NE1   1 
ATOM   9833  C  CE2   . TRP M  1 99  ? -32.000 -20.285 26.560  1.00 29.39  ? 342 TRP M CE2   1 
ATOM   9834  C  CE3   . TRP M  1 99  ? -32.097 -19.425 28.807  1.00 28.28  ? 342 TRP M CE3   1 
ATOM   9835  C  CZ2   . TRP M  1 99  ? -32.041 -19.017 26.020  1.00 27.88  ? 342 TRP M CZ2   1 
ATOM   9836  C  CZ3   . TRP M  1 99  ? -32.117 -18.157 28.273  1.00 27.33  ? 342 TRP M CZ3   1 
ATOM   9837  C  CH2   . TRP M  1 99  ? -32.083 -17.958 26.891  1.00 28.99  ? 342 TRP M CH2   1 
ATOM   9838  N  N     . GLY M  1 100 ? -29.513 -20.548 30.344  1.00 28.18  ? 343 GLY M N     1 
ATOM   9839  C  CA    . GLY M  1 100 ? -29.191 -19.276 30.938  1.00 23.92  ? 343 GLY M CA    1 
ATOM   9840  C  C     . GLY M  1 100 ? -27.959 -19.384 31.787  1.00 26.22  ? 343 GLY M C     1 
ATOM   9841  O  O     . GLY M  1 100 ? -27.373 -18.401 32.101  1.00 27.49  ? 343 GLY M O     1 
ATOM   9842  N  N     . ALA M  1 101 ? -27.540 -20.577 32.189  1.00 28.86  ? 344 ALA M N     1 
ATOM   9843  C  CA    . ALA M  1 101 ? -26.312 -20.670 32.976  1.00 28.04  ? 344 ALA M CA    1 
ATOM   9844  C  C     . ALA M  1 101 ? -25.254 -21.293 32.113  1.00 27.78  ? 344 ALA M C     1 
ATOM   9845  O  O     . ALA M  1 101 ? -25.486 -22.345 31.533  1.00 29.63  ? 344 ALA M O     1 
ATOM   9846  C  CB    . ALA M  1 101 ? -26.560 -21.496 34.236  1.00 27.30  ? 344 ALA M CB    1 
ATOM   9847  N  N     . GLY M  1 102 ? -24.104 -20.645 31.987  1.00 27.94  ? 345 GLY M N     1 
ATOM   9848  C  CA    . GLY M  1 102 ? -23.020 -21.227 31.188  1.00 28.16  ? 345 GLY M CA    1 
ATOM   9849  C  C     . GLY M  1 102 ? -21.861 -21.584 32.097  1.00 32.14  ? 345 GLY M C     1 
ATOM   9850  O  O     . GLY M  1 102 ? -22.046 -21.745 33.312  1.00 33.39  ? 345 GLY M O     1 
ATOM   9851  N  N     . THR M  1 103 ? -20.659 -21.634 31.532  1.00 33.93  ? 346 THR M N     1 
ATOM   9852  C  CA    . THR M  1 103 ? -19.481 -22.041 32.280  1.00 36.88  ? 346 THR M CA    1 
ATOM   9853  C  C     . THR M  1 103 ? -19.113 -21.147 33.489  1.00 35.98  ? 346 THR M C     1 
ATOM   9854  O  O     . THR M  1 103 ? -18.751 -21.678 34.536  1.00 31.58  ? 346 THR M O     1 
ATOM   9855  C  CB    . THR M  1 103 ? -18.254 -22.233 31.367  1.00 37.02  ? 346 THR M CB    1 
ATOM   9856  O  OG1   . THR M  1 103 ? -17.245 -22.967 32.087  1.00 39.44  ? 346 THR M OG1   1 
ATOM   9857  C  CG2   . THR M  1 103 ? -17.676 -20.876 30.896  1.00 35.68  ? 346 THR M CG2   1 
ATOM   9858  N  N     . LYS M  1 104 ? -19.209 -19.823 33.367  1.00 38.87  ? 347 LYS M N     1 
ATOM   9859  C  CA    . LYS M  1 104 ? -18.831 -18.929 34.494  1.00 40.19  ? 347 LYS M CA    1 
ATOM   9860  C  C     . LYS M  1 104 ? -19.755 -19.021 35.717  1.00 40.17  ? 347 LYS M C     1 
ATOM   9861  O  O     . LYS M  1 104 ? -19.319 -18.956 36.849  1.00 39.97  ? 347 LYS M O     1 
ATOM   9862  C  CB    . LYS M  1 104 ? -18.798 -17.473 34.032  1.00 43.88  ? 347 LYS M CB    1 
ATOM   9863  C  CG    . LYS M  1 104 ? -17.806 -17.212 32.918  1.00 44.82  ? 347 LYS M CG    1 
ATOM   9864  C  CD    . LYS M  1 104 ? -16.389 -17.521 33.364  1.00 45.55  ? 347 LYS M CD    1 
ATOM   9865  C  CE    . LYS M  1 104 ? -15.391 -17.202 32.275  1.00 47.54  ? 347 LYS M CE    1 
ATOM   9866  N  NZ    . LYS M  1 104 ? -14.045 -17.239 32.909  1.00 53.47  ? 347 LYS M NZ    1 
ATOM   9867  N  N     . THR M  1 105 ? -21.044 -19.160 35.481  1.00 38.80  ? 348 THR M N     1 
ATOM   9868  C  CA    . THR M  1 105 ? -21.980 -19.266 36.578  1.00 41.44  ? 348 THR M CA    1 
ATOM   9869  C  C     . THR M  1 105 ? -21.735 -20.564 37.310  1.00 40.89  ? 348 THR M C     1 
ATOM   9870  O  O     . THR M  1 105 ? -21.603 -20.582 38.525  1.00 43.14  ? 348 THR M O     1 
ATOM   9871  C  CB    . THR M  1 105 ? -23.433 -19.223 36.065  1.00 37.84  ? 348 THR M CB    1 
ATOM   9872  O  OG1   . THR M  1 105 ? -23.641 -17.983 35.385  1.00 36.84  ? 348 THR M OG1   1 
ATOM   9873  C  CG2   . THR M  1 105 ? -24.408 -19.331 37.176  1.00 39.09  ? 348 THR M CG2   1 
ATOM   9874  N  N     . ALA M  1 106 ? -21.728 -21.652 36.547  1.00 44.82  ? 349 ALA M N     1 
ATOM   9875  C  CA    . ALA M  1 106 ? -21.445 -22.983 37.070  1.00 42.80  ? 349 ALA M CA    1 
ATOM   9876  C  C     . ALA M  1 106 ? -20.155 -22.943 37.914  1.00 40.41  ? 349 ALA M C     1 
ATOM   9877  O  O     . ALA M  1 106 ? -20.202 -23.277 39.078  1.00 38.71  ? 349 ALA M O     1 
ATOM   9878  C  CB    . ALA M  1 106 ? -21.365 -23.990 35.938  1.00 43.19  ? 349 ALA M CB    1 
ATOM   9879  N  N     . GLN M  1 107 ? -19.052 -22.418 37.377  1.00 41.57  ? 350 GLN M N     1 
ATOM   9880  C  CA    . GLN M  1 107 ? -17.834 -22.198 38.191  1.00 45.08  ? 350 GLN M CA    1 
ATOM   9881  C  C     . GLN M  1 107 ? -18.108 -21.467 39.510  1.00 47.14  ? 350 GLN M C     1 
ATOM   9882  O  O     . GLN M  1 107 ? -17.842 -22.023 40.592  1.00 44.49  ? 350 GLN M O     1 
ATOM   9883  C  CB    . GLN M  1 107 ? -16.742 -21.450 37.435  1.00 45.42  ? 350 GLN M CB    1 
ATOM   9884  C  CG    . GLN M  1 107 ? -15.981 -22.322 36.444  1.00 52.07  ? 350 GLN M CG    1 
ATOM   9885  C  CD    . GLN M  1 107 ? -14.977 -21.537 35.607  1.00 55.53  ? 350 GLN M CD    1 
ATOM   9886  O  OE1   . GLN M  1 107 ? -14.023 -20.952 36.150  1.00 61.06  ? 350 GLN M OE1   1 
ATOM   9887  N  NE2   . GLN M  1 107 ? -15.183 -21.518 34.274  1.00 54.96  ? 350 GLN M NE2   1 
ATOM   9888  N  N     . MET M  1 108 ? -18.629 -20.237 39.407  1.00 47.83  ? 351 MET M N     1 
ATOM   9889  C  CA    . MET M  1 108 ? -19.021 -19.436 40.575  1.00 44.60  ? 351 MET M CA    1 
ATOM   9890  C  C     . MET M  1 108 ? -19.874 -20.245 41.541  1.00 40.26  ? 351 MET M C     1 
ATOM   9891  O  O     . MET M  1 108 ? -19.669 -20.192 42.743  1.00 40.29  ? 351 MET M O     1 
ATOM   9892  C  CB    . MET M  1 108 ? -19.779 -18.174 40.154  1.00 49.53  ? 351 MET M CB    1 
ATOM   9893  C  CG    . MET M  1 108 ? -20.299 -17.307 41.311  1.00 52.81  ? 351 MET M CG    1 
ATOM   9894  S  SD    . MET M  1 108 ? -21.597 -16.117 40.849  1.00 64.72  ? 351 MET M SD    1 
ATOM   9895  C  CE    . MET M  1 108 ? -23.119 -17.082 40.962  1.00 52.60  ? 351 MET M CE    1 
ATOM   9896  N  N     . TRP M  1 109 ? -20.819 -21.010 41.039  1.00 40.77  ? 352 TRP M N     1 
ATOM   9897  C  CA    . TRP M  1 109 ? -21.591 -21.855 41.942  1.00 42.97  ? 352 TRP M CA    1 
ATOM   9898  C  C     . TRP M  1 109 ? -20.717 -22.910 42.632  1.00 44.31  ? 352 TRP M C     1 
ATOM   9899  O  O     . TRP M  1 109 ? -20.751 -23.048 43.854  1.00 45.59  ? 352 TRP M O     1 
ATOM   9900  C  CB    . TRP M  1 109 ? -22.799 -22.487 41.225  1.00 41.73  ? 352 TRP M CB    1 
ATOM   9901  C  CG    . TRP M  1 109 ? -23.888 -21.459 40.894  1.00 44.45  ? 352 TRP M CG    1 
ATOM   9902  C  CD1   . TRP M  1 109 ? -24.063 -20.230 41.465  1.00 39.35  ? 352 TRP M CD1   1 
ATOM   9903  C  CD2   . TRP M  1 109 ? -24.960 -21.608 39.944  1.00 40.25  ? 352 TRP M CD2   1 
ATOM   9904  N  NE1   . TRP M  1 109 ? -25.135 -19.607 40.906  1.00 37.23  ? 352 TRP M NE1   1 
ATOM   9905  C  CE2   . TRP M  1 109 ? -25.709 -20.426 39.976  1.00 39.59  ? 352 TRP M CE2   1 
ATOM   9906  C  CE3   . TRP M  1 109 ? -25.323 -22.607 39.041  1.00 40.06  ? 352 TRP M CE3   1 
ATOM   9907  C  CZ2   . TRP M  1 109 ? -26.822 -20.217 39.148  1.00 39.18  ? 352 TRP M CZ2   1 
ATOM   9908  C  CZ3   . TRP M  1 109 ? -26.429 -22.404 38.217  1.00 41.69  ? 352 TRP M CZ3   1 
ATOM   9909  C  CH2   . TRP M  1 109 ? -27.168 -21.219 38.287  1.00 40.59  ? 352 TRP M CH2   1 
ATOM   9910  N  N     . TYR M  1 110 ? -19.924 -23.643 41.857  1.00 48.27  ? 353 TYR M N     1 
ATOM   9911  C  CA    . TYR M  1 110 ? -19.004 -24.626 42.431  1.00 45.59  ? 353 TYR M CA    1 
ATOM   9912  C  C     . TYR M  1 110 ? -18.163 -23.985 43.554  1.00 47.03  ? 353 TYR M C     1 
ATOM   9913  O  O     . TYR M  1 110 ? -18.061 -24.541 44.663  1.00 49.60  ? 353 TYR M O     1 
ATOM   9914  C  CB    . TYR M  1 110 ? -18.107 -25.241 41.336  1.00 44.51  ? 353 TYR M CB    1 
ATOM   9915  C  CG    . TYR M  1 110 ? -17.501 -26.581 41.694  1.00 39.65  ? 353 TYR M CG    1 
ATOM   9916  C  CD1   . TYR M  1 110 ? -18.193 -27.741 41.468  1.00 39.61  ? 353 TYR M CD1   1 
ATOM   9917  C  CD2   . TYR M  1 110 ? -16.224 -26.679 42.243  1.00 46.36  ? 353 TYR M CD2   1 
ATOM   9918  C  CE1   . TYR M  1 110 ? -17.667 -28.974 41.788  1.00 41.99  ? 353 TYR M CE1   1 
ATOM   9919  C  CE2   . TYR M  1 110 ? -15.668 -27.920 42.565  1.00 47.41  ? 353 TYR M CE2   1 
ATOM   9920  C  CZ    . TYR M  1 110 ? -16.407 -29.066 42.333  1.00 46.68  ? 353 TYR M CZ    1 
ATOM   9921  O  OH    . TYR M  1 110 ? -15.898 -30.315 42.625  1.00 47.87  ? 353 TYR M OH    1 
ATOM   9922  N  N     . GLN M  1 111 ? -17.585 -22.817 43.286  1.00 49.86  ? 354 GLN M N     1 
ATOM   9923  C  CA    . GLN M  1 111 ? -16.801 -22.089 44.306  1.00 52.47  ? 354 GLN M CA    1 
ATOM   9924  C  C     . GLN M  1 111 ? -17.586 -21.904 45.586  1.00 53.74  ? 354 GLN M C     1 
ATOM   9925  O  O     . GLN M  1 111 ? -17.068 -22.124 46.662  1.00 63.04  ? 354 GLN M O     1 
ATOM   9926  C  CB    . GLN M  1 111 ? -16.345 -20.724 43.789  1.00 55.45  ? 354 GLN M CB    1 
ATOM   9927  C  CG    . GLN M  1 111 ? -14.968 -20.701 43.134  1.00 60.29  ? 354 GLN M CG    1 
ATOM   9928  C  CD    . GLN M  1 111 ? -14.570 -22.038 42.485  1.00 68.17  ? 354 GLN M CD    1 
ATOM   9929  O  OE1   . GLN M  1 111 ? -15.215 -22.510 41.531  1.00 76.39  ? 354 GLN M OE1   1 
ATOM   9930  N  NE2   . GLN M  1 111 ? -13.503 -22.656 43.007  1.00 61.60  ? 354 GLN M NE2   1 
ATOM   9931  N  N     . GLN M  1 112 ? -18.850 -21.534 45.460  1.00 53.06  ? 355 GLN M N     1 
ATOM   9932  C  CA    . GLN M  1 112 ? -19.709 -21.311 46.617  1.00 53.05  ? 355 GLN M CA    1 
ATOM   9933  C  C     . GLN M  1 112 ? -20.023 -22.601 47.370  1.00 49.81  ? 355 GLN M C     1 
ATOM   9934  O  O     . GLN M  1 112 ? -20.578 -22.557 48.469  1.00 44.80  ? 355 GLN M O     1 
ATOM   9935  C  CB    . GLN M  1 112 ? -21.022 -20.644 46.190  1.00 52.80  ? 355 GLN M CB    1 
ATOM   9936  C  CG    . GLN M  1 112 ? -20.874 -19.187 45.799  1.00 55.26  ? 355 GLN M CG    1 
ATOM   9937  C  CD    . GLN M  1 112 ? -22.220 -18.536 45.541  1.00 62.57  ? 355 GLN M CD    1 
ATOM   9938  O  OE1   . GLN M  1 112 ? -22.844 -18.738 44.495  1.00 67.66  ? 355 GLN M OE1   1 
ATOM   9939  N  NE2   . GLN M  1 112 ? -22.687 -17.762 46.506  1.00 64.31  ? 355 GLN M NE2   1 
ATOM   9940  N  N     . GLY M  1 113 ? -19.706 -23.740 46.764  1.00 44.97  ? 356 GLY M N     1 
ATOM   9941  C  CA    . GLY M  1 113 ? -19.822 -25.011 47.430  1.00 38.56  ? 356 GLY M CA    1 
ATOM   9942  C  C     . GLY M  1 113 ? -21.100 -25.735 47.092  1.00 43.27  ? 356 GLY M C     1 
ATOM   9943  O  O     . GLY M  1 113 ? -21.502 -26.639 47.824  1.00 42.47  ? 356 GLY M O     1 
ATOM   9944  N  N     . PHE M  1 114 ? -21.738 -25.375 45.974  1.00 44.77  ? 357 PHE M N     1 
ATOM   9945  C  CA    . PHE M  1 114 ? -22.951 -26.062 45.525  1.00 41.81  ? 357 PHE M CA    1 
ATOM   9946  C  C     . PHE M  1 114 ? -22.638 -27.296 44.699  1.00 37.94  ? 357 PHE M C     1 
ATOM   9947  O  O     . PHE M  1 114 ? -21.584 -27.394 44.090  1.00 39.03  ? 357 PHE M O     1 
ATOM   9948  C  CB    . PHE M  1 114 ? -23.853 -25.117 44.701  1.00 47.38  ? 357 PHE M CB    1 
ATOM   9949  C  CG    . PHE M  1 114 ? -24.209 -23.820 45.389  1.00 49.64  ? 357 PHE M CG    1 
ATOM   9950  C  CD1   . PHE M  1 114 ? -24.400 -23.750 46.768  1.00 50.88  ? 357 PHE M CD1   1 
ATOM   9951  C  CD2   . PHE M  1 114 ? -24.387 -22.663 44.642  1.00 50.81  ? 357 PHE M CD2   1 
ATOM   9952  C  CE1   . PHE M  1 114 ? -24.734 -22.536 47.366  1.00 54.55  ? 357 PHE M CE1   1 
ATOM   9953  C  CE2   . PHE M  1 114 ? -24.741 -21.456 45.239  1.00 53.28  ? 357 PHE M CE2   1 
ATOM   9954  C  CZ    . PHE M  1 114 ? -24.911 -21.385 46.599  1.00 48.43  ? 357 PHE M CZ    1 
ATOM   9955  N  N     . ARG M  1 115 ? -23.567 -28.239 44.639  1.00 35.55  ? 358 ARG M N     1 
ATOM   9956  C  CA    . ARG M  1 115 ? -23.236 -29.509 44.080  1.00 35.98  ? 358 ARG M CA    1 
ATOM   9957  C  C     . ARG M  1 115 ? -24.390 -30.191 43.444  1.00 36.35  ? 358 ARG M C     1 
ATOM   9958  O  O     . ARG M  1 115 ? -24.196 -31.151 42.722  1.00 41.12  ? 358 ARG M O     1 
ATOM   9959  C  CB    . ARG M  1 115 ? -22.656 -30.459 45.162  1.00 37.63  ? 358 ARG M CB    1 
ATOM   9960  C  CG    . ARG M  1 115 ? -21.301 -30.055 45.744  1.00 38.51  ? 358 ARG M CG    1 
ATOM   9961  C  CD    . ARG M  1 115 ? -20.199 -30.104 44.707  1.00 41.31  ? 358 ARG M CD    1 
ATOM   9962  N  NE    . ARG M  1 115 ? -18.886 -29.629 45.152  1.00 42.73  ? 358 ARG M NE    1 
ATOM   9963  C  CZ    . ARG M  1 115 ? -18.493 -28.364 45.241  1.00 45.59  ? 358 ARG M CZ    1 
ATOM   9964  N  NH1   . ARG M  1 115 ? -19.301 -27.355 44.963  1.00 50.13  ? 358 ARG M NH1   1 
ATOM   9965  N  NH2   . ARG M  1 115 ? -17.254 -28.098 45.619  1.00 48.09  ? 358 ARG M NH2   1 
ATOM   9966  N  N     . SER M  1 116 ? -25.589 -29.749 43.740  1.00 37.75  ? 359 SER M N     1 
ATOM   9967  C  CA    . SER M  1 116 ? -26.780 -30.413 43.250  1.00 39.99  ? 359 SER M CA    1 
ATOM   9968  C  C     . SER M  1 116 ? -27.739 -29.312 42.817  1.00 36.86  ? 359 SER M C     1 
ATOM   9969  O  O     . SER M  1 116 ? -27.608 -28.175 43.239  1.00 34.70  ? 359 SER M O     1 
ATOM   9970  C  CB    . SER M  1 116 ? -27.407 -31.248 44.383  1.00 41.28  ? 359 SER M CB    1 
ATOM   9971  O  OG    . SER M  1 116 ? -28.082 -30.422 45.342  1.00 38.64  ? 359 SER M OG    1 
ATOM   9972  N  N     . LEU M  1 117 ? -28.735 -29.645 42.030  1.00 39.12  ? 360 LEU M N     1 
ATOM   9973  C  CA    . LEU M  1 117 ? -29.719 -28.630 41.629  1.00 43.59  ? 360 LEU M CA    1 
ATOM   9974  C  C     . LEU M  1 117 ? -30.447 -28.026 42.856  1.00 43.44  ? 360 LEU M C     1 
ATOM   9975  O  O     . LEU M  1 117 ? -30.909 -26.871 42.841  1.00 42.21  ? 360 LEU M O     1 
ATOM   9976  C  CB    . LEU M  1 117 ? -30.739 -29.254 40.656  1.00 43.88  ? 360 LEU M CB    1 
ATOM   9977  C  CG    . LEU M  1 117 ? -30.232 -29.904 39.368  1.00 44.31  ? 360 LEU M CG    1 
ATOM   9978  C  CD1   . LEU M  1 117 ? -31.383 -30.396 38.491  1.00 43.37  ? 360 LEU M CD1   1 
ATOM   9979  C  CD2   . LEU M  1 117 ? -29.369 -28.891 38.642  1.00 48.90  ? 360 LEU M CD2   1 
ATOM   9980  N  N     . GLU M  1 118 ? -30.553 -28.830 43.914  1.00 47.49  ? 361 GLU M N     1 
ATOM   9981  C  CA    . GLU M  1 118 ? -31.276 -28.432 45.103  1.00 45.34  ? 361 GLU M CA    1 
ATOM   9982  C  C     . GLU M  1 118 ? -30.520 -27.376 45.795  1.00 43.25  ? 361 GLU M C     1 
ATOM   9983  O  O     . GLU M  1 118 ? -31.125 -26.450 46.315  1.00 52.17  ? 361 GLU M O     1 
ATOM   9984  C  CB    . GLU M  1 118 ? -31.481 -29.610 46.044  1.00 52.65  ? 361 GLU M CB    1 
ATOM   9985  C  CG    . GLU M  1 118 ? -32.850 -30.245 45.891  1.00 56.62  ? 361 GLU M CG    1 
ATOM   9986  C  CD    . GLU M  1 118 ? -33.965 -29.291 46.278  1.00 60.01  ? 361 GLU M CD    1 
ATOM   9987  O  OE1   . GLU M  1 118 ? -33.763 -28.493 47.225  1.00 65.92  ? 361 GLU M OE1   1 
ATOM   9988  O  OE2   . GLU M  1 118 ? -35.029 -29.322 45.629  1.00 54.69  ? 361 GLU M OE2   1 
ATOM   9989  N  N     . ASP M  1 119 ? -29.195 -27.501 45.797  1.00 42.74  ? 362 ASP M N     1 
ATOM   9990  C  CA    . ASP M  1 119 ? -28.308 -26.465 46.358  1.00 43.64  ? 362 ASP M CA    1 
ATOM   9991  C  C     . ASP M  1 119 ? -28.574 -25.103 45.696  1.00 47.55  ? 362 ASP M C     1 
ATOM   9992  O  O     . ASP M  1 119 ? -28.709 -24.060 46.351  1.00 49.10  ? 362 ASP M O     1 
ATOM   9993  C  CB    . ASP M  1 119 ? -26.823 -26.831 46.139  1.00 51.55  ? 362 ASP M CB    1 
ATOM   9994  C  CG    . ASP M  1 119 ? -26.383 -28.151 46.836  1.00 55.80  ? 362 ASP M CG    1 
ATOM   9995  O  OD1   . ASP M  1 119 ? -27.205 -28.856 47.450  1.00 58.72  ? 362 ASP M OD1   1 
ATOM   9996  O  OD2   . ASP M  1 119 ? -25.174 -28.493 46.750  1.00 60.61  ? 362 ASP M OD2   1 
ATOM   9997  N  N     . ILE M  1 120 ? -28.630 -25.147 44.364  1.00 50.83  ? 363 ILE M N     1 
ATOM   9998  C  CA    . ILE M  1 120 ? -28.901 -23.982 43.508  1.00 46.89  ? 363 ILE M CA    1 
ATOM   9999  C  C     . ILE M  1 120 ? -30.256 -23.330 43.830  1.00 41.05  ? 363 ILE M C     1 
ATOM   10000 O  O     . ILE M  1 120 ? -30.326 -22.166 44.189  1.00 41.38  ? 363 ILE M O     1 
ATOM   10001 C  CB    . ILE M  1 120 ? -28.934 -24.381 42.001  1.00 44.19  ? 363 ILE M CB    1 
ATOM   10002 C  CG1   . ILE M  1 120 ? -27.717 -25.240 41.594  1.00 43.61  ? 363 ILE M CG1   1 
ATOM   10003 C  CG2   . ILE M  1 120 ? -29.042 -23.118 41.141  1.00 45.71  ? 363 ILE M CG2   1 
ATOM   10004 C  CD1   . ILE M  1 120 ? -26.364 -24.586 41.850  1.00 42.01  ? 363 ILE M CD1   1 
ATOM   10005 N  N     . ARG M  1 121 ? -31.299 -24.119 43.661  1.00 36.53  ? 364 ARG M N     1 
ATOM   10006 C  CA    . ARG M  1 121 ? -32.672 -23.738 43.888  1.00 43.96  ? 364 ARG M CA    1 
ATOM   10007 C  C     . ARG M  1 121 ? -32.907 -23.054 45.244  1.00 45.71  ? 364 ARG M C     1 
ATOM   10008 O  O