data_4K8T
# 
_entry.id   4K8T 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4K8T         
RCSB  RCSB079035   
WWPDB D_1000079035 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
TargetTrack NYSGRC-014306 . unspecified 
PDB         4E3A          . unspecified 
PDB         4K8C          . unspecified 
PDB         4K8K          . unspecified 
PDB         4K8P          . unspecified 
# 
_pdbx_database_status.entry_id                        4K8T 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-04-18 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Malashkevich, V.N.'                                        1  
'Bhosle, R.'                                                2  
'Toro, R.'                                                  3  
'Hillerich, B.'                                             4  
'Gizzi, A.'                                                 5  
'Garforth, S.'                                              6  
'Kar, A.'                                                   7  
'Chan, M.K.'                                                8  
'Lafluer, J.'                                               9  
'Patel, H.'                                                 10 
'Matikainen, B.'                                            11 
'Chamala, S.'                                               12 
'Lim, S.'                                                   13 
'Celikgil, A.'                                              14 
'Villegas, G.'                                              15 
'Evans, B.'                                                 16 
'Love, J.'                                                  17 
'Fiser, A.'                                                 18 
'Khafizov, K.'                                              19 
'Seidel, R.'                                                20 
'Bonanno, J.B.'                                             21 
'Almo, S.C.'                                                22 
'New York Structural Genomics Research Consortium (NYSGRC)' 23 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of probable sugar kinase protein from Rhizobium etli CFN 42 complexed with ethyl 3,4-diaminobenzoate' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Malashkevich, V.N.' 1  
primary 'Bhosle, R.'         2  
primary 'Toro, R.'           3  
primary 'Hillerich, B.'      4  
primary 'Gizzi, A.'          5  
primary 'Garforth, S.'       6  
primary 'Kar, A.'            7  
primary 'Chan, M.K.'         8  
primary 'Lafluer, J.'        9  
primary 'Patel, H.'          10 
primary 'Matikainen, B.'     11 
primary 'Chamala, S.'        12 
primary 'Lim, S.'            13 
primary 'Celikgil, A.'       14 
primary 'Villegas, G.'       15 
primary 'Evans, B.'          16 
primary 'Love, J.'           17 
primary 'Fiser, A.'          18 
primary 'Khafizov, K.'       19 
primary 'Seidel, R.'         20 
primary 'Bonanno, J.B.'      21 
primary 'Almo, S.C.'         22 
# 
_cell.length_a           51.326 
_cell.length_b           80.981 
_cell.length_c           82.793 
_cell.angle_alpha        90.000 
_cell.angle_beta         98.250 
_cell.angle_gamma        90.000 
_cell.entry_id           4K8T 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         4K8T 
_symmetry.Int_Tables_number                4 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'sugar kinase'              38849.992 2   ? ? ? ? 
2 non-polymer syn ADENOSINE                   267.241   2   ? ? ? ? 
3 non-polymer syn 'ethyl 3,4-diaminobenzoate' 180.204   1   ? ? ? ? 
4 non-polymer syn 'DIMETHYL SULFOXIDE'        78.133    3   ? ? ? ? 
5 non-polymer syn 'POTASSIUM ION'             39.098    2   ? ? ? ? 
6 water       nat water                       18.015    428 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)HHHHHHSSGVDLGTENLYFQS(MSE)TRFDVLTVGNAIVDIISRCNDQFLIDNQITKAA(MSE)NLIDAERAELL
YSR(MSE)GPALEASGGSAGNTAAGVANLGGKAAYFGNVAADQLGDIFTHDIRAQGVHYQTKPKGAFPPTARS(MSE)IF
VTEDGERS(MSE)NTYLGACVELGPEDVEADVVADAKVTYFEGYLWDPPRAKEAILDCARIAHQHGRE(MSE)S(MSE)T
LSDSFCVDRYRGEFLDL(MSE)RSGKVDIVFANRQEALSLYQTDDFEEALNRIAADCKIAAVT(MSE)SENGAVILKGRE
RYYVNAIRIREVVDTTGAGDLFASGFLYGYTQGRSLEDCGKLGCLAAGIVIQQIGPRP(MSE)TSLSEAAKQAGLI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMTRFDVLTVGNAIVDIISRCNDQFLIDNQITKAAMNLIDAERAELLYSRMGPALEASG
GSAGNTAAGVANLGGKAAYFGNVAADQLGDIFTHDIRAQGVHYQTKPKGAFPPTARSMIFVTEDGERSMNTYLGACVELG
PEDVEADVVADAKVTYFEGYLWDPPRAKEAILDCARIAHQHGREMSMTLSDSFCVDRYRGEFLDLMRSGKVDIVFANRQE
ALSLYQTDDFEEALNRIAADCKIAAVTMSENGAVILKGRERYYVNAIRIREVVDTTGAGDLFASGFLYGYTQGRSLEDCG
KLGCLAAGIVIQQIGPRPMTSLSEAAKQAGLI
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         NYSGRC-014306 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MSE n 
1 24  THR n 
1 25  ARG n 
1 26  PHE n 
1 27  ASP n 
1 28  VAL n 
1 29  LEU n 
1 30  THR n 
1 31  VAL n 
1 32  GLY n 
1 33  ASN n 
1 34  ALA n 
1 35  ILE n 
1 36  VAL n 
1 37  ASP n 
1 38  ILE n 
1 39  ILE n 
1 40  SER n 
1 41  ARG n 
1 42  CYS n 
1 43  ASN n 
1 44  ASP n 
1 45  GLN n 
1 46  PHE n 
1 47  LEU n 
1 48  ILE n 
1 49  ASP n 
1 50  ASN n 
1 51  GLN n 
1 52  ILE n 
1 53  THR n 
1 54  LYS n 
1 55  ALA n 
1 56  ALA n 
1 57  MSE n 
1 58  ASN n 
1 59  LEU n 
1 60  ILE n 
1 61  ASP n 
1 62  ALA n 
1 63  GLU n 
1 64  ARG n 
1 65  ALA n 
1 66  GLU n 
1 67  LEU n 
1 68  LEU n 
1 69  TYR n 
1 70  SER n 
1 71  ARG n 
1 72  MSE n 
1 73  GLY n 
1 74  PRO n 
1 75  ALA n 
1 76  LEU n 
1 77  GLU n 
1 78  ALA n 
1 79  SER n 
1 80  GLY n 
1 81  GLY n 
1 82  SER n 
1 83  ALA n 
1 84  GLY n 
1 85  ASN n 
1 86  THR n 
1 87  ALA n 
1 88  ALA n 
1 89  GLY n 
1 90  VAL n 
1 91  ALA n 
1 92  ASN n 
1 93  LEU n 
1 94  GLY n 
1 95  GLY n 
1 96  LYS n 
1 97  ALA n 
1 98  ALA n 
1 99  TYR n 
1 100 PHE n 
1 101 GLY n 
1 102 ASN n 
1 103 VAL n 
1 104 ALA n 
1 105 ALA n 
1 106 ASP n 
1 107 GLN n 
1 108 LEU n 
1 109 GLY n 
1 110 ASP n 
1 111 ILE n 
1 112 PHE n 
1 113 THR n 
1 114 HIS n 
1 115 ASP n 
1 116 ILE n 
1 117 ARG n 
1 118 ALA n 
1 119 GLN n 
1 120 GLY n 
1 121 VAL n 
1 122 HIS n 
1 123 TYR n 
1 124 GLN n 
1 125 THR n 
1 126 LYS n 
1 127 PRO n 
1 128 LYS n 
1 129 GLY n 
1 130 ALA n 
1 131 PHE n 
1 132 PRO n 
1 133 PRO n 
1 134 THR n 
1 135 ALA n 
1 136 ARG n 
1 137 SER n 
1 138 MSE n 
1 139 ILE n 
1 140 PHE n 
1 141 VAL n 
1 142 THR n 
1 143 GLU n 
1 144 ASP n 
1 145 GLY n 
1 146 GLU n 
1 147 ARG n 
1 148 SER n 
1 149 MSE n 
1 150 ASN n 
1 151 THR n 
1 152 TYR n 
1 153 LEU n 
1 154 GLY n 
1 155 ALA n 
1 156 CYS n 
1 157 VAL n 
1 158 GLU n 
1 159 LEU n 
1 160 GLY n 
1 161 PRO n 
1 162 GLU n 
1 163 ASP n 
1 164 VAL n 
1 165 GLU n 
1 166 ALA n 
1 167 ASP n 
1 168 VAL n 
1 169 VAL n 
1 170 ALA n 
1 171 ASP n 
1 172 ALA n 
1 173 LYS n 
1 174 VAL n 
1 175 THR n 
1 176 TYR n 
1 177 PHE n 
1 178 GLU n 
1 179 GLY n 
1 180 TYR n 
1 181 LEU n 
1 182 TRP n 
1 183 ASP n 
1 184 PRO n 
1 185 PRO n 
1 186 ARG n 
1 187 ALA n 
1 188 LYS n 
1 189 GLU n 
1 190 ALA n 
1 191 ILE n 
1 192 LEU n 
1 193 ASP n 
1 194 CYS n 
1 195 ALA n 
1 196 ARG n 
1 197 ILE n 
1 198 ALA n 
1 199 HIS n 
1 200 GLN n 
1 201 HIS n 
1 202 GLY n 
1 203 ARG n 
1 204 GLU n 
1 205 MSE n 
1 206 SER n 
1 207 MSE n 
1 208 THR n 
1 209 LEU n 
1 210 SER n 
1 211 ASP n 
1 212 SER n 
1 213 PHE n 
1 214 CYS n 
1 215 VAL n 
1 216 ASP n 
1 217 ARG n 
1 218 TYR n 
1 219 ARG n 
1 220 GLY n 
1 221 GLU n 
1 222 PHE n 
1 223 LEU n 
1 224 ASP n 
1 225 LEU n 
1 226 MSE n 
1 227 ARG n 
1 228 SER n 
1 229 GLY n 
1 230 LYS n 
1 231 VAL n 
1 232 ASP n 
1 233 ILE n 
1 234 VAL n 
1 235 PHE n 
1 236 ALA n 
1 237 ASN n 
1 238 ARG n 
1 239 GLN n 
1 240 GLU n 
1 241 ALA n 
1 242 LEU n 
1 243 SER n 
1 244 LEU n 
1 245 TYR n 
1 246 GLN n 
1 247 THR n 
1 248 ASP n 
1 249 ASP n 
1 250 PHE n 
1 251 GLU n 
1 252 GLU n 
1 253 ALA n 
1 254 LEU n 
1 255 ASN n 
1 256 ARG n 
1 257 ILE n 
1 258 ALA n 
1 259 ALA n 
1 260 ASP n 
1 261 CYS n 
1 262 LYS n 
1 263 ILE n 
1 264 ALA n 
1 265 ALA n 
1 266 VAL n 
1 267 THR n 
1 268 MSE n 
1 269 SER n 
1 270 GLU n 
1 271 ASN n 
1 272 GLY n 
1 273 ALA n 
1 274 VAL n 
1 275 ILE n 
1 276 LEU n 
1 277 LYS n 
1 278 GLY n 
1 279 ARG n 
1 280 GLU n 
1 281 ARG n 
1 282 TYR n 
1 283 TYR n 
1 284 VAL n 
1 285 ASN n 
1 286 ALA n 
1 287 ILE n 
1 288 ARG n 
1 289 ILE n 
1 290 ARG n 
1 291 GLU n 
1 292 VAL n 
1 293 VAL n 
1 294 ASP n 
1 295 THR n 
1 296 THR n 
1 297 GLY n 
1 298 ALA n 
1 299 GLY n 
1 300 ASP n 
1 301 LEU n 
1 302 PHE n 
1 303 ALA n 
1 304 SER n 
1 305 GLY n 
1 306 PHE n 
1 307 LEU n 
1 308 TYR n 
1 309 GLY n 
1 310 TYR n 
1 311 THR n 
1 312 GLN n 
1 313 GLY n 
1 314 ARG n 
1 315 SER n 
1 316 LEU n 
1 317 GLU n 
1 318 ASP n 
1 319 CYS n 
1 320 GLY n 
1 321 LYS n 
1 322 LEU n 
1 323 GLY n 
1 324 CYS n 
1 325 LEU n 
1 326 ALA n 
1 327 ALA n 
1 328 GLY n 
1 329 ILE n 
1 330 VAL n 
1 331 ILE n 
1 332 GLN n 
1 333 GLN n 
1 334 ILE n 
1 335 GLY n 
1 336 PRO n 
1 337 ARG n 
1 338 PRO n 
1 339 MSE n 
1 340 THR n 
1 341 SER n 
1 342 LEU n 
1 343 SER n 
1 344 GLU n 
1 345 ALA n 
1 346 ALA n 
1 347 LYS n 
1 348 GLN n 
1 349 ALA n 
1 350 GLY n 
1 351 LEU n 
1 352 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 RHE_CH00135 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'CFN 42' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rhizobium etli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     347834 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)CODON+RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'BC-PSGX3(BC)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q2KDX6_RHIEC 
_struct_ref.pdbx_db_accession          Q2KDX6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MTRFDVLTVGNAIVDIISRCNDQFLIDNQITKAAMNLIDAERAELLYSRMGPALEASGGSAGNTAAGVANLGGKAAYFGN
VAADQLGDIFTHDIRAQGVHYQTKPKGAFPPTARSMIFVTEDGERSMNTYLGACVELGPEDVEADVVADAKVTYFEGYLW
DPPRAKEAILDCARIAHQHGREMSMTLSDSFCVDRYRGEFLDLMRSGKVDIVFANRQEALSLYQTDDFEEALNRIAADCK
IAAVTMSENGAVILKGRERYYVNAIRIREVVDTTGAGDLFASGFLYGYTQGRSLEDCGKLGCLAAGIVIQQIGPRPMTSL
SEAAKQAGLI
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4K8T A 23 ? 352 ? Q2KDX6 1 ? 330 ? -1 328 
2 1 4K8T B 23 ? 352 ? Q2KDX6 1 ? 330 ? -1 328 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4K8T MSE A 1  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -23 1  
1 4K8T HIS A 2  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -22 2  
1 4K8T HIS A 3  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -21 3  
1 4K8T HIS A 4  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -20 4  
1 4K8T HIS A 5  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -19 5  
1 4K8T HIS A 6  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -18 6  
1 4K8T HIS A 7  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -17 7  
1 4K8T SER A 8  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -16 8  
1 4K8T SER A 9  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -15 9  
1 4K8T GLY A 10 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -14 10 
1 4K8T VAL A 11 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -13 11 
1 4K8T ASP A 12 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -12 12 
1 4K8T LEU A 13 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -11 13 
1 4K8T GLY A 14 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -10 14 
1 4K8T THR A 15 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -9  15 
1 4K8T GLU A 16 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -8  16 
1 4K8T ASN A 17 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -7  17 
1 4K8T LEU A 18 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -6  18 
1 4K8T TYR A 19 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -5  19 
1 4K8T PHE A 20 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -4  20 
1 4K8T GLN A 21 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -3  21 
1 4K8T SER A 22 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -2  22 
2 4K8T MSE B 1  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -23 23 
2 4K8T HIS B 2  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -22 24 
2 4K8T HIS B 3  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -21 25 
2 4K8T HIS B 4  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -20 26 
2 4K8T HIS B 5  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -19 27 
2 4K8T HIS B 6  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -18 28 
2 4K8T HIS B 7  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -17 29 
2 4K8T SER B 8  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -16 30 
2 4K8T SER B 9  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -15 31 
2 4K8T GLY B 10 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -14 32 
2 4K8T VAL B 11 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -13 33 
2 4K8T ASP B 12 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -12 34 
2 4K8T LEU B 13 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -11 35 
2 4K8T GLY B 14 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -10 36 
2 4K8T THR B 15 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -9  37 
2 4K8T GLU B 16 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -8  38 
2 4K8T ASN B 17 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -7  39 
2 4K8T LEU B 18 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -6  40 
2 4K8T TYR B 19 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -5  41 
2 4K8T PHE B 20 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -4  42 
2 4K8T GLN B 21 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -3  43 
2 4K8T SER B 22 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -2  44 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADN non-polymer         . ADENOSINE                   ? 'C10 H13 N5 O4'  267.241 
ALA 'L-peptide linking' y ALANINE                     ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                    ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                    ? 'C3 H7 N O2 S'   121.158 
DMS non-polymer         . 'DIMETHYL SULFOXIDE'        ? 'C2 H6 O S'      78.133  
E34 non-polymer         . 'ethyl 3,4-diaminobenzoate' ? 'C9 H12 N2 O2'   180.204 
GLN 'L-peptide linking' y GLUTAMINE                   ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                     ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                   ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                       ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                  ? 'C6 H13 N O2'    131.173 
K   non-polymer         . 'POTASSIUM ION'             ? 'K 1'            39.098  
LEU 'L-peptide linking' y LEUCINE                     ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                      ? 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE            ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE               ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                     ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                      ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                   ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                    ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                      ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4K8T 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.19 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   43.87 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
'0.2M AMMONIUM ACETATE, 0.1M BIS:TRIS:HCL, PH 6.5,25% PEG3350, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.details                ? 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2013-03-28 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             SAD 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.075 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_wavelength_list        1.075 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
# 
_reflns.pdbx_chi_squared             0.838 
_reflns.pdbx_scaling_rejects         ? 
_reflns.limit_k_max                  ? 
_reflns.d_resolution_high            1.700 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_netI_over_sigmaI        6.800 
_reflns.observed_criterion_F_max     ? 
_reflns.pdbx_Rmerge_I_obs            0.094 
_reflns.limit_l_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.entry_id                     4K8T 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.percent_possible_obs         97.200 
_reflns.pdbx_Rsym_value              ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.limit_l_min                  ? 
_reflns.limit_h_min                  ? 
_reflns.R_free_details               ? 
_reflns.number_all                   ? 
_reflns.d_resolution_low             50.000 
_reflns.pdbx_redundancy              3.100 
_reflns.number_obs                   71834 
_reflns.limit_h_max                  ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.700 1.730  ? ? ? 0.562 ? ? 0.564 2.500 ? 3184 86.200 1  1 
1.730 1.760  ? ? ? 0.525 ? ? 0.573 2.700 ? 3380 91.600 2  1 
1.760 1.790  ? ? ? 0.405 ? ? 0.565 2.800 ? 3407 93.300 3  1 
1.790 1.830  ? ? ? 0.393 ? ? 0.581 2.800 ? 3533 95.400 4  1 
1.830 1.870  ? ? ? 0.322 ? ? 0.588 2.900 ? 3534 96.800 5  1 
1.870 1.910  ? ? ? 0.260 ? ? 0.601 2.900 ? 3577 97.300 6  1 
1.910 1.960  ? ? ? 0.212 ? ? 0.665 2.900 ? 3559 96.400 7  1 
1.960 2.020  ? ? ? 0.190 ? ? 0.752 3.100 ? 3578 98.100 8  1 
2.020 2.070  ? ? ? 0.174 ? ? 0.869 3.100 ? 3674 98.500 9  1 
2.070 2.140  ? ? ? 0.160 ? ? 0.838 3.300 ? 3649 99.200 10 1 
2.140 2.220  ? ? ? 0.151 ? ? 0.803 3.300 ? 3642 99.200 11 1 
2.220 2.310  ? ? ? 0.143 ? ? 0.898 3.300 ? 3638 99.000 12 1 
2.310 2.410  ? ? ? 0.129 ? ? 0.882 3.300 ? 3677 99.500 13 1 
2.410 2.540  ? ? ? 0.121 ? ? 0.905 3.300 ? 3667 99.300 14 1 
2.540 2.700  ? ? ? 0.115 ? ? 0.961 3.400 ? 3692 99.600 15 1 
2.700 2.910  ? ? ? 0.108 ? ? 0.975 3.400 ? 3664 99.300 16 1 
2.910 3.200  ? ? ? 0.093 ? ? 0.937 3.400 ? 3676 99.100 17 1 
3.200 3.660  ? ? ? 0.077 ? ? 1.137 3.300 ? 3660 98.900 18 1 
3.660 4.610  ? ? ? 0.069 ? ? 1.206 3.400 ? 3685 99.000 19 1 
4.610 50.000 ? ? ? 0.058 ? ? 0.943 3.400 ? 3758 98.900 20 1 
# 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.overall_SU_B                             5.2880 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.entry_id                                 4K8T 
_refine.aniso_B[2][3]                            -0.0000 
_refine.overall_SU_R_Cruickshank_DPI             0.0507 
_refine.overall_SU_ML                            0.0840 
_refine.pdbx_ls_sigma_I                          ? 
_refine.aniso_B[1][3]                            -1.8200 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.aniso_B[3][3]                            23.7000 
_refine.occupancy_max                            1.000 
_refine.ls_number_restraints                     ? 
_refine.aniso_B[1][1]                            -1.6500 
_refine.pdbx_overall_ESU_R                       0.0510 
_refine.ls_R_factor_obs                          0.2462 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_starting_model                      'PDB ENTRY 4E3A' 
_refine.ls_wR_factor_R_free                      0.3091 
_refine.ls_wR_factor_R_work                      0.2463 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.correlation_coeff_Fo_to_Fc               0.9220 
_refine.ls_number_reflns_R_free                  3629 
_refine.correlation_coeff_Fo_to_Fc_free          0.8880 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.ls_percent_reflns_obs                    97.2800 
_refine.ls_R_factor_R_work                       0.2430 
_refine.overall_SU_R_free                        0.0323 
_refine.ls_d_res_high                            1.7000 
_refine.pdbx_overall_ESU_R_Free                  0.0320 
_refine.B_iso_min                                9.440 
_refine.occupancy_min                            0.400 
_refine.B_iso_mean                               23.2654 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.ls_R_factor_all                          ? 
_refine.aniso_B[2][2]                            -22.0500 
_refine.B_iso_max                                128.780 
_refine.ls_d_res_low                             43.0300 
_refine.pdbx_overall_phase_error                 ? 
_refine.solvent_model_details                    MASK 
_refine.aniso_B[1][2]                            0.0000 
_refine.ls_R_factor_R_free                       0.3045 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_number_reflns_obs                     71687 
_refine.overall_FOM_work_R_set                   0.7751 
_refine.ls_number_parameters                     ? 
_refine.details                                  
;THE RESIDUAL FLAT DENSITY BETWEEN ILE-307 AND SER-245 IS DUE TO THE TRACE AMOUNTS OF EXOGENOUS ADP OR ITS ANALOGS. HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES      : REFINED INDIVIDUALLY
;
_refine.ls_number_reflns_all                     ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.solvent_model_param_bsol                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5008 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         65 
_refine_hist.number_atoms_solvent             428 
_refine_hist.number_atoms_total               5501 
_refine_hist.d_res_high                       1.7000 
_refine_hist.d_res_low                        43.0300 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       5274 0.009  0.019  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    7156 1.257  1.984  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 696  5.383  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 247  36.262 23.765 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 818  13.868 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 47   15.629 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         799  0.086  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   4064 0.005  0.021  ? ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr     5274 2.991  3.000  ? ? 'X-RAY DIFFRACTION' 
r_sphericity_free      147  41.789 5.000  ? ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded    5459 18.157 5.000  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       1.7000 
_refine_ls_shell.d_res_low                        1.7440 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               88.3000 
_refine_ls_shell.number_reflns_R_work             4526 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2220 
_refine_ls_shell.R_factor_R_free                  0.3650 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             236 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                4762 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4K8T 
_struct.title                     
'Crystal structure of probable sugar kinase protein from Rhizobium etli CFN 42 complexed with ethyl 3,4-diaminobenzoate' 
_struct.pdbx_descriptor           'sugar kinase' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, NEW YORK STRUCTURAL GENOMIX RESEARCHCONSORTIUM, NYSGRC, PSI-Biology, New York Structural Genomics Research Consortium, TRANSFERASE
;
_struct_keywords.entry_id        4K8T 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 2 ? 
H N N 4 ? 
I N N 4 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   dimeric 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 43  ? ASN A 50  ? ASN A 19  ASN A 26  1 ? 8  
HELX_P HELX_P2  2  ASP A 61  ? MSE A 72  ? ASP A 37  MSE A 48  1 ? 12 
HELX_P HELX_P3  3  GLY A 81  ? GLY A 94  ? GLY A 57  GLY A 70  1 ? 14 
HELX_P HELX_P4  4  ASP A 106 ? GLN A 119 ? ASP A 82  GLN A 95  1 ? 14 
HELX_P HELX_P5  5  LEU A 153 ? LEU A 159 ? LEU A 129 LEU A 135 5 ? 7  
HELX_P HELX_P6  6  GLY A 160 ? VAL A 164 ? GLY A 136 VAL A 140 5 ? 5  
HELX_P HELX_P7  7  GLU A 165 ? ASP A 171 ? GLU A 141 ASP A 147 1 ? 7  
HELX_P HELX_P8  8  TYR A 180 ? ASP A 183 ? TYR A 156 ASP A 159 5 ? 4  
HELX_P HELX_P9  9  ARG A 186 ? HIS A 201 ? ARG A 162 HIS A 177 1 ? 16 
HELX_P HELX_P10 10 ASP A 211 ? SER A 228 ? ASP A 187 SER A 204 1 ? 18 
HELX_P HELX_P11 11 ARG A 238 ? TYR A 245 ? ARG A 214 TYR A 221 1 ? 8  
HELX_P HELX_P12 12 ASP A 249 ? CYS A 261 ? ASP A 225 CYS A 237 1 ? 13 
HELX_P HELX_P13 13 SER A 269 ? ASN A 271 ? SER A 245 ASN A 247 5 ? 3  
HELX_P HELX_P14 14 GLY A 297 ? GLN A 312 ? GLY A 273 GLN A 288 1 ? 16 
HELX_P HELX_P15 15 SER A 315 ? ILE A 331 ? SER A 291 ILE A 307 1 ? 17 
HELX_P HELX_P16 16 SER A 341 ? ALA A 349 ? SER A 317 ALA A 325 1 ? 9  
HELX_P HELX_P17 17 ASN B 43  ? ASN B 50  ? ASN B 19  ASN B 26  1 ? 8  
HELX_P HELX_P18 18 ASP B 61  ? MSE B 72  ? ASP B 37  MSE B 48  1 ? 12 
HELX_P HELX_P19 19 GLY B 81  ? GLY B 94  ? GLY B 57  GLY B 70  1 ? 14 
HELX_P HELX_P20 20 ASP B 106 ? GLN B 119 ? ASP B 82  GLN B 95  1 ? 14 
HELX_P HELX_P21 21 LEU B 153 ? LEU B 159 ? LEU B 129 LEU B 135 5 ? 7  
HELX_P HELX_P22 22 GLY B 160 ? VAL B 164 ? GLY B 136 VAL B 140 5 ? 5  
HELX_P HELX_P23 23 GLU B 165 ? ASP B 171 ? GLU B 141 ASP B 147 1 ? 7  
HELX_P HELX_P24 24 TYR B 180 ? ASP B 183 ? TYR B 156 ASP B 159 5 ? 4  
HELX_P HELX_P25 25 ARG B 186 ? HIS B 201 ? ARG B 162 HIS B 177 1 ? 16 
HELX_P HELX_P26 26 ASP B 211 ? SER B 228 ? ASP B 187 SER B 204 1 ? 18 
HELX_P HELX_P27 27 ARG B 238 ? TYR B 245 ? ARG B 214 TYR B 221 1 ? 8  
HELX_P HELX_P28 28 ASP B 249 ? CYS B 261 ? ASP B 225 CYS B 237 1 ? 13 
HELX_P HELX_P29 29 SER B 269 ? ASN B 271 ? SER B 245 ASN B 247 5 ? 3  
HELX_P HELX_P30 30 GLY B 297 ? GLN B 312 ? GLY B 273 GLN B 288 1 ? 16 
HELX_P HELX_P31 31 SER B 315 ? ILE B 331 ? SER B 291 ILE B 307 1 ? 17 
HELX_P HELX_P32 32 SER B 341 ? ALA B 349 ? SER B 317 ALA B 325 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A MSE 23  C   ? ? ? 1_555 A THR 24  N ? ? A MSE -1  A THR 0   1_555 ? ? ? ? ? ? ? 1.333 ? 
covale2  covale ? ? A ALA 56  C   ? ? ? 1_555 A MSE 57  N ? ? A ALA 32  A MSE 33  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale3  covale ? ? A MSE 57  C   ? ? ? 1_555 A ASN 58  N ? ? A MSE 33  A ASN 34  1_555 ? ? ? ? ? ? ? 1.341 ? 
covale4  covale ? ? A ARG 71  C   ? ? ? 1_555 A MSE 72  N ? ? A ARG 47  A MSE 48  1_555 ? ? ? ? ? ? ? 1.337 ? 
covale5  covale ? ? A MSE 72  C   ? ? ? 1_555 A GLY 73  N ? ? A MSE 48  A GLY 49  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale6  covale ? ? A SER 137 C   ? ? ? 1_555 A MSE 138 N ? ? A SER 113 A MSE 114 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale7  covale ? ? A MSE 138 C   ? ? ? 1_555 A ILE 139 N ? ? A MSE 114 A ILE 115 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale8  covale ? ? A SER 148 C   ? ? ? 1_555 A MSE 149 N ? ? A SER 124 A MSE 125 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale9  covale ? ? A MSE 149 C   ? ? ? 1_555 A ASN 150 N ? ? A MSE 125 A ASN 126 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale10 covale ? ? A GLU 204 C   ? ? ? 1_555 A MSE 205 N ? ? A GLU 180 A MSE 181 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale11 covale ? ? A MSE 205 C   ? ? ? 1_555 A SER 206 N ? ? A MSE 181 A SER 182 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale12 covale ? ? A SER 206 C   ? ? ? 1_555 A MSE 207 N ? ? A SER 182 A MSE 183 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale13 covale ? ? A MSE 207 C   ? ? ? 1_555 A THR 208 N ? ? A MSE 183 A THR 184 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale14 covale ? ? A LEU 225 C   ? ? ? 1_555 A MSE 226 N ? ? A LEU 201 A MSE 202 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale15 covale ? ? A MSE 226 C   ? ? ? 1_555 A ARG 227 N ? ? A MSE 202 A ARG 203 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale16 covale ? ? A THR 267 C   ? ? ? 1_555 A MSE 268 N ? ? A THR 243 A MSE 244 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale17 covale ? ? A MSE 268 C   ? ? ? 1_555 A SER 269 N ? ? A MSE 244 A SER 245 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale18 covale ? ? A PRO 338 C   ? ? ? 1_555 A MSE 339 N ? ? A PRO 314 A MSE 315 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale19 covale ? ? A MSE 339 C   ? ? ? 1_555 A THR 340 N ? ? A MSE 315 A THR 316 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale20 covale ? ? B MSE 23  C   ? ? ? 1_555 B THR 24  N ? ? B MSE -1  B THR 0   1_555 ? ? ? ? ? ? ? 1.336 ? 
covale21 covale ? ? B ALA 56  C   ? ? ? 1_555 B MSE 57  N ? ? B ALA 32  B MSE 33  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale22 covale ? ? B MSE 57  C   ? ? ? 1_555 B ASN 58  N ? ? B MSE 33  B ASN 34  1_555 ? ? ? ? ? ? ? 1.337 ? 
covale23 covale ? ? B ARG 71  C   ? ? ? 1_555 B MSE 72  N ? ? B ARG 47  B MSE 48  1_555 ? ? ? ? ? ? ? 1.336 ? 
covale24 covale ? ? B MSE 72  C   ? ? ? 1_555 B GLY 73  N ? ? B MSE 48  B GLY 49  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale25 covale ? ? B SER 137 C   ? ? ? 1_555 B MSE 138 N ? ? B SER 113 B MSE 114 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale26 covale ? ? B MSE 138 C   ? ? ? 1_555 B ILE 139 N ? ? B MSE 114 B ILE 115 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale27 covale ? ? B SER 148 C   ? ? ? 1_555 B MSE 149 N ? ? B SER 124 B MSE 125 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale28 covale ? ? B MSE 149 C   ? ? ? 1_555 B ASN 150 N ? ? B MSE 125 B ASN 126 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale29 covale ? ? B GLU 204 C   ? ? ? 1_555 B MSE 205 N ? ? B GLU 180 B MSE 181 1_555 ? ? ? ? ? ? ? 1.321 ? 
covale30 covale ? ? B MSE 205 C   ? ? ? 1_555 B SER 206 N ? ? B MSE 181 B SER 182 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale31 covale ? ? B SER 206 C   ? ? ? 1_555 B MSE 207 N ? ? B SER 182 B MSE 183 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale32 covale ? ? B MSE 207 C   ? ? ? 1_555 B THR 208 N ? ? B MSE 183 B THR 184 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale33 covale ? ? B LEU 225 C   ? ? ? 1_555 B MSE 226 N ? ? B LEU 201 B MSE 202 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale34 covale ? ? B MSE 226 C   ? ? ? 1_555 B ARG 227 N ? ? B MSE 202 B ARG 203 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale35 covale ? ? B THR 267 C   ? ? ? 1_555 B MSE 268 N ? ? B THR 243 B MSE 244 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale36 covale ? ? B MSE 268 C   ? ? ? 1_555 B SER 269 N ? ? B MSE 244 B SER 245 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale37 covale ? ? B PRO 338 C   ? ? ? 1_555 B MSE 339 N ? ? B PRO 314 B MSE 315 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale38 covale ? ? B MSE 339 C   ? ? ? 1_555 B THR 340 N ? ? B MSE 315 B THR 316 1_555 ? ? ? ? ? ? ? 1.338 ? 
metalc1  metalc ? ? A GLY 335 O   ? ? ? 1_555 F K   .   K ? ? A GLY 311 A K   404 1_555 ? ? ? ? ? ? ? 2.710 ? 
metalc2  metalc ? ? A VAL 330 O   ? ? ? 1_555 F K   .   K ? ? A VAL 306 A K   404 1_555 ? ? ? ? ? ? ? 2.735 ? 
metalc3  metalc ? ? B GLN 333 O   ? ? ? 1_555 J K   .   K ? ? B GLN 309 B K   404 1_555 ? ? ? ? ? ? ? 2.737 ? 
metalc4  metalc ? ? A GLN 333 O   ? ? ? 1_555 F K   .   K ? ? A GLN 309 A K   404 1_555 ? ? ? ? ? ? ? 2.750 ? 
metalc5  metalc ? ? B VAL 330 O   ? ? ? 1_555 J K   .   K ? ? B VAL 306 B K   404 1_555 ? ? ? ? ? ? ? 2.765 ? 
metalc6  metalc ? ? B GLY 335 O   ? ? ? 1_555 J K   .   K ? ? B GLY 311 B K   404 1_555 ? ? ? ? ? ? ? 2.792 ? 
metalc7  metalc ? ? A ASP 294 O   ? ? ? 1_555 F K   .   K ? ? A ASP 270 A K   404 1_555 ? ? ? ? ? ? ? 2.832 ? 
metalc8  metalc ? ? B ASP 294 O   ? ? ? 1_555 J K   .   K ? ? B ASP 270 B K   404 1_555 ? ? ? ? ? ? ? 2.846 ? 
metalc9  metalc ? ? A THR 296 O   ? ? ? 1_555 F K   .   K ? ? A THR 272 A K   404 1_555 ? ? ? ? ? ? ? 2.937 ? 
metalc10 metalc ? ? B THR 296 O   ? ? ? 1_555 J K   .   K ? ? B THR 272 B K   404 1_555 ? ? ? ? ? ? ? 2.988 ? 
metalc11 metalc ? ? B ASP 294 OD2 ? ? ? 1_555 J K   .   K ? ? B ASP 270 B K   404 1_555 ? ? ? ? ? ? ? 3.470 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 131 A . ? PHE 107 A PRO 132 A ? PRO 108 A 1 0.25  
2 PHE 131 B . ? PHE 107 B PRO 132 B ? PRO 108 B 1 -0.94 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 5 ? 
C ? 9 ? 
D ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
C 7 8 ? anti-parallel 
C 8 9 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS A 122 ? TYR A 123 ? HIS A 98  TYR A 99  
A 2 ALA A 97  ? PHE A 100 ? ALA A 73  PHE A 76  
A 3 PHE A 26  ? VAL A 31  ? PHE A 2   VAL A 7   
A 4 ALA A 172 ? GLU A 178 ? ALA A 148 GLU A 154 
A 5 GLU A 204 ? THR A 208 ? GLU A 180 THR A 184 
A 6 ILE A 233 ? ASN A 237 ? ILE A 209 ASN A 213 
A 7 ILE A 263 ? THR A 267 ? ILE A 239 THR A 243 
A 8 ALA A 273 ? LYS A 277 ? ALA A 249 LYS A 253 
A 9 GLU A 280 ? VAL A 284 ? GLU A 256 VAL A 260 
B 1 MSE A 57  ? LEU A 59  ? MSE A 33  LEU A 35  
B 2 ARG A 147 ? TYR A 152 ? ARG A 123 TYR A 128 
B 3 ALA A 135 ? VAL A 141 ? ALA A 111 VAL A 117 
B 4 ILE A 35  ? ARG A 41  ? ILE A 11  ARG A 17  
B 5 LEU A 76  ? SER A 79  ? LEU A 52  SER A 55  
C 1 HIS B 122 ? TYR B 123 ? HIS B 98  TYR B 99  
C 2 ALA B 97  ? PHE B 100 ? ALA B 73  PHE B 76  
C 3 PHE B 26  ? VAL B 31  ? PHE B 2   VAL B 7   
C 4 ALA B 172 ? GLU B 178 ? ALA B 148 GLU B 154 
C 5 GLU B 204 ? THR B 208 ? GLU B 180 THR B 184 
C 6 ILE B 233 ? ASN B 237 ? ILE B 209 ASN B 213 
C 7 ILE B 263 ? THR B 267 ? ILE B 239 THR B 243 
C 8 ALA B 273 ? LYS B 277 ? ALA B 249 LYS B 253 
C 9 GLU B 280 ? VAL B 284 ? GLU B 256 VAL B 260 
D 1 MSE B 57  ? LEU B 59  ? MSE B 33  LEU B 35  
D 2 ARG B 147 ? TYR B 152 ? ARG B 123 TYR B 128 
D 3 ALA B 135 ? VAL B 141 ? ALA B 111 VAL B 117 
D 4 ILE B 35  ? ARG B 41  ? ILE B 11  ARG B 17  
D 5 LEU B 76  ? SER B 79  ? LEU B 52  SER B 55  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O HIS A 122 ? O HIS A 98  N TYR A 99  ? N TYR A 75  
A 2 3 O ALA A 98  ? O ALA A 74  N THR A 30  ? N THR A 6   
A 3 4 N LEU A 29  ? N LEU A 5   O TYR A 176 ? O TYR A 152 
A 4 5 N THR A 175 ? N THR A 151 O SER A 206 ? O SER A 182 
A 5 6 N MSE A 207 ? N MSE A 183 O PHE A 235 ? O PHE A 211 
A 6 7 N VAL A 234 ? N VAL A 210 O ALA A 265 ? O ALA A 241 
A 7 8 N ALA A 264 ? N ALA A 240 O LEU A 276 ? O LEU A 252 
A 8 9 N ALA A 273 ? N ALA A 249 O VAL A 284 ? O VAL A 260 
B 1 2 N ASN A 58  ? N ASN A 34  O MSE A 149 ? O MSE A 125 
B 2 3 O TYR A 152 ? O TYR A 128 N ARG A 136 ? N ARG A 112 
B 3 4 O VAL A 141 ? O VAL A 117 N SER A 40  ? N SER A 16  
B 4 5 N ILE A 39  ? N ILE A 15  O LEU A 76  ? O LEU A 52  
C 1 2 O HIS B 122 ? O HIS B 98  N TYR B 99  ? N TYR B 75  
C 2 3 O ALA B 98  ? O ALA B 74  N THR B 30  ? N THR B 6   
C 3 4 N LEU B 29  ? N LEU B 5   O TYR B 176 ? O TYR B 152 
C 4 5 N THR B 175 ? N THR B 151 O SER B 206 ? O SER B 182 
C 5 6 N MSE B 207 ? N MSE B 183 O PHE B 235 ? O PHE B 211 
C 6 7 N VAL B 234 ? N VAL B 210 O ALA B 265 ? O ALA B 241 
C 7 8 N ALA B 264 ? N ALA B 240 O LEU B 276 ? O LEU B 252 
C 8 9 N ILE B 275 ? N ILE B 251 O TYR B 282 ? O TYR B 258 
D 1 2 N ASN B 58  ? N ASN B 34  O MSE B 149 ? O MSE B 125 
D 2 3 O TYR B 152 ? O TYR B 128 N ARG B 136 ? N ARG B 112 
D 3 4 O SER B 137 ? O SER B 113 N ILE B 38  ? N ILE B 14  
D 4 5 N ILE B 39  ? N ILE B 15  O LEU B 76  ? O LEU B 52  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE ADN A 401' 
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE E34 A 402' 
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE DMS A 403' 
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE K A 404'   
AC5 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE ADN B 401' 
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE DMS B 402' 
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE DMS B 403' 
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE K B 404'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 19 ASN A 33  ? ASN A 9   . ? 1_555 ? 
2  AC1 19 ILE A 35  ? ILE A 11  . ? 1_555 ? 
3  AC1 19 ASP A 37  ? ASP A 13  . ? 1_555 ? 
4  AC1 19 MSE A 57  ? MSE A 33  . ? 1_555 ? 
5  AC1 19 GLY A 80  ? GLY A 56  . ? 1_555 ? 
6  AC1 19 GLY A 81  ? GLY A 57  . ? 1_555 ? 
7  AC1 19 SER A 82  ? SER A 58  . ? 1_555 ? 
8  AC1 19 ASN A 85  ? ASN A 61  . ? 1_555 ? 
9  AC1 19 MSE A 149 ? MSE A 125 . ? 1_555 ? 
10 AC1 19 THR A 151 ? THR A 127 . ? 1_555 ? 
11 AC1 19 GLU A 178 ? GLU A 154 . ? 1_555 ? 
12 AC1 19 TYR A 180 ? TYR A 156 . ? 1_555 ? 
13 AC1 19 THR A 296 ? THR A 272 . ? 1_555 ? 
14 AC1 19 GLY A 297 ? GLY A 273 . ? 1_555 ? 
15 AC1 19 ASP A 300 ? ASP A 276 . ? 1_555 ? 
16 AC1 19 PRO A 336 ? PRO A 312 . ? 1_555 ? 
17 AC1 19 HOH K .   ? HOH A 503 . ? 1_555 ? 
18 AC1 19 HOH K .   ? HOH A 519 . ? 1_555 ? 
19 AC1 19 HOH K .   ? HOH A 523 . ? 1_555 ? 
20 AC2 7  ALA A 65  ? ALA A 41  . ? 1_555 ? 
21 AC2 7  PHE A 131 ? PHE A 107 . ? 1_555 ? 
22 AC2 7  PRO A 133 ? PRO A 109 . ? 1_555 ? 
23 AC2 7  ARG A 136 ? ARG A 112 . ? 1_555 ? 
24 AC2 7  TYR A 152 ? TYR A 128 . ? 1_555 ? 
25 AC2 7  DMS E .   ? DMS A 403 . ? 1_555 ? 
26 AC2 7  GLN B 348 ? GLN B 324 . ? 1_655 ? 
27 AC3 6  ILE A 38  ? ILE A 14  . ? 1_555 ? 
28 AC3 6  ALA A 65  ? ALA A 41  . ? 1_555 ? 
29 AC3 6  GLU A 66  ? GLU A 42  . ? 1_555 ? 
30 AC3 6  TYR A 69  ? TYR A 45  . ? 1_555 ? 
31 AC3 6  ARG A 136 ? ARG A 112 . ? 1_555 ? 
32 AC3 6  E34 D .   ? E34 A 402 . ? 1_555 ? 
33 AC4 5  ASP A 294 ? ASP A 270 . ? 1_555 ? 
34 AC4 5  THR A 296 ? THR A 272 . ? 1_555 ? 
35 AC4 5  VAL A 330 ? VAL A 306 . ? 1_555 ? 
36 AC4 5  GLN A 333 ? GLN A 309 . ? 1_555 ? 
37 AC4 5  GLY A 335 ? GLY A 311 . ? 1_555 ? 
38 AC5 19 ASN B 33  ? ASN B 9   . ? 1_555 ? 
39 AC5 19 ILE B 35  ? ILE B 11  . ? 1_555 ? 
40 AC5 19 ASP B 37  ? ASP B 13  . ? 1_555 ? 
41 AC5 19 MSE B 57  ? MSE B 33  . ? 1_555 ? 
42 AC5 19 GLY B 80  ? GLY B 56  . ? 1_555 ? 
43 AC5 19 GLY B 81  ? GLY B 57  . ? 1_555 ? 
44 AC5 19 SER B 82  ? SER B 58  . ? 1_555 ? 
45 AC5 19 ASN B 85  ? ASN B 61  . ? 1_555 ? 
46 AC5 19 MSE B 149 ? MSE B 125 . ? 1_555 ? 
47 AC5 19 THR B 151 ? THR B 127 . ? 1_555 ? 
48 AC5 19 GLU B 178 ? GLU B 154 . ? 1_555 ? 
49 AC5 19 TYR B 180 ? TYR B 156 . ? 1_555 ? 
50 AC5 19 GLY B 297 ? GLY B 273 . ? 1_555 ? 
51 AC5 19 ASP B 300 ? ASP B 276 . ? 1_555 ? 
52 AC5 19 PRO B 336 ? PRO B 312 . ? 1_555 ? 
53 AC5 19 HOH L .   ? HOH B 501 . ? 1_555 ? 
54 AC5 19 HOH L .   ? HOH B 511 . ? 1_555 ? 
55 AC5 19 HOH L .   ? HOH B 535 . ? 1_555 ? 
56 AC5 19 HOH L .   ? HOH B 551 . ? 1_555 ? 
57 AC6 6  ILE B 38  ? ILE B 14  . ? 1_555 ? 
58 AC6 6  ALA B 65  ? ALA B 41  . ? 1_555 ? 
59 AC6 6  GLU B 66  ? GLU B 42  . ? 1_555 ? 
60 AC6 6  TYR B 69  ? TYR B 45  . ? 1_555 ? 
61 AC6 6  ARG B 136 ? ARG B 112 . ? 1_555 ? 
62 AC6 6  DMS I .   ? DMS B 403 . ? 1_555 ? 
63 AC7 4  ALA B 62  ? ALA B 38  . ? 1_555 ? 
64 AC7 4  GLU B 66  ? GLU B 42  . ? 1_555 ? 
65 AC7 4  TYR B 152 ? TYR B 128 . ? 1_555 ? 
66 AC7 4  DMS H .   ? DMS B 402 . ? 1_555 ? 
67 AC8 5  ASP B 294 ? ASP B 270 . ? 1_555 ? 
68 AC8 5  THR B 296 ? THR B 272 . ? 1_555 ? 
69 AC8 5  VAL B 330 ? VAL B 306 . ? 1_555 ? 
70 AC8 5  GLN B 333 ? GLN B 309 . ? 1_555 ? 
71 AC8 5  GLY B 335 ? GLY B 311 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4K8T 
_atom_sites.fract_transf_matrix[1][1]   0.019483 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002825 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012349 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012205 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
K  
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1    N  N     . MSE A 1 23  ? 75.904 36.469 52.969  1.00 50.67  ? -1  MSE A N     1 
HETATM 2    C  CA    . MSE A 1 23  ? 75.000 36.089 51.845  1.00 51.25  ? -1  MSE A CA    1 
HETATM 3    C  C     . MSE A 1 23  ? 75.775 35.503 50.691  1.00 47.09  ? -1  MSE A C     1 
HETATM 4    O  O     . MSE A 1 23  ? 76.915 35.911 50.399  1.00 43.55  ? -1  MSE A O     1 
HETATM 5    C  CB    . MSE A 1 23  ? 74.143 37.268 51.391  1.00 62.07  ? -1  MSE A CB    1 
HETATM 6    C  CG    . MSE A 1 23  ? 74.883 38.596 51.467  1.00 70.77  ? -1  MSE A CG    1 
HETATM 7    SE SE    . MSE A 1 23  ? 74.073 39.837 50.169  1.00 87.23  ? -1  MSE A SE    1 
HETATM 8    C  CE    . MSE A 1 23  ? 75.677 40.939 49.868  1.00 128.78 ? -1  MSE A CE    1 
ATOM   9    N  N     . THR A 1 24  ? 75.154 34.523 50.034  1.00 44.82  ? 0   THR A N     1 
ATOM   10   C  CA    . THR A 1 24  ? 75.799 33.810 48.932  1.00 42.68  ? 0   THR A CA    1 
ATOM   11   C  C     . THR A 1 24  ? 75.022 33.916 47.615  1.00 34.85  ? 0   THR A C     1 
ATOM   12   O  O     . THR A 1 24  ? 73.800 34.128 47.595  1.00 31.69  ? 0   THR A O     1 
ATOM   13   C  CB    . THR A 1 24  ? 76.203 32.354 49.304  1.00 42.71  ? 0   THR A CB    1 
ATOM   14   O  OG1   . THR A 1 24  ? 75.081 31.628 49.831  1.00 44.41  ? 0   THR A OG1   1 
ATOM   15   C  CG2   . THR A 1 24  ? 77.326 32.364 50.345  1.00 48.75  ? 0   THR A CG2   1 
ATOM   16   N  N     . ARG A 1 25  ? 75.768 33.793 46.524  1.00 30.95  ? 1   ARG A N     1 
ATOM   17   C  CA    . ARG A 1 25  ? 75.253 33.931 45.175  1.00 33.03  ? 1   ARG A CA    1 
ATOM   18   C  C     . ARG A 1 25  ? 74.164 32.927 44.850  1.00 28.21  ? 1   ARG A C     1 
ATOM   19   O  O     . ARG A 1 25  ? 73.250 33.235 44.093  1.00 37.49  ? 1   ARG A O     1 
ATOM   20   C  CB    . ARG A 1 25  ? 76.387 33.752 44.168  1.00 35.39  ? 1   ARG A CB    1 
ATOM   21   C  CG    . ARG A 1 25  ? 77.424 34.858 44.161  1.00 37.60  ? 1   ARG A CG    1 
ATOM   22   C  CD    . ARG A 1 25  ? 78.332 34.695 42.956  1.00 36.60  ? 1   ARG A CD    1 
ATOM   23   N  NE    . ARG A 1 25  ? 79.186 33.518 43.076  1.00 35.31  ? 1   ARG A NE    1 
ATOM   24   C  CZ    . ARG A 1 25  ? 80.125 33.166 42.201  1.00 39.14  ? 1   ARG A CZ    1 
ATOM   25   N  NH1   . ARG A 1 25  ? 80.849 32.075 42.421  1.00 44.05  ? 1   ARG A NH1   1 
ATOM   26   N  NH2   . ARG A 1 25  ? 80.343 33.889 41.110  1.00 51.78  ? 1   ARG A NH2   1 
ATOM   27   N  N     . PHE A 1 26  ? 74.267 31.721 45.407  1.00 29.52  ? 2   PHE A N     1 
ATOM   28   C  CA    . PHE A 1 26  ? 73.387 30.626 44.995  1.00 23.39  ? 2   PHE A CA    1 
ATOM   29   C  C     . PHE A 1 26  ? 72.743 29.879 46.155  1.00 24.60  ? 2   PHE A C     1 
ATOM   30   O  O     . PHE A 1 26  ? 73.382 29.616 47.187  1.00 28.09  ? 2   PHE A O     1 
ATOM   31   C  CB    . PHE A 1 26  ? 74.121 29.653 44.056  1.00 25.02  ? 2   PHE A CB    1 
ATOM   32   C  CG    . PHE A 1 26  ? 74.764 30.323 42.880  1.00 23.97  ? 2   PHE A CG    1 
ATOM   33   C  CD1   . PHE A 1 26  ? 73.984 30.811 41.824  1.00 24.16  ? 2   PHE A CD1   1 
ATOM   34   C  CD2   . PHE A 1 26  ? 76.147 30.476 42.818  1.00 25.86  ? 2   PHE A CD2   1 
ATOM   35   C  CE1   . PHE A 1 26  ? 74.573 31.430 40.744  1.00 19.57  ? 2   PHE A CE1   1 
ATOM   36   C  CE2   . PHE A 1 26  ? 76.740 31.113 41.730  1.00 28.31  ? 2   PHE A CE2   1 
ATOM   37   C  CZ    . PHE A 1 26  ? 75.949 31.581 40.693  1.00 24.32  ? 2   PHE A CZ    1 
ATOM   38   N  N     . ASP A 1 27  ? 71.459 29.587 45.985  1.00 20.85  ? 3   ASP A N     1 
ATOM   39   C  CA    . ASP A 1 27  ? 70.740 28.704 46.869  1.00 22.78  ? 3   ASP A CA    1 
ATOM   40   C  C     . ASP A 1 27  ? 71.024 27.273 46.444  1.00 26.98  ? 3   ASP A C     1 
ATOM   41   O  O     . ASP A 1 27  ? 71.488 26.468 47.250  1.00 28.52  ? 3   ASP A O     1 
ATOM   42   C  CB    . ASP A 1 27  ? 69.246 28.990 46.813  1.00 23.31  ? 3   ASP A CB    1 
ATOM   43   C  CG    . ASP A 1 27  ? 68.915 30.421 47.194  1.00 26.23  ? 3   ASP A CG    1 
ATOM   44   O  OD1   . ASP A 1 27  ? 69.448 30.909 48.228  1.00 27.30  ? 3   ASP A OD1   1 
ATOM   45   O  OD2   . ASP A 1 27  ? 68.127 31.058 46.451  1.00 26.30  ? 3   ASP A OD2   1 
ATOM   46   N  N     . VAL A 1 28  ? 70.751 26.961 45.177  1.00 23.55  ? 4   VAL A N     1 
ATOM   47   C  CA    . VAL A 1 28  ? 70.970 25.606 44.658  1.00 25.17  ? 4   VAL A CA    1 
ATOM   48   C  C     . VAL A 1 28  ? 71.873 25.572 43.417  1.00 21.65  ? 4   VAL A C     1 
ATOM   49   O  O     . VAL A 1 28  ? 71.575 26.204 42.388  1.00 22.52  ? 4   VAL A O     1 
ATOM   50   C  CB    . VAL A 1 28  ? 69.639 24.859 44.333  1.00 24.47  ? 4   VAL A CB    1 
ATOM   51   C  CG1   . VAL A 1 28  ? 69.890 23.367 44.135  1.00 21.84  ? 4   VAL A CG1   1 
ATOM   52   C  CG2   . VAL A 1 28  ? 68.608 25.044 45.435  1.00 24.05  ? 4   VAL A CG2   1 
ATOM   53   N  N     . LEU A 1 29  ? 72.969 24.836 43.525  1.00 17.92  ? 5   LEU A N     1 
ATOM   54   C  CA    . LEU A 1 29  ? 73.711 24.370 42.365  1.00 17.32  ? 5   LEU A CA    1 
ATOM   55   C  C     . LEU A 1 29  ? 73.334 22.905 42.078  1.00 18.11  ? 5   LEU A C     1 
ATOM   56   O  O     . LEU A 1 29  ? 73.321 22.044 42.967  1.00 17.99  ? 5   LEU A O     1 
ATOM   57   C  CB    . LEU A 1 29  ? 75.233 24.518 42.541  1.00 17.68  ? 5   LEU A CB    1 
ATOM   58   C  CG    . LEU A 1 29  ? 76.176 23.771 41.573  1.00 20.34  ? 5   LEU A CG    1 
ATOM   59   C  CD1   . LEU A 1 29  ? 76.140 24.310 40.149  1.00 19.45  ? 5   LEU A CD1   1 
ATOM   60   C  CD2   . LEU A 1 29  ? 77.602 23.756 42.101  1.00 23.83  ? 5   LEU A CD2   1 
ATOM   61   N  N     . THR A 1 30  ? 72.999 22.621 40.826  1.00 18.91  ? 6   THR A N     1 
ATOM   62   C  CA    . THR A 1 30  ? 72.767 21.254 40.418  1.00 15.24  ? 6   THR A CA    1 
ATOM   63   C  C     . THR A 1 30  ? 73.812 20.842 39.363  1.00 12.76  ? 6   THR A C     1 
ATOM   64   O  O     . THR A 1 30  ? 74.398 21.675 38.689  1.00 13.98  ? 6   THR A O     1 
ATOM   65   C  CB    . THR A 1 30  ? 71.361 21.040 39.811  1.00 18.07  ? 6   THR A CB    1 
ATOM   66   O  OG1   . THR A 1 30  ? 71.281 21.658 38.515  1.00 18.54  ? 6   THR A OG1   1 
ATOM   67   C  CG2   . THR A 1 30  ? 70.265 21.560 40.743  1.00 14.71  ? 6   THR A CG2   1 
ATOM   68   N  N     . VAL A 1 31  ? 74.056 19.542 39.290  1.00 15.94  ? 7   VAL A N     1 
ATOM   69   C  CA    . VAL A 1 31  ? 75.057 18.970 38.378  1.00 14.02  ? 7   VAL A CA    1 
ATOM   70   C  C     . VAL A 1 31  ? 74.443 17.750 37.732  1.00 15.76  ? 7   VAL A C     1 
ATOM   71   O  O     . VAL A 1 31  ? 73.930 16.864 38.421  1.00 19.09  ? 7   VAL A O     1 
ATOM   72   C  CB    . VAL A 1 31  ? 76.351 18.572 39.106  1.00 16.70  ? 7   VAL A CB    1 
ATOM   73   C  CG1   . VAL A 1 31  ? 77.370 18.042 38.117  1.00 18.49  ? 7   VAL A CG1   1 
ATOM   74   C  CG2   . VAL A 1 31  ? 76.947 19.781 39.768  1.00 14.66  ? 7   VAL A CG2   1 
ATOM   75   N  N     . GLY A 1 32  ? 74.500 17.715 36.408  1.00 14.47  ? 8   GLY A N     1 
ATOM   76   C  CA    . GLY A 1 32  ? 73.881 16.592 35.674  1.00 13.32  ? 8   GLY A CA    1 
ATOM   77   C  C     . GLY A 1 32  ? 74.271 16.426 34.217  1.00 14.93  ? 8   GLY A C     1 
ATOM   78   O  O     . GLY A 1 32  ? 75.105 17.156 33.703  1.00 17.33  ? 8   GLY A O     1 
ATOM   79   N  N     . ASN A 1 33  ? 73.696 15.401 33.597  1.00 14.03  ? 9   ASN A N     1 
ATOM   80   C  CA    . ASN A 1 33  ? 73.814 15.183 32.130  1.00 14.25  ? 9   ASN A CA    1 
ATOM   81   C  C     . ASN A 1 33  ? 72.998 16.224 31.405  1.00 12.98  ? 9   ASN A C     1 
ATOM   82   O  O     . ASN A 1 33  ? 71.803 16.307 31.611  1.00 13.95  ? 9   ASN A O     1 
ATOM   83   C  CB    . ASN A 1 33  ? 73.357 13.773 31.797  1.00 13.01  ? 9   ASN A CB    1 
ATOM   84   C  CG    . ASN A 1 33  ? 74.284 12.713 32.371  1.00 14.31  ? 9   ASN A CG    1 
ATOM   85   O  OD1   . ASN A 1 33  ? 75.503 12.766 32.182  1.00 16.19  ? 9   ASN A OD1   1 
ATOM   86   N  ND2   . ASN A 1 33  ? 73.709 11.729 33.051  1.00 14.52  ? 9   ASN A ND2   1 
ATOM   87   N  N     . ALA A 1 34  ? 73.659 17.061 30.604  1.00 12.12  ? 10  ALA A N     1 
ATOM   88   C  CA    . ALA A 1 34  ? 72.950 18.106 29.854  1.00 13.12  ? 10  ALA A CA    1 
ATOM   89   C  C     . ALA A 1 34  ? 72.326 17.457 28.624  1.00 13.57  ? 10  ALA A C     1 
ATOM   90   O  O     . ALA A 1 34  ? 73.034 16.964 27.755  1.00 15.40  ? 10  ALA A O     1 
ATOM   91   C  CB    . ALA A 1 34  ? 73.879 19.238 29.471  1.00 14.27  ? 10  ALA A CB    1 
ATOM   92   N  N     . ILE A 1 35  ? 71.001 17.457 28.577  1.00 12.83  ? 11  ILE A N     1 
ATOM   93   C  CA    . ILE A 1 35  ? 70.252 16.691 27.564  1.00 11.32  ? 11  ILE A CA    1 
ATOM   94   C  C     . ILE A 1 35  ? 69.118 17.528 26.988  1.00 13.64  ? 11  ILE A C     1 
ATOM   95   O  O     . ILE A 1 35  ? 68.456 18.310 27.696  1.00 13.40  ? 11  ILE A O     1 
ATOM   96   C  CB    . ILE A 1 35  ? 69.689 15.391 28.199  1.00 12.65  ? 11  ILE A CB    1 
ATOM   97   C  CG1   . ILE A 1 35  ? 70.820 14.403 28.510  1.00 15.41  ? 11  ILE A CG1   1 
ATOM   98   C  CG2   . ILE A 1 35  ? 68.576 14.727 27.371  1.00 13.08  ? 11  ILE A CG2   1 
ATOM   99   C  CD1   . ILE A 1 35  ? 70.460 13.421 29.590  1.00 14.58  ? 11  ILE A CD1   1 
ATOM   100  N  N     . VAL A 1 36  ? 68.888 17.351 25.688  1.00 14.05  ? 12  VAL A N     1 
ATOM   101  C  CA    . VAL A 1 36  ? 67.679 17.881 25.067  1.00 13.80  ? 12  VAL A CA    1 
ATOM   102  C  C     . VAL A 1 36  ? 66.721 16.715 24.793  1.00 12.39  ? 12  VAL A C     1 
ATOM   103  O  O     . VAL A 1 36  ? 67.132 15.709 24.230  1.00 14.33  ? 12  VAL A O     1 
ATOM   104  C  CB    . VAL A 1 36  ? 68.020 18.568 23.732  1.00 14.52  ? 12  VAL A CB    1 
ATOM   105  C  CG1   . VAL A 1 36  ? 66.751 18.993 23.019  1.00 15.30  ? 12  VAL A CG1   1 
ATOM   106  C  CG2   . VAL A 1 36  ? 68.916 19.781 23.990  1.00 15.12  ? 12  VAL A CG2   1 
ATOM   107  N  N     . ASP A 1 37  ? 65.464 16.868 25.199  1.00 14.30  ? 13  ASP A N     1 
ATOM   108  C  CA    . ASP A 1 37  ? 64.441 15.842 25.034  1.00 14.87  ? 13  ASP A CA    1 
ATOM   109  C  C     . ASP A 1 37  ? 63.776 15.948 23.663  1.00 14.42  ? 13  ASP A C     1 
ATOM   110  O  O     . ASP A 1 37  ? 63.520 17.035 23.176  1.00 15.17  ? 13  ASP A O     1 
ATOM   111  C  CB    . ASP A 1 37  ? 63.370 15.973 26.103  1.00 16.05  ? 13  ASP A CB    1 
ATOM   112  C  CG    . ASP A 1 37  ? 63.922 15.752 27.511  1.00 17.34  ? 13  ASP A CG    1 
ATOM   113  O  OD1   . ASP A 1 37  ? 65.053 15.247 27.624  1.00 19.92  ? 13  ASP A OD1   1 
ATOM   114  O  OD2   . ASP A 1 37  ? 63.199 16.063 28.477  1.00 17.59  ? 13  ASP A OD2   1 
ATOM   115  N  N     . ILE A 1 38  ? 63.520 14.791 23.087  1.00 14.92  ? 14  ILE A N     1 
ATOM   116  C  CA    . ILE A 1 38  ? 62.775 14.626 21.835  1.00 13.91  ? 14  ILE A CA    1 
ATOM   117  C  C     . ILE A 1 38  ? 61.556 13.803 22.261  1.00 13.96  ? 14  ILE A C     1 
ATOM   118  O  O     . ILE A 1 38  ? 61.687 12.622 22.619  1.00 14.31  ? 14  ILE A O     1 
ATOM   119  C  CB    . ILE A 1 38  ? 63.639 13.901 20.782  1.00 14.12  ? 14  ILE A CB    1 
ATOM   120  C  CG1   . ILE A 1 38  ? 64.943 14.679 20.565  1.00 15.39  ? 14  ILE A CG1   1 
ATOM   121  C  CG2   . ILE A 1 38  ? 62.865 13.712 19.461  1.00 14.62  ? 14  ILE A CG2   1 
ATOM   122  C  CD1   . ILE A 1 38  ? 65.937 14.033 19.627  1.00 18.76  ? 14  ILE A CD1   1 
ATOM   123  N  N     . ILE A 1 39  ? 60.384 14.435 22.255  1.00 15.31  ? 15  ILE A N     1 
ATOM   124  C  CA    . ILE A 1 39  ? 59.189 13.871 22.895  1.00 15.64  ? 15  ILE A CA    1 
ATOM   125  C  C     . ILE A 1 39  ? 58.114 13.453 21.896  1.00 16.12  ? 15  ILE A C     1 
ATOM   126  O  O     . ILE A 1 39  ? 57.751 14.231 21.002  1.00 19.49  ? 15  ILE A O     1 
ATOM   127  C  CB    . ILE A 1 39  ? 58.573 14.864 23.918  1.00 18.06  ? 15  ILE A CB    1 
ATOM   128  C  CG1   . ILE A 1 39  ? 59.636 15.364 24.909  1.00 20.79  ? 15  ILE A CG1   1 
ATOM   129  C  CG2   . ILE A 1 39  ? 57.388 14.243 24.666  1.00 17.71  ? 15  ILE A CG2   1 
ATOM   130  C  CD1   . ILE A 1 39  ? 59.307 16.692 25.570  1.00 26.30  ? 15  ILE A CD1   1 
ATOM   131  N  N     . SER A 1 40  ? 57.595 12.235 22.066  1.00 16.10  ? 16  SER A N     1 
ATOM   132  C  CA    . SER A 1 40  ? 56.490 11.738 21.232  1.00 17.65  ? 16  SER A CA    1 
ATOM   133  C  C     . SER A 1 40  ? 55.547 10.860 22.057  1.00 20.16  ? 16  SER A C     1 
ATOM   134  O  O     . SER A 1 40  ? 55.961 10.218 23.022  1.00 23.44  ? 16  SER A O     1 
ATOM   135  C  CB    . SER A 1 40  ? 57.030 10.955 20.030  1.00 20.57  ? 16  SER A CB    1 
ATOM   136  O  OG    . SER A 1 40  ? 56.031 10.794 19.032  1.00 28.75  ? 16  SER A OG    1 
ATOM   137  N  N     . ARG A 1 41  ? 54.276 10.860 21.684  1.00 20.87  ? 17  ARG A N     1 
ATOM   138  C  CA    . ARG A 1 41  ? 53.282 9.975  22.272  1.00 21.82  ? 17  ARG A CA    1 
ATOM   139  C  C     . ARG A 1 41  ? 53.304 8.636  21.512  1.00 22.85  ? 17  ARG A C     1 
ATOM   140  O  O     . ARG A 1 41  ? 53.433 8.625  20.277  1.00 28.53  ? 17  ARG A O     1 
ATOM   141  C  CB    . ARG A 1 41  ? 51.904 10.642 22.153  1.00 26.47  ? 17  ARG A CB    1 
ATOM   142  C  CG    . ARG A 1 41  ? 50.912 10.244 23.224  1.00 33.70  ? 17  ARG A CG    1 
ATOM   143  C  CD    . ARG A 1 41  ? 50.767 11.319 24.291  1.00 43.29  ? 17  ARG A CD    1 
ATOM   144  N  NE    . ARG A 1 41  ? 50.217 10.765 25.524  1.00 49.39  ? 17  ARG A NE    1 
ATOM   145  C  CZ    . ARG A 1 41  ? 49.827 11.482 26.575  1.00 43.17  ? 17  ARG A CZ    1 
ATOM   146  N  NH1   . ARG A 1 41  ? 49.904 12.813 26.563  1.00 42.48  ? 17  ARG A NH1   1 
ATOM   147  N  NH2   . ARG A 1 41  ? 49.348 10.862 27.644  1.00 42.17  ? 17  ARG A NH2   1 
ATOM   148  N  N     . CYS A 1 42  ? 53.187 7.515  22.224  1.00 20.26  ? 18  CYS A N     1 
ATOM   149  C  CA    . CYS A 1 42  ? 53.075 6.194  21.556  1.00 20.47  ? 18  CYS A CA    1 
ATOM   150  C  C     . CYS A 1 42  ? 52.009 5.305  22.202  1.00 22.50  ? 18  CYS A C     1 
ATOM   151  O  O     . CYS A 1 42  ? 51.512 5.621  23.279  1.00 23.70  ? 18  CYS A O     1 
ATOM   152  C  CB    . CYS A 1 42  ? 54.442 5.480  21.500  1.00 22.74  ? 18  CYS A CB    1 
ATOM   153  S  SG    . CYS A 1 42  ? 55.079 4.909  23.109  1.00 22.35  ? 18  CYS A SG    1 
ATOM   154  N  N     . ASN A 1 43  ? 51.640 4.211  21.530  1.00 25.04  ? 19  ASN A N     1 
ATOM   155  C  CA    . ASN A 1 43  ? 50.823 3.167  22.163  1.00 25.95  ? 19  ASN A CA    1 
ATOM   156  C  C     . ASN A 1 43  ? 51.729 2.210  22.946  1.00 23.84  ? 19  ASN A C     1 
ATOM   157  O  O     . ASN A 1 43  ? 52.959 2.258  22.789  1.00 23.15  ? 19  ASN A O     1 
ATOM   158  C  CB    . ASN A 1 43  ? 49.947 2.420  21.144  1.00 27.27  ? 19  ASN A CB    1 
ATOM   159  C  CG    . ASN A 1 43  ? 50.737 1.806  19.997  1.00 29.66  ? 19  ASN A CG    1 
ATOM   160  O  OD1   . ASN A 1 43  ? 51.906 1.433  20.133  1.00 30.25  ? 19  ASN A OD1   1 
ATOM   161  N  ND2   . ASN A 1 43  ? 50.074 1.674  18.846  1.00 35.43  ? 19  ASN A ND2   1 
ATOM   162  N  N     . ASP A 1 44  ? 51.140 1.355  23.781  1.00 27.10  ? 20  ASP A N     1 
ATOM   163  C  CA    A ASP A 1 44  ? 51.984 0.506  24.620  0.50 28.19  ? 20  ASP A CA    1 
ATOM   164  C  CA    B ASP A 1 44  ? 51.870 0.407  24.639  0.50 27.08  ? 20  ASP A CA    1 
ATOM   165  C  C     . ASP A 1 44  ? 52.666 -0.605 23.822  1.00 25.33  ? 20  ASP A C     1 
ATOM   166  O  O     . ASP A 1 44  ? 53.726 -1.091 24.236  1.00 24.69  ? 20  ASP A O     1 
ATOM   167  C  CB    A ASP A 1 44  ? 51.259 -0.024 25.869  0.50 30.08  ? 20  ASP A CB    1 
ATOM   168  C  CB    B ASP A 1 44  ? 50.886 -0.349 25.551  0.50 25.80  ? 20  ASP A CB    1 
ATOM   169  C  CG    A ASP A 1 44  ? 52.200 -0.180 27.062  0.50 27.69  ? 20  ASP A CG    1 
ATOM   170  C  CG    B ASP A 1 44  ? 49.941 0.582  26.298  0.50 22.70  ? 20  ASP A CG    1 
ATOM   171  O  OD1   A ASP A 1 44  ? 53.069 -1.074 27.010  0.50 30.45  ? 20  ASP A OD1   1 
ATOM   172  O  OD1   B ASP A 1 44  ? 50.343 1.724  26.592  0.50 23.21  ? 20  ASP A OD1   1 
ATOM   173  O  OD2   A ASP A 1 44  ? 52.086 0.600  28.045  0.50 20.80  ? 20  ASP A OD2   1 
ATOM   174  O  OD2   B ASP A 1 44  ? 48.796 0.171  26.596  0.50 22.61  ? 20  ASP A OD2   1 
ATOM   175  N  N     . GLN A 1 45  ? 52.108 -0.964 22.667  1.00 25.50  ? 21  GLN A N     1 
ATOM   176  C  CA    . GLN A 1 45  ? 52.729 -1.948 21.795  1.00 24.09  ? 21  GLN A CA    1 
ATOM   177  C  C     . GLN A 1 45  ? 54.064 -1.433 21.245  1.00 15.36  ? 21  GLN A C     1 
ATOM   178  O  O     . GLN A 1 45  ? 54.955 -2.204 20.986  1.00 16.28  ? 21  GLN A O     1 
ATOM   179  C  CB    . GLN A 1 45  ? 51.776 -2.352 20.661  1.00 27.11  ? 21  GLN A CB    1 
ATOM   180  C  CG    . GLN A 1 45  ? 52.199 -3.579 19.857  1.00 27.30  ? 21  GLN A CG    1 
ATOM   181  C  CD    . GLN A 1 45  ? 52.372 -4.831 20.699  1.00 31.07  ? 21  GLN A CD    1 
ATOM   182  O  OE1   . GLN A 1 45  ? 51.611 -5.085 21.634  1.00 33.36  ? 21  GLN A OE1   1 
ATOM   183  N  NE2   . GLN A 1 45  ? 53.383 -5.628 20.363  1.00 37.48  ? 21  GLN A NE2   1 
ATOM   184  N  N     . PHE A 1 46  ? 54.197 -0.124 21.074  1.00 18.61  ? 22  PHE A N     1 
ATOM   185  C  CA    . PHE A 1 46  ? 55.464 0.435  20.625  1.00 16.81  ? 22  PHE A CA    1 
ATOM   186  C  C     . PHE A 1 46  ? 56.611 0.062  21.586  1.00 17.84  ? 22  PHE A C     1 
ATOM   187  O  O     . PHE A 1 46  ? 57.715 -0.309 21.159  1.00 17.70  ? 22  PHE A O     1 
ATOM   188  C  CB    . PHE A 1 46  ? 55.380 1.955  20.479  1.00 15.81  ? 22  PHE A CB    1 
ATOM   189  C  CG    . PHE A 1 46  ? 56.631 2.563  19.927  1.00 17.41  ? 22  PHE A CG    1 
ATOM   190  C  CD1   . PHE A 1 46  ? 56.780 2.716  18.562  1.00 18.29  ? 22  PHE A CD1   1 
ATOM   191  C  CD2   . PHE A 1 46  ? 57.657 2.996  20.757  1.00 16.06  ? 22  PHE A CD2   1 
ATOM   192  C  CE1   . PHE A 1 46  ? 57.931 3.269  18.039  1.00 21.27  ? 22  PHE A CE1   1 
ATOM   193  C  CE2   . PHE A 1 46  ? 58.818 3.536  20.248  1.00 18.52  ? 22  PHE A CE2   1 
ATOM   194  C  CZ    . PHE A 1 46  ? 58.951 3.686  18.869  1.00 19.77  ? 22  PHE A CZ    1 
ATOM   195  N  N     . LEU A 1 47  ? 56.344 0.152  22.885  1.00 17.75  ? 23  LEU A N     1 
ATOM   196  C  CA    . LEU A 1 47  ? 57.372 -0.152 23.870  1.00 16.68  ? 23  LEU A CA    1 
ATOM   197  C  C     . LEU A 1 47  ? 57.797 -1.601 23.771  1.00 14.67  ? 23  LEU A C     1 
ATOM   198  O  O     . LEU A 1 47  ? 58.980 -1.884 23.750  1.00 17.49  ? 23  LEU A O     1 
ATOM   199  C  CB    . LEU A 1 47  ? 56.882 0.184  25.297  1.00 15.52  ? 23  LEU A CB    1 
ATOM   200  C  CG    . LEU A 1 47  ? 56.582 1.671  25.564  1.00 15.91  ? 23  LEU A CG    1 
ATOM   201  C  CD1   . LEU A 1 47  ? 56.137 1.875  26.994  1.00 16.80  ? 23  LEU A CD1   1 
ATOM   202  C  CD2   . LEU A 1 47  ? 57.741 2.593  25.208  1.00 17.61  ? 23  LEU A CD2   1 
ATOM   203  N  N     . ILE A 1 48  ? 56.820 -2.504 23.706  1.00 19.18  ? 24  ILE A N     1 
ATOM   204  C  CA    . ILE A 1 48  ? 57.057 -3.945 23.596  1.00 20.72  ? 24  ILE A CA    1 
ATOM   205  C  C     . ILE A 1 48  ? 57.835 -4.297 22.320  1.00 19.12  ? 24  ILE A C     1 
ATOM   206  O  O     . ILE A 1 48  ? 58.842 -4.986 22.385  1.00 21.83  ? 24  ILE A O     1 
ATOM   207  C  CB    . ILE A 1 48  ? 55.741 -4.769 23.718  1.00 23.38  ? 24  ILE A CB    1 
ATOM   208  C  CG1   . ILE A 1 48  ? 54.973 -4.355 24.985  1.00 22.46  ? 24  ILE A CG1   1 
ATOM   209  C  CG2   . ILE A 1 48  ? 56.040 -6.266 23.729  1.00 24.77  ? 24  ILE A CG2   1 
ATOM   210  C  CD1   . ILE A 1 48  ? 53.520 -4.764 25.036  1.00 26.10  ? 24  ILE A CD1   1 
ATOM   211  N  N     . ASP A 1 49  ? 57.377 -3.810 21.165  1.00 18.08  ? 25  ASP A N     1 
ATOM   212  C  CA    . ASP A 1 49  ? 58.045 -4.121 19.894  1.00 18.21  ? 25  ASP A CA    1 
ATOM   213  C  C     . ASP A 1 49  ? 59.510 -3.658 19.846  1.00 19.38  ? 25  ASP A C     1 
ATOM   214  O  O     . ASP A 1 49  ? 60.345 -4.269 19.181  1.00 17.95  ? 25  ASP A O     1 
ATOM   215  C  CB    . ASP A 1 49  ? 57.255 -3.535 18.707  1.00 18.77  ? 25  ASP A CB    1 
ATOM   216  C  CG    . ASP A 1 49  ? 55.847 -4.058 18.627  1.00 20.59  ? 25  ASP A CG    1 
ATOM   217  O  OD1   . ASP A 1 49  ? 55.516 -5.077 19.286  1.00 23.62  ? 25  ASP A OD1   1 
ATOM   218  O  OD2   . ASP A 1 49  ? 55.061 -3.466 17.865  1.00 21.96  ? 25  ASP A OD2   1 
ATOM   219  N  N     . ASN A 1 50  ? 59.823 -2.592 20.577  1.00 18.35  ? 26  ASN A N     1 
ATOM   220  C  CA    . ASN A 1 50  ? 61.150 -2.001 20.538  1.00 18.17  ? 26  ASN A CA    1 
ATOM   221  C  C     . ASN A 1 50  ? 62.008 -2.301 21.753  1.00 19.26  ? 26  ASN A C     1 
ATOM   222  O  O     . ASN A 1 50  ? 63.112 -1.770 21.861  1.00 20.65  ? 26  ASN A O     1 
ATOM   223  C  CB    . ASN A 1 50  ? 61.042 -0.496 20.336  1.00 19.36  ? 26  ASN A CB    1 
ATOM   224  C  CG    . ASN A 1 50  ? 60.712 -0.145 18.902  1.00 18.09  ? 26  ASN A CG    1 
ATOM   225  O  OD1   . ASN A 1 50  ? 61.527 -0.346 18.003  1.00 22.42  ? 26  ASN A OD1   1 
ATOM   226  N  ND2   . ASN A 1 50  ? 59.502 0.359  18.682  1.00 16.46  ? 26  ASN A ND2   1 
ATOM   227  N  N     . GLN A 1 51  ? 61.498 -3.164 22.634  1.00 18.78  ? 27  GLN A N     1 
ATOM   228  C  CA    . GLN A 1 51  ? 62.220 -3.630 23.827  1.00 18.95  ? 27  GLN A CA    1 
ATOM   229  C  C     . GLN A 1 51  ? 62.691 -2.462 24.693  1.00 15.96  ? 27  GLN A C     1 
ATOM   230  O  O     . GLN A 1 51  ? 63.779 -2.508 25.314  1.00 21.58  ? 27  GLN A O     1 
ATOM   231  C  CB    . GLN A 1 51  ? 63.351 -4.592 23.430  1.00 23.97  ? 27  GLN A CB    1 
ATOM   232  C  CG    . GLN A 1 51  ? 62.834 -6.001 23.120  1.00 28.10  ? 27  GLN A CG    1 
ATOM   233  C  CD    . GLN A 1 51  ? 63.787 -6.837 22.282  1.00 37.31  ? 27  GLN A CD    1 
ATOM   234  O  OE1   . GLN A 1 51  ? 64.341 -6.370 21.284  1.00 40.51  ? 27  GLN A OE1   1 
ATOM   235  N  NE2   . GLN A 1 51  ? 63.956 -8.092 22.667  1.00 42.70  ? 27  GLN A NE2   1 
ATOM   236  N  N     . ILE A 1 52  ? 61.847 -1.440 24.751  1.00 14.57  ? 28  ILE A N     1 
ATOM   237  C  CA    . ILE A 1 52  ? 62.040 -0.262 25.604  1.00 16.91  ? 28  ILE A CA    1 
ATOM   238  C  C     . ILE A 1 52  ? 61.469 -0.569 26.989  1.00 17.13  ? 28  ILE A C     1 
ATOM   239  O  O     . ILE A 1 52  ? 60.301 -0.913 27.113  1.00 18.72  ? 28  ILE A O     1 
ATOM   240  C  CB    . ILE A 1 52  ? 61.352 0.996  25.000  1.00 16.13  ? 28  ILE A CB    1 
ATOM   241  C  CG1   . ILE A 1 52  ? 62.085 1.443  23.744  1.00 16.58  ? 28  ILE A CG1   1 
ATOM   242  C  CG2   . ILE A 1 52  ? 61.359 2.183  25.958  1.00 17.02  ? 28  ILE A CG2   1 
ATOM   243  C  CD1   . ILE A 1 52  ? 61.241 2.320  22.828  1.00 18.46  ? 28  ILE A CD1   1 
ATOM   244  N  N     . THR A 1 53  ? 62.279 -0.426 28.034  1.00 16.61  ? 29  THR A N     1 
ATOM   245  C  CA    . THR A 1 53  ? 61.786 -0.719 29.392  1.00 17.27  ? 29  THR A CA    1 
ATOM   246  C  C     . THR A 1 53  ? 60.897 0.451  29.864  1.00 15.78  ? 29  THR A C     1 
ATOM   247  O  O     . THR A 1 53  ? 61.369 1.601  29.961  1.00 16.95  ? 29  THR A O     1 
ATOM   248  C  CB    . THR A 1 53  ? 62.957 -1.006 30.356  1.00 20.69  ? 29  THR A CB    1 
ATOM   249  O  OG1   . THR A 1 53  ? 63.849 -1.953 29.751  1.00 22.39  ? 29  THR A OG1   1 
ATOM   250  C  CG2   . THR A 1 53  ? 62.440 -1.586 31.659  1.00 25.70  ? 29  THR A CG2   1 
ATOM   251  N  N     . LYS A 1 54  ? 59.615 0.162  30.129  1.00 15.92  ? 30  LYS A N     1 
ATOM   252  C  CA    . LYS A 1 54  ? 58.624 1.206  30.447  1.00 15.75  ? 30  LYS A CA    1 
ATOM   253  C  C     . LYS A 1 54  ? 58.962 1.923  31.762  1.00 16.33  ? 30  LYS A C     1 
ATOM   254  O  O     . LYS A 1 54  ? 59.404 1.276  32.742  1.00 17.47  ? 30  LYS A O     1 
ATOM   255  C  CB    . LYS A 1 54  ? 57.199 0.627  30.501  1.00 16.01  ? 30  LYS A CB    1 
ATOM   256  C  CG    . LYS A 1 54  ? 56.106 1.658  30.788  1.00 18.31  ? 30  LYS A CG    1 
ATOM   257  C  CD    . LYS A 1 54  ? 54.699 1.134  30.547  1.00 20.79  ? 30  LYS A CD    1 
ATOM   258  C  CE    . LYS A 1 54  ? 53.654 2.244  30.629  1.00 20.14  ? 30  LYS A CE    1 
ATOM   259  N  NZ    . LYS A 1 54  ? 52.265 1.706  30.555  1.00 21.28  ? 30  LYS A NZ    1 
ATOM   260  N  N     . ALA A 1 55  ? 58.754 3.246  31.765  1.00 17.76  ? 31  ALA A N     1 
ATOM   261  C  CA    . ALA A 1 55  ? 58.967 4.116  32.924  1.00 18.44  ? 31  ALA A CA    1 
ATOM   262  C  C     . ALA A 1 55  ? 60.430 4.283  33.333  1.00 18.89  ? 31  ALA A C     1 
ATOM   263  O  O     . ALA A 1 55  ? 60.722 4.881  34.380  1.00 21.69  ? 31  ALA A O     1 
ATOM   264  C  CB    . ALA A 1 55  ? 58.114 3.666  34.115  1.00 20.13  ? 31  ALA A CB    1 
ATOM   265  N  N     . ALA A 1 56  ? 61.346 3.791  32.507  1.00 17.11  ? 32  ALA A N     1 
ATOM   266  C  CA    . ALA A 1 56  ? 62.766 3.744  32.862  1.00 20.04  ? 32  ALA A CA    1 
ATOM   267  C  C     . ALA A 1 56  ? 63.630 4.620  31.952  1.00 18.76  ? 32  ALA A C     1 
ATOM   268  O  O     . ALA A 1 56  ? 63.189 5.052  30.875  1.00 18.27  ? 32  ALA A O     1 
ATOM   269  C  CB    . ALA A 1 56  ? 63.262 2.306  32.844  1.00 22.72  ? 32  ALA A CB    1 
HETATM 270  N  N     . MSE A 1 57  ? 64.847 4.895  32.402  1.00 16.34  ? 33  MSE A N     1 
HETATM 271  C  CA    . MSE A 1 57  ? 65.862 5.538  31.567  1.00 15.20  ? 33  MSE A CA    1 
HETATM 272  C  C     . MSE A 1 57  ? 66.683 4.448  30.907  1.00 17.18  ? 33  MSE A C     1 
HETATM 273  O  O     . MSE A 1 57  ? 67.417 3.701  31.576  1.00 16.87  ? 33  MSE A O     1 
HETATM 274  C  CB    . MSE A 1 57  ? 66.704 6.478  32.456  1.00 16.47  ? 33  MSE A CB    1 
HETATM 275  C  CG    . MSE A 1 57  ? 67.483 7.483  31.624  1.00 20.16  ? 33  MSE A CG    1 
HETATM 276  SE SE    . MSE A 1 57  ? 69.090 6.721  30.773  1.00 31.71  ? 33  MSE A SE    1 
HETATM 277  C  CE    . MSE A 1 57  ? 70.091 6.298  32.423  1.00 17.50  ? 33  MSE A CE    1 
ATOM   278  N  N     . ASN A 1 58  ? 66.545 4.331  29.578  1.00 14.60  ? 34  ASN A N     1 
ATOM   279  C  CA    . ASN A 1 58  ? 67.226 3.322  28.783  1.00 14.42  ? 34  ASN A CA    1 
ATOM   280  C  C     . ASN A 1 58  ? 68.411 3.937  28.063  1.00 16.88  ? 34  ASN A C     1 
ATOM   281  O  O     . ASN A 1 58  ? 68.220 4.724  27.128  1.00 17.78  ? 34  ASN A O     1 
ATOM   282  C  CB    . ASN A 1 58  ? 66.265 2.745  27.693  1.00 13.65  ? 34  ASN A CB    1 
ATOM   283  C  CG    . ASN A 1 58  ? 65.042 2.038  28.278  1.00 16.01  ? 34  ASN A CG    1 
ATOM   284  O  OD1   . ASN A 1 58  ? 64.999 0.823  28.314  1.00 19.55  ? 34  ASN A OD1   1 
ATOM   285  N  ND2   . ASN A 1 58  ? 64.050 2.808  28.748  1.00 17.56  ? 34  ASN A ND2   1 
ATOM   286  N  N     . LEU A 1 59  ? 69.632 3.602  28.488  1.00 15.81  ? 35  LEU A N     1 
ATOM   287  C  CA    . LEU A 1 59  ? 70.825 4.062  27.761  1.00 14.66  ? 35  LEU A CA    1 
ATOM   288  C  C     . LEU A 1 59  ? 70.926 3.401  26.395  1.00 16.26  ? 35  LEU A C     1 
ATOM   289  O  O     . LEU A 1 59  ? 70.598 2.209  26.231  1.00 16.14  ? 35  LEU A O     1 
ATOM   290  C  CB    . LEU A 1 59  ? 72.111 3.812  28.552  1.00 14.60  ? 35  LEU A CB    1 
ATOM   291  C  CG    . LEU A 1 59  ? 72.333 4.721  29.764  1.00 17.77  ? 35  LEU A CG    1 
ATOM   292  C  CD1   . LEU A 1 59  ? 73.381 4.123  30.695  1.00 21.49  ? 35  LEU A CD1   1 
ATOM   293  C  CD2   . LEU A 1 59  ? 72.713 6.137  29.341  1.00 17.07  ? 35  LEU A CD2   1 
ATOM   294  N  N     . ILE A 1 60  ? 71.366 4.194  25.427  1.00 15.56  ? 36  ILE A N     1 
ATOM   295  C  CA    . ILE A 1 60  ? 71.476 3.723  24.031  1.00 16.05  ? 36  ILE A CA    1 
ATOM   296  C  C     . ILE A 1 60  ? 72.728 4.283  23.364  1.00 16.96  ? 36  ILE A C     1 
ATOM   297  O  O     . ILE A 1 60  ? 73.180 5.377  23.704  1.00 16.56  ? 36  ILE A O     1 
ATOM   298  C  CB    . ILE A 1 60  ? 70.221 4.112  23.205  1.00 15.80  ? 36  ILE A CB    1 
ATOM   299  C  CG1   . ILE A 1 60  ? 70.021 5.622  23.121  1.00 16.63  ? 36  ILE A CG1   1 
ATOM   300  C  CG2   . ILE A 1 60  ? 68.981 3.411  23.742  1.00 18.31  ? 36  ILE A CG2   1 
ATOM   301  C  CD1   . ILE A 1 60  ? 68.876 6.040  22.214  1.00 18.26  ? 36  ILE A CD1   1 
ATOM   302  N  N     . ASP A 1 61  ? 73.276 3.531  22.409  1.00 20.18  ? 37  ASP A N     1 
ATOM   303  C  CA    . ASP A 1 61  ? 74.382 4.009  21.587  1.00 19.08  ? 37  ASP A CA    1 
ATOM   304  C  C     . ASP A 1 61  ? 73.880 4.781  20.366  1.00 18.57  ? 37  ASP A C     1 
ATOM   305  O  O     . ASP A 1 61  ? 72.666 4.905  20.155  1.00 18.50  ? 37  ASP A O     1 
ATOM   306  C  CB    . ASP A 1 61  ? 75.369 2.886  21.206  1.00 22.53  ? 37  ASP A CB    1 
ATOM   307  C  CG    . ASP A 1 61  ? 74.724 1.728  20.430  1.00 22.84  ? 37  ASP A CG    1 
ATOM   308  O  OD1   . ASP A 1 61  ? 73.745 1.927  19.675  1.00 21.84  ? 37  ASP A OD1   1 
ATOM   309  O  OD2   . ASP A 1 61  ? 75.241 0.596  20.555  1.00 25.77  ? 37  ASP A OD2   1 
ATOM   310  N  N     . ALA A 1 62  ? 74.823 5.291  19.581  1.00 17.50  ? 38  ALA A N     1 
ATOM   311  C  CA    . ALA A 1 62  ? 74.524 6.154  18.440  1.00 18.55  ? 38  ALA A CA    1 
ATOM   312  C  C     . ALA A 1 62  ? 73.712 5.413  17.384  1.00 19.12  ? 38  ALA A C     1 
ATOM   313  O  O     . ALA A 1 62  ? 72.816 6.002  16.761  1.00 23.12  ? 38  ALA A O     1 
ATOM   314  C  CB    . ALA A 1 62  ? 75.807 6.707  17.828  1.00 18.83  ? 38  ALA A CB    1 
ATOM   315  N  N     . GLU A 1 63  ? 74.018 4.132  17.193  1.00 19.41  ? 39  GLU A N     1 
ATOM   316  C  CA    . GLU A 1 63  ? 73.322 3.316  16.174  1.00 21.34  ? 39  GLU A CA    1 
ATOM   317  C  C     . GLU A 1 63  ? 71.858 3.056  16.561  1.00 20.20  ? 39  GLU A C     1 
ATOM   318  O  O     . GLU A 1 63  ? 70.949 3.150  15.724  1.00 22.31  ? 39  GLU A O     1 
ATOM   319  C  CB    . GLU A 1 63  ? 74.064 1.995  15.917  1.00 25.46  ? 39  GLU A CB    1 
ATOM   320  C  CG    . GLU A 1 63  ? 73.421 1.124  14.839  1.00 28.71  ? 39  GLU A CG    1 
ATOM   321  C  CD    . GLU A 1 63  ? 74.078 -0.239 14.657  1.00 37.12  ? 39  GLU A CD    1 
ATOM   322  O  OE1   . GLU A 1 63  ? 74.938 -0.644 15.472  1.00 38.80  ? 39  GLU A OE1   1 
ATOM   323  O  OE2   . GLU A 1 63  ? 73.717 -0.918 13.677  1.00 45.52  ? 39  GLU A OE2   1 
ATOM   324  N  N     . ARG A 1 64  ? 71.640 2.741  17.834  1.00 19.37  ? 40  ARG A N     1 
ATOM   325  C  CA    . ARG A 1 64  ? 70.301 2.536  18.369  1.00 18.05  ? 40  ARG A CA    1 
ATOM   326  C  C     . ARG A 1 64  ? 69.502 3.832  18.381  1.00 15.55  ? 40  ARG A C     1 
ATOM   327  O  O     . ARG A 1 64  ? 68.291 3.810  18.243  1.00 17.75  ? 40  ARG A O     1 
ATOM   328  C  CB    . ARG A 1 64  ? 70.377 1.929  19.794  1.00 17.10  ? 40  ARG A CB    1 
ATOM   329  C  CG    . ARG A 1 64  ? 69.013 1.850  20.491  1.00 19.07  ? 40  ARG A CG    1 
ATOM   330  C  CD    . ARG A 1 64  ? 68.739 0.487  21.093  1.00 22.12  ? 40  ARG A CD    1 
ATOM   331  N  NE    . ARG A 1 64  ? 67.453 0.430  21.789  1.00 25.71  ? 40  ARG A NE    1 
ATOM   332  C  CZ    . ARG A 1 64  ? 66.308 -0.032 21.286  1.00 26.55  ? 40  ARG A CZ    1 
ATOM   333  N  NH1   . ARG A 1 64  ? 66.225 -0.497 20.030  1.00 24.33  ? 40  ARG A NH1   1 
ATOM   334  N  NH2   . ARG A 1 64  ? 65.226 -0.026 22.058  1.00 25.15  ? 40  ARG A NH2   1 
ATOM   335  N  N     . ALA A 1 65  ? 70.178 4.963  18.572  1.00 15.82  ? 41  ALA A N     1 
ATOM   336  C  CA    . ALA A 1 65  ? 69.488 6.256  18.603  1.00 15.62  ? 41  ALA A CA    1 
ATOM   337  C  C     . ALA A 1 65  ? 68.904 6.556  17.213  1.00 17.73  ? 41  ALA A C     1 
ATOM   338  O  O     . ALA A 1 65  ? 67.751 6.970  17.084  1.00 17.70  ? 41  ALA A O     1 
ATOM   339  C  CB    . ALA A 1 65  ? 70.430 7.362  19.055  1.00 15.13  ? 41  ALA A CB    1 
ATOM   340  N  N     . GLU A 1 66  ? 69.708 6.302  16.187  1.00 19.34  ? 42  GLU A N     1 
ATOM   341  C  CA    . GLU A 1 66  ? 69.278 6.470  14.787  1.00 20.36  ? 42  GLU A CA    1 
ATOM   342  C  C     . GLU A 1 66  ? 68.097 5.526  14.525  1.00 17.17  ? 42  GLU A C     1 
ATOM   343  O  O     . GLU A 1 66  ? 67.054 5.938  13.997  1.00 17.10  ? 42  GLU A O     1 
ATOM   344  C  CB    . GLU A 1 66  ? 70.436 6.167  13.836  1.00 19.59  ? 42  GLU A CB    1 
ATOM   345  C  CG    . GLU A 1 66  ? 71.607 7.146  13.897  1.00 24.69  ? 42  GLU A CG    1 
ATOM   346  C  CD    . GLU A 1 66  ? 71.300 8.533  13.338  1.00 30.44  ? 42  GLU A CD    1 
ATOM   347  O  OE1   . GLU A 1 66  ? 70.367 8.686  12.504  1.00 38.21  ? 42  GLU A OE1   1 
ATOM   348  O  OE2   . GLU A 1 66  ? 72.018 9.483  13.724  1.00 40.32  ? 42  GLU A OE2   1 
ATOM   349  N  N     . LEU A 1 67  ? 68.234 4.272  14.948  1.00 20.19  ? 43  LEU A N     1 
ATOM   350  C  CA    . LEU A 1 67  ? 67.179 3.297  14.713  1.00 21.18  ? 43  LEU A CA    1 
ATOM   351  C  C     . LEU A 1 67  ? 65.876 3.766  15.352  1.00 16.66  ? 43  LEU A C     1 
ATOM   352  O  O     . LEU A 1 67  ? 64.860 3.901  14.670  1.00 15.51  ? 43  LEU A O     1 
ATOM   353  C  CB    . LEU A 1 67  ? 67.585 1.932  15.250  1.00 22.97  ? 43  LEU A CB    1 
ATOM   354  C  CG    . LEU A 1 67  ? 66.654 0.737  15.060  1.00 25.81  ? 43  LEU A CG    1 
ATOM   355  C  CD1   . LEU A 1 67  ? 66.281 0.564  13.600  1.00 29.28  ? 43  LEU A CD1   1 
ATOM   356  C  CD2   . LEU A 1 67  ? 67.351 -0.502 15.590  1.00 30.21  ? 43  LEU A CD2   1 
ATOM   357  N  N     . LEU A 1 68  ? 65.915 4.072  16.653  1.00 15.35  ? 44  LEU A N     1 
ATOM   358  C  CA    . LEU A 1 68  ? 64.696 4.487  17.351  1.00 14.36  ? 44  LEU A CA    1 
ATOM   359  C  C     . LEU A 1 68  ? 64.052 5.750  16.789  1.00 12.04  ? 44  LEU A C     1 
ATOM   360  O  O     . LEU A 1 68  ? 62.838 5.880  16.770  1.00 14.07  ? 44  LEU A O     1 
ATOM   361  C  CB    . LEU A 1 68  ? 64.978 4.687  18.847  1.00 17.23  ? 44  LEU A CB    1 
ATOM   362  C  CG    . LEU A 1 68  ? 65.034 3.454  19.717  1.00 19.78  ? 44  LEU A CG    1 
ATOM   363  C  CD1   . LEU A 1 68  ? 65.253 3.893  21.174  1.00 21.47  ? 44  LEU A CD1   1 
ATOM   364  C  CD2   . LEU A 1 68  ? 63.776 2.612  19.565  1.00 21.33  ? 44  LEU A CD2   1 
ATOM   365  N  N     . TYR A 1 69  ? 64.881 6.684  16.349  1.00 12.87  ? 45  TYR A N     1 
ATOM   366  C  CA    . TYR A 1 69  ? 64.391 7.945  15.807  1.00 14.33  ? 45  TYR A CA    1 
ATOM   367  C  C     . TYR A 1 69  ? 63.647 7.657  14.504  1.00 14.24  ? 45  TYR A C     1 
ATOM   368  O  O     . TYR A 1 69  ? 62.588 8.229  14.231  1.00 14.46  ? 45  TYR A O     1 
ATOM   369  C  CB    . TYR A 1 69  ? 65.555 8.907  15.554  1.00 13.22  ? 45  TYR A CB    1 
ATOM   370  C  CG    . TYR A 1 69  ? 65.180 10.371 15.383  1.00 14.94  ? 45  TYR A CG    1 
ATOM   371  C  CD1   . TYR A 1 69  ? 64.247 11.000 16.223  1.00 14.47  ? 45  TYR A CD1   1 
ATOM   372  C  CD2   . TYR A 1 69  ? 65.780 11.149 14.370  1.00 14.89  ? 45  TYR A CD2   1 
ATOM   373  C  CE1   . TYR A 1 69  ? 63.921 12.348 16.054  1.00 14.28  ? 45  TYR A CE1   1 
ATOM   374  C  CE2   . TYR A 1 69  ? 65.489 12.496 14.220  1.00 14.48  ? 45  TYR A CE2   1 
ATOM   375  C  CZ    . TYR A 1 69  ? 64.561 13.090 15.059  1.00 14.90  ? 45  TYR A CZ    1 
ATOM   376  O  OH    . TYR A 1 69  ? 64.284 14.402 14.882  1.00 17.21  ? 45  TYR A OH    1 
ATOM   377  N  N     . SER A 1 70  ? 64.185 6.703  13.756  1.00 14.77  ? 46  SER A N     1 
ATOM   378  C  CA    . SER A 1 70  ? 63.609 6.319  12.462  1.00 16.63  ? 46  SER A CA    1 
ATOM   379  C  C     . SER A 1 70  ? 62.209 5.724  12.613  1.00 17.24  ? 46  SER A C     1 
ATOM   380  O  O     . SER A 1 70  ? 61.427 5.702  11.643  1.00 20.45  ? 46  SER A O     1 
ATOM   381  C  CB    . SER A 1 70  ? 64.534 5.339  11.742  1.00 17.72  ? 46  SER A CB    1 
ATOM   382  O  OG    . SER A 1 70  ? 64.365 4.017  12.221  1.00 19.69  ? 46  SER A OG    1 
ATOM   383  N  N     . ARG A 1 71  ? 61.905 5.227  13.811  1.00 15.68  ? 47  ARG A N     1 
ATOM   384  C  CA    . ARG A 1 71  ? 60.614 4.621  14.123  1.00 16.66  ? 47  ARG A CA    1 
ATOM   385  C  C     . ARG A 1 71  ? 59.696 5.529  14.925  1.00 15.07  ? 47  ARG A C     1 
ATOM   386  O  O     . ARG A 1 71  ? 58.503 5.241  15.066  1.00 15.81  ? 47  ARG A O     1 
ATOM   387  C  CB    . ARG A 1 71  ? 60.816 3.324  14.904  1.00 15.76  ? 47  ARG A CB    1 
ATOM   388  C  CG    . ARG A 1 71  ? 61.697 2.288  14.228  1.00 14.75  ? 47  ARG A CG    1 
ATOM   389  C  CD    . ARG A 1 71  ? 61.684 0.988  15.000  1.00 17.62  ? 47  ARG A CD    1 
ATOM   390  N  NE    . ARG A 1 71  ? 62.206 -0.119 14.213  1.00 18.99  ? 47  ARG A NE    1 
ATOM   391  C  CZ    . ARG A 1 71  ? 62.069 -1.411 14.509  1.00 19.31  ? 47  ARG A CZ    1 
ATOM   392  N  NH1   . ARG A 1 71  ? 61.405 -1.803 15.597  1.00 20.21  ? 47  ARG A NH1   1 
ATOM   393  N  NH2   . ARG A 1 71  ? 62.602 -2.325 13.701  1.00 20.56  ? 47  ARG A NH2   1 
HETATM 394  N  N     . MSE A 1 72  ? 60.269 6.616  15.453  1.00 15.83  ? 48  MSE A N     1 
HETATM 395  C  CA    . MSE A 1 72  ? 59.554 7.580  16.262  1.00 13.17  ? 48  MSE A CA    1 
HETATM 396  C  C     . MSE A 1 72  ? 58.668 8.444  15.408  1.00 15.51  ? 48  MSE A C     1 
HETATM 397  O  O     . MSE A 1 72  ? 59.027 8.790  14.269  1.00 18.50  ? 48  MSE A O     1 
HETATM 398  C  CB    . MSE A 1 72  ? 60.590 8.458  16.939  1.00 15.31  ? 48  MSE A CB    1 
HETATM 399  C  CG    . MSE A 1 72  ? 59.897 9.369  17.940  1.00 21.29  ? 48  MSE A CG    1 
HETATM 400  SE SE    . MSE A 1 72  ? 61.307 10.366 18.841  1.00 40.89  ? 48  MSE A SE    1 
HETATM 401  C  CE    . MSE A 1 72  ? 60.618 10.264 20.687  1.00 33.43  ? 48  MSE A CE    1 
ATOM   402  N  N     . GLY A 1 73  ? 57.513 8.816  15.959  1.00 16.58  ? 49  GLY A N     1 
ATOM   403  C  CA    . GLY A 1 73  ? 56.584 9.728  15.289  1.00 17.12  ? 49  GLY A CA    1 
ATOM   404  C  C     . GLY A 1 73  ? 57.065 11.172 15.246  1.00 16.03  ? 49  GLY A C     1 
ATOM   405  O  O     . GLY A 1 73  ? 58.157 11.479 15.741  1.00 17.76  ? 49  GLY A O     1 
ATOM   406  N  N     . PRO A 1 74  ? 56.268 12.080 14.637  1.00 16.26  ? 50  PRO A N     1 
ATOM   407  C  CA    . PRO A 1 74  ? 56.591 13.516 14.730  1.00 16.26  ? 50  PRO A CA    1 
ATOM   408  C  C     . PRO A 1 74  ? 56.749 13.944 16.189  1.00 15.62  ? 50  PRO A C     1 
ATOM   409  O  O     . PRO A 1 74  ? 55.944 13.547 17.039  1.00 18.41  ? 50  PRO A O     1 
ATOM   410  C  CB    . PRO A 1 74  ? 55.383 14.179 14.090  1.00 16.62  ? 50  PRO A CB    1 
ATOM   411  C  CG    . PRO A 1 74  ? 54.971 13.181 13.039  1.00 18.52  ? 50  PRO A CG    1 
ATOM   412  C  CD    . PRO A 1 74  ? 55.168 11.833 13.680  1.00 19.17  ? 50  PRO A CD    1 
ATOM   413  N  N     . ALA A 1 75  ? 57.791 14.719 16.467  1.00 15.09  ? 51  ALA A N     1 
ATOM   414  C  CA    . ALA A 1 75  ? 58.224 14.986 17.855  1.00 15.17  ? 51  ALA A CA    1 
ATOM   415  C  C     . ALA A 1 75  ? 58.284 16.469 18.183  1.00 16.74  ? 51  ALA A C     1 
ATOM   416  O  O     . ALA A 1 75  ? 58.200 17.329 17.298  1.00 18.32  ? 51  ALA A O     1 
ATOM   417  C  CB    . ALA A 1 75  ? 59.573 14.325 18.109  1.00 14.96  ? 51  ALA A CB    1 
ATOM   418  N  N     . LEU A 1 76  ? 58.429 16.769 19.473  1.00 16.82  ? 52  LEU A N     1 
ATOM   419  C  CA    . LEU A 1 76  ? 58.674 18.124 19.941  1.00 16.04  ? 52  LEU A CA    1 
ATOM   420  C  C     . LEU A 1 76  ? 59.970 18.079 20.697  1.00 15.35  ? 52  LEU A C     1 
ATOM   421  O  O     . LEU A 1 76  ? 60.249 17.084 21.361  1.00 16.80  ? 52  LEU A O     1 
ATOM   422  C  CB    . LEU A 1 76  ? 57.588 18.562 20.915  1.00 17.53  ? 52  LEU A CB    1 
ATOM   423  C  CG    . LEU A 1 76  ? 56.137 18.697 20.459  1.00 19.21  ? 52  LEU A CG    1 
ATOM   424  C  CD1   . LEU A 1 76  ? 55.279 18.915 21.695  1.00 23.69  ? 52  LEU A CD1   1 
ATOM   425  C  CD2   . LEU A 1 76  ? 55.987 19.845 19.474  1.00 23.74  ? 52  LEU A CD2   1 
ATOM   426  N  N     . GLU A 1 77  ? 60.748 19.148 20.621  1.00 16.16  ? 53  GLU A N     1 
ATOM   427  C  CA    . GLU A 1 77  ? 61.992 19.197 21.399  1.00 13.71  ? 53  GLU A CA    1 
ATOM   428  C  C     . GLU A 1 77  ? 61.885 20.179 22.547  1.00 14.24  ? 53  GLU A C     1 
ATOM   429  O  O     . GLU A 1 77  ? 61.263 21.236 22.438  1.00 15.10  ? 53  GLU A O     1 
ATOM   430  C  CB    . GLU A 1 77  ? 63.220 19.502 20.520  1.00 14.90  ? 53  GLU A CB    1 
ATOM   431  C  CG    . GLU A 1 77  ? 63.543 18.416 19.499  1.00 17.56  ? 53  GLU A CG    1 
ATOM   432  C  CD    . GLU A 1 77  ? 62.538 18.345 18.359  1.00 17.79  ? 53  GLU A CD    1 
ATOM   433  O  OE1   . GLU A 1 77  ? 62.133 17.225 18.023  1.00 19.01  ? 53  GLU A OE1   1 
ATOM   434  O  OE2   . GLU A 1 77  ? 62.137 19.398 17.822  1.00 19.93  ? 53  GLU A OE2   1 
ATOM   435  N  N     . ALA A 1 78  ? 62.493 19.808 23.667  1.00 14.63  ? 54  ALA A N     1 
ATOM   436  C  CA    . ALA A 1 78  ? 62.515 20.662 24.849  1.00 15.18  ? 54  ALA A CA    1 
ATOM   437  C  C     . ALA A 1 78  ? 63.759 20.334 25.659  1.00 15.21  ? 54  ALA A C     1 
ATOM   438  O  O     . ALA A 1 78  ? 64.126 19.166 25.779  1.00 15.16  ? 54  ALA A O     1 
ATOM   439  C  CB    . ALA A 1 78  ? 61.275 20.429 25.697  1.00 15.02  ? 54  ALA A CB    1 
ATOM   440  N  N     . SER A 1 79  ? 64.390 21.372 26.206  1.00 15.12  ? 55  SER A N     1 
ATOM   441  C  CA    . SER A 1 79  ? 65.592 21.201 27.000  1.00 13.74  ? 55  SER A CA    1 
ATOM   442  C  C     . SER A 1 79  ? 65.248 20.341 28.211  1.00 15.49  ? 55  SER A C     1 
ATOM   443  O  O     . SER A 1 79  ? 64.210 20.564 28.854  1.00 18.61  ? 55  SER A O     1 
ATOM   444  C  CB    . SER A 1 79  ? 66.148 22.565 27.428  1.00 16.52  ? 55  SER A CB    1 
ATOM   445  O  OG    . SER A 1 79  ? 66.900 23.168 26.387  1.00 19.80  ? 55  SER A OG    1 
ATOM   446  N  N     . GLY A 1 80  ? 66.087 19.341 28.489  1.00 15.30  ? 56  GLY A N     1 
ATOM   447  C  CA    . GLY A 1 80  ? 65.840 18.423 29.609  1.00 12.70  ? 56  GLY A CA    1 
ATOM   448  C  C     . GLY A 1 80  ? 67.039 18.270 30.529  1.00 12.82  ? 56  GLY A C     1 
ATOM   449  O  O     . GLY A 1 80  ? 67.705 19.235 30.824  1.00 14.77  ? 56  GLY A O     1 
ATOM   450  N  N     . GLY A 1 81  ? 67.321 17.035 30.909  1.00 12.85  ? 57  GLY A N     1 
ATOM   451  C  CA    . GLY A 1 81  ? 68.333 16.705 31.928  1.00 13.65  ? 57  GLY A CA    1 
ATOM   452  C  C     . GLY A 1 81  ? 67.700 16.847 33.311  1.00 13.04  ? 57  GLY A C     1 
ATOM   453  O  O     . GLY A 1 81  ? 67.085 17.871 33.611  1.00 14.79  ? 57  GLY A O     1 
ATOM   454  N  N     . SER A 1 82  ? 67.781 15.796 34.126  1.00 13.83  ? 58  SER A N     1 
ATOM   455  C  CA    A SER A 1 82  ? 67.123 15.798 35.426  0.50 15.23  ? 58  SER A CA    1 
ATOM   456  C  CA    B SER A 1 82  ? 67.137 15.795 35.441  0.50 15.24  ? 58  SER A CA    1 
ATOM   457  C  C     . SER A 1 82  ? 67.527 17.040 36.251  1.00 15.35  ? 58  SER A C     1 
ATOM   458  O  O     . SER A 1 82  ? 66.662 17.871 36.598  1.00 14.69  ? 58  SER A O     1 
ATOM   459  C  CB    A SER A 1 82  ? 67.423 14.488 36.166  0.50 15.45  ? 58  SER A CB    1 
ATOM   460  C  CB    B SER A 1 82  ? 67.497 14.520 36.214  0.50 15.27  ? 58  SER A CB    1 
ATOM   461  O  OG    A SER A 1 82  ? 66.747 14.430 37.408  0.50 16.13  ? 58  SER A OG    1 
ATOM   462  O  OG    B SER A 1 82  ? 66.569 13.485 35.981  0.50 17.24  ? 58  SER A OG    1 
ATOM   463  N  N     . ALA A 1 83  ? 68.835 17.177 36.528  1.00 14.84  ? 59  ALA A N     1 
ATOM   464  C  CA    . ALA A 1 83  ? 69.430 18.338 37.236  1.00 15.01  ? 59  ALA A CA    1 
ATOM   465  C  C     . ALA A 1 83  ? 69.153 19.685 36.593  1.00 15.40  ? 59  ALA A C     1 
ATOM   466  O  O     . ALA A 1 83  ? 68.976 20.700 37.268  1.00 14.78  ? 59  ALA A O     1 
ATOM   467  C  CB    . ALA A 1 83  ? 70.930 18.142 37.369  1.00 17.84  ? 59  ALA A CB    1 
ATOM   468  N  N     . GLY A 1 84  ? 69.170 19.694 35.262  1.00 16.29  ? 60  GLY A N     1 
ATOM   469  C  CA    . GLY A 1 84  ? 68.813 20.883 34.500  1.00 16.59  ? 60  GLY A CA    1 
ATOM   470  C  C     . GLY A 1 84  ? 67.421 21.358 34.854  1.00 15.90  ? 60  GLY A C     1 
ATOM   471  O  O     . GLY A 1 84  ? 67.233 22.532 35.214  1.00 14.53  ? 60  GLY A O     1 
ATOM   472  N  N     . ASN A 1 85  ? 66.452 20.443 34.755  1.00 15.75  ? 61  ASN A N     1 
ATOM   473  C  CA    . ASN A 1 85  ? 65.060 20.732 35.059  1.00 15.15  ? 61  ASN A CA    1 
ATOM   474  C  C     . ASN A 1 85  ? 64.962 21.244 36.491  1.00 15.79  ? 61  ASN A C     1 
ATOM   475  O  O     . ASN A 1 85  ? 64.259 22.210 36.775  1.00 14.79  ? 61  ASN A O     1 
ATOM   476  C  CB    . ASN A 1 85  ? 64.191 19.488 34.897  1.00 15.67  ? 61  ASN A CB    1 
ATOM   477  C  CG    . ASN A 1 85  ? 64.207 18.933 33.481  1.00 16.88  ? 61  ASN A CG    1 
ATOM   478  O  OD1   . ASN A 1 85  ? 64.447 19.660 32.507  1.00 18.46  ? 61  ASN A OD1   1 
ATOM   479  N  ND2   . ASN A 1 85  ? 63.953 17.647 33.365  1.00 15.13  ? 61  ASN A ND2   1 
ATOM   480  N  N     . THR A 1 86  ? 65.709 20.595 37.374  1.00 16.92  ? 62  THR A N     1 
ATOM   481  C  CA    . THR A 1 86  ? 65.681 20.976 38.794  1.00 14.90  ? 62  THR A CA    1 
ATOM   482  C  C     . THR A 1 86  ? 66.180 22.395 39.035  1.00 14.88  ? 62  THR A C     1 
ATOM   483  O  O     . THR A 1 86  ? 65.517 23.168 39.748  1.00 15.71  ? 62  THR A O     1 
ATOM   484  C  CB    . THR A 1 86  ? 66.412 19.926 39.646  1.00 16.85  ? 62  THR A CB    1 
ATOM   485  O  OG1   . THR A 1 86  ? 65.704 18.688 39.538  1.00 17.13  ? 62  THR A OG1   1 
ATOM   486  C  CG2   . THR A 1 86  ? 66.488 20.369 41.129  1.00 18.01  ? 62  THR A CG2   1 
ATOM   487  N  N     . ALA A 1 87  ? 67.315 22.761 38.426  1.00 14.51  ? 63  ALA A N     1 
ATOM   488  C  CA    . ALA A 1 87  ? 67.824 24.126 38.536  1.00 14.55  ? 63  ALA A CA    1 
ATOM   489  C  C     . ALA A 1 87  ? 66.796 25.124 37.997  1.00 15.55  ? 63  ALA A C     1 
ATOM   490  O  O     . ALA A 1 87  ? 66.412 26.070 38.686  1.00 14.27  ? 63  ALA A O     1 
ATOM   491  C  CB    . ALA A 1 87  ? 69.160 24.256 37.837  1.00 16.65  ? 63  ALA A CB    1 
ATOM   492  N  N     . ALA A 1 88  ? 66.317 24.884 36.773  1.00 16.67  ? 64  ALA A N     1 
ATOM   493  C  CA    . ALA A 1 88  ? 65.308 25.741 36.169  1.00 15.12  ? 64  ALA A CA    1 
ATOM   494  C  C     . ALA A 1 88  ? 64.074 25.911 37.063  1.00 15.15  ? 64  ALA A C     1 
ATOM   495  O  O     . ALA A 1 88  ? 63.524 26.999 37.132  1.00 18.21  ? 64  ALA A O     1 
ATOM   496  C  CB    . ALA A 1 88  ? 64.921 25.206 34.791  1.00 16.55  ? 64  ALA A CB    1 
ATOM   497  N  N     . GLY A 1 89  ? 63.667 24.841 37.758  1.00 16.87  ? 65  GLY A N     1 
ATOM   498  C  CA    . GLY A 1 89  ? 62.518 24.869 38.669  1.00 17.79  ? 65  GLY A CA    1 
ATOM   499  C  C     . GLY A 1 89  ? 62.755 25.742 39.892  1.00 17.35  ? 65  GLY A C     1 
ATOM   500  O  O     . GLY A 1 89  ? 61.857 26.471 40.348  1.00 19.18  ? 65  GLY A O     1 
ATOM   501  N  N     . VAL A 1 90  ? 63.962 25.665 40.436  1.00 18.53  ? 66  VAL A N     1 
ATOM   502  C  CA    . VAL A 1 90  ? 64.388 26.573 41.516  1.00 15.70  ? 66  VAL A CA    1 
ATOM   503  C  C     . VAL A 1 90  ? 64.377 28.038 41.063  1.00 18.80  ? 66  VAL A C     1 
ATOM   504  O  O     . VAL A 1 90  ? 63.855 28.893 41.763  1.00 21.43  ? 66  VAL A O     1 
ATOM   505  C  CB    . VAL A 1 90  ? 65.754 26.144 42.082  1.00 18.26  ? 66  VAL A CB    1 
ATOM   506  C  CG1   . VAL A 1 90  ? 66.300 27.150 43.093  1.00 17.91  ? 66  VAL A CG1   1 
ATOM   507  C  CG2   . VAL A 1 90  ? 65.616 24.785 42.749  1.00 17.59  ? 66  VAL A CG2   1 
ATOM   508  N  N     . ALA A 1 91  ? 64.911 28.312 39.869  1.00 18.46  ? 67  ALA A N     1 
ATOM   509  C  CA    . ALA A 1 91  ? 64.865 29.664 39.295  1.00 22.24  ? 67  ALA A CA    1 
ATOM   510  C  C     . ALA A 1 91  ? 63.420 30.169 39.078  1.00 21.21  ? 67  ALA A C     1 
ATOM   511  O  O     . ALA A 1 91  ? 63.077 31.259 39.479  1.00 26.18  ? 67  ALA A O     1 
ATOM   512  C  CB    . ALA A 1 91  ? 65.686 29.748 38.012  1.00 17.12  ? 67  ALA A CB    1 
ATOM   513  N  N     . ASN A 1 92  ? 62.574 29.347 38.476  1.00 24.42  ? 68  ASN A N     1 
ATOM   514  C  CA    . ASN A 1 92  ? 61.151 29.663 38.338  1.00 22.78  ? 68  ASN A CA    1 
ATOM   515  C  C     . ASN A 1 92  ? 60.502 30.082 39.677  1.00 24.53  ? 68  ASN A C     1 
ATOM   516  O  O     . ASN A 1 92  ? 59.794 31.078 39.743  1.00 26.60  ? 68  ASN A O     1 
ATOM   517  C  CB    . ASN A 1 92  ? 60.420 28.462 37.726  1.00 22.70  ? 68  ASN A CB    1 
ATOM   518  C  CG    . ASN A 1 92  ? 59.069 28.825 37.131  1.00 23.42  ? 68  ASN A CG    1 
ATOM   519  O  OD1   . ASN A 1 92  ? 58.368 29.716 37.608  1.00 26.39  ? 68  ASN A OD1   1 
ATOM   520  N  ND2   . ASN A 1 92  ? 58.677 28.089 36.102  1.00 22.55  ? 68  ASN A ND2   1 
ATOM   521  N  N     . LEU A 1 93  ? 60.756 29.325 40.741  1.00 25.71  ? 69  LEU A N     1 
ATOM   522  C  CA    . LEU A 1 93  ? 60.148 29.615 42.049  1.00 22.72  ? 69  LEU A CA    1 
ATOM   523  C  C     . LEU A 1 93  ? 60.655 30.900 42.717  1.00 20.11  ? 69  LEU A C     1 
ATOM   524  O  O     . LEU A 1 93  ? 60.031 31.383 43.657  1.00 24.33  ? 69  LEU A O     1 
ATOM   525  C  CB    . LEU A 1 93  ? 60.319 28.429 43.010  1.00 20.35  ? 69  LEU A CB    1 
ATOM   526  C  CG    . LEU A 1 93  ? 59.395 27.210 42.915  1.00 21.23  ? 69  LEU A CG    1 
ATOM   527  C  CD1   . LEU A 1 93  ? 60.104 25.969 43.447  1.00 25.00  ? 69  LEU A CD1   1 
ATOM   528  C  CD2   . LEU A 1 93  ? 58.102 27.468 43.678  1.00 25.08  ? 69  LEU A CD2   1 
ATOM   529  N  N     . GLY A 1 94  ? 61.765 31.449 42.221  1.00 22.08  ? 70  GLY A N     1 
ATOM   530  C  CA    . GLY A 1 94  ? 62.379 32.669 42.773  1.00 24.44  ? 70  GLY A CA    1 
ATOM   531  C  C     . GLY A 1 94  ? 63.724 32.501 43.462  1.00 22.73  ? 70  GLY A C     1 
ATOM   532  O  O     . GLY A 1 94  ? 64.288 33.474 43.983  1.00 24.87  ? 70  GLY A O     1 
ATOM   533  N  N     . GLY A 1 95  ? 64.244 31.276 43.466  1.00 26.17  ? 71  GLY A N     1 
ATOM   534  C  CA    . GLY A 1 95  ? 65.526 30.955 44.104  1.00 25.65  ? 71  GLY A CA    1 
ATOM   535  C  C     . GLY A 1 95  ? 66.719 31.212 43.201  1.00 22.33  ? 71  GLY A C     1 
ATOM   536  O  O     . GLY A 1 95  ? 66.567 31.365 41.999  1.00 25.66  ? 71  GLY A O     1 
ATOM   537  N  N     . LYS A 1 96  ? 67.910 31.268 43.782  1.00 19.69  ? 72  LYS A N     1 
ATOM   538  C  CA    . LYS A 1 96  ? 69.107 31.564 43.000  1.00 21.13  ? 72  LYS A CA    1 
ATOM   539  C  C     . LYS A 1 96  ? 69.793 30.271 42.598  1.00 20.71  ? 72  LYS A C     1 
ATOM   540  O  O     . LYS A 1 96  ? 70.329 29.585 43.463  1.00 20.12  ? 72  LYS A O     1 
ATOM   541  C  CB    . LYS A 1 96  ? 70.037 32.478 43.805  1.00 18.72  ? 72  LYS A CB    1 
ATOM   542  C  CG    . LYS A 1 96  ? 69.596 33.913 43.749  1.00 20.13  ? 72  LYS A CG    1 
ATOM   543  C  CD    . LYS A 1 96  ? 69.818 34.632 45.042  1.00 26.20  ? 72  LYS A CD    1 
ATOM   544  C  CE    . LYS A 1 96  ? 69.588 36.106 44.792  1.00 27.83  ? 72  LYS A CE    1 
ATOM   545  N  NZ    . LYS A 1 96  ? 70.170 36.910 45.892  1.00 30.61  ? 72  LYS A NZ    1 
ATOM   546  N  N     . ALA A 1 97  ? 69.733 29.936 41.294  1.00 18.07  ? 73  ALA A N     1 
ATOM   547  C  CA    . ALA A 1 97  ? 70.255 28.651 40.790  1.00 13.57  ? 73  ALA A CA    1 
ATOM   548  C  C     . ALA A 1 97  ? 71.512 28.700 39.909  1.00 13.74  ? 73  ALA A C     1 
ATOM   549  O  O     . ALA A 1 97  ? 71.825 29.723 39.297  1.00 19.04  ? 73  ALA A O     1 
ATOM   550  C  CB    . ALA A 1 97  ? 69.132 27.853 40.128  1.00 14.89  ? 73  ALA A CB    1 
ATOM   551  N  N     . ALA A 1 98  ? 72.250 27.596 39.898  1.00 14.12  ? 74  ALA A N     1 
ATOM   552  C  CA    . ALA A 1 98  ? 73.434 27.404 39.062  1.00 14.66  ? 74  ALA A CA    1 
ATOM   553  C  C     . ALA A 1 98  ? 73.437 25.957 38.583  1.00 18.09  ? 74  ALA A C     1 
ATOM   554  O  O     . ALA A 1 98  ? 72.827 25.089 39.221  1.00 17.77  ? 74  ALA A O     1 
ATOM   555  C  CB    . ALA A 1 98  ? 74.714 27.725 39.855  1.00 16.95  ? 74  ALA A CB    1 
ATOM   556  N  N     . TYR A 1 99  ? 74.091 25.716 37.437  1.00 16.66  ? 75  TYR A N     1 
ATOM   557  C  CA    . TYR A 1 99  ? 74.128 24.400 36.787  1.00 15.37  ? 75  TYR A CA    1 
ATOM   558  C  C     . TYR A 1 99  ? 75.481 24.079 36.151  1.00 16.97  ? 75  TYR A C     1 
ATOM   559  O  O     . TYR A 1 99  ? 76.054 24.932 35.444  1.00 16.30  ? 75  TYR A O     1 
ATOM   560  C  CB    . TYR A 1 99  ? 73.013 24.294 35.723  1.00 16.36  ? 75  TYR A CB    1 
ATOM   561  C  CG    . TYR A 1 99  ? 72.955 22.960 34.989  1.00 17.38  ? 75  TYR A CG    1 
ATOM   562  C  CD1   . TYR A 1 99  ? 72.473 21.805 35.616  1.00 15.09  ? 75  TYR A CD1   1 
ATOM   563  C  CD2   . TYR A 1 99  ? 73.373 22.853 33.644  1.00 17.99  ? 75  TYR A CD2   1 
ATOM   564  C  CE1   . TYR A 1 99  ? 72.410 20.577 34.947  1.00 15.81  ? 75  TYR A CE1   1 
ATOM   565  C  CE2   . TYR A 1 99  ? 73.325 21.635 32.973  1.00 16.72  ? 75  TYR A CE2   1 
ATOM   566  C  CZ    . TYR A 1 99  ? 72.843 20.492 33.630  1.00 16.60  ? 75  TYR A CZ    1 
ATOM   567  O  OH    . TYR A 1 99  ? 72.777 19.273 32.980  1.00 17.07  ? 75  TYR A OH    1 
ATOM   568  N  N     . PHE A 1 100 ? 75.948 22.846 36.373  1.00 14.94  ? 76  PHE A N     1 
ATOM   569  C  CA    . PHE A 1 100 ? 77.137 22.260 35.712  1.00 14.43  ? 76  PHE A CA    1 
ATOM   570  C  C     . PHE A 1 100 ? 76.661 21.111 34.837  1.00 16.57  ? 76  PHE A C     1 
ATOM   571  O  O     . PHE A 1 100 ? 76.013 20.194 35.325  1.00 17.43  ? 76  PHE A O     1 
ATOM   572  C  CB    . PHE A 1 100 ? 78.147 21.671 36.739  1.00 13.68  ? 76  PHE A CB    1 
ATOM   573  C  CG    . PHE A 1 100 ? 78.799 22.688 37.651  1.00 15.12  ? 76  PHE A CG    1 
ATOM   574  C  CD1   . PHE A 1 100 ? 78.851 24.051 37.351  1.00 15.27  ? 76  PHE A CD1   1 
ATOM   575  C  CD2   . PHE A 1 100 ? 79.383 22.240 38.855  1.00 18.23  ? 76  PHE A CD2   1 
ATOM   576  C  CE1   . PHE A 1 100 ? 79.464 24.949 38.226  1.00 17.68  ? 76  PHE A CE1   1 
ATOM   577  C  CE2   . PHE A 1 100 ? 80.007 23.136 39.710  1.00 18.33  ? 76  PHE A CE2   1 
ATOM   578  C  CZ    . PHE A 1 100 ? 80.041 24.482 39.406  1.00 17.97  ? 76  PHE A CZ    1 
ATOM   579  N  N     . GLY A 1 101 ? 76.945 21.174 33.535  1.00 20.21  ? 77  GLY A N     1 
ATOM   580  C  CA    . GLY A 1 101 ? 76.602 20.087 32.614  1.00 18.84  ? 77  GLY A CA    1 
ATOM   581  C  C     . GLY A 1 101 ? 77.199 20.418 31.261  1.00 19.05  ? 77  GLY A C     1 
ATOM   582  O  O     . GLY A 1 101 ? 77.278 21.592 30.896  1.00 18.30  ? 77  GLY A O     1 
ATOM   583  N  N     . ASN A 1 102 ? 77.645 19.388 30.543  1.00 18.86  ? 78  ASN A N     1 
ATOM   584  C  CA    . ASN A 1 102 ? 78.423 19.578 29.332  1.00 16.56  ? 78  ASN A CA    1 
ATOM   585  C  C     . ASN A 1 102 ? 77.611 19.258 28.083  1.00 16.02  ? 78  ASN A C     1 
ATOM   586  O  O     . ASN A 1 102 ? 77.111 18.158 27.948  1.00 16.57  ? 78  ASN A O     1 
ATOM   587  C  CB    . ASN A 1 102 ? 79.675 18.713 29.341  1.00 15.85  ? 78  ASN A CB    1 
ATOM   588  C  CG    . ASN A 1 102 ? 80.628 19.070 28.208  1.00 15.87  ? 78  ASN A CG    1 
ATOM   589  O  OD1   . ASN A 1 102 ? 81.125 20.187 28.127  1.00 18.69  ? 78  ASN A OD1   1 
ATOM   590  N  ND2   . ASN A 1 102 ? 80.897 18.110 27.344  1.00 19.77  ? 78  ASN A ND2   1 
ATOM   591  N  N     . VAL A 1 103 ? 77.508 20.243 27.200  1.00 16.34  ? 79  VAL A N     1 
ATOM   592  C  CA    . VAL A 1 103 ? 76.936 20.071 25.860  1.00 15.03  ? 79  VAL A CA    1 
ATOM   593  C  C     . VAL A 1 103 ? 78.058 20.132 24.815  1.00 15.66  ? 79  VAL A C     1 
ATOM   594  O  O     . VAL A 1 103 ? 79.210 20.394 25.152  1.00 18.06  ? 79  VAL A O     1 
ATOM   595  C  CB    . VAL A 1 103 ? 75.871 21.165 25.539  1.00 13.40  ? 79  VAL A CB    1 
ATOM   596  C  CG1   . VAL A 1 103 ? 74.652 21.043 26.459  1.00 14.51  ? 79  VAL A CG1   1 
ATOM   597  C  CG2   . VAL A 1 103 ? 76.454 22.584 25.599  1.00 13.59  ? 79  VAL A CG2   1 
ATOM   598  N  N     . ALA A 1 104 ? 77.711 19.880 23.552  1.00 18.47  ? 80  ALA A N     1 
ATOM   599  C  CA    . ALA A 1 104 ? 78.622 20.112 22.434  1.00 16.08  ? 80  ALA A CA    1 
ATOM   600  C  C     . ALA A 1 104 ? 78.376 21.472 21.801  1.00 16.61  ? 80  ALA A C     1 
ATOM   601  O  O     . ALA A 1 104 ? 77.328 22.094 21.999  1.00 15.74  ? 80  ALA A O     1 
ATOM   602  C  CB    . ALA A 1 104 ? 78.459 19.018 21.373  1.00 17.22  ? 80  ALA A CB    1 
ATOM   603  N  N     . ALA A 1 105 ? 79.354 21.918 21.017  1.00 17.66  ? 81  ALA A N     1 
ATOM   604  C  CA    . ALA A 1 105 ? 79.225 23.131 20.233  1.00 17.66  ? 81  ALA A CA    1 
ATOM   605  C  C     . ALA A 1 105 ? 78.391 22.853 18.969  1.00 19.51  ? 81  ALA A C     1 
ATOM   606  O  O     . ALA A 1 105 ? 78.916 22.820 17.862  1.00 22.32  ? 81  ALA A O     1 
ATOM   607  C  CB    . ALA A 1 105 ? 80.605 23.659 19.886  1.00 22.32  ? 81  ALA A CB    1 
ATOM   608  N  N     . ASP A 1 106 ? 77.092 22.637 19.160  1.00 17.21  ? 82  ASP A N     1 
ATOM   609  C  CA    . ASP A 1 106 ? 76.159 22.391 18.051  1.00 15.19  ? 82  ASP A CA    1 
ATOM   610  C  C     . ASP A 1 106 ? 74.813 23.051 18.346  1.00 16.75  ? 82  ASP A C     1 
ATOM   611  O  O     . ASP A 1 106 ? 74.653 23.720 19.379  1.00 18.04  ? 82  ASP A O     1 
ATOM   612  C  CB    . ASP A 1 106 ? 76.039 20.884 17.760  1.00 17.36  ? 82  ASP A CB    1 
ATOM   613  C  CG    . ASP A 1 106 ? 75.649 20.053 18.998  1.00 17.40  ? 82  ASP A CG    1 
ATOM   614  O  OD1   . ASP A 1 106 ? 75.136 20.625 19.984  1.00 20.52  ? 82  ASP A OD1   1 
ATOM   615  O  OD2   . ASP A 1 106 ? 75.841 18.813 18.963  1.00 16.11  ? 82  ASP A OD2   1 
ATOM   616  N  N     . GLN A 1 107 ? 73.849 22.887 17.443  1.00 16.44  ? 83  GLN A N     1 
ATOM   617  C  CA    . GLN A 1 107 ? 72.538 23.518 17.613  1.00 16.64  ? 83  GLN A CA    1 
ATOM   618  C  C     . GLN A 1 107 ? 71.749 23.043 18.832  1.00 15.42  ? 83  GLN A C     1 
ATOM   619  O  O     . GLN A 1 107 ? 71.126 23.856 19.508  1.00 16.97  ? 83  GLN A O     1 
ATOM   620  C  CB    . GLN A 1 107 ? 71.707 23.403 16.325  1.00 17.15  ? 83  GLN A CB    1 
ATOM   621  C  CG    . GLN A 1 107 ? 72.252 24.267 15.200  1.00 16.56  ? 83  GLN A CG    1 
ATOM   622  C  CD    . GLN A 1 107 ? 71.628 23.935 13.845  1.00 17.20  ? 83  GLN A CD    1 
ATOM   623  O  OE1   . GLN A 1 107 ? 71.149 22.828 13.630  1.00 15.86  ? 83  GLN A OE1   1 
ATOM   624  N  NE2   . GLN A 1 107 ? 71.646 24.902 12.925  1.00 20.00  ? 83  GLN A NE2   1 
ATOM   625  N  N     . LEU A 1 108 ? 71.790 21.742 19.125  1.00 14.48  ? 84  LEU A N     1 
ATOM   626  C  CA    . LEU A 1 108 ? 71.114 21.205 20.303  1.00 14.52  ? 84  LEU A CA    1 
ATOM   627  C  C     . LEU A 1 108 ? 71.757 21.783 21.568  1.00 14.90  ? 84  LEU A C     1 
ATOM   628  O  O     . LEU A 1 108 ? 71.067 22.121 22.538  1.00 14.53  ? 84  LEU A O     1 
ATOM   629  C  CB    . LEU A 1 108 ? 71.177 19.693 20.335  1.00 11.26  ? 84  LEU A CB    1 
ATOM   630  C  CG    . LEU A 1 108 ? 70.321 18.939 19.301  1.00 13.64  ? 84  LEU A CG    1 
ATOM   631  C  CD1   . LEU A 1 108 ? 70.563 17.447 19.437  1.00 19.78  ? 84  LEU A CD1   1 
ATOM   632  C  CD2   . LEU A 1 108 ? 68.835 19.258 19.482  1.00 15.06  ? 84  LEU A CD2   1 
ATOM   633  N  N     . GLY A 1 109 ? 73.078 21.890 21.543  1.00 15.86  ? 85  GLY A N     1 
ATOM   634  C  CA    . GLY A 1 109 ? 73.806 22.512 22.655  1.00 13.72  ? 85  GLY A CA    1 
ATOM   635  C  C     . GLY A 1 109 ? 73.458 23.977 22.842  1.00 15.81  ? 85  GLY A C     1 
ATOM   636  O  O     . GLY A 1 109 ? 73.333 24.463 23.968  1.00 15.98  ? 85  GLY A O     1 
ATOM   637  N  N     . ASP A 1 110 ? 73.303 24.695 21.735  1.00 16.69  ? 86  ASP A N     1 
ATOM   638  C  CA    . ASP A 1 110 ? 72.904 26.095 21.791  1.00 17.46  ? 86  ASP A CA    1 
ATOM   639  C  C     . ASP A 1 110 ? 71.486 26.252 22.352  1.00 15.65  ? 86  ASP A C     1 
ATOM   640  O  O     . ASP A 1 110 ? 71.203 27.210 23.071  1.00 16.14  ? 86  ASP A O     1 
ATOM   641  C  CB    . ASP A 1 110 ? 73.005 26.749 20.408  1.00 18.97  ? 86  ASP A CB    1 
ATOM   642  C  CG    . ASP A 1 110 ? 74.446 26.847 19.903  1.00 25.03  ? 86  ASP A CG    1 
ATOM   643  O  OD1   . ASP A 1 110 ? 75.386 26.773 20.726  1.00 29.14  ? 86  ASP A OD1   1 
ATOM   644  O  OD2   . ASP A 1 110 ? 74.639 26.991 18.677  1.00 33.02  ? 86  ASP A OD2   1 
ATOM   645  N  N     . ILE A 1 111 ? 70.602 25.323 22.002  1.00 15.52  ? 87  ILE A N     1 
ATOM   646  C  CA    . ILE A 1 111 ? 69.229 25.305 22.535  1.00 16.62  ? 87  ILE A CA    1 
ATOM   647  C  C     . ILE A 1 111 ? 69.267 25.088 24.048  1.00 16.23  ? 87  ILE A C     1 
ATOM   648  O  O     . ILE A 1 111 ? 68.587 25.799 24.809  1.00 14.82  ? 87  ILE A O     1 
ATOM   649  C  CB    . ILE A 1 111 ? 68.378 24.201 21.869  1.00 17.17  ? 87  ILE A CB    1 
ATOM   650  C  CG1   . ILE A 1 111 ? 68.013 24.608 20.430  1.00 17.34  ? 87  ILE A CG1   1 
ATOM   651  C  CG2   . ILE A 1 111 ? 67.119 23.904 22.681  1.00 16.17  ? 87  ILE A CG2   1 
ATOM   652  C  CD1   . ILE A 1 111 ? 67.535 23.437 19.597  1.00 17.64  ? 87  ILE A CD1   1 
ATOM   653  N  N     . PHE A 1 112 ? 70.064 24.108 24.470  1.00 16.01  ? 88  PHE A N     1 
ATOM   654  C  CA    . PHE A 1 112 ? 70.169 23.784 25.879  1.00 15.51  ? 88  PHE A CA    1 
ATOM   655  C  C     . PHE A 1 112 ? 70.694 24.999 26.623  1.00 14.76  ? 88  PHE A C     1 
ATOM   656  O  O     . PHE A 1 112 ? 70.130 25.410 27.657  1.00 15.25  ? 88  PHE A O     1 
ATOM   657  C  CB    . PHE A 1 112 ? 71.060 22.559 26.143  1.00 15.57  ? 88  PHE A CB    1 
ATOM   658  C  CG    . PHE A 1 112 ? 71.101 22.166 27.588  1.00 16.83  ? 88  PHE A CG    1 
ATOM   659  C  CD1   . PHE A 1 112 ? 71.991 22.788 28.464  1.00 16.78  ? 88  PHE A CD1   1 
ATOM   660  C  CD2   . PHE A 1 112 ? 70.220 21.210 28.079  1.00 15.41  ? 88  PHE A CD2   1 
ATOM   661  C  CE1   . PHE A 1 112 ? 71.997 22.448 29.816  1.00 18.08  ? 88  PHE A CE1   1 
ATOM   662  C  CE2   . PHE A 1 112 ? 70.227 20.859 29.425  1.00 15.49  ? 88  PHE A CE2   1 
ATOM   663  C  CZ    . PHE A 1 112 ? 71.111 21.493 30.291  1.00 15.77  ? 88  PHE A CZ    1 
ATOM   664  N  N     . THR A 1 113 ? 71.758 25.582 26.089  1.00 13.85  ? 89  THR A N     1 
ATOM   665  C  CA    . THR A 1 113 ? 72.405 26.748 26.734  1.00 13.73  ? 89  THR A CA    1 
ATOM   666  C  C     . THR A 1 113 ? 71.421 27.919 26.833  1.00 15.51  ? 89  THR A C     1 
ATOM   667  O  O     . THR A 1 113 ? 71.291 28.561 27.873  1.00 15.45  ? 89  THR A O     1 
ATOM   668  C  CB    . THR A 1 113 ? 73.680 27.166 25.971  1.00 14.84  ? 89  THR A CB    1 
ATOM   669  O  OG1   . THR A 1 113 ? 74.594 26.067 25.913  1.00 18.63  ? 89  THR A OG1   1 
ATOM   670  C  CG2   . THR A 1 113 ? 74.380 28.373 26.631  1.00 14.28  ? 89  THR A CG2   1 
ATOM   671  N  N     . HIS A 1 114 ? 70.682 28.176 25.754  1.00 15.35  ? 90  HIS A N     1 
ATOM   672  C  CA    . HIS A 1 114 ? 69.680 29.218 25.796  1.00 14.99  ? 90  HIS A CA    1 
ATOM   673  C  C     . HIS A 1 114 ? 68.602 29.033 26.859  1.00 14.41  ? 90  HIS A C     1 
ATOM   674  O  O     . HIS A 1 114 ? 68.302 29.963 27.600  1.00 17.56  ? 90  HIS A O     1 
ATOM   675  C  CB    . HIS A 1 114 ? 68.937 29.344 24.464  1.00 14.21  ? 90  HIS A CB    1 
ATOM   676  C  CG    . HIS A 1 114 ? 67.763 30.265 24.563  1.00 14.75  ? 90  HIS A CG    1 
ATOM   677  N  ND1   . HIS A 1 114 ? 66.508 29.830 24.928  1.00 16.07  ? 90  HIS A ND1   1 
ATOM   678  C  CD2   . HIS A 1 114 ? 67.673 31.610 24.448  1.00 15.62  ? 90  HIS A CD2   1 
ATOM   679  C  CE1   . HIS A 1 114 ? 65.687 30.863 24.987  1.00 14.95  ? 90  HIS A CE1   1 
ATOM   680  N  NE2   . HIS A 1 114 ? 66.366 31.952 24.690  1.00 15.18  ? 90  HIS A NE2   1 
ATOM   681  N  N     . ASP A 1 115 ? 67.961 27.865 26.859  1.00 15.58  ? 91  ASP A N     1 
ATOM   682  C  CA    . ASP A 1 115 ? 66.792 27.632 27.710  1.00 17.43  ? 91  ASP A CA    1 
ATOM   683  C  C     . ASP A 1 115 ? 67.111 27.719 29.206  1.00 18.29  ? 91  ASP A C     1 
ATOM   684  O  O     . ASP A 1 115 ? 66.329 28.283 29.999  1.00 17.62  ? 91  ASP A O     1 
ATOM   685  C  CB    . ASP A 1 115 ? 66.173 26.289 27.408  1.00 19.28  ? 91  ASP A CB    1 
ATOM   686  C  CG    . ASP A 1 115 ? 65.625 26.206 25.996  1.00 18.88  ? 91  ASP A CG    1 
ATOM   687  O  OD1   . ASP A 1 115 ? 65.245 27.263 25.401  1.00 19.27  ? 91  ASP A OD1   1 
ATOM   688  O  OD2   . ASP A 1 115 ? 65.574 25.079 25.494  1.00 20.72  ? 91  ASP A OD2   1 
ATOM   689  N  N     . ILE A 1 116 ? 68.249 27.160 29.586  1.00 17.28  ? 92  ILE A N     1 
ATOM   690  C  CA    . ILE A 1 116 ? 68.635 27.192 31.012  1.00 18.09  ? 92  ILE A CA    1 
ATOM   691  C  C     . ILE A 1 116 ? 69.059 28.592 31.448  1.00 16.96  ? 92  ILE A C     1 
ATOM   692  O  O     . ILE A 1 116 ? 68.595 29.080 32.485  1.00 20.81  ? 92  ILE A O     1 
ATOM   693  C  CB    . ILE A 1 116 ? 69.619 26.049 31.388  1.00 15.51  ? 92  ILE A CB    1 
ATOM   694  C  CG1   . ILE A 1 116 ? 69.593 25.735 32.902  1.00 18.99  ? 92  ILE A CG1   1 
ATOM   695  C  CG2   . ILE A 1 116 ? 71.043 26.301 30.897  1.00 17.48  ? 92  ILE A CG2   1 
ATOM   696  C  CD1   . ILE A 1 116 ? 70.166 24.361 33.178  1.00 20.84  ? 92  ILE A CD1   1 
ATOM   697  N  N     . ARG A 1 117 ? 69.869 29.273 30.643  1.00 17.24  ? 93  ARG A N     1 
ATOM   698  C  CA    . ARG A 1 117 ? 70.235 30.673 30.929  1.00 16.89  ? 93  ARG A CA    1 
ATOM   699  C  C     . ARG A 1 117 ? 69.035 31.623 30.920  1.00 17.79  ? 93  ARG A C     1 
ATOM   700  O  O     . ARG A 1 117 ? 68.912 32.464 31.785  1.00 19.44  ? 93  ARG A O     1 
ATOM   701  C  CB    . ARG A 1 117 ? 71.347 31.168 29.984  1.00 18.52  ? 93  ARG A CB    1 
ATOM   702  C  CG    . ARG A 1 117 ? 72.691 30.465 30.200  1.00 18.98  ? 93  ARG A CG    1 
ATOM   703  C  CD    . ARG A 1 117 ? 73.812 31.030 29.341  1.00 22.60  ? 93  ARG A CD    1 
ATOM   704  N  NE    . ARG A 1 117 ? 74.394 32.235 29.920  1.00 23.20  ? 93  ARG A NE    1 
ATOM   705  C  CZ    . ARG A 1 117 ? 75.092 33.156 29.258  1.00 27.16  ? 93  ARG A CZ    1 
ATOM   706  N  NH1   . ARG A 1 117 ? 75.310 33.049 27.950  1.00 29.18  ? 93  ARG A NH1   1 
ATOM   707  N  NH2   . ARG A 1 117 ? 75.567 34.204 29.917  1.00 27.72  ? 93  ARG A NH2   1 
ATOM   708  N  N     . ALA A 1 118 ? 68.133 31.481 29.944  1.00 18.86  ? 94  ALA A N     1 
ATOM   709  C  CA    . ALA A 1 118 ? 66.952 32.342 29.874  1.00 20.41  ? 94  ALA A CA    1 
ATOM   710  C  C     . ALA A 1 118 ? 65.991 32.186 31.063  1.00 21.54  ? 94  ALA A C     1 
ATOM   711  O  O     . ALA A 1 118 ? 65.167 33.066 31.319  1.00 25.45  ? 94  ALA A O     1 
ATOM   712  C  CB    . ALA A 1 118 ? 66.210 32.122 28.560  1.00 22.44  ? 94  ALA A CB    1 
ATOM   713  N  N     . GLN A 1 119 ? 66.104 31.075 31.781  1.00 19.58  ? 95  GLN A N     1 
ATOM   714  C  CA    . GLN A 1 119 ? 65.359 30.878 33.024  1.00 21.28  ? 95  GLN A CA    1 
ATOM   715  C  C     . GLN A 1 119 ? 66.053 31.578 34.223  1.00 19.93  ? 95  GLN A C     1 
ATOM   716  O  O     . GLN A 1 119 ? 65.482 31.659 35.310  1.00 22.75  ? 95  GLN A O     1 
ATOM   717  C  CB    . GLN A 1 119 ? 65.106 29.372 33.267  1.00 22.74  ? 95  GLN A CB    1 
ATOM   718  C  CG    . GLN A 1 119 ? 64.316 29.007 34.529  1.00 25.16  ? 95  GLN A CG    1 
ATOM   719  C  CD    . GLN A 1 119 ? 62.879 29.493 34.515  1.00 28.79  ? 95  GLN A CD    1 
ATOM   720  O  OE1   . GLN A 1 119 ? 62.545 30.522 35.122  1.00 36.78  ? 95  GLN A OE1   1 
ATOM   721  N  NE2   . GLN A 1 119 ? 62.013 28.760 33.817  1.00 27.76  ? 95  GLN A NE2   1 
ATOM   722  N  N     . GLY A 1 120 ? 67.265 32.102 34.005  1.00 17.67  ? 96  GLY A N     1 
ATOM   723  C  CA    . GLY A 1 120 ? 68.008 32.872 35.015  1.00 15.82  ? 96  GLY A CA    1 
ATOM   724  C  C     . GLY A 1 120 ? 68.926 32.034 35.871  1.00 16.53  ? 96  GLY A C     1 
ATOM   725  O  O     . GLY A 1 120 ? 69.336 32.458 36.969  1.00 18.05  ? 96  GLY A O     1 
ATOM   726  N  N     . VAL A 1 121 ? 69.240 30.848 35.361  1.00 14.97  ? 97  VAL A N     1 
ATOM   727  C  CA    . VAL A 1 121 ? 70.215 29.909 35.913  1.00 15.69  ? 97  VAL A CA    1 
ATOM   728  C  C     . VAL A 1 121 ? 71.623 30.245 35.414  1.00 16.89  ? 97  VAL A C     1 
ATOM   729  O  O     . VAL A 1 121 ? 71.845 30.466 34.222  1.00 16.19  ? 97  VAL A O     1 
ATOM   730  C  CB    . VAL A 1 121 ? 69.880 28.458 35.513  1.00 15.49  ? 97  VAL A CB    1 
ATOM   731  C  CG1   . VAL A 1 121 ? 70.852 27.481 36.177  1.00 19.49  ? 97  VAL A CG1   1 
ATOM   732  C  CG2   . VAL A 1 121 ? 68.418 28.130 35.813  1.00 18.31  ? 97  VAL A CG2   1 
ATOM   733  N  N     . HIS A 1 122 ? 72.561 30.336 36.345  1.00 15.45  ? 98  HIS A N     1 
ATOM   734  C  CA    . HIS A 1 122 ? 73.968 30.507 36.019  1.00 16.48  ? 98  HIS A CA    1 
ATOM   735  C  C     . HIS A 1 122 ? 74.434 29.220 35.346  1.00 17.41  ? 98  HIS A C     1 
ATOM   736  O  O     . HIS A 1 122 ? 74.359 28.151 35.947  1.00 18.60  ? 98  HIS A O     1 
ATOM   737  C  CB    . HIS A 1 122 ? 74.761 30.740 37.327  1.00 20.11  ? 98  HIS A CB    1 
ATOM   738  C  CG    . HIS A 1 122 ? 76.248 30.667 37.164  1.00 23.31  ? 98  HIS A CG    1 
ATOM   739  N  ND1   . HIS A 1 122 ? 77.061 31.765 37.326  1.00 26.66  ? 98  HIS A ND1   1 
ATOM   740  C  CD2   . HIS A 1 122 ? 77.067 29.634 36.853  1.00 21.47  ? 98  HIS A CD2   1 
ATOM   741  C  CE1   . HIS A 1 122 ? 78.316 31.417 37.117  1.00 23.51  ? 98  HIS A CE1   1 
ATOM   742  N  NE2   . HIS A 1 122 ? 78.346 30.130 36.823  1.00 22.31  ? 98  HIS A NE2   1 
ATOM   743  N  N     . TYR A 1 123 ? 74.924 29.326 34.110  1.00 17.99  ? 99  TYR A N     1 
ATOM   744  C  CA    . TYR A 1 123 ? 75.423 28.186 33.371  1.00 17.80  ? 99  TYR A CA    1 
ATOM   745  C  C     . TYR A 1 123 ? 76.597 28.601 32.501  1.00 20.23  ? 99  TYR A C     1 
ATOM   746  O  O     . TYR A 1 123 ? 76.423 29.342 31.506  1.00 21.20  ? 99  TYR A O     1 
ATOM   747  C  CB    . TYR A 1 123 ? 74.317 27.583 32.482  1.00 16.12  ? 99  TYR A CB    1 
ATOM   748  C  CG    . TYR A 1 123 ? 74.809 26.475 31.590  1.00 16.64  ? 99  TYR A CG    1 
ATOM   749  C  CD1   . TYR A 1 123 ? 75.543 25.383 32.101  1.00 16.90  ? 99  TYR A CD1   1 
ATOM   750  C  CD2   . TYR A 1 123 ? 74.515 26.491 30.212  1.00 17.65  ? 99  TYR A CD2   1 
ATOM   751  C  CE1   . TYR A 1 123 ? 75.962 24.344 31.260  1.00 18.88  ? 99  TYR A CE1   1 
ATOM   752  C  CE2   . TYR A 1 123 ? 74.922 25.467 29.386  1.00 17.42  ? 99  TYR A CE2   1 
ATOM   753  C  CZ    . TYR A 1 123 ? 75.650 24.409 29.898  1.00 17.51  ? 99  TYR A CZ    1 
ATOM   754  O  OH    . TYR A 1 123 ? 76.063 23.416 29.046  1.00 18.11  ? 99  TYR A OH    1 
ATOM   755  N  N     . GLN A 1 124 ? 77.789 28.125 32.873  1.00 23.04  ? 100 GLN A N     1 
ATOM   756  C  CA    A GLN A 1 124 ? 79.033 28.581 32.260  0.50 19.62  ? 100 GLN A CA    1 
ATOM   757  C  CA    B GLN A 1 124 ? 79.018 28.582 32.232  0.50 19.62  ? 100 GLN A CA    1 
ATOM   758  C  C     . GLN A 1 124 ? 79.902 27.447 31.715  1.00 21.07  ? 100 GLN A C     1 
ATOM   759  O  O     . GLN A 1 124 ? 80.990 27.701 31.177  1.00 20.88  ? 100 GLN A O     1 
ATOM   760  C  CB    A GLN A 1 124 ? 79.829 29.447 33.250  0.50 17.37  ? 100 GLN A CB    1 
ATOM   761  C  CB    B GLN A 1 124 ? 79.795 29.524 33.167  0.50 17.37  ? 100 GLN A CB    1 
ATOM   762  C  CG    A GLN A 1 124 ? 79.531 30.935 33.170  0.50 16.75  ? 100 GLN A CG    1 
ATOM   763  C  CG    B GLN A 1 124 ? 79.121 30.869 33.384  0.50 16.75  ? 100 GLN A CG    1 
ATOM   764  C  CD    A GLN A 1 124 ? 79.994 31.683 34.412  0.50 19.95  ? 100 GLN A CD    1 
ATOM   765  C  CD    B GLN A 1 124 ? 79.143 31.746 32.156  0.50 16.76  ? 100 GLN A CD    1 
ATOM   766  O  OE1   A GLN A 1 124 ? 79.668 32.855 34.606  0.50 23.70  ? 100 GLN A OE1   1 
ATOM   767  O  OE1   B GLN A 1 124 ? 80.117 32.462 31.916  0.50 17.46  ? 100 GLN A OE1   1 
ATOM   768  N  NE2   A GLN A 1 124 ? 80.762 31.006 35.258  0.50 19.48  ? 100 GLN A NE2   1 
ATOM   769  N  NE2   B GLN A 1 124 ? 78.063 31.706 31.367  0.50 18.26  ? 100 GLN A NE2   1 
ATOM   770  N  N     . THR A 1 125 ? 79.425 26.203 31.852  1.00 21.47  ? 101 THR A N     1 
ATOM   771  C  CA    . THR A 1 125 ? 80.164 25.038 31.361  1.00 20.87  ? 101 THR A CA    1 
ATOM   772  C  C     . THR A 1 125 ? 80.431 25.165 29.861  1.00 22.38  ? 101 THR A C     1 
ATOM   773  O  O     . THR A 1 125 ? 79.499 25.310 29.064  1.00 21.53  ? 101 THR A O     1 
ATOM   774  C  CB    . THR A 1 125 ? 79.429 23.706 31.610  1.00 21.32  ? 101 THR A CB    1 
ATOM   775  O  OG1   . THR A 1 125 ? 78.980 23.630 32.970  1.00 20.72  ? 101 THR A OG1   1 
ATOM   776  C  CG2   . THR A 1 125 ? 80.351 22.541 31.302  1.00 20.96  ? 101 THR A CG2   1 
ATOM   777  N  N     . LYS A 1 126 ? 81.711 25.089 29.505  1.00 23.03  ? 102 LYS A N     1 
ATOM   778  C  CA    . LYS A 1 126 ? 82.197 25.351 28.167  1.00 25.34  ? 102 LYS A CA    1 
ATOM   779  C  C     . LYS A 1 126 ? 82.206 24.080 27.314  1.00 24.63  ? 102 LYS A C     1 
ATOM   780  O  O     . LYS A 1 126 ? 82.738 23.062 27.739  1.00 23.33  ? 102 LYS A O     1 
ATOM   781  C  CB    . LYS A 1 126 ? 83.617 25.939 28.257  1.00 25.07  ? 102 LYS A CB    1 
ATOM   782  C  CG    . LYS A 1 126 ? 83.730 27.244 29.041  1.00 25.22  ? 102 LYS A CG    1 
ATOM   783  C  CD    . LYS A 1 126 ? 83.021 28.400 28.337  1.00 33.85  ? 102 LYS A CD    1 
ATOM   784  C  CE    . LYS A 1 126 ? 83.288 29.739 29.019  1.00 42.73  ? 102 LYS A CE    1 
ATOM   785  N  NZ    . LYS A 1 126 ? 82.690 29.830 30.384  1.00 40.95  ? 102 LYS A NZ    1 
ATOM   786  N  N     . PRO A 1 127 ? 81.586 24.121 26.117  1.00 25.48  ? 103 PRO A N     1 
ATOM   787  C  CA    . PRO A 1 127 ? 81.672 22.959 25.228  1.00 24.95  ? 103 PRO A CA    1 
ATOM   788  C  C     . PRO A 1 127 ? 83.110 22.678 24.788  1.00 24.67  ? 103 PRO A C     1 
ATOM   789  O  O     . PRO A 1 127 ? 83.907 23.614 24.640  1.00 26.07  ? 103 PRO A O     1 
ATOM   790  C  CB    . PRO A 1 127 ? 80.798 23.355 24.027  1.00 24.85  ? 103 PRO A CB    1 
ATOM   791  C  CG    . PRO A 1 127 ? 80.581 24.824 24.148  1.00 31.08  ? 103 PRO A CG    1 
ATOM   792  C  CD    . PRO A 1 127 ? 80.641 25.134 25.612  1.00 31.28  ? 103 PRO A CD    1 
ATOM   793  N  N     . LYS A 1 128 ? 83.429 21.398 24.589  1.00 20.81  ? 104 LYS A N     1 
ATOM   794  C  CA    . LYS A 1 128 ? 84.799 20.978 24.265  1.00 23.92  ? 104 LYS A CA    1 
ATOM   795  C  C     . LYS A 1 128 ? 85.030 20.847 22.773  1.00 27.37  ? 104 LYS A C     1 
ATOM   796  O  O     . LYS A 1 128 ? 86.173 20.751 22.325  1.00 34.30  ? 104 LYS A O     1 
ATOM   797  C  CB    . LYS A 1 128 ? 85.128 19.662 24.953  1.00 25.91  ? 104 LYS A CB    1 
ATOM   798  C  CG    . LYS A 1 128 ? 85.382 19.835 26.438  1.00 29.91  ? 104 LYS A CG    1 
ATOM   799  C  CD    . LYS A 1 128 ? 84.671 18.767 27.241  1.00 33.10  ? 104 LYS A CD    1 
ATOM   800  C  CE    . LYS A 1 128 ? 84.649 19.133 28.720  1.00 33.78  ? 104 LYS A CE    1 
ATOM   801  N  NZ    . LYS A 1 128 ? 83.930 20.416 28.982  1.00 32.29  ? 104 LYS A NZ    1 
ATOM   802  N  N     A GLY A 1 129 ? 83.940 20.851 22.012  0.50 27.53  ? 105 GLY A N     1 
ATOM   803  N  N     B GLY A 1 129 ? 83.940 20.841 22.015  0.50 27.74  ? 105 GLY A N     1 
ATOM   804  C  CA    A GLY A 1 129 ? 83.981 20.702 20.559  0.50 24.29  ? 105 GLY A CA    1 
ATOM   805  C  CA    B GLY A 1 129 ? 83.982 20.650 20.571  0.50 24.69  ? 105 GLY A CA    1 
ATOM   806  C  C     A GLY A 1 129 ? 82.598 20.352 20.047  0.50 21.93  ? 105 GLY A C     1 
ATOM   807  C  C     B GLY A 1 129 ? 82.630 20.168 20.092  0.50 22.47  ? 105 GLY A C     1 
ATOM   808  O  O     A GLY A 1 129 ? 81.620 20.467 20.786  0.50 20.96  ? 105 GLY A O     1 
ATOM   809  O  O     B GLY A 1 129 ? 81.708 20.004 20.891  0.50 21.63  ? 105 GLY A O     1 
ATOM   810  N  N     . ALA A 1 130 ? 82.515 19.924 18.789  1.00 22.49  ? 106 ALA A N     1 
ATOM   811  C  CA    . ALA A 1 130 ? 81.233 19.521 18.186  1.00 21.51  ? 106 ALA A CA    1 
ATOM   812  C  C     . ALA A 1 130 ? 80.944 18.027 18.375  1.00 21.89  ? 106 ALA A C     1 
ATOM   813  O  O     . ALA A 1 130 ? 79.785 17.602 18.312  1.00 22.99  ? 106 ALA A O     1 
ATOM   814  C  CB    . ALA A 1 130 ? 81.184 19.909 16.704  1.00 23.70  ? 106 ALA A CB    1 
ATOM   815  N  N     . PHE A 1 131 ? 81.991 17.234 18.619  1.00 21.36  ? 107 PHE A N     1 
ATOM   816  C  CA    . PHE A 1 131 ? 81.837 15.785 18.727  1.00 21.07  ? 107 PHE A CA    1 
ATOM   817  C  C     . PHE A 1 131 ? 82.522 15.182 19.958  1.00 20.16  ? 107 PHE A C     1 
ATOM   818  O  O     . PHE A 1 131 ? 83.660 15.538 20.261  1.00 21.33  ? 107 PHE A O     1 
ATOM   819  C  CB    . PHE A 1 131 ? 82.317 15.112 17.448  1.00 22.64  ? 107 PHE A CB    1 
ATOM   820  C  CG    . PHE A 1 131 ? 81.598 15.596 16.223  1.00 25.59  ? 107 PHE A CG    1 
ATOM   821  C  CD1   . PHE A 1 131 ? 80.338 15.093 15.903  1.00 28.82  ? 107 PHE A CD1   1 
ATOM   822  C  CD2   . PHE A 1 131 ? 82.151 16.587 15.417  1.00 26.62  ? 107 PHE A CD2   1 
ATOM   823  C  CE1   . PHE A 1 131 ? 79.653 15.544 14.784  1.00 31.59  ? 107 PHE A CE1   1 
ATOM   824  C  CE2   . PHE A 1 131 ? 81.466 17.046 14.296  1.00 30.27  ? 107 PHE A CE2   1 
ATOM   825  C  CZ    . PHE A 1 131 ? 80.219 16.518 13.977  1.00 33.46  ? 107 PHE A CZ    1 
ATOM   826  N  N     . PRO A 1 132 ? 81.827 14.265 20.671  1.00 20.25  ? 108 PRO A N     1 
ATOM   827  C  CA    . PRO A 1 132 ? 80.469 13.746 20.422  1.00 20.17  ? 108 PRO A CA    1 
ATOM   828  C  C     . PRO A 1 132 ? 79.416 14.855 20.506  1.00 18.10  ? 108 PRO A C     1 
ATOM   829  O  O     . PRO A 1 132 ? 79.635 15.832 21.220  1.00 17.53  ? 108 PRO A O     1 
ATOM   830  C  CB    . PRO A 1 132 ? 80.243 12.752 21.570  1.00 23.03  ? 108 PRO A CB    1 
ATOM   831  C  CG    . PRO A 1 132 ? 81.586 12.487 22.160  1.00 23.83  ? 108 PRO A CG    1 
ATOM   832  C  CD    . PRO A 1 132 ? 82.427 13.690 21.889  1.00 22.06  ? 108 PRO A CD    1 
ATOM   833  N  N     . PRO A 1 133 ? 78.276 14.701 19.797  1.00 16.32  ? 109 PRO A N     1 
ATOM   834  C  CA    . PRO A 1 133 ? 77.259 15.756 19.809  1.00 16.29  ? 109 PRO A CA    1 
ATOM   835  C  C     . PRO A 1 133 ? 76.525 15.835 21.146  1.00 16.95  ? 109 PRO A C     1 
ATOM   836  O  O     . PRO A 1 133 ? 76.704 14.960 22.022  1.00 17.20  ? 109 PRO A O     1 
ATOM   837  C  CB    . PRO A 1 133 ? 76.276 15.312 18.714  1.00 19.56  ? 109 PRO A CB    1 
ATOM   838  C  CG    . PRO A 1 133 ? 76.406 13.828 18.679  1.00 20.04  ? 109 PRO A CG    1 
ATOM   839  C  CD    . PRO A 1 133 ? 77.826 13.505 19.052  1.00 16.89  ? 109 PRO A CD    1 
ATOM   840  N  N     . THR A 1 134 ? 75.700 16.867 21.284  1.00 15.82  ? 110 THR A N     1 
ATOM   841  C  CA    . THR A 1 134 ? 74.939 17.106 22.515  1.00 14.23  ? 110 THR A CA    1 
ATOM   842  C  C     . THR A 1 134 ? 74.018 15.922 22.776  1.00 15.53  ? 110 THR A C     1 
ATOM   843  O  O     . THR A 1 134 ? 73.393 15.377 21.855  1.00 14.64  ? 110 THR A O     1 
ATOM   844  C  CB    . THR A 1 134 ? 74.172 18.447 22.436  1.00 14.39  ? 110 THR A CB    1 
ATOM   845  O  OG1   . THR A 1 134 ? 75.116 19.508 22.390  1.00 17.34  ? 110 THR A OG1   1 
ATOM   846  C  CG2   . THR A 1 134 ? 73.258 18.662 23.623  1.00 15.56  ? 110 THR A CG2   1 
ATOM   847  N  N     . ALA A 1 135 ? 73.971 15.494 24.037  1.00 16.56  ? 111 ALA A N     1 
ATOM   848  C  CA    . ALA A 1 135 ? 73.078 14.411 24.433  1.00 14.06  ? 111 ALA A CA    1 
ATOM   849  C  C     . ALA A 1 135 ? 71.616 14.696 24.074  1.00 12.66  ? 111 ALA A C     1 
ATOM   850  O  O     . ALA A 1 135 ? 71.143 15.839 24.088  1.00 13.25  ? 111 ALA A O     1 
ATOM   851  C  CB    . ALA A 1 135 ? 73.209 14.156 25.924  1.00 12.69  ? 111 ALA A CB    1 
ATOM   852  N  N     . ARG A 1 136 ? 70.906 13.634 23.743  1.00 14.57  ? 112 ARG A N     1 
ATOM   853  C  CA    . ARG A 1 136 ? 69.468 13.713 23.551  1.00 14.16  ? 112 ARG A CA    1 
ATOM   854  C  C     . ARG A 1 136 ? 68.803 12.466 24.094  1.00 12.94  ? 112 ARG A C     1 
ATOM   855  O  O     . ARG A 1 136 ? 69.426 11.380 24.162  1.00 16.37  ? 112 ARG A O     1 
ATOM   856  C  CB    . ARG A 1 136 ? 69.094 13.973 22.073  1.00 14.26  ? 112 ARG A CB    1 
ATOM   857  C  CG    . ARG A 1 136 ? 69.263 12.786 21.126  1.00 15.15  ? 112 ARG A CG    1 
ATOM   858  C  CD    . ARG A 1 136 ? 70.711 12.320 20.957  1.00 17.18  ? 112 ARG A CD    1 
ATOM   859  N  NE    . ARG A 1 136 ? 71.661 13.385 20.620  1.00 19.01  ? 112 ARG A NE    1 
ATOM   860  C  CZ    . ARG A 1 136 ? 71.988 13.761 19.387  1.00 19.41  ? 112 ARG A CZ    1 
ATOM   861  N  NH1   . ARG A 1 136 ? 71.421 13.170 18.341  1.00 19.91  ? 112 ARG A NH1   1 
ATOM   862  N  NH2   . ARG A 1 136 ? 72.876 14.734 19.197  1.00 18.19  ? 112 ARG A NH2   1 
ATOM   863  N  N     . SER A 1 137 ? 67.551 12.632 24.500  1.00 12.56  ? 113 SER A N     1 
ATOM   864  C  CA    . SER A 1 137 ? 66.750 11.538 25.012  1.00 13.39  ? 113 SER A CA    1 
ATOM   865  C  C     . SER A 1 137 ? 65.415 11.502 24.312  1.00 13.23  ? 113 SER A C     1 
ATOM   866  O  O     . SER A 1 137 ? 64.655 12.478 24.331  1.00 14.59  ? 113 SER A O     1 
ATOM   867  C  CB    . SER A 1 137 ? 66.521 11.708 26.524  1.00 14.60  ? 113 SER A CB    1 
ATOM   868  O  OG    . SER A 1 137 ? 65.882 10.564 27.064  1.00 16.58  ? 113 SER A OG    1 
HETATM 869  N  N     . MSE A 1 138 ? 65.145 10.376 23.668  1.00 14.63  ? 114 MSE A N     1 
HETATM 870  C  CA    . MSE A 1 138 ? 63.873 10.160 23.017  1.00 14.19  ? 114 MSE A CA    1 
HETATM 871  C  C     . MSE A 1 138 ? 62.928 9.618  24.031  1.00 12.41  ? 114 MSE A C     1 
HETATM 872  O  O     . MSE A 1 138 ? 63.092 8.489  24.526  1.00 14.18  ? 114 MSE A O     1 
HETATM 873  C  CB    . MSE A 1 138 ? 64.107 9.207  21.875  1.00 16.00  ? 114 MSE A CB    1 
HETATM 874  C  CG    . MSE A 1 138 ? 64.742 10.032 20.773  1.00 25.01  ? 114 MSE A CG    1 
HETATM 875  SE SE    . MSE A 1 138 ? 64.961 8.784  19.285  1.00 40.44  ? 114 MSE A SE    1 
HETATM 876  C  CE    . MSE A 1 138 ? 66.672 7.985  19.844  1.00 23.00  ? 114 MSE A CE    1 
ATOM   877  N  N     . ILE A 1 139 ? 61.950 10.446 24.369  1.00 13.58  ? 115 ILE A N     1 
ATOM   878  C  CA    . ILE A 1 139 ? 61.006 10.142 25.428  1.00 16.45  ? 115 ILE A CA    1 
ATOM   879  C  C     . ILE A 1 139 ? 59.642 9.814  24.815  1.00 16.67  ? 115 ILE A C     1 
ATOM   880  O  O     . ILE A 1 139 ? 59.012 10.656 24.147  1.00 16.33  ? 115 ILE A O     1 
ATOM   881  C  CB    . ILE A 1 139 ? 60.895 11.319 26.414  1.00 16.60  ? 115 ILE A CB    1 
ATOM   882  C  CG1   . ILE A 1 139 ? 62.291 11.704 26.934  1.00 14.99  ? 115 ILE A CG1   1 
ATOM   883  C  CG2   . ILE A 1 139 ? 59.946 10.969 27.553  1.00 18.32  ? 115 ILE A CG2   1 
ATOM   884  C  CD1   . ILE A 1 139 ? 62.280 12.822 27.951  1.00 14.18  ? 115 ILE A CD1   1 
ATOM   885  N  N     . PHE A 1 140 ? 59.205 8.580  25.047  1.00 14.93  ? 116 PHE A N     1 
ATOM   886  C  CA    . PHE A 1 140 ? 57.915 8.123  24.575  1.00 15.48  ? 116 PHE A CA    1 
ATOM   887  C  C     . PHE A 1 140 ? 56.899 8.170  25.715  1.00 17.67  ? 116 PHE A C     1 
ATOM   888  O  O     . PHE A 1 140 ? 57.105 7.561  26.773  1.00 16.88  ? 116 PHE A O     1 
ATOM   889  C  CB    . PHE A 1 140 ? 58.025 6.725  23.954  1.00 13.98  ? 116 PHE A CB    1 
ATOM   890  C  CG    . PHE A 1 140 ? 58.962 6.654  22.782  1.00 16.04  ? 116 PHE A CG    1 
ATOM   891  C  CD1   . PHE A 1 140 ? 58.491 6.905  21.493  1.00 17.50  ? 116 PHE A CD1   1 
ATOM   892  C  CD2   . PHE A 1 140 ? 60.299 6.328  22.946  1.00 16.17  ? 116 PHE A CD2   1 
ATOM   893  C  CE1   . PHE A 1 140 ? 59.348 6.847  20.405  1.00 17.84  ? 116 PHE A CE1   1 
ATOM   894  C  CE2   . PHE A 1 140 ? 61.166 6.279  21.867  1.00 18.44  ? 116 PHE A CE2   1 
ATOM   895  C  CZ    . PHE A 1 140 ? 60.688 6.528  20.579  1.00 17.07  ? 116 PHE A CZ    1 
ATOM   896  N  N     . VAL A 1 141 ? 55.815 8.907  25.498  1.00 19.11  ? 117 VAL A N     1 
ATOM   897  C  CA    . VAL A 1 141 ? 54.763 9.040  26.506  1.00 20.48  ? 117 VAL A CA    1 
ATOM   898  C  C     . VAL A 1 141 ? 53.546 8.192  26.142  1.00 20.94  ? 117 VAL A C     1 
ATOM   899  O  O     . VAL A 1 141 ? 52.962 8.355  25.060  1.00 21.32  ? 117 VAL A O     1 
ATOM   900  C  CB    . VAL A 1 141 ? 54.356 10.518 26.725  1.00 21.39  ? 117 VAL A CB    1 
ATOM   901  C  CG1   . VAL A 1 141 ? 53.245 10.615 27.757  1.00 23.07  ? 117 VAL A CG1   1 
ATOM   902  C  CG2   . VAL A 1 141 ? 55.554 11.370 27.153  1.00 18.37  ? 117 VAL A CG2   1 
ATOM   903  N  N     . THR A 1 142 ? 53.172 7.283  27.041  1.00 20.41  ? 118 THR A N     1 
ATOM   904  C  CA    . THR A 1 142 ? 52.033 6.385  26.799  1.00 21.62  ? 118 THR A CA    1 
ATOM   905  C  C     . THR A 1 142 ? 50.718 7.016  27.288  1.00 22.93  ? 118 THR A C     1 
ATOM   906  O  O     . THR A 1 142 ? 50.744 8.046  27.978  1.00 25.63  ? 118 THR A O     1 
ATOM   907  C  CB    . THR A 1 142 ? 52.250 4.994  27.449  1.00 20.94  ? 118 THR A CB    1 
ATOM   908  O  OG1   . THR A 1 142 ? 52.855 5.152  28.737  1.00 21.48  ? 118 THR A OG1   1 
ATOM   909  C  CG2   . THR A 1 142 ? 53.156 4.119  26.597  1.00 19.65  ? 118 THR A CG2   1 
ATOM   910  N  N     . GLU A 1 143 ? 49.583 6.407  26.926  1.00 23.61  ? 119 GLU A N     1 
ATOM   911  C  CA    . GLU A 1 143 ? 48.238 6.943  27.239  1.00 25.63  ? 119 GLU A CA    1 
ATOM   912  C  C     . GLU A 1 143 ? 48.007 7.207  28.723  1.00 25.20  ? 119 GLU A C     1 
ATOM   913  O  O     . GLU A 1 143 ? 47.276 8.133  29.094  1.00 25.91  ? 119 GLU A O     1 
ATOM   914  C  CB    . GLU A 1 143 ? 47.144 6.007  26.711  1.00 28.38  ? 119 GLU A CB    1 
ATOM   915  C  CG    . GLU A 1 143 ? 46.998 6.014  25.199  1.00 37.40  ? 119 GLU A CG    1 
ATOM   916  C  CD    . GLU A 1 143 ? 45.952 5.031  24.701  1.00 49.22  ? 119 GLU A CD    1 
ATOM   917  O  OE1   . GLU A 1 143 ? 46.168 4.435  23.621  1.00 54.99  ? 119 GLU A OE1   1 
ATOM   918  O  OE2   . GLU A 1 143 ? 44.916 4.853  25.387  1.00 52.43  ? 119 GLU A OE2   1 
ATOM   919  N  N     . ASP A 1 144 ? 48.633 6.388  29.560  1.00 25.26  ? 120 ASP A N     1 
ATOM   920  C  CA    . ASP A 1 144 ? 48.562 6.541  31.013  1.00 25.35  ? 120 ASP A CA    1 
ATOM   921  C  C     . ASP A 1 144 ? 49.431 7.703  31.532  1.00 26.13  ? 120 ASP A C     1 
ATOM   922  O  O     . ASP A 1 144 ? 49.422 8.006  32.728  1.00 28.01  ? 120 ASP A O     1 
ATOM   923  C  CB    . ASP A 1 144 ? 48.949 5.219  31.702  1.00 28.09  ? 120 ASP A CB    1 
ATOM   924  C  CG    . ASP A 1 144 ? 50.351 4.741  31.328  1.00 23.42  ? 120 ASP A CG    1 
ATOM   925  O  OD1   . ASP A 1 144 ? 51.081 5.491  30.648  1.00 23.74  ? 120 ASP A OD1   1 
ATOM   926  O  OD2   . ASP A 1 144 ? 50.730 3.618  31.724  1.00 25.50  ? 120 ASP A OD2   1 
ATOM   927  N  N     . GLY A 1 145 ? 50.185 8.333  30.631  1.00 25.68  ? 121 GLY A N     1 
ATOM   928  C  CA    . GLY A 1 145 ? 51.025 9.486  30.967  1.00 25.83  ? 121 GLY A CA    1 
ATOM   929  C  C     . GLY A 1 145 ? 52.419 9.122  31.442  1.00 22.99  ? 121 GLY A C     1 
ATOM   930  O  O     . GLY A 1 145 ? 53.207 9.999  31.814  1.00 19.99  ? 121 GLY A O     1 
ATOM   931  N  N     . GLU A 1 146 ? 52.731 7.829  31.433  1.00 23.08  ? 122 GLU A N     1 
ATOM   932  C  CA    . GLU A 1 146 ? 54.074 7.370  31.792  1.00 20.18  ? 122 GLU A CA    1 
ATOM   933  C  C     . GLU A 1 146 ? 55.077 7.696  30.699  1.00 19.13  ? 122 GLU A C     1 
ATOM   934  O  O     . GLU A 1 146 ? 54.722 7.715  29.500  1.00 21.09  ? 122 GLU A O     1 
ATOM   935  C  CB    . GLU A 1 146 ? 54.103 5.872  32.084  1.00 20.05  ? 122 GLU A CB    1 
ATOM   936  C  CG    . GLU A 1 146 ? 55.362 5.460  32.827  1.00 23.78  ? 122 GLU A CG    1 
ATOM   937  C  CD    . GLU A 1 146 ? 55.580 6.292  34.089  1.00 28.32  ? 122 GLU A CD    1 
ATOM   938  O  OE1   . GLU A 1 146 ? 56.426 7.237  34.081  1.00 24.83  ? 122 GLU A OE1   1 
ATOM   939  O  OE2   . GLU A 1 146 ? 54.870 6.016  35.076  1.00 32.02  ? 122 GLU A OE2   1 
ATOM   940  N  N     . ARG A 1 147 ? 56.322 7.930  31.106  1.00 18.45  ? 123 ARG A N     1 
ATOM   941  C  CA    A ARG A 1 147 ? 57.379 8.291  30.154  0.50 15.97  ? 123 ARG A CA    1 
ATOM   942  C  CA    B ARG A 1 147 ? 57.385 8.311  30.178  0.50 16.16  ? 123 ARG A CA    1 
ATOM   943  C  C     . ARG A 1 147 ? 58.525 7.293  30.180  1.00 17.24  ? 123 ARG A C     1 
ATOM   944  O  O     . ARG A 1 147 ? 59.009 6.877  31.250  1.00 18.64  ? 123 ARG A O     1 
ATOM   945  C  CB    A ARG A 1 147 ? 57.891 9.723  30.384  0.50 16.07  ? 123 ARG A CB    1 
ATOM   946  C  CB    B ARG A 1 147 ? 57.887 9.724  30.513  0.50 16.71  ? 123 ARG A CB    1 
ATOM   947  C  CG    A ARG A 1 147 ? 59.119 9.854  31.287  0.50 17.17  ? 123 ARG A CG    1 
ATOM   948  C  CG    B ARG A 1 147 ? 58.476 9.893  31.919  0.50 15.74  ? 123 ARG A CG    1 
ATOM   949  C  CD    A ARG A 1 147 ? 58.774 9.686  32.759  0.50 16.23  ? 123 ARG A CD    1 
ATOM   950  C  CD    B ARG A 1 147 ? 59.993 9.941  31.840  0.50 15.49  ? 123 ARG A CD    1 
ATOM   951  N  NE    A ARG A 1 147 ? 59.957 9.861  33.606  0.50 17.09  ? 123 ARG A NE    1 
ATOM   952  N  NE    B ARG A 1 147 ? 60.643 9.955  33.149  0.50 14.46  ? 123 ARG A NE    1 
ATOM   953  C  CZ    A ARG A 1 147 ? 60.896 8.936  33.790  0.50 17.16  ? 123 ARG A CZ    1 
ATOM   954  C  CZ    B ARG A 1 147 ? 61.113 8.869  33.758  0.50 15.43  ? 123 ARG A CZ    1 
ATOM   955  N  NH1   A ARG A 1 147 ? 60.801 7.756  33.191  0.50 16.03  ? 123 ARG A NH1   1 
ATOM   956  N  NH1   B ARG A 1 147 ? 61.009 7.681  33.176  0.50 14.04  ? 123 ARG A NH1   1 
ATOM   957  N  NH2   A ARG A 1 147 ? 61.941 9.198  34.574  0.50 20.02  ? 123 ARG A NH2   1 
ATOM   958  N  NH2   B ARG A 1 147 ? 61.695 8.974  34.948  0.50 19.85  ? 123 ARG A NH2   1 
ATOM   959  N  N     . SER A 1 148 ? 58.959 6.900  28.994  1.00 15.98  ? 124 SER A N     1 
ATOM   960  C  CA    . SER A 1 148 ? 60.028 5.927  28.872  1.00 15.03  ? 124 SER A CA    1 
ATOM   961  C  C     . SER A 1 148 ? 61.104 6.565  28.022  1.00 17.11  ? 124 SER A C     1 
ATOM   962  O  O     . SER A 1 148 ? 60.864 6.952  26.850  1.00 17.41  ? 124 SER A O     1 
ATOM   963  C  CB    . SER A 1 148 ? 59.504 4.634  28.235  1.00 15.15  ? 124 SER A CB    1 
ATOM   964  O  OG    . SER A 1 148 ? 58.343 4.172  28.897  1.00 16.09  ? 124 SER A OG    1 
HETATM 965  N  N     . MSE A 1 149 ? 62.277 6.710  28.623  1.00 16.34  ? 125 MSE A N     1 
HETATM 966  C  CA    . MSE A 1 149 ? 63.334 7.564  28.082  1.00 13.62  ? 125 MSE A CA    1 
HETATM 967  C  C     . MSE A 1 149 ? 64.415 6.733  27.477  1.00 13.82  ? 125 MSE A C     1 
HETATM 968  O  O     . MSE A 1 149 ? 64.783 5.679  28.010  1.00 13.58  ? 125 MSE A O     1 
HETATM 969  C  CB    . MSE A 1 149 ? 63.918 8.437  29.193  1.00 15.74  ? 125 MSE A CB    1 
HETATM 970  C  CG    . MSE A 1 149 ? 62.770 9.102  29.923  1.00 18.33  ? 125 MSE A CG    1 
HETATM 971  SE SE    . MSE A 1 149 ? 63.508 10.586 30.950  1.00 33.18  ? 125 MSE A SE    1 
HETATM 972  C  CE    . MSE A 1 149 ? 64.444 9.458  32.262  1.00 22.05  ? 125 MSE A CE    1 
ATOM   973  N  N     . ASN A 1 150 ? 64.939 7.215  26.348  1.00 14.08  ? 126 ASN A N     1 
ATOM   974  C  CA    . ASN A 1 150 ? 65.971 6.505  25.589  1.00 12.52  ? 126 ASN A CA    1 
ATOM   975  C  C     . ASN A 1 150 ? 67.120 7.440  25.245  1.00 12.99  ? 126 ASN A C     1 
ATOM   976  O  O     . ASN A 1 150 ? 67.051 8.234  24.290  1.00 14.47  ? 126 ASN A O     1 
ATOM   977  C  CB    . ASN A 1 150 ? 65.335 5.880  24.340  1.00 13.94  ? 126 ASN A CB    1 
ATOM   978  C  CG    . ASN A 1 150 ? 64.242 4.919  24.704  1.00 11.65  ? 126 ASN A CG    1 
ATOM   979  O  OD1   . ASN A 1 150 ? 64.488 3.740  24.913  1.00 12.82  ? 126 ASN A OD1   1 
ATOM   980  N  ND2   . ASN A 1 150 ? 63.028 5.440  24.843  1.00 12.17  ? 126 ASN A ND2   1 
ATOM   981  N  N     . THR A 1 151 ? 68.185 7.351  26.042  1.00 11.87  ? 127 THR A N     1 
ATOM   982  C  CA    . THR A 1 151 ? 69.168 8.425  26.136  1.00 12.95  ? 127 THR A CA    1 
ATOM   983  C  C     . THR A 1 151 ? 70.528 8.104  25.557  1.00 12.74  ? 127 THR A C     1 
ATOM   984  O  O     . THR A 1 151 ? 71.175 7.119  25.937  1.00 14.46  ? 127 THR A O     1 
ATOM   985  C  CB    . THR A 1 151 ? 69.349 8.845  27.612  1.00 12.83  ? 127 THR A CB    1 
ATOM   986  O  OG1   . THR A 1 151 ? 68.082 9.226  28.140  1.00 14.01  ? 127 THR A OG1   1 
ATOM   987  C  CG2   . THR A 1 151 ? 70.304 10.028 27.747  1.00 13.43  ? 127 THR A CG2   1 
ATOM   988  N  N     . TYR A 1 152 ? 70.950 8.929  24.603  1.00 13.73  ? 128 TYR A N     1 
ATOM   989  C  CA    . TYR A 1 152 ? 72.301 8.872  24.094  1.00 15.07  ? 128 TYR A CA    1 
ATOM   990  C  C     . TYR A 1 152 ? 73.093 9.983  24.777  1.00 15.66  ? 128 TYR A C     1 
ATOM   991  O  O     . TYR A 1 152 ? 72.779 11.173 24.633  1.00 16.29  ? 128 TYR A O     1 
ATOM   992  C  CB    . TYR A 1 152 ? 72.315 9.039  22.561  1.00 16.83  ? 128 TYR A CB    1 
ATOM   993  C  CG    . TYR A 1 152 ? 73.698 9.267  22.028  1.00 16.64  ? 128 TYR A CG    1 
ATOM   994  C  CD1   . TYR A 1 152 ? 74.629 8.231  21.975  1.00 19.58  ? 128 TYR A CD1   1 
ATOM   995  C  CD2   . TYR A 1 152 ? 74.088 10.532 21.581  1.00 18.13  ? 128 TYR A CD2   1 
ATOM   996  C  CE1   . TYR A 1 152 ? 75.910 8.447  21.480  1.00 20.34  ? 128 TYR A CE1   1 
ATOM   997  C  CE2   . TYR A 1 152 ? 75.364 10.758 21.095  1.00 17.90  ? 128 TYR A CE2   1 
ATOM   998  C  CZ    . TYR A 1 152 ? 76.265 9.717  21.049  1.00 20.37  ? 128 TYR A CZ    1 
ATOM   999  O  OH    . TYR A 1 152 ? 77.516 9.961  20.566  1.00 26.64  ? 128 TYR A OH    1 
ATOM   1000 N  N     . LEU A 1 153 ? 74.109 9.589  25.539  1.00 16.08  ? 129 LEU A N     1 
ATOM   1001 C  CA    . LEU A 1 153 ? 74.834 10.546 26.368  1.00 15.14  ? 129 LEU A CA    1 
ATOM   1002 C  C     . LEU A 1 153 ? 75.715 11.547 25.618  1.00 16.10  ? 129 LEU A C     1 
ATOM   1003 O  O     . LEU A 1 153 ? 75.945 12.640 26.111  1.00 16.81  ? 129 LEU A O     1 
ATOM   1004 C  CB    . LEU A 1 153 ? 75.633 9.802  27.436  1.00 14.35  ? 129 LEU A CB    1 
ATOM   1005 C  CG    . LEU A 1 153 ? 74.796 9.202  28.569  1.00 16.19  ? 129 LEU A CG    1 
ATOM   1006 C  CD1   . LEU A 1 153 ? 75.713 8.413  29.504  1.00 18.08  ? 129 LEU A CD1   1 
ATOM   1007 C  CD2   . LEU A 1 153 ? 74.005 10.256 29.338  1.00 16.90  ? 129 LEU A CD2   1 
ATOM   1008 N  N     . GLY A 1 154 ? 76.180 11.194 24.419  1.00 18.16  ? 130 GLY A N     1 
ATOM   1009 C  CA    . GLY A 1 154 ? 76.981 12.127 23.611  1.00 16.78  ? 130 GLY A CA    1 
ATOM   1010 C  C     . GLY A 1 154 ? 78.031 12.884 24.412  1.00 15.25  ? 130 GLY A C     1 
ATOM   1011 O  O     . GLY A 1 154 ? 78.841 12.271 25.128  1.00 18.23  ? 130 GLY A O     1 
ATOM   1012 N  N     . ALA A 1 155 ? 77.992 14.215 24.304  1.00 12.87  ? 131 ALA A N     1 
ATOM   1013 C  CA    . ALA A 1 155 ? 78.978 15.098 24.916  1.00 14.77  ? 131 ALA A CA    1 
ATOM   1014 C  C     . ALA A 1 155 ? 79.004 15.005 26.449  1.00 16.44  ? 131 ALA A C     1 
ATOM   1015 O  O     . ALA A 1 155 ? 79.965 15.462 27.070  1.00 16.49  ? 131 ALA A O     1 
ATOM   1016 C  CB    . ALA A 1 155 ? 78.770 16.540 24.452  1.00 15.40  ? 131 ALA A CB    1 
ATOM   1017 N  N     . CYS A 1 156 ? 77.966 14.407 27.042  1.00 17.95  ? 132 CYS A N     1 
ATOM   1018 C  CA    . CYS A 1 156 ? 77.901 14.200 28.506  1.00 16.36  ? 132 CYS A CA    1 
ATOM   1019 C  C     . CYS A 1 156 ? 79.058 13.374 29.047  1.00 18.23  ? 132 CYS A C     1 
ATOM   1020 O  O     . CYS A 1 156 ? 79.450 13.527 30.230  1.00 20.57  ? 132 CYS A O     1 
ATOM   1021 C  CB    . CYS A 1 156 ? 76.573 13.545 28.921  1.00 17.72  ? 132 CYS A CB    1 
ATOM   1022 S  SG    . CYS A 1 156 ? 75.188 14.691 28.859  1.00 18.27  ? 132 CYS A SG    1 
ATOM   1023 N  N     . VAL A 1 157 ? 79.616 12.504 28.206  1.00 14.44  ? 133 VAL A N     1 
ATOM   1024 C  CA    . VAL A 1 157 ? 80.748 11.647 28.646  1.00 17.55  ? 133 VAL A CA    1 
ATOM   1025 C  C     . VAL A 1 157 ? 82.027 12.456 28.943  1.00 18.22  ? 133 VAL A C     1 
ATOM   1026 O  O     . VAL A 1 157 ? 82.978 11.933 29.531  1.00 20.25  ? 133 VAL A O     1 
ATOM   1027 C  CB    . VAL A 1 157 ? 81.063 10.521 27.631  1.00 20.32  ? 133 VAL A CB    1 
ATOM   1028 C  CG1   . VAL A 1 157 ? 79.834 9.663  27.377  1.00 18.61  ? 133 VAL A CG1   1 
ATOM   1029 C  CG2   . VAL A 1 157 ? 81.613 11.092 26.329  1.00 21.10  ? 133 VAL A CG2   1 
ATOM   1030 N  N     . GLU A 1 158 ? 82.031 13.731 28.540  1.00 19.58  ? 134 GLU A N     1 
ATOM   1031 C  CA    . GLU A 1 158 ? 83.200 14.587 28.655  1.00 21.34  ? 134 GLU A CA    1 
ATOM   1032 C  C     . GLU A 1 158 ? 83.230 15.434 29.928  1.00 20.72  ? 134 GLU A C     1 
ATOM   1033 O  O     . GLU A 1 158 ? 84.236 16.078 30.208  1.00 22.03  ? 134 GLU A O     1 
ATOM   1034 C  CB    . GLU A 1 158 ? 83.328 15.480 27.424  1.00 23.75  ? 134 GLU A CB    1 
ATOM   1035 C  CG    . GLU A 1 158 ? 83.980 14.780 26.244  1.00 30.60  ? 134 GLU A CG    1 
ATOM   1036 C  CD    . GLU A 1 158 ? 83.853 15.577 24.970  1.00 38.82  ? 134 GLU A CD    1 
ATOM   1037 O  OE1   . GLU A 1 158 ? 84.896 15.955 24.396  1.00 48.30  ? 134 GLU A OE1   1 
ATOM   1038 O  OE2   . GLU A 1 158 ? 82.701 15.836 24.557  1.00 45.86  ? 134 GLU A OE2   1 
ATOM   1039 N  N     . LEU A 1 159 ? 82.137 15.427 30.689  1.00 18.65  ? 135 LEU A N     1 
ATOM   1040 C  CA    . LEU A 1 159 ? 82.069 16.178 31.953  1.00 16.85  ? 135 LEU A CA    1 
ATOM   1041 C  C     . LEU A 1 159 ? 83.021 15.591 32.991  1.00 18.72  ? 135 LEU A C     1 
ATOM   1042 O  O     . LEU A 1 159 ? 82.998 14.392 33.248  1.00 19.70  ? 135 LEU A O     1 
ATOM   1043 C  CB    . LEU A 1 159 ? 80.640 16.198 32.512  1.00 17.68  ? 135 LEU A CB    1 
ATOM   1044 C  CG    . LEU A 1 159 ? 80.497 17.055 33.777  1.00 14.15  ? 135 LEU A CG    1 
ATOM   1045 C  CD1   . LEU A 1 159 ? 80.478 18.542 33.464  1.00 16.70  ? 135 LEU A CD1   1 
ATOM   1046 C  CD2   . LEU A 1 159 ? 79.246 16.678 34.553  1.00 15.70  ? 135 LEU A CD2   1 
ATOM   1047 N  N     . GLY A 1 160 ? 83.847 16.452 33.576  1.00 19.54  ? 136 GLY A N     1 
ATOM   1048 C  CA    . GLY A 1 160 ? 84.882 16.029 34.512  1.00 20.33  ? 136 GLY A CA    1 
ATOM   1049 C  C     . GLY A 1 160 ? 85.266 17.121 35.487  1.00 21.96  ? 136 GLY A C     1 
ATOM   1050 O  O     . GLY A 1 160 ? 84.679 18.206 35.454  1.00 20.14  ? 136 GLY A O     1 
ATOM   1051 N  N     . PRO A 1 161 ? 86.271 16.843 36.356  1.00 22.45  ? 137 PRO A N     1 
ATOM   1052 C  CA    . PRO A 1 161 ? 86.695 17.794 37.402  1.00 23.91  ? 137 PRO A CA    1 
ATOM   1053 C  C     . PRO A 1 161 ? 87.031 19.184 36.864  1.00 23.38  ? 137 PRO A C     1 
ATOM   1054 O  O     . PRO A 1 161 ? 86.885 20.173 37.584  1.00 23.48  ? 137 PRO A O     1 
ATOM   1055 C  CB    . PRO A 1 161 ? 87.955 17.138 37.998  1.00 22.32  ? 137 PRO A CB    1 
ATOM   1056 C  CG    . PRO A 1 161 ? 87.841 15.698 37.662  1.00 21.88  ? 137 PRO A CG    1 
ATOM   1057 C  CD    . PRO A 1 161 ? 87.161 15.669 36.302  1.00 21.01  ? 137 PRO A CD    1 
ATOM   1058 N  N     . GLU A 1 162 ? 87.454 19.252 35.602  1.00 24.21  ? 138 GLU A N     1 
ATOM   1059 C  CA    . GLU A 1 162 ? 87.763 20.522 34.936  1.00 27.17  ? 138 GLU A CA    1 
ATOM   1060 C  C     . GLU A 1 162 ? 86.554 21.478 34.812  1.00 23.31  ? 138 GLU A C     1 
ATOM   1061 O  O     . GLU A 1 162 ? 86.720 22.680 34.609  1.00 29.75  ? 138 GLU A O     1 
ATOM   1062 C  CB    . GLU A 1 162 ? 88.433 20.263 33.574  1.00 33.61  ? 138 GLU A CB    1 
ATOM   1063 C  CG    . GLU A 1 162 ? 87.527 19.697 32.478  1.00 38.48  ? 138 GLU A CG    1 
ATOM   1064 C  CD    . GLU A 1 162 ? 87.514 18.173 32.389  1.00 38.40  ? 138 GLU A CD    1 
ATOM   1065 O  OE1   . GLU A 1 162 ? 87.800 17.484 33.401  1.00 31.57  ? 138 GLU A OE1   1 
ATOM   1066 O  OE2   . GLU A 1 162 ? 87.200 17.662 31.283  1.00 46.70  ? 138 GLU A OE2   1 
ATOM   1067 N  N     . ASP A 1 163 ? 85.348 20.938 34.957  1.00 23.45  ? 139 ASP A N     1 
ATOM   1068 C  CA    . ASP A 1 163 ? 84.118 21.703 34.815  1.00 20.41  ? 139 ASP A CA    1 
ATOM   1069 C  C     . ASP A 1 163 ? 83.581 22.153 36.166  1.00 22.22  ? 139 ASP A C     1 
ATOM   1070 O  O     . ASP A 1 163 ? 82.523 22.759 36.254  1.00 23.89  ? 139 ASP A O     1 
ATOM   1071 C  CB    . ASP A 1 163 ? 83.061 20.872 34.034  1.00 18.34  ? 139 ASP A CB    1 
ATOM   1072 C  CG    . ASP A 1 163 ? 83.548 20.478 32.678  1.00 20.44  ? 139 ASP A CG    1 
ATOM   1073 O  OD1   . ASP A 1 163 ? 83.903 21.401 31.905  1.00 24.01  ? 139 ASP A OD1   1 
ATOM   1074 O  OD2   . ASP A 1 163 ? 83.584 19.255 32.390  1.00 20.90  ? 139 ASP A OD2   1 
ATOM   1075 N  N     . VAL A 1 164 ? 84.329 21.865 37.230  1.00 19.32  ? 140 VAL A N     1 
ATOM   1076 C  CA    . VAL A 1 164 ? 83.910 22.276 38.555  1.00 20.14  ? 140 VAL A CA    1 
ATOM   1077 C  C     . VAL A 1 164 ? 84.343 23.721 38.695  1.00 21.47  ? 140 VAL A C     1 
ATOM   1078 O  O     . VAL A 1 164 ? 85.533 24.028 38.601  1.00 25.76  ? 140 VAL A O     1 
ATOM   1079 C  CB    . VAL A 1 164 ? 84.557 21.413 39.656  1.00 19.18  ? 140 VAL A CB    1 
ATOM   1080 C  CG1   . VAL A 1 164 ? 84.020 21.826 41.029  1.00 23.08  ? 140 VAL A CG1   1 
ATOM   1081 C  CG2   . VAL A 1 164 ? 84.290 19.936 39.389  1.00 17.54  ? 140 VAL A CG2   1 
ATOM   1082 N  N     . GLU A 1 165 ? 83.363 24.609 38.843  1.00 21.38  ? 141 GLU A N     1 
ATOM   1083 C  CA    . GLU A 1 165 ? 83.641 26.003 39.113  1.00 21.53  ? 141 GLU A CA    1 
ATOM   1084 C  C     . GLU A 1 165 ? 83.613 26.068 40.619  1.00 21.38  ? 141 GLU A C     1 
ATOM   1085 O  O     . GLU A 1 165 ? 82.533 26.082 41.222  1.00 18.54  ? 141 GLU A O     1 
ATOM   1086 C  CB    . GLU A 1 165 ? 82.581 26.907 38.507  1.00 23.00  ? 141 GLU A CB    1 
ATOM   1087 C  CG    . GLU A 1 165 ? 82.473 26.768 36.992  1.00 23.86  ? 141 GLU A CG    1 
ATOM   1088 C  CD    . GLU A 1 165 ? 81.245 27.456 36.415  1.00 24.54  ? 141 GLU A CD    1 
ATOM   1089 O  OE1   . GLU A 1 165 ? 80.914 28.596 36.818  1.00 26.42  ? 141 GLU A OE1   1 
ATOM   1090 O  OE2   . GLU A 1 165 ? 80.613 26.841 35.534  1.00 27.99  ? 141 GLU A OE2   1 
ATOM   1091 N  N     . ALA A 1 166 ? 84.812 26.020 41.209  1.00 25.04  ? 142 ALA A N     1 
ATOM   1092 C  CA    . ALA A 1 166 ? 85.005 25.920 42.655  1.00 25.01  ? 142 ALA A CA    1 
ATOM   1093 C  C     . ALA A 1 166 ? 84.334 27.069 43.416  1.00 25.19  ? 142 ALA A C     1 
ATOM   1094 O  O     . ALA A 1 166 ? 83.663 26.860 44.434  1.00 22.31  ? 142 ALA A O     1 
ATOM   1095 C  CB    . ALA A 1 166 ? 86.493 25.849 42.971  1.00 25.94  ? 142 ALA A CB    1 
ATOM   1096 N  N     . ASP A 1 167 ? 84.478 28.284 42.891  1.00 25.56  ? 143 ASP A N     1 
ATOM   1097 C  CA    . ASP A 1 167 ? 83.794 29.442 43.449  1.00 23.79  ? 143 ASP A CA    1 
ATOM   1098 C  C     . ASP A 1 167 ? 82.264 29.257 43.539  1.00 24.15  ? 143 ASP A C     1 
ATOM   1099 O  O     . ASP A 1 167 ? 81.632 29.748 44.474  1.00 24.60  ? 143 ASP A O     1 
ATOM   1100 C  CB    . ASP A 1 167 ? 84.150 30.663 42.605  1.00 31.53  ? 143 ASP A CB    1 
ATOM   1101 C  CG    . ASP A 1 167 ? 84.817 30.278 41.279  1.00 36.50  ? 143 ASP A CG    1 
ATOM   1102 O  OD1   . ASP A 1 167 ? 84.114 29.810 40.349  1.00 36.82  ? 143 ASP A OD1   1 
ATOM   1103 O  OD2   . ASP A 1 167 ? 86.057 30.426 41.174  1.00 42.05  ? 143 ASP A OD2   1 
ATOM   1104 N  N     . VAL A 1 168 ? 81.660 28.564 42.571  1.00 19.47  ? 144 VAL A N     1 
ATOM   1105 C  CA    . VAL A 1 168 ? 80.207 28.323 42.633  1.00 23.73  ? 144 VAL A CA    1 
ATOM   1106 C  C     . VAL A 1 168 ? 79.793 27.318 43.730  1.00 20.57  ? 144 VAL A C     1 
ATOM   1107 O  O     . VAL A 1 168 ? 78.852 27.568 44.494  1.00 22.69  ? 144 VAL A O     1 
ATOM   1108 C  CB    . VAL A 1 168 ? 79.627 27.960 41.241  1.00 22.08  ? 144 VAL A CB    1 
ATOM   1109 C  CG1   . VAL A 1 168 ? 78.146 27.625 41.335  1.00 22.30  ? 144 VAL A CG1   1 
ATOM   1110 C  CG2   . VAL A 1 168 ? 79.852 29.124 40.295  1.00 23.89  ? 144 VAL A CG2   1 
ATOM   1111 N  N     . VAL A 1 169 ? 80.503 26.196 43.815  1.00 19.91  ? 145 VAL A N     1 
ATOM   1112 C  CA    . VAL A 1 169 ? 80.269 25.214 44.871  1.00 19.98  ? 145 VAL A CA    1 
ATOM   1113 C  C     . VAL A 1 169 ? 80.470 25.856 46.254  1.00 19.75  ? 145 VAL A C     1 
ATOM   1114 O  O     . VAL A 1 169 ? 79.587 25.811 47.106  1.00 20.84  ? 145 VAL A O     1 
ATOM   1115 C  CB    . VAL A 1 169 ? 81.171 23.982 44.700  1.00 18.80  ? 145 VAL A CB    1 
ATOM   1116 C  CG1   . VAL A 1 169 ? 80.848 22.958 45.758  1.00 21.18  ? 145 VAL A CG1   1 
ATOM   1117 C  CG2   . VAL A 1 169 ? 80.973 23.348 43.307  1.00 19.52  ? 145 VAL A CG2   1 
ATOM   1118 N  N     . ALA A 1 170 ? 81.615 26.492 46.438  1.00 19.42  ? 146 ALA A N     1 
ATOM   1119 C  CA    . ALA A 1 170 ? 81.907 27.294 47.648  1.00 22.21  ? 146 ALA A CA    1 
ATOM   1120 C  C     . ALA A 1 170 ? 80.775 28.243 48.088  1.00 25.36  ? 146 ALA A C     1 
ATOM   1121 O  O     . ALA A 1 170 ? 80.540 28.405 49.305  1.00 28.85  ? 146 ALA A O     1 
ATOM   1122 C  CB    . ALA A 1 170 ? 83.205 28.058 47.450  1.00 25.31  ? 146 ALA A CB    1 
ATOM   1123 N  N     . ASP A 1 171 ? 80.080 28.853 47.115  1.00 25.34  ? 147 ASP A N     1 
ATOM   1124 C  CA    . ASP A 1 171 ? 79.060 29.884 47.386  1.00 24.06  ? 147 ASP A CA    1 
ATOM   1125 C  C     . ASP A 1 171 ? 77.612 29.400 47.202  1.00 21.22  ? 147 ASP A C     1 
ATOM   1126 O  O     . ASP A 1 171 ? 76.692 30.218 47.144  1.00 23.78  ? 147 ASP A O     1 
ATOM   1127 C  CB    . ASP A 1 171 ? 79.264 31.149 46.520  1.00 29.51  ? 147 ASP A CB    1 
ATOM   1128 C  CG    . ASP A 1 171 ? 80.679 31.714 46.580  1.00 34.58  ? 147 ASP A CG    1 
ATOM   1129 O  OD1   . ASP A 1 171 ? 81.416 31.459 47.555  1.00 42.68  ? 147 ASP A OD1   1 
ATOM   1130 O  OD2   . ASP A 1 171 ? 81.051 32.442 45.631  1.00 41.24  ? 147 ASP A OD2   1 
ATOM   1131 N  N     . ALA A 1 172 ? 77.394 28.088 47.124  1.00 23.39  ? 148 ALA A N     1 
ATOM   1132 C  CA    . ALA A 1 172 ? 76.022 27.575 47.044  1.00 23.33  ? 148 ALA A CA    1 
ATOM   1133 C  C     . ALA A 1 172 ? 75.537 26.870 48.323  1.00 17.45  ? 148 ALA A C     1 
ATOM   1134 O  O     . ALA A 1 172 ? 76.208 25.992 48.879  1.00 18.44  ? 148 ALA A O     1 
ATOM   1135 C  CB    . ALA A 1 172 ? 75.827 26.682 45.826  1.00 25.86  ? 148 ALA A CB    1 
ATOM   1136 N  N     . LYS A 1 173 ? 74.338 27.225 48.752  1.00 16.83  ? 149 LYS A N     1 
ATOM   1137 C  CA    . LYS A 1 173 ? 73.776 26.608 49.948  1.00 18.17  ? 149 LYS A CA    1 
ATOM   1138 C  C     . LYS A 1 173 ? 73.679 25.099 49.763  1.00 19.95  ? 149 LYS A C     1 
ATOM   1139 O  O     . LYS A 1 173 ? 74.077 24.351 50.653  1.00 24.27  ? 149 LYS A O     1 
ATOM   1140 C  CB    . LYS A 1 173 ? 72.431 27.235 50.348  1.00 18.90  ? 149 LYS A CB    1 
ATOM   1141 C  CG    . LYS A 1 173 ? 72.473 28.741 50.543  1.00 20.21  ? 149 LYS A CG    1 
ATOM   1142 C  CD    . LYS A 1 173 ? 71.200 29.241 51.218  1.00 24.30  ? 149 LYS A CD    1 
ATOM   1143 C  CE    . LYS A 1 173 ? 70.936 30.718 50.978  1.00 23.42  ? 149 LYS A CE    1 
ATOM   1144 N  NZ    . LYS A 1 173 ? 69.501 31.032 51.276  1.00 26.71  ? 149 LYS A NZ    1 
ATOM   1145 N  N     . VAL A 1 174 ? 73.196 24.647 48.588  1.00 21.95  ? 150 VAL A N     1 
ATOM   1146 C  CA    . VAL A 1 174 ? 73.090 23.227 48.308  1.00 20.70  ? 150 VAL A CA    1 
ATOM   1147 C  C     . VAL A 1 174 ? 73.655 22.928 46.926  1.00 23.77  ? 150 VAL A C     1 
ATOM   1148 O  O     . VAL A 1 174 ? 73.303 23.606 45.961  1.00 22.95  ? 150 VAL A O     1 
ATOM   1149 C  CB    . VAL A 1 174 ? 71.616 22.742 48.356  1.00 17.27  ? 150 VAL A CB    1 
ATOM   1150 C  CG1   . VAL A 1 174 ? 71.540 21.280 48.044  1.00 19.97  ? 150 VAL A CG1   1 
ATOM   1151 C  CG2   . VAL A 1 174 ? 71.018 22.990 49.734  1.00 21.57  ? 150 VAL A CG2   1 
ATOM   1152 N  N     . THR A 1 175 ? 74.540 21.936 46.846  1.00 22.84  ? 151 THR A N     1 
ATOM   1153 C  CA    . THR A 1 175 ? 74.909 21.343 45.566  1.00 18.74  ? 151 THR A CA    1 
ATOM   1154 C  C     . THR A 1 175 ? 74.191 19.998 45.443  1.00 19.01  ? 151 THR A C     1 
ATOM   1155 O  O     . THR A 1 175 ? 74.292 19.139 46.325  1.00 21.45  ? 151 THR A O     1 
ATOM   1156 C  CB    . THR A 1 175 ? 76.441 21.207 45.390  1.00 18.71  ? 151 THR A CB    1 
ATOM   1157 O  OG1   . THR A 1 175 ? 77.052 22.502 45.413  1.00 17.97  ? 151 THR A OG1   1 
ATOM   1158 C  CG2   . THR A 1 175 ? 76.781 20.540 44.074  1.00 17.85  ? 151 THR A CG2   1 
ATOM   1159 N  N     . TYR A 1 176 ? 73.435 19.846 44.353  1.00 18.45  ? 152 TYR A N     1 
ATOM   1160 C  CA    . TYR A 1 176 ? 72.568 18.680 44.118  1.00 17.97  ? 152 TYR A CA    1 
ATOM   1161 C  C     . TYR A 1 176 ? 73.008 17.990 42.849  1.00 18.41  ? 152 TYR A C     1 
ATOM   1162 O  O     . TYR A 1 176 ? 73.300 18.660 41.854  1.00 18.27  ? 152 TYR A O     1 
ATOM   1163 C  CB    . TYR A 1 176 ? 71.109 19.151 44.038  1.00 16.60  ? 152 TYR A CB    1 
ATOM   1164 C  CG    . TYR A 1 176 ? 70.058 18.216 43.479  1.00 18.22  ? 152 TYR A CG    1 
ATOM   1165 C  CD1   . TYR A 1 176 ? 69.757 18.223 42.108  1.00 20.37  ? 152 TYR A CD1   1 
ATOM   1166 C  CD2   . TYR A 1 176 ? 69.317 17.361 44.309  1.00 19.44  ? 152 TYR A CD2   1 
ATOM   1167 C  CE1   . TYR A 1 176 ? 68.763 17.409 41.581  1.00 18.43  ? 152 TYR A CE1   1 
ATOM   1168 C  CE2   . TYR A 1 176 ? 68.307 16.545 43.783  1.00 20.47  ? 152 TYR A CE2   1 
ATOM   1169 C  CZ    . TYR A 1 176 ? 68.039 16.572 42.415  1.00 20.56  ? 152 TYR A CZ    1 
ATOM   1170 O  OH    . TYR A 1 176 ? 67.053 15.778 41.874  1.00 17.54  ? 152 TYR A OH    1 
ATOM   1171 N  N     . PHE A 1 177 ? 73.084 16.664 42.881  1.00 15.45  ? 153 PHE A N     1 
ATOM   1172 C  CA    . PHE A 1 177 ? 73.506 15.905 41.685  1.00 15.40  ? 153 PHE A CA    1 
ATOM   1173 C  C     . PHE A 1 177 ? 72.700 14.649 41.397  1.00 17.06  ? 153 PHE A C     1 
ATOM   1174 O  O     . PHE A 1 177 ? 72.056 14.090 42.299  1.00 16.70  ? 153 PHE A O     1 
ATOM   1175 C  CB    . PHE A 1 177 ? 75.005 15.609 41.759  1.00 16.27  ? 153 PHE A CB    1 
ATOM   1176 C  CG    . PHE A 1 177 ? 75.411 14.612 42.845  1.00 17.23  ? 153 PHE A CG    1 
ATOM   1177 C  CD1   . PHE A 1 177 ? 75.694 15.046 44.148  1.00 18.59  ? 153 PHE A CD1   1 
ATOM   1178 C  CD2   . PHE A 1 177 ? 75.554 13.250 42.560  1.00 15.02  ? 153 PHE A CD2   1 
ATOM   1179 C  CE1   . PHE A 1 177 ? 76.076 14.133 45.130  1.00 16.96  ? 153 PHE A CE1   1 
ATOM   1180 C  CE2   . PHE A 1 177 ? 75.964 12.334 43.533  1.00 12.91  ? 153 PHE A CE2   1 
ATOM   1181 C  CZ    . PHE A 1 177 ? 76.221 12.788 44.839  1.00 15.53  ? 153 PHE A CZ    1 
ATOM   1182 N  N     . GLU A 1 178 ? 72.709 14.208 40.114  1.00 17.24  ? 154 GLU A N     1 
ATOM   1183 C  CA    . GLU A 1 178 ? 72.054 12.982 39.712  1.00 17.20  ? 154 GLU A CA    1 
ATOM   1184 C  C     . GLU A 1 178 ? 72.871 11.718 39.891  1.00 15.97  ? 154 GLU A C     1 
ATOM   1185 O  O     . GLU A 1 178 ? 74.055 11.666 39.545  1.00 14.44  ? 154 GLU A O     1 
ATOM   1186 C  CB    . GLU A 1 178 ? 71.719 13.016 38.194  1.00 16.75  ? 154 GLU A CB    1 
ATOM   1187 C  CG    . GLU A 1 178 ? 71.228 14.334 37.640  1.00 16.55  ? 154 GLU A CG    1 
ATOM   1188 C  CD    . GLU A 1 178 ? 71.362 14.431 36.125  1.00 14.06  ? 154 GLU A CD    1 
ATOM   1189 O  OE1   . GLU A 1 178 ? 72.225 13.731 35.567  1.00 13.22  ? 154 GLU A OE1   1 
ATOM   1190 O  OE2   . GLU A 1 178 ? 70.627 15.233 35.489  1.00 16.72  ? 154 GLU A OE2   1 
ATOM   1191 N  N     . GLY A 1 179 ? 72.195 10.670 40.349  1.00 16.90  ? 155 GLY A N     1 
ATOM   1192 C  CA    . GLY A 1 179 ? 72.722 9.319  40.263  1.00 15.87  ? 155 GLY A CA    1 
ATOM   1193 C  C     . GLY A 1 179 ? 73.126 8.960  38.847  1.00 15.99  ? 155 GLY A C     1 
ATOM   1194 O  O     . GLY A 1 179 ? 74.085 8.215  38.633  1.00 14.98  ? 155 GLY A O     1 
ATOM   1195 N  N     . TYR A 1 180 ? 72.366 9.496  37.878  1.00 15.99  ? 156 TYR A N     1 
ATOM   1196 C  CA    . TYR A 1 180 ? 72.648 9.302  36.461  1.00 16.65  ? 156 TYR A CA    1 
ATOM   1197 C  C     . TYR A 1 180 ? 74.096 9.619  36.091  1.00 15.78  ? 156 TYR A C     1 
ATOM   1198 O  O     . TYR A 1 180 ? 74.605 9.101  35.098  1.00 18.37  ? 156 TYR A O     1 
ATOM   1199 C  CB    . TYR A 1 180 ? 71.745 10.214 35.632  1.00 15.35  ? 156 TYR A CB    1 
ATOM   1200 C  CG    . TYR A 1 180 ? 70.284 9.828  35.524  1.00 14.46  ? 156 TYR A CG    1 
ATOM   1201 C  CD1   . TYR A 1 180 ? 69.892 8.519  35.260  1.00 12.67  ? 156 TYR A CD1   1 
ATOM   1202 C  CD2   . TYR A 1 180 ? 69.293 10.814 35.588  1.00 17.51  ? 156 TYR A CD2   1 
ATOM   1203 C  CE1   . TYR A 1 180 ? 68.537 8.187  35.123  1.00 13.85  ? 156 TYR A CE1   1 
ATOM   1204 C  CE2   . TYR A 1 180 ? 67.950 10.506 35.439  1.00 13.65  ? 156 TYR A CE2   1 
ATOM   1205 C  CZ    . TYR A 1 180 ? 67.576 9.187  35.209  1.00 13.53  ? 156 TYR A CZ    1 
ATOM   1206 O  OH    . TYR A 1 180 ? 66.233 8.896  35.062  1.00 18.67  ? 156 TYR A OH    1 
ATOM   1207 N  N     . LEU A 1 181 ? 74.742 10.492 36.872  1.00 17.63  ? 157 LEU A N     1 
ATOM   1208 C  CA    . LEU A 1 181 ? 76.132 10.870 36.630  1.00 14.83  ? 157 LEU A CA    1 
ATOM   1209 C  C     . LEU A 1 181 ? 77.126 9.726  36.782  1.00 15.98  ? 157 LEU A C     1 
ATOM   1210 O  O     . LEU A 1 181 ? 78.264 9.873  36.349  1.00 18.86  ? 157 LEU A O     1 
ATOM   1211 C  CB    . LEU A 1 181 ? 76.561 12.064 37.502  1.00 14.90  ? 157 LEU A CB    1 
ATOM   1212 C  CG    . LEU A 1 181 ? 76.003 13.417 37.085  1.00 15.20  ? 157 LEU A CG    1 
ATOM   1213 C  CD1   . LEU A 1 181 ? 76.411 14.464 38.110  1.00 16.74  ? 157 LEU A CD1   1 
ATOM   1214 C  CD2   . LEU A 1 181 ? 76.509 13.854 35.701  1.00 16.93  ? 157 LEU A CD2   1 
ATOM   1215 N  N     . TRP A 1 182 ? 76.714 8.599  37.378  1.00 15.38  ? 158 TRP A N     1 
ATOM   1216 C  CA    . TRP A 1 182 ? 77.622 7.462  37.502  1.00 16.59  ? 158 TRP A CA    1 
ATOM   1217 C  C     . TRP A 1 182 ? 77.771 6.687  36.175  1.00 15.94  ? 158 TRP A C     1 
ATOM   1218 O  O     . TRP A 1 182 ? 78.698 5.908  36.001  1.00 17.68  ? 158 TRP A O     1 
ATOM   1219 C  CB    . TRP A 1 182 ? 77.260 6.544  38.683  1.00 18.41  ? 158 TRP A CB    1 
ATOM   1220 C  CG    . TRP A 1 182 ? 78.073 6.860  39.956  1.00 18.62  ? 158 TRP A CG    1 
ATOM   1221 C  CD1   . TRP A 1 182 ? 78.801 5.971  40.707  1.00 20.03  ? 158 TRP A CD1   1 
ATOM   1222 C  CD2   . TRP A 1 182 ? 78.243 8.138  40.569  1.00 21.02  ? 158 TRP A CD2   1 
ATOM   1223 N  NE1   . TRP A 1 182 ? 79.408 6.625  41.774  1.00 22.15  ? 158 TRP A NE1   1 
ATOM   1224 C  CE2   . TRP A 1 182 ? 79.073 7.951  41.719  1.00 20.80  ? 158 TRP A CE2   1 
ATOM   1225 C  CE3   . TRP A 1 182 ? 77.756 9.422  40.292  1.00 21.78  ? 158 TRP A CE3   1 
ATOM   1226 C  CZ2   . TRP A 1 182 ? 79.449 9.011  42.550  1.00 20.04  ? 158 TRP A CZ2   1 
ATOM   1227 C  CZ3   . TRP A 1 182 ? 78.116 10.482 41.148  1.00 25.52  ? 158 TRP A CZ3   1 
ATOM   1228 C  CH2   . TRP A 1 182 ? 78.956 10.265 42.256  1.00 21.15  ? 158 TRP A CH2   1 
ATOM   1229 N  N     . ASP A 1 183 ? 76.869 6.927  35.232  1.00 16.70  ? 159 ASP A N     1 
ATOM   1230 C  CA    . ASP A 1 183 ? 76.997 6.311  33.916  1.00 16.95  ? 159 ASP A CA    1 
ATOM   1231 C  C     . ASP A 1 183 ? 78.193 6.810  33.081  1.00 17.02  ? 159 ASP A C     1 
ATOM   1232 O  O     . ASP A 1 183 ? 79.014 5.992  32.674  1.00 19.76  ? 159 ASP A O     1 
ATOM   1233 C  CB    . ASP A 1 183 ? 75.666 6.362  33.143  1.00 16.27  ? 159 ASP A CB    1 
ATOM   1234 C  CG    . ASP A 1 183 ? 74.665 5.338  33.639  1.00 16.94  ? 159 ASP A CG    1 
ATOM   1235 O  OD1   . ASP A 1 183 ? 75.058 4.177  33.881  1.00 20.52  ? 159 ASP A OD1   1 
ATOM   1236 O  OD2   . ASP A 1 183 ? 73.471 5.680  33.776  1.00 18.18  ? 159 ASP A OD2   1 
ATOM   1237 N  N     . PRO A 1 184 ? 78.307 8.146  32.832  1.00 17.01  ? 160 PRO A N     1 
ATOM   1238 C  CA    . PRO A 1 184 ? 79.523 8.635  32.145  1.00 19.26  ? 160 PRO A CA    1 
ATOM   1239 C  C     . PRO A 1 184 ? 80.775 8.402  32.992  1.00 20.58  ? 160 PRO A C     1 
ATOM   1240 O  O     . PRO A 1 184 ? 80.643 8.258  34.192  1.00 22.51  ? 160 PRO A O     1 
ATOM   1241 C  CB    . PRO A 1 184 ? 79.259 10.137 31.952  1.00 21.07  ? 160 PRO A CB    1 
ATOM   1242 C  CG    . PRO A 1 184 ? 78.150 10.484 32.873  1.00 19.90  ? 160 PRO A CG    1 
ATOM   1243 C  CD    . PRO A 1 184 ? 77.362 9.241  33.136  1.00 17.66  ? 160 PRO A CD    1 
ATOM   1244 N  N     . PRO A 1 185 ? 81.972 8.382  32.371  1.00 22.01  ? 161 PRO A N     1 
ATOM   1245 C  CA    . PRO A 1 185 ? 83.167 7.870  33.051  1.00 22.95  ? 161 PRO A CA    1 
ATOM   1246 C  C     . PRO A 1 185 ? 83.759 8.732  34.172  1.00 24.60  ? 161 PRO A C     1 
ATOM   1247 O  O     . PRO A 1 185 ? 84.173 8.180  35.207  1.00 27.82  ? 161 PRO A O     1 
ATOM   1248 C  CB    . PRO A 1 185 ? 84.177 7.704  31.904  1.00 23.09  ? 161 PRO A CB    1 
ATOM   1249 C  CG    . PRO A 1 185 ? 83.748 8.705  30.884  1.00 26.29  ? 161 PRO A CG    1 
ATOM   1250 C  CD    . PRO A 1 185 ? 82.251 8.748  30.967  1.00 25.07  ? 161 PRO A CD    1 
ATOM   1251 N  N     . ARG A 1 186 ? 83.779 10.055 33.988  1.00 23.06  ? 162 ARG A N     1 
ATOM   1252 C  CA    A ARG A 1 186 ? 84.554 10.921 34.884  0.50 23.25  ? 162 ARG A CA    1 
ATOM   1253 C  CA    B ARG A 1 186 ? 84.560 10.960 34.849  0.50 23.30  ? 162 ARG A CA    1 
ATOM   1254 C  C     . ARG A 1 186 ? 83.722 11.938 35.677  1.00 22.02  ? 162 ARG A C     1 
ATOM   1255 O  O     . ARG A 1 186 ? 84.266 12.690 36.498  1.00 21.72  ? 162 ARG A O     1 
ATOM   1256 C  CB    A ARG A 1 186 ? 85.712 11.590 34.123  0.50 24.66  ? 162 ARG A CB    1 
ATOM   1257 C  CB    B ARG A 1 186 ? 85.595 11.737 34.021  0.50 23.96  ? 162 ARG A CB    1 
ATOM   1258 C  CG    A ARG A 1 186 ? 86.638 10.591 33.435  0.50 25.94  ? 162 ARG A CG    1 
ATOM   1259 C  CG    B ARG A 1 186 ? 86.716 10.884 33.444  0.50 22.80  ? 162 ARG A CG    1 
ATOM   1260 C  CD    A ARG A 1 186 ? 87.910 11.225 32.893  0.50 26.98  ? 162 ARG A CD    1 
ATOM   1261 C  CD    B ARG A 1 186 ? 87.812 11.735 32.815  0.50 21.52  ? 162 ARG A CD    1 
ATOM   1262 N  NE    A ARG A 1 186 ? 88.741 11.777 33.960  0.50 30.50  ? 162 ARG A NE    1 
ATOM   1263 N  NE    B ARG A 1 186 ? 87.295 12.670 31.814  0.50 20.64  ? 162 ARG A NE    1 
ATOM   1264 C  CZ    A ARG A 1 186 ? 89.160 13.037 34.015  0.50 30.76  ? 162 ARG A CZ    1 
ATOM   1265 C  CZ    B ARG A 1 186 ? 87.472 13.987 31.844  0.50 21.81  ? 162 ARG A CZ    1 
ATOM   1266 N  NH1   A ARG A 1 186 ? 88.842 13.896 33.052  0.50 34.24  ? 162 ARG A NH1   1 
ATOM   1267 N  NH1   B ARG A 1 186 ? 86.957 14.741 30.886  0.50 24.27  ? 162 ARG A NH1   1 
ATOM   1268 N  NH2   A ARG A 1 186 ? 89.901 13.440 35.034  0.50 28.87  ? 162 ARG A NH2   1 
ATOM   1269 N  NH2   B ARG A 1 186 ? 88.177 14.556 32.817  0.50 21.84  ? 162 ARG A NH2   1 
ATOM   1270 N  N     . ALA A 1 187 ? 82.404 11.940 35.464  1.00 18.38  ? 163 ALA A N     1 
ATOM   1271 C  CA    . ALA A 1 187 ? 81.506 12.811 36.236  1.00 19.75  ? 163 ALA A CA    1 
ATOM   1272 C  C     . ALA A 1 187 ? 81.641 12.617 37.767  1.00 21.57  ? 163 ALA A C     1 
ATOM   1273 O  O     . ALA A 1 187 ? 81.593 13.587 38.529  1.00 19.24  ? 163 ALA A O     1 
ATOM   1274 C  CB    . ALA A 1 187 ? 80.057 12.626 35.796  1.00 19.27  ? 163 ALA A CB    1 
ATOM   1275 N  N     . LYS A 1 188 ? 81.815 11.371 38.197  1.00 20.23  ? 164 LYS A N     1 
ATOM   1276 C  CA    . LYS A 1 188 ? 81.904 11.036 39.619  1.00 19.63  ? 164 LYS A CA    1 
ATOM   1277 C  C     . LYS A 1 188 ? 83.071 11.753 40.273  1.00 19.53  ? 164 LYS A C     1 
ATOM   1278 O  O     . LYS A 1 188 ? 82.971 12.154 41.425  1.00 24.61  ? 164 LYS A O     1 
ATOM   1279 C  CB    . LYS A 1 188 ? 81.993 9.510  39.843  1.00 19.17  ? 164 LYS A CB    1 
ATOM   1280 C  CG    . LYS A 1 188 ? 83.188 8.821  39.172  1.00 21.02  ? 164 LYS A CG    1 
ATOM   1281 C  CD    . LYS A 1 188 ? 83.355 7.361  39.590  1.00 24.62  ? 164 LYS A CD    1 
ATOM   1282 C  CE    . LYS A 1 188 ? 82.100 6.563  39.315  1.00 25.95  ? 164 LYS A CE    1 
ATOM   1283 N  NZ    . LYS A 1 188 ? 82.230 5.177  39.831  1.00 27.84  ? 164 LYS A NZ    1 
ATOM   1284 N  N     . GLU A 1 189 ? 84.152 11.952 39.511  1.00 20.98  ? 165 GLU A N     1 
ATOM   1285 C  CA    . GLU A 1 189 ? 85.331 12.701 39.968  1.00 21.75  ? 165 GLU A CA    1 
ATOM   1286 C  C     . GLU A 1 189 ? 85.001 14.178 40.215  1.00 22.39  ? 165 GLU A C     1 
ATOM   1287 O  O     . GLU A 1 189 ? 85.455 14.755 41.202  1.00 24.92  ? 165 GLU A O     1 
ATOM   1288 C  CB    . GLU A 1 189 ? 86.475 12.605 38.958  1.00 22.22  ? 165 GLU A CB    1 
ATOM   1289 C  CG    . GLU A 1 189 ? 86.960 11.204 38.601  1.00 23.12  ? 165 GLU A CG    1 
ATOM   1290 C  CD    . GLU A 1 189 ? 87.961 11.229 37.449  1.00 31.45  ? 165 GLU A CD    1 
ATOM   1291 O  OE1   . GLU A 1 189 ? 88.076 10.221 36.718  1.00 31.78  ? 165 GLU A OE1   1 
ATOM   1292 O  OE2   . GLU A 1 189 ? 88.631 12.268 37.261  1.00 34.57  ? 165 GLU A OE2   1 
ATOM   1293 N  N     . ALA A 1 190 ? 84.212 14.787 39.319  1.00 21.85  ? 166 ALA A N     1 
ATOM   1294 C  CA    . ALA A 1 190 ? 83.746 16.156 39.530  1.00 20.20  ? 166 ALA A CA    1 
ATOM   1295 C  C     . ALA A 1 190 ? 82.919 16.267 40.811  1.00 18.68  ? 166 ALA A C     1 
ATOM   1296 O  O     . ALA A 1 190 ? 83.080 17.225 41.593  1.00 19.80  ? 166 ALA A O     1 
ATOM   1297 C  CB    . ALA A 1 190 ? 82.950 16.648 38.333  1.00 19.71  ? 166 ALA A CB    1 
ATOM   1298 N  N     . ILE A 1 191 ? 82.059 15.274 41.032  1.00 18.61  ? 167 ILE A N     1 
ATOM   1299 C  CA    . ILE A 1 191 ? 81.160 15.248 42.177  1.00 19.61  ? 167 ILE A CA    1 
ATOM   1300 C  C     . ILE A 1 191 ? 81.916 15.151 43.497  1.00 19.65  ? 167 ILE A C     1 
ATOM   1301 O  O     . ILE A 1 191 ? 81.589 15.887 44.430  1.00 19.08  ? 167 ILE A O     1 
ATOM   1302 C  CB    . ILE A 1 191 ? 80.130 14.115 42.049  1.00 18.04  ? 167 ILE A CB    1 
ATOM   1303 C  CG1   . ILE A 1 191 ? 79.182 14.371 40.863  1.00 16.18  ? 167 ILE A CG1   1 
ATOM   1304 C  CG2   . ILE A 1 191 ? 79.315 13.944 43.322  1.00 14.74  ? 167 ILE A CG2   1 
ATOM   1305 C  CD1   . ILE A 1 191 ? 78.542 15.750 40.818  1.00 14.85  ? 167 ILE A CD1   1 
ATOM   1306 N  N     . LEU A 1 192 ? 82.917 14.270 43.560  1.00 23.03  ? 168 LEU A N     1 
ATOM   1307 C  CA    . LEU A 1 192 ? 83.790 14.173 44.759  1.00 22.56  ? 168 LEU A CA    1 
ATOM   1308 C  C     . LEU A 1 192 ? 84.516 15.497 45.029  1.00 23.71  ? 168 LEU A C     1 
ATOM   1309 O  O     . LEU A 1 192 ? 84.647 15.923 46.191  1.00 25.33  ? 168 LEU A O     1 
ATOM   1310 C  CB    . LEU A 1 192 ? 84.778 12.997 44.667  1.00 22.55  ? 168 LEU A CB    1 
ATOM   1311 C  CG    . LEU A 1 192 ? 84.204 11.566 44.623  1.00 26.94  ? 168 LEU A CG    1 
ATOM   1312 C  CD1   . LEU A 1 192 ? 85.291 10.496 44.523  1.00 28.31  ? 168 LEU A CD1   1 
ATOM   1313 C  CD2   . LEU A 1 192 ? 83.296 11.293 45.814  1.00 36.51  ? 168 LEU A CD2   1 
ATOM   1314 N  N     . ASP A 1 193 ? 84.946 16.171 43.961  1.00 21.46  ? 169 ASP A N     1 
ATOM   1315 C  CA    . ASP A 1 193 ? 85.498 17.504 44.111  1.00 23.29  ? 169 ASP A CA    1 
ATOM   1316 C  C     . ASP A 1 193 ? 84.446 18.475 44.662  1.00 22.94  ? 169 ASP A C     1 
ATOM   1317 O  O     . ASP A 1 193 ? 84.757 19.281 45.518  1.00 22.51  ? 169 ASP A O     1 
ATOM   1318 C  CB    . ASP A 1 193 ? 86.114 18.028 42.811  1.00 23.25  ? 169 ASP A CB    1 
ATOM   1319 C  CG    . ASP A 1 193 ? 87.367 17.273 42.396  1.00 25.96  ? 169 ASP A CG    1 
ATOM   1320 O  OD1   . ASP A 1 193 ? 87.986 16.577 43.229  1.00 27.65  ? 169 ASP A OD1   1 
ATOM   1321 O  OD2   . ASP A 1 193 ? 87.755 17.387 41.219  1.00 27.05  ? 169 ASP A OD2   1 
ATOM   1322 N  N     . CYS A 1 194 ? 83.208 18.401 44.164  1.00 25.49  ? 170 CYS A N     1 
ATOM   1323 C  CA    . CYS A 1 194 ? 82.126 19.229 44.695  1.00 24.07  ? 170 CYS A CA    1 
ATOM   1324 C  C     . CYS A 1 194 ? 81.843 18.958 46.179  1.00 22.51  ? 170 CYS A C     1 
ATOM   1325 O  O     . CYS A 1 194 ? 81.614 19.899 46.955  1.00 20.47  ? 170 CYS A O     1 
ATOM   1326 C  CB    . CYS A 1 194 ? 80.855 19.026 43.874  1.00 27.75  ? 170 CYS A CB    1 
ATOM   1327 S  SG    . CYS A 1 194 ? 80.967 19.719 42.217  1.00 28.28  ? 170 CYS A SG    1 
ATOM   1328 N  N     . ALA A 1 195 ? 81.869 17.682 46.564  1.00 20.92  ? 171 ALA A N     1 
ATOM   1329 C  CA    . ALA A 1 195 ? 81.573 17.251 47.953  1.00 24.67  ? 171 ALA A CA    1 
ATOM   1330 C  C     . ALA A 1 195 ? 82.551 17.904 48.894  1.00 21.16  ? 171 ALA A C     1 
ATOM   1331 O  O     . ALA A 1 195 ? 82.162 18.489 49.916  1.00 27.19  ? 171 ALA A O     1 
ATOM   1332 C  CB    . ALA A 1 195 ? 81.658 15.734 48.086  1.00 27.36  ? 171 ALA A CB    1 
ATOM   1333 N  N     . ARG A 1 196 ? 83.815 17.846 48.504  1.00 20.66  ? 172 ARG A N     1 
ATOM   1334 C  CA    . ARG A 1 196 ? 84.913 18.358 49.332  1.00 21.42  ? 172 ARG A CA    1 
ATOM   1335 C  C     . ARG A 1 196 ? 84.780 19.859 49.510  1.00 23.74  ? 172 ARG A C     1 
ATOM   1336 O  O     . ARG A 1 196 ? 84.857 20.365 50.644  1.00 26.86  ? 172 ARG A O     1 
ATOM   1337 C  CB    . ARG A 1 196 ? 86.270 18.021 48.719  1.00 20.64  ? 172 ARG A CB    1 
ATOM   1338 C  CG    . ARG A 1 196 ? 87.453 18.539 49.534  1.00 24.68  ? 172 ARG A CG    1 
ATOM   1339 C  CD    . ARG A 1 196 ? 88.804 18.224 48.892  1.00 32.24  ? 172 ARG A CD    1 
ATOM   1340 N  NE    . ARG A 1 196 ? 88.771 18.194 47.424  1.00 36.24  ? 172 ARG A NE    1 
ATOM   1341 C  CZ    . ARG A 1 196 ? 89.053 19.225 46.622  1.00 39.44  ? 172 ARG A CZ    1 
ATOM   1342 N  NH1   . ARG A 1 196 ? 89.400 20.416 47.105  1.00 29.62  ? 172 ARG A NH1   1 
ATOM   1343 N  NH2   . ARG A 1 196 ? 88.994 19.063 45.314  1.00 42.46  ? 172 ARG A NH2   1 
ATOM   1344 N  N     . ILE A 1 197 ? 84.573 20.558 48.391  1.00 24.08  ? 173 ILE A N     1 
ATOM   1345 C  CA    . ILE A 1 197 ? 84.518 22.011 48.366  1.00 23.03  ? 173 ILE A CA    1 
ATOM   1346 C  C     . ILE A 1 197 ? 83.288 22.493 49.142  1.00 23.03  ? 173 ILE A C     1 
ATOM   1347 O  O     . ILE A 1 197 ? 83.383 23.405 49.972  1.00 25.04  ? 173 ILE A O     1 
ATOM   1348 C  CB    . ILE A 1 197 ? 84.499 22.571 46.920  1.00 22.33  ? 173 ILE A CB    1 
ATOM   1349 C  CG1   . ILE A 1 197 ? 85.768 22.160 46.134  1.00 20.39  ? 173 ILE A CG1   1 
ATOM   1350 C  CG2   . ILE A 1 197 ? 84.311 24.083 46.940  1.00 22.32  ? 173 ILE A CG2   1 
ATOM   1351 C  CD1   . ILE A 1 197 ? 85.813 22.685 44.704  1.00 19.08  ? 173 ILE A CD1   1 
ATOM   1352 N  N     . ALA A 1 198 ? 82.151 21.857 48.886  1.00 25.61  ? 174 ALA A N     1 
ATOM   1353 C  CA    . ALA A 1 198 ? 80.894 22.188 49.552  1.00 21.66  ? 174 ALA A CA    1 
ATOM   1354 C  C     . ALA A 1 198 ? 81.031 22.070 51.063  1.00 26.44  ? 174 ALA A C     1 
ATOM   1355 O  O     . ALA A 1 198 ? 80.749 23.039 51.801  1.00 26.60  ? 174 ALA A O     1 
ATOM   1356 C  CB    . ALA A 1 198 ? 79.775 21.288 49.039  1.00 18.98  ? 174 ALA A CB    1 
ATOM   1357 N  N     . HIS A 1 199 ? 81.489 20.905 51.523  1.00 23.65  ? 175 HIS A N     1 
ATOM   1358 C  CA    . HIS A 1 199 ? 81.635 20.633 52.971  1.00 27.84  ? 175 HIS A CA    1 
ATOM   1359 C  C     . HIS A 1 199 ? 82.692 21.509 53.658  1.00 27.71  ? 175 HIS A C     1 
ATOM   1360 O  O     . HIS A 1 199 ? 82.524 21.954 54.810  1.00 31.82  ? 175 HIS A O     1 
ATOM   1361 C  CB    . HIS A 1 199 ? 81.932 19.150 53.204  1.00 28.75  ? 175 HIS A CB    1 
ATOM   1362 C  CG    . HIS A 1 199 ? 80.740 18.258 53.022  1.00 26.26  ? 175 HIS A CG    1 
ATOM   1363 N  ND1   . HIS A 1 199 ? 80.760 17.150 52.204  1.00 28.11  ? 175 HIS A ND1   1 
ATOM   1364 C  CD2   . HIS A 1 199 ? 79.495 18.310 53.558  1.00 28.34  ? 175 HIS A CD2   1 
ATOM   1365 C  CE1   . HIS A 1 199 ? 79.573 16.563 52.240  1.00 28.88  ? 175 HIS A CE1   1 
ATOM   1366 N  NE2   . HIS A 1 199 ? 78.796 17.238 53.069  1.00 24.28  ? 175 HIS A NE2   1 
ATOM   1367 N  N     . GLN A 1 200 ? 83.781 21.780 52.952  1.00 26.89  ? 176 GLN A N     1 
ATOM   1368 C  CA    . GLN A 1 200 ? 84.798 22.681 53.489  1.00 27.94  ? 176 GLN A CA    1 
ATOM   1369 C  C     . GLN A 1 200 ? 84.323 24.128 53.631  1.00 26.29  ? 176 GLN A C     1 
ATOM   1370 O  O     . GLN A 1 200 ? 84.869 24.888 54.449  1.00 29.66  ? 176 GLN A O     1 
ATOM   1371 C  CB    . GLN A 1 200 ? 86.120 22.544 52.715  1.00 27.80  ? 176 GLN A CB    1 
ATOM   1372 C  CG    . GLN A 1 200 ? 86.850 21.265 53.128  1.00 30.69  ? 176 GLN A CG    1 
ATOM   1373 C  CD    . GLN A 1 200 ? 88.117 20.978 52.355  1.00 40.81  ? 176 GLN A CD    1 
ATOM   1374 O  OE1   . GLN A 1 200 ? 88.414 21.613 51.338  1.00 58.54  ? 176 GLN A OE1   1 
ATOM   1375 N  NE2   . GLN A 1 200 ? 88.866 19.990 52.826  1.00 44.11  ? 176 GLN A NE2   1 
ATOM   1376 N  N     . HIS A 1 201 ? 83.278 24.488 52.875  1.00 23.18  ? 177 HIS A N     1 
ATOM   1377 C  CA    . HIS A 1 201 ? 82.670 25.800 52.968  1.00 24.30  ? 177 HIS A CA    1 
ATOM   1378 C  C     . HIS A 1 201 ? 81.349 25.767 53.739  1.00 22.39  ? 177 HIS A C     1 
ATOM   1379 O  O     . HIS A 1 201 ? 80.565 26.703 53.683  1.00 26.82  ? 177 HIS A O     1 
ATOM   1380 C  CB    . HIS A 1 201 ? 82.540 26.426 51.562  1.00 24.17  ? 177 HIS A CB    1 
ATOM   1381 C  CG    . HIS A 1 201 ? 83.828 26.987 51.045  1.00 25.48  ? 177 HIS A CG    1 
ATOM   1382 N  ND1   . HIS A 1 201 ? 84.793 26.208 50.452  1.00 25.73  ? 177 HIS A ND1   1 
ATOM   1383 C  CD2   . HIS A 1 201 ? 84.332 28.244 51.077  1.00 30.52  ? 177 HIS A CD2   1 
ATOM   1384 C  CE1   . HIS A 1 201 ? 85.834 26.959 50.129  1.00 27.27  ? 177 HIS A CE1   1 
ATOM   1385 N  NE2   . HIS A 1 201 ? 85.574 28.199 50.491  1.00 26.53  ? 177 HIS A NE2   1 
ATOM   1386 N  N     . GLY A 1 202 ? 81.148 24.694 54.511  1.00 24.25  ? 178 GLY A N     1 
ATOM   1387 C  CA    . GLY A 1 202 ? 79.969 24.546 55.352  1.00 28.08  ? 178 GLY A CA    1 
ATOM   1388 C  C     . GLY A 1 202 ? 78.620 24.386 54.664  1.00 27.84  ? 178 GLY A C     1 
ATOM   1389 O  O     . GLY A 1 202 ? 77.581 24.664 55.259  1.00 29.36  ? 178 GLY A O     1 
ATOM   1390 N  N     . ARG A 1 203 ? 78.623 23.928 53.417  1.00 23.62  ? 179 ARG A N     1 
ATOM   1391 C  CA    . ARG A 1 203 ? 77.385 23.784 52.657  1.00 19.23  ? 179 ARG A CA    1 
ATOM   1392 C  C     . ARG A 1 203 ? 76.922 22.352 52.709  1.00 19.42  ? 179 ARG A C     1 
ATOM   1393 O  O     . ARG A 1 203 ? 77.640 21.491 53.224  1.00 24.23  ? 179 ARG A O     1 
ATOM   1394 C  CB    . ARG A 1 203 ? 77.628 24.146 51.187  1.00 20.74  ? 179 ARG A CB    1 
ATOM   1395 C  CG    . ARG A 1 203 ? 78.531 25.351 50.984  1.00 24.77  ? 179 ARG A CG    1 
ATOM   1396 C  CD    . ARG A 1 203 ? 77.845 26.621 51.456  1.00 25.75  ? 179 ARG A CD    1 
ATOM   1397 N  NE    . ARG A 1 203 ? 78.595 27.835 51.120  1.00 28.92  ? 179 ARG A NE    1 
ATOM   1398 C  CZ    . ARG A 1 203 ? 78.338 29.038 51.632  1.00 40.24  ? 179 ARG A CZ    1 
ATOM   1399 N  NH1   . ARG A 1 203 ? 79.084 30.081 51.286  1.00 40.80  ? 179 ARG A NH1   1 
ATOM   1400 N  NH2   . ARG A 1 203 ? 77.342 29.204 52.500  1.00 42.33  ? 179 ARG A NH2   1 
ATOM   1401 N  N     . GLU A 1 204 ? 75.761 22.075 52.110  1.00 23.39  ? 180 GLU A N     1 
ATOM   1402 C  CA    . GLU A 1 204 ? 75.254 20.700 52.031  1.00 21.58  ? 180 GLU A CA    1 
ATOM   1403 C  C     . GLU A 1 204 ? 75.196 20.122 50.608  1.00 21.81  ? 180 GLU A C     1 
ATOM   1404 O  O     . GLU A 1 204 ? 75.090 20.849 49.630  1.00 24.58  ? 180 GLU A O     1 
ATOM   1405 C  CB    . GLU A 1 204 ? 73.906 20.574 52.733  1.00 25.37  ? 180 GLU A CB    1 
ATOM   1406 C  CG    . GLU A 1 204 ? 74.010 20.695 54.262  1.00 27.47  ? 180 GLU A CG    1 
ATOM   1407 C  CD    . GLU A 1 204 ? 72.687 20.973 54.953  1.00 34.53  ? 180 GLU A CD    1 
ATOM   1408 O  OE1   . GLU A 1 204 ? 72.451 20.404 56.037  1.00 43.72  ? 180 GLU A OE1   1 
ATOM   1409 O  OE2   . GLU A 1 204 ? 71.889 21.779 54.448  1.00 38.83  ? 180 GLU A OE2   1 
HETATM 1410 N  N     . MSE A 1 205 ? 75.335 18.805 50.541  1.00 19.68  ? 181 MSE A N     1 
HETATM 1411 C  CA    . MSE A 1 205 ? 75.332 18.051 49.323  1.00 21.13  ? 181 MSE A CA    1 
HETATM 1412 C  C     . MSE A 1 205 ? 74.070 17.247 49.291  1.00 21.99  ? 181 MSE A C     1 
HETATM 1413 O  O     . MSE A 1 205 ? 73.631 16.691 50.314  1.00 19.61  ? 181 MSE A O     1 
HETATM 1414 C  CB    . MSE A 1 205 ? 76.521 17.094 49.319  1.00 26.47  ? 181 MSE A CB    1 
HETATM 1415 C  CG    . MSE A 1 205 ? 77.873 17.805 49.240  1.00 31.34  ? 181 MSE A CG    1 
HETATM 1416 SE SE    . MSE A 1 205 ? 78.094 18.547 47.427  1.00 42.98  ? 181 MSE A SE    1 
HETATM 1417 C  CE    . MSE A 1 205 ? 78.076 16.832 46.444  1.00 25.51  ? 181 MSE A CE    1 
ATOM   1418 N  N     . SER A 1 206 ? 73.481 17.166 48.101  1.00 20.67  ? 182 SER A N     1 
ATOM   1419 C  CA    . SER A 1 206 ? 72.246 16.433 47.891  1.00 19.41  ? 182 SER A CA    1 
ATOM   1420 C  C     . SER A 1 206 ? 72.358 15.593 46.627  1.00 19.09  ? 182 SER A C     1 
ATOM   1421 O  O     . SER A 1 206 ? 73.078 15.961 45.694  1.00 19.05  ? 182 SER A O     1 
ATOM   1422 C  CB    . SER A 1 206 ? 71.068 17.392 47.763  1.00 16.76  ? 182 SER A CB    1 
ATOM   1423 O  OG    . SER A 1 206 ? 69.843 16.685 47.635  1.00 16.12  ? 182 SER A OG    1 
HETATM 1424 N  N     . MSE A 1 207 ? 71.658 14.464 46.596  1.00 17.94  ? 183 MSE A N     1 
HETATM 1425 C  CA    . MSE A 1 207 ? 71.594 13.642 45.377  1.00 21.83  ? 183 MSE A CA    1 
HETATM 1426 C  C     . MSE A 1 207 ? 70.234 13.049 45.148  1.00 21.19  ? 183 MSE A C     1 
HETATM 1427 O  O     . MSE A 1 207 ? 69.437 12.883 46.068  1.00 20.09  ? 183 MSE A O     1 
HETATM 1428 C  CB    . MSE A 1 207 ? 72.660 12.550 45.422  1.00 25.51  ? 183 MSE A CB    1 
HETATM 1429 C  CG    . MSE A 1 207 ? 72.183 11.286 46.116  1.00 29.55  ? 183 MSE A CG    1 
HETATM 1430 SE SE    . MSE A 1 207 ? 73.533 9.907  45.794  1.00 40.33  ? 183 MSE A SE    1 
HETATM 1431 C  CE    . MSE A 1 207 ? 73.261 9.814  43.839  1.00 37.80  ? 183 MSE A CE    1 
ATOM   1432 N  N     . THR A 1 208 ? 69.936 12.755 43.887  1.00 19.91  ? 184 THR A N     1 
ATOM   1433 C  CA    . THR A 1 208 ? 68.788 11.948 43.596  1.00 18.71  ? 184 THR A CA    1 
ATOM   1434 C  C     . THR A 1 208 ? 69.259 10.589 43.106  1.00 15.74  ? 184 THR A C     1 
ATOM   1435 O  O     . THR A 1 208 ? 70.291 10.489 42.438  1.00 15.53  ? 184 THR A O     1 
ATOM   1436 C  CB    . THR A 1 208 ? 67.869 12.590 42.537  1.00 18.15  ? 184 THR A CB    1 
ATOM   1437 O  OG1   . THR A 1 208 ? 66.852 11.649 42.227  1.00 18.44  ? 184 THR A OG1   1 
ATOM   1438 C  CG2   . THR A 1 208 ? 68.658 13.005 41.254  1.00 17.24  ? 184 THR A CG2   1 
ATOM   1439 N  N     . LEU A 1 209 ? 68.513 9.550  43.480  1.00 16.24  ? 185 LEU A N     1 
ATOM   1440 C  CA    . LEU A 1 209 ? 68.796 8.181  43.080  1.00 14.44  ? 185 LEU A CA    1 
ATOM   1441 C  C     . LEU A 1 209 ? 68.451 7.959  41.590  1.00 15.89  ? 185 LEU A C     1 
ATOM   1442 O  O     . LEU A 1 209 ? 68.845 6.958  41.024  1.00 16.94  ? 185 LEU A O     1 
ATOM   1443 C  CB    . LEU A 1 209 ? 68.035 7.195  43.963  1.00 15.66  ? 185 LEU A CB    1 
ATOM   1444 C  CG    . LEU A 1 209 ? 68.448 7.148  45.454  1.00 17.32  ? 185 LEU A CG    1 
ATOM   1445 C  CD1   . LEU A 1 209 ? 67.747 6.006  46.176  1.00 18.14  ? 185 LEU A CD1   1 
ATOM   1446 C  CD2   . LEU A 1 209 ? 69.958 7.043  45.607  1.00 20.79  ? 185 LEU A CD2   1 
ATOM   1447 N  N     . SER A 1 210 ? 67.686 8.888  41.019  1.00 15.52  ? 186 SER A N     1 
ATOM   1448 C  CA    . SER A 1 210 ? 67.467 9.039  39.550  1.00 17.50  ? 186 SER A CA    1 
ATOM   1449 C  C     . SER A 1 210 ? 66.532 8.022  38.891  1.00 16.60  ? 186 SER A C     1 
ATOM   1450 O  O     . SER A 1 210 ? 65.551 8.402  38.231  1.00 20.52  ? 186 SER A O     1 
ATOM   1451 C  CB    . SER A 1 210 ? 68.797 9.104  38.783  1.00 15.64  ? 186 SER A CB    1 
ATOM   1452 O  OG    . SER A 1 210 ? 69.517 10.293 39.054  1.00 19.35  ? 186 SER A OG    1 
ATOM   1453 N  N     . ASP A 1 211 ? 66.834 6.735  39.056  1.00 16.01  ? 187 ASP A N     1 
ATOM   1454 C  CA    . ASP A 1 211 ? 66.147 5.652  38.323  1.00 17.61  ? 187 ASP A CA    1 
ATOM   1455 C  C     . ASP A 1 211 ? 66.486 4.316  38.987  1.00 16.46  ? 187 ASP A C     1 
ATOM   1456 O  O     . ASP A 1 211 ? 67.620 4.132  39.444  1.00 17.45  ? 187 ASP A O     1 
ATOM   1457 C  CB    . ASP A 1 211 ? 66.562 5.690  36.837  1.00 19.63  ? 187 ASP A CB    1 
ATOM   1458 C  CG    . ASP A 1 211 ? 66.028 4.509  36.033  1.00 20.22  ? 187 ASP A CG    1 
ATOM   1459 O  OD1   . ASP A 1 211 ? 66.657 3.437  36.068  1.00 20.59  ? 187 ASP A OD1   1 
ATOM   1460 O  OD2   . ASP A 1 211 ? 65.001 4.666  35.341  1.00 22.66  ? 187 ASP A OD2   1 
ATOM   1461 N  N     . SER A 1 212 ? 65.508 3.411  39.085  1.00 16.50  ? 188 SER A N     1 
ATOM   1462 C  CA    . SER A 1 212 ? 65.695 2.128  39.829  1.00 15.49  ? 188 SER A CA    1 
ATOM   1463 C  C     . SER A 1 212 ? 66.821 1.257  39.251  1.00 17.31  ? 188 SER A C     1 
ATOM   1464 O  O     . SER A 1 212 ? 67.504 0.543  39.974  1.00 18.92  ? 188 SER A O     1 
ATOM   1465 C  CB    . SER A 1 212 ? 64.396 1.320  39.880  1.00 18.72  ? 188 SER A CB    1 
ATOM   1466 O  OG    . SER A 1 212 ? 63.824 1.146  38.560  1.00 22.83  ? 188 SER A OG    1 
ATOM   1467 N  N     . PHE A 1 213 ? 67.003 1.307  37.934  1.00 16.97  ? 189 PHE A N     1 
ATOM   1468 C  CA    . PHE A 1 213 ? 68.070 0.543  37.286  1.00 17.67  ? 189 PHE A CA    1 
ATOM   1469 C  C     . PHE A 1 213 ? 69.408 1.227  37.429  1.00 17.45  ? 189 PHE A C     1 
ATOM   1470 O  O     . PHE A 1 213 ? 70.459 0.559  37.586  1.00 19.89  ? 189 PHE A O     1 
ATOM   1471 C  CB    . PHE A 1 213 ? 67.735 0.296  35.801  1.00 17.29  ? 189 PHE A CB    1 
ATOM   1472 C  CG    . PHE A 1 213 ? 66.476 -0.489 35.599  1.00 18.16  ? 189 PHE A CG    1 
ATOM   1473 C  CD1   . PHE A 1 213 ? 65.241 0.153  35.534  1.00 17.25  ? 189 PHE A CD1   1 
ATOM   1474 C  CD2   . PHE A 1 213 ? 66.519 -1.876 35.499  1.00 19.47  ? 189 PHE A CD2   1 
ATOM   1475 C  CE1   . PHE A 1 213 ? 64.069 -0.577 35.343  1.00 18.95  ? 189 PHE A CE1   1 
ATOM   1476 C  CE2   . PHE A 1 213 ? 65.357 -2.613 35.324  1.00 18.00  ? 189 PHE A CE2   1 
ATOM   1477 C  CZ    . PHE A 1 213 ? 64.127 -1.956 35.241  1.00 17.88  ? 189 PHE A CZ    1 
ATOM   1478 N  N     . CYS A 1 214 ? 69.383 2.554  37.400  1.00 16.72  ? 190 CYS A N     1 
ATOM   1479 C  CA    . CYS A 1 214 ? 70.585 3.310  37.748  1.00 17.46  ? 190 CYS A CA    1 
ATOM   1480 C  C     . CYS A 1 214 ? 71.053 2.839  39.127  1.00 15.73  ? 190 CYS A C     1 
ATOM   1481 O  O     . CYS A 1 214 ? 72.228 2.519  39.297  1.00 16.44  ? 190 CYS A O     1 
ATOM   1482 C  CB    . CYS A 1 214 ? 70.336 4.808  37.786  1.00 16.66  ? 190 CYS A CB    1 
ATOM   1483 S  SG    . CYS A 1 214 ? 71.855 5.759  37.995  1.00 19.28  ? 190 CYS A SG    1 
ATOM   1484 N  N     . VAL A 1 215 ? 70.125 2.770  40.076  1.00 15.99  ? 191 VAL A N     1 
ATOM   1485 C  CA    . VAL A 1 215 ? 70.433 2.249  41.459  1.00 15.61  ? 191 VAL A CA    1 
ATOM   1486 C  C     . VAL A 1 215 ? 70.979 0.826  41.453  1.00 15.87  ? 191 VAL A C     1 
ATOM   1487 O  O     . VAL A 1 215 ? 71.957 0.541  42.117  1.00 16.17  ? 191 VAL A O     1 
ATOM   1488 C  CB    . VAL A 1 215 ? 69.195 2.327  42.403  1.00 15.67  ? 191 VAL A CB    1 
ATOM   1489 C  CG1   . VAL A 1 215 ? 69.457 1.591  43.760  1.00 13.31  ? 191 VAL A CG1   1 
ATOM   1490 C  CG2   . VAL A 1 215 ? 68.822 3.756  42.672  1.00 18.54  ? 191 VAL A CG2   1 
ATOM   1491 N  N     . ASP A 1 216 ? 70.341 -0.070 40.695  1.00 17.44  ? 192 ASP A N     1 
ATOM   1492 C  CA    . ASP A 1 216 ? 70.799 -1.446 40.479  1.00 17.37  ? 192 ASP A CA    1 
ATOM   1493 C  C     . ASP A 1 216 ? 72.289 -1.401 40.101  1.00 18.89  ? 192 ASP A C     1 
ATOM   1494 O  O     . ASP A 1 216 ? 73.088 -2.180 40.615  1.00 19.82  ? 192 ASP A O     1 
ATOM   1495 C  CB    . ASP A 1 216 ? 70.024 -2.107 39.297  1.00 20.22  ? 192 ASP A CB    1 
ATOM   1496 C  CG    . ASP A 1 216 ? 68.659 -2.791 39.672  1.00 22.59  ? 192 ASP A CG    1 
ATOM   1497 O  OD1   . ASP A 1 216 ? 68.337 -3.077 40.842  1.00 24.20  ? 192 ASP A OD1   1 
ATOM   1498 O  OD2   . ASP A 1 216 ? 67.882 -3.132 38.722  1.00 21.90  ? 192 ASP A OD2   1 
ATOM   1499 N  N     . ARG A 1 217 ? 72.645 -0.497 39.183  1.00 17.67  ? 193 ARG A N     1 
ATOM   1500 C  CA    . ARG A 1 217 ? 74.000 -0.395 38.630  1.00 17.30  ? 193 ARG A CA    1 
ATOM   1501 C  C     . ARG A 1 217 ? 75.040 0.122  39.619  1.00 16.71  ? 193 ARG A C     1 
ATOM   1502 O  O     . ARG A 1 217 ? 76.204 -0.287 39.582  1.00 21.07  ? 193 ARG A O     1 
ATOM   1503 C  CB    . ARG A 1 217 ? 74.015 0.485  37.367  1.00 16.78  ? 193 ARG A CB    1 
ATOM   1504 C  CG    . ARG A 1 217 ? 73.365 -0.148 36.144  1.00 17.47  ? 193 ARG A CG    1 
ATOM   1505 C  CD    . ARG A 1 217 ? 73.727 0.596  34.857  1.00 15.41  ? 193 ARG A CD    1 
ATOM   1506 N  NE    . ARG A 1 217 ? 73.233 1.973  34.747  1.00 15.27  ? 193 ARG A NE    1 
ATOM   1507 C  CZ    . ARG A 1 217 ? 71.959 2.322  34.518  1.00 15.64  ? 193 ARG A CZ    1 
ATOM   1508 N  NH1   . ARG A 1 217 ? 71.005 1.402  34.430  1.00 15.77  ? 193 ARG A NH1   1 
ATOM   1509 N  NH2   . ARG A 1 217 ? 71.631 3.609  34.408  1.00 21.03  ? 193 ARG A NH2   1 
ATOM   1510 N  N     . TYR A 1 218 ? 74.615 1.001  40.511  1.00 15.64  ? 194 TYR A N     1 
ATOM   1511 C  CA    . TYR A 1 218 ? 75.571 1.726  41.370  1.00 19.06  ? 194 TYR A CA    1 
ATOM   1512 C  C     . TYR A 1 218 ? 75.213 1.715  42.855  1.00 19.75  ? 194 TYR A C     1 
ATOM   1513 O  O     . TYR A 1 218 ? 75.635 2.609  43.609  1.00 18.97  ? 194 TYR A O     1 
ATOM   1514 C  CB    . TYR A 1 218 ? 75.779 3.164  40.853  1.00 19.46  ? 194 TYR A CB    1 
ATOM   1515 C  CG    . TYR A 1 218 ? 76.146 3.196  39.399  1.00 19.49  ? 194 TYR A CG    1 
ATOM   1516 C  CD1   . TYR A 1 218 ? 77.393 2.765  38.967  1.00 20.10  ? 194 TYR A CD1   1 
ATOM   1517 C  CD2   . TYR A 1 218 ? 75.222 3.642  38.437  1.00 19.37  ? 194 TYR A CD2   1 
ATOM   1518 C  CE1   . TYR A 1 218 ? 77.722 2.764  37.607  1.00 18.29  ? 194 TYR A CE1   1 
ATOM   1519 C  CE2   . TYR A 1 218 ? 75.544 3.647  37.095  1.00 19.35  ? 194 TYR A CE2   1 
ATOM   1520 C  CZ    . TYR A 1 218 ? 76.791 3.218  36.686  1.00 20.53  ? 194 TYR A CZ    1 
ATOM   1521 O  OH    . TYR A 1 218 ? 77.105 3.230  35.347  1.00 22.72  ? 194 TYR A OH    1 
ATOM   1522 N  N     . ARG A 1 219 ? 74.469 0.681  43.252  1.00 19.95  ? 195 ARG A N     1 
ATOM   1523 C  CA    A ARG A 1 219 ? 73.967 0.519  44.625  0.50 21.11  ? 195 ARG A CA    1 
ATOM   1524 C  CA    B ARG A 1 219 ? 73.967 0.523  44.622  0.50 21.39  ? 195 ARG A CA    1 
ATOM   1525 C  C     . ARG A 1 219 ? 75.043 0.738  45.701  1.00 22.10  ? 195 ARG A C     1 
ATOM   1526 O  O     . ARG A 1 219 ? 74.864 1.560  46.618  1.00 21.26  ? 195 ARG A O     1 
ATOM   1527 C  CB    A ARG A 1 219 ? 73.333 -0.874 44.773  0.50 21.41  ? 195 ARG A CB    1 
ATOM   1528 C  CB    B ARG A 1 219 ? 73.331 -0.866 44.773  0.50 22.16  ? 195 ARG A CB    1 
ATOM   1529 C  CG    A ARG A 1 219 ? 72.757 -1.181 46.146  0.50 21.53  ? 195 ARG A CG    1 
ATOM   1530 C  CG    B ARG A 1 219 ? 72.498 -1.031 46.028  0.50 23.95  ? 195 ARG A CG    1 
ATOM   1531 C  CD    A ARG A 1 219 ? 71.979 -2.488 46.136  0.50 19.52  ? 195 ARG A CD    1 
ATOM   1532 C  CD    B ARG A 1 219 ? 71.975 -2.447 46.200  0.50 26.15  ? 195 ARG A CD    1 
ATOM   1533 N  NE    A ARG A 1 219 ? 70.786 -2.403 45.301  0.50 16.87  ? 195 ARG A NE    1 
ATOM   1534 N  NE    B ARG A 1 219 ? 71.461 -2.608 47.553  0.50 30.14  ? 195 ARG A NE    1 
ATOM   1535 C  CZ    A ARG A 1 219 ? 70.680 -2.936 44.085  0.50 15.86  ? 195 ARG A CZ    1 
ATOM   1536 C  CZ    B ARG A 1 219 ? 72.189 -3.032 48.583  0.50 27.11  ? 195 ARG A CZ    1 
ATOM   1537 N  NH1   A ARG A 1 219 ? 69.548 -2.807 43.408  0.50 13.70  ? 195 ARG A NH1   1 
ATOM   1538 N  NH1   B ARG A 1 219 ? 73.455 -3.375 48.403  0.50 26.49  ? 195 ARG A NH1   1 
ATOM   1539 N  NH2   A ARG A 1 219 ? 71.696 -3.600 43.550  0.50 12.27  ? 195 ARG A NH2   1 
ATOM   1540 N  NH2   B ARG A 1 219 ? 71.642 -3.130 49.787  0.50 23.10  ? 195 ARG A NH2   1 
ATOM   1541 N  N     . GLY A 1 220 ? 76.140 -0.015 45.598  1.00 22.82  ? 196 GLY A N     1 
ATOM   1542 C  CA    . GLY A 1 220 ? 77.278 0.107  46.506  1.00 23.93  ? 196 GLY A CA    1 
ATOM   1543 C  C     . GLY A 1 220 ? 77.848 1.518  46.571  1.00 24.99  ? 196 GLY A C     1 
ATOM   1544 O  O     . GLY A 1 220 ? 78.138 2.014  47.653  1.00 27.27  ? 196 GLY A O     1 
ATOM   1545 N  N     . GLU A 1 221 ? 77.983 2.174  45.415  1.00 22.63  ? 197 GLU A N     1 
ATOM   1546 C  CA    . GLU A 1 221 ? 78.575 3.501  45.360  1.00 21.51  ? 197 GLU A CA    1 
ATOM   1547 C  C     . GLU A 1 221 ? 77.667 4.571  45.954  1.00 20.82  ? 197 GLU A C     1 
ATOM   1548 O  O     . GLU A 1 221 ? 78.149 5.470  46.654  1.00 22.42  ? 197 GLU A O     1 
ATOM   1549 C  CB    . GLU A 1 221 ? 78.990 3.874  43.935  1.00 24.26  ? 197 GLU A CB    1 
ATOM   1550 C  CG    . GLU A 1 221 ? 80.146 3.057  43.399  1.00 27.61  ? 197 GLU A CG    1 
ATOM   1551 C  CD    . GLU A 1 221 ? 79.693 1.849  42.592  1.00 31.16  ? 197 GLU A CD    1 
ATOM   1552 O  OE1   . GLU A 1 221 ? 78.529 1.392  42.736  1.00 31.21  ? 197 GLU A OE1   1 
ATOM   1553 O  OE2   . GLU A 1 221 ? 80.521 1.345  41.808  1.00 39.27  ? 197 GLU A OE2   1 
ATOM   1554 N  N     . PHE A 1 222 ? 76.366 4.476  45.676  1.00 19.08  ? 198 PHE A N     1 
ATOM   1555 C  CA    . PHE A 1 222 ? 75.381 5.398  46.229  1.00 18.84  ? 198 PHE A CA    1 
ATOM   1556 C  C     . PHE A 1 222 ? 75.341 5.304  47.765  1.00 17.55  ? 198 PHE A C     1 
ATOM   1557 O  O     . PHE A 1 222 ? 75.414 6.325  48.445  1.00 20.05  ? 198 PHE A O     1 
ATOM   1558 C  CB    . PHE A 1 222 ? 73.996 5.167  45.636  1.00 18.62  ? 198 PHE A CB    1 
ATOM   1559 C  CG    . PHE A 1 222 ? 73.890 5.526  44.166  1.00 17.48  ? 198 PHE A CG    1 
ATOM   1560 C  CD1   . PHE A 1 222 ? 74.936 6.167  43.497  1.00 17.05  ? 198 PHE A CD1   1 
ATOM   1561 C  CD2   . PHE A 1 222 ? 72.713 5.273  43.472  1.00 18.65  ? 198 PHE A CD2   1 
ATOM   1562 C  CE1   . PHE A 1 222 ? 74.818 6.508  42.136  1.00 17.05  ? 198 PHE A CE1   1 
ATOM   1563 C  CE2   . PHE A 1 222 ? 72.587 5.604  42.123  1.00 16.46  ? 198 PHE A CE2   1 
ATOM   1564 C  CZ    . PHE A 1 222 ? 73.637 6.225  41.464  1.00 15.14  ? 198 PHE A CZ    1 
ATOM   1565 N  N     . LEU A 1 223 ? 75.237 4.084  48.288  1.00 18.51  ? 199 LEU A N     1 
ATOM   1566 C  CA    . LEU A 1 223 ? 75.215 3.863  49.750  1.00 17.91  ? 199 LEU A CA    1 
ATOM   1567 C  C     . LEU A 1 223 ? 76.465 4.412  50.438  1.00 19.08  ? 199 LEU A C     1 
ATOM   1568 O  O     . LEU A 1 223 ? 76.379 4.950  51.548  1.00 24.26  ? 199 LEU A O     1 
ATOM   1569 C  CB    . LEU A 1 223 ? 75.029 2.370  50.079  1.00 19.02  ? 199 LEU A CB    1 
ATOM   1570 C  CG    . LEU A 1 223 ? 73.648 1.790  49.740  1.00 21.11  ? 199 LEU A CG    1 
ATOM   1571 C  CD1   . LEU A 1 223 ? 73.660 0.277  49.570  1.00 28.93  ? 199 LEU A CD1   1 
ATOM   1572 C  CD2   . LEU A 1 223 ? 72.554 2.213  50.708  1.00 20.41  ? 199 LEU A CD2   1 
ATOM   1573 N  N     . ASP A 1 224 ? 77.615 4.255  49.787  1.00 18.41  ? 200 ASP A N     1 
ATOM   1574 C  CA    . ASP A 1 224 ? 78.900 4.734  50.305  1.00 19.22  ? 200 ASP A CA    1 
ATOM   1575 C  C     . ASP A 1 224 ? 78.931 6.261  50.360  1.00 20.84  ? 200 ASP A C     1 
ATOM   1576 O  O     . ASP A 1 224 ? 79.413 6.844  51.342  1.00 24.71  ? 200 ASP A O     1 
ATOM   1577 C  CB    . ASP A 1 224 ? 80.067 4.188  49.471  1.00 23.56  ? 200 ASP A CB    1 
ATOM   1578 C  CG    . ASP A 1 224 ? 81.379 4.881  49.771  1.00 29.52  ? 200 ASP A CG    1 
ATOM   1579 O  OD1   . ASP A 1 224 ? 81.853 4.792  50.929  1.00 34.97  ? 200 ASP A OD1   1 
ATOM   1580 O  OD2   . ASP A 1 224 ? 81.945 5.513  48.852  1.00 37.02  ? 200 ASP A OD2   1 
ATOM   1581 N  N     . LEU A 1 225 ? 78.409 6.912  49.318  1.00 21.50  ? 201 LEU A N     1 
ATOM   1582 C  CA    . LEU A 1 225 ? 78.226 8.361  49.342  1.00 20.52  ? 201 LEU A CA    1 
ATOM   1583 C  C     . LEU A 1 225 ? 77.412 8.815  50.563  1.00 18.77  ? 201 LEU A C     1 
ATOM   1584 O  O     . LEU A 1 225 ? 77.727 9.836  51.197  1.00 23.70  ? 201 LEU A O     1 
ATOM   1585 C  CB    . LEU A 1 225 ? 77.525 8.822  48.053  1.00 19.35  ? 201 LEU A CB    1 
ATOM   1586 C  CG    . LEU A 1 225 ? 78.326 8.825  46.757  1.00 21.62  ? 201 LEU A CG    1 
ATOM   1587 C  CD1   . LEU A 1 225 ? 77.359 8.920  45.575  1.00 21.24  ? 201 LEU A CD1   1 
ATOM   1588 C  CD2   . LEU A 1 225 ? 79.359 9.942  46.709  1.00 26.71  ? 201 LEU A CD2   1 
HETATM 1589 N  N     . MSE A 1 226 ? 76.375 8.052  50.891  1.00 17.95  ? 202 MSE A N     1 
HETATM 1590 C  CA    . MSE A 1 226 ? 75.447 8.431  51.960  1.00 21.61  ? 202 MSE A CA    1 
HETATM 1591 C  C     . MSE A 1 226 ? 76.084 8.180  53.306  1.00 22.81  ? 202 MSE A C     1 
HETATM 1592 O  O     . MSE A 1 226 ? 76.063 9.062  54.172  1.00 24.23  ? 202 MSE A O     1 
HETATM 1593 C  CB    . MSE A 1 226 ? 74.138 7.657  51.844  1.00 23.47  ? 202 MSE A CB    1 
HETATM 1594 C  CG    . MSE A 1 226 ? 73.284 8.183  50.684  1.00 28.01  ? 202 MSE A CG    1 
HETATM 1595 SE SE    . MSE A 1 226 ? 72.041 6.771  50.095  1.00 57.03  ? 202 MSE A SE    1 
HETATM 1596 C  CE    . MSE A 1 226 ? 70.559 7.184  51.322  1.00 55.13  ? 202 MSE A CE    1 
ATOM   1597 N  N     . ARG A 1 227 ? 76.666 6.997  53.478  1.00 21.18  ? 203 ARG A N     1 
ATOM   1598 C  CA    . ARG A 1 227 ? 77.267 6.602  54.776  1.00 18.78  ? 203 ARG A CA    1 
ATOM   1599 C  C     . ARG A 1 227 ? 78.557 7.359  55.110  1.00 22.63  ? 203 ARG A C     1 
ATOM   1600 O  O     . ARG A 1 227 ? 78.840 7.585  56.283  1.00 28.02  ? 203 ARG A O     1 
ATOM   1601 C  CB    . ARG A 1 227 ? 77.475 5.086  54.843  1.00 17.86  ? 203 ARG A CB    1 
ATOM   1602 C  CG    . ARG A 1 227 ? 76.154 4.305  54.818  1.00 17.37  ? 203 ARG A CG    1 
ATOM   1603 C  CD    . ARG A 1 227 ? 76.294 2.817  54.505  1.00 18.32  ? 203 ARG A CD    1 
ATOM   1604 N  NE    . ARG A 1 227 ? 74.986 2.152  54.525  1.00 21.91  ? 203 ARG A NE    1 
ATOM   1605 C  CZ    . ARG A 1 227 ? 74.760 0.884  54.169  1.00 18.63  ? 203 ARG A CZ    1 
ATOM   1606 N  NH1   . ARG A 1 227 ? 75.763 0.105  53.767  1.00 22.10  ? 203 ARG A NH1   1 
ATOM   1607 N  NH2   . ARG A 1 227 ? 73.522 0.387  54.213  1.00 18.96  ? 203 ARG A NH2   1 
ATOM   1608 N  N     . SER A 1 228 ? 79.315 7.791  54.099  1.00 22.76  ? 204 SER A N     1 
ATOM   1609 C  CA    . SER A 1 228 ? 80.565 8.551  54.342  1.00 22.66  ? 204 SER A CA    1 
ATOM   1610 C  C     . SER A 1 228 ? 80.351 10.032 54.696  1.00 24.13  ? 204 SER A C     1 
ATOM   1611 O  O     . SER A 1 228 ? 81.262 10.690 55.239  1.00 29.22  ? 204 SER A O     1 
ATOM   1612 C  CB    . SER A 1 228 ? 81.508 8.445  53.151  1.00 26.31  ? 204 SER A CB    1 
ATOM   1613 O  OG    . SER A 1 228 ? 80.969 9.144  52.040  1.00 24.96  ? 204 SER A OG    1 
ATOM   1614 N  N     . GLY A 1 229 ? 79.151 10.536 54.421  1.00 28.81  ? 205 GLY A N     1 
ATOM   1615 C  CA    . GLY A 1 229 ? 78.799 11.926 54.700  1.00 28.27  ? 205 GLY A CA    1 
ATOM   1616 C  C     . GLY A 1 229 ? 79.022 12.877 53.534  1.00 31.33  ? 205 GLY A C     1 
ATOM   1617 O  O     . GLY A 1 229 ? 78.884 14.091 53.697  1.00 30.18  ? 205 GLY A O     1 
ATOM   1618 N  N     . LYS A 1 230 ? 79.369 12.331 52.365  1.00 27.70  ? 206 LYS A N     1 
ATOM   1619 C  CA    . LYS A 1 230 ? 79.492 13.128 51.127  1.00 25.69  ? 206 LYS A CA    1 
ATOM   1620 C  C     . LYS A 1 230 ? 78.131 13.569 50.603  1.00 23.08  ? 206 LYS A C     1 
ATOM   1621 O  O     . LYS A 1 230 ? 78.022 14.572 49.874  1.00 27.52  ? 206 LYS A O     1 
ATOM   1622 C  CB    . LYS A 1 230 ? 80.273 12.373 50.051  1.00 24.23  ? 206 LYS A CB    1 
ATOM   1623 C  CG    . LYS A 1 230 ? 81.707 12.031 50.457  1.00 27.36  ? 206 LYS A CG    1 
ATOM   1624 C  CD    . LYS A 1 230 ? 82.393 11.136 49.427  1.00 31.51  ? 206 LYS A CD    1 
ATOM   1625 C  CE    . LYS A 1 230 ? 83.867 10.921 49.735  1.00 30.79  ? 206 LYS A CE    1 
ATOM   1626 N  NZ    . LYS A 1 230 ? 84.048 9.969  50.869  1.00 31.69  ? 206 LYS A NZ    1 
ATOM   1627 N  N     . VAL A 1 231 ? 77.083 12.833 50.979  1.00 22.46  ? 207 VAL A N     1 
ATOM   1628 C  CA    . VAL A 1 231 ? 75.707 13.212 50.618  1.00 26.63  ? 207 VAL A CA    1 
ATOM   1629 C  C     . VAL A 1 231 ? 74.890 13.408 51.897  1.00 27.21  ? 207 VAL A C     1 
ATOM   1630 O  O     . VAL A 1 231 ? 74.826 12.505 52.736  1.00 29.22  ? 207 VAL A O     1 
ATOM   1631 C  CB    . VAL A 1 231 ? 75.051 12.150 49.686  1.00 24.82  ? 207 VAL A CB    1 
ATOM   1632 C  CG1   . VAL A 1 231 ? 73.563 12.429 49.482  1.00 26.12  ? 207 VAL A CG1   1 
ATOM   1633 C  CG2   . VAL A 1 231 ? 75.773 12.115 48.350  1.00 22.77  ? 207 VAL A CG2   1 
ATOM   1634 N  N     . ASP A 1 232 ? 74.293 14.591 52.046  1.00 27.39  ? 208 ASP A N     1 
ATOM   1635 C  CA    . ASP A 1 232 ? 73.535 14.951 53.259  1.00 25.96  ? 208 ASP A CA    1 
ATOM   1636 C  C     . ASP A 1 232 ? 72.045 14.743 53.094  1.00 26.22  ? 208 ASP A C     1 
ATOM   1637 O  O     . ASP A 1 232 ? 71.368 14.374 54.045  1.00 28.88  ? 208 ASP A O     1 
ATOM   1638 C  CB    . ASP A 1 232 ? 73.762 16.409 53.657  1.00 25.61  ? 208 ASP A CB    1 
ATOM   1639 C  CG    . ASP A 1 232 ? 75.214 16.743 53.846  1.00 28.24  ? 208 ASP A CG    1 
ATOM   1640 O  OD1   . ASP A 1 232 ? 75.799 16.385 54.905  1.00 28.29  ? 208 ASP A OD1   1 
ATOM   1641 O  OD2   . ASP A 1 232 ? 75.773 17.372 52.932  1.00 29.79  ? 208 ASP A OD2   1 
ATOM   1642 N  N     . ILE A 1 233 ? 71.532 15.038 51.895  1.00 22.27  ? 209 ILE A N     1 
ATOM   1643 C  CA    . ILE A 1 233 ? 70.099 14.952 51.609  1.00 18.81  ? 209 ILE A CA    1 
ATOM   1644 C  C     . ILE A 1 233 ? 69.903 14.104 50.359  1.00 18.51  ? 209 ILE A C     1 
ATOM   1645 O  O     . ILE A 1 233 ? 70.541 14.363 49.344  1.00 20.54  ? 209 ILE A O     1 
ATOM   1646 C  CB    . ILE A 1 233 ? 69.486 16.351 51.366  1.00 20.50  ? 209 ILE A CB    1 
ATOM   1647 C  CG1   . ILE A 1 233 ? 69.698 17.266 52.583  1.00 22.36  ? 209 ILE A CG1   1 
ATOM   1648 C  CG2   . ILE A 1 233 ? 68.009 16.253 50.990  1.00 18.92  ? 209 ILE A CG2   1 
ATOM   1649 C  CD1   . ILE A 1 233 ? 69.654 18.743 52.246  1.00 22.60  ? 209 ILE A CD1   1 
ATOM   1650 N  N     . VAL A 1 234 ? 69.021 13.112 50.441  1.00 16.52  ? 210 VAL A N     1 
ATOM   1651 C  CA    A VAL A 1 234 ? 68.790 12.178 49.334  0.60 17.56  ? 210 VAL A CA    1 
ATOM   1652 C  CA    B VAL A 1 234 ? 68.793 12.185 49.331  0.40 16.97  ? 210 VAL A CA    1 
ATOM   1653 C  C     . VAL A 1 234 ? 67.347 12.219 48.852  1.00 18.11  ? 210 VAL A C     1 
ATOM   1654 O  O     . VAL A 1 234 ? 66.429 12.232 49.657  1.00 19.15  ? 210 VAL A O     1 
ATOM   1655 C  CB    A VAL A 1 234 ? 69.141 10.725 49.740  0.60 19.06  ? 210 VAL A CB    1 
ATOM   1656 C  CB    B VAL A 1 234 ? 69.207 10.735 49.700  0.40 17.46  ? 210 VAL A CB    1 
ATOM   1657 C  CG1   A VAL A 1 234 ? 68.999 9.772  48.558  0.60 19.31  ? 210 VAL A CG1   1 
ATOM   1658 C  CG1   B VAL A 1 234 ? 68.282 10.142 50.763  0.40 14.08  ? 210 VAL A CG1   1 
ATOM   1659 C  CG2   A VAL A 1 234 ? 70.549 10.649 50.318  0.60 20.33  ? 210 VAL A CG2   1 
ATOM   1660 C  CG2   B VAL A 1 234 ? 69.250 9.846  48.463  0.40 18.58  ? 210 VAL A CG2   1 
ATOM   1661 N  N     . PHE A 1 235 ? 67.157 12.233 47.523  1.00 18.56  ? 211 PHE A N     1 
ATOM   1662 C  CA    . PHE A 1 235 ? 65.834 12.137 46.935  1.00 16.85  ? 211 PHE A CA    1 
ATOM   1663 C  C     . PHE A 1 235 ? 65.642 10.777 46.278  1.00 16.61  ? 211 PHE A C     1 
ATOM   1664 O  O     . PHE A 1 235 ? 66.549 10.267 45.631  1.00 17.06  ? 211 PHE A O     1 
ATOM   1665 C  CB    . PHE A 1 235 ? 65.627 13.240 45.891  1.00 16.59  ? 211 PHE A CB    1 
ATOM   1666 C  CG    . PHE A 1 235 ? 65.558 14.623 46.475  1.00 16.46  ? 211 PHE A CG    1 
ATOM   1667 C  CD1   . PHE A 1 235 ? 66.724 15.353 46.750  1.00 15.15  ? 211 PHE A CD1   1 
ATOM   1668 C  CD2   . PHE A 1 235 ? 64.321 15.227 46.707  1.00 15.99  ? 211 PHE A CD2   1 
ATOM   1669 C  CE1   . PHE A 1 235 ? 66.646 16.647 47.242  1.00 14.49  ? 211 PHE A CE1   1 
ATOM   1670 C  CE2   . PHE A 1 235 ? 64.251 16.503 47.235  1.00 17.43  ? 211 PHE A CE2   1 
ATOM   1671 C  CZ    . PHE A 1 235 ? 65.414 17.213 47.488  1.00 15.55  ? 211 PHE A CZ    1 
ATOM   1672 N  N     . ALA A 1 236 ? 64.467 10.195 46.482  1.00 17.26  ? 212 ALA A N     1 
ATOM   1673 C  CA    . ALA A 1 236 ? 64.104 8.886  45.929  1.00 17.81  ? 212 ALA A CA    1 
ATOM   1674 C  C     . ALA A 1 236 ? 62.595 8.791  45.713  1.00 19.64  ? 212 ALA A C     1 
ATOM   1675 O  O     . ALA A 1 236 ? 61.822 9.397  46.442  1.00 24.59  ? 212 ALA A O     1 
ATOM   1676 C  CB    . ALA A 1 236 ? 64.575 7.759  46.858  1.00 18.59  ? 212 ALA A CB    1 
ATOM   1677 N  N     . ASN A 1 237 ? 62.174 8.056  44.685  1.00 20.23  ? 213 ASN A N     1 
ATOM   1678 C  CA    . ASN A 1 237 ? 60.780 7.654  44.594  1.00 19.45  ? 213 ASN A CA    1 
ATOM   1679 C  C     . ASN A 1 237 ? 60.658 6.253  45.182  1.00 18.94  ? 213 ASN A C     1 
ATOM   1680 O  O     . ASN A 1 237 ? 61.673 5.665  45.614  1.00 20.49  ? 213 ASN A O     1 
ATOM   1681 C  CB    . ASN A 1 237 ? 60.231 7.751  43.161  1.00 20.90  ? 213 ASN A CB    1 
ATOM   1682 C  CG    . ASN A 1 237 ? 60.974 6.875  42.185  1.00 22.55  ? 213 ASN A CG    1 
ATOM   1683 O  OD1   . ASN A 1 237 ? 61.631 5.908  42.569  1.00 22.29  ? 213 ASN A OD1   1 
ATOM   1684 N  ND2   . ASN A 1 237 ? 60.879 7.217  40.896  1.00 25.82  ? 213 ASN A ND2   1 
ATOM   1685 N  N     . ARG A 1 238 ? 59.438 5.720  45.220  1.00 18.23  ? 214 ARG A N     1 
ATOM   1686 C  CA    . ARG A 1 238 ? 59.211 4.411  45.837  1.00 19.98  ? 214 ARG A CA    1 
ATOM   1687 C  C     . ARG A 1 238 ? 60.087 3.326  45.201  1.00 20.76  ? 214 ARG A C     1 
ATOM   1688 O  O     . ARG A 1 238 ? 60.762 2.567  45.903  1.00 19.43  ? 214 ARG A O     1 
ATOM   1689 C  CB    . ARG A 1 238 ? 57.731 4.021  45.770  1.00 24.03  ? 214 ARG A CB    1 
ATOM   1690 C  CG    . ARG A 1 238 ? 57.371 2.808  46.621  1.00 28.13  ? 214 ARG A CG    1 
ATOM   1691 C  CD    . ARG A 1 238 ? 55.901 2.441  46.491  1.00 35.73  ? 214 ARG A CD    1 
ATOM   1692 N  NE    . ARG A 1 238 ? 55.562 1.304  47.345  1.00 45.06  ? 214 ARG A NE    1 
ATOM   1693 C  CZ    . ARG A 1 238 ? 54.871 1.388  48.481  1.00 48.30  ? 214 ARG A CZ    1 
ATOM   1694 N  NH1   . ARG A 1 238 ? 54.425 2.562  48.911  1.00 57.89  ? 214 ARG A NH1   1 
ATOM   1695 N  NH2   . ARG A 1 238 ? 54.616 0.290  49.185  1.00 42.35  ? 214 ARG A NH2   1 
ATOM   1696 N  N     . GLN A 1 239 ? 60.088 3.261  43.866  1.00 19.87  ? 215 GLN A N     1 
ATOM   1697 C  CA    A GLN A 1 239 ? 60.853 2.257  43.132  0.60 21.69  ? 215 GLN A CA    1 
ATOM   1698 C  CA    B GLN A 1 239 ? 60.849 2.219  43.180  0.40 21.63  ? 215 GLN A CA    1 
ATOM   1699 C  C     . GLN A 1 239 ? 62.351 2.297  43.460  1.00 18.53  ? 215 GLN A C     1 
ATOM   1700 O  O     . GLN A 1 239 ? 62.994 1.266  43.601  1.00 18.82  ? 215 GLN A O     1 
ATOM   1701 C  CB    A GLN A 1 239 ? 60.642 2.427  41.619  0.60 22.39  ? 215 GLN A CB    1 
ATOM   1702 C  CB    B GLN A 1 239 ? 60.575 2.206  41.672  0.40 22.96  ? 215 GLN A CB    1 
ATOM   1703 C  CG    A GLN A 1 239 ? 59.181 2.444  41.159  0.60 25.25  ? 215 GLN A CG    1 
ATOM   1704 C  CG    B GLN A 1 239 ? 59.195 1.682  41.289  0.40 27.58  ? 215 GLN A CG    1 
ATOM   1705 C  CD    A GLN A 1 239 ? 58.575 3.839  41.091  0.60 25.46  ? 215 GLN A CD    1 
ATOM   1706 C  CD    B GLN A 1 239 ? 58.991 0.212  41.624  0.40 29.08  ? 215 GLN A CD    1 
ATOM   1707 O  OE1   A GLN A 1 239 ? 58.602 4.598  42.060  0.60 23.02  ? 215 GLN A OE1   1 
ATOM   1708 O  OE1   B GLN A 1 239 ? 59.853 -0.628 41.364  0.40 30.73  ? 215 GLN A OE1   1 
ATOM   1709 N  NE2   A GLN A 1 239 ? 58.008 4.178  39.938  0.60 29.36  ? 215 GLN A NE2   1 
ATOM   1710 N  NE2   B GLN A 1 239 ? 57.838 -0.103 42.196  0.40 33.49  ? 215 GLN A NE2   1 
ATOM   1711 N  N     . GLU A 1 240 ? 62.893 3.511  43.569  1.00 16.39  ? 216 GLU A N     1 
ATOM   1712 C  CA    . GLU A 1 240 ? 64.317 3.714  43.786  1.00 16.51  ? 216 GLU A CA    1 
ATOM   1713 C  C     . GLU A 1 240 ? 64.665 3.288  45.195  1.00 17.25  ? 216 GLU A C     1 
ATOM   1714 O  O     . GLU A 1 240 ? 65.724 2.711  45.419  1.00 16.73  ? 216 GLU A O     1 
ATOM   1715 C  CB    . GLU A 1 240 ? 64.693 5.177  43.589  1.00 18.26  ? 216 GLU A CB    1 
ATOM   1716 C  CG    . GLU A 1 240 ? 64.835 5.586  42.128  1.00 19.50  ? 216 GLU A CG    1 
ATOM   1717 C  CD    . GLU A 1 240 ? 64.590 7.066  41.911  1.00 21.22  ? 216 GLU A CD    1 
ATOM   1718 O  OE1   . GLU A 1 240 ? 64.718 7.848  42.869  1.00 21.48  ? 216 GLU A OE1   1 
ATOM   1719 O  OE2   . GLU A 1 240 ? 64.264 7.465  40.778  1.00 24.42  ? 216 GLU A OE2   1 
ATOM   1720 N  N     . ALA A 1 241 ? 63.760 3.575  46.125  1.00 18.33  ? 217 ALA A N     1 
ATOM   1721 C  CA    . ALA A 1 241 ? 63.988 3.239  47.545  1.00 19.72  ? 217 ALA A CA    1 
ATOM   1722 C  C     . ALA A 1 241 ? 64.001 1.725  47.718  1.00 19.74  ? 217 ALA A C     1 
ATOM   1723 O  O     . ALA A 1 241 ? 64.900 1.175  48.348  1.00 20.87  ? 217 ALA A O     1 
ATOM   1724 C  CB    . ALA A 1 241 ? 62.927 3.875  48.425  1.00 22.88  ? 217 ALA A CB    1 
ATOM   1725 N  N     . LEU A 1 242 ? 63.017 1.051  47.116  1.00 22.91  ? 218 LEU A N     1 
ATOM   1726 C  CA    . LEU A 1 242 ? 62.945 -0.409 47.145  1.00 20.30  ? 218 LEU A CA    1 
ATOM   1727 C  C     . LEU A 1 242 ? 64.175 -1.065 46.508  1.00 20.81  ? 218 LEU A C     1 
ATOM   1728 O  O     . LEU A 1 242 ? 64.663 -2.083 47.005  1.00 22.91  ? 218 LEU A O     1 
ATOM   1729 C  CB    . LEU A 1 242 ? 61.663 -0.907 46.463  1.00 18.31  ? 218 LEU A CB    1 
ATOM   1730 C  CG    . LEU A 1 242 ? 60.321 -0.610 47.141  1.00 20.74  ? 218 LEU A CG    1 
ATOM   1731 C  CD1   . LEU A 1 242 ? 59.183 -1.134 46.279  1.00 21.53  ? 218 LEU A CD1   1 
ATOM   1732 C  CD2   . LEU A 1 242 ? 60.239 -1.205 48.533  1.00 23.90  ? 218 LEU A CD2   1 
ATOM   1733 N  N     A SER A 1 243 ? 64.662 -0.474 45.417  0.50 18.56  ? 219 SER A N     1 
ATOM   1734 N  N     B SER A 1 243 ? 64.684 -0.468 45.432  0.50 19.28  ? 219 SER A N     1 
ATOM   1735 C  CA    A SER A 1 243 ? 65.833 -0.990 44.724  0.50 19.48  ? 219 SER A CA    1 
ATOM   1736 C  CA    B SER A 1 243 ? 65.840 -1.016 44.736  0.50 21.35  ? 219 SER A CA    1 
ATOM   1737 C  C     A SER A 1 243 ? 67.118 -0.754 45.509  0.50 16.76  ? 219 SER A C     1 
ATOM   1738 C  C     B SER A 1 243 ? 67.155 -0.722 45.450  0.50 17.39  ? 219 SER A C     1 
ATOM   1739 O  O     A SER A 1 243 ? 68.000 -1.616 45.550  0.50 17.29  ? 219 SER A O     1 
ATOM   1740 O  O     B SER A 1 243 ? 68.096 -1.515 45.384  0.50 18.97  ? 219 SER A O     1 
ATOM   1741 C  CB    A SER A 1 243 ? 65.953 -0.401 43.317  0.50 15.46  ? 219 SER A CB    1 
ATOM   1742 C  CB    B SER A 1 243 ? 65.874 -0.536 43.287  0.50 20.68  ? 219 SER A CB    1 
ATOM   1743 O  OG    A SER A 1 243 ? 67.163 -0.816 42.724  0.50 14.66  ? 219 SER A OG    1 
ATOM   1744 O  OG    B SER A 1 243 ? 64.599 -0.734 42.705  0.50 23.09  ? 219 SER A OG    1 
ATOM   1745 N  N     . LEU A 1 244 ? 67.222 0.407  46.145  1.00 17.56  ? 220 LEU A N     1 
ATOM   1746 C  CA    . LEU A 1 244 ? 68.402 0.732  46.901  1.00 17.30  ? 220 LEU A CA    1 
ATOM   1747 C  C     . LEU A 1 244 ? 68.684 -0.384 47.923  1.00 17.33  ? 220 LEU A C     1 
ATOM   1748 O  O     . LEU A 1 244 ? 69.840 -0.747 48.131  1.00 20.48  ? 220 LEU A O     1 
ATOM   1749 C  CB    . LEU A 1 244 ? 68.275 2.082  47.591  1.00 17.08  ? 220 LEU A CB    1 
ATOM   1750 C  CG    . LEU A 1 244 ? 69.518 2.531  48.378  1.00 16.33  ? 220 LEU A CG    1 
ATOM   1751 C  CD1   . LEU A 1 244 ? 70.785 2.554  47.532  1.00 19.69  ? 220 LEU A CD1   1 
ATOM   1752 C  CD2   . LEU A 1 244 ? 69.228 3.898  48.941  1.00 17.98  ? 220 LEU A CD2   1 
ATOM   1753 N  N     . TYR A 1 245 ? 67.614 -0.950 48.489  1.00 17.92  ? 221 TYR A N     1 
ATOM   1754 C  CA    . TYR A 1 245 ? 67.719 -2.009 49.499  1.00 20.93  ? 221 TYR A CA    1 
ATOM   1755 C  C     . TYR A 1 245 ? 67.220 -3.392 49.020  1.00 22.19  ? 221 TYR A C     1 
ATOM   1756 O  O     . TYR A 1 245 ? 67.131 -4.339 49.809  1.00 25.17  ? 221 TYR A O     1 
ATOM   1757 C  CB    . TYR A 1 245 ? 67.043 -1.548 50.805  1.00 20.81  ? 221 TYR A CB    1 
ATOM   1758 C  CG    . TYR A 1 245 ? 67.654 -0.263 51.312  1.00 20.16  ? 221 TYR A CG    1 
ATOM   1759 C  CD1   . TYR A 1 245 ? 68.965 -0.244 51.806  1.00 22.83  ? 221 TYR A CD1   1 
ATOM   1760 C  CD2   . TYR A 1 245 ? 66.950 0.940  51.257  1.00 20.51  ? 221 TYR A CD2   1 
ATOM   1761 C  CE1   . TYR A 1 245 ? 69.546 0.934  52.238  1.00 21.33  ? 221 TYR A CE1   1 
ATOM   1762 C  CE2   . TYR A 1 245 ? 67.519 2.128  51.691  1.00 18.68  ? 221 TYR A CE2   1 
ATOM   1763 C  CZ    . TYR A 1 245 ? 68.817 2.126  52.167  1.00 20.89  ? 221 TYR A CZ    1 
ATOM   1764 O  OH    . TYR A 1 245 ? 69.379 3.308  52.592  1.00 23.74  ? 221 TYR A OH    1 
ATOM   1765 N  N     . GLN A 1 246 ? 66.931 -3.507 47.721  1.00 22.79  ? 222 GLN A N     1 
ATOM   1766 C  CA    . GLN A 1 246 ? 66.546 -4.779 47.101  1.00 20.26  ? 222 GLN A CA    1 
ATOM   1767 C  C     . GLN A 1 246 ? 65.480 -5.492 47.910  1.00 21.34  ? 222 GLN A C     1 
ATOM   1768 O  O     . GLN A 1 246 ? 65.620 -6.675 48.243  1.00 26.31  ? 222 GLN A O     1 
ATOM   1769 C  CB    . GLN A 1 246 ? 67.769 -5.694 46.924  1.00 20.85  ? 222 GLN A CB    1 
ATOM   1770 C  CG    . GLN A 1 246 ? 68.805 -5.113 45.989  1.00 21.53  ? 222 GLN A CG    1 
ATOM   1771 C  CD    . GLN A 1 246 ? 70.061 -5.943 45.877  1.00 27.44  ? 222 GLN A CD    1 
ATOM   1772 O  OE1   . GLN A 1 246 ? 70.840 -6.052 46.831  1.00 34.22  ? 222 GLN A OE1   1 
ATOM   1773 N  NE2   . GLN A 1 246 ? 70.281 -6.517 44.696  1.00 31.11  ? 222 GLN A NE2   1 
ATOM   1774 N  N     . THR A 1 247 ? 64.427 -4.750 48.236  1.00 21.68  ? 223 THR A N     1 
ATOM   1775 C  CA    . THR A 1 247 ? 63.335 -5.223 49.072  1.00 21.55  ? 223 THR A CA    1 
ATOM   1776 C  C     . THR A 1 247 ? 62.005 -4.886 48.412  1.00 21.99  ? 223 THR A C     1 
ATOM   1777 O  O     . THR A 1 247 ? 61.936 -3.946 47.627  1.00 23.48  ? 223 THR A O     1 
ATOM   1778 C  CB    . THR A 1 247 ? 63.413 -4.611 50.489  1.00 20.50  ? 223 THR A CB    1 
ATOM   1779 O  OG1   . THR A 1 247 ? 62.397 -5.184 51.323  1.00 20.00  ? 223 THR A OG1   1 
ATOM   1780 C  CG2   . THR A 1 247 ? 63.271 -3.082 50.450  1.00 20.66  ? 223 THR A CG2   1 
ATOM   1781 N  N     . ASP A 1 248 ? 60.958 -5.662 48.698  1.00 25.32  ? 224 ASP A N     1 
ATOM   1782 C  CA    . ASP A 1 248 ? 59.592 -5.241 48.335  1.00 28.73  ? 224 ASP A CA    1 
ATOM   1783 C  C     . ASP A 1 248 ? 58.819 -4.694 49.531  1.00 26.23  ? 224 ASP A C     1 
ATOM   1784 O  O     . ASP A 1 248 ? 57.622 -4.414 49.442  1.00 29.12  ? 224 ASP A O     1 
ATOM   1785 C  CB    . ASP A 1 248 ? 58.795 -6.319 47.572  1.00 39.44  ? 224 ASP A CB    1 
ATOM   1786 C  CG    . ASP A 1 248 ? 58.949 -7.713 48.153  1.00 49.30  ? 224 ASP A CG    1 
ATOM   1787 O  OD1   . ASP A 1 248 ? 59.040 -7.864 49.392  1.00 48.23  ? 224 ASP A OD1   1 
ATOM   1788 O  OD2   . ASP A 1 248 ? 58.958 -8.673 47.349  1.00 60.49  ? 224 ASP A OD2   1 
ATOM   1789 N  N     . ASP A 1 249 ? 59.537 -4.528 50.643  1.00 23.99  ? 225 ASP A N     1 
ATOM   1790 C  CA    . ASP A 1 249 ? 58.987 -3.971 51.870  1.00 26.13  ? 225 ASP A CA    1 
ATOM   1791 C  C     . ASP A 1 249 ? 59.347 -2.488 51.947  1.00 23.90  ? 225 ASP A C     1 
ATOM   1792 O  O     . ASP A 1 249 ? 60.489 -2.129 52.235  1.00 23.90  ? 225 ASP A O     1 
ATOM   1793 C  CB    . ASP A 1 249 ? 59.540 -4.725 53.087  1.00 28.65  ? 225 ASP A CB    1 
ATOM   1794 C  CG    . ASP A 1 249 ? 58.864 -4.324 54.393  1.00 32.37  ? 225 ASP A CG    1 
ATOM   1795 O  OD1   . ASP A 1 249 ? 58.059 -3.365 54.412  1.00 34.81  ? 225 ASP A OD1   1 
ATOM   1796 O  OD2   . ASP A 1 249 ? 59.149 -4.972 55.417  1.00 39.24  ? 225 ASP A OD2   1 
ATOM   1797 N  N     . PHE A 1 250 ? 58.362 -1.635 51.694  1.00 22.52  ? 226 PHE A N     1 
ATOM   1798 C  CA    . PHE A 1 250 ? 58.583 -0.193 51.667  1.00 21.91  ? 226 PHE A CA    1 
ATOM   1799 C  C     . PHE A 1 250 ? 58.881 0.389  53.047  1.00 24.27  ? 226 PHE A C     1 
ATOM   1800 O  O     . PHE A 1 250 ? 59.583 1.396  53.159  1.00 21.47  ? 226 PHE A O     1 
ATOM   1801 C  CB    . PHE A 1 250 ? 57.381 0.511  51.037  1.00 21.18  ? 226 PHE A CB    1 
ATOM   1802 C  CG    . PHE A 1 250 ? 57.558 1.990  50.878  1.00 25.11  ? 226 PHE A CG    1 
ATOM   1803 C  CD1   . PHE A 1 250 ? 58.616 2.512  50.129  1.00 24.91  ? 226 PHE A CD1   1 
ATOM   1804 C  CD2   . PHE A 1 250 ? 56.647 2.868  51.458  1.00 24.65  ? 226 PHE A CD2   1 
ATOM   1805 C  CE1   . PHE A 1 250 ? 58.772 3.881  49.991  1.00 23.61  ? 226 PHE A CE1   1 
ATOM   1806 C  CE2   . PHE A 1 250 ? 56.794 4.238  51.313  1.00 23.06  ? 226 PHE A CE2   1 
ATOM   1807 C  CZ    . PHE A 1 250 ? 57.856 4.746  50.573  1.00 23.17  ? 226 PHE A CZ    1 
ATOM   1808 N  N     . GLU A 1 251 ? 58.359 -0.248 54.095  1.00 28.33  ? 227 GLU A N     1 
ATOM   1809 C  CA    . GLU A 1 251 ? 58.608 0.231  55.455  1.00 29.36  ? 227 GLU A CA    1 
ATOM   1810 C  C     . GLU A 1 251 ? 60.055 -0.017 55.839  1.00 24.18  ? 227 GLU A C     1 
ATOM   1811 O  O     . GLU A 1 251 ? 60.672 0.808  56.510  1.00 26.11  ? 227 GLU A O     1 
ATOM   1812 C  CB    . GLU A 1 251 ? 57.642 -0.398 56.472  1.00 35.62  ? 227 GLU A CB    1 
ATOM   1813 C  CG    . GLU A 1 251 ? 56.180 0.012  56.296  1.00 42.14  ? 227 GLU A CG    1 
ATOM   1814 C  CD    . GLU A 1 251 ? 55.956 1.520  56.340  1.00 41.06  ? 227 GLU A CD    1 
ATOM   1815 O  OE1   . GLU A 1 251 ? 56.578 2.207  57.184  1.00 39.45  ? 227 GLU A OE1   1 
ATOM   1816 O  OE2   . GLU A 1 251 ? 55.144 2.020  55.528  1.00 42.10  ? 227 GLU A OE2   1 
ATOM   1817 N  N     . GLU A 1 252 ? 60.596 -1.145 55.386  1.00 23.46  ? 228 GLU A N     1 
ATOM   1818 C  CA    . GLU A 1 252 ? 62.011 -1.453 55.552  1.00 26.10  ? 228 GLU A CA    1 
ATOM   1819 C  C     . GLU A 1 252 ? 62.879 -0.409 54.854  1.00 23.30  ? 228 GLU A C     1 
ATOM   1820 O  O     . GLU A 1 252 ? 63.840 0.106  55.443  1.00 22.49  ? 228 GLU A O     1 
ATOM   1821 C  CB    . GLU A 1 252 ? 62.329 -2.855 55.020  1.00 27.23  ? 228 GLU A CB    1 
ATOM   1822 C  CG    . GLU A 1 252 ? 63.805 -3.221 55.093  1.00 28.96  ? 228 GLU A CG    1 
ATOM   1823 C  CD    . GLU A 1 252 ? 64.140 -4.512 54.373  1.00 31.02  ? 228 GLU A CD    1 
ATOM   1824 O  OE1   . GLU A 1 252 ? 63.241 -5.364 54.195  1.00 42.37  ? 228 GLU A OE1   1 
ATOM   1825 O  OE2   . GLU A 1 252 ? 65.312 -4.677 53.982  1.00 31.12  ? 228 GLU A OE2   1 
ATOM   1826 N  N     . ALA A 1 253 ? 62.530 -0.110 53.604  1.00 22.76  ? 229 ALA A N     1 
ATOM   1827 C  CA    . ALA A 1 253 ? 63.217 0.910  52.808  1.00 22.37  ? 229 ALA A CA    1 
ATOM   1828 C  C     . ALA A 1 253 ? 63.270 2.273  53.514  1.00 20.35  ? 229 ALA A C     1 
ATOM   1829 O  O     . ALA A 1 253 ? 64.317 2.901  53.557  1.00 22.36  ? 229 ALA A O     1 
ATOM   1830 C  CB    . ALA A 1 253 ? 62.581 1.034  51.420  1.00 22.39  ? 229 ALA A CB    1 
ATOM   1831 N  N     . LEU A 1 254 ? 62.148 2.718  54.079  1.00 21.41  ? 230 LEU A N     1 
ATOM   1832 C  CA    . LEU A 1 254 ? 62.098 4.008  54.779  1.00 21.60  ? 230 LEU A CA    1 
ATOM   1833 C  C     . LEU A 1 254 ? 62.960 4.008  56.050  1.00 22.81  ? 230 LEU A C     1 
ATOM   1834 O  O     . LEU A 1 254 ? 63.696 4.962  56.325  1.00 21.17  ? 230 LEU A O     1 
ATOM   1835 C  CB    . LEU A 1 254 ? 60.655 4.396  55.112  1.00 21.56  ? 230 LEU A CB    1 
ATOM   1836 C  CG    . LEU A 1 254 ? 59.649 4.734  54.006  1.00 21.11  ? 230 LEU A CG    1 
ATOM   1837 C  CD1   . LEU A 1 254 ? 58.279 4.911  54.639  1.00 20.81  ? 230 LEU A CD1   1 
ATOM   1838 C  CD2   . LEU A 1 254 ? 60.035 5.974  53.197  1.00 20.88  ? 230 LEU A CD2   1 
ATOM   1839 N  N     . ASN A 1 255 ? 62.886 2.934  56.821  1.00 24.95  ? 231 ASN A N     1 
ATOM   1840 C  CA    . ASN A 1 255 ? 63.745 2.845  58.007  1.00 25.34  ? 231 ASN A CA    1 
ATOM   1841 C  C     . ASN A 1 255 ? 65.223 2.823  57.626  1.00 23.90  ? 231 ASN A C     1 
ATOM   1842 O  O     . ASN A 1 255 ? 66.029 3.524  58.226  1.00 25.93  ? 231 ASN A O     1 
ATOM   1843 C  CB    . ASN A 1 255 ? 63.379 1.647  58.882  1.00 29.33  ? 231 ASN A CB    1 
ATOM   1844 C  CG    . ASN A 1 255 ? 61.983 1.754  59.475  1.00 30.00  ? 231 ASN A CG    1 
ATOM   1845 O  OD1   . ASN A 1 255 ? 61.540 2.828  59.877  1.00 27.26  ? 231 ASN A OD1   1 
ATOM   1846 N  ND2   . ASN A 1 255 ? 61.286 0.628  59.537  1.00 36.70  ? 231 ASN A ND2   1 
ATOM   1847 N  N     . ARG A 1 256 ? 65.571 2.051  56.601  1.00 23.91  ? 232 ARG A N     1 
ATOM   1848 C  CA    . ARG A 1 256 ? 66.967 1.940  56.190  1.00 22.14  ? 232 ARG A CA    1 
ATOM   1849 C  C     . ARG A 1 256 ? 67.495 3.257  55.591  1.00 21.92  ? 232 ARG A C     1 
ATOM   1850 O  O     . ARG A 1 256 ? 68.596 3.704  55.937  1.00 23.49  ? 232 ARG A O     1 
ATOM   1851 C  CB    . ARG A 1 256 ? 67.182 0.740  55.255  1.00 22.77  ? 232 ARG A CB    1 
ATOM   1852 C  CG    . ARG A 1 256 ? 67.079 -0.620 55.943  1.00 21.52  ? 232 ARG A CG    1 
ATOM   1853 C  CD    . ARG A 1 256 ? 67.429 -1.769 55.009  1.00 20.68  ? 232 ARG A CD    1 
ATOM   1854 N  NE    . ARG A 1 256 ? 68.850 -1.822 54.667  1.00 24.71  ? 232 ARG A NE    1 
ATOM   1855 C  CZ    . ARG A 1 256 ? 69.436 -2.809 53.982  1.00 27.26  ? 232 ARG A CZ    1 
ATOM   1856 N  NH1   . ARG A 1 256 ? 68.735 -3.841 53.540  1.00 27.94  ? 232 ARG A NH1   1 
ATOM   1857 N  NH2   . ARG A 1 256 ? 70.740 -2.764 53.738  1.00 34.09  ? 232 ARG A NH2   1 
ATOM   1858 N  N     . ILE A 1 257 ? 66.704 3.903  54.734  1.00 21.32  ? 233 ILE A N     1 
ATOM   1859 C  CA    . ILE A 1 257 ? 67.137 5.166  54.133  1.00 19.23  ? 233 ILE A CA    1 
ATOM   1860 C  C     . ILE A 1 257 ? 67.358 6.269  55.180  1.00 21.91  ? 233 ILE A C     1 
ATOM   1861 O  O     . ILE A 1 257 ? 68.334 7.038  55.100  1.00 21.34  ? 233 ILE A O     1 
ATOM   1862 C  CB    . ILE A 1 257 ? 66.239 5.595  52.930  1.00 19.17  ? 233 ILE A CB    1 
ATOM   1863 C  CG1   . ILE A 1 257 ? 67.048 6.474  51.985  1.00 20.87  ? 233 ILE A CG1   1 
ATOM   1864 C  CG2   . ILE A 1 257 ? 64.931 6.253  53.385  1.00 19.18  ? 233 ILE A CG2   1 
ATOM   1865 C  CD1   . ILE A 1 257 ? 66.401 6.707  50.636  1.00 19.66  ? 233 ILE A CD1   1 
ATOM   1866 N  N     . ALA A 1 258 ? 66.488 6.300  56.190  1.00 23.46  ? 234 ALA A N     1 
ATOM   1867 C  CA    . ALA A 1 258 ? 66.595 7.267  57.287  1.00 22.75  ? 234 ALA A CA    1 
ATOM   1868 C  C     . ALA A 1 258 ? 67.868 7.033  58.113  1.00 22.52  ? 234 ALA A C     1 
ATOM   1869 O  O     . ALA A 1 258 ? 68.442 7.975  58.670  1.00 24.41  ? 234 ALA A O     1 
ATOM   1870 C  CB    . ALA A 1 258 ? 65.358 7.203  58.168  1.00 23.50  ? 234 ALA A CB    1 
ATOM   1871 N  N     . ALA A 1 259 ? 68.311 5.779  58.156  1.00 21.74  ? 235 ALA A N     1 
ATOM   1872 C  CA    . ALA A 1 259 ? 69.523 5.411  58.875  1.00 22.26  ? 235 ALA A CA    1 
ATOM   1873 C  C     . ALA A 1 259 ? 70.801 5.730  58.094  1.00 24.30  ? 235 ALA A C     1 
ATOM   1874 O  O     . ALA A 1 259 ? 71.873 5.879  58.683  1.00 23.08  ? 235 ALA A O     1 
ATOM   1875 C  CB    . ALA A 1 259 ? 69.480 3.939  59.250  1.00 23.63  ? 235 ALA A CB    1 
ATOM   1876 N  N     . ASP A 1 260 ? 70.680 5.859  56.768  1.00 20.75  ? 236 ASP A N     1 
ATOM   1877 C  CA    . ASP A 1 260 ? 71.849 6.020  55.912  1.00 20.15  ? 236 ASP A CA    1 
ATOM   1878 C  C     . ASP A 1 260 ? 72.169 7.461  55.502  1.00 21.18  ? 236 ASP A C     1 
ATOM   1879 O  O     . ASP A 1 260 ? 73.291 7.740  55.062  1.00 22.60  ? 236 ASP A O     1 
ATOM   1880 C  CB    . ASP A 1 260 ? 71.738 5.121  54.669  1.00 21.94  ? 236 ASP A CB    1 
ATOM   1881 C  CG    . ASP A 1 260 ? 71.991 3.649  54.981  1.00 23.69  ? 236 ASP A CG    1 
ATOM   1882 O  OD1   . ASP A 1 260 ? 72.733 3.341  55.949  1.00 24.34  ? 236 ASP A OD1   1 
ATOM   1883 O  OD2   . ASP A 1 260 ? 71.458 2.791  54.248  1.00 23.43  ? 236 ASP A OD2   1 
ATOM   1884 N  N     . CYS A 1 261 ? 71.202 8.368  55.655  1.00 21.06  ? 237 CYS A N     1 
ATOM   1885 C  CA    A CYS A 1 261 ? 71.440 9.779  55.340  0.60 22.99  ? 237 CYS A CA    1 
ATOM   1886 C  CA    B CYS A 1 261 ? 71.347 9.777  55.262  0.40 22.68  ? 237 CYS A CA    1 
ATOM   1887 C  C     . CYS A 1 261 ? 70.721 10.702 56.314  1.00 24.80  ? 237 CYS A C     1 
ATOM   1888 O  O     . CYS A 1 261 ? 69.801 10.281 57.024  1.00 28.85  ? 237 CYS A O     1 
ATOM   1889 C  CB    A CYS A 1 261 ? 71.019 10.088 53.905  0.60 23.40  ? 237 CYS A CB    1 
ATOM   1890 C  CB    B CYS A 1 261 ? 70.682 9.995  53.894  0.40 22.88  ? 237 CYS A CB    1 
ATOM   1891 S  SG    A CYS A 1 261 ? 69.233 10.105 53.739  0.60 27.37  ? 237 CYS A SG    1 
ATOM   1892 S  SG    B CYS A 1 261 ? 71.234 11.453 52.981  0.40 23.24  ? 237 CYS A SG    1 
ATOM   1893 N  N     . LYS A 1 262 ? 71.174 11.961 56.378  1.00 22.17  ? 238 LYS A N     1 
ATOM   1894 C  CA    . LYS A 1 262 ? 70.637 12.928 57.345  1.00 23.72  ? 238 LYS A CA    1 
ATOM   1895 C  C     . LYS A 1 262 ? 69.184 13.286 57.069  1.00 23.02  ? 238 LYS A C     1 
ATOM   1896 O  O     . LYS A 1 262 ? 68.351 13.299 57.977  1.00 22.79  ? 238 LYS A O     1 
ATOM   1897 C  CB    . LYS A 1 262 ? 71.514 14.186 57.445  1.00 25.03  ? 238 LYS A CB    1 
ATOM   1898 C  CG    . LYS A 1 262 ? 72.893 13.918 58.023  1.00 31.38  ? 238 LYS A CG    1 
ATOM   1899 C  CD    . LYS A 1 262 ? 73.765 15.168 58.056  1.00 36.05  ? 238 LYS A CD    1 
ATOM   1900 C  CE    . LYS A 1 262 ? 75.242 14.804 57.936  1.00 37.59  ? 238 LYS A CE    1 
ATOM   1901 N  NZ    . LYS A 1 262 ? 75.555 14.041 56.684  1.00 32.52  ? 238 LYS A NZ    1 
ATOM   1902 N  N     . ILE A 1 263 ? 68.873 13.543 55.801  1.00 21.12  ? 239 ILE A N     1 
ATOM   1903 C  CA    . ILE A 1 263 ? 67.520 13.889 55.419  1.00 20.15  ? 239 ILE A CA    1 
ATOM   1904 C  C     . ILE A 1 263 ? 67.219 13.090 54.164  1.00 20.12  ? 239 ILE A C     1 
ATOM   1905 O  O     . ILE A 1 263 ? 68.043 13.047 53.268  1.00 22.53  ? 239 ILE A O     1 
ATOM   1906 C  CB    . ILE A 1 263 ? 67.353 15.403 55.142  1.00 20.64  ? 239 ILE A CB    1 
ATOM   1907 C  CG1   . ILE A 1 263 ? 67.489 16.228 56.444  1.00 21.16  ? 239 ILE A CG1   1 
ATOM   1908 C  CG2   . ILE A 1 263 ? 65.994 15.673 54.517  1.00 22.12  ? 239 ILE A CG2   1 
ATOM   1909 C  CD1   . ILE A 1 263 ? 67.637 17.725 56.227  1.00 20.48  ? 239 ILE A CD1   1 
ATOM   1910 N  N     . ALA A 1 264 ? 66.058 12.446 54.151  1.00 20.02  ? 240 ALA A N     1 
ATOM   1911 C  CA    . ALA A 1 264 ? 65.559 11.700 53.004  1.00 19.93  ? 240 ALA A CA    1 
ATOM   1912 C  C     . ALA A 1 264 ? 64.203 12.258 52.563  1.00 22.86  ? 240 ALA A C     1 
ATOM   1913 O  O     . ALA A 1 264 ? 63.301 12.516 53.385  1.00 21.93  ? 240 ALA A O     1 
ATOM   1914 C  CB    . ALA A 1 264 ? 65.457 10.220 53.348  1.00 19.88  ? 240 ALA A CB    1 
ATOM   1915 N  N     . ALA A 1 265 ? 64.052 12.452 51.257  1.00 21.02  ? 241 ALA A N     1 
ATOM   1916 C  CA    . ALA A 1 265 ? 62.765 12.870 50.723  1.00 18.43  ? 241 ALA A CA    1 
ATOM   1917 C  C     . ALA A 1 265 ? 62.332 11.784 49.767  1.00 18.10  ? 241 ALA A C     1 
ATOM   1918 O  O     . ALA A 1 265 ? 63.002 11.534 48.774  1.00 18.26  ? 241 ALA A O     1 
ATOM   1919 C  CB    . ALA A 1 265 ? 62.863 14.236 50.044  1.00 17.06  ? 241 ALA A CB    1 
ATOM   1920 N  N     . VAL A 1 266 ? 61.256 11.091 50.129  1.00 19.81  ? 242 VAL A N     1 
ATOM   1921 C  CA    . VAL A 1 266 ? 60.801 9.935  49.374  1.00 20.32  ? 242 VAL A CA    1 
ATOM   1922 C  C     . VAL A 1 266 ? 59.430 10.201 48.768  1.00 22.84  ? 242 VAL A C     1 
ATOM   1923 O  O     . VAL A 1 266 ? 58.421 10.270 49.480  1.00 24.37  ? 242 VAL A O     1 
ATOM   1924 C  CB    . VAL A 1 266 ? 60.780 8.634  50.217  1.00 22.62  ? 242 VAL A CB    1 
ATOM   1925 C  CG1   . VAL A 1 266 ? 60.389 7.436  49.345  1.00 22.56  ? 242 VAL A CG1   1 
ATOM   1926 C  CG2   . VAL A 1 266 ? 62.125 8.395  50.898  1.00 24.70  ? 242 VAL A CG2   1 
ATOM   1927 N  N     . THR A 1 267 ? 59.402 10.332 47.445  1.00 23.44  ? 243 THR A N     1 
ATOM   1928 C  CA    . THR A 1 267 ? 58.154 10.562 46.732  1.00 22.78  ? 243 THR A CA    1 
ATOM   1929 C  C     . THR A 1 267 ? 57.409 9.259  46.438  1.00 22.20  ? 243 THR A C     1 
ATOM   1930 O  O     . THR A 1 267 ? 58.020 8.198  46.256  1.00 21.34  ? 243 THR A O     1 
ATOM   1931 C  CB    . THR A 1 267 ? 58.374 11.341 45.415  1.00 22.79  ? 243 THR A CB    1 
ATOM   1932 O  OG1   . THR A 1 267 ? 59.255 10.607 44.566  1.00 20.78  ? 243 THR A OG1   1 
ATOM   1933 C  CG2   . THR A 1 267 ? 58.980 12.712 45.686  1.00 25.44  ? 243 THR A CG2   1 
HETATM 1934 N  N     . MSE A 1 268 ? 56.079 9.355  46.388  1.00 23.47  ? 244 MSE A N     1 
HETATM 1935 C  CA    . MSE A 1 268 ? 55.216 8.194  46.206  1.00 26.53  ? 244 MSE A CA    1 
HETATM 1936 C  C     . MSE A 1 268 ? 54.127 8.473  45.201  1.00 26.60  ? 244 MSE A C     1 
HETATM 1937 O  O     . MSE A 1 268 ? 52.992 8.018  45.365  1.00 29.48  ? 244 MSE A O     1 
HETATM 1938 C  CB    . MSE A 1 268 ? 54.603 7.840  47.560  1.00 27.01  ? 244 MSE A CB    1 
HETATM 1939 C  CG    . MSE A 1 268 ? 55.677 7.593  48.617  1.00 35.05  ? 244 MSE A CG    1 
HETATM 1940 SE SE    . MSE A 1 268 ? 54.734 7.204  50.293  1.00 59.29  ? 244 MSE A SE    1 
HETATM 1941 C  CE    . MSE A 1 268 ? 54.387 9.023  50.971  1.00 40.97  ? 244 MSE A CE    1 
ATOM   1942 N  N     . SER A 1 269 ? 54.468 9.214  44.147  1.00 25.59  ? 245 SER A N     1 
ATOM   1943 C  CA    . SER A 1 269 ? 53.526 9.532  43.063  1.00 29.34  ? 245 SER A CA    1 
ATOM   1944 C  C     . SER A 1 269 ? 52.214 10.115 43.607  1.00 30.71  ? 245 SER A C     1 
ATOM   1945 O  O     . SER A 1 269 ? 52.256 11.038 44.425  1.00 29.47  ? 245 SER A O     1 
ATOM   1946 C  CB    . SER A 1 269 ? 53.301 8.304  42.176  1.00 31.64  ? 245 SER A CB    1 
ATOM   1947 O  OG    . SER A 1 269 ? 54.545 7.797  41.714  1.00 33.04  ? 245 SER A OG    1 
ATOM   1948 N  N     . GLU A 1 270 ? 51.069 9.572  43.177  1.00 32.28  ? 246 GLU A N     1 
ATOM   1949 C  CA    . GLU A 1 270 ? 49.745 10.052 43.611  1.00 32.62  ? 246 GLU A CA    1 
ATOM   1950 C  C     . GLU A 1 270 ? 49.533 9.992  45.133  1.00 35.12  ? 246 GLU A C     1 
ATOM   1951 O  O     . GLU A 1 270 ? 48.636 10.659 45.664  1.00 32.56  ? 246 GLU A O     1 
ATOM   1952 C  CB    . GLU A 1 270 ? 48.613 9.305  42.881  1.00 34.81  ? 246 GLU A CB    1 
ATOM   1953 C  CG    . GLU A 1 270 ? 48.326 7.895  43.388  1.00 35.41  ? 246 GLU A CG    1 
ATOM   1954 C  CD    . GLU A 1 270 ? 49.212 6.831  42.764  1.00 40.90  ? 246 GLU A CD    1 
ATOM   1955 O  OE1   . GLU A 1 270 ? 50.159 7.176  42.025  1.00 40.53  ? 246 GLU A OE1   1 
ATOM   1956 O  OE2   . GLU A 1 270 ? 48.952 5.632  43.011  1.00 47.76  ? 246 GLU A OE2   1 
ATOM   1957 N  N     . ASN A 1 271 ? 50.359 9.201  45.819  1.00 34.29  ? 247 ASN A N     1 
ATOM   1958 C  CA    . ASN A 1 271 ? 50.310 9.082  47.281  1.00 34.08  ? 247 ASN A CA    1 
ATOM   1959 C  C     . ASN A 1 271 ? 51.162 10.118 48.018  1.00 31.27  ? 247 ASN A C     1 
ATOM   1960 O  O     . ASN A 1 271 ? 51.338 10.033 49.234  1.00 33.71  ? 247 ASN A O     1 
ATOM   1961 C  CB    . ASN A 1 271 ? 50.692 7.664  47.724  1.00 32.06  ? 247 ASN A CB    1 
ATOM   1962 C  CG    . ASN A 1 271 ? 49.726 6.607  47.217  1.00 40.35  ? 247 ASN A CG    1 
ATOM   1963 O  OD1   . ASN A 1 271 ? 48.510 6.742  47.347  1.00 45.67  ? 247 ASN A OD1   1 
ATOM   1964 N  ND2   . ASN A 1 271 ? 50.269 5.540  46.646  1.00 42.50  ? 247 ASN A ND2   1 
ATOM   1965 N  N     . GLY A 1 272 ? 51.679 11.092 47.272  1.00 29.41  ? 248 GLY A N     1 
ATOM   1966 C  CA    . GLY A 1 272 ? 52.407 12.221 47.838  1.00 27.15  ? 248 GLY A CA    1 
ATOM   1967 C  C     . GLY A 1 272 ? 53.851 11.923 48.161  1.00 26.81  ? 248 GLY A C     1 
ATOM   1968 O  O     . GLY A 1 272 ? 54.559 11.306 47.363  1.00 29.75  ? 248 GLY A O     1 
ATOM   1969 N  N     . ALA A 1 273 ? 54.292 12.375 49.332  1.00 24.05  ? 249 ALA A N     1 
ATOM   1970 C  CA    . ALA A 1 273 ? 55.682 12.198 49.775  1.00 22.66  ? 249 ALA A CA    1 
ATOM   1971 C  C     . ALA A 1 273 ? 55.792 12.044 51.282  1.00 22.16  ? 249 ALA A C     1 
ATOM   1972 O  O     . ALA A 1 273 ? 54.879 12.403 52.027  1.00 23.51  ? 249 ALA A O     1 
ATOM   1973 C  CB    . ALA A 1 273 ? 56.550 13.370 49.329  1.00 24.98  ? 249 ALA A CB    1 
ATOM   1974 N  N     . VAL A 1 274 ? 56.929 11.507 51.707  1.00 22.79  ? 250 VAL A N     1 
ATOM   1975 C  CA    . VAL A 1 274 ? 57.293 11.466 53.131  1.00 23.26  ? 250 VAL A CA    1 
ATOM   1976 C  C     . VAL A 1 274 ? 58.744 11.912 53.302  1.00 21.83  ? 250 VAL A C     1 
ATOM   1977 O  O     . VAL A 1 274 ? 59.675 11.383 52.658  1.00 23.17  ? 250 VAL A O     1 
ATOM   1978 C  CB    . VAL A 1 274 ? 57.013 10.092 53.786  1.00 25.91  ? 250 VAL A CB    1 
ATOM   1979 C  CG1   . VAL A 1 274 ? 57.668 8.960  53.009  1.00 28.28  ? 250 VAL A CG1   1 
ATOM   1980 C  CG2   . VAL A 1 274 ? 57.467 10.070 55.246  1.00 24.60  ? 250 VAL A CG2   1 
ATOM   1981 N  N     . ILE A 1 275 ? 58.920 12.926 54.141  1.00 20.71  ? 251 ILE A N     1 
ATOM   1982 C  CA    . ILE A 1 275 ? 60.253 13.431 54.458  1.00 20.13  ? 251 ILE A CA    1 
ATOM   1983 C  C     . ILE A 1 275 ? 60.683 12.790 55.787  1.00 20.86  ? 251 ILE A C     1 
ATOM   1984 O  O     . ILE A 1 275 ? 59.882 12.703 56.728  1.00 20.21  ? 251 ILE A O     1 
ATOM   1985 C  CB    . ILE A 1 275 ? 60.280 14.971 54.576  1.00 20.75  ? 251 ILE A CB    1 
ATOM   1986 C  CG1   . ILE A 1 275 ? 59.366 15.633 53.524  1.00 22.99  ? 251 ILE A CG1   1 
ATOM   1987 C  CG2   . ILE A 1 275 ? 61.707 15.485 54.472  1.00 20.80  ? 251 ILE A CG2   1 
ATOM   1988 C  CD1   . ILE A 1 275 ? 59.673 15.250 52.086  1.00 23.68  ? 251 ILE A CD1   1 
ATOM   1989 N  N     . LEU A 1 276 ? 61.936 12.339 55.837  1.00 20.75  ? 252 LEU A N     1 
ATOM   1990 C  CA    . LEU A 1 276 ? 62.475 11.604 56.985  1.00 20.32  ? 252 LEU A CA    1 
ATOM   1991 C  C     . LEU A 1 276 ? 63.741 12.268 57.481  1.00 23.34  ? 252 LEU A C     1 
ATOM   1992 O  O     . LEU A 1 276 ? 64.629 12.574 56.693  1.00 20.52  ? 252 LEU A O     1 
ATOM   1993 C  CB    . LEU A 1 276 ? 62.785 10.149 56.612  1.00 21.92  ? 252 LEU A CB    1 
ATOM   1994 C  CG    . LEU A 1 276 ? 61.585 9.273  56.226  1.00 28.26  ? 252 LEU A CG    1 
ATOM   1995 C  CD1   . LEU A 1 276 ? 61.467 9.185  54.710  1.00 33.96  ? 252 LEU A CD1   1 
ATOM   1996 C  CD2   . LEU A 1 276 ? 61.682 7.883  56.841  1.00 28.26  ? 252 LEU A CD2   1 
ATOM   1997 N  N     . LYS A 1 277 ? 63.825 12.474 58.795  1.00 24.17  ? 253 LYS A N     1 
ATOM   1998 C  CA    . LYS A 1 277 ? 65.019 13.029 59.420  1.00 24.21  ? 253 LYS A CA    1 
ATOM   1999 C  C     . LYS A 1 277 ? 65.173 12.326 60.757  1.00 23.60  ? 253 LYS A C     1 
ATOM   2000 O  O     . LYS A 1 277 ? 64.421 12.607 61.699  1.00 27.04  ? 253 LYS A O     1 
ATOM   2001 C  CB    . LYS A 1 277 ? 64.906 14.548 59.631  1.00 21.53  ? 253 LYS A CB    1 
ATOM   2002 C  CG    . LYS A 1 277 ? 66.192 15.192 60.151  1.00 24.00  ? 253 LYS A CG    1 
ATOM   2003 C  CD    . LYS A 1 277 ? 66.037 16.693 60.337  1.00 25.26  ? 253 LYS A CD    1 
ATOM   2004 C  CE    . LYS A 1 277 ? 67.285 17.303 60.962  1.00 30.26  ? 253 LYS A CE    1 
ATOM   2005 N  NZ    . LYS A 1 277 ? 67.153 18.779 61.122  1.00 36.87  ? 253 LYS A NZ    1 
ATOM   2006 N  N     . GLY A 1 278 ? 66.136 11.416 60.830  1.00 24.47  ? 254 GLY A N     1 
ATOM   2007 C  CA    . GLY A 1 278 ? 66.336 10.613 62.044  1.00 25.85  ? 254 GLY A CA    1 
ATOM   2008 C  C     . GLY A 1 278 ? 65.102 9.758  62.262  1.00 27.93  ? 254 GLY A C     1 
ATOM   2009 O  O     . GLY A 1 278 ? 64.768 8.909  61.423  1.00 31.94  ? 254 GLY A O     1 
ATOM   2010 N  N     . ARG A 1 279 ? 64.408 10.016 63.368  1.00 28.86  ? 255 ARG A N     1 
ATOM   2011 C  CA    . ARG A 1 279 ? 63.155 9.334  63.697  1.00 31.62  ? 255 ARG A CA    1 
ATOM   2012 C  C     . ARG A 1 279 ? 61.904 10.133 63.308  1.00 30.87  ? 255 ARG A C     1 
ATOM   2013 O  O     . ARG A 1 279 ? 60.783 9.629  63.415  1.00 32.33  ? 255 ARG A O     1 
ATOM   2014 C  CB    . ARG A 1 279 ? 63.132 8.969  65.189  1.00 34.05  ? 255 ARG A CB    1 
ATOM   2015 C  CG    . ARG A 1 279 ? 64.423 8.303  65.633  1.00 39.81  ? 255 ARG A CG    1 
ATOM   2016 C  CD    . ARG A 1 279 ? 64.279 7.557  66.948  1.00 46.59  ? 255 ARG A CD    1 
ATOM   2017 N  NE    . ARG A 1 279 ? 65.449 6.719  67.207  1.00 43.75  ? 255 ARG A NE    1 
ATOM   2018 C  CZ    . ARG A 1 279 ? 66.352 6.944  68.160  1.00 47.38  ? 255 ARG A CZ    1 
ATOM   2019 N  NH1   . ARG A 1 279 ? 66.235 7.989  68.977  1.00 45.35  ? 255 ARG A NH1   1 
ATOM   2020 N  NH2   . ARG A 1 279 ? 67.375 6.112  68.304  1.00 56.34  ? 255 ARG A NH2   1 
ATOM   2021 N  N     . GLU A 1 280 ? 62.096 11.368 62.846  1.00 31.75  ? 256 GLU A N     1 
ATOM   2022 C  CA    . GLU A 1 280 ? 60.986 12.219 62.413  1.00 31.92  ? 256 GLU A CA    1 
ATOM   2023 C  C     . GLU A 1 280 ? 60.468 11.802 61.034  1.00 30.46  ? 256 GLU A C     1 
ATOM   2024 O  O     . GLU A 1 280 ? 61.254 11.503 60.132  1.00 29.51  ? 256 GLU A O     1 
ATOM   2025 C  CB    . GLU A 1 280 ? 61.420 13.688 62.346  1.00 31.96  ? 256 GLU A CB    1 
ATOM   2026 C  CG    . GLU A 1 280 ? 62.095 14.242 63.596  1.00 36.53  ? 256 GLU A CG    1 
ATOM   2027 C  CD    . GLU A 1 280 ? 62.823 15.550 63.325  1.00 43.34  ? 256 GLU A CD    1 
ATOM   2028 O  OE1   . GLU A 1 280 ? 62.406 16.302 62.413  1.00 42.29  ? 256 GLU A OE1   1 
ATOM   2029 O  OE2   . GLU A 1 280 ? 63.823 15.828 64.021  1.00 51.22  ? 256 GLU A OE2   1 
ATOM   2030 N  N     . ARG A 1 281 ? 59.145 11.784 60.880  1.00 28.72  ? 257 ARG A N     1 
ATOM   2031 C  CA    . ARG A 1 281 ? 58.510 11.564 59.575  1.00 28.67  ? 257 ARG A CA    1 
ATOM   2032 C  C     . ARG A 1 281 ? 57.458 12.633 59.318  1.00 27.95  ? 257 ARG A C     1 
ATOM   2033 O  O     . ARG A 1 281 ? 56.617 12.896 60.173  1.00 30.80  ? 257 ARG A O     1 
ATOM   2034 C  CB    . ARG A 1 281 ? 57.879 10.165 59.465  1.00 28.92  ? 257 ARG A CB    1 
ATOM   2035 C  CG    . ARG A 1 281 ? 58.867 9.035  59.181  1.00 27.45  ? 257 ARG A CG    1 
ATOM   2036 C  CD    . ARG A 1 281 ? 58.141 7.740  58.834  1.00 31.40  ? 257 ARG A CD    1 
ATOM   2037 N  NE    . ARG A 1 281 ? 59.046 6.590  58.789  1.00 35.18  ? 257 ARG A NE    1 
ATOM   2038 C  CZ    . ARG A 1 281 ? 58.663 5.327  58.611  1.00 33.21  ? 257 ARG A CZ    1 
ATOM   2039 N  NH1   . ARG A 1 281 ? 57.377 5.025  58.451  1.00 34.69  ? 257 ARG A NH1   1 
ATOM   2040 N  NH2   . ARG A 1 281 ? 59.568 4.360  58.591  1.00 38.53  ? 257 ARG A NH2   1 
ATOM   2041 N  N     . TYR A 1 282 ? 57.501 13.242 58.135  1.00 27.85  ? 258 TYR A N     1 
ATOM   2042 C  CA    . TYR A 1 282 ? 56.534 14.271 57.773  1.00 26.84  ? 258 TYR A CA    1 
ATOM   2043 C  C     . TYR A 1 282 ? 55.850 13.875 56.473  1.00 25.03  ? 258 TYR A C     1 
ATOM   2044 O  O     . TYR A 1 282 ? 56.483 13.863 55.434  1.00 26.23  ? 258 TYR A O     1 
ATOM   2045 C  CB    . TYR A 1 282 ? 57.222 15.636 57.625  1.00 31.00  ? 258 TYR A CB    1 
ATOM   2046 C  CG    . TYR A 1 282 ? 57.947 16.093 58.864  1.00 31.69  ? 258 TYR A CG    1 
ATOM   2047 C  CD1   . TYR A 1 282 ? 57.265 16.737 59.894  1.00 32.93  ? 258 TYR A CD1   1 
ATOM   2048 C  CD2   . TYR A 1 282 ? 59.317 15.883 59.005  1.00 28.14  ? 258 TYR A CD2   1 
ATOM   2049 C  CE1   . TYR A 1 282 ? 57.929 17.146 61.035  1.00 34.21  ? 258 TYR A CE1   1 
ATOM   2050 C  CE2   . TYR A 1 282 ? 59.992 16.289 60.142  1.00 29.37  ? 258 TYR A CE2   1 
ATOM   2051 C  CZ    . TYR A 1 282 ? 59.292 16.922 61.150  1.00 33.61  ? 258 TYR A CZ    1 
ATOM   2052 O  OH    . TYR A 1 282 ? 59.954 17.338 62.284  1.00 40.39  ? 258 TYR A OH    1 
ATOM   2053 N  N     . TYR A 1 283 ? 54.574 13.513 56.565  1.00 26.54  ? 259 TYR A N     1 
ATOM   2054 C  CA    . TYR A 1 283 ? 53.794 13.036 55.416  1.00 22.49  ? 259 TYR A CA    1 
ATOM   2055 C  C     . TYR A 1 283 ? 53.049 14.169 54.733  1.00 24.01  ? 259 TYR A C     1 
ATOM   2056 O  O     . TYR A 1 283 ? 52.398 14.983 55.387  1.00 23.65  ? 259 TYR A O     1 
ATOM   2057 C  CB    . TYR A 1 283 ? 52.794 11.970 55.847  1.00 26.00  ? 259 TYR A CB    1 
ATOM   2058 C  CG    . TYR A 1 283 ? 53.387 10.599 56.046  1.00 31.54  ? 259 TYR A CG    1 
ATOM   2059 C  CD1   . TYR A 1 283 ? 53.450 9.679  54.994  1.00 32.24  ? 259 TYR A CD1   1 
ATOM   2060 C  CD2   . TYR A 1 283 ? 53.877 10.214 57.289  1.00 33.93  ? 259 TYR A CD2   1 
ATOM   2061 C  CE1   . TYR A 1 283 ? 53.993 8.410  55.185  1.00 35.54  ? 259 TYR A CE1   1 
ATOM   2062 C  CE2   . TYR A 1 283 ? 54.420 8.957  57.488  1.00 36.21  ? 259 TYR A CE2   1 
ATOM   2063 C  CZ    . TYR A 1 283 ? 54.474 8.058  56.444  1.00 38.50  ? 259 TYR A CZ    1 
ATOM   2064 O  OH    . TYR A 1 283 ? 55.020 6.817  56.671  1.00 41.92  ? 259 TYR A OH    1 
ATOM   2065 N  N     . VAL A 1 284 ? 53.143 14.197 53.404  1.00 27.85  ? 260 VAL A N     1 
ATOM   2066 C  CA    . VAL A 1 284 ? 52.574 15.264 52.585  1.00 28.15  ? 260 VAL A CA    1 
ATOM   2067 C  C     . VAL A 1 284 ? 51.728 14.643 51.473  1.00 25.96  ? 260 VAL A C     1 
ATOM   2068 O  O     . VAL A 1 284 ? 52.125 13.644 50.875  1.00 23.86  ? 260 VAL A O     1 
ATOM   2069 C  CB    . VAL A 1 284 ? 53.690 16.148 51.963  1.00 30.71  ? 260 VAL A CB    1 
ATOM   2070 C  CG1   . VAL A 1 284 ? 53.137 17.105 50.916  1.00 33.21  ? 260 VAL A CG1   1 
ATOM   2071 C  CG2   . VAL A 1 284 ? 54.422 16.940 53.036  1.00 28.78  ? 260 VAL A CG2   1 
ATOM   2072 N  N     . ASN A 1 285 ? 50.568 15.251 51.220  1.00 28.96  ? 261 ASN A N     1 
ATOM   2073 C  CA    . ASN A 1 285 ? 49.660 14.851 50.143  1.00 30.12  ? 261 ASN A CA    1 
ATOM   2074 C  C     . ASN A 1 285 ? 50.065 15.384 48.770  1.00 31.42  ? 261 ASN A C     1 
ATOM   2075 O  O     . ASN A 1 285 ? 50.635 16.476 48.646  1.00 33.51  ? 261 ASN A O     1 
ATOM   2076 C  CB    . ASN A 1 285 ? 48.225 15.322 50.447  1.00 34.54  ? 261 ASN A CB    1 
ATOM   2077 C  CG    . ASN A 1 285 ? 47.600 14.608 51.635  1.00 39.32  ? 261 ASN A CG    1 
ATOM   2078 O  OD1   . ASN A 1 285 ? 48.003 13.500 52.004  1.00 42.45  ? 261 ASN A OD1   1 
ATOM   2079 N  ND2   . ASN A 1 285 ? 46.596 15.242 52.239  1.00 36.52  ? 261 ASN A ND2   1 
ATOM   2080 N  N     . ALA A 1 286 ? 49.747 14.608 47.738  1.00 29.87  ? 262 ALA A N     1 
ATOM   2081 C  CA    . ALA A 1 286 ? 49.838 15.083 46.357  1.00 29.98  ? 262 ALA A CA    1 
ATOM   2082 C  C     . ALA A 1 286 ? 48.687 16.041 46.081  1.00 27.17  ? 262 ALA A C     1 
ATOM   2083 O  O     . ALA A 1 286 ? 47.557 15.793 46.502  1.00 29.68  ? 262 ALA A O     1 
ATOM   2084 C  CB    . ALA A 1 286 ? 49.788 13.913 45.396  1.00 29.89  ? 262 ALA A CB    1 
ATOM   2085 N  N     . ILE A 1 287 ? 48.975 17.132 45.375  1.00 31.13  ? 263 ILE A N     1 
ATOM   2086 C  CA    . ILE A 1 287 ? 47.937 18.084 44.962  1.00 32.13  ? 263 ILE A CA    1 
ATOM   2087 C  C     . ILE A 1 287 ? 46.933 17.419 44.006  1.00 30.97  ? 263 ILE A C     1 
ATOM   2088 O  O     . ILE A 1 287 ? 47.246 16.403 43.374  1.00 34.48  ? 263 ILE A O     1 
ATOM   2089 C  CB    . ILE A 1 287 ? 48.540 19.374 44.335  1.00 28.98  ? 263 ILE A CB    1 
ATOM   2090 C  CG1   . ILE A 1 287 ? 49.224 19.079 42.989  1.00 29.61  ? 263 ILE A CG1   1 
ATOM   2091 C  CG2   . ILE A 1 287 ? 49.480 20.069 45.324  1.00 35.31  ? 263 ILE A CG2   1 
ATOM   2092 C  CD1   . ILE A 1 287 ? 49.537 20.319 42.177  1.00 32.22  ? 263 ILE A CD1   1 
ATOM   2093 N  N     . ARG A 1 288 ? 45.728 17.980 43.915  1.00 31.69  ? 264 ARG A N     1 
ATOM   2094 C  CA    . ARG A 1 288 ? 44.721 17.455 42.996  1.00 36.32  ? 264 ARG A CA    1 
ATOM   2095 C  C     . ARG A 1 288 ? 45.107 17.731 41.541  1.00 37.86  ? 264 ARG A C     1 
ATOM   2096 O  O     . ARG A 1 288 ? 45.538 18.836 41.192  1.00 38.44  ? 264 ARG A O     1 
ATOM   2097 C  CB    . ARG A 1 288 ? 43.328 18.000 43.317  1.00 43.92  ? 264 ARG A CB    1 
ATOM   2098 C  CG    . ARG A 1 288 ? 42.203 17.128 42.777  1.00 51.58  ? 264 ARG A CG    1 
ATOM   2099 C  CD    . ARG A 1 288 ? 41.055 17.007 43.768  1.00 69.55  ? 264 ARG A CD    1 
ATOM   2100 N  NE    . ARG A 1 288 ? 41.405 16.197 44.938  1.00 84.09  ? 264 ARG A NE    1 
ATOM   2101 C  CZ    . ARG A 1 288 ? 40.548 15.833 45.891  1.00 90.91  ? 264 ARG A CZ    1 
ATOM   2102 N  NH1   . ARG A 1 288 ? 39.274 16.198 45.826  1.00 106.20 ? 264 ARG A NH1   1 
ATOM   2103 N  NH2   . ARG A 1 288 ? 40.966 15.098 46.914  1.00 86.46  ? 264 ARG A NH2   1 
ATOM   2104 N  N     . ILE A 1 289 ? 44.960 16.707 40.706  1.00 41.77  ? 265 ILE A N     1 
ATOM   2105 C  CA    . ILE A 1 289 ? 45.412 16.747 39.320  1.00 45.60  ? 265 ILE A CA    1 
ATOM   2106 C  C     . ILE A 1 289 ? 44.213 16.692 38.385  1.00 45.60  ? 265 ILE A C     1 
ATOM   2107 O  O     . ILE A 1 289 ? 43.321 15.862 38.563  1.00 42.64  ? 265 ILE A O     1 
ATOM   2108 C  CB    . ILE A 1 289 ? 46.353 15.551 39.012  1.00 49.17  ? 265 ILE A CB    1 
ATOM   2109 C  CG1   . ILE A 1 289 ? 47.491 15.455 40.045  1.00 49.83  ? 265 ILE A CG1   1 
ATOM   2110 C  CG2   . ILE A 1 289 ? 46.890 15.609 37.584  1.00 48.42  ? 265 ILE A CG2   1 
ATOM   2111 C  CD1   . ILE A 1 289 ? 48.465 16.616 40.044  1.00 50.13  ? 265 ILE A CD1   1 
ATOM   2112 N  N     . ARG A 1 290 ? 44.194 17.586 37.398  1.00 45.34  ? 266 ARG A N     1 
ATOM   2113 C  CA    . ARG A 1 290 ? 43.184 17.543 36.345  1.00 46.56  ? 266 ARG A CA    1 
ATOM   2114 C  C     . ARG A 1 290 ? 43.359 16.274 35.513  1.00 44.24  ? 266 ARG A C     1 
ATOM   2115 O  O     . ARG A 1 290 ? 42.409 15.518 35.308  1.00 40.77  ? 266 ARG A O     1 
ATOM   2116 C  CB    . ARG A 1 290 ? 43.277 18.781 35.446  1.00 49.85  ? 266 ARG A CB    1 
ATOM   2117 C  CG    . ARG A 1 290 ? 42.737 20.056 36.073  1.00 58.76  ? 266 ARG A CG    1 
ATOM   2118 C  CD    . ARG A 1 290 ? 42.865 21.228 35.111  1.00 70.84  ? 266 ARG A CD    1 
ATOM   2119 N  NE    . ARG A 1 290 ? 42.343 22.470 35.680  1.00 83.59  ? 266 ARG A NE    1 
ATOM   2120 C  CZ    . ARG A 1 290 ? 42.351 23.649 35.061  1.00 93.10  ? 266 ARG A CZ    1 
ATOM   2121 N  NH1   . ARG A 1 290 ? 42.858 23.767 33.839  1.00 97.84  ? 266 ARG A NH1   1 
ATOM   2122 N  NH2   . ARG A 1 290 ? 41.851 24.717 35.667  1.00 94.73  ? 266 ARG A NH2   1 
ATOM   2123 N  N     . GLU A 1 291 ? 44.590 16.039 35.066  1.00 41.59  ? 267 GLU A N     1 
ATOM   2124 C  CA    . GLU A 1 291 ? 44.917 14.914 34.201  1.00 42.59  ? 267 GLU A CA    1 
ATOM   2125 C  C     . GLU A 1 291 ? 46.427 14.717 34.151  1.00 37.07  ? 267 GLU A C     1 
ATOM   2126 O  O     . GLU A 1 291 ? 47.185 15.683 34.034  1.00 38.27  ? 267 GLU A O     1 
ATOM   2127 C  CB    . GLU A 1 291 ? 44.378 15.170 32.789  1.00 46.32  ? 267 GLU A CB    1 
ATOM   2128 C  CG    . GLU A 1 291 ? 44.538 14.013 31.813  1.00 45.34  ? 267 GLU A CG    1 
ATOM   2129 C  CD    . GLU A 1 291 ? 44.228 14.415 30.383  1.00 45.65  ? 267 GLU A CD    1 
ATOM   2130 O  OE1   . GLU A 1 291 ? 44.396 13.571 29.480  1.00 50.18  ? 267 GLU A OE1   1 
ATOM   2131 O  OE2   . GLU A 1 291 ? 43.820 15.575 30.159  1.00 40.62  ? 267 GLU A OE2   1 
ATOM   2132 N  N     . VAL A 1 292 ? 46.861 13.465 34.244  1.00 37.85  ? 268 VAL A N     1 
ATOM   2133 C  CA    . VAL A 1 292 ? 48.272 13.130 34.066  1.00 34.93  ? 268 VAL A CA    1 
ATOM   2134 C  C     . VAL A 1 292 ? 48.582 13.134 32.566  1.00 34.57  ? 268 VAL A C     1 
ATOM   2135 O  O     . VAL A 1 292 ? 48.308 12.160 31.848  1.00 40.09  ? 268 VAL A O     1 
ATOM   2136 C  CB    . VAL A 1 292 ? 48.620 11.764 34.693  1.00 36.78  ? 268 VAL A CB    1 
ATOM   2137 C  CG1   . VAL A 1 292 ? 50.087 11.432 34.478  1.00 35.19  ? 268 VAL A CG1   1 
ATOM   2138 C  CG2   . VAL A 1 292 ? 48.284 11.755 36.180  1.00 36.49  ? 268 VAL A CG2   1 
ATOM   2139 N  N     . VAL A 1 293 ? 49.133 14.252 32.103  1.00 31.18  ? 269 VAL A N     1 
ATOM   2140 C  CA    . VAL A 1 293 ? 49.459 14.452 30.690  1.00 27.88  ? 269 VAL A CA    1 
ATOM   2141 C  C     . VAL A 1 293 ? 50.768 13.744 30.343  1.00 23.62  ? 269 VAL A C     1 
ATOM   2142 O  O     . VAL A 1 293 ? 50.843 12.996 29.368  1.00 24.28  ? 269 VAL A O     1 
ATOM   2143 C  CB    . VAL A 1 293 ? 49.534 15.966 30.348  1.00 28.66  ? 269 VAL A CB    1 
ATOM   2144 C  CG1   . VAL A 1 293 ? 50.123 16.198 28.954  1.00 25.49  ? 269 VAL A CG1   1 
ATOM   2145 C  CG2   . VAL A 1 293 ? 48.156 16.618 30.474  1.00 26.14  ? 269 VAL A CG2   1 
ATOM   2146 N  N     . ASP A 1 294 ? 51.792 13.972 31.169  1.00 22.66  ? 270 ASP A N     1 
ATOM   2147 C  CA    . ASP A 1 294 ? 53.138 13.487 30.925  1.00 21.40  ? 270 ASP A CA    1 
ATOM   2148 C  C     . ASP A 1 294 ? 53.910 13.626 32.235  1.00 19.63  ? 270 ASP A C     1 
ATOM   2149 O  O     . ASP A 1 294 ? 54.161 14.741 32.676  1.00 22.93  ? 270 ASP A O     1 
ATOM   2150 C  CB    . ASP A 1 294 ? 53.773 14.315 29.791  1.00 22.37  ? 270 ASP A CB    1 
ATOM   2151 C  CG    . ASP A 1 294 ? 55.277 14.096 29.642  1.00 21.94  ? 270 ASP A CG    1 
ATOM   2152 O  OD1   . ASP A 1 294 ? 55.816 13.078 30.121  1.00 22.51  ? 270 ASP A OD1   1 
ATOM   2153 O  OD2   . ASP A 1 294 ? 55.924 14.964 29.016  1.00 29.05  ? 270 ASP A OD2   1 
ATOM   2154 N  N     . THR A 1 295 ? 54.281 12.494 32.834  1.00 18.37  ? 271 THR A N     1 
ATOM   2155 C  CA    . THR A 1 295 ? 55.006 12.458 34.110  1.00 19.16  ? 271 THR A CA    1 
ATOM   2156 C  C     . THR A 1 295 ? 56.470 12.900 34.037  1.00 18.76  ? 271 THR A C     1 
ATOM   2157 O  O     . THR A 1 295 ? 57.136 12.963 35.075  1.00 22.59  ? 271 THR A O     1 
ATOM   2158 C  CB    . THR A 1 295 ? 54.965 11.047 34.745  1.00 20.33  ? 271 THR A CB    1 
ATOM   2159 O  OG1   . THR A 1 295 ? 55.620 10.096 33.892  1.00 23.14  ? 271 THR A OG1   1 
ATOM   2160 C  CG2   . THR A 1 295 ? 53.530 10.601 34.998  1.00 22.38  ? 271 THR A CG2   1 
ATOM   2161 N  N     . THR A 1 296 ? 56.987 13.163 32.837  1.00 17.80  ? 272 THR A N     1 
ATOM   2162 C  CA    . THR A 1 296 ? 58.382 13.613 32.676  1.00 17.43  ? 272 THR A CA    1 
ATOM   2163 C  C     . THR A 1 296 ? 58.667 14.847 33.521  1.00 17.63  ? 272 THR A C     1 
ATOM   2164 O  O     . THR A 1 296 ? 57.995 15.871 33.380  1.00 16.45  ? 272 THR A O     1 
ATOM   2165 C  CB    . THR A 1 296 ? 58.729 13.945 31.208  1.00 18.24  ? 272 THR A CB    1 
ATOM   2166 O  OG1   . THR A 1 296 ? 58.386 12.831 30.379  1.00 20.48  ? 272 THR A OG1   1 
ATOM   2167 C  CG2   . THR A 1 296 ? 60.226 14.244 31.066  1.00 16.37  ? 272 THR A CG2   1 
ATOM   2168 N  N     . GLY A 1 297 ? 59.652 14.728 34.418  1.00 18.00  ? 273 GLY A N     1 
ATOM   2169 C  CA    . GLY A 1 297 ? 60.072 15.839 35.251  1.00 17.73  ? 273 GLY A CA    1 
ATOM   2170 C  C     . GLY A 1 297 ? 59.494 15.879 36.664  1.00 15.58  ? 273 GLY A C     1 
ATOM   2171 O  O     . GLY A 1 297 ? 59.812 16.798 37.418  1.00 15.32  ? 273 GLY A O     1 
ATOM   2172 N  N     . ALA A 1 298 ? 58.647 14.908 37.018  1.00 14.47  ? 274 ALA A N     1 
ATOM   2173 C  CA    . ALA A 1 298 ? 57.910 14.952 38.289  1.00 16.64  ? 274 ALA A CA    1 
ATOM   2174 C  C     . ALA A 1 298 ? 58.877 14.981 39.472  1.00 16.44  ? 274 ALA A C     1 
ATOM   2175 O  O     . ALA A 1 298 ? 58.779 15.852 40.341  1.00 18.14  ? 274 ALA A O     1 
ATOM   2176 C  CB    . ALA A 1 298 ? 56.970 13.786 38.422  1.00 16.94  ? 274 ALA A CB    1 
ATOM   2177 N  N     . GLY A 1 299 ? 59.805 14.031 39.471  1.00 15.76  ? 275 GLY A N     1 
ATOM   2178 C  CA    . GLY A 1 299 ? 60.819 13.934 40.512  1.00 17.90  ? 275 GLY A CA    1 
ATOM   2179 C  C     . GLY A 1 299 ? 61.740 15.132 40.478  1.00 17.22  ? 275 GLY A C     1 
ATOM   2180 O  O     . GLY A 1 299 ? 62.097 15.680 41.540  1.00 18.13  ? 275 GLY A O     1 
ATOM   2181 N  N     . ASP A 1 300 ? 62.103 15.575 39.267  1.00 18.14  ? 276 ASP A N     1 
ATOM   2182 C  CA    . ASP A 1 300 ? 62.994 16.717 39.125  1.00 18.08  ? 276 ASP A CA    1 
ATOM   2183 C  C     . ASP A 1 300 ? 62.406 17.949 39.787  1.00 16.15  ? 276 ASP A C     1 
ATOM   2184 O  O     . ASP A 1 300 ? 63.102 18.640 40.521  1.00 16.86  ? 276 ASP A O     1 
ATOM   2185 C  CB    . ASP A 1 300 ? 63.310 17.045 37.663  1.00 18.44  ? 276 ASP A CB    1 
ATOM   2186 C  CG    . ASP A 1 300 ? 63.819 15.861 36.876  1.00 19.00  ? 276 ASP A CG    1 
ATOM   2187 O  OD1   . ASP A 1 300 ? 64.352 14.900 37.469  1.00 18.49  ? 276 ASP A OD1   1 
ATOM   2188 O  OD2   . ASP A 1 300 ? 63.701 15.913 35.625  1.00 19.21  ? 276 ASP A OD2   1 
ATOM   2189 N  N     . LEU A 1 301 ? 61.128 18.200 39.534  1.00 15.73  ? 277 LEU A N     1 
ATOM   2190 C  CA    . LEU A 1 301 ? 60.448 19.395 40.039  1.00 16.43  ? 277 LEU A CA    1 
ATOM   2191 C  C     . LEU A 1 301 ? 60.047 19.283 41.506  1.00 16.07  ? 277 LEU A C     1 
ATOM   2192 O  O     . LEU A 1 301 ? 59.964 20.305 42.190  1.00 16.71  ? 277 LEU A O     1 
ATOM   2193 C  CB    . LEU A 1 301 ? 59.234 19.754 39.195  1.00 16.13  ? 277 LEU A CB    1 
ATOM   2194 C  CG    . LEU A 1 301 ? 59.467 20.625 37.959  1.00 14.88  ? 277 LEU A CG    1 
ATOM   2195 C  CD1   . LEU A 1 301 ? 59.815 22.032 38.415  1.00 17.82  ? 277 LEU A CD1   1 
ATOM   2196 C  CD2   . LEU A 1 301 ? 60.578 20.086 37.080  1.00 14.71  ? 277 LEU A CD2   1 
ATOM   2197 N  N     . PHE A 1 302 ? 59.767 18.068 41.966  1.00 16.54  ? 278 PHE A N     1 
ATOM   2198 C  CA    . PHE A 1 302 ? 59.679 17.836 43.434  1.00 17.55  ? 278 PHE A CA    1 
ATOM   2199 C  C     . PHE A 1 302 ? 60.912 18.366 44.179  1.00 17.34  ? 278 PHE A C     1 
ATOM   2200 O  O     . PHE A 1 302 ? 60.791 19.070 45.225  1.00 16.57  ? 278 PHE A O     1 
ATOM   2201 C  CB    . PHE A 1 302 ? 59.443 16.364 43.774  1.00 17.53  ? 278 PHE A CB    1 
ATOM   2202 C  CG    . PHE A 1 302 ? 59.401 16.109 45.269  1.00 16.25  ? 278 PHE A CG    1 
ATOM   2203 C  CD1   . PHE A 1 302 ? 58.202 16.237 45.963  1.00 17.81  ? 278 PHE A CD1   1 
ATOM   2204 C  CD2   . PHE A 1 302 ? 60.563 15.802 45.976  1.00 17.14  ? 278 PHE A CD2   1 
ATOM   2205 C  CE1   . PHE A 1 302 ? 58.149 16.030 47.335  1.00 20.69  ? 278 PHE A CE1   1 
ATOM   2206 C  CE2   . PHE A 1 302 ? 60.516 15.615 47.365  1.00 18.00  ? 278 PHE A CE2   1 
ATOM   2207 C  CZ    . PHE A 1 302 ? 59.310 15.719 48.030  1.00 18.24  ? 278 PHE A CZ    1 
ATOM   2208 N  N     . ALA A 1 303 ? 62.088 18.036 43.651  1.00 16.30  ? 279 ALA A N     1 
ATOM   2209 C  CA    . ALA A 1 303 ? 63.349 18.520 44.202  1.00 15.97  ? 279 ALA A CA    1 
ATOM   2210 C  C     . ALA A 1 303 ? 63.476 20.029 44.060  1.00 15.58  ? 279 ALA A C     1 
ATOM   2211 O  O     . ALA A 1 303 ? 64.040 20.693 44.929  1.00 19.78  ? 279 ALA A O     1 
ATOM   2212 C  CB    . ALA A 1 303 ? 64.535 17.803 43.565  1.00 17.01  ? 279 ALA A CB    1 
ATOM   2213 N  N     . SER A 1 304 ? 62.977 20.594 42.964  1.00 16.06  ? 280 SER A N     1 
ATOM   2214 C  CA    . SER A 1 304 ? 62.985 22.042 42.862  1.00 16.07  ? 280 SER A CA    1 
ATOM   2215 C  C     . SER A 1 304 ? 62.218 22.680 44.040  1.00 20.31  ? 280 SER A C     1 
ATOM   2216 O  O     . SER A 1 304 ? 62.729 23.593 44.725  1.00 21.44  ? 280 SER A O     1 
ATOM   2217 C  CB    . SER A 1 304 ? 62.369 22.483 41.523  1.00 15.74  ? 280 SER A CB    1 
ATOM   2218 O  OG    . SER A 1 304 ? 63.203 22.102 40.438  1.00 17.05  ? 280 SER A OG    1 
ATOM   2219 N  N     . GLY A 1 305 ? 61.005 22.179 44.283  1.00 20.33  ? 281 GLY A N     1 
ATOM   2220 C  CA    . GLY A 1 305 ? 60.131 22.752 45.290  1.00 22.64  ? 281 GLY A CA    1 
ATOM   2221 C  C     . GLY A 1 305 ? 60.775 22.533 46.644  1.00 20.44  ? 281 GLY A C     1 
ATOM   2222 O  O     . GLY A 1 305 ? 60.936 23.486 47.438  1.00 20.29  ? 281 GLY A O     1 
ATOM   2223 N  N     . PHE A 1 306 ? 61.214 21.296 46.869  1.00 20.60  ? 282 PHE A N     1 
ATOM   2224 C  CA    . PHE A 1 306 ? 61.846 20.931 48.154  1.00 19.59  ? 282 PHE A CA    1 
ATOM   2225 C  C     . PHE A 1 306 ? 63.069 21.784 48.492  1.00 21.01  ? 282 PHE A C     1 
ATOM   2226 O  O     . PHE A 1 306 ? 63.192 22.338 49.611  1.00 19.50  ? 282 PHE A O     1 
ATOM   2227 C  CB    . PHE A 1 306 ? 62.226 19.451 48.216  1.00 18.14  ? 282 PHE A CB    1 
ATOM   2228 C  CG    . PHE A 1 306 ? 62.635 19.003 49.620  1.00 20.53  ? 282 PHE A CG    1 
ATOM   2229 C  CD1   . PHE A 1 306 ? 63.874 19.366 50.155  1.00 21.18  ? 282 PHE A CD1   1 
ATOM   2230 C  CD2   . PHE A 1 306 ? 61.758 18.271 50.418  1.00 25.17  ? 282 PHE A CD2   1 
ATOM   2231 C  CE1   . PHE A 1 306 ? 64.241 18.982 51.446  1.00 21.44  ? 282 PHE A CE1   1 
ATOM   2232 C  CE2   . PHE A 1 306 ? 62.114 17.885 51.710  1.00 24.38  ? 282 PHE A CE2   1 
ATOM   2233 C  CZ    . PHE A 1 306 ? 63.355 18.238 52.224  1.00 22.12  ? 282 PHE A CZ    1 
ATOM   2234 N  N     . LEU A 1 307 ? 63.979 21.882 47.529  1.00 18.67  ? 283 LEU A N     1 
ATOM   2235 C  CA    . LEU A 1 307 ? 65.227 22.579 47.744  1.00 17.39  ? 283 LEU A CA    1 
ATOM   2236 C  C     . LEU A 1 307 ? 65.056 24.093 47.850  1.00 16.92  ? 283 LEU A C     1 
ATOM   2237 O  O     . LEU A 1 307 ? 65.874 24.738 48.495  1.00 16.54  ? 283 LEU A O     1 
ATOM   2238 C  CB    . LEU A 1 307 ? 66.260 22.188 46.690  1.00 16.86  ? 283 LEU A CB    1 
ATOM   2239 C  CG    . LEU A 1 307 ? 66.761 20.743 46.720  1.00 18.23  ? 283 LEU A CG    1 
ATOM   2240 C  CD1   . LEU A 1 307 ? 67.715 20.465 45.560  1.00 21.68  ? 283 LEU A CD1   1 
ATOM   2241 C  CD2   . LEU A 1 307 ? 67.408 20.395 48.083  1.00 18.09  ? 283 LEU A CD2   1 
ATOM   2242 N  N     . TYR A 1 308 ? 64.003 24.632 47.212  1.00 17.84  ? 284 TYR A N     1 
ATOM   2243 C  CA    . TYR A 1 308 ? 63.646 26.042 47.317  1.00 18.28  ? 284 TYR A CA    1 
ATOM   2244 C  C     . TYR A 1 308 ? 63.198 26.328 48.749  1.00 21.01  ? 284 TYR A C     1 
ATOM   2245 O  O     . TYR A 1 308 ? 63.805 27.159 49.447  1.00 22.01  ? 284 TYR A O     1 
ATOM   2246 C  CB    . TYR A 1 308 ? 62.526 26.414 46.328  1.00 17.46  ? 284 TYR A CB    1 
ATOM   2247 C  CG    . TYR A 1 308 ? 61.930 27.794 46.533  1.00 19.55  ? 284 TYR A CG    1 
ATOM   2248 C  CD1   . TYR A 1 308 ? 62.609 28.943 46.115  1.00 22.63  ? 284 TYR A CD1   1 
ATOM   2249 C  CD2   . TYR A 1 308 ? 60.673 27.957 47.109  1.00 25.28  ? 284 TYR A CD2   1 
ATOM   2250 C  CE1   . TYR A 1 308 ? 62.064 30.214 46.295  1.00 25.38  ? 284 TYR A CE1   1 
ATOM   2251 C  CE2   . TYR A 1 308 ? 60.115 29.225 47.286  1.00 32.33  ? 284 TYR A CE2   1 
ATOM   2252 C  CZ    . TYR A 1 308 ? 60.815 30.353 46.875  1.00 28.54  ? 284 TYR A CZ    1 
ATOM   2253 O  OH    . TYR A 1 308 ? 60.271 31.621 47.025  1.00 30.53  ? 284 TYR A OH    1 
ATOM   2254 N  N     . GLY A 1 309 ? 62.170 25.611 49.197  1.00 19.97  ? 285 GLY A N     1 
ATOM   2255 C  CA    . GLY A 1 309 ? 61.764 25.709 50.603  1.00 22.98  ? 285 GLY A CA    1 
ATOM   2256 C  C     . GLY A 1 309 ? 62.947 25.552 51.549  1.00 23.14  ? 285 GLY A C     1 
ATOM   2257 O  O     . GLY A 1 309 ? 63.176 26.412 52.422  1.00 24.18  ? 285 GLY A O     1 
ATOM   2258 N  N     . TYR A 1 310 ? 63.726 24.485 51.358  1.00 22.68  ? 286 TYR A N     1 
ATOM   2259 C  CA    . TYR A 1 310 ? 64.882 24.164 52.228  1.00 22.81  ? 286 TYR A CA    1 
ATOM   2260 C  C     . TYR A 1 310 ? 65.881 25.316 52.351  1.00 21.84  ? 286 TYR A C     1 
ATOM   2261 O  O     . TYR A 1 310 ? 66.324 25.670 53.456  1.00 25.67  ? 286 TYR A O     1 
ATOM   2262 C  CB    . TYR A 1 310 ? 65.589 22.896 51.734  1.00 17.41  ? 286 TYR A CB    1 
ATOM   2263 C  CG    . TYR A 1 310 ? 66.621 22.349 52.701  1.00 17.82  ? 286 TYR A CG    1 
ATOM   2264 C  CD1   . TYR A 1 310 ? 66.237 21.591 53.806  1.00 23.05  ? 286 TYR A CD1   1 
ATOM   2265 C  CD2   . TYR A 1 310 ? 67.974 22.590 52.504  1.00 18.25  ? 286 TYR A CD2   1 
ATOM   2266 C  CE1   . TYR A 1 310 ? 67.181 21.084 54.689  1.00 22.69  ? 286 TYR A CE1   1 
ATOM   2267 C  CE2   . TYR A 1 310 ? 68.928 22.099 53.390  1.00 24.51  ? 286 TYR A CE2   1 
ATOM   2268 C  CZ    . TYR A 1 310 ? 68.523 21.343 54.481  1.00 25.47  ? 286 TYR A CZ    1 
ATOM   2269 O  OH    . TYR A 1 310 ? 69.458 20.830 55.354  1.00 33.24  ? 286 TYR A OH    1 
ATOM   2270 N  N     . THR A 1 311 ? 66.203 25.930 51.220  1.00 19.93  ? 287 THR A N     1 
ATOM   2271 C  CA    . THR A 1 311 ? 67.156 27.016 51.220  1.00 18.77  ? 287 THR A CA    1 
ATOM   2272 C  C     . THR A 1 311 ? 66.536 28.319 51.700  1.00 20.73  ? 287 THR A C     1 
ATOM   2273 O  O     . THR A 1 311 ? 67.250 29.312 51.902  1.00 29.22  ? 287 THR A O     1 
ATOM   2274 C  CB    . THR A 1 311 ? 67.811 27.190 49.846  1.00 20.31  ? 287 THR A CB    1 
ATOM   2275 O  OG1   . THR A 1 311 ? 66.787 27.304 48.846  1.00 22.84  ? 287 THR A OG1   1 
ATOM   2276 C  CG2   . THR A 1 311 ? 68.728 25.985 49.548  1.00 19.01  ? 287 THR A CG2   1 
ATOM   2277 N  N     . GLN A 1 312 ? 65.218 28.320 51.888  1.00 21.34  ? 288 GLN A N     1 
ATOM   2278 C  CA    . GLN A 1 312 ? 64.529 29.524 52.369  1.00 27.35  ? 288 GLN A CA    1 
ATOM   2279 C  C     . GLN A 1 312 ? 64.250 29.423 53.865  1.00 29.22  ? 288 GLN A C     1 
ATOM   2280 O  O     . GLN A 1 312 ? 63.594 30.289 54.440  1.00 34.27  ? 288 GLN A O     1 
ATOM   2281 C  CB    . GLN A 1 312 ? 63.231 29.784 51.595  1.00 30.41  ? 288 GLN A CB    1 
ATOM   2282 C  CG    . GLN A 1 312 ? 63.405 30.081 50.107  1.00 30.64  ? 288 GLN A CG    1 
ATOM   2283 C  CD    . GLN A 1 312 ? 64.072 31.411 49.789  1.00 36.13  ? 288 GLN A CD    1 
ATOM   2284 O  OE1   . GLN A 1 312 ? 64.887 31.497 48.872  1.00 42.55  ? 288 GLN A OE1   1 
ATOM   2285 N  NE2   . GLN A 1 312 ? 63.710 32.451 50.517  1.00 36.74  ? 288 GLN A NE2   1 
ATOM   2286 N  N     . GLY A 1 313 ? 64.744 28.350 54.481  1.00 24.48  ? 289 GLY A N     1 
ATOM   2287 C  CA    . GLY A 1 313 ? 64.574 28.124 55.917  1.00 29.36  ? 289 GLY A CA    1 
ATOM   2288 C  C     . GLY A 1 313 ? 63.224 27.552 56.308  1.00 25.53  ? 289 GLY A C     1 
ATOM   2289 O  O     . GLY A 1 313 ? 62.887 27.492 57.490  1.00 30.77  ? 289 GLY A O     1 
ATOM   2290 N  N     . ARG A 1 314 ? 62.445 27.115 55.324  1.00 28.19  ? 290 ARG A N     1 
ATOM   2291 C  CA    . ARG A 1 314 ? 61.139 26.526 55.601  1.00 26.33  ? 290 ARG A CA    1 
ATOM   2292 C  C     . ARG A 1 314 ? 61.277 25.171 56.303  1.00 25.39  ? 290 ARG A C     1 
ATOM   2293 O  O     . ARG A 1 314 ? 62.341 24.555 56.265  1.00 22.95  ? 290 ARG A O     1 
ATOM   2294 C  CB    . ARG A 1 314 ? 60.321 26.417 54.307  1.00 27.63  ? 290 ARG A CB    1 
ATOM   2295 C  CG    . ARG A 1 314 ? 60.187 27.740 53.560  1.00 31.17  ? 290 ARG A CG    1 
ATOM   2296 C  CD    . ARG A 1 314 ? 59.384 28.772 54.345  1.00 28.72  ? 290 ARG A CD    1 
ATOM   2297 N  NE    . ARG A 1 314 ? 57.981 28.377 54.478  1.00 33.92  ? 290 ARG A NE    1 
ATOM   2298 C  CZ    . ARG A 1 314 ? 57.044 28.598 53.560  1.00 32.70  ? 290 ARG A CZ    1 
ATOM   2299 N  NH1   . ARG A 1 314 ? 55.801 28.187 53.775  1.00 38.93  ? 290 ARG A NH1   1 
ATOM   2300 N  NH2   . ARG A 1 314 ? 57.343 29.228 52.429  1.00 30.95  ? 290 ARG A NH2   1 
ATOM   2301 N  N     . SER A 1 315 ? 60.209 24.746 56.976  1.00 22.85  ? 291 SER A N     1 
ATOM   2302 C  CA    . SER A 1 315 ? 60.171 23.473 57.667  1.00 25.31  ? 291 SER A CA    1 
ATOM   2303 C  C     . SER A 1 315 ? 60.193 22.338 56.645  1.00 25.05  ? 291 SER A C     1 
ATOM   2304 O  O     . SER A 1 315 ? 59.825 22.531 55.490  1.00 23.12  ? 291 SER A O     1 
ATOM   2305 C  CB    . SER A 1 315 ? 58.914 23.379 58.540  1.00 28.57  ? 291 SER A CB    1 
ATOM   2306 O  OG    . SER A 1 315 ? 57.748 23.144 57.757  1.00 30.39  ? 291 SER A OG    1 
ATOM   2307 N  N     . LEU A 1 316 ? 60.615 21.156 57.076  1.00 26.25  ? 292 LEU A N     1 
ATOM   2308 C  CA    . LEU A 1 316 ? 60.640 19.978 56.200  1.00 25.53  ? 292 LEU A CA    1 
ATOM   2309 C  C     . LEU A 1 316 ? 59.271 19.659 55.585  1.00 25.31  ? 292 LEU A C     1 
ATOM   2310 O  O     . LEU A 1 316 ? 59.189 19.199 54.441  1.00 27.66  ? 292 LEU A O     1 
ATOM   2311 C  CB    . LEU A 1 316 ? 61.202 18.764 56.951  1.00 26.34  ? 292 LEU A CB    1 
ATOM   2312 C  CG    . LEU A 1 316 ? 62.675 18.883 57.356  1.00 24.39  ? 292 LEU A CG    1 
ATOM   2313 C  CD1   . LEU A 1 316 ? 63.170 17.610 58.042  1.00 24.24  ? 292 LEU A CD1   1 
ATOM   2314 C  CD2   . LEU A 1 316 ? 63.539 19.221 56.147  1.00 24.68  ? 292 LEU A CD2   1 
ATOM   2315 N  N     . GLU A 1 317 ? 58.203 19.897 56.346  1.00 26.51  ? 293 GLU A N     1 
ATOM   2316 C  CA    . GLU A 1 317 ? 56.854 19.630 55.856  1.00 25.10  ? 293 GLU A CA    1 
ATOM   2317 C  C     . GLU A 1 317 ? 56.512 20.564 54.692  1.00 25.29  ? 293 GLU A C     1 
ATOM   2318 O  O     . GLU A 1 317 ? 56.007 20.110 53.662  1.00 26.81  ? 293 GLU A O     1 
ATOM   2319 C  CB    . GLU A 1 317 ? 55.818 19.766 56.968  1.00 29.75  ? 293 GLU A CB    1 
ATOM   2320 C  CG    . GLU A 1 317 ? 54.418 19.343 56.554  1.00 32.44  ? 293 GLU A CG    1 
ATOM   2321 C  CD    . GLU A 1 317 ? 53.379 19.608 57.622  1.00 39.77  ? 293 GLU A CD    1 
ATOM   2322 O  OE1   . GLU A 1 317 ? 52.199 19.743 57.260  1.00 39.20  ? 293 GLU A OE1   1 
ATOM   2323 O  OE2   . GLU A 1 317 ? 53.730 19.681 58.820  1.00 47.44  ? 293 GLU A OE2   1 
ATOM   2324 N  N     . ASP A 1 318 ? 56.804 21.854 54.872  1.00 25.83  ? 294 ASP A N     1 
ATOM   2325 C  CA    . ASP A 1 318 ? 56.533 22.888 53.869  1.00 24.56  ? 294 ASP A CA    1 
ATOM   2326 C  C     . ASP A 1 318 ? 57.418 22.715 52.626  1.00 24.10  ? 294 ASP A C     1 
ATOM   2327 O  O     . ASP A 1 318 ? 57.013 23.077 51.504  1.00 22.07  ? 294 ASP A O     1 
ATOM   2328 C  CB    . ASP A 1 318 ? 56.693 24.298 54.482  1.00 24.74  ? 294 ASP A CB    1 
ATOM   2329 C  CG    . ASP A 1 318 ? 55.487 24.719 55.324  1.00 28.17  ? 294 ASP A CG    1 
ATOM   2330 O  OD1   . ASP A 1 318 ? 54.444 24.028 55.273  1.00 32.34  ? 294 ASP A OD1   1 
ATOM   2331 O  OD2   . ASP A 1 318 ? 55.576 25.749 56.040  1.00 31.48  ? 294 ASP A OD2   1 
ATOM   2332 N  N     . CYS A 1 319 ? 58.607 22.151 52.833  1.00 23.79  ? 295 CYS A N     1 
ATOM   2333 C  CA    . CYS A 1 319 ? 59.499 21.773 51.730  1.00 23.07  ? 295 CYS A CA    1 
ATOM   2334 C  C     . CYS A 1 319 ? 58.843 20.669 50.891  1.00 21.28  ? 295 CYS A C     1 
ATOM   2335 O  O     . CYS A 1 319 ? 58.781 20.764 49.662  1.00 23.31  ? 295 CYS A O     1 
ATOM   2336 C  CB    . CYS A 1 319 ? 60.876 21.339 52.247  1.00 22.37  ? 295 CYS A CB    1 
ATOM   2337 S  SG    . CYS A 1 319 ? 61.857 22.631 53.049  1.00 22.95  ? 295 CYS A SG    1 
ATOM   2338 N  N     . GLY A 1 320 ? 58.319 19.652 51.574  1.00 22.71  ? 296 GLY A N     1 
ATOM   2339 C  CA    . GLY A 1 320 ? 57.510 18.603 50.959  1.00 20.24  ? 296 GLY A CA    1 
ATOM   2340 C  C     . GLY A 1 320 ? 56.366 19.190 50.152  1.00 22.05  ? 296 GLY A C     1 
ATOM   2341 O  O     . GLY A 1 320 ? 56.153 18.802 48.997  1.00 24.34  ? 296 GLY A O     1 
ATOM   2342 N  N     . LYS A 1 321 ? 55.637 20.126 50.765  1.00 23.84  ? 297 LYS A N     1 
ATOM   2343 C  CA    . LYS A 1 321 ? 54.469 20.738 50.147  1.00 23.38  ? 297 LYS A CA    1 
ATOM   2344 C  C     . LYS A 1 321 ? 54.838 21.487 48.870  1.00 21.07  ? 297 LYS A C     1 
ATOM   2345 O  O     . LYS A 1 321 ? 54.166 21.359 47.846  1.00 24.00  ? 297 LYS A O     1 
ATOM   2346 C  CB    . LYS A 1 321 ? 53.738 21.641 51.147  1.00 23.17  ? 297 LYS A CB    1 
ATOM   2347 C  CG    . LYS A 1 321 ? 52.999 20.876 52.240  1.00 27.24  ? 297 LYS A CG    1 
ATOM   2348 C  CD    . LYS A 1 321 ? 52.216 21.808 53.152  1.00 29.23  ? 297 LYS A CD    1 
ATOM   2349 C  CE    . LYS A 1 321 ? 51.579 21.027 54.287  1.00 33.13  ? 297 LYS A CE    1 
ATOM   2350 N  NZ    . LYS A 1 321 ? 50.559 21.816 55.031  1.00 36.50  ? 297 LYS A NZ    1 
ATOM   2351 N  N     . LEU A 1 322 ? 55.922 22.248 48.932  1.00 20.44  ? 298 LEU A N     1 
ATOM   2352 C  CA    . LEU A 1 322 ? 56.405 22.992 47.775  1.00 21.35  ? 298 LEU A CA    1 
ATOM   2353 C  C     . LEU A 1 322 ? 56.845 22.024 46.658  1.00 20.03  ? 298 LEU A C     1 
ATOM   2354 O  O     . LEU A 1 322 ? 56.526 22.227 45.474  1.00 21.65  ? 298 LEU A O     1 
ATOM   2355 C  CB    . LEU A 1 322 ? 57.527 23.937 48.193  1.00 19.11  ? 298 LEU A CB    1 
ATOM   2356 C  CG    . LEU A 1 322 ? 57.130 25.239 48.913  1.00 19.85  ? 298 LEU A CG    1 
ATOM   2357 C  CD1   . LEU A 1 322 ? 58.335 25.873 49.597  1.00 24.11  ? 298 LEU A CD1   1 
ATOM   2358 C  CD2   . LEU A 1 322 ? 56.452 26.225 47.958  1.00 22.39  ? 298 LEU A CD2   1 
ATOM   2359 N  N     . GLY A 1 323 ? 57.525 20.944 47.046  1.00 18.51  ? 299 GLY A N     1 
ATOM   2360 C  CA    . GLY A 1 323 ? 57.845 19.838 46.121  1.00 20.12  ? 299 GLY A CA    1 
ATOM   2361 C  C     . GLY A 1 323 ? 56.634 19.254 45.426  1.00 20.13  ? 299 GLY A C     1 
ATOM   2362 O  O     . GLY A 1 323 ? 56.583 19.198 44.176  1.00 20.99  ? 299 GLY A O     1 
ATOM   2363 N  N     . CYS A 1 324 ? 55.636 18.854 46.209  1.00 19.45  ? 300 CYS A N     1 
ATOM   2364 C  CA    . CYS A 1 324 ? 54.427 18.247 45.632  1.00 22.32  ? 300 CYS A CA    1 
ATOM   2365 C  C     . CYS A 1 324 ? 53.676 19.197 44.694  1.00 20.72  ? 300 CYS A C     1 
ATOM   2366 O  O     . CYS A 1 324 ? 53.098 18.769 43.697  1.00 21.92  ? 300 CYS A O     1 
ATOM   2367 C  CB    . CYS A 1 324 ? 53.499 17.697 46.713  1.00 22.85  ? 300 CYS A CB    1 
ATOM   2368 S  SG    . CYS A 1 324 ? 54.145 16.235 47.565  1.00 27.75  ? 300 CYS A SG    1 
ATOM   2369 N  N     . LEU A 1 325 ? 53.712 20.479 45.013  1.00 19.63  ? 301 LEU A N     1 
ATOM   2370 C  CA    . LEU A 1 325 ? 53.089 21.506 44.195  1.00 21.31  ? 301 LEU A CA    1 
ATOM   2371 C  C     . LEU A 1 325 ? 53.798 21.630 42.844  1.00 21.13  ? 301 LEU A C     1 
ATOM   2372 O  O     . LEU A 1 325 ? 53.146 21.507 41.790  1.00 23.66  ? 301 LEU A O     1 
ATOM   2373 C  CB    . LEU A 1 325 ? 53.034 22.849 44.943  1.00 23.17  ? 301 LEU A CB    1 
ATOM   2374 C  CG    . LEU A 1 325 ? 52.447 23.979 44.088  1.00 22.86  ? 301 LEU A CG    1 
ATOM   2375 C  CD1   . LEU A 1 325 ? 50.949 23.763 43.928  1.00 25.26  ? 301 LEU A CD1   1 
ATOM   2376 C  CD2   . LEU A 1 325 ? 52.735 25.349 44.684  1.00 25.96  ? 301 LEU A CD2   1 
ATOM   2377 N  N     . ALA A 1 326 ? 55.122 21.820 42.871  1.00 20.17  ? 302 ALA A N     1 
ATOM   2378 C  CA    . ALA A 1 326 ? 55.914 21.902 41.632  1.00 19.76  ? 302 ALA A CA    1 
ATOM   2379 C  C     . ALA A 1 326 ? 55.803 20.617 40.802  1.00 19.24  ? 302 ALA A C     1 
ATOM   2380 O  O     . ALA A 1 326 ? 55.582 20.651 39.573  1.00 16.65  ? 302 ALA A O     1 
ATOM   2381 C  CB    . ALA A 1 326 ? 57.365 22.220 41.948  1.00 18.83  ? 302 ALA A CB    1 
ATOM   2382 N  N     . ALA A 1 327 ? 55.935 19.479 41.465  1.00 18.25  ? 303 ALA A N     1 
ATOM   2383 C  CA    . ALA A 1 327 ? 55.684 18.186 40.801  1.00 20.20  ? 303 ALA A CA    1 
ATOM   2384 C  C     . ALA A 1 327 ? 54.294 18.080 40.146  1.00 19.93  ? 303 ALA A C     1 
ATOM   2385 O  O     . ALA A 1 327 ? 54.186 17.667 39.007  1.00 18.43  ? 303 ALA A O     1 
ATOM   2386 C  CB    . ALA A 1 327 ? 55.920 17.025 41.762  1.00 20.75  ? 303 ALA A CB    1 
ATOM   2387 N  N     . GLY A 1 328 ? 53.245 18.448 40.878  1.00 19.76  ? 304 GLY A N     1 
ATOM   2388 C  CA    . GLY A 1 328 ? 51.867 18.358 40.385  1.00 20.20  ? 304 GLY A CA    1 
ATOM   2389 C  C     . GLY A 1 328 ? 51.593 19.224 39.161  1.00 19.29  ? 304 GLY A C     1 
ATOM   2390 O  O     . GLY A 1 328 ? 50.818 18.836 38.276  1.00 21.52  ? 304 GLY A O     1 
ATOM   2391 N  N     . ILE A 1 329 ? 52.235 20.383 39.101  1.00 19.05  ? 305 ILE A N     1 
ATOM   2392 C  CA    . ILE A 1 329 ? 52.100 21.296 37.949  1.00 18.88  ? 305 ILE A CA    1 
ATOM   2393 C  C     . ILE A 1 329 ? 52.804 20.714 36.717  1.00 18.59  ? 305 ILE A C     1 
ATOM   2394 O  O     . ILE A 1 329 ? 52.255 20.723 35.605  1.00 23.28  ? 305 ILE A O     1 
ATOM   2395 C  CB    . ILE A 1 329 ? 52.669 22.696 38.285  1.00 21.24  ? 305 ILE A CB    1 
ATOM   2396 C  CG1   . ILE A 1 329 ? 51.809 23.361 39.368  1.00 21.03  ? 305 ILE A CG1   1 
ATOM   2397 C  CG2   . ILE A 1 329 ? 52.761 23.581 37.037  1.00 21.47  ? 305 ILE A CG2   1 
ATOM   2398 C  CD1   . ILE A 1 329 ? 52.459 24.542 40.052  1.00 22.27  ? 305 ILE A CD1   1 
ATOM   2399 N  N     . VAL A 1 330 ? 54.009 20.191 36.904  1.00 18.15  ? 306 VAL A N     1 
ATOM   2400 C  CA    . VAL A 1 330 ? 54.790 19.724 35.750  1.00 19.25  ? 306 VAL A CA    1 
ATOM   2401 C  C     . VAL A 1 330 ? 54.139 18.548 35.019  1.00 20.35  ? 306 VAL A C     1 
ATOM   2402 O  O     . VAL A 1 330 ? 54.256 18.442 33.793  1.00 22.95  ? 306 VAL A O     1 
ATOM   2403 C  CB    . VAL A 1 330 ? 56.282 19.455 36.083  1.00 19.25  ? 306 VAL A CB    1 
ATOM   2404 C  CG1   . VAL A 1 330 ? 56.496 18.085 36.719  1.00 16.47  ? 306 VAL A CG1   1 
ATOM   2405 C  CG2   . VAL A 1 330 ? 57.137 19.616 34.830  1.00 18.63  ? 306 VAL A CG2   1 
ATOM   2406 N  N     . ILE A 1 331 ? 53.446 17.678 35.748  1.00 19.41  ? 307 ILE A N     1 
ATOM   2407 C  CA    . ILE A 1 331 ? 52.865 16.467 35.145  1.00 20.41  ? 307 ILE A CA    1 
ATOM   2408 C  C     . ILE A 1 331 ? 51.577 16.720 34.355  1.00 21.05  ? 307 ILE A C     1 
ATOM   2409 O  O     . ILE A 1 331 ? 51.062 15.810 33.704  1.00 21.11  ? 307 ILE A O     1 
ATOM   2410 C  CB    . ILE A 1 331 ? 52.677 15.303 36.152  1.00 20.07  ? 307 ILE A CB    1 
ATOM   2411 C  CG1   . ILE A 1 331 ? 51.527 15.566 37.139  1.00 23.51  ? 307 ILE A CG1   1 
ATOM   2412 C  CG2   . ILE A 1 331 ? 53.984 14.997 36.875  1.00 20.57  ? 307 ILE A CG2   1 
ATOM   2413 C  CD1   . ILE A 1 331 ? 51.178 14.349 37.996  1.00 24.03  ? 307 ILE A CD1   1 
ATOM   2414 N  N     . GLN A 1 332 ? 51.071 17.950 34.429  1.00 22.61  ? 308 GLN A N     1 
ATOM   2415 C  CA    . GLN A 1 332 ? 49.861 18.347 33.712  1.00 24.74  ? 308 GLN A CA    1 
ATOM   2416 C  C     . GLN A 1 332 ? 50.174 19.051 32.389  1.00 24.66  ? 308 GLN A C     1 
ATOM   2417 O  O     . GLN A 1 332 ? 49.284 19.652 31.768  1.00 27.55  ? 308 GLN A O     1 
ATOM   2418 C  CB    . GLN A 1 332 ? 48.971 19.222 34.600  1.00 24.19  ? 308 GLN A CB    1 
ATOM   2419 C  CG    . GLN A 1 332 ? 48.513 18.532 35.877  1.00 27.54  ? 308 GLN A CG    1 
ATOM   2420 C  CD    . GLN A 1 332 ? 47.620 19.407 36.734  1.00 26.04  ? 308 GLN A CD    1 
ATOM   2421 O  OE1   . GLN A 1 332 ? 46.434 19.588 36.437  1.00 31.64  ? 308 GLN A OE1   1 
ATOM   2422 N  NE2   . GLN A 1 332 ? 48.177 19.944 37.810  1.00 26.70  ? 308 GLN A NE2   1 
ATOM   2423 N  N     . GLN A 1 333 ? 51.430 18.963 31.955  1.00 24.12  ? 309 GLN A N     1 
ATOM   2424 C  CA    . GLN A 1 333 ? 51.881 19.579 30.697  1.00 26.45  ? 309 GLN A CA    1 
ATOM   2425 C  C     . GLN A 1 333 ? 52.860 18.662 29.971  1.00 26.28  ? 309 GLN A C     1 
ATOM   2426 O  O     . GLN A 1 333 ? 53.431 17.743 30.574  1.00 26.38  ? 309 GLN A O     1 
ATOM   2427 C  CB    . GLN A 1 333 ? 52.541 20.950 30.938  1.00 25.05  ? 309 GLN A CB    1 
ATOM   2428 C  CG    . GLN A 1 333 ? 53.737 20.937 31.903  1.00 26.75  ? 309 GLN A CG    1 
ATOM   2429 C  CD    . GLN A 1 333 ? 54.717 22.082 31.682  1.00 27.23  ? 309 GLN A CD    1 
ATOM   2430 O  OE1   . GLN A 1 333 ? 54.350 23.257 31.767  1.00 30.15  ? 309 GLN A OE1   1 
ATOM   2431 N  NE2   . GLN A 1 333 ? 55.981 21.741 31.414  1.00 25.81  ? 309 GLN A NE2   1 
ATOM   2432 N  N     . ILE A 1 334 ? 53.049 18.916 28.681  1.00 27.41  ? 310 ILE A N     1 
ATOM   2433 C  CA    . ILE A 1 334 ? 54.092 18.267 27.890  1.00 29.39  ? 310 ILE A CA    1 
ATOM   2434 C  C     . ILE A 1 334 ? 55.397 19.029 28.117  1.00 28.31  ? 310 ILE A C     1 
ATOM   2435 O  O     . ILE A 1 334 ? 55.404 20.255 28.139  1.00 33.47  ? 310 ILE A O     1 
ATOM   2436 C  CB    . ILE A 1 334 ? 53.719 18.276 26.385  1.00 28.96  ? 310 ILE A CB    1 
ATOM   2437 C  CG1   . ILE A 1 334 ? 52.405 17.531 26.158  1.00 32.77  ? 310 ILE A CG1   1 
ATOM   2438 C  CG2   . ILE A 1 334 ? 54.825 17.663 25.530  1.00 32.65  ? 310 ILE A CG2   1 
ATOM   2439 C  CD1   . ILE A 1 334 ? 51.749 17.848 24.827  1.00 36.82  ? 310 ILE A CD1   1 
ATOM   2440 N  N     . GLY A 1 335 ? 56.499 18.310 28.311  1.00 28.50  ? 311 GLY A N     1 
ATOM   2441 C  CA    . GLY A 1 335 ? 57.786 18.961 28.552  1.00 29.80  ? 311 GLY A CA    1 
ATOM   2442 C  C     . GLY A 1 335 ? 58.149 18.932 30.026  1.00 24.43  ? 311 GLY A C     1 
ATOM   2443 O  O     . GLY A 1 335 ? 57.256 18.950 30.888  1.00 22.15  ? 311 GLY A O     1 
ATOM   2444 N  N     . PRO A 1 336 ? 59.454 18.892 30.332  1.00 23.00  ? 312 PRO A N     1 
ATOM   2445 C  CA    . PRO A 1 336 ? 59.918 18.640 31.699  1.00 19.86  ? 312 PRO A CA    1 
ATOM   2446 C  C     . PRO A 1 336 ? 60.075 19.885 32.566  1.00 21.59  ? 312 PRO A C     1 
ATOM   2447 O  O     . PRO A 1 336 ? 60.426 19.772 33.753  1.00 23.33  ? 312 PRO A O     1 
ATOM   2448 C  CB    . PRO A 1 336 ? 61.286 18.011 31.470  1.00 20.08  ? 312 PRO A CB    1 
ATOM   2449 C  CG    . PRO A 1 336 ? 61.786 18.621 30.213  1.00 19.01  ? 312 PRO A CG    1 
ATOM   2450 C  CD    . PRO A 1 336 ? 60.583 19.048 29.400  1.00 21.77  ? 312 PRO A CD    1 
ATOM   2451 N  N     . ARG A 1 337 ? 59.852 21.060 31.982  1.00 23.19  ? 313 ARG A N     1 
ATOM   2452 C  CA    . ARG A 1 337 ? 60.042 22.303 32.704  1.00 21.06  ? 313 ARG A CA    1 
ATOM   2453 C  C     . ARG A 1 337 ? 58.767 23.119 32.623  1.00 20.84  ? 313 ARG A C     1 
ATOM   2454 O  O     . ARG A 1 337 ? 58.278 23.401 31.532  1.00 23.53  ? 313 ARG A O     1 
ATOM   2455 C  CB    . ARG A 1 337 ? 61.257 23.079 32.184  1.00 16.31  ? 313 ARG A CB    1 
ATOM   2456 C  CG    . ARG A 1 337 ? 62.545 22.281 32.228  1.00 15.42  ? 313 ARG A CG    1 
ATOM   2457 C  CD    . ARG A 1 337 ? 63.752 23.133 31.907  1.00 17.48  ? 313 ARG A CD    1 
ATOM   2458 N  NE    . ARG A 1 337 ? 64.955 22.315 31.780  1.00 15.68  ? 313 ARG A NE    1 
ATOM   2459 C  CZ    . ARG A 1 337 ? 66.102 22.739 31.266  1.00 13.73  ? 313 ARG A CZ    1 
ATOM   2460 N  NH1   . ARG A 1 337 ? 66.253 24.000 30.833  1.00 15.57  ? 313 ARG A NH1   1 
ATOM   2461 N  NH2   . ARG A 1 337 ? 67.092 21.893 31.171  1.00 15.19  ? 313 ARG A NH2   1 
ATOM   2462 N  N     . PRO A 1 338 ? 58.195 23.466 33.785  1.00 22.74  ? 314 PRO A N     1 
ATOM   2463 C  CA    . PRO A 1 338 ? 56.932 24.202 33.832  1.00 21.38  ? 314 PRO A CA    1 
ATOM   2464 C  C     . PRO A 1 338 ? 56.965 25.503 33.022  1.00 23.93  ? 314 PRO A C     1 
ATOM   2465 O  O     . PRO A 1 338 ? 57.918 26.288 33.107  1.00 27.16  ? 314 PRO A O     1 
ATOM   2466 C  CB    . PRO A 1 338 ? 56.745 24.461 35.330  1.00 20.77  ? 314 PRO A CB    1 
ATOM   2467 C  CG    . PRO A 1 338 ? 57.438 23.303 35.972  1.00 19.04  ? 314 PRO A CG    1 
ATOM   2468 C  CD    . PRO A 1 338 ? 58.658 23.087 35.132  1.00 21.31  ? 314 PRO A CD    1 
HETATM 2469 N  N     . MSE A 1 339 ? 55.931 25.705 32.219  1.00 25.73  ? 315 MSE A N     1 
HETATM 2470 C  CA    . MSE A 1 339 ? 55.864 26.839 31.305  1.00 26.71  ? 315 MSE A CA    1 
HETATM 2471 C  C     . MSE A 1 339 ? 55.138 27.976 31.963  1.00 27.79  ? 315 MSE A C     1 
HETATM 2472 O  O     . MSE A 1 339 ? 55.122 29.111 31.442  1.00 28.89  ? 315 MSE A O     1 
HETATM 2473 C  CB    . MSE A 1 339 ? 55.121 26.331 30.085  1.00 30.26  ? 315 MSE A CB    1 
HETATM 2474 C  CG    . MSE A 1 339 ? 55.949 25.226 29.449  1.00 37.34  ? 315 MSE A CG    1 
HETATM 2475 SE SE    . MSE A 1 339 ? 55.122 24.745 27.736  1.00 60.22  ? 315 MSE A SE    1 
HETATM 2476 C  CE    . MSE A 1 339 ? 53.997 23.251 28.353  1.00 35.97  ? 315 MSE A CE    1 
ATOM   2477 N  N     . THR A 1 340 ? 54.536 27.666 33.115  1.00 26.46  ? 316 THR A N     1 
ATOM   2478 C  CA    . THR A 1 340 ? 53.810 28.632 33.940  1.00 30.38  ? 316 THR A CA    1 
ATOM   2479 C  C     . THR A 1 340 ? 54.630 29.031 35.168  1.00 29.01  ? 316 THR A C     1 
ATOM   2480 O  O     . THR A 1 340 ? 55.608 28.350 35.521  1.00 28.29  ? 316 THR A O     1 
ATOM   2481 C  CB    . THR A 1 340 ? 52.433 28.093 34.386  1.00 33.10  ? 316 THR A CB    1 
ATOM   2482 O  OG1   . THR A 1 340 ? 52.600 26.886 35.136  1.00 29.78  ? 316 THR A OG1   1 
ATOM   2483 C  CG2   . THR A 1 340 ? 51.536 27.822 33.178  1.00 33.23  ? 316 THR A CG2   1 
ATOM   2484 N  N     . SER A 1 341 ? 54.232 30.120 35.820  1.00 28.89  ? 317 SER A N     1 
ATOM   2485 C  CA    . SER A 1 341 ? 54.961 30.627 36.986  1.00 27.90  ? 317 SER A CA    1 
ATOM   2486 C  C     . SER A 1 341 ? 54.714 29.795 38.226  1.00 26.87  ? 317 SER A C     1 
ATOM   2487 O  O     . SER A 1 341 ? 53.600 29.762 38.766  1.00 32.47  ? 317 SER A O     1 
ATOM   2488 C  CB    . SER A 1 341 ? 54.619 32.088 37.268  1.00 28.11  ? 317 SER A CB    1 
ATOM   2489 O  OG    . SER A 1 341 ? 55.176 32.505 38.511  1.00 25.38  ? 317 SER A OG    1 
ATOM   2490 N  N     . LEU A 1 342 ? 55.769 29.125 38.671  1.00 28.54  ? 318 LEU A N     1 
ATOM   2491 C  CA    . LEU A 1 342 ? 55.725 28.342 39.901  1.00 24.21  ? 318 LEU A CA    1 
ATOM   2492 C  C     . LEU A 1 342 ? 55.578 29.239 41.112  1.00 25.92  ? 318 LEU A C     1 
ATOM   2493 O  O     . LEU A 1 342 ? 54.830 28.906 42.047  1.00 25.93  ? 318 LEU A O     1 
ATOM   2494 C  CB    . LEU A 1 342 ? 56.983 27.489 40.043  1.00 24.35  ? 318 LEU A CB    1 
ATOM   2495 C  CG    . LEU A 1 342 ? 57.148 26.345 39.044  1.00 20.18  ? 318 LEU A CG    1 
ATOM   2496 C  CD1   . LEU A 1 342 ? 58.474 25.648 39.299  1.00 20.06  ? 318 LEU A CD1   1 
ATOM   2497 C  CD2   . LEU A 1 342 ? 55.984 25.362 39.114  1.00 18.94  ? 318 LEU A CD2   1 
ATOM   2498 N  N     . SER A 1 343 ? 56.281 30.374 41.096  1.00 25.78  ? 319 SER A N     1 
ATOM   2499 C  CA    . SER A 1 343 ? 56.241 31.286 42.246  1.00 30.22  ? 319 SER A CA    1 
ATOM   2500 C  C     . SER A 1 343 ? 54.815 31.800 42.462  1.00 30.22  ? 319 SER A C     1 
ATOM   2501 O  O     . SER A 1 343 ? 54.338 31.871 43.603  1.00 32.72  ? 319 SER A O     1 
ATOM   2502 C  CB    . SER A 1 343 ? 57.257 32.428 42.108  1.00 26.68  ? 319 SER A CB    1 
ATOM   2503 O  OG    . SER A 1 343 ? 56.804 33.417 41.202  1.00 31.94  ? 319 SER A OG    1 
ATOM   2504 N  N     . GLU A 1 344 ? 54.131 32.110 41.357  1.00 28.45  ? 320 GLU A N     1 
ATOM   2505 C  CA    . GLU A 1 344 ? 52.731 32.548 41.392  1.00 31.19  ? 320 GLU A CA    1 
ATOM   2506 C  C     . GLU A 1 344 ? 51.822 31.437 41.899  1.00 27.38  ? 320 GLU A C     1 
ATOM   2507 O  O     . GLU A 1 344 ? 50.917 31.695 42.704  1.00 27.02  ? 320 GLU A O     1 
ATOM   2508 C  CB    . GLU A 1 344 ? 52.254 33.033 40.010  1.00 31.41  ? 320 GLU A CB    1 
ATOM   2509 C  CG    . GLU A 1 344 ? 52.800 34.385 39.562  1.00 36.23  ? 320 GLU A CG    1 
ATOM   2510 C  CD    . GLU A 1 344 ? 52.428 35.535 40.489  1.00 43.91  ? 320 GLU A CD    1 
ATOM   2511 O  OE1   . GLU A 1 344 ? 51.369 35.464 41.153  1.00 46.22  ? 320 GLU A OE1   1 
ATOM   2512 O  OE2   . GLU A 1 344 ? 53.199 36.520 40.551  1.00 50.27  ? 320 GLU A OE2   1 
ATOM   2513 N  N     . ALA A 1 345 ? 52.069 30.210 41.431  1.00 24.73  ? 321 ALA A N     1 
ATOM   2514 C  CA    . ALA A 1 345 ? 51.327 29.043 41.900  1.00 26.36  ? 321 ALA A CA    1 
ATOM   2515 C  C     . ALA A 1 345 ? 51.491 28.857 43.417  1.00 26.51  ? 321 ALA A C     1 
ATOM   2516 O  O     . ALA A 1 345 ? 50.511 28.583 44.117  1.00 23.57  ? 321 ALA A O     1 
ATOM   2517 C  CB    . ALA A 1 345 ? 51.786 27.806 41.159  1.00 27.86  ? 321 ALA A CB    1 
ATOM   2518 N  N     . ALA A 1 346 ? 52.724 29.017 43.907  1.00 27.40  ? 322 ALA A N     1 
ATOM   2519 C  CA    . ALA A 1 346 ? 53.035 28.897 45.345  1.00 27.68  ? 322 ALA A CA    1 
ATOM   2520 C  C     . ALA A 1 346 ? 52.420 30.025 46.171  1.00 29.89  ? 322 ALA A C     1 
ATOM   2521 O  O     . ALA A 1 346 ? 52.041 29.827 47.337  1.00 31.58  ? 322 ALA A O     1 
ATOM   2522 C  CB    . ALA A 1 346 ? 54.545 28.820 45.575  1.00 21.62  ? 322 ALA A CB    1 
ATOM   2523 N  N     . LYS A 1 347 ? 52.342 31.212 45.576  1.00 25.56  ? 323 LYS A N     1 
ATOM   2524 C  CA    . LYS A 1 347 ? 51.711 32.354 46.236  1.00 30.06  ? 323 LYS A CA    1 
ATOM   2525 C  C     . LYS A 1 347 ? 50.210 32.111 46.366  1.00 32.22  ? 323 LYS A C     1 
ATOM   2526 O  O     . LYS A 1 347 ? 49.632 32.314 47.426  1.00 37.42  ? 323 LYS A O     1 
ATOM   2527 C  CB    . LYS A 1 347 ? 52.019 33.656 45.502  1.00 35.62  ? 323 LYS A CB    1 
ATOM   2528 C  CG    . LYS A 1 347 ? 53.389 34.232 45.819  1.00 38.03  ? 323 LYS A CG    1 
ATOM   2529 C  CD    . LYS A 1 347 ? 53.533 35.642 45.275  1.00 45.98  ? 323 LYS A CD    1 
ATOM   2530 C  CE    . LYS A 1 347 ? 54.949 36.165 45.466  1.00 49.78  ? 323 LYS A CE    1 
ATOM   2531 N  NZ    . LYS A 1 347 ? 55.101 37.567 44.977  1.00 62.39  ? 323 LYS A NZ    1 
ATOM   2532 N  N     . GLN A 1 348 ? 49.603 31.633 45.284  1.00 33.53  ? 324 GLN A N     1 
ATOM   2533 C  CA    . GLN A 1 348 ? 48.196 31.253 45.268  1.00 34.70  ? 324 GLN A CA    1 
ATOM   2534 C  C     . GLN A 1 348 ? 47.923 30.074 46.205  1.00 37.43  ? 324 GLN A C     1 
ATOM   2535 O  O     . GLN A 1 348 ? 46.860 30.009 46.835  1.00 39.79  ? 324 GLN A O     1 
ATOM   2536 C  CB    . GLN A 1 348 ? 47.791 30.887 43.841  1.00 38.85  ? 324 GLN A CB    1 
ATOM   2537 C  CG    . GLN A 1 348 ? 46.296 30.746 43.604  1.00 43.51  ? 324 GLN A CG    1 
ATOM   2538 C  CD    . GLN A 1 348 ? 45.972 30.294 42.189  1.00 56.30  ? 324 GLN A CD    1 
ATOM   2539 O  OE1   . GLN A 1 348 ? 46.787 29.647 41.526  1.00 59.14  ? 324 GLN A OE1   1 
ATOM   2540 N  NE2   . GLN A 1 348 ? 44.777 30.631 41.719  1.00 69.13  ? 324 GLN A NE2   1 
ATOM   2541 N  N     . ALA A 1 349 ? 48.883 29.152 46.289  1.00 35.27  ? 325 ALA A N     1 
ATOM   2542 C  CA    . ALA A 1 349 ? 48.748 27.928 47.087  1.00 34.77  ? 325 ALA A CA    1 
ATOM   2543 C  C     . ALA A 1 349 ? 48.807 28.164 48.599  1.00 37.75  ? 325 ALA A C     1 
ATOM   2544 O  O     . ALA A 1 349 ? 48.491 27.264 49.381  1.00 42.37  ? 325 ALA A O     1 
ATOM   2545 C  CB    . ALA A 1 349 ? 49.804 26.912 46.672  1.00 32.94  ? 325 ALA A CB    1 
ATOM   2546 N  N     . GLY A 1 350 ? 49.209 29.366 49.009  1.00 39.79  ? 326 GLY A N     1 
ATOM   2547 C  CA    . GLY A 1 350 ? 49.364 29.687 50.432  1.00 38.80  ? 326 GLY A CA    1 
ATOM   2548 C  C     . GLY A 1 350 ? 50.666 29.179 51.020  1.00 38.61  ? 326 GLY A C     1 
ATOM   2549 O  O     . GLY A 1 350 ? 50.819 29.103 52.242  1.00 45.17  ? 326 GLY A O     1 
ATOM   2550 N  N     . LEU A 1 351 ? 51.601 28.837 50.139  1.00 31.50  ? 327 LEU A N     1 
ATOM   2551 C  CA    . LEU A 1 351 ? 52.922 28.350 50.506  1.00 34.45  ? 327 LEU A CA    1 
ATOM   2552 C  C     . LEU A 1 351 ? 53.948 29.483 50.424  1.00 38.04  ? 327 LEU A C     1 
ATOM   2553 O  O     . LEU A 1 351 ? 55.037 29.397 51.005  1.00 43.88  ? 327 LEU A O     1 
ATOM   2554 C  CB    . LEU A 1 351 ? 53.326 27.184 49.591  1.00 35.54  ? 327 LEU A CB    1 
ATOM   2555 C  CG    . LEU A 1 351 ? 52.385 25.975 49.448  1.00 32.15  ? 327 LEU A CG    1 
ATOM   2556 C  CD1   . LEU A 1 351 ? 52.951 24.943 48.476  1.00 32.68  ? 327 LEU A CD1   1 
ATOM   2557 C  CD2   . LEU A 1 351 ? 52.088 25.327 50.796  1.00 36.49  ? 327 LEU A CD2   1 
ATOM   2558 N  N     . ILE A 1 352 ? 53.561 30.545 49.721  1.00 38.92  ? 328 ILE A N     1 
ATOM   2559 C  CA    . ILE A 1 352 ? 54.350 31.767 49.501  1.00 47.85  ? 328 ILE A CA    1 
ATOM   2560 C  C     . ILE A 1 352 ? 55.626 31.497 48.709  1.00 49.32  ? 328 ILE A C     1 
ATOM   2561 O  O     . ILE A 1 352 ? 55.810 32.046 47.620  1.00 57.00  ? 328 ILE A O     1 
ATOM   2562 C  CB    . ILE A 1 352 ? 54.648 32.558 50.805  1.00 47.05  ? 328 ILE A CB    1 
ATOM   2563 C  CG1   . ILE A 1 352 ? 53.371 32.746 51.641  1.00 45.31  ? 328 ILE A CG1   1 
ATOM   2564 C  CG2   . ILE A 1 352 ? 55.275 33.916 50.480  1.00 45.54  ? 328 ILE A CG2   1 
ATOM   2565 C  CD1   . ILE A 1 352 ? 53.619 33.036 53.109  1.00 44.61  ? 328 ILE A CD1   1 
HETATM 2566 N  N     . MSE B 1 23  ? 45.016 6.372  -11.644 1.00 61.64  ? -1  MSE B N     1 
HETATM 2567 C  CA    . MSE B 1 23  ? 45.603 6.221  -10.263 1.00 51.65  ? -1  MSE B CA    1 
HETATM 2568 C  C     . MSE B 1 23  ? 46.887 7.032  -10.095 1.00 42.06  ? -1  MSE B C     1 
HETATM 2569 O  O     . MSE B 1 23  ? 47.883 6.827  -10.814 1.00 35.27  ? -1  MSE B O     1 
HETATM 2570 C  CB    . MSE B 1 23  ? 45.730 4.708  -10.045 1.00 52.21  ? -1  MSE B CB    1 
HETATM 2571 C  CG    . MSE B 1 23  ? 46.672 4.315  -8.907  1.00 61.90  ? -1  MSE B CG    1 
HETATM 2572 SE SE    . MSE B 1 23  ? 46.264 2.453  -8.386  1.00 85.26  ? -1  MSE B SE    1 
HETATM 2573 C  CE    . MSE B 1 23  ? 45.238 2.937  -6.772  1.00 105.21 ? -1  MSE B CE    1 
ATOM   2574 N  N     . THR B 1 24  ? 46.879 7.974  -9.148  1.00 38.76  ? 0   THR B N     1 
ATOM   2575 C  CA    . THR B 1 24  ? 48.007 8.924  -9.005  1.00 34.18  ? 0   THR B CA    1 
ATOM   2576 C  C     . THR B 1 24  ? 48.738 8.868  -7.658  1.00 30.80  ? 0   THR B C     1 
ATOM   2577 O  O     . THR B 1 24  ? 48.141 8.639  -6.617  1.00 26.61  ? 0   THR B O     1 
ATOM   2578 C  CB    . THR B 1 24  ? 47.668 10.388 -9.442  1.00 33.38  ? 0   THR B CB    1 
ATOM   2579 O  OG1   . THR B 1 24  ? 46.777 11.018 -8.512  1.00 36.60  ? 0   THR B OG1   1 
ATOM   2580 C  CG2   . THR B 1 24  ? 47.036 10.419 -10.847 1.00 38.59  ? 0   THR B CG2   1 
ATOM   2581 N  N     . ARG B 1 25  ? 50.050 9.074  -7.706  1.00 32.07  ? 1   ARG B N     1 
ATOM   2582 C  CA    . ARG B 1 25  ? 50.895 8.929  -6.545  1.00 26.88  ? 1   ARG B CA    1 
ATOM   2583 C  C     . ARG B 1 25  ? 50.486 9.806  -5.371  1.00 22.95  ? 1   ARG B C     1 
ATOM   2584 O  O     . ARG B 1 25  ? 50.434 9.328  -4.249  1.00 27.72  ? 1   ARG B O     1 
ATOM   2585 C  CB    . ARG B 1 25  ? 52.348 9.215  -6.893  1.00 29.87  ? 1   ARG B CB    1 
ATOM   2586 C  CG    . ARG B 1 25  ? 53.172 7.974  -7.144  1.00 32.88  ? 1   ARG B CG    1 
ATOM   2587 C  CD    . ARG B 1 25  ? 54.634 8.226  -6.817  1.00 38.76  ? 1   ARG B CD    1 
ATOM   2588 N  NE    . ARG B 1 25  ? 55.221 9.246  -7.679  1.00 42.52  ? 1   ARG B NE    1 
ATOM   2589 C  CZ    . ARG B 1 25  ? 56.484 9.661  -7.615  1.00 45.04  ? 1   ARG B CZ    1 
ATOM   2590 N  NH1   . ARG B 1 25  ? 56.906 10.598 -8.455  1.00 54.43  ? 1   ARG B NH1   1 
ATOM   2591 N  NH2   . ARG B 1 25  ? 57.323 9.152  -6.717  1.00 51.00  ? 1   ARG B NH2   1 
ATOM   2592 N  N     . PHE B 1 26  ? 50.193 11.076 -5.645  1.00 24.09  ? 2   PHE B N     1 
ATOM   2593 C  CA    . PHE B 1 26  ? 49.924 12.043 -4.584  1.00 19.26  ? 2   PHE B CA    1 
ATOM   2594 C  C     . PHE B 1 26  ? 48.614 12.793 -4.749  1.00 18.36  ? 2   PHE B C     1 
ATOM   2595 O  O     . PHE B 1 26  ? 48.177 13.121 -5.860  1.00 22.11  ? 2   PHE B O     1 
ATOM   2596 C  CB    . PHE B 1 26  ? 51.098 13.025 -4.411  1.00 17.07  ? 2   PHE B CB    1 
ATOM   2597 C  CG    . PHE B 1 26  ? 52.400 12.347 -4.114  1.00 19.07  ? 2   PHE B CG    1 
ATOM   2598 C  CD1   . PHE B 1 26  ? 52.706 11.933 -2.806  1.00 19.94  ? 2   PHE B CD1   1 
ATOM   2599 C  CD2   . PHE B 1 26  ? 53.307 12.068 -5.132  1.00 22.34  ? 2   PHE B CD2   1 
ATOM   2600 C  CE1   . PHE B 1 26  ? 53.893 11.292 -2.537  1.00 17.30  ? 2   PHE B CE1   1 
ATOM   2601 C  CE2   . PHE B 1 26  ? 54.506 11.401 -4.854  1.00 23.30  ? 2   PHE B CE2   1 
ATOM   2602 C  CZ    . PHE B 1 26  ? 54.794 11.022 -3.552  1.00 22.77  ? 2   PHE B CZ    1 
ATOM   2603 N  N     . ASP B 1 27  ? 47.959 13.022 -3.621  1.00 16.56  ? 3   ASP B N     1 
ATOM   2604 C  CA    . ASP B 1 27  ? 46.830 13.912 -3.584  1.00 18.37  ? 3   ASP B CA    1 
ATOM   2605 C  C     . ASP B 1 27  ? 47.317 15.347 -3.539  1.00 17.78  ? 3   ASP B C     1 
ATOM   2606 O  O     . ASP B 1 27  ? 46.897 16.155 -4.340  1.00 18.88  ? 3   ASP B O     1 
ATOM   2607 C  CB    . ASP B 1 27  ? 45.932 13.605 -2.387  1.00 20.04  ? 3   ASP B CB    1 
ATOM   2608 C  CG    . ASP B 1 27  ? 45.369 12.183 -2.438  1.00 21.93  ? 3   ASP B CG    1 
ATOM   2609 O  OD1   . ASP B 1 27  ? 44.847 11.763 -3.514  1.00 23.61  ? 3   ASP B OD1   1 
ATOM   2610 O  OD2   . ASP B 1 27  ? 45.475 11.476 -1.417  1.00 22.99  ? 3   ASP B OD2   1 
ATOM   2611 N  N     . VAL B 1 28  ? 48.201 15.662 -2.591  1.00 18.50  ? 4   VAL B N     1 
ATOM   2612 C  CA    . VAL B 1 28  ? 48.658 17.029 -2.401  1.00 18.04  ? 4   VAL B CA    1 
ATOM   2613 C  C     . VAL B 1 28  ? 50.183 17.124 -2.272  1.00 17.10  ? 4   VAL B C     1 
ATOM   2614 O  O     . VAL B 1 28  ? 50.814 16.485 -1.402  1.00 19.84  ? 4   VAL B O     1 
ATOM   2615 C  CB    . VAL B 1 28  ? 48.008 17.705 -1.150  1.00 18.28  ? 4   VAL B CB    1 
ATOM   2616 C  CG1   . VAL B 1 28  ? 48.476 19.156 -1.003  1.00 20.03  ? 4   VAL B CG1   1 
ATOM   2617 C  CG2   . VAL B 1 28  ? 46.479 17.650 -1.190  1.00 20.93  ? 4   VAL B CG2   1 
ATOM   2618 N  N     . LEU B 1 29  ? 50.763 17.930 -3.139  1.00 15.33  ? 5   LEU B N     1 
ATOM   2619 C  CA    . LEU B 1 29  ? 52.136 18.378 -3.017  1.00 14.57  ? 5   LEU B CA    1 
ATOM   2620 C  C     . LEU B 1 29  ? 52.124 19.837 -2.547  1.00 16.23  ? 5   LEU B C     1 
ATOM   2621 O  O     . LEU B 1 29  ? 51.464 20.706 -3.133  1.00 16.08  ? 5   LEU B O     1 
ATOM   2622 C  CB    . LEU B 1 29  ? 52.882 18.249 -4.372  1.00 12.75  ? 5   LEU B CB    1 
ATOM   2623 C  CG    . LEU B 1 29  ? 54.241 18.939 -4.578  1.00 14.57  ? 5   LEU B CG    1 
ATOM   2624 C  CD1   . LEU B 1 29  ? 55.321 18.388 -3.643  1.00 12.29  ? 5   LEU B CD1   1 
ATOM   2625 C  CD2   . LEU B 1 29  ? 54.672 18.806 -6.038  1.00 17.24  ? 5   LEU B CD2   1 
ATOM   2626 N  N     . THR B 1 30  ? 52.827 20.108 -1.451  1.00 16.02  ? 6   THR B N     1 
ATOM   2627 C  CA    . THR B 1 30  ? 53.008 21.468 -1.035  1.00 13.46  ? 6   THR B CA    1 
ATOM   2628 C  C     . THR B 1 30  ? 54.487 21.874 -1.186  1.00 11.60  ? 6   THR B C     1 
ATOM   2629 O  O     . THR B 1 30  ? 55.383 21.047 -1.121  1.00 12.43  ? 6   THR B O     1 
ATOM   2630 C  CB    . THR B 1 30  ? 52.597 21.696 0.438   1.00 13.77  ? 6   THR B CB    1 
ATOM   2631 O  OG1   . THR B 1 30  ? 53.527 21.009 1.262   1.00 15.47  ? 6   THR B OG1   1 
ATOM   2632 C  CG2   . THR B 1 30  ? 51.140 21.216 0.705   1.00 11.91  ? 6   THR B CG2   1 
ATOM   2633 N  N     . VAL B 1 31  ? 54.706 23.163 -1.406  1.00 11.98  ? 7   VAL B N     1 
ATOM   2634 C  CA    . VAL B 1 31  ? 56.045 23.742 -1.550  1.00 12.16  ? 7   VAL B CA    1 
ATOM   2635 C  C     . VAL B 1 31  ? 56.135 24.946 -0.646  1.00 12.43  ? 7   VAL B C     1 
ATOM   2636 O  O     . VAL B 1 31  ? 55.262 25.829 -0.667  1.00 12.73  ? 7   VAL B O     1 
ATOM   2637 C  CB    . VAL B 1 31  ? 56.363 24.132 -3.005  1.00 13.91  ? 7   VAL B CB    1 
ATOM   2638 C  CG1   . VAL B 1 31  ? 57.810 24.589 -3.138  1.00 13.94  ? 7   VAL B CG1   1 
ATOM   2639 C  CG2   . VAL B 1 31  ? 56.134 22.940 -3.900  1.00 13.92  ? 7   VAL B CG2   1 
ATOM   2640 N  N     . GLY B 1 32  ? 57.184 24.968 0.179   1.00 13.23  ? 8   GLY B N     1 
ATOM   2641 C  CA    . GLY B 1 32  ? 57.330 26.104 1.101   1.00 12.28  ? 8   GLY B CA    1 
ATOM   2642 C  C     . GLY B 1 32  ? 58.723 26.297 1.677   1.00 12.83  ? 8   GLY B C     1 
ATOM   2643 O  O     . GLY B 1 32  ? 59.646 25.564 1.356   1.00 14.26  ? 8   GLY B O     1 
ATOM   2644 N  N     . ASN B 1 33  ? 58.856 27.340 2.480   1.00 12.41  ? 9   ASN B N     1 
ATOM   2645 C  CA    . ASN B 1 33  ? 60.049 27.574 3.314   1.00 12.23  ? 9   ASN B CA    1 
ATOM   2646 C  C     . ASN B 1 33  ? 60.115 26.528 4.415   1.00 11.23  ? 9   ASN B C     1 
ATOM   2647 O  O     . ASN B 1 33  ? 59.188 26.422 5.203   1.00 13.06  ? 9   ASN B O     1 
ATOM   2648 C  CB    . ASN B 1 33  ? 59.998 28.988 3.869   1.00 14.14  ? 9   ASN B CB    1 
ATOM   2649 C  CG    . ASN B 1 33  ? 60.213 30.043 2.791   1.00 14.79  ? 9   ASN B CG    1 
ATOM   2650 O  OD1   . ASN B 1 33  ? 61.152 29.951 2.003   1.00 16.59  ? 9   ASN B OD1   1 
ATOM   2651 N  ND2   . ASN B 1 33  ? 59.359 31.063 2.771   1.00 16.22  ? 9   ASN B ND2   1 
ATOM   2652 N  N     . ALA B 1 34  ? 61.163 25.707 4.415   1.00 10.06  ? 10  ALA B N     1 
ATOM   2653 C  CA    . ALA B 1 34  ? 61.291 24.662 5.441   1.00 11.73  ? 10  ALA B CA    1 
ATOM   2654 C  C     . ALA B 1 34  ? 61.847 25.302 6.716   1.00 12.93  ? 10  ALA B C     1 
ATOM   2655 O  O     . ALA B 1 34  ? 62.964 25.815 6.707   1.00 13.60  ? 10  ALA B O     1 
ATOM   2656 C  CB    . ALA B 1 34  ? 62.174 23.533 4.974   1.00 12.56  ? 10  ALA B CB    1 
ATOM   2657 N  N     . ILE B 1 35  ? 61.057 25.257 7.788   1.00 13.27  ? 11  ILE B N     1 
ATOM   2658 C  CA    . ILE B 1 35  ? 61.343 26.029 9.021   1.00 11.85  ? 11  ILE B CA    1 
ATOM   2659 C  C     . ILE B 1 35  ? 61.108 25.206 10.283  1.00 12.94  ? 11  ILE B C     1 
ATOM   2660 O  O     . ILE B 1 35  ? 60.160 24.409 10.373  1.00 12.65  ? 11  ILE B O     1 
ATOM   2661 C  CB    . ILE B 1 35  ? 60.510 27.352 9.046   1.00 12.08  ? 11  ILE B CB    1 
ATOM   2662 C  CG1   . ILE B 1 35  ? 60.950 28.282 7.888   1.00 12.29  ? 11  ILE B CG1   1 
ATOM   2663 C  CG2   . ILE B 1 35  ? 60.593 28.054 10.428  1.00 12.28  ? 11  ILE B CG2   1 
ATOM   2664 C  CD1   . ILE B 1 35  ? 59.912 29.298 7.471   1.00 13.45  ? 11  ILE B CD1   1 
ATOM   2665 N  N     . VAL B 1 36  ? 62.004 25.376 11.250  1.00 13.50  ? 12  VAL B N     1 
ATOM   2666 C  CA    . VAL B 1 36  ? 61.759 24.855 12.602  1.00 13.27  ? 12  VAL B CA    1 
ATOM   2667 C  C     . VAL B 1 36  ? 61.361 26.046 13.486  1.00 11.61  ? 12  VAL B C     1 
ATOM   2668 O  O     . VAL B 1 36  ? 61.997 27.077 13.448  1.00 13.46  ? 12  VAL B O     1 
ATOM   2669 C  CB    . VAL B 1 36  ? 63.011 24.139 13.149  1.00 13.37  ? 12  VAL B CB    1 
ATOM   2670 C  CG1   . VAL B 1 36  ? 62.826 23.785 14.625  1.00 15.74  ? 12  VAL B CG1   1 
ATOM   2671 C  CG2   . VAL B 1 36  ? 63.311 22.885 12.323  1.00 13.94  ? 12  VAL B CG2   1 
ATOM   2672 N  N     . ASP B 1 37  ? 60.261 25.896 14.215  1.00 12.80  ? 13  ASP B N     1 
ATOM   2673 C  CA    . ASP B 1 37  ? 59.716 26.915 15.094  1.00 13.44  ? 13  ASP B CA    1 
ATOM   2674 C  C     . ASP B 1 37  ? 60.390 26.791 16.442  1.00 13.67  ? 13  ASP B C     1 
ATOM   2675 O  O     . ASP B 1 37  ? 60.679 25.683 16.901  1.00 14.65  ? 13  ASP B O     1 
ATOM   2676 C  CB    . ASP B 1 37  ? 58.208 26.731 15.272  1.00 15.11  ? 13  ASP B CB    1 
ATOM   2677 C  CG    . ASP B 1 37  ? 57.434 27.053 13.998  1.00 16.67  ? 13  ASP B CG    1 
ATOM   2678 O  OD1   . ASP B 1 37  ? 58.050 27.687 13.121  1.00 18.16  ? 13  ASP B OD1   1 
ATOM   2679 O  OD2   . ASP B 1 37  ? 56.233 26.699 13.899  1.00 16.62  ? 13  ASP B OD2   1 
ATOM   2680 N  N     . ILE B 1 38  ? 60.620 27.951 17.036  1.00 15.14  ? 14  ILE B N     1 
ATOM   2681 C  CA    . ILE B 1 38  ? 61.115 28.109 18.409  1.00 14.60  ? 14  ILE B CA    1 
ATOM   2682 C  C     . ILE B 1 38  ? 60.034 28.935 19.099  1.00 15.19  ? 14  ILE B C     1 
ATOM   2683 O  O     . ILE B 1 38  ? 59.840 30.118 18.777  1.00 14.95  ? 14  ILE B O     1 
ATOM   2684 C  CB    . ILE B 1 38  ? 62.481 28.809 18.440  1.00 15.12  ? 14  ILE B CB    1 
ATOM   2685 C  CG1   . ILE B 1 38  ? 63.497 28.006 17.633  1.00 15.88  ? 14  ILE B CG1   1 
ATOM   2686 C  CG2   . ILE B 1 38  ? 62.970 28.952 19.897  1.00 15.00  ? 14  ILE B CG2   1 
ATOM   2687 C  CD1   . ILE B 1 38  ? 64.748 28.762 17.237  1.00 19.15  ? 14  ILE B CD1   1 
ATOM   2688 N  N     . ILE B 1 39  ? 59.310 28.301 20.017  1.00 15.65  ? 15  ILE B N     1 
ATOM   2689 C  CA    . ILE B 1 39  ? 58.064 28.864 20.548  1.00 16.83  ? 15  ILE B CA    1 
ATOM   2690 C  C     . ILE B 1 39  ? 58.173 29.272 22.011  1.00 17.17  ? 15  ILE B C     1 
ATOM   2691 O  O     . ILE B 1 39  ? 58.641 28.493 22.835  1.00 18.81  ? 15  ILE B O     1 
ATOM   2692 C  CB    . ILE B 1 39  ? 56.897 27.853 20.412  1.00 18.35  ? 15  ILE B CB    1 
ATOM   2693 C  CG1   . ILE B 1 39  ? 56.806 27.313 18.981  1.00 19.55  ? 15  ILE B CG1   1 
ATOM   2694 C  CG2   . ILE B 1 39  ? 55.564 28.479 20.821  1.00 20.11  ? 15  ILE B CG2   1 
ATOM   2695 C  CD1   . ILE B 1 39  ? 56.130 25.957 18.886  1.00 19.13  ? 15  ILE B CD1   1 
ATOM   2696 N  N     . SER B 1 40  ? 57.731 30.491 22.325  1.00 17.84  ? 16  SER B N     1 
ATOM   2697 C  CA    . SER B 1 40  ? 57.691 30.959 23.719  1.00 17.86  ? 16  SER B CA    1 
ATOM   2698 C  C     . SER B 1 40  ? 56.480 31.859 23.940  1.00 20.48  ? 16  SER B C     1 
ATOM   2699 O  O     . SER B 1 40  ? 55.953 32.465 22.998  1.00 21.63  ? 16  SER B O     1 
ATOM   2700 C  CB    . SER B 1 40  ? 58.979 31.695 24.084  1.00 21.23  ? 16  SER B CB    1 
ATOM   2701 O  OG    . SER B 1 40  ? 59.088 31.862 25.491  1.00 29.45  ? 16  SER B OG    1 
ATOM   2702 N  N     . ARG B 1 41  ? 56.023 31.922 25.181  1.00 22.35  ? 17  ARG B N     1 
ATOM   2703 C  CA    . ARG B 1 41  ? 54.911 32.779 25.562  1.00 22.19  ? 17  ARG B CA    1 
ATOM   2704 C  C     . ARG B 1 41  ? 55.480 34.136 26.003  1.00 21.44  ? 17  ARG B C     1 
ATOM   2705 O  O     . ARG B 1 41  ? 56.523 34.181 26.657  1.00 27.87  ? 17  ARG B O     1 
ATOM   2706 C  CB    . ARG B 1 41  ? 54.140 32.097 26.702  1.00 28.61  ? 17  ARG B CB    1 
ATOM   2707 C  CG    . ARG B 1 41  ? 52.642 32.330 26.707  1.00 33.50  ? 17  ARG B CG    1 
ATOM   2708 C  CD    . ARG B 1 41  ? 51.843 31.184 26.089  1.00 38.78  ? 17  ARG B CD    1 
ATOM   2709 N  NE    . ARG B 1 41  ? 50.434 31.559 25.920  1.00 45.41  ? 17  ARG B NE    1 
ATOM   2710 C  CZ    . ARG B 1 41  ? 49.447 30.733 25.570  1.00 46.41  ? 17  ARG B CZ    1 
ATOM   2711 N  NH1   . ARG B 1 41  ? 49.673 29.441 25.343  1.00 46.31  ? 17  ARG B NH1   1 
ATOM   2712 N  NH2   . ARG B 1 41  ? 48.213 31.207 25.449  1.00 47.36  ? 17  ARG B NH2   1 
ATOM   2713 N  N     . CYS B 1 42  ? 54.826 35.238 25.633  1.00 20.41  ? 18  CYS B N     1 
ATOM   2714 C  CA    . CYS B 1 42  ? 55.236 36.581 26.103  1.00 18.60  ? 18  CYS B CA    1 
ATOM   2715 C  C     . CYS B 1 42  ? 54.042 37.469 26.461  1.00 21.34  ? 18  CYS B C     1 
ATOM   2716 O  O     . CYS B 1 42  ? 52.899 37.129 26.156  1.00 21.15  ? 18  CYS B O     1 
ATOM   2717 C  CB    . CYS B 1 42  ? 56.134 37.278 25.075  1.00 22.59  ? 18  CYS B CB    1 
ATOM   2718 S  SG    . CYS B 1 42  ? 55.279 37.813 23.548  1.00 22.94  ? 18  CYS B SG    1 
ATOM   2719 N  N     . ASN B 1 43  ? 54.307 38.583 27.147  1.00 25.03  ? 19  ASN B N     1 
ATOM   2720 C  CA    . ASN B 1 43  ? 53.299 39.639 27.328  1.00 28.30  ? 19  ASN B CA    1 
ATOM   2721 C  C     . ASN B 1 43  ? 53.285 40.584 26.117  1.00 27.12  ? 19  ASN B C     1 
ATOM   2722 O  O     . ASN B 1 43  ? 54.197 40.528 25.290  1.00 25.31  ? 19  ASN B O     1 
ATOM   2723 C  CB    . ASN B 1 43  ? 53.493 40.391 28.663  1.00 31.93  ? 19  ASN B CB    1 
ATOM   2724 C  CG    . ASN B 1 43  ? 54.892 40.981 28.838  1.00 35.44  ? 19  ASN B CG    1 
ATOM   2725 O  OD1   . ASN B 1 43  ? 55.562 41.375 27.876  1.00 31.95  ? 19  ASN B OD1   1 
ATOM   2726 N  ND2   . ASN B 1 43  ? 55.328 41.072 30.093  1.00 39.43  ? 19  ASN B ND2   1 
ATOM   2727 N  N     . ASP B 1 44  ? 52.270 41.439 25.973  1.00 30.06  ? 20  ASP B N     1 
ATOM   2728 C  CA    . ASP B 1 44  ? 52.245 42.287 24.762  1.00 30.29  ? 20  ASP B CA    1 
ATOM   2729 C  C     . ASP B 1 44  ? 53.291 43.393 24.825  1.00 27.44  ? 20  ASP B C     1 
ATOM   2730 O  O     . ASP B 1 44  ? 53.695 43.934 23.801  1.00 25.19  ? 20  ASP B O     1 
ATOM   2731 C  CB    . ASP B 1 44  ? 50.861 42.858 24.440  1.00 28.07  ? 20  ASP B CB    1 
ATOM   2732 C  CG    . ASP B 1 44  ? 50.520 42.750 22.947  1.00 29.54  ? 20  ASP B CG    1 
ATOM   2733 O  OD1   . ASP B 1 44  ? 51.096 43.514 22.125  1.00 29.81  ? 20  ASP B OD1   1 
ATOM   2734 O  OD2   . ASP B 1 44  ? 49.687 41.882 22.589  1.00 27.45  ? 20  ASP B OD2   1 
ATOM   2735 N  N     . GLN B 1 45  ? 53.728 43.735 26.033  1.00 29.77  ? 21  GLN B N     1 
ATOM   2736 C  CA    . GLN B 1 45  ? 54.811 44.699 26.180  1.00 26.60  ? 21  GLN B CA    1 
ATOM   2737 C  C     . GLN B 1 45  ? 56.092 44.186 25.523  1.00 16.94  ? 21  GLN B C     1 
ATOM   2738 O  O     . GLN B 1 45  ? 56.900 44.961 25.057  1.00 17.13  ? 21  GLN B O     1 
ATOM   2739 C  CB    . GLN B 1 45  ? 55.051 45.042 27.650  1.00 26.83  ? 21  GLN B CB    1 
ATOM   2740 C  CG    . GLN B 1 45  ? 55.884 46.296 27.874  1.00 21.96  ? 21  GLN B CG    1 
ATOM   2741 C  CD    . GLN B 1 45  ? 55.244 47.549 27.305  1.00 29.56  ? 21  GLN B CD    1 
ATOM   2742 O  OE1   . GLN B 1 45  ? 54.024 47.724 27.366  1.00 31.51  ? 21  GLN B OE1   1 
ATOM   2743 N  NE2   . GLN B 1 45  ? 56.068 48.431 26.740  1.00 35.80  ? 21  GLN B NE2   1 
ATOM   2744 N  N     . PHE B 1 46  ? 56.283 42.873 25.502  1.00 20.37  ? 22  PHE B N     1 
ATOM   2745 C  CA    . PHE B 1 46  ? 57.463 42.326 24.867  1.00 18.49  ? 22  PHE B CA    1 
ATOM   2746 C  C     . PHE B 1 46  ? 57.478 42.680 23.372  1.00 19.60  ? 22  PHE B C     1 
ATOM   2747 O  O     . PHE B 1 46  ? 58.521 43.051 22.821  1.00 17.85  ? 22  PHE B O     1 
ATOM   2748 C  CB    . PHE B 1 46  ? 57.537 40.815 25.044  1.00 18.96  ? 22  PHE B CB    1 
ATOM   2749 C  CG    . PHE B 1 46  ? 58.773 40.212 24.454  1.00 20.33  ? 22  PHE B CG    1 
ATOM   2750 C  CD1   . PHE B 1 46  ? 59.931 40.106 25.207  1.00 20.75  ? 22  PHE B CD1   1 
ATOM   2751 C  CD2   . PHE B 1 46  ? 58.778 39.731 23.144  1.00 18.47  ? 22  PHE B CD2   1 
ATOM   2752 C  CE1   . PHE B 1 46  ? 61.078 39.554 24.667  1.00 21.38  ? 22  PHE B CE1   1 
ATOM   2753 C  CE2   . PHE B 1 46  ? 59.925 39.187 22.596  1.00 22.93  ? 22  PHE B CE2   1 
ATOM   2754 C  CZ    . PHE B 1 46  ? 61.077 39.084 23.368  1.00 23.49  ? 22  PHE B CZ    1 
ATOM   2755 N  N     . LEU B 1 47  ? 56.320 42.549 22.732  1.00 18.68  ? 23  LEU B N     1 
ATOM   2756 C  CA    . LEU B 1 47  ? 56.188 42.882 21.322  1.00 18.88  ? 23  LEU B CA    1 
ATOM   2757 C  C     . LEU B 1 47  ? 56.490 44.348 21.067  1.00 17.39  ? 23  LEU B C     1 
ATOM   2758 O  O     . LEU B 1 47  ? 57.275 44.668 20.193  1.00 20.57  ? 23  LEU B O     1 
ATOM   2759 C  CB    . LEU B 1 47  ? 54.808 42.484 20.787  1.00 16.24  ? 23  LEU B CB    1 
ATOM   2760 C  CG    . LEU B 1 47  ? 54.472 40.994 20.885  1.00 14.85  ? 23  LEU B CG    1 
ATOM   2761 C  CD1   . LEU B 1 47  ? 53.067 40.757 20.381  1.00 15.17  ? 23  LEU B CD1   1 
ATOM   2762 C  CD2   . LEU B 1 47  ? 55.496 40.112 20.179  1.00 13.82  ? 23  LEU B CD2   1 
ATOM   2763 N  N     . ILE B 1 48  ? 55.899 45.227 21.870  1.00 20.31  ? 24  ILE B N     1 
ATOM   2764 C  CA    . ILE B 1 48  ? 56.123 46.665 21.747  1.00 21.81  ? 24  ILE B CA    1 
ATOM   2765 C  C     . ILE B 1 48  ? 57.588 47.015 21.993  1.00 19.13  ? 24  ILE B C     1 
ATOM   2766 O  O     . ILE B 1 48  ? 58.191 47.722 21.188  1.00 23.08  ? 24  ILE B O     1 
ATOM   2767 C  CB    . ILE B 1 48  ? 55.161 47.461 22.651  1.00 23.43  ? 24  ILE B CB    1 
ATOM   2768 C  CG1   . ILE B 1 48  ? 53.724 47.166 22.219  1.00 23.39  ? 24  ILE B CG1   1 
ATOM   2769 C  CG2   . ILE B 1 48  ? 55.428 48.954 22.535  1.00 25.11  ? 24  ILE B CG2   1 
ATOM   2770 C  CD1   . ILE B 1 48  ? 52.735 47.020 23.346  1.00 24.57  ? 24  ILE B CD1   1 
ATOM   2771 N  N     . ASP B 1 49  ? 58.180 46.488 23.065  1.00 18.77  ? 25  ASP B N     1 
ATOM   2772 C  CA    . ASP B 1 49  ? 59.573 46.792 23.357  1.00 19.43  ? 25  ASP B CA    1 
ATOM   2773 C  C     . ASP B 1 49  ? 60.527 46.373 22.239  1.00 19.47  ? 25  ASP B C     1 
ATOM   2774 O  O     . ASP B 1 49  ? 61.516 47.060 21.955  1.00 22.49  ? 25  ASP B O     1 
ATOM   2775 C  CB    . ASP B 1 49  ? 59.992 46.195 24.725  1.00 19.18  ? 25  ASP B CB    1 
ATOM   2776 C  CG    . ASP B 1 49  ? 59.206 46.775 25.856  1.00 23.77  ? 25  ASP B CG    1 
ATOM   2777 O  OD1   . ASP B 1 49  ? 58.581 47.840 25.658  1.00 24.88  ? 25  ASP B OD1   1 
ATOM   2778 O  OD2   . ASP B 1 49  ? 59.221 46.187 26.961  1.00 31.03  ? 25  ASP B OD2   1 
ATOM   2779 N  N     . ASN B 1 50  ? 60.206 45.264 21.586  1.00 20.16  ? 26  ASN B N     1 
ATOM   2780 C  CA    . ASN B 1 50  ? 61.031 44.723 20.518  1.00 19.97  ? 26  ASN B CA    1 
ATOM   2781 C  C     . ASN B 1 50  ? 60.619 45.064 19.094  1.00 19.81  ? 26  ASN B C     1 
ATOM   2782 O  O     . ASN B 1 50  ? 61.223 44.552 18.144  1.00 19.22  ? 26  ASN B O     1 
ATOM   2783 C  CB    . ASN B 1 50  ? 61.173 43.223 20.692  1.00 18.57  ? 26  ASN B CB    1 
ATOM   2784 C  CG    . ASN B 1 50  ? 62.137 42.891 21.799  1.00 19.32  ? 26  ASN B CG    1 
ATOM   2785 O  OD1   . ASN B 1 50  ? 63.342 43.092 21.648  1.00 21.94  ? 26  ASN B OD1   1 
ATOM   2786 N  ND2   . ASN B 1 50  ? 61.606 42.443 22.943  1.00 17.70  ? 26  ASN B ND2   1 
ATOM   2787 N  N     . GLN B 1 51  ? 59.609 45.926 18.956  1.00 18.72  ? 27  GLN B N     1 
ATOM   2788 C  CA    . GLN B 1 51  ? 59.130 46.391 17.643  1.00 18.72  ? 27  GLN B CA    1 
ATOM   2789 C  C     . GLN B 1 51  ? 58.805 45.242 16.687  1.00 16.28  ? 27  GLN B C     1 
ATOM   2790 O  O     . GLN B 1 51  ? 59.056 45.312 15.442  1.00 23.55  ? 27  GLN B O     1 
ATOM   2791 C  CB    . GLN B 1 51  ? 60.094 47.423 17.069  1.00 20.04  ? 27  GLN B CB    1 
ATOM   2792 C  CG    . GLN B 1 51  ? 59.880 48.801 17.710  1.00 21.94  ? 27  GLN B CG    1 
ATOM   2793 C  CD    . GLN B 1 51  ? 61.062 49.737 17.576  1.00 30.56  ? 27  GLN B CD    1 
ATOM   2794 O  OE1   . GLN B 1 51  ? 62.149 49.348 17.144  1.00 41.44  ? 27  GLN B OE1   1 
ATOM   2795 N  NE2   . GLN B 1 51  ? 60.856 50.984 17.962  1.00 33.24  ? 27  GLN B NE2   1 
ATOM   2796 N  N     . ILE B 1 52  ? 58.211 44.204 17.268  1.00 14.26  ? 28  ILE B N     1 
ATOM   2797 C  CA    . ILE B 1 52  ? 57.704 43.015 16.563  1.00 15.93  ? 28  ILE B CA    1 
ATOM   2798 C  C     . ILE B 1 52  ? 56.262 43.266 16.158  1.00 17.72  ? 28  ILE B C     1 
ATOM   2799 O  O     . ILE B 1 52  ? 55.421 43.513 17.009  1.00 18.19  ? 28  ILE B O     1 
ATOM   2800 C  CB    . ILE B 1 52  ? 57.761 41.748 17.493  1.00 15.63  ? 28  ILE B CB    1 
ATOM   2801 C  CG1   . ILE B 1 52  ? 59.210 41.370 17.831  1.00 15.63  ? 28  ILE B CG1   1 
ATOM   2802 C  CG2   . ILE B 1 52  ? 57.083 40.539 16.852  1.00 15.58  ? 28  ILE B CG2   1 
ATOM   2803 C  CD1   . ILE B 1 52  ? 59.340 40.404 19.011  1.00 17.81  ? 28  ILE B CD1   1 
ATOM   2804 N  N     . THR B 1 53  ? 55.958 43.215 14.858  1.00 17.81  ? 29  THR B N     1 
ATOM   2805 C  CA    . THR B 1 53  ? 54.585 43.447 14.407  1.00 17.46  ? 29  THR B CA    1 
ATOM   2806 C  C     . THR B 1 53  ? 53.686 42.263 14.824  1.00 16.12  ? 29  THR B C     1 
ATOM   2807 O  O     . THR B 1 53  ? 53.915 41.109 14.388  1.00 18.20  ? 29  THR B O     1 
ATOM   2808 C  CB    . THR B 1 53  ? 54.567 43.704 12.884  1.00 19.48  ? 29  THR B CB    1 
ATOM   2809 O  OG1   . THR B 1 53  ? 55.459 44.784 12.591  1.00 18.53  ? 29  THR B OG1   1 
ATOM   2810 C  CG2   . THR B 1 53  ? 53.174 44.073 12.398  1.00 22.17  ? 29  THR B CG2   1 
ATOM   2811 N  N     . LYS B 1 54  ? 52.677 42.542 15.660  1.00 15.39  ? 30  LYS B N     1 
ATOM   2812 C  CA    . LYS B 1 54  ? 51.865 41.477 16.262  1.00 16.86  ? 30  LYS B CA    1 
ATOM   2813 C  C     . LYS B 1 54  ? 51.025 40.754 15.200  1.00 16.65  ? 30  LYS B C     1 
ATOM   2814 O  O     . LYS B 1 54  ? 50.489 41.399 14.291  1.00 20.51  ? 30  LYS B O     1 
ATOM   2815 C  CB    . LYS B 1 54  ? 50.982 42.014 17.408  1.00 17.49  ? 30  LYS B CB    1 
ATOM   2816 C  CG    . LYS B 1 54  ? 49.966 41.024 17.965  1.00 19.25  ? 30  LYS B CG    1 
ATOM   2817 C  CD    . LYS B 1 54  ? 49.374 41.474 19.296  1.00 24.44  ? 30  LYS B CD    1 
ATOM   2818 C  CE    . LYS B 1 54  ? 48.352 40.472 19.819  1.00 23.35  ? 30  LYS B CE    1 
ATOM   2819 N  NZ    . LYS B 1 54  ? 47.786 40.854 21.151  1.00 22.35  ? 30  LYS B NZ    1 
ATOM   2820 N  N     . ALA B 1 55  ? 50.947 39.424 15.316  1.00 19.12  ? 31  ALA B N     1 
ATOM   2821 C  CA    . ALA B 1 55  ? 50.141 38.568 14.442  1.00 18.65  ? 31  ALA B CA    1 
ATOM   2822 C  C     . ALA B 1 55  ? 50.722 38.404 13.035  1.00 18.17  ? 31  ALA B C     1 
ATOM   2823 O  O     . ALA B 1 55  ? 50.121 37.749 12.193  1.00 22.79  ? 31  ALA B O     1 
ATOM   2824 C  CB    . ALA B 1 55  ? 48.684 39.044 14.382  1.00 20.12  ? 31  ALA B CB    1 
ATOM   2825 N  N     . ALA B 1 56  ? 51.905 38.962 12.809  1.00 16.78  ? 32  ALA B N     1 
ATOM   2826 C  CA    . ALA B 1 56  ? 52.523 38.983 11.490  1.00 17.44  ? 32  ALA B CA    1 
ATOM   2827 C  C     . ALA B 1 56  ? 53.775 38.101 11.395  1.00 17.74  ? 32  ALA B C     1 
ATOM   2828 O  O     . ALA B 1 56  ? 54.347 37.664 12.414  1.00 18.17  ? 32  ALA B O     1 
ATOM   2829 C  CB    . ALA B 1 56  ? 52.842 40.420 11.098  1.00 21.80  ? 32  ALA B CB    1 
HETATM 2830 N  N     . MSE B 1 57  ? 54.185 37.823 10.163  1.00 16.29  ? 33  MSE B N     1 
HETATM 2831 C  CA    . MSE B 1 57  ? 55.471 37.200 9.894   1.00 15.04  ? 33  MSE B CA    1 
HETATM 2832 C  C     . MSE B 1 57  ? 56.482 38.304 9.676   1.00 15.87  ? 33  MSE B C     1 
HETATM 2833 O  O     . MSE B 1 57  ? 56.402 39.069 8.709   1.00 16.89  ? 33  MSE B O     1 
HETATM 2834 C  CB    . MSE B 1 57  ? 55.292 36.301 8.662   1.00 16.69  ? 33  MSE B CB    1 
HETATM 2835 C  CG    . MSE B 1 57  ? 56.363 35.240 8.565   1.00 18.33  ? 33  MSE B CG    1 
HETATM 2836 SE SE    . MSE B 1 57  ? 58.048 36.040 7.968   1.00 32.42  ? 33  MSE B SE    1 
HETATM 2837 C  CE    . MSE B 1 57  ? 57.486 36.547 6.146   1.00 19.58  ? 33  MSE B CE    1 
ATOM   2838 N  N     . ASN B 1 58  ? 57.427 38.420 10.614  1.00 12.59  ? 34  ASN B N     1 
ATOM   2839 C  CA    . ASN B 1 58  ? 58.484 39.420 10.582  1.00 13.89  ? 34  ASN B CA    1 
ATOM   2840 C  C     . ASN B 1 58  ? 59.779 38.792 10.095  1.00 16.12  ? 34  ASN B C     1 
ATOM   2841 O  O     . ASN B 1 58  ? 60.363 37.968 10.802  1.00 16.36  ? 34  ASN B O     1 
ATOM   2842 C  CB    . ASN B 1 58  ? 58.748 39.964 12.024  1.00 12.81  ? 34  ASN B CB    1 
ATOM   2843 C  CG    . ASN B 1 58  ? 57.534 40.670 12.629  1.00 15.67  ? 34  ASN B CG    1 
ATOM   2844 O  OD1   . ASN B 1 58  ? 57.458 41.890 12.613  1.00 20.83  ? 34  ASN B OD1   1 
ATOM   2845 N  ND2   . ASN B 1 58  ? 56.571 39.904 13.125  1.00 16.13  ? 34  ASN B ND2   1 
ATOM   2846 N  N     . LEU B 1 59  ? 60.245 39.163 8.901   1.00 17.03  ? 35  LEU B N     1 
ATOM   2847 C  CA    . LEU B 1 59  ? 61.566 38.717 8.435   1.00 15.19  ? 35  LEU B CA    1 
ATOM   2848 C  C     . LEU B 1 59  ? 62.703 39.367 9.230   1.00 16.21  ? 35  LEU B C     1 
ATOM   2849 O  O     . LEU B 1 59  ? 62.649 40.580 9.598   1.00 16.87  ? 35  LEU B O     1 
ATOM   2850 C  CB    . LEU B 1 59  ? 61.760 38.966 6.926   1.00 15.88  ? 35  LEU B CB    1 
ATOM   2851 C  CG    . LEU B 1 59  ? 60.983 38.031 5.993   1.00 16.83  ? 35  LEU B CG    1 
ATOM   2852 C  CD1   . LEU B 1 59  ? 60.935 38.631 4.591   1.00 19.92  ? 35  LEU B CD1   1 
ATOM   2853 C  CD2   . LEU B 1 59  ? 61.568 36.631 5.952   1.00 17.30  ? 35  LEU B CD2   1 
ATOM   2854 N  N     . ILE B 1 60  ? 63.709 38.550 9.521   1.00 15.77  ? 36  ILE B N     1 
ATOM   2855 C  CA    . ILE B 1 60  ? 64.871 39.029 10.289  1.00 13.83  ? 36  ILE B CA    1 
ATOM   2856 C  C     . ILE B 1 60  ? 66.179 38.445 9.748   1.00 14.93  ? 36  ILE B C     1 
ATOM   2857 O  O     . ILE B 1 60  ? 66.208 37.309 9.261   1.00 16.48  ? 36  ILE B O     1 
ATOM   2858 C  CB    . ILE B 1 60  ? 64.729 38.665 11.798  1.00 14.33  ? 36  ILE B CB    1 
ATOM   2859 C  CG1   . ILE B 1 60  ? 64.668 37.163 12.016  1.00 16.67  ? 36  ILE B CG1   1 
ATOM   2860 C  CG2   . ILE B 1 60  ? 63.506 39.356 12.419  1.00 17.06  ? 36  ILE B CG2   1 
ATOM   2861 C  CD1   . ILE B 1 60  ? 64.675 36.770 13.481  1.00 16.55  ? 36  ILE B CD1   1 
ATOM   2862 N  N     . ASP B 1 61  ? 67.261 39.216 9.844   1.00 17.17  ? 37  ASP B N     1 
ATOM   2863 C  CA    . ASP B 1 61  ? 68.600 38.728 9.507   1.00 18.13  ? 37  ASP B CA    1 
ATOM   2864 C  C     . ASP B 1 61  ? 69.247 37.973 10.664  1.00 19.47  ? 37  ASP B C     1 
ATOM   2865 O  O     . ASP B 1 61  ? 68.656 37.860 11.746  1.00 18.14  ? 37  ASP B O     1 
ATOM   2866 C  CB    . ASP B 1 61  ? 69.515 39.860 8.972   1.00 21.96  ? 37  ASP B CB    1 
ATOM   2867 C  CG    . ASP B 1 61  ? 69.765 40.992 9.985   1.00 21.50  ? 37  ASP B CG    1 
ATOM   2868 O  OD1   . ASP B 1 61  ? 69.683 40.784 11.218  1.00 23.87  ? 37  ASP B OD1   1 
ATOM   2869 O  OD2   . ASP B 1 61  ? 70.069 42.124 9.525   1.00 24.44  ? 37  ASP B OD2   1 
ATOM   2870 N  N     . ALA B 1 62  ? 70.452 37.462 10.421  1.00 17.89  ? 38  ALA B N     1 
ATOM   2871 C  CA    . ALA B 1 62  ? 71.141 36.591 11.367  1.00 18.57  ? 38  ALA B CA    1 
ATOM   2872 C  C     . ALA B 1 62  ? 71.441 37.345 12.671  1.00 20.57  ? 38  ALA B C     1 
ATOM   2873 O  O     . ALA B 1 62  ? 71.290 36.782 13.767  1.00 22.17  ? 38  ALA B O     1 
ATOM   2874 C  CB    . ALA B 1 62  ? 72.417 36.022 10.744  1.00 18.92  ? 38  ALA B CB    1 
ATOM   2875 N  N     . GLU B 1 63  ? 71.832 38.617 12.551  1.00 20.13  ? 39  GLU B N     1 
ATOM   2876 C  CA    . GLU B 1 63  ? 72.137 39.443 13.736  1.00 22.76  ? 39  GLU B CA    1 
ATOM   2877 C  C     . GLU B 1 63  ? 70.906 39.695 14.619  1.00 21.53  ? 39  GLU B C     1 
ATOM   2878 O  O     . GLU B 1 63  ? 70.975 39.590 15.844  1.00 22.76  ? 39  GLU B O     1 
ATOM   2879 C  CB    . GLU B 1 63  ? 72.813 40.775 13.365  1.00 22.35  ? 39  GLU B CB    1 
ATOM   2880 C  CG    . GLU B 1 63  ? 73.380 41.509 14.582  1.00 29.80  ? 39  GLU B CG    1 
ATOM   2881 C  CD    . GLU B 1 63  ? 73.910 42.908 14.290  1.00 35.09  ? 39  GLU B CD    1 
ATOM   2882 O  OE1   . GLU B 1 63  ? 73.846 43.372 13.135  1.00 38.30  ? 39  GLU B OE1   1 
ATOM   2883 O  OE2   . GLU B 1 63  ? 74.403 43.557 15.239  1.00 43.73  ? 39  GLU B OE2   1 
ATOM   2884 N  N     . ARG B 1 64  ? 69.780 40.024 13.996  1.00 22.21  ? 40  ARG B N     1 
ATOM   2885 C  CA    . ARG B 1 64  ? 68.538 40.204 14.743  1.00 18.80  ? 40  ARG B CA    1 
ATOM   2886 C  C     . ARG B 1 64  ? 68.030 38.905 15.367  1.00 17.44  ? 40  ARG B C     1 
ATOM   2887 O  O     . ARG B 1 64  ? 67.391 38.932 16.420  1.00 18.42  ? 40  ARG B O     1 
ATOM   2888 C  CB    . ARG B 1 64  ? 67.460 40.846 13.855  1.00 18.39  ? 40  ARG B CB    1 
ATOM   2889 C  CG    . ARG B 1 64  ? 66.092 40.955 14.522  1.00 17.50  ? 40  ARG B CG    1 
ATOM   2890 C  CD    . ARG B 1 64  ? 65.429 42.303 14.310  1.00 23.16  ? 40  ARG B CD    1 
ATOM   2891 N  NE    . ARG B 1 64  ? 64.083 42.350 14.891  1.00 26.91  ? 40  ARG B NE    1 
ATOM   2892 C  CZ    . ARG B 1 64  ? 63.777 42.778 16.115  1.00 27.25  ? 40  ARG B CZ    1 
ATOM   2893 N  NH1   . ARG B 1 64  ? 64.717 43.224 16.953  1.00 26.41  ? 40  ARG B NH1   1 
ATOM   2894 N  NH2   . ARG B 1 64  ? 62.506 42.765 16.502  1.00 24.13  ? 40  ARG B NH2   1 
ATOM   2895 N  N     . ALA B 1 65  ? 68.287 37.777 14.706  1.00 18.97  ? 41  ALA B N     1 
ATOM   2896 C  CA    . ALA B 1 65  ? 67.892 36.462 15.229  1.00 17.90  ? 41  ALA B CA    1 
ATOM   2897 C  C     . ALA B 1 65  ? 68.592 36.203 16.570  1.00 18.99  ? 41  ALA B C     1 
ATOM   2898 O  O     . ALA B 1 65  ? 67.958 35.816 17.551  1.00 18.13  ? 41  ALA B O     1 
ATOM   2899 C  CB    . ALA B 1 65  ? 68.206 35.357 14.228  1.00 16.80  ? 41  ALA B CB    1 
ATOM   2900 N  N     . GLU B 1 66  ? 69.897 36.452 16.600  1.00 19.24  ? 42  GLU B N     1 
ATOM   2901 C  CA    . GLU B 1 66  ? 70.697 36.305 17.821  1.00 21.22  ? 42  GLU B CA    1 
ATOM   2902 C  C     . GLU B 1 66  ? 70.179 37.241 18.904  1.00 20.28  ? 42  GLU B C     1 
ATOM   2903 O  O     . GLU B 1 66  ? 70.011 36.823 20.056  1.00 22.78  ? 42  GLU B O     1 
ATOM   2904 C  CB    . GLU B 1 66  ? 72.172 36.580 17.539  1.00 20.97  ? 42  GLU B CB    1 
ATOM   2905 C  CG    . GLU B 1 66  ? 72.847 35.569 16.620  1.00 27.81  ? 42  GLU B CG    1 
ATOM   2906 C  CD    . GLU B 1 66  ? 73.095 34.198 17.255  1.00 36.26  ? 42  GLU B CD    1 
ATOM   2907 O  OE1   . GLU B 1 66  ? 72.952 34.027 18.495  1.00 40.43  ? 42  GLU B OE1   1 
ATOM   2908 O  OE2   . GLU B 1 66  ? 73.453 33.270 16.500  1.00 40.54  ? 42  GLU B OE2   1 
ATOM   2909 N  N     . LEU B 1 67  ? 69.888 38.487 18.531  1.00 21.36  ? 43  LEU B N     1 
ATOM   2910 C  CA    . LEU B 1 67  ? 69.392 39.475 19.482  1.00 19.55  ? 43  LEU B CA    1 
ATOM   2911 C  C     . LEU B 1 67  ? 68.077 38.997 20.087  1.00 17.55  ? 43  LEU B C     1 
ATOM   2912 O  O     . LEU B 1 67  ? 67.945 38.924 21.298  1.00 17.87  ? 43  LEU B O     1 
ATOM   2913 C  CB    . LEU B 1 67  ? 69.236 40.849 18.816  1.00 19.12  ? 43  LEU B CB    1 
ATOM   2914 C  CG    . LEU B 1 67  ? 68.993 42.095 19.688  1.00 23.79  ? 43  LEU B CG    1 
ATOM   2915 C  CD1   . LEU B 1 67  ? 67.509 42.278 19.999  1.00 24.87  ? 43  LEU B CD1   1 
ATOM   2916 C  CD2   . LEU B 1 67  ? 69.814 42.047 20.969  1.00 28.90  ? 43  LEU B CD2   1 
ATOM   2917 N  N     . LEU B 1 68  ? 67.113 38.639 19.239  1.00 16.39  ? 44  LEU B N     1 
ATOM   2918 C  CA    . LEU B 1 68  ? 65.800 38.223 19.748  1.00 14.77  ? 44  LEU B CA    1 
ATOM   2919 C  C     . LEU B 1 68  ? 65.861 36.967 20.642  1.00 13.79  ? 44  LEU B C     1 
ATOM   2920 O  O     . LEU B 1 68  ? 65.126 36.846 21.607  1.00 15.85  ? 44  LEU B O     1 
ATOM   2921 C  CB    . LEU B 1 68  ? 64.823 38.002 18.590  1.00 17.24  ? 44  LEU B CB    1 
ATOM   2922 C  CG    . LEU B 1 68  ? 64.162 39.235 18.003  1.00 19.51  ? 44  LEU B CG    1 
ATOM   2923 C  CD1   . LEU B 1 68  ? 63.379 38.860 16.731  1.00 20.26  ? 44  LEU B CD1   1 
ATOM   2924 C  CD2   . LEU B 1 68  ? 63.265 39.956 18.998  1.00 20.33  ? 44  LEU B CD2   1 
ATOM   2925 N  N     . TYR B 1 69  ? 66.744 36.040 20.299  1.00 14.68  ? 45  TYR B N     1 
ATOM   2926 C  CA    . TYR B 1 69  ? 66.833 34.769 20.984  1.00 16.33  ? 45  TYR B CA    1 
ATOM   2927 C  C     . TYR B 1 69  ? 67.387 35.039 22.375  1.00 15.99  ? 45  TYR B C     1 
ATOM   2928 O  O     . TYR B 1 69  ? 66.955 34.443 23.336  1.00 16.50  ? 45  TYR B O     1 
ATOM   2929 C  CB    . TYR B 1 69  ? 67.749 33.814 20.220  1.00 16.59  ? 45  TYR B CB    1 
ATOM   2930 C  CG    . TYR B 1 69  ? 67.662 32.357 20.622  1.00 13.17  ? 45  TYR B CG    1 
ATOM   2931 C  CD1   . TYR B 1 69  ? 66.430 31.725 20.834  1.00 12.88  ? 45  TYR B CD1   1 
ATOM   2932 C  CD2   . TYR B 1 69  ? 68.826 31.593 20.757  1.00 14.17  ? 45  TYR B CD2   1 
ATOM   2933 C  CE1   . TYR B 1 69  ? 66.373 30.373 21.198  1.00 13.01  ? 45  TYR B CE1   1 
ATOM   2934 C  CE2   . TYR B 1 69  ? 68.784 30.242 21.095  1.00 14.51  ? 45  TYR B CE2   1 
ATOM   2935 C  CZ    . TYR B 1 69  ? 67.561 29.637 21.306  1.00 13.59  ? 45  TYR B CZ    1 
ATOM   2936 O  OH    . TYR B 1 69  ? 67.533 28.312 21.623  1.00 17.39  ? 45  TYR B OH    1 
ATOM   2937 N  N     . SER B 1 70  ? 68.285 36.008 22.440  1.00 15.73  ? 46  SER B N     1 
ATOM   2938 C  CA    . SER B 1 70  ? 68.937 36.405 23.710  1.00 16.84  ? 46  SER B CA    1 
ATOM   2939 C  C     . SER B 1 70  ? 67.900 36.949 24.679  1.00 17.30  ? 46  SER B C     1 
ATOM   2940 O  O     . SER B 1 70  ? 68.078 36.863 25.915  1.00 21.63  ? 46  SER B O     1 
ATOM   2941 C  CB    . SER B 1 70  ? 70.054 37.421 23.442  1.00 18.68  ? 46  SER B CB    1 
ATOM   2942 O  OG    . SER B 1 70  ? 69.573 38.748 23.248  1.00 20.58  ? 46  SER B OG    1 
ATOM   2943 N  N     . ARG B 1 71  ? 66.818 37.492 24.126  1.00 15.35  ? 47  ARG B N     1 
ATOM   2944 C  CA    . ARG B 1 71  ? 65.751 38.114 24.906  1.00 15.74  ? 47  ARG B CA    1 
ATOM   2945 C  C     . ARG B 1 71  ? 64.561 37.193 25.150  1.00 15.61  ? 47  ARG B C     1 
ATOM   2946 O  O     . ARG B 1 71  ? 63.699 37.507 25.978  1.00 16.79  ? 47  ARG B O     1 
ATOM   2947 C  CB    . ARG B 1 71  ? 65.279 39.403 24.222  1.00 15.79  ? 47  ARG B CB    1 
ATOM   2948 C  CG    . ARG B 1 71  ? 66.341 40.493 24.141  1.00 15.28  ? 47  ARG B CG    1 
ATOM   2949 C  CD    . ARG B 1 71  ? 65.774 41.788 23.588  1.00 16.80  ? 47  ARG B CD    1 
ATOM   2950 N  NE    . ARG B 1 71  ? 66.774 42.843 23.618  1.00 19.45  ? 47  ARG B NE    1 
ATOM   2951 C  CZ    . ARG B 1 71  ? 66.526 44.140 23.482  1.00 20.61  ? 47  ARG B CZ    1 
ATOM   2952 N  NH1   . ARG B 1 71  ? 65.286 44.573 23.277  1.00 20.52  ? 47  ARG B NH1   1 
ATOM   2953 N  NH2   . ARG B 1 71  ? 67.527 45.013 23.548  1.00 23.31  ? 47  ARG B NH2   1 
HETATM 2954 N  N     . MSE B 1 72  ? 64.521 36.075 24.420  1.00 15.22  ? 48  MSE B N     1 
HETATM 2955 C  CA    . MSE B 1 72  ? 63.415 35.127 24.462  1.00 14.21  ? 48  MSE B CA    1 
HETATM 2956 C  C     . MSE B 1 72  ? 63.561 34.255 25.670  1.00 16.00  ? 48  MSE B C     1 
HETATM 2957 O  O     . MSE B 1 72  ? 64.671 33.859 26.024  1.00 17.90  ? 48  MSE B O     1 
HETATM 2958 C  CB    . MSE B 1 72  ? 63.526 34.251 23.235  1.00 17.08  ? 48  MSE B CB    1 
HETATM 2959 C  CG    . MSE B 1 72  ? 62.333 33.318 23.154  1.00 20.43  ? 48  MSE B CG    1 
HETATM 2960 SE SE    . MSE B 1 72  ? 62.448 32.406 21.438  1.00 39.12  ? 48  MSE B SE    1 
HETATM 2961 C  CE    . MSE B 1 72  ? 60.522 32.496 21.068  1.00 25.32  ? 48  MSE B CE    1 
ATOM   2962 N  N     . GLY B 1 73  ? 62.425 33.927 26.282  1.00 19.15  ? 49  GLY B N     1 
ATOM   2963 C  CA    . GLY B 1 73  ? 62.383 33.017 27.413  1.00 20.03  ? 49  GLY B CA    1 
ATOM   2964 C  C     . GLY B 1 73  ? 62.645 31.580 26.994  1.00 19.79  ? 49  GLY B C     1 
ATOM   2965 O  O     . GLY B 1 73  ? 62.873 31.301 25.813  1.00 20.42  ? 49  GLY B O     1 
ATOM   2966 N  N     . PRO B 1 74  ? 62.621 30.649 27.962  1.00 18.27  ? 50  PRO B N     1 
ATOM   2967 C  CA    . PRO B 1 74  ? 62.781 29.229 27.655  1.00 17.53  ? 50  PRO B CA    1 
ATOM   2968 C  C     . PRO B 1 74  ? 61.726 28.819 26.639  1.00 16.94  ? 50  PRO B C     1 
ATOM   2969 O  O     . PRO B 1 74  ? 60.571 29.234 26.744  1.00 17.60  ? 50  PRO B O     1 
ATOM   2970 C  CB    . PRO B 1 74  ? 62.514 28.566 28.991  1.00 19.26  ? 50  PRO B CB    1 
ATOM   2971 C  CG    . PRO B 1 74  ? 63.024 29.567 29.969  1.00 22.02  ? 50  PRO B CG    1 
ATOM   2972 C  CD    . PRO B 1 74  ? 62.612 30.892 29.420  1.00 23.27  ? 50  PRO B CD    1 
ATOM   2973 N  N     . ALA B 1 75  ? 62.139 28.011 25.675  1.00 16.75  ? 51  ALA B N     1 
ATOM   2974 C  CA    . ALA B 1 75  ? 61.312 27.756 24.485  1.00 15.94  ? 51  ALA B CA    1 
ATOM   2975 C  C     . ALA B 1 75  ? 61.124 26.264 24.198  1.00 16.62  ? 51  ALA B C     1 
ATOM   2976 O  O     . ALA B 1 75  ? 61.783 25.405 24.792  1.00 18.49  ? 51  ALA B O     1 
ATOM   2977 C  CB    . ALA B 1 75  ? 61.908 28.483 23.283  1.00 17.34  ? 51  ALA B CB    1 
ATOM   2978 N  N     . LEU B 1 76  ? 60.199 25.960 23.286  1.00 15.32  ? 52  LEU B N     1 
ATOM   2979 C  CA    . LEU B 1 76  ? 60.012 24.606 22.785  1.00 15.89  ? 52  LEU B CA    1 
ATOM   2980 C  C     . LEU B 1 76  ? 60.274 24.690 21.299  1.00 16.41  ? 52  LEU B C     1 
ATOM   2981 O  O     . LEU B 1 76  ? 59.991 25.720 20.688  1.00 18.07  ? 52  LEU B O     1 
ATOM   2982 C  CB    . LEU B 1 76  ? 58.568 24.131 22.982  1.00 17.48  ? 52  LEU B CB    1 
ATOM   2983 C  CG    . LEU B 1 76  ? 57.949 24.078 24.380  1.00 17.79  ? 52  LEU B CG    1 
ATOM   2984 C  CD1   . LEU B 1 76  ? 56.473 23.704 24.285  1.00 16.45  ? 52  LEU B CD1   1 
ATOM   2985 C  CD2   . LEU B 1 76  ? 58.712 23.093 25.248  1.00 24.10  ? 52  LEU B CD2   1 
ATOM   2986 N  N     . GLU B 1 77  ? 60.811 23.620 20.731  1.00 16.77  ? 53  GLU B N     1 
ATOM   2987 C  CA    . GLU B 1 77  ? 61.020 23.549 19.279  1.00 14.33  ? 53  GLU B CA    1 
ATOM   2988 C  C     . GLU B 1 77  ? 60.081 22.555 18.640  1.00 13.99  ? 53  GLU B C     1 
ATOM   2989 O  O     . GLU B 1 77  ? 59.791 21.501 19.195  1.00 14.46  ? 53  GLU B O     1 
ATOM   2990 C  CB    . GLU B 1 77  ? 62.465 23.199 18.913  1.00 15.92  ? 53  GLU B CB    1 
ATOM   2991 C  CG    . GLU B 1 77  ? 63.477 24.264 19.298  1.00 17.94  ? 53  GLU B CG    1 
ATOM   2992 C  CD    . GLU B 1 77  ? 63.682 24.345 20.806  1.00 19.07  ? 53  GLU B CD    1 
ATOM   2993 O  OE1   . GLU B 1 77  ? 63.630 25.463 21.333  1.00 20.44  ? 53  GLU B OE1   1 
ATOM   2994 O  OE2   . GLU B 1 77  ? 63.867 23.289 21.449  1.00 18.03  ? 53  GLU B OE2   1 
ATOM   2995 N  N     . ALA B 1 78  ? 59.610 22.901 17.441  1.00 12.66  ? 54  ALA B N     1 
ATOM   2996 C  CA    . ALA B 1 78  ? 58.670 22.037 16.728  1.00 13.47  ? 54  ALA B CA    1 
ATOM   2997 C  C     . ALA B 1 78  ? 58.813 22.367 15.258  1.00 13.51  ? 54  ALA B C     1 
ATOM   2998 O  O     . ALA B 1 78  ? 58.926 23.531 14.901  1.00 13.10  ? 54  ALA B O     1 
ATOM   2999 C  CB    . ALA B 1 78  ? 57.234 22.303 17.152  1.00 14.01  ? 54  ALA B CB    1 
ATOM   3000 N  N     . SER B 1 79  ? 58.794 21.333 14.429  1.00 15.62  ? 55  SER B N     1 
ATOM   3001 C  CA    . SER B 1 79  ? 58.874 21.539 12.989  1.00 13.49  ? 55  SER B CA    1 
ATOM   3002 C  C     . SER B 1 79  ? 57.737 22.432 12.500  1.00 13.71  ? 55  SER B C     1 
ATOM   3003 O  O     . SER B 1 79  ? 56.577 22.236 12.895  1.00 15.65  ? 55  SER B O     1 
ATOM   3004 C  CB    . SER B 1 79  ? 58.881 20.205 12.259  1.00 14.91  ? 55  SER B CB    1 
ATOM   3005 O  OG    . SER B 1 79  ? 60.182 19.633 12.209  1.00 17.47  ? 55  SER B OG    1 
ATOM   3006 N  N     . GLY B 1 80  ? 58.066 23.407 11.642  1.00 15.26  ? 56  GLY B N     1 
ATOM   3007 C  CA    . GLY B 1 80  ? 57.080 24.355 11.128  1.00 13.09  ? 56  GLY B CA    1 
ATOM   3008 C  C     . GLY B 1 80  ? 57.085 24.489 9.604   1.00 11.96  ? 56  GLY B C     1 
ATOM   3009 O  O     . GLY B 1 80  ? 57.199 23.498 8.905   1.00 13.75  ? 56  GLY B O     1 
ATOM   3010 N  N     . GLY B 1 81  ? 56.997 25.718 9.125   1.00 12.84  ? 57  GLY B N     1 
ATOM   3011 C  CA    . GLY B 1 81  ? 56.839 25.982 7.676   1.00 13.20  ? 57  GLY B CA    1 
ATOM   3012 C  C     . GLY B 1 81  ? 55.370 25.862 7.331   1.00 11.75  ? 57  GLY B C     1 
ATOM   3013 O  O     . GLY B 1 81  ? 54.741 24.833 7.613   1.00 12.73  ? 57  GLY B O     1 
ATOM   3014 N  N     . SER B 1 82  ? 54.797 26.927 6.782   1.00 12.18  ? 58  SER B N     1 
ATOM   3015 C  CA    A SER B 1 82  ? 53.372 26.934 6.503   0.50 12.34  ? 58  SER B CA    1 
ATOM   3016 C  CA    B SER B 1 82  ? 53.360 26.945 6.486   0.50 12.65  ? 58  SER B CA    1 
ATOM   3017 C  C     . SER B 1 82  ? 52.957 25.722 5.644   1.00 13.11  ? 58  SER B C     1 
ATOM   3018 O  O     . SER B 1 82  ? 52.137 24.898 6.072   1.00 11.23  ? 58  SER B O     1 
ATOM   3019 C  CB    A SER B 1 82  ? 52.974 28.251 5.852   0.50 13.01  ? 58  SER B CB    1 
ATOM   3020 C  CB    B SER B 1 82  ? 52.953 28.256 5.796   0.50 14.41  ? 58  SER B CB    1 
ATOM   3021 O  OG    A SER B 1 82  ? 51.576 28.298 5.721   0.50 13.79  ? 58  SER B OG    1 
ATOM   3022 O  OG    B SER B 1 82  ? 52.338 29.165 6.693   0.50 18.73  ? 58  SER B OG    1 
ATOM   3023 N  N     . ALA B 1 83  ? 53.573 25.577 4.467   1.00 14.29  ? 59  ALA B N     1 
ATOM   3024 C  CA    . ALA B 1 83  ? 53.333 24.422 3.576   1.00 14.08  ? 59  ALA B CA    1 
ATOM   3025 C  C     . ALA B 1 83  ? 53.722 23.051 4.160   1.00 13.55  ? 59  ALA B C     1 
ATOM   3026 O  O     . ALA B 1 83  ? 53.113 22.038 3.844   1.00 15.01  ? 59  ALA B O     1 
ATOM   3027 C  CB    . ALA B 1 83  ? 54.049 24.633 2.256   1.00 14.49  ? 59  ALA B CB    1 
ATOM   3028 N  N     . GLY B 1 84  ? 54.776 23.012 4.973   1.00 13.95  ? 60  GLY B N     1 
ATOM   3029 C  CA    . GLY B 1 84  ? 55.166 21.780 5.666   1.00 14.26  ? 60  GLY B CA    1 
ATOM   3030 C  C     . GLY B 1 84  ? 54.043 21.306 6.575   1.00 14.38  ? 60  GLY B C     1 
ATOM   3031 O  O     . GLY B 1 84  ? 53.637 20.134 6.503   1.00 13.61  ? 60  GLY B O     1 
ATOM   3032 N  N     . ASN B 1 85  ? 53.519 22.234 7.385   1.00 14.26  ? 61  ASN B N     1 
ATOM   3033 C  CA    . ASN B 1 85  ? 52.362 21.994 8.244   1.00 13.09  ? 61  ASN B CA    1 
ATOM   3034 C  C     . ASN B 1 85  ? 51.171 21.506 7.438   1.00 12.69  ? 61  ASN B C     1 
ATOM   3035 O  O     . ASN B 1 85  ? 50.471 20.562 7.815   1.00 12.38  ? 61  ASN B O     1 
ATOM   3036 C  CB    . ASN B 1 85  ? 51.964 23.261 9.009   1.00 13.49  ? 61  ASN B CB    1 
ATOM   3037 C  CG    . ASN B 1 85  ? 53.060 23.764 9.950   1.00 14.44  ? 61  ASN B CG    1 
ATOM   3038 O  OD1   . ASN B 1 85  ? 53.954 23.015 10.358  1.00 15.71  ? 61  ASN B OD1   1 
ATOM   3039 N  ND2   . ASN B 1 85  ? 52.991 25.045 10.292  1.00 15.51  ? 61  ASN B ND2   1 
ATOM   3040 N  N     . THR B 1 86  ? 50.963 22.147 6.295   1.00 13.34  ? 62  THR B N     1 
ATOM   3041 C  CA    . THR B 1 86  ? 49.828 21.758 5.456   1.00 11.96  ? 62  THR B CA    1 
ATOM   3042 C  C     . THR B 1 86  ? 49.973 20.322 4.931   1.00 12.39  ? 62  THR B C     1 
ATOM   3043 O  O     . THR B 1 86  ? 49.009 19.549 4.993   1.00 12.46  ? 62  THR B O     1 
ATOM   3044 C  CB    . THR B 1 86  ? 49.585 22.792 4.337   1.00 12.52  ? 62  THR B CB    1 
ATOM   3045 O  OG1   . THR B 1 86  ? 49.151 24.026 4.924   1.00 15.47  ? 62  THR B OG1   1 
ATOM   3046 C  CG2   . THR B 1 86  ? 48.485 22.302 3.373   1.00 13.96  ? 62  THR B CG2   1 
ATOM   3047 N  N     . ALA B 1 87  ? 51.159 19.962 4.412   1.00 12.70  ? 63  ALA B N     1 
ATOM   3048 C  CA    . ALA B 1 87  ? 51.428 18.582 4.005   1.00 12.75  ? 63  ALA B CA    1 
ATOM   3049 C  C     . ALA B 1 87  ? 51.190 17.602 5.166   1.00 13.00  ? 63  ALA B C     1 
ATOM   3050 O  O     . ALA B 1 87  ? 50.517 16.592 5.027   1.00 13.73  ? 63  ALA B O     1 
ATOM   3051 C  CB    . ALA B 1 87  ? 52.848 18.455 3.495   1.00 13.09  ? 63  ALA B CB    1 
ATOM   3052 N  N     . ALA B 1 88  ? 51.759 17.922 6.322   1.00 14.10  ? 64  ALA B N     1 
ATOM   3053 C  CA    . ALA B 1 88  ? 51.587 17.071 7.500   1.00 13.60  ? 64  ALA B CA    1 
ATOM   3054 C  C     . ALA B 1 88  ? 50.116 16.852 7.810   1.00 11.78  ? 64  ALA B C     1 
ATOM   3055 O  O     . ALA B 1 88  ? 49.723 15.747 8.143   1.00 16.03  ? 64  ALA B O     1 
ATOM   3056 C  CB    . ALA B 1 88  ? 52.324 17.656 8.684   1.00 15.70  ? 64  ALA B CB    1 
ATOM   3057 N  N     . GLY B 1 89  ? 49.298 17.901 7.664   1.00 13.45  ? 65  GLY B N     1 
ATOM   3058 C  CA    . GLY B 1 89  ? 47.879 17.830 7.970   1.00 15.07  ? 65  GLY B CA    1 
ATOM   3059 C  C     . GLY B 1 89  ? 47.099 16.959 7.009   1.00 14.11  ? 65  GLY B C     1 
ATOM   3060 O  O     . GLY B 1 89  ? 46.198 16.213 7.397   1.00 15.59  ? 65  GLY B O     1 
ATOM   3061 N  N     . VAL B 1 90  ? 47.441 17.065 5.734   1.00 14.80  ? 66  VAL B N     1 
ATOM   3062 C  CA    . VAL B 1 90  ? 46.903 16.149 4.722   1.00 14.51  ? 66  VAL B CA    1 
ATOM   3063 C  C     . VAL B 1 90  ? 47.207 14.677 5.030   1.00 13.76  ? 66  VAL B C     1 
ATOM   3064 O  O     . VAL B 1 90  ? 46.317 13.848 5.002   1.00 19.04  ? 66  VAL B O     1 
ATOM   3065 C  CB    . VAL B 1 90  ? 47.400 16.569 3.329   1.00 13.49  ? 66  VAL B CB    1 
ATOM   3066 C  CG1   . VAL B 1 90  ? 47.035 15.546 2.254   1.00 13.19  ? 66  VAL B CG1   1 
ATOM   3067 C  CG2   . VAL B 1 90  ? 46.857 17.953 2.996   1.00 14.14  ? 66  VAL B CG2   1 
ATOM   3068 N  N     . ALA B 1 91  ? 48.459 14.374 5.358   1.00 13.15  ? 67  ALA B N     1 
ATOM   3069 C  CA    . ALA B 1 91  ? 48.880 13.032 5.768   1.00 14.08  ? 67  ALA B CA    1 
ATOM   3070 C  C     . ALA B 1 91  ? 48.129 12.512 7.007   1.00 14.21  ? 67  ALA B C     1 
ATOM   3071 O  O     . ALA B 1 91  ? 47.546 11.461 6.965   1.00 20.19  ? 67  ALA B O     1 
ATOM   3072 C  CB    . ALA B 1 91  ? 50.376 12.990 5.968   1.00 10.35  ? 67  ALA B CB    1 
ATOM   3073 N  N     . ASN B 1 92  ? 48.126 13.283 8.085   1.00 18.11  ? 68  ASN B N     1 
ATOM   3074 C  CA    . ASN B 1 92  ? 47.329 12.978 9.288   1.00 18.62  ? 68  ASN B CA    1 
ATOM   3075 C  C     . ASN B 1 92  ? 45.879 12.593 8.929   1.00 19.48  ? 68  ASN B C     1 
ATOM   3076 O  O     . ASN B 1 92  ? 45.377 11.579 9.375   1.00 21.30  ? 68  ASN B O     1 
ATOM   3077 C  CB    . ASN B 1 92  ? 47.347 14.199 10.214  1.00 20.35  ? 68  ASN B CB    1 
ATOM   3078 C  CG    . ASN B 1 92  ? 46.911 13.887 11.638  1.00 19.50  ? 68  ASN B CG    1 
ATOM   3079 O  OD1   . ASN B 1 92  ? 46.031 13.053 11.879  1.00 21.39  ? 68  ASN B OD1   1 
ATOM   3080 N  ND2   . ASN B 1 92  ? 47.502 14.613 12.603  1.00 21.39  ? 68  ASN B ND2   1 
ATOM   3081 N  N     . LEU B 1 93  ? 45.223 13.407 8.108   1.00 21.67  ? 69  LEU B N     1 
ATOM   3082 C  CA    . LEU B 1 93  ? 43.850 13.126 7.644   1.00 19.97  ? 69  LEU B CA    1 
ATOM   3083 C  C     . LEU B 1 93  ? 43.670 11.821 6.842   1.00 17.74  ? 69  LEU B C     1 
ATOM   3084 O  O     . LEU B 1 93  ? 42.578 11.289 6.791   1.00 19.68  ? 69  LEU B O     1 
ATOM   3085 C  CB    . LEU B 1 93  ? 43.269 14.328 6.871   1.00 20.17  ? 69  LEU B CB    1 
ATOM   3086 C  CG    . LEU B 1 93  ? 42.700 15.540 7.639   1.00 16.29  ? 69  LEU B CG    1 
ATOM   3087 C  CD1   . LEU B 1 93  ? 42.792 16.826 6.826   1.00 18.78  ? 69  LEU B CD1   1 
ATOM   3088 C  CD2   . LEU B 1 93  ? 41.257 15.309 8.076   1.00 19.38  ? 69  LEU B CD2   1 
ATOM   3089 N  N     . GLY B 1 94  ? 44.748 11.320 6.236   1.00 18.48  ? 70  GLY B N     1 
ATOM   3090 C  CA    . GLY B 1 94  ? 44.720 10.079 5.477   1.00 22.82  ? 70  GLY B CA    1 
ATOM   3091 C  C     . GLY B 1 94  ? 45.025 10.247 4.000   1.00 21.11  ? 70  GLY B C     1 
ATOM   3092 O  O     . GLY B 1 94  ? 45.061 9.263  3.263   1.00 25.10  ? 70  GLY B O     1 
ATOM   3093 N  N     . GLY B 1 95  ? 45.270 11.480 3.571   1.00 20.99  ? 71  GLY B N     1 
ATOM   3094 C  CA    . GLY B 1 95  ? 45.596 11.774 2.169   1.00 20.61  ? 71  GLY B CA    1 
ATOM   3095 C  C     . GLY B 1 95  ? 47.061 11.534 1.853   1.00 18.18  ? 71  GLY B C     1 
ATOM   3096 O  O     . GLY B 1 95  ? 47.885 11.408 2.745   1.00 19.19  ? 71  GLY B O     1 
ATOM   3097 N  N     . LYS B 1 96  ? 47.389 11.457 0.570   1.00 17.33  ? 72  LYS B N     1 
ATOM   3098 C  CA    A LYS B 1 96  ? 48.760 11.168 0.168   0.50 15.06  ? 72  LYS B CA    1 
ATOM   3099 C  CA    B LYS B 1 96  ? 48.758 11.154 0.167   0.50 14.88  ? 72  LYS B CA    1 
ATOM   3100 C  C     . LYS B 1 96  ? 49.496 12.453 -0.151  1.00 16.33  ? 72  LYS B C     1 
ATOM   3101 O  O     . LYS B 1 96  ? 49.183 13.122 -1.138  1.00 17.44  ? 72  LYS B O     1 
ATOM   3102 C  CB    A LYS B 1 96  ? 48.785 10.225 -1.035  0.50 14.37  ? 72  LYS B CB    1 
ATOM   3103 C  CB    B LYS B 1 96  ? 48.764 10.198 -1.037  0.50 13.99  ? 72  LYS B CB    1 
ATOM   3104 C  CG    A LYS B 1 96  ? 48.688 8.766  -0.684  0.50 13.10  ? 72  LYS B CG    1 
ATOM   3105 C  CG    B LYS B 1 96  ? 47.920 8.942  -0.883  0.50 11.50  ? 72  LYS B CG    1 
ATOM   3106 C  CD    A LYS B 1 96  ? 47.399 8.134  -1.138  0.50 18.57  ? 72  LYS B CD    1 
ATOM   3107 C  CD    B LYS B 1 96  ? 48.762 7.752  -0.470  0.50 14.51  ? 72  LYS B CD    1 
ATOM   3108 C  CE    A LYS B 1 96  ? 47.562 6.625  -1.095  0.50 20.83  ? 72  LYS B CE    1 
ATOM   3109 C  CE    B LYS B 1 96  ? 49.197 7.885  0.987   0.50 10.97  ? 72  LYS B CE    1 
ATOM   3110 N  NZ    A LYS B 1 96  ? 46.916 5.960  -2.263  0.50 23.72  ? 72  LYS B NZ    1 
ATOM   3111 N  NZ    B LYS B 1 96  ? 48.245 7.185  1.880   0.50 11.09  ? 72  LYS B NZ    1 
ATOM   3112 N  N     . ALA B 1 97  ? 50.466 12.818 0.712   1.00 15.06  ? 73  ALA B N     1 
ATOM   3113 C  CA    . ALA B 1 97  ? 51.166 14.102 0.569   1.00 12.58  ? 73  ALA B CA    1 
ATOM   3114 C  C     . ALA B 1 97  ? 52.643 14.040 0.184   1.00 13.41  ? 73  ALA B C     1 
ATOM   3115 O  O     . ALA B 1 97  ? 53.307 13.042 0.384   1.00 16.10  ? 73  ALA B O     1 
ATOM   3116 C  CB    . ALA B 1 97  ? 50.957 14.936 1.836   1.00 16.17  ? 73  ALA B CB    1 
ATOM   3117 N  N     . ALA B 1 98  ? 53.138 15.134 -0.377  1.00 13.23  ? 74  ALA B N     1 
ATOM   3118 C  CA    . ALA B 1 98  ? 54.531 15.317 -0.726  1.00 13.58  ? 74  ALA B CA    1 
ATOM   3119 C  C     . ALA B 1 98  ? 54.910 16.758 -0.404  1.00 14.49  ? 74  ALA B C     1 
ATOM   3120 O  O     . ALA B 1 98  ? 54.036 17.626 -0.305  1.00 15.84  ? 74  ALA B O     1 
ATOM   3121 C  CB    . ALA B 1 98  ? 54.743 15.014 -2.220  1.00 15.57  ? 74  ALA B CB    1 
ATOM   3122 N  N     . TYR B 1 99  ? 56.210 17.002 -0.207  1.00 14.10  ? 75  TYR B N     1 
ATOM   3123 C  CA    . TYR B 1 99  ? 56.708 18.330 0.168   1.00 13.12  ? 75  TYR B CA    1 
ATOM   3124 C  C     . TYR B 1 99  ? 58.047 18.657 -0.489  1.00 12.78  ? 75  TYR B C     1 
ATOM   3125 O  O     . TYR B 1 99  ? 58.939 17.796 -0.519  1.00 13.27  ? 75  TYR B O     1 
ATOM   3126 C  CB    . TYR B 1 99  ? 56.837 18.435 1.706   1.00 14.11  ? 75  TYR B CB    1 
ATOM   3127 C  CG    . TYR B 1 99  ? 57.382 19.769 2.199   1.00 13.50  ? 75  TYR B CG    1 
ATOM   3128 C  CD1   . TYR B 1 99  ? 56.575 20.912 2.241   1.00 13.38  ? 75  TYR B CD1   1 
ATOM   3129 C  CD2   . TYR B 1 99  ? 58.710 19.883 2.668   1.00 15.14  ? 75  TYR B CD2   1 
ATOM   3130 C  CE1   . TYR B 1 99  ? 57.063 22.139 2.716   1.00 15.10  ? 75  TYR B CE1   1 
ATOM   3131 C  CE2   . TYR B 1 99  ? 59.209 21.098 3.132   1.00 14.11  ? 75  TYR B CE2   1 
ATOM   3132 C  CZ    . TYR B 1 99  ? 58.383 22.226 3.153   1.00 12.30  ? 75  TYR B CZ    1 
ATOM   3133 O  OH    . TYR B 1 99  ? 58.872 23.435 3.589   1.00 14.41  ? 75  TYR B OH    1 
ATOM   3134 N  N     . PHE B 1 100 ? 58.182 19.894 -0.976  1.00 12.65  ? 76  PHE B N     1 
ATOM   3135 C  CA    . PHE B 1 100 ? 59.455 20.471 -1.471  1.00 11.65  ? 76  PHE B CA    1 
ATOM   3136 C  C     . PHE B 1 100 ? 59.841 21.625 -0.548  1.00 12.79  ? 76  PHE B C     1 
ATOM   3137 O  O     . PHE B 1 100 ? 59.056 22.547 -0.317  1.00 12.99  ? 76  PHE B O     1 
ATOM   3138 C  CB    . PHE B 1 100 ? 59.354 21.041 -2.916  1.00 13.24  ? 76  PHE B CB    1 
ATOM   3139 C  CG    . PHE B 1 100 ? 59.024 20.030 -3.984  1.00 12.89  ? 76  PHE B CG    1 
ATOM   3140 C  CD1   . PHE B 1 100 ? 59.237 18.667 -3.840  1.00 13.68  ? 76  PHE B CD1   1 
ATOM   3141 C  CD2   . PHE B 1 100 ? 58.520 20.508 -5.211  1.00 14.04  ? 76  PHE B CD2   1 
ATOM   3142 C  CE1   . PHE B 1 100 ? 58.907 17.773 -4.870  1.00 14.44  ? 76  PHE B CE1   1 
ATOM   3143 C  CE2   . PHE B 1 100 ? 58.211 19.624 -6.248  1.00 14.48  ? 76  PHE B CE2   1 
ATOM   3144 C  CZ    . PHE B 1 100 ? 58.390 18.271 -6.078  1.00 13.63  ? 76  PHE B CZ    1 
ATOM   3145 N  N     . GLY B 1 101 ? 61.053 21.571 -0.008  1.00 15.85  ? 77  GLY B N     1 
ATOM   3146 C  CA    . GLY B 1 101 ? 61.541 22.642 0.865   1.00 13.97  ? 77  GLY B CA    1 
ATOM   3147 C  C     . GLY B 1 101 ? 62.976 22.344 1.266   1.00 13.77  ? 77  GLY B C     1 
ATOM   3148 O  O     . GLY B 1 101 ? 63.331 21.183 1.488   1.00 15.52  ? 77  GLY B O     1 
ATOM   3149 N  N     . ASN B 1 102 ? 63.804 23.379 1.336   1.00 13.71  ? 78  ASN B N     1 
ATOM   3150 C  CA    . ASN B 1 102 ? 65.227 23.174 1.550   1.00 14.92  ? 78  ASN B CA    1 
ATOM   3151 C  C     . ASN B 1 102 ? 65.673 23.484 2.970   1.00 13.94  ? 78  ASN B C     1 
ATOM   3152 O  O     . ASN B 1 102 ? 65.446 24.586 3.443   1.00 15.22  ? 78  ASN B O     1 
ATOM   3153 C  CB    . ASN B 1 102 ? 66.028 24.026 0.584   1.00 14.71  ? 78  ASN B CB    1 
ATOM   3154 C  CG    . ASN B 1 102 ? 67.480 23.618 0.520   1.00 12.83  ? 78  ASN B CG    1 
ATOM   3155 O  OD1   . ASN B 1 102 ? 67.810 22.485 0.178   1.00 15.20  ? 78  ASN B OD1   1 
ATOM   3156 N  ND2   . ASN B 1 102 ? 68.363 24.550 0.858   1.00 16.83  ? 78  ASN B ND2   1 
ATOM   3157 N  N     . VAL B 1 103 ? 66.294 22.504 3.620   1.00 14.69  ? 79  VAL B N     1 
ATOM   3158 C  CA    . VAL B 1 103 ? 66.940 22.695 4.927   1.00 13.00  ? 79  VAL B CA    1 
ATOM   3159 C  C     . VAL B 1 103 ? 68.459 22.610 4.740   1.00 14.13  ? 79  VAL B C     1 
ATOM   3160 O  O     . VAL B 1 103 ? 68.953 22.316 3.646   1.00 15.00  ? 79  VAL B O     1 
ATOM   3161 C  CB    . VAL B 1 103 ? 66.448 21.643 5.968   1.00 11.25  ? 79  VAL B CB    1 
ATOM   3162 C  CG1   . VAL B 1 103 ? 64.964 21.817 6.279   1.00 12.90  ? 79  VAL B CG1   1 
ATOM   3163 C  CG2   . VAL B 1 103 ? 66.724 20.206 5.497   1.00 11.72  ? 79  VAL B CG2   1 
ATOM   3164 N  N     . ALA B 1 104 ? 69.216 22.876 5.806   1.00 14.85  ? 80  ALA B N     1 
ATOM   3165 C  CA    . ALA B 1 104 ? 70.658 22.633 5.769   1.00 14.26  ? 80  ALA B CA    1 
ATOM   3166 C  C     . ALA B 1 104 ? 71.025 21.256 6.342   1.00 16.97  ? 80  ALA B C     1 
ATOM   3167 O  O     . ALA B 1 104 ? 70.188 20.586 6.978   1.00 16.35  ? 80  ALA B O     1 
ATOM   3168 C  CB    . ALA B 1 104 ? 71.401 23.742 6.499   1.00 15.90  ? 80  ALA B CB    1 
ATOM   3169 N  N     . ALA B 1 105 ? 72.270 20.839 6.098   1.00 16.86  ? 81  ALA B N     1 
ATOM   3170 C  CA    . ALA B 1 105 ? 72.814 19.609 6.662   1.00 17.74  ? 81  ALA B CA    1 
ATOM   3171 C  C     . ALA B 1 105 ? 73.260 19.896 8.108   1.00 17.57  ? 81  ALA B C     1 
ATOM   3172 O  O     . ALA B 1 105 ? 74.461 19.977 8.422   1.00 20.78  ? 81  ALA B O     1 
ATOM   3173 C  CB    . ALA B 1 105 ? 73.964 19.091 5.809   1.00 18.38  ? 81  ALA B CB    1 
ATOM   3174 N  N     . ASP B 1 106 ? 72.276 20.088 8.973   1.00 17.24  ? 82  ASP B N     1 
ATOM   3175 C  CA    . ASP B 1 106 ? 72.533 20.389 10.403  1.00 16.97  ? 82  ASP B CA    1 
ATOM   3176 C  C     . ASP B 1 106 ? 71.470 19.725 11.273  1.00 16.92  ? 82  ASP B C     1 
ATOM   3177 O  O     . ASP B 1 106 ? 70.585 19.049 10.769  1.00 17.22  ? 82  ASP B O     1 
ATOM   3178 C  CB    . ASP B 1 106 ? 72.668 21.911 10.647  1.00 18.04  ? 82  ASP B CB    1 
ATOM   3179 C  CG    . ASP B 1 106 ? 71.429 22.721 10.208  1.00 16.93  ? 82  ASP B CG    1 
ATOM   3180 O  OD1   . ASP B 1 106 ? 70.321 22.157 10.087  1.00 18.86  ? 82  ASP B OD1   1 
ATOM   3181 O  OD2   . ASP B 1 106 ? 71.557 23.953 10.031  1.00 15.11  ? 82  ASP B OD2   1 
ATOM   3182 N  N     . GLN B 1 107 ? 71.552 19.897 12.585  1.00 16.01  ? 83  GLN B N     1 
ATOM   3183 C  CA    . GLN B 1 107 ? 70.617 19.224 13.480  1.00 15.75  ? 83  GLN B CA    1 
ATOM   3184 C  C     . GLN B 1 107 ? 69.172 19.693 13.340  1.00 13.57  ? 83  GLN B C     1 
ATOM   3185 O  O     . GLN B 1 107 ? 68.242 18.876 13.432  1.00 14.18  ? 83  GLN B O     1 
ATOM   3186 C  CB    . GLN B 1 107 ? 71.112 19.353 14.930  1.00 16.87  ? 83  GLN B CB    1 
ATOM   3187 C  CG    . GLN B 1 107 ? 72.350 18.504 15.199  1.00 17.29  ? 83  GLN B CG    1 
ATOM   3188 C  CD    . GLN B 1 107 ? 73.008 18.833 16.530  1.00 17.48  ? 83  GLN B CD    1 
ATOM   3189 O  OE1   . GLN B 1 107 ? 72.877 19.938 17.043  1.00 17.33  ? 83  GLN B OE1   1 
ATOM   3190 N  NE2   . GLN B 1 107 ? 73.727 17.862 17.087  1.00 19.48  ? 83  GLN B NE2   1 
ATOM   3191 N  N     . LEU B 1 108 ? 68.976 20.983 13.065  1.00 14.02  ? 84  LEU B N     1 
ATOM   3192 C  CA    . LEU B 1 108 ? 67.631 21.525 12.849  1.00 14.33  ? 84  LEU B CA    1 
ATOM   3193 C  C     . LEU B 1 108 ? 67.064 20.960 11.549  1.00 14.17  ? 84  LEU B C     1 
ATOM   3194 O  O     . LEU B 1 108 ? 65.868 20.643 11.459  1.00 14.86  ? 84  LEU B O     1 
ATOM   3195 C  CB    . LEU B 1 108 ? 67.625 23.053 12.815  1.00 14.29  ? 84  LEU B CB    1 
ATOM   3196 C  CG    . LEU B 1 108 ? 67.879 23.757 14.161  1.00 15.93  ? 84  LEU B CG    1 
ATOM   3197 C  CD1   . LEU B 1 108 ? 67.969 25.251 13.939  1.00 20.30  ? 84  LEU B CD1   1 
ATOM   3198 C  CD2   . LEU B 1 108 ? 66.782 23.403 15.162  1.00 18.30  ? 84  LEU B CD2   1 
ATOM   3199 N  N     . GLY B 1 109 ? 67.937 20.830 10.559  1.00 14.36  ? 85  GLY B N     1 
ATOM   3200 C  CA    . GLY B 1 109 ? 67.552 20.200 9.289   1.00 13.71  ? 85  GLY B CA    1 
ATOM   3201 C  C     . GLY B 1 109 ? 67.138 18.753 9.474   1.00 15.35  ? 85  GLY B C     1 
ATOM   3202 O  O     . GLY B 1 109 ? 66.148 18.292 8.875   1.00 15.53  ? 85  GLY B O     1 
ATOM   3203 N  N     . ASP B 1 110 ? 67.881 18.035 10.319  1.00 16.80  ? 86  ASP B N     1 
ATOM   3204 C  CA    . ASP B 1 110 ? 67.576 16.638 10.645  1.00 16.25  ? 86  ASP B CA    1 
ATOM   3205 C  C     . ASP B 1 110 ? 66.231 16.508 11.361  1.00 14.61  ? 86  ASP B C     1 
ATOM   3206 O  O     . ASP B 1 110 ? 65.482 15.571 11.107  1.00 16.56  ? 86  ASP B O     1 
ATOM   3207 C  CB    . ASP B 1 110 ? 68.687 15.997 11.482  1.00 18.39  ? 86  ASP B CB    1 
ATOM   3208 C  CG    . ASP B 1 110 ? 70.011 15.903 10.742  1.00 21.59  ? 86  ASP B CG    1 
ATOM   3209 O  OD1   . ASP B 1 110 ? 70.034 15.912 9.492   1.00 24.05  ? 86  ASP B OD1   1 
ATOM   3210 O  OD2   . ASP B 1 110 ? 71.044 15.813 11.429  1.00 26.44  ? 86  ASP B OD2   1 
ATOM   3211 N  N     . ILE B 1 111 ? 65.939 17.435 12.271  1.00 13.68  ? 87  ILE B N     1 
ATOM   3212 C  CA    . ILE B 1 111 ? 64.632 17.452 12.952  1.00 14.91  ? 87  ILE B CA    1 
ATOM   3213 C  C     . ILE B 1 111 ? 63.495 17.672 11.962  1.00 14.40  ? 87  ILE B C     1 
ATOM   3214 O  O     . ILE B 1 111 ? 62.486 16.923 11.959  1.00 14.30  ? 87  ILE B O     1 
ATOM   3215 C  CB    . ILE B 1 111 ? 64.602 18.515 14.061  1.00 15.34  ? 87  ILE B CB    1 
ATOM   3216 C  CG1   . ILE B 1 111 ? 65.423 17.990 15.249  1.00 16.34  ? 87  ILE B CG1   1 
ATOM   3217 C  CG2   . ILE B 1 111 ? 63.168 18.849 14.482  1.00 16.01  ? 87  ILE B CG2   1 
ATOM   3218 C  CD1   . ILE B 1 111 ? 65.827 19.083 16.218  1.00 18.68  ? 87  ILE B CD1   1 
ATOM   3219 N  N     . PHE B 1 112 ? 63.669 18.681 11.114  1.00 12.78  ? 88  PHE B N     1 
ATOM   3220 C  CA    . PHE B 1 112 ? 62.658 18.981 10.121  1.00 12.19  ? 88  PHE B CA    1 
ATOM   3221 C  C     . PHE B 1 112 ? 62.428 17.753 9.258   1.00 12.15  ? 88  PHE B C     1 
ATOM   3222 O  O     . PHE B 1 112 ? 61.279 17.307 9.091   1.00 13.43  ? 88  PHE B O     1 
ATOM   3223 C  CB    . PHE B 1 112 ? 63.051 20.169 9.261   1.00 11.27  ? 88  PHE B CB    1 
ATOM   3224 C  CG    . PHE B 1 112 ? 61.969 20.583 8.325   1.00 13.09  ? 88  PHE B CG    1 
ATOM   3225 C  CD1   . PHE B 1 112 ? 61.826 19.932 7.098   1.00 13.24  ? 88  PHE B CD1   1 
ATOM   3226 C  CD2   . PHE B 1 112 ? 61.066 21.576 8.675   1.00 13.50  ? 88  PHE B CD2   1 
ATOM   3227 C  CE1   . PHE B 1 112 ? 60.798 20.289 6.223   1.00 15.39  ? 88  PHE B CE1   1 
ATOM   3228 C  CE2   . PHE B 1 112 ? 60.048 21.949 7.798   1.00 14.31  ? 88  PHE B CE2   1 
ATOM   3229 C  CZ    . PHE B 1 112 ? 59.906 21.286 6.578   1.00 14.86  ? 88  PHE B CZ    1 
ATOM   3230 N  N     . THR B 1 113 ? 63.521 17.183 8.758   1.00 12.29  ? 89  THR B N     1 
ATOM   3231 C  CA    . THR B 1 113 ? 63.430 15.987 7.876   1.00 12.88  ? 89  THR B CA    1 
ATOM   3232 C  C     . THR B 1 113 ? 62.724 14.832 8.568   1.00 13.92  ? 89  THR B C     1 
ATOM   3233 O  O     . THR B 1 113 ? 61.802 14.221 8.012   1.00 15.61  ? 89  THR B O     1 
ATOM   3234 C  CB    . THR B 1 113 ? 64.814 15.541 7.360   1.00 14.51  ? 89  THR B CB    1 
ATOM   3235 O  OG1   . THR B 1 113 ? 65.415 16.603 6.620   1.00 16.67  ? 89  THR B OG1   1 
ATOM   3236 C  CG2   . THR B 1 113 ? 64.695 14.302 6.448   1.00 15.34  ? 89  THR B CG2   1 
ATOM   3237 N  N     . HIS B 1 114 ? 63.101 14.565 9.820   1.00 14.01  ? 90  HIS B N     1 
ATOM   3238 C  CA    . HIS B 1 114 ? 62.448 13.504 10.557  1.00 15.02  ? 90  HIS B CA    1 
ATOM   3239 C  C     . HIS B 1 114 ? 60.939 13.687 10.689  1.00 13.52  ? 90  HIS B C     1 
ATOM   3240 O  O     . HIS B 1 114 ? 60.175 12.760 10.420  1.00 14.04  ? 90  HIS B O     1 
ATOM   3241 C  CB    . HIS B 1 114 ? 63.000 13.369 11.979  1.00 13.56  ? 90  HIS B CB    1 
ATOM   3242 C  CG    . HIS B 1 114 ? 62.134 12.507 12.840  1.00 14.70  ? 90  HIS B CG    1 
ATOM   3243 N  ND1   . HIS B 1 114 ? 62.261 11.136 12.885  1.00 16.13  ? 90  HIS B ND1   1 
ATOM   3244 C  CD2   . HIS B 1 114 ? 61.054 12.808 13.600  1.00 14.86  ? 90  HIS B CD2   1 
ATOM   3245 C  CE1   . HIS B 1 114 ? 61.326 10.636 13.676  1.00 15.58  ? 90  HIS B CE1   1 
ATOM   3246 N  NE2   . HIS B 1 114 ? 60.584 11.629 14.126  1.00 15.66  ? 90  HIS B NE2   1 
ATOM   3247 N  N     . ASP B 1 115 ? 60.528 14.863 11.159  1.00 13.49  ? 91  ASP B N     1 
ATOM   3248 C  CA    . ASP B 1 115 ? 59.135 15.099 11.525  1.00 15.78  ? 91  ASP B CA    1 
ATOM   3249 C  C     . ASP B 1 115 ? 58.176 14.977 10.342  1.00 16.08  ? 91  ASP B C     1 
ATOM   3250 O  O     . ASP B 1 115 ? 57.119 14.344 10.449  1.00 15.64  ? 91  ASP B O     1 
ATOM   3251 C  CB    . ASP B 1 115 ? 58.966 16.451 12.187  1.00 17.28  ? 91  ASP B CB    1 
ATOM   3252 C  CG    . ASP B 1 115 ? 59.665 16.521 13.523  1.00 16.23  ? 91  ASP B CG    1 
ATOM   3253 O  OD1   . ASP B 1 115 ? 59.864 15.447 14.160  1.00 16.73  ? 91  ASP B OD1   1 
ATOM   3254 O  OD2   . ASP B 1 115 ? 60.026 17.637 13.918  1.00 18.29  ? 91  ASP B OD2   1 
ATOM   3255 N  N     . ILE B 1 116 ? 58.556 15.588 9.236   1.00 15.26  ? 92  ILE B N     1 
ATOM   3256 C  CA    . ILE B 1 116 ? 57.712 15.556 8.026   1.00 14.45  ? 92  ILE B CA    1 
ATOM   3257 C  C     . ILE B 1 116 ? 57.616 14.141 7.438   1.00 14.25  ? 92  ILE B C     1 
ATOM   3258 O  O     . ILE B 1 116 ? 56.515 13.677 7.137   1.00 16.23  ? 92  ILE B O     1 
ATOM   3259 C  CB    . ILE B 1 116 ? 58.119 16.681 7.030   1.00 12.31  ? 92  ILE B CB    1 
ATOM   3260 C  CG1   . ILE B 1 116 ? 56.957 17.027 6.072   1.00 13.80  ? 92  ILE B CG1   1 
ATOM   3261 C  CG2   . ILE B 1 116 ? 59.428 16.395 6.306   1.00 13.90  ? 92  ILE B CG2   1 
ATOM   3262 C  CD1   . ILE B 1 116 ? 57.165 18.382 5.411   1.00 14.61  ? 92  ILE B CD1   1 
ATOM   3263 N  N     . ARG B 1 117 ? 58.751 13.436 7.335   1.00 16.14  ? 93  ARG B N     1 
ATOM   3264 C  CA    . ARG B 1 117 ? 58.777 12.038 6.857   1.00 16.86  ? 93  ARG B CA    1 
ATOM   3265 C  C     . ARG B 1 117 ? 58.040 11.082 7.797   1.00 15.80  ? 93  ARG B C     1 
ATOM   3266 O  O     . ARG B 1 117 ? 57.327 10.208 7.349   1.00 17.17  ? 93  ARG B O     1 
ATOM   3267 C  CB    . ARG B 1 117 ? 60.212 11.544 6.602   1.00 17.34  ? 93  ARG B CB    1 
ATOM   3268 C  CG    . ARG B 1 117 ? 60.959 12.331 5.530   1.00 18.56  ? 93  ARG B CG    1 
ATOM   3269 C  CD    . ARG B 1 117 ? 62.291 11.705 5.147   1.00 19.13  ? 93  ARG B CD    1 
ATOM   3270 N  NE    . ARG B 1 117 ? 62.099 10.490 4.362   1.00 20.65  ? 93  ARG B NE    1 
ATOM   3271 C  CZ    . ARG B 1 117 ? 62.994 9.515  4.216   1.00 20.73  ? 93  ARG B CZ    1 
ATOM   3272 N  NH1   . ARG B 1 117 ? 64.175 9.575  4.819   1.00 24.87  ? 93  ARG B NH1   1 
ATOM   3273 N  NH2   . ARG B 1 117 ? 62.690 8.460  3.475   1.00 19.29  ? 93  ARG B NH2   1 
ATOM   3274 N  N     . ALA B 1 118 ? 58.178 11.289 9.110   1.00 16.43  ? 94  ALA B N     1 
ATOM   3275 C  CA    . ALA B 1 118 ? 57.518 10.433 10.082  1.00 17.31  ? 94  ALA B CA    1 
ATOM   3276 C  C     . ALA B 1 118 ? 55.996 10.569 10.066  1.00 16.08  ? 94  ALA B C     1 
ATOM   3277 O  O     . ALA B 1 118 ? 55.290 9.651  10.453  1.00 20.83  ? 94  ALA B O     1 
ATOM   3278 C  CB    . ALA B 1 118 ? 58.058 10.690 11.487  1.00 17.84  ? 94  ALA B CB    1 
ATOM   3279 N  N     . GLN B 1 119 ? 55.499 11.712 9.611   1.00 15.45  ? 95  GLN B N     1 
ATOM   3280 C  CA    . GLN B 1 119 ? 54.064 11.901 9.399   1.00 16.83  ? 95  GLN B CA    1 
ATOM   3281 C  C     . GLN B 1 119 ? 53.574 11.179 8.107   1.00 16.87  ? 95  GLN B C     1 
ATOM   3282 O  O     . GLN B 1 119 ? 52.383 11.067 7.883   1.00 20.14  ? 95  GLN B O     1 
ATOM   3283 C  CB    . GLN B 1 119 ? 53.714 13.403 9.402   1.00 17.60  ? 95  GLN B CB    1 
ATOM   3284 C  CG    . GLN B 1 119 ? 52.219 13.764 9.318   1.00 20.04  ? 95  GLN B CG    1 
ATOM   3285 C  CD    . GLN B 1 119 ? 51.354 13.140 10.404  1.00 27.15  ? 95  GLN B CD    1 
ATOM   3286 O  OE1   . GLN B 1 119 ? 50.636 12.151 10.164  1.00 33.25  ? 95  GLN B OE1   1 
ATOM   3287 N  NE2   . GLN B 1 119 ? 51.411 13.709 11.606  1.00 28.53  ? 95  GLN B NE2   1 
ATOM   3288 N  N     . GLY B 1 120 ? 54.503 10.688 7.286   1.00 16.60  ? 96  GLY B N     1 
ATOM   3289 C  CA    . GLY B 1 120 ? 54.166 9.894  6.085   1.00 13.84  ? 96  GLY B CA    1 
ATOM   3290 C  C     . GLY B 1 120 ? 54.110 10.693 4.803   1.00 14.55  ? 96  GLY B C     1 
ATOM   3291 O  O     . GLY B 1 120 ? 53.510 10.240 3.797   1.00 14.56  ? 96  GLY B O     1 
ATOM   3292 N  N     . VAL B 1 121 ? 54.735 11.868 4.843   1.00 15.86  ? 97  VAL B N     1 
ATOM   3293 C  CA    . VAL B 1 121 ? 54.880 12.780 3.707   1.00 13.76  ? 97  VAL B CA    1 
ATOM   3294 C  C     . VAL B 1 121 ? 56.148 12.439 2.949   1.00 14.02  ? 97  VAL B C     1 
ATOM   3295 O  O     . VAL B 1 121 ? 57.200 12.239 3.539   1.00 13.69  ? 97  VAL B O     1 
ATOM   3296 C  CB    . VAL B 1 121 ? 54.968 14.258 4.167   1.00 14.91  ? 97  VAL B CB    1 
ATOM   3297 C  CG1   . VAL B 1 121 ? 55.252 15.176 2.977   1.00 16.62  ? 97  VAL B CG1   1 
ATOM   3298 C  CG2   . VAL B 1 121 ? 53.712 14.660 4.922   1.00 16.57  ? 97  VAL B CG2   1 
ATOM   3299 N  N     . HIS B 1 122 ? 56.032 12.312 1.628   1.00 13.12  ? 98  HIS B N     1 
ATOM   3300 C  CA    . HIS B 1 122 ? 57.196 12.195 0.753   1.00 14.92  ? 98  HIS B CA    1 
ATOM   3301 C  C     . HIS B 1 122 ? 58.001 13.495 0.842   1.00 13.57  ? 98  HIS B C     1 
ATOM   3302 O  O     . HIS B 1 122 ? 57.483 14.566 0.550   1.00 14.64  ? 98  HIS B O     1 
ATOM   3303 C  CB    . HIS B 1 122 ? 56.686 11.978 -0.690  1.00 16.56  ? 98  HIS B CB    1 
ATOM   3304 C  CG    . HIS B 1 122 ? 57.743 12.072 -1.755  1.00 19.56  ? 98  HIS B CG    1 
ATOM   3305 N  ND1   . HIS B 1 122 ? 58.098 10.994 -2.535  1.00 24.56  ? 98  HIS B ND1   1 
ATOM   3306 C  CD2   . HIS B 1 122 ? 58.510 13.105 -2.177  1.00 18.47  ? 98  HIS B CD2   1 
ATOM   3307 C  CE1   . HIS B 1 122 ? 59.044 11.353 -3.383  1.00 19.61  ? 98  HIS B CE1   1 
ATOM   3308 N  NE2   . HIS B 1 122 ? 59.318 12.630 -3.182  1.00 20.14  ? 98  HIS B NE2   1 
ATOM   3309 N  N     . TYR B 1 123 ? 59.263 13.386 1.254   1.00 13.96  ? 99  TYR B N     1 
ATOM   3310 C  CA    . TYR B 1 123 ? 60.170 14.521 1.360   1.00 14.67  ? 99  TYR B CA    1 
ATOM   3311 C  C     . TYR B 1 123 ? 61.571 14.079 0.948   1.00 16.49  ? 99  TYR B C     1 
ATOM   3312 O  O     . TYR B 1 123 ? 62.215 13.290 1.674   1.00 17.99  ? 99  TYR B O     1 
ATOM   3313 C  CB    . TYR B 1 123 ? 60.194 15.090 2.806   1.00 14.31  ? 99  TYR B CB    1 
ATOM   3314 C  CG    . TYR B 1 123 ? 61.197 16.216 2.951   1.00 13.48  ? 99  TYR B CG    1 
ATOM   3315 C  CD1   . TYR B 1 123 ? 61.209 17.295 2.055   1.00 14.02  ? 99  TYR B CD1   1 
ATOM   3316 C  CD2   . TYR B 1 123 ? 62.138 16.226 4.009   1.00 15.11  ? 99  TYR B CD2   1 
ATOM   3317 C  CE1   . TYR B 1 123 ? 62.119 18.335 2.180   1.00 15.66  ? 99  TYR B CE1   1 
ATOM   3318 C  CE2   . TYR B 1 123 ? 63.041 17.275 4.145   1.00 14.90  ? 99  TYR B CE2   1 
ATOM   3319 C  CZ    . TYR B 1 123 ? 63.043 18.316 3.223   1.00 16.95  ? 99  TYR B CZ    1 
ATOM   3320 O  OH    . TYR B 1 123 ? 63.936 19.353 3.326   1.00 17.61  ? 99  TYR B OH    1 
ATOM   3321 N  N     . GLN B 1 124 ? 62.041 14.578 -0.203  1.00 19.55  ? 100 GLN B N     1 
ATOM   3322 C  CA    A GLN B 1 124 ? 63.293 14.104 -0.786  0.50 18.62  ? 100 GLN B CA    1 
ATOM   3323 C  CA    B GLN B 1 124 ? 63.296 14.100 -0.779  0.50 18.16  ? 100 GLN B CA    1 
ATOM   3324 C  C     . GLN B 1 124 ? 64.283 15.218 -1.143  1.00 18.15  ? 100 GLN B C     1 
ATOM   3325 O  O     . GLN B 1 124 ? 65.352 14.941 -1.680  1.00 18.70  ? 100 GLN B O     1 
ATOM   3326 C  CB    A GLN B 1 124 ? 63.012 13.203 -1.993  0.50 19.28  ? 100 GLN B CB    1 
ATOM   3327 C  CB    B GLN B 1 124 ? 63.028 13.172 -1.972  0.50 17.35  ? 100 GLN B CB    1 
ATOM   3328 C  CG    A GLN B 1 124 ? 62.590 11.790 -1.636  0.50 17.49  ? 100 GLN B CG    1 
ATOM   3329 C  CG    B GLN B 1 124 ? 62.496 11.794 -1.608  0.50 14.58  ? 100 GLN B CG    1 
ATOM   3330 C  CD    A GLN B 1 124 ? 62.202 10.973 -2.851  0.50 19.19  ? 100 GLN B CD    1 
ATOM   3331 C  CD    B GLN B 1 124 ? 63.500 10.960 -0.836  0.50 14.62  ? 100 GLN B CD    1 
ATOM   3332 O  OE1   A GLN B 1 124 ? 61.804 9.816  -2.732  0.50 22.28  ? 100 GLN B OE1   1 
ATOM   3333 O  OE1   B GLN B 1 124 ? 64.300 10.231 -1.422  0.50 16.26  ? 100 GLN B OE1   1 
ATOM   3334 N  NE2   A GLN B 1 124 ? 62.331 11.566 -4.032  0.50 23.07  ? 100 GLN B NE2   1 
ATOM   3335 N  NE2   B GLN B 1 124 ? 63.458 11.056 0.484   0.50 15.74  ? 100 GLN B NE2   1 
ATOM   3336 N  N     . THR B 1 125 ? 63.921 16.472 -0.837  1.00 17.39  ? 101 THR B N     1 
ATOM   3337 C  CA    . THR B 1 125 ? 64.772 17.630 -1.098  1.00 14.85  ? 101 THR B CA    1 
ATOM   3338 C  C     . THR B 1 125 ? 66.097 17.484 -0.353  1.00 17.39  ? 101 THR B C     1 
ATOM   3339 O  O     . THR B 1 125 ? 66.097 17.329 0.870   1.00 22.00  ? 101 THR B O     1 
ATOM   3340 C  CB    . THR B 1 125 ? 64.117 18.961 -0.648  1.00 15.02  ? 101 THR B CB    1 
ATOM   3341 O  OG1   . THR B 1 125 ? 62.737 19.011 -1.052  1.00 16.59  ? 101 THR B OG1   1 
ATOM   3342 C  CG2   . THR B 1 125 ? 64.877 20.148 -1.226  1.00 18.49  ? 101 THR B CG2   1 
ATOM   3343 N  N     . LYS B 1 126 ? 67.205 17.550 -1.096  1.00 17.09  ? 102 LYS B N     1 
ATOM   3344 C  CA    . LYS B 1 126 ? 68.541 17.341 -0.543  1.00 21.24  ? 102 LYS B CA    1 
ATOM   3345 C  C     . LYS B 1 126 ? 69.156 18.640 -0.014  1.00 20.19  ? 102 LYS B C     1 
ATOM   3346 O  O     . LYS B 1 126 ? 69.082 19.668 -0.674  1.00 18.77  ? 102 LYS B O     1 
ATOM   3347 C  CB    . LYS B 1 126 ? 69.456 16.710 -1.606  1.00 23.64  ? 102 LYS B CB    1 
ATOM   3348 C  CG    . LYS B 1 126 ? 68.884 15.498 -2.337  1.00 27.01  ? 102 LYS B CG    1 
ATOM   3349 C  CD    . LYS B 1 126 ? 68.678 14.289 -1.424  1.00 29.41  ? 102 LYS B CD    1 
ATOM   3350 C  CE    . LYS B 1 126 ? 68.358 13.016 -2.214  1.00 30.46  ? 102 LYS B CE    1 
ATOM   3351 N  NZ    . LYS B 1 126 ? 66.989 12.974 -2.820  1.00 26.81  ? 102 LYS B NZ    1 
ATOM   3352 N  N     . PRO B 1 127 ? 69.737 18.613 1.209   1.00 22.18  ? 103 PRO B N     1 
ATOM   3353 C  CA    . PRO B 1 127 ? 70.469 19.786 1.655   1.00 21.40  ? 103 PRO B CA    1 
ATOM   3354 C  C     . PRO B 1 127 ? 71.665 20.085 0.746   1.00 18.41  ? 103 PRO B C     1 
ATOM   3355 O  O     . PRO B 1 127 ? 72.218 19.168 0.129   1.00 21.65  ? 103 PRO B O     1 
ATOM   3356 C  CB    . PRO B 1 127 ? 70.936 19.397 3.058   1.00 21.76  ? 103 PRO B CB    1 
ATOM   3357 C  CG    . PRO B 1 127 ? 69.944 18.391 3.516   1.00 25.23  ? 103 PRO B CG    1 
ATOM   3358 C  CD    . PRO B 1 127 ? 69.582 17.613 2.279   1.00 25.41  ? 103 PRO B CD    1 
ATOM   3359 N  N     . LYS B 1 128 ? 72.053 21.356 0.671   1.00 17.92  ? 104 LYS B N     1 
ATOM   3360 C  CA    . LYS B 1 128 ? 73.136 21.782 -0.213  1.00 20.18  ? 104 LYS B CA    1 
ATOM   3361 C  C     . LYS B 1 128 ? 74.435 22.028 0.530   1.00 23.52  ? 104 LYS B C     1 
ATOM   3362 O  O     . LYS B 1 128 ? 75.486 22.205 -0.093  1.00 29.61  ? 104 LYS B O     1 
ATOM   3363 C  CB    . LYS B 1 128 ? 72.724 23.029 -1.002  1.00 21.79  ? 104 LYS B CB    1 
ATOM   3364 C  CG    . LYS B 1 128 ? 71.683 22.735 -2.089  1.00 24.78  ? 104 LYS B CG    1 
ATOM   3365 C  CD    . LYS B 1 128 ? 70.496 23.675 -2.007  1.00 28.56  ? 104 LYS B CD    1 
ATOM   3366 C  CE    . LYS B 1 128 ? 69.360 23.231 -2.933  1.00 29.30  ? 104 LYS B CE    1 
ATOM   3367 N  NZ    . LYS B 1 128 ? 68.779 21.913 -2.536  1.00 24.49  ? 104 LYS B NZ    1 
ATOM   3368 N  N     . GLY B 1 129 ? 74.358 22.023 1.858   1.00 21.24  ? 105 GLY B N     1 
ATOM   3369 C  CA    . GLY B 1 129 ? 75.508 22.290 2.723   1.00 21.17  ? 105 GLY B CA    1 
ATOM   3370 C  C     . GLY B 1 129 ? 75.024 22.658 4.114   1.00 19.62  ? 105 GLY B C     1 
ATOM   3371 O  O     . GLY B 1 129 ? 73.823 22.559 4.394   1.00 19.09  ? 105 GLY B O     1 
ATOM   3372 N  N     . ALA B 1 130 ? 75.947 23.097 4.973   1.00 19.81  ? 106 ALA B N     1 
ATOM   3373 C  CA    . ALA B 1 130 ? 75.614 23.486 6.349   1.00 19.61  ? 106 ALA B CA    1 
ATOM   3374 C  C     . ALA B 1 130 ? 75.321 24.977 6.533   1.00 22.58  ? 106 ALA B C     1 
ATOM   3375 O  O     . ALA B 1 130 ? 74.646 25.363 7.506   1.00 24.28  ? 106 ALA B O     1 
ATOM   3376 C  CB    . ALA B 1 130 ? 76.715 23.030 7.306   1.00 22.42  ? 106 ALA B CB    1 
ATOM   3377 N  N     . PHE B 1 131 ? 75.824 25.812 5.618   1.00 21.85  ? 107 PHE B N     1 
ATOM   3378 C  CA    . PHE B 1 131 ? 75.565 27.255 5.639   1.00 21.71  ? 107 PHE B CA    1 
ATOM   3379 C  C     . PHE B 1 131 ? 74.997 27.736 4.296   1.00 21.84  ? 107 PHE B C     1 
ATOM   3380 O  O     . PHE B 1 131 ? 75.510 27.354 3.240   1.00 23.51  ? 107 PHE B O     1 
ATOM   3381 C  CB    . PHE B 1 131 ? 76.816 28.078 5.985   1.00 23.70  ? 107 PHE B CB    1 
ATOM   3382 C  CG    . PHE B 1 131 ? 76.524 29.551 6.221   1.00 29.17  ? 107 PHE B CG    1 
ATOM   3383 C  CD1   . PHE B 1 131 ? 76.448 30.455 5.147   1.00 29.64  ? 107 PHE B CD1   1 
ATOM   3384 C  CD2   . PHE B 1 131 ? 76.300 30.037 7.511   1.00 32.12  ? 107 PHE B CD2   1 
ATOM   3385 C  CE1   . PHE B 1 131 ? 76.167 31.797 5.360   1.00 33.43  ? 107 PHE B CE1   1 
ATOM   3386 C  CE2   . PHE B 1 131 ? 76.019 31.382 7.726   1.00 37.38  ? 107 PHE B CE2   1 
ATOM   3387 C  CZ    . PHE B 1 131 ? 75.952 32.260 6.651   1.00 38.96  ? 107 PHE B CZ    1 
ATOM   3388 N  N     . PRO B 1 132 ? 73.940 28.574 4.333   1.00 22.42  ? 108 PRO B N     1 
ATOM   3389 C  CA    . PRO B 1 132 ? 73.250 29.070 5.533   1.00 20.46  ? 108 PRO B CA    1 
ATOM   3390 C  C     . PRO B 1 132 ? 72.602 27.923 6.303   1.00 19.24  ? 108 PRO B C     1 
ATOM   3391 O  O     . PRO B 1 132 ? 72.219 26.914 5.695   1.00 17.90  ? 108 PRO B O     1 
ATOM   3392 C  CB    . PRO B 1 132 ? 72.166 30.000 4.967   1.00 22.65  ? 108 PRO B CB    1 
ATOM   3393 C  CG    . PRO B 1 132 ? 72.600 30.317 3.572   1.00 23.55  ? 108 PRO B CG    1 
ATOM   3394 C  CD    . PRO B 1 132 ? 73.328 29.099 3.099   1.00 22.82  ? 108 PRO B CD    1 
ATOM   3395 N  N     . PRO B 1 133 ? 72.452 28.083 7.628   1.00 17.47  ? 109 PRO B N     1 
ATOM   3396 C  CA    . PRO B 1 133 ? 71.837 27.022 8.406   1.00 16.06  ? 109 PRO B CA    1 
ATOM   3397 C  C     . PRO B 1 133 ? 70.335 26.937 8.154   1.00 14.55  ? 109 PRO B C     1 
ATOM   3398 O  O     . PRO B 1 133 ? 69.751 27.833 7.527   1.00 15.43  ? 109 PRO B O     1 
ATOM   3399 C  CB    . PRO B 1 133 ? 72.101 27.450 9.861   1.00 17.79  ? 109 PRO B CB    1 
ATOM   3400 C  CG    . PRO B 1 133 ? 72.243 28.926 9.802   1.00 17.88  ? 109 PRO B CG    1 
ATOM   3401 C  CD    . PRO B 1 133 ? 72.776 29.270 8.445   1.00 19.12  ? 109 PRO B CD    1 
ATOM   3402 N  N     . THR B 1 134 ? 69.724 25.875 8.669   1.00 14.99  ? 110 THR B N     1 
ATOM   3403 C  CA    . THR B 1 134 ? 68.282 25.633 8.535   1.00 13.71  ? 110 THR B CA    1 
ATOM   3404 C  C     . THR B 1 134 ? 67.463 26.807 9.079   1.00 14.43  ? 110 THR B C     1 
ATOM   3405 O  O     . THR B 1 134 ? 67.717 27.320 10.179  1.00 15.33  ? 110 THR B O     1 
ATOM   3406 C  CB    . THR B 1 134 ? 67.882 24.284 9.202   1.00 12.86  ? 110 THR B CB    1 
ATOM   3407 O  OG1   . THR B 1 134 ? 68.561 23.214 8.542   1.00 16.32  ? 110 THR B OG1   1 
ATOM   3408 C  CG2   . THR B 1 134 ? 66.370 24.037 9.133   1.00 12.59  ? 110 THR B CG2   1 
ATOM   3409 N  N     . ALA B 1 135 ? 66.490 27.252 8.285   1.00 14.03  ? 111 ALA B N     1 
ATOM   3410 C  CA    . ALA B 1 135 ? 65.577 28.300 8.722   1.00 13.70  ? 111 ALA B CA    1 
ATOM   3411 C  C     . ALA B 1 135 ? 64.950 28.023 10.089  1.00 14.08  ? 111 ALA B C     1 
ATOM   3412 O  O     . ALA B 1 135 ? 64.640 26.879 10.437  1.00 14.02  ? 111 ALA B O     1 
ATOM   3413 C  CB    . ALA B 1 135 ? 64.481 28.506 7.691   1.00 13.13  ? 111 ALA B CB    1 
ATOM   3414 N  N     . ARG B 1 136 ? 64.791 29.087 10.861  1.00 15.51  ? 112 ARG B N     1 
ATOM   3415 C  CA    . ARG B 1 136 ? 64.025 29.040 12.101  1.00 14.37  ? 112 ARG B CA    1 
ATOM   3416 C  C     . ARG B 1 136 ? 63.171 30.286 12.293  1.00 13.33  ? 112 ARG B C     1 
ATOM   3417 O  O     . ARG B 1 136 ? 63.493 31.367 11.773  1.00 16.08  ? 112 ARG B O     1 
ATOM   3418 C  CB    . ARG B 1 136 ? 64.933 28.764 13.317  1.00 14.47  ? 112 ARG B CB    1 
ATOM   3419 C  CG    . ARG B 1 136 ? 65.771 29.946 13.802  1.00 14.89  ? 112 ARG B CG    1 
ATOM   3420 C  CD    . ARG B 1 136 ? 66.839 30.434 12.825  1.00 17.89  ? 112 ARG B CD    1 
ATOM   3421 N  NE    . ARG B 1 136 ? 67.694 29.372 12.301  1.00 17.22  ? 112 ARG B NE    1 
ATOM   3422 C  CZ    . ARG B 1 136 ? 68.865 29.017 12.819  1.00 17.61  ? 112 ARG B CZ    1 
ATOM   3423 N  NH1   . ARG B 1 136 ? 69.341 29.648 13.889  1.00 20.04  ? 112 ARG B NH1   1 
ATOM   3424 N  NH2   . ARG B 1 136 ? 69.566 28.033 12.267  1.00 16.72  ? 112 ARG B NH2   1 
ATOM   3425 N  N     . SER B 1 137 ? 62.072 30.116 13.021  1.00 14.32  ? 113 SER B N     1 
ATOM   3426 C  CA    . SER B 1 137 ? 61.175 31.210 13.351  1.00 13.72  ? 113 SER B CA    1 
ATOM   3427 C  C     . SER B 1 137 ? 60.925 31.246 14.844  1.00 14.30  ? 113 SER B C     1 
ATOM   3428 O  O     . SER B 1 137 ? 60.423 30.275 15.424  1.00 14.43  ? 113 SER B O     1 
ATOM   3429 C  CB    . SER B 1 137 ? 59.840 31.078 12.583  1.00 13.83  ? 113 SER B CB    1 
ATOM   3430 O  OG    . SER B 1 137 ? 59.013 32.224 12.738  1.00 16.36  ? 113 SER B OG    1 
HETATM 3431 N  N     . MSE B 1 138 ? 61.306 32.357 15.465  1.00 15.82  ? 114 MSE B N     1 
HETATM 3432 C  CA    . MSE B 1 138 ? 60.939 32.601 16.849  1.00 14.17  ? 114 MSE B CA    1 
HETATM 3433 C  C     . MSE B 1 138 ? 59.528 33.107 16.875  1.00 12.24  ? 114 MSE B C     1 
HETATM 3434 O  O     . MSE B 1 138 ? 59.238 34.228 16.425  1.00 14.44  ? 114 MSE B O     1 
HETATM 3435 C  CB    . MSE B 1 138 ? 61.954 33.546 17.458  1.00 14.64  ? 114 MSE B CB    1 
HETATM 3436 C  CG    . MSE B 1 138 ? 63.225 32.735 17.703  1.00 20.97  ? 114 MSE B CG    1 
HETATM 3437 SE SE    . MSE B 1 138 ? 64.602 34.016 18.262  1.00 39.77  ? 114 MSE B SE    1 
HETATM 3438 C  CE    . MSE B 1 138 ? 65.047 34.632 16.438  1.00 26.67  ? 114 MSE B CE    1 
ATOM   3439 N  N     . ILE B 1 139 ? 58.645 32.281 17.420  1.00 12.47  ? 115 ILE B N     1 
ATOM   3440 C  CA    . ILE B 1 139 ? 57.223 32.587 17.508  1.00 14.67  ? 115 ILE B CA    1 
ATOM   3441 C  C     . ILE B 1 139 ? 56.859 32.929 18.951  1.00 16.64  ? 115 ILE B C     1 
ATOM   3442 O  O     . ILE B 1 139 ? 57.021 32.100 19.864  1.00 16.61  ? 115 ILE B O     1 
ATOM   3443 C  CB    . ILE B 1 139 ? 56.375 31.408 17.006  1.00 15.64  ? 115 ILE B CB    1 
ATOM   3444 C  CG1   . ILE B 1 139 ? 56.887 30.980 15.626  1.00 15.50  ? 115 ILE B CG1   1 
ATOM   3445 C  CG2   . ILE B 1 139 ? 54.890 31.761 17.011  1.00 14.25  ? 115 ILE B CG2   1 
ATOM   3446 C  CD1   . ILE B 1 139 ? 56.028 29.956 14.924  1.00 15.12  ? 115 ILE B CD1   1 
ATOM   3447 N  N     . PHE B 1 140 ? 56.358 34.144 19.134  1.00 15.58  ? 116 PHE B N     1 
ATOM   3448 C  CA    . PHE B 1 140 ? 55.941 34.623 20.448  1.00 17.27  ? 116 PHE B CA    1 
ATOM   3449 C  C     . PHE B 1 140 ? 54.421 34.584 20.540  1.00 19.32  ? 116 PHE B C     1 
ATOM   3450 O  O     . PHE B 1 140 ? 53.722 35.190 19.720  1.00 19.56  ? 116 PHE B O     1 
ATOM   3451 C  CB    . PHE B 1 140 ? 56.491 36.030 20.742  1.00 15.74  ? 116 PHE B CB    1 
ATOM   3452 C  CG    . PHE B 1 140 ? 57.990 36.099 20.745  1.00 17.50  ? 116 PHE B CG    1 
ATOM   3453 C  CD1   . PHE B 1 140 ? 58.706 35.845 21.912  1.00 17.60  ? 116 PHE B CD1   1 
ATOM   3454 C  CD2   . PHE B 1 140 ? 58.699 36.410 19.587  1.00 16.54  ? 116 PHE B CD2   1 
ATOM   3455 C  CE1   . PHE B 1 140 ? 60.083 35.893 21.922  1.00 17.86  ? 116 PHE B CE1   1 
ATOM   3456 C  CE2   . PHE B 1 140 ? 60.085 36.462 19.591  1.00 18.32  ? 116 PHE B CE2   1 
ATOM   3457 C  CZ    . PHE B 1 140 ? 60.786 36.199 20.770  1.00 17.13  ? 116 PHE B CZ    1 
ATOM   3458 N  N     . VAL B 1 141 ? 53.924 33.841 21.529  1.00 19.23  ? 117 VAL B N     1 
ATOM   3459 C  CA    . VAL B 1 141 ? 52.487 33.672 21.700  1.00 18.74  ? 117 VAL B CA    1 
ATOM   3460 C  C     . VAL B 1 141 ? 52.031 34.520 22.879  1.00 20.86  ? 117 VAL B C     1 
ATOM   3461 O  O     . VAL B 1 141 ? 52.525 34.345 24.001  1.00 22.73  ? 117 VAL B O     1 
ATOM   3462 C  CB    . VAL B 1 141 ? 52.104 32.187 21.909  1.00 17.98  ? 117 VAL B CB    1 
ATOM   3463 C  CG1   . VAL B 1 141 ? 50.600 32.035 22.103  1.00 20.76  ? 117 VAL B CG1   1 
ATOM   3464 C  CG2   . VAL B 1 141 ? 52.572 31.324 20.745  1.00 19.60  ? 117 VAL B CG2   1 
ATOM   3465 N  N     . THR B 1 142 ? 51.112 35.451 22.612  1.00 20.93  ? 118 THR B N     1 
ATOM   3466 C  CA    . THR B 1 142 ? 50.570 36.340 23.640  1.00 20.99  ? 118 THR B CA    1 
ATOM   3467 C  C     . THR B 1 142 ? 49.367 35.696 24.332  1.00 22.39  ? 118 THR B C     1 
ATOM   3468 O  O     . THR B 1 142 ? 48.837 34.692 23.850  1.00 25.34  ? 118 THR B O     1 
ATOM   3469 C  CB    . THR B 1 142 ? 50.219 37.733 23.072  1.00 19.20  ? 118 THR B CB    1 
ATOM   3470 O  OG1   . THR B 1 142 ? 49.590 37.593 21.787  1.00 21.33  ? 118 THR B OG1   1 
ATOM   3471 C  CG2   . THR B 1 142 ? 51.472 38.563 22.906  1.00 19.73  ? 118 THR B CG2   1 
ATOM   3472 N  N     . GLU B 1 143 ? 48.950 36.268 25.462  1.00 25.85  ? 119 GLU B N     1 
ATOM   3473 C  CA    . GLU B 1 143 ? 47.895 35.686 26.306  1.00 25.99  ? 119 GLU B CA    1 
ATOM   3474 C  C     . GLU B 1 143 ? 46.580 35.455 25.573  1.00 26.52  ? 119 GLU B C     1 
ATOM   3475 O  O     . GLU B 1 143 ? 45.817 34.548 25.924  1.00 26.36  ? 119 GLU B O     1 
ATOM   3476 C  CB    . GLU B 1 143 ? 47.653 36.569 27.531  1.00 30.16  ? 119 GLU B CB    1 
ATOM   3477 C  CG    . GLU B 1 143 ? 48.732 36.434 28.589  1.00 40.55  ? 119 GLU B CG    1 
ATOM   3478 C  CD    . GLU B 1 143 ? 48.666 37.527 29.637  1.00 49.37  ? 119 GLU B CD    1 
ATOM   3479 O  OE1   . GLU B 1 143 ? 49.724 38.123 29.935  1.00 56.58  ? 119 GLU B OE1   1 
ATOM   3480 O  OE2   . GLU B 1 143 ? 47.558 37.795 30.153  1.00 57.49  ? 119 GLU B OE2   1 
ATOM   3481 N  N     . ASP B 1 144 ? 46.331 36.270 24.552  1.00 29.71  ? 120 ASP B N     1 
ATOM   3482 C  CA    . ASP B 1 144 ? 45.147 36.124 23.698  1.00 26.92  ? 120 ASP B CA    1 
ATOM   3483 C  C     . ASP B 1 144 ? 45.243 34.948 22.713  1.00 25.75  ? 120 ASP B C     1 
ATOM   3484 O  O     . ASP B 1 144 ? 44.306 34.695 21.956  1.00 27.43  ? 120 ASP B O     1 
ATOM   3485 C  CB    . ASP B 1 144 ? 44.845 37.444 22.951  1.00 27.60  ? 120 ASP B CB    1 
ATOM   3486 C  CG    . ASP B 1 144 ? 46.017 37.937 22.097  1.00 22.74  ? 120 ASP B CG    1 
ATOM   3487 O  OD1   . ASP B 1 144 ? 47.025 37.217 21.972  1.00 22.11  ? 120 ASP B OD1   1 
ATOM   3488 O  OD2   . ASP B 1 144 ? 45.928 39.062 21.547  1.00 23.42  ? 120 ASP B OD2   1 
ATOM   3489 N  N     . GLY B 1 145 ? 46.377 34.249 22.720  1.00 22.13  ? 121 GLY B N     1 
ATOM   3490 C  CA    . GLY B 1 145 ? 46.601 33.099 21.842  1.00 23.58  ? 121 GLY B CA    1 
ATOM   3491 C  C     . GLY B 1 145 ? 47.148 33.475 20.473  1.00 23.36  ? 121 GLY B C     1 
ATOM   3492 O  O     . GLY B 1 145 ? 47.487 32.596 19.668  1.00 25.41  ? 121 GLY B O     1 
ATOM   3493 N  N     . GLU B 1 146 ? 47.232 34.773 20.194  1.00 23.25  ? 122 GLU B N     1 
ATOM   3494 C  CA    . GLU B 1 146 ? 47.821 35.244 18.936  1.00 22.26  ? 122 GLU B CA    1 
ATOM   3495 C  C     . GLU B 1 146 ? 49.319 34.927 18.845  1.00 20.31  ? 122 GLU B C     1 
ATOM   3496 O  O     . GLU B 1 146 ? 50.010 34.874 19.865  1.00 22.58  ? 122 GLU B O     1 
ATOM   3497 C  CB    . GLU B 1 146 ? 47.587 36.742 18.741  1.00 23.48  ? 122 GLU B CB    1 
ATOM   3498 C  CG    . GLU B 1 146 ? 47.895 37.209 17.329  1.00 25.06  ? 122 GLU B CG    1 
ATOM   3499 C  CD    . GLU B 1 146 ? 47.123 36.405 16.283  1.00 26.17  ? 122 GLU B CD    1 
ATOM   3500 O  OE1   . GLU B 1 146 ? 47.734 35.564 15.563  1.00 24.19  ? 122 GLU B OE1   1 
ATOM   3501 O  OE2   . GLU B 1 146 ? 45.895 36.599 16.217  1.00 31.85  ? 122 GLU B OE2   1 
ATOM   3502 N  N     . ARG B 1 147 ? 49.813 34.725 17.623  1.00 19.22  ? 123 ARG B N     1 
ATOM   3503 C  CA    A ARG B 1 147 ? 51.228 34.388 17.414  0.50 17.47  ? 123 ARG B CA    1 
ATOM   3504 C  CA    B ARG B 1 147 ? 51.212 34.370 17.400  0.50 17.26  ? 123 ARG B CA    1 
ATOM   3505 C  C     . ARG B 1 147 ? 51.934 35.395 16.519  1.00 17.91  ? 123 ARG B C     1 
ATOM   3506 O  O     . ARG B 1 147 ? 51.410 35.819 15.474  1.00 21.10  ? 123 ARG B O     1 
ATOM   3507 C  CB    A ARG B 1 147 ? 51.415 32.960 16.871  0.50 18.63  ? 123 ARG B CB    1 
ATOM   3508 C  CB    B ARG B 1 147 ? 51.306 32.954 16.813  0.50 17.72  ? 123 ARG B CB    1 
ATOM   3509 C  CG    A ARG B 1 147 ? 51.550 32.833 15.355  0.50 18.79  ? 123 ARG B CG    1 
ATOM   3510 C  CG    B ARG B 1 147 ? 50.564 32.740 15.497  0.50 17.60  ? 123 ARG B CG    1 
ATOM   3511 C  CD    A ARG B 1 147 ? 50.204 32.971 14.664  0.50 18.07  ? 123 ARG B CD    1 
ATOM   3512 C  CD    B ARG B 1 147 ? 51.580 32.726 14.368  0.50 15.05  ? 123 ARG B CD    1 
ATOM   3513 N  NE    A ARG B 1 147 ? 50.316 32.738 13.231  0.50 18.91  ? 123 ARG B NE    1 
ATOM   3514 N  NE    B ARG B 1 147 ? 50.979 32.749 13.043  0.50 14.45  ? 123 ARG B NE    1 
ATOM   3515 C  CZ    A ARG B 1 147 ? 50.745 33.639 12.355  0.50 17.52  ? 123 ARG B CZ    1 
ATOM   3516 C  CZ    B ARG B 1 147 ? 50.825 33.846 12.314  0.50 15.94  ? 123 ARG B CZ    1 
ATOM   3517 N  NH1   A ARG B 1 147 ? 51.102 34.847 12.768  0.50 15.20  ? 123 ARG B NH1   1 
ATOM   3518 N  NH1   B ARG B 1 147 ? 51.230 35.017 12.779  0.50 14.47  ? 123 ARG B NH1   1 
ATOM   3519 N  NH2   A ARG B 1 147 ? 50.807 33.328 11.055  0.50 17.11  ? 123 ARG B NH2   1 
ATOM   3520 N  NH2   B ARG B 1 147 ? 50.270 33.765 11.107  0.50 20.64  ? 123 ARG B NH2   1 
ATOM   3521 N  N     . SER B 1 148 ? 53.133 35.774 16.927  1.00 17.23  ? 124 SER B N     1 
ATOM   3522 C  CA    . SER B 1 148 ? 53.906 36.760 16.183  1.00 15.06  ? 124 SER B CA    1 
ATOM   3523 C  C     . SER B 1 148 ? 55.242 36.137 15.826  1.00 16.82  ? 124 SER B C     1 
ATOM   3524 O  O     . SER B 1 148 ? 56.040 35.785 16.717  1.00 16.77  ? 124 SER B O     1 
ATOM   3525 C  CB    . SER B 1 148 ? 54.101 38.028 17.020  1.00 15.18  ? 124 SER B CB    1 
ATOM   3526 O  OG    . SER B 1 148 ? 52.853 38.568 17.412  1.00 16.31  ? 124 SER B OG    1 
HETATM 3527 N  N     . MSE B 1 149 ? 55.487 35.975 14.528  1.00 14.62  ? 125 MSE B N     1 
HETATM 3528 C  CA    . MSE B 1 149 ? 56.626 35.175 14.074  1.00 13.59  ? 125 MSE B CA    1 
HETATM 3529 C  C     . MSE B 1 149 ? 57.773 36.002 13.592  1.00 14.84  ? 125 MSE B C     1 
HETATM 3530 O  O     . MSE B 1 149 ? 57.597 37.037 12.908  1.00 15.44  ? 125 MSE B O     1 
HETATM 3531 C  CB    . MSE B 1 149 ? 56.193 34.238 12.951  1.00 15.34  ? 125 MSE B CB    1 
HETATM 3532 C  CG    . MSE B 1 149 ? 54.858 33.626 13.320  1.00 17.93  ? 125 MSE B CG    1 
HETATM 3533 SE SE    . MSE B 1 149 ? 54.509 32.122 12.117  1.00 31.90  ? 125 MSE B SE    1 
HETATM 3534 C  CE    . MSE B 1 149 ? 54.088 33.146 10.485  1.00 24.21  ? 125 MSE B CE    1 
ATOM   3535 N  N     . ASN B 1 150 ? 58.970 35.516 13.909  1.00 13.63  ? 126 ASN B N     1 
ATOM   3536 C  CA    . ASN B 1 150 ? 60.212 36.210 13.580  1.00 13.10  ? 126 ASN B CA    1 
ATOM   3537 C  C     . ASN B 1 150 ? 61.182 35.262 12.898  1.00 14.63  ? 126 ASN B C     1 
ATOM   3538 O  O     . ASN B 1 150 ? 61.853 34.455 13.551  1.00 14.98  ? 126 ASN B O     1 
ATOM   3539 C  CB    . ASN B 1 150 ? 60.801 36.840 14.861  1.00 13.34  ? 126 ASN B CB    1 
ATOM   3540 C  CG    . ASN B 1 150 ? 59.863 37.850 15.467  1.00 12.64  ? 126 ASN B CG    1 
ATOM   3541 O  OD1   . ASN B 1 150 ? 59.908 39.030 15.124  1.00 15.00  ? 126 ASN B OD1   1 
ATOM   3542 N  ND2   . ASN B 1 150 ? 58.945 37.376 16.314  1.00 13.51  ? 126 ASN B ND2   1 
ATOM   3543 N  N     . THR B 1 151 ? 61.235 35.369 11.560  1.00 14.96  ? 127 THR B N     1 
ATOM   3544 C  CA    . THR B 1 151 ? 61.785 34.318 10.721  1.00 13.61  ? 127 THR B CA    1 
ATOM   3545 C  C     . THR B 1 151 ? 63.100 34.659 10.040  1.00 12.52  ? 127 THR B C     1 
ATOM   3546 O  O     . THR B 1 151 ? 63.199 35.637 9.270   1.00 14.08  ? 127 THR B O     1 
ATOM   3547 C  CB    . THR B 1 151 ? 60.743 33.877 9.658   1.00 14.91  ? 127 THR B CB    1 
ATOM   3548 O  OG1   . THR B 1 151 ? 59.523 33.519 10.316  1.00 14.64  ? 127 THR B OG1   1 
ATOM   3549 C  CG2   . THR B 1 151 ? 61.259 32.694 8.848   1.00 16.39  ? 127 THR B CG2   1 
ATOM   3550 N  N     . TYR B 1 152 ? 64.120 33.872 10.368  1.00 12.29  ? 128 TYR B N     1 
ATOM   3551 C  CA    . TYR B 1 152 ? 65.389 33.895 9.658   1.00 14.67  ? 128 TYR B CA    1 
ATOM   3552 C  C     . TYR B 1 152 ? 65.353 32.776 8.616   1.00 14.45  ? 128 TYR B C     1 
ATOM   3553 O  O     . TYR B 1 152 ? 65.304 31.587 8.947   1.00 14.80  ? 128 TYR B O     1 
ATOM   3554 C  CB    . TYR B 1 152 ? 66.580 33.726 10.614  1.00 17.03  ? 128 TYR B CB    1 
ATOM   3555 C  CG    . TYR B 1 152 ? 67.883 33.491 9.906   1.00 15.19  ? 128 TYR B CG    1 
ATOM   3556 C  CD1   . TYR B 1 152 ? 68.500 34.508 9.174   1.00 18.69  ? 128 TYR B CD1   1 
ATOM   3557 C  CD2   . TYR B 1 152 ? 68.487 32.233 9.935   1.00 16.08  ? 128 TYR B CD2   1 
ATOM   3558 C  CE1   . TYR B 1 152 ? 69.697 34.278 8.496   1.00 20.38  ? 128 TYR B CE1   1 
ATOM   3559 C  CE2   . TYR B 1 152 ? 69.691 31.992 9.287   1.00 19.46  ? 128 TYR B CE2   1 
ATOM   3560 C  CZ    . TYR B 1 152 ? 70.287 33.012 8.566   1.00 21.63  ? 128 TYR B CZ    1 
ATOM   3561 O  OH    . TYR B 1 152 ? 71.466 32.754 7.917   1.00 26.45  ? 128 TYR B OH    1 
ATOM   3562 N  N     . LEU B 1 153 ? 65.368 33.167 7.347   1.00 16.16  ? 129 LEU B N     1 
ATOM   3563 C  CA    . LEU B 1 153 ? 65.135 32.212 6.258   1.00 15.21  ? 129 LEU B CA    1 
ATOM   3564 C  C     . LEU B 1 153 ? 66.260 31.203 5.998   1.00 15.12  ? 129 LEU B C     1 
ATOM   3565 O  O     . LEU B 1 153 ? 66.007 30.119 5.445   1.00 15.45  ? 129 LEU B O     1 
ATOM   3566 C  CB    . LEU B 1 153 ? 64.793 32.967 4.966   1.00 14.71  ? 129 LEU B CB    1 
ATOM   3567 C  CG    . LEU B 1 153 ? 63.411 33.615 4.868   1.00 16.03  ? 129 LEU B CG    1 
ATOM   3568 C  CD1   . LEU B 1 153 ? 63.345 34.438 3.587   1.00 16.56  ? 129 LEU B CD1   1 
ATOM   3569 C  CD2   . LEU B 1 153 ? 62.297 32.583 4.897   1.00 18.38  ? 129 LEU B CD2   1 
ATOM   3570 N  N     . GLY B 1 154 ? 67.490 31.533 6.398   1.00 17.64  ? 130 GLY B N     1 
ATOM   3571 C  CA    . GLY B 1 154 ? 68.609 30.579 6.292   1.00 15.57  ? 130 GLY B CA    1 
ATOM   3572 C  C     . GLY B 1 154 ? 68.674 29.837 4.959   1.00 15.34  ? 130 GLY B C     1 
ATOM   3573 O  O     . GLY B 1 154 ? 68.689 30.461 3.886   1.00 17.60  ? 130 GLY B O     1 
ATOM   3574 N  N     . ALA B 1 155 ? 68.694 28.507 5.039   1.00 14.50  ? 131 ALA B N     1 
ATOM   3575 C  CA    . ALA B 1 155 ? 68.849 27.633 3.884   1.00 14.85  ? 131 ALA B CA    1 
ATOM   3576 C  C     . ALA B 1 155 ? 67.677 27.721 2.883   1.00 15.56  ? 131 ALA B C     1 
ATOM   3577 O  O     . ALA B 1 155 ? 67.811 27.277 1.737   1.00 17.25  ? 131 ALA B O     1 
ATOM   3578 C  CB    . ALA B 1 155 ? 69.069 26.191 4.336   1.00 15.87  ? 131 ALA B CB    1 
ATOM   3579 N  N     . CYS B 1 156 ? 66.549 28.289 3.308   1.00 14.16  ? 132 CYS B N     1 
ATOM   3580 C  CA    . CYS B 1 156 ? 65.395 28.537 2.416   1.00 15.97  ? 132 CYS B CA    1 
ATOM   3581 C  C     . CYS B 1 156 ? 65.740 29.352 1.162   1.00 16.51  ? 132 CYS B C     1 
ATOM   3582 O  O     . CYS B 1 156 ? 65.090 29.172 0.097   1.00 17.75  ? 132 CYS B O     1 
ATOM   3583 C  CB    . CYS B 1 156 ? 64.249 29.201 3.191   1.00 16.54  ? 132 CYS B CB    1 
ATOM   3584 S  SG    . CYS B 1 156 ? 63.436 28.068 4.346   1.00 17.68  ? 132 CYS B SG    1 
ATOM   3585 N  N     . VAL B 1 157 ? 66.738 30.239 1.278   1.00 14.08  ? 133 VAL B N     1 
ATOM   3586 C  CA    . VAL B 1 157 ? 67.153 31.091 0.139   1.00 16.82  ? 133 VAL B CA    1 
ATOM   3587 C  C     . VAL B 1 157 ? 67.753 30.276 -1.011  1.00 17.60  ? 133 VAL B C     1 
ATOM   3588 O  O     . VAL B 1 157 ? 67.916 30.798 -2.123  1.00 20.35  ? 133 VAL B O     1 
ATOM   3589 C  CB    . VAL B 1 157 ? 68.147 32.212 0.545   1.00 16.42  ? 133 VAL B CB    1 
ATOM   3590 C  CG1   . VAL B 1 157 ? 67.597 33.078 1.671   1.00 16.74  ? 133 VAL B CG1   1 
ATOM   3591 C  CG2   . VAL B 1 157 ? 69.523 31.639 0.886   1.00 18.33  ? 133 VAL B CG2   1 
ATOM   3592 N  N     . GLU B 1 158 ? 68.094 29.010 -0.744  1.00 15.27  ? 134 GLU B N     1 
ATOM   3593 C  CA    . GLU B 1 158 ? 68.694 28.128 -1.757  1.00 19.73  ? 134 GLU B CA    1 
ATOM   3594 C  C     . GLU B 1 158 ? 67.715 27.282 -2.594  1.00 19.56  ? 134 GLU B C     1 
ATOM   3595 O  O     . GLU B 1 158 ? 68.141 26.584 -3.511  1.00 20.48  ? 134 GLU B O     1 
ATOM   3596 C  CB    . GLU B 1 158 ? 69.768 27.246 -1.128  1.00 23.74  ? 134 GLU B CB    1 
ATOM   3597 C  CG    . GLU B 1 158 ? 71.034 28.025 -0.805  1.00 29.10  ? 134 GLU B CG    1 
ATOM   3598 C  CD    . GLU B 1 158 ? 71.907 27.348 0.221   1.00 38.65  ? 134 GLU B CD    1 
ATOM   3599 O  OE1   . GLU B 1 158 ? 73.130 27.575 0.171   1.00 48.78  ? 134 GLU B OE1   1 
ATOM   3600 O  OE2   . GLU B 1 158 ? 71.378 26.602 1.080   1.00 42.90  ? 134 GLU B OE2   1 
ATOM   3601 N  N     . LEU B 1 159 ? 66.426 27.329 -2.261  1.00 17.43  ? 135 LEU B N     1 
ATOM   3602 C  CA    . LEU B 1 159 ? 65.417 26.569 -2.993  1.00 16.28  ? 135 LEU B CA    1 
ATOM   3603 C  C     . LEU B 1 159 ? 65.249 27.172 -4.380  1.00 17.75  ? 135 LEU B C     1 
ATOM   3604 O  O     . LEU B 1 159 ? 65.046 28.376 -4.519  1.00 17.84  ? 135 LEU B O     1 
ATOM   3605 C  CB    . LEU B 1 159 ? 64.080 26.571 -2.245  1.00 16.79  ? 135 LEU B CB    1 
ATOM   3606 C  CG    . LEU B 1 159 ? 62.971 25.805 -2.968  1.00 13.41  ? 135 LEU B CG    1 
ATOM   3607 C  CD1   . LEU B 1 159 ? 63.191 24.315 -2.802  1.00 15.63  ? 135 LEU B CD1   1 
ATOM   3608 C  CD2   . LEU B 1 159 ? 61.615 26.194 -2.399  1.00 14.00  ? 135 LEU B CD2   1 
ATOM   3609 N  N     . GLY B 1 160 ? 65.352 26.319 -5.396  1.00 18.30  ? 136 GLY B N     1 
ATOM   3610 C  CA    . GLY B 1 160 ? 65.255 26.758 -6.781  1.00 21.23  ? 136 GLY B CA    1 
ATOM   3611 C  C     . GLY B 1 160 ? 64.694 25.646 -7.642  1.00 20.83  ? 136 GLY B C     1 
ATOM   3612 O  O     . GLY B 1 160 ? 64.302 24.602 -7.129  1.00 19.30  ? 136 GLY B O     1 
ATOM   3613 N  N     . PRO B 1 161 ? 64.651 25.874 -8.973  1.00 21.03  ? 137 PRO B N     1 
ATOM   3614 C  CA    . PRO B 1 161 ? 64.165 24.894 -9.946  1.00 21.62  ? 137 PRO B CA    1 
ATOM   3615 C  C     . PRO B 1 161 ? 64.841 23.526 -9.816  1.00 21.22  ? 137 PRO B C     1 
ATOM   3616 O  O     . PRO B 1 161 ? 64.215 22.507 -10.104 1.00 20.64  ? 137 PRO B O     1 
ATOM   3617 C  CB    . PRO B 1 161 ? 64.516 25.540 -11.300 1.00 19.81  ? 137 PRO B CB    1 
ATOM   3618 C  CG    . PRO B 1 161 ? 64.596 26.992 -11.019 1.00 21.06  ? 137 PRO B CG    1 
ATOM   3619 C  CD    . PRO B 1 161 ? 65.143 27.098 -9.623  1.00 22.07  ? 137 PRO B CD    1 
ATOM   3620 N  N     . GLU B 1 162 ? 66.093 23.509 -9.347  1.00 22.44  ? 138 GLU B N     1 
ATOM   3621 C  CA    . GLU B 1 162 ? 66.853 22.271 -9.198  1.00 24.72  ? 138 GLU B CA    1 
ATOM   3622 C  C     . GLU B 1 162 ? 66.210 21.309 -8.179  1.00 19.34  ? 138 GLU B C     1 
ATOM   3623 O  O     . GLU B 1 162 ? 66.544 20.127 -8.127  1.00 22.18  ? 138 GLU B O     1 
ATOM   3624 C  CB    . GLU B 1 162 ? 68.331 22.564 -8.863  1.00 29.27  ? 138 GLU B CB    1 
ATOM   3625 C  CG    . GLU B 1 162 ? 68.607 23.075 -7.452  1.00 31.75  ? 138 GLU B CG    1 
ATOM   3626 C  CD    . GLU B 1 162 ? 68.483 24.587 -7.279  1.00 33.33  ? 138 GLU B CD    1 
ATOM   3627 O  OE1   . GLU B 1 162 ? 68.127 25.307 -8.242  1.00 29.22  ? 138 GLU B OE1   1 
ATOM   3628 O  OE2   . GLU B 1 162 ? 68.744 25.061 -6.144  1.00 40.16  ? 138 GLU B OE2   1 
ATOM   3629 N  N     . ASP B 1 163 ? 65.255 21.827 -7.419  1.00 18.02  ? 139 ASP B N     1 
ATOM   3630 C  CA    . ASP B 1 163 ? 64.585 21.077 -6.382  1.00 19.41  ? 139 ASP B CA    1 
ATOM   3631 C  C     . ASP B 1 163 ? 63.191 20.634 -6.790  1.00 19.03  ? 139 ASP B C     1 
ATOM   3632 O  O     . ASP B 1 163 ? 62.451 20.108 -5.986  1.00 19.81  ? 139 ASP B O     1 
ATOM   3633 C  CB    . ASP B 1 163 ? 64.528 21.899 -5.088  1.00 16.73  ? 139 ASP B CB    1 
ATOM   3634 C  CG    . ASP B 1 163 ? 65.897 22.268 -4.596  1.00 17.74  ? 139 ASP B CG    1 
ATOM   3635 O  OD1   . ASP B 1 163 ? 66.715 21.327 -4.368  1.00 19.67  ? 139 ASP B OD1   1 
ATOM   3636 O  OD2   . ASP B 1 163 ? 66.142 23.488 -4.435  1.00 17.58  ? 139 ASP B OD2   1 
ATOM   3637 N  N     . VAL B 1 164 ? 62.828 20.853 -8.050  1.00 16.32  ? 140 VAL B N     1 
ATOM   3638 C  CA    . VAL B 1 164 ? 61.526 20.433 -8.536  1.00 18.39  ? 140 VAL B CA    1 
ATOM   3639 C  C     . VAL B 1 164 ? 61.684 18.993 -8.969  1.00 16.75  ? 140 VAL B C     1 
ATOM   3640 O  O     . VAL B 1 164 ? 62.524 18.688 -9.823  1.00 20.61  ? 140 VAL B O     1 
ATOM   3641 C  CB    . VAL B 1 164 ? 61.053 21.327 -9.719  1.00 17.09  ? 140 VAL B CB    1 
ATOM   3642 C  CG1   . VAL B 1 164 ? 59.829 20.734 -10.421 1.00 20.27  ? 140 VAL B CG1   1 
ATOM   3643 C  CG2   . VAL B 1 164 ? 60.787 22.747 -9.228  1.00 16.16  ? 140 VAL B CG2   1 
ATOM   3644 N  N     . GLU B 1 165 ? 60.906 18.106 -8.352  1.00 15.08  ? 141 GLU B N     1 
ATOM   3645 C  CA    . GLU B 1 165 ? 60.898 16.699 -8.713  1.00 16.62  ? 141 GLU B CA    1 
ATOM   3646 C  C     . GLU B 1 165 ? 59.731 16.601 -9.662  1.00 17.63  ? 141 GLU B C     1 
ATOM   3647 O  O     . GLU B 1 165 ? 58.570 16.558 -9.243  1.00 16.97  ? 141 GLU B O     1 
ATOM   3648 C  CB    . GLU B 1 165 ? 60.720 15.785 -7.492  1.00 17.05  ? 141 GLU B CB    1 
ATOM   3649 C  CG    . GLU B 1 165 ? 61.788 15.978 -6.412  1.00 20.32  ? 141 GLU B CG    1 
ATOM   3650 C  CD    . GLU B 1 165 ? 61.439 15.284 -5.107  1.00 20.93  ? 141 GLU B CD    1 
ATOM   3651 O  OE1   . GLU B 1 165 ? 60.936 14.139 -5.131  1.00 23.66  ? 141 GLU B OE1   1 
ATOM   3652 O  OE2   . GLU B 1 165 ? 61.668 15.899 -4.046  1.00 24.82  ? 141 GLU B OE2   1 
ATOM   3653 N  N     . ALA B 1 166 ? 60.051 16.669 -10.952 1.00 18.32  ? 142 ALA B N     1 
ATOM   3654 C  CA    . ALA B 1 166 ? 59.044 16.789 -11.993 1.00 20.13  ? 142 ALA B CA    1 
ATOM   3655 C  C     . ALA B 1 166 ? 58.017 15.666 -11.916 1.00 18.53  ? 142 ALA B C     1 
ATOM   3656 O  O     . ALA B 1 166 ? 56.810 15.940 -11.974 1.00 19.42  ? 142 ALA B O     1 
ATOM   3657 C  CB    . ALA B 1 166 ? 59.719 16.847 -13.353 1.00 22.60  ? 142 ALA B CB    1 
ATOM   3658 N  N     . ASP B 1 167 ? 58.483 14.423 -11.724 1.00 19.91  ? 143 ASP B N     1 
ATOM   3659 C  CA    . ASP B 1 167 ? 57.584 13.266 -11.605 1.00 21.26  ? 143 ASP B CA    1 
ATOM   3660 C  C     . ASP B 1 167 ? 56.593 13.425 -10.434 1.00 20.49  ? 143 ASP B C     1 
ATOM   3661 O  O     . ASP B 1 167 ? 55.478 12.920 -10.447 1.00 23.21  ? 143 ASP B O     1 
ATOM   3662 C  CB    . ASP B 1 167 ? 58.386 11.960 -11.477 1.00 25.11  ? 143 ASP B CB    1 
ATOM   3663 C  CG    . ASP B 1 167 ? 59.346 11.715 -12.654 1.00 32.12  ? 143 ASP B CG    1 
ATOM   3664 O  OD1   . ASP B 1 167 ? 59.190 12.342 -13.729 1.00 30.81  ? 143 ASP B OD1   1 
ATOM   3665 O  OD2   . ASP B 1 167 ? 60.258 10.868 -12.506 1.00 36.47  ? 143 ASP B OD2   1 
ATOM   3666 N  N     . VAL B 1 168 ? 56.987 14.146 -9.401  1.00 16.71  ? 144 VAL B N     1 
ATOM   3667 C  CA    . VAL B 1 168 ? 56.043 14.355 -8.297  1.00 18.77  ? 144 VAL B CA    1 
ATOM   3668 C  C     . VAL B 1 168 ? 54.897 15.341 -8.633  1.00 17.66  ? 144 VAL B C     1 
ATOM   3669 O  O     . VAL B 1 168 ? 53.732 15.022 -8.424  1.00 17.18  ? 144 VAL B O     1 
ATOM   3670 C  CB    . VAL B 1 168 ? 56.799 14.706 -7.002  1.00 16.36  ? 144 VAL B CB    1 
ATOM   3671 C  CG1   . VAL B 1 168 ? 55.848 14.984 -5.854  1.00 17.35  ? 144 VAL B CG1   1 
ATOM   3672 C  CG2   . VAL B 1 168 ? 57.723 13.559 -6.647  1.00 17.30  ? 144 VAL B CG2   1 
ATOM   3673 N  N     . VAL B 1 169 ? 55.235 16.511 -9.169  1.00 18.88  ? 145 VAL B N     1 
ATOM   3674 C  CA    . VAL B 1 169 ? 54.247 17.486 -9.657  1.00 15.81  ? 145 VAL B CA    1 
ATOM   3675 C  C     . VAL B 1 169 ? 53.302 16.841 -10.699 1.00 16.79  ? 145 VAL B C     1 
ATOM   3676 O  O     . VAL B 1 169 ? 52.075 16.885 -10.583 1.00 16.32  ? 145 VAL B O     1 
ATOM   3677 C  CB    . VAL B 1 169 ? 54.937 18.712 -10.303 1.00 14.51  ? 145 VAL B CB    1 
ATOM   3678 C  CG1   . VAL B 1 169 ? 53.898 19.765 -10.638 1.00 16.57  ? 145 VAL B CG1   1 
ATOM   3679 C  CG2   . VAL B 1 169 ? 56.036 19.310 -9.406  1.00 16.56  ? 145 VAL B CG2   1 
ATOM   3680 N  N     . ALA B 1 170 ? 53.900 16.210 -11.689 1.00 17.54  ? 146 ALA B N     1 
ATOM   3681 C  CA    . ALA B 1 170 ? 53.158 15.408 -12.675 1.00 17.99  ? 146 ALA B CA    1 
ATOM   3682 C  C     . ALA B 1 170 ? 52.169 14.394 -12.057 1.00 20.36  ? 146 ALA B C     1 
ATOM   3683 O  O     . ALA B 1 170 ? 51.110 14.114 -12.641 1.00 22.67  ? 146 ALA B O     1 
ATOM   3684 C  CB    . ALA B 1 170 ? 54.146 14.697 -13.591 1.00 20.22  ? 146 ALA B CB    1 
ATOM   3685 N  N     . ASP B 1 171 ? 52.499 13.873 -10.865 1.00 22.92  ? 147 ASP B N     1 
ATOM   3686 C  CA    . ASP B 1 171 ? 51.717 12.796 -10.250 1.00 24.12  ? 147 ASP B CA    1 
ATOM   3687 C  C     . ASP B 1 171 ? 50.878 13.251 -9.037  1.00 20.94  ? 147 ASP B C     1 
ATOM   3688 O  O     . ASP B 1 171 ? 50.353 12.412 -8.305  1.00 28.02  ? 147 ASP B O     1 
ATOM   3689 C  CB    . ASP B 1 171 ? 52.631 11.621 -9.834  1.00 31.65  ? 147 ASP B CB    1 
ATOM   3690 C  CG    . ASP B 1 171 ? 53.346 10.948 -11.014 1.00 30.82  ? 147 ASP B CG    1 
ATOM   3691 O  OD1   . ASP B 1 171 ? 52.979 11.141 -12.207 1.00 38.88  ? 147 ASP B OD1   1 
ATOM   3692 O  OD2   . ASP B 1 171 ? 54.298 10.177 -10.734 1.00 34.04  ? 147 ASP B OD2   1 
ATOM   3693 N  N     . ALA B 1 172 ? 50.732 14.565 -8.850  1.00 19.48  ? 148 ALA B N     1 
ATOM   3694 C  CA    . ALA B 1 172 ? 49.948 15.110 -7.727  1.00 18.34  ? 148 ALA B CA    1 
ATOM   3695 C  C     . ALA B 1 172 ? 48.676 15.862 -8.153  1.00 15.65  ? 148 ALA B C     1 
ATOM   3696 O  O     . ALA B 1 172 ? 48.704 16.746 -9.018  1.00 17.98  ? 148 ALA B O     1 
ATOM   3697 C  CB    . ALA B 1 172 ? 50.813 15.978 -6.828  1.00 17.68  ? 148 ALA B CB    1 
ATOM   3698 N  N     . LYS B 1 173 ? 47.558 15.508 -7.534  1.00 13.76  ? 149 LYS B N     1 
ATOM   3699 C  CA    . LYS B 1 173 ? 46.274 16.108 -7.871  1.00 15.89  ? 149 LYS B CA    1 
ATOM   3700 C  C     . LYS B 1 173 ? 46.341 17.613 -7.709  1.00 16.96  ? 149 LYS B C     1 
ATOM   3701 O  O     . LYS B 1 173 ? 45.907 18.332 -8.595  1.00 19.19  ? 149 LYS B O     1 
ATOM   3702 C  CB    . LYS B 1 173 ? 45.131 15.510 -7.036  1.00 14.40  ? 149 LYS B CB    1 
ATOM   3703 C  CG    . LYS B 1 173 ? 44.943 14.024 -7.237  1.00 13.18  ? 149 LYS B CG    1 
ATOM   3704 C  CD    . LYS B 1 173 ? 43.693 13.523 -6.540  1.00 16.29  ? 149 LYS B CD    1 
ATOM   3705 C  CE    . LYS B 1 173 ? 43.665 12.010 -6.504  1.00 23.92  ? 149 LYS B CE    1 
ATOM   3706 N  NZ    . LYS B 1 173 ? 42.544 11.527 -5.648  1.00 31.12  ? 149 LYS B NZ    1 
ATOM   3707 N  N     . VAL B 1 174 ? 46.904 18.081 -6.571  1.00 16.86  ? 150 VAL B N     1 
ATOM   3708 C  CA    . VAL B 1 174 ? 47.059 19.507 -6.299  1.00 14.51  ? 150 VAL B CA    1 
ATOM   3709 C  C     . VAL B 1 174 ? 48.511 19.788 -5.888  1.00 16.79  ? 150 VAL B C     1 
ATOM   3710 O  O     . VAL B 1 174 ? 49.038 19.132 -4.967  1.00 16.85  ? 150 VAL B O     1 
ATOM   3711 C  CB    . VAL B 1 174 ? 46.167 20.021 -5.125  1.00 14.49  ? 150 VAL B CB    1 
ATOM   3712 C  CG1   . VAL B 1 174 ? 46.223 21.524 -5.071  1.00 15.99  ? 150 VAL B CG1   1 
ATOM   3713 C  CG2   . VAL B 1 174 ? 44.719 19.584 -5.257  1.00 16.78  ? 150 VAL B CG2   1 
ATOM   3714 N  N     . THR B 1 175 ? 49.139 20.760 -6.551  1.00 14.90  ? 151 THR B N     1 
ATOM   3715 C  CA    . THR B 1 175 ? 50.373 21.368 -6.028  1.00 16.14  ? 151 THR B CA    1 
ATOM   3716 C  C     . THR B 1 175 ? 50.036 22.729 -5.392  1.00 17.13  ? 151 THR B C     1 
ATOM   3717 O  O     . THR B 1 175 ? 49.504 23.635 -6.060  1.00 19.35  ? 151 THR B O     1 
ATOM   3718 C  CB    . THR B 1 175 ? 51.479 21.489 -7.107  1.00 15.87  ? 151 THR B CB    1 
ATOM   3719 O  OG1   . THR B 1 175 ? 51.870 20.189 -7.543  1.00 18.43  ? 151 THR B OG1   1 
ATOM   3720 C  CG2   . THR B 1 175 ? 52.714 22.190 -6.568  1.00 15.08  ? 151 THR B CG2   1 
ATOM   3721 N  N     . TYR B 1 176 ? 50.335 22.849 -4.094  1.00 16.88  ? 152 TYR B N     1 
ATOM   3722 C  CA    . TYR B 1 176 ? 49.995 24.027 -3.274  1.00 16.79  ? 152 TYR B CA    1 
ATOM   3723 C  C     . TYR B 1 176 ? 51.280 24.712 -2.808  1.00 15.23  ? 152 TYR B C     1 
ATOM   3724 O  O     . TYR B 1 176 ? 52.244 24.035 -2.441  1.00 16.41  ? 152 TYR B O     1 
ATOM   3725 C  CB    . TYR B 1 176 ? 49.170 23.553 -2.079  1.00 14.76  ? 152 TYR B CB    1 
ATOM   3726 C  CG    . TYR B 1 176 ? 48.932 24.493 -0.944  1.00 14.50  ? 152 TYR B CG    1 
ATOM   3727 C  CD1   . TYR B 1 176 ? 47.854 25.393 -0.946  1.00 14.61  ? 152 TYR B CD1   1 
ATOM   3728 C  CD2   . TYR B 1 176 ? 49.768 24.451 0.197   1.00 15.69  ? 152 TYR B CD2   1 
ATOM   3729 C  CE1   . TYR B 1 176 ? 47.613 26.211 0.161   1.00 18.97  ? 152 TYR B CE1   1 
ATOM   3730 C  CE2   . TYR B 1 176 ? 49.533 25.271 1.289   1.00 14.86  ? 152 TYR B CE2   1 
ATOM   3731 C  CZ    . TYR B 1 176 ? 48.475 26.151 1.272   1.00 17.43  ? 152 TYR B CZ    1 
ATOM   3732 O  OH    . TYR B 1 176 ? 48.275 26.939 2.379   1.00 18.69  ? 152 TYR B OH    1 
ATOM   3733 N  N     . PHE B 1 177 ? 51.304 26.037 -2.852  1.00 13.31  ? 153 PHE B N     1 
ATOM   3734 C  CA    . PHE B 1 177 ? 52.506 26.791 -2.463  1.00 14.20  ? 153 PHE B CA    1 
ATOM   3735 C  C     . PHE B 1 177 ? 52.222 28.064 -1.673  1.00 14.86  ? 153 PHE B C     1 
ATOM   3736 O  O     . PHE B 1 177 ? 51.126 28.635 -1.763  1.00 15.16  ? 153 PHE B O     1 
ATOM   3737 C  CB    . PHE B 1 177 ? 53.383 27.075 -3.681  1.00 14.51  ? 153 PHE B CB    1 
ATOM   3738 C  CG    . PHE B 1 177 ? 52.795 28.084 -4.648  1.00 15.00  ? 153 PHE B CG    1 
ATOM   3739 C  CD1   . PHE B 1 177 ? 51.936 27.666 -5.678  1.00 16.19  ? 153 PHE B CD1   1 
ATOM   3740 C  CD2   . PHE B 1 177 ? 53.102 29.437 -4.550  1.00 13.82  ? 153 PHE B CD2   1 
ATOM   3741 C  CE1   . PHE B 1 177 ? 51.409 28.592 -6.578  1.00 15.79  ? 153 PHE B CE1   1 
ATOM   3742 C  CE2   . PHE B 1 177 ? 52.575 30.371 -5.467  1.00 12.15  ? 153 PHE B CE2   1 
ATOM   3743 C  CZ    . PHE B 1 177 ? 51.714 29.939 -6.474  1.00 12.90  ? 153 PHE B CZ    1 
ATOM   3744 N  N     . GLU B 1 178 ? 53.211 28.497 -0.871  1.00 14.02  ? 154 GLU B N     1 
ATOM   3745 C  CA    . GLU B 1 178 ? 53.101 29.724 -0.092  1.00 12.80  ? 154 GLU B CA    1 
ATOM   3746 C  C     . GLU B 1 178 ? 53.483 30.994 -0.815  1.00 12.33  ? 154 GLU B C     1 
ATOM   3747 O  O     . GLU B 1 178 ? 54.527 31.070 -1.493  1.00 14.10  ? 154 GLU B O     1 
ATOM   3748 C  CB    . GLU B 1 178 ? 54.020 29.668 1.167   1.00 12.58  ? 154 GLU B CB    1 
ATOM   3749 C  CG    . GLU B 1 178 ? 54.082 28.363 1.927   1.00 13.10  ? 154 GLU B CG    1 
ATOM   3750 C  CD    . GLU B 1 178 ? 55.374 28.237 2.734   1.00 13.52  ? 154 GLU B CD    1 
ATOM   3751 O  OE1   . GLU B 1 178 ? 56.361 28.939 2.412   1.00 12.56  ? 154 GLU B OE1   1 
ATOM   3752 O  OE2   . GLU B 1 178 ? 55.422 27.415 3.687   1.00 17.34  ? 154 GLU B OE2   1 
ATOM   3753 N  N     . GLY B 1 179 ? 52.672 32.027 -0.609  1.00 14.08  ? 155 GLY B N     1 
ATOM   3754 C  CA    . GLY B 1 179 ? 53.061 33.379 -0.962  1.00 15.09  ? 155 GLY B CA    1 
ATOM   3755 C  C     . GLY B 1 179 ? 54.386 33.786 -0.333  1.00 14.85  ? 155 GLY B C     1 
ATOM   3756 O  O     . GLY B 1 179 ? 55.142 34.560 -0.908  1.00 14.16  ? 155 GLY B O     1 
ATOM   3757 N  N     . TYR B 1 180 ? 54.653 33.253 0.860   1.00 15.92  ? 156 TYR B N     1 
ATOM   3758 C  CA    . TYR B 1 180 ? 55.942 33.405 1.534   1.00 16.02  ? 156 TYR B CA    1 
ATOM   3759 C  C     . TYR B 1 180 ? 57.166 33.102 0.655   1.00 14.72  ? 156 TYR B C     1 
ATOM   3760 O  O     . TYR B 1 180 ? 58.237 33.641 0.901   1.00 16.55  ? 156 TYR B O     1 
ATOM   3761 C  CB    . TYR B 1 180 ? 56.012 32.483 2.754   1.00 15.35  ? 156 TYR B CB    1 
ATOM   3762 C  CG    . TYR B 1 180 ? 55.193 32.865 3.972   1.00 15.08  ? 156 TYR B CG    1 
ATOM   3763 C  CD1   . TYR B 1 180 ? 55.139 34.184 4.437   1.00 14.32  ? 156 TYR B CD1   1 
ATOM   3764 C  CD2   . TYR B 1 180 ? 54.537 31.874 4.707   1.00 16.29  ? 156 TYR B CD2   1 
ATOM   3765 C  CE1   . TYR B 1 180 ? 54.400 34.513 5.562   1.00 14.79  ? 156 TYR B CE1   1 
ATOM   3766 C  CE2   . TYR B 1 180 ? 53.823 32.180 5.854   1.00 15.42  ? 156 TYR B CE2   1 
ATOM   3767 C  CZ    . TYR B 1 180 ? 53.757 33.495 6.277   1.00 15.08  ? 156 TYR B CZ    1 
ATOM   3768 O  OH    . TYR B 1 180 ? 53.045 33.766 7.421   1.00 15.34  ? 156 TYR B OH    1 
ATOM   3769 N  N     . LEU B 1 181 ? 57.016 32.226 -0.345  1.00 16.62  ? 157 LEU B N     1 
ATOM   3770 C  CA    . LEU B 1 181 ? 58.111 31.907 -1.277  1.00 16.09  ? 157 LEU B CA    1 
ATOM   3771 C  C     . LEU B 1 181 ? 58.586 33.059 -2.166  1.00 15.14  ? 157 LEU B C     1 
ATOM   3772 O  O     . LEU B 1 181 ? 59.641 32.937 -2.782  1.00 16.00  ? 157 LEU B O     1 
ATOM   3773 C  CB    . LEU B 1 181 ? 57.754 30.720 -2.188  1.00 16.68  ? 157 LEU B CB    1 
ATOM   3774 C  CG    . LEU B 1 181 ? 57.643 29.359 -1.535  1.00 15.23  ? 157 LEU B CG    1 
ATOM   3775 C  CD1   . LEU B 1 181 ? 57.178 28.367 -2.580  1.00 16.78  ? 157 LEU B CD1   1 
ATOM   3776 C  CD2   . LEU B 1 181 ? 58.961 28.884 -0.943  1.00 15.95  ? 157 LEU B CD2   1 
ATOM   3777 N  N     . TRP B 1 182 ? 57.829 34.156 -2.237  1.00 14.31  ? 158 TRP B N     1 
ATOM   3778 C  CA    . TRP B 1 182 ? 58.289 35.328 -2.984  1.00 14.78  ? 158 TRP B CA    1 
ATOM   3779 C  C     . TRP B 1 182 ? 59.407 36.106 -2.276  1.00 15.50  ? 158 TRP B C     1 
ATOM   3780 O  O     . TRP B 1 182 ? 60.082 36.908 -2.898  1.00 16.42  ? 158 TRP B O     1 
ATOM   3781 C  CB    . TRP B 1 182 ? 57.112 36.222 -3.443  1.00 16.18  ? 158 TRP B CB    1 
ATOM   3782 C  CG    . TRP B 1 182 ? 56.652 35.909 -4.893  1.00 16.65  ? 158 TRP B CG    1 
ATOM   3783 C  CD1   . TRP B 1 182 ? 56.591 36.786 -5.946  1.00 19.63  ? 158 TRP B CD1   1 
ATOM   3784 C  CD2   . TRP B 1 182 ? 56.218 34.647 -5.400  1.00 18.91  ? 158 TRP B CD2   1 
ATOM   3785 N  NE1   . TRP B 1 182 ? 56.138 36.137 -7.090  1.00 23.28  ? 158 TRP B NE1   1 
ATOM   3786 C  CE2   . TRP B 1 182 ? 55.902 34.826 -6.780  1.00 21.69  ? 158 TRP B CE2   1 
ATOM   3787 C  CE3   . TRP B 1 182 ? 56.051 33.376 -4.829  1.00 18.45  ? 158 TRP B CE3   1 
ATOM   3788 C  CZ2   . TRP B 1 182 ? 55.453 33.770 -7.590  1.00 20.50  ? 158 TRP B CZ2   1 
ATOM   3789 C  CZ3   . TRP B 1 182 ? 55.593 32.329 -5.636  1.00 22.72  ? 158 TRP B CZ3   1 
ATOM   3790 C  CH2   . TRP B 1 182 ? 55.299 32.538 -7.004  1.00 21.44  ? 158 TRP B CH2   1 
ATOM   3791 N  N     . ASP B 1 183 ? 59.609 35.856 -0.977  1.00 15.48  ? 159 ASP B N     1 
ATOM   3792 C  CA    . ASP B 1 183 ? 60.717 36.487 -0.259  1.00 15.65  ? 159 ASP B CA    1 
ATOM   3793 C  C     . ASP B 1 183 ? 62.112 35.964 -0.651  1.00 15.91  ? 159 ASP B C     1 
ATOM   3794 O  O     . ASP B 1 183 ? 62.978 36.770 -0.990  1.00 18.98  ? 159 ASP B O     1 
ATOM   3795 C  CB    . ASP B 1 183 ? 60.491 36.456 1.273   1.00 16.07  ? 159 ASP B CB    1 
ATOM   3796 C  CG    . ASP B 1 183 ? 59.433 37.447 1.716   1.00 17.07  ? 159 ASP B CG    1 
ATOM   3797 O  OD1   . ASP B 1 183 ? 59.423 38.589 1.206   1.00 18.63  ? 159 ASP B OD1   1 
ATOM   3798 O  OD2   . ASP B 1 183 ? 58.603 37.099 2.572   1.00 18.81  ? 159 ASP B OD2   1 
ATOM   3799 N  N     . PRO B 1 184 ? 62.337 34.622 -0.627  1.00 16.72  ? 160 PRO B N     1 
ATOM   3800 C  CA    . PRO B 1 184 ? 63.654 34.152 -1.072  1.00 18.51  ? 160 PRO B CA    1 
ATOM   3801 C  C     . PRO B 1 184 ? 63.794 34.345 -2.579  1.00 19.68  ? 160 PRO B C     1 
ATOM   3802 O  O     . PRO B 1 184 ? 62.781 34.440 -3.260  1.00 19.71  ? 160 PRO B O     1 
ATOM   3803 C  CB    . PRO B 1 184 ? 63.648 32.669 -0.706  1.00 19.26  ? 160 PRO B CB    1 
ATOM   3804 C  CG    . PRO B 1 184 ? 62.214 32.295 -0.621  1.00 18.14  ? 160 PRO B CG    1 
ATOM   3805 C  CD    . PRO B 1 184 ? 61.517 33.509 -0.100  1.00 17.40  ? 160 PRO B CD    1 
ATOM   3806 N  N     . PRO B 1 185 ? 65.035 34.401 -3.090  1.00 20.75  ? 161 PRO B N     1 
ATOM   3807 C  CA    . PRO B 1 185 ? 65.244 34.920 -4.438  1.00 23.62  ? 161 PRO B CA    1 
ATOM   3808 C  C     . PRO B 1 185 ? 64.759 34.051 -5.608  1.00 22.32  ? 161 PRO B C     1 
ATOM   3809 O  O     . PRO B 1 185 ? 64.205 34.595 -6.579  1.00 28.08  ? 161 PRO B O     1 
ATOM   3810 C  CB    . PRO B 1 185 ? 66.769 35.125 -4.497  1.00 25.79  ? 161 PRO B CB    1 
ATOM   3811 C  CG    . PRO B 1 185 ? 67.325 34.146 -3.524  1.00 27.83  ? 161 PRO B CG    1 
ATOM   3812 C  CD    . PRO B 1 185 ? 66.303 34.017 -2.437  1.00 23.08  ? 161 PRO B CD    1 
ATOM   3813 N  N     . ARG B 1 186 ? 64.942 32.735 -5.513  1.00 19.19  ? 162 ARG B N     1 
ATOM   3814 C  CA    A ARG B 1 186 ? 64.772 31.850 -6.671  0.50 20.56  ? 162 ARG B CA    1 
ATOM   3815 C  CA    B ARG B 1 186 ? 64.781 31.836 -6.662  0.50 20.46  ? 162 ARG B CA    1 
ATOM   3816 C  C     . ARG B 1 186 ? 63.617 30.857 -6.550  1.00 19.26  ? 162 ARG B C     1 
ATOM   3817 O  O     . ARG B 1 186 ? 63.325 30.119 -7.494  1.00 21.11  ? 162 ARG B O     1 
ATOM   3818 C  CB    A ARG B 1 186 ? 66.089 31.131 -6.994  0.50 23.54  ? 162 ARG B CB    1 
ATOM   3819 C  CB    B ARG B 1 186 ? 66.084 31.073 -6.927  0.50 22.64  ? 162 ARG B CB    1 
ATOM   3820 C  CG    A ARG B 1 186 ? 67.230 32.075 -7.353  0.50 25.90  ? 162 ARG B CG    1 
ATOM   3821 C  CG    B ARG B 1 186 ? 67.187 31.926 -7.531  0.50 23.05  ? 162 ARG B CG    1 
ATOM   3822 C  CD    A ARG B 1 186 ? 68.406 31.357 -8.001  0.50 27.17  ? 162 ARG B CD    1 
ATOM   3823 C  CD    B ARG B 1 186 ? 68.366 31.078 -7.981  0.50 22.60  ? 162 ARG B CD    1 
ATOM   3824 N  NE    A ARG B 1 186 ? 68.111 30.931 -9.366  0.50 28.26  ? 162 ARG B NE    1 
ATOM   3825 N  NE    B ARG B 1 186 ? 68.813 30.164 -6.934  0.50 21.69  ? 162 ARG B NE    1 
ATOM   3826 C  CZ    A ARG B 1 186 ? 68.151 29.671 -9.789  0.50 26.38  ? 162 ARG B CZ    1 
ATOM   3827 C  CZ    B ARG B 1 186 ? 68.887 28.844 -7.068  0.50 20.99  ? 162 ARG B CZ    1 
ATOM   3828 N  NH1   A ARG B 1 186 ? 68.483 28.691 -8.956  0.50 28.44  ? 162 ARG B NH1   1 
ATOM   3829 N  NH1   B ARG B 1 186 ? 69.303 28.098 -6.051  0.50 22.58  ? 162 ARG B NH1   1 
ATOM   3830 N  NH2   A ARG B 1 186 ? 67.858 29.388 -11.048 0.50 25.87  ? 162 ARG B NH2   1 
ATOM   3831 N  NH2   B ARG B 1 186 ? 68.552 28.265 -8.211  0.50 19.13  ? 162 ARG B NH2   1 
ATOM   3832 N  N     . ALA B 1 187 ? 62.947 30.841 -5.396  1.00 19.16  ? 163 ALA B N     1 
ATOM   3833 C  CA    . ALA B 1 187 ? 61.835 29.924 -5.203  1.00 18.75  ? 163 ALA B CA    1 
ATOM   3834 C  C     . ALA B 1 187 ? 60.717 30.106 -6.254  1.00 19.16  ? 163 ALA B C     1 
ATOM   3835 O  O     . ALA B 1 187 ? 60.127 29.129 -6.708  1.00 21.10  ? 163 ALA B O     1 
ATOM   3836 C  CB    . ALA B 1 187 ? 61.283 30.017 -3.781  1.00 21.37  ? 163 ALA B CB    1 
ATOM   3837 N  N     . LYS B 1 188 ? 60.461 31.351 -6.642  1.00 19.36  ? 164 LYS B N     1 
ATOM   3838 C  CA    . LYS B 1 188 ? 59.409 31.669 -7.600  1.00 18.09  ? 164 LYS B CA    1 
ATOM   3839 C  C     . LYS B 1 188 ? 59.634 30.942 -8.921  1.00 18.66  ? 164 LYS B C     1 
ATOM   3840 O  O     . LYS B 1 188 ? 58.673 30.545 -9.551  1.00 20.86  ? 164 LYS B O     1 
ATOM   3841 C  CB    . LYS B 1 188 ? 59.247 33.190 -7.804  1.00 16.18  ? 164 LYS B CB    1 
ATOM   3842 C  CG    . LYS B 1 188 ? 60.395 33.900 -8.519  1.00 21.16  ? 164 LYS B CG    1 
ATOM   3843 C  CD    . LYS B 1 188 ? 60.073 35.350 -8.858  1.00 21.34  ? 164 LYS B CD    1 
ATOM   3844 C  CE    . LYS B 1 188 ? 59.783 36.146 -7.602  1.00 23.66  ? 164 LYS B CE    1 
ATOM   3845 N  NZ    . LYS B 1 188 ? 59.233 37.502 -7.882  1.00 23.35  ? 164 LYS B NZ    1 
ATOM   3846 N  N     . GLU B 1 189 ? 60.904 30.721 -9.284  1.00 18.68  ? 165 GLU B N     1 
ATOM   3847 C  CA    . GLU B 1 189 ? 61.269 30.001 -10.514 1.00 20.38  ? 165 GLU B CA    1 
ATOM   3848 C  C     . GLU B 1 189 ? 60.888 28.529 -10.406 1.00 20.38  ? 165 GLU B C     1 
ATOM   3849 O  O     . GLU B 1 189 ? 60.400 27.954 -11.365 1.00 21.60  ? 165 GLU B O     1 
ATOM   3850 C  CB    . GLU B 1 189 ? 62.768 30.120 -10.814 1.00 18.22  ? 165 GLU B CB    1 
ATOM   3851 C  CG    . GLU B 1 189 ? 63.319 31.538 -10.829 1.00 18.88  ? 165 GLU B CG    1 
ATOM   3852 C  CD    . GLU B 1 189 ? 64.832 31.550 -10.871 1.00 26.81  ? 165 GLU B CD    1 
ATOM   3853 O  OE1   . GLU B 1 189 ? 65.437 32.428 -10.233 1.00 29.23  ? 165 GLU B OE1   1 
ATOM   3854 O  OE2   . GLU B 1 189 ? 65.423 30.678 -11.545 1.00 32.97  ? 165 GLU B OE2   1 
ATOM   3855 N  N     . ALA B 1 190 ? 61.117 27.921 -9.233  1.00 20.82  ? 166 ALA B N     1 
ATOM   3856 C  CA    . ALA B 1 190 ? 60.627 26.580 -8.972  1.00 19.70  ? 166 ALA B CA    1 
ATOM   3857 C  C     . ALA B 1 190 ? 59.106 26.518 -9.155  1.00 17.97  ? 166 ALA B C     1 
ATOM   3858 O  O     . ALA B 1 190 ? 58.589 25.606 -9.805  1.00 19.12  ? 166 ALA B O     1 
ATOM   3859 C  CB    . ALA B 1 190 ? 61.041 26.102 -7.582  1.00 19.07  ? 166 ALA B CB    1 
ATOM   3860 N  N     . ILE B 1 191 ? 58.402 27.522 -8.637  1.00 17.56  ? 167 ILE B N     1 
ATOM   3861 C  CA    . ILE B 1 191 ? 56.945 27.527 -8.657  1.00 17.69  ? 167 ILE B CA    1 
ATOM   3862 C  C     . ILE B 1 191 ? 56.385 27.637 -10.071 1.00 18.43  ? 167 ILE B C     1 
ATOM   3863 O  O     . ILE B 1 191 ? 55.437 26.911 -10.402 1.00 17.92  ? 167 ILE B O     1 
ATOM   3864 C  CB    . ILE B 1 191 ? 56.357 28.627 -7.762  1.00 16.15  ? 167 ILE B CB    1 
ATOM   3865 C  CG1   . ILE B 1 191 ? 56.626 28.291 -6.288  1.00 16.18  ? 167 ILE B CG1   1 
ATOM   3866 C  CG2   . ILE B 1 191 ? 54.854 28.806 -8.008  1.00 14.18  ? 167 ILE B CG2   1 
ATOM   3867 C  CD1   . ILE B 1 191 ? 56.289 26.871 -5.879  1.00 13.62  ? 167 ILE B CD1   1 
ATOM   3868 N  N     . LEU B 1 192 ? 56.961 28.524 -10.882 1.00 20.18  ? 168 LEU B N     1 
ATOM   3869 C  CA    . LEU B 1 192 ? 56.574 28.612 -12.320 1.00 20.80  ? 168 LEU B CA    1 
ATOM   3870 C  C     . LEU B 1 192 ? 56.801 27.296 -13.054 1.00 20.50  ? 168 LEU B C     1 
ATOM   3871 O  O     . LEU B 1 192 ? 55.975 26.892 -13.890 1.00 20.32  ? 168 LEU B O     1 
ATOM   3872 C  CB    . LEU B 1 192 ? 57.277 29.772 -13.042 1.00 21.17  ? 168 LEU B CB    1 
ATOM   3873 C  CG    . LEU B 1 192 ? 56.869 31.194 -12.628 1.00 23.28  ? 168 LEU B CG    1 
ATOM   3874 C  CD1   . LEU B 1 192 ? 57.619 32.243 -13.441 1.00 26.61  ? 168 LEU B CD1   1 
ATOM   3875 C  CD2   . LEU B 1 192 ? 55.370 31.383 -12.753 1.00 29.05  ? 168 LEU B CD2   1 
ATOM   3876 N  N     . ASP B 1 193 ? 57.896 26.617 -12.714 1.00 18.91  ? 169 ASP B N     1 
ATOM   3877 C  CA    . ASP B 1 193 ? 58.170 25.293 -13.226 1.00 18.73  ? 169 ASP B CA    1 
ATOM   3878 C  C     . ASP B 1 193 ? 57.082 24.299 -12.780 1.00 20.08  ? 169 ASP B C     1 
ATOM   3879 O  O     . ASP B 1 193 ? 56.545 23.549 -13.601 1.00 20.32  ? 169 ASP B O     1 
ATOM   3880 C  CB    . ASP B 1 193 ? 59.582 24.831 -12.844 1.00 19.86  ? 169 ASP B CB    1 
ATOM   3881 C  CG    . ASP B 1 193 ? 60.691 25.507 -13.657 1.00 23.84  ? 169 ASP B CG    1 
ATOM   3882 O  OD1   . ASP B 1 193 ? 60.421 26.130 -14.709 1.00 29.14  ? 169 ASP B OD1   1 
ATOM   3883 O  OD2   . ASP B 1 193 ? 61.865 25.400 -13.245 1.00 23.97  ? 169 ASP B OD2   1 
ATOM   3884 N  N     . CYS B 1 194 ? 56.736 24.323 -11.491 1.00 20.21  ? 170 CYS B N     1 
ATOM   3885 C  CA    . CYS B 1 194 ? 55.633 23.531 -10.962 1.00 19.42  ? 170 CYS B CA    1 
ATOM   3886 C  C     . CYS B 1 194 ? 54.312 23.790 -11.703 1.00 19.79  ? 170 CYS B C     1 
ATOM   3887 O  O     . CYS B 1 194 ? 53.602 22.832 -12.075 1.00 18.15  ? 170 CYS B O     1 
ATOM   3888 C  CB    . CYS B 1 194 ? 55.459 23.808 -9.473  1.00 21.32  ? 170 CYS B CB    1 
ATOM   3889 S  SG    . CYS B 1 194 ? 56.725 23.026 -8.465  1.00 22.32  ? 170 CYS B SG    1 
ATOM   3890 N  N     . ALA B 1 195 ? 54.001 25.069 -11.928 1.00 17.56  ? 171 ALA B N     1 
ATOM   3891 C  CA    . ALA B 1 195 ? 52.731 25.494 -12.533 1.00 19.78  ? 171 ALA B CA    1 
ATOM   3892 C  C     . ALA B 1 195 ? 52.574 24.822 -13.882 1.00 19.07  ? 171 ALA B C     1 
ATOM   3893 O  O     . ALA B 1 195 ? 51.524 24.259 -14.181 1.00 25.95  ? 171 ALA B O     1 
ATOM   3894 C  CB    . ALA B 1 195 ? 52.680 27.005 -12.705 1.00 18.62  ? 171 ALA B CB    1 
ATOM   3895 N  N     . ARG B 1 196 ? 53.665 24.837 -14.641 1.00 20.77  ? 172 ARG B N     1 
ATOM   3896 C  CA    . ARG B 1 196 ? 53.708 24.397 -16.043 1.00 19.94  ? 172 ARG B CA    1 
ATOM   3897 C  C     . ARG B 1 196 ? 53.555 22.888 -16.170 1.00 21.66  ? 172 ARG B C     1 
ATOM   3898 O  O     . ARG B 1 196 ? 52.799 22.399 -17.029 1.00 22.27  ? 172 ARG B O     1 
ATOM   3899 C  CB    . ARG B 1 196 ? 55.017 24.840 -16.683 1.00 23.93  ? 172 ARG B CB    1 
ATOM   3900 C  CG    . ARG B 1 196 ? 55.107 24.597 -18.191 1.00 26.27  ? 172 ARG B CG    1 
ATOM   3901 C  CD    . ARG B 1 196 ? 56.435 25.110 -18.752 1.00 31.04  ? 172 ARG B CD    1 
ATOM   3902 N  NE    . ARG B 1 196 ? 57.594 24.514 -18.083 1.00 35.25  ? 172 ARG B NE    1 
ATOM   3903 C  CZ    . ARG B 1 196 ? 58.365 25.129 -17.183 1.00 30.05  ? 172 ARG B CZ    1 
ATOM   3904 N  NH1   . ARG B 1 196 ? 58.126 26.386 -16.827 1.00 33.80  ? 172 ARG B NH1   1 
ATOM   3905 N  NH2   . ARG B 1 196 ? 59.389 24.483 -16.646 1.00 38.18  ? 172 ARG B NH2   1 
ATOM   3906 N  N     . ILE B 1 197 ? 54.292 22.163 -15.325 1.00 19.89  ? 173 ILE B N     1 
ATOM   3907 C  CA    . ILE B 1 197 ? 54.232 20.709 -15.239 1.00 20.35  ? 173 ILE B CA    1 
ATOM   3908 C  C     . ILE B 1 197 ? 52.834 20.240 -14.793 1.00 19.56  ? 173 ILE B C     1 
ATOM   3909 O  O     . ILE B 1 197 ? 52.247 19.347 -15.409 1.00 22.19  ? 173 ILE B O     1 
ATOM   3910 C  CB    . ILE B 1 197 ? 55.305 20.150 -14.266 1.00 18.97  ? 173 ILE B CB    1 
ATOM   3911 C  CG1   . ILE B 1 197 ? 56.739 20.464 -14.767 1.00 19.27  ? 173 ILE B CG1   1 
ATOM   3912 C  CG2   . ILE B 1 197 ? 55.092 18.653 -14.046 1.00 18.60  ? 173 ILE B CG2   1 
ATOM   3913 C  CD1   . ILE B 1 197 ? 57.844 20.230 -13.745 1.00 17.80  ? 173 ILE B CD1   1 
ATOM   3914 N  N     . ALA B 1 198 ? 52.321 20.843 -13.721 1.00 19.34  ? 174 ALA B N     1 
ATOM   3915 C  CA    . ALA B 1 198 ? 50.989 20.548 -13.178 1.00 18.46  ? 174 ALA B CA    1 
ATOM   3916 C  C     . ALA B 1 198 ? 49.911 20.683 -14.243 1.00 21.28  ? 174 ALA B C     1 
ATOM   3917 O  O     . ALA B 1 198 ? 49.128 19.740 -14.490 1.00 23.20  ? 174 ALA B O     1 
ATOM   3918 C  CB    . ALA B 1 198 ? 50.690 21.463 -12.005 1.00 16.42  ? 174 ALA B CB    1 
ATOM   3919 N  N     . HIS B 1 199 ? 49.893 21.837 -14.900 1.00 21.50  ? 175 HIS B N     1 
ATOM   3920 C  CA    . HIS B 1 199 ? 48.869 22.113 -15.910 1.00 23.07  ? 175 HIS B CA    1 
ATOM   3921 C  C     . HIS B 1 199 ? 49.012 21.256 -17.166 1.00 22.53  ? 175 HIS B C     1 
ATOM   3922 O  O     . HIS B 1 199 ? 48.015 20.803 -17.717 1.00 26.35  ? 175 HIS B O     1 
ATOM   3923 C  CB    . HIS B 1 199 ? 48.804 23.595 -16.231 1.00 26.65  ? 175 HIS B CB    1 
ATOM   3924 C  CG    . HIS B 1 199 ? 48.172 24.409 -15.141 1.00 25.26  ? 175 HIS B CG    1 
ATOM   3925 N  ND1   . HIS B 1 199 ? 48.652 25.639 -14.759 1.00 24.95  ? 175 HIS B ND1   1 
ATOM   3926 C  CD2   . HIS B 1 199 ? 47.110 24.151 -14.336 1.00 28.10  ? 175 HIS B CD2   1 
ATOM   3927 C  CE1   . HIS B 1 199 ? 47.907 26.111 -13.773 1.00 30.30  ? 175 HIS B CE1   1 
ATOM   3928 N  NE2   . HIS B 1 199 ? 46.952 25.237 -13.513 1.00 26.86  ? 175 HIS B NE2   1 
ATOM   3929 N  N     . GLN B 1 200 ? 50.244 21.010 -17.604 1.00 19.61  ? 176 GLN B N     1 
ATOM   3930 C  CA    . GLN B 1 200 ? 50.475 20.048 -18.685 1.00 23.24  ? 176 GLN B CA    1 
ATOM   3931 C  C     . GLN B 1 200 ? 50.023 18.613 -18.356 1.00 24.28  ? 176 GLN B C     1 
ATOM   3932 O  O     . GLN B 1 200 ? 49.737 17.823 -19.264 1.00 27.39  ? 176 GLN B O     1 
ATOM   3933 C  CB    . GLN B 1 200 ? 51.936 20.093 -19.140 1.00 25.32  ? 176 GLN B CB    1 
ATOM   3934 C  CG    . GLN B 1 200 ? 52.270 21.342 -19.952 1.00 31.38  ? 176 GLN B CG    1 
ATOM   3935 C  CD    . GLN B 1 200 ? 53.702 21.368 -20.467 1.00 43.74  ? 176 GLN B CD    1 
ATOM   3936 O  OE1   . GLN B 1 200 ? 54.547 20.544 -20.077 1.00 47.47  ? 176 GLN B OE1   1 
ATOM   3937 N  NE2   . GLN B 1 200 ? 53.984 22.319 -21.351 1.00 46.73  ? 176 GLN B NE2   1 
ATOM   3938 N  N     . HIS B 1 201 ? 49.936 18.286 -17.063 1.00 22.98  ? 177 HIS B N     1 
ATOM   3939 C  CA    . HIS B 1 201 ? 49.466 16.977 -16.622 1.00 19.44  ? 177 HIS B CA    1 
ATOM   3940 C  C     . HIS B 1 201 ? 48.022 17.020 -16.157 1.00 19.26  ? 177 HIS B C     1 
ATOM   3941 O  O     . HIS B 1 201 ? 47.506 16.050 -15.562 1.00 21.47  ? 177 HIS B O     1 
ATOM   3942 C  CB    . HIS B 1 201 ? 50.441 16.409 -15.555 1.00 19.12  ? 177 HIS B CB    1 
ATOM   3943 C  CG    . HIS B 1 201 ? 51.639 15.760 -16.160 1.00 17.58  ? 177 HIS B CG    1 
ATOM   3944 N  ND1   . HIS B 1 201 ? 52.695 16.484 -16.678 1.00 20.58  ? 177 HIS B ND1   1 
ATOM   3945 C  CD2   . HIS B 1 201 ? 51.910 14.457 -16.425 1.00 20.76  ? 177 HIS B CD2   1 
ATOM   3946 C  CE1   . HIS B 1 201 ? 53.572 15.654 -17.221 1.00 23.16  ? 177 HIS B CE1   1 
ATOM   3947 N  NE2   . HIS B 1 201 ? 53.126 14.420 -17.064 1.00 26.36  ? 177 HIS B NE2   1 
ATOM   3948 N  N     . GLY B 1 202 ? 47.375 18.152 -16.459 1.00 20.43  ? 178 GLY B N     1 
ATOM   3949 C  CA    . GLY B 1 202 ? 45.981 18.415 -16.077 1.00 24.10  ? 178 GLY B CA    1 
ATOM   3950 C  C     . GLY B 1 202 ? 45.647 18.514 -14.590 1.00 21.88  ? 178 GLY B C     1 
ATOM   3951 O  O     . GLY B 1 202 ? 44.494 18.327 -14.191 1.00 23.49  ? 178 GLY B O     1 
ATOM   3952 N  N     . ARG B 1 203 ? 46.645 18.820 -13.765 1.00 18.45  ? 179 ARG B N     1 
ATOM   3953 C  CA    . ARG B 1 203 ? 46.449 18.921 -12.312 1.00 14.97  ? 179 ARG B CA    1 
ATOM   3954 C  C     . ARG B 1 203 ? 46.086 20.374 -12.038 1.00 16.14  ? 179 ARG B C     1 
ATOM   3955 O  O     . ARG B 1 203 ? 46.033 21.198 -12.968 1.00 17.77  ? 179 ARG B O     1 
ATOM   3956 C  CB    . ARG B 1 203 ? 47.758 18.604 -11.587 1.00 14.91  ? 179 ARG B CB    1 
ATOM   3957 C  CG    . ARG B 1 203 ? 48.479 17.357 -12.073 1.00 19.54  ? 179 ARG B CG    1 
ATOM   3958 C  CD    . ARG B 1 203 ? 47.561 16.133 -12.022 1.00 22.13  ? 179 ARG B CD    1 
ATOM   3959 N  NE    . ARG B 1 203 ? 48.243 14.883 -12.369 1.00 22.27  ? 179 ARG B NE    1 
ATOM   3960 C  CZ    . ARG B 1 203 ? 47.649 13.702 -12.501 1.00 27.52  ? 179 ARG B CZ    1 
ATOM   3961 N  NH1   . ARG B 1 203 ? 48.373 12.637 -12.828 1.00 31.29  ? 179 ARG B NH1   1 
ATOM   3962 N  NH2   . ARG B 1 203 ? 46.333 13.576 -12.315 1.00 38.86  ? 179 ARG B NH2   1 
ATOM   3963 N  N     . GLU B 1 204 ? 45.850 20.707 -10.776 1.00 17.57  ? 180 GLU B N     1 
ATOM   3964 C  CA    . GLU B 1 204 ? 45.595 22.095 -10.415 1.00 15.19  ? 180 GLU B CA    1 
ATOM   3965 C  C     . GLU B 1 204 ? 46.652 22.636 -9.428  1.00 16.27  ? 180 GLU B C     1 
ATOM   3966 O  O     . GLU B 1 204 ? 47.354 21.878 -8.763  1.00 17.15  ? 180 GLU B O     1 
ATOM   3967 C  CB    . GLU B 1 204 ? 44.195 22.260 -9.851  1.00 19.02  ? 180 GLU B CB    1 
ATOM   3968 C  CG    . GLU B 1 204 ? 43.053 22.027 -10.835 1.00 25.24  ? 180 GLU B CG    1 
ATOM   3969 C  CD    . GLU B 1 204 ? 41.715 21.848 -10.148 1.00 32.13  ? 180 GLU B CD    1 
ATOM   3970 O  OE1   . GLU B 1 204 ? 40.814 22.689 -10.348 1.00 40.20  ? 180 GLU B OE1   1 
ATOM   3971 O  OE2   . GLU B 1 204 ? 41.551 20.855 -9.416  1.00 39.36  ? 180 GLU B OE2   1 
HETATM 3972 N  N     . MSE B 1 205 ? 46.766 23.952 -9.413  1.00 16.89  ? 181 MSE B N     1 
HETATM 3973 C  CA    . MSE B 1 205 ? 47.739 24.685 -8.658  1.00 18.07  ? 181 MSE B CA    1 
HETATM 3974 C  C     . MSE B 1 205 ? 46.991 25.486 -7.647  1.00 17.63  ? 181 MSE B C     1 
HETATM 3975 O  O     . MSE B 1 205 ? 45.927 26.052 -7.937  1.00 16.23  ? 181 MSE B O     1 
HETATM 3976 C  CB    . MSE B 1 205 ? 48.457 25.656 -9.592  1.00 21.57  ? 181 MSE B CB    1 
HETATM 3977 C  CG    . MSE B 1 205 ? 49.397 24.974 -10.587 1.00 25.40  ? 181 MSE B CG    1 
HETATM 3978 SE SE    . MSE B 1 205 ? 50.917 24.173 -9.610  1.00 38.09  ? 181 MSE B SE    1 
HETATM 3979 C  CE    . MSE B 1 205 ? 51.602 25.854 -8.843  1.00 27.92  ? 181 MSE B CE    1 
ATOM   3980 N  N     . SER B 1 206 ? 47.551 25.568 -6.439  1.00 19.53  ? 182 SER B N     1 
ATOM   3981 C  CA    . SER B 1 206 ? 46.920 26.288 -5.362  1.00 16.50  ? 182 SER B CA    1 
ATOM   3982 C  C     . SER B 1 206 ? 47.957 27.134 -4.629  1.00 16.31  ? 182 SER B C     1 
ATOM   3983 O  O     . SER B 1 206 ? 49.133 26.774 -4.578  1.00 16.97  ? 182 SER B O     1 
ATOM   3984 C  CB    . SER B 1 206 ? 46.229 25.325 -4.396  1.00 16.16  ? 182 SER B CB    1 
ATOM   3985 O  OG    . SER B 1 206 ? 45.577 26.057 -3.371  1.00 14.15  ? 182 SER B OG    1 
HETATM 3986 N  N     . MSE B 1 207 ? 47.524 28.272 -4.093  1.00 15.49  ? 183 MSE B N     1 
HETATM 3987 C  CA    . MSE B 1 207 ? 48.402 29.115 -3.288  1.00 18.59  ? 183 MSE B CA    1 
HETATM 3988 C  C     . MSE B 1 207 ? 47.699 29.678 -2.081  1.00 17.46  ? 183 MSE B C     1 
HETATM 3989 O  O     . MSE B 1 207 ? 46.476 29.839 -2.050  1.00 14.81  ? 183 MSE B O     1 
HETATM 3990 C  CB    . MSE B 1 207 ? 49.051 30.215 -4.123  1.00 20.86  ? 183 MSE B CB    1 
HETATM 3991 C  CG    . MSE B 1 207 ? 48.234 31.486 -4.158  1.00 25.51  ? 183 MSE B CG    1 
HETATM 3992 SE SE    . MSE B 1 207 ? 49.323 32.856 -5.037  1.00 39.29  ? 183 MSE B SE    1 
HETATM 3993 C  CE    . MSE B 1 207 ? 50.618 33.069 -3.562  1.00 33.76  ? 183 MSE B CE    1 
ATOM   3994 N  N     . THR B 1 208 ? 48.481 29.946 -1.043  1.00 16.14  ? 184 THR B N     1 
ATOM   3995 C  CA    . THR B 1 208 ? 47.981 30.775 -0.007  1.00 15.46  ? 184 THR B CA    1 
ATOM   3996 C  C     . THR B 1 208 ? 48.642 32.141 -0.077  1.00 12.92  ? 184 THR B C     1 
ATOM   3997 O  O     . THR B 1 208 ? 49.823 32.256 -0.412  1.00 13.64  ? 184 THR B O     1 
ATOM   3998 C  CB    . THR B 1 208 ? 48.242 30.155 1.376   1.00 15.49  ? 184 THR B CB    1 
ATOM   3999 O  OG1   . THR B 1 208 ? 47.835 31.103 2.347   1.00 15.57  ? 184 THR B OG1   1 
ATOM   4000 C  CG2   . THR B 1 208 ? 49.737 29.753 1.534   1.00 13.38  ? 184 THR B CG2   1 
ATOM   4001 N  N     . LEU B 1 209 ? 47.882 33.177 0.269   1.00 15.21  ? 185 LEU B N     1 
ATOM   4002 C  CA    . LEU B 1 209 ? 48.404 34.538 0.349   1.00 13.78  ? 185 LEU B CA    1 
ATOM   4003 C  C     . LEU B 1 209 ? 49.346 34.751 1.574   1.00 14.06  ? 185 LEU B C     1 
ATOM   4004 O  O     . LEU B 1 209 ? 50.070 35.745 1.635   1.00 14.58  ? 185 LEU B O     1 
ATOM   4005 C  CB    . LEU B 1 209 ? 47.235 35.513 0.410   1.00 14.40  ? 185 LEU B CB    1 
ATOM   4006 C  CG    . LEU B 1 209 ? 46.315 35.497 -0.829  1.00 14.84  ? 185 LEU B CG    1 
ATOM   4007 C  CD1   . LEU B 1 209 ? 45.207 36.526 -0.701  1.00 16.43  ? 185 LEU B CD1   1 
ATOM   4008 C  CD2   . LEU B 1 209 ? 47.128 35.672 -2.099  1.00 17.65  ? 185 LEU B CD2   1 
ATOM   4009 N  N     . SER B 1 210 ? 49.284 33.828 2.528   1.00 14.98  ? 186 SER B N     1 
ATOM   4010 C  CA    . SER B 1 210 ? 50.273 33.685 3.639   1.00 13.88  ? 186 SER B CA    1 
ATOM   4011 C  C     . SER B 1 210 ? 50.189 34.711 4.772   1.00 15.12  ? 186 SER B C     1 
ATOM   4012 O  O     . SER B 1 210 ? 50.096 34.330 5.945   1.00 18.46  ? 186 SER B O     1 
ATOM   4013 C  CB    . SER B 1 210 ? 51.730 33.637 3.106   1.00 13.54  ? 186 SER B CB    1 
ATOM   4014 O  OG    . SER B 1 210 ? 51.968 32.506 2.278   1.00 17.61  ? 186 SER B OG    1 
ATOM   4015 N  N     . ASP B 1 211 ? 50.236 35.995 4.438   1.00 14.88  ? 187 ASP B N     1 
ATOM   4016 C  CA    . ASP B 1 211 ? 50.384 37.071 5.431   1.00 15.94  ? 187 ASP B CA    1 
ATOM   4017 C  C     . ASP B 1 211 ? 50.059 38.416 4.766   1.00 16.28  ? 187 ASP B C     1 
ATOM   4018 O  O     . ASP B 1 211 ? 50.440 38.635 3.613   1.00 18.22  ? 187 ASP B O     1 
ATOM   4019 C  CB    . ASP B 1 211 ? 51.820 37.041 5.996   1.00 18.25  ? 187 ASP B CB    1 
ATOM   4020 C  CG    . ASP B 1 211 ? 52.125 38.210 6.919   1.00 19.28  ? 187 ASP B CG    1 
ATOM   4021 O  OD1   . ASP B 1 211 ? 52.506 39.280 6.416   1.00 19.74  ? 187 ASP B OD1   1 
ATOM   4022 O  OD2   . ASP B 1 211 ? 52.013 38.042 8.152   1.00 24.18  ? 187 ASP B OD2   1 
ATOM   4023 N  N     . SER B 1 212 ? 49.356 39.309 5.467   1.00 16.24  ? 188 SER B N     1 
ATOM   4024 C  CA    . SER B 1 212 ? 48.921 40.612 4.866   1.00 17.01  ? 188 SER B CA    1 
ATOM   4025 C  C     . SER B 1 212 ? 50.071 41.520 4.385   1.00 16.54  ? 188 SER B C     1 
ATOM   4026 O  O     . SER B 1 212 ? 49.926 42.283 3.417   1.00 18.80  ? 188 SER B O     1 
ATOM   4027 C  CB    . SER B 1 212 ? 48.016 41.392 5.823   1.00 19.21  ? 188 SER B CB    1 
ATOM   4028 O  OG    . SER B 1 212 ? 48.605 41.539 7.121   1.00 20.13  ? 188 SER B OG    1 
ATOM   4029 N  N     . PHE B 1 213 ? 51.208 41.452 5.068   1.00 14.94  ? 189 PHE B N     1 
ATOM   4030 C  CA    . PHE B 1 213 ? 52.390 42.197 4.652   1.00 16.47  ? 189 PHE B CA    1 
ATOM   4031 C  C     . PHE B 1 213 ? 53.076 41.534 3.477   1.00 16.91  ? 189 PHE B C     1 
ATOM   4032 O  O     . PHE B 1 213 ? 53.556 42.218 2.538   1.00 18.01  ? 189 PHE B O     1 
ATOM   4033 C  CB    . PHE B 1 213 ? 53.341 42.382 5.833   1.00 16.60  ? 189 PHE B CB    1 
ATOM   4034 C  CG    . PHE B 1 213 ? 52.723 43.138 6.961   1.00 17.90  ? 189 PHE B CG    1 
ATOM   4035 C  CD1   . PHE B 1 213 ? 51.965 42.477 7.919   1.00 17.87  ? 189 PHE B CD1   1 
ATOM   4036 C  CD2   . PHE B 1 213 ? 52.865 44.519 7.044   1.00 20.45  ? 189 PHE B CD2   1 
ATOM   4037 C  CE1   . PHE B 1 213 ? 51.392 43.177 8.979   1.00 18.53  ? 189 PHE B CE1   1 
ATOM   4038 C  CE2   . PHE B 1 213 ? 52.276 45.220 8.077   1.00 20.65  ? 189 PHE B CE2   1 
ATOM   4039 C  CZ    . PHE B 1 213 ? 51.535 44.547 9.047   1.00 19.04  ? 189 PHE B CZ    1 
ATOM   4040 N  N     . CYS B 1 214 ? 53.096 40.205 3.501   1.00 15.24  ? 190 CYS B N     1 
ATOM   4041 C  CA    . CYS B 1 214 ? 53.582 39.443 2.352   1.00 14.15  ? 190 CYS B CA    1 
ATOM   4042 C  C     . CYS B 1 214 ? 52.772 39.877 1.139   1.00 12.33  ? 190 CYS B C     1 
ATOM   4043 O  O     . CYS B 1 214 ? 53.345 40.144 0.083   1.00 14.95  ? 190 CYS B O     1 
ATOM   4044 C  CB    . CYS B 1 214 ? 53.395 37.944 2.518   1.00 14.12  ? 190 CYS B CB    1 
ATOM   4045 S  SG    . CYS B 1 214 ? 54.195 36.982 1.221   1.00 17.29  ? 190 CYS B SG    1 
ATOM   4046 N  N     . VAL B 1 215 ? 51.463 39.988 1.310   1.00 12.97  ? 191 VAL B N     1 
ATOM   4047 C  CA    . VAL B 1 215 ? 50.586 40.465 0.182   1.00 13.30  ? 191 VAL B CA    1 
ATOM   4048 C  C     . VAL B 1 215 ? 50.966 41.865 -0.267  1.00 15.28  ? 191 VAL B C     1 
ATOM   4049 O  O     . VAL B 1 215 ? 51.035 42.143 -1.476  1.00 16.87  ? 191 VAL B O     1 
ATOM   4050 C  CB    . VAL B 1 215 ? 49.074 40.422 0.545   1.00 11.81  ? 191 VAL B CB    1 
ATOM   4051 C  CG1   . VAL B 1 215 ? 48.187 41.108 -0.538  1.00 12.23  ? 191 VAL B CG1   1 
ATOM   4052 C  CG2   . VAL B 1 215 ? 48.626 38.996 0.766   1.00 16.80  ? 191 VAL B CG2   1 
ATOM   4053 N  N     . ASP B 1 216 ? 51.205 42.751 0.698   1.00 15.66  ? 192 ASP B N     1 
ATOM   4054 C  CA    . ASP B 1 216 ? 51.642 44.139 0.491   1.00 16.92  ? 192 ASP B CA    1 
ATOM   4055 C  C     . ASP B 1 216 ? 52.874 44.126 -0.410  1.00 18.32  ? 192 ASP B C     1 
ATOM   4056 O  O     . ASP B 1 216 ? 52.971 44.919 -1.351  1.00 19.81  ? 192 ASP B O     1 
ATOM   4057 C  CB    . ASP B 1 216 ? 52.045 44.802 1.841   1.00 22.39  ? 192 ASP B CB    1 
ATOM   4058 C  CG    . ASP B 1 216 ? 50.875 45.415 2.641   1.00 25.60  ? 192 ASP B CG    1 
ATOM   4059 O  OD1   . ASP B 1 216 ? 49.762 45.556 2.121   1.00 26.58  ? 192 ASP B OD1   1 
ATOM   4060 O  OD2   . ASP B 1 216 ? 51.083 45.798 3.850   1.00 26.03  ? 192 ASP B OD2   1 
ATOM   4061 N  N     . ARG B 1 217 ? 53.819 43.231 -0.104  1.00 14.82  ? 193 ARG B N     1 
ATOM   4062 C  CA    . ARG B 1 217 ? 55.107 43.174 -0.806  1.00 14.84  ? 193 ARG B CA    1 
ATOM   4063 C  C     . ARG B 1 217 ? 54.944 42.646 -2.239  1.00 15.36  ? 193 ARG B C     1 
ATOM   4064 O  O     . ARG B 1 217 ? 55.676 43.063 -3.148  1.00 18.52  ? 193 ARG B O     1 
ATOM   4065 C  CB    . ARG B 1 217 ? 56.127 42.298 -0.041  1.00 14.04  ? 193 ARG B CB    1 
ATOM   4066 C  CG    . ARG B 1 217 ? 56.570 42.875 1.297   1.00 16.00  ? 193 ARG B CG    1 
ATOM   4067 C  CD    . ARG B 1 217 ? 57.801 42.155 1.849   1.00 14.45  ? 193 ARG B CD    1 
ATOM   4068 N  NE    . ARG B 1 217 ? 57.609 40.757 2.241   1.00 16.41  ? 193 ARG B NE    1 
ATOM   4069 C  CZ    . ARG B 1 217 ? 56.967 40.351 3.345   1.00 17.23  ? 193 ARG B CZ    1 
ATOM   4070 N  NH1   . ARG B 1 217 ? 56.359 41.228 4.138   1.00 15.32  ? 193 ARG B NH1   1 
ATOM   4071 N  NH2   . ARG B 1 217 ? 56.893 39.056 3.632   1.00 21.24  ? 193 ARG B NH2   1 
ATOM   4072 N  N     . TYR B 1 218 ? 53.992 41.739 -2.437  1.00 15.14  ? 194 TYR B N     1 
ATOM   4073 C  CA    . TYR B 1 218 ? 53.919 41.012 -3.739  1.00 14.95  ? 194 TYR B CA    1 
ATOM   4074 C  C     . TYR B 1 218 ? 52.551 41.056 -4.433  1.00 15.63  ? 194 TYR B C     1 
ATOM   4075 O  O     . TYR B 1 218 ? 52.230 40.188 -5.273  1.00 17.09  ? 194 TYR B O     1 
ATOM   4076 C  CB    . TYR B 1 218 ? 54.432 39.561 -3.592  1.00 12.56  ? 194 TYR B CB    1 
ATOM   4077 C  CG    . TYR B 1 218 ? 55.800 39.522 -3.009  1.00 14.43  ? 194 TYR B CG    1 
ATOM   4078 C  CD1   . TYR B 1 218 ? 56.916 39.950 -3.728  1.00 15.20  ? 194 TYR B CD1   1 
ATOM   4079 C  CD2   . TYR B 1 218 ? 55.983 39.115 -1.674  1.00 15.83  ? 194 TYR B CD2   1 
ATOM   4080 C  CE1   . TYR B 1 218 ? 58.184 39.945 -3.140  1.00 16.80  ? 194 TYR B CE1   1 
ATOM   4081 C  CE2   . TYR B 1 218 ? 57.237 39.089 -1.107  1.00 16.97  ? 194 TYR B CE2   1 
ATOM   4082 C  CZ    . TYR B 1 218 ? 58.334 39.497 -1.832  1.00 18.48  ? 194 TYR B CZ    1 
ATOM   4083 O  OH    . TYR B 1 218 ? 59.584 39.492 -1.223  1.00 20.39  ? 194 TYR B OH    1 
ATOM   4084 N  N     . ARG B 1 219 ? 51.771 42.070 -4.095  1.00 15.60  ? 195 ARG B N     1 
ATOM   4085 C  CA    . ARG B 1 219 ? 50.387 42.218 -4.560  1.00 18.90  ? 195 ARG B CA    1 
ATOM   4086 C  C     . ARG B 1 219 ? 50.199 42.003 -6.088  1.00 19.97  ? 195 ARG B C     1 
ATOM   4087 O  O     . ARG B 1 219 ? 49.365 41.184 -6.518  1.00 19.05  ? 195 ARG B O     1 
ATOM   4088 C  CB    . ARG B 1 219 ? 49.877 43.603 -4.148  1.00 19.15  ? 195 ARG B CB    1 
ATOM   4089 C  CG    . ARG B 1 219 ? 48.395 43.831 -4.371  1.00 21.88  ? 195 ARG B CG    1 
ATOM   4090 C  CD    . ARG B 1 219 ? 47.952 45.176 -3.811  1.00 22.91  ? 195 ARG B CD    1 
ATOM   4091 N  NE    . ARG B 1 219 ? 47.877 45.134 -2.360  1.00 22.44  ? 195 ARG B NE    1 
ATOM   4092 C  CZ    . ARG B 1 219 ? 48.741 45.724 -1.538  1.00 23.53  ? 195 ARG B CZ    1 
ATOM   4093 N  NH1   . ARG B 1 219 ? 48.578 45.614 -0.227  1.00 24.71  ? 195 ARG B NH1   1 
ATOM   4094 N  NH2   . ARG B 1 219 ? 49.762 46.418 -2.020  1.00 21.74  ? 195 ARG B NH2   1 
ATOM   4095 N  N     . GLY B 1 220 ? 50.967 42.742 -6.888  1.00 20.34  ? 196 GLY B N     1 
ATOM   4096 C  CA    . GLY B 1 220 ? 50.883 42.657 -8.360  1.00 19.99  ? 196 GLY B CA    1 
ATOM   4097 C  C     . GLY B 1 220 ? 51.199 41.265 -8.872  1.00 19.51  ? 196 GLY B C     1 
ATOM   4098 O  O     . GLY B 1 220 ? 50.541 40.765 -9.789  1.00 18.80  ? 196 GLY B O     1 
ATOM   4099 N  N     . GLU B 1 221 ? 52.184 40.618 -8.250  1.00 16.95  ? 197 GLU B N     1 
ATOM   4100 C  CA    . GLU B 1 221 ? 52.651 39.332 -8.703  1.00 18.02  ? 197 GLU B CA    1 
ATOM   4101 C  C     . GLU B 1 221 ? 51.635 38.238 -8.385  1.00 18.22  ? 197 GLU B C     1 
ATOM   4102 O  O     . GLU B 1 221 ? 51.412 37.331 -9.193  1.00 17.18  ? 197 GLU B O     1 
ATOM   4103 C  CB    . GLU B 1 221 ? 54.006 39.000 -8.086  1.00 19.12  ? 197 GLU B CB    1 
ATOM   4104 C  CG    . GLU B 1 221 ? 55.154 39.808 -8.658  1.00 21.90  ? 197 GLU B CG    1 
ATOM   4105 C  CD    . GLU B 1 221 ? 55.510 41.015 -7.807  1.00 24.66  ? 197 GLU B CD    1 
ATOM   4106 O  OE1   . GLU B 1 221 ? 54.672 41.476 -6.991  1.00 24.72  ? 197 GLU B OE1   1 
ATOM   4107 O  OE2   . GLU B 1 221 ? 56.645 41.515 -7.970  1.00 31.86  ? 197 GLU B OE2   1 
ATOM   4108 N  N     . PHE B 1 222 ? 51.040 38.319 -7.198  1.00 18.63  ? 198 PHE B N     1 
ATOM   4109 C  CA    . PHE B 1 222 ? 50.017 37.369 -6.778  1.00 17.21  ? 198 PHE B CA    1 
ATOM   4110 C  C     . PHE B 1 222 ? 48.782 37.450 -7.674  1.00 14.54  ? 198 PHE B C     1 
ATOM   4111 O  O     . PHE B 1 222 ? 48.267 36.421 -8.131  1.00 16.72  ? 198 PHE B O     1 
ATOM   4112 C  CB    . PHE B 1 222 ? 49.624 37.611 -5.326  1.00 17.59  ? 198 PHE B CB    1 
ATOM   4113 C  CG    . PHE B 1 222 ? 50.694 37.235 -4.313  1.00 18.09  ? 198 PHE B CG    1 
ATOM   4114 C  CD1   . PHE B 1 222 ? 51.857 36.557 -4.688  1.00 18.57  ? 198 PHE B CD1   1 
ATOM   4115 C  CD2   . PHE B 1 222 ? 50.499 37.521 -2.968  1.00 18.79  ? 198 PHE B CD2   1 
ATOM   4116 C  CE1   . PHE B 1 222 ? 52.817 36.195 -3.748  1.00 19.28  ? 198 PHE B CE1   1 
ATOM   4117 C  CE2   . PHE B 1 222 ? 51.461 37.173 -2.014  1.00 18.12  ? 198 PHE B CE2   1 
ATOM   4118 C  CZ    . PHE B 1 222 ? 52.615 36.510 -2.408  1.00 18.32  ? 198 PHE B CZ    1 
ATOM   4119 N  N     . LEU B 1 223 ? 48.318 38.669 -7.924  1.00 14.33  ? 199 LEU B N     1 
ATOM   4120 C  CA    . LEU B 1 223 ? 47.189 38.912 -8.832  1.00 15.38  ? 199 LEU B CA    1 
ATOM   4121 C  C     . LEU B 1 223 ? 47.462 38.354 -10.230 1.00 16.80  ? 199 LEU B C     1 
ATOM   4122 O  O     . LEU B 1 223 ? 46.581 37.747 -10.830 1.00 20.01  ? 199 LEU B O     1 
ATOM   4123 C  CB    . LEU B 1 223 ? 46.852 40.415 -8.887  1.00 17.59  ? 199 LEU B CB    1 
ATOM   4124 C  CG    . LEU B 1 223 ? 46.141 41.002 -7.658  1.00 19.97  ? 199 LEU B CG    1 
ATOM   4125 C  CD1   . LEU B 1 223 ? 46.140 42.523 -7.664  1.00 24.04  ? 199 LEU B CD1   1 
ATOM   4126 C  CD2   . LEU B 1 223 ? 44.732 40.462 -7.459  1.00 22.48  ? 199 LEU B CD2   1 
ATOM   4127 N  N     . ASP B 1 224 ? 48.688 38.543 -10.718 1.00 16.90  ? 200 ASP B N     1 
ATOM   4128 C  CA    . ASP B 1 224 ? 49.122 38.020 -12.020 1.00 19.23  ? 200 ASP B CA    1 
ATOM   4129 C  C     . ASP B 1 224 ? 49.058 36.495 -12.093 1.00 18.29  ? 200 ASP B C     1 
ATOM   4130 O  O     . ASP B 1 224 ? 48.600 35.936 -13.103 1.00 22.05  ? 200 ASP B O     1 
ATOM   4131 C  CB    . ASP B 1 224 ? 50.535 38.512 -12.353 1.00 23.71  ? 200 ASP B CB    1 
ATOM   4132 C  CG    . ASP B 1 224 ? 51.083 37.921 -13.641 1.00 28.61  ? 200 ASP B CG    1 
ATOM   4133 O  OD1   . ASP B 1 224 ? 50.441 38.084 -14.705 1.00 31.24  ? 200 ASP B OD1   1 
ATOM   4134 O  OD2   . ASP B 1 224 ? 52.175 37.305 -13.600 1.00 34.51  ? 200 ASP B OD2   1 
ATOM   4135 N  N     . LEU B 1 225 ? 49.504 35.827 -11.030 1.00 18.63  ? 201 LEU B N     1 
ATOM   4136 C  CA    . LEU B 1 225 ? 49.428 34.380 -10.913 1.00 17.46  ? 201 LEU B CA    1 
ATOM   4137 C  C     . LEU B 1 225 ? 47.982 33.886 -11.044 1.00 17.56  ? 201 LEU B C     1 
ATOM   4138 O  O     . LEU B 1 225 ? 47.710 32.889 -11.750 1.00 21.04  ? 201 LEU B O     1 
ATOM   4139 C  CB    . LEU B 1 225 ? 50.013 33.937 -9.551  1.00 16.91  ? 201 LEU B CB    1 
ATOM   4140 C  CG    . LEU B 1 225 ? 51.532 33.884 -9.344  1.00 18.79  ? 201 LEU B CG    1 
ATOM   4141 C  CD1   . LEU B 1 225 ? 51.782 33.605 -7.868  1.00 23.15  ? 201 LEU B CD1   1 
ATOM   4142 C  CD2   . LEU B 1 225 ? 52.211 32.825 -10.194 1.00 23.14  ? 201 LEU B CD2   1 
HETATM 4143 N  N     . MSE B 1 226 ? 47.061 34.602 -10.395 1.00 16.58  ? 202 MSE B N     1 
HETATM 4144 C  CA    . MSE B 1 226 ? 45.647 34.235 -10.368 1.00 18.43  ? 202 MSE B CA    1 
HETATM 4145 C  C     . MSE B 1 226 ? 45.039 34.479 -11.729 1.00 18.57  ? 202 MSE B C     1 
HETATM 4146 O  O     . MSE B 1 226 ? 44.418 33.581 -12.317 1.00 20.81  ? 202 MSE B O     1 
HETATM 4147 C  CB    . MSE B 1 226 ? 44.932 35.078 -9.320  1.00 22.03  ? 202 MSE B CB    1 
HETATM 4148 C  CG    . MSE B 1 226 ? 45.180 34.490 -7.931  1.00 28.27  ? 202 MSE B CG    1 
HETATM 4149 SE SE    . MSE B 1 226 ? 44.831 35.866 -6.561  1.00 52.35  ? 202 MSE B SE    1 
HETATM 4150 C  CE    . MSE B 1 226 ? 42.914 35.585 -6.239  1.00 44.08  ? 202 MSE B CE    1 
ATOM   4151 N  N     . ARG B 1 227 ? 45.231 35.687 -12.234 1.00 19.51  ? 203 ARG B N     1 
ATOM   4152 C  CA    . ARG B 1 227 ? 44.618 36.106 -13.519 1.00 18.63  ? 203 ARG B CA    1 
ATOM   4153 C  C     . ARG B 1 227 ? 45.134 35.366 -14.778 1.00 21.42  ? 203 ARG B C     1 
ATOM   4154 O  O     . ARG B 1 227 ? 44.371 35.167 -15.724 1.00 24.67  ? 203 ARG B O     1 
ATOM   4155 C  CB    . ARG B 1 227 ? 44.651 37.630 -13.682 1.00 16.67  ? 203 ARG B CB    1 
ATOM   4156 C  CG    . ARG B 1 227 ? 43.892 38.367 -12.563 1.00 15.31  ? 203 ARG B CG    1 
ATOM   4157 C  CD    . ARG B 1 227 ? 44.075 39.872 -12.613 1.00 16.28  ? 203 ARG B CD    1 
ATOM   4158 N  NE    . ARG B 1 227 ? 43.259 40.547 -11.608 1.00 21.38  ? 203 ARG B NE    1 
ATOM   4159 C  CZ    . ARG B 1 227 ? 43.431 41.804 -11.215 1.00 19.72  ? 203 ARG B CZ    1 
ATOM   4160 N  NH1   . ARG B 1 227 ? 44.381 42.553 -11.755 1.00 23.36  ? 203 ARG B NH1   1 
ATOM   4161 N  NH2   . ARG B 1 227 ? 42.634 42.325 -10.289 1.00 19.15  ? 203 ARG B NH2   1 
ATOM   4162 N  N     . SER B 1 228 ? 46.400 34.945 -14.779 1.00 21.36  ? 204 SER B N     1 
ATOM   4163 C  CA    . SER B 1 228 ? 46.995 34.174 -15.914 1.00 21.67  ? 204 SER B CA    1 
ATOM   4164 C  C     . SER B 1 228 ? 46.620 32.671 -15.979 1.00 22.71  ? 204 SER B C     1 
ATOM   4165 O  O     . SER B 1 228 ? 46.830 31.983 -17.021 1.00 23.93  ? 204 SER B O     1 
ATOM   4166 C  CB    . SER B 1 228 ? 48.511 34.316 -15.902 1.00 25.11  ? 204 SER B CB    1 
ATOM   4167 O  OG    . SER B 1 228 ? 49.058 33.740 -14.720 1.00 25.27  ? 204 SER B OG    1 
ATOM   4168 N  N     . GLY B 1 229 ? 46.027 32.183 -14.894 1.00 21.88  ? 205 GLY B N     1 
ATOM   4169 C  CA    . GLY B 1 229 ? 45.632 30.783 -14.767 1.00 22.30  ? 205 GLY B CA    1 
ATOM   4170 C  C     . GLY B 1 229 ? 46.708 29.882 -14.190 1.00 25.82  ? 205 GLY B C     1 
ATOM   4171 O  O     . GLY B 1 229 ? 46.537 28.676 -14.175 1.00 27.93  ? 205 GLY B O     1 
ATOM   4172 N  N     . LYS B 1 230 ? 47.806 30.461 -13.706 1.00 26.44  ? 206 LYS B N     1 
ATOM   4173 C  CA    . LYS B 1 230 ? 48.870 29.694 -13.036 1.00 24.54  ? 206 LYS B CA    1 
ATOM   4174 C  C     . LYS B 1 230 ? 48.474 29.247 -11.629 1.00 22.73  ? 206 LYS B C     1 
ATOM   4175 O  O     . LYS B 1 230 ? 49.018 28.265 -11.102 1.00 24.06  ? 206 LYS B O     1 
ATOM   4176 C  CB    . LYS B 1 230 ? 50.196 30.467 -13.022 1.00 25.79  ? 206 LYS B CB    1 
ATOM   4177 C  CG    . LYS B 1 230 ? 50.717 30.813 -14.414 1.00 28.58  ? 206 LYS B CG    1 
ATOM   4178 C  CD    . LYS B 1 230 ? 51.957 31.692 -14.355 1.00 31.63  ? 206 LYS B CD    1 
ATOM   4179 C  CE    . LYS B 1 230 ? 52.482 32.006 -15.745 1.00 32.33  ? 206 LYS B CE    1 
ATOM   4180 N  NZ    . LYS B 1 230 ? 51.619 32.994 -16.459 1.00 29.73  ? 206 LYS B NZ    1 
ATOM   4181 N  N     . VAL B 1 231 ? 47.519 29.951 -11.023 1.00 17.13  ? 207 VAL B N     1 
ATOM   4182 C  CA    . VAL B 1 231 ? 46.946 29.524 -9.731  1.00 21.17  ? 207 VAL B CA    1 
ATOM   4183 C  C     . VAL B 1 231 ? 45.451 29.266 -9.904  1.00 20.16  ? 207 VAL B C     1 
ATOM   4184 O  O     . VAL B 1 231 ? 44.722 30.142 -10.393 1.00 24.45  ? 207 VAL B O     1 
ATOM   4185 C  CB    . VAL B 1 231 ? 47.196 30.573 -8.602  1.00 22.69  ? 207 VAL B CB    1 
ATOM   4186 C  CG1   . VAL B 1 231 ? 46.413 30.228 -7.342  1.00 23.07  ? 207 VAL B CG1   1 
ATOM   4187 C  CG2   . VAL B 1 231 ? 48.671 30.640 -8.288  1.00 23.33  ? 207 VAL B CG2   1 
ATOM   4188 N  N     . ASP B 1 232 ? 45.003 28.070 -9.525  1.00 18.57  ? 208 ASP B N     1 
ATOM   4189 C  CA    . ASP B 1 232 ? 43.584 27.682 -9.693  1.00 19.74  ? 208 ASP B CA    1 
ATOM   4190 C  C     . ASP B 1 232 ? 42.737 27.861 -8.439  1.00 19.08  ? 208 ASP B C     1 
ATOM   4191 O  O     . ASP B 1 232 ? 41.560 28.170 -8.530  1.00 20.74  ? 208 ASP B O     1 
ATOM   4192 C  CB    . ASP B 1 232 ? 43.440 26.237 -10.168 1.00 20.85  ? 208 ASP B CB    1 
ATOM   4193 C  CG    . ASP B 1 232 ? 44.180 25.958 -11.448 1.00 24.20  ? 208 ASP B CG    1 
ATOM   4194 O  OD1   . ASP B 1 232 ? 43.799 26.502 -12.509 1.00 26.70  ? 208 ASP B OD1   1 
ATOM   4195 O  OD2   . ASP B 1 232 ? 45.136 25.168 -11.402 1.00 23.71  ? 208 ASP B OD2   1 
ATOM   4196 N  N     . ILE B 1 233 ? 43.323 27.618 -7.266  1.00 17.91  ? 209 ILE B N     1 
ATOM   4197 C  CA    . ILE B 1 233 ? 42.591 27.725 -6.008  1.00 16.10  ? 209 ILE B CA    1 
ATOM   4198 C  C     . ILE B 1 233 ? 43.427 28.582 -5.075  1.00 16.01  ? 209 ILE B C     1 
ATOM   4199 O  O     . ILE B 1 233 ? 44.609 28.326 -4.926  1.00 17.10  ? 209 ILE B O     1 
ATOM   4200 C  CB    . ILE B 1 233 ? 42.400 26.334 -5.362  1.00 16.73  ? 209 ILE B CB    1 
ATOM   4201 C  CG1   . ILE B 1 233 ? 41.682 25.391 -6.344  1.00 18.25  ? 209 ILE B CG1   1 
ATOM   4202 C  CG2   . ILE B 1 233 ? 41.598 26.446 -4.082  1.00 15.79  ? 209 ILE B CG2   1 
ATOM   4203 C  CD1   . ILE B 1 233 ? 41.821 23.922 -6.010  1.00 23.33  ? 209 ILE B CD1   1 
ATOM   4204 N  N     . VAL B 1 234 ? 42.805 29.570 -4.442  1.00 14.83  ? 210 VAL B N     1 
ATOM   4205 C  CA    A VAL B 1 234 ? 43.520 30.545 -3.601  0.60 15.05  ? 210 VAL B CA    1 
ATOM   4206 C  CA    B VAL B 1 234 ? 43.544 30.506 -3.592  0.40 12.95  ? 210 VAL B CA    1 
ATOM   4207 C  C     . VAL B 1 234 ? 42.989 30.487 -2.172  1.00 14.80  ? 210 VAL B C     1 
ATOM   4208 O  O     . VAL B 1 234 ? 41.772 30.443 -1.973  1.00 15.19  ? 210 VAL B O     1 
ATOM   4209 C  CB    A VAL B 1 234 ? 43.360 31.983 -4.165  0.60 18.80  ? 210 VAL B CB    1 
ATOM   4210 C  CB    B VAL B 1 234 ? 43.591 31.942 -4.201  0.40 10.08  ? 210 VAL B CB    1 
ATOM   4211 C  CG1   A VAL B 1 234 ? 44.059 33.022 -3.296  0.60 17.33  ? 210 VAL B CG1   1 
ATOM   4212 C  CG1   B VAL B 1 234 ? 42.214 32.608 -4.213  0.40 11.48  ? 210 VAL B CG1   1 
ATOM   4213 C  CG2   A VAL B 1 234 ? 43.870 32.063 -5.597  0.60 20.71  ? 210 VAL B CG2   1 
ATOM   4214 C  CG2   B VAL B 1 234 ? 44.606 32.817 -3.486  0.40 9.44   ? 210 VAL B CG2   1 
ATOM   4215 N  N     . PHE B 1 235 ? 43.906 30.473 -1.184  1.00 14.82  ? 211 PHE B N     1 
ATOM   4216 C  CA    . PHE B 1 235 ? 43.543 30.578 0.220   1.00 14.65  ? 211 PHE B CA    1 
ATOM   4217 C  C     . PHE B 1 235 ? 43.930 31.939 0.763   1.00 15.62  ? 211 PHE B C     1 
ATOM   4218 O  O     . PHE B 1 235 ? 45.022 32.434 0.486   1.00 15.66  ? 211 PHE B O     1 
ATOM   4219 C  CB    . PHE B 1 235 ? 44.241 29.494 1.059   1.00 14.99  ? 211 PHE B CB    1 
ATOM   4220 C  CG    . PHE B 1 235 ? 43.764 28.110 0.771   1.00 14.61  ? 211 PHE B CG    1 
ATOM   4221 C  CD1   . PHE B 1 235 ? 44.261 27.387 -0.323  1.00 12.70  ? 211 PHE B CD1   1 
ATOM   4222 C  CD2   . PHE B 1 235 ? 42.796 27.512 1.583   1.00 14.71  ? 211 PHE B CD2   1 
ATOM   4223 C  CE1   . PHE B 1 235 ? 43.815 26.104 -0.560  1.00 13.01  ? 211 PHE B CE1   1 
ATOM   4224 C  CE2   . PHE B 1 235 ? 42.342 26.233 1.316   1.00 15.33  ? 211 PHE B CE2   1 
ATOM   4225 C  CZ    . PHE B 1 235 ? 42.849 25.534 0.244   1.00 14.55  ? 211 PHE B CZ    1 
ATOM   4226 N  N     . ALA B 1 236 ? 43.031 32.523 1.548   1.00 16.26  ? 212 ALA B N     1 
ATOM   4227 C  CA    . ALA B 1 236 ? 43.217 33.850 2.134   1.00 17.75  ? 212 ALA B CA    1 
ATOM   4228 C  C     . ALA B 1 236 ? 42.458 33.907 3.450   1.00 19.55  ? 212 ALA B C     1 
ATOM   4229 O  O     . ALA B 1 236 ? 41.405 33.305 3.581   1.00 21.62  ? 212 ALA B O     1 
ATOM   4230 C  CB    . ALA B 1 236 ? 42.693 34.929 1.179   1.00 18.20  ? 212 ALA B CB    1 
ATOM   4231 N  N     . ASN B 1 237 ? 43.001 34.617 4.434   1.00 19.71  ? 213 ASN B N     1 
ATOM   4232 C  CA    . ASN B 1 237 ? 42.192 35.022 5.567   1.00 18.29  ? 213 ASN B CA    1 
ATOM   4233 C  C     . ASN B 1 237 ? 41.672 36.435 5.311   1.00 17.87  ? 213 ASN B C     1 
ATOM   4234 O  O     . ASN B 1 237 ? 41.999 37.036 4.272   1.00 16.21  ? 213 ASN B O     1 
ATOM   4235 C  CB    . ASN B 1 237 ? 42.960 34.878 6.899   1.00 17.55  ? 213 ASN B CB    1 
ATOM   4236 C  CG    . ASN B 1 237 ? 44.129 35.835 7.014   1.00 21.59  ? 213 ASN B CG    1 
ATOM   4237 O  OD1   . ASN B 1 237 ? 44.233 36.807 6.272   1.00 22.45  ? 213 ASN B OD1   1 
ATOM   4238 N  ND2   . ASN B 1 237 ? 45.021 35.558 7.955   1.00 29.64  ? 213 ASN B ND2   1 
ATOM   4239 N  N     . ARG B 1 238 ? 40.846 36.957 6.217   1.00 17.51  ? 214 ARG B N     1 
ATOM   4240 C  CA    . ARG B 1 238 ? 40.208 38.255 5.999   1.00 18.45  ? 214 ARG B CA    1 
ATOM   4241 C  C     . ARG B 1 238 ? 41.234 39.376 5.778   1.00 19.53  ? 214 ARG B C     1 
ATOM   4242 O  O     . ARG B 1 238 ? 41.090 40.195 4.855   1.00 18.93  ? 214 ARG B O     1 
ATOM   4243 C  CB    . ARG B 1 238 ? 39.267 38.580 7.167   1.00 18.95  ? 214 ARG B CB    1 
ATOM   4244 C  CG    . ARG B 1 238 ? 38.653 39.968 7.122   1.00 24.17  ? 214 ARG B CG    1 
ATOM   4245 C  CD    . ARG B 1 238 ? 37.874 40.279 8.387   1.00 32.73  ? 214 ARG B CD    1 
ATOM   4246 N  NE    . ARG B 1 238 ? 36.441 40.058 8.220   1.00 42.72  ? 214 ARG B NE    1 
ATOM   4247 C  CZ    . ARG B 1 238 ? 35.560 41.023 7.971   1.00 43.60  ? 214 ARG B CZ    1 
ATOM   4248 N  NH1   . ARG B 1 238 ? 35.958 42.290 7.856   1.00 43.98  ? 214 ARG B NH1   1 
ATOM   4249 N  NH2   . ARG B 1 238 ? 34.275 40.725 7.843   1.00 43.00  ? 214 ARG B NH2   1 
ATOM   4250 N  N     . GLN B 1 239 ? 42.259 39.410 6.632   1.00 20.23  ? 215 GLN B N     1 
ATOM   4251 C  CA    . GLN B 1 239 ? 43.327 40.401 6.533   1.00 18.80  ? 215 GLN B CA    1 
ATOM   4252 C  C     . GLN B 1 239 ? 44.034 40.362 5.163   1.00 16.92  ? 215 GLN B C     1 
ATOM   4253 O  O     . GLN B 1 239 ? 44.288 41.405 4.574   1.00 17.73  ? 215 GLN B O     1 
ATOM   4254 C  CB    . GLN B 1 239 ? 44.338 40.219 7.665   1.00 24.42  ? 215 GLN B CB    1 
ATOM   4255 C  CG    . GLN B 1 239 ? 43.706 40.334 9.048   1.00 29.03  ? 215 GLN B CG    1 
ATOM   4256 C  CD    . GLN B 1 239 ? 43.360 38.995 9.695   1.00 32.85  ? 215 GLN B CD    1 
ATOM   4257 O  OE1   . GLN B 1 239 ? 42.624 38.178 9.138   1.00 28.82  ? 215 GLN B OE1   1 
ATOM   4258 N  NE2   . GLN B 1 239 ? 43.882 38.778 10.899  1.00 38.71  ? 215 GLN B NE2   1 
ATOM   4259 N  N     . GLU B 1 240 ? 44.362 39.163 4.704   1.00 15.70  ? 216 GLU B N     1 
ATOM   4260 C  CA    . GLU B 1 240 ? 45.063 38.948 3.442   1.00 17.18  ? 216 GLU B CA    1 
ATOM   4261 C  C     . GLU B 1 240 ? 44.205 39.407 2.262   1.00 17.62  ? 216 GLU B C     1 
ATOM   4262 O  O     . GLU B 1 240 ? 44.712 40.008 1.307   1.00 18.23  ? 216 GLU B O     1 
ATOM   4263 C  CB    . GLU B 1 240 ? 45.428 37.475 3.266   1.00 18.55  ? 216 GLU B CB    1 
ATOM   4264 C  CG    . GLU B 1 240 ? 46.674 37.032 4.013   1.00 20.89  ? 216 GLU B CG    1 
ATOM   4265 C  CD    . GLU B 1 240 ? 46.595 35.589 4.466   1.00 22.71  ? 216 GLU B CD    1 
ATOM   4266 O  OE1   . GLU B 1 240 ? 45.881 34.786 3.817   1.00 22.33  ? 216 GLU B OE1   1 
ATOM   4267 O  OE2   . GLU B 1 240 ? 47.228 35.268 5.491   1.00 25.24  ? 216 GLU B OE2   1 
ATOM   4268 N  N     . ALA B 1 241 ? 42.914 39.116 2.340   1.00 17.03  ? 217 ALA B N     1 
ATOM   4269 C  CA    . ALA B 1 241 ? 41.959 39.492 1.282   1.00 16.07  ? 217 ALA B CA    1 
ATOM   4270 C  C     . ALA B 1 241 ? 41.795 41.001 1.217   1.00 16.78  ? 217 ALA B C     1 
ATOM   4271 O  O     . ALA B 1 241 ? 41.829 41.598 0.131   1.00 17.09  ? 217 ALA B O     1 
ATOM   4272 C  CB    . ALA B 1 241 ? 40.625 38.833 1.529   1.00 16.85  ? 217 ALA B CB    1 
ATOM   4273 N  N     . LEU B 1 242 ? 41.604 41.617 2.389   1.00 18.55  ? 218 LEU B N     1 
ATOM   4274 C  CA    . LEU B 1 242 ? 41.510 43.078 2.502   1.00 18.45  ? 218 LEU B CA    1 
ATOM   4275 C  C     . LEU B 1 242 ? 42.772 43.751 1.955   1.00 18.59  ? 218 LEU B C     1 
ATOM   4276 O  O     . LEU B 1 242 ? 42.684 44.767 1.263   1.00 23.04  ? 218 LEU B O     1 
ATOM   4277 C  CB    . LEU B 1 242 ? 41.219 43.498 3.947   1.00 19.07  ? 218 LEU B CB    1 
ATOM   4278 C  CG    . LEU B 1 242 ? 39.817 43.199 4.504   1.00 19.02  ? 218 LEU B CG    1 
ATOM   4279 C  CD1   . LEU B 1 242 ? 39.741 43.547 5.990   1.00 21.90  ? 218 LEU B CD1   1 
ATOM   4280 C  CD2   . LEU B 1 242 ? 38.726 43.920 3.738   1.00 19.06  ? 218 LEU B CD2   1 
ATOM   4281 N  N     A SER B 1 243 ? 43.933 43.163 2.251   0.50 17.37  ? 219 SER B N     1 
ATOM   4282 N  N     B SER B 1 243 ? 43.935 43.159 2.221   0.50 18.15  ? 219 SER B N     1 
ATOM   4283 C  CA    A SER B 1 243 ? 45.206 43.683 1.780   0.50 18.11  ? 219 SER B CA    1 
ATOM   4284 C  CA    B SER B 1 243 ? 45.194 43.723 1.758   0.50 19.50  ? 219 SER B CA    1 
ATOM   4285 C  C     A SER B 1 243 ? 45.373 43.510 0.270   0.50 18.21  ? 219 SER B C     1 
ATOM   4286 C  C     B SER B 1 243 ? 45.455 43.471 0.273   0.50 18.74  ? 219 SER B C     1 
ATOM   4287 O  O     A SER B 1 243 ? 45.854 44.415 -0.411  0.50 19.99  ? 219 SER B O     1 
ATOM   4288 O  O     B SER B 1 243 ? 46.088 44.287 -0.390  0.50 22.05  ? 219 SER B O     1 
ATOM   4289 C  CB    A SER B 1 243 ? 46.377 43.046 2.534   0.50 15.18  ? 219 SER B CB    1 
ATOM   4290 C  CB    B SER B 1 243 ? 46.350 43.243 2.630   0.50 20.86  ? 219 SER B CB    1 
ATOM   4291 O  OG    A SER B 1 243 ? 47.601 43.578 2.071   0.50 16.23  ? 219 SER B OG    1 
ATOM   4292 O  OG    B SER B 1 243 ? 46.079 43.581 3.975   0.50 22.03  ? 219 SER B OG    1 
ATOM   4293 N  N     . LEU B 1 244 ? 44.942 42.364 -0.257  1.00 17.36  ? 220 LEU B N     1 
ATOM   4294 C  CA    . LEU B 1 244 ? 45.103 42.071 -1.670  1.00 17.32  ? 220 LEU B CA    1 
ATOM   4295 C  C     . LEU B 1 244 ? 44.446 43.181 -2.513  1.00 17.64  ? 220 LEU B C     1 
ATOM   4296 O  O     . LEU B 1 244 ? 45.015 43.620 -3.510  1.00 19.81  ? 220 LEU B O     1 
ATOM   4297 C  CB    . LEU B 1 244 ? 44.535 40.698 -2.011  1.00 17.68  ? 220 LEU B CB    1 
ATOM   4298 C  CG    . LEU B 1 244 ? 44.729 40.230 -3.459  1.00 16.34  ? 220 LEU B CG    1 
ATOM   4299 C  CD1   . LEU B 1 244 ? 46.192 40.226 -3.867  1.00 17.84  ? 220 LEU B CD1   1 
ATOM   4300 C  CD2   . LEU B 1 244 ? 44.125 38.850 -3.605  1.00 15.55  ? 220 LEU B CD2   1 
ATOM   4301 N  N     . TYR B 1 245 ? 43.293 43.668 -2.056  1.00 17.62  ? 221 TYR B N     1 
ATOM   4302 C  CA    . TYR B 1 245 ? 42.566 44.720 -2.771  1.00 18.02  ? 221 TYR B CA    1 
ATOM   4303 C  C     . TYR B 1 245 ? 42.603 46.095 -2.057  1.00 20.10  ? 221 TYR B C     1 
ATOM   4304 O  O     . TYR B 1 245 ? 41.877 47.031 -2.427  1.00 24.08  ? 221 TYR B O     1 
ATOM   4305 C  CB    . TYR B 1 245 ? 41.145 44.230 -3.086  1.00 17.34  ? 221 TYR B CB    1 
ATOM   4306 C  CG    . TYR B 1 245 ? 41.167 42.950 -3.894  1.00 17.15  ? 221 TYR B CG    1 
ATOM   4307 C  CD1   . TYR B 1 245 ? 41.618 42.949 -5.217  1.00 21.73  ? 221 TYR B CD1   1 
ATOM   4308 C  CD2   . TYR B 1 245 ? 40.792 41.741 -3.328  1.00 18.66  ? 221 TYR B CD2   1 
ATOM   4309 C  CE1   . TYR B 1 245 ? 41.662 41.774 -5.956  1.00 19.71  ? 221 TYR B CE1   1 
ATOM   4310 C  CE2   . TYR B 1 245 ? 40.828 40.557 -4.052  1.00 16.81  ? 221 TYR B CE2   1 
ATOM   4311 C  CZ    . TYR B 1 245 ? 41.273 40.574 -5.362  1.00 19.43  ? 221 TYR B CZ    1 
ATOM   4312 O  OH    . TYR B 1 245 ? 41.315 39.402 -6.081  1.00 21.53  ? 221 TYR B OH    1 
ATOM   4313 N  N     . GLN B 1 246 ? 43.485 46.214 -1.059  1.00 20.93  ? 222 GLN B N     1 
ATOM   4314 C  CA    . GLN B 1 246 ? 43.721 47.463 -0.326  1.00 18.95  ? 222 GLN B CA    1 
ATOM   4315 C  C     . GLN B 1 246 ? 42.413 48.169 -0.020  1.00 19.15  ? 222 GLN B C     1 
ATOM   4316 O  O     . GLN B 1 246 ? 42.230 49.336 -0.355  1.00 22.99  ? 222 GLN B O     1 
ATOM   4317 C  CB    . GLN B 1 246 ? 44.632 48.404 -1.133  1.00 20.68  ? 222 GLN B CB    1 
ATOM   4318 C  CG    . GLN B 1 246 ? 45.989 47.807 -1.476  1.00 20.89  ? 222 GLN B CG    1 
ATOM   4319 C  CD    . GLN B 1 246 ? 46.831 48.714 -2.340  1.00 27.38  ? 222 GLN B CD    1 
ATOM   4320 O  OE1   . GLN B 1 246 ? 46.589 48.849 -3.550  1.00 29.63  ? 222 GLN B OE1   1 
ATOM   4321 N  NE2   . GLN B 1 246 ? 47.833 49.340 -1.730  1.00 29.93  ? 222 GLN B NE2   1 
ATOM   4322 N  N     . THR B 1 247 ? 41.502 47.425 0.595   1.00 19.68  ? 223 THR B N     1 
ATOM   4323 C  CA    . THR B 1 247 ? 40.146 47.866 0.850   1.00 19.16  ? 223 THR B CA    1 
ATOM   4324 C  C     . THR B 1 247 ? 39.819 47.541 2.297   1.00 19.46  ? 223 THR B C     1 
ATOM   4325 O  O     . THR B 1 247 ? 40.390 46.610 2.853   1.00 21.27  ? 223 THR B O     1 
ATOM   4326 C  CB    . THR B 1 247 ? 39.141 47.183 -0.101  1.00 19.30  ? 223 THR B CB    1 
ATOM   4327 O  OG1   . THR B 1 247 ? 37.817 47.670 0.162   1.00 21.86  ? 223 THR B OG1   1 
ATOM   4328 C  CG2   . THR B 1 247 ? 39.183 45.651 0.048   1.00 17.62  ? 223 THR B CG2   1 
ATOM   4329 N  N     . ASP B 1 248 ? 38.919 48.319 2.894   1.00 23.09  ? 224 ASP B N     1 
ATOM   4330 C  CA    . ASP B 1 248 ? 38.342 47.986 4.193   1.00 25.20  ? 224 ASP B CA    1 
ATOM   4331 C  C     . ASP B 1 248 ? 36.953 47.378 4.025   1.00 23.92  ? 224 ASP B C     1 
ATOM   4332 O  O     . ASP B 1 248 ? 36.281 47.073 5.002   1.00 27.53  ? 224 ASP B O     1 
ATOM   4333 C  CB    . ASP B 1 248 ? 38.317 49.201 5.136   1.00 33.94  ? 224 ASP B CB    1 
ATOM   4334 C  CG    . ASP B 1 248 ? 39.459 49.175 6.162   1.00 44.50  ? 224 ASP B CG    1 
ATOM   4335 O  OD1   . ASP B 1 248 ? 40.645 49.293 5.765   1.00 40.12  ? 224 ASP B OD1   1 
ATOM   4336 O  OD2   . ASP B 1 248 ? 39.169 49.041 7.374   1.00 46.06  ? 224 ASP B OD2   1 
ATOM   4337 N  N     . ASP B 1 249 ? 36.534 47.201 2.770   1.00 23.07  ? 225 ASP B N     1 
ATOM   4338 C  CA    . ASP B 1 249 ? 35.250 46.588 2.452   1.00 23.40  ? 225 ASP B CA    1 
ATOM   4339 C  C     . ASP B 1 249 ? 35.449 45.103 2.136   1.00 22.70  ? 225 ASP B C     1 
ATOM   4340 O  O     . ASP B 1 249 ? 35.874 44.738 1.036   1.00 24.46  ? 225 ASP B O     1 
ATOM   4341 C  CB    . ASP B 1 249 ? 34.586 47.327 1.275   1.00 25.18  ? 225 ASP B CB    1 
ATOM   4342 C  CG    . ASP B 1 249 ? 33.160 46.862 0.998   1.00 30.23  ? 225 ASP B CG    1 
ATOM   4343 O  OD1   . ASP B 1 249 ? 32.739 45.802 1.502   1.00 30.01  ? 225 ASP B OD1   1 
ATOM   4344 O  OD2   . ASP B 1 249 ? 32.454 47.573 0.251   1.00 35.09  ? 225 ASP B OD2   1 
ATOM   4345 N  N     . PHE B 1 250 ? 35.146 44.255 3.116   1.00 21.08  ? 226 PHE B N     1 
ATOM   4346 C  CA    . PHE B 1 250 ? 35.265 42.803 2.955   1.00 20.34  ? 226 PHE B CA    1 
ATOM   4347 C  C     . PHE B 1 250 ? 34.374 42.234 1.845   1.00 22.42  ? 226 PHE B C     1 
ATOM   4348 O  O     . PHE B 1 250 ? 34.753 41.269 1.176   1.00 22.30  ? 226 PHE B O     1 
ATOM   4349 C  CB    . PHE B 1 250 ? 34.990 42.084 4.287   1.00 22.47  ? 226 PHE B CB    1 
ATOM   4350 C  CG    . PHE B 1 250 ? 35.278 40.606 4.261   1.00 23.77  ? 226 PHE B CG    1 
ATOM   4351 C  CD1   . PHE B 1 250 ? 36.521 40.123 3.871   1.00 22.19  ? 226 PHE B CD1   1 
ATOM   4352 C  CD2   . PHE B 1 250 ? 34.300 39.689 4.659   1.00 24.69  ? 226 PHE B CD2   1 
ATOM   4353 C  CE1   . PHE B 1 250 ? 36.779 38.757 3.857   1.00 24.58  ? 226 PHE B CE1   1 
ATOM   4354 C  CE2   . PHE B 1 250 ? 34.553 38.327 4.653   1.00 22.21  ? 226 PHE B CE2   1 
ATOM   4355 C  CZ    . PHE B 1 250 ? 35.797 37.857 4.247   1.00 21.36  ? 226 PHE B CZ    1 
ATOM   4356 N  N     . GLU B 1 251 ? 33.189 42.814 1.665   1.00 24.36  ? 227 GLU B N     1 
ATOM   4357 C  CA    . GLU B 1 251 ? 32.308 42.399 0.573   1.00 26.98  ? 227 GLU B CA    1 
ATOM   4358 C  C     . GLU B 1 251 ? 32.935 42.661 -0.795  1.00 25.66  ? 227 GLU B C     1 
ATOM   4359 O  O     . GLU B 1 251 ? 32.815 41.830 -1.697  1.00 28.39  ? 227 GLU B O     1 
ATOM   4360 C  CB    . GLU B 1 251 ? 30.914 43.032 0.688   1.00 31.36  ? 227 GLU B CB    1 
ATOM   4361 C  CG    . GLU B 1 251 ? 30.057 42.457 1.813   1.00 34.30  ? 227 GLU B CG    1 
ATOM   4362 C  CD    . GLU B 1 251 ? 29.912 40.940 1.753   1.00 35.09  ? 227 GLU B CD    1 
ATOM   4363 O  OE1   . GLU B 1 251 ? 29.638 40.392 0.661   1.00 34.34  ? 227 GLU B OE1   1 
ATOM   4364 O  OE2   . GLU B 1 251 ? 30.070 40.290 2.810   1.00 35.98  ? 227 GLU B OE2   1 
ATOM   4365 N  N     . GLU B 1 252 ? 33.603 43.809 -0.936  1.00 24.11  ? 228 GLU B N     1 
ATOM   4366 C  CA    . GLU B 1 252 ? 34.377 44.119 -2.138  1.00 24.70  ? 228 GLU B CA    1 
ATOM   4367 C  C     . GLU B 1 252 ? 35.473 43.078 -2.338  1.00 19.85  ? 228 GLU B C     1 
ATOM   4368 O  O     . GLU B 1 252 ? 35.625 42.547 -3.428  1.00 20.20  ? 228 GLU B O     1 
ATOM   4369 C  CB    . GLU B 1 252 ? 34.976 45.534 -2.091  1.00 24.83  ? 228 GLU B CB    1 
ATOM   4370 C  CG    . GLU B 1 252 ? 35.860 45.875 -3.294  1.00 24.79  ? 228 GLU B CG    1 
ATOM   4371 C  CD    . GLU B 1 252 ? 36.745 47.084 -3.055  1.00 27.06  ? 228 GLU B CD    1 
ATOM   4372 O  OE1   . GLU B 1 252 ? 36.360 47.966 -2.266  1.00 35.18  ? 228 GLU B OE1   1 
ATOM   4373 O  OE2   . GLU B 1 252 ? 37.840 47.150 -3.646  1.00 30.39  ? 228 GLU B OE2   1 
ATOM   4374 N  N     . ALA B 1 253 ? 36.225 42.780 -1.277  1.00 19.03  ? 229 ALA B N     1 
ATOM   4375 C  CA    . ALA B 1 253 ? 37.278 41.772 -1.347  1.00 18.16  ? 229 ALA B CA    1 
ATOM   4376 C  C     . ALA B 1 253 ? 36.766 40.412 -1.826  1.00 18.38  ? 229 ALA B C     1 
ATOM   4377 O  O     . ALA B 1 253 ? 37.420 39.768 -2.632  1.00 21.59  ? 229 ALA B O     1 
ATOM   4378 C  CB    . ALA B 1 253 ? 37.988 41.645 -0.008  1.00 18.28  ? 229 ALA B CB    1 
ATOM   4379 N  N     . LEU B 1 254 ? 35.602 39.983 -1.332  1.00 17.34  ? 230 LEU B N     1 
ATOM   4380 C  CA    . LEU B 1 254 ? 35.044 38.687 -1.698  1.00 17.90  ? 230 LEU B CA    1 
ATOM   4381 C  C     . LEU B 1 254 ? 34.632 38.645 -3.184  1.00 17.82  ? 230 LEU B C     1 
ATOM   4382 O  O     . LEU B 1 254 ? 34.911 37.671 -3.881  1.00 19.44  ? 230 LEU B O     1 
ATOM   4383 C  CB    . LEU B 1 254 ? 33.854 38.336 -0.810  1.00 18.68  ? 230 LEU B CB    1 
ATOM   4384 C  CG    . LEU B 1 254 ? 34.076 37.956 0.658   1.00 19.03  ? 230 LEU B CG    1 
ATOM   4385 C  CD1   . LEU B 1 254 ? 32.748 37.528 1.251   1.00 20.82  ? 230 LEU B CD1   1 
ATOM   4386 C  CD2   . LEU B 1 254 ? 35.107 36.847 0.810   1.00 18.47  ? 230 LEU B CD2   1 
ATOM   4387 N  N     . ASN B 1 255 ? 33.983 39.703 -3.665  1.00 20.45  ? 231 ASN B N     1 
ATOM   4388 C  CA    . ASN B 1 255 ? 33.575 39.757 -5.082  1.00 20.22  ? 231 ASN B CA    1 
ATOM   4389 C  C     . ASN B 1 255 ? 34.797 39.781 -6.010  1.00 20.37  ? 231 ASN B C     1 
ATOM   4390 O  O     . ASN B 1 255 ? 34.838 39.090 -7.034  1.00 22.34  ? 231 ASN B O     1 
ATOM   4391 C  CB    . ASN B 1 255 ? 32.693 40.987 -5.344  1.00 26.53  ? 231 ASN B CB    1 
ATOM   4392 C  CG    . ASN B 1 255 ? 31.332 40.911 -4.654  1.00 28.13  ? 231 ASN B CG    1 
ATOM   4393 O  OD1   . ASN B 1 255 ? 30.691 39.862 -4.610  1.00 27.00  ? 231 ASN B OD1   1 
ATOM   4394 N  ND2   . ASN B 1 255 ? 30.874 42.046 -4.139  1.00 29.57  ? 231 ASN B ND2   1 
ATOM   4395 N  N     . ARG B 1 256 ? 35.812 40.546 -5.628  1.00 20.21  ? 232 ARG B N     1 
ATOM   4396 C  CA    . ARG B 1 256 ? 37.027 40.665 -6.429  1.00 19.91  ? 232 ARG B CA    1 
ATOM   4397 C  C     . ARG B 1 256 ? 37.822 39.358 -6.474  1.00 18.93  ? 232 ARG B C     1 
ATOM   4398 O  O     . ARG B 1 256 ? 38.211 38.907 -7.551  1.00 19.83  ? 232 ARG B O     1 
ATOM   4399 C  CB    . ARG B 1 256 ? 37.875 41.853 -5.956  1.00 19.94  ? 232 ARG B CB    1 
ATOM   4400 C  CG    . ARG B 1 256 ? 37.107 43.167 -5.982  1.00 23.40  ? 232 ARG B CG    1 
ATOM   4401 C  CD    . ARG B 1 256 ? 37.600 44.104 -7.050  1.00 31.88  ? 232 ARG B CD    1 
ATOM   4402 N  NE    . ARG B 1 256 ? 38.616 45.002 -6.523  1.00 34.89  ? 232 ARG B NE    1 
ATOM   4403 C  CZ    . ARG B 1 256 ? 39.807 45.209 -7.081  1.00 37.00  ? 232 ARG B CZ    1 
ATOM   4404 N  NH1   . ARG B 1 256 ? 40.651 46.057 -6.521  1.00 31.35  ? 232 ARG B NH1   1 
ATOM   4405 N  NH2   . ARG B 1 256 ? 40.152 44.586 -8.206  1.00 43.92  ? 232 ARG B NH2   1 
ATOM   4406 N  N     . ILE B 1 257 ? 38.026 38.721 -5.325  1.00 19.14  ? 233 ILE B N     1 
ATOM   4407 C  CA    . ILE B 1 257 ? 38.754 37.442 -5.285  1.00 17.52  ? 233 ILE B CA    1 
ATOM   4408 C  C     . ILE B 1 257 ? 38.054 36.335 -6.101  1.00 18.78  ? 233 ILE B C     1 
ATOM   4409 O  O     . ILE B 1 257 ? 38.725 35.549 -6.804  1.00 21.28  ? 233 ILE B O     1 
ATOM   4410 C  CB    . ILE B 1 257 ? 39.123 37.018 -3.821  1.00 18.31  ? 233 ILE B CB    1 
ATOM   4411 C  CG1   . ILE B 1 257 ? 40.349 36.113 -3.829  1.00 19.99  ? 233 ILE B CG1   1 
ATOM   4412 C  CG2   . ILE B 1 257 ? 37.942 36.378 -3.101  1.00 18.18  ? 233 ILE B CG2   1 
ATOM   4413 C  CD1   . ILE B 1 257 ? 41.003 35.972 -2.464  1.00 18.23  ? 233 ILE B CD1   1 
ATOM   4414 N  N     . ALA B 1 258 ? 36.721 36.304 -6.046  1.00 19.77  ? 234 ALA B N     1 
ATOM   4415 C  CA    . ALA B 1 258 ? 35.911 35.377 -6.858  1.00 20.97  ? 234 ALA B CA    1 
ATOM   4416 C  C     . ALA B 1 258 ? 36.145 35.603 -8.360  1.00 19.38  ? 234 ALA B C     1 
ATOM   4417 O  O     . ALA B 1 258 ? 36.163 34.651 -9.150  1.00 21.20  ? 234 ALA B O     1 
ATOM   4418 C  CB    . ALA B 1 258 ? 34.427 35.517 -6.514  1.00 16.81  ? 234 ALA B CB    1 
ATOM   4419 N  N     . ALA B 1 259 ? 36.355 36.861 -8.736  1.00 18.38  ? 235 ALA B N     1 
ATOM   4420 C  CA    . ALA B 1 259 ? 36.542 37.226 -10.141 1.00 18.87  ? 235 ALA B CA    1 
ATOM   4421 C  C     . ALA B 1 259 ? 37.958 36.906 -10.614 1.00 19.86  ? 235 ALA B C     1 
ATOM   4422 O  O     . ALA B 1 259 ? 38.225 36.754 -11.817 1.00 21.88  ? 235 ALA B O     1 
ATOM   4423 C  CB    . ALA B 1 259 ? 36.228 38.700 -10.339 1.00 22.24  ? 235 ALA B CB    1 
ATOM   4424 N  N     . ASP B 1 260 ? 38.876 36.795 -9.656  1.00 17.64  ? 236 ASP B N     1 
ATOM   4425 C  CA    . ASP B 1 260 ? 40.291 36.673 -9.986  1.00 17.92  ? 236 ASP B CA    1 
ATOM   4426 C  C     . ASP B 1 260 ? 40.841 35.241 -10.028 1.00 19.78  ? 236 ASP B C     1 
ATOM   4427 O  O     . ASP B 1 260 ? 41.901 35.006 -10.623 1.00 21.53  ? 236 ASP B O     1 
ATOM   4428 C  CB    . ASP B 1 260 ? 41.137 37.557 -9.055  1.00 21.16  ? 236 ASP B CB    1 
ATOM   4429 C  CG    . ASP B 1 260 ? 41.102 39.034 -9.453  1.00 22.59  ? 236 ASP B CG    1 
ATOM   4430 O  OD1   . ASP B 1 260 ? 40.900 39.348 -10.658 1.00 24.75  ? 236 ASP B OD1   1 
ATOM   4431 O  OD2   . ASP B 1 260 ? 41.286 39.895 -8.569  1.00 23.07  ? 236 ASP B OD2   1 
ATOM   4432 N  N     . CYS B 1 261 ? 40.132 34.299 -9.405  1.00 19.59  ? 237 CYS B N     1 
ATOM   4433 C  CA    A CYS B 1 261 ? 40.567 32.904 -9.415  0.60 20.26  ? 237 CYS B CA    1 
ATOM   4434 C  CA    B CYS B 1 261 ? 40.568 32.902 -9.292  0.40 19.71  ? 237 CYS B CA    1 
ATOM   4435 C  C     . CYS B 1 261 ? 39.381 31.960 -9.506  1.00 21.05  ? 237 CYS B C     1 
ATOM   4436 O  O     . CYS B 1 261 ? 38.233 32.357 -9.258  1.00 27.48  ? 237 CYS B O     1 
ATOM   4437 C  CB    A CYS B 1 261 ? 41.391 32.587 -8.175  0.60 21.52  ? 237 CYS B CB    1 
ATOM   4438 C  CB    B CYS B 1 261 ? 41.188 32.664 -7.906  0.40 18.93  ? 237 CYS B CB    1 
ATOM   4439 S  SG    A CYS B 1 261 ? 40.371 32.637 -6.700  0.60 22.16  ? 237 CYS B SG    1 
ATOM   4440 S  SG    B CYS B 1 261 ? 42.304 31.247 -7.778  0.40 15.39  ? 237 CYS B SG    1 
ATOM   4441 N  N     . LYS B 1 262 ? 39.653 30.718 -9.909  1.00 16.99  ? 238 LYS B N     1 
ATOM   4442 C  CA    . LYS B 1 262 ? 38.577 29.729 -10.127 1.00 21.66  ? 238 LYS B CA    1 
ATOM   4443 C  C     . LYS B 1 262 ? 37.858 29.370 -8.829  1.00 19.88  ? 238 LYS B C     1 
ATOM   4444 O  O     . LYS B 1 262 ? 36.629 29.345 -8.771  1.00 17.65  ? 238 LYS B O     1 
ATOM   4445 C  CB    . LYS B 1 262 ? 39.083 28.471 -10.846 1.00 25.04  ? 238 LYS B CB    1 
ATOM   4446 C  CG    . LYS B 1 262 ? 39.376 28.658 -12.332 1.00 30.63  ? 238 LYS B CG    1 
ATOM   4447 C  CD    . LYS B 1 262 ? 40.070 27.432 -12.909 1.00 32.56  ? 238 LYS B CD    1 
ATOM   4448 C  CE    . LYS B 1 262 ? 41.070 27.806 -13.999 1.00 35.16  ? 238 LYS B CE    1 
ATOM   4449 N  NZ    . LYS B 1 262 ? 42.222 28.605 -13.487 1.00 36.80  ? 238 LYS B NZ    1 
ATOM   4450 N  N     . ILE B 1 263 ? 38.634 29.123 -7.773  1.00 18.39  ? 239 ILE B N     1 
ATOM   4451 C  CA    . ILE B 1 263 ? 38.078 28.834 -6.460  1.00 16.50  ? 239 ILE B CA    1 
ATOM   4452 C  C     . ILE B 1 263 ? 38.867 29.628 -5.425  1.00 16.01  ? 239 ILE B C     1 
ATOM   4453 O  O     . ILE B 1 263 ? 40.091 29.674 -5.482  1.00 19.62  ? 239 ILE B O     1 
ATOM   4454 C  CB    . ILE B 1 263 ? 38.136 27.334 -6.116  1.00 15.73  ? 239 ILE B CB    1 
ATOM   4455 C  CG1   . ILE B 1 263 ? 37.232 26.517 -7.067  1.00 16.85  ? 239 ILE B CG1   1 
ATOM   4456 C  CG2   . ILE B 1 263 ? 37.703 27.104 -4.676  1.00 17.34  ? 239 ILE B CG2   1 
ATOM   4457 C  CD1   . ILE B 1 263 ? 37.468 25.026 -7.015  1.00 18.22  ? 239 ILE B CD1   1 
ATOM   4458 N  N     . ALA B 1 264 ? 38.158 30.276 -4.517  1.00 16.04  ? 240 ALA B N     1 
ATOM   4459 C  CA    . ALA B 1 264 ? 38.803 30.982 -3.411  1.00 16.77  ? 240 ALA B CA    1 
ATOM   4460 C  C     . ALA B 1 264 ? 38.232 30.445 -2.117  1.00 17.85  ? 240 ALA B C     1 
ATOM   4461 O  O     . ALA B 1 264 ? 37.006 30.322 -1.971  1.00 19.03  ? 240 ALA B O     1 
ATOM   4462 C  CB    . ALA B 1 264 ? 38.580 32.483 -3.511  1.00 15.81  ? 240 ALA B CB    1 
ATOM   4463 N  N     . ALA B 1 265 ? 39.116 30.142 -1.171  1.00 18.55  ? 241 ALA B N     1 
ATOM   4464 C  CA    . ALA B 1 265 ? 38.675 29.746 0.164   1.00 16.76  ? 241 ALA B CA    1 
ATOM   4465 C  C     . ALA B 1 265 ? 39.133 30.849 1.100   1.00 16.82  ? 241 ALA B C     1 
ATOM   4466 O  O     . ALA B 1 265 ? 40.338 31.106 1.203   1.00 17.68  ? 241 ALA B O     1 
ATOM   4467 C  CB    . ALA B 1 265 ? 39.264 28.399 0.564   1.00 15.59  ? 241 ALA B CB    1 
ATOM   4468 N  N     . VAL B 1 266 ? 38.172 31.516 1.746   1.00 18.61  ? 242 VAL B N     1 
ATOM   4469 C  CA    . VAL B 1 266 ? 38.467 32.686 2.582   1.00 18.30  ? 242 VAL B CA    1 
ATOM   4470 C  C     . VAL B 1 266 ? 38.079 32.452 4.038   1.00 19.40  ? 242 VAL B C     1 
ATOM   4471 O  O     . VAL B 1 266 ? 36.899 32.295 4.367   1.00 21.90  ? 242 VAL B O     1 
ATOM   4472 C  CB    . VAL B 1 266 ? 37.820 33.983 2.042   1.00 20.17  ? 242 VAL B CB    1 
ATOM   4473 C  CG1   . VAL B 1 266 ? 38.224 35.183 2.889   1.00 20.50  ? 242 VAL B CG1   1 
ATOM   4474 C  CG2   . VAL B 1 266 ? 38.219 34.222 0.594   1.00 21.64  ? 242 VAL B CG2   1 
ATOM   4475 N  N     . THR B 1 267 ? 39.083 32.407 4.908   1.00 20.45  ? 243 THR B N     1 
ATOM   4476 C  CA    . THR B 1 267 ? 38.824 32.154 6.320   1.00 18.91  ? 243 THR B CA    1 
ATOM   4477 C  C     . THR B 1 267 ? 38.581 33.448 7.092   1.00 20.61  ? 243 THR B C     1 
ATOM   4478 O  O     . THR B 1 267 ? 39.094 34.510 6.729   1.00 20.57  ? 243 THR B O     1 
ATOM   4479 C  CB    . THR B 1 267 ? 39.968 31.369 6.991   1.00 18.10  ? 243 THR B CB    1 
ATOM   4480 O  OG1   . THR B 1 267 ? 41.196 32.097 6.894   1.00 17.04  ? 243 THR B OG1   1 
ATOM   4481 C  CG2   . THR B 1 267 ? 40.141 29.984 6.364   1.00 22.13  ? 243 THR B CG2   1 
HETATM 4482 N  N     . MSE B 1 268 ? 37.793 33.353 8.162   1.00 21.51  ? 244 MSE B N     1 
HETATM 4483 C  CA    . MSE B 1 268 ? 37.438 34.524 8.961   1.00 23.24  ? 244 MSE B CA    1 
HETATM 4484 C  C     . MSE B 1 268 ? 37.525 34.177 10.427  1.00 23.91  ? 244 MSE B C     1 
HETATM 4485 O  O     . MSE B 1 268 ? 36.652 34.545 11.212  1.00 23.50  ? 244 MSE B O     1 
HETATM 4486 C  CB    . MSE B 1 268 ? 36.035 34.999 8.598   1.00 26.14  ? 244 MSE B CB    1 
HETATM 4487 C  CG    . MSE B 1 268 ? 35.955 35.315 7.106   1.00 32.63  ? 244 MSE B CG    1 
HETATM 4488 SE SE    . MSE B 1 268 ? 34.065 35.303 6.588   1.00 53.55  ? 244 MSE B SE    1 
HETATM 4489 C  CE    . MSE B 1 268 ? 33.426 33.552 7.207   1.00 38.65  ? 244 MSE B CE    1 
ATOM   4490 N  N     . SER B 1 269 ? 38.583 33.462 10.798  1.00 24.03  ? 245 SER B N     1 
ATOM   4491 C  CA    . SER B 1 269 ? 38.840 33.085 12.202  1.00 27.41  ? 245 SER B CA    1 
ATOM   4492 C  C     . SER B 1 269 ? 37.615 32.454 12.877  1.00 28.87  ? 245 SER B C     1 
ATOM   4493 O  O     . SER B 1 269 ? 37.038 31.506 12.334  1.00 26.05  ? 245 SER B O     1 
ATOM   4494 C  CB    . SER B 1 269 ? 39.380 34.280 13.000  1.00 28.84  ? 245 SER B CB    1 
ATOM   4495 O  OG    . SER B 1 269 ? 40.590 34.760 12.442  1.00 32.38  ? 245 SER B OG    1 
ATOM   4496 N  N     . GLU B 1 270 ? 37.205 32.987 14.032  1.00 32.40  ? 246 GLU B N     1 
ATOM   4497 C  CA    . GLU B 1 270 ? 36.064 32.445 14.787  1.00 31.53  ? 246 GLU B CA    1 
ATOM   4498 C  C     . GLU B 1 270 ? 34.725 32.561 14.050  1.00 30.83  ? 246 GLU B C     1 
ATOM   4499 O  O     . GLU B 1 270 ? 33.742 31.922 14.440  1.00 30.14  ? 246 GLU B O     1 
ATOM   4500 C  CB    . GLU B 1 270 ? 35.967 33.085 16.185  1.00 34.69  ? 246 GLU B CB    1 
ATOM   4501 C  CG    . GLU B 1 270 ? 35.360 34.484 16.223  1.00 35.62  ? 246 GLU B CG    1 
ATOM   4502 C  CD    . GLU B 1 270 ? 36.332 35.581 15.816  1.00 41.51  ? 246 GLU B CD    1 
ATOM   4503 O  OE1   . GLU B 1 270 ? 37.550 35.306 15.690  1.00 36.96  ? 246 GLU B OE1   1 
ATOM   4504 O  OE2   . GLU B 1 270 ? 35.874 36.730 15.626  1.00 48.08  ? 246 GLU B OE2   1 
ATOM   4505 N  N     . ASN B 1 271 ? 34.694 33.367 12.994  1.00 31.48  ? 247 ASN B N     1 
ATOM   4506 C  CA    . ASN B 1 271 ? 33.497 33.508 12.153  1.00 31.59  ? 247 ASN B CA    1 
ATOM   4507 C  C     . ASN B 1 271 ? 33.432 32.497 11.004  1.00 26.93  ? 247 ASN B C     1 
ATOM   4508 O  O     . ASN B 1 271 ? 32.519 32.544 10.180  1.00 28.74  ? 247 ASN B O     1 
ATOM   4509 C  CB    . ASN B 1 271 ? 33.356 34.947 11.632  1.00 33.94  ? 247 ASN B CB    1 
ATOM   4510 C  CG    . ASN B 1 271 ? 33.213 35.965 12.755  1.00 39.48  ? 247 ASN B CG    1 
ATOM   4511 O  OD1   . ASN B 1 271 ? 32.413 35.786 13.669  1.00 38.91  ? 247 ASN B OD1   1 
ATOM   4512 N  ND2   . ASN B 1 271 ? 33.992 37.043 12.687  1.00 44.48  ? 247 ASN B ND2   1 
ATOM   4513 N  N     . GLY B 1 272 ? 34.401 31.587 10.957  1.00 25.07  ? 248 GLY B N     1 
ATOM   4514 C  CA    . GLY B 1 272 ? 34.367 30.464 10.029  1.00 23.57  ? 248 GLY B CA    1 
ATOM   4515 C  C     . GLY B 1 272 ? 34.985 30.779 8.685   1.00 23.07  ? 248 GLY B C     1 
ATOM   4516 O  O     . GLY B 1 272 ? 36.030 31.423 8.605   1.00 23.63  ? 248 GLY B O     1 
ATOM   4517 N  N     . ALA B 1 273 ? 34.331 30.326 7.620   1.00 19.22  ? 249 ALA B N     1 
ATOM   4518 C  CA    . ALA B 1 273 ? 34.889 30.463 6.280   1.00 18.92  ? 249 ALA B CA    1 
ATOM   4519 C  C     . ALA B 1 273 ? 33.805 30.635 5.245   1.00 21.12  ? 249 ALA B C     1 
ATOM   4520 O  O     . ALA B 1 273 ? 32.646 30.255 5.469   1.00 21.03  ? 249 ALA B O     1 
ATOM   4521 C  CB    . ALA B 1 273 ? 35.730 29.241 5.925   1.00 17.58  ? 249 ALA B CB    1 
ATOM   4522 N  N     . VAL B 1 274 ? 34.206 31.191 4.104   1.00 19.96  ? 250 VAL B N     1 
ATOM   4523 C  CA    . VAL B 1 274 ? 33.350 31.229 2.922   1.00 20.83  ? 250 VAL B CA    1 
ATOM   4524 C  C     . VAL B 1 274 ? 34.160 30.731 1.735   1.00 20.53  ? 250 VAL B C     1 
ATOM   4525 O  O     . VAL B 1 274 ? 35.304 31.172 1.507   1.00 21.46  ? 250 VAL B O     1 
ATOM   4526 C  CB    . VAL B 1 274 ? 32.733 32.615 2.659   1.00 23.57  ? 250 VAL B CB    1 
ATOM   4527 C  CG1   . VAL B 1 274 ? 33.800 33.678 2.464   1.00 22.69  ? 250 VAL B CG1   1 
ATOM   4528 C  CG2   . VAL B 1 274 ? 31.821 32.566 1.441   1.00 24.05  ? 250 VAL B CG2   1 
ATOM   4529 N  N     . ILE B 1 275 ? 33.579 29.782 1.013   1.00 18.95  ? 251 ILE B N     1 
ATOM   4530 C  CA    . ILE B 1 275 ? 34.219 29.232 -0.175  1.00 17.10  ? 251 ILE B CA    1 
ATOM   4531 C  C     . ILE B 1 275 ? 33.505 29.839 -1.357  1.00 17.35  ? 251 ILE B C     1 
ATOM   4532 O  O     . ILE B 1 275 ? 32.263 29.892 -1.373  1.00 19.65  ? 251 ILE B O     1 
ATOM   4533 C  CB    . ILE B 1 275 ? 34.134 27.696 -0.250  1.00 17.56  ? 251 ILE B CB    1 
ATOM   4534 C  CG1   . ILE B 1 275 ? 34.418 27.042 1.121   1.00 18.60  ? 251 ILE B CG1   1 
ATOM   4535 C  CG2   . ILE B 1 275 ? 35.035 27.165 -1.367  1.00 19.74  ? 251 ILE B CG2   1 
ATOM   4536 C  CD1   . ILE B 1 275 ? 35.734 27.439 1.775   1.00 18.13  ? 251 ILE B CD1   1 
ATOM   4537 N  N     . LEU B 1 276 ? 34.279 30.303 -2.332  1.00 17.68  ? 252 LEU B N     1 
ATOM   4538 C  CA    . LEU B 1 276 ? 33.712 30.972 -3.516  1.00 18.59  ? 252 LEU B CA    1 
ATOM   4539 C  C     . LEU B 1 276 ? 34.120 30.294 -4.815  1.00 18.76  ? 252 LEU B C     1 
ATOM   4540 O  O     . LEU B 1 276 ? 35.275 29.925 -5.004  1.00 19.64  ? 252 LEU B O     1 
ATOM   4541 C  CB    . LEU B 1 276 ? 34.117 32.455 -3.539  1.00 18.76  ? 252 LEU B CB    1 
ATOM   4542 C  CG    . LEU B 1 276 ? 33.710 33.301 -2.316  1.00 23.29  ? 252 LEU B CG    1 
ATOM   4543 C  CD1   . LEU B 1 276 ? 34.867 33.389 -1.321  1.00 26.88  ? 252 LEU B CD1   1 
ATOM   4544 C  CD2   . LEU B 1 276 ? 33.209 34.690 -2.714  1.00 25.95  ? 252 LEU B CD2   1 
ATOM   4545 N  N     . LYS B 1 277 ? 33.153 30.135 -5.713  1.00 21.39  ? 253 LYS B N     1 
ATOM   4546 C  CA    . LYS B 1 277 ? 33.421 29.607 -7.046  1.00 19.07  ? 253 LYS B CA    1 
ATOM   4547 C  C     . LYS B 1 277 ? 32.470 30.301 -8.005  1.00 20.72  ? 253 LYS B C     1 
ATOM   4548 O  O     . LYS B 1 277 ? 31.258 30.045 -7.991  1.00 24.44  ? 253 LYS B O     1 
ATOM   4549 C  CB    . LYS B 1 277 ? 33.219 28.093 -7.133  1.00 21.12  ? 253 LYS B CB    1 
ATOM   4550 C  CG    . LYS B 1 277 ? 33.526 27.541 -8.533  1.00 23.51  ? 253 LYS B CG    1 
ATOM   4551 C  CD    . LYS B 1 277 ? 33.426 26.023 -8.606  1.00 28.52  ? 253 LYS B CD    1 
ATOM   4552 C  CE    . LYS B 1 277 ? 33.654 25.508 -10.024 1.00 30.08  ? 253 LYS B CE    1 
ATOM   4553 N  NZ    . LYS B 1 277 ? 33.575 24.021 -10.101 1.00 33.13  ? 253 LYS B NZ    1 
ATOM   4554 N  N     . GLY B 1 278 ? 33.025 31.186 -8.819  1.00 21.69  ? 254 GLY B N     1 
ATOM   4555 C  CA    . GLY B 1 278 ? 32.219 31.947 -9.770  1.00 23.66  ? 254 GLY B CA    1 
ATOM   4556 C  C     . GLY B 1 278 ? 31.243 32.818 -9.003  1.00 24.97  ? 254 GLY B C     1 
ATOM   4557 O  O     . GLY B 1 278 ? 31.648 33.745 -8.298  1.00 28.86  ? 254 GLY B O     1 
ATOM   4558 N  N     . ARG B 1 279 ? 29.957 32.502 -9.119  1.00 29.77  ? 255 ARG B N     1 
ATOM   4559 C  CA    . ARG B 1 279 ? 28.919 33.232 -8.403  1.00 28.50  ? 255 ARG B CA    1 
ATOM   4560 C  C     . ARG B 1 279 ? 28.439 32.475 -7.169  1.00 27.28  ? 255 ARG B C     1 
ATOM   4561 O  O     . ARG B 1 279 ? 27.646 33.009 -6.390  1.00 29.33  ? 255 ARG B O     1 
ATOM   4562 C  CB    . ARG B 1 279 ? 27.740 33.559 -9.335  1.00 33.89  ? 255 ARG B CB    1 
ATOM   4563 C  CG    . ARG B 1 279 ? 28.103 34.540 -10.440 1.00 39.39  ? 255 ARG B CG    1 
ATOM   4564 C  CD    . ARG B 1 279 ? 26.883 35.019 -11.215 1.00 46.43  ? 255 ARG B CD    1 
ATOM   4565 N  NE    . ARG B 1 279 ? 27.248 36.009 -12.227 1.00 50.58  ? 255 ARG B NE    1 
ATOM   4566 C  CZ    . ARG B 1 279 ? 27.338 35.758 -13.532 1.00 50.29  ? 255 ARG B CZ    1 
ATOM   4567 N  NH1   . ARG B 1 279 ? 27.072 34.547 -14.005 1.00 43.07  ? 255 ARG B NH1   1 
ATOM   4568 N  NH2   . ARG B 1 279 ? 27.682 36.722 -14.371 1.00 54.80  ? 255 ARG B NH2   1 
ATOM   4569 N  N     . GLU B 1 280 ? 28.917 31.240 -6.999  1.00 26.31  ? 256 GLU B N     1 
ATOM   4570 C  CA    . GLU B 1 280 ? 28.558 30.414 -5.837  1.00 25.97  ? 256 GLU B CA    1 
ATOM   4571 C  C     . GLU B 1 280 ? 29.338 30.857 -4.602  1.00 26.19  ? 256 GLU B C     1 
ATOM   4572 O  O     . GLU B 1 280 ? 30.544 31.123 -4.683  1.00 25.21  ? 256 GLU B O     1 
ATOM   4573 C  CB    . GLU B 1 280 ? 28.831 28.922 -6.094  1.00 27.84  ? 256 GLU B CB    1 
ATOM   4574 C  CG    . GLU B 1 280 ? 28.210 28.322 -7.354  1.00 36.01  ? 256 GLU B CG    1 
ATOM   4575 C  CD    . GLU B 1 280 ? 28.906 27.040 -7.807  1.00 40.95  ? 256 GLU B CD    1 
ATOM   4576 O  OE1   . GLU B 1 280 ? 29.455 26.304 -6.952  1.00 38.12  ? 256 GLU B OE1   1 
ATOM   4577 O  OE2   . GLU B 1 280 ? 28.907 26.760 -9.028  1.00 52.21  ? 256 GLU B OE2   1 
ATOM   4578 N  N     . ARG B 1 281 ? 28.643 30.933 -3.465  1.00 25.98  ? 257 ARG B N     1 
ATOM   4579 C  CA    . ARG B 1 281 ? 29.280 31.104 -2.151  1.00 24.40  ? 257 ARG B CA    1 
ATOM   4580 C  C     . ARG B 1 281 ? 28.826 29.992 -1.225  1.00 25.24  ? 257 ARG B C     1 
ATOM   4581 O  O     . ARG B 1 281 ? 27.635 29.661 -1.176  1.00 26.19  ? 257 ARG B O     1 
ATOM   4582 C  CB    . ARG B 1 281 ? 28.933 32.460 -1.521  1.00 27.30  ? 257 ARG B CB    1 
ATOM   4583 C  CG    . ARG B 1 281 ? 29.597 33.651 -2.189  1.00 27.68  ? 257 ARG B CG    1 
ATOM   4584 C  CD    . ARG B 1 281 ? 29.403 34.922 -1.379  1.00 31.94  ? 257 ARG B CD    1 
ATOM   4585 N  NE    . ARG B 1 281 ? 29.824 36.106 -2.129  1.00 34.69  ? 257 ARG B NE    1 
ATOM   4586 C  CZ    . ARG B 1 281 ? 29.891 37.336 -1.626  1.00 32.55  ? 257 ARG B CZ    1 
ATOM   4587 N  NH1   . ARG B 1 281 ? 29.571 37.570 -0.354  1.00 36.06  ? 257 ARG B NH1   1 
ATOM   4588 N  NH2   . ARG B 1 281 ? 30.281 38.338 -2.393  1.00 34.89  ? 257 ARG B NH2   1 
ATOM   4589 N  N     . TYR B 1 282 ? 29.775 29.414 -0.490  1.00 22.95  ? 258 TYR B N     1 
ATOM   4590 C  CA    . TYR B 1 282 ? 29.457 28.387 0.494   1.00 24.99  ? 258 TYR B CA    1 
ATOM   4591 C  C     . TYR B 1 282 ? 30.042 28.773 1.840   1.00 24.21  ? 258 TYR B C     1 
ATOM   4592 O  O     . TYR B 1 282 ? 31.256 28.798 2.004   1.00 22.67  ? 258 TYR B O     1 
ATOM   4593 C  CB    . TYR B 1 282 ? 29.980 27.010 0.059   1.00 22.40  ? 258 TYR B CB    1 
ATOM   4594 C  CG    . TYR B 1 282 ? 29.478 26.561 -1.284  1.00 25.04  ? 258 TYR B CG    1 
ATOM   4595 C  CD1   . TYR B 1 282 ? 28.221 25.975 -1.412  1.00 28.84  ? 258 TYR B CD1   1 
ATOM   4596 C  CD2   . TYR B 1 282 ? 30.259 26.717 -2.434  1.00 27.53  ? 258 TYR B CD2   1 
ATOM   4597 C  CE1   . TYR B 1 282 ? 27.750 25.560 -2.648  1.00 31.11  ? 258 TYR B CE1   1 
ATOM   4598 C  CE2   . TYR B 1 282 ? 29.797 26.304 -3.674  1.00 29.49  ? 258 TYR B CE2   1 
ATOM   4599 C  CZ    . TYR B 1 282 ? 28.546 25.727 -3.775  1.00 33.85  ? 258 TYR B CZ    1 
ATOM   4600 O  OH    . TYR B 1 282 ? 28.082 25.316 -5.005  1.00 43.58  ? 258 TYR B OH    1 
ATOM   4601 N  N     . TYR B 1 283 ? 29.159 29.087 2.781   1.00 25.27  ? 259 TYR B N     1 
ATOM   4602 C  CA    . TYR B 1 283 ? 29.548 29.525 4.124   1.00 23.12  ? 259 TYR B CA    1 
ATOM   4603 C  C     . TYR B 1 283 ? 29.596 28.363 5.093   1.00 24.30  ? 259 TYR B C     1 
ATOM   4604 O  O     . TYR B 1 283 ? 28.676 27.547 5.139   1.00 28.02  ? 259 TYR B O     1 
ATOM   4605 C  CB    . TYR B 1 283 ? 28.572 30.575 4.648   1.00 22.73  ? 259 TYR B CB    1 
ATOM   4606 C  CG    . TYR B 1 283 ? 28.730 31.935 4.016   1.00 27.78  ? 259 TYR B CG    1 
ATOM   4607 C  CD1   . TYR B 1 283 ? 28.032 32.274 2.857   1.00 31.01  ? 259 TYR B CD1   1 
ATOM   4608 C  CD2   . TYR B 1 283 ? 29.557 32.900 4.594   1.00 30.74  ? 259 TYR B CD2   1 
ATOM   4609 C  CE1   . TYR B 1 283 ? 28.167 33.529 2.280   1.00 28.12  ? 259 TYR B CE1   1 
ATOM   4610 C  CE2   . TYR B 1 283 ? 29.696 34.160 4.026   1.00 35.81  ? 259 TYR B CE2   1 
ATOM   4611 C  CZ    . TYR B 1 283 ? 29.000 34.468 2.869   1.00 34.60  ? 259 TYR B CZ    1 
ATOM   4612 O  OH    . TYR B 1 283 ? 29.141 35.714 2.302   1.00 39.65  ? 259 TYR B OH    1 
ATOM   4613 N  N     . VAL B 1 284 ? 30.674 28.309 5.874   1.00 25.81  ? 260 VAL B N     1 
ATOM   4614 C  CA    . VAL B 1 284 ? 30.907 27.249 6.856   1.00 27.28  ? 260 VAL B CA    1 
ATOM   4615 C  C     . VAL B 1 284 ? 31.178 27.896 8.216   1.00 28.33  ? 260 VAL B C     1 
ATOM   4616 O  O     . VAL B 1 284 ? 31.922 28.869 8.298   1.00 25.09  ? 260 VAL B O     1 
ATOM   4617 C  CB    . VAL B 1 284 ? 32.113 26.371 6.448   1.00 29.00  ? 260 VAL B CB    1 
ATOM   4618 C  CG1   . VAL B 1 284 ? 32.483 25.395 7.551   1.00 30.53  ? 260 VAL B CG1   1 
ATOM   4619 C  CG2   . VAL B 1 284 ? 31.826 25.604 5.160   1.00 28.25  ? 260 VAL B CG2   1 
ATOM   4620 N  N     . ASN B 1 285 ? 30.576 27.340 9.272   1.00 30.43  ? 261 ASN B N     1 
ATOM   4621 C  CA    . ASN B 1 285 ? 30.814 27.779 10.650  1.00 33.45  ? 261 ASN B CA    1 
ATOM   4622 C  C     . ASN B 1 285 ? 32.153 27.284 11.210  1.00 33.02  ? 261 ASN B C     1 
ATOM   4623 O  O     . ASN B 1 285 ? 32.663 26.234 10.803  1.00 36.30  ? 261 ASN B O     1 
ATOM   4624 C  CB    . ASN B 1 285 ? 29.678 27.303 11.569  1.00 42.69  ? 261 ASN B CB    1 
ATOM   4625 C  CG    . ASN B 1 285 ? 28.330 27.906 11.211  1.00 46.26  ? 261 ASN B CG    1 
ATOM   4626 O  OD1   . ASN B 1 285 ? 28.197 29.120 11.048  1.00 51.31  ? 261 ASN B OD1   1 
ATOM   4627 N  ND2   . ASN B 1 285 ? 27.316 27.056 11.100  1.00 46.99  ? 261 ASN B ND2   1 
ATOM   4628 N  N     . ALA B 1 286 ? 32.715 28.048 12.144  1.00 30.73  ? 262 ALA B N     1 
ATOM   4629 C  CA    . ALA B 1 286 ? 33.881 27.614 12.895  1.00 34.32  ? 262 ALA B CA    1 
ATOM   4630 C  C     . ALA B 1 286 ? 33.420 26.792 14.086  1.00 35.10  ? 262 ALA B C     1 
ATOM   4631 O  O     . ALA B 1 286 ? 32.370 27.065 14.662  1.00 32.46  ? 262 ALA B O     1 
ATOM   4632 C  CB    . ALA B 1 286 ? 34.689 28.813 13.365  1.00 32.38  ? 262 ALA B CB    1 
ATOM   4633 N  N     . ILE B 1 287 ? 34.202 25.782 14.455  1.00 41.26  ? 263 ILE B N     1 
ATOM   4634 C  CA    . ILE B 1 287 ? 33.872 24.982 15.638  1.00 43.98  ? 263 ILE B CA    1 
ATOM   4635 C  C     . ILE B 1 287 ? 33.956 25.868 16.881  1.00 42.77  ? 263 ILE B C     1 
ATOM   4636 O  O     . ILE B 1 287 ? 34.715 26.845 16.907  1.00 46.15  ? 263 ILE B O     1 
ATOM   4637 C  CB    . ILE B 1 287 ? 34.749 23.710 15.783  1.00 41.05  ? 263 ILE B CB    1 
ATOM   4638 C  CG1   . ILE B 1 287 ? 36.126 24.041 16.371  1.00 41.77  ? 263 ILE B CG1   1 
ATOM   4639 C  CG2   . ILE B 1 287 ? 34.866 22.971 14.451  1.00 47.14  ? 263 ILE B CG2   1 
ATOM   4640 C  CD1   . ILE B 1 287 ? 36.531 23.115 17.504  1.00 46.60  ? 263 ILE B CD1   1 
ATOM   4641 N  N     . ARG B 1 288 ? 33.159 25.549 17.895  1.00 50.39  ? 264 ARG B N     1 
ATOM   4642 C  CA    . ARG B 1 288 ? 33.154 26.338 19.120  1.00 53.46  ? 264 ARG B CA    1 
ATOM   4643 C  C     . ARG B 1 288 ? 34.294 25.881 20.027  1.00 51.88  ? 264 ARG B C     1 
ATOM   4644 O  O     . ARG B 1 288 ? 34.376 24.708 20.394  1.00 59.84  ? 264 ARG B O     1 
ATOM   4645 C  CB    . ARG B 1 288 ? 31.801 26.242 19.823  1.00 56.25  ? 264 ARG B CB    1 
ATOM   4646 C  CG    . ARG B 1 288 ? 31.283 27.576 20.338  1.00 62.24  ? 264 ARG B CG    1 
ATOM   4647 C  CD    . ARG B 1 288 ? 29.835 27.477 20.795  1.00 61.82  ? 264 ARG B CD    1 
ATOM   4648 N  NE    . ARG B 1 288 ? 28.920 27.139 19.701  1.00 56.97  ? 264 ARG B NE    1 
ATOM   4649 C  CZ    . ARG B 1 288 ? 27.630 26.842 19.860  1.00 53.36  ? 264 ARG B CZ    1 
ATOM   4650 N  NH1   . ARG B 1 288 ? 27.086 26.833 21.070  1.00 58.66  ? 264 ARG B NH1   1 
ATOM   4651 N  NH2   . ARG B 1 288 ? 26.882 26.542 18.805  1.00 50.48  ? 264 ARG B NH2   1 
ATOM   4652 N  N     . ILE B 1 289 ? 35.167 26.823 20.376  1.00 47.47  ? 265 ILE B N     1 
ATOM   4653 C  CA    . ILE B 1 289 ? 36.431 26.520 21.056  1.00 58.54  ? 265 ILE B CA    1 
ATOM   4654 C  C     . ILE B 1 289 ? 36.302 26.608 22.575  1.00 56.25  ? 265 ILE B C     1 
ATOM   4655 O  O     . ILE B 1 289 ? 35.641 27.509 23.098  1.00 58.98  ? 265 ILE B O     1 
ATOM   4656 C  CB    . ILE B 1 289 ? 37.566 27.466 20.577  1.00 54.73  ? 265 ILE B CB    1 
ATOM   4657 C  CG1   . ILE B 1 289 ? 37.683 27.463 19.047  1.00 57.11  ? 265 ILE B CG1   1 
ATOM   4658 C  CG2   . ILE B 1 289 ? 38.903 27.099 21.205  1.00 55.40  ? 265 ILE B CG2   1 
ATOM   4659 C  CD1   . ILE B 1 289 ? 38.301 26.210 18.454  1.00 57.93  ? 265 ILE B CD1   1 
ATOM   4660 N  N     . ARG B 1 290 ? 36.932 25.663 23.272  1.00 60.97  ? 266 ARG B N     1 
ATOM   4661 C  CA    . ARG B 1 290 ? 37.070 25.724 24.727  1.00 62.14  ? 266 ARG B CA    1 
ATOM   4662 C  C     . ARG B 1 290 ? 37.928 26.934 25.112  1.00 59.67  ? 266 ARG B C     1 
ATOM   4663 O  O     . ARG B 1 290 ? 37.493 27.809 25.863  1.00 53.83  ? 266 ARG B O     1 
ATOM   4664 C  CB    . ARG B 1 290 ? 37.707 24.441 25.273  1.00 71.44  ? 266 ARG B CB    1 
ATOM   4665 C  CG    . ARG B 1 290 ? 36.956 23.156 24.953  1.00 77.24  ? 266 ARG B CG    1 
ATOM   4666 C  CD    . ARG B 1 290 ? 37.636 21.963 25.607  1.00 76.18  ? 266 ARG B CD    1 
ATOM   4667 N  NE    . ARG B 1 290 ? 37.150 20.687 25.086  1.00 74.27  ? 266 ARG B NE    1 
ATOM   4668 C  CZ    . ARG B 1 290 ? 37.582 19.494 25.487  1.00 71.93  ? 266 ARG B CZ    1 
ATOM   4669 N  NH1   . ARG B 1 290 ? 38.517 19.396 26.424  1.00 77.69  ? 266 ARG B NH1   1 
ATOM   4670 N  NH2   . ARG B 1 290 ? 37.076 18.391 24.949  1.00 72.33  ? 266 ARG B NH2   1 
ATOM   4671 N  N     . GLU B 1 291 ? 39.146 26.969 24.575  1.00 59.67  ? 267 GLU B N     1 
ATOM   4672 C  CA    . GLU B 1 291 ? 40.099 28.043 24.824  1.00 58.21  ? 267 GLU B CA    1 
ATOM   4673 C  C     . GLU B 1 291 ? 41.102 28.109 23.673  1.00 50.59  ? 267 GLU B C     1 
ATOM   4674 O  O     . GLU B 1 291 ? 41.590 27.075 23.203  1.00 49.23  ? 267 GLU B O     1 
ATOM   4675 C  CB    . GLU B 1 291 ? 40.834 27.803 26.147  1.00 60.15  ? 267 GLU B CB    1 
ATOM   4676 C  CG    . GLU B 1 291 ? 41.717 28.954 26.605  1.00 63.69  ? 267 GLU B CG    1 
ATOM   4677 C  CD    . GLU B 1 291 ? 42.856 28.500 27.499  1.00 66.57  ? 267 GLU B CD    1 
ATOM   4678 O  OE1   . GLU B 1 291 ? 43.963 29.072 27.383  1.00 82.38  ? 267 GLU B OE1   1 
ATOM   4679 O  OE2   . GLU B 1 291 ? 42.655 27.573 28.311  1.00 66.67  ? 267 GLU B OE2   1 
ATOM   4680 N  N     . VAL B 1 292 ? 41.394 29.320 23.209  1.00 42.14  ? 268 VAL B N     1 
ATOM   4681 C  CA    . VAL B 1 292 ? 42.430 29.512 22.196  1.00 38.60  ? 268 VAL B CA    1 
ATOM   4682 C  C     . VAL B 1 292 ? 43.801 29.459 22.867  1.00 34.89  ? 268 VAL B C     1 
ATOM   4683 O  O     . VAL B 1 292 ? 44.166 30.348 23.647  1.00 41.14  ? 268 VAL B O     1 
ATOM   4684 C  CB    . VAL B 1 292 ? 42.243 30.827 21.405  1.00 36.58  ? 268 VAL B CB    1 
ATOM   4685 C  CG1   . VAL B 1 292 ? 43.394 31.042 20.436  1.00 33.32  ? 268 VAL B CG1   1 
ATOM   4686 C  CG2   . VAL B 1 292 ? 40.918 30.813 20.650  1.00 31.82  ? 268 VAL B CG2   1 
ATOM   4687 N  N     . VAL B 1 293 ? 44.538 28.390 22.581  1.00 30.01  ? 269 VAL B N     1 
ATOM   4688 C  CA    . VAL B 1 293 ? 45.862 28.180 23.148  1.00 29.62  ? 269 VAL B CA    1 
ATOM   4689 C  C     . VAL B 1 293 ? 46.913 28.925 22.339  1.00 25.31  ? 269 VAL B C     1 
ATOM   4690 O  O     . VAL B 1 293 ? 47.655 29.734 22.878  1.00 24.99  ? 269 VAL B O     1 
ATOM   4691 C  CB    . VAL B 1 293 ? 46.218 26.676 23.237  1.00 28.47  ? 269 VAL B CB    1 
ATOM   4692 C  CG1   . VAL B 1 293 ? 47.663 26.486 23.707  1.00 27.77  ? 269 VAL B CG1   1 
ATOM   4693 C  CG2   . VAL B 1 293 ? 45.239 25.954 24.159  1.00 31.42  ? 269 VAL B CG2   1 
ATOM   4694 N  N     . ASP B 1 294 ? 46.948 28.664 21.033  1.00 24.87  ? 270 ASP B N     1 
ATOM   4695 C  CA    . ASP B 1 294 ? 47.993 29.188 20.176  1.00 22.47  ? 270 ASP B CA    1 
ATOM   4696 C  C     . ASP B 1 294 ? 47.477 29.082 18.742  1.00 19.51  ? 270 ASP B C     1 
ATOM   4697 O  O     . ASP B 1 294 ? 47.252 27.977 18.242  1.00 20.09  ? 270 ASP B O     1 
ATOM   4698 C  CB    . ASP B 1 294 ? 49.290 28.382 20.414  1.00 22.76  ? 270 ASP B CB    1 
ATOM   4699 C  CG    . ASP B 1 294 ? 50.356 28.596 19.337  1.00 22.71  ? 270 ASP B CG    1 
ATOM   4700 O  OD1   . ASP B 1 294 ? 50.333 29.621 18.631  1.00 21.75  ? 270 ASP B OD1   1 
ATOM   4701 O  OD2   . ASP B 1 294 ? 51.239 27.720 19.211  1.00 28.38  ? 270 ASP B OD2   1 
ATOM   4702 N  N     . THR B 1 295 ? 47.272 30.230 18.100  1.00 16.90  ? 271 THR B N     1 
ATOM   4703 C  CA    . THR B 1 295 ? 46.695 30.259 16.739  1.00 18.39  ? 271 THR B CA    1 
ATOM   4704 C  C     . THR B 1 295 ? 47.652 29.765 15.643  1.00 18.54  ? 271 THR B C     1 
ATOM   4705 O  O     . THR B 1 295 ? 47.249 29.649 14.473  1.00 20.49  ? 271 THR B O     1 
ATOM   4706 C  CB    . THR B 1 295 ? 46.205 31.671 16.369  1.00 20.57  ? 271 THR B CB    1 
ATOM   4707 O  OG1   . THR B 1 295 ? 47.293 32.595 16.474  1.00 22.67  ? 271 THR B OG1   1 
ATOM   4708 C  CG2   . THR B 1 295 ? 45.069 32.113 17.287  1.00 23.72  ? 271 THR B CG2   1 
ATOM   4709 N  N     . THR B 1 296 ? 48.914 29.515 16.002  1.00 16.46  ? 272 THR B N     1 
ATOM   4710 C  CA    . THR B 1 296 ? 49.944 29.065 15.046  1.00 16.90  ? 272 THR B CA    1 
ATOM   4711 C  C     . THR B 1 296 ? 49.477 27.852 14.256  1.00 16.33  ? 272 THR B C     1 
ATOM   4712 O  O     . THR B 1 296 ? 49.130 26.826 14.837  1.00 16.22  ? 272 THR B O     1 
ATOM   4713 C  CB    . THR B 1 296 ? 51.291 28.723 15.734  1.00 17.73  ? 272 THR B CB    1 
ATOM   4714 O  OG1   . THR B 1 296 ? 51.757 29.855 16.472  1.00 17.31  ? 272 THR B OG1   1 
ATOM   4715 C  CG2   . THR B 1 296 ? 52.344 28.353 14.710  1.00 18.64  ? 272 THR B CG2   1 
ATOM   4716 N  N     . GLY B 1 297 ? 49.455 27.989 12.924  1.00 15.40  ? 273 GLY B N     1 
ATOM   4717 C  CA    . GLY B 1 297 ? 49.037 26.912 12.027  1.00 14.84  ? 273 GLY B CA    1 
ATOM   4718 C  C     . GLY B 1 297 ? 47.563 26.833 11.637  1.00 12.89  ? 273 GLY B C     1 
ATOM   4719 O  O     . GLY B 1 297 ? 47.158 25.875 10.957  1.00 13.51  ? 273 GLY B O     1 
ATOM   4720 N  N     . ALA B 1 298 ? 46.746 27.787 12.092  1.00 12.54  ? 274 ALA B N     1 
ATOM   4721 C  CA    . ALA B 1 298 ? 45.302 27.713 11.844  1.00 14.85  ? 274 ALA B CA    1 
ATOM   4722 C  C     . ALA B 1 298 ? 45.027 27.706 10.346  1.00 14.24  ? 274 ALA B C     1 
ATOM   4723 O  O     . ALA B 1 298 ? 44.302 26.849 9.871   1.00 15.00  ? 274 ALA B O     1 
ATOM   4724 C  CB    . ALA B 1 298 ? 44.550 28.855 12.470  1.00 15.12  ? 274 ALA B CB    1 
ATOM   4725 N  N     . GLY B 1 299 ? 45.630 28.655 9.643   1.00 15.48  ? 275 GLY B N     1 
ATOM   4726 C  CA    . GLY B 1 299 ? 45.440 28.774 8.179   1.00 16.52  ? 275 GLY B CA    1 
ATOM   4727 C  C     . GLY B 1 299 ? 46.005 27.565 7.470   1.00 13.29  ? 275 GLY B C     1 
ATOM   4728 O  O     . GLY B 1 299 ? 45.348 26.989 6.613   1.00 14.74  ? 275 GLY B O     1 
ATOM   4729 N  N     . ASP B 1 300 ? 47.205 27.139 7.878   1.00 14.70  ? 276 ASP B N     1 
ATOM   4730 C  CA    . ASP B 1 300 ? 47.852 25.969 7.286   1.00 12.97  ? 276 ASP B CA    1 
ATOM   4731 C  C     . ASP B 1 300 ? 46.970 24.740 7.336   1.00 13.58  ? 276 ASP B C     1 
ATOM   4732 O  O     . ASP B 1 300 ? 46.801 24.055 6.320   1.00 14.86  ? 276 ASP B O     1 
ATOM   4733 C  CB    . ASP B 1 300 ? 49.164 25.626 8.002   1.00 12.97  ? 276 ASP B CB    1 
ATOM   4734 C  CG    . ASP B 1 300 ? 50.107 26.797 8.121   1.00 15.06  ? 276 ASP B CG    1 
ATOM   4735 O  OD1   . ASP B 1 300 ? 50.066 27.722 7.286   1.00 16.69  ? 276 ASP B OD1   1 
ATOM   4736 O  OD2   . ASP B 1 300 ? 50.921 26.780 9.072   1.00 15.98  ? 276 ASP B OD2   1 
ATOM   4737 N  N     . LEU B 1 301 ? 46.384 24.484 8.502   1.00 11.86  ? 277 LEU B N     1 
ATOM   4738 C  CA    . LEU B 1 301 ? 45.566 23.298 8.709   1.00 12.63  ? 277 LEU B CA    1 
ATOM   4739 C  C     . LEU B 1 301 ? 44.167 23.407 8.093   1.00 12.08  ? 277 LEU B C     1 
ATOM   4740 O  O     . LEU B 1 301 ? 43.577 22.385 7.746   1.00 12.79  ? 277 LEU B O     1 
ATOM   4741 C  CB    . LEU B 1 301 ? 45.472 22.944 10.192  1.00 12.58  ? 277 LEU B CB    1 
ATOM   4742 C  CG    . LEU B 1 301 ? 46.626 22.062 10.699  1.00 12.13  ? 277 LEU B CG    1 
ATOM   4743 C  CD1   . LEU B 1 301 ? 46.506 20.641 10.171  1.00 15.66  ? 277 LEU B CD1   1 
ATOM   4744 C  CD2   . LEU B 1 301 ? 48.022 22.582 10.409  1.00 11.72  ? 277 LEU B CD2   1 
ATOM   4745 N  N     . PHE B 1 302 ? 43.636 24.622 8.012   1.00 14.21  ? 278 PHE B N     1 
ATOM   4746 C  CA    . PHE B 1 302 ? 42.446 24.862 7.155   1.00 12.45  ? 278 PHE B CA    1 
ATOM   4747 C  C     . PHE B 1 302 ? 42.696 24.339 5.730   1.00 13.16  ? 278 PHE B C     1 
ATOM   4748 O  O     . PHE B 1 302 ? 41.856 23.604 5.188   1.00 13.48  ? 278 PHE B O     1 
ATOM   4749 C  CB    . PHE B 1 302 ? 42.021 26.335 7.112   1.00 12.81  ? 278 PHE B CB    1 
ATOM   4750 C  CG    . PHE B 1 302 ? 40.807 26.581 6.213   1.00 13.27  ? 278 PHE B CG    1 
ATOM   4751 C  CD1   . PHE B 1 302 ? 39.515 26.430 6.706   1.00 15.37  ? 278 PHE B CD1   1 
ATOM   4752 C  CD2   . PHE B 1 302 ? 40.972 26.890 4.865   1.00 15.03  ? 278 PHE B CD2   1 
ATOM   4753 C  CE1   . PHE B 1 302 ? 38.405 26.635 5.890   1.00 18.41  ? 278 PHE B CE1   1 
ATOM   4754 C  CE2   . PHE B 1 302 ? 39.866 27.081 4.041   1.00 16.45  ? 278 PHE B CE2   1 
ATOM   4755 C  CZ    . PHE B 1 302 ? 38.584 26.958 4.551   1.00 17.26  ? 278 PHE B CZ    1 
ATOM   4756 N  N     . ALA B 1 303 ? 43.853 24.685 5.170   1.00 12.07  ? 279 ALA B N     1 
ATOM   4757 C  CA    . ALA B 1 303 ? 44.247 24.198 3.837   1.00 12.75  ? 279 ALA B CA    1 
ATOM   4758 C  C     . ALA B 1 303 ? 44.391 22.687 3.838   1.00 12.50  ? 279 ALA B C     1 
ATOM   4759 O  O     . ALA B 1 303 ? 44.007 22.032 2.866   1.00 14.77  ? 279 ALA B O     1 
ATOM   4760 C  CB    . ALA B 1 303 ? 45.521 24.889 3.347   1.00 13.84  ? 279 ALA B CB    1 
ATOM   4761 N  N     . SER B 1 304 ? 44.923 22.105 4.930   1.00 11.50  ? 280 SER B N     1 
ATOM   4762 C  CA    . SER B 1 304 ? 45.016 20.670 4.992   1.00 11.34  ? 280 SER B CA    1 
ATOM   4763 C  C     . SER B 1 304 ? 43.655 19.987 4.807   1.00 13.97  ? 280 SER B C     1 
ATOM   4764 O  O     . SER B 1 304 ? 43.528 19.026 4.029   1.00 15.73  ? 280 SER B O     1 
ATOM   4765 C  CB    . SER B 1 304 ? 45.636 20.223 6.340   1.00 12.39  ? 280 SER B CB    1 
ATOM   4766 O  OG    . SER B 1 304 ? 46.989 20.634 6.436   1.00 14.48  ? 280 SER B OG    1 
ATOM   4767 N  N     . GLY B 1 305 ? 42.659 20.454 5.564   1.00 13.69  ? 281 GLY B N     1 
ATOM   4768 C  CA    . GLY B 1 305 ? 41.325 19.852 5.568   1.00 15.97  ? 281 GLY B CA    1 
ATOM   4769 C  C     . GLY B 1 305 ? 40.637 20.102 4.244   1.00 15.53  ? 281 GLY B C     1 
ATOM   4770 O  O     . GLY B 1 305 ? 40.048 19.166 3.648   1.00 17.61  ? 281 GLY B O     1 
ATOM   4771 N  N     . PHE B 1 306 ? 40.737 21.344 3.770   1.00 16.65  ? 282 PHE B N     1 
ATOM   4772 C  CA    . PHE B 1 306 ? 40.128 21.721 2.475   1.00 16.57  ? 282 PHE B CA    1 
ATOM   4773 C  C     . PHE B 1 306 ? 40.684 20.884 1.316   1.00 18.09  ? 282 PHE B C     1 
ATOM   4774 O  O     . PHE B 1 306 ? 39.916 20.313 0.476   1.00 17.05  ? 282 PHE B O     1 
ATOM   4775 C  CB    . PHE B 1 306 ? 40.282 23.216 2.185   1.00 15.00  ? 282 PHE B CB    1 
ATOM   4776 C  CG    . PHE B 1 306 ? 39.506 23.656 0.966   1.00 16.86  ? 282 PHE B CG    1 
ATOM   4777 C  CD1   . PHE B 1 306 ? 39.945 23.302 -0.297  1.00 17.64  ? 282 PHE B CD1   1 
ATOM   4778 C  CD2   . PHE B 1 306 ? 38.318 24.378 1.097   1.00 20.23  ? 282 PHE B CD2   1 
ATOM   4779 C  CE1   . PHE B 1 306 ? 39.209 23.663 -1.424  1.00 17.87  ? 282 PHE B CE1   1 
ATOM   4780 C  CE2   . PHE B 1 306 ? 37.578 24.752 -0.023  1.00 20.21  ? 282 PHE B CE2   1 
ATOM   4781 C  CZ    . PHE B 1 306 ? 38.032 24.391 -1.279  1.00 18.53  ? 282 PHE B CZ    1 
ATOM   4782 N  N     . LEU B 1 307 ? 42.012 20.817 1.250   1.00 17.65  ? 283 LEU B N     1 
ATOM   4783 C  CA    . LEU B 1 307 ? 42.670 20.101 0.169   1.00 16.47  ? 283 LEU B CA    1 
ATOM   4784 C  C     . LEU B 1 307 ? 42.484 18.583 0.268   1.00 14.63  ? 283 LEU B C     1 
ATOM   4785 O  O     . LEU B 1 307 ? 42.356 17.923 -0.749  1.00 16.45  ? 283 LEU B O     1 
ATOM   4786 C  CB    . LEU B 1 307 ? 44.143 20.519 0.029   1.00 18.55  ? 283 LEU B CB    1 
ATOM   4787 C  CG    . LEU B 1 307 ? 44.434 21.974 -0.358  1.00 17.04  ? 283 LEU B CG    1 
ATOM   4788 C  CD1   . LEU B 1 307 ? 45.930 22.306 -0.275  1.00 18.96  ? 283 LEU B CD1   1 
ATOM   4789 C  CD2   . LEU B 1 307 ? 43.841 22.322 -1.739  1.00 19.15  ? 283 LEU B CD2   1 
ATOM   4790 N  N     . TYR B 1 308 ? 42.412 18.050 1.492   1.00 13.88  ? 284 TYR B N     1 
ATOM   4791 C  CA    . TYR B 1 308 ? 42.074 16.643 1.693   1.00 14.88  ? 284 TYR B CA    1 
ATOM   4792 C  C     . TYR B 1 308 ? 40.674 16.386 1.138   1.00 15.84  ? 284 TYR B C     1 
ATOM   4793 O  O     . TYR B 1 308 ? 40.489 15.524 0.257   1.00 19.85  ? 284 TYR B O     1 
ATOM   4794 C  CB    . TYR B 1 308 ? 42.145 16.260 3.183   1.00 16.90  ? 284 TYR B CB    1 
ATOM   4795 C  CG    . TYR B 1 308 ? 41.592 14.869 3.511   1.00 16.48  ? 284 TYR B CG    1 
ATOM   4796 C  CD1   . TYR B 1 308 ? 42.337 13.711 3.266   1.00 18.04  ? 284 TYR B CD1   1 
ATOM   4797 C  CD2   . TYR B 1 308 ? 40.310 14.718 4.050   1.00 18.27  ? 284 TYR B CD2   1 
ATOM   4798 C  CE1   . TYR B 1 308 ? 41.818 12.439 3.534   1.00 21.27  ? 284 TYR B CE1   1 
ATOM   4799 C  CE2   . TYR B 1 308 ? 39.792 13.458 4.341   1.00 26.01  ? 284 TYR B CE2   1 
ATOM   4800 C  CZ    . TYR B 1 308 ? 40.551 12.321 4.086   1.00 23.93  ? 284 TYR B CZ    1 
ATOM   4801 O  OH    . TYR B 1 308 ? 40.045 11.072 4.390   1.00 26.44  ? 284 TYR B OH    1 
ATOM   4802 N  N     . GLY B 1 309 ? 39.703 17.175 1.594   1.00 14.90  ? 285 GLY B N     1 
ATOM   4803 C  CA    . GLY B 1 309 ? 38.340 17.030 1.086   1.00 18.69  ? 285 GLY B CA    1 
ATOM   4804 C  C     . GLY B 1 309 ? 38.284 17.187 -0.428  1.00 18.81  ? 285 GLY B C     1 
ATOM   4805 O  O     . GLY B 1 309 ? 37.646 16.378 -1.129  1.00 20.00  ? 285 GLY B O     1 
ATOM   4806 N  N     . TYR B 1 310 ? 38.979 18.198 -0.937  1.00 19.10  ? 286 TYR B N     1 
ATOM   4807 C  CA    . TYR B 1 310 ? 38.988 18.507 -2.373  1.00 18.58  ? 286 TYR B CA    1 
ATOM   4808 C  C     . TYR B 1 310 ? 39.502 17.351 -3.232  1.00 19.34  ? 286 TYR B C     1 
ATOM   4809 O  O     . TYR B 1 310 ? 38.920 17.032 -4.276  1.00 22.51  ? 286 TYR B O     1 
ATOM   4810 C  CB    . TYR B 1 310 ? 39.771 19.798 -2.638  1.00 17.77  ? 286 TYR B CB    1 
ATOM   4811 C  CG    . TYR B 1 310 ? 39.617 20.338 -4.061  1.00 17.67  ? 286 TYR B CG    1 
ATOM   4812 C  CD1   . TYR B 1 310 ? 38.525 21.136 -4.416  1.00 21.49  ? 286 TYR B CD1   1 
ATOM   4813 C  CD2   . TYR B 1 310 ? 40.574 20.058 -5.037  1.00 18.69  ? 286 TYR B CD2   1 
ATOM   4814 C  CE1   . TYR B 1 310 ? 38.397 21.644 -5.703  1.00 22.72  ? 286 TYR B CE1   1 
ATOM   4815 C  CE2   . TYR B 1 310 ? 40.448 20.550 -6.332  1.00 24.19  ? 286 TYR B CE2   1 
ATOM   4816 C  CZ    . TYR B 1 310 ? 39.358 21.343 -6.656  1.00 24.68  ? 286 TYR B CZ    1 
ATOM   4817 O  OH    . TYR B 1 310 ? 39.232 21.851 -7.921  1.00 30.51  ? 286 TYR B OH    1 
ATOM   4818 N  N     . THR B 1 311 ? 40.549 16.685 -2.775  1.00 16.81  ? 287 THR B N     1 
ATOM   4819 C  CA    . THR B 1 311 ? 41.148 15.617 -3.569  1.00 16.07  ? 287 THR B CA    1 
ATOM   4820 C  C     . THR B 1 311 ? 40.440 14.283 -3.387  1.00 19.29  ? 287 THR B C     1 
ATOM   4821 O  O     . THR B 1 311 ? 40.769 13.286 -4.065  1.00 26.37  ? 287 THR B O     1 
ATOM   4822 C  CB    . THR B 1 311 ? 42.651 15.475 -3.288  1.00 19.90  ? 287 THR B CB    1 
ATOM   4823 O  OG1   . THR B 1 311 ? 42.881 15.411 -1.873  1.00 22.60  ? 287 THR B OG1   1 
ATOM   4824 C  CG2   . THR B 1 311 ? 43.392 16.656 -3.889  1.00 21.37  ? 287 THR B CG2   1 
ATOM   4825 N  N     . GLN B 1 312 ? 39.470 14.269 -2.479  1.00 19.52  ? 288 GLN B N     1 
ATOM   4826 C  CA    . GLN B 1 312 ? 38.667 13.082 -2.213  1.00 22.88  ? 288 GLN B CA    1 
ATOM   4827 C  C     . GLN B 1 312 ? 37.332 13.193 -2.945  1.00 23.87  ? 288 GLN B C     1 
ATOM   4828 O  O     . GLN B 1 312 ? 36.506 12.275 -2.896  1.00 31.15  ? 288 GLN B O     1 
ATOM   4829 C  CB    . GLN B 1 312 ? 38.428 12.909 -0.708  1.00 23.59  ? 288 GLN B CB    1 
ATOM   4830 C  CG    . GLN B 1 312 ? 39.645 12.410 0.071   1.00 21.22  ? 288 GLN B CG    1 
ATOM   4831 C  CD    . GLN B 1 312 ? 40.261 11.155 -0.521  1.00 29.37  ? 288 GLN B CD    1 
ATOM   4832 O  OE1   . GLN B 1 312 ? 41.445 11.130 -0.855  1.00 37.36  ? 288 GLN B OE1   1 
ATOM   4833 N  NE2   . GLN B 1 312 ? 39.458 10.114 -0.668  1.00 31.66  ? 288 GLN B NE2   1 
ATOM   4834 N  N     . GLY B 1 313 ? 37.129 14.334 -3.601  1.00 23.11  ? 289 GLY B N     1 
ATOM   4835 C  CA    . GLY B 1 313 ? 35.939 14.572 -4.415  1.00 25.89  ? 289 GLY B CA    1 
ATOM   4836 C  C     . GLY B 1 313 ? 34.754 15.100 -3.630  1.00 22.64  ? 289 GLY B C     1 
ATOM   4837 O  O     . GLY B 1 313 ? 33.619 15.002 -4.067  1.00 28.14  ? 289 GLY B O     1 
ATOM   4838 N  N     . ARG B 1 314 ? 35.024 15.662 -2.458  1.00 23.78  ? 290 ARG B N     1 
ATOM   4839 C  CA    . ARG B 1 314 ? 33.969 16.186 -1.604  1.00 21.70  ? 290 ARG B CA    1 
ATOM   4840 C  C     . ARG B 1 314 ? 33.454 17.531 -2.121  1.00 21.98  ? 290 ARG B C     1 
ATOM   4841 O  O     . ARG B 1 314 ? 34.134 18.187 -2.901  1.00 22.49  ? 290 ARG B O     1 
ATOM   4842 C  CB    . ARG B 1 314 ? 34.478 16.294 -0.163  1.00 22.56  ? 290 ARG B CB    1 
ATOM   4843 C  CG    . ARG B 1 314 ? 35.048 14.983 0.352   1.00 24.92  ? 290 ARG B CG    1 
ATOM   4844 C  CD    . ARG B 1 314 ? 33.986 13.895 0.467   1.00 24.83  ? 290 ARG B CD    1 
ATOM   4845 N  NE    . ARG B 1 314 ? 32.946 14.266 1.424   1.00 28.74  ? 290 ARG B NE    1 
ATOM   4846 C  CZ    . ARG B 1 314 ? 33.015 14.031 2.730   1.00 27.81  ? 290 ARG B CZ    1 
ATOM   4847 N  NH1   . ARG B 1 314 ? 32.028 14.409 3.537   1.00 29.31  ? 290 ARG B NH1   1 
ATOM   4848 N  NH2   . ARG B 1 314 ? 34.074 13.420 3.226   1.00 26.44  ? 290 ARG B NH2   1 
ATOM   4849 N  N     . SER B 1 315 ? 32.244 17.901 -1.694  1.00 21.82  ? 291 SER B N     1 
ATOM   4850 C  CA    . SER B 1 315 ? 31.621 19.176 -2.011  1.00 20.69  ? 291 SER B CA    1 
ATOM   4851 C  C     . SER B 1 315 ? 32.458 20.334 -1.467  1.00 19.05  ? 291 SER B C     1 
ATOM   4852 O  O     . SER B 1 315 ? 33.183 20.182 -0.488  1.00 18.04  ? 291 SER B O     1 
ATOM   4853 C  CB    . SER B 1 315 ? 30.194 19.230 -1.445  1.00 20.76  ? 291 SER B CB    1 
ATOM   4854 O  OG    . SER B 1 315 ? 30.181 19.441 -0.030  1.00 21.94  ? 291 SER B OG    1 
ATOM   4855 N  N     . LEU B 1 316 ? 32.376 21.490 -2.108  1.00 19.41  ? 292 LEU B N     1 
ATOM   4856 C  CA    . LEU B 1 316 ? 33.137 22.657 -1.625  1.00 20.32  ? 292 LEU B CA    1 
ATOM   4857 C  C     . LEU B 1 316 ? 32.770 23.025 -0.178  1.00 20.74  ? 292 LEU B C     1 
ATOM   4858 O  O     . LEU B 1 316 ? 33.623 23.509 0.586   1.00 25.43  ? 292 LEU B O     1 
ATOM   4859 C  CB    . LEU B 1 316 ? 32.987 23.846 -2.574  1.00 23.98  ? 292 LEU B CB    1 
ATOM   4860 C  CG    . LEU B 1 316 ? 33.650 23.746 -3.956  1.00 26.05  ? 292 LEU B CG    1 
ATOM   4861 C  CD1   . LEU B 1 316 ? 33.267 24.964 -4.782  1.00 22.06  ? 292 LEU B CD1   1 
ATOM   4862 C  CD2   . LEU B 1 316 ? 35.174 23.610 -3.886  1.00 24.18  ? 292 LEU B CD2   1 
ATOM   4863 N  N     . GLU B 1 317 ? 31.523 22.762 0.211   1.00 20.96  ? 293 GLU B N     1 
ATOM   4864 C  CA    . GLU B 1 317 ? 31.092 22.998 1.597   1.00 20.41  ? 293 GLU B CA    1 
ATOM   4865 C  C     . GLU B 1 317 ? 31.786 22.032 2.550   1.00 19.86  ? 293 GLU B C     1 
ATOM   4866 O  O     . GLU B 1 317 ? 32.264 22.442 3.614   1.00 23.67  ? 293 GLU B O     1 
ATOM   4867 C  CB    . GLU B 1 317 ? 29.571 22.912 1.780   1.00 23.05  ? 293 GLU B CB    1 
ATOM   4868 C  CG    . GLU B 1 317 ? 29.141 23.405 3.164   1.00 25.27  ? 293 GLU B CG    1 
ATOM   4869 C  CD    . GLU B 1 317 ? 27.704 23.091 3.521   1.00 30.43  ? 293 GLU B CD    1 
ATOM   4870 O  OE1   . GLU B 1 317 ? 27.349 21.901 3.608   1.00 34.71  ? 293 GLU B OE1   1 
ATOM   4871 O  OE2   . GLU B 1 317 ? 26.930 24.043 3.733   1.00 36.40  ? 293 GLU B OE2   1 
ATOM   4872 N  N     . ASP B 1 318 ? 31.819 20.756 2.169   1.00 20.41  ? 294 ASP B N     1 
ATOM   4873 C  CA    . ASP B 1 318 ? 32.451 19.703 2.975   1.00 18.62  ? 294 ASP B CA    1 
ATOM   4874 C  C     . ASP B 1 318 ? 33.952 19.880 3.108   1.00 18.77  ? 294 ASP B C     1 
ATOM   4875 O  O     . ASP B 1 318 ? 34.534 19.544 4.153   1.00 18.94  ? 294 ASP B O     1 
ATOM   4876 C  CB    . ASP B 1 318 ? 32.109 18.308 2.429   1.00 21.29  ? 294 ASP B CB    1 
ATOM   4877 C  CG    . ASP B 1 318 ? 30.723 17.838 2.860   1.00 25.95  ? 294 ASP B CG    1 
ATOM   4878 O  OD1   . ASP B 1 318 ? 30.042 18.572 3.612   1.00 28.17  ? 294 ASP B OD1   1 
ATOM   4879 O  OD2   . ASP B 1 318 ? 30.310 16.734 2.447   1.00 32.94  ? 294 ASP B OD2   1 
ATOM   4880 N  N     . CYS B 1 319 ? 34.571 20.427 2.063   1.00 20.59  ? 295 CYS B N     1 
ATOM   4881 C  CA    . CYS B 1 319 ? 35.980 20.807 2.130   1.00 19.57  ? 295 CYS B CA    1 
ATOM   4882 C  C     . CYS B 1 319 ? 36.140 21.910 3.172   1.00 17.69  ? 295 CYS B C     1 
ATOM   4883 O  O     . CYS B 1 319 ? 37.034 21.851 4.017   1.00 21.83  ? 295 CYS B O     1 
ATOM   4884 C  CB    . CYS B 1 319 ? 36.486 21.283 0.770   1.00 20.09  ? 295 CYS B CB    1 
ATOM   4885 S  SG    . CYS B 1 319 ? 36.418 20.051 -0.551  1.00 21.04  ? 295 CYS B SG    1 
ATOM   4886 N  N     . GLY B 1 320 ? 35.263 22.910 3.112   1.00 17.37  ? 296 GLY B N     1 
ATOM   4887 C  CA    . GLY B 1 320 ? 35.223 23.980 4.119   1.00 18.73  ? 296 GLY B CA    1 
ATOM   4888 C  C     . GLY B 1 320 ? 35.097 23.433 5.530   1.00 18.51  ? 296 GLY B C     1 
ATOM   4889 O  O     . GLY B 1 320 ? 35.838 23.852 6.433   1.00 19.66  ? 296 GLY B O     1 
ATOM   4890 N  N     . LYS B 1 321 ? 34.174 22.487 5.717   1.00 19.99  ? 297 LYS B N     1 
ATOM   4891 C  CA    . LYS B 1 321 ? 33.940 21.877 7.019   1.00 19.73  ? 297 LYS B CA    1 
ATOM   4892 C  C     . LYS B 1 321 ? 35.180 21.177 7.546   1.00 17.16  ? 297 LYS B C     1 
ATOM   4893 O  O     . LYS B 1 321 ? 35.536 21.324 8.721   1.00 16.63  ? 297 LYS B O     1 
ATOM   4894 C  CB    . LYS B 1 321 ? 32.757 20.901 6.971   1.00 22.98  ? 297 LYS B CB    1 
ATOM   4895 C  CG    . LYS B 1 321 ? 31.412 21.544 6.666   1.00 22.77  ? 297 LYS B CG    1 
ATOM   4896 C  CD    . LYS B 1 321 ? 30.275 20.624 7.097   1.00 27.99  ? 297 LYS B CD    1 
ATOM   4897 C  CE    . LYS B 1 321 ? 28.939 21.074 6.517   1.00 33.52  ? 297 LYS B CE    1 
ATOM   4898 N  NZ    . LYS B 1 321 ? 27.815 20.194 6.954   1.00 41.84  ? 297 LYS B NZ    1 
ATOM   4899 N  N     . LEU B 1 322 ? 35.838 20.416 6.672   1.00 16.33  ? 298 LEU B N     1 
ATOM   4900 C  CA    . LEU B 1 322 ? 37.049 19.686 7.047   1.00 15.69  ? 298 LEU B CA    1 
ATOM   4901 C  C     . LEU B 1 322 ? 38.175 20.657 7.414   1.00 14.29  ? 298 LEU B C     1 
ATOM   4902 O  O     . LEU B 1 322 ? 38.919 20.435 8.382   1.00 17.55  ? 298 LEU B O     1 
ATOM   4903 C  CB    . LEU B 1 322 ? 37.474 18.748 5.926   1.00 16.60  ? 298 LEU B CB    1 
ATOM   4904 C  CG    . LEU B 1 322 ? 36.712 17.420 5.795   1.00 17.31  ? 298 LEU B CG    1 
ATOM   4905 C  CD1   . LEU B 1 322 ? 36.764 16.924 4.356   1.00 19.38  ? 298 LEU B CD1   1 
ATOM   4906 C  CD2   . LEU B 1 322 ? 37.295 16.391 6.751   1.00 21.89  ? 298 LEU B CD2   1 
ATOM   4907 N  N     . GLY B 1 323 ? 38.274 21.739 6.652   1.00 13.79  ? 299 GLY B N     1 
ATOM   4908 C  CA    . GLY B 1 323 ? 39.211 22.824 6.930   1.00 14.74  ? 299 GLY B CA    1 
ATOM   4909 C  C     . GLY B 1 323 ? 38.995 23.418 8.299   1.00 14.44  ? 299 GLY B C     1 
ATOM   4910 O  O     . GLY B 1 323 ? 39.952 23.499 9.109   1.00 16.93  ? 299 GLY B O     1 
ATOM   4911 N  N     . CYS B 1 324 ? 37.750 23.783 8.591   1.00 13.91  ? 300 CYS B N     1 
ATOM   4912 C  CA    . CYS B 1 324 ? 37.439 24.380 9.895   1.00 15.95  ? 300 CYS B CA    1 
ATOM   4913 C  C     . CYS B 1 324 ? 37.703 23.400 11.052  1.00 16.50  ? 300 CYS B C     1 
ATOM   4914 O  O     . CYS B 1 324 ? 38.104 23.806 12.148  1.00 17.71  ? 300 CYS B O     1 
ATOM   4915 C  CB    . CYS B 1 324 ? 36.000 24.898 9.936   1.00 19.58  ? 300 CYS B CB    1 
ATOM   4916 S  SG    . CYS B 1 324 ? 35.761 26.391 8.950   1.00 22.72  ? 300 CYS B SG    1 
ATOM   4917 N  N     . LEU B 1 325 ? 37.470 22.121 10.800  1.00 15.92  ? 301 LEU B N     1 
ATOM   4918 C  CA    . LEU B 1 325 ? 37.693 21.094 11.801  1.00 17.97  ? 301 LEU B CA    1 
ATOM   4919 C  C     . LEU B 1 325 ? 39.182 21.002 12.112  1.00 18.43  ? 301 LEU B C     1 
ATOM   4920 O  O     . LEU B 1 325 ? 39.583 21.116 13.282  1.00 19.64  ? 301 LEU B O     1 
ATOM   4921 C  CB    . LEU B 1 325 ? 37.106 19.747 11.355  1.00 18.71  ? 301 LEU B CB    1 
ATOM   4922 C  CG    . LEU B 1 325 ? 37.449 18.537 12.225  1.00 19.66  ? 301 LEU B CG    1 
ATOM   4923 C  CD1   . LEU B 1 325 ? 36.865 18.675 13.629  1.00 23.29  ? 301 LEU B CD1   1 
ATOM   4924 C  CD2   . LEU B 1 325 ? 36.926 17.268 11.577  1.00 19.98  ? 301 LEU B CD2   1 
ATOM   4925 N  N     . ALA B 1 326 ? 40.006 20.862 11.077  1.00 16.58  ? 302 ALA B N     1 
ATOM   4926 C  CA    . ALA B 1 326 ? 41.466 20.774 11.297  1.00 16.61  ? 302 ALA B CA    1 
ATOM   4927 C  C     . ALA B 1 326 ? 42.023 22.059 11.933  1.00 15.48  ? 302 ALA B C     1 
ATOM   4928 O  O     . ALA B 1 326 ? 42.777 22.014 12.930  1.00 15.13  ? 302 ALA B O     1 
ATOM   4929 C  CB    . ALA B 1 326 ? 42.165 20.447 9.990   1.00 18.14  ? 302 ALA B CB    1 
ATOM   4930 N  N     . ALA B 1 327 ? 41.639 23.208 11.385  1.00 13.92  ? 303 ALA B N     1 
ATOM   4931 C  CA    . ALA B 1 327 ? 42.012 24.495 11.994  1.00 17.47  ? 303 ALA B CA    1 
ATOM   4932 C  C     . ALA B 1 327 ? 41.618 24.603 13.490  1.00 17.14  ? 303 ALA B C     1 
ATOM   4933 O  O     . ALA B 1 327 ? 42.433 24.995 14.330  1.00 16.24  ? 303 ALA B O     1 
ATOM   4934 C  CB    . ALA B 1 327 ? 41.438 25.650 11.187  1.00 16.21  ? 303 ALA B CB    1 
ATOM   4935 N  N     . GLY B 1 328 ? 40.373 24.247 13.810  1.00 18.86  ? 304 GLY B N     1 
ATOM   4936 C  CA    . GLY B 1 328 ? 39.852 24.288 15.176  1.00 17.59  ? 304 GLY B CA    1 
ATOM   4937 C  C     . GLY B 1 328 ? 40.683 23.465 16.149  1.00 16.52  ? 304 GLY B C     1 
ATOM   4938 O  O     . GLY B 1 328 ? 40.952 23.921 17.276  1.00 21.74  ? 304 GLY B O     1 
ATOM   4939 N  N     . ILE B 1 329 ? 41.117 22.292 15.706  1.00 15.70  ? 305 ILE B N     1 
ATOM   4940 C  CA    . ILE B 1 329 ? 41.956 21.377 16.518  1.00 17.34  ? 305 ILE B CA    1 
ATOM   4941 C  C     . ILE B 1 329 ? 43.350 21.959 16.781  1.00 17.72  ? 305 ILE B C     1 
ATOM   4942 O  O     . ILE B 1 329 ? 43.809 22.000 17.936  1.00 20.62  ? 305 ILE B O     1 
ATOM   4943 C  CB    . ILE B 1 329 ? 42.042 19.973 15.863  1.00 15.45  ? 305 ILE B CB    1 
ATOM   4944 C  CG1   . ILE B 1 329 ? 40.664 19.330 15.900  1.00 19.13  ? 305 ILE B CG1   1 
ATOM   4945 C  CG2   . ILE B 1 329 ? 43.123 19.094 16.523  1.00 18.25  ? 305 ILE B CG2   1 
ATOM   4946 C  CD1   . ILE B 1 329 ? 40.469 18.205 14.917  1.00 19.71  ? 305 ILE B CD1   1 
ATOM   4947 N  N     . VAL B 1 330 ? 44.017 22.430 15.729  1.00 16.30  ? 306 VAL B N     1 
ATOM   4948 C  CA    . VAL B 1 330 ? 45.387 22.933 15.861  1.00 17.07  ? 306 VAL B CA    1 
ATOM   4949 C  C     . VAL B 1 330 ? 45.508 24.142 16.805  1.00 18.53  ? 306 VAL B C     1 
ATOM   4950 O  O     . VAL B 1 330 ? 46.532 24.294 17.466  1.00 21.86  ? 306 VAL B O     1 
ATOM   4951 C  CB    . VAL B 1 330 ? 46.072 23.196 14.498  1.00 17.92  ? 306 VAL B CB    1 
ATOM   4952 C  CG1   . VAL B 1 330 ? 45.641 24.525 13.892  1.00 16.19  ? 306 VAL B CG1   1 
ATOM   4953 C  CG2   . VAL B 1 330 ? 47.588 23.101 14.637  1.00 17.57  ? 306 VAL B CG2   1 
ATOM   4954 N  N     . ILE B 1 331 ? 44.468 24.974 16.901  1.00 18.60  ? 307 ILE B N     1 
ATOM   4955 C  CA    . ILE B 1 331 ? 44.549 26.176 17.761  1.00 18.34  ? 307 ILE B CA    1 
ATOM   4956 C  C     . ILE B 1 331 ? 44.331 25.910 19.265  1.00 20.36  ? 307 ILE B C     1 
ATOM   4957 O  O     . ILE B 1 331 ? 44.462 26.821 20.082  1.00 22.64  ? 307 ILE B O     1 
ATOM   4958 C  CB    . ILE B 1 331 ? 43.662 27.343 17.277  1.00 17.91  ? 307 ILE B CB    1 
ATOM   4959 C  CG1   . ILE B 1 331 ? 42.189 27.083 17.592  1.00 18.90  ? 307 ILE B CG1   1 
ATOM   4960 C  CG2   . ILE B 1 331 ? 43.903 27.615 15.792  1.00 19.49  ? 307 ILE B CG2   1 
ATOM   4961 C  CD1   . ILE B 1 331 ? 41.320 28.320 17.450  1.00 24.13  ? 307 ILE B CD1   1 
ATOM   4962 N  N     . GLN B 1 332 ? 44.004 24.665 19.597  1.00 21.31  ? 308 GLN B N     1 
ATOM   4963 C  CA    . GLN B 1 332 ? 43.799 24.244 20.991  1.00 22.96  ? 308 GLN B CA    1 
ATOM   4964 C  C     . GLN B 1 332 ? 45.005 23.507 21.557  1.00 22.45  ? 308 GLN B C     1 
ATOM   4965 O  O     . GLN B 1 332 ? 44.907 22.853 22.604  1.00 26.35  ? 308 GLN B O     1 
ATOM   4966 C  CB    . GLN B 1 332 ? 42.550 23.372 21.110  1.00 24.74  ? 308 GLN B CB    1 
ATOM   4967 C  CG    . GLN B 1 332 ? 41.255 24.084 20.759  1.00 28.82  ? 308 GLN B CG    1 
ATOM   4968 C  CD    . GLN B 1 332 ? 40.058 23.166 20.873  1.00 32.39  ? 308 GLN B CD    1 
ATOM   4969 O  OE1   . GLN B 1 332 ? 39.652 22.792 21.972  1.00 38.60  ? 308 GLN B OE1   1 
ATOM   4970 N  NE2   . GLN B 1 332 ? 39.486 22.793 19.735  1.00 34.33  ? 308 GLN B NE2   1 
ATOM   4971 N  N     . GLN B 1 333 ? 46.136 23.614 20.864  1.00 21.92  ? 309 GLN B N     1 
ATOM   4972 C  CA    . GLN B 1 333 ? 47.407 23.034 21.317  1.00 24.04  ? 309 GLN B CA    1 
ATOM   4973 C  C     . GLN B 1 333 ? 48.572 23.976 21.015  1.00 22.56  ? 309 GLN B C     1 
ATOM   4974 O  O     . GLN B 1 333 ? 48.455 24.898 20.178  1.00 22.97  ? 309 GLN B O     1 
ATOM   4975 C  CB    . GLN B 1 333 ? 47.665 21.667 20.653  1.00 24.56  ? 309 GLN B CB    1 
ATOM   4976 C  CG    . GLN B 1 333 ? 47.678 21.688 19.122  1.00 24.57  ? 309 GLN B CG    1 
ATOM   4977 C  CD    . GLN B 1 333 ? 48.470 20.545 18.518  1.00 23.46  ? 309 GLN B CD    1 
ATOM   4978 O  OE1   . GLN B 1 333 ? 48.106 19.378 18.662  1.00 24.34  ? 309 GLN B OE1   1 
ATOM   4979 N  NE2   . GLN B 1 333 ? 49.568 20.880 17.834  1.00 22.20  ? 309 GLN B NE2   1 
ATOM   4980 N  N     . ILE B 1 334 ? 49.686 23.735 21.701  1.00 24.07  ? 310 ILE B N     1 
ATOM   4981 C  CA    . ILE B 1 334 ? 50.967 24.356 21.404  1.00 25.41  ? 310 ILE B CA    1 
ATOM   4982 C  C     . ILE B 1 334 ? 51.620 23.594 20.261  1.00 27.20  ? 310 ILE B C     1 
ATOM   4983 O  O     . ILE B 1 334 ? 51.673 22.363 20.276  1.00 27.83  ? 310 ILE B O     1 
ATOM   4984 C  CB    . ILE B 1 334 ? 51.919 24.291 22.626  1.00 29.94  ? 310 ILE B CB    1 
ATOM   4985 C  CG1   . ILE B 1 334 ? 51.205 24.768 23.888  1.00 30.99  ? 310 ILE B CG1   1 
ATOM   4986 C  CG2   . ILE B 1 334 ? 53.197 25.076 22.352  1.00 34.05  ? 310 ILE B CG2   1 
ATOM   4987 C  CD1   . ILE B 1 334 ? 51.910 24.364 25.171  1.00 29.57  ? 310 ILE B CD1   1 
ATOM   4988 N  N     . GLY B 1 335 ? 52.130 24.327 19.276  1.00 28.23  ? 311 GLY B N     1 
ATOM   4989 C  CA    . GLY B 1 335 ? 52.761 23.690 18.125  1.00 30.68  ? 311 GLY B CA    1 
ATOM   4990 C  C     . GLY B 1 335 ? 51.862 23.723 16.901  1.00 25.04  ? 311 GLY B C     1 
ATOM   4991 O  O     . GLY B 1 335 ? 50.635 23.639 17.018  1.00 23.32  ? 311 GLY B O     1 
ATOM   4992 N  N     . PRO B 1 336 ? 52.465 23.846 15.714  1.00 21.22  ? 312 PRO B N     1 
ATOM   4993 C  CA    . PRO B 1 336 ? 51.721 24.078 14.464  1.00 18.81  ? 312 PRO B CA    1 
ATOM   4994 C  C     . PRO B 1 336 ? 51.146 22.814 13.804  1.00 18.59  ? 312 PRO B C     1 
ATOM   4995 O  O     . PRO B 1 336 ? 50.402 22.912 12.812  1.00 20.19  ? 312 PRO B O     1 
ATOM   4996 C  CB    . PRO B 1 336 ? 52.776 24.700 13.563  1.00 17.78  ? 312 PRO B CB    1 
ATOM   4997 C  CG    . PRO B 1 336 ? 54.073 24.150 14.040  1.00 19.24  ? 312 PRO B CG    1 
ATOM   4998 C  CD    . PRO B 1 336 ? 53.927 23.890 15.514  1.00 20.31  ? 312 PRO B CD    1 
ATOM   4999 N  N     . ARG B 1 337 ? 51.507 21.640 14.312  1.00 18.46  ? 313 ARG B N     1 
ATOM   5000 C  CA    . ARG B 1 337 ? 51.045 20.402 13.697  1.00 21.20  ? 313 ARG B CA    1 
ATOM   5001 C  C     . ARG B 1 337 ? 50.320 19.564 14.730  1.00 22.70  ? 313 ARG B C     1 
ATOM   5002 O  O     . ARG B 1 337 ? 50.896 19.229 15.758  1.00 25.33  ? 313 ARG B O     1 
ATOM   5003 C  CB    . ARG B 1 337 ? 52.201 19.620 13.067  1.00 17.95  ? 313 ARG B CB    1 
ATOM   5004 C  CG    . ARG B 1 337 ? 53.102 20.460 12.184  1.00 17.04  ? 313 ARG B CG    1 
ATOM   5005 C  CD    . ARG B 1 337 ? 53.950 19.584 11.283  1.00 18.71  ? 313 ARG B CD    1 
ATOM   5006 N  NE    . ARG B 1 337 ? 54.826 20.387 10.444  1.00 13.75  ? 313 ARG B NE    1 
ATOM   5007 C  CZ    . ARG B 1 337 ? 55.959 19.955 9.921   1.00 11.89  ? 313 ARG B CZ    1 
ATOM   5008 N  NH1   . ARG B 1 337 ? 56.359 18.693 10.100  1.00 14.85  ? 313 ARG B NH1   1 
ATOM   5009 N  NH2   . ARG B 1 337 ? 56.684 20.788 9.208   1.00 13.06  ? 313 ARG B NH2   1 
ATOM   5010 N  N     . PRO B 1 338 ? 49.038 19.255 14.465  1.00 23.15  ? 314 PRO B N     1 
ATOM   5011 C  CA    . PRO B 1 338 ? 48.192 18.487 15.372  1.00 21.56  ? 314 PRO B CA    1 
ATOM   5012 C  C     . PRO B 1 338 ? 48.864 17.219 15.872  1.00 22.35  ? 314 PRO B C     1 
ATOM   5013 O  O     . PRO B 1 338 ? 49.367 16.418 15.082  1.00 27.07  ? 314 PRO B O     1 
ATOM   5014 C  CB    . PRO B 1 338 ? 46.999 18.127 14.496  1.00 22.71  ? 314 PRO B CB    1 
ATOM   5015 C  CG    . PRO B 1 338 ? 46.866 19.300 13.593  1.00 23.90  ? 314 PRO B CG    1 
ATOM   5016 C  CD    . PRO B 1 338 ? 48.283 19.708 13.275  1.00 23.87  ? 314 PRO B CD    1 
HETATM 5017 N  N     . MSE B 1 339 ? 48.863 17.043 17.185  1.00 23.47  ? 315 MSE B N     1 
HETATM 5018 C  CA    . MSE B 1 339 ? 49.502 15.889 17.813  1.00 23.75  ? 315 MSE B CA    1 
HETATM 5019 C  C     . MSE B 1 339 ? 48.507 14.774 17.994  1.00 25.27  ? 315 MSE B C     1 
HETATM 5020 O  O     . MSE B 1 339 ? 48.869 13.663 18.431  1.00 29.39  ? 315 MSE B O     1 
HETATM 5021 C  CB    . MSE B 1 339 ? 50.023 16.378 19.147  1.00 27.54  ? 315 MSE B CB    1 
HETATM 5022 C  CG    . MSE B 1 339 ? 51.160 17.362 18.914  1.00 37.02  ? 315 MSE B CG    1 
HETATM 5023 SE SE    . MSE B 1 339 ? 51.869 17.876 20.672  1.00 68.53  ? 315 MSE B SE    1 
HETATM 5024 C  CE    . MSE B 1 339 ? 50.489 19.191 21.180  1.00 41.26  ? 315 MSE B CE    1 
ATOM   5025 N  N     . THR B 1 340 ? 47.245 15.071 17.664  1.00 22.77  ? 316 THR B N     1 
ATOM   5026 C  CA    . THR B 1 340 ? 46.154 14.096 17.701  1.00 24.60  ? 316 THR B CA    1 
ATOM   5027 C  C     . THR B 1 340 ? 45.756 13.632 16.305  1.00 24.98  ? 316 THR B C     1 
ATOM   5028 O  O     . THR B 1 340 ? 46.227 14.175 15.302  1.00 25.31  ? 316 THR B O     1 
ATOM   5029 C  CB    . THR B 1 340 ? 44.905 14.634 18.423  1.00 29.45  ? 316 THR B CB    1 
ATOM   5030 O  OG1   . THR B 1 340 ? 44.561 15.919 17.912  1.00 28.24  ? 316 THR B OG1   1 
ATOM   5031 C  CG2   . THR B 1 340 ? 45.145 14.721 19.938  1.00 30.94  ? 316 THR B CG2   1 
ATOM   5032 N  N     . SER B 1 341 ? 44.892 12.629 16.240  1.00 26.46  ? 317 SER B N     1 
ATOM   5033 C  CA    . SER B 1 341 ? 44.485 12.085 14.944  1.00 24.35  ? 317 SER B CA    1 
ATOM   5034 C  C     . SER B 1 341 ? 43.382 12.901 14.279  1.00 21.80  ? 317 SER B C     1 
ATOM   5035 O  O     . SER B 1 341 ? 42.232 12.950 14.747  1.00 25.62  ? 317 SER B O     1 
ATOM   5036 C  CB    . SER B 1 341 ? 44.075 10.620 15.055  1.00 21.90  ? 317 SER B CB    1 
ATOM   5037 O  OG    . SER B 1 341 ? 43.534 10.165 13.827  1.00 24.79  ? 317 SER B OG    1 
ATOM   5038 N  N     . LEU B 1 342 ? 43.739 13.541 13.178  1.00 21.82  ? 318 LEU B N     1 
ATOM   5039 C  CA    . LEU B 1 342 ? 42.756 14.300 12.404  1.00 19.65  ? 318 LEU B CA    1 
ATOM   5040 C  C     . LEU B 1 342 ? 41.720 13.388 11.767  1.00 19.46  ? 318 LEU B C     1 
ATOM   5041 O  O     . LEU B 1 342 ? 40.523 13.718 11.768  1.00 20.73  ? 318 LEU B O     1 
ATOM   5042 C  CB    . LEU B 1 342 ? 43.424 15.156 11.326  1.00 20.12  ? 318 LEU B CB    1 
ATOM   5043 C  CG    . LEU B 1 342 ? 44.259 16.349 11.794  1.00 19.10  ? 318 LEU B CG    1 
ATOM   5044 C  CD1   . LEU B 1 342 ? 44.815 17.109 10.597  1.00 20.00  ? 318 LEU B CD1   1 
ATOM   5045 C  CD2   . LEU B 1 342 ? 43.470 17.289 12.697  1.00 19.66  ? 318 LEU B CD2   1 
ATOM   5046 N  N     . SER B 1 343 ? 42.170 12.250 11.241  1.00 19.79  ? 319 SER B N     1 
ATOM   5047 C  CA    . SER B 1 343 ? 41.251 11.316 10.565  1.00 21.54  ? 319 SER B CA    1 
ATOM   5048 C  C     . SER B 1 343 ? 40.191 10.820 11.554  1.00 22.25  ? 319 SER B C     1 
ATOM   5049 O  O     . SER B 1 343 ? 39.005 10.728 11.221  1.00 22.78  ? 319 SER B O     1 
ATOM   5050 C  CB    . SER B 1 343 ? 41.986 10.161 9.880   1.00 22.20  ? 319 SER B CB    1 
ATOM   5051 O  OG    . SER B 1 343 ? 42.626 9.303  10.818  1.00 26.00  ? 319 SER B OG    1 
ATOM   5052 N  N     . GLU B 1 344 ? 40.620 10.557 12.788  1.00 23.25  ? 320 GLU B N     1 
ATOM   5053 C  CA    . GLU B 1 344 ? 39.700 10.118 13.829  1.00 25.65  ? 320 GLU B CA    1 
ATOM   5054 C  C     . GLU B 1 344 ? 38.722 11.230 14.177  1.00 22.94  ? 320 GLU B C     1 
ATOM   5055 O  O     . GLU B 1 344 ? 37.525 10.979 14.285  1.00 26.57  ? 320 GLU B O     1 
ATOM   5056 C  CB    . GLU B 1 344 ? 40.451 9.604  15.067  1.00 27.32  ? 320 GLU B CB    1 
ATOM   5057 C  CG    . GLU B 1 344 ? 41.092 8.226  14.883  1.00 31.84  ? 320 GLU B CG    1 
ATOM   5058 C  CD    . GLU B 1 344 ? 40.070 7.103  14.710  1.00 37.55  ? 320 GLU B CD    1 
ATOM   5059 O  OE1   . GLU B 1 344 ? 39.014 7.145  15.382  1.00 45.87  ? 320 GLU B OE1   1 
ATOM   5060 O  OE2   . GLU B 1 344 ? 40.318 6.171  13.906  1.00 42.88  ? 320 GLU B OE2   1 
ATOM   5061 N  N     . ALA B 1 345 ? 39.235 12.455 14.323  1.00 19.68  ? 321 ALA B N     1 
ATOM   5062 C  CA    . ALA B 1 345 ? 38.396 13.617 14.580  1.00 19.11  ? 321 ALA B CA    1 
ATOM   5063 C  C     . ALA B 1 345 ? 37.344 13.776 13.477  1.00 21.12  ? 321 ALA B C     1 
ATOM   5064 O  O     . ALA B 1 345 ? 36.167 14.020 13.760  1.00 19.26  ? 321 ALA B O     1 
ATOM   5065 C  CB    . ALA B 1 345 ? 39.253 14.872 14.693  1.00 20.21  ? 321 ALA B CB    1 
ATOM   5066 N  N     . ALA B 1 346 ? 37.779 13.609 12.227  1.00 21.36  ? 322 ALA B N     1 
ATOM   5067 C  CA    . ALA B 1 346 ? 36.900 13.719 11.055  1.00 21.46  ? 322 ALA B CA    1 
ATOM   5068 C  C     . ALA B 1 346 ? 35.840 12.611 11.004  1.00 21.33  ? 322 ALA B C     1 
ATOM   5069 O  O     . ALA B 1 346 ? 34.729 12.830 10.508  1.00 23.68  ? 322 ALA B O     1 
ATOM   5070 C  CB    . ALA B 1 346 ? 37.725 13.725 9.779   1.00 20.02  ? 322 ALA B CB    1 
ATOM   5071 N  N     . LYS B 1 347 ? 36.191 11.428 11.499  1.00 19.95  ? 323 LYS B N     1 
ATOM   5072 C  CA    . LYS B 1 347 ? 35.247 10.295 11.562  1.00 22.13  ? 323 LYS B CA    1 
ATOM   5073 C  C     . LYS B 1 347 ? 34.184 10.549 12.630  1.00 22.64  ? 323 LYS B C     1 
ATOM   5074 O  O     . LYS B 1 347 ? 33.004 10.291 12.426  1.00 26.75  ? 323 LYS B O     1 
ATOM   5075 C  CB    . LYS B 1 347 ? 35.963 8.985  11.859  1.00 26.93  ? 323 LYS B CB    1 
ATOM   5076 C  CG    . LYS B 1 347 ? 36.786 8.392  10.733  1.00 27.89  ? 323 LYS B CG    1 
ATOM   5077 C  CD    . LYS B 1 347 ? 37.553 7.184  11.256  1.00 32.69  ? 323 LYS B CD    1 
ATOM   5078 C  CE    . LYS B 1 347 ? 38.453 6.537  10.210  1.00 36.58  ? 323 LYS B CE    1 
ATOM   5079 N  NZ    . LYS B 1 347 ? 39.222 5.398  10.802  1.00 36.47  ? 323 LYS B NZ    1 
ATOM   5080 N  N     . GLN B 1 348 ? 34.620 11.067 13.773  1.00 24.30  ? 324 GLN B N     1 
ATOM   5081 C  CA    . GLN B 1 348 ? 33.715 11.411 14.853  1.00 26.49  ? 324 GLN B CA    1 
ATOM   5082 C  C     . GLN B 1 348 ? 32.739 12.509 14.424  1.00 22.99  ? 324 GLN B C     1 
ATOM   5083 O  O     . GLN B 1 348 ? 31.587 12.532 14.874  1.00 24.99  ? 324 GLN B O     1 
ATOM   5084 C  CB    . GLN B 1 348 ? 34.512 11.843 16.079  1.00 29.25  ? 324 GLN B CB    1 
ATOM   5085 C  CG    . GLN B 1 348 ? 33.660 12.342 17.232  1.00 31.17  ? 324 GLN B CG    1 
ATOM   5086 C  CD    . GLN B 1 348 ? 34.485 12.875 18.389  1.00 38.09  ? 324 GLN B CD    1 
ATOM   5087 O  OE1   . GLN B 1 348 ? 34.051 12.836 19.535  1.00 40.24  ? 324 GLN B OE1   1 
ATOM   5088 N  NE2   . GLN B 1 348 ? 35.680 13.377 18.092  1.00 44.40  ? 324 GLN B NE2   1 
ATOM   5089 N  N     . ALA B 1 349 ? 33.205 13.397 13.542  1.00 20.21  ? 325 ALA B N     1 
ATOM   5090 C  CA    . ALA B 1 349 ? 32.457 14.571 13.120  1.00 22.44  ? 325 ALA B CA    1 
ATOM   5091 C  C     . ALA B 1 349 ? 31.536 14.248 11.941  1.00 25.43  ? 325 ALA B C     1 
ATOM   5092 O  O     . ALA B 1 349 ? 30.825 15.124 11.432  1.00 27.10  ? 325 ALA B O     1 
ATOM   5093 C  CB    . ALA B 1 349 ? 33.418 15.699 12.770  1.00 22.90  ? 325 ALA B CB    1 
ATOM   5094 N  N     . GLY B 1 350 ? 31.546 12.984 11.526  1.00 26.65  ? 326 GLY B N     1 
ATOM   5095 C  CA    . GLY B 1 350 ? 30.753 12.521 10.382  1.00 27.00  ? 326 GLY B CA    1 
ATOM   5096 C  C     . GLY B 1 350 ? 31.222 13.016 9.020   1.00 26.99  ? 326 GLY B C     1 
ATOM   5097 O  O     . GLY B 1 350 ? 30.512 12.847 8.012   1.00 29.54  ? 326 GLY B O     1 
ATOM   5098 N  N     . LEU B 1 351 ? 32.411 13.620 8.983   1.00 24.65  ? 327 LEU B N     1 
ATOM   5099 C  CA    . LEU B 1 351 ? 32.989 14.135 7.745   1.00 28.81  ? 327 LEU B CA    1 
ATOM   5100 C  C     . LEU B 1 351 ? 33.738 13.026 7.013   1.00 31.12  ? 327 LEU B C     1 
ATOM   5101 O  O     . LEU B 1 351 ? 33.924 13.089 5.792   1.00 39.97  ? 327 LEU B O     1 
ATOM   5102 C  CB    . LEU B 1 351 ? 33.887 15.358 8.011   1.00 27.90  ? 327 LEU B CB    1 
ATOM   5103 C  CG    . LEU B 1 351 ? 33.285 16.515 8.819   1.00 26.87  ? 327 LEU B CG    1 
ATOM   5104 C  CD1   . LEU B 1 351 ? 34.309 17.630 9.006   1.00 26.84  ? 327 LEU B CD1   1 
ATOM   5105 C  CD2   . LEU B 1 351 ? 32.017 17.065 8.177   1.00 26.90  ? 327 LEU B CD2   1 
ATOM   5106 N  N     . ILE B 1 352 ? 34.145 12.021 7.786   1.00 32.23  ? 328 ILE B N     1 
ATOM   5107 C  CA    . ILE B 1 352 ? 34.726 10.759 7.314   1.00 38.37  ? 328 ILE B CA    1 
ATOM   5108 C  C     . ILE B 1 352 ? 36.129 10.908 6.721   1.00 40.71  ? 328 ILE B C     1 
ATOM   5109 O  O     . ILE B 1 352 ? 37.067 10.228 7.161   1.00 46.20  ? 328 ILE B O     1 
ATOM   5110 C  CB    . ILE B 1 352 ? 33.772 9.988  6.353   1.00 41.76  ? 328 ILE B CB    1 
ATOM   5111 C  CG1   . ILE B 1 352 ? 32.331 9.920  6.920   1.00 39.02  ? 328 ILE B CG1   1 
ATOM   5112 C  CG2   . ILE B 1 352 ? 34.331 8.609  6.006   1.00 39.41  ? 328 ILE B CG2   1 
ATOM   5113 C  CD1   . ILE B 1 352 ? 32.195 9.322  8.310   1.00 43.07  ? 328 ILE B CD1   1 
HETATM 5114 O  "O5'" . ADN C 2 .   ? 63.398 13.351 34.773  1.00 19.41  ? 401 ADN A "O5'" 1 
HETATM 5115 C  "C5'" . ADN C 2 .   ? 63.021 13.610 33.397  1.00 17.06  ? 401 ADN A "C5'" 1 
HETATM 5116 C  "C4'" . ADN C 2 .   ? 64.238 14.098 32.647  1.00 14.64  ? 401 ADN A "C4'" 1 
HETATM 5117 O  "O4'" . ADN C 2 .   ? 65.226 13.069 32.678  1.00 14.42  ? 401 ADN A "O4'" 1 
HETATM 5118 C  "C3'" . ADN C 2 .   ? 64.028 14.364 31.158  1.00 13.53  ? 401 ADN A "C3'" 1 
HETATM 5119 O  "O3'" . ADN C 2 .   ? 63.865 15.757 30.927  1.00 12.56  ? 401 ADN A "O3'" 1 
HETATM 5120 C  "C2'" . ADN C 2 .   ? 65.304 13.845 30.509  1.00 14.62  ? 401 ADN A "C2'" 1 
HETATM 5121 O  "O2'" . ADN C 2 .   ? 66.024 14.840 29.812  1.00 14.95  ? 401 ADN A "O2'" 1 
HETATM 5122 C  "C1'" . ADN C 2 .   ? 66.170 13.444 31.699  1.00 13.60  ? 401 ADN A "C1'" 1 
HETATM 5123 N  N9    . ADN C 2 .   ? 67.115 12.337 31.437  1.00 14.74  ? 401 ADN A N9    1 
HETATM 5124 C  C8    . ADN C 2 .   ? 66.947 11.273 30.636  1.00 14.63  ? 401 ADN A C8    1 
HETATM 5125 N  N7    . ADN C 2 .   ? 68.027 10.465 30.640  1.00 15.81  ? 401 ADN A N7    1 
HETATM 5126 C  C5    . ADN C 2 .   ? 68.918 11.011 31.492  1.00 15.85  ? 401 ADN A C5    1 
HETATM 5127 C  C6    . ADN C 2 .   ? 70.276 10.676 31.960  1.00 14.86  ? 401 ADN A C6    1 
HETATM 5128 N  N6    . ADN C 2 .   ? 70.905 9.550  31.553  1.00 14.00  ? 401 ADN A N6    1 
HETATM 5129 N  N1    . ADN C 2 .   ? 70.850 11.538 32.842  1.00 14.53  ? 401 ADN A N1    1 
HETATM 5130 C  C2    . ADN C 2 .   ? 70.235 12.660 33.272  1.00 12.59  ? 401 ADN A C2    1 
HETATM 5131 N  N3    . ADN C 2 .   ? 69.001 13.039 32.898  1.00 13.35  ? 401 ADN A N3    1 
HETATM 5132 C  C4    . ADN C 2 .   ? 68.312 12.253 32.012  1.00 14.67  ? 401 ADN A C4    1 
HETATM 5133 O  O8    . E34 D 3 .   ? 75.148 11.129 14.949  1.00 27.65  ? 402 E34 A O8    1 
HETATM 5134 C  C4    . E34 D 3 .   ? 75.693 10.926 16.033  1.00 20.15  ? 402 E34 A C4    1 
HETATM 5135 O  O7    . E34 D 3 .   ? 74.870 10.590 17.189  1.00 20.30  ? 402 E34 A O7    1 
HETATM 5136 C  C11   . E34 D 3 .   ? 73.494 10.895 17.291  1.00 18.48  ? 402 E34 A C11   1 
HETATM 5137 C  C13   . E34 D 3 .   ? 72.827 9.643  17.792  1.00 22.57  ? 402 E34 A C13   1 
HETATM 5138 C  C1    . E34 D 3 .   ? 77.177 11.028 16.209  1.00 19.07  ? 402 E34 A C1    1 
HETATM 5139 C  C3    . E34 D 3 .   ? 77.768 10.569 17.396  1.00 19.42  ? 402 E34 A C3    1 
HETATM 5140 C  C6    . E34 D 3 .   ? 79.139 10.652 17.601  1.00 19.58  ? 402 E34 A C6    1 
HETATM 5141 C  C9    . E34 D 3 .   ? 79.959 11.187 16.610  1.00 19.13  ? 402 E34 A C9    1 
HETATM 5142 N  N12   . E34 D 3 .   ? 81.287 11.252 16.827  1.00 22.53  ? 402 E34 A N12   1 
HETATM 5143 C  C5    . E34 D 3 .   ? 79.378 11.635 15.413  1.00 19.49  ? 402 E34 A C5    1 
HETATM 5144 N  N10   . E34 D 3 .   ? 80.159 12.155 14.440  1.00 24.48  ? 402 E34 A N10   1 
HETATM 5145 C  C2    . E34 D 3 .   ? 78.007 11.557 15.215  1.00 19.91  ? 402 E34 A C2    1 
HETATM 5146 S  S     . DMS E 4 .   ? 68.521 10.734 17.321  1.00 27.44  ? 403 DMS A S     1 
HETATM 5147 O  O     . DMS E 4 .   ? 69.635 10.782 18.283  1.00 24.47  ? 403 DMS A O     1 
HETATM 5148 C  C1    . DMS E 4 .   ? 67.940 12.318 17.103  1.00 27.67  ? 403 DMS A C1    1 
HETATM 5149 C  C2    . DMS E 4 .   ? 69.181 10.376 15.789  1.00 30.55  ? 403 DMS A C2    1 
HETATM 5150 K  K     . K   F 5 .   ? 55.693 17.012 31.957  1.00 43.41  ? 404 K   A K     1 
HETATM 5151 O  "O5'" . ADN G 2 .   ? 51.486 29.319 9.865   1.00 18.12  ? 401 ADN B "O5'" 1 
HETATM 5152 C  "C5'" . ADN G 2 .   ? 52.351 29.076 11.003  1.00 15.76  ? 401 ADN B "C5'" 1 
HETATM 5153 C  "C4'" . ADN G 2 .   ? 53.695 28.587 10.497  1.00 13.70  ? 401 ADN B "C4'" 1 
HETATM 5154 O  "O4'" . ADN G 2 .   ? 54.290 29.596 9.673   1.00 14.01  ? 401 ADN B "O4'" 1 
HETATM 5155 C  "C3'" . ADN G 2 .   ? 54.749 28.340 11.585  1.00 12.93  ? 401 ADN B "C3'" 1 
HETATM 5156 O  "O3'" . ADN G 2 .   ? 54.851 26.935 11.803  1.00 13.46  ? 401 ADN B "O3'" 1 
HETATM 5157 C  "C2'" . ADN G 2 .   ? 56.037 28.890 10.988  1.00 14.60  ? 401 ADN B "C2'" 1 
HETATM 5158 O  "O2'" . ADN G 2 .   ? 57.079 27.941 10.909  1.00 14.39  ? 401 ADN B "O2'" 1 
HETATM 5159 C  "C1'" . ADN G 2 .   ? 55.658 29.257 9.559   1.00 14.63  ? 401 ADN B "C1'" 1 
HETATM 5160 N  N9    . ADN G 2 .   ? 56.445 30.386 9.020   1.00 15.11  ? 401 ADN B N9    1 
HETATM 5161 C  C8    . ADN G 2 .   ? 56.959 31.452 9.659   1.00 14.21  ? 401 ADN B C8    1 
HETATM 5162 N  N7    . ADN G 2 .   ? 57.612 32.274 8.802   1.00 15.24  ? 401 ADN B N7    1 
HETATM 5163 C  C5    . ADN G 2 .   ? 57.498 31.728 7.562   1.00 16.01  ? 401 ADN B C5    1 
HETATM 5164 C  C6    . ADN G 2 .   ? 57.959 32.054 6.193   1.00 14.04  ? 401 ADN B C6    1 
HETATM 5165 N  N6    . ADN G 2 .   ? 58.662 33.184 5.946   1.00 12.86  ? 401 ADN B N6    1 
HETATM 5166 N  N1    . ADN G 2 .   ? 57.620 31.183 5.190   1.00 12.42  ? 401 ADN B N1    1 
HETATM 5167 C  C2    . ADN G 2 .   ? 56.913 30.059 5.409   1.00 12.79  ? 401 ADN B C2    1 
HETATM 5168 N  N3    . ADN G 2 .   ? 56.453 29.698 6.636   1.00 14.16  ? 401 ADN B N3    1 
HETATM 5169 C  C4    . ADN G 2 .   ? 56.733 30.479 7.714   1.00 14.79  ? 401 ADN B C4    1 
HETATM 5170 S  S     . DMS H 4 .   ? 68.323 32.152 16.630  1.00 31.39  ? 402 DMS B S     1 
HETATM 5171 O  O     . DMS H 4 .   ? 68.518 31.956 15.175  1.00 27.22  ? 402 DMS B O     1 
HETATM 5172 C  C1    . DMS H 4 .   ? 67.931 30.639 17.303  1.00 26.32  ? 402 DMS B C1    1 
HETATM 5173 C  C2    . DMS H 4 .   ? 69.832 32.518 17.340  1.00 30.57  ? 402 DMS B C2    1 
HETATM 5174 S  S     . DMS I 4 .   ? 72.032 31.791 12.497  1.00 47.17  ? 403 DMS B S     1 
HETATM 5175 O  O     . DMS I 4 .   ? 72.839 31.801 13.741  1.00 53.38  ? 403 DMS B O     1 
HETATM 5176 C  C1    . DMS I 4 .   ? 70.795 32.956 12.637  1.00 36.69  ? 403 DMS B C1    1 
HETATM 5177 C  C2    . DMS I 4 .   ? 72.985 32.431 11.234  1.00 45.54  ? 403 DMS B C2    1 
HETATM 5178 K  K     . K   J 5 .   ? 48.887 25.735 17.608  1.00 43.08  ? 404 K   B K     1 
HETATM 5179 O  O     . HOH K 6 .   ? 75.268 16.943 26.139  1.00 22.50  ? 501 HOH A O     1 
HETATM 5180 O  O     . HOH K 6 .   ? 56.080 5.362  28.261  1.00 19.60  ? 502 HOH A O     1 
HETATM 5181 O  O     . HOH K 6 .   ? 72.998 8.354  32.944  1.00 18.08  ? 503 HOH A O     1 
HETATM 5182 O  O     . HOH K 6 .   ? 80.960 9.074  36.653  1.00 22.09  ? 504 HOH A O     1 
HETATM 5183 O  O     . HOH K 6 .   ? 56.235 7.683  18.416  1.00 25.96  ? 505 HOH A O     1 
HETATM 5184 O  O     . HOH K 6 .   ? 68.570 23.695 29.234  1.00 17.97  ? 506 HOH A O     1 
HETATM 5185 O  O     . HOH K 6 .   ? 77.915 26.983 35.348  1.00 24.29  ? 507 HOH A O     1 
HETATM 5186 O  O     . HOH K 6 .   ? 70.845 17.404 34.010  1.00 19.67  ? 508 HOH A O     1 
HETATM 5187 O  O     . HOH K 6 .   ? 62.312 3.647  38.429  1.00 32.99  ? 509 HOH A O     1 
HETATM 5188 O  O     . HOH K 6 .   ? 77.536 23.701 47.842  1.00 28.20  ? 510 HOH A O     1 
HETATM 5189 O  O     . HOH K 6 .   ? 82.218 11.856 32.563  1.00 27.95  ? 511 HOH A O     1 
HETATM 5190 O  O     . HOH K 6 .   ? 59.203 22.268 28.868  1.00 32.00  ? 512 HOH A O     1 
HETATM 5191 O  O     . HOH K 6 .   ? 58.007 0.527  16.167  1.00 28.34  ? 513 HOH A O     1 
HETATM 5192 O  O     . HOH K 6 .   ? 67.011 16.160 39.382  1.00 23.34  ? 514 HOH A O     1 
HETATM 5193 O  O     . HOH K 6 .   ? 49.884 4.353  25.130  1.00 30.50  ? 515 HOH A O     1 
HETATM 5194 O  O     . HOH K 6 .   ? 77.430 17.945 16.831  1.00 24.03  ? 516 HOH A O     1 
HETATM 5195 O  O     . HOH K 6 .   ? 67.575 -8.379 49.114  1.00 27.94  ? 517 HOH A O     1 
HETATM 5196 O  O     . HOH K 6 .   ? 68.744 3.350  34.061  1.00 22.77  ? 518 HOH A O     1 
HETATM 5197 O  O     . HOH K 6 .   ? 60.637 12.288 35.084  1.00 21.80  ? 519 HOH A O     1 
HETATM 5198 O  O     . HOH K 6 .   ? 49.826 7.799  24.484  1.00 37.55  ? 520 HOH A O     1 
HETATM 5199 O  O     . HOH K 6 .   ? 79.333 22.538 27.884  1.00 20.37  ? 521 HOH A O     1 
HETATM 5200 O  O     . HOH K 6 .   ? 66.003 1.412  24.167  1.00 23.68  ? 522 HOH A O     1 
HETATM 5201 O  O     . HOH K 6 .   ? 64.432 10.960 35.479  1.00 26.25  ? 523 HOH A O     1 
HETATM 5202 O  O     . HOH K 6 .   ? 74.738 6.804  25.626  1.00 25.26  ? 524 HOH A O     1 
HETATM 5203 O  O     . HOH K 6 .   ? 62.089 15.459 15.915  1.00 20.30  ? 525 HOH A O     1 
HETATM 5204 O  O     . HOH K 6 .   ? 62.145 22.507 28.626  1.00 23.64  ? 526 HOH A O     1 
HETATM 5205 O  O     . HOH K 6 .   ? 75.039 32.037 54.125  1.00 37.89  ? 527 HOH A O     1 
HETATM 5206 O  O     . HOH K 6 .   ? 72.306 0.768  22.470  1.00 30.52  ? 528 HOH A O     1 
HETATM 5207 O  O     . HOH K 6 .   ? 67.684 12.248 38.364  1.00 20.46  ? 529 HOH A O     1 
HETATM 5208 O  O     . HOH K 6 .   ? 81.601 19.147 24.635  1.00 21.35  ? 530 HOH A O     1 
HETATM 5209 O  O     . HOH K 6 .   ? 81.780 17.413 22.413  1.00 26.18  ? 531 HOH A O     1 
HETATM 5210 O  O     . HOH K 6 .   ? 67.238 8.110  12.318  1.00 31.96  ? 532 HOH A O     1 
HETATM 5211 O  O     . HOH K 6 .   ? 72.322 27.696 13.437  1.00 23.47  ? 533 HOH A O     1 
HETATM 5212 O  O     . HOH K 6 .   ? 77.617 5.374  20.610  1.00 31.35  ? 534 HOH A O     1 
HETATM 5213 O  O     . HOH K 6 .   ? 53.261 13.059 19.981  1.00 46.21  ? 535 HOH A O     1 
HETATM 5214 O  O     . HOH K 6 .   ? 51.338 21.112 48.201  1.00 31.11  ? 536 HOH A O     1 
HETATM 5215 O  O     . HOH K 6 .   ? 75.732 24.197 14.486  1.00 51.70  ? 537 HOH A O     1 
HETATM 5216 O  O     . HOH K 6 .   ? 59.588 11.559 38.137  1.00 33.74  ? 538 HOH A O     1 
HETATM 5217 O  O     . HOH K 6 .   ? 78.044 35.922 48.012  1.00 38.66  ? 539 HOH A O     1 
HETATM 5218 O  O     . HOH K 6 .   ? 63.773 7.143  35.602  1.00 25.86  ? 540 HOH A O     1 
HETATM 5219 O  O     . HOH K 6 .   ? 61.300 20.685 60.163  1.00 31.18  ? 541 HOH A O     1 
HETATM 5220 O  O     . HOH K 6 .   ? 68.335 31.650 39.541  1.00 26.07  ? 542 HOH A O     1 
HETATM 5221 O  O     . HOH K 6 .   ? 56.910 6.561  43.392  1.00 31.33  ? 543 HOH A O     1 
HETATM 5222 O  O     . HOH K 6 .   ? 51.360 16.548 43.848  1.00 30.77  ? 544 HOH A O     1 
HETATM 5223 O  O     . HOH K 6 .   ? 58.414 32.681 38.164  1.00 34.00  ? 545 HOH A O     1 
HETATM 5224 O  O     . HOH K 6 .   ? 84.653 14.102 48.397  1.00 31.14  ? 546 HOH A O     1 
HETATM 5225 O  O     . HOH K 6 .   ? 72.508 29.835 22.582  1.00 35.43  ? 547 HOH A O     1 
HETATM 5226 O  O     . HOH K 6 .   ? 58.042 26.794 56.957  1.00 32.84  ? 548 HOH A O     1 
HETATM 5227 O  O     . HOH K 6 .   ? 61.910 13.299 37.505  1.00 29.81  ? 549 HOH A O     1 
HETATM 5228 O  O     . HOH K 6 .   ? 54.039 11.275 17.220  1.00 36.40  ? 550 HOH A O     1 
HETATM 5229 O  O     . HOH K 6 .   ? 59.362 7.628  12.010  1.00 31.13  ? 551 HOH A O     1 
HETATM 5230 O  O     . HOH K 6 .   ? 84.765 17.711 18.485  1.00 35.17  ? 552 HOH A O     1 
HETATM 5231 O  O     . HOH K 6 .   ? 77.780 19.447 14.525  1.00 33.62  ? 553 HOH A O     1 
HETATM 5232 O  O     . HOH K 6 .   ? 62.566 13.874 43.690  1.00 31.74  ? 554 HOH A O     1 
HETATM 5233 O  O     . HOH K 6 .   ? 80.913 24.296 34.649  1.00 28.10  ? 555 HOH A O     1 
HETATM 5234 O  O     . HOH K 6 .   ? 78.902 9.506  23.835  1.00 30.82  ? 556 HOH A O     1 
HETATM 5235 O  O     . HOH K 6 .   ? 76.632 3.158  17.693  1.00 33.83  ? 557 HOH A O     1 
HETATM 5236 O  O     . HOH K 6 .   ? 66.085 4.278  60.778  1.00 39.60  ? 558 HOH A O     1 
HETATM 5237 O  O     . HOH K 6 .   ? 77.212 7.389  24.502  1.00 34.81  ? 559 HOH A O     1 
HETATM 5238 O  O     . HOH K 6 .   ? 66.240 37.123 45.510  1.00 45.72  ? 560 HOH A O     1 
HETATM 5239 O  O     . HOH K 6 .   ? 52.802 4.633  18.759  1.00 32.92  ? 561 HOH A O     1 
HETATM 5240 O  O     . HOH K 6 .   ? 83.783 24.322 32.069  1.00 32.06  ? 562 HOH A O     1 
HETATM 5241 O  O     . HOH K 6 .   ? 60.839 26.067 34.932  1.00 34.25  ? 563 HOH A O     1 
HETATM 5242 O  O     . HOH K 6 .   ? 70.277 -7.414 49.162  1.00 35.68  ? 564 HOH A O     1 
HETATM 5243 O  O     . HOH K 6 .   ? 87.902 19.853 39.850  1.00 29.21  ? 565 HOH A O     1 
HETATM 5244 O  O     . HOH K 6 .   ? 56.683 17.420 14.873  1.00 27.17  ? 566 HOH A O     1 
HETATM 5245 O  O     . HOH K 6 .   ? 48.474 12.232 47.990  1.00 35.21  ? 567 HOH A O     1 
HETATM 5246 O  O     . HOH K 6 .   ? 57.101 9.597  42.814  1.00 29.80  ? 568 HOH A O     1 
HETATM 5247 O  O     . HOH K 6 .   ? 79.045 3.117  19.319  1.00 43.12  ? 569 HOH A O     1 
HETATM 5248 O  O     . HOH K 6 .   ? 83.574 26.005 33.966  1.00 36.87  ? 570 HOH A O     1 
HETATM 5249 O  O     . HOH K 6 .   ? 77.644 14.387 32.439  1.00 24.37  ? 571 HOH A O     1 
HETATM 5250 O  O     . HOH K 6 .   ? 76.850 16.844 31.411  1.00 29.33  ? 572 HOH A O     1 
HETATM 5251 O  O     . HOH K 6 .   ? 76.814 34.267 37.530  1.00 36.64  ? 573 HOH A O     1 
HETATM 5252 O  O     . HOH K 6 .   ? 73.918 21.340 14.306  1.00 32.47  ? 574 HOH A O     1 
HETATM 5253 O  O     . HOH K 6 .   ? 64.768 26.199 31.416  1.00 23.19  ? 575 HOH A O     1 
HETATM 5254 O  O     . HOH K 6 .   ? 65.084 35.159 29.906  1.00 39.04  ? 576 HOH A O     1 
HETATM 5255 O  O     . HOH K 6 .   ? 49.230 3.181  28.754  1.00 28.26  ? 577 HOH A O     1 
HETATM 5256 O  O     . HOH K 6 .   ? 78.891 21.324 55.371  1.00 35.99  ? 578 HOH A O     1 
HETATM 5257 O  O     . HOH K 6 .   ? 52.579 16.332 58.338  1.00 41.16  ? 579 HOH A O     1 
HETATM 5258 O  O     . HOH K 6 .   ? 71.377 38.843 47.189  1.00 38.98  ? 580 HOH A O     1 
HETATM 5259 O  O     . HOH K 6 .   ? 50.964 20.954 27.805  1.00 41.72  ? 581 HOH A O     1 
HETATM 5260 O  O     . HOH K 6 .   ? 67.371 10.474 58.623  1.00 35.22  ? 582 HOH A O     1 
HETATM 5261 O  O     . HOH K 6 .   ? 82.647 13.369 54.444  1.00 42.50  ? 583 HOH A O     1 
HETATM 5262 O  O     . HOH K 6 .   ? 81.364 6.213  43.670  1.00 36.53  ? 584 HOH A O     1 
HETATM 5263 O  O     . HOH K 6 .   ? 74.263 12.158 55.183  1.00 41.43  ? 585 HOH A O     1 
HETATM 5264 O  O     . HOH K 6 .   ? 60.065 26.725 31.061  1.00 39.70  ? 586 HOH A O     1 
HETATM 5265 O  O     . HOH K 6 .   ? 64.842 13.869 42.162  1.00 32.91  ? 587 HOH A O     1 
HETATM 5266 O  O     . HOH K 6 .   ? 84.664 20.240 17.170  1.00 32.98  ? 588 HOH A O     1 
HETATM 5267 O  O     . HOH K 6 .   ? 78.355 22.229 15.193  1.00 27.38  ? 589 HOH A O     1 
HETATM 5268 O  O     . HOH K 6 .   ? 62.632 27.089 32.553  1.00 25.60  ? 590 HOH A O     1 
HETATM 5269 O  O     . HOH K 6 .   ? 58.505 -2.293 30.097  1.00 22.60  ? 591 HOH A O     1 
HETATM 5270 O  O     . HOH K 6 .   ? 79.213 7.820  15.692  1.00 50.17  ? 592 HOH A O     1 
HETATM 5271 O  O     . HOH K 6 .   ? 67.894 -2.384 18.341  1.00 37.94  ? 593 HOH A O     1 
HETATM 5272 O  O     . HOH K 6 .   ? 77.443 -1.395 43.422  1.00 31.49  ? 594 HOH A O     1 
HETATM 5273 O  O     . HOH K 6 .   ? 81.799 1.009  45.981  1.00 40.50  ? 595 HOH A O     1 
HETATM 5274 O  O     . HOH K 6 .   ? 53.786 13.827 42.643  1.00 45.45  ? 596 HOH A O     1 
HETATM 5275 O  O     . HOH K 6 .   ? 76.102 -4.768 40.905  1.00 99.19  ? 597 HOH A O     1 
HETATM 5276 O  O     . HOH K 6 .   ? 47.261 1.735  23.903  1.00 47.19  ? 598 HOH A O     1 
HETATM 5277 O  O     . HOH K 6 .   ? 74.091 -4.709 44.567  1.00 36.19  ? 599 HOH A O     1 
HETATM 5278 O  O     . HOH K 6 .   ? 70.435 -0.411 16.997  1.00 30.98  ? 600 HOH A O     1 
HETATM 5279 O  O     . HOH K 6 .   ? 65.037 -2.212 38.829  1.00 52.37  ? 601 HOH A O     1 
HETATM 5280 O  O     . HOH K 6 .   ? 49.178 -0.704 21.784  1.00 31.08  ? 602 HOH A O     1 
HETATM 5281 O  O     . HOH K 6 .   ? 77.453 28.735 28.833  1.00 41.49  ? 603 HOH A O     1 
HETATM 5282 O  O     . HOH K 6 .   ? 68.647 11.237 11.905  1.00 35.79  ? 604 HOH A O     1 
HETATM 5283 O  O     . HOH K 6 .   ? 64.440 10.678 43.265  1.00 28.67  ? 605 HOH A O     1 
HETATM 5284 O  O     . HOH K 6 .   ? 59.576 30.900 32.355  1.00 39.01  ? 606 HOH A O     1 
HETATM 5285 O  O     . HOH K 6 .   ? 54.944 15.149 21.104  1.00 39.05  ? 607 HOH A O     1 
HETATM 5286 O  O     . HOH K 6 .   ? 52.899 15.240 23.003  1.00 48.18  ? 608 HOH A O     1 
HETATM 5287 O  O     . HOH K 6 .   ? 80.939 5.903  46.390  1.00 28.31  ? 609 HOH A O     1 
HETATM 5288 O  O     . HOH K 6 .   ? 68.224 15.309 15.427  1.00 50.08  ? 610 HOH A O     1 
HETATM 5289 O  O     . HOH K 6 .   ? 68.322 -2.167 22.827  1.00 37.94  ? 611 HOH A O     1 
HETATM 5290 O  O     . HOH K 6 .   ? 63.192 -4.106 44.903  1.00 33.26  ? 612 HOH A O     1 
HETATM 5291 O  O     . HOH K 6 .   ? 54.207 12.968 45.072  1.00 42.03  ? 613 HOH A O     1 
HETATM 5292 O  O     . HOH K 6 .   ? 67.297 7.594  63.882  1.00 44.80  ? 614 HOH A O     1 
HETATM 5293 O  O     . HOH K 6 .   ? 52.178 24.484 33.030  1.00 35.12  ? 615 HOH A O     1 
HETATM 5294 O  O     . HOH K 6 .   ? 53.459 0.589  17.910  1.00 33.67  ? 616 HOH A O     1 
HETATM 5295 O  O     . HOH K 6 .   ? 58.630 7.451  35.724  1.00 41.63  ? 617 HOH A O     1 
HETATM 5296 O  O     . HOH K 6 .   ? 61.114 8.975  10.047  1.00 35.29  ? 618 HOH A O     1 
HETATM 5297 O  O     . HOH K 6 .   ? 52.132 31.208 34.481  1.00 38.32  ? 619 HOH A O     1 
HETATM 5298 O  O     . HOH K 6 .   ? 63.468 -4.400 19.974  1.00 29.24  ? 620 HOH A O     1 
HETATM 5299 O  O     . HOH K 6 .   ? 87.310 28.437 45.272  1.00 43.11  ? 621 HOH A O     1 
HETATM 5300 O  O     . HOH K 6 .   ? 69.337 13.464 60.537  1.00 30.06  ? 622 HOH A O     1 
HETATM 5301 O  O     . HOH K 6 .   ? 63.839 22.399 58.013  1.00 31.73  ? 623 HOH A O     1 
HETATM 5302 O  O     . HOH K 6 .   ? 78.134 -0.118 49.716  1.00 37.62  ? 624 HOH A O     1 
HETATM 5303 O  O     . HOH K 6 .   ? 75.438 35.699 56.563  1.00 35.38  ? 625 HOH A O     1 
HETATM 5304 O  O     . HOH K 6 .   ? 56.005 -1.520 47.709  1.00 45.03  ? 626 HOH A O     1 
HETATM 5305 O  O     . HOH K 6 .   ? 73.803 32.189 51.909  1.00 24.29  ? 627 HOH A O     1 
HETATM 5306 O  O     . HOH K 6 .   ? 59.510 25.066 28.824  1.00 45.37  ? 628 HOH A O     1 
HETATM 5307 O  O     . HOH K 6 .   ? 64.962 11.174 38.213  1.00 24.13  ? 629 HOH A O     1 
HETATM 5308 O  O     . HOH K 6 .   ? 60.015 -8.081 18.488  1.00 32.65  ? 630 HOH A O     1 
HETATM 5309 O  O     . HOH K 6 .   ? 63.923 -1.722 18.179  1.00 34.84  ? 631 HOH A O     1 
HETATM 5310 O  O     . HOH K 6 .   ? 77.361 -4.563 47.397  1.00 47.31  ? 632 HOH A O     1 
HETATM 5311 O  O     . HOH K 6 .   ? 82.902 15.162 51.861  1.00 46.14  ? 633 HOH A O     1 
HETATM 5312 O  O     . HOH K 6 .   ? 62.549 34.554 46.525  1.00 47.83  ? 634 HOH A O     1 
HETATM 5313 O  O     . HOH K 6 .   ? 82.371 30.547 52.204  1.00 41.66  ? 635 HOH A O     1 
HETATM 5314 O  O     . HOH K 6 .   ? 64.161 13.231 39.654  1.00 28.73  ? 636 HOH A O     1 
HETATM 5315 O  O     . HOH K 6 .   ? 78.304 -0.990 37.512  1.00 30.92  ? 637 HOH A O     1 
HETATM 5316 O  O     . HOH K 6 .   ? 79.655 1.898  52.666  1.00 39.98  ? 638 HOH A O     1 
HETATM 5317 O  O     . HOH K 6 .   ? 83.860 33.753 50.000  1.00 37.03  ? 639 HOH A O     1 
HETATM 5318 O  O     . HOH K 6 .   ? 77.686 4.884  23.368  1.00 45.60  ? 640 HOH A O     1 
HETATM 5319 O  O     . HOH K 6 .   ? 72.794 0.822  30.967  1.00 36.54  ? 641 HOH A O     1 
HETATM 5320 O  O     . HOH K 6 .   ? 81.425 -0.710 50.751  1.00 35.58  ? 642 HOH A O     1 
HETATM 5321 O  O     . HOH K 6 .   ? 77.729 0.196  35.030  1.00 37.08  ? 643 HOH A O     1 
HETATM 5322 O  O     . HOH K 6 .   ? 75.322 27.262 53.729  1.00 34.08  ? 644 HOH A O     1 
HETATM 5323 O  O     . HOH K 6 .   ? 55.578 0.808  34.450  1.00 44.42  ? 645 HOH A O     1 
HETATM 5324 O  O     . HOH K 6 .   ? 48.816 30.238 39.630  1.00 47.51  ? 646 HOH A O     1 
HETATM 5325 O  O     . HOH K 6 .   ? 55.783 -2.271 28.145  1.00 39.19  ? 647 HOH A O     1 
HETATM 5326 O  O     . HOH K 6 .   ? 58.078 -2.809 27.183  1.00 33.22  ? 648 HOH A O     1 
HETATM 5327 O  O     . HOH K 6 .   ? 60.668 -6.015 28.584  1.00 32.12  ? 649 HOH A O     1 
HETATM 5328 O  O     . HOH K 6 .   ? 85.348 25.054 35.700  1.00 43.62  ? 650 HOH A O     1 
HETATM 5329 O  O     . HOH K 6 .   ? 78.694 22.749 57.132  1.00 30.84  ? 651 HOH A O     1 
HETATM 5330 O  O     . HOH K 6 .   ? 81.283 33.916 37.040  1.00 58.28  ? 652 HOH A O     1 
HETATM 5331 O  O     . HOH K 6 .   ? 63.874 35.844 48.859  1.00 59.25  ? 653 HOH A O     1 
HETATM 5332 O  O     . HOH K 6 .   ? 65.176 24.629 56.217  1.00 39.36  ? 654 HOH A O     1 
HETATM 5333 O  O     . HOH K 6 .   ? 53.027 4.587  46.091  1.00 50.62  ? 655 HOH A O     1 
HETATM 5334 O  O     . HOH K 6 .   ? 54.731 5.006  54.725  1.00 45.39  ? 656 HOH A O     1 
HETATM 5335 O  O     . HOH K 6 .   ? 75.722 -2.713 52.889  1.00 47.22  ? 657 HOH A O     1 
HETATM 5336 O  O     . HOH K 6 .   ? 81.070 2.414  39.239  1.00 47.42  ? 658 HOH A O     1 
HETATM 5337 O  O     . HOH K 6 .   ? 80.803 4.455  37.312  1.00 33.53  ? 659 HOH A O     1 
HETATM 5338 O  O     . HOH K 6 .   ? 86.190 7.710  37.078  1.00 43.04  ? 660 HOH A O     1 
HETATM 5339 O  O     . HOH K 6 .   ? 81.322 8.221  23.202  1.00 40.86  ? 661 HOH A O     1 
HETATM 5340 O  O     . HOH K 6 .   ? 68.980 3.779  11.296  1.00 45.83  ? 662 HOH A O     1 
HETATM 5341 O  O     . HOH K 6 .   ? 70.711 2.509  13.168  1.00 32.15  ? 663 HOH A O     1 
HETATM 5342 O  O     . HOH K 6 .   ? 65.279 32.945 40.286  1.00 36.86  ? 664 HOH A O     1 
HETATM 5343 O  O     . HOH K 6 .   ? 89.090 22.610 45.727  1.00 26.63  ? 665 HOH A O     1 
HETATM 5344 O  O     . HOH K 6 .   ? 91.752 24.000 51.971  1.00 33.39  ? 666 HOH A O     1 
HETATM 5345 O  O     . HOH K 6 .   ? 49.795 19.644 58.539  1.00 43.91  ? 667 HOH A O     1 
HETATM 5346 O  O     . HOH K 6 .   ? 52.298 -0.419 32.661  1.00 35.98  ? 668 HOH A O     1 
HETATM 5347 O  O     . HOH K 6 .   ? 51.667 -3.267 28.688  1.00 42.12  ? 669 HOH A O     1 
HETATM 5348 O  O     . HOH K 6 .   ? 67.181 33.233 47.935  1.00 40.22  ? 670 HOH A O     1 
HETATM 5349 O  O     . HOH K 6 .   ? 87.292 26.716 39.404  1.00 33.14  ? 671 HOH A O     1 
HETATM 5350 O  O     . HOH K 6 .   ? 62.537 -1.349 41.397  1.00 98.45  ? 672 HOH A O     1 
HETATM 5351 O  O     . HOH K 6 .   ? 79.864 22.729 59.142  1.00 41.22  ? 673 HOH A O     1 
HETATM 5352 O  O     . HOH K 6 .   ? 77.506 25.956 27.168  1.00 31.43  ? 674 HOH A O     1 
HETATM 5353 O  O     . HOH K 6 .   ? 81.515 36.350 41.467  1.00 53.18  ? 675 HOH A O     1 
HETATM 5354 O  O     . HOH K 6 .   ? 55.659 -0.983 16.673  1.00 36.06  ? 676 HOH A O     1 
HETATM 5355 O  O     . HOH K 6 .   ? 62.348 -5.637 13.740  1.00 33.77  ? 677 HOH A O     1 
HETATM 5356 O  O     . HOH K 6 .   ? 64.744 -3.174 27.566  1.00 46.21  ? 678 HOH A O     1 
HETATM 5357 O  O     . HOH K 6 .   ? 79.716 36.122 39.272  1.00 41.00  ? 679 HOH A O     1 
HETATM 5358 O  O     . HOH K 6 .   ? 67.764 -6.075 42.904  1.00 29.43  ? 680 HOH A O     1 
HETATM 5359 O  O     . HOH K 6 .   ? 65.923 -3.040 16.415  1.00 32.41  ? 681 HOH A O     1 
HETATM 5360 O  O     . HOH K 6 .   ? 74.874 -2.276 50.431  1.00 36.60  ? 682 HOH A O     1 
HETATM 5361 O  O     . HOH K 6 .   ? 52.727 27.528 54.090  1.00 39.35  ? 683 HOH A O     1 
HETATM 5362 O  O     . HOH K 6 .   ? 69.161 0.535  27.755  1.00 28.58  ? 684 HOH A O     1 
HETATM 5363 O  O     . HOH K 6 .   ? 79.694 37.576 43.947  1.00 43.92  ? 685 HOH A O     1 
HETATM 5364 O  O     . HOH K 6 .   ? 50.566 22.585 34.555  1.00 34.40  ? 686 HOH A O     1 
HETATM 5365 O  O     . HOH K 6 .   ? 85.085 19.448 14.706  1.00 38.76  ? 687 HOH A O     1 
HETATM 5366 O  O     . HOH K 6 .   ? 90.047 19.315 43.049  1.00 36.96  ? 688 HOH A O     1 
HETATM 5367 O  O     . HOH K 6 .   ? 62.360 8.864  59.854  1.00 35.19  ? 689 HOH A O     1 
HETATM 5368 O  O     . HOH K 6 .   ? 57.299 13.123 63.363  1.00 39.82  ? 690 HOH A O     1 
HETATM 5369 O  O     . HOH K 6 .   ? 68.580 27.269 54.558  1.00 32.03  ? 691 HOH A O     1 
HETATM 5370 O  O     . HOH K 6 .   ? 87.186 30.346 43.584  1.00 30.34  ? 692 HOH A O     1 
HETATM 5371 O  O     . HOH L 6 .   ? 58.977 34.340 3.386   1.00 16.94  ? 501 HOH B O     1 
HETATM 5372 O  O     . HOH L 6 .   ? 65.690 25.827 5.991   1.00 17.05  ? 502 HOH B O     1 
HETATM 5373 O  O     . HOH L 6 .   ? 51.774 37.361 19.565  1.00 17.81  ? 503 HOH B O     1 
HETATM 5374 O  O     . HOH L 6 .   ? 56.867 25.230 4.477   1.00 18.51  ? 504 HOH B O     1 
HETATM 5375 O  O     . HOH L 6 .   ? 59.151 19.044 9.416   1.00 16.33  ? 505 HOH B O     1 
HETATM 5376 O  O     . HOH L 6 .   ? 47.816 38.797 8.078   1.00 33.20  ? 506 HOH B O     1 
HETATM 5377 O  O     . HOH L 6 .   ? 60.132 15.735 -1.760  1.00 19.03  ? 507 HOH B O     1 
HETATM 5378 O  O     . HOH L 6 .   ? 50.396 18.959 -9.405  1.00 23.40  ? 508 HOH B O     1 
HETATM 5379 O  O     . HOH L 6 .   ? 53.466 20.493 16.685  1.00 29.00  ? 509 HOH B O     1 
HETATM 5380 O  O     . HOH L 6 .   ? 60.089 19.027 16.120  1.00 19.16  ? 510 HOH B O     1 
HETATM 5381 O  O     . HOH L 6 .   ? 49.556 30.463 11.655  1.00 21.09  ? 511 HOH B O     1 
HETATM 5382 O  O     . HOH L 6 .   ? 63.808 23.705 24.045  1.00 18.17  ? 512 HOH B O     1 
HETATM 5383 O  O     . HOH L 6 .   ? 50.366 38.373 26.477  1.00 29.75  ? 513 HOH B O     1 
HETATM 5384 O  O     . HOH L 6 .   ? 51.479 30.357 4.111   1.00 19.44  ? 514 HOH B O     1 
HETATM 5385 O  O     . HOH L 6 .   ? 50.226 26.637 4.148   1.00 20.02  ? 515 HOH B O     1 
HETATM 5386 O  O     . HOH L 6 .   ? 43.529 13.286 -0.009  1.00 26.82  ? 516 HOH B O     1 
HETATM 5387 O  O     . HOH L 6 .   ? 66.966 20.206 1.870   1.00 19.84  ? 517 HOH B O     1 
HETATM 5388 O  O     . HOH L 6 .   ? 55.327 39.431 6.204   1.00 23.10  ? 518 HOH B O     1 
HETATM 5389 O  O     . HOH L 6 .   ? 44.418 49.976 -4.718  1.00 38.32  ? 519 HOH B O     1 
HETATM 5390 O  O     . HOH L 6 .   ? 70.855 23.475 2.110   1.00 19.06  ? 520 HOH B O     1 
HETATM 5391 O  O     . HOH L 6 .   ? 55.528 20.134 14.638  1.00 23.29  ? 521 HOH B O     1 
HETATM 5392 O  O     . HOH L 6 .   ? 65.670 35.781 6.595   1.00 24.51  ? 522 HOH B O     1 
HETATM 5393 O  O     . HOH L 6 .   ? 65.195 30.887 -3.190  1.00 26.15  ? 523 HOH B O     1 
HETATM 5394 O  O     . HOH L 6 .   ? 42.716 51.016 -2.349  1.00 21.34  ? 524 HOH B O     1 
HETATM 5395 O  O     . HOH L 6 .   ? 61.041 33.711 -5.085  1.00 19.29  ? 525 HOH B O     1 
HETATM 5396 O  O     . HOH L 6 .   ? 72.493 25.450 3.180   1.00 27.16  ? 526 HOH B O     1 
HETATM 5397 O  O     . HOH L 6 .   ? 74.187 24.827 10.135  1.00 21.16  ? 527 HOH B O     1 
HETATM 5398 O  O     . HOH L 6 .   ? 62.839 18.288 -3.796  1.00 21.76  ? 528 HOH B O     1 
HETATM 5399 O  O     . HOH L 6 .   ? 73.138 39.646 10.101  1.00 29.20  ? 529 HOH B O     1 
HETATM 5400 O  O     . HOH L 6 .   ? 64.785 9.509  11.443  1.00 33.82  ? 530 HOH B O     1 
HETATM 5401 O  O     . HOH L 6 .   ? 53.510 36.859 -11.327 1.00 28.87  ? 531 HOH B O     1 
HETATM 5402 O  O     . HOH L 6 .   ? 30.492 22.182 -4.587  1.00 36.24  ? 532 HOH B O     1 
HETATM 5403 O  O     . HOH L 6 .   ? 46.876 30.845 11.077  1.00 31.04  ? 533 HOH B O     1 
HETATM 5404 O  O     . HOH L 6 .   ? 30.671 31.760 7.501   1.00 43.91  ? 534 HOH B O     1 
HETATM 5405 O  O     . HOH L 6 .   ? 51.502 31.668 8.611   1.00 21.43  ? 535 HOH B O     1 
HETATM 5406 O  O     . HOH L 6 .   ? 71.357 37.423 7.633   1.00 28.35  ? 536 HOH B O     1 
HETATM 5407 O  O     . HOH L 6 .   ? 40.647 36.027 9.554   1.00 27.36  ? 537 HOH B O     1 
HETATM 5408 O  O     . HOH L 6 .   ? 69.857 33.077 4.397   1.00 25.61  ? 538 HOH B O     1 
HETATM 5409 O  O     . HOH L 6 .   ? 52.239 15.693 14.860  1.00 37.96  ? 539 HOH B O     1 
HETATM 5410 O  O     . HOH L 6 .   ? 46.707 28.395 3.736   1.00 27.35  ? 540 HOH B O     1 
HETATM 5411 O  O     . HOH L 6 .   ? 44.166 15.567 -11.273 1.00 42.68  ? 541 HOH B O     1 
HETATM 5412 O  O     . HOH L 6 .   ? 50.673 47.102 -4.944  1.00 33.69  ? 542 HOH B O     1 
HETATM 5413 O  O     . HOH L 6 .   ? 31.842 30.497 13.045  1.00 31.71  ? 543 HOH B O     1 
HETATM 5414 O  O     . HOH L 6 .   ? 24.829 23.309 11.453  1.00 30.54  ? 544 HOH B O     1 
HETATM 5415 O  O     . HOH L 6 .   ? 44.066 28.736 4.683   1.00 25.22  ? 545 HOH B O     1 
HETATM 5416 O  O     . HOH L 6 .   ? 49.799 16.660 11.685  1.00 32.73  ? 546 HOH B O     1 
HETATM 5417 O  O     . HOH L 6 .   ? 35.559 32.062 -8.162  1.00 30.46  ? 547 HOH B O     1 
HETATM 5418 O  O     . HOH L 6 .   ? 33.643 21.589 10.706  1.00 28.76  ? 548 HOH B O     1 
HETATM 5419 O  O     . HOH L 6 .   ? 65.307 27.313 22.658  1.00 24.23  ? 549 HOH B O     1 
HETATM 5420 O  O     . HOH L 6 .   ? 66.717 13.112 10.353  1.00 32.82  ? 550 HOH B O     1 
HETATM 5421 O  O     . HOH L 6 .   ? 48.464 29.263 9.250   1.00 28.02  ? 551 HOH B O     1 
HETATM 5422 O  O     . HOH L 6 .   ? 55.001 16.506 10.785  1.00 22.38  ? 552 HOH B O     1 
HETATM 5423 O  O     . HOH L 6 .   ? 44.401 11.620 18.816  1.00 32.09  ? 553 HOH B O     1 
HETATM 5424 O  O     . HOH L 6 .   ? 41.330 33.080 9.501   1.00 25.60  ? 554 HOH B O     1 
HETATM 5425 O  O     . HOH L 6 .   ? 43.044 18.041 -9.227  1.00 38.76  ? 555 HOH B O     1 
HETATM 5426 O  O     . HOH L 6 .   ? 65.200 17.104 -5.070  1.00 30.19  ? 556 HOH B O     1 
HETATM 5427 O  O     . HOH L 6 .   ? 62.945 15.840 -11.757 1.00 37.50  ? 557 HOH B O     1 
HETATM 5428 O  O     . HOH L 6 .   ? 67.037 18.517 -4.164  1.00 31.46  ? 558 HOH B O     1 
HETATM 5429 O  O     . HOH L 6 .   ? 54.363 28.547 -15.395 1.00 28.02  ? 559 HOH B O     1 
HETATM 5430 O  O     . HOH L 6 .   ? 47.926 9.553  4.949   1.00 34.13  ? 560 HOH B O     1 
HETATM 5431 O  O     . HOH L 6 .   ? 45.381 32.054 3.684   1.00 25.57  ? 561 HOH B O     1 
HETATM 5432 O  O     . HOH L 6 .   ? 45.620 10.150 11.487  1.00 26.77  ? 562 HOH B O     1 
HETATM 5433 O  O     . HOH L 6 .   ? 28.023 24.905 6.265   1.00 41.75  ? 563 HOH B O     1 
HETATM 5434 O  O     . HOH L 6 .   ? 64.759 11.200 9.478   1.00 30.29  ? 564 HOH B O     1 
HETATM 5435 O  O     . HOH L 6 .   ? 56.379 29.474 26.938  1.00 43.82  ? 565 HOH B O     1 
HETATM 5436 O  O     . HOH L 6 .   ? 41.912 36.131 -16.245 1.00 28.78  ? 566 HOH B O     1 
HETATM 5437 O  O     . HOH L 6 .   ? 32.739 38.149 -8.639  1.00 37.38  ? 567 HOH B O     1 
HETATM 5438 O  O     . HOH L 6 .   ? 52.041 8.824  -1.879  1.00 28.04  ? 568 HOH B O     1 
HETATM 5439 O  O     . HOH L 6 .   ? 69.292 17.886 7.193   1.00 24.51  ? 569 HOH B O     1 
HETATM 5440 O  O     . HOH L 6 .   ? 28.820 16.802 6.067   1.00 35.51  ? 570 HOH B O     1 
HETATM 5441 O  O     . HOH L 6 .   ? 75.365 18.263 2.547   1.00 61.38  ? 571 HOH B O     1 
HETATM 5442 O  O     . HOH L 6 .   ? 44.017 9.075  -1.257  1.00 32.78  ? 572 HOH B O     1 
HETATM 5443 O  O     . HOH L 6 .   ? 62.743 22.900 -12.400 1.00 26.59  ? 573 HOH B O     1 
HETATM 5444 O  O     . HOH L 6 .   ? 64.465 47.101 23.319  1.00 35.61  ? 574 HOH B O     1 
HETATM 5445 O  O     . HOH L 6 .   ? 52.827 10.318 0.287   1.00 28.14  ? 575 HOH B O     1 
HETATM 5446 O  O     . HOH L 6 .   ? 25.487 24.957 22.752  1.00 23.85  ? 576 HOH B O     1 
HETATM 5447 O  O     . HOH L 6 .   ? 31.375 33.916 -5.342  1.00 26.68  ? 577 HOH B O     1 
HETATM 5448 O  O     . HOH L 6 .   ? 50.964 10.999 2.668   1.00 21.51  ? 578 HOH B O     1 
HETATM 5449 O  O     . HOH L 6 .   ? 45.554 42.829 -14.510 1.00 43.59  ? 579 HOH B O     1 
HETATM 5450 O  O     . HOH L 6 .   ? 30.917 15.687 -0.113  1.00 34.72  ? 580 HOH B O     1 
HETATM 5451 O  O     . HOH L 6 .   ? 49.611 41.821 11.661  1.00 36.30  ? 581 HOH B O     1 
HETATM 5452 O  O     . HOH L 6 .   ? 73.762 15.089 16.207  1.00 33.48  ? 582 HOH B O     1 
HETATM 5453 O  O     . HOH L 6 .   ? 48.860 43.195 -10.989 1.00 35.63  ? 583 HOH B O     1 
HETATM 5454 O  O     . HOH L 6 .   ? 70.404 32.996 23.346  1.00 35.38  ? 584 HOH B O     1 
HETATM 5455 O  O     . HOH L 6 .   ? 47.577 40.582 -14.169 1.00 36.80  ? 585 HOH B O     1 
HETATM 5456 O  O     . HOH L 6 .   ? 71.317 34.495 20.945  1.00 32.61  ? 586 HOH B O     1 
HETATM 5457 O  O     . HOH L 6 .   ? 49.515 44.797 6.109   1.00 34.91  ? 587 HOH B O     1 
HETATM 5458 O  O     . HOH L 6 .   ? 50.925 35.641 9.193   1.00 25.96  ? 588 HOH B O     1 
HETATM 5459 O  O     . HOH L 6 .   ? 43.571 31.101 5.887   1.00 30.15  ? 589 HOH B O     1 
HETATM 5460 O  O     . HOH L 6 .   ? 57.392 38.355 28.082  1.00 31.19  ? 590 HOH B O     1 
HETATM 5461 O  O     . HOH L 6 .   ? 36.246 17.805 -5.102  1.00 32.34  ? 591 HOH B O     1 
HETATM 5462 O  O     . HOH L 6 .   ? 49.331 21.359 23.549  1.00 34.36  ? 592 HOH B O     1 
HETATM 5463 O  O     . HOH L 6 .   ? 66.293 35.375 27.494  1.00 31.38  ? 593 HOH B O     1 
HETATM 5464 O  O     . HOH L 6 .   ? 48.359 29.499 5.789   1.00 28.04  ? 594 HOH B O     1 
HETATM 5465 O  O     . HOH L 6 .   ? 67.254 48.140 23.814  1.00 55.49  ? 595 HOH B O     1 
HETATM 5466 O  O     . HOH L 6 .   ? 39.043 41.074 -11.788 1.00 33.82  ? 596 HOH B O     1 
HETATM 5467 O  O     . HOH L 6 .   ? 65.624 10.142 1.996   1.00 40.50  ? 597 HOH B O     1 
HETATM 5468 O  O     . HOH L 6 .   ? 36.944 26.174 13.567  1.00 31.83  ? 598 HOH B O     1 
HETATM 5469 O  O     . HOH L 6 .   ? 49.178 13.201 15.324  1.00 36.14  ? 599 HOH B O     1 
HETATM 5470 O  O     . HOH L 6 .   ? 68.984 33.719 27.020  1.00 38.56  ? 600 HOH B O     1 
HETATM 5471 O  O     . HOH L 6 .   ? 62.330 25.798 1.519   1.00 19.67  ? 601 HOH B O     1 
HETATM 5472 O  O     . HOH L 6 .   ? 62.370 28.343 0.180   1.00 21.74  ? 602 HOH B O     1 
HETATM 5473 O  O     . HOH L 6 .   ? 47.225 32.222 13.142  1.00 35.76  ? 603 HOH B O     1 
HETATM 5474 O  O     . HOH L 6 .   ? 76.022 20.569 10.572  1.00 26.55  ? 604 HOH B O     1 
HETATM 5475 O  O     . HOH L 6 .   ? 59.710 35.201 25.689  1.00 25.89  ? 605 HOH B O     1 
HETATM 5476 O  O     . HOH L 6 .   ? 50.982 34.674 26.701  1.00 38.03  ? 606 HOH B O     1 
HETATM 5477 O  O     . HOH L 6 .   ? 51.959 45.012 16.587  1.00 25.55  ? 607 HOH B O     1 
HETATM 5478 O  O     . HOH L 6 .   ? 35.146 29.323 -10.989 1.00 23.69  ? 608 HOH B O     1 
HETATM 5479 O  O     . HOH L 6 .   ? 49.757 31.521 6.442   1.00 25.94  ? 609 HOH B O     1 
HETATM 5480 O  O     . HOH L 6 .   ? 26.604 35.702 5.694   1.00 44.20  ? 610 HOH B O     1 
HETATM 5481 O  O     . HOH L 6 .   ? 44.290 21.316 -15.417 1.00 32.36  ? 611 HOH B O     1 
HETATM 5482 O  O     . HOH L 6 .   ? 63.402 40.222 27.424  1.00 41.48  ? 612 HOH B O     1 
HETATM 5483 O  O     . HOH L 6 .   ? 47.792 48.798 1.411   1.00 31.85  ? 613 HOH B O     1 
HETATM 5484 O  O     . HOH L 6 .   ? 64.577 17.550 -7.649  1.00 34.02  ? 614 HOH B O     1 
HETATM 5485 O  O     . HOH L 6 .   ? 54.258 27.419 24.608  1.00 41.56  ? 615 HOH B O     1 
HETATM 5486 O  O     . HOH L 6 .   ? 68.437 14.009 7.903   1.00 34.52  ? 616 HOH B O     1 
HETATM 5487 O  O     . HOH L 6 .   ? 47.340 39.379 24.693  1.00 28.01  ? 617 HOH B O     1 
HETATM 5488 O  O     . HOH L 6 .   ? 42.261 8.906  -5.430  1.00 46.13  ? 618 HOH B O     1 
HETATM 5489 O  O     . HOH L 6 .   ? 45.640 18.289 19.164  1.00 38.12  ? 619 HOH B O     1 
HETATM 5490 O  O     . HOH L 6 .   ? 28.795 30.802 -10.840 1.00 38.69  ? 620 HOH B O     1 
HETATM 5491 O  O     . HOH L 6 .   ? 37.781 21.483 15.139  1.00 30.91  ? 621 HOH B O     1 
HETATM 5492 O  O     . HOH L 6 .   ? 29.319 22.791 -1.840  1.00 29.47  ? 622 HOH B O     1 
HETATM 5493 O  O     . HOH L 6 .   ? 37.271 46.057 7.538   1.00 45.40  ? 623 HOH B O     1 
HETATM 5494 O  O     . HOH L 6 .   ? 25.728 30.405 -3.668  1.00 36.59  ? 624 HOH B O     1 
HETATM 5495 O  O     . HOH L 6 .   ? 35.547 38.335 10.150  1.00 55.28  ? 625 HOH B O     1 
HETATM 5496 O  O     . HOH L 6 .   ? 38.327 37.470 10.459  1.00 42.88  ? 626 HOH B O     1 
HETATM 5497 O  O     . HOH L 6 .   ? 52.750 15.714 11.929  1.00 23.25  ? 627 HOH B O     1 
HETATM 5498 O  O     . HOH L 6 .   ? 61.411 41.302 14.439  1.00 26.51  ? 628 HOH B O     1 
HETATM 5499 O  O     . HOH L 6 .   ? 53.250 44.312 -6.516  1.00 30.86  ? 629 HOH B O     1 
HETATM 5500 O  O     . HOH L 6 .   ? 62.905 42.271 25.540  1.00 24.76  ? 630 HOH B O     1 
HETATM 5501 O  O     . HOH L 6 .   ? 41.668 7.879  2.770   1.00 37.98  ? 631 HOH B O     1 
HETATM 5502 O  O     . HOH L 6 .   ? 60.340 38.289 -5.414  1.00 33.45  ? 632 HOH B O     1 
HETATM 5503 O  O     . HOH L 6 .   ? 67.194 44.993 16.581  1.00 35.66  ? 633 HOH B O     1 
HETATM 5504 O  O     . HOH L 6 .   ? 38.145 29.720 9.861   1.00 45.04  ? 634 HOH B O     1 
HETATM 5505 O  O     . HOH L 6 .   ? 67.025 13.957 1.680   1.00 40.99  ? 635 HOH B O     1 
HETATM 5506 O  O     . HOH L 6 .   ? 74.397 25.231 0.944   1.00 35.31  ? 636 HOH B O     1 
HETATM 5507 O  O     . HOH L 6 .   ? 35.078 41.910 -10.087 1.00 39.26  ? 637 HOH B O     1 
HETATM 5508 O  O     . HOH L 6 .   ? 55.926 36.874 -9.739  1.00 32.92  ? 638 HOH B O     1 
HETATM 5509 O  O     . HOH L 6 .   ? 50.167 41.019 29.221  1.00 43.38  ? 639 HOH B O     1 
HETATM 5510 O  O     . HOH L 6 .   ? 66.601 42.050 10.606  1.00 29.07  ? 640 HOH B O     1 
HETATM 5511 O  O     . HOH L 6 .   ? 43.299 43.503 8.496   1.00 43.07  ? 641 HOH B O     1 
HETATM 5512 O  O     . HOH L 6 .   ? 48.339 23.726 -20.020 1.00 38.05  ? 642 HOH B O     1 
HETATM 5513 O  O     . HOH L 6 .   ? 72.443 31.280 19.868  1.00 41.38  ? 643 HOH B O     1 
HETATM 5514 O  O     . HOH L 6 .   ? 71.173 24.834 -5.187  1.00 46.20  ? 644 HOH B O     1 
HETATM 5515 O  O     . HOH L 6 .   ? 70.071 43.195 12.415  1.00 34.51  ? 645 HOH B O     1 
HETATM 5516 O  O     . HOH L 6 .   ? 71.659 33.408 27.012  1.00 93.02  ? 646 HOH B O     1 
HETATM 5517 O  O     . HOH L 6 .   ? 69.669 27.836 18.435  1.00 55.63  ? 647 HOH B O     1 
HETATM 5518 O  O     . HOH L 6 .   ? 57.609 49.690 20.330  1.00 29.50  ? 648 HOH B O     1 
HETATM 5519 O  O     . HOH L 6 .   ? 49.174 5.482  3.852   1.00 37.43  ? 649 HOH B O     1 
HETATM 5520 O  O     . HOH L 6 .   ? 33.199 20.434 -5.473  1.00 43.57  ? 650 HOH B O     1 
HETATM 5521 O  O     . HOH L 6 .   ? 43.582 46.790 3.924   1.00 35.07  ? 651 HOH B O     1 
HETATM 5522 O  O     . HOH L 6 .   ? 49.706 27.965 -15.820 1.00 36.89  ? 652 HOH B O     1 
HETATM 5523 O  O     . HOH L 6 .   ? 69.698 43.004 15.904  1.00 38.31  ? 653 HOH B O     1 
HETATM 5524 O  O     . HOH L 6 .   ? 68.171 35.216 5.050   1.00 36.27  ? 654 HOH B O     1 
HETATM 5525 O  O     . HOH L 6 .   ? 52.196 27.673 -17.016 1.00 38.78  ? 655 HOH B O     1 
HETATM 5526 O  O     . HOH L 6 .   ? 32.706 35.740 -10.706 1.00 66.40  ? 656 HOH B O     1 
HETATM 5527 O  O     . HOH L 6 .   ? 47.693 32.166 8.793   1.00 36.47  ? 657 HOH B O     1 
HETATM 5528 O  O     . HOH L 6 .   ? 43.167 35.398 19.301  1.00 42.45  ? 658 HOH B O     1 
HETATM 5529 O  O     . HOH L 6 .   ? 63.014 47.198 19.181  1.00 30.29  ? 659 HOH B O     1 
HETATM 5530 O  O     . HOH L 6 .   ? 46.862 32.527 6.083   1.00 31.10  ? 660 HOH B O     1 
HETATM 5531 O  O     . HOH L 6 .   ? 62.868 25.158 27.441  1.00 27.09  ? 661 HOH B O     1 
HETATM 5532 O  O     . HOH L 6 .   ? 56.932 27.490 24.956  1.00 35.35  ? 662 HOH B O     1 
HETATM 5533 O  O     . HOH L 6 .   ? 48.140 29.653 -17.434 1.00 37.17  ? 663 HOH B O     1 
HETATM 5534 O  O     . HOH L 6 .   ? 30.851 42.050 5.251   1.00 44.86  ? 664 HOH B O     1 
HETATM 5535 O  O     . HOH L 6 .   ? 27.590 19.880 0.612   1.00 34.31  ? 665 HOH B O     1 
HETATM 5536 O  O     . HOH L 6 .   ? 63.664 44.865 13.477  1.00 34.49  ? 666 HOH B O     1 
HETATM 5537 O  O     . HOH L 6 .   ? 76.113 15.944 14.721  1.00 43.10  ? 667 HOH B O     1 
HETATM 5538 O  O     . HOH L 6 .   ? 62.190 44.497 7.984   1.00 58.97  ? 668 HOH B O     1 
HETATM 5539 O  O     . HOH L 6 .   ? 43.553 20.278 20.066  1.00 32.71  ? 669 HOH B O     1 
HETATM 5540 O  O     . HOH L 6 .   ? 40.674 29.319 11.692  1.00 52.70  ? 670 HOH B O     1 
HETATM 5541 O  O     . HOH L 6 .   ? 43.430 10.546 -11.128 1.00 25.93  ? 671 HOH B O     1 
HETATM 5542 O  O     . HOH L 6 .   ? 46.598 3.985  -4.017  1.00 32.30  ? 672 HOH B O     1 
HETATM 5543 O  O     . HOH L 6 .   ? 38.094 28.658 12.580  1.00 41.62  ? 673 HOH B O     1 
HETATM 5544 O  O     . HOH L 6 .   ? 52.428 6.659  9.292   1.00 48.19  ? 674 HOH B O     1 
HETATM 5545 O  O     . HOH L 6 .   ? 42.505 30.583 -11.680 1.00 40.34  ? 675 HOH B O     1 
HETATM 5546 O  O     . HOH L 6 .   ? 64.722 13.770 2.780   1.00 43.03  ? 676 HOH B O     1 
HETATM 5547 O  O     . HOH L 6 .   ? 39.281 15.656 -6.985  1.00 39.01  ? 677 HOH B O     1 
HETATM 5548 O  O     . HOH L 6 .   ? 51.364 26.135 -19.421 1.00 53.50  ? 678 HOH B O     1 
HETATM 5549 O  O     . HOH L 6 .   ? 67.417 45.587 19.251  1.00 28.49  ? 679 HOH B O     1 
HETATM 5550 O  O     . HOH L 6 .   ? 58.991 41.165 -6.310  1.00 43.95  ? 680 HOH B O     1 
HETATM 5551 O  O     . HOH L 6 .   ? 26.303 29.339 2.398   1.00 54.26  ? 681 HOH B O     1 
HETATM 5552 O  O     . HOH L 6 .   ? 45.121 26.661 -14.765 1.00 33.45  ? 682 HOH B O     1 
HETATM 5553 O  O     . HOH L 6 .   ? 44.773 45.049 -10.528 1.00 39.19  ? 683 HOH B O     1 
HETATM 5554 O  O     . HOH L 6 .   ? 47.221 46.237 -6.309  1.00 32.01  ? 684 HOH B O     1 
HETATM 5555 O  O     . HOH L 6 .   ? 44.721 32.005 8.312   1.00 33.97  ? 685 HOH B O     1 
HETATM 5556 O  O     . HOH L 6 .   ? 60.039 42.949 -1.502  1.00 37.06  ? 686 HOH B O     1 
HETATM 5557 O  O     . HOH L 6 .   ? 38.627 12.466 17.898  1.00 37.19  ? 687 HOH B O     1 
HETATM 5558 O  O     . HOH L 6 .   ? 53.762 39.430 -12.354 1.00 38.35  ? 688 HOH B O     1 
HETATM 5559 O  O     . HOH L 6 .   ? 57.567 8.217  -2.225  1.00 33.89  ? 689 HOH B O     1 
HETATM 5560 O  O     . HOH L 6 .   ? 50.812 9.344  -10.363 1.00 28.54  ? 690 HOH B O     1 
HETATM 5561 O  O     . HOH L 6 .   ? 72.525 16.248 7.863   1.00 39.39  ? 691 HOH B O     1 
HETATM 5562 O  O     . HOH L 6 .   ? 53.306 42.341 -11.973 1.00 56.77  ? 692 HOH B O     1 
HETATM 5563 O  O     . HOH L 6 .   ? 58.872 40.701 7.062   1.00 30.08  ? 693 HOH B O     1 
HETATM 5564 O  O     . HOH L 6 .   ? 63.837 35.255 -9.127  1.00 51.12  ? 694 HOH B O     1 
HETATM 5565 O  O     . HOH L 6 .   ? 44.517 45.035 -6.109  1.00 33.62  ? 695 HOH B O     1 
HETATM 5566 O  O     . HOH L 6 .   ? 56.577 7.494  11.326  1.00 34.30  ? 696 HOH B O     1 
HETATM 5567 O  O     . HOH L 6 .   ? 49.769 9.712  8.534   1.00 40.65  ? 697 HOH B O     1 
HETATM 5568 O  O     . HOH L 6 .   ? 57.706 45.240 -1.808  1.00 44.72  ? 698 HOH B O     1 
HETATM 5569 O  O     . HOH L 6 .   ? 57.262 43.467 -5.666  1.00 33.09  ? 699 HOH B O     1 
HETATM 5570 O  O     . HOH L 6 .   ? 27.585 20.957 9.611   1.00 42.94  ? 700 HOH B O     1 
HETATM 5571 O  O     . HOH L 6 .   ? 27.432 16.730 2.774   1.00 51.18  ? 701 HOH B O     1 
HETATM 5572 O  O     . HOH L 6 .   ? 76.474 17.326 0.047   1.00 68.22  ? 702 HOH B O     1 
HETATM 5573 O  O     . HOH L 6 .   ? 25.563 18.641 7.802   1.00 43.57  ? 703 HOH B O     1 
HETATM 5574 O  O     . HOH L 6 .   ? 39.319 18.881 -9.565  1.00 41.76  ? 704 HOH B O     1 
HETATM 5575 O  O     . HOH L 6 .   ? 54.787 9.834  -14.481 1.00 37.06  ? 705 HOH B O     1 
HETATM 5576 O  O     . HOH L 6 .   ? 45.347 43.803 6.341   1.00 38.96  ? 706 HOH B O     1 
HETATM 5577 O  O     . HOH L 6 .   ? 61.759 11.947 -6.376  1.00 36.33  ? 707 HOH B O     1 
HETATM 5578 O  O     . HOH L 6 .   ? 68.474 17.728 -8.728  1.00 37.70  ? 708 HOH B O     1 
HETATM 5579 O  O     . HOH L 6 .   ? 65.903 16.366 3.714   1.00 31.96  ? 709 HOH B O     1 
HETATM 5580 O  O     . HOH L 6 .   ? 55.294 19.651 -22.772 1.00 53.84  ? 710 HOH B O     1 
HETATM 5581 O  O     . HOH L 6 .   ? 59.195 19.992 -17.087 1.00 35.56  ? 711 HOH B O     1 
HETATM 5582 O  O     . HOH L 6 .   ? 60.722 28.988 -14.004 1.00 36.16  ? 712 HOH B O     1 
HETATM 5583 O  O     . HOH L 6 .   ? 60.960 31.781 -14.231 1.00 38.35  ? 713 HOH B O     1 
HETATM 5584 O  O     . HOH L 6 .   ? 52.353 43.316 28.926  1.00 30.33  ? 714 HOH B O     1 
HETATM 5585 O  O     . HOH L 6 .   ? 71.965 31.389 24.969  1.00 69.49  ? 715 HOH B O     1 
HETATM 5586 O  O     . HOH L 6 .   ? 53.259 45.190 18.929  1.00 34.79  ? 716 HOH B O     1 
HETATM 5587 O  O     . HOH L 6 .   ? 58.966 14.601 -15.360 1.00 31.23  ? 717 HOH B O     1 
HETATM 5588 O  O     . HOH L 6 .   ? 50.042 6.671  -9.275  1.00 28.68  ? 718 HOH B O     1 
HETATM 5589 O  O     . HOH L 6 .   ? 36.425 36.966 -13.955 1.00 32.47  ? 719 HOH B O     1 
HETATM 5590 O  O     . HOH L 6 .   ? 58.036 22.118 -18.151 1.00 27.90  ? 720 HOH B O     1 
HETATM 5591 O  O     . HOH L 6 .   ? 60.568 42.201 9.735   1.00 28.31  ? 721 HOH B O     1 
HETATM 5592 O  O     . HOH L 6 .   ? 61.079 45.810 28.462  1.00 41.63  ? 722 HOH B O     1 
HETATM 5593 O  O     . HOH L 6 .   ? 44.920 7.670  0.965   1.00 29.85  ? 723 HOH B O     1 
HETATM 5594 O  O     . HOH L 6 .   ? 26.406 35.393 -16.575 1.00 41.61  ? 724 HOH B O     1 
HETATM 5595 O  O     . HOH L 6 .   ? 72.783 40.264 17.650  1.00 32.87  ? 725 HOH B O     1 
HETATM 5596 O  O     . HOH L 6 .   ? 43.658 15.614 -14.191 1.00 43.70  ? 726 HOH B O     1 
HETATM 5597 O  O     . HOH L 6 .   ? 63.017 48.735 14.910  1.00 33.93  ? 727 HOH B O     1 
HETATM 5598 O  O     . HOH L 6 .   ? 31.993 16.378 -5.934  1.00 47.96  ? 728 HOH B O     1 
HETATM 5599 O  O     . HOH L 6 .   ? 50.699 44.237 14.190  1.00 32.95  ? 729 HOH B O     1 
HETATM 5600 O  O     . HOH L 6 .   ? 49.776 45.039 11.744  1.00 31.87  ? 730 HOH B O     1 
HETATM 5601 O  O     . HOH L 6 .   ? 54.238 5.305  -8.515  1.00 35.01  ? 731 HOH B O     1 
HETATM 5602 O  O     . HOH L 6 .   ? 64.602 44.602 19.454  1.00 28.42  ? 732 HOH B O     1 
HETATM 5603 O  O     . HOH L 6 .   ? 60.759 43.570 27.011  1.00 39.02  ? 733 HOH B O     1 
HETATM 5604 O  O     . HOH L 6 .   ? 57.733 14.452 -17.807 1.00 28.52  ? 734 HOH B O     1 
HETATM 5605 O  O     . HOH L 6 .   ? 44.343 15.850 -16.662 1.00 44.66  ? 735 HOH B O     1 
HETATM 5606 O  O     . HOH L 6 .   ? 61.508 23.561 -16.091 1.00 34.99  ? 736 HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N     . MSE A 23  ? 0.6319 0.5822 0.7108 -0.0984 -0.2117 -0.5314 -1  MSE A N     
2    C  CA    . MSE A 23  ? 0.6763 0.6944 0.5762 0.0181  -0.2425 -0.3591 -1  MSE A CA    
3    C  C     . MSE A 23  ? 1.0764 0.5959 0.1169 0.0671  -0.2824 -0.1125 -1  MSE A C     
4    O  O     . MSE A 23  ? 1.1058 0.3266 0.2220 0.0903  -0.4385 -0.1107 -1  MSE A O     
5    C  CB    . MSE A 23  ? 0.9102 0.7047 0.7433 0.0452  -0.2360 -0.2325 -1  MSE A CB    
6    C  CG    . MSE A 23  ? 1.1698 1.0585 0.4605 -0.1548 -0.2100 -0.6052 -1  MSE A CG    
7    SE SE    . MSE A 23  ? 0.9720 1.5910 0.7510 -0.3591 -0.2282 -0.2628 -1  MSE A SE    
8    C  CE    . MSE A 23  ? 1.8117 2.0027 1.0785 -1.0735 0.9951  -1.4132 -1  MSE A CE    
9    N  N     . THR A 24  ? 0.8706 0.4345 0.3978 0.0587  -0.1388 -0.0822 0   THR A N     
10   C  CA    . THR A 24  ? 0.7584 0.4931 0.3701 0.0206  -0.1067 -0.0521 0   THR A CA    
11   C  C     . THR A 24  ? 0.5661 0.3819 0.3761 0.0185  -0.0565 -0.1186 0   THR A C     
12   O  O     . THR A 24  ? 0.6148 0.3227 0.2663 0.1093  -0.0805 -0.0892 0   THR A O     
13   C  CB    . THR A 24  ? 0.6783 0.4974 0.4470 -0.0431 -0.0774 -0.0088 0   THR A CB    
14   O  OG1   . THR A 24  ? 0.8035 0.5098 0.3739 -0.0975 -0.1071 0.1565  0   THR A OG1   
15   C  CG2   . THR A 24  ? 0.7784 0.6076 0.4662 0.1501  -0.1218 0.0874  0   THR A CG2   
16   N  N     . ARG A 25  ? 0.4716 0.3404 0.3639 -0.0152 -0.0750 -0.0394 1   ARG A N     
17   C  CA    . ARG A 25  ? 0.4814 0.4208 0.3526 -0.0052 -0.0323 -0.0682 1   ARG A CA    
18   C  C     . ARG A 25  ? 0.4597 0.3577 0.2545 0.0402  -0.1069 -0.0672 1   ARG A C     
19   O  O     . ARG A 25  ? 0.6204 0.4727 0.3314 0.1463  -0.1394 0.0594  1   ARG A O     
20   C  CB    . ARG A 25  ? 0.4869 0.4166 0.4410 -0.0153 0.0160  -0.0235 1   ARG A CB    
21   C  CG    . ARG A 25  ? 0.5591 0.4322 0.4373 -0.0540 0.0883  -0.0479 1   ARG A CG    
22   C  CD    . ARG A 25  ? 0.6713 0.4601 0.2589 -0.0483 0.0203  -0.1048 1   ARG A CD    
23   N  NE    . ARG A 25  ? 0.7827 0.3657 0.1933 -0.0884 0.0168  -0.0483 1   ARG A NE    
24   C  CZ    . ARG A 25  ? 0.7810 0.3134 0.3926 -0.0031 0.0578  -0.0751 1   ARG A CZ    
25   N  NH1   . ARG A 25  ? 0.8722 0.3222 0.4791 0.0233  0.0080  -0.0368 1   ARG A NH1   
26   N  NH2   . ARG A 25  ? 0.8883 0.4796 0.5991 -0.0430 0.0993  0.1121  1   ARG A NH2   
27   N  N     . PHE A 26  ? 0.4493 0.3747 0.2976 -0.0071 -0.0900 -0.0313 2   PHE A N     
28   C  CA    . PHE A 26  ? 0.4029 0.3360 0.1497 0.0502  -0.0810 -0.0460 2   PHE A CA    
29   C  C     . PHE A 26  ? 0.3819 0.3876 0.1650 0.0151  -0.0968 -0.0259 2   PHE A C     
30   O  O     . PHE A 26  ? 0.4476 0.4434 0.1762 -0.0382 -0.1903 -0.1297 2   PHE A O     
31   C  CB    . PHE A 26  ? 0.4075 0.3774 0.1654 0.0348  -0.0527 -0.0752 2   PHE A CB    
32   C  CG    . PHE A 26  ? 0.3668 0.3457 0.1982 0.0547  -0.0446 -0.0675 2   PHE A CG    
33   C  CD1   . PHE A 26  ? 0.3735 0.3276 0.2166 0.0565  -0.0210 -0.0148 2   PHE A CD1   
34   C  CD2   . PHE A 26  ? 0.3809 0.4280 0.1734 0.0403  -0.0457 0.0125  2   PHE A CD2   
35   C  CE1   . PHE A 26  ? 0.3205 0.2777 0.1452 0.0012  -0.0724 -0.0718 2   PHE A CE1   
36   C  CE2   . PHE A 26  ? 0.4311 0.4037 0.2409 0.0439  -0.0106 0.0230  2   PHE A CE2   
37   C  CZ    . PHE A 26  ? 0.3225 0.3237 0.2776 0.0648  -0.0421 -0.0632 2   PHE A CZ    
38   N  N     . ASP A 27  ? 0.3751 0.3678 0.0493 0.0400  -0.0887 0.0121  3   ASP A N     
39   C  CA    . ASP A 27  ? 0.3830 0.3031 0.1793 0.0392  -0.0289 -0.0326 3   ASP A CA    
40   C  C     . ASP A 27  ? 0.4810 0.3266 0.2175 0.0387  -0.0595 -0.1062 3   ASP A C     
41   O  O     . ASP A 27  ? 0.4956 0.3507 0.2371 0.0652  -0.1329 -0.1540 3   ASP A O     
42   C  CB    . ASP A 27  ? 0.3709 0.3563 0.1584 0.0419  -0.0699 -0.0618 3   ASP A CB    
43   C  CG    . ASP A 27  ? 0.4149 0.3669 0.2147 0.1035  -0.0839 -0.0307 3   ASP A CG    
44   O  OD1   . ASP A 27  ? 0.5058 0.4229 0.1086 0.0687  -0.0369 0.0065  3   ASP A OD1   
45   O  OD2   . ASP A 27  ? 0.4395 0.3785 0.1812 0.1177  -0.1116 -0.0501 3   ASP A OD2   
46   N  N     . VAL A 28  ? 0.3821 0.3122 0.2003 0.0654  -0.0801 -0.0504 4   VAL A N     
47   C  CA    . VAL A 28  ? 0.3893 0.3003 0.2664 0.0305  0.0149  -0.0436 4   VAL A CA    
48   C  C     . VAL A 28  ? 0.3304 0.2878 0.2043 0.0212  -0.0375 0.0522  4   VAL A C     
49   O  O     . VAL A 28  ? 0.3798 0.2901 0.1856 0.0205  -0.0609 0.0418  4   VAL A O     
50   C  CB    . VAL A 28  ? 0.3501 0.3418 0.2377 0.0593  -0.0336 -0.0174 4   VAL A CB    
51   C  CG1   . VAL A 28  ? 0.4379 0.3024 0.0895 0.0231  -0.0854 0.1084  4   VAL A CG1   
52   C  CG2   . VAL A 28  ? 0.3504 0.3839 0.1792 0.0393  -0.0345 0.0951  4   VAL A CG2   
53   N  N     . LEU A 29  ? 0.3027 0.2682 0.1098 0.0123  -0.0361 0.0147  5   LEU A N     
54   C  CA    . LEU A 29  ? 0.2495 0.2776 0.1310 -0.0206 -0.0540 -0.0652 5   LEU A CA    
55   C  C     . LEU A 29  ? 0.3161 0.2615 0.1103 -0.0137 -0.0127 -0.0614 5   LEU A C     
56   O  O     . LEU A 29  ? 0.3175 0.3045 0.0613 -0.0170 -0.0826 -0.0544 5   LEU A O     
57   C  CB    . LEU A 29  ? 0.2620 0.2811 0.1286 -0.0231 -0.0727 -0.1032 5   LEU A CB    
58   C  CG    . LEU A 29  ? 0.2519 0.3319 0.1890 -0.0038 -0.0261 -0.0740 5   LEU A CG    
59   C  CD1   . LEU A 29  ? 0.2977 0.3058 0.1353 0.0035  -0.0949 -0.1454 5   LEU A CD1   
60   C  CD2   . LEU A 29  ? 0.2520 0.4616 0.1917 0.0149  -0.0165 -0.0495 5   LEU A CD2   
61   N  N     . THR A 30  ? 0.3116 0.3011 0.1057 -0.0117 -0.0538 -0.0184 6   THR A N     
62   C  CA    . THR A 30  ? 0.1962 0.2837 0.0992 -0.0210 -0.0356 -0.0373 6   THR A CA    
63   C  C     . THR A 30  ? 0.1714 0.2350 0.0783 -0.0321 -0.0674 -0.0518 6   THR A C     
64   O  O     . THR A 30  ? 0.2024 0.2735 0.0550 -0.0373 -0.0616 -0.0314 6   THR A O     
65   C  CB    . THR A 30  ? 0.1745 0.3217 0.1904 0.0175  -0.0449 0.0139  6   THR A CB    
66   O  OG1   . THR A 30  ? 0.2940 0.3324 0.0778 -0.0472 -0.0588 -0.0985 6   THR A OG1   
67   C  CG2   . THR A 30  ? 0.2137 0.2715 0.0737 0.0033  -0.0698 -0.0005 6   THR A CG2   
68   N  N     . VAL A 31  ? 0.2043 0.2579 0.1431 0.0243  -0.0744 -0.0677 7   VAL A N     
69   C  CA    . VAL A 31  ? 0.2017 0.2495 0.0814 -0.0049 -0.0548 -0.0384 7   VAL A CA    
70   C  C     . VAL A 31  ? 0.2021 0.2446 0.1518 -0.0201 -0.0517 -0.0229 7   VAL A C     
71   O  O     . VAL A 31  ? 0.2066 0.2584 0.2600 -0.0379 -0.0815 0.0039  7   VAL A O     
72   C  CB    . VAL A 31  ? 0.1710 0.2357 0.2278 0.0102  -0.0395 -0.0297 7   VAL A CB    
73   C  CG1   . VAL A 31  ? 0.1697 0.2618 0.2708 -0.0037 -0.0032 -0.0322 7   VAL A CG1   
74   C  CG2   . VAL A 31  ? 0.1597 0.2679 0.1293 0.0007  -0.1116 -0.0009 7   VAL A CG2   
75   N  N     . GLY A 32  ? 0.2034 0.2078 0.1384 -0.0255 -0.0870 -0.0517 8   GLY A N     
76   C  CA    . GLY A 32  ? 0.2097 0.1975 0.0987 -0.0282 -0.0647 -0.0473 8   GLY A CA    
77   C  C     . GLY A 32  ? 0.2388 0.2260 0.1022 -0.0324 -0.0312 0.0258  8   GLY A C     
78   O  O     . GLY A 32  ? 0.2558 0.2747 0.1279 -0.0477 -0.0606 0.0671  8   GLY A O     
79   N  N     . ASN A 33  ? 0.2351 0.2302 0.0677 -0.0044 0.0141  -0.0375 9   ASN A N     
80   C  CA    . ASN A 33  ? 0.2517 0.2254 0.0642 0.0085  -0.0096 -0.0211 9   ASN A CA    
81   C  C     . ASN A 33  ? 0.2026 0.2572 0.0331 -0.0231 -0.0348 -0.0105 9   ASN A C     
82   O  O     . ASN A 33  ? 0.2139 0.2806 0.0355 0.0227  -0.0419 -0.0198 9   ASN A O     
83   C  CB    . ASN A 33  ? 0.2338 0.2347 0.0255 0.0042  -0.0010 -0.0072 9   ASN A CB    
84   C  CG    . ASN A 33  ? 0.1906 0.2435 0.1095 0.0032  -0.0289 -0.0313 9   ASN A CG    
85   O  OD1   . ASN A 33  ? 0.1798 0.2864 0.1486 0.0146  -0.0518 -0.0164 9   ASN A OD1   
86   N  ND2   . ASN A 33  ? 0.2234 0.2516 0.0764 0.0225  -0.0352 -0.0077 9   ASN A ND2   
87   N  N     . ALA A 34  ? 0.2152 0.1735 0.0717 -0.0185 -0.0463 -0.0241 10  ALA A N     
88   C  CA    . ALA A 34  ? 0.2051 0.2032 0.0901 -0.0259 -0.0667 -0.0093 10  ALA A CA    
89   C  C     . ALA A 34  ? 0.1702 0.2207 0.1244 -0.0192 -0.0601 -0.0453 10  ALA A C     
90   O  O     . ALA A 34  ? 0.1911 0.2793 0.1144 -0.0122 -0.0719 -0.0499 10  ALA A O     
91   C  CB    . ALA A 34  ? 0.2564 0.2505 0.0352 -0.0437 -0.0458 -0.0048 10  ALA A CB    
92   N  N     . ILE A 35  ? 0.1692 0.2055 0.1127 -0.0288 -0.0421 -0.0523 11  ILE A N     
93   C  CA    . ILE A 35  ? 0.1452 0.1719 0.1129 -0.0285 -0.0533 -0.0180 11  ILE A CA    
94   C  C     . ILE A 35  ? 0.1953 0.2033 0.1195 0.0057  -0.0737 -0.0173 11  ILE A C     
95   O  O     . ILE A 35  ? 0.2259 0.2238 0.0594 0.0255  -0.0827 -0.0118 11  ILE A O     
96   C  CB    . ILE A 35  ? 0.1886 0.1590 0.1328 -0.0339 -0.0619 -0.0110 11  ILE A CB    
97   C  CG1   . ILE A 35  ? 0.2219 0.1722 0.1912 -0.0111 -0.0302 -0.0001 11  ILE A CG1   
98   C  CG2   . ILE A 35  ? 0.2157 0.1563 0.1248 -0.0384 -0.0799 0.0019  11  ILE A CG2   
99   C  CD1   . ILE A 35  ? 0.2178 0.2197 0.1162 -0.0287 -0.0509 -0.0079 11  ILE A CD1   
100  N  N     . VAL A 36  ? 0.1777 0.2327 0.1234 0.0035  -0.1027 -0.0052 12  VAL A N     
101  C  CA    . VAL A 36  ? 0.1728 0.2002 0.1511 0.0112  -0.0698 0.0514  12  VAL A CA    
102  C  C     . VAL A 36  ? 0.2011 0.1754 0.0942 0.0248  -0.0949 0.0374  12  VAL A C     
103  O  O     . VAL A 36  ? 0.2424 0.2170 0.0848 0.0250  -0.1135 -0.0075 12  VAL A O     
104  C  CB    . VAL A 36  ? 0.1689 0.2182 0.1643 -0.0165 -0.0620 0.0583  12  VAL A CB    
105  C  CG1   . VAL A 36  ? 0.1572 0.2654 0.1585 0.0016  -0.0695 -0.0060 12  VAL A CG1   
106  C  CG2   . VAL A 36  ? 0.1887 0.2155 0.1701 -0.0311 -0.0465 0.0440  12  VAL A CG2   
107  N  N     . ASP A 37  ? 0.2144 0.2508 0.0779 -0.0074 -0.0805 0.0337  13  ASP A N     
108  C  CA    . ASP A 37  ? 0.2098 0.2485 0.1067 0.0041  -0.0718 -0.0022 13  ASP A CA    
109  C  C     . ASP A 37  ? 0.2236 0.2283 0.0956 0.0211  -0.0601 0.0055  13  ASP A C     
110  O  O     . ASP A 37  ? 0.2180 0.2377 0.1206 0.0371  -0.1076 -0.0164 13  ASP A O     
111  C  CB    . ASP A 37  ? 0.2292 0.2727 0.1077 -0.0015 -0.0670 -0.0072 13  ASP A CB    
112  C  CG    . ASP A 37  ? 0.2431 0.3077 0.1081 0.0048  -0.0694 -0.0136 13  ASP A CG    
113  O  OD1   . ASP A 37  ? 0.2970 0.3428 0.1169 0.0384  -0.1049 0.0060  13  ASP A OD1   
114  O  OD2   . ASP A 37  ? 0.2743 0.2927 0.1013 0.0334  -0.0932 -0.0607 13  ASP A OD2   
115  N  N     . ILE A 38  ? 0.2268 0.2574 0.0824 0.0027  -0.0436 -0.0030 14  ILE A N     
116  C  CA    . ILE A 38  ? 0.1895 0.2209 0.1179 0.0040  -0.0567 -0.0223 14  ILE A CA    
117  C  C     . ILE A 38  ? 0.1974 0.2325 0.1005 -0.0059 -0.0466 -0.0341 14  ILE A C     
118  O  O     . ILE A 38  ? 0.2165 0.2305 0.0966 -0.0185 -0.0767 -0.0260 14  ILE A O     
119  C  CB    . ILE A 38  ? 0.1794 0.2656 0.0914 0.0024  -0.0508 -0.0020 14  ILE A CB    
120  C  CG1   . ILE A 38  ? 0.1820 0.2856 0.1168 0.0196  -0.0230 0.0138  14  ILE A CG1   
121  C  CG2   . ILE A 38  ? 0.2236 0.2425 0.0892 0.0028  -0.0580 -0.0117 14  ILE A CG2   
122  C  CD1   . ILE A 38  ? 0.2298 0.3217 0.1613 0.0291  -0.0012 -0.0191 14  ILE A CD1   
123  N  N     . ILE A 39  ? 0.1848 0.2795 0.1173 -0.0125 -0.0606 -0.0232 15  ILE A N     
124  C  CA    . ILE A 39  ? 0.1855 0.2602 0.1485 -0.0125 -0.0485 0.0017  15  ILE A CA    
125  C  C     . ILE A 39  ? 0.2209 0.2397 0.1517 -0.0227 -0.0569 -0.0079 15  ILE A C     
126  O  O     . ILE A 39  ? 0.2825 0.2998 0.1580 0.0167  -0.0648 0.0078  15  ILE A O     
127  C  CB    . ILE A 39  ? 0.1776 0.3077 0.2006 -0.0135 -0.0329 -0.0324 15  ILE A CB    
128  C  CG1   . ILE A 39  ? 0.2604 0.3452 0.1844 -0.0274 -0.0505 -0.0717 15  ILE A CG1   
129  C  CG2   . ILE A 39  ? 0.1869 0.2791 0.2068 -0.0494 -0.0558 -0.0527 15  ILE A CG2   
130  C  CD1   . ILE A 39  ? 0.3441 0.3464 0.3087 0.0025  -0.0820 -0.0796 15  ILE A CD1   
131  N  N     . SER A 40  ? 0.1984 0.2550 0.1580 -0.0239 -0.0392 0.0010  16  SER A N     
132  C  CA    . SER A 40  ? 0.2130 0.2836 0.1738 -0.0259 -0.0441 -0.0144 16  SER A CA    
133  C  C     . SER A 40  ? 0.2171 0.3315 0.2173 -0.0267 -0.0509 0.0230  16  SER A C     
134  O  O     . SER A 40  ? 0.2910 0.3635 0.2359 -0.0261 -0.0622 0.0605  16  SER A O     
135  C  CB    . SER A 40  ? 0.2368 0.3627 0.1818 0.0223  -0.0263 -0.0124 16  SER A CB    
136  O  OG    . SER A 40  ? 0.3715 0.4858 0.2348 -0.0402 -0.0999 -0.0315 16  SER A OG    
137  N  N     . ARG A 41  ? 0.2510 0.3805 0.1614 -0.0548 -0.1014 0.0055  17  ARG A N     
138  C  CA    . ARG A 41  ? 0.2773 0.3365 0.2149 -0.0346 -0.1023 0.0214  17  ARG A CA    
139  C  C     . ARG A 41  ? 0.3743 0.2916 0.2022 -0.0245 -0.0894 0.0567  17  ARG A C     
140  O  O     . ARG A 41  ? 0.4717 0.4324 0.1796 -0.0610 -0.1463 0.0054  17  ARG A O     
141  C  CB    . ARG A 41  ? 0.2614 0.3589 0.3853 -0.0350 -0.0661 0.0156  17  ARG A CB    
142  C  CG    . ARG A 41  ? 0.4421 0.5175 0.3208 0.0000  -0.0262 0.0180  17  ARG A CG    
143  C  CD    . ARG A 41  ? 0.6233 0.6220 0.3992 0.0038  -0.0469 -0.0751 17  ARG A CD    
144  N  NE    . ARG A 41  ? 0.6429 0.6754 0.5579 0.0237  0.0427  0.0149  17  ARG A NE    
145  C  CZ    . ARG A 41  ? 0.5302 0.5080 0.6018 0.1146  0.0129  0.0618  17  ARG A CZ    
146  N  NH1   . ARG A 41  ? 0.5390 0.4810 0.5938 0.1884  -0.0315 0.0498  17  ARG A NH1   
147  N  NH2   . ARG A 41  ? 0.3773 0.4567 0.7680 0.1211  -0.0590 0.1999  17  ARG A NH2   
148  N  N     . CYS A 42  ? 0.3424 0.3094 0.1176 -0.0275 -0.1165 0.0368  18  CYS A N     
149  C  CA    . CYS A 42  ? 0.3059 0.3008 0.1708 0.0042  -0.1438 0.0533  18  CYS A CA    
150  C  C     . CYS A 42  ? 0.3058 0.3017 0.2471 -0.0239 -0.0944 -0.0133 18  CYS A C     
151  O  O     . CYS A 42  ? 0.3026 0.3542 0.2434 -0.0520 -0.0512 0.0344  18  CYS A O     
152  C  CB    . CYS A 42  ? 0.3290 0.3312 0.2035 0.0350  -0.0994 0.0509  18  CYS A CB    
153  S  SG    . CYS A 42  ? 0.3420 0.3328 0.1743 -0.0284 -0.1401 -0.0029 18  CYS A SG    
154  N  N     . ASN A 43  ? 0.3785 0.2773 0.2954 -0.0170 -0.0600 -0.0285 19  ASN A N     
155  C  CA    . ASN A 43  ? 0.3425 0.3423 0.3009 -0.0184 -0.0428 -0.0138 19  ASN A CA    
156  C  C     . ASN A 43  ? 0.3485 0.3315 0.2258 -0.0099 0.0040  0.0054  19  ASN A C     
157  O  O     . ASN A 43  ? 0.3380 0.3358 0.2058 -0.0308 -0.0461 -0.0232 19  ASN A O     
158  C  CB    . ASN A 43  ? 0.3061 0.3825 0.3474 -0.0171 -0.1133 0.0427  19  ASN A CB    
159  C  CG    . ASN A 43  ? 0.3390 0.4517 0.3361 -0.0414 -0.0932 0.0318  19  ASN A CG    
160  O  OD1   . ASN A 43  ? 0.3287 0.4709 0.3497 -0.0502 -0.0331 0.0371  19  ASN A OD1   
161  N  ND2   . ASN A 43  ? 0.4010 0.5668 0.3784 0.0205  -0.1591 0.0358  19  ASN A ND2   
162  N  N     . ASP A 44  ? 0.3660 0.3438 0.3195 -0.0432 0.0555  -0.0085 20  ASP A N     
163  C  CA    A ASP A 44  ? 0.3711 0.3875 0.3121 -0.0260 0.0722  0.0204  20  ASP A CA    
164  C  CA    B ASP A 44  ? 0.3455 0.3593 0.3237 -0.0528 0.0742  0.0251  20  ASP A CA    
165  C  C     . ASP A 44  ? 0.3351 0.3628 0.2642 -0.0431 0.0040  -0.0044 20  ASP A C     
166  O  O     . ASP A 44  ? 0.2757 0.4119 0.2504 -0.0828 0.0118  0.0401  20  ASP A O     
167  C  CB    A ASP A 44  ? 0.4371 0.4625 0.2433 -0.0336 0.0642  -0.0018 20  ASP A CB    
168  C  CB    B ASP A 44  ? 0.3847 0.3223 0.2730 -0.0938 0.0537  0.0016  20  ASP A CB    
169  C  CG    A ASP A 44  ? 0.4553 0.3172 0.2792 0.0056  0.0302  -0.0568 20  ASP A CG    
170  C  CG    B ASP A 44  ? 0.3634 0.3243 0.1746 -0.0765 0.0138  0.0401  20  ASP A CG    
171  O  OD1   A ASP A 44  ? 0.5333 0.2651 0.3585 0.0125  0.0037  -0.0193 20  ASP A OD1   
172  O  OD1   B ASP A 44  ? 0.4073 0.3471 0.1274 -0.1071 -0.0089 0.0557  20  ASP A OD1   
173  O  OD2   A ASP A 44  ? 0.3185 0.3449 0.1269 -0.0385 -0.0877 -0.0143 20  ASP A OD2   
174  O  OD2   B ASP A 44  ? 0.3723 0.3349 0.1517 -0.0727 0.0188  0.0460  20  ASP A OD2   
175  N  N     . GLN A 45  ? 0.3119 0.3479 0.3089 -0.0549 -0.0154 -0.0028 21  GLN A N     
176  C  CA    . GLN A 45  ? 0.2354 0.3933 0.2864 -0.0518 0.0058  -0.0057 21  GLN A CA    
177  C  C     . GLN A 45  ? 0.2159 0.2593 0.1081 -0.0233 -0.0510 -0.0147 21  GLN A C     
178  O  O     . GLN A 45  ? 0.2350 0.2967 0.0868 0.0063  -0.0422 -0.0214 21  GLN A O     
179  C  CB    . GLN A 45  ? 0.2833 0.4137 0.3329 -0.0681 -0.0155 -0.0309 21  GLN A CB    
180  C  CG    . GLN A 45  ? 0.3107 0.4604 0.2662 -0.0591 -0.0019 -0.0377 21  GLN A CG    
181  C  CD    . GLN A 45  ? 0.2689 0.5479 0.3637 -0.0893 0.1889  0.0692  21  GLN A CD    
182  O  OE1   . GLN A 45  ? 0.2847 0.6028 0.3798 -0.1360 0.1790  0.1207  21  GLN A OE1   
183  N  NE2   . GLN A 45  ? 0.3705 0.5269 0.5264 -0.0441 0.0801  -0.0399 21  GLN A NE2   
184  N  N     . PHE A 46  ? 0.2679 0.2921 0.1467 -0.0635 -0.0462 -0.0371 22  PHE A N     
185  C  CA    . PHE A 46  ? 0.2393 0.2726 0.1268 -0.0279 -0.0286 -0.0285 22  PHE A CA    
186  C  C     . PHE A 46  ? 0.2443 0.3050 0.1285 -0.0153 -0.0251 -0.0043 22  PHE A C     
187  O  O     . PHE A 46  ? 0.2338 0.3235 0.1150 -0.0267 -0.0755 -0.0466 22  PHE A O     
188  C  CB    . PHE A 46  ? 0.2240 0.2847 0.0918 -0.0161 -0.0247 0.0187  22  PHE A CB    
189  C  CG    . PHE A 46  ? 0.2325 0.3195 0.1091 -0.0295 -0.0376 0.0607  22  PHE A CG    
190  C  CD1   . PHE A 46  ? 0.2470 0.3569 0.0907 -0.0402 -0.0587 0.0422  22  PHE A CD1   
191  C  CD2   . PHE A 46  ? 0.2657 0.2950 0.0493 -0.0356 -0.0410 0.0731  22  PHE A CD2   
192  C  CE1   . PHE A 46  ? 0.2613 0.3619 0.1846 -0.0475 -0.0241 0.0393  22  PHE A CE1   
193  C  CE2   . PHE A 46  ? 0.2481 0.3272 0.1283 -0.0350 -0.0112 0.0256  22  PHE A CE2   
194  C  CZ    . PHE A 46  ? 0.2874 0.3264 0.1373 -0.0189 -0.0446 0.0841  22  PHE A CZ    
195  N  N     . LEU A 47  ? 0.2658 0.2862 0.1221 -0.0305 -0.0572 -0.0344 23  LEU A N     
196  C  CA    . LEU A 47  ? 0.2497 0.2945 0.0895 -0.0125 -0.0205 -0.0133 23  LEU A CA    
197  C  C     . LEU A 47  ? 0.2192 0.2912 0.0468 -0.0015 -0.0464 -0.0028 23  LEU A C     
198  O  O     . LEU A 47  ? 0.2258 0.3069 0.1318 0.0244  -0.0361 0.0117  23  LEU A O     
199  C  CB    . LEU A 47  ? 0.2934 0.2373 0.0588 -0.0066 -0.0686 -0.0327 23  LEU A CB    
200  C  CG    . LEU A 47  ? 0.2614 0.2330 0.1099 -0.0015 -0.0691 -0.0008 23  LEU A CG    
201  C  CD1   . LEU A 47  ? 0.2714 0.2414 0.1251 0.0144  -0.0398 0.0141  23  LEU A CD1   
202  C  CD2   . LEU A 47  ? 0.2753 0.2557 0.1379 -0.0109 -0.0698 0.0339  23  LEU A CD2   
203  N  N     . ILE A 48  ? 0.2979 0.2679 0.1629 -0.0332 -0.0667 -0.0134 24  ILE A N     
204  C  CA    . ILE A 48  ? 0.3283 0.2885 0.1704 -0.0122 -0.0785 -0.0084 24  ILE A CA    
205  C  C     . ILE A 48  ? 0.3034 0.2565 0.1663 -0.0008 -0.0847 -0.0053 24  ILE A C     
206  O  O     . ILE A 48  ? 0.2843 0.2955 0.2493 -0.0325 -0.1121 0.0107  24  ILE A O     
207  C  CB    . ILE A 48  ? 0.3875 0.2680 0.2327 -0.0450 -0.0689 -0.0211 24  ILE A CB    
208  C  CG1   . ILE A 48  ? 0.3377 0.2547 0.2608 -0.0554 -0.0496 -0.0178 24  ILE A CG1   
209  C  CG2   . ILE A 48  ? 0.4734 0.2825 0.1851 -0.0233 -0.0185 -0.0135 24  ILE A CG2   
210  C  CD1   . ILE A 48  ? 0.3404 0.2727 0.3783 -0.0296 0.0016  -0.0211 24  ILE A CD1   
211  N  N     . ASP A 49  ? 0.3191 0.2442 0.1235 -0.0061 -0.1146 -0.0659 25  ASP A N     
212  C  CA    . ASP A 49  ? 0.2859 0.2640 0.1419 0.0053  -0.0906 -0.0122 25  ASP A CA    
213  C  C     . ASP A 49  ? 0.2983 0.2676 0.1701 0.0034  -0.1039 -0.0210 25  ASP A C     
214  O  O     . ASP A 49  ? 0.3447 0.2542 0.0828 -0.0026 -0.1203 -0.0419 25  ASP A O     
215  C  CB    . ASP A 49  ? 0.3153 0.2167 0.1810 0.0347  -0.0957 -0.0028 25  ASP A CB    
216  C  CG    . ASP A 49  ? 0.3158 0.2981 0.1685 0.0420  -0.0973 0.0196  25  ASP A CG    
217  O  OD1   . ASP A 49  ? 0.3544 0.4137 0.1293 -0.0405 -0.1719 0.0948  25  ASP A OD1   
218  O  OD2   . ASP A 49  ? 0.4188 0.3743 0.0412 0.1117  -0.0783 -0.0126 25  ASP A OD2   
219  N  N     . ASN A 50  ? 0.2912 0.2776 0.1281 -0.0188 -0.1071 -0.0052 26  ASN A N     
220  C  CA    . ASN A 50  ? 0.2666 0.2836 0.1399 -0.0006 -0.0721 0.0248  26  ASN A CA    
221  C  C     . ASN A 50  ? 0.2643 0.3067 0.1605 -0.0035 -0.0892 0.0180  26  ASN A C     
222  O  O     . ASN A 50  ? 0.2853 0.3574 0.1420 -0.0033 -0.1415 0.0559  26  ASN A O     
223  C  CB    . ASN A 50  ? 0.2963 0.3021 0.1371 0.0082  -0.0697 0.0633  26  ASN A CB    
224  C  CG    . ASN A 50  ? 0.2686 0.3288 0.0896 -0.0728 -0.0951 -0.0421 26  ASN A CG    
225  O  OD1   . ASN A 50  ? 0.2398 0.4251 0.1867 -0.0631 -0.0533 0.0392  26  ASN A OD1   
226  N  ND2   . ASN A 50  ? 0.2908 0.2924 0.0422 -0.0627 -0.0475 -0.0347 26  ASN A ND2   
227  N  N     . GLN A 51  ? 0.2962 0.3365 0.0806 0.0032  -0.0782 -0.0150 27  GLN A N     
228  C  CA    . GLN A 51  ? 0.2766 0.2779 0.1655 -0.0026 -0.1292 -0.0018 27  GLN A CA    
229  C  C     . GLN A 51  ? 0.2360 0.2919 0.0783 -0.0083 -0.0818 0.0041  27  GLN A C     
230  O  O     . GLN A 51  ? 0.2279 0.3709 0.2211 0.0110  -0.1057 -0.0458 27  GLN A O     
231  C  CB    . GLN A 51  ? 0.3401 0.2955 0.2750 -0.0019 -0.1170 -0.0280 27  GLN A CB    
232  C  CG    . GLN A 51  ? 0.5537 0.3134 0.2005 -0.0278 -0.1728 -0.1020 27  GLN A CG    
233  C  CD    . GLN A 51  ? 0.6674 0.4176 0.3324 0.0518  -0.0654 0.0354  27  GLN A CD    
234  O  OE1   . GLN A 51  ? 0.6877 0.7131 0.1380 0.0198  -0.2545 0.0936  27  GLN A OE1   
235  N  NE2   . GLN A 51  ? 1.0602 0.4827 0.0794 0.0153  -0.1902 0.0906  27  GLN A NE2   
236  N  N     . ILE A 52  ? 0.2555 0.2511 0.0468 -0.0214 -0.0683 0.0228  28  ILE A N     
237  C  CA    . ILE A 52  ? 0.2943 0.2212 0.1268 -0.0426 -0.0275 0.0229  28  ILE A CA    
238  C  C     . ILE A 52  ? 0.2767 0.2586 0.1153 -0.0664 -0.0367 0.0246  28  ILE A C     
239  O  O     . ILE A 52  ? 0.2823 0.3228 0.1061 -0.0844 -0.0586 0.0188  28  ILE A O     
240  C  CB    . ILE A 52  ? 0.3031 0.2139 0.0957 -0.0219 -0.0468 -0.0060 28  ILE A CB    
241  C  CG1   . ILE A 52  ? 0.2627 0.2171 0.1501 0.0006  -0.0307 0.0476  28  ILE A CG1   
242  C  CG2   . ILE A 52  ? 0.3435 0.2406 0.0625 -0.0218 -0.0504 -0.0131 28  ILE A CG2   
243  C  CD1   . ILE A 52  ? 0.2771 0.2174 0.2066 0.0339  -0.0298 0.0633  28  ILE A CD1   
244  N  N     . THR A 53  ? 0.2581 0.2649 0.1080 -0.0589 -0.0274 0.0418  29  THR A N     
245  C  CA    . THR A 53  ? 0.2619 0.2971 0.0970 -0.0584 -0.0407 0.0487  29  THR A CA    
246  C  C     . THR A 53  ? 0.2632 0.2951 0.0413 -0.0469 -0.0410 0.0562  29  THR A C     
247  O  O     . THR A 53  ? 0.3081 0.3012 0.0345 -0.0296 -0.0458 -0.0174 29  THR A O     
248  C  CB    . THR A 53  ? 0.2406 0.3725 0.1729 -0.0157 -0.0434 0.0456  29  THR A CB    
249  O  OG1   . THR A 53  ? 0.2617 0.4405 0.1484 -0.0151 -0.1031 -0.0187 29  THR A OG1   
250  C  CG2   . THR A 53  ? 0.3141 0.4114 0.2509 -0.0668 -0.0027 0.1080  29  THR A CG2   
251  N  N     . LYS A 54  ? 0.2592 0.3107 0.0349 -0.0266 -0.0422 0.0286  30  LYS A N     
252  C  CA    . LYS A 54  ? 0.2431 0.2852 0.0699 -0.0379 -0.0552 0.0274  30  LYS A CA    
253  C  C     . LYS A 54  ? 0.2788 0.2272 0.1144 -0.0184 -0.0595 -0.0019 30  LYS A C     
254  O  O     . LYS A 54  ? 0.2847 0.2839 0.0950 -0.0188 -0.0321 0.0268  30  LYS A O     
255  C  CB    . LYS A 54  ? 0.2526 0.2806 0.0749 -0.0367 -0.0599 -0.0114 30  LYS A CB    
256  C  CG    . LYS A 54  ? 0.2872 0.2535 0.1550 -0.0213 -0.0340 -0.0260 30  LYS A CG    
257  C  CD    . LYS A 54  ? 0.2693 0.3030 0.2175 0.0040  -0.0228 -0.0519 30  LYS A CD    
258  C  CE    . LYS A 54  ? 0.2530 0.3398 0.1725 0.0085  -0.0641 -0.0539 30  LYS A CE    
259  N  NZ    . LYS A 54  ? 0.3098 0.3775 0.1211 -0.0689 -0.0646 -0.0527 30  LYS A NZ    
260  N  N     . ALA A 55  ? 0.2491 0.2452 0.1805 -0.0264 -0.0976 -0.0180 31  ALA A N     
261  C  CA    . ALA A 55  ? 0.2694 0.2640 0.1669 -0.0175 -0.0333 -0.0274 31  ALA A CA    
262  C  C     . ALA A 55  ? 0.2700 0.2662 0.1814 -0.0046 -0.0496 -0.0361 31  ALA A C     
263  O  O     . ALA A 55  ? 0.3332 0.3433 0.1475 -0.0174 -0.1163 -0.0055 31  ALA A O     
264  C  CB    . ALA A 55  ? 0.2920 0.3229 0.1498 -0.0437 -0.0451 0.0096  31  ALA A CB    
265  N  N     . ALA A 56  ? 0.2372 0.2819 0.1308 -0.0366 -0.0632 -0.0310 32  ALA A N     
266  C  CA    . ALA A 56  ? 0.2379 0.3087 0.2146 -0.0382 -0.0566 0.0552  32  ALA A CA    
267  C  C     . ALA A 56  ? 0.1649 0.3468 0.2008 -0.0236 -0.0664 0.0504  32  ALA A C     
268  O  O     . ALA A 56  ? 0.2646 0.3364 0.0930 -0.0189 -0.0607 -0.0343 32  ALA A O     
269  C  CB    . ALA A 56  ? 0.3078 0.3331 0.2223 0.0018  -0.0255 0.1276  32  ALA A CB    
270  N  N     . MSE A 57  ? 0.1895 0.2481 0.1830 -0.0159 -0.0939 0.0201  33  MSE A N     
271  C  CA    . MSE A 57  ? 0.2239 0.2212 0.1323 -0.0397 -0.0862 0.0010  33  MSE A CA    
272  C  C     . MSE A 57  ? 0.2564 0.2747 0.1214 -0.0104 -0.0973 -0.0201 33  MSE A C     
273  O  O     . MSE A 57  ? 0.2698 0.2942 0.0770 -0.0141 -0.1047 -0.0367 33  MSE A O     
274  C  CB    . MSE A 57  ? 0.2992 0.2108 0.1156 -0.0288 -0.0940 -0.0169 33  MSE A CB    
275  C  CG    . MSE A 57  ? 0.3490 0.2319 0.1848 -0.0797 -0.1198 -0.0058 33  MSE A CG    
276  SE SE    . MSE A 57  ? 0.4773 0.4655 0.2618 0.0253  -0.1478 0.0239  33  MSE A SE    
277  C  CE    . MSE A 57  ? 0.2834 0.1973 0.1841 0.0170  -0.0302 0.0433  33  MSE A CE    
278  N  N     . ASN A 58  ? 0.2062 0.2292 0.1193 0.0158  -0.1201 -0.0246 34  ASN A N     
279  C  CA    . ASN A 58  ? 0.1905 0.2260 0.1311 0.0033  -0.0939 -0.0014 34  ASN A CA    
280  C  C     . ASN A 58  ? 0.2030 0.2641 0.1741 0.0195  -0.0564 -0.0062 34  ASN A C     
281  O  O     . ASN A 58  ? 0.2736 0.2720 0.1299 0.0182  -0.0461 -0.0265 34  ASN A O     
282  C  CB    . ASN A 58  ? 0.2235 0.2280 0.0671 -0.0085 -0.0732 0.0019  34  ASN A CB    
283  C  CG    . ASN A 58  ? 0.2363 0.2346 0.1373 -0.0162 -0.0658 -0.0193 34  ASN A CG    
284  O  OD1   . ASN A 58  ? 0.2886 0.2456 0.2086 -0.0651 0.0037  -0.0337 34  ASN A OD1   
285  N  ND2   . ASN A 58  ? 0.2147 0.3065 0.1457 0.0094  -0.0922 0.0024  34  ASN A ND2   
286  N  N     . LEU A 59  ? 0.1792 0.2626 0.1587 0.0031  -0.0475 -0.0588 35  LEU A N     
287  C  CA    . LEU A 59  ? 0.1905 0.2374 0.1289 -0.0016 -0.0518 -0.0573 35  LEU A CA    
288  C  C     . LEU A 59  ? 0.2514 0.2490 0.1173 -0.0045 -0.0292 -0.0430 35  LEU A C     
289  O  O     . LEU A 59  ? 0.2964 0.2420 0.0749 0.0039  -0.1035 0.0230  35  LEU A O     
290  C  CB    . LEU A 59  ? 0.2023 0.2264 0.1257 0.0063  -0.0567 -0.0398 35  LEU A CB    
291  C  CG    . LEU A 59  ? 0.2986 0.2310 0.1454 0.0154  -0.0711 -0.0523 35  LEU A CG    
292  C  CD1   . LEU A 59  ? 0.3147 0.3515 0.1503 0.0365  -0.0798 -0.0369 35  LEU A CD1   
293  C  CD2   . LEU A 59  ? 0.2911 0.2303 0.1269 0.0181  -0.1506 -0.0301 35  LEU A CD2   
294  N  N     . ILE A 60  ? 0.2503 0.2400 0.1008 0.0021  -0.0582 -0.0448 36  ILE A N     
295  C  CA    . ILE A 60  ? 0.2492 0.2522 0.1083 -0.0062 -0.0512 -0.0547 36  ILE A CA    
296  C  C     . ILE A 60  ? 0.2438 0.2479 0.1527 -0.0002 -0.0659 -0.0130 36  ILE A C     
297  O  O     . ILE A 60  ? 0.2328 0.2643 0.1321 0.0065  -0.0981 -0.0221 36  ILE A O     
298  C  CB    . ILE A 60  ? 0.2347 0.2607 0.1048 -0.0291 -0.0525 -0.0468 36  ILE A CB    
299  C  CG1   . ILE A 60  ? 0.2348 0.2841 0.1126 0.0008  -0.0724 -0.0473 36  ILE A CG1   
300  C  CG2   . ILE A 60  ? 0.2302 0.3926 0.0727 -0.0696 -0.0671 -0.0706 36  ILE A CG2   
301  C  CD1   . ILE A 60  ? 0.2152 0.3157 0.1626 0.0038  -0.0707 -0.0195 36  ILE A CD1   
302  N  N     . ASP A 61  ? 0.2523 0.3113 0.2030 0.0057  -0.0254 -0.0276 37  ASP A N     
303  C  CA    . ASP A 61  ? 0.2619 0.2984 0.1647 0.0066  -0.0584 0.0289  37  ASP A CA    
304  C  C     . ASP A 61  ? 0.2287 0.2865 0.1904 0.0180  -0.0636 0.0331  37  ASP A C     
305  O  O     . ASP A 61  ? 0.2577 0.3153 0.1299 0.0227  -0.1036 0.0552  37  ASP A O     
306  C  CB    . ASP A 61  ? 0.3000 0.3168 0.2392 0.0425  -0.0973 0.0335  37  ASP A CB    
307  C  CG    . ASP A 61  ? 0.2906 0.3126 0.2643 0.0553  -0.0879 0.0145  37  ASP A CG    
308  O  OD1   . ASP A 61  ? 0.2904 0.3529 0.1864 0.0606  -0.0660 0.0172  37  ASP A OD1   
309  O  OD2   . ASP A 61  ? 0.3592 0.3430 0.2768 0.0981  -0.1481 -0.0300 37  ASP A OD2   
310  N  N     . ALA A 62  ? 0.2821 0.2565 0.1261 0.0090  -0.0617 0.0284  38  ALA A N     
311  C  CA    . ALA A 62  ? 0.2567 0.2866 0.1612 0.0018  -0.0962 0.0493  38  ALA A CA    
312  C  C     . ALA A 62  ? 0.3032 0.2989 0.1242 -0.0109 -0.0589 0.0123  38  ALA A C     
313  O  O     . ALA A 62  ? 0.2721 0.3655 0.2405 0.0156  -0.0595 -0.0024 38  ALA A O     
314  C  CB    . ALA A 62  ? 0.2206 0.3321 0.1626 0.0480  -0.0933 0.0564  38  ALA A CB    
315  N  N     . GLU A 63  ? 0.3329 0.3086 0.0957 0.0065  -0.0859 0.0246  39  GLU A N     
316  C  CA    . GLU A 63  ? 0.2870 0.3290 0.1946 -0.0161 -0.0829 -0.0143 39  GLU A CA    
317  C  C     . GLU A 63  ? 0.2936 0.3135 0.1603 0.0101  -0.0392 0.0232  39  GLU A C     
318  O  O     . GLU A 63  ? 0.2916 0.3616 0.1944 0.0187  -0.0460 0.0395  39  GLU A O     
319  C  CB    . GLU A 63  ? 0.3846 0.3328 0.2498 0.0205  -0.0561 -0.0191 39  GLU A CB    
320  C  CG    . GLU A 63  ? 0.4490 0.3739 0.2680 0.0379  -0.0164 -0.0938 39  GLU A CG    
321  C  CD    . GLU A 63  ? 0.5144 0.3826 0.5134 0.0468  -0.0490 -0.1165 39  GLU A CD    
322  O  OE1   . GLU A 63  ? 0.5212 0.4473 0.5054 0.0387  -0.0611 -0.1137 39  GLU A OE1   
323  O  OE2   . GLU A 63  ? 0.5444 0.4997 0.6854 -0.0402 -0.0630 -0.2361 39  GLU A OE2   
324  N  N     . ARG A 64  ? 0.2825 0.2965 0.1569 0.0017  -0.0461 0.0312  40  ARG A N     
325  C  CA    . ARG A 64  ? 0.2899 0.2662 0.1295 -0.0067 -0.0490 0.0295  40  ARG A CA    
326  C  C     . ARG A 64  ? 0.2260 0.2843 0.0804 -0.0172 -0.0631 0.0424  40  ARG A C     
327  O  O     . ARG A 64  ? 0.2322 0.3237 0.1186 -0.0416 -0.0885 0.0140  40  ARG A O     
328  C  CB    . ARG A 64  ? 0.2365 0.2580 0.1552 0.0235  -0.0478 0.0572  40  ARG A CB    
329  C  CG    . ARG A 64  ? 0.2782 0.2707 0.1754 0.0119  -0.0070 0.0682  40  ARG A CG    
330  C  CD    . ARG A 64  ? 0.3148 0.2489 0.2766 -0.0233 0.0837  0.0290  40  ARG A CD    
331  N  NE    . ARG A 64  ? 0.2396 0.4317 0.3055 -0.0032 0.0259  -0.0518 40  ARG A NE    
332  C  CZ    . ARG A 64  ? 0.3103 0.4046 0.2938 -0.0297 -0.0144 -0.0571 40  ARG A CZ    
333  N  NH1   . ARG A 64  ? 0.3017 0.3196 0.3030 -0.0424 -0.0416 -0.0465 40  ARG A NH1   
334  N  NH2   . ARG A 64  ? 0.2553 0.3975 0.3025 0.0103  -0.0682 -0.0946 40  ARG A NH2   
335  N  N     . ALA A 65  ? 0.2859 0.2411 0.0740 -0.0094 -0.0395 0.0495  41  ALA A N     
336  C  CA    . ALA A 65  ? 0.2651 0.2149 0.1133 -0.0277 -0.0485 0.0314  41  ALA A CA    
337  C  C     . ALA A 65  ? 0.2580 0.2915 0.1240 -0.0090 -0.0590 0.0270  41  ALA A C     
338  O  O     . ALA A 65  ? 0.2860 0.3079 0.0785 -0.0019 -0.1174 -0.0085 41  ALA A O     
339  C  CB    . ALA A 65  ? 0.1954 0.3027 0.0766 -0.0372 -0.0908 0.0473  41  ALA A CB    
340  N  N     . GLU A 66  ? 0.2777 0.3266 0.1305 0.0015  -0.0644 0.0084  42  GLU A N     
341  C  CA    . GLU A 66  ? 0.2831 0.3637 0.1268 -0.0225 -0.0763 -0.0194 42  GLU A CA    
342  C  C     . GLU A 66  ? 0.2513 0.3104 0.0905 0.0152  -0.0614 -0.0217 42  GLU A C     
343  O  O     . GLU A 66  ? 0.2037 0.3537 0.0923 -0.0112 -0.0454 -0.0083 42  GLU A O     
344  C  CB    . GLU A 66  ? 0.2621 0.3550 0.1271 0.0377  -0.1185 -0.0194 42  GLU A CB    
345  C  CG    . GLU A 66  ? 0.3712 0.4444 0.1224 -0.0406 -0.1520 -0.0942 42  GLU A CG    
346  C  CD    . GLU A 66  ? 0.4877 0.4704 0.1983 -0.0241 -0.1432 -0.0935 42  GLU A CD    
347  O  OE1   . GLU A 66  ? 0.4742 0.6275 0.3497 0.0062  -0.1791 -0.0070 42  GLU A OE1   
348  O  OE2   . GLU A 66  ? 0.5524 0.5748 0.4048 -0.1505 -0.1301 -0.0472 42  GLU A OE2   
349  N  N     . LEU A 67  ? 0.2904 0.2929 0.1837 -0.0045 -0.0132 -0.0540 43  LEU A N     
350  C  CA    . LEU A 67  ? 0.2838 0.2850 0.2359 0.0070  -0.0148 -0.0382 43  LEU A CA    
351  C  C     . LEU A 67  ? 0.2379 0.2622 0.1327 -0.0117 -0.0427 -0.0269 43  LEU A C     
352  O  O     . LEU A 67  ? 0.2615 0.2626 0.0648 -0.0274 -0.0502 -0.0397 43  LEU A O     
353  C  CB    . LEU A 67  ? 0.3259 0.3156 0.2311 0.0706  -0.0811 -0.0352 43  LEU A CB    
354  C  CG    . LEU A 67  ? 0.4163 0.2628 0.3015 0.0644  -0.0413 -0.0651 43  LEU A CG    
355  C  CD1   . LEU A 67  ? 0.4743 0.3490 0.2889 0.0211  -0.0041 -0.0395 43  LEU A CD1   
356  C  CD2   . LEU A 67  ? 0.5340 0.3178 0.2959 0.1590  -0.0183 -0.0966 43  LEU A CD2   
357  N  N     . LEU A 68  ? 0.2543 0.2153 0.1135 0.0013  -0.0278 0.0063  44  LEU A N     
358  C  CA    . LEU A 68  ? 0.2584 0.1753 0.1119 -0.0182 -0.0270 -0.0187 44  LEU A CA    
359  C  C     . LEU A 68  ? 0.2133 0.2058 0.0382 -0.0132 -0.0409 -0.0237 44  LEU A C     
360  O  O     . LEU A 68  ? 0.2205 0.2560 0.0578 -0.0060 -0.0782 -0.0135 44  LEU A O     
361  C  CB    . LEU A 68  ? 0.2196 0.2890 0.1458 -0.0320 -0.1273 -0.0152 44  LEU A CB    
362  C  CG    . LEU A 68  ? 0.2432 0.3126 0.1957 -0.0219 -0.1071 0.0080  44  LEU A CG    
363  C  CD1   . LEU A 68  ? 0.3235 0.2970 0.1953 0.0120  -0.1322 0.0045  44  LEU A CD1   
364  C  CD2   . LEU A 68  ? 0.2823 0.3703 0.1579 -0.0565 -0.1630 0.0105  44  LEU A CD2   
365  N  N     . TYR A 69  ? 0.2438 0.1960 0.0492 -0.0316 -0.0580 -0.0290 45  TYR A N     
366  C  CA    . TYR A 69  ? 0.2320 0.2044 0.1079 -0.0207 -0.0595 -0.0112 45  TYR A CA    
367  C  C     . TYR A 69  ? 0.2108 0.2421 0.0879 -0.0046 -0.0459 -0.0036 45  TYR A C     
368  O  O     . TYR A 69  ? 0.2207 0.2566 0.0721 -0.0245 -0.0720 0.0216  45  TYR A O     
369  C  CB    . TYR A 69  ? 0.2134 0.2339 0.0549 -0.0182 -0.0723 0.0264  45  TYR A CB    
370  C  CG    . TYR A 69  ? 0.2244 0.2204 0.1228 -0.0196 -0.0253 0.0203  45  TYR A CG    
371  C  CD1   . TYR A 69  ? 0.2525 0.2139 0.0831 -0.0089 -0.0479 -0.0028 45  TYR A CD1   
372  C  CD2   . TYR A 69  ? 0.2612 0.2161 0.0884 -0.0181 -0.0957 0.0711  45  TYR A CD2   
373  C  CE1   . TYR A 69  ? 0.2503 0.2026 0.0896 -0.0274 -0.0693 -0.0187 45  TYR A CE1   
374  C  CE2   . TYR A 69  ? 0.2002 0.2286 0.1212 0.0168  -0.0916 -0.0092 45  TYR A CE2   
375  C  CZ    . TYR A 69  ? 0.2256 0.2343 0.1061 -0.0056 -0.0688 -0.0056 45  TYR A CZ    
376  O  OH    . TYR A 69  ? 0.2553 0.2656 0.1330 0.0252  -0.0989 0.0075  45  TYR A OH    
377  N  N     . SER A 70  ? 0.2334 0.2302 0.0974 -0.0102 -0.0704 -0.0172 46  SER A N     
378  C  CA    . SER A 70  ? 0.2397 0.2771 0.1150 -0.0150 -0.0722 -0.0505 46  SER A CA    
379  C  C     . SER A 70  ? 0.2451 0.2823 0.1276 -0.0231 -0.0611 -0.0244 46  SER A C     
380  O  O     . SER A 70  ? 0.2955 0.3143 0.1669 -0.0269 -0.1100 0.0024  46  SER A O     
381  C  CB    . SER A 70  ? 0.2740 0.2846 0.1144 0.0232  -0.0651 -0.0222 46  SER A CB    
382  O  OG    . SER A 70  ? 0.3140 0.2734 0.1607 -0.0201 -0.0655 -0.0566 46  SER A OG    
383  N  N     . ARG A 71  ? 0.2383 0.2166 0.1406 -0.0031 -0.0837 -0.0008 47  ARG A N     
384  C  CA    . ARG A 71  ? 0.2746 0.2100 0.1483 -0.0020 -0.0562 0.0250  47  ARG A CA    
385  C  C     . ARG A 71  ? 0.2058 0.2329 0.1338 -0.0067 -0.0512 0.0532  47  ARG A C     
386  O  O     . ARG A 71  ? 0.2126 0.2872 0.1006 -0.0217 -0.0436 0.0388  47  ARG A O     
387  C  CB    . ARG A 71  ? 0.2644 0.1964 0.1377 0.0029  -0.0482 0.0189  47  ARG A CB    
388  C  CG    . ARG A 71  ? 0.2369 0.2520 0.0712 -0.0191 -0.0387 -0.0139 47  ARG A CG    
389  C  CD    . ARG A 71  ? 0.2812 0.2418 0.1465 -0.0197 -0.0230 -0.0089 47  ARG A CD    
390  N  NE    . ARG A 71  ? 0.3073 0.2565 0.1576 -0.0119 -0.0318 -0.0297 47  ARG A NE    
391  C  CZ    . ARG A 71  ? 0.3191 0.2689 0.1455 -0.0520 -0.0382 -0.0077 47  ARG A CZ    
392  N  NH1   . ARG A 71  ? 0.2717 0.3368 0.1593 -0.0707 -0.0507 -0.0061 47  ARG A NH1   
393  N  NH2   . ARG A 71  ? 0.3731 0.2856 0.1222 -0.0140 -0.0433 0.0052  47  ARG A NH2   
394  N  N     . MSE A 72  ? 0.2580 0.2464 0.0969 0.0022  -0.0540 0.0359  48  MSE A N     
395  C  CA    . MSE A 72  ? 0.2191 0.2127 0.0686 -0.0075 -0.0405 0.0509  48  MSE A CA    
396  C  C     . MSE A 72  ? 0.2131 0.2590 0.1171 0.0218  -0.0464 0.0480  48  MSE A C     
397  O  O     . MSE A 72  ? 0.2946 0.3176 0.0907 -0.0242 -0.0433 0.0154  48  MSE A O     
398  C  CB    . MSE A 72  ? 0.2020 0.2590 0.1204 -0.0164 -0.0266 0.0376  48  MSE A CB    
399  C  CG    . MSE A 72  ? 0.3136 0.3330 0.1623 0.0515  -0.0047 0.0158  48  MSE A CG    
400  SE SE    . MSE A 72  ? 0.5414 0.6136 0.3984 -0.0654 -0.1099 -0.0321 48  MSE A SE    
401  C  CE    . MSE A 72  ? 0.4677 0.4420 0.3604 0.0384  -0.0661 -0.1737 48  MSE A CE    
402  N  N     . GLY A 73  ? 0.2117 0.3077 0.1104 0.0172  -0.0615 0.0107  49  GLY A N     
403  C  CA    . GLY A 73  ? 0.2448 0.2490 0.1565 0.0124  -0.0521 0.0433  49  GLY A CA    
404  C  C     . GLY A 73  ? 0.2389 0.2669 0.1032 -0.0052 -0.0423 -0.0095 49  GLY A C     
405  O  O     . GLY A 73  ? 0.2356 0.3163 0.1226 0.0086  -0.0677 0.0382  49  GLY A O     
406  N  N     . PRO A 74  ? 0.2524 0.2331 0.1320 -0.0059 -0.0682 -0.0332 50  PRO A N     
407  C  CA    . PRO A 74  ? 0.2631 0.2214 0.1331 0.0078  -0.0761 -0.0290 50  PRO A CA    
408  C  C     . PRO A 74  ? 0.2287 0.2616 0.1031 -0.0081 -0.0337 0.0057  50  PRO A C     
409  O  O     . PRO A 74  ? 0.2859 0.3460 0.0673 -0.0317 -0.0341 0.0084  50  PRO A O     
410  C  CB    . PRO A 74  ? 0.2566 0.2349 0.1397 -0.0077 -0.0943 -0.0444 50  PRO A CB    
411  C  CG    . PRO A 74  ? 0.3075 0.2463 0.1497 -0.0166 -0.1314 -0.0430 50  PRO A CG    
412  C  CD    . PRO A 74  ? 0.2527 0.2720 0.2034 -0.0250 -0.0912 -0.0280 50  PRO A CD    
413  N  N     . ALA A 75  ? 0.2469 0.2341 0.0924 -0.0079 -0.0649 0.0176  51  ALA A N     
414  C  CA    . ALA A 75  ? 0.2246 0.2544 0.0975 0.0153  -0.0702 0.0227  51  ALA A CA    
415  C  C     . ALA A 75  ? 0.2491 0.2599 0.1271 0.0008  -0.0907 0.0102  51  ALA A C     
416  O  O     . ALA A 75  ? 0.3052 0.2937 0.0972 0.0044  -0.0970 0.0138  51  ALA A O     
417  C  CB    . ALA A 75  ? 0.2379 0.2222 0.1083 0.0084  -0.0992 0.0410  51  ALA A CB    
418  N  N     . LEU A 76  ? 0.2699 0.2567 0.1124 0.0256  -0.0269 0.0079  52  LEU A N     
419  C  CA    . LEU A 76  ? 0.1824 0.2536 0.1734 0.0152  -0.0507 0.0380  52  LEU A CA    
420  C  C     . LEU A 76  ? 0.1908 0.2401 0.1520 0.0069  -0.0559 0.0083  52  LEU A C     
421  O  O     . LEU A 76  ? 0.2391 0.2655 0.1335 0.0194  -0.0628 0.0239  52  LEU A O     
422  C  CB    . LEU A 76  ? 0.1781 0.3172 0.1708 0.0148  -0.0462 0.0156  52  LEU A CB    
423  C  CG    . LEU A 76  ? 0.1675 0.3509 0.2112 0.0320  -0.0138 0.0224  52  LEU A CG    
424  C  CD1   . LEU A 76  ? 0.2477 0.4072 0.2449 -0.0032 0.0595  0.0763  52  LEU A CD1   
425  C  CD2   . LEU A 76  ? 0.3325 0.3228 0.2465 -0.0178 -0.0211 0.0221  52  LEU A CD2   
426  N  N     . GLU A 77  ? 0.1530 0.2996 0.1614 -0.0035 -0.0525 -0.0016 53  GLU A N     
427  C  CA    . GLU A 77  ? 0.1618 0.2489 0.1102 0.0295  -0.0505 -0.0096 53  GLU A CA    
428  C  C     . GLU A 77  ? 0.2001 0.2199 0.1208 0.0304  -0.0598 -0.0069 53  GLU A C     
429  O  O     . GLU A 77  ? 0.2512 0.2355 0.0869 0.0480  -0.1032 -0.0089 53  GLU A O     
430  C  CB    . GLU A 77  ? 0.1982 0.2373 0.1306 0.0472  -0.0259 0.0174  53  GLU A CB    
431  C  CG    . GLU A 77  ? 0.2299 0.2619 0.1753 0.0155  -0.0441 -0.0230 53  GLU A CG    
432  C  CD    . GLU A 77  ? 0.2587 0.2212 0.1959 0.0042  -0.0669 0.0108  53  GLU A CD    
433  O  OE1   . GLU A 77  ? 0.2993 0.2650 0.1578 0.0013  -0.1216 -0.0291 53  GLU A OE1   
434  O  OE2   . GLU A 77  ? 0.3083 0.2939 0.1548 0.0090  -0.0912 0.0696  53  GLU A OE2   
435  N  N     . ALA A 78  ? 0.2218 0.2412 0.0928 0.0226  -0.0509 -0.0139 54  ALA A N     
436  C  CA    . ALA A 78  ? 0.2009 0.2610 0.1147 0.0085  -0.0624 -0.0373 54  ALA A CA    
437  C  C     . ALA A 78  ? 0.2065 0.2408 0.1306 0.0102  -0.0598 -0.0061 54  ALA A C     
438  O  O     . ALA A 78  ? 0.2394 0.2793 0.0573 0.0361  -0.0795 0.0110  54  ALA A O     
439  C  CB    . ALA A 78  ? 0.1624 0.3062 0.1021 0.0039  -0.0888 -0.0391 54  ALA A CB    
440  N  N     . SER A 79  ? 0.1844 0.2647 0.1254 0.0004  -0.0622 0.0016  55  SER A N     
441  C  CA    . SER A 79  ? 0.1987 0.2013 0.1221 -0.0091 -0.0733 0.0087  55  SER A CA    
442  C  C     . SER A 79  ? 0.2246 0.2353 0.1285 0.0240  -0.0399 0.0280  55  SER A C     
443  O  O     . SER A 79  ? 0.2832 0.2931 0.1304 0.0242  -0.0146 0.0220  55  SER A O     
444  C  CB    . SER A 79  ? 0.2668 0.1961 0.1648 -0.0346 -0.0604 0.0268  55  SER A CB    
445  O  OG    . SER A 79  ? 0.2651 0.2549 0.2320 -0.0823 -0.0044 -0.0246 55  SER A OG    
446  N  N     . GLY A 80  ? 0.2837 0.1850 0.1125 0.0059  -0.0568 0.0480  56  GLY A N     
447  C  CA    . GLY A 80  ? 0.1955 0.1939 0.0928 0.0330  -0.0539 0.0392  56  GLY A CA    
448  C  C     . GLY A 80  ? 0.2171 0.1806 0.0892 0.0175  -0.0719 -0.0016 56  GLY A C     
449  O  O     . GLY A 80  ? 0.2409 0.1967 0.1236 -0.0161 -0.1033 0.0576  56  GLY A O     
450  N  N     . GLY A 81  ? 0.2194 0.1867 0.0821 0.0289  -0.0589 0.0162  57  GLY A N     
451  C  CA    . GLY A 81  ? 0.1431 0.2483 0.1272 0.0179  -0.0491 0.0190  57  GLY A CA    
452  C  C     . GLY A 81  ? 0.2327 0.1729 0.0897 0.0093  -0.0719 -0.0176 57  GLY A C     
453  O  O     . GLY A 81  ? 0.3014 0.1706 0.0897 -0.0019 -0.0915 -0.0504 57  GLY A O     
454  N  N     . SER A 82  ? 0.2641 0.1845 0.0769 0.0177  -0.0818 -0.0200 58  SER A N     
455  C  CA    A SER A 82  ? 0.2810 0.1837 0.1138 0.0103  -0.0471 -0.0052 58  SER A CA    
456  C  CA    B SER A 82  ? 0.2829 0.1863 0.1096 0.0048  -0.0497 -0.0021 58  SER A CA    
457  C  C     . SER A 82  ? 0.2544 0.1975 0.1313 0.0182  -0.0405 -0.0251 58  SER A C     
458  O  O     . SER A 82  ? 0.2358 0.1993 0.1232 0.0121  -0.0439 -0.0334 58  SER A O     
459  C  CB    A SER A 82  ? 0.2837 0.2019 0.1013 0.0108  -0.0339 0.0134  58  SER A CB    
460  C  CB    B SER A 82  ? 0.2952 0.2205 0.0645 -0.0113 -0.0428 0.0262  58  SER A CB    
461  O  OG    A SER A 82  ? 0.2716 0.2133 0.1276 0.1011  -0.0082 -0.0039 58  SER A OG    
462  O  OG    B SER A 82  ? 0.3189 0.2689 0.0671 -0.0340 -0.0400 0.0038  58  SER A OG    
463  N  N     . ALA A 83  ? 0.2681 0.2137 0.0818 -0.0023 -0.0598 0.0281  59  ALA A N     
464  C  CA    . ALA A 83  ? 0.2465 0.2578 0.0661 -0.0014 -0.0932 0.0167  59  ALA A CA    
465  C  C     . ALA A 83  ? 0.2718 0.2141 0.0989 0.0083  -0.0727 -0.0273 59  ALA A C     
466  O  O     . ALA A 83  ? 0.2824 0.2093 0.0698 0.0457  -0.0969 0.0086  59  ALA A O     
467  C  CB    . ALA A 83  ? 0.2395 0.2695 0.1686 0.0223  -0.0383 -0.0567 59  ALA A CB    
468  N  N     . GLY A 84  ? 0.2772 0.2462 0.0953 0.0064  -0.0620 0.0323  60  GLY A N     
469  C  CA    . GLY A 84  ? 0.2331 0.1788 0.2182 0.0346  -0.0841 -0.0058 60  GLY A CA    
470  C  C     . GLY A 84  ? 0.2437 0.2309 0.1292 0.0091  -0.0346 -0.0306 60  GLY A C     
471  O  O     . GLY A 84  ? 0.2019 0.2295 0.1204 0.0003  -0.0771 -0.0074 60  GLY A O     
472  N  N     . ASN A 85  ? 0.2336 0.2742 0.0905 0.0056  -0.0245 -0.0294 61  ASN A N     
473  C  CA    . ASN A 85  ? 0.2268 0.2747 0.0739 0.0116  -0.0400 -0.0142 61  ASN A CA    
474  C  C     . ASN A 85  ? 0.2460 0.2559 0.0980 0.0453  -0.0428 -0.0399 61  ASN A C     
475  O  O     . ASN A 85  ? 0.2731 0.2209 0.0677 0.0417  -0.0601 -0.0412 61  ASN A O     
476  C  CB    . ASN A 85  ? 0.2901 0.2139 0.0914 0.0356  -0.0218 -0.0154 61  ASN A CB    
477  C  CG    . ASN A 85  ? 0.3236 0.2088 0.1089 0.0269  -0.0406 -0.0290 61  ASN A CG    
478  O  OD1   . ASN A 85  ? 0.2754 0.2829 0.1430 0.0526  -0.0595 0.0364  61  ASN A OD1   
479  N  ND2   . ASN A 85  ? 0.3014 0.2032 0.0700 0.0299  -0.0439 -0.0530 61  ASN A ND2   
480  N  N     . THR A 86  ? 0.2772 0.2860 0.0796 0.0208  -0.0571 -0.0148 62  THR A N     
481  C  CA    . THR A 86  ? 0.2459 0.2390 0.0810 0.0320  -0.0537 -0.0115 62  THR A CA    
482  C  C     . THR A 86  ? 0.2408 0.2462 0.0780 0.0370  -0.0591 -0.0177 62  THR A C     
483  O  O     . THR A 86  ? 0.2768 0.2544 0.0655 0.0685  -0.0757 -0.0150 62  THR A O     
484  C  CB    . THR A 86  ? 0.2991 0.2247 0.1162 0.0054  -0.0706 0.0226  62  THR A CB    
485  O  OG1   . THR A 86  ? 0.3319 0.2463 0.0724 0.0034  -0.1159 0.0256  62  THR A OG1   
486  C  CG2   . THR A 86  ? 0.2832 0.2686 0.1324 -0.0014 -0.0814 -0.0080 62  THR A CG2   
487  N  N     . ALA A 87  ? 0.2679 0.2374 0.0460 0.0207  -0.0704 -0.0132 63  ALA A N     
488  C  CA    . ALA A 87  ? 0.2522 0.2461 0.0542 0.0027  -0.0576 0.0124  63  ALA A CA    
489  C  C     . ALA A 87  ? 0.2614 0.2246 0.1049 0.0144  -0.0418 -0.0059 63  ALA A C     
490  O  O     . ALA A 87  ? 0.2815 0.2047 0.0560 -0.0064 -0.0540 0.0110  63  ALA A O     
491  C  CB    . ALA A 87  ? 0.2476 0.2808 0.1041 0.0087  -0.0571 -0.0239 63  ALA A CB    
492  N  N     . ALA A 88  ? 0.2468 0.2708 0.1156 0.0244  -0.0627 0.0069  64  ALA A N     
493  C  CA    . ALA A 88  ? 0.2335 0.2595 0.0812 -0.0012 -0.0790 0.0089  64  ALA A CA    
494  C  C     . ALA A 88  ? 0.2744 0.2470 0.0540 0.0279  -0.0823 -0.0274 64  ALA A C     
495  O  O     . ALA A 88  ? 0.3543 0.2763 0.0611 0.0673  -0.0580 0.0177  64  ALA A O     
496  C  CB    . ALA A 88  ? 0.3050 0.2351 0.0885 0.0492  -0.0829 -0.0143 64  ALA A CB    
497  N  N     . GLY A 89  ? 0.2664 0.2869 0.0875 -0.0024 -0.0697 -0.0232 65  GLY A N     
498  C  CA    . GLY A 89  ? 0.2951 0.2756 0.1053 0.0174  -0.0492 -0.0004 65  GLY A CA    
499  C  C     . GLY A 89  ? 0.2756 0.2751 0.1086 0.0305  -0.0675 -0.0017 65  GLY A C     
500  O  O     . GLY A 89  ? 0.2960 0.3291 0.1036 0.0579  -0.0691 0.0121  65  GLY A O     
501  N  N     . VAL A 90  ? 0.2733 0.2702 0.1604 -0.0045 -0.0690 -0.0476 66  VAL A N     
502  C  CA    . VAL A 90  ? 0.2861 0.2655 0.0449 0.0335  -0.0617 -0.0066 66  VAL A CA    
503  C  C     . VAL A 90  ? 0.3110 0.2560 0.1470 0.0017  -0.0178 -0.0303 66  VAL A C     
504  O  O     . VAL A 90  ? 0.3034 0.2584 0.2521 0.0117  -0.0453 -0.0810 66  VAL A O     
505  C  CB    . VAL A 90  ? 0.3068 0.2095 0.1773 0.0296  -0.0936 -0.0131 66  VAL A CB    
506  C  CG1   . VAL A 90  ? 0.3367 0.2465 0.0970 0.0078  -0.1429 0.0331  66  VAL A CG1   
507  C  CG2   . VAL A 90  ? 0.3651 0.2355 0.0676 0.0312  -0.1142 0.0178  66  VAL A CG2   
508  N  N     . ALA A 91  ? 0.2955 0.2507 0.1550 -0.0165 -0.0377 0.0155  67  ALA A N     
509  C  CA    . ALA A 91  ? 0.3300 0.2578 0.2569 0.0044  -0.0294 0.0281  67  ALA A CA    
510  C  C     . ALA A 91  ? 0.3137 0.2314 0.2607 0.0042  -0.0678 0.0193  67  ALA A C     
511  O  O     . ALA A 91  ? 0.3555 0.3306 0.3084 0.1163  -0.0826 -0.0186 67  ALA A O     
512  C  CB    . ALA A 91  ? 0.3632 0.1638 0.1233 -0.0365 -0.0977 0.0006  67  ALA A CB    
513  N  N     . ASN A 92  ? 0.2775 0.3288 0.3214 0.0124  -0.0633 -0.0334 68  ASN A N     
514  C  CA    . ASN A 92  ? 0.2906 0.3368 0.2380 0.0153  -0.1112 -0.0991 68  ASN A CA    
515  C  C     . ASN A 92  ? 0.3756 0.2726 0.2835 0.0938  -0.0374 -0.0362 68  ASN A C     
516  O  O     . ASN A 92  ? 0.4231 0.2673 0.3202 0.1251  -0.0437 -0.0235 68  ASN A O     
517  C  CB    . ASN A 92  ? 0.2975 0.3129 0.2520 -0.0033 -0.0843 -0.0814 68  ASN A CB    
518  C  CG    . ASN A 92  ? 0.3523 0.3244 0.2129 0.0248  -0.1297 -0.0641 68  ASN A CG    
519  O  OD1   . ASN A 92  ? 0.4297 0.3767 0.1960 0.0302  -0.1199 -0.1218 68  ASN A OD1   
520  N  ND2   . ASN A 92  ? 0.3985 0.3125 0.1456 -0.0157 -0.1193 -0.0021 68  ASN A ND2   
521  N  N     . LEU A 93  ? 0.3858 0.3683 0.2227 0.0284  -0.0413 -0.0251 69  LEU A N     
522  C  CA    . LEU A 93  ? 0.4132 0.2153 0.2347 0.0521  -0.0362 -0.0520 69  LEU A CA    
523  C  C     . LEU A 93  ? 0.3602 0.2220 0.1818 0.0579  -0.0366 -0.0474 69  LEU A C     
524  O  O     . LEU A 93  ? 0.4375 0.3131 0.1735 0.1006  -0.0109 -0.0231 69  LEU A O     
525  C  CB    . LEU A 93  ? 0.3570 0.1687 0.2474 0.0209  -0.0305 -0.0527 69  LEU A CB    
526  C  CG    . LEU A 93  ? 0.2748 0.2324 0.2994 0.0199  -0.0403 -0.0624 69  LEU A CG    
527  C  CD1   . LEU A 93  ? 0.3950 0.2960 0.2587 0.0033  -0.1007 0.0216  69  LEU A CD1   
528  C  CD2   . LEU A 93  ? 0.3126 0.3392 0.3007 -0.0392 0.0025  -0.0871 69  LEU A CD2   
529  N  N     . GLY A 94  ? 0.3159 0.3066 0.2164 0.0247  -0.0666 -0.1010 70  GLY A N     
530  C  CA    . GLY A 94  ? 0.3286 0.2992 0.3005 -0.0294 -0.0238 -0.0625 70  GLY A CA    
531  C  C     . GLY A 94  ? 0.4161 0.3026 0.1449 -0.0448 -0.0739 0.0221  70  GLY A C     
532  O  O     . GLY A 94  ? 0.4886 0.3528 0.1035 -0.0519 -0.1267 0.0353  70  GLY A O     
533  N  N     . GLY A 95  ? 0.3917 0.3691 0.2334 -0.0221 -0.0752 -0.0041 71  GLY A N     
534  C  CA    . GLY A 95  ? 0.3517 0.3817 0.2410 -0.0645 -0.0525 -0.0326 71  GLY A CA    
535  C  C     . GLY A 95  ? 0.3325 0.3511 0.1645 -0.0784 -0.0977 -0.0299 71  GLY A C     
536  O  O     . GLY A 95  ? 0.5119 0.3346 0.1283 -0.1067 -0.0546 -0.0598 71  GLY A O     
537  N  N     . LYS A 96  ? 0.3355 0.3056 0.1068 -0.0279 -0.1040 -0.0074 72  LYS A N     
538  C  CA    . LYS A 96  ? 0.3339 0.2541 0.2148 -0.0220 -0.0885 -0.0984 72  LYS A CA    
539  C  C     . LYS A 96  ? 0.3711 0.2567 0.1591 0.0367  -0.0961 -0.0172 72  LYS A C     
540  O  O     . LYS A 96  ? 0.3857 0.2660 0.1126 0.0063  -0.0537 0.0287  72  LYS A O     
541  C  CB    . LYS A 96  ? 0.3448 0.2523 0.1142 0.0188  -0.1207 -0.0765 72  LYS A CB    
542  C  CG    . LYS A 96  ? 0.3350 0.2483 0.1815 0.0382  -0.0962 -0.0401 72  LYS A CG    
543  C  CD    . LYS A 96  ? 0.3722 0.2910 0.3321 0.0355  -0.0304 -0.1953 72  LYS A CD    
544  C  CE    . LYS A 96  ? 0.3149 0.3031 0.4393 0.0215  -0.0509 -0.1247 72  LYS A CE    
545  N  NZ    . LYS A 96  ? 0.3322 0.5054 0.3254 0.0277  0.0658  -0.2263 72  LYS A NZ    
546  N  N     . ALA A 97  ? 0.3814 0.1607 0.1442 0.0008  -0.0773 0.0018  73  ALA A N     
547  C  CA    . ALA A 97  ? 0.2488 0.1489 0.1178 -0.0488 -0.0864 0.0010  73  ALA A CA    
548  C  C     . ALA A 97  ? 0.2334 0.1851 0.1034 -0.0389 -0.1166 -0.0223 73  ALA A C     
549  O  O     . ALA A 97  ? 0.3232 0.2382 0.1619 -0.0700 -0.0398 -0.0055 73  ALA A O     
550  C  CB    . ALA A 97  ? 0.1752 0.2092 0.1814 -0.0634 -0.0345 -0.0188 73  ALA A CB    
551  N  N     . ALA A 98  ? 0.1705 0.2352 0.1306 -0.0344 -0.0928 -0.0396 74  ALA A N     
552  C  CA    . ALA A 98  ? 0.1719 0.2596 0.1254 -0.0458 -0.0791 -0.0273 74  ALA A CA    
553  C  C     . ALA A 98  ? 0.2548 0.2675 0.1648 0.0069  -0.0303 -0.0328 74  ALA A C     
554  O  O     . ALA A 98  ? 0.2913 0.3262 0.0575 0.0077  -0.0589 -0.0198 74  ALA A O     
555  C  CB    . ALA A 98  ? 0.1767 0.2896 0.1777 -0.0184 -0.1092 -0.0282 74  ALA A CB    
556  N  N     . TYR A 99  ? 0.2942 0.2185 0.1201 0.0513  -0.0647 -0.0388 75  TYR A N     
557  C  CA    . TYR A 99  ? 0.2471 0.1965 0.1402 -0.0219 -0.0516 -0.0265 75  TYR A CA    
558  C  C     . TYR A 99  ? 0.2698 0.2242 0.1508 -0.0081 -0.0484 -0.0207 75  TYR A C     
559  O  O     . TYR A 99  ? 0.2711 0.2277 0.1204 -0.0382 -0.0804 -0.0442 75  TYR A O     
560  C  CB    . TYR A 99  ? 0.2415 0.2246 0.1553 0.0180  -0.0564 -0.0105 75  TYR A CB    
561  C  CG    . TYR A 99  ? 0.2650 0.2374 0.1578 0.0046  -0.0691 -0.0275 75  TYR A CG    
562  C  CD1   . TYR A 99  ? 0.2455 0.2086 0.1190 0.0324  -0.0806 -0.0206 75  TYR A CD1   
563  C  CD2   . TYR A 99  ? 0.2639 0.2636 0.1560 0.0451  -0.0801 0.0067  75  TYR A CD2   
564  C  CE1   . TYR A 99  ? 0.2510 0.1848 0.1647 0.0171  -0.0491 0.0019  75  TYR A CE1   
565  C  CE2   . TYR A 99  ? 0.2666 0.2299 0.1385 -0.0015 -0.1122 0.0273  75  TYR A CE2   
566  C  CZ    . TYR A 99  ? 0.2869 0.1926 0.1510 0.0128  -0.0691 0.0038  75  TYR A CZ    
567  O  OH    . TYR A 99  ? 0.2693 0.2516 0.1276 0.0227  -0.0148 -0.0321 75  TYR A OH    
568  N  N     . PHE A 100 ? 0.2333 0.2249 0.1093 -0.0068 -0.0747 -0.0355 76  PHE A N     
569  C  CA    . PHE A 100 ? 0.2512 0.2241 0.0729 0.0193  -0.0737 0.0057  76  PHE A CA    
570  C  C     . PHE A 100 ? 0.3006 0.2102 0.1187 0.0012  -0.1193 0.0251  76  PHE A C     
571  O  O     . PHE A 100 ? 0.3006 0.2637 0.0978 -0.0401 -0.1380 -0.0075 76  PHE A O     
572  C  CB    . PHE A 100 ? 0.2166 0.2530 0.0499 -0.0119 -0.0660 0.0026  76  PHE A CB    
573  C  CG    . PHE A 100 ? 0.2665 0.2065 0.1012 -0.0330 -0.0738 0.0167  76  PHE A CG    
574  C  CD1   . PHE A 100 ? 0.2335 0.2024 0.1443 -0.0481 -0.0714 -0.0101 76  PHE A CD1   
575  C  CD2   . PHE A 100 ? 0.2816 0.2649 0.1461 -0.0331 -0.1295 0.0200  76  PHE A CD2   
576  C  CE1   . PHE A 100 ? 0.3045 0.2400 0.1270 -0.0448 -0.0872 -0.0225 76  PHE A CE1   
577  C  CE2   . PHE A 100 ? 0.3394 0.2549 0.1020 -0.0645 -0.0568 0.0098  76  PHE A CE2   
578  C  CZ    . PHE A 100 ? 0.3029 0.2449 0.1347 -0.0540 -0.0697 0.0131  76  PHE A CZ    
579  N  N     . GLY A 101 ? 0.3166 0.3165 0.1346 -0.0213 -0.0941 -0.0370 77  GLY A N     
580  C  CA    . GLY A 101 ? 0.3259 0.2530 0.1367 -0.0210 -0.0732 -0.0020 77  GLY A CA    
581  C  C     . GLY A 101 ? 0.3118 0.2554 0.1565 -0.0127 -0.0776 0.0444  77  GLY A C     
582  O  O     . GLY A 101 ? 0.3084 0.2575 0.1295 0.0189  -0.1585 0.0491  77  GLY A O     
583  N  N     . ASN A 102 ? 0.3040 0.2854 0.1269 -0.0168 -0.0523 0.0663  78  ASN A N     
584  C  CA    . ASN A 102 ? 0.2230 0.2888 0.1171 0.0097  -0.0579 -0.0032 78  ASN A CA    
585  C  C     . ASN A 102 ? 0.2232 0.2597 0.1258 -0.0132 -0.0589 0.0015  78  ASN A C     
586  O  O     . ASN A 102 ? 0.2748 0.2818 0.0730 -0.0335 -0.1088 0.0065  78  ASN A O     
587  C  CB    . ASN A 102 ? 0.2179 0.2801 0.1043 -0.0013 -0.0723 0.0633  78  ASN A CB    
588  C  CG    . ASN A 102 ? 0.2547 0.2514 0.0967 0.0242  -0.0527 0.0532  78  ASN A CG    
589  O  OD1   . ASN A 102 ? 0.3049 0.2687 0.1362 0.0220  -0.0590 0.0386  78  ASN A OD1   
590  N  ND2   . ASN A 102 ? 0.2963 0.2649 0.1900 0.0295  -0.0620 0.0068  78  ASN A ND2   
591  N  N     . VAL A 103 ? 0.1969 0.2741 0.1496 0.0187  -0.0439 0.0120  79  VAL A N     
592  C  CA    . VAL A 103 ? 0.1567 0.2656 0.1486 0.0003  -0.0283 -0.0088 79  VAL A CA    
593  C  C     . VAL A 103 ? 0.1567 0.2810 0.1572 -0.0153 -0.0306 -0.0106 79  VAL A C     
594  O  O     . VAL A 103 ? 0.1809 0.3264 0.1788 -0.0124 -0.0843 -0.0087 79  VAL A O     
595  C  CB    . VAL A 103 ? 0.1687 0.2379 0.1025 -0.0194 -0.0434 0.0149  79  VAL A CB    
596  C  CG1   . VAL A 103 ? 0.1880 0.2883 0.0747 -0.0343 -0.0347 0.0217  79  VAL A CG1   
597  C  CG2   . VAL A 103 ? 0.2334 0.2194 0.0635 0.0051  -0.0851 0.0235  79  VAL A CG2   
598  N  N     . ALA A 104 ? 0.2407 0.3133 0.1475 -0.0022 -0.0334 -0.0113 80  ALA A N     
599  C  CA    . ALA A 104 ? 0.2024 0.2404 0.1683 -0.0223 -0.0321 -0.0246 80  ALA A CA    
600  C  C     . ALA A 104 ? 0.1966 0.2607 0.1738 -0.0070 -0.0271 -0.0148 80  ALA A C     
601  O  O     . ALA A 104 ? 0.2163 0.2476 0.1342 0.0255  -0.0695 0.0030  80  ALA A O     
602  C  CB    . ALA A 104 ? 0.2340 0.2590 0.1611 -0.0191 -0.0804 -0.0207 80  ALA A CB    
603  N  N     . ALA A 105 ? 0.2226 0.2396 0.2087 -0.0291 -0.0384 0.0488  81  ALA A N     
604  C  CA    . ALA A 105 ? 0.2377 0.2489 0.1845 -0.0230 -0.0278 0.0427  81  ALA A CA    
605  C  C     . ALA A 105 ? 0.2053 0.3475 0.1886 -0.0280 -0.0128 0.0338  81  ALA A C     
606  O  O     . ALA A 105 ? 0.3068 0.3921 0.1491 -0.0415 -0.0224 0.0378  81  ALA A O     
607  C  CB    . ALA A 105 ? 0.2191 0.3809 0.2479 -0.0322 -0.0527 0.0644  81  ALA A CB    
608  N  N     . ASP A 106 ? 0.1842 0.2901 0.1794 -0.0307 -0.0641 0.0116  82  ASP A N     
609  C  CA    . ASP A 106 ? 0.1925 0.2351 0.1495 -0.0309 -0.0450 0.0118  82  ASP A CA    
610  C  C     . ASP A 106 ? 0.1975 0.2681 0.1707 -0.0121 -0.0633 0.0094  82  ASP A C     
611  O  O     . ASP A 106 ? 0.2216 0.2879 0.1757 -0.0373 -0.0467 0.0044  82  ASP A O     
612  C  CB    . ASP A 106 ? 0.2670 0.2333 0.1593 -0.0102 -0.0387 0.0225  82  ASP A CB    
613  C  CG    . ASP A 106 ? 0.2929 0.1973 0.1709 0.0259  -0.0523 0.0376  82  ASP A CG    
614  O  OD1   . ASP A 106 ? 0.3172 0.2822 0.1799 0.0025  -0.0592 -0.0144 82  ASP A OD1   
615  O  OD2   . ASP A 106 ? 0.2465 0.2082 0.1574 0.0388  -0.0775 0.0404  82  ASP A OD2   
616  N  N     . GLN A 107 ? 0.1793 0.2652 0.1799 -0.0012 -0.0604 -0.0003 83  GLN A N     
617  C  CA    . GLN A 107 ? 0.1857 0.3066 0.1397 0.0183  -0.0690 0.0318  83  GLN A CA    
618  C  C     . GLN A 107 ? 0.2236 0.2372 0.1251 0.0188  -0.0599 -0.0077 83  GLN A C     
619  O  O     . GLN A 107 ? 0.2466 0.2680 0.1300 0.0452  -0.0421 0.0060  83  GLN A O     
620  C  CB    . GLN A 107 ? 0.2196 0.2838 0.1479 -0.0355 -0.0741 -0.0177 83  GLN A CB    
621  C  CG    . GLN A 107 ? 0.2193 0.2719 0.1378 -0.0215 -0.0911 -0.0026 83  GLN A CG    
622  C  CD    . GLN A 107 ? 0.2591 0.2535 0.1410 -0.0373 -0.1131 0.0255  83  GLN A CD    
623  O  OE1   . GLN A 107 ? 0.2899 0.2544 0.0582 -0.0219 -0.0826 0.0192  83  GLN A OE1   
624  N  NE2   . GLN A 107 ? 0.3058 0.3105 0.1434 -0.0666 -0.1492 0.0460  83  GLN A NE2   
625  N  N     . LEU A 108 ? 0.2199 0.2366 0.0934 -0.0383 -0.0481 -0.0145 84  LEU A N     
626  C  CA    . LEU A 108 ? 0.2086 0.2191 0.1240 -0.0502 -0.0331 -0.0141 84  LEU A CA    
627  C  C     . LEU A 108 ? 0.2022 0.2377 0.1261 -0.0212 -0.0384 -0.0245 84  LEU A C     
628  O  O     . LEU A 108 ? 0.2416 0.2316 0.0787 0.0036  -0.0280 0.0309  84  LEU A O     
629  C  CB    . LEU A 108 ? 0.1291 0.2156 0.0830 -0.0733 -0.0436 -0.0267 84  LEU A CB    
630  C  CG    . LEU A 108 ? 0.1811 0.2443 0.0927 -0.0888 -0.0437 -0.0563 84  LEU A CG    
631  C  CD1   . LEU A 108 ? 0.2836 0.2737 0.1941 -0.0350 -0.0884 -0.0846 84  LEU A CD1   
632  C  CD2   . LEU A 108 ? 0.2028 0.3139 0.0555 -0.0290 -0.0613 -0.0404 84  LEU A CD2   
633  N  N     . GLY A 109 ? 0.2068 0.2241 0.1714 -0.0233 -0.0448 -0.0340 85  GLY A N     
634  C  CA    . GLY A 109 ? 0.2416 0.1971 0.0825 0.0018  -0.0611 0.0328  85  GLY A CA    
635  C  C     . GLY A 109 ? 0.2514 0.2131 0.1360 0.0304  -0.0636 0.0313  85  GLY A C     
636  O  O     . GLY A 109 ? 0.2481 0.2323 0.1266 0.0035  -0.0601 0.0204  85  GLY A O     
637  N  N     . ASP A 110 ? 0.2652 0.2476 0.1210 -0.0242 -0.0371 0.0461  86  ASP A N     
638  C  CA    . ASP A 110 ? 0.2356 0.2717 0.1561 0.0144  -0.0414 0.0496  86  ASP A CA    
639  C  C     . ASP A 110 ? 0.2241 0.2500 0.1203 0.0140  -0.0499 0.0406  86  ASP A C     
640  O  O     . ASP A 110 ? 0.2920 0.2498 0.0714 -0.0056 -0.0871 0.0259  86  ASP A O     
641  C  CB    . ASP A 110 ? 0.2839 0.2938 0.1428 -0.0119 -0.0417 0.0433  86  ASP A CB    
642  C  CG    . ASP A 110 ? 0.3348 0.3904 0.2257 -0.0209 0.0308  0.0515  86  ASP A CG    
643  O  OD1   . ASP A 110 ? 0.3144 0.3955 0.3971 -0.0458 -0.0170 0.0109  86  ASP A OD1   
644  O  OD2   . ASP A 110 ? 0.5139 0.4808 0.2596 0.0541  0.1389  0.1182  86  ASP A OD2   
645  N  N     . ILE A 111 ? 0.2170 0.2706 0.1018 0.0043  -0.0508 0.0447  87  ILE A N     
646  C  CA    . ILE A 111 ? 0.2262 0.2829 0.1224 0.0066  -0.0282 0.0217  87  ILE A CA    
647  C  C     . ILE A 111 ? 0.2448 0.2507 0.1211 0.0270  -0.0541 0.0051  87  ILE A C     
648  O  O     . ILE A 111 ? 0.2369 0.2405 0.0857 0.0193  -0.0739 0.0043  87  ILE A O     
649  C  CB    . ILE A 111 ? 0.2333 0.3016 0.1172 -0.0031 -0.0420 0.0212  87  ILE A CB    
650  C  CG1   . ILE A 111 ? 0.2803 0.2663 0.1123 0.0120  -0.0510 0.0022  87  ILE A CG1   
651  C  CG2   . ILE A 111 ? 0.2293 0.2651 0.1200 -0.0183 -0.0484 -0.0386 87  ILE A CG2   
652  C  CD1   . ILE A 111 ? 0.2959 0.2651 0.1089 -0.0126 -0.0747 0.0140  87  ILE A CD1   
653  N  N     . PHE A 112 ? 0.2345 0.2526 0.1210 0.0079  -0.0814 -0.0100 88  PHE A N     
654  C  CA    . PHE A 112 ? 0.2522 0.2191 0.1178 0.0250  -0.0692 -0.0043 88  PHE A CA    
655  C  C     . PHE A 112 ? 0.2198 0.2082 0.1327 -0.0046 -0.0601 0.0187  88  PHE A C     
656  O  O     . PHE A 112 ? 0.2420 0.2086 0.1286 0.0181  -0.0542 -0.0029 88  PHE A O     
657  C  CB    . PHE A 112 ? 0.2488 0.2145 0.1282 0.0135  -0.0975 -0.0235 88  PHE A CB    
658  C  CG    . PHE A 112 ? 0.2503 0.2452 0.1437 0.0036  -0.0439 0.0123  88  PHE A CG    
659  C  CD1   . PHE A 112 ? 0.2966 0.2250 0.1158 0.0256  -0.0581 0.0052  88  PHE A CD1   
660  C  CD2   . PHE A 112 ? 0.2458 0.2240 0.1154 0.0145  -0.0222 0.0289  88  PHE A CD2   
661  C  CE1   . PHE A 112 ? 0.3164 0.2472 0.1231 -0.0126 -0.0653 0.0293  88  PHE A CE1   
662  C  CE2   . PHE A 112 ? 0.2375 0.2280 0.1228 0.0020  -0.0771 0.0377  88  PHE A CE2   
663  C  CZ    . PHE A 112 ? 0.2831 0.2485 0.0675 -0.0006 -0.0753 0.0348  88  PHE A CZ    
664  N  N     . THR A 113 ? 0.2097 0.2224 0.0941 -0.0275 -0.0970 0.0326  89  THR A N     
665  C  CA    . THR A 113 ? 0.2195 0.2197 0.0822 -0.0135 -0.1010 0.0098  89  THR A CA    
666  C  C     . THR A 113 ? 0.2311 0.2401 0.1178 0.0000  -0.0936 -0.0070 89  THR A C     
667  O  O     . THR A 113 ? 0.2692 0.2261 0.0918 0.0090  -0.0872 0.0183  89  THR A O     
668  C  CB    . THR A 113 ? 0.2575 0.2502 0.0560 -0.0247 -0.0817 0.0297  89  THR A CB    
669  O  OG1   . THR A 113 ? 0.3033 0.2930 0.1114 -0.0049 -0.0941 0.0125  89  THR A OG1   
670  C  CG2   . THR A 113 ? 0.2415 0.2493 0.0516 -0.0354 -0.0714 0.0360  89  THR A CG2   
671  N  N     . HIS A 114 ? 0.2282 0.2306 0.1242 0.0267  -0.0806 0.0297  90  HIS A N     
672  C  CA    . HIS A 114 ? 0.2052 0.2515 0.1128 0.0288  -0.0773 -0.0132 90  HIS A CA    
673  C  C     . HIS A 114 ? 0.2368 0.2426 0.0679 0.0166  -0.0906 0.0144  90  HIS A C     
674  O  O     . HIS A 114 ? 0.2680 0.2625 0.1366 0.0076  -0.1429 -0.0376 90  HIS A O     
675  C  CB    . HIS A 114 ? 0.2047 0.2370 0.0980 0.0133  -0.0671 -0.0084 90  HIS A CB    
676  C  CG    . HIS A 114 ? 0.2252 0.2360 0.0989 0.0188  -0.0902 -0.0202 90  HIS A CG    
677  N  ND1   . HIS A 114 ? 0.2411 0.2732 0.0960 0.0111  -0.0828 -0.0096 90  HIS A ND1   
678  C  CD2   . HIS A 114 ? 0.2740 0.2435 0.0759 0.0131  -0.0924 -0.0003 90  HIS A CD2   
679  C  CE1   . HIS A 114 ? 0.2865 0.2111 0.0703 -0.0066 -0.0909 -0.0474 90  HIS A CE1   
680  N  NE2   . HIS A 114 ? 0.2672 0.2448 0.0646 -0.0119 -0.0742 -0.0283 90  HIS A NE2   
681  N  N     . ASP A 115 ? 0.2569 0.2736 0.0614 -0.0004 -0.0910 -0.0087 91  ASP A N     
682  C  CA    . ASP A 115 ? 0.2415 0.3062 0.1143 -0.0049 -0.0696 -0.0081 91  ASP A CA    
683  C  C     . ASP A 115 ? 0.2460 0.3194 0.1295 0.0264  -0.1049 -0.0194 91  ASP A C     
684  O  O     . ASP A 115 ? 0.2897 0.3146 0.0648 0.0367  -0.1010 0.0022  91  ASP A O     
685  C  CB    . ASP A 115 ? 0.2730 0.3017 0.1578 0.0041  -0.0522 -0.0181 91  ASP A CB    
686  C  CG    . ASP A 115 ? 0.3065 0.2383 0.1723 0.0055  -0.0879 0.0283  91  ASP A CG    
687  O  OD1   . ASP A 115 ? 0.3552 0.3077 0.0690 0.0441  -0.0916 0.0426  91  ASP A OD1   
688  O  OD2   . ASP A 115 ? 0.3102 0.2876 0.1891 0.0005  -0.0765 -0.0120 91  ASP A OD2   
689  N  N     . ILE A 116 ? 0.2427 0.2834 0.1302 0.0088  -0.1135 -0.0405 92  ILE A N     
690  C  CA    . ILE A 116 ? 0.3038 0.2746 0.1087 0.0343  -0.0856 -0.0096 92  ILE A CA    
691  C  C     . ILE A 116 ? 0.2734 0.2514 0.1194 0.0282  -0.0628 0.0204  92  ILE A C     
692  O  O     . ILE A 116 ? 0.3379 0.2792 0.1735 0.0122  -0.0376 -0.0635 92  ILE A O     
693  C  CB    . ILE A 116 ? 0.2720 0.2423 0.0749 0.0172  -0.0707 0.0030  92  ILE A CB    
694  C  CG1   . ILE A 116 ? 0.3795 0.2476 0.0943 0.0030  -0.1069 0.0450  92  ILE A CG1   
695  C  CG2   . ILE A 116 ? 0.2594 0.2673 0.1372 0.0419  -0.0899 0.0425  92  ILE A CG2   
696  C  CD1   . ILE A 116 ? 0.3838 0.2632 0.1446 -0.0012 -0.1970 0.0520  92  ILE A CD1   
697  N  N     . ARG A 117 ? 0.2724 0.2495 0.1330 0.0151  -0.0537 -0.0040 93  ARG A N     
698  C  CA    . ARG A 117 ? 0.2674 0.2621 0.1121 -0.0042 -0.0721 0.0101  93  ARG A CA    
699  C  C     . ARG A 117 ? 0.2610 0.2680 0.1469 -0.0077 -0.0686 -0.0487 93  ARG A C     
700  O  O     . ARG A 117 ? 0.3383 0.2974 0.1027 0.0091  -0.0860 -0.0450 93  ARG A O     
701  C  CB    . ARG A 117 ? 0.2748 0.2823 0.1464 -0.0038 -0.0403 -0.0063 93  ARG A CB    
702  C  CG    . ARG A 117 ? 0.2803 0.2886 0.1520 0.0095  -0.0420 -0.0309 93  ARG A CG    
703  C  CD    . ARG A 117 ? 0.3748 0.3106 0.1731 -0.0383 -0.0260 0.0104  93  ARG A CD    
704  N  NE    . ARG A 117 ? 0.3695 0.3452 0.1668 -0.0611 -0.0369 0.0118  93  ARG A NE    
705  C  CZ    . ARG A 117 ? 0.4058 0.3831 0.2427 -0.0980 0.0025  0.0057  93  ARG A CZ    
706  N  NH1   . ARG A 117 ? 0.3461 0.5067 0.2558 -0.0891 0.0642  0.0791  93  ARG A NH1   
707  N  NH2   . ARG A 117 ? 0.4398 0.3386 0.2747 -0.0420 -0.0096 -0.0190 93  ARG A NH2   
708  N  N     . ALA A 118 ? 0.2582 0.3061 0.1521 0.0136  -0.0844 -0.0316 94  ALA A N     
709  C  CA    . ALA A 118 ? 0.3182 0.3048 0.1523 0.0438  -0.0698 0.0135  94  ALA A CA    
710  C  C     . ALA A 118 ? 0.3213 0.3293 0.1675 0.0147  -0.0648 -0.0058 94  ALA A C     
711  O  O     . ALA A 118 ? 0.3703 0.4319 0.1647 0.0707  -0.0612 0.0092  94  ALA A O     
712  C  CB    . ALA A 118 ? 0.3494 0.3010 0.2020 0.0903  -0.1236 -0.0145 94  ALA A CB    
713  N  N     . GLN A 119 ? 0.2802 0.2884 0.1751 -0.0182 -0.0734 -0.0187 95  GLN A N     
714  C  CA    . GLN A 119 ? 0.3187 0.2868 0.2027 0.0051  -0.0549 0.0429  95  GLN A CA    
715  C  C     . GLN A 119 ? 0.2822 0.2663 0.2085 0.0038  -0.0343 0.0333  95  GLN A C     
716  O  O     . GLN A 119 ? 0.3672 0.3394 0.1577 0.0405  -0.0647 0.0149  95  GLN A O     
717  C  CB    . GLN A 119 ? 0.3366 0.2831 0.2440 -0.0017 -0.0642 0.0152  95  GLN A CB    
718  C  CG    . GLN A 119 ? 0.3481 0.3785 0.2292 0.0408  -0.0524 0.0132  95  GLN A CG    
719  C  CD    . GLN A 119 ? 0.3362 0.4462 0.3112 0.0437  -0.0168 0.0164  95  GLN A CD    
720  O  OE1   . GLN A 119 ? 0.3615 0.5645 0.4714 0.0926  0.0510  -0.0886 95  GLN A OE1   
721  N  NE2   . GLN A 119 ? 0.3919 0.4320 0.2308 -0.0105 0.0103  0.0824  95  GLN A NE2   
722  N  N     . GLY A 120 ? 0.2797 0.2462 0.1454 0.0036  -0.0614 0.0082  96  GLY A N     
723  C  CA    . GLY A 120 ? 0.3065 0.2223 0.0722 0.0342  -0.0438 0.0114  96  GLY A CA    
724  C  C     . GLY A 120 ? 0.2897 0.2344 0.1037 0.0268  -0.0851 -0.0237 96  GLY A C     
725  O  O     . GLY A 120 ? 0.3011 0.2904 0.0941 0.0227  -0.1056 -0.0142 96  GLY A O     
726  N  N     . VAL A 121 ? 0.2966 0.2087 0.0635 0.0088  -0.1011 -0.0123 97  VAL A N     
727  C  CA    . VAL A 121 ? 0.2448 0.2189 0.1322 0.0121  -0.0522 0.0002  97  VAL A CA    
728  C  C     . VAL A 121 ? 0.2365 0.2780 0.1271 0.0030  -0.0387 -0.0121 97  VAL A C     
729  O  O     . VAL A 121 ? 0.2534 0.2551 0.1063 -0.0030 -0.0728 -0.0239 97  VAL A O     
730  C  CB    . VAL A 121 ? 0.2771 0.2320 0.0794 -0.0094 -0.0316 -0.0035 97  VAL A CB    
731  C  CG1   . VAL A 121 ? 0.2986 0.2353 0.2064 0.0226  -0.0797 -0.0635 97  VAL A CG1   
732  C  CG2   . VAL A 121 ? 0.3037 0.3426 0.0491 -0.0135 -0.0257 0.0837  97  VAL A CG2   
733  N  N     . HIS A 122 ? 0.2301 0.2206 0.1363 -0.0079 -0.0415 0.0030  98  HIS A N     
734  C  CA    . HIS A 122 ? 0.2270 0.2595 0.1396 0.0035  -0.0676 0.0079  98  HIS A CA    
735  C  C     . HIS A 122 ? 0.2565 0.2637 0.1410 0.0009  -0.0655 -0.0057 98  HIS A C     
736  O  O     . HIS A 122 ? 0.2859 0.2953 0.1255 -0.0021 -0.0527 0.0082  98  HIS A O     
737  C  CB    . HIS A 122 ? 0.2580 0.3036 0.2023 -0.0285 -0.1150 -0.0198 98  HIS A CB    
738  C  CG    . HIS A 122 ? 0.3001 0.3197 0.2656 0.0171  -0.0398 -0.0237 98  HIS A CG    
739  N  ND1   . HIS A 122 ? 0.3413 0.3861 0.2853 -0.0272 -0.0499 -0.0222 98  HIS A ND1   
740  C  CD2   . HIS A 122 ? 0.2816 0.3324 0.2015 0.0386  -0.0984 -0.0013 98  HIS A CD2   
741  C  CE1   . HIS A 122 ? 0.3713 0.3731 0.1487 0.0338  -0.0657 -0.0145 98  HIS A CE1   
742  N  NE2   . HIS A 122 ? 0.3389 0.3537 0.1549 -0.0029 -0.0649 0.0262  98  HIS A NE2   
743  N  N     . TYR A 123 ? 0.2293 0.2950 0.1591 -0.0149 -0.0586 0.0024  99  TYR A N     
744  C  CA    . TYR A 123 ? 0.2050 0.2909 0.1803 -0.0415 -0.0911 -0.0431 99  TYR A CA    
745  C  C     . TYR A 123 ? 0.2304 0.2967 0.2415 -0.0431 -0.0763 0.0052  99  TYR A C     
746  O  O     . TYR A 123 ? 0.3017 0.3470 0.1568 -0.0476 -0.0586 -0.0319 99  TYR A O     
747  C  CB    . TYR A 123 ? 0.2165 0.2760 0.1200 -0.0099 -0.1181 0.0039  99  TYR A CB    
748  C  CG    . TYR A 123 ? 0.2485 0.2611 0.1225 -0.0093 -0.1030 -0.0136 99  TYR A CG    
749  C  CD1   . TYR A 123 ? 0.2432 0.2451 0.1536 0.0045  -0.1052 -0.0723 99  TYR A CD1   
750  C  CD2   . TYR A 123 ? 0.2556 0.3065 0.1085 0.0166  -0.0709 -0.0337 99  TYR A CD2   
751  C  CE1   . TYR A 123 ? 0.2730 0.2983 0.1458 -0.0026 -0.1210 -0.1155 99  TYR A CE1   
752  C  CE2   . TYR A 123 ? 0.2397 0.2767 0.1454 0.0148  -0.1194 -0.0559 99  TYR A CE2   
753  C  CZ    . TYR A 123 ? 0.2896 0.2305 0.1453 0.0022  -0.1036 -0.0444 99  TYR A CZ    
754  O  OH    . TYR A 123 ? 0.2763 0.2955 0.1162 -0.0042 -0.1105 -0.0710 99  TYR A OH    
755  N  N     . GLN A 124 ? 0.2406 0.3246 0.3100 -0.0040 -0.0418 -0.0173 100 GLN A N     
756  C  CA    A GLN A 124 ? 0.2463 0.2719 0.2272 0.0152  -0.0353 -0.0206 100 GLN A CA    
757  C  CA    B GLN A 124 ? 0.2390 0.2667 0.2398 0.0133  -0.0421 -0.0217 100 GLN A CA    
758  C  C     . GLN A 124 ? 0.2444 0.2749 0.2809 0.0076  -0.0232 -0.0356 100 GLN A C     
759  O  O     . GLN A 124 ? 0.2977 0.2682 0.2274 -0.0244 0.0136  -0.0216 100 GLN A O     
760  C  CB    A GLN A 124 ? 0.2854 0.2482 0.1263 0.0250  -0.0151 0.0037  100 GLN A CB    
761  C  CB    B GLN A 124 ? 0.2524 0.2390 0.1686 0.0233  -0.0293 0.0030  100 GLN A CB    
762  C  CG    A GLN A 124 ? 0.3069 0.2330 0.0965 -0.0023 0.0344  -0.0144 100 GLN A CG    
763  C  CG    B GLN A 124 ? 0.2365 0.2230 0.1767 -0.0069 -0.0049 -0.0088 100 GLN A CG    
764  C  CD    A GLN A 124 ? 0.3291 0.3019 0.1267 0.0108  -0.0282 -0.0230 100 GLN A CD    
765  C  CD    B GLN A 124 ? 0.2132 0.2446 0.1790 -0.0026 -0.0042 -0.0016 100 GLN A CD    
766  O  OE1   A GLN A 124 ? 0.4313 0.3412 0.1278 0.0622  -0.0491 0.0191  100 GLN A OE1   
767  O  OE1   B GLN A 124 ? 0.2582 0.2465 0.1584 -0.0180 0.0124  0.0029  100 GLN A OE1   
768  N  NE2   A GLN A 124 ? 0.2877 0.4052 0.0469 -0.0011 -0.0512 -0.0661 100 GLN A NE2   
769  N  NE2   B GLN A 124 ? 0.2078 0.2898 0.1960 -0.0422 -0.0008 0.0410  100 GLN A NE2   
770  N  N     . THR A 125 ? 0.2749 0.2560 0.2846 0.0291  -0.0684 -0.0240 101 THR A N     
771  C  CA    . THR A 125 ? 0.2766 0.2691 0.2470 0.0105  -0.0627 -0.0363 101 THR A CA    
772  C  C     . THR A 125 ? 0.2444 0.3413 0.2643 -0.0073 -0.0327 0.0021  101 THR A C     
773  O  O     . THR A 125 ? 0.3734 0.3590 0.0857 -0.0149 -0.0305 0.0549  101 THR A O     
774  C  CB    . THR A 125 ? 0.3124 0.2694 0.2280 0.0211  -0.0492 0.0003  101 THR A CB    
775  O  OG1   . THR A 125 ? 0.3396 0.2729 0.1744 0.0676  -0.1228 -0.0271 101 THR A OG1   
776  C  CG2   . THR A 125 ? 0.2786 0.2212 0.2963 -0.0199 -0.0157 0.0333  101 THR A CG2   
777  N  N     . LYS A 126 ? 0.2593 0.3141 0.3016 -0.0257 0.0054  -0.0467 102 LYS A N     
778  C  CA    . LYS A 126 ? 0.3391 0.3010 0.3226 -0.0552 0.0154  0.0138  102 LYS A CA    
779  C  C     . LYS A 126 ? 0.3203 0.3465 0.2690 -0.0454 -0.0041 -0.0023 102 LYS A C     
780  O  O     . LYS A 126 ? 0.3287 0.3625 0.1951 -0.0350 -0.0781 -0.0500 102 LYS A O     
781  C  CB    . LYS A 126 ? 0.3662 0.3347 0.2515 -0.0877 -0.0214 -0.0233 102 LYS A CB    
782  C  CG    . LYS A 126 ? 0.4748 0.2716 0.2116 -0.1046 0.0302  0.0520  102 LYS A CG    
783  C  CD    . LYS A 126 ? 0.6142 0.2946 0.3771 -0.0354 0.0257  0.0717  102 LYS A CD    
784  C  CE    . LYS A 126 ? 0.7369 0.4107 0.4759 -0.0902 0.0099  -0.0477 102 LYS A CE    
785  N  NZ    . LYS A 126 ? 0.6647 0.3633 0.5276 -0.1630 0.0441  -0.0631 102 LYS A NZ    
786  N  N     . PRO A 127 ? 0.2956 0.3555 0.3169 -0.0669 -0.0380 0.0306  103 PRO A N     
787  C  CA    . PRO A 127 ? 0.2717 0.3917 0.2846 -0.0148 -0.0069 0.0219  103 PRO A CA    
788  C  C     . PRO A 127 ? 0.2772 0.3591 0.3008 -0.0272 -0.0119 0.0000  103 PRO A C     
789  O  O     . PRO A 127 ? 0.2652 0.4304 0.2948 -0.0602 -0.0434 -0.0373 103 PRO A O     
790  C  CB    . PRO A 127 ? 0.2877 0.3376 0.3188 -0.0266 -0.0141 0.0830  103 PRO A CB    
791  C  CG    . PRO A 127 ? 0.3798 0.3678 0.4331 0.0158  -0.0658 0.0513  103 PRO A CG    
792  C  CD    . PRO A 127 ? 0.3792 0.3920 0.4172 0.0055  -0.0083 0.0472  103 PRO A CD    
793  N  N     . LYS A 128 ? 0.2966 0.3929 0.1011 0.0081  -0.0139 -0.0408 104 LYS A N     
794  C  CA    . LYS A 128 ? 0.3256 0.4101 0.1731 0.0422  -0.0136 -0.0572 104 LYS A CA    
795  C  C     . LYS A 128 ? 0.3575 0.4979 0.1846 0.0628  0.0198  -0.0629 104 LYS A C     
796  O  O     . LYS A 128 ? 0.4149 0.6157 0.2722 0.0696  0.0800  -0.0538 104 LYS A O     
797  C  CB    . LYS A 128 ? 0.3586 0.4338 0.1918 0.0306  -0.0846 -0.0461 104 LYS A CB    
798  C  CG    . LYS A 128 ? 0.5001 0.4635 0.1727 0.0046  -0.0622 -0.0189 104 LYS A CG    
799  C  CD    . LYS A 128 ? 0.5252 0.4656 0.2668 -0.0531 -0.0345 -0.0538 104 LYS A CD    
800  C  CE    . LYS A 128 ? 0.5512 0.4215 0.3106 -0.0411 -0.1659 -0.1558 104 LYS A CE    
801  N  NZ    . LYS A 128 ? 0.4065 0.5175 0.3026 0.0680  -0.2444 0.0072  104 LYS A NZ    
802  N  N     A GLY A 129 ? 0.3447 0.4781 0.2229 0.0602  0.0156  -0.0762 105 GLY A N     
803  N  N     B GLY A 129 ? 0.3456 0.4848 0.2234 0.0584  0.0152  -0.0825 105 GLY A N     
804  C  CA    A GLY A 129 ? 0.2846 0.4195 0.2185 0.0646  0.0225  -0.0615 105 GLY A CA    
805  C  CA    B GLY A 129 ? 0.2870 0.4305 0.2204 0.0617  0.0225  -0.0759 105 GLY A CA    
806  C  C     A GLY A 129 ? 0.2891 0.3073 0.2367 0.0424  0.0132  -0.0136 105 GLY A C     
807  C  C     B GLY A 129 ? 0.2908 0.3322 0.2306 0.0508  0.0141  -0.0325 105 GLY A C     
808  O  O     A GLY A 129 ? 0.2521 0.3112 0.2329 0.0020  -0.0030 0.0582  105 GLY A O     
809  O  O     B GLY A 129 ? 0.2526 0.3485 0.2204 0.0205  -0.0198 -0.0323 105 GLY A O     
810  N  N     . ALA A 130 ? 0.2744 0.3589 0.2212 0.0104  -0.0527 0.0087  106 ALA A N     
811  C  CA    . ALA A 130 ? 0.2676 0.3360 0.2135 0.0131  -0.0527 0.0765  106 ALA A CA    
812  C  C     . ALA A 130 ? 0.2973 0.3396 0.1948 0.0227  -0.0478 0.0696  106 ALA A C     
813  O  O     . ALA A 130 ? 0.3251 0.4053 0.1429 0.0064  -0.0943 0.1012  106 ALA A O     
814  C  CB    . ALA A 130 ? 0.3377 0.3276 0.2350 0.0514  0.0097  0.1261  106 ALA A CB    
815  N  N     . PHE A 131 ? 0.3428 0.3204 0.1484 0.0369  -0.0462 0.0765  107 PHE A N     
816  C  CA    . PHE A 131 ? 0.3117 0.3087 0.1803 0.0599  -0.0405 0.0417  107 PHE A CA    
817  C  C     . PHE A 131 ? 0.2596 0.3632 0.1430 0.0185  -0.0262 0.0416  107 PHE A C     
818  O  O     . PHE A 131 ? 0.2588 0.4426 0.1089 0.0122  -0.0120 0.0542  107 PHE A O     
819  C  CB    . PHE A 131 ? 0.3067 0.3360 0.2172 0.0480  -0.0273 0.0004  107 PHE A CB    
820  C  CG    . PHE A 131 ? 0.3595 0.3846 0.2280 0.0368  -0.0452 0.0211  107 PHE A CG    
821  C  CD1   . PHE A 131 ? 0.3602 0.4454 0.2892 -0.0098 -0.0441 0.0235  107 PHE A CD1   
822  C  CD2   . PHE A 131 ? 0.3953 0.3643 0.2517 0.0544  -0.0338 0.0310  107 PHE A CD2   
823  C  CE1   . PHE A 131 ? 0.3992 0.4718 0.3293 0.0391  -0.0631 0.0377  107 PHE A CE1   
824  C  CE2   . PHE A 131 ? 0.3501 0.4580 0.3418 0.1131  -0.0935 0.0219  107 PHE A CE2   
825  C  CZ    . PHE A 131 ? 0.4154 0.4776 0.3780 0.0030  -0.0440 0.0295  107 PHE A CZ    
826  N  N     . PRO A 132 ? 0.2213 0.3501 0.1978 0.0229  -0.0133 0.0329  108 PRO A N     
827  C  CA    . PRO A 132 ? 0.2457 0.2732 0.2474 0.0314  -0.0532 0.0016  108 PRO A CA    
828  C  C     . PRO A 132 ? 0.2171 0.2488 0.2217 0.0127  -0.0410 -0.0011 108 PRO A C     
829  O  O     . PRO A 132 ? 0.2358 0.2537 0.1765 0.0158  -0.0272 -0.0062 108 PRO A O     
830  C  CB    . PRO A 132 ? 0.2750 0.2773 0.3225 0.0374  -0.0429 0.0383  108 PRO A CB    
831  C  CG    . PRO A 132 ? 0.2847 0.3495 0.2709 -0.0136 -0.0948 -0.0029 108 PRO A CG    
832  C  CD    . PRO A 132 ? 0.2689 0.3402 0.2288 0.0372  -0.0203 0.0682  108 PRO A CD    
833  N  N     . PRO A 133 ? 0.2157 0.2137 0.1904 0.0284  -0.0298 -0.0108 109 PRO A N     
834  C  CA    . PRO A 133 ? 0.2096 0.2220 0.1871 0.0334  -0.0445 -0.0160 109 PRO A CA    
835  C  C     . PRO A 133 ? 0.2343 0.2296 0.1800 0.0343  -0.0456 -0.0242 109 PRO A C     
836  O  O     . PRO A 133 ? 0.2324 0.2539 0.1670 -0.0027 -0.0489 -0.0220 109 PRO A O     
837  C  CB    . PRO A 133 ? 0.2562 0.2515 0.2352 -0.0001 -0.0816 -0.0120 109 PRO A CB    
838  C  CG    . PRO A 133 ? 0.2170 0.2591 0.2850 0.0253  -0.0444 -0.0196 109 PRO A CG    
839  C  CD    . PRO A 133 ? 0.2128 0.2608 0.1681 0.0035  -0.0578 -0.0117 109 PRO A CD    
840  N  N     . THR A 134 ? 0.2226 0.2457 0.1328 0.0326  -0.0357 -0.0499 110 THR A N     
841  C  CA    . THR A 134 ? 0.1862 0.2195 0.1350 0.0354  -0.0347 -0.0171 110 THR A CA    
842  C  C     . THR A 134 ? 0.2345 0.2385 0.1170 0.0127  -0.0374 0.0065  110 THR A C     
843  O  O     . THR A 134 ? 0.1900 0.2529 0.1131 0.0131  -0.0452 0.0124  110 THR A O     
844  C  CB    . THR A 134 ? 0.2210 0.2164 0.1093 0.0304  -0.0699 0.0130  110 THR A CB    
845  O  OG1   . THR A 134 ? 0.2564 0.2499 0.1525 0.0077  -0.0830 0.0214  110 THR A OG1   
846  C  CG2   . THR A 134 ? 0.1864 0.2742 0.1307 0.0342  -0.0766 -0.0335 110 THR A CG2   
847  N  N     . ALA A 135 ? 0.2400 0.2485 0.1404 -0.0114 -0.0266 0.0480  111 ALA A N     
848  C  CA    . ALA A 135 ? 0.2038 0.2325 0.0977 0.0064  -0.0265 0.0341  111 ALA A CA    
849  C  C     . ALA A 135 ? 0.2080 0.2022 0.0707 0.0074  -0.0330 0.0145  111 ALA A C     
850  O  O     . ALA A 135 ? 0.2608 0.1762 0.0664 -0.0078 -0.0631 -0.0097 111 ALA A O     
851  C  CB    . ALA A 135 ? 0.1819 0.2092 0.0909 0.0060  -0.0428 0.0090  111 ALA A CB    
852  N  N     . ARG A 136 ? 0.1989 0.2393 0.1151 0.0039  -0.0407 -0.0072 112 ARG A N     
853  C  CA    . ARG A 136 ? 0.2018 0.2289 0.1071 0.0081  -0.0620 0.0082  112 ARG A CA    
854  C  C     . ARG A 136 ? 0.2188 0.2073 0.0655 0.0111  -0.0600 -0.0090 112 ARG A C     
855  O  O     . ARG A 136 ? 0.2570 0.2227 0.1422 0.0157  -0.0679 0.0181  112 ARG A O     
856  C  CB    . ARG A 136 ? 0.2400 0.2116 0.0900 -0.0132 -0.0505 -0.0139 112 ARG A CB    
857  C  CG    . ARG A 136 ? 0.2281 0.2433 0.1039 -0.0061 -0.0371 -0.0366 112 ARG A CG    
858  C  CD    . ARG A 136 ? 0.2036 0.3118 0.1370 -0.0197 -0.0646 -0.0107 112 ARG A CD    
859  N  NE    . ARG A 136 ? 0.2930 0.2613 0.1678 -0.0508 -0.0460 -0.0618 112 ARG A NE    
860  C  CZ    . ARG A 136 ? 0.2675 0.2812 0.1887 -0.0298 -0.0687 -0.0102 112 ARG A CZ    
861  N  NH1   . ARG A 136 ? 0.2529 0.3541 0.1493 0.0137  -0.0794 -0.0050 112 ARG A NH1   
862  N  NH2   . ARG A 136 ? 0.2539 0.2630 0.1740 -0.0140 -0.1111 -0.0234 112 ARG A NH2   
863  N  N     . SER A 137 ? 0.2064 0.2267 0.0441 -0.0138 -0.0569 0.0181  113 SER A N     
864  C  CA    . SER A 137 ? 0.2082 0.2163 0.0840 -0.0177 -0.0523 0.0128  113 SER A CA    
865  C  C     . SER A 137 ? 0.1958 0.2080 0.0988 0.0032  -0.0444 0.0055  113 SER A C     
866  O  O     . SER A 137 ? 0.2233 0.2390 0.0918 0.0215  -0.0701 -0.0075 113 SER A O     
867  C  CB    . SER A 137 ? 0.2521 0.2288 0.0738 -0.0377 -0.0593 0.0316  113 SER A CB    
868  O  OG    . SER A 137 ? 0.2631 0.2470 0.1198 -0.0686 -0.0899 0.0358  113 SER A OG    
869  N  N     . MSE A 138 ? 0.1957 0.2062 0.1538 -0.0087 -0.0597 0.0171  114 MSE A N     
870  C  CA    . MSE A 138 ? 0.1997 0.2090 0.1303 -0.0173 -0.0502 -0.0036 114 MSE A CA    
871  C  C     . MSE A 138 ? 0.2016 0.1552 0.1145 -0.0110 -0.0523 -0.0088 114 MSE A C     
872  O  O     . MSE A 138 ? 0.2623 0.2139 0.0625 -0.0106 -0.0785 0.0396  114 MSE A O     
873  C  CB    . MSE A 138 ? 0.2856 0.1929 0.1292 -0.0227 -0.0899 -0.0169 114 MSE A CB    
874  C  CG    . MSE A 138 ? 0.3750 0.3085 0.2668 0.0228  -0.0792 0.1402  114 MSE A CG    
875  SE SE    . MSE A 138 ? 0.5857 0.5682 0.3824 -0.0088 -0.1618 0.0399  114 MSE A SE    
876  C  CE    . MSE A 138 ? 0.4470 0.3952 0.0314 -0.0178 -0.0118 -0.0458 114 MSE A CE    
877  N  N     . ILE A 139 ? 0.1704 0.2300 0.1155 -0.0025 -0.0621 0.0064  115 ILE A N     
878  C  CA    . ILE A 139 ? 0.1856 0.2573 0.1820 -0.0165 -0.0276 0.0178  115 ILE A CA    
879  C  C     . ILE A 139 ? 0.2123 0.2229 0.1981 -0.0212 -0.0518 0.0229  115 ILE A C     
880  O  O     . ILE A 139 ? 0.2207 0.3053 0.0943 -0.0250 -0.0699 0.0219  115 ILE A O     
881  C  CB    . ILE A 139 ? 0.1862 0.2810 0.1635 -0.0022 -0.0390 0.0150  115 ILE A CB    
882  C  CG1   . ILE A 139 ? 0.2266 0.2099 0.1328 -0.0339 -0.0607 0.0089  115 ILE A CG1   
883  C  CG2   . ILE A 139 ? 0.2290 0.2949 0.1722 0.0330  -0.0126 0.0432  115 ILE A CG2   
884  C  CD1   . ILE A 139 ? 0.2185 0.2489 0.0713 0.0211  -0.0924 0.0102  115 ILE A CD1   
885  N  N     . PHE A 140 ? 0.2235 0.2185 0.1253 -0.0260 -0.0322 0.0136  116 PHE A N     
886  C  CA    . PHE A 140 ? 0.2113 0.2358 0.1408 -0.0074 -0.0352 0.0260  116 PHE A CA    
887  C  C     . PHE A 140 ? 0.2134 0.2932 0.1645 0.0137  -0.0277 0.0544  116 PHE A C     
888  O  O     . PHE A 140 ? 0.2179 0.2980 0.1253 -0.0136 -0.0700 0.0278  116 PHE A O     
889  C  CB    . PHE A 140 ? 0.2254 0.2214 0.0843 -0.0184 -0.0901 0.0402  116 PHE A CB    
890  C  CG    . PHE A 140 ? 0.2040 0.2619 0.1436 -0.0330 -0.0616 0.0114  116 PHE A CG    
891  C  CD1   . PHE A 140 ? 0.2420 0.2755 0.1474 -0.0050 -0.0390 0.0704  116 PHE A CD1   
892  C  CD2   . PHE A 140 ? 0.2200 0.2815 0.1129 -0.0061 -0.0584 0.0234  116 PHE A CD2   
893  C  CE1   . PHE A 140 ? 0.2354 0.2877 0.1548 -0.0016 -0.0361 0.0080  116 PHE A CE1   
894  C  CE2   . PHE A 140 ? 0.2379 0.3162 0.1463 0.0354  -0.0365 0.0441  116 PHE A CE2   
895  C  CZ    . PHE A 140 ? 0.2320 0.2637 0.1529 -0.0292 -0.0926 -0.0240 116 PHE A CZ    
896  N  N     . VAL A 141 ? 0.2254 0.3224 0.1783 0.0320  -0.0750 0.0171  117 VAL A N     
897  C  CA    . VAL A 141 ? 0.2383 0.3277 0.2121 0.0064  -0.0573 -0.0254 117 VAL A CA    
898  C  C     . VAL A 141 ? 0.2434 0.3315 0.2206 -0.0040 -0.0601 0.0289  117 VAL A C     
899  O  O     . VAL A 141 ? 0.2361 0.3551 0.2187 -0.0112 -0.0874 -0.0153 117 VAL A O     
900  C  CB    . VAL A 141 ? 0.2383 0.3173 0.2570 0.0140  -0.0626 0.0053  117 VAL A CB    
901  C  CG1   . VAL A 141 ? 0.2705 0.3333 0.2726 0.0330  -0.0337 -0.0062 117 VAL A CG1   
902  C  CG2   . VAL A 141 ? 0.3197 0.2724 0.1055 0.0040  -0.0666 -0.0263 117 VAL A CG2   
903  N  N     . THR A 142 ? 0.2682 0.2782 0.2288 0.0337  -0.0586 0.0348  118 THR A N     
904  C  CA    . THR A 142 ? 0.2721 0.2967 0.2524 0.0175  -0.0553 0.0109  118 THR A CA    
905  C  C     . THR A 142 ? 0.2711 0.3100 0.2901 0.0197  -0.0596 0.0087  118 THR A C     
906  O  O     . THR A 142 ? 0.3320 0.3229 0.3187 -0.0014 -0.0793 -0.0086 118 THR A O     
907  C  CB    . THR A 142 ? 0.3216 0.2797 0.1942 0.0062  -0.0362 -0.0244 118 THR A CB    
908  O  OG1   . THR A 142 ? 0.2796 0.3006 0.2357 -0.0508 -0.0713 -0.0270 118 THR A OG1   
909  C  CG2   . THR A 142 ? 0.2915 0.3863 0.0685 0.0092  -0.0624 -0.0326 118 THR A CG2   
910  N  N     . GLU A 143 ? 0.2704 0.3923 0.2341 0.0321  -0.0974 -0.0273 119 GLU A N     
911  C  CA    . GLU A 143 ? 0.2550 0.4402 0.2784 -0.0053 -0.0651 -0.0282 119 GLU A CA    
912  C  C     . GLU A 143 ? 0.2752 0.3833 0.2988 0.0235  -0.0102 -0.0103 119 GLU A C     
913  O  O     . GLU A 143 ? 0.3322 0.3649 0.2870 0.0108  -0.0130 -0.0679 119 GLU A O     
914  C  CB    . GLU A 143 ? 0.2870 0.4351 0.3560 -0.0267 -0.0752 -0.0276 119 GLU A CB    
915  C  CG    . GLU A 143 ? 0.4635 0.5844 0.3729 -0.0628 -0.1111 -0.0333 119 GLU A CG    
916  C  CD    . GLU A 143 ? 0.5903 0.8165 0.4631 -0.2054 -0.1590 -0.0719 119 GLU A CD    
917  O  OE1   . GLU A 143 ? 0.7407 0.9198 0.4285 -0.2965 -0.0776 -0.0811 119 GLU A OE1   
918  O  OE2   . GLU A 143 ? 0.6008 0.9189 0.4722 -0.1936 -0.1173 -0.1891 119 GLU A OE2   
919  N  N     . ASP A 144 ? 0.2613 0.3906 0.3078 0.0226  -0.0349 -0.0172 120 ASP A N     
920  C  CA    . ASP A 144 ? 0.2858 0.3851 0.2921 0.0134  0.0248  -0.0173 120 ASP A CA    
921  C  C     . ASP A 144 ? 0.3224 0.3936 0.2766 0.0063  0.0189  -0.0172 120 ASP A C     
922  O  O     . ASP A 144 ? 0.3391 0.4387 0.2862 0.0400  -0.0123 -0.0481 120 ASP A O     
923  C  CB    . ASP A 144 ? 0.3427 0.3907 0.3339 0.0152  0.0057  -0.0140 120 ASP A CB    
924  C  CG    . ASP A 144 ? 0.3119 0.3417 0.2359 -0.0257 -0.0277 -0.0188 120 ASP A CG    
925  O  OD1   . ASP A 144 ? 0.3148 0.3466 0.2406 -0.0373 -0.0340 -0.0167 120 ASP A OD1   
926  O  OD2   . ASP A 144 ? 0.3210 0.3988 0.2487 0.0133  -0.0801 0.0049  120 ASP A OD2   
927  N  N     . GLY A 145 ? 0.2900 0.3768 0.3087 -0.0247 -0.0074 -0.0130 121 GLY A N     
928  C  CA    . GLY A 145 ? 0.2807 0.3747 0.3257 0.0000  -0.0092 -0.0538 121 GLY A CA    
929  C  C     . GLY A 145 ? 0.2916 0.2972 0.2844 0.0009  -0.0146 -0.0237 121 GLY A C     
930  O  O     . GLY A 145 ? 0.2661 0.3013 0.1919 0.0285  -0.0529 -0.0247 121 GLY A O     
931  N  N     . GLU A 146 ? 0.2950 0.3152 0.2665 0.0272  -0.0165 -0.0206 122 GLU A N     
932  C  CA    . GLU A 146 ? 0.2850 0.3089 0.1725 0.0084  -0.0082 0.0056  122 GLU A CA    
933  C  C     . GLU A 146 ? 0.2289 0.3193 0.1785 -0.0056 -0.0239 -0.0150 122 GLU A C     
934  O  O     . GLU A 146 ? 0.2709 0.3512 0.1790 0.0356  -0.0551 -0.0133 122 GLU A O     
935  C  CB    . GLU A 146 ? 0.2995 0.2990 0.1631 -0.0144 -0.0148 -0.0364 122 GLU A CB    
936  C  CG    . GLU A 146 ? 0.3211 0.3540 0.2285 -0.0131 -0.0392 -0.0033 122 GLU A CG    
937  C  CD    . GLU A 146 ? 0.4574 0.4288 0.1897 -0.0215 -0.0340 -0.0080 122 GLU A CD    
938  O  OE1   . GLU A 146 ? 0.3817 0.4549 0.1068 -0.0011 -0.0943 0.0541  122 GLU A OE1   
939  O  OE2   . GLU A 146 ? 0.6046 0.4934 0.1184 -0.0677 -0.0419 0.0157  122 GLU A OE2   
940  N  N     . ARG A 147 ? 0.2420 0.2973 0.1617 -0.0251 -0.0331 0.0059  123 ARG A N     
941  C  CA    A ARG A 147 ? 0.2326 0.2361 0.1381 -0.0109 -0.0445 0.0061  123 ARG A CA    
942  C  CA    B ARG A 147 ? 0.2250 0.2455 0.1434 -0.0106 -0.0486 0.0099  123 ARG A CA    
943  C  C     . ARG A 147 ? 0.2634 0.2587 0.1328 0.0119  -0.0440 -0.0179 123 ARG A C     
944  O  O     . ARG A 147 ? 0.2951 0.2790 0.1339 0.0152  -0.0414 0.0213  123 ARG A O     
945  C  CB    A ARG A 147 ? 0.2573 0.2235 0.1296 -0.0002 -0.0343 0.0131  123 ARG A CB    
946  C  CB    B ARG A 147 ? 0.2502 0.2304 0.1542 0.0051  -0.0542 0.0192  123 ARG A CB    
947  C  CG    A ARG A 147 ? 0.2306 0.2580 0.1635 -0.0245 -0.0215 -0.0128 123 ARG A CG    
948  C  CG    B ARG A 147 ? 0.1915 0.2494 0.1570 0.0090  -0.0477 0.0193  123 ARG A CG    
949  C  CD    A ARG A 147 ? 0.2277 0.2364 0.1523 -0.0056 -0.0338 -0.0251 123 ARG A CD    
950  C  CD    B ARG A 147 ? 0.1888 0.2608 0.1389 0.0238  -0.0198 0.0282  123 ARG A CD    
951  N  NE    A ARG A 147 ? 0.2272 0.2610 0.1611 0.0077  -0.0416 -0.0360 123 ARG A NE    
952  N  NE    B ARG A 147 ? 0.2050 0.2034 0.1408 0.0294  -0.0241 0.0087  123 ARG A NE    
953  C  CZ    A ARG A 147 ? 0.2453 0.2325 0.1742 -0.0067 -0.0471 -0.0211 123 ARG A CZ    
954  C  CZ    B ARG A 147 ? 0.2632 0.1820 0.1408 0.0318  -0.0323 -0.0126 123 ARG A CZ    
955  N  NH1   A ARG A 147 ? 0.2757 0.2215 0.1117 -0.0094 -0.0559 -0.0001 123 ARG A NH1   
956  N  NH1   B ARG A 147 ? 0.2546 0.1725 0.1061 0.0286  -0.0474 0.0017  123 ARG A NH1   
957  N  NH2   A ARG A 147 ? 0.2420 0.3241 0.1945 -0.0484 -0.0517 0.0018  123 ARG A NH2   
958  N  NH2   B ARG A 147 ? 0.2752 0.3273 0.1513 0.0154  -0.0526 0.0098  123 ARG A NH2   
959  N  N     . SER A 148 ? 0.2770 0.2221 0.1077 0.0018  -0.0550 -0.0114 124 SER A N     
960  C  CA    . SER A 148 ? 0.2427 0.2280 0.1001 -0.0064 -0.0736 0.0009  124 SER A CA    
961  C  C     . SER A 148 ? 0.2050 0.2955 0.1496 -0.0145 -0.0721 0.0136  124 SER A C     
962  O  O     . SER A 148 ? 0.2515 0.2888 0.1211 -0.0166 -0.1241 -0.0367 124 SER A O     
963  C  CB    . SER A 148 ? 0.2054 0.2598 0.1103 -0.0462 -0.0972 0.0027  124 SER A CB    
964  O  OG    . SER A 148 ? 0.2452 0.3005 0.0653 -0.0485 -0.0928 0.0055  124 SER A OG    
965  N  N     . MSE A 149 ? 0.1982 0.2953 0.1272 0.0029  -0.0700 0.0372  125 MSE A N     
966  C  CA    . MSE A 149 ? 0.1839 0.2609 0.0724 0.0017  -0.0640 0.0148  125 MSE A CA    
967  C  C     . MSE A 149 ? 0.2138 0.2182 0.0930 0.0016  -0.0550 0.0061  125 MSE A C     
968  O  O     . MSE A 149 ? 0.2414 0.1763 0.0981 0.0027  -0.0541 -0.0232 125 MSE A O     
969  C  CB    . MSE A 149 ? 0.2093 0.2850 0.1038 -0.0073 -0.0530 -0.0125 125 MSE A CB    
970  C  CG    . MSE A 149 ? 0.2132 0.3662 0.1168 0.0357  -0.0401 0.0355  125 MSE A CG    
971  SE SE    . MSE A 149 ? 0.5202 0.4534 0.2868 0.0012  -0.1250 0.0083  125 MSE A SE    
972  C  CE    . MSE A 149 ? 0.3045 0.3556 0.1774 -0.0570 -0.0860 -0.0263 125 MSE A CE    
973  N  N     . ASN A 150 ? 0.1785 0.2566 0.0997 -0.0056 -0.0463 0.0057  126 ASN A N     
974  C  CA    . ASN A 150 ? 0.1651 0.2260 0.0845 -0.0234 -0.0559 -0.0013 126 ASN A CA    
975  C  C     . ASN A 150 ? 0.1609 0.2362 0.0963 -0.0191 -0.0515 0.0314  126 ASN A C     
976  O  O     . ASN A 150 ? 0.2218 0.2244 0.1033 -0.0318 -0.0670 0.0358  126 ASN A O     
977  C  CB    . ASN A 150 ? 0.1834 0.2528 0.0932 -0.0381 -0.0411 -0.0272 126 ASN A CB    
978  C  CG    . ASN A 150 ? 0.1782 0.2196 0.0449 -0.0224 -0.0461 -0.0261 126 ASN A CG    
979  O  OD1   . ASN A 150 ? 0.2176 0.2140 0.0553 -0.0283 -0.0525 -0.0345 126 ASN A OD1   
980  N  ND2   . ASN A 150 ? 0.1549 0.2707 0.0365 -0.0356 -0.0380 0.0083  126 ASN A ND2   
981  N  N     . THR A 151 ? 0.1433 0.2300 0.0775 -0.0228 -0.0355 0.0349  127 THR A N     
982  C  CA    . THR A 151 ? 0.1900 0.2181 0.0838 -0.0299 -0.0593 -0.0034 127 THR A CA    
983  C  C     . THR A 151 ? 0.2116 0.1940 0.0783 -0.0108 -0.0552 -0.0124 127 THR A C     
984  O  O     . THR A 151 ? 0.2412 0.2028 0.1052 0.0077  -0.0891 -0.0237 127 THR A O     
985  C  CB    . THR A 151 ? 0.1837 0.2325 0.0712 -0.0153 -0.0619 0.0133  127 THR A CB    
986  O  OG1   . THR A 151 ? 0.1952 0.2705 0.0666 0.0146  -0.0582 0.0452  127 THR A OG1   
987  C  CG2   . THR A 151 ? 0.1955 0.2230 0.0916 -0.0122 -0.0241 -0.0094 127 THR A CG2   
988  N  N     . TYR A 152 ? 0.2102 0.2019 0.1096 -0.0404 -0.0415 -0.0083 128 TYR A N     
989  C  CA    . TYR A 152 ? 0.2180 0.2442 0.1103 0.0039  -0.0394 -0.0017 128 TYR A CA    
990  C  C     . TYR A 152 ? 0.2184 0.1996 0.1769 0.0132  -0.0422 0.0107  128 TYR A C     
991  O  O     . TYR A 152 ? 0.2690 0.2042 0.1456 0.0004  -0.0396 0.0358  128 TYR A O     
992  C  CB    . TYR A 152 ? 0.2390 0.2815 0.1188 0.0187  -0.0301 0.0402  128 TYR A CB    
993  C  CG    . TYR A 152 ? 0.2525 0.2705 0.1090 0.0013  -0.0252 0.0362  128 TYR A CG    
994  C  CD1   . TYR A 152 ? 0.2507 0.3229 0.1704 0.0241  -0.0300 0.0563  128 TYR A CD1   
995  C  CD2   . TYR A 152 ? 0.2561 0.2677 0.1648 -0.0063 -0.0419 0.0511  128 TYR A CD2   
996  C  CE1   . TYR A 152 ? 0.2468 0.3443 0.1815 -0.0033 -0.0338 0.0106  128 TYR A CE1   
997  C  CE2   . TYR A 152 ? 0.2389 0.3201 0.1211 0.0256  -0.0606 0.0509  128 TYR A CE2   
998  C  CZ    . TYR A 152 ? 0.2436 0.3371 0.1930 0.0185  -0.0046 0.0084  128 TYR A CZ    
999  O  OH    . TYR A 152 ? 0.2750 0.4282 0.3089 -0.0151 0.0496  0.0325  128 TYR A OH    
1000 N  N     . LEU A 153 ? 0.2555 0.2521 0.1031 -0.0041 -0.0707 -0.0219 129 LEU A N     
1001 C  CA    . LEU A 153 ? 0.2336 0.2143 0.1272 0.0063  -0.0634 -0.0081 129 LEU A CA    
1002 C  C     . LEU A 153 ? 0.2210 0.2108 0.1799 0.0013  -0.0500 -0.0137 129 LEU A C     
1003 O  O     . LEU A 153 ? 0.2429 0.2255 0.1701 -0.0145 -0.0889 -0.0062 129 LEU A O     
1004 C  CB    . LEU A 153 ? 0.2232 0.2160 0.1059 0.0042  -0.0760 -0.0294 129 LEU A CB    
1005 C  CG    . LEU A 153 ? 0.1980 0.2158 0.2014 0.0033  -0.0353 -0.0164 129 LEU A CG    
1006 C  CD1   . LEU A 153 ? 0.2289 0.2539 0.2039 0.0300  -0.0487 -0.0208 129 LEU A CD1   
1007 C  CD2   . LEU A 153 ? 0.1961 0.2526 0.1932 -0.0027 -0.0193 -0.0254 129 LEU A CD2   
1008 N  N     . GLY A 154 ? 0.2392 0.2689 0.1819 -0.0326 -0.0279 -0.0034 130 GLY A N     
1009 C  CA    . GLY A 154 ? 0.2127 0.2382 0.1863 -0.0303 -0.0486 -0.0111 130 GLY A CA    
1010 C  C     . GLY A 154 ? 0.2177 0.2234 0.1380 0.0012  -0.0462 -0.0252 130 GLY A C     
1011 O  O     . GLY A 154 ? 0.2217 0.2515 0.2192 0.0299  -0.0477 -0.0090 130 GLY A O     
1012 N  N     . ALA A 155 ? 0.1964 0.2222 0.0703 -0.0172 -0.0678 -0.0348 131 ALA A N     
1013 C  CA    . ALA A 155 ? 0.2077 0.2127 0.1405 -0.0361 -0.0579 -0.0302 131 ALA A CA    
1014 C  C     . ALA A 155 ? 0.2086 0.2724 0.1435 0.0033  -0.0242 -0.0252 131 ALA A C     
1015 O  O     . ALA A 155 ? 0.2277 0.2662 0.1325 0.0053  -0.0453 -0.0120 131 ALA A O     
1016 C  CB    . ALA A 155 ? 0.2465 0.2526 0.0858 -0.0015 -0.1069 -0.0156 131 ALA A CB    
1017 N  N     . CYS A 156 ? 0.2523 0.2634 0.1662 -0.0184 -0.0447 0.0098  132 CYS A N     
1018 C  CA    . CYS A 156 ? 0.2079 0.2636 0.1499 -0.0079 -0.0515 -0.0130 132 CYS A CA    
1019 C  C     . CYS A 156 ? 0.2367 0.3116 0.1443 0.0236  -0.0689 -0.0362 132 CYS A C     
1020 O  O     . CYS A 156 ? 0.2394 0.3833 0.1589 -0.0158 -0.0948 -0.0527 132 CYS A O     
1021 C  CB    . CYS A 156 ? 0.1904 0.3159 0.1668 0.0055  -0.0668 -0.0323 132 CYS A CB    
1022 S  SG    . CYS A 156 ? 0.2349 0.3186 0.1405 0.0357  -0.0887 -0.0531 132 CYS A SG    
1023 N  N     . VAL A 157 ? 0.1981 0.2623 0.0880 0.0539  -0.0971 0.0105  133 VAL A N     
1024 C  CA    . VAL A 157 ? 0.1906 0.2443 0.2319 0.0743  -0.0671 -0.0030 133 VAL A CA    
1025 C  C     . VAL A 157 ? 0.2088 0.2630 0.2204 0.0670  -0.0805 -0.0163 133 VAL A C     
1026 O  O     . VAL A 157 ? 0.2226 0.3353 0.2115 0.0488  -0.1044 0.0128  133 VAL A O     
1027 C  CB    . VAL A 157 ? 0.2639 0.2894 0.2188 0.0379  0.0006  -0.0141 133 VAL A CB    
1028 C  CG1   . VAL A 157 ? 0.2395 0.3093 0.1580 0.0585  -0.0155 -0.0558 133 VAL A CG1   
1029 C  CG2   . VAL A 157 ? 0.3186 0.2989 0.1842 0.0880  -0.0302 0.0178  133 VAL A CG2   
1030 N  N     . GLU A 158 ? 0.2802 0.2871 0.1767 0.0088  -0.0695 -0.0250 134 GLU A N     
1031 C  CA    . GLU A 158 ? 0.3114 0.2952 0.2042 -0.0145 -0.0162 -0.0316 134 GLU A CA    
1032 C  C     . GLU A 158 ? 0.2741 0.3466 0.1665 -0.0092 -0.0569 -0.0302 134 GLU A C     
1033 O  O     . GLU A 158 ? 0.3300 0.3772 0.1298 -0.0284 -0.0850 -0.0393 134 GLU A O     
1034 C  CB    . GLU A 158 ? 0.3100 0.3424 0.2498 -0.0300 -0.0143 0.0087  134 GLU A CB    
1035 C  CG    . GLU A 158 ? 0.4233 0.4774 0.2619 -0.0735 0.0568  -0.0242 134 GLU A CG    
1036 C  CD    . GLU A 158 ? 0.4563 0.6782 0.3403 -0.0333 -0.0320 0.0497  134 GLU A CD    
1037 O  OE1   . GLU A 158 ? 0.4785 0.8310 0.5257 -0.0439 0.1113  -0.1156 134 GLU A OE1   
1038 O  OE2   . GLU A 158 ? 0.5495 0.7112 0.4816 0.0709  -0.1196 0.0772  134 GLU A OE2   
1039 N  N     . LEU A 159 ? 0.2321 0.3266 0.1499 0.0226  -0.0921 -0.0698 135 LEU A N     
1040 C  CA    . LEU A 159 ? 0.2155 0.2706 0.1541 0.0680  -0.0527 -0.0527 135 LEU A CA    
1041 C  C     . LEU A 159 ? 0.2541 0.2839 0.1732 0.0346  -0.0607 0.0001  135 LEU A C     
1042 O  O     . LEU A 159 ? 0.2932 0.2870 0.1682 0.0482  -0.0871 -0.0078 135 LEU A O     
1043 C  CB    . LEU A 159 ? 0.2412 0.2684 0.1619 0.0328  -0.0234 -0.0367 135 LEU A CB    
1044 C  CG    . LEU A 159 ? 0.2092 0.2458 0.0823 0.0350  -0.0907 0.0128  135 LEU A CG    
1045 C  CD1   . LEU A 159 ? 0.2800 0.2462 0.1083 0.0529  -0.0556 -0.0077 135 LEU A CD1   
1046 C  CD2   . LEU A 159 ? 0.1998 0.2756 0.1209 0.0120  -0.1177 0.0555  135 LEU A CD2   
1047 N  N     . GLY A 160 ? 0.2338 0.3168 0.1916 0.0203  -0.0706 0.0289  136 GLY A N     
1048 C  CA    . GLY A 160 ? 0.2424 0.3480 0.1820 -0.0092 -0.0968 0.0158  136 GLY A CA    
1049 C  C     . GLY A 160 ? 0.2968 0.2920 0.2454 0.0265  -0.1057 0.0203  136 GLY A C     
1050 O  O     . GLY A 160 ? 0.2884 0.3104 0.1662 0.0371  -0.1582 0.0618  136 GLY A O     
1051 N  N     . PRO A 161 ? 0.2992 0.3493 0.2045 -0.0229 -0.1144 0.0137  137 PRO A N     
1052 C  CA    . PRO A 161 ? 0.3373 0.3394 0.2318 -0.0196 -0.1413 0.0073  137 PRO A CA    
1053 C  C     . PRO A 161 ? 0.3220 0.3303 0.2358 0.0016  -0.1428 -0.0125 137 PRO A C     
1054 O  O     . PRO A 161 ? 0.3626 0.4369 0.0925 -0.0058 -0.1051 -0.0354 137 PRO A O     
1055 C  CB    . PRO A 161 ? 0.3347 0.2940 0.2190 -0.0193 -0.1494 -0.0404 137 PRO A CB    
1056 C  CG    . PRO A 161 ? 0.3253 0.3131 0.1926 -0.0464 -0.1320 -0.0761 137 PRO A CG    
1057 C  CD    . PRO A 161 ? 0.3103 0.3391 0.1488 -0.0289 -0.0908 0.0369  137 PRO A CD    
1058 N  N     . GLU A 162 ? 0.3279 0.3444 0.2473 -0.0042 -0.1014 0.0389  138 GLU A N     
1059 C  CA    . GLU A 162 ? 0.4098 0.3685 0.2540 -0.0158 -0.1266 0.0531  138 GLU A CA    
1060 C  C     . GLU A 162 ? 0.3515 0.3382 0.1960 -0.0468 -0.0830 0.0254  138 GLU A C     
1061 O  O     . GLU A 162 ? 0.4903 0.3554 0.2845 -0.0147 -0.1366 0.0388  138 GLU A O     
1062 C  CB    . GLU A 162 ? 0.5096 0.4438 0.3234 0.0006  -0.0639 0.0259  138 GLU A CB    
1063 C  CG    . GLU A 162 ? 0.6117 0.4275 0.4227 -0.0146 -0.1339 0.0081  138 GLU A CG    
1064 C  CD    . GLU A 162 ? 0.7147 0.4346 0.3094 0.0098  -0.2302 0.0417  138 GLU A CD    
1065 O  OE1   . GLU A 162 ? 0.4849 0.4292 0.2854 0.0982  -0.1682 0.0283  138 GLU A OE1   
1066 O  OE2   . GLU A 162 ? 0.8639 0.6604 0.2500 -0.0324 -0.1036 -0.0401 138 GLU A OE2   
1067 N  N     . ASP A 163 ? 0.2977 0.3624 0.2307 -0.0160 -0.1378 -0.0178 139 ASP A N     
1068 C  CA    . ASP A 163 ? 0.3062 0.2831 0.1861 -0.0143 -0.0981 0.0101  139 ASP A CA    
1069 C  C     . ASP A 163 ? 0.2762 0.3537 0.2144 0.0236  -0.1004 0.0128  139 ASP A C     
1070 O  O     . ASP A 163 ? 0.3285 0.3498 0.2292 0.0633  -0.1113 0.0185  139 ASP A O     
1071 C  CB    . ASP A 163 ? 0.2971 0.2517 0.1480 0.0250  -0.0961 0.0122  139 ASP A CB    
1072 C  CG    . ASP A 163 ? 0.3526 0.2508 0.1730 0.0057  -0.0577 0.0353  139 ASP A CG    
1073 O  OD1   . ASP A 163 ? 0.4181 0.4031 0.0910 0.0263  -0.0115 0.1012  139 ASP A OD1   
1074 O  OD2   . ASP A 163 ? 0.3557 0.2724 0.1657 0.0592  -0.1129 -0.0048 139 ASP A OD2   
1075 N  N     . VAL A 164 ? 0.3271 0.2361 0.1708 -0.0003 -0.1043 -0.0233 140 VAL A N     
1076 C  CA    . VAL A 164 ? 0.3111 0.2764 0.1775 0.0367  -0.0764 0.0000  140 VAL A CA    
1077 C  C     . VAL A 164 ? 0.2848 0.3207 0.2102 0.0100  -0.1165 -0.0119 140 VAL A C     
1078 O  O     . VAL A 164 ? 0.2869 0.3930 0.2987 -0.0423 -0.1810 0.0096  140 VAL A O     
1079 C  CB    . VAL A 164 ? 0.3550 0.2723 0.1012 0.0351  -0.0198 -0.0033 140 VAL A CB    
1080 C  CG1   . VAL A 164 ? 0.3850 0.4277 0.0640 0.0655  -0.0379 0.0069  140 VAL A CG1   
1081 C  CG2   . VAL A 164 ? 0.3365 0.2853 0.0446 0.0297  0.0192  -0.0585 140 VAL A CG2   
1082 N  N     . GLU A 165 ? 0.3186 0.3022 0.1915 0.0203  -0.1378 -0.0364 141 GLU A N     
1083 C  CA    . GLU A 165 ? 0.3557 0.3027 0.1595 0.0172  -0.0988 -0.0806 141 GLU A CA    
1084 C  C     . GLU A 165 ? 0.3257 0.3288 0.1575 0.0307  -0.1088 -0.0859 141 GLU A C     
1085 O  O     . GLU A 165 ? 0.3367 0.2753 0.0922 0.0618  -0.1330 -0.0753 141 GLU A O     
1086 C  CB    . GLU A 165 ? 0.3387 0.3661 0.1689 -0.0025 -0.1715 -0.1287 141 GLU A CB    
1087 C  CG    . GLU A 165 ? 0.3794 0.3871 0.1397 0.0192  -0.1546 -0.0110 141 GLU A CG    
1088 C  CD    . GLU A 165 ? 0.3651 0.3608 0.2064 0.0594  -0.1035 -0.0389 141 GLU A CD    
1089 O  OE1   . GLU A 165 ? 0.4317 0.4346 0.1372 0.0834  -0.0933 -0.1027 141 GLU A OE1   
1090 O  OE2   . GLU A 165 ? 0.3885 0.3971 0.2778 0.0281  -0.2208 0.0317  141 GLU A OE2   
1091 N  N     . ALA A 166 ? 0.3017 0.4087 0.2409 0.0097  -0.0799 -0.0540 142 ALA A N     
1092 C  CA    . ALA A 166 ? 0.2892 0.4291 0.2319 -0.0130 -0.1262 -0.1249 142 ALA A CA    
1093 C  C     . ALA A 166 ? 0.3297 0.3708 0.2565 0.0000  -0.0623 -0.0375 142 ALA A C     
1094 O  O     . ALA A 166 ? 0.3164 0.4059 0.1252 -0.0721 -0.1532 -0.0455 142 ALA A O     
1095 C  CB    . ALA A 166 ? 0.2990 0.4615 0.2249 -0.0021 -0.1359 -0.1214 142 ALA A CB    
1096 N  N     . ASP A 167 ? 0.3351 0.3736 0.2621 -0.0158 -0.1595 -0.0264 143 ASP A N     
1097 C  CA    . ASP A 167 ? 0.3157 0.4010 0.1872 0.0177  -0.2156 0.0122  143 ASP A CA    
1098 C  C     . ASP A 167 ? 0.3406 0.3629 0.2141 -0.0569 -0.1060 -0.1125 143 ASP A C     
1099 O  O     . ASP A 167 ? 0.4500 0.3396 0.1450 -0.0728 -0.1324 -0.1304 143 ASP A O     
1100 C  CB    . ASP A 167 ? 0.3991 0.4855 0.3132 -0.0194 -0.0526 0.0609  143 ASP A CB    
1101 C  CG    . ASP A 167 ? 0.4406 0.6784 0.2677 -0.1087 -0.0850 -0.0111 143 ASP A CG    
1102 O  OD1   . ASP A 167 ? 0.5407 0.7292 0.1289 -0.1478 -0.1626 0.1765  143 ASP A OD1   
1103 O  OD2   . ASP A 167 ? 0.4130 0.7157 0.4687 0.0132  -0.0355 0.0650  143 ASP A OD2   
1104 N  N     . VAL A 168 ? 0.3103 0.3442 0.0852 -0.0334 -0.1272 -0.0072 144 VAL A N     
1105 C  CA    . VAL A 168 ? 0.3027 0.4295 0.1693 -0.0236 -0.1045 -0.0906 144 VAL A CA    
1106 C  C     . VAL A 168 ? 0.2783 0.3610 0.1420 -0.0023 -0.0764 -0.1227 144 VAL A C     
1107 O  O     . VAL A 168 ? 0.2838 0.4641 0.1141 0.0425  -0.1122 -0.1500 144 VAL A O     
1108 C  CB    . VAL A 168 ? 0.3109 0.3575 0.1705 -0.0481 -0.1085 -0.0719 144 VAL A CB    
1109 C  CG1   . VAL A 168 ? 0.2720 0.4497 0.1255 0.0305  -0.1343 -0.0210 144 VAL A CG1   
1110 C  CG2   . VAL A 168 ? 0.4445 0.3145 0.1486 -0.1013 -0.1498 -0.0997 144 VAL A CG2   
1111 N  N     . VAL A 169 ? 0.3463 0.3273 0.0828 -0.0171 -0.0864 -0.0875 145 VAL A N     
1112 C  CA    . VAL A 169 ? 0.3139 0.2477 0.1974 -0.0839 -0.0601 -0.1013 145 VAL A CA    
1113 C  C     . VAL A 169 ? 0.2841 0.2789 0.1875 -0.0574 -0.0260 -0.1097 145 VAL A C     
1114 O  O     . VAL A 169 ? 0.3633 0.3440 0.0844 -0.0945 -0.0554 -0.1054 145 VAL A O     
1115 C  CB    . VAL A 169 ? 0.3038 0.2474 0.1630 -0.0749 -0.1292 -0.0743 145 VAL A CB    
1116 C  CG1   . VAL A 169 ? 0.3092 0.3290 0.1665 -0.0714 -0.0584 -0.0503 145 VAL A CG1   
1117 C  CG2   . VAL A 169 ? 0.3321 0.2440 0.1657 -0.0614 -0.1091 -0.0856 145 VAL A CG2   
1118 N  N     . ALA A 170 ? 0.2745 0.3312 0.1321 -0.0519 -0.0675 -0.1030 146 ALA A N     
1119 C  CA    . ALA A 170 ? 0.3769 0.2518 0.2149 -0.0861 -0.0436 -0.1410 146 ALA A CA    
1120 C  C     . ALA A 170 ? 0.3819 0.3483 0.2331 -0.0242 -0.0730 -0.1349 146 ALA A C     
1121 O  O     . ALA A 170 ? 0.4064 0.4888 0.2009 -0.0069 -0.0929 -0.0493 146 ALA A O     
1122 C  CB    . ALA A 170 ? 0.3384 0.3018 0.3213 -0.0881 -0.0975 -0.1445 146 ALA A CB    
1123 N  N     . ASP A 171 ? 0.3685 0.3298 0.2642 -0.0622 -0.0773 -0.1007 147 ASP A N     
1124 C  CA    . ASP A 171 ? 0.3964 0.3954 0.1223 -0.0179 -0.0590 -0.0271 147 ASP A CA    
1125 C  C     . ASP A 171 ? 0.3880 0.2983 0.1199 0.0173  -0.1204 0.0818  147 ASP A C     
1126 O  O     . ASP A 171 ? 0.4478 0.3348 0.1206 0.0713  -0.0331 0.0981  147 ASP A O     
1127 C  CB    . ASP A 171 ? 0.5610 0.3020 0.2580 -0.0334 -0.1054 -0.0786 147 ASP A CB    
1128 C  CG    . ASP A 171 ? 0.5339 0.4473 0.3324 -0.0045 -0.1038 -0.1080 147 ASP A CG    
1129 O  OD1   . ASP A 171 ? 0.6377 0.6535 0.3302 0.0076  -0.1525 -0.0980 147 ASP A OD1   
1130 O  OD2   . ASP A 171 ? 0.6647 0.4496 0.4524 -0.0408 -0.0438 -0.1008 147 ASP A OD2   
1131 N  N     . ALA A 172 ? 0.3490 0.3119 0.2278 0.0187  -0.0760 -0.0168 148 ALA A N     
1132 C  CA    . ALA A 172 ? 0.3613 0.3123 0.2127 -0.0210 -0.0245 -0.0122 148 ALA A CA    
1133 C  C     . ALA A 172 ? 0.3142 0.2625 0.0863 -0.0021 -0.1116 -0.0642 148 ALA A C     
1134 O  O     . ALA A 172 ? 0.3670 0.2343 0.0994 0.0021  -0.1269 -0.0741 148 ALA A O     
1135 C  CB    . ALA A 172 ? 0.3920 0.3554 0.2350 -0.0496 -0.0674 -0.0312 148 ALA A CB    
1136 N  N     . LYS A 173 ? 0.3563 0.1982 0.0847 -0.0210 -0.0592 -0.0667 149 LYS A N     
1137 C  CA    . LYS A 173 ? 0.3489 0.2539 0.0874 -0.0168 -0.0892 -0.0299 149 LYS A CA    
1138 C  C     . LYS A 173 ? 0.3900 0.2440 0.1238 -0.0242 -0.0837 -0.0447 149 LYS A C     
1139 O  O     . LYS A 173 ? 0.4166 0.2965 0.2087 0.0946  -0.1860 -0.1002 149 LYS A O     
1140 C  CB    . LYS A 173 ? 0.3630 0.2494 0.1055 0.0493  -0.1620 -0.0453 149 LYS A CB    
1141 C  CG    . LYS A 173 ? 0.3622 0.2494 0.1563 0.0014  -0.0712 -0.0786 149 LYS A CG    
1142 C  CD    . LYS A 173 ? 0.3676 0.3212 0.2344 0.0079  -0.0216 -0.0643 149 LYS A CD    
1143 C  CE    . LYS A 173 ? 0.3878 0.3882 0.1138 0.1351  -0.0362 -0.1019 149 LYS A CE    
1144 N  NZ    . LYS A 173 ? 0.4225 0.5363 0.0557 0.2444  -0.1070 -0.0895 149 LYS A NZ    
1145 N  N     . VAL A 174 ? 0.3689 0.2863 0.1788 -0.0562 -0.0700 -0.1180 150 VAL A N     
1146 C  CA    . VAL A 174 ? 0.3335 0.2588 0.1939 0.0167  -0.0942 -0.0095 150 VAL A CA    
1147 C  C     . VAL A 174 ? 0.3833 0.3002 0.2194 0.0675  -0.0707 -0.0348 150 VAL A C     
1148 O  O     . VAL A 174 ? 0.3457 0.3875 0.1385 0.0045  -0.1697 -0.0942 150 VAL A O     
1149 C  CB    . VAL A 174 ? 0.3052 0.2552 0.0958 0.0168  -0.1221 0.0511  150 VAL A CB    
1150 C  CG1   . VAL A 174 ? 0.3371 0.2813 0.1403 -0.0058 -0.0900 -0.0025 150 VAL A CG1   
1151 C  CG2   . VAL A 174 ? 0.3655 0.2774 0.1766 -0.0092 -0.0515 -0.0579 150 VAL A CG2   
1152 N  N     . THR A 175 ? 0.3808 0.2444 0.2424 0.0179  -0.0419 -0.0588 151 THR A N     
1153 C  CA    . THR A 175 ? 0.2810 0.2620 0.1687 -0.0257 -0.1170 -0.0464 151 THR A CA    
1154 C  C     . THR A 175 ? 0.3061 0.2480 0.1679 -0.0242 -0.0957 -0.0202 151 THR A C     
1155 O  O     . THR A 175 ? 0.3579 0.3240 0.1331 -0.0396 -0.0960 -0.0171 151 THR A O     
1156 C  CB    . THR A 175 ? 0.2972 0.2508 0.1629 -0.0326 -0.0656 -0.0014 151 THR A CB    
1157 O  OG1   . THR A 175 ? 0.3608 0.2620 0.0598 -0.0480 -0.0850 0.0666  151 THR A OG1   
1158 C  CG2   . THR A 175 ? 0.2851 0.2558 0.1371 -0.0924 -0.1376 -0.0362 151 THR A CG2   
1159 N  N     . TYR A 176 ? 0.2501 0.2990 0.1519 -0.0235 -0.0520 -0.0925 152 TYR A N     
1160 C  CA    . TYR A 176 ? 0.2385 0.2681 0.1760 -0.0183 -0.0114 -0.0203 152 TYR A CA    
1161 C  C     . TYR A 176 ? 0.2772 0.2577 0.1646 -0.0255 -0.0406 -0.0249 152 TYR A C     
1162 O  O     . TYR A 176 ? 0.3156 0.3117 0.0668 -0.0250 -0.0821 -0.0297 152 TYR A O     
1163 C  CB    . TYR A 176 ? 0.2554 0.2842 0.0911 0.0132  -0.0694 0.0524  152 TYR A CB    
1164 C  CG    . TYR A 176 ? 0.2342 0.2979 0.1598 0.0315  -0.0174 -0.0230 152 TYR A CG    
1165 C  CD1   . TYR A 176 ? 0.3110 0.2949 0.1679 0.0297  -0.0536 -0.0072 152 TYR A CD1   
1166 C  CD2   . TYR A 176 ? 0.2677 0.2433 0.2274 0.0151  0.0089  -0.0389 152 TYR A CD2   
1167 C  CE1   . TYR A 176 ? 0.3344 0.2492 0.1165 0.0274  -0.0225 -0.0211 152 TYR A CE1   
1168 C  CE2   . TYR A 176 ? 0.3393 0.2341 0.2041 0.0234  -0.0233 -0.0311 152 TYR A CE2   
1169 C  CZ    . TYR A 176 ? 0.3571 0.2195 0.2046 0.0150  -0.0261 -0.0156 152 TYR A CZ    
1170 O  OH    . TYR A 176 ? 0.3724 0.2093 0.0848 0.0707  -0.0919 0.0057  152 TYR A OH    
1171 N  N     . PHE A 177 ? 0.2192 0.2428 0.1248 -0.0174 -0.1047 -0.0867 153 PHE A N     
1172 C  CA    . PHE A 177 ? 0.2039 0.2776 0.1036 0.0475  -0.0585 -0.0314 153 PHE A CA    
1173 C  C     . PHE A 177 ? 0.2705 0.2756 0.1021 0.0290  -0.0594 -0.0809 153 PHE A C     
1174 O  O     . PHE A 177 ? 0.3086 0.2614 0.0645 0.0436  -0.0808 -0.0733 153 PHE A O     
1175 C  CB    . PHE A 177 ? 0.1910 0.2642 0.1628 0.0532  -0.0209 0.0052  153 PHE A CB    
1176 C  CG    . PHE A 177 ? 0.2619 0.2332 0.1594 0.0076  -0.0741 -0.0035 153 PHE A CG    
1177 C  CD1   . PHE A 177 ? 0.2918 0.2491 0.1652 0.0379  -0.0743 -0.0120 153 PHE A CD1   
1178 C  CD2   . PHE A 177 ? 0.1998 0.2271 0.1436 0.0316  -0.0721 0.0025  153 PHE A CD2   
1179 C  CE1   . PHE A 177 ? 0.3199 0.1852 0.1392 -0.0053 -0.1131 -0.0459 153 PHE A CE1   
1180 C  CE2   . PHE A 177 ? 0.2398 0.1576 0.0928 -0.0098 -0.0493 -0.0219 153 PHE A CE2   
1181 C  CZ    . PHE A 177 ? 0.2623 0.1948 0.1328 -0.0270 -0.0441 -0.0811 153 PHE A CZ    
1182 N  N     . GLU A 178 ? 0.2716 0.2848 0.0984 0.0505  -0.1248 -0.0752 154 GLU A N     
1183 C  CA    . GLU A 178 ? 0.2594 0.2847 0.1094 0.0037  -0.0958 -0.0134 154 GLU A CA    
1184 C  C     . GLU A 178 ? 0.2492 0.2642 0.0932 -0.0256 -0.0879 0.0172  154 GLU A C     
1185 O  O     . GLU A 178 ? 0.2564 0.2430 0.0491 0.0095  -0.0726 -0.0177 154 GLU A O     
1186 C  CB    . GLU A 178 ? 0.2797 0.2559 0.1008 -0.0046 -0.0872 -0.0646 154 GLU A CB    
1187 C  CG    . GLU A 178 ? 0.2999 0.2259 0.1030 -0.0029 -0.0593 -0.0878 154 GLU A CG    
1188 C  CD    . GLU A 178 ? 0.2056 0.2219 0.1067 0.0109  -0.0809 -0.0367 154 GLU A CD    
1189 O  OE1   . GLU A 178 ? 0.2226 0.2234 0.0561 0.0153  -0.0767 -0.0200 154 GLU A OE1   
1190 O  OE2   . GLU A 178 ? 0.2467 0.2651 0.1232 0.0472  -0.0560 -0.0040 154 GLU A OE2   
1191 N  N     . GLY A 179 ? 0.2844 0.2320 0.1257 -0.0291 -0.0865 0.0001  155 GLY A N     
1192 C  CA    . GLY A 179 ? 0.2588 0.2400 0.1038 0.0073  -0.0863 -0.0080 155 GLY A CA    
1193 C  C     . GLY A 179 ? 0.2426 0.2423 0.1226 0.0187  -0.0665 -0.0116 155 GLY A C     
1194 O  O     . GLY A 179 ? 0.2384 0.2643 0.0662 0.0235  -0.0930 -0.0015 155 GLY A O     
1195 N  N     . TYR A 180 ? 0.2556 0.2441 0.1076 -0.0045 -0.0769 -0.0143 156 TYR A N     
1196 C  CA    . TYR A 180 ? 0.2384 0.2707 0.1235 0.0205  -0.0521 0.0143  156 TYR A CA    
1197 C  C     . TYR A 180 ? 0.2448 0.2211 0.1334 0.0124  -0.0368 -0.0046 156 TYR A C     
1198 O  O     . TYR A 180 ? 0.2869 0.2473 0.1634 0.0430  -0.0299 -0.0115 156 TYR A O     
1199 C  CB    . TYR A 180 ? 0.2028 0.2546 0.1257 -0.0028 -0.0605 0.0206  156 TYR A CB    
1200 C  CG    . TYR A 180 ? 0.1998 0.2364 0.1129 0.0027  -0.0528 0.0443  156 TYR A CG    
1201 C  CD1   . TYR A 180 ? 0.1900 0.2498 0.0414 0.0073  -0.0514 -0.0004 156 TYR A CD1   
1202 C  CD2   . TYR A 180 ? 0.2003 0.2638 0.2010 0.0040  -0.0068 -0.0146 156 TYR A CD2   
1203 C  CE1   . TYR A 180 ? 0.1834 0.2682 0.0745 0.0236  -0.0514 0.0051  156 TYR A CE1   
1204 C  CE2   . TYR A 180 ? 0.2106 0.1957 0.1123 -0.0191 -0.0491 -0.0055 156 TYR A CE2   
1205 C  CZ    . TYR A 180 ? 0.2359 0.1933 0.0845 0.0058  -0.0286 -0.0454 156 TYR A CZ    
1206 O  OH    . TYR A 180 ? 0.2628 0.3205 0.1259 -0.0133 -0.0445 -0.0644 156 TYR A OH    
1207 N  N     . LEU A 181 ? 0.2496 0.2979 0.1221 -0.0218 -0.0687 0.0201  157 LEU A N     
1208 C  CA    . LEU A 181 ? 0.2587 0.2153 0.0895 -0.0100 -0.0560 -0.0145 157 LEU A CA    
1209 C  C     . LEU A 181 ? 0.2510 0.2659 0.0901 0.0164  -0.0709 -0.0210 157 LEU A C     
1210 O  O     . LEU A 181 ? 0.2686 0.3177 0.1302 -0.0012 -0.0692 0.0181  157 LEU A O     
1211 C  CB    . LEU A 181 ? 0.2739 0.2186 0.0733 -0.0119 -0.0077 -0.0267 157 LEU A CB    
1212 C  CG    . LEU A 181 ? 0.2636 0.2033 0.1106 -0.0736 -0.0458 0.0174  157 LEU A CG    
1213 C  CD1   . LEU A 181 ? 0.2638 0.2481 0.1239 -0.0821 -0.0620 -0.0009 157 LEU A CD1   
1214 C  CD2   . LEU A 181 ? 0.2596 0.3085 0.0749 -0.0933 -0.1042 0.0404  157 LEU A CD2   
1215 N  N     . TRP A 182 ? 0.2579 0.2466 0.0798 -0.0078 -0.0708 -0.0692 158 TRP A N     
1216 C  CA    . TRP A 182 ? 0.3020 0.2352 0.0932 0.0046  -0.0587 -0.0409 158 TRP A CA    
1217 C  C     . TRP A 182 ? 0.2632 0.2475 0.0946 0.0078  -0.0757 -0.0492 158 TRP A C     
1218 O  O     . TRP A 182 ? 0.2792 0.3015 0.0909 0.0229  -0.1221 -0.0544 158 TRP A O     
1219 C  CB    . TRP A 182 ? 0.2856 0.2773 0.1365 -0.0062 -0.0618 -0.0093 158 TRP A CB    
1220 C  CG    . TRP A 182 ? 0.2818 0.3038 0.1216 -0.0081 -0.0419 -0.0319 158 TRP A CG    
1221 C  CD1   . TRP A 182 ? 0.3242 0.2973 0.1392 -0.0056 -0.0437 -0.0158 158 TRP A CD1   
1222 C  CD2   . TRP A 182 ? 0.3246 0.2831 0.1906 -0.0103 -0.0735 -0.0157 158 TRP A CD2   
1223 N  NE1   . TRP A 182 ? 0.3903 0.2979 0.1531 -0.0139 -0.0805 -0.0006 158 TRP A NE1   
1224 C  CE2   . TRP A 182 ? 0.3836 0.2802 0.1266 -0.0180 -0.0612 -0.0473 158 TRP A CE2   
1225 C  CE3   . TRP A 182 ? 0.3679 0.2733 0.1860 -0.0026 -0.0485 -0.0213 158 TRP A CE3   
1226 C  CZ2   . TRP A 182 ? 0.3985 0.2439 0.1188 -0.0496 -0.0469 -0.0154 158 TRP A CZ2   
1227 C  CZ3   . TRP A 182 ? 0.4331 0.3496 0.1867 -0.0228 -0.0601 -0.0472 158 TRP A CZ3   
1228 C  CH2   . TRP A 182 ? 0.3763 0.3122 0.1151 0.0114  0.0151  -0.0166 158 TRP A CH2   
1229 N  N     . ASP A 183 ? 0.2256 0.2691 0.1396 -0.0102 -0.0898 -0.0716 159 ASP A N     
1230 C  CA    . ASP A 183 ? 0.2338 0.2952 0.1149 0.0336  -0.0878 -0.0426 159 ASP A CA    
1231 C  C     . ASP A 183 ? 0.2251 0.2882 0.1334 0.0128  -0.1146 -0.0418 159 ASP A C     
1232 O  O     . ASP A 183 ? 0.2684 0.3281 0.1541 0.0617  -0.1410 -0.0223 159 ASP A O     
1233 C  CB    . ASP A 183 ? 0.2149 0.3053 0.0980 0.0246  -0.0748 -0.0629 159 ASP A CB    
1234 C  CG    . ASP A 183 ? 0.2631 0.3058 0.0747 0.0220  -0.0821 -0.0370 159 ASP A CG    
1235 O  OD1   . ASP A 183 ? 0.2772 0.3118 0.1903 0.0131  -0.0777 -0.0436 159 ASP A OD1   
1236 O  OD2   . ASP A 183 ? 0.3064 0.3207 0.0636 0.0482  -0.0613 -0.0613 159 ASP A OD2   
1237 N  N     . PRO A 184 ? 0.2476 0.2953 0.1030 0.0142  -0.0869 -0.0318 160 PRO A N     
1238 C  CA    . PRO A 184 ? 0.2469 0.3075 0.1773 0.0011  -0.0866 -0.0303 160 PRO A CA    
1239 C  C     . PRO A 184 ? 0.2519 0.3356 0.1942 0.0280  -0.0838 -0.0236 160 PRO A C     
1240 O  O     . PRO A 184 ? 0.3165 0.3662 0.1726 0.0171  -0.1748 -0.0236 160 PRO A O     
1241 C  CB    . PRO A 184 ? 0.2644 0.3097 0.2262 0.0302  -0.0803 -0.0539 160 PRO A CB    
1242 C  CG    . PRO A 184 ? 0.2740 0.3005 0.1816 -0.0086 -0.0709 -0.0204 160 PRO A CG    
1243 C  CD    . PRO A 184 ? 0.2516 0.2538 0.1653 0.0042  -0.1045 -0.0217 160 PRO A CD    
1244 N  N     . PRO A 185 ? 0.2632 0.3425 0.2306 0.0150  -0.0738 -0.0393 161 PRO A N     
1245 C  CA    . PRO A 185 ? 0.2494 0.3304 0.2920 0.0216  -0.0521 -0.0248 161 PRO A CA    
1246 C  C     . PRO A 185 ? 0.3038 0.3299 0.3007 -0.0233 -0.0795 -0.0045 161 PRO A C     
1247 O  O     . PRO A 185 ? 0.3473 0.3817 0.3279 -0.0379 -0.1224 -0.0086 161 PRO A O     
1248 C  CB    . PRO A 185 ? 0.2925 0.3252 0.2594 0.0315  -0.0461 0.0013  161 PRO A CB    
1249 C  CG    . PRO A 185 ? 0.2906 0.3711 0.3369 0.0463  -0.0442 0.0387  161 PRO A CG    
1250 C  CD    . PRO A 185 ? 0.2836 0.3982 0.2708 0.0155  -0.0180 -0.0051 161 PRO A CD    
1251 N  N     . ARG A 186 ? 0.2755 0.3466 0.2540 -0.0128 -0.1117 0.0211  162 ARG A N     
1252 C  CA    A ARG A 186 ? 0.2825 0.3570 0.2438 -0.0303 -0.0703 -0.0009 162 ARG A CA    
1253 C  CA    B ARG A 186 ? 0.2868 0.3582 0.2401 -0.0268 -0.0743 -0.0005 162 ARG A CA    
1254 C  C     . ARG A 186 ? 0.2511 0.3325 0.2529 -0.0255 -0.0951 0.0038  162 ARG A C     
1255 O  O     . ARG A 186 ? 0.2626 0.3733 0.1894 -0.0050 -0.1286 0.0280  162 ARG A O     
1256 C  CB    A ARG A 186 ? 0.2653 0.3831 0.2883 -0.0277 -0.0506 -0.0195 162 ARG A CB    
1257 C  CB    B ARG A 186 ? 0.2518 0.3806 0.2776 -0.0240 -0.0611 -0.0205 162 ARG A CB    
1258 C  CG    A ARG A 186 ? 0.2951 0.3667 0.3237 -0.0109 -0.0465 -0.0114 162 ARG A CG    
1259 C  CG    B ARG A 186 ? 0.2632 0.3571 0.2460 -0.0077 -0.0827 -0.0058 162 ARG A CG    
1260 C  CD    A ARG A 186 ? 0.3180 0.3850 0.3219 -0.0159 -0.0316 0.0251  162 ARG A CD    
1261 C  CD    B ARG A 186 ? 0.2788 0.3525 0.1864 0.0100  -0.0755 0.0210  162 ARG A CD    
1262 N  NE    A ARG A 186 ? 0.3469 0.4242 0.3876 0.0075  -0.0421 -0.0523 162 ARG A NE    
1263 N  NE    B ARG A 186 ? 0.2473 0.3091 0.2276 0.0017  -0.0863 0.0184  162 ARG A NE    
1264 C  CZ    A ARG A 186 ? 0.3363 0.4501 0.3821 -0.0307 -0.0479 -0.0457 162 ARG A CZ    
1265 C  CZ    B ARG A 186 ? 0.3217 0.2952 0.2118 0.0154  -0.0748 0.0138  162 ARG A CZ    
1266 N  NH1   A ARG A 186 ? 0.4057 0.5258 0.3693 -0.0176 -0.1162 -0.0422 162 ARG A NH1   
1267 N  NH1   B ARG A 186 ? 0.4147 0.2416 0.2657 0.0555  -0.0957 0.0099  162 ARG A NH1   
1268 N  NH2   A ARG A 186 ? 0.2076 0.5392 0.3499 -0.0264 0.0005  -0.0487 162 ARG A NH2   
1269 N  NH2   B ARG A 186 ? 0.3457 0.2700 0.2139 0.0058  -0.0459 -0.0164 162 ARG A NH2   
1270 N  N     . ALA A 187 ? 0.2568 0.3292 0.1123 -0.0109 -0.1082 0.0576  163 ALA A N     
1271 C  CA    . ALA A 187 ? 0.2258 0.3292 0.1953 -0.0063 -0.1099 0.0348  163 ALA A CA    
1272 C  C     . ALA A 187 ? 0.3012 0.3213 0.1972 0.0130  -0.1129 0.0070  163 ALA A C     
1273 O  O     . ALA A 187 ? 0.2647 0.3078 0.1584 -0.0017 -0.1441 0.0198  163 ALA A O     
1274 C  CB    . ALA A 187 ? 0.2519 0.3627 0.1173 0.0061  -0.1389 -0.0076 163 ALA A CB    
1275 N  N     . LYS A 188 ? 0.2512 0.3193 0.1981 -0.0210 -0.0779 0.0285  164 LYS A N     
1276 C  CA    . LYS A 188 ? 0.2579 0.2918 0.1961 0.0022  -0.0652 0.0121  164 LYS A CA    
1277 C  C     . LYS A 188 ? 0.2469 0.3124 0.1825 0.0231  -0.0915 0.0100  164 LYS A C     
1278 O  O     . LYS A 188 ? 0.3506 0.3815 0.2026 -0.0040 -0.0892 -0.0339 164 LYS A O     
1279 C  CB    . LYS A 188 ? 0.3122 0.2787 0.1374 0.0111  -0.0611 -0.0111 164 LYS A CB    
1280 C  CG    . LYS A 188 ? 0.3286 0.3030 0.1670 0.0362  -0.0646 -0.0240 164 LYS A CG    
1281 C  CD    . LYS A 188 ? 0.4359 0.2844 0.2151 0.0444  -0.0359 -0.0715 164 LYS A CD    
1282 C  CE    . LYS A 188 ? 0.4727 0.3600 0.1531 0.0057  -0.0135 -0.0654 164 LYS A CE    
1283 N  NZ    . LYS A 188 ? 0.5132 0.3765 0.1681 0.0725  -0.0777 -0.0538 164 LYS A NZ    
1284 N  N     . GLU A 189 ? 0.2342 0.3401 0.2226 -0.0015 -0.0926 -0.0066 165 GLU A N     
1285 C  CA    . GLU A 189 ? 0.2532 0.3326 0.2403 -0.0160 -0.0840 -0.0073 165 GLU A CA    
1286 C  C     . GLU A 189 ? 0.2454 0.3248 0.2804 -0.0266 -0.0747 -0.0081 165 GLU A C     
1287 O  O     . GLU A 189 ? 0.2144 0.3580 0.3743 -0.0673 -0.0654 -0.0671 165 GLU A O     
1288 C  CB    . GLU A 189 ? 0.2579 0.3191 0.2669 -0.0229 -0.0584 0.0013  165 GLU A CB    
1289 C  CG    . GLU A 189 ? 0.2838 0.3557 0.2390 0.0673  -0.1050 0.0722  165 GLU A CG    
1290 C  CD    . GLU A 189 ? 0.3736 0.4758 0.3456 0.0320  -0.0066 0.0042  165 GLU A CD    
1291 O  OE1   . GLU A 189 ? 0.4371 0.5619 0.2086 -0.0251 0.0805  -0.0002 165 GLU A OE1   
1292 O  OE2   . GLU A 189 ? 0.4507 0.4911 0.3715 -0.0052 -0.0581 0.0086  165 GLU A OE2   
1293 N  N     . ALA A 190 ? 0.2620 0.2784 0.2899 -0.0247 -0.0587 0.0082  166 ALA A N     
1294 C  CA    . ALA A 190 ? 0.2392 0.2911 0.2372 -0.0227 -0.0792 0.0025  166 ALA A CA    
1295 C  C     . ALA A 190 ? 0.2675 0.2615 0.1805 -0.0459 -0.1029 -0.0177 166 ALA A C     
1296 O  O     . ALA A 190 ? 0.3131 0.3033 0.1359 -0.0585 -0.1172 -0.0165 166 ALA A O     
1297 C  CB    . ALA A 190 ? 0.2641 0.2998 0.1847 0.0034  -0.0411 0.0168  166 ALA A CB    
1298 N  N     . ILE A 191 ? 0.2331 0.3083 0.1656 -0.0231 -0.0830 0.0280  167 ILE A N     
1299 C  CA    . ILE A 191 ? 0.2281 0.3447 0.1721 -0.0108 -0.0828 0.0200  167 ILE A CA    
1300 C  C     . ILE A 191 ? 0.2403 0.3424 0.1637 0.0001  -0.0781 0.0042  167 ILE A C     
1301 O  O     . ILE A 191 ? 0.2651 0.3639 0.0958 0.0024  -0.1297 -0.0111 167 ILE A O     
1302 C  CB    . ILE A 191 ? 0.1926 0.3345 0.1584 0.0023  -0.0334 0.0122  167 ILE A CB    
1303 C  CG1   . ILE A 191 ? 0.2167 0.2553 0.1425 0.0323  -0.0404 -0.0217 167 ILE A CG1   
1304 C  CG2   . ILE A 191 ? 0.1836 0.3094 0.0668 0.0426  -0.0660 -0.0796 167 ILE A CG2   
1305 C  CD1   . ILE A 191 ? 0.2706 0.2034 0.0900 -0.0204 -0.0674 -0.0846 167 ILE A CD1   
1306 N  N     . LEU A 192 ? 0.2779 0.4033 0.1936 0.0366  -0.1022 0.0111  168 LEU A N     
1307 C  CA    . LEU A 192 ? 0.3158 0.3718 0.1693 0.0155  -0.1028 -0.0065 168 LEU A CA    
1308 C  C     . LEU A 192 ? 0.3044 0.3953 0.2013 -0.0029 -0.1490 0.0206  168 LEU A C     
1309 O  O     . LEU A 192 ? 0.3707 0.4038 0.1879 0.0621  -0.2095 0.0440  168 LEU A O     
1310 C  CB    . LEU A 192 ? 0.3280 0.3931 0.1355 0.0346  -0.1823 -0.0102 168 LEU A CB    
1311 C  CG    . LEU A 192 ? 0.3693 0.3539 0.3003 0.0617  -0.1136 0.0724  168 LEU A CG    
1312 C  CD1   . LEU A 192 ? 0.4011 0.3696 0.3048 0.0773  -0.1241 0.1174  168 LEU A CD1   
1313 C  CD2   . LEU A 192 ? 0.4894 0.4506 0.4470 0.0591  -0.0087 0.1038  168 LEU A CD2   
1314 N  N     . ASP A 193 ? 0.3138 0.3291 0.1723 0.0103  -0.1476 -0.0162 169 ASP A N     
1315 C  CA    . ASP A 193 ? 0.3238 0.3339 0.2270 0.0070  -0.1367 0.0515  169 ASP A CA    
1316 C  C     . ASP A 193 ? 0.3017 0.3365 0.2333 0.0014  -0.1567 0.0245  169 ASP A C     
1317 O  O     . ASP A 193 ? 0.3494 0.3336 0.1722 0.0045  -0.1389 0.0244  169 ASP A O     
1318 C  CB    . ASP A 193 ? 0.3337 0.3778 0.1718 0.0076  -0.1619 0.0260  169 ASP A CB    
1319 C  CG    . ASP A 193 ? 0.3957 0.3726 0.2180 0.0296  -0.1095 0.0021  169 ASP A CG    
1320 O  OD1   . ASP A 193 ? 0.3842 0.4643 0.2020 0.0507  -0.1275 -0.0048 169 ASP A OD1   
1321 O  OD2   . ASP A 193 ? 0.4236 0.3999 0.2042 0.0351  -0.1046 0.0422  169 ASP A OD2   
1322 N  N     . CYS A 194 ? 0.2587 0.4234 0.2862 0.0085  -0.1066 -0.0026 170 CYS A N     
1323 C  CA    . CYS A 194 ? 0.2925 0.3930 0.2289 -0.0100 -0.0940 0.0046  170 CYS A CA    
1324 C  C     . CYS A 194 ? 0.3293 0.3198 0.2058 -0.0321 -0.1334 0.0008  170 CYS A C     
1325 O  O     . CYS A 194 ? 0.2867 0.3124 0.1783 -0.0298 -0.1479 0.0133  170 CYS A O     
1326 C  CB    . CYS A 194 ? 0.3424 0.4674 0.2444 0.0304  -0.1517 0.0134  170 CYS A CB    
1327 S  SG    . CYS A 194 ? 0.4526 0.4419 0.1797 -0.0026 -0.2486 -0.0563 170 CYS A SG    
1328 N  N     . ALA A 195 ? 0.3125 0.3416 0.1407 -0.0227 -0.1781 0.0533  171 ALA A N     
1329 C  CA    . ALA A 195 ? 0.3613 0.4173 0.1586 -0.0384 -0.1419 0.0654  171 ALA A CA    
1330 C  C     . ALA A 195 ? 0.3309 0.3577 0.1153 0.0129  -0.1382 0.0896  171 ALA A C     
1331 O  O     . ALA A 195 ? 0.4277 0.4152 0.1899 -0.0172 -0.0928 0.0245  171 ALA A O     
1332 C  CB    . ALA A 195 ? 0.5223 0.4243 0.0928 -0.0459 -0.1828 0.0070  171 ALA A CB    
1333 N  N     . ARG A 196 ? 0.3534 0.3532 0.0783 0.0162  -0.1214 0.0455  172 ARG A N     
1334 C  CA    . ARG A 196 ? 0.2957 0.3510 0.1669 0.0010  -0.0991 -0.0008 172 ARG A CA    
1335 C  C     . ARG A 196 ? 0.3451 0.3457 0.2110 -0.0055 -0.0906 -0.0022 172 ARG A C     
1336 O  O     . ARG A 196 ? 0.4314 0.3536 0.2353 0.0232  -0.1619 -0.0373 172 ARG A O     
1337 C  CB    . ARG A 196 ? 0.2943 0.4140 0.0757 -0.0352 -0.1060 -0.0137 172 ARG A CB    
1338 C  CG    . ARG A 196 ? 0.3631 0.3911 0.1835 -0.0247 -0.1353 -0.1519 172 ARG A CG    
1339 C  CD    . ARG A 196 ? 0.3643 0.5272 0.3334 -0.0255 -0.0700 -0.0574 172 ARG A CD    
1340 N  NE    . ARG A 196 ? 0.4833 0.5514 0.3419 -0.0066 -0.0701 -0.0060 172 ARG A NE    
1341 C  CZ    . ARG A 196 ? 0.5902 0.5147 0.3937 -0.0380 -0.1439 -0.0244 172 ARG A CZ    
1342 N  NH1   . ARG A 196 ? 0.5020 0.4982 0.1250 0.0799  -0.2180 -0.0332 172 ARG A NH1   
1343 N  NH2   . ARG A 196 ? 0.5135 0.7007 0.3990 -0.0373 -0.2474 -0.0249 172 ARG A NH2   
1344 N  N     . ILE A 197 ? 0.3482 0.3368 0.2299 -0.0126 -0.1441 -0.0077 173 ILE A N     
1345 C  CA    . ILE A 197 ? 0.3701 0.3117 0.1931 -0.0151 -0.0933 0.0088  173 ILE A CA    
1346 C  C     . ILE A 197 ? 0.3208 0.3280 0.2262 -0.0525 -0.1030 -0.0033 173 ILE A C     
1347 O  O     . ILE A 197 ? 0.3427 0.3809 0.2278 -0.0895 -0.1481 -0.0399 173 ILE A O     
1348 C  CB    . ILE A 197 ? 0.3017 0.3056 0.2412 -0.0322 -0.1167 0.0679  173 ILE A CB    
1349 C  CG1   . ILE A 197 ? 0.3522 0.2268 0.1957 -0.0108 -0.0872 0.1300  173 ILE A CG1   
1350 C  CG2   . ILE A 197 ? 0.2713 0.3046 0.2722 -0.0572 -0.1582 0.0057  173 ILE A CG2   
1351 C  CD1   . ILE A 197 ? 0.3224 0.1762 0.2261 0.0256  -0.0475 0.1603  173 ILE A CD1   
1352 N  N     . ALA A 198 ? 0.3152 0.3992 0.2585 -0.0567 -0.1057 0.0277  174 ALA A N     
1353 C  CA    . ALA A 198 ? 0.2822 0.3019 0.2386 -0.0466 -0.1298 -0.0019 174 ALA A CA    
1354 C  C     . ALA A 198 ? 0.3961 0.3667 0.2414 -0.0634 -0.1133 0.0343  174 ALA A C     
1355 O  O     . ALA A 198 ? 0.4008 0.4118 0.1977 -0.0191 -0.1874 0.0430  174 ALA A O     
1356 C  CB    . ALA A 198 ? 0.2994 0.2526 0.1689 -0.0496 -0.1638 0.0720  174 ALA A CB    
1357 N  N     . HIS A 199 ? 0.3367 0.3228 0.2390 -0.0570 -0.1834 -0.0825 175 HIS A N     
1358 C  CA    . HIS A 199 ? 0.4191 0.3601 0.2785 -0.0245 -0.1139 0.0236  175 HIS A CA    
1359 C  C     . HIS A 199 ? 0.3974 0.4329 0.2223 -0.0157 -0.1058 -0.0062 175 HIS A C     
1360 O  O     . HIS A 199 ? 0.4346 0.5594 0.2147 -0.0369 -0.2310 -0.0826 175 HIS A O     
1361 C  CB    . HIS A 199 ? 0.4399 0.3051 0.3474 -0.0648 -0.1106 -0.0080 175 HIS A CB    
1362 C  CG    . HIS A 199 ? 0.3708 0.3448 0.2822 -0.0285 -0.0791 -0.0390 175 HIS A CG    
1363 N  ND1   . HIS A 199 ? 0.4840 0.2233 0.3607 -0.0056 -0.1889 0.0247  175 HIS A ND1   
1364 C  CD2   . HIS A 199 ? 0.3769 0.4375 0.2624 -0.0257 -0.0785 -0.0661 175 HIS A CD2   
1365 C  CE1   . HIS A 199 ? 0.3944 0.2836 0.4191 0.0633  -0.0543 0.0112  175 HIS A CE1   
1366 N  NE2   . HIS A 199 ? 0.3677 0.3899 0.1649 -0.0211 -0.0704 -0.0001 175 HIS A NE2   
1367 N  N     . GLN A 200 ? 0.3942 0.4383 0.1892 -0.0528 -0.1302 -0.0221 176 GLN A N     
1368 C  CA    . GLN A 200 ? 0.4450 0.3670 0.2494 -0.0076 -0.2057 -0.0598 176 GLN A CA    
1369 C  C     . GLN A 200 ? 0.3982 0.3736 0.2270 0.0031  -0.2027 -0.0031 176 GLN A C     
1370 O  O     . GLN A 200 ? 0.5032 0.3558 0.2677 -0.0144 -0.2008 -0.0272 176 GLN A O     
1371 C  CB    . GLN A 200 ? 0.4980 0.4124 0.1457 0.0220  -0.2113 -0.1099 176 GLN A CB    
1372 C  CG    . GLN A 200 ? 0.5423 0.3357 0.2879 0.0565  -0.1812 -0.2345 176 GLN A CG    
1373 C  CD    . GLN A 200 ? 0.5750 0.5435 0.4320 0.0777  -0.1380 -0.1981 176 GLN A CD    
1374 O  OE1   . GLN A 200 ? 0.8613 0.8261 0.5366 -0.0050 -0.1744 -0.0620 176 GLN A OE1   
1375 N  NE2   . GLN A 200 ? 0.6573 0.7809 0.2378 0.2357  -0.3015 -0.3265 176 GLN A NE2   
1376 N  N     . HIS A 201 ? 0.4279 0.3430 0.1098 -0.0055 -0.1536 0.0700  177 HIS A N     
1377 C  CA    . HIS A 201 ? 0.4684 0.3437 0.1111 -0.0076 -0.1402 0.0197  177 HIS A CA    
1378 C  C     . HIS A 201 ? 0.4440 0.2751 0.1314 -0.0143 -0.1785 -0.0088 177 HIS A C     
1379 O  O     . HIS A 201 ? 0.5312 0.3306 0.1570 0.0814  -0.2579 -0.0485 177 HIS A O     
1380 C  CB    . HIS A 201 ? 0.4754 0.2661 0.1768 0.0302  -0.0926 0.0831  177 HIS A CB    
1381 C  CG    . HIS A 201 ? 0.4971 0.2040 0.2669 -0.0052 -0.0787 0.0248  177 HIS A CG    
1382 N  ND1   . HIS A 201 ? 0.5843 0.3427 0.0505 -0.0575 -0.0576 -0.0419 177 HIS A ND1   
1383 C  CD2   . HIS A 201 ? 0.4657 0.3508 0.3431 -0.1929 -0.0344 0.0124  177 HIS A CD2   
1384 C  CE1   . HIS A 201 ? 0.6828 0.3173 0.0358 -0.0644 -0.0340 0.0533  177 HIS A CE1   
1385 N  NE2   . HIS A 201 ? 0.6332 0.3479 0.0268 -0.1458 0.0214  0.0094  177 HIS A NE2   
1386 N  N     . GLY A 202 ? 0.4880 0.3774 0.0556 -0.0393 -0.1170 0.0256  178 GLY A N     
1387 C  CA    . GLY A 202 ? 0.4667 0.4306 0.1694 0.0164  -0.0832 0.0102  178 GLY A CA    
1388 C  C     . GLY A 202 ? 0.4823 0.4485 0.1269 0.0305  -0.1023 -0.0352 178 GLY A C     
1389 O  O     . GLY A 202 ? 0.4866 0.5291 0.0996 -0.0612 -0.0849 0.0586  178 GLY A O     
1390 N  N     . ARG A 203 ? 0.3999 0.2847 0.2127 -0.0710 -0.1576 -0.1221 179 ARG A N     
1391 C  CA    . ARG A 203 ? 0.3392 0.2426 0.1485 -0.0285 -0.1267 0.0736  179 ARG A CA    
1392 C  C     . ARG A 203 ? 0.3886 0.2032 0.1458 -0.0190 -0.1375 -0.0577 179 ARG A C     
1393 O  O     . ARG A 203 ? 0.4713 0.2745 0.1747 -0.0033 -0.1912 -0.0397 179 ARG A O     
1394 C  CB    . ARG A 203 ? 0.4283 0.2644 0.0951 -0.0058 -0.1634 0.0314  179 ARG A CB    
1395 C  CG    . ARG A 203 ? 0.4923 0.3248 0.1238 -0.0435 -0.2010 0.0781  179 ARG A CG    
1396 C  CD    . ARG A 203 ? 0.5117 0.3736 0.0928 -0.0135 -0.1809 0.0140  179 ARG A CD    
1397 N  NE    . ARG A 203 ? 0.5720 0.4231 0.1035 -0.1012 -0.1522 -0.0883 179 ARG A NE    
1398 C  CZ    . ARG A 203 ? 0.6683 0.5293 0.3311 -0.0776 0.0318  -0.1928 179 ARG A CZ    
1399 N  NH1   . ARG A 203 ? 0.9307 0.4308 0.1886 -0.0536 0.1144  -0.2013 179 ARG A NH1   
1400 N  NH2   . ARG A 203 ? 0.6011 0.6544 0.3528 -0.0479 -0.0237 -0.4232 179 ARG A NH2   
1401 N  N     . GLU A 204 ? 0.3834 0.2680 0.2373 -0.0457 -0.1493 0.0166  180 GLU A N     
1402 C  CA    . GLU A 204 ? 0.3659 0.2604 0.1934 -0.0365 -0.2062 -0.0778 180 GLU A CA    
1403 C  C     . GLU A 204 ? 0.3878 0.2843 0.1565 -0.0284 -0.2055 -0.0363 180 GLU A C     
1404 O  O     . GLU A 204 ? 0.4633 0.2977 0.1728 0.0193  -0.2318 -0.0375 180 GLU A O     
1405 C  CB    . GLU A 204 ? 0.4275 0.3281 0.2083 -0.1081 -0.1503 -0.1458 180 GLU A CB    
1406 C  CG    . GLU A 204 ? 0.4860 0.3992 0.1583 -0.1059 0.0034  -0.1110 180 GLU A CG    
1407 C  CD    . GLU A 204 ? 0.4975 0.5633 0.2509 -0.0674 0.0152  0.0448  180 GLU A CD    
1408 O  OE1   . GLU A 204 ? 0.5865 0.6768 0.3978 -0.1148 0.2359  0.1147  180 GLU A OE1   
1409 O  OE2   . GLU A 204 ? 0.6863 0.6793 0.1097 -0.0456 -0.0430 0.0791  180 GLU A OE2   
1410 N  N     . MSE A 205 ? 0.3261 0.2795 0.1422 -0.0540 -0.1806 -0.0127 181 MSE A N     
1411 C  CA    . MSE A 205 ? 0.3651 0.3036 0.1341 -0.0191 -0.1033 -0.0097 181 MSE A CA    
1412 C  C     . MSE A 205 ? 0.3400 0.3498 0.1456 -0.0189 -0.0421 0.0310  181 MSE A C     
1413 O  O     . MSE A 205 ? 0.3795 0.2909 0.0744 -0.0372 -0.1075 0.0176  181 MSE A O     
1414 C  CB    . MSE A 205 ? 0.4104 0.3792 0.2161 0.0117  -0.1038 0.0233  181 MSE A CB    
1415 C  CG    . MSE A 205 ? 0.3859 0.5782 0.2266 -0.0171 -0.2052 -0.0756 181 MSE A CG    
1416 SE SE    . MSE A 205 ? 0.6994 0.6073 0.3263 0.0124  -0.2047 -0.0183 181 MSE A SE    
1417 C  CE    . MSE A 205 ? 0.3896 0.3341 0.2455 -0.1875 -0.1571 0.1531  181 MSE A CE    
1418 N  N     . SER A 206 ? 0.3165 0.3025 0.1662 -0.0351 -0.0647 0.0494  182 SER A N     
1419 C  CA    . SER A 206 ? 0.2855 0.2747 0.1771 -0.0075 -0.0159 0.0218  182 SER A CA    
1420 C  C     . SER A 206 ? 0.3184 0.2746 0.1320 -0.0160 -0.0927 0.0322  182 SER A C     
1421 O  O     . SER A 206 ? 0.2759 0.2956 0.1522 0.0014  -0.0844 -0.0076 182 SER A O     
1422 C  CB    . SER A 206 ? 0.2644 0.2459 0.1264 -0.0051 0.0161  0.0332  182 SER A CB    
1423 O  OG    . SER A 206 ? 0.3222 0.2338 0.0564 -0.0308 -0.0894 -0.0198 182 SER A OG    
1424 N  N     . MSE A 207 ? 0.3078 0.2748 0.0989 -0.0108 -0.1069 0.0132  183 MSE A N     
1425 C  CA    . MSE A 207 ? 0.3519 0.3237 0.1537 0.0111  -0.1208 -0.0373 183 MSE A CA    
1426 C  C     . MSE A 207 ? 0.3494 0.3074 0.1481 -0.0028 -0.0883 -0.0354 183 MSE A C     
1427 O  O     . MSE A 207 ? 0.3830 0.3062 0.0740 0.0001  -0.1192 -0.0502 183 MSE A O     
1428 C  CB    . MSE A 207 ? 0.3648 0.3377 0.2664 0.0096  -0.0802 0.0244  183 MSE A CB    
1429 C  CG    . MSE A 207 ? 0.4152 0.3474 0.3600 -0.0458 -0.0944 0.0224  183 MSE A CG    
1430 SE SE    . MSE A 207 ? 0.5657 0.5186 0.4479 0.0859  -0.1284 0.0698  183 MSE A SE    
1431 C  CE    . MSE A 207 ? 0.4452 0.5748 0.4161 0.0267  -0.1097 0.0767  183 MSE A CE    
1432 N  N     . THR A 208 ? 0.3051 0.2841 0.1672 0.0201  -0.1480 -0.0212 184 THR A N     
1433 C  CA    . THR A 208 ? 0.2822 0.2514 0.1770 0.0347  -0.1017 0.0076  184 THR A CA    
1434 C  C     . THR A 208 ? 0.2515 0.2467 0.0998 0.0076  -0.1002 -0.0031 184 THR A C     
1435 O  O     . THR A 208 ? 0.2684 0.2565 0.0650 -0.0210 -0.0976 -0.0015 184 THR A O     
1436 C  CB    . THR A 208 ? 0.2660 0.2745 0.1491 0.0416  -0.0789 0.0059  184 THR A CB    
1437 O  OG1   . THR A 208 ? 0.2977 0.2422 0.1603 0.0301  -0.0664 -0.0049 184 THR A OG1   
1438 C  CG2   . THR A 208 ? 0.3229 0.1873 0.1446 -0.0146 -0.1000 0.0063  184 THR A CG2   
1439 N  N     . LEU A 209 ? 0.2759 0.2253 0.1158 0.0039  -0.1004 -0.0122 185 LEU A N     
1440 C  CA    . LEU A 209 ? 0.2397 0.2086 0.1004 -0.0089 -0.0895 -0.0122 185 LEU A CA    
1441 C  C     . LEU A 209 ? 0.2766 0.2419 0.0853 0.0039  -0.0627 -0.0097 185 LEU A C     
1442 O  O     . LEU A 209 ? 0.3141 0.2248 0.1046 0.0033  -0.1069 -0.0152 185 LEU A O     
1443 C  CB    . LEU A 209 ? 0.2679 0.2268 0.1003 0.0026  -0.0828 -0.0031 185 LEU A CB    
1444 C  CG    . LEU A 209 ? 0.2981 0.2631 0.0967 0.0132  -0.0755 0.0401  185 LEU A CG    
1445 C  CD1   . LEU A 209 ? 0.3211 0.3316 0.0365 -0.0367 -0.0575 0.0043  185 LEU A CD1   
1446 C  CD2   . LEU A 209 ? 0.3082 0.3356 0.1461 0.0008  -0.0297 0.0927  185 LEU A CD2   
1447 N  N     . SER A 210 ? 0.2539 0.2480 0.0877 -0.0165 -0.0462 0.0215  186 SER A N     
1448 C  CA    . SER A 210 ? 0.2852 0.2873 0.0922 0.0106  -0.0746 0.0000  186 SER A CA    
1449 C  C     . SER A 210 ? 0.2769 0.2421 0.1117 0.0322  -0.0692 -0.0067 186 SER A C     
1450 O  O     . SER A 210 ? 0.3144 0.3054 0.1597 0.0582  -0.1117 -0.0129 186 SER A O     
1451 C  CB    . SER A 210 ? 0.3013 0.2465 0.0463 0.0253  -0.0743 -0.0092 186 SER A CB    
1452 O  OG    . SER A 210 ? 0.3192 0.2804 0.1353 0.0091  -0.0973 0.0245  186 SER A OG    
1453 N  N     . ASP A 211 ? 0.2754 0.2309 0.1019 0.0294  -0.0832 0.0016  187 ASP A N     
1454 C  CA    . ASP A 211 ? 0.3011 0.2233 0.1444 0.0167  -0.0811 0.0071  187 ASP A CA    
1455 C  C     . ASP A 211 ? 0.2449 0.2112 0.1692 0.0149  -0.0519 0.0059  187 ASP A C     
1456 O  O     . ASP A 211 ? 0.2519 0.2630 0.1480 0.0310  -0.0548 -0.0041 187 ASP A O     
1457 C  CB    . ASP A 211 ? 0.3170 0.2714 0.1574 0.0189  -0.0583 0.0073  187 ASP A CB    
1458 C  CG    . ASP A 211 ? 0.2897 0.2785 0.1999 0.0011  -0.0670 0.0003  187 ASP A CG    
1459 O  OD1   . ASP A 211 ? 0.3051 0.2817 0.1954 -0.0115 -0.1026 -0.0132 187 ASP A OD1   
1460 O  OD2   . ASP A 211 ? 0.2909 0.3385 0.2314 0.0058  -0.0719 0.0030  187 ASP A OD2   
1461 N  N     . SER A 212 ? 0.2813 0.2099 0.1355 -0.0015 -0.0715 0.0313  188 SER A N     
1462 C  CA    . SER A 212 ? 0.2944 0.2003 0.0937 -0.0040 -0.0315 0.0209  188 SER A CA    
1463 C  C     . SER A 212 ? 0.2699 0.2686 0.1191 0.0004  -0.0229 0.0301  188 SER A C     
1464 O  O     . SER A 212 ? 0.2775 0.3322 0.1090 0.0099  -0.0525 0.0064  188 SER A O     
1465 C  CB    . SER A 212 ? 0.2624 0.3338 0.1148 -0.0198 -0.0632 0.0790  188 SER A CB    
1466 O  OG    . SER A 212 ? 0.2855 0.3382 0.2436 -0.0371 -0.2149 0.0635  188 SER A OG    
1467 N  N     . PHE A 213 ? 0.2927 0.2589 0.0932 -0.0167 -0.0723 -0.0049 189 PHE A N     
1468 C  CA    . PHE A 213 ? 0.2619 0.3075 0.1019 0.0248  -0.1039 0.0405  189 PHE A CA    
1469 C  C     . PHE A 213 ? 0.2848 0.2702 0.1079 0.0144  -0.0726 0.0087  189 PHE A C     
1470 O  O     . PHE A 213 ? 0.3079 0.3003 0.1472 0.0441  -0.1665 -0.1058 189 PHE A O     
1471 C  CB    . PHE A 213 ? 0.2596 0.3215 0.0755 -0.0025 -0.0273 0.0195  189 PHE A CB    
1472 C  CG    . PHE A 213 ? 0.2776 0.3248 0.0876 -0.0096 -0.0328 0.0380  189 PHE A CG    
1473 C  CD1   . PHE A 213 ? 0.2519 0.3421 0.0611 -0.0155 -0.0440 0.0518  189 PHE A CD1   
1474 C  CD2   . PHE A 213 ? 0.2849 0.3170 0.1377 -0.0234 -0.0902 0.0620  189 PHE A CD2   
1475 C  CE1   . PHE A 213 ? 0.3192 0.2652 0.1355 -0.0337 -0.0326 0.0081  189 PHE A CE1   
1476 C  CE2   . PHE A 213 ? 0.2900 0.3091 0.0847 -0.0272 -0.1251 0.0213  189 PHE A CE2   
1477 C  CZ    . PHE A 213 ? 0.3028 0.2546 0.1216 -0.0236 -0.0238 0.0438  189 PHE A CZ    
1478 N  N     . CYS A 214 ? 0.2892 0.2759 0.0699 0.0252  -0.1019 0.0262  190 CYS A N     
1479 C  CA    . CYS A 214 ? 0.2906 0.2608 0.1118 0.0169  -0.1034 0.0132  190 CYS A CA    
1480 C  C     . CYS A 214 ? 0.2734 0.2266 0.0974 0.0104  -0.0786 0.0142  190 CYS A C     
1481 O  O     . CYS A 214 ? 0.2859 0.2607 0.0778 0.0033  -0.0821 0.0385  190 CYS A O     
1482 C  CB    . CYS A 214 ? 0.2959 0.2546 0.0825 0.0131  -0.1027 0.0594  190 CYS A CB    
1483 S  SG    . CYS A 214 ? 0.3204 0.2986 0.1134 -0.0038 -0.1107 0.0332  190 CYS A SG    
1484 N  N     . VAL A 215 ? 0.2720 0.2371 0.0984 0.0114  -0.0860 0.0421  191 VAL A N     
1485 C  CA    . VAL A 215 ? 0.2898 0.2111 0.0918 0.0056  -0.0966 0.0267  191 VAL A CA    
1486 C  C     . VAL A 215 ? 0.2352 0.2547 0.1131 0.0143  -0.0908 -0.0181 191 VAL A C     
1487 O  O     . VAL A 215 ? 0.2238 0.3171 0.0732 -0.0029 -0.0901 -0.0436 191 VAL A O     
1488 C  CB    . VAL A 215 ? 0.3155 0.1780 0.1018 0.0387  -0.0627 0.0534  191 VAL A CB    
1489 C  CG1   . VAL A 215 ? 0.2814 0.1491 0.0750 0.0605  -0.0604 0.0159  191 VAL A CG1   
1490 C  CG2   . VAL A 215 ? 0.3400 0.2231 0.1409 0.0784  -0.0650 0.0235  191 VAL A CG2   
1491 N  N     . ASP A 216 ? 0.3180 0.2543 0.0902 -0.0038 -0.1374 -0.0078 192 ASP A N     
1492 C  CA    . ASP A 216 ? 0.2797 0.2926 0.0877 0.0483  -0.1063 0.0478  192 ASP A CA    
1493 C  C     . ASP A 216 ? 0.2907 0.2883 0.1387 0.0212  -0.1236 0.0131  192 ASP A C     
1494 O  O     . ASP A 216 ? 0.3451 0.2633 0.1445 0.0614  -0.0938 0.0135  192 ASP A O     
1495 C  CB    . ASP A 216 ? 0.3145 0.3306 0.1232 0.0356  -0.1043 -0.0167 192 ASP A CB    
1496 C  CG    . ASP A 216 ? 0.3269 0.3729 0.1585 0.0368  -0.1454 0.0815  192 ASP A CG    
1497 O  OD1   . ASP A 216 ? 0.3933 0.4212 0.1049 -0.0065 -0.1688 -0.0119 192 ASP A OD1   
1498 O  OD2   . ASP A 216 ? 0.3891 0.3798 0.0632 0.0209  -0.0942 0.0530  192 ASP A OD2   
1499 N  N     . ARG A 217 ? 0.2816 0.2639 0.1258 -0.0369 -0.0951 -0.0360 193 ARG A N     
1500 C  CA    . ARG A 217 ? 0.2851 0.2379 0.1342 -0.0051 -0.0742 -0.0280 193 ARG A CA    
1501 C  C     . ARG A 217 ? 0.2802 0.2307 0.1240 0.0073  -0.0795 -0.0054 193 ARG A C     
1502 O  O     . ARG A 217 ? 0.3106 0.3455 0.1444 0.0439  -0.1827 -0.0029 193 ARG A O     
1503 C  CB    . ARG A 217 ? 0.2505 0.2136 0.1732 0.0162  -0.0896 -0.0087 193 ARG A CB    
1504 C  CG    . ARG A 217 ? 0.2588 0.2826 0.1223 0.0233  -0.0273 -0.0400 193 ARG A CG    
1505 C  CD    . ARG A 217 ? 0.2762 0.2010 0.1081 0.0752  -0.0297 -0.0496 193 ARG A CD    
1506 N  NE    . ARG A 217 ? 0.2668 0.1928 0.1203 0.0372  -0.0404 -0.0031 193 ARG A NE    
1507 C  CZ    . ARG A 217 ? 0.2499 0.2476 0.0965 0.0062  -0.0720 -0.0147 193 ARG A CZ    
1508 N  NH1   . ARG A 217 ? 0.2222 0.2699 0.1070 0.0074  -0.1268 -0.0020 193 ARG A NH1   
1509 N  NH2   . ARG A 217 ? 0.3269 0.2809 0.1912 0.0290  -0.0891 -0.0048 193 ARG A NH2   
1510 N  N     . TYR A 218 ? 0.2887 0.1739 0.1315 0.0181  -0.1010 0.0038  194 TYR A N     
1511 C  CA    . TYR A 218 ? 0.2905 0.2390 0.1946 -0.0104 -0.0935 -0.0424 194 TYR A CA    
1512 C  C     . TYR A 218 ? 0.3026 0.2570 0.1907 -0.0166 -0.1005 0.0184  194 TYR A C     
1513 O  O     . TYR A 218 ? 0.3451 0.3009 0.0749 0.0195  -0.1177 0.0126  194 TYR A O     
1514 C  CB    . TYR A 218 ? 0.2942 0.2630 0.1821 0.0196  -0.1003 -0.0067 194 TYR A CB    
1515 C  CG    . TYR A 218 ? 0.2529 0.2863 0.2012 0.0275  -0.0559 -0.0096 194 TYR A CG    
1516 C  CD1   . TYR A 218 ? 0.2980 0.2773 0.1883 0.0111  0.0165  -0.0269 194 TYR A CD1   
1517 C  CD2   . TYR A 218 ? 0.2906 0.2568 0.1883 0.0108  -0.0681 -0.0023 194 TYR A CD2   
1518 C  CE1   . TYR A 218 ? 0.2889 0.2529 0.1531 0.0223  -0.0328 -0.0215 194 TYR A CE1   
1519 C  CE2   . TYR A 218 ? 0.2721 0.2783 0.1846 0.0296  -0.0826 -0.0055 194 TYR A CE2   
1520 C  CZ    . TYR A 218 ? 0.2920 0.2849 0.2030 0.0370  -0.0438 -0.0158 194 TYR A CZ    
1521 O  OH    . TYR A 218 ? 0.3078 0.3629 0.1922 0.0323  -0.0722 -0.0271 194 TYR A OH    
1522 N  N     . ARG A 219 ? 0.2937 0.2911 0.1731 -0.0170 -0.0815 0.0401  195 ARG A N     
1523 C  CA    A ARG A 219 ? 0.2874 0.3239 0.1905 -0.0220 -0.0570 0.0334  195 ARG A CA    
1524 C  CA    B ARG A 219 ? 0.2901 0.3337 0.1888 -0.0171 -0.0583 0.0326  195 ARG A CA    
1525 C  C     . ARG A 219 ? 0.2930 0.3428 0.2039 -0.0038 -0.0626 0.0058  195 ARG A C     
1526 O  O     . ARG A 219 ? 0.3386 0.3029 0.1662 0.0019  -0.1165 0.0417  195 ARG A O     
1527 C  CB    A ARG A 219 ? 0.3052 0.3019 0.2060 -0.0206 -0.0576 -0.0012 195 ARG A CB    
1528 C  CB    B ARG A 219 ? 0.3149 0.3118 0.2151 -0.0160 -0.0600 -0.0047 195 ARG A CB    
1529 C  CG    A ARG A 219 ? 0.2861 0.2686 0.2631 -0.0305 -0.0373 0.0717  195 ARG A CG    
1530 C  CG    B ARG A 219 ? 0.3082 0.3138 0.2879 -0.0086 -0.0265 0.0782  195 ARG A CG    
1531 C  CD    A ARG A 219 ? 0.2393 0.2744 0.2279 -0.0243 -0.0768 0.0423  195 ARG A CD    
1532 C  CD    B ARG A 219 ? 0.3001 0.3316 0.3619 -0.0446 -0.0603 0.0515  195 ARG A CD    
1533 N  NE    A ARG A 219 ? 0.2604 0.2394 0.1410 0.0010  -0.0586 0.0815  195 ARG A NE    
1534 N  NE    B ARG A 219 ? 0.3504 0.4287 0.3662 -0.0522 -0.0627 0.0891  195 ARG A NE    
1535 C  CZ    A ARG A 219 ? 0.2106 0.2332 0.1588 0.0224  -0.0375 0.0416  195 ARG A CZ    
1536 C  CZ    B ARG A 219 ? 0.2620 0.3806 0.3874 -0.0540 -0.0435 0.1058  195 ARG A CZ    
1537 N  NH1   A ARG A 219 ? 0.2319 0.2149 0.0737 0.0624  -0.0241 0.0324  195 ARG A NH1   
1538 N  NH1   B ARG A 219 ? 0.2541 0.3279 0.4243 -0.1130 0.0355  0.0588  195 ARG A NH1   
1539 N  NH2   A ARG A 219 ? 0.1443 0.2090 0.1127 -0.0043 -0.0837 0.0652  195 ARG A NH2   
1540 N  NH2   B ARG A 219 ? 0.1586 0.3498 0.3691 -0.0447 -0.0941 0.1469  195 ARG A NH2   
1541 N  N     . GLY A 220 ? 0.2682 0.3997 0.1989 -0.0078 -0.0413 0.0066  196 GLY A N     
1542 C  CA    . GLY A 220 ? 0.3312 0.3497 0.2283 0.0004  -0.0973 0.0456  196 GLY A CA    
1543 C  C     . GLY A 220 ? 0.3500 0.3658 0.2337 -0.0097 -0.0885 0.0506  196 GLY A C     
1544 O  O     . GLY A 220 ? 0.3832 0.3720 0.2807 0.0095  -0.1170 0.0300  196 GLY A O     
1545 N  N     . GLU A 221 ? 0.3018 0.3688 0.1891 0.0011  -0.1428 0.0313  197 GLU A N     
1546 C  CA    . GLU A 221 ? 0.3319 0.3347 0.1504 0.0378  -0.1470 0.0643  197 GLU A CA    
1547 C  C     . GLU A 221 ? 0.2934 0.3554 0.1422 0.0014  -0.0871 0.0362  197 GLU A C     
1548 O  O     . GLU A 221 ? 0.3250 0.3867 0.1401 0.0381  -0.1124 0.0140  197 GLU A O     
1549 C  CB    . GLU A 221 ? 0.3434 0.4041 0.1741 -0.0301 -0.0516 -0.0330 197 GLU A CB    
1550 C  CG    . GLU A 221 ? 0.3883 0.4070 0.2536 -0.0146 -0.0645 -0.1057 197 GLU A CG    
1551 C  CD    . GLU A 221 ? 0.4030 0.4397 0.3412 -0.0728 -0.0545 -0.1268 197 GLU A CD    
1552 O  OE1   . GLU A 221 ? 0.3399 0.5788 0.2670 -0.0563 -0.1824 -0.1795 197 GLU A OE1   
1553 O  OE2   . GLU A 221 ? 0.4517 0.6093 0.4310 -0.0204 0.0213  -0.1135 197 GLU A OE2   
1554 N  N     . PHE A 222 ? 0.2954 0.3726 0.0570 0.0033  -0.0545 -0.0178 198 PHE A N     
1555 C  CA    . PHE A 222 ? 0.2701 0.3474 0.0981 -0.0015 -0.0682 0.0021  198 PHE A CA    
1556 C  C     . PHE A 222 ? 0.2994 0.2704 0.0968 0.0158  -0.0809 0.0034  198 PHE A C     
1557 O  O     . PHE A 222 ? 0.3226 0.2994 0.1396 0.0224  -0.0924 -0.0280 198 PHE A O     
1558 C  CB    . PHE A 222 ? 0.2574 0.3503 0.0996 -0.0191 -0.0404 0.0280  198 PHE A CB    
1559 C  CG    . PHE A 222 ? 0.2602 0.3067 0.0973 -0.0087 -0.0508 0.0167  198 PHE A CG    
1560 C  CD1   . PHE A 222 ? 0.2492 0.3023 0.0964 0.0093  -0.0561 0.0394  198 PHE A CD1   
1561 C  CD2   . PHE A 222 ? 0.2813 0.3038 0.1236 -0.0137 -0.0701 0.0317  198 PHE A CD2   
1562 C  CE1   . PHE A 222 ? 0.2513 0.3014 0.0950 0.0235  -0.0590 0.0309  198 PHE A CE1   
1563 C  CE2   . PHE A 222 ? 0.2880 0.2372 0.1000 -0.0460 0.0081  0.0147  198 PHE A CE2   
1564 C  CZ    . PHE A 222 ? 0.2159 0.2723 0.0868 -0.0016 -0.0166 0.0382  198 PHE A CZ    
1565 N  N     . LEU A 223 ? 0.3007 0.3003 0.1023 0.0215  -0.0749 0.0145  199 LEU A N     
1566 C  CA    . LEU A 223 ? 0.3045 0.2668 0.1089 0.0332  -0.0825 0.0315  199 LEU A CA    
1567 C  C     . LEU A 223 ? 0.2994 0.2896 0.1358 0.0267  -0.0617 -0.0222 199 LEU A C     
1568 O  O     . LEU A 223 ? 0.4359 0.3302 0.1554 -0.0015 -0.0837 -0.0593 199 LEU A O     
1569 C  CB    . LEU A 223 ? 0.3205 0.2656 0.1366 -0.0226 -0.0909 -0.0066 199 LEU A CB    
1570 C  CG    . LEU A 223 ? 0.2641 0.3113 0.2264 -0.0056 -0.0232 -0.0205 199 LEU A CG    
1571 C  CD1   . LEU A 223 ? 0.4358 0.3180 0.3454 0.0122  -0.0813 -0.0331 199 LEU A CD1   
1572 C  CD2   . LEU A 223 ? 0.3717 0.3608 0.0427 -0.0379 -0.0204 -0.0500 199 LEU A CD2   
1573 N  N     . ASP A 224 ? 0.2827 0.3091 0.1075 -0.0078 -0.0708 0.0237  200 ASP A N     
1574 C  CA    . ASP A 224 ? 0.3205 0.3182 0.0915 -0.0123 -0.0808 -0.0452 200 ASP A CA    
1575 C  C     . ASP A 224 ? 0.3206 0.3006 0.1705 -0.0041 -0.0989 -0.0088 200 ASP A C     
1576 O  O     . ASP A 224 ? 0.3803 0.3949 0.1634 -0.0116 -0.1066 -0.0338 200 ASP A O     
1577 C  CB    . ASP A 224 ? 0.3375 0.3714 0.1861 0.0460  -0.0780 -0.0502 200 ASP A CB    
1578 C  CG    . ASP A 224 ? 0.3842 0.4883 0.2490 0.0008  -0.1033 -0.0420 200 ASP A CG    
1579 O  OD1   . ASP A 224 ? 0.4132 0.6064 0.3091 0.0648  -0.2110 -0.1656 200 ASP A OD1   
1580 O  OD2   . ASP A 224 ? 0.5491 0.5923 0.2651 -0.0157 -0.1008 -0.0098 200 ASP A OD2   
1581 N  N     . LEU A 225 ? 0.3260 0.2861 0.2047 0.0147  -0.0840 0.0082  201 LEU A N     
1582 C  CA    . LEU A 225 ? 0.2873 0.3027 0.1894 0.0648  -0.0815 0.0277  201 LEU A CA    
1583 C  C     . LEU A 225 ? 0.2418 0.3388 0.1323 0.0598  -0.1219 0.0433  201 LEU A C     
1584 O  O     . LEU A 225 ? 0.2913 0.4353 0.1737 0.0110  -0.1759 0.0420  201 LEU A O     
1585 C  CB    . LEU A 225 ? 0.2651 0.3352 0.1346 0.0389  -0.0805 -0.0378 201 LEU A CB    
1586 C  CG    . LEU A 225 ? 0.2584 0.4296 0.1335 0.0066  -0.0808 -0.0630 201 LEU A CG    
1587 C  CD1   . LEU A 225 ? 0.2369 0.4774 0.0927 0.0426  -0.0453 -0.0424 201 LEU A CD1   
1588 C  CD2   . LEU A 225 ? 0.3021 0.5095 0.2030 -0.0407 -0.0152 -0.0075 201 LEU A CD2   
1589 N  N     . MSE A 226 ? 0.2690 0.3124 0.1006 0.0347  -0.1281 0.0289  202 MSE A N     
1590 C  CA    . MSE A 226 ? 0.2829 0.4034 0.1346 0.0250  -0.0980 0.0236  202 MSE A CA    
1591 C  C     . MSE A 226 ? 0.3379 0.3655 0.1633 0.0485  -0.1266 0.0419  202 MSE A C     
1592 O  O     . MSE A 226 ? 0.4114 0.4128 0.0961 0.0088  -0.1420 0.0488  202 MSE A O     
1593 C  CB    . MSE A 226 ? 0.2939 0.4141 0.1834 0.0275  -0.1124 0.0351  202 MSE A CB    
1594 C  CG    . MSE A 226 ? 0.4053 0.4650 0.1936 0.0996  -0.1141 0.0702  202 MSE A CG    
1595 SE SE    . MSE A 226 ? 0.7055 0.7838 0.6773 -0.1215 -0.2329 0.0779  202 MSE A SE    
1596 C  CE    . MSE A 226 ? 0.9786 0.9533 0.1626 0.0122  -0.3070 -0.1926 202 MSE A CE    
1597 N  N     . ARG A 227 ? 0.3137 0.3306 0.1604 0.0183  -0.1240 0.0358  203 ARG A N     
1598 C  CA    . ARG A 227 ? 0.3404 0.2882 0.0846 -0.0080 -0.0870 -0.0193 203 ARG A CA    
1599 C  C     . ARG A 227 ? 0.3424 0.3183 0.1990 -0.0281 -0.1356 0.0690  203 ARG A C     
1600 O  O     . ARG A 227 ? 0.4812 0.3573 0.2259 -0.0003 -0.2604 0.1155  203 ARG A O     
1601 C  CB    . ARG A 227 ? 0.3159 0.2857 0.0770 -0.0095 -0.0642 0.0368  203 ARG A CB    
1602 C  CG    . ARG A 227 ? 0.3364 0.2365 0.0870 -0.0229 -0.1014 0.0045  203 ARG A CG    
1603 C  CD    . ARG A 227 ? 0.3769 0.2325 0.0865 -0.0218 -0.1068 0.0384  203 ARG A CD    
1604 N  NE    . ARG A 227 ? 0.3790 0.3129 0.1404 -0.0294 -0.1316 -0.0115 203 ARG A NE    
1605 C  CZ    . ARG A 227 ? 0.3364 0.2670 0.1042 -0.0021 -0.0722 0.0391  203 ARG A CZ    
1606 N  NH1   . ARG A 227 ? 0.4191 0.3697 0.0506 0.0481  -0.0744 -0.0707 203 ARG A NH1   
1607 N  NH2   . ARG A 227 ? 0.3228 0.3528 0.0446 -0.0004 -0.0533 0.0523  203 ARG A NH2   
1608 N  N     . SER A 228 ? 0.3622 0.3771 0.1253 -0.0284 -0.1726 0.0781  204 SER A N     
1609 C  CA    . SER A 228 ? 0.4136 0.3618 0.0856 -0.0556 -0.1251 0.0517  204 SER A CA    
1610 C  C     . SER A 228 ? 0.3977 0.3648 0.1541 -0.0187 -0.1817 0.0512  204 SER A C     
1611 O  O     . SER A 228 ? 0.3668 0.4682 0.2749 -0.0485 -0.2453 0.1278  204 SER A O     
1612 C  CB    . SER A 228 ? 0.4080 0.3668 0.2249 0.0191  -0.0488 0.0688  204 SER A CB    
1613 O  OG    . SER A 228 ? 0.4274 0.3629 0.1580 -0.0083 -0.0774 0.0297  204 SER A OG    
1614 N  N     . GLY A 229 ? 0.4679 0.3953 0.2313 0.0520  -0.1914 -0.0122 205 GLY A N     
1615 C  CA    . GLY A 229 ? 0.4110 0.3738 0.2891 0.0698  -0.3103 0.0126  205 GLY A CA    
1616 C  C     . GLY A 229 ? 0.4821 0.4416 0.2666 0.0632  -0.2073 0.0145  205 GLY A C     
1617 O  O     . GLY A 229 ? 0.4648 0.4726 0.2091 0.1122  -0.2451 0.0596  205 GLY A O     
1618 N  N     . LYS A 230 ? 0.4036 0.3857 0.2628 0.0157  -0.1743 0.0418  206 LYS A N     
1619 C  CA    . LYS A 230 ? 0.3500 0.3653 0.2607 0.0470  -0.0979 0.0126  206 LYS A CA    
1620 C  C     . LYS A 230 ? 0.3491 0.3843 0.1432 -0.0358 -0.1635 -0.0487 206 LYS A C     
1621 O  O     . LYS A 230 ? 0.4333 0.4474 0.1649 -0.0332 -0.1342 0.0164  206 LYS A O     
1622 C  CB    . LYS A 230 ? 0.3860 0.4478 0.0867 0.0082  -0.0914 0.0834  206 LYS A CB    
1623 C  CG    . LYS A 230 ? 0.3623 0.4290 0.2481 0.0125  -0.0828 -0.0375 206 LYS A CG    
1624 C  CD    . LYS A 230 ? 0.3821 0.4347 0.3805 0.0730  -0.0135 -0.0160 206 LYS A CD    
1625 C  CE    . LYS A 230 ? 0.3717 0.3244 0.4737 0.1020  -0.0087 -0.0593 206 LYS A CE    
1626 N  NZ    . LYS A 230 ? 0.3502 0.3578 0.4959 -0.0215 -0.1032 -0.0591 206 LYS A NZ    
1627 N  N     . VAL A 231 ? 0.3215 0.3924 0.1393 0.0008  -0.1392 -0.1034 207 VAL A N     
1628 C  CA    . VAL A 231 ? 0.3281 0.4851 0.1985 0.0204  -0.1675 -0.0608 207 VAL A CA    
1629 C  C     . VAL A 231 ? 0.3689 0.4350 0.2299 0.0219  -0.1200 -0.0294 207 VAL A C     
1630 O  O     . VAL A 231 ? 0.4468 0.4908 0.1725 0.0408  -0.2432 -0.0080 207 VAL A O     
1631 C  CB    . VAL A 231 ? 0.3609 0.4806 0.1013 0.0319  -0.1591 -0.0321 207 VAL A CB    
1632 C  CG1   . VAL A 231 ? 0.3880 0.5437 0.0605 0.0652  -0.1109 -0.0456 207 VAL A CG1   
1633 C  CG2   . VAL A 231 ? 0.2487 0.4241 0.1922 -0.0108 -0.1183 0.0309  207 VAL A CG2   
1634 N  N     . ASP A 232 ? 0.3325 0.4509 0.2570 0.0090  -0.1234 -0.0134 208 ASP A N     
1635 C  CA    . ASP A 232 ? 0.3838 0.4059 0.1965 0.0424  -0.1272 0.0398  208 ASP A CA    
1636 C  C     . ASP A 232 ? 0.3633 0.4276 0.2051 0.0619  -0.0903 0.0768  208 ASP A C     
1637 O  O     . ASP A 232 ? 0.4623 0.4896 0.1455 0.0365  -0.1310 0.1223  208 ASP A O     
1638 C  CB    . ASP A 232 ? 0.3996 0.3741 0.1994 0.0838  -0.1609 0.0876  208 ASP A CB    
1639 C  CG    . ASP A 232 ? 0.3644 0.4349 0.2734 0.0926  -0.1590 0.0697  208 ASP A CG    
1640 O  OD1   . ASP A 232 ? 0.3566 0.5181 0.2001 0.0332  -0.1537 0.0182  208 ASP A OD1   
1641 O  OD2   . ASP A 232 ? 0.3834 0.4924 0.2561 0.0592  -0.2115 0.0460  208 ASP A OD2   
1642 N  N     . ILE A 233 ? 0.2853 0.3780 0.1825 0.0530  -0.0977 0.0086  209 ILE A N     
1643 C  CA    . ILE A 233 ? 0.2729 0.2768 0.1649 0.0024  -0.0474 -0.0122 209 ILE A CA    
1644 C  C     . ILE A 233 ? 0.2567 0.2708 0.1756 0.0090  -0.0226 -0.0239 209 ILE A C     
1645 O  O     . ILE A 233 ? 0.3333 0.3313 0.1156 0.0164  -0.0620 0.0333  209 ILE A O     
1646 C  CB    . ILE A 233 ? 0.2683 0.2666 0.2438 0.0039  -0.0877 -0.0334 209 ILE A CB    
1647 C  CG1   . ILE A 233 ? 0.3509 0.2761 0.2225 0.0030  -0.0696 -0.0287 209 ILE A CG1   
1648 C  CG2   . ILE A 233 ? 0.2766 0.2800 0.1623 0.0122  -0.1002 0.0164  209 ILE A CG2   
1649 C  CD1   . ILE A 233 ? 0.3581 0.2964 0.2040 -0.0520 -0.0895 0.0015  209 ILE A CD1   
1650 N  N     . VAL A 234 ? 0.2679 0.2234 0.1362 0.0224  -0.0298 -0.0182 210 VAL A N     
1651 C  CA    A VAL A 234 ? 0.2911 0.2579 0.1180 0.0069  -0.0255 -0.0211 210 VAL A CA    
1652 C  CA    B VAL A 234 ? 0.2876 0.2422 0.1146 0.0127  -0.0221 -0.0135 210 VAL A CA    
1653 C  C     . VAL A 234 ? 0.2839 0.2917 0.1126 0.0435  -0.0194 -0.0028 210 VAL A C     
1654 O  O     . VAL A 234 ? 0.3146 0.3302 0.0827 0.0150  -0.0314 0.0486  210 VAL A O     
1655 C  CB    A VAL A 234 ? 0.2604 0.2773 0.1865 0.0293  -0.0459 -0.0093 210 VAL A CB    
1656 C  CB    B VAL A 234 ? 0.2712 0.2557 0.1363 0.0193  -0.0134 0.0097  210 VAL A CB    
1657 C  CG1   A VAL A 234 ? 0.2841 0.2960 0.1533 0.0343  -0.0350 -0.0007 210 VAL A CG1   
1658 C  CG1   B VAL A 234 ? 0.2537 0.2227 0.0583 0.0403  -0.0472 0.0087  210 VAL A CG1   
1659 C  CG2   A VAL A 234 ? 0.2453 0.3222 0.2050 0.0168  -0.0365 -0.0258 210 VAL A CG2   
1660 C  CG2   B VAL A 234 ? 0.2890 0.2777 0.1392 0.0257  -0.0209 0.0001  210 VAL A CG2   
1661 N  N     . PHE A 235 ? 0.2876 0.2967 0.1208 0.0225  -0.0515 0.0396  211 PHE A N     
1662 C  CA    . PHE A 235 ? 0.2670 0.2115 0.1614 0.0234  -0.0228 0.0529  211 PHE A CA    
1663 C  C     . PHE A 235 ? 0.2662 0.2432 0.1216 0.0038  -0.0392 0.0339  211 PHE A C     
1664 O  O     . PHE A 235 ? 0.3024 0.2759 0.0697 0.0379  -0.0592 0.0630  211 PHE A O     
1665 C  CB    . PHE A 235 ? 0.2520 0.2105 0.1676 0.0196  -0.0602 0.0516  211 PHE A CB    
1666 C  CG    . PHE A 235 ? 0.2627 0.2421 0.1205 0.0217  -0.0049 0.0310  211 PHE A CG    
1667 C  CD1   . PHE A 235 ? 0.2962 0.2527 0.0267 -0.0011 -0.0105 0.0153  211 PHE A CD1   
1668 C  CD2   . PHE A 235 ? 0.2720 0.2539 0.0815 0.0383  -0.0024 0.0478  211 PHE A CD2   
1669 C  CE1   . PHE A 235 ? 0.2820 0.2243 0.0442 0.0510  -0.0337 0.0455  211 PHE A CE1   
1670 C  CE2   . PHE A 235 ? 0.3082 0.2520 0.1019 -0.0326 -0.0213 0.0440  211 PHE A CE2   
1671 C  CZ    . PHE A 235 ? 0.2347 0.3236 0.0325 0.0055  -0.0346 0.0202  211 PHE A CZ    
1672 N  N     . ALA A 236 ? 0.2575 0.2615 0.1369 -0.0111 -0.0686 0.0078  212 ALA A N     
1673 C  CA    . ALA A 236 ? 0.3094 0.2493 0.1181 0.0100  -0.0744 0.0175  212 ALA A CA    
1674 C  C     . ALA A 236 ? 0.3068 0.2945 0.1447 0.0026  -0.0398 -0.0104 212 ALA A C     
1675 O  O     . ALA A 236 ? 0.3381 0.4061 0.1899 0.0088  -0.0154 -0.0342 212 ALA A O     
1676 C  CB    . ALA A 236 ? 0.2938 0.2198 0.1925 -0.0033 -0.0572 0.0397  212 ALA A CB    
1677 N  N     . ASN A 237 ? 0.3103 0.2472 0.2110 -0.0162 -0.0449 -0.0321 213 ASN A N     
1678 C  CA    . ASN A 237 ? 0.3009 0.2779 0.1601 0.0019  -0.0240 -0.0181 213 ASN A CA    
1679 C  C     . ASN A 237 ? 0.2855 0.2802 0.1536 -0.0112 -0.0264 -0.0181 213 ASN A C     
1680 O  O     . ASN A 237 ? 0.3030 0.3033 0.1722 0.0089  -0.0261 -0.0363 213 ASN A O     
1681 C  CB    . ASN A 237 ? 0.3171 0.3009 0.1760 0.0083  -0.0364 0.0284  213 ASN A CB    
1682 C  CG    . ASN A 237 ? 0.3503 0.2965 0.2101 0.0438  -0.0426 0.0212  213 ASN A CG    
1683 O  OD1   . ASN A 237 ? 0.3585 0.2964 0.1919 0.0288  -0.0665 0.0370  213 ASN A OD1   
1684 N  ND2   . ASN A 237 ? 0.3511 0.4088 0.2209 0.0009  -0.0627 0.0511  213 ASN A ND2   
1685 N  N     . ARG A 238 ? 0.2693 0.3128 0.1105 -0.0123 -0.0359 -0.0288 214 ARG A N     
1686 C  CA    . ARG A 238 ? 0.2906 0.3111 0.1574 -0.0191 -0.0462 -0.0143 214 ARG A CA    
1687 C  C     . ARG A 238 ? 0.3159 0.3228 0.1497 0.0036  -0.0475 -0.0024 214 ARG A C     
1688 O  O     . ARG A 238 ? 0.2933 0.3281 0.1165 -0.0053 -0.0542 -0.0103 214 ARG A O     
1689 C  CB    . ARG A 238 ? 0.2990 0.3589 0.2549 -0.0536 -0.0248 0.0051  214 ARG A CB    
1690 C  CG    . ARG A 238 ? 0.3194 0.3680 0.3812 -0.0832 -0.0227 0.0357  214 ARG A CG    
1691 C  CD    . ARG A 238 ? 0.3376 0.5025 0.5173 -0.1402 -0.0267 0.0589  214 ARG A CD    
1692 N  NE    . ARG A 238 ? 0.4801 0.6057 0.6259 -0.1117 0.0005  0.1602  214 ARG A NE    
1693 C  CZ    . ARG A 238 ? 0.6503 0.6638 0.5210 -0.0631 -0.0312 0.1293  214 ARG A CZ    
1694 N  NH1   . ARG A 238 ? 0.7890 0.7061 0.7042 -0.0530 -0.0033 0.0157  214 ARG A NH1   
1695 N  NH2   . ARG A 238 ? 0.5239 0.7136 0.3715 -0.0015 -0.2133 0.1840  214 ARG A NH2   
1696 N  N     . GLN A 239 ? 0.3131 0.2958 0.1458 -0.0199 -0.0374 0.0030  215 GLN A N     
1697 C  CA    A GLN A 239 ? 0.2844 0.3608 0.1785 0.0097  -0.0516 -0.0148 215 GLN A CA    
1698 C  CA    B GLN A 239 ? 0.2855 0.3436 0.1927 0.0065  -0.0534 -0.0157 215 GLN A CA    
1699 C  C     . GLN A 239 ? 0.2884 0.2766 0.1387 0.0047  -0.0555 0.0093  215 GLN A C     
1700 O  O     . GLN A 239 ? 0.3037 0.3018 0.1092 0.0208  -0.0496 -0.0015 215 GLN A O     
1701 C  CB    A GLN A 239 ? 0.2853 0.3868 0.1783 -0.0009 -0.0611 -0.0035 215 GLN A CB    
1702 C  CB    B GLN A 239 ? 0.3143 0.3593 0.1988 0.0065  -0.0809 -0.0006 215 GLN A CB    
1703 C  CG    A GLN A 239 ? 0.2546 0.3821 0.3226 -0.0032 -0.0218 -0.0109 215 GLN A CG    
1704 C  CG    B GLN A 239 ? 0.3219 0.3183 0.4076 -0.0365 -0.0312 -0.0374 215 GLN A CG    
1705 C  CD    A GLN A 239 ? 0.3487 0.3816 0.2368 0.0053  -0.0533 0.0174  215 GLN A CD    
1706 C  CD    B GLN A 239 ? 0.3429 0.2915 0.4705 0.0075  -0.0116 -0.0672 215 GLN A CD    
1707 O  OE1   A GLN A 239 ? 0.3331 0.3177 0.2235 -0.0035 -0.0750 0.0443  215 GLN A OE1   
1708 O  OE1   B GLN A 239 ? 0.4116 0.1858 0.5702 0.0016  -0.0817 -0.1287 215 GLN A OE1   
1709 N  NE2   A GLN A 239 ? 0.3491 0.4915 0.2750 0.0190  -0.0901 0.0371  215 GLN A NE2   
1710 N  NE2   B GLN A 239 ? 0.3891 0.3525 0.5307 -0.0368 0.0231  -0.0125 215 GLN A NE2   
1711 N  N     . GLU A 240 ? 0.2670 0.2995 0.0560 -0.0244 -0.0778 0.0469  216 GLU A N     
1712 C  CA    . GLU A 240 ? 0.2447 0.2574 0.1252 0.0233  -0.0200 0.0459  216 GLU A CA    
1713 C  C     . GLU A 240 ? 0.3020 0.2481 0.1053 0.0144  -0.0625 -0.0172 216 GLU A C     
1714 O  O     . GLU A 240 ? 0.3634 0.2274 0.0448 0.0392  -0.0628 0.0016  216 GLU A O     
1715 C  CB    . GLU A 240 ? 0.2648 0.2731 0.1558 0.0212  -0.0075 0.0805  216 GLU A CB    
1716 C  CG    . GLU A 240 ? 0.2936 0.3260 0.1213 0.0556  -0.0894 0.0583  216 GLU A CG    
1717 C  CD    . GLU A 240 ? 0.3318 0.3082 0.1662 0.0434  -0.0829 0.0213  216 GLU A CD    
1718 O  OE1   . GLU A 240 ? 0.3444 0.3438 0.1279 0.0530  -0.0810 0.0206  216 GLU A OE1   
1719 O  OE2   . GLU A 240 ? 0.3854 0.3704 0.1719 0.0616  -0.1431 -0.0007 216 GLU A OE2   
1720 N  N     . ALA A 241 ? 0.2916 0.2628 0.1417 0.0244  -0.0276 0.0621  217 ALA A N     
1721 C  CA    . ALA A 241 ? 0.3448 0.2790 0.1254 0.0248  -0.0260 0.0315  217 ALA A CA    
1722 C  C     . ALA A 241 ? 0.2904 0.2768 0.1828 0.0229  -0.0433 -0.0026 217 ALA A C     
1723 O  O     . ALA A 241 ? 0.3078 0.3275 0.1575 0.0240  -0.0536 0.0169  217 ALA A O     
1724 C  CB    . ALA A 241 ? 0.3081 0.3142 0.2467 0.0381  -0.0371 -0.0177 217 ALA A CB    
1725 N  N     . LEU A 242 ? 0.3075 0.2958 0.2671 -0.0150 -0.0466 0.0021  218 LEU A N     
1726 C  CA    . LEU A 242 ? 0.2518 0.2887 0.2306 -0.0269 -0.0245 -0.0122 218 LEU A CA    
1727 C  C     . LEU A 242 ? 0.2989 0.2726 0.2191 -0.0042 -0.0152 0.0268  218 LEU A C     
1728 O  O     . LEU A 242 ? 0.3537 0.2745 0.2421 0.0270  -0.0028 0.0194  218 LEU A O     
1729 C  CB    . LEU A 242 ? 0.2218 0.3006 0.1730 0.0163  -0.0370 0.0282  218 LEU A CB    
1730 C  CG    . LEU A 242 ? 0.2464 0.3452 0.1964 -0.0064 -0.0100 0.0226  218 LEU A CG    
1731 C  CD1   . LEU A 242 ? 0.3150 0.4304 0.0724 0.0324  -0.0323 -0.0183 218 LEU A CD1   
1732 C  CD2   . LEU A 242 ? 0.4118 0.3110 0.1851 0.0239  -0.0112 -0.0010 218 LEU A CD2   
1733 N  N     A SER A 243 ? 0.2763 0.2523 0.1764 0.0149  -0.0429 0.0200  219 SER A N     
1734 N  N     B SER A 243 ? 0.2950 0.2624 0.1751 0.0051  -0.0457 0.0225  219 SER A N     
1735 C  CA    A SER A 243 ? 0.2617 0.2929 0.1854 -0.0037 -0.0217 0.0577  219 SER A CA    
1736 C  CA    B SER A 243 ? 0.2845 0.3254 0.2012 -0.0102 -0.0214 0.0515  219 SER A CA    
1737 C  C     A SER A 243 ? 0.2937 0.2464 0.0965 -0.0008 -0.0280 0.0478  219 SER A C     
1738 C  C     B SER A 243 ? 0.3061 0.2464 0.1082 -0.0020 -0.0272 0.0501  219 SER A C     
1739 O  O     A SER A 243 ? 0.3086 0.2976 0.0505 0.0237  -0.0533 -0.0131 219 SER A O     
1740 O  O     B SER A 243 ? 0.3185 0.3000 0.1019 0.0159  -0.0309 0.0021  219 SER A O     
1741 C  CB    A SER A 243 ? 0.1990 0.2437 0.1444 0.0196  -0.0294 0.0049  219 SER A CB    
1742 C  CB    B SER A 243 ? 0.3074 0.3293 0.1489 -0.0026 -0.0301 -0.0211 219 SER A CB    
1743 O  OG    A SER A 243 ? 0.2069 0.1534 0.1964 0.0166  -0.0274 -0.0285 219 SER A OG    
1744 O  OG    B SER A 243 ? 0.3200 0.2551 0.3021 -0.0486 -0.0506 -0.0460 219 SER A OG    
1745 N  N     . LEU A 244 ? 0.2799 0.2545 0.1326 -0.0048 -0.0449 0.0586  220 LEU A N     
1746 C  CA    . LEU A 244 ? 0.2819 0.2153 0.1602 0.0029  -0.0580 0.0369  220 LEU A CA    
1747 C  C     . LEU A 244 ? 0.2703 0.2765 0.1117 0.0129  -0.0671 0.0501  220 LEU A C     
1748 O  O     . LEU A 244 ? 0.2752 0.3065 0.1963 0.0363  -0.0732 -0.0108 220 LEU A O     
1749 C  CB    . LEU A 244 ? 0.2175 0.2422 0.1889 0.0012  -0.0578 0.0023  220 LEU A CB    
1750 C  CG    . LEU A 244 ? 0.2318 0.2491 0.1393 -0.0120 -0.0450 -0.0215 220 LEU A CG    
1751 C  CD1   . LEU A 244 ? 0.2295 0.2816 0.2369 -0.0074 -0.0254 0.0102  220 LEU A CD1   
1752 C  CD2   . LEU A 244 ? 0.2729 0.2235 0.1866 -0.0310 -0.0893 -0.0402 220 LEU A CD2   
1753 N  N     . TYR A 245 ? 0.2783 0.2688 0.1335 -0.0090 -0.0807 0.0302  221 TYR A N     
1754 C  CA    . TYR A 245 ? 0.3616 0.2456 0.1879 0.0179  -0.0168 0.0396  221 TYR A CA    
1755 C  C     . TYR A 245 ? 0.3385 0.2893 0.2150 -0.0070 -0.0669 0.0028  221 TYR A C     
1756 O  O     . TYR A 245 ? 0.4011 0.2866 0.2683 -0.0571 -0.0279 0.0002  221 TYR A O     
1757 C  CB    . TYR A 245 ? 0.3684 0.3110 0.1111 -0.0068 -0.0445 0.0691  221 TYR A CB    
1758 C  CG    . TYR A 245 ? 0.3022 0.3118 0.1520 0.0251  -0.0602 0.0563  221 TYR A CG    
1759 C  CD1   . TYR A 245 ? 0.2844 0.3422 0.2406 -0.0043 -0.0552 0.0282  221 TYR A CD1   
1760 C  CD2   . TYR A 245 ? 0.3616 0.2732 0.1443 0.0046  -0.0624 0.0326  221 TYR A CD2   
1761 C  CE1   . TYR A 245 ? 0.3566 0.2928 0.1608 0.0274  -0.0034 0.0084  221 TYR A CE1   
1762 C  CE2   . TYR A 245 ? 0.3616 0.3070 0.0410 -0.0008 -0.0518 0.0267  221 TYR A CE2   
1763 C  CZ    . TYR A 245 ? 0.3317 0.3085 0.1532 0.0352  -0.0234 0.0264  221 TYR A CZ    
1764 O  OH    . TYR A 245 ? 0.4149 0.3634 0.1235 -0.0057 -0.0681 0.0120  221 TYR A OH    
1765 N  N     . GLN A 246 ? 0.3691 0.2949 0.2017 0.0016  -0.0186 -0.0014 222 GLN A N     
1766 C  CA    . GLN A 246 ? 0.3062 0.2831 0.1804 0.0096  -0.0520 0.0135  222 GLN A CA    
1767 C  C     . GLN A 246 ? 0.3062 0.2822 0.2222 -0.0235 -0.0735 0.0216  222 GLN A C     
1768 O  O     . GLN A 246 ? 0.4026 0.2924 0.3044 0.0183  -0.1188 0.0122  222 GLN A O     
1769 C  CB    . GLN A 246 ? 0.3199 0.2962 0.1761 0.0140  -0.0386 -0.0529 222 GLN A CB    
1770 C  CG    . GLN A 246 ? 0.3448 0.2702 0.2028 0.0234  -0.0419 0.0395  222 GLN A CG    
1771 C  CD    . GLN A 246 ? 0.3894 0.3183 0.3349 0.0576  0.0259  0.0592  222 GLN A CD    
1772 O  OE1   . GLN A 246 ? 0.4162 0.4782 0.4055 0.0461  -0.0205 -0.0030 222 GLN A OE1   
1773 N  NE2   . GLN A 246 ? 0.4339 0.3542 0.3937 0.0647  0.1178  0.0262  222 GLN A NE2   
1774 N  N     . THR A 247 ? 0.3031 0.2945 0.2262 -0.0278 -0.0591 0.0334  223 THR A N     
1775 C  CA    . THR A 247 ? 0.3155 0.2940 0.2093 -0.0254 -0.0467 0.0435  223 THR A CA    
1776 C  C     . THR A 247 ? 0.2908 0.2873 0.2573 0.0084  -0.0201 0.0273  223 THR A C     
1777 O  O     . THR A 247 ? 0.3222 0.3669 0.2029 -0.0125 -0.0592 0.0551  223 THR A O     
1778 C  CB    . THR A 247 ? 0.2899 0.2532 0.2357 -0.0431 -0.0120 0.0189  223 THR A CB    
1779 O  OG1   . THR A 247 ? 0.2798 0.3304 0.1497 -0.0144 -0.0466 0.0676  223 THR A OG1   
1780 C  CG2   . THR A 247 ? 0.3195 0.2693 0.1960 0.0157  -0.0589 0.0067  223 THR A CG2   
1781 N  N     . ASP A 248 ? 0.3434 0.3499 0.2687 -0.0308 0.0024  0.0303  224 ASP A N     
1782 C  CA    . ASP A 248 ? 0.3834 0.4374 0.2705 0.0187  -0.0578 0.0093  224 ASP A CA    
1783 C  C     . ASP A 248 ? 0.3001 0.4522 0.2443 -0.0337 -0.0426 0.0873  224 ASP A C     
1784 O  O     . ASP A 248 ? 0.3546 0.5045 0.2471 0.0467  -0.1153 0.0132  224 ASP A O     
1785 C  CB    . ASP A 248 ? 0.4737 0.5470 0.4776 -0.0890 -0.0642 -0.0354 224 ASP A CB    
1786 C  CG    . ASP A 248 ? 0.7188 0.6374 0.5167 -0.0882 -0.1232 0.0304  224 ASP A CG    
1787 O  OD1   . ASP A 248 ? 0.6638 0.7227 0.4457 0.0532  0.0950  -0.1316 224 ASP A OD1   
1788 O  OD2   . ASP A 248 ? 1.1189 0.9801 0.1991 -0.3930 -0.3971 -0.0123 224 ASP A OD2   
1789 N  N     . ASP A 249 ? 0.3772 0.3230 0.2110 -0.0247 -0.0429 0.0458  225 ASP A N     
1790 C  CA    . ASP A 249 ? 0.4031 0.3208 0.2687 0.0474  0.0160  0.0856  225 ASP A CA    
1791 C  C     . ASP A 249 ? 0.3109 0.3417 0.2553 0.0395  0.0127  0.0347  225 ASP A C     
1792 O  O     . ASP A 249 ? 0.3050 0.3632 0.2397 0.0309  -0.0076 0.0543  225 ASP A O     
1793 C  CB    . ASP A 249 ? 0.4324 0.3793 0.2768 0.0655  -0.0049 0.0947  225 ASP A CB    
1794 C  CG    . ASP A 249 ? 0.5023 0.4254 0.3022 0.0380  0.0492  0.1029  225 ASP A CG    
1795 O  OD1   . ASP A 249 ? 0.5120 0.4893 0.3212 0.0608  0.0502  0.0980  225 ASP A OD1   
1796 O  OD2   . ASP A 249 ? 0.6238 0.5798 0.2871 -0.0752 0.0039  0.1545  225 ASP A OD2   
1797 N  N     . PHE A 250 ? 0.3339 0.3217 0.2001 0.0540  0.0138  0.0157  226 PHE A N     
1798 C  CA    . PHE A 250 ? 0.2866 0.3164 0.2294 0.0790  -0.0251 0.0358  226 PHE A CA    
1799 C  C     . PHE A 250 ? 0.3581 0.3097 0.2541 0.0311  -0.0147 0.0086  226 PHE A C     
1800 O  O     . PHE A 250 ? 0.3601 0.3300 0.1253 0.0314  -0.1088 0.0186  226 PHE A O     
1801 C  CB    . PHE A 250 ? 0.3194 0.3529 0.1325 0.0711  -0.0498 0.0488  226 PHE A CB    
1802 C  CG    . PHE A 250 ? 0.3506 0.3562 0.2471 0.0315  -0.0248 0.0018  226 PHE A CG    
1803 C  CD1   . PHE A 250 ? 0.3546 0.3637 0.2282 0.0319  -0.0483 0.0335  226 PHE A CD1   
1804 C  CD2   . PHE A 250 ? 0.3755 0.3083 0.2525 0.0609  -0.0540 0.0131  226 PHE A CD2   
1805 C  CE1   . PHE A 250 ? 0.3819 0.3668 0.1481 0.0842  -0.0664 0.0472  226 PHE A CE1   
1806 C  CE2   . PHE A 250 ? 0.3612 0.3224 0.1924 0.0111  -0.1012 0.0357  226 PHE A CE2   
1807 C  CZ    . PHE A 250 ? 0.3653 0.3923 0.1228 0.0806  -0.0522 0.0490  226 PHE A CZ    
1808 N  N     . GLU A 251 ? 0.4350 0.3266 0.3148 0.0208  0.0392  0.0084  227 GLU A N     
1809 C  CA    . GLU A 251 ? 0.3776 0.4278 0.3098 0.0070  -0.0193 0.0287  227 GLU A CA    
1810 C  C     . GLU A 251 ? 0.3750 0.3044 0.2390 0.0130  -0.0109 0.0246  227 GLU A C     
1811 O  O     . GLU A 251 ? 0.3967 0.3666 0.2286 0.0074  0.0057  -0.0260 227 GLU A O     
1812 C  CB    . GLU A 251 ? 0.4494 0.4856 0.4184 0.0080  0.0515  0.0534  227 GLU A CB    
1813 C  CG    . GLU A 251 ? 0.4568 0.5646 0.5794 0.0274  0.0540  0.0134  227 GLU A CG    
1814 C  CD    . GLU A 251 ? 0.4804 0.5829 0.4965 0.0718  -0.0212 -0.0310 227 GLU A CD    
1815 O  OE1   . GLU A 251 ? 0.5118 0.5848 0.4023 0.0296  -0.0243 0.0270  227 GLU A OE1   
1816 O  OE2   . GLU A 251 ? 0.4907 0.6820 0.4266 0.1281  0.0124  -0.0330 227 GLU A OE2   
1817 N  N     . GLU A 252 ? 0.3929 0.3056 0.1928 0.0177  -0.0213 0.0344  228 GLU A N     
1818 C  CA    . GLU A 252 ? 0.3745 0.2864 0.3306 0.0035  -0.0127 0.0115  228 GLU A CA    
1819 C  C     . GLU A 252 ? 0.3077 0.3123 0.2651 0.0197  -0.0446 0.0161  228 GLU A C     
1820 O  O     . GLU A 252 ? 0.3265 0.3088 0.2189 0.0410  -0.0764 -0.0133 228 GLU A O     
1821 C  CB    . GLU A 252 ? 0.3706 0.3179 0.3458 0.0559  -0.0003 -0.0009 228 GLU A CB    
1822 C  CG    . GLU A 252 ? 0.3680 0.3894 0.3427 0.0556  -0.0394 -0.0016 228 GLU A CG    
1823 C  CD    . GLU A 252 ? 0.4285 0.3881 0.3619 0.0546  -0.0316 -0.0146 228 GLU A CD    
1824 O  OE1   . GLU A 252 ? 0.5774 0.4526 0.5797 -0.0197 -0.0059 -0.1241 228 GLU A OE1   
1825 O  OE2   . GLU A 252 ? 0.4138 0.3949 0.3734 0.1064  -0.0802 -0.0859 228 GLU A OE2   
1826 N  N     . ALA A 253 ? 0.3125 0.3009 0.2511 0.0283  -0.0476 -0.0158 229 ALA A N     
1827 C  CA    . ALA A 253 ? 0.3211 0.3182 0.2108 0.0306  -0.0958 0.0338  229 ALA A CA    
1828 C  C     . ALA A 253 ? 0.2986 0.3223 0.1523 0.0436  -0.0892 0.0397  229 ALA A C     
1829 O  O     . ALA A 253 ? 0.3455 0.3506 0.1533 0.0122  -0.0501 -0.0217 229 ALA A O     
1830 C  CB    . ALA A 253 ? 0.2428 0.3674 0.2403 -0.0592 -0.1292 -0.0308 229 ALA A CB    
1831 N  N     . LEU A 254 ? 0.3284 0.3248 0.1601 0.0488  -0.0736 0.0133  230 LEU A N     
1832 C  CA    . LEU A 254 ? 0.2981 0.3344 0.1882 0.0502  -0.0593 -0.0025 230 LEU A CA    
1833 C  C     . LEU A 254 ? 0.3665 0.3305 0.1696 0.0189  -0.0670 0.0389  230 LEU A C     
1834 O  O     . LEU A 254 ? 0.3724 0.3193 0.1124 0.0501  -0.1231 0.0311  230 LEU A O     
1835 C  CB    . LEU A 254 ? 0.2975 0.3290 0.1924 0.0224  -0.0558 -0.0359 230 LEU A CB    
1836 C  CG    . LEU A 254 ? 0.3339 0.2827 0.1854 0.0245  -0.0357 0.0443  230 LEU A CG    
1837 C  CD1   . LEU A 254 ? 0.3673 0.3515 0.0717 0.0324  -0.0255 0.0494  230 LEU A CD1   
1838 C  CD2   . LEU A 254 ? 0.4080 0.2820 0.1034 0.0253  -0.0601 0.0353  230 LEU A CD2   
1839 N  N     . ASN A 255 ? 0.4067 0.3670 0.1740 0.0514  -0.0451 0.0674  231 ASN A N     
1840 C  CA    . ASN A 255 ? 0.3634 0.3839 0.2151 0.0548  -0.0623 0.0176  231 ASN A CA    
1841 C  C     . ASN A 255 ? 0.3785 0.3491 0.1804 0.0331  -0.0327 0.0346  231 ASN A C     
1842 O  O     . ASN A 255 ? 0.4168 0.4287 0.1394 -0.0064 0.0036  0.0179  231 ASN A O     
1843 C  CB    . ASN A 255 ? 0.4413 0.4106 0.2622 0.0257  -0.0229 0.0436  231 ASN A CB    
1844 C  CG    . ASN A 255 ? 0.4345 0.4074 0.2979 0.0435  -0.0453 0.0096  231 ASN A CG    
1845 O  OD1   . ASN A 255 ? 0.4492 0.4152 0.1713 0.0476  -0.0988 0.0214  231 ASN A OD1   
1846 N  ND2   . ASN A 255 ? 0.4808 0.4953 0.4182 -0.0383 -0.0551 0.0380  231 ASN A ND2   
1847 N  N     . ARG A 256 ? 0.3551 0.3723 0.1808 0.0629  -0.0389 0.0448  232 ARG A N     
1848 C  CA    . ARG A 256 ? 0.3339 0.3121 0.1953 0.0334  -0.0464 0.0035  232 ARG A CA    
1849 C  C     . ARG A 256 ? 0.2914 0.3260 0.2155 0.0309  -0.0498 0.0154  232 ARG A C     
1850 O  O     . ARG A 256 ? 0.3075 0.3552 0.2296 0.0242  -0.0575 -0.0250 232 ARG A O     
1851 C  CB    . ARG A 256 ? 0.3461 0.2530 0.2657 0.0289  -0.1096 0.0033  232 ARG A CB    
1852 C  CG    . ARG A 256 ? 0.3583 0.2735 0.1858 0.0196  -0.1171 -0.0032 232 ARG A CG    
1853 C  CD    . ARG A 256 ? 0.3417 0.3302 0.1139 0.0832  -0.0822 0.0196  232 ARG A CD    
1854 N  NE    . ARG A 256 ? 0.3683 0.4208 0.1496 0.0874  -0.0391 0.0628  232 ARG A NE    
1855 C  CZ    . ARG A 256 ? 0.4227 0.4139 0.1989 0.1112  0.0197  0.0896  232 ARG A CZ    
1856 N  NH1   . ARG A 256 ? 0.5754 0.4298 0.0561 0.0620  0.0980  0.0840  232 ARG A NH1   
1857 N  NH2   . ARG A 256 ? 0.4892 0.4394 0.3665 0.2326  0.2477  0.1663  232 ARG A NH2   
1858 N  N     . ILE A 257 ? 0.3175 0.2636 0.2287 0.0391  -0.0511 -0.0032 233 ILE A N     
1859 C  CA    . ILE A 257 ? 0.2821 0.3095 0.1391 0.0396  -0.0585 0.0317  233 ILE A CA    
1860 C  C     . ILE A 257 ? 0.3113 0.3174 0.2034 0.0049  -0.0291 0.0103  233 ILE A C     
1861 O  O     . ILE A 257 ? 0.3253 0.3516 0.1337 -0.0289 -0.1228 -0.0117 233 ILE A O     
1862 C  CB    . ILE A 257 ? 0.2343 0.3217 0.1722 0.0053  -0.0832 0.0155  233 ILE A CB    
1863 C  CG1   . ILE A 257 ? 0.2764 0.3539 0.1628 -0.0031 -0.0857 0.0356  233 ILE A CG1   
1864 C  CG2   . ILE A 257 ? 0.2539 0.3597 0.1149 0.0411  -0.1175 0.0204  233 ILE A CG2   
1865 C  CD1   . ILE A 257 ? 0.2234 0.3402 0.1835 0.0067  -0.0928 0.0511  233 ILE A CD1   
1866 N  N     . ALA A 258 ? 0.3365 0.3512 0.2036 0.0565  -0.0144 0.0033  234 ALA A N     
1867 C  CA    . ALA A 258 ? 0.2872 0.3586 0.2185 0.0626  -0.0512 -0.0095 234 ALA A CA    
1868 C  C     . ALA A 258 ? 0.3401 0.3404 0.1750 0.0465  -0.0690 0.0107  234 ALA A C     
1869 O  O     . ALA A 258 ? 0.3618 0.4231 0.1422 0.0177  -0.0820 -0.0169 234 ALA A O     
1870 C  CB    . ALA A 258 ? 0.2854 0.3487 0.2587 0.0363  -0.0459 -0.0189 234 ALA A CB    
1871 N  N     . ALA A 259 ? 0.3315 0.3446 0.1497 0.0609  -0.0517 0.0012  235 ALA A N     
1872 C  CA    . ALA A 259 ? 0.3175 0.3506 0.1776 0.0621  -0.0499 0.0014  235 ALA A CA    
1873 C  C     . ALA A 259 ? 0.3295 0.4262 0.1675 0.0231  -0.0572 0.0217  235 ALA A C     
1874 O  O     . ALA A 259 ? 0.3860 0.4416 0.0491 0.0556  -0.0673 -0.0504 235 ALA A O     
1875 C  CB    . ALA A 259 ? 0.3898 0.3615 0.1464 0.0337  -0.1146 0.0409  235 ALA A CB    
1876 N  N     . ASP A 260 ? 0.3008 0.3246 0.1627 0.0493  -0.0636 0.0194  236 ASP A N     
1877 C  CA    . ASP A 260 ? 0.2866 0.2937 0.1853 0.0298  -0.0634 -0.0043 236 ASP A CA    
1878 C  C     . ASP A 260 ? 0.3302 0.3072 0.1673 0.0214  -0.0642 0.0088  236 ASP A C     
1879 O  O     . ASP A 260 ? 0.3088 0.4037 0.1462 0.0288  -0.1018 -0.0083 236 ASP A O     
1880 C  CB    . ASP A 260 ? 0.2980 0.3031 0.2324 0.0122  -0.0726 -0.0301 236 ASP A CB    
1881 C  CG    . ASP A 260 ? 0.3192 0.3175 0.2633 0.0599  -0.0730 -0.0313 236 ASP A CG    
1882 O  OD1   . ASP A 260 ? 0.3814 0.3412 0.2020 0.0878  -0.0550 -0.0187 236 ASP A OD1   
1883 O  OD2   . ASP A 260 ? 0.3559 0.3325 0.2016 0.0767  -0.0475 -0.0537 236 ASP A OD2   
1884 N  N     . CYS A 261 ? 0.3258 0.2965 0.1777 0.0167  -0.0546 0.0204  237 CYS A N     
1885 C  CA    A CYS A 261 ? 0.3683 0.2957 0.2094 0.0292  -0.0566 0.0115  237 CYS A CA    
1886 C  CA    B CYS A 261 ? 0.3570 0.2923 0.2121 0.0285  -0.0556 0.0090  237 CYS A CA    
1887 C  C     . CYS A 261 ? 0.3973 0.3010 0.2439 0.0072  -0.0222 -0.0059 237 CYS A C     
1888 O  O     . CYS A 261 ? 0.4866 0.3408 0.2687 -0.0021 0.0407  -0.0159 237 CYS A O     
1889 C  CB    A CYS A 261 ? 0.3620 0.3056 0.2212 0.0678  -0.0529 0.0333  237 CYS A CB    
1890 C  CB    B CYS A 261 ? 0.3373 0.3111 0.2208 0.0491  -0.0694 -0.0223 237 CYS A CB    
1891 S  SG    A CYS A 261 ? 0.3753 0.4112 0.2532 0.0406  -0.1155 0.0202  237 CYS A SG    
1892 S  SG    B CYS A 261 ? 0.3657 0.3240 0.1931 0.0466  -0.1001 -0.0230 237 CYS A SG    
1893 N  N     . LYS A 262 ? 0.3535 0.3031 0.1855 0.0218  -0.0662 0.0434  238 LYS A N     
1894 C  CA    . LYS A 262 ? 0.3462 0.3104 0.2446 -0.0182 -0.0458 0.0096  238 LYS A CA    
1895 C  C     . LYS A 262 ? 0.3751 0.3307 0.1689 0.0445  -0.0409 0.0256  238 LYS A C     
1896 O  O     . LYS A 262 ? 0.4131 0.3219 0.1306 0.0512  -0.0454 -0.0048 238 LYS A O     
1897 C  CB    . LYS A 262 ? 0.3390 0.3297 0.2823 -0.0268 -0.0585 -0.0011 238 LYS A CB    
1898 C  CG    . LYS A 262 ? 0.3944 0.4407 0.3572 0.0179  -0.1200 -0.0263 238 LYS A CG    
1899 C  CD    . LYS A 262 ? 0.4691 0.4887 0.4120 -0.0368 -0.1774 -0.1308 238 LYS A CD    
1900 C  CE    . LYS A 262 ? 0.5441 0.4802 0.4036 0.0348  -0.0949 -0.2144 238 LYS A CE    
1901 N  NZ    . LYS A 262 ? 0.7620 0.3182 0.1554 0.0773  -0.3032 -0.0707 238 LYS A NZ    
1902 N  N     . ILE A 263 ? 0.3361 0.2830 0.1834 0.0388  -0.1054 -0.0159 239 ILE A N     
1903 C  CA    . ILE A 263 ? 0.3114 0.2722 0.1818 0.0077  -0.0826 -0.0854 239 ILE A CA    
1904 C  C     . ILE A 263 ? 0.3152 0.3147 0.1344 0.0190  -0.0561 -0.0738 239 ILE A C     
1905 O  O     . ILE A 263 ? 0.3870 0.3757 0.0930 0.0399  -0.0744 -0.0380 239 ILE A O     
1906 C  CB    . ILE A 263 ? 0.3380 0.2806 0.1654 0.0187  -0.0829 -0.0688 239 ILE A CB    
1907 C  CG1   . ILE A 263 ? 0.3836 0.2468 0.1734 0.0336  -0.0269 -0.0746 239 ILE A CG1   
1908 C  CG2   . ILE A 263 ? 0.3496 0.3622 0.1287 0.0519  -0.0804 -0.0443 239 ILE A CG2   
1909 C  CD1   . ILE A 263 ? 0.3383 0.2727 0.1670 0.0229  -0.1136 0.0106  239 ILE A CD1   
1910 N  N     . ALA A 264 ? 0.3080 0.3257 0.1269 0.0175  -0.1003 -0.0725 240 ALA A N     
1911 C  CA    . ALA A 264 ? 0.2971 0.2969 0.1630 -0.0356 -0.0708 -0.0809 240 ALA A CA    
1912 C  C     . ALA A 264 ? 0.3551 0.3472 0.1660 0.0197  -0.0933 -0.0338 240 ALA A C     
1913 O  O     . ALA A 264 ? 0.3192 0.3873 0.1264 -0.0121 -0.1154 -0.0040 240 ALA A O     
1914 C  CB    . ALA A 264 ? 0.3692 0.2989 0.0872 -0.0224 -0.1028 -0.0854 240 ALA A CB    
1915 N  N     . ALA A 265 ? 0.3448 0.2854 0.1684 0.0271  -0.0344 0.0065  241 ALA A N     
1916 C  CA    . ALA A 265 ? 0.3440 0.2348 0.1214 0.0137  -0.0345 0.0057  241 ALA A CA    
1917 C  C     . ALA A 265 ? 0.2850 0.2657 0.1369 0.0029  -0.0146 -0.0006 241 ALA A C     
1918 O  O     . ALA A 265 ? 0.3609 0.2557 0.0768 0.0195  -0.0255 0.0007  241 ALA A O     
1919 C  CB    . ALA A 265 ? 0.3131 0.2308 0.1042 -0.0392 -0.0093 -0.0111 241 ALA A CB    
1920 N  N     . VAL A 266 ? 0.2872 0.2882 0.1772 -0.0071 -0.0168 0.0418  242 VAL A N     
1921 C  CA    . VAL A 266 ? 0.2792 0.3235 0.1692 0.0000  -0.0108 0.0017  242 VAL A CA    
1922 C  C     . VAL A 266 ? 0.2881 0.3711 0.2085 0.0154  -0.0306 -0.0225 242 VAL A C     
1923 O  O     . VAL A 266 ? 0.2955 0.4431 0.1870 0.0513  -0.0499 -0.0102 242 VAL A O     
1924 C  CB    . VAL A 266 ? 0.3016 0.3593 0.1984 0.0233  -0.0223 0.0213  242 VAL A CB    
1925 C  CG1   . VAL A 266 ? 0.3798 0.3830 0.0943 0.0275  -0.0222 0.0332  242 VAL A CG1   
1926 C  CG2   . VAL A 266 ? 0.3142 0.4473 0.1769 0.0040  -0.0397 0.0035  242 VAL A CG2   
1927 N  N     . THR A 267 ? 0.3045 0.3694 0.2164 0.0528  -0.0434 0.0005  243 THR A N     
1928 C  CA    . THR A 267 ? 0.3099 0.3472 0.2083 0.0478  -0.0605 -0.0177 243 THR A CA    
1929 C  C     . THR A 267 ? 0.3236 0.3065 0.2131 0.0648  -0.0511 0.0269  243 THR A C     
1930 O  O     . THR A 267 ? 0.3455 0.3052 0.1600 0.0659  -0.0779 0.0130  243 THR A O     
1931 C  CB    . THR A 267 ? 0.3207 0.3171 0.2280 0.0407  -0.0403 -0.0117 243 THR A CB    
1932 O  OG1   . THR A 267 ? 0.3491 0.3065 0.1338 0.0438  -0.0652 -0.0093 243 THR A OG1   
1933 C  CG2   . THR A 267 ? 0.3433 0.3276 0.2954 0.0184  -0.0376 0.0354  243 THR A CG2   
1934 N  N     . MSE A 268 ? 0.3102 0.3844 0.1969 0.0309  -0.0570 0.0234  244 MSE A N     
1935 C  CA    . MSE A 268 ? 0.3615 0.3838 0.2626 0.0163  -0.0563 0.0422  244 MSE A CA    
1936 C  C     . MSE A 268 ? 0.3715 0.3561 0.2828 0.0422  -0.0693 0.0014  244 MSE A C     
1937 O  O     . MSE A 268 ? 0.3642 0.4780 0.2776 0.0568  -0.0571 0.0221  244 MSE A O     
1938 C  CB    . MSE A 268 ? 0.3559 0.4085 0.2618 -0.0189 -0.0399 -0.0077 244 MSE A CB    
1939 C  CG    . MSE A 268 ? 0.4652 0.3986 0.4678 0.1328  -0.1432 0.0044  244 MSE A CG    
1940 SE SE    . MSE A 268 ? 0.8197 0.8404 0.5926 0.1923  -0.1116 0.1046  244 MSE A SE    
1941 C  CE    . MSE A 268 ? 0.5711 0.6990 0.2866 0.2235  -0.0456 0.2918  244 MSE A CE    
1942 N  N     . SER A 269 ? 0.3744 0.3294 0.2686 0.0476  -0.0763 -0.0132 245 SER A N     
1943 C  CA    . SER A 269 ? 0.4118 0.4191 0.2837 0.0439  -0.0663 0.0639  245 SER A CA    
1944 C  C     . SER A 269 ? 0.4038 0.4495 0.3134 0.0362  -0.0545 0.0890  245 SER A C     
1945 O  O     . SER A 269 ? 0.4822 0.4385 0.1988 0.0526  -0.1127 0.1643  245 SER A O     
1946 C  CB    . SER A 269 ? 0.4173 0.4962 0.2884 0.0729  -0.0694 -0.0014 245 SER A CB    
1947 O  OG    . SER A 269 ? 0.5063 0.5897 0.1592 0.1134  -0.0281 -0.0793 245 SER A OG    
1948 N  N     . GLU A 270 ? 0.4506 0.5054 0.2704 0.0109  -0.0560 0.0357  246 GLU A N     
1949 C  CA    . GLU A 270 ? 0.4089 0.4994 0.3309 0.0259  -0.1132 0.0396  246 GLU A CA    
1950 C  C     . GLU A 270 ? 0.4305 0.5438 0.3601 0.0561  -0.0596 0.0213  246 GLU A C     
1951 O  O     . GLU A 270 ? 0.4331 0.6024 0.2015 0.0764  -0.1740 -0.0610 246 GLU A O     
1952 C  CB    . GLU A 270 ? 0.4127 0.4429 0.4668 -0.0156 -0.0675 0.0208  246 GLU A CB    
1953 C  CG    . GLU A 270 ? 0.4297 0.4600 0.4556 -0.0377 -0.0446 0.0063  246 GLU A CG    
1954 C  CD    . GLU A 270 ? 0.4664 0.5530 0.5345 0.0281  -0.0279 0.0183  246 GLU A CD    
1955 O  OE1   . GLU A 270 ? 0.4791 0.5888 0.4719 0.0084  -0.0123 -0.0811 246 GLU A OE1   
1956 O  OE2   . GLU A 270 ? 0.5230 0.5644 0.7272 0.0685  -0.1430 0.0803  246 GLU A OE2   
1957 N  N     . ASN A 271 ? 0.4160 0.5107 0.3758 0.0300  -0.0629 0.0447  247 ASN A N     
1958 C  CA    . ASN A 271 ? 0.3905 0.5181 0.3861 0.0304  -0.0418 0.0118  247 ASN A CA    
1959 C  C     . ASN A 271 ? 0.3598 0.4806 0.3476 0.0610  -0.0451 0.0227  247 ASN A C     
1960 O  O     . ASN A 271 ? 0.4027 0.5517 0.3261 0.0801  0.0260  0.0042  247 ASN A O     
1961 C  CB    . ASN A 271 ? 0.3659 0.5333 0.3188 0.0674  -0.0935 0.0093  247 ASN A CB    
1962 C  CG    . ASN A 271 ? 0.4353 0.5230 0.5747 0.0067  -0.0717 0.0090  247 ASN A CG    
1963 O  OD1   . ASN A 271 ? 0.4301 0.6689 0.6359 -0.0134 -0.1055 0.0165  247 ASN A OD1   
1964 N  ND2   . ASN A 271 ? 0.5830 0.4235 0.6082 0.0268  -0.0960 0.0728  247 ASN A ND2   
1965 N  N     . GLY A 272 ? 0.3797 0.4108 0.3270 0.0620  -0.0914 0.0160  248 GLY A N     
1966 C  CA    . GLY A 272 ? 0.3501 0.4537 0.2278 0.0727  -0.1524 0.0351  248 GLY A CA    
1967 C  C     . GLY A 272 ? 0.2885 0.4351 0.2947 0.0063  -0.0608 0.0166  248 GLY A C     
1968 O  O     . GLY A 272 ? 0.3867 0.4627 0.2806 0.0434  -0.0758 -0.0049 248 GLY A O     
1969 N  N     . ALA A 273 ? 0.2446 0.4401 0.2289 0.0041  -0.0418 0.0592  249 ALA A N     
1970 C  CA    . ALA A 273 ? 0.2779 0.3786 0.2045 0.0480  -0.0651 0.1305  249 ALA A CA    
1971 C  C     . ALA A 273 ? 0.2887 0.3630 0.1903 0.0286  -0.0138 0.1012  249 ALA A C     
1972 O  O     . ALA A 273 ? 0.3044 0.3948 0.1937 0.0364  -0.0405 0.0558  249 ALA A O     
1973 C  CB    . ALA A 273 ? 0.3223 0.3922 0.2346 0.0069  -0.0674 0.1067  249 ALA A CB    
1974 N  N     . VAL A 274 ? 0.3343 0.3757 0.1556 0.0255  -0.0692 0.0915  250 VAL A N     
1975 C  CA    . VAL A 274 ? 0.3477 0.3682 0.1678 0.0046  -0.0974 0.0372  250 VAL A CA    
1976 C  C     . VAL A 274 ? 0.3496 0.3342 0.1457 0.0102  -0.0884 -0.0050 250 VAL A C     
1977 O  O     . VAL A 274 ? 0.3665 0.3806 0.1333 0.0071  -0.0640 0.0145  250 VAL A O     
1978 C  CB    . VAL A 274 ? 0.4095 0.3980 0.1769 0.0280  -0.0352 0.0598  250 VAL A CB    
1979 C  CG1   . VAL A 274 ? 0.4836 0.4021 0.1886 0.0293  -0.0225 0.0301  250 VAL A CG1   
1980 C  CG2   . VAL A 274 ? 0.2761 0.4620 0.1964 0.0262  -0.0480 0.0384  250 VAL A CG2   
1981 N  N     . ILE A 275 ? 0.3620 0.3184 0.1064 0.0194  -0.0685 0.0090  251 ILE A N     
1982 C  CA    . ILE A 275 ? 0.3497 0.3186 0.0962 0.0162  -0.0480 0.0054  251 ILE A CA    
1983 C  C     . ILE A 275 ? 0.3372 0.3132 0.1419 0.0540  -0.0011 0.0689  251 ILE A C     
1984 O  O     . ILE A 275 ? 0.4094 0.3199 0.0385 0.0337  -0.0356 0.0507  251 ILE A O     
1985 C  CB    . ILE A 275 ? 0.3691 0.3307 0.0885 -0.0213 -0.0230 0.0378  251 ILE A CB    
1986 C  CG1   . ILE A 275 ? 0.3359 0.3671 0.1702 0.0160  -0.0574 0.0002  251 ILE A CG1   
1987 C  CG2   . ILE A 275 ? 0.3699 0.3619 0.0583 -0.0484 -0.0820 -0.0267 251 ILE A CG2   
1988 C  CD1   . ILE A 275 ? 0.3448 0.4281 0.1269 0.0154  -0.1077 0.0149  251 ILE A CD1   
1989 N  N     . LEU A 276 ? 0.3377 0.2631 0.1876 0.0510  -0.0422 0.0473  252 LEU A N     
1990 C  CA    . LEU A 276 ? 0.3693 0.3034 0.0994 0.0345  -0.0261 0.0088  252 LEU A CA    
1991 C  C     . LEU A 276 ? 0.3668 0.3680 0.1517 -0.0044 -0.0230 0.0366  252 LEU A C     
1992 O  O     . LEU A 276 ? 0.4033 0.3461 0.0300 -0.0089 -0.0420 -0.0007 252 LEU A O     
1993 C  CB    . LEU A 276 ? 0.4079 0.2765 0.1485 0.0328  -0.0640 0.0630  252 LEU A CB    
1994 C  CG    . LEU A 276 ? 0.4434 0.3253 0.3050 -0.0006 -0.0716 -0.0200 252 LEU A CG    
1995 C  CD1   . LEU A 276 ? 0.5102 0.4710 0.3091 0.0310  -0.0228 -0.0409 252 LEU A CD1   
1996 C  CD2   . LEU A 276 ? 0.4528 0.3929 0.2278 0.0173  0.0081  0.0424  252 LEU A CD2   
1997 N  N     . LYS A 277 ? 0.4339 0.3650 0.1194 0.0069  -0.0557 0.1391  253 LYS A N     
1998 C  CA    . LYS A 277 ? 0.4228 0.3282 0.1687 0.0102  -0.0442 0.1168  253 LYS A CA    
1999 C  C     . LYS A 277 ? 0.4134 0.3306 0.1526 0.0280  -0.0941 0.0878  253 LYS A C     
2000 O  O     . LYS A 277 ? 0.4728 0.4052 0.1492 0.0261  -0.0626 0.0531  253 LYS A O     
2001 C  CB    . LYS A 277 ? 0.4221 0.3293 0.0664 -0.0091 -0.0526 0.1031  253 LYS A CB    
2002 C  CG    . LYS A 277 ? 0.4725 0.3686 0.0707 -0.0249 -0.0392 0.0901  253 LYS A CG    
2003 C  CD    . LYS A 277 ? 0.4528 0.3774 0.1295 -0.0284 -0.0626 0.0798  253 LYS A CD    
2004 C  CE    . LYS A 277 ? 0.4862 0.4194 0.2438 -0.0363 -0.0859 -0.0252 253 LYS A CE    
2005 N  NZ    . LYS A 277 ? 0.6772 0.4587 0.2648 0.0420  -0.0970 -0.0640 253 LYS A NZ    
2006 N  N     . GLY A 278 ? 0.4357 0.3287 0.1654 0.0391  -0.1381 0.0681  254 GLY A N     
2007 C  CA    . GLY A 278 ? 0.4537 0.3528 0.1755 0.0585  -0.0796 0.0942  254 GLY A CA    
2008 C  C     . GLY A 278 ? 0.4664 0.3812 0.2133 0.0309  -0.0434 0.0272  254 GLY A C     
2009 O  O     . GLY A 278 ? 0.5664 0.5443 0.1029 0.0132  -0.0973 0.0188  254 GLY A O     
2010 N  N     . ARG A 279 ? 0.4550 0.4422 0.1992 0.0172  -0.0571 0.0196  255 ARG A N     
2011 C  CA    . ARG A 279 ? 0.4713 0.5224 0.2077 -0.0063 -0.0585 0.0561  255 ARG A CA    
2012 C  C     . ARG A 279 ? 0.4467 0.5030 0.2233 -0.0293 -0.0663 0.0352  255 ARG A C     
2013 O  O     . ARG A 279 ? 0.4164 0.5791 0.2326 -0.0153 -0.0650 0.0300  255 ARG A O     
2014 C  CB    . ARG A 279 ? 0.5223 0.5256 0.2458 -0.0007 -0.0116 0.1380  255 ARG A CB    
2015 C  CG    . ARG A 279 ? 0.5923 0.6820 0.2383 0.0415  -0.1097 0.1636  255 ARG A CG    
2016 C  CD    . ARG A 279 ? 0.7460 0.7157 0.3083 0.0332  -0.0080 0.2154  255 ARG A CD    
2017 N  NE    . ARG A 279 ? 0.7094 0.8466 0.1062 0.0471  -0.1048 0.1166  255 ARG A NE    
2018 C  CZ    . ARG A 279 ? 0.6365 0.7953 0.3684 0.0411  -0.1509 -0.0087 255 ARG A CZ    
2019 N  NH1   . ARG A 279 ? 0.7323 0.9127 0.0781 -0.0804 0.1764  0.0679  255 ARG A NH1   
2020 N  NH2   . ARG A 279 ? 0.7399 0.6262 0.7745 0.1055  0.0036  -0.0461 255 ARG A NH2   
2021 N  N     . GLU A 280 ? 0.4964 0.4738 0.2362 0.0003  -0.1182 0.0053  256 GLU A N     
2022 C  CA    . GLU A 280 ? 0.4397 0.4913 0.2816 0.0281  -0.0774 -0.0649 256 GLU A CA    
2023 C  C     . GLU A 280 ? 0.3879 0.5275 0.2416 0.0201  -0.0527 -0.0186 256 GLU A C     
2024 O  O     . GLU A 280 ? 0.4194 0.5132 0.1886 0.0984  -0.0885 0.0461  256 GLU A O     
2025 C  CB    . GLU A 280 ? 0.4741 0.4947 0.2455 0.0306  -0.1063 -0.0725 256 GLU A CB    
2026 C  CG    . GLU A 280 ? 0.4844 0.6100 0.2934 0.0284  -0.1563 -0.0904 256 GLU A CG    
2027 C  CD    . GLU A 280 ? 0.5659 0.6568 0.4238 -0.0354 -0.1530 -0.1385 256 GLU A CD    
2028 O  OE1   . GLU A 280 ? 0.6619 0.5943 0.3506 -0.0440 -0.1376 -0.1827 256 GLU A OE1   
2029 O  OE2   . GLU A 280 ? 0.5449 0.9274 0.4736 0.0025  -0.1562 -0.2178 256 GLU A OE2   
2030 N  N     . ARG A 281 ? 0.3725 0.4963 0.2223 0.0477  0.0079  -0.0350 257 ARG A N     
2031 C  CA    . ARG A 281 ? 0.4541 0.4180 0.2169 0.0317  -0.0067 0.0097  257 ARG A CA    
2032 C  C     . ARG A 281 ? 0.4545 0.4173 0.1899 0.0356  0.0267  0.0244  257 ARG A C     
2033 O  O     . ARG A 281 ? 0.5291 0.5725 0.0684 0.0379  0.0222  0.0506  257 ARG A O     
2034 C  CB    . ARG A 281 ? 0.4556 0.4017 0.2414 0.0407  0.0440  0.0125  257 ARG A CB    
2035 C  CG    . ARG A 281 ? 0.4357 0.4086 0.1986 0.0057  0.0872  -0.0658 257 ARG A CG    
2036 C  CD    . ARG A 281 ? 0.4671 0.3978 0.3280 -0.0144 0.0791  0.0197  257 ARG A CD    
2037 N  NE    . ARG A 281 ? 0.4739 0.4475 0.4153 -0.0094 0.0850  -0.0039 257 ARG A NE    
2038 C  CZ    . ARG A 281 ? 0.3856 0.4581 0.4181 -0.0157 0.0992  0.0470  257 ARG A CZ    
2039 N  NH1   . ARG A 281 ? 0.3918 0.6431 0.2828 -0.0854 0.1429  0.1386  257 ARG A NH1   
2040 N  NH2   . ARG A 281 ? 0.4464 0.5511 0.4662 0.0605  0.1416  0.0373  257 ARG A NH2   
2041 N  N     . TYR A 282 ? 0.5023 0.4207 0.1352 -0.0039 -0.0324 -0.0185 258 TYR A N     
2042 C  CA    . TYR A 282 ? 0.4975 0.3829 0.1392 0.0068  -0.0244 -0.0837 258 TYR A CA    
2043 C  C     . TYR A 282 ? 0.3838 0.3896 0.1774 0.0493  -0.1138 0.0434  258 TYR A C     
2044 O  O     . TYR A 282 ? 0.4718 0.3744 0.1500 0.0276  -0.0924 0.0428  258 TYR A O     
2045 C  CB    . TYR A 282 ? 0.5121 0.4514 0.2141 -0.0401 -0.0602 -0.0016 258 TYR A CB    
2046 C  CG    . TYR A 282 ? 0.5037 0.4559 0.2444 -0.0359 -0.0435 -0.0631 258 TYR A CG    
2047 C  CD1   . TYR A 282 ? 0.5293 0.4158 0.3058 -0.0889 -0.0627 -0.1519 258 TYR A CD1   
2048 C  CD2   . TYR A 282 ? 0.4902 0.4016 0.1774 -0.0584 -0.0555 -0.0761 258 TYR A CD2   
2049 C  CE1   . TYR A 282 ? 0.4913 0.4424 0.3661 -0.1387 -0.1233 -0.1096 258 TYR A CE1   
2050 C  CE2   . TYR A 282 ? 0.5519 0.3049 0.2590 -0.0939 -0.1055 -0.0961 258 TYR A CE2   
2051 C  CZ    . TYR A 282 ? 0.5278 0.4400 0.3090 -0.0569 -0.0890 -0.1384 258 TYR A CZ    
2052 O  OH    . TYR A 282 ? 0.6710 0.6283 0.2351 -0.0997 -0.0433 -0.2137 258 TYR A OH    
2053 N  N     . TYR A 283 ? 0.3973 0.3890 0.2221 0.0123  -0.1122 -0.0127 259 TYR A N     
2054 C  CA    . TYR A 283 ? 0.3561 0.3652 0.1329 0.0245  -0.0630 0.0115  259 TYR A CA    
2055 C  C     . TYR A 283 ? 0.3834 0.3469 0.1819 0.0735  -0.0062 -0.0204 259 TYR A C     
2056 O  O     . TYR A 283 ? 0.3623 0.3941 0.1421 0.0858  0.0041  -0.0172 259 TYR A O     
2057 C  CB    . TYR A 283 ? 0.3469 0.3745 0.2664 0.0401  -0.0206 0.0060  259 TYR A CB    
2058 C  CG    . TYR A 283 ? 0.4417 0.4106 0.3460 0.0758  0.0011  0.0551  259 TYR A CG    
2059 C  CD1   . TYR A 283 ? 0.4090 0.4753 0.3406 0.1185  0.0483  0.0274  259 TYR A CD1   
2060 C  CD2   . TYR A 283 ? 0.4154 0.5422 0.3313 0.0357  0.0162  0.0827  259 TYR A CD2   
2061 C  CE1   . TYR A 283 ? 0.4985 0.4590 0.3927 0.0814  0.0821  0.0805  259 TYR A CE1   
2062 C  CE2   . TYR A 283 ? 0.4974 0.5278 0.3503 0.0419  0.0654  0.1228  259 TYR A CE2   
2063 C  CZ    . TYR A 283 ? 0.5543 0.5079 0.4005 0.0545  0.0572  0.1118  259 TYR A CZ    
2064 O  OH    . TYR A 283 ? 0.5828 0.5363 0.4736 0.0431  0.0910  0.1863  259 TYR A OH    
2065 N  N     . VAL A 284 ? 0.4238 0.4671 0.1670 0.0687  -0.0307 0.0165  260 VAL A N     
2066 C  CA    . VAL A 284 ? 0.3873 0.4002 0.2819 0.0511  -0.0793 -0.0129 260 VAL A CA    
2067 C  C     . VAL A 284 ? 0.3815 0.2843 0.3205 0.0627  -0.0695 -0.0370 260 VAL A C     
2068 O  O     . VAL A 284 ? 0.3804 0.3633 0.1626 0.1046  -0.0793 -0.0435 260 VAL A O     
2069 C  CB    . VAL A 284 ? 0.4760 0.3775 0.3131 0.0096  -0.0685 0.0071  260 VAL A CB    
2070 C  CG1   . VAL A 284 ? 0.4470 0.4230 0.3918 0.0562  -0.1041 0.0111  260 VAL A CG1   
2071 C  CG2   . VAL A 284 ? 0.4184 0.4470 0.2280 0.0007  -0.0010 0.0049  260 VAL A CG2   
2072 N  N     . ASN A 285 ? 0.3397 0.3920 0.3686 0.0573  -0.0619 0.0014  261 ASN A N     
2073 C  CA    . ASN A 285 ? 0.3784 0.4709 0.2949 0.0828  -0.0483 -0.0090 261 ASN A CA    
2074 C  C     . ASN A 285 ? 0.4332 0.4582 0.3022 0.0504  -0.0335 -0.0258 261 ASN A C     
2075 O  O     . ASN A 285 ? 0.4616 0.5113 0.3001 0.0295  0.0000  -0.0206 261 ASN A O     
2076 C  CB    . ASN A 285 ? 0.3859 0.6088 0.3176 0.1082  -0.0512 0.0291  261 ASN A CB    
2077 C  CG    . ASN A 285 ? 0.5078 0.5975 0.3884 0.0521  0.0216  -0.0054 261 ASN A CG    
2078 O  OD1   . ASN A 285 ? 0.6105 0.6068 0.3955 0.0836  0.0389  0.0056  261 ASN A OD1   
2079 N  ND2   . ASN A 285 ? 0.4911 0.7255 0.1708 0.0152  -0.0807 -0.1436 261 ASN A ND2   
2080 N  N     . ALA A 286 ? 0.4481 0.4917 0.1951 0.0622  -0.0018 0.0154  262 ALA A N     
2081 C  CA    . ALA A 286 ? 0.4825 0.4501 0.2065 0.0692  -0.0366 0.0246  262 ALA A CA    
2082 C  C     . ALA A 286 ? 0.4120 0.4872 0.1328 0.0489  -0.0361 0.0024  262 ALA A C     
2083 O  O     . ALA A 286 ? 0.3901 0.5668 0.1707 0.0715  -0.0514 0.0066  262 ALA A O     
2084 C  CB    . ALA A 286 ? 0.4920 0.4568 0.1865 0.0775  -0.0626 0.0312  262 ALA A CB    
2085 N  N     . ILE A 287 ? 0.4472 0.3934 0.3421 0.0671  -0.0783 0.0052  263 ILE A N     
2086 C  CA    . ILE A 287 ? 0.4136 0.4531 0.3539 0.0787  -0.0251 -0.0001 263 ILE A CA    
2087 C  C     . ILE A 287 ? 0.3768 0.5004 0.2995 0.0683  0.0065  -0.0001 263 ILE A C     
2088 O  O     . ILE A 287 ? 0.4499 0.4940 0.3658 0.0181  0.0125  -0.0149 263 ILE A O     
2089 C  CB    . ILE A 287 ? 0.4289 0.4386 0.2335 0.0187  -0.0210 -0.0924 263 ILE A CB    
2090 C  CG1   . ILE A 287 ? 0.4721 0.4261 0.2268 0.0838  0.0019  -0.0257 263 ILE A CG1   
2091 C  CG2   . ILE A 287 ? 0.4129 0.5848 0.3438 -0.0401 -0.0671 -0.0896 263 ILE A CG2   
2092 C  CD1   . ILE A 287 ? 0.5858 0.5060 0.1325 0.0639  0.0617  -0.0426 263 ILE A CD1   
2093 N  N     . ARG A 288 ? 0.3516 0.5991 0.2533 0.0663  0.0520  0.0379  264 ARG A N     
2094 C  CA    . ARG A 288 ? 0.3708 0.5736 0.4355 0.0032  0.0452  -0.0406 264 ARG A CA    
2095 C  C     . ARG A 288 ? 0.4389 0.5894 0.4100 0.0451  -0.0196 -0.0274 264 ARG A C     
2096 O  O     . ARG A 288 ? 0.4595 0.5888 0.4122 0.1043  -0.0660 0.0158  264 ARG A O     
2097 C  CB    . ARG A 288 ? 0.4171 0.6794 0.5722 0.0504  0.0976  -0.0478 264 ARG A CB    
2098 C  CG    . ARG A 288 ? 0.5424 0.7887 0.6285 -0.0237 0.0584  -0.0805 264 ARG A CG    
2099 C  CD    . ARG A 288 ? 0.7073 1.1120 0.8233 -0.1556 0.1842  0.0791  264 ARG A CD    
2100 N  NE    . ARG A 288 ? 0.9458 1.2753 0.9737 -0.2515 0.0915  0.2388  264 ARG A NE    
2101 C  CZ    . ARG A 288 ? 1.0003 1.2819 1.1718 -0.3029 0.1812  0.3053  264 ARG A CZ    
2102 N  NH1   . ARG A 288 ? 1.0340 1.3649 1.6362 -0.2671 0.1601  0.1635  264 ARG A NH1   
2103 N  NH2   . ARG A 288 ? 0.9519 1.2229 1.1100 -0.3686 0.5025  0.4742  264 ARG A NH2   
2104 N  N     . ILE A 289 ? 0.5213 0.6585 0.4070 0.0235  -0.0255 -0.0777 265 ILE A N     
2105 C  CA    . ILE A 289 ? 0.5450 0.7502 0.4372 0.0004  -0.0151 0.0532  265 ILE A CA    
2106 C  C     . ILE A 289 ? 0.5445 0.7643 0.4236 -0.0340 -0.0166 0.0007  265 ILE A C     
2107 O  O     . ILE A 289 ? 0.5637 0.8145 0.2416 -0.0675 -0.0633 0.0022  265 ILE A O     
2108 C  CB    . ILE A 289 ? 0.5273 0.7922 0.5487 0.0331  -0.0496 0.0242  265 ILE A CB    
2109 C  CG1   . ILE A 289 ? 0.6392 0.6923 0.5616 0.0059  -0.1222 0.0280  265 ILE A CG1   
2110 C  CG2   . ILE A 289 ? 0.5094 0.7966 0.5337 0.0333  -0.0713 0.0363  265 ILE A CG2   
2111 C  CD1   . ILE A 289 ? 0.7090 0.6295 0.5662 0.0119  -0.0962 -0.0525 265 ILE A CD1   
2112 N  N     . ARG A 290 ? 0.5287 0.7125 0.4814 0.0232  -0.0145 -0.0074 266 ARG A N     
2113 C  CA    . ARG A 290 ? 0.5376 0.7016 0.5298 0.0170  -0.0354 -0.0310 266 ARG A CA    
2114 C  C     . ARG A 290 ? 0.4249 0.7494 0.5065 0.0160  0.0030  -0.0515 266 ARG A C     
2115 O  O     . ARG A 290 ? 0.3523 0.8017 0.3951 0.0702  0.0108  -0.1484 266 ARG A O     
2116 C  CB    . ARG A 290 ? 0.5737 0.6196 0.7007 -0.0271 0.0184  -0.0274 266 ARG A CB    
2117 C  CG    . ARG A 290 ? 0.6684 0.6656 0.8986 -0.0191 0.0749  -0.0831 266 ARG A CG    
2118 C  CD    . ARG A 290 ? 0.8536 0.8619 0.9760 0.0299  0.1053  0.0553  266 ARG A CD    
2119 N  NE    . ARG A 290 ? 1.1420 0.9388 1.0950 0.0653  0.2294  -0.0208 266 ARG A NE    
2120 C  CZ    . ARG A 290 ? 1.4266 1.0174 1.0931 -0.0140 0.2879  0.0485  266 ARG A CZ    
2121 N  NH1   . ARG A 290 ? 1.5403 1.0892 1.0879 -0.0899 0.2907  0.0749  266 ARG A NH1   
2122 N  NH2   . ARG A 290 ? 1.5261 0.9579 1.1152 -0.0241 0.3773  0.1108  266 ARG A NH2   
2123 N  N     . GLU A 291 ? 0.4085 0.7377 0.4339 0.0263  -0.0197 -0.0265 267 GLU A N     
2124 C  CA    . GLU A 291 ? 0.4201 0.6984 0.4996 0.0415  -0.0604 -0.0352 267 GLU A CA    
2125 C  C     . GLU A 291 ? 0.4172 0.5785 0.4126 0.0152  -0.0488 -0.0539 267 GLU A C     
2126 O  O     . GLU A 291 ? 0.4657 0.6475 0.3409 -0.0404 -0.1563 -0.1444 267 GLU A O     
2127 C  CB    . GLU A 291 ? 0.5544 0.7472 0.4580 0.0276  -0.0495 -0.0664 267 GLU A CB    
2128 C  CG    . GLU A 291 ? 0.5513 0.6266 0.5448 0.0613  -0.0879 -0.0336 267 GLU A CG    
2129 C  CD    . GLU A 291 ? 0.5546 0.6287 0.5511 0.1091  -0.1023 -0.0171 267 GLU A CD    
2130 O  OE1   . GLU A 291 ? 0.5579 0.7646 0.5841 0.1604  -0.2156 -0.0905 267 GLU A OE1   
2131 O  OE2   . GLU A 291 ? 0.5123 0.6601 0.3708 0.1335  -0.0531 0.0103  267 GLU A OE2   
2132 N  N     . VAL A 292 ? 0.4135 0.5667 0.4579 0.0106  0.0266  -0.0475 268 VAL A N     
2133 C  CA    . VAL A 292 ? 0.3833 0.5358 0.4080 -0.0228 -0.0132 -0.0523 268 VAL A CA    
2134 C  C     . VAL A 292 ? 0.4173 0.4952 0.4010 -0.0208 -0.0249 -0.0826 268 VAL A C     
2135 O  O     . VAL A 292 ? 0.5082 0.6203 0.3944 -0.0685 -0.0764 -0.1300 268 VAL A O     
2136 C  CB    . VAL A 292 ? 0.4187 0.5849 0.3938 0.0090  -0.0451 -0.0395 268 VAL A CB    
2137 C  CG1   . VAL A 292 ? 0.4090 0.5179 0.4100 -0.0329 0.0056  -0.0437 268 VAL A CG1   
2138 C  CG2   . VAL A 292 ? 0.4097 0.6320 0.3446 -0.0807 -0.1406 -0.1460 268 VAL A CG2   
2139 N  N     . VAL A 293 ? 0.3403 0.5259 0.3182 0.0234  -0.0374 -0.0556 269 VAL A N     
2140 C  CA    . VAL A 293 ? 0.2835 0.4650 0.3107 0.0194  -0.0524 -0.0437 269 VAL A CA    
2141 C  C     . VAL A 293 ? 0.2937 0.3647 0.2389 -0.0022 -0.0813 -0.0980 269 VAL A C     
2142 O  O     . VAL A 293 ? 0.3464 0.4223 0.1537 0.0164  -0.0868 -0.0694 269 VAL A O     
2143 C  CB    . VAL A 293 ? 0.3143 0.4791 0.2953 0.0555  0.0028  0.0029  269 VAL A CB    
2144 C  CG1   . VAL A 293 ? 0.2993 0.4210 0.2481 0.0742  -0.0569 -0.0008 269 VAL A CG1   
2145 C  CG2   . VAL A 293 ? 0.3546 0.4868 0.1516 0.0841  -0.0005 -0.0267 269 VAL A CG2   
2146 N  N     . ASP A 294 ? 0.2490 0.4032 0.2088 0.0520  -0.0739 -0.0499 270 ASP A N     
2147 C  CA    . ASP A 294 ? 0.2474 0.3889 0.1765 0.0199  -0.0574 -0.0623 270 ASP A CA    
2148 C  C     . ASP A 294 ? 0.2354 0.3106 0.1998 -0.0063 -0.0693 -0.0483 270 ASP A C     
2149 O  O     . ASP A 294 ? 0.3137 0.3372 0.2204 0.0118  -0.0683 -0.0799 270 ASP A O     
2150 C  CB    . ASP A 294 ? 0.2666 0.3537 0.2296 0.0356  -0.0726 -0.0210 270 ASP A CB    
2151 C  CG    . ASP A 294 ? 0.2617 0.3391 0.2327 -0.0145 -0.0498 -0.0265 270 ASP A CG    
2152 O  OD1   . ASP A 294 ? 0.3287 0.3508 0.1754 -0.0217 -0.0805 -0.0330 270 ASP A OD1   
2153 O  OD2   . ASP A 294 ? 0.3054 0.4224 0.3756 -0.0575 -0.0245 0.0034  270 ASP A OD2   
2154 N  N     . THR A 295 ? 0.2553 0.3335 0.1091 -0.0474 -0.0516 -0.0157 271 THR A N     
2155 C  CA    . THR A 295 ? 0.2223 0.3467 0.1588 -0.0103 -0.0793 0.0160  271 THR A CA    
2156 C  C     . THR A 295 ? 0.2246 0.3141 0.1739 0.0022  -0.0641 0.0258  271 THR A C     
2157 O  O     . THR A 295 ? 0.2610 0.3957 0.2016 -0.0279 -0.1000 0.0311  271 THR A O     
2158 C  CB    . THR A 295 ? 0.2556 0.3287 0.1880 -0.0103 -0.0443 0.0062  271 THR A CB    
2159 O  OG1   . THR A 295 ? 0.3511 0.3099 0.2182 0.0306  -0.0456 0.0246  271 THR A OG1   
2160 C  CG2   . THR A 295 ? 0.2537 0.3913 0.2052 -0.0199 -0.0426 0.0446  271 THR A CG2   
2161 N  N     . THR A 296 ? 0.2397 0.3002 0.1363 0.0070  -0.0832 0.0068  272 THR A N     
2162 C  CA    . THR A 296 ? 0.2497 0.2897 0.1225 -0.0013 -0.0784 0.0143  272 THR A CA    
2163 C  C     . THR A 296 ? 0.2520 0.2839 0.1340 0.0234  -0.0814 0.0062  272 THR A C     
2164 O  O     . THR A 296 ? 0.2632 0.2904 0.0712 0.0316  -0.0658 -0.0418 272 THR A O     
2165 C  CB    . THR A 296 ? 0.2794 0.2860 0.1276 0.0124  -0.0484 -0.0025 272 THR A CB    
2166 O  OG1   . THR A 296 ? 0.3298 0.2685 0.1798 -0.0081 -0.0468 0.0003  272 THR A OG1   
2167 C  CG2   . THR A 296 ? 0.2773 0.3075 0.0371 0.0191  -0.0535 0.0065  272 THR A CG2   
2168 N  N     . GLY A 297 ? 0.2489 0.3030 0.1318 0.0035  -0.0888 -0.0252 273 GLY A N     
2169 C  CA    . GLY A 297 ? 0.2591 0.2639 0.1507 -0.0027 -0.0355 -0.0258 273 GLY A CA    
2170 C  C     . GLY A 297 ? 0.2559 0.2247 0.1112 -0.0097 -0.0729 0.0462  273 GLY A C     
2171 O  O     . GLY A 297 ? 0.2669 0.2278 0.0873 -0.0009 -0.0918 0.0621  273 GLY A O     
2172 N  N     . ALA A 298 ? 0.1912 0.2774 0.0811 -0.0256 -0.0962 0.0137  274 ALA A N     
2173 C  CA    . ALA A 298 ? 0.1831 0.3180 0.1310 0.0096  -0.0558 0.0040  274 ALA A CA    
2174 C  C     . ALA A 298 ? 0.2170 0.2834 0.1242 0.0162  -0.0668 0.0310  274 ALA A C     
2175 O  O     . ALA A 298 ? 0.2713 0.2891 0.1286 0.0244  -0.0879 0.0364  274 ALA A O     
2176 C  CB    . ALA A 298 ? 0.2165 0.3001 0.1268 0.0103  -0.0367 0.0085  274 ALA A CB    
2177 N  N     . GLY A 299 ? 0.1919 0.2850 0.1218 0.0082  -0.0516 0.0368  275 GLY A N     
2178 C  CA    . GLY A 299 ? 0.2274 0.3115 0.1410 -0.0016 -0.0822 -0.0140 275 GLY A CA    
2179 C  C     . GLY A 299 ? 0.2775 0.2359 0.1405 0.0134  -0.0800 0.0136  275 GLY A C     
2180 O  O     . GLY A 299 ? 0.3087 0.2537 0.1264 0.0196  -0.1005 0.0255  275 GLY A O     
2181 N  N     . ASP A 300 ? 0.2792 0.2332 0.1766 -0.0017 -0.0193 -0.0035 276 ASP A N     
2182 C  CA    . ASP A 300 ? 0.2935 0.2524 0.1410 -0.0123 -0.0339 0.0130  276 ASP A CA    
2183 C  C     . ASP A 300 ? 0.2248 0.2308 0.1580 -0.0138 -0.0578 0.0217  276 ASP A C     
2184 O  O     . ASP A 300 ? 0.2752 0.2676 0.0977 0.0517  -0.1135 -0.0150 276 ASP A O     
2185 C  CB    . ASP A 300 ? 0.2662 0.2986 0.1356 -0.0200 -0.0200 0.0043  276 ASP A CB    
2186 C  CG    . ASP A 300 ? 0.3130 0.2850 0.1238 -0.0130 -0.0589 0.0033  276 ASP A CG    
2187 O  OD1   . ASP A 300 ? 0.3510 0.3209 0.0303 0.0000  -0.0133 0.0154  276 ASP A OD1   
2188 O  OD2   . ASP A 300 ? 0.3179 0.2915 0.1205 -0.0303 -0.0710 0.0234  276 ASP A OD2   
2189 N  N     . LEU A 301 ? 0.2316 0.2658 0.1000 0.0289  -0.0367 0.0431  277 LEU A N     
2190 C  CA    . LEU A 301 ? 0.2721 0.2512 0.1010 0.0080  -0.0221 0.0163  277 LEU A CA    
2191 C  C     . LEU A 301 ? 0.2575 0.2452 0.1076 0.0466  -0.0099 0.0222  277 LEU A C     
2192 O  O     . LEU A 301 ? 0.2798 0.2781 0.0768 -0.0080 -0.0677 -0.0083 277 LEU A O     
2193 C  CB    . LEU A 301 ? 0.2144 0.2181 0.1802 0.0064  -0.0007 0.0338  277 LEU A CB    
2194 C  CG    . LEU A 301 ? 0.2233 0.2338 0.1080 0.0149  -0.0278 0.0054  277 LEU A CG    
2195 C  CD1   . LEU A 301 ? 0.2961 0.2174 0.1634 0.0143  -0.0199 0.0206  277 LEU A CD1   
2196 C  CD2   . LEU A 301 ? 0.2292 0.2204 0.1092 0.0512  -0.0717 -0.0305 277 LEU A CD2   
2197 N  N     . PHE A 302 ? 0.2765 0.2616 0.0903 0.0878  0.0067  0.0659  278 PHE A N     
2198 C  CA    . PHE A 302 ? 0.2991 0.2866 0.0810 0.0131  -0.0469 0.0568  278 PHE A CA    
2199 C  C     . PHE A 302 ? 0.2818 0.2893 0.0876 0.0269  -0.0242 0.0257  278 PHE A C     
2200 O  O     . PHE A 302 ? 0.2860 0.2589 0.0844 0.0040  -0.0949 0.0120  278 PHE A O     
2201 C  CB    . PHE A 302 ? 0.3283 0.2596 0.0781 0.0375  -0.0512 0.0124  278 PHE A CB    
2202 C  CG    . PHE A 302 ? 0.2658 0.2579 0.0936 0.0129  -0.0345 0.0505  278 PHE A CG    
2203 C  CD1   . PHE A 302 ? 0.2789 0.2708 0.1270 -0.0179 -0.0152 0.0407  278 PHE A CD1   
2204 C  CD2   . PHE A 302 ? 0.2710 0.2854 0.0948 -0.0082 -0.0454 0.0493  278 PHE A CD2   
2205 C  CE1   . PHE A 302 ? 0.2966 0.3577 0.1319 0.0415  -0.0146 0.0567  278 PHE A CE1   
2206 C  CE2   . PHE A 302 ? 0.2542 0.3320 0.0976 -0.0261 -0.0117 0.0593  278 PHE A CE2   
2207 C  CZ    . PHE A 302 ? 0.2792 0.3526 0.0611 -0.0028 -0.0210 0.0326  278 PHE A CZ    
2208 N  N     . ALA A 303 ? 0.2625 0.3098 0.0468 0.0346  -0.0547 0.0401  279 ALA A N     
2209 C  CA    . ALA A 303 ? 0.2757 0.2396 0.0914 0.0120  -0.0269 -0.0041 279 ALA A CA    
2210 C  C     . ALA A 303 ? 0.2673 0.2272 0.0973 0.0459  -0.0492 0.0418  279 ALA A C     
2211 O  O     . ALA A 303 ? 0.3640 0.3054 0.0818 0.0744  -0.1182 0.0374  279 ALA A O     
2212 C  CB    . ALA A 303 ? 0.2972 0.3185 0.0305 0.0413  -0.0346 -0.0198 279 ALA A CB    
2213 N  N     . SER A 304 ? 0.2722 0.1968 0.1411 0.0403  -0.0522 0.0765  280 SER A N     
2214 C  CA    . SER A 304 ? 0.2830 0.1845 0.1432 0.0477  -0.0733 0.0530  280 SER A CA    
2215 C  C     . SER A 304 ? 0.3249 0.3188 0.1278 0.0270  -0.0600 0.0579  280 SER A C     
2216 O  O     . SER A 304 ? 0.3569 0.3689 0.0886 0.0194  -0.1191 0.0768  280 SER A O     
2217 C  CB    . SER A 304 ? 0.2268 0.2318 0.1394 0.0736  -0.0582 0.0464  280 SER A CB    
2218 O  OG    . SER A 304 ? 0.2940 0.2564 0.0975 0.0559  -0.0814 -0.0006 280 SER A OG    
2219 N  N     . GLY A 305 ? 0.3095 0.3738 0.0889 0.0444  -0.0587 0.1234  281 GLY A N     
2220 C  CA    . GLY A 305 ? 0.3044 0.3770 0.1785 0.0818  -0.0695 0.0550  281 GLY A CA    
2221 C  C     . GLY A 305 ? 0.3539 0.2672 0.1554 0.0679  -0.0735 0.0022  281 GLY A C     
2222 O  O     . GLY A 305 ? 0.3417 0.3848 0.0441 0.0274  -0.0737 -0.0303 281 GLY A O     
2223 N  N     . PHE A 306 ? 0.3322 0.2774 0.1729 0.0607  -0.0714 0.0526  282 PHE A N     
2224 C  CA    . PHE A 306 ? 0.3133 0.3046 0.1261 0.0412  -0.0421 0.0356  282 PHE A CA    
2225 C  C     . PHE A 306 ? 0.3330 0.3188 0.1464 0.0324  -0.0289 0.0024  282 PHE A C     
2226 O  O     . PHE A 306 ? 0.3585 0.2651 0.1172 0.0208  -0.0326 0.0431  282 PHE A O     
2227 C  CB    . PHE A 306 ? 0.3081 0.2910 0.0900 0.0264  -0.0646 -0.0498 282 PHE A CB    
2228 C  CG    . PHE A 306 ? 0.3482 0.2978 0.1340 0.0520  -0.0557 0.0242  282 PHE A CG    
2229 C  CD1   . PHE A 306 ? 0.3336 0.2972 0.1738 0.0968  -0.0544 0.0134  282 PHE A CD1   
2230 C  CD2   . PHE A 306 ? 0.4286 0.3165 0.2111 0.0145  -0.0221 0.0306  282 PHE A CD2   
2231 C  CE1   . PHE A 306 ? 0.3451 0.3140 0.1553 0.0162  -0.1097 -0.0357 282 PHE A CE1   
2232 C  CE2   . PHE A 306 ? 0.3733 0.3544 0.1983 -0.0014 -0.0661 -0.0360 282 PHE A CE2   
2233 C  CZ    . PHE A 306 ? 0.3487 0.3788 0.1128 0.0426  -0.0615 -0.0499 282 PHE A CZ    
2234 N  N     . LEU A 307 ? 0.3379 0.3157 0.0557 -0.0001 -0.0798 0.0056  283 LEU A N     
2235 C  CA    . LEU A 307 ? 0.3153 0.2165 0.1287 0.0160  -0.0312 0.0809  283 LEU A CA    
2236 C  C     . LEU A 307 ? 0.2684 0.2346 0.1397 0.0384  -0.0500 -0.0180 283 LEU A C     
2237 O  O     . LEU A 307 ? 0.2953 0.2602 0.0728 -0.0019 -0.0389 0.0141  283 LEU A O     
2238 C  CB    . LEU A 307 ? 0.3558 0.2360 0.0488 0.0046  -0.0769 -0.0021 283 LEU A CB    
2239 C  CG    . LEU A 307 ? 0.3462 0.2433 0.1030 0.0265  -0.0661 0.0473  283 LEU A CG    
2240 C  CD1   . LEU A 307 ? 0.3846 0.3176 0.1212 -0.0037 -0.0520 0.0391  283 LEU A CD1   
2241 C  CD2   . LEU A 307 ? 0.3164 0.2034 0.1672 0.0294  -0.1127 0.0669  283 LEU A CD2   
2242 N  N     . TYR A 308 ? 0.3352 0.2594 0.0830 0.0543  -0.0990 -0.0207 284 TYR A N     
2243 C  CA    . TYR A 308 ? 0.2763 0.2851 0.1331 0.0636  -0.0971 -0.0216 284 TYR A CA    
2244 C  C     . TYR A 308 ? 0.3425 0.3170 0.1387 0.0388  -0.0488 0.0027  284 TYR A C     
2245 O  O     . TYR A 308 ? 0.4218 0.2921 0.1222 0.0413  -0.0662 0.0137  284 TYR A O     
2246 C  CB    . TYR A 308 ? 0.3142 0.2378 0.1112 0.0668  -0.0720 0.0787  284 TYR A CB    
2247 C  CG    . TYR A 308 ? 0.3202 0.2774 0.1449 0.0952  -0.0526 0.0327  284 TYR A CG    
2248 C  CD1   . TYR A 308 ? 0.4235 0.2566 0.1797 0.0781  -0.0536 0.0435  284 TYR A CD1   
2249 C  CD2   . TYR A 308 ? 0.3422 0.3732 0.2449 0.0776  0.0057  0.0741  284 TYR A CD2   
2250 C  CE1   . TYR A 308 ? 0.4291 0.3400 0.1950 0.1448  -0.0532 -0.0223 284 TYR A CE1   
2251 C  CE2   . TYR A 308 ? 0.5038 0.3624 0.3621 0.0816  -0.0406 0.0251  284 TYR A CE2   
2252 C  CZ    . TYR A 308 ? 0.4548 0.4036 0.2258 0.0558  -0.0225 -0.0438 284 TYR A CZ    
2253 O  OH    . TYR A 308 ? 0.5884 0.4189 0.1528 0.0866  0.0046  -0.0040 284 TYR A OH    
2254 N  N     . GLY A 309 ? 0.2621 0.3869 0.1095 0.0467  -0.1232 -0.0151 285 GLY A N     
2255 C  CA    . GLY A 309 ? 0.3634 0.3507 0.1590 0.0417  -0.0337 -0.0573 285 GLY A CA    
2256 C  C     . GLY A 309 ? 0.3982 0.2970 0.1839 0.0359  -0.0667 -0.0544 285 GLY A C     
2257 O  O     . GLY A 309 ? 0.5045 0.3506 0.0635 0.1176  -0.1310 -0.0435 285 GLY A O     
2258 N  N     . TYR A 310 ? 0.3429 0.3014 0.2174 0.0228  -0.0528 -0.0012 286 TYR A N     
2259 C  CA    . TYR A 310 ? 0.3148 0.2754 0.2763 0.0570  -0.0344 0.0076  286 TYR A CA    
2260 C  C     . TYR A 310 ? 0.3604 0.2933 0.1758 0.0403  -0.0827 0.0277  286 TYR A C     
2261 O  O     . TYR A 310 ? 0.4781 0.3233 0.1739 0.0840  -0.1376 0.0490  286 TYR A O     
2262 C  CB    . TYR A 310 ? 0.2145 0.2572 0.1895 0.0262  -0.0508 0.0030  286 TYR A CB    
2263 C  CG    . TYR A 310 ? 0.2960 0.2906 0.0901 0.0277  -0.0487 0.0021  286 TYR A CG    
2264 C  CD1   . TYR A 310 ? 0.3932 0.3552 0.1271 0.0310  -0.0136 0.0254  286 TYR A CD1   
2265 C  CD2   . TYR A 310 ? 0.3064 0.3429 0.0439 0.0262  -0.0259 0.0136  286 TYR A CD2   
2266 C  CE1   . TYR A 310 ? 0.4081 0.4265 0.0274 0.0068  -0.0230 -0.0178 286 TYR A CE1   
2267 C  CE2   . TYR A 310 ? 0.3255 0.4157 0.1898 0.0461  -0.0861 0.0202  286 TYR A CE2   
2268 C  CZ    . TYR A 310 ? 0.3967 0.5061 0.0648 0.0086  -0.0575 -0.0562 286 TYR A CZ    
2269 O  OH    . TYR A 310 ? 0.4814 0.6408 0.1405 0.0219  -0.1556 -0.1015 286 TYR A OH    
2270 N  N     . THR A 311 ? 0.3010 0.3363 0.1196 0.0100  -0.1283 0.0202  287 THR A N     
2271 C  CA    . THR A 311 ? 0.3384 0.2649 0.1097 0.0385  -0.1142 0.0538  287 THR A CA    
2272 C  C     . THR A 311 ? 0.3835 0.3220 0.0821 0.0638  -0.1305 -0.0160 287 THR A C     
2273 O  O     . THR A 311 ? 0.5617 0.3341 0.2142 0.0084  -0.0459 -0.0855 287 THR A O     
2274 C  CB    . THR A 311 ? 0.3361 0.2686 0.1669 0.0345  -0.0391 -0.0244 287 THR A CB    
2275 O  OG1   . THR A 311 ? 0.3674 0.2784 0.2220 0.0262  -0.0773 0.0015  287 THR A OG1   
2276 C  CG2   . THR A 311 ? 0.3383 0.2487 0.1353 0.0090  -0.0394 -0.0712 287 THR A CG2   
2277 N  N     . GLN A 312 ? 0.3875 0.3807 0.0425 0.0765  -0.0768 -0.0334 288 GLN A N     
2278 C  CA    . GLN A 312 ? 0.4936 0.3760 0.1694 0.0863  -0.0611 -0.0583 288 GLN A CA    
2279 C  C     . GLN A 312 ? 0.5086 0.3874 0.2141 0.0671  0.0217  -0.0281 288 GLN A C     
2280 O  O     . GLN A 312 ? 0.6035 0.4432 0.2555 0.0626  0.0097  -0.1297 288 GLN A O     
2281 C  CB    . GLN A 312 ? 0.4240 0.4593 0.2719 0.0810  -0.0060 -0.0556 288 GLN A CB    
2282 C  CG    . GLN A 312 ? 0.5877 0.3411 0.2353 0.0265  -0.0656 -0.1013 288 GLN A CG    
2283 C  CD    . GLN A 312 ? 0.5795 0.4067 0.3864 0.0210  0.0192  -0.0562 288 GLN A CD    
2284 O  OE1   . GLN A 312 ? 0.5193 0.5084 0.5890 0.1667  0.1086  -0.0660 288 GLN A OE1   
2285 N  NE2   . GLN A 312 ? 0.6717 0.3635 0.3606 0.0373  -0.0677 -0.0525 288 GLN A NE2   
2286 N  N     . GLY A 313 ? 0.4392 0.3574 0.1334 -0.0099 -0.1056 -0.0351 289 GLY A N     
2287 C  CA    . GLY A 313 ? 0.5154 0.4182 0.1818 0.0281  0.0569  -0.0027 289 GLY A CA    
2288 C  C     . GLY A 313 ? 0.4764 0.3319 0.1614 0.0287  0.0008  -0.0243 289 GLY A C     
2289 O  O     . GLY A 313 ? 0.6175 0.4217 0.1299 0.0647  -0.0020 -0.0525 289 GLY A O     
2290 N  N     . ARG A 314 ? 0.4882 0.3977 0.1849 0.0255  0.0071  -0.0543 290 ARG A N     
2291 C  CA    . ARG A 314 ? 0.4326 0.3850 0.1828 0.0411  -0.0695 -0.0210 290 ARG A CA    
2292 C  C     . ARG A 314 ? 0.4003 0.3629 0.2013 0.0440  -0.0438 -0.0401 290 ARG A C     
2293 O  O     . ARG A 314 ? 0.4582 0.3022 0.1117 0.0769  -0.0111 -0.0253 290 ARG A O     
2294 C  CB    . ARG A 314 ? 0.4016 0.4548 0.1933 0.0233  -0.0698 0.0148  290 ARG A CB    
2295 C  CG    . ARG A 314 ? 0.4653 0.4423 0.2766 0.0518  -0.0559 0.0219  290 ARG A CG    
2296 C  CD    . ARG A 314 ? 0.4597 0.5134 0.1181 0.0235  -0.0532 -0.0100 290 ARG A CD    
2297 N  NE    . ARG A 314 ? 0.4202 0.6025 0.2660 0.0920  -0.0476 -0.0496 290 ARG A NE    
2298 C  CZ    . ARG A 314 ? 0.3724 0.6072 0.2626 0.1074  -0.0043 -0.0346 290 ARG A CZ    
2299 N  NH1   . ARG A 314 ? 0.4445 0.7339 0.3007 0.0374  0.1365  -0.1100 290 ARG A NH1   
2300 N  NH2   . ARG A 314 ? 0.4080 0.5936 0.1740 0.1115  -0.0196 -0.0861 290 ARG A NH2   
2301 N  N     . SER A 315 ? 0.3488 0.3768 0.1425 0.0292  -0.1055 -0.0137 291 SER A N     
2302 C  CA    . SER A 315 ? 0.3985 0.3277 0.2355 -0.0243 -0.0482 -0.0590 291 SER A CA    
2303 C  C     . SER A 315 ? 0.4367 0.3345 0.1804 0.0169  -0.0395 -0.0278 291 SER A C     
2304 O  O     . SER A 315 ? 0.3736 0.3500 0.1546 -0.0053 -0.0320 -0.0012 291 SER A O     
2305 C  CB    . SER A 315 ? 0.3358 0.4154 0.3342 0.0161  -0.0598 -0.1082 291 SER A CB    
2306 O  OG    . SER A 315 ? 0.4374 0.4648 0.2522 0.0154  -0.0893 -0.1813 291 SER A OG    
2307 N  N     . LEU A 316 ? 0.4127 0.3495 0.2348 0.0527  -0.1063 -0.0156 292 LEU A N     
2308 C  CA    . LEU A 316 ? 0.4057 0.3533 0.2107 0.0439  -0.0430 -0.0195 292 LEU A CA    
2309 C  C     . LEU A 316 ? 0.3965 0.3577 0.2074 0.0379  -0.0173 -0.0290 292 LEU A C     
2310 O  O     . LEU A 316 ? 0.4561 0.3748 0.2200 0.0499  0.0132  -0.0590 292 LEU A O     
2311 C  CB    . LEU A 316 ? 0.3746 0.3538 0.2724 0.0230  -0.0586 -0.0099 292 LEU A CB    
2312 C  CG    . LEU A 316 ? 0.3609 0.3912 0.1743 0.0421  -0.0529 0.0540  292 LEU A CG    
2313 C  CD1   . LEU A 316 ? 0.3978 0.3680 0.1550 0.0359  -0.1150 -0.0021 292 LEU A CD1   
2314 C  CD2   . LEU A 316 ? 0.4013 0.4202 0.1161 0.0577  -0.0658 0.0444  292 LEU A CD2   
2315 N  N     . GLU A 317 ? 0.3637 0.4009 0.2425 0.0391  -0.0202 0.0230  293 GLU A N     
2316 C  CA    . GLU A 317 ? 0.3816 0.3888 0.1832 0.0412  -0.0358 0.0237  293 GLU A CA    
2317 C  C     . GLU A 317 ? 0.3953 0.3320 0.2333 0.0577  -0.0424 0.0248  293 GLU A C     
2318 O  O     . GLU A 317 ? 0.3885 0.3996 0.2304 0.0016  0.0007  -0.0088 293 GLU A O     
2319 C  CB    . GLU A 317 ? 0.4166 0.4151 0.2985 -0.0161 0.0361  0.0094  293 GLU A CB    
2320 C  CG    . GLU A 317 ? 0.4232 0.5036 0.3056 0.0101  -0.0282 0.0116  293 GLU A CG    
2321 C  CD    . GLU A 317 ? 0.4763 0.6339 0.4010 0.0284  0.0361  0.0149  293 GLU A CD    
2322 O  OE1   . GLU A 317 ? 0.5900 0.7512 0.1480 0.0518  -0.1017 -0.0164 293 GLU A OE1   
2323 O  OE2   . GLU A 317 ? 0.6502 0.7513 0.4009 -0.0792 0.0492  0.0124  293 GLU A OE2   
2324 N  N     . ASP A 318 ? 0.4288 0.3455 0.2068 0.0152  -0.0693 0.0567  294 ASP A N     
2325 C  CA    . ASP A 318 ? 0.4558 0.2979 0.1795 0.0468  0.0329  0.0396  294 ASP A CA    
2326 C  C     . ASP A 318 ? 0.3413 0.3601 0.2141 0.0539  0.0202  0.0075  294 ASP A C     
2327 O  O     . ASP A 318 ? 0.2395 0.3627 0.2364 0.1006  0.0094  0.0139  294 ASP A O     
2328 C  CB    . ASP A 318 ? 0.5336 0.3204 0.0860 0.0164  0.0217  0.0536  294 ASP A CB    
2329 C  CG    . ASP A 318 ? 0.5071 0.3617 0.2011 0.0170  0.0024  -0.0681 294 ASP A CG    
2330 O  OD1   . ASP A 318 ? 0.5211 0.4729 0.2348 -0.0224 0.0605  -0.1179 294 ASP A OD1   
2331 O  OD2   . ASP A 318 ? 0.6272 0.3708 0.1979 0.1147  -0.0561 -0.0785 294 ASP A OD2   
2332 N  N     . CYS A 319 ? 0.2993 0.3737 0.2308 -0.0009 0.0061  -0.0285 295 CYS A N     
2333 C  CA    . CYS A 319 ? 0.2448 0.3571 0.2745 0.0516  -0.0076 -0.0091 295 CYS A CA    
2334 C  C     . CYS A 319 ? 0.2623 0.2964 0.2498 0.0572  0.0172  -0.0065 295 CYS A C     
2335 O  O     . CYS A 319 ? 0.2946 0.3360 0.2550 0.0189  0.0836  -0.0424 295 CYS A O     
2336 C  CB    . CYS A 319 ? 0.2776 0.3766 0.1955 0.0024  -0.0817 0.0128  295 CYS A CB    
2337 S  SG    . CYS A 319 ? 0.3698 0.3930 0.1088 -0.0082 -0.0751 0.0005  295 CYS A SG    
2338 N  N     . GLY A 320 ? 0.3398 0.2869 0.2361 -0.0002 -0.0501 -0.0353 296 GLY A N     
2339 C  CA    . GLY A 320 ? 0.2666 0.3270 0.1753 -0.0186 -0.0601 0.0114  296 GLY A CA    
2340 C  C     . GLY A 320 ? 0.2759 0.3103 0.2516 0.0890  -0.0173 -0.0327 296 GLY A C     
2341 O  O     . GLY A 320 ? 0.3517 0.3531 0.2198 0.0824  -0.0469 0.0153  296 GLY A O     
2342 N  N     . LYS A 321 ? 0.2950 0.3772 0.2335 0.0713  0.0354  -0.0671 297 LYS A N     
2343 C  CA    . LYS A 321 ? 0.3756 0.2878 0.2248 0.0621  0.0162  -0.0117 297 LYS A CA    
2344 C  C     . LYS A 321 ? 0.3056 0.2805 0.2145 0.0081  0.0162  -0.0306 297 LYS A C     
2345 O  O     . LYS A 321 ? 0.3332 0.3756 0.2028 0.0305  0.0031  0.0377  297 LYS A O     
2346 C  CB    . LYS A 321 ? 0.3379 0.2614 0.2809 0.0513  0.0572  0.0071  297 LYS A CB    
2347 C  CG    . LYS A 321 ? 0.4478 0.3121 0.2751 0.0506  0.0776  0.0179  297 LYS A CG    
2348 C  CD    . LYS A 321 ? 0.4716 0.3602 0.2787 0.0375  0.0732  -0.0257 297 LYS A CD    
2349 C  CE    . LYS A 321 ? 0.5032 0.4785 0.2770 0.0123  0.0405  0.0285  297 LYS A CE    
2350 N  NZ    . LYS A 321 ? 0.5957 0.6378 0.1533 -0.0006 0.0340  -0.0855 297 LYS A NZ    
2351 N  N     . LEU A 322 ? 0.2711 0.3308 0.1747 0.0434  0.0284  -0.0224 298 LEU A N     
2352 C  CA    . LEU A 322 ? 0.3343 0.2613 0.2156 0.0061  0.0072  0.0030  298 LEU A CA    
2353 C  C     . LEU A 322 ? 0.3368 0.2234 0.2007 0.0088  0.0202  0.0145  298 LEU A C     
2354 O  O     . LEU A 322 ? 0.3604 0.2802 0.1818 -0.0124 0.0875  0.0409  298 LEU A O     
2355 C  CB    . LEU A 322 ? 0.3270 0.2317 0.1673 0.0523  -0.0506 -0.0203 298 LEU A CB    
2356 C  CG    . LEU A 322 ? 0.2772 0.2544 0.2226 0.1033  -0.0669 -0.0179 298 LEU A CG    
2357 C  CD1   . LEU A 322 ? 0.3520 0.2862 0.2775 0.0230  -0.0617 -0.0176 298 LEU A CD1   
2358 C  CD2   . LEU A 322 ? 0.3743 0.2810 0.1952 0.0491  -0.1172 0.0111  298 LEU A CD2   
2359 N  N     . GLY A 323 ? 0.2972 0.2372 0.1687 0.0231  -0.0385 -0.0696 299 GLY A N     
2360 C  CA    . GLY A 323 ? 0.3572 0.2454 0.1617 0.0716  -0.0273 -0.0372 299 GLY A CA    
2361 C  C     . GLY A 323 ? 0.3259 0.2554 0.1834 0.0193  0.0076  0.0133  299 GLY A C     
2362 O  O     . GLY A 323 ? 0.3275 0.2924 0.1774 0.0349  -0.0419 0.0187  299 GLY A O     
2363 N  N     . CYS A 324 ? 0.3410 0.3149 0.0831 0.0137  -0.0347 0.0646  300 CYS A N     
2364 C  CA    . CYS A 324 ? 0.2982 0.3709 0.1788 0.0468  -0.0463 0.0372  300 CYS A CA    
2365 C  C     . CYS A 324 ? 0.3110 0.3050 0.1712 0.0469  -0.0277 0.0217  300 CYS A C     
2366 O  O     . CYS A 324 ? 0.3269 0.3178 0.1879 0.0919  -0.0754 0.0278  300 CYS A O     
2367 C  CB    . CYS A 324 ? 0.3364 0.4212 0.1105 0.0425  -0.0613 0.0207  300 CYS A CB    
2368 S  SG    . CYS A 324 ? 0.4468 0.4167 0.1906 0.0589  -0.0648 0.0313  300 CYS A SG    
2369 N  N     . LEU A 325 ? 0.3031 0.3093 0.1332 0.0313  -0.0624 0.0061  301 LEU A N     
2370 C  CA    . LEU A 325 ? 0.3789 0.2707 0.1598 0.0311  -0.0192 0.0217  301 LEU A CA    
2371 C  C     . LEU A 325 ? 0.2767 0.3509 0.1753 0.0202  -0.0253 0.0323  301 LEU A C     
2372 O  O     . LEU A 325 ? 0.2856 0.4324 0.1810 0.0314  -0.0373 0.0144  301 LEU A O     
2373 C  CB    . LEU A 325 ? 0.3807 0.2734 0.2261 0.0605  0.0079  -0.0029 301 LEU A CB    
2374 C  CG    . LEU A 325 ? 0.3079 0.2841 0.2763 0.0586  -0.0146 -0.0025 301 LEU A CG    
2375 C  CD1   . LEU A 325 ? 0.3022 0.4330 0.2246 0.0705  -0.0633 0.0637  301 LEU A CD1   
2376 C  CD2   . LEU A 325 ? 0.4250 0.2888 0.2725 -0.0226 0.0246  0.0187  301 LEU A CD2   
2377 N  N     . ALA A 326 ? 0.3047 0.3150 0.1463 -0.0179 0.0041  0.0122  302 ALA A N     
2378 C  CA    . ALA A 326 ? 0.1998 0.3443 0.2065 -0.0157 0.0099  -0.0082 302 ALA A CA    
2379 C  C     . ALA A 326 ? 0.2712 0.2994 0.1602 0.0028  -0.0140 0.0314  302 ALA A C     
2380 O  O     . ALA A 326 ? 0.1978 0.2839 0.1507 0.0152  -0.0266 0.0307  302 ALA A O     
2381 C  CB    . ALA A 326 ? 0.2281 0.2845 0.2026 -0.0568 -0.0212 -0.0438 302 ALA A CB    
2382 N  N     . ALA A 327 ? 0.2690 0.2767 0.1476 0.0304  -0.0410 0.0136  303 ALA A N     
2383 C  CA    . ALA A 327 ? 0.2723 0.2943 0.2008 0.0228  -0.0546 -0.0080 303 ALA A CA    
2384 C  C     . ALA A 327 ? 0.2612 0.3183 0.1776 0.0320  -0.0355 -0.0035 303 ALA A C     
2385 O  O     . ALA A 327 ? 0.2334 0.2995 0.1672 0.0179  -0.1204 0.0088  303 ALA A O     
2386 C  CB    . ALA A 327 ? 0.3743 0.3565 0.0575 -0.0013 -0.0823 -0.0145 303 ALA A CB    
2387 N  N     . GLY A 328 ? 0.2318 0.3413 0.1776 0.0403  -0.0313 0.0374  304 GLY A N     
2388 C  CA    . GLY A 328 ? 0.2579 0.3447 0.1648 0.0058  -0.0683 0.0361  304 GLY A CA    
2389 C  C     . GLY A 328 ? 0.2511 0.3038 0.1781 0.0166  -0.0373 0.0358  304 GLY A C     
2390 O  O     . GLY A 328 ? 0.3354 0.3867 0.0952 0.0065  -0.0265 -0.0021 304 GLY A O     
2391 N  N     . ILE A 329 ? 0.2858 0.2538 0.1842 0.0587  -0.0126 0.0607  305 ILE A N     
2392 C  CA    . ILE A 329 ? 0.3006 0.2606 0.1560 0.0619  -0.0302 0.0435  305 ILE A CA    
2393 C  C     . ILE A 329 ? 0.2366 0.3011 0.1685 0.0557  -0.0337 0.0368  305 ILE A C     
2394 O  O     . ILE A 329 ? 0.2790 0.4036 0.2019 0.0654  -0.0832 0.0241  305 ILE A O     
2395 C  CB    . ILE A 329 ? 0.3274 0.2605 0.2190 0.0730  -0.0051 0.0181  305 ILE A CB    
2396 C  CG1   . ILE A 329 ? 0.3163 0.2891 0.1936 0.0681  -0.0526 -0.0359 305 ILE A CG1   
2397 C  CG2   . ILE A 329 ? 0.3356 0.3091 0.1709 0.0694  -0.0402 0.0060  305 ILE A CG2   
2398 C  CD1   . ILE A 329 ? 0.3149 0.2845 0.2464 0.0269  -0.0453 -0.0055 305 ILE A CD1   
2399 N  N     . VAL A 330 ? 0.2135 0.3205 0.1557 0.0353  -0.0540 0.0000  306 VAL A N     
2400 C  CA    . VAL A 330 ? 0.2020 0.3358 0.1936 0.0459  -0.0310 0.0050  306 VAL A CA    
2401 C  C     . VAL A 330 ? 0.2149 0.3404 0.2178 0.0162  -0.0297 0.0163  306 VAL A C     
2402 O  O     . VAL A 330 ? 0.2534 0.4203 0.1983 0.0252  -0.0563 0.0445  306 VAL A O     
2403 C  CB    . VAL A 330 ? 0.2037 0.2965 0.2311 0.0405  -0.0289 0.0245  306 VAL A CB    
2404 C  CG1   . VAL A 330 ? 0.2146 0.2920 0.1191 0.0530  -0.0940 0.0042  306 VAL A CG1   
2405 C  CG2   . VAL A 330 ? 0.2316 0.2869 0.1892 -0.0045 -0.0424 -0.0236 306 VAL A CG2   
2406 N  N     . ILE A 331 ? 0.2397 0.3126 0.1851 0.0367  -0.0617 0.0621  307 ILE A N     
2407 C  CA    . ILE A 331 ? 0.2371 0.3174 0.2208 0.0291  -0.0643 0.0489  307 ILE A CA    
2408 C  C     . ILE A 331 ? 0.2294 0.3576 0.2126 0.0185  -0.0597 0.0407  307 ILE A C     
2409 O  O     . ILE A 331 ? 0.2607 0.3932 0.1482 0.0527  -0.0836 0.0164  307 ILE A O     
2410 C  CB    . ILE A 331 ? 0.2485 0.3311 0.1829 -0.0102 -0.0510 0.0375  307 ILE A CB    
2411 C  CG1   . ILE A 331 ? 0.2536 0.3798 0.2599 -0.0078 -0.0335 0.0382  307 ILE A CG1   
2412 C  CG2   . ILE A 331 ? 0.2081 0.3017 0.2718 0.0039  -0.0305 0.0279  307 ILE A CG2   
2413 C  CD1   . ILE A 331 ? 0.3191 0.3326 0.2612 -0.0153 -0.0680 0.0153  307 ILE A CD1   
2414 N  N     . GLN A 332 ? 0.2507 0.3816 0.2267 0.0398  -0.0729 0.0432  308 GLN A N     
2415 C  CA    . GLN A 332 ? 0.2507 0.4179 0.2711 0.0897  -0.0681 0.0281  308 GLN A CA    
2416 C  C     . GLN A 332 ? 0.2574 0.4145 0.2650 0.0988  -0.0632 0.0149  308 GLN A C     
2417 O  O     . GLN A 332 ? 0.3177 0.4746 0.2542 0.1539  -0.0823 0.0005  308 GLN A O     
2418 C  CB    . GLN A 332 ? 0.2836 0.4337 0.2018 0.0625  -0.0668 0.0093  308 GLN A CB    
2419 C  CG    . GLN A 332 ? 0.3249 0.4558 0.2654 0.0000  0.0069  -0.0033 308 GLN A CG    
2420 C  CD    . GLN A 332 ? 0.3347 0.3985 0.2561 -0.0218 -0.0338 -0.0502 308 GLN A CD    
2421 O  OE1   . GLN A 332 ? 0.3636 0.4829 0.3557 0.0254  -0.0557 -0.0245 308 GLN A OE1   
2422 N  NE2   . GLN A 332 ? 0.3867 0.4015 0.2260 -0.0196 -0.0267 -0.0575 308 GLN A NE2   
2423 N  N     . GLN A 333 ? 0.2569 0.4036 0.2556 0.0271  -0.0705 0.0057  309 GLN A N     
2424 C  CA    . GLN A 333 ? 0.3535 0.4191 0.2320 0.0873  -0.0639 0.0152  309 GLN A CA    
2425 C  C     . GLN A 333 ? 0.3745 0.4209 0.2030 0.0744  -0.0521 -0.0074 309 GLN A C     
2426 O  O     . GLN A 333 ? 0.3887 0.4717 0.1417 0.0587  -0.1333 -0.0256 309 GLN A O     
2427 C  CB    . GLN A 333 ? 0.3373 0.4253 0.1889 0.0747  -0.0889 0.0389  309 GLN A CB    
2428 C  CG    . GLN A 333 ? 0.3043 0.4486 0.2633 0.0626  -0.0979 -0.0377 309 GLN A CG    
2429 C  CD    . GLN A 333 ? 0.3340 0.4772 0.2233 0.0588  -0.0569 0.0205  309 GLN A CD    
2430 O  OE1   . GLN A 333 ? 0.3937 0.4843 0.2674 0.0492  -0.0457 0.0485  309 GLN A OE1   
2431 N  NE2   . GLN A 333 ? 0.3491 0.4458 0.1855 0.1024  -0.1059 0.0326  309 GLN A NE2   
2432 N  N     . ILE A 334 ? 0.3639 0.5230 0.1543 0.0736  -0.1199 -0.0522 310 ILE A N     
2433 C  CA    . ILE A 334 ? 0.3519 0.5634 0.2014 0.0629  -0.1048 -0.0849 310 ILE A CA    
2434 C  C     . ILE A 334 ? 0.3560 0.5049 0.2147 0.0649  -0.0598 -0.0549 310 ILE A C     
2435 O  O     . ILE A 334 ? 0.4364 0.5087 0.3265 0.0741  -0.0587 0.0168  310 ILE A O     
2436 C  CB    . ILE A 334 ? 0.3122 0.5948 0.1933 0.0248  -0.0857 -0.0544 310 ILE A CB    
2437 C  CG1   . ILE A 334 ? 0.3681 0.6637 0.2133 -0.0298 -0.1380 -0.0540 310 ILE A CG1   
2438 C  CG2   . ILE A 334 ? 0.3651 0.6275 0.2477 0.0186  -0.0688 -0.1424 310 ILE A CG2   
2439 C  CD1   . ILE A 334 ? 0.4630 0.6861 0.2499 0.0440  -0.1891 -0.0742 310 ILE A CD1   
2440 N  N     . GLY A 335 ? 0.3316 0.5564 0.1948 0.0612  -0.0660 -0.0467 311 GLY A N     
2441 C  CA    . GLY A 335 ? 0.3215 0.5987 0.2117 0.0427  -0.0366 0.0110  311 GLY A CA    
2442 C  C     . GLY A 335 ? 0.2403 0.4847 0.2030 0.0269  -0.0250 -0.0290 311 GLY A C     
2443 O  O     . GLY A 335 ? 0.2998 0.4979 0.0438 0.0368  -0.0710 -0.0006 311 GLY A O     
2444 N  N     . PRO A 336 ? 0.2487 0.4299 0.1951 0.0276  -0.0240 0.0346  312 PRO A N     
2445 C  CA    . PRO A 336 ? 0.2240 0.3329 0.1976 0.0157  -0.0273 0.0504  312 PRO A CA    
2446 C  C     . PRO A 336 ? 0.2822 0.3305 0.2073 0.0427  -0.0256 0.0504  312 PRO A C     
2447 O  O     . PRO A 336 ? 0.3051 0.3710 0.2101 0.0017  -0.0458 0.0378  312 PRO A O     
2448 C  CB    . PRO A 336 ? 0.2721 0.2910 0.1995 0.0621  -0.0280 0.0415  312 PRO A CB    
2449 C  CG    . PRO A 336 ? 0.2507 0.2779 0.1935 0.0530  -0.0143 0.0184  312 PRO A CG    
2450 C  CD    . PRO A 336 ? 0.2462 0.3822 0.1986 0.0587  -0.0115 0.0368  312 PRO A CD    
2451 N  N     . ARG A 337 ? 0.3026 0.3325 0.2459 0.0404  -0.0416 0.0473  313 ARG A N     
2452 C  CA    . ARG A 337 ? 0.2456 0.3295 0.2250 0.0434  -0.0034 0.0717  313 ARG A CA    
2453 C  C     . ARG A 337 ? 0.2554 0.3600 0.1761 0.0651  0.0244  0.0839  313 ARG A C     
2454 O  O     . ARG A 337 ? 0.3299 0.3826 0.1813 0.0905  -0.0034 0.0931  313 ARG A O     
2455 C  CB    . ARG A 337 ? 0.2076 0.3172 0.0947 0.0691  -0.0280 0.0696  313 ARG A CB    
2456 C  CG    . ARG A 337 ? 0.1868 0.2731 0.1260 0.0376  -0.0680 0.0023  313 ARG A CG    
2457 C  CD    . ARG A 337 ? 0.2708 0.2898 0.1033 0.0031  -0.0362 0.0307  313 ARG A CD    
2458 N  NE    . ARG A 337 ? 0.2600 0.2826 0.0532 -0.0057 -0.0808 -0.0002 313 ARG A NE    
2459 C  CZ    . ARG A 337 ? 0.2507 0.2069 0.0640 -0.0143 -0.0843 -0.0306 313 ARG A CZ    
2460 N  NH1   . ARG A 337 ? 0.3169 0.2149 0.0598 0.0013  -0.0575 -0.0215 313 ARG A NH1   
2461 N  NH2   . ARG A 337 ? 0.3073 0.2054 0.0641 0.0256  -0.1027 -0.0247 313 ARG A NH2   
2462 N  N     . PRO A 338 ? 0.3110 0.3541 0.1987 0.0563  0.0329  0.0400  314 PRO A N     
2463 C  CA    . PRO A 338 ? 0.3076 0.3416 0.1630 0.0537  0.0488  0.0194  314 PRO A CA    
2464 C  C     . PRO A 338 ? 0.3475 0.3533 0.2081 0.0597  -0.0207 0.0378  314 PRO A C     
2465 O  O     . PRO A 338 ? 0.4239 0.4441 0.1637 0.0068  -0.0530 0.0880  314 PRO A O     
2466 C  CB    . PRO A 338 ? 0.3121 0.3175 0.1596 0.0482  -0.0176 -0.0134 314 PRO A CB    
2467 C  CG    . PRO A 338 ? 0.2718 0.2921 0.1594 0.0410  0.0414  -0.0155 314 PRO A CG    
2468 C  CD    . PRO A 338 ? 0.2487 0.3609 0.2000 0.0817  0.0267  0.0057  314 PRO A CD    
2469 N  N     . MSE A 339 ? 0.3881 0.3589 0.2303 0.0509  -0.0412 0.0996  315 MSE A N     
2470 C  CA    . MSE A 339 ? 0.4296 0.3325 0.2528 0.0605  -0.0640 0.0925  315 MSE A CA    
2471 C  C     . MSE A 339 ? 0.4915 0.3033 0.2610 0.0335  -0.0877 0.0515  315 MSE A C     
2472 O  O     . MSE A 339 ? 0.6167 0.3680 0.1127 0.0901  -0.1735 0.0681  315 MSE A O     
2473 C  CB    . MSE A 339 ? 0.5181 0.4289 0.2025 0.0511  -0.0724 0.1260  315 MSE A CB    
2474 C  CG    . MSE A 339 ? 0.6067 0.4960 0.3159 0.1437  -0.0046 0.1815  315 MSE A CG    
2475 SE SE    . MSE A 339 ? 0.8920 0.9649 0.4310 0.0324  -0.0632 0.1040  315 MSE A SE    
2476 C  CE    . MSE A 339 ? 0.5040 0.7405 0.1223 0.1199  -0.2094 0.0083  315 MSE A CE    
2477 N  N     . THR A 340 ? 0.4193 0.3836 0.2021 0.0136  -0.1300 0.0137  316 THR A N     
2478 C  CA    . THR A 340 ? 0.3950 0.4020 0.3572 0.0626  -0.0946 0.0368  316 THR A CA    
2479 C  C     . THR A 340 ? 0.3763 0.3611 0.3649 0.0512  -0.0791 0.0055  316 THR A C     
2480 O  O     . THR A 340 ? 0.3508 0.3682 0.3557 0.0515  -0.0744 0.0030  316 THR A O     
2481 C  CB    . THR A 340 ? 0.4320 0.4172 0.4084 0.0504  -0.0499 0.0594  316 THR A CB    
2482 O  OG1   . THR A 340 ? 0.4180 0.5262 0.1871 0.0198  -0.1229 0.0611  316 THR A OG1   
2483 C  CG2   . THR A 340 ? 0.4374 0.4375 0.3876 0.0521  -0.0040 -0.0154 316 THR A CG2   
2484 N  N     . SER A 341 ? 0.3998 0.2597 0.4380 -0.0390 -0.0867 0.0167  317 SER A N     
2485 C  CA    . SER A 341 ? 0.4083 0.2600 0.3917 -0.0154 -0.0255 -0.0468 317 SER A CA    
2486 C  C     . SER A 341 ? 0.3326 0.3219 0.3661 0.0466  -0.0282 -0.0509 317 SER A C     
2487 O  O     . SER A 341 ? 0.3324 0.4123 0.4888 0.0457  0.0174  -0.0696 317 SER A O     
2488 C  CB    . SER A 341 ? 0.4159 0.2711 0.3807 -0.0171 -0.0758 -0.0740 317 SER A CB    
2489 O  OG    . SER A 341 ? 0.4690 0.2417 0.2534 0.0193  -0.0200 0.0154  317 SER A OG    
2490 N  N     . LEU A 342 ? 0.3124 0.4490 0.3228 0.0533  -0.0360 -0.0538 318 LEU A N     
2491 C  CA    . LEU A 342 ? 0.2874 0.3192 0.3131 0.0739  -0.0188 -0.0722 318 LEU A CA    
2492 C  C     . LEU A 342 ? 0.3814 0.3357 0.2676 0.0229  -0.0456 -0.0533 318 LEU A C     
2493 O  O     . LEU A 342 ? 0.4313 0.3446 0.2094 0.0416  -0.0633 0.0026  318 LEU A O     
2494 C  CB    . LEU A 342 ? 0.3284 0.3082 0.2885 0.0946  0.0112  -0.0288 318 LEU A CB    
2495 C  CG    . LEU A 342 ? 0.2657 0.2817 0.2194 0.0601  0.0229  0.0022  318 LEU A CG    
2496 C  CD1   . LEU A 342 ? 0.3213 0.3019 0.1391 0.0836  -0.0530 0.0705  318 LEU A CD1   
2497 C  CD2   . LEU A 342 ? 0.2618 0.2936 0.1639 0.0613  0.0891  0.0264  318 LEU A CD2   
2498 N  N     . SER A 343 ? 0.3869 0.3150 0.2775 0.0295  -0.1100 -0.0019 319 SER A N     
2499 C  CA    . SER A 343 ? 0.4245 0.3159 0.4077 0.0483  -0.0507 -0.0724 319 SER A CA    
2500 C  C     . SER A 343 ? 0.4179 0.3850 0.3452 0.0526  -0.0370 -0.0459 319 SER A C     
2501 O  O     . SER A 343 ? 0.5134 0.4527 0.2769 0.0415  -0.1256 -0.1191 319 SER A O     
2502 C  CB    . SER A 343 ? 0.3544 0.3102 0.3489 0.0980  0.0040  0.0078  319 SER A CB    
2503 O  OG    . SER A 343 ? 0.4612 0.3544 0.3980 0.1230  -0.0229 0.0371  319 SER A OG    
2504 N  N     . GLU A 344 ? 0.4029 0.3531 0.3250 0.0528  -0.0161 -0.0398 320 GLU A N     
2505 C  CA    . GLU A 344 ? 0.4112 0.4227 0.3511 0.0528  -0.0099 0.0313  320 GLU A CA    
2506 C  C     . GLU A 344 ? 0.4279 0.3707 0.2415 0.0647  -0.0145 -0.0095 320 GLU A C     
2507 O  O     . GLU A 344 ? 0.4688 0.3993 0.1583 0.0985  -0.0006 0.0171  320 GLU A O     
2508 C  CB    . GLU A 344 ? 0.4941 0.4071 0.2922 0.0481  -0.0338 -0.0533 320 GLU A CB    
2509 C  CG    . GLU A 344 ? 0.6065 0.4785 0.2914 0.0717  -0.0069 0.0787  320 GLU A CG    
2510 C  CD    . GLU A 344 ? 0.6601 0.5622 0.4459 0.1257  0.0622  0.0196  320 GLU A CD    
2511 O  OE1   . GLU A 344 ? 0.6119 0.6498 0.4943 0.1136  0.0355  0.0448  320 GLU A OE1   
2512 O  OE2   . GLU A 344 ? 0.7265 0.7282 0.4551 0.0055  0.1098  0.1161  320 GLU A OE2   
2513 N  N     . ALA A 345 ? 0.4835 0.2921 0.1639 0.0591  -0.1253 0.0784  321 ALA A N     
2514 C  CA    . ALA A 345 ? 0.5122 0.2876 0.2015 0.0424  -0.0862 0.0066  321 ALA A CA    
2515 C  C     . ALA A 345 ? 0.4506 0.3659 0.1906 0.0628  -0.0505 -0.0165 321 ALA A C     
2516 O  O     . ALA A 345 ? 0.4769 0.3526 0.0660 0.0602  -0.0840 0.0178  321 ALA A O     
2517 C  CB    . ALA A 345 ? 0.5049 0.2612 0.2923 -0.0042 -0.1055 -0.0184 321 ALA A CB    
2518 N  N     . ALA A 346 ? 0.4364 0.3857 0.2190 0.1186  -0.0548 -0.0200 322 ALA A N     
2519 C  CA    . ALA A 346 ? 0.4576 0.3973 0.1966 0.0791  -0.0034 -0.0195 322 ALA A CA    
2520 C  C     . ALA A 346 ? 0.5327 0.3498 0.2532 0.0882  0.0242  -0.0072 322 ALA A C     
2521 O  O     . ALA A 346 ? 0.4635 0.4620 0.2743 0.1816  0.1328  -0.0908 322 ALA A O     
2522 C  CB    . ALA A 346 ? 0.4614 0.3105 0.0491 0.1558  0.0022  -0.0328 322 ALA A CB    
2523 N  N     . LYS A 347 ? 0.4548 0.3688 0.1476 0.1192  -0.0617 -0.0100 323 LYS A N     
2524 C  CA    . LYS A 347 ? 0.4344 0.3796 0.3279 0.1407  -0.0366 -0.0204 323 LYS A CA    
2525 C  C     . LYS A 347 ? 0.4363 0.4518 0.3360 0.1622  0.0261  -0.0495 323 LYS A C     
2526 O  O     . LYS A 347 ? 0.5134 0.5600 0.3480 0.0809  0.0950  -0.0255 323 LYS A O     
2527 C  CB    . LYS A 347 ? 0.4713 0.3753 0.5065 0.1077  -0.0284 -0.0075 323 LYS A CB    
2528 C  CG    . LYS A 347 ? 0.4400 0.4186 0.5864 0.1462  -0.0719 0.0364  323 LYS A CG    
2529 C  CD    . LYS A 347 ? 0.5701 0.3566 0.8202 0.1026  0.0356  -0.0448 323 LYS A CD    
2530 C  CE    . LYS A 347 ? 0.5237 0.3831 0.9844 0.1590  0.0833  -0.1734 323 LYS A CE    
2531 N  NZ    . LYS A 347 ? 0.7211 0.5189 1.1304 0.0721  0.1741  0.0055  323 LYS A NZ    
2532 N  N     . GLN A 348 ? 0.4909 0.4834 0.2996 0.0957  0.0583  -0.0517 324 GLN A N     
2533 C  CA    . GLN A 348 ? 0.4805 0.4599 0.3780 0.0921  0.0678  -0.0098 324 GLN A CA    
2534 C  C     . GLN A 348 ? 0.5261 0.4558 0.4400 0.1144  0.0814  0.0139  324 GLN A C     
2535 O  O     . GLN A 348 ? 0.5870 0.4467 0.4780 0.1198  0.1317  -0.0308 324 GLN A O     
2536 C  CB    . GLN A 348 ? 0.5426 0.5154 0.4180 0.1121  0.0162  -0.0632 324 GLN A CB    
2537 C  CG    . GLN A 348 ? 0.4938 0.5164 0.6430 0.2449  0.1327  -0.1001 324 GLN A CG    
2538 C  CD    . GLN A 348 ? 0.7050 0.7274 0.7065 0.1803  0.0111  -0.1158 324 GLN A CD    
2539 O  OE1   . GLN A 348 ? 0.7665 0.7104 0.7698 0.1531  0.0796  -0.0967 324 GLN A OE1   
2540 N  NE2   . GLN A 348 ? 0.6325 1.0118 0.9823 0.2336  0.0592  -0.1415 324 GLN A NE2   
2541 N  N     . ALA A 349 ? 0.5678 0.4120 0.3600 0.0982  0.0036  0.1220  325 ALA A N     
2542 C  CA    . ALA A 349 ? 0.5644 0.3283 0.4282 0.1239  0.0384  0.0843  325 ALA A CA    
2543 C  C     . ALA A 349 ? 0.5943 0.4198 0.4200 0.1259  0.0279  0.0911  325 ALA A C     
2544 O  O     . ALA A 349 ? 0.7472 0.4661 0.3966 0.1635  0.0645  0.1195  325 ALA A O     
2545 C  CB    . ALA A 349 ? 0.5602 0.3745 0.3169 0.1557  -0.0127 0.1273  325 ALA A CB    
2546 N  N     . GLY A 350 ? 0.6044 0.4995 0.4077 0.0858  -0.0047 0.0549  326 GLY A N     
2547 C  CA    . GLY A 350 ? 0.5177 0.5833 0.3730 0.1195  0.0424  0.0961  326 GLY A CA    
2548 C  C     . GLY A 350 ? 0.5338 0.6483 0.2848 0.1302  0.0522  0.1149  326 GLY A C     
2549 O  O     . GLY A 350 ? 0.6138 0.8202 0.2821 0.1697  0.0368  0.0543  326 GLY A O     
2550 N  N     . LEU A 351 ? 0.5364 0.4863 0.1740 0.1639  -0.0247 0.1040  327 LEU A N     
2551 C  CA    . LEU A 351 ? 0.4980 0.5039 0.3069 0.1292  -0.0142 0.0207  327 LEU A CA    
2552 C  C     . LEU A 351 ? 0.5127 0.4907 0.4419 0.1342  0.0282  -0.0595 327 LEU A C     
2553 O  O     . LEU A 351 ? 0.4242 0.6802 0.5626 0.1342  0.1308  -0.0880 327 LEU A O     
2554 C  CB    . LEU A 351 ? 0.5345 0.4522 0.3633 0.0465  0.0871  0.0283  327 LEU A CB    
2555 C  CG    . LEU A 351 ? 0.4220 0.4817 0.3178 0.0829  0.1001  -0.0896 327 LEU A CG    
2556 C  CD1   . LEU A 351 ? 0.4795 0.5113 0.2508 0.0880  0.0903  -0.0827 327 LEU A CD1   
2557 C  CD2   . LEU A 351 ? 0.5268 0.5863 0.2733 0.0968  0.0631  -0.0752 327 LEU A CD2   
2558 N  N     . ILE A 352 ? 0.6253 0.4168 0.4366 0.1371  -0.0510 -0.0966 328 ILE A N     
2559 C  CA    . ILE A 352 ? 0.5788 0.6116 0.6277 0.0199  0.0069  -0.1011 328 ILE A CA    
2560 C  C     . ILE A 352 ? 0.6577 0.5590 0.6570 0.1982  0.0117  -0.1286 328 ILE A C     
2561 O  O     . ILE A 352 ? 0.8007 0.6008 0.7640 0.2925  -0.0443 -0.0063 328 ILE A O     
2562 C  CB    . ILE A 352 ? 0.6351 0.5656 0.5869 0.0581  0.1022  -0.0974 328 ILE A CB    
2563 C  CG1   . ILE A 352 ? 0.6169 0.4518 0.6528 0.0851  0.1094  -0.0792 328 ILE A CG1   
2564 C  CG2   . ILE A 352 ? 0.7870 0.4031 0.5400 0.2254  0.1735  -0.0921 328 ILE A CG2   
2565 C  CD1   . ILE A 352 ? 0.6883 0.4043 0.6021 0.0359  0.1999  -0.0829 328 ILE A CD1   
2566 N  N     . MSE B 23  ? 0.9631 0.8872 0.4915 -0.1091 -0.0422 -0.2922 -1  MSE B N     
2567 C  CA    . MSE B 23  ? 0.6284 0.6852 0.6487 -0.1361 -0.1822 -0.1593 -1  MSE B CA    
2568 C  C     . MSE B 23  ? 0.6967 0.4523 0.4490 -0.0988 -0.3726 -0.1067 -1  MSE B C     
2569 O  O     . MSE B 23  ? 0.8163 0.2876 0.2362 -0.1238 -0.4049 0.0337  -1  MSE B O     
2570 C  CB    . MSE B 23  ? 0.6472 0.6556 0.6809 -0.2895 -0.4018 -0.2558 -1  MSE B CB    
2571 C  CG    . MSE B 23  ? 0.7082 0.8695 0.7741 -0.1729 -0.4573 -0.1540 -1  MSE B CG    
2572 SE SE    . MSE B 23  ? 1.0723 0.9564 1.2107 -0.4083 -0.4699 -0.1963 -1  MSE B SE    
2573 C  CE    . MSE B 23  ? 1.2800 1.2516 1.4657 -0.0467 -0.1735 0.1215  -1  MSE B CE    
2574 N  N     . THR B 24  ? 0.6169 0.4435 0.4121 -0.0345 -0.1531 -0.0673 0   THR B N     
2575 C  CA    . THR B 24  ? 0.5112 0.5009 0.2865 -0.0354 -0.0798 -0.1182 0   THR B CA    
2576 C  C     . THR B 24  ? 0.3794 0.4917 0.2990 -0.0632 -0.0193 -0.0170 0   THR B C     
2577 O  O     . THR B 24  ? 0.5136 0.4172 0.0803 -0.0671 -0.1287 -0.0312 0   THR B O     
2578 C  CB    . THR B 24  ? 0.4711 0.5079 0.2892 -0.0071 -0.1644 -0.1828 0   THR B CB    
2579 O  OG1   . THR B 24  ? 0.5064 0.4912 0.3928 0.1775  -0.2540 -0.1913 0   THR B OG1   
2580 C  CG2   . THR B 24  ? 0.4161 0.6145 0.4356 -0.1782 -0.3143 -0.1394 0   THR B CG2   
2581 N  N     . ARG B 25  ? 0.3588 0.4819 0.3777 -0.0129 -0.1176 -0.1135 1   ARG B N     
2582 C  CA    . ARG B 25  ? 0.3773 0.4375 0.2062 -0.0477 -0.0007 -0.0237 1   ARG B CA    
2583 C  C     . ARG B 25  ? 0.3506 0.3271 0.1942 -0.0352 -0.0508 0.0054  1   ARG B C     
2584 O  O     . ARG B 25  ? 0.4196 0.3961 0.2375 0.0320  -0.1037 0.1030  1   ARG B O     
2585 C  CB    . ARG B 25  ? 0.3597 0.4271 0.3478 -0.0118 0.0456  -0.0699 1   ARG B CB    
2586 C  CG    . ARG B 25  ? 0.4176 0.3565 0.4751 0.0081  -0.0635 -0.0050 1   ARG B CG    
2587 C  CD    . ARG B 25  ? 0.4634 0.5060 0.5033 -0.0544 -0.1506 -0.0356 1   ARG B CD    
2588 N  NE    . ARG B 25  ? 0.5636 0.3309 0.7209 -0.0460 -0.1481 -0.0538 1   ARG B NE    
2589 C  CZ    . ARG B 25  ? 0.5027 0.3634 0.8449 0.0191  -0.0305 0.0189  1   ARG B CZ    
2590 N  NH1   . ARG B 25  ? 0.8643 0.4365 0.7673 0.0099  0.0521  0.0220  1   ARG B NH1   
2591 N  NH2   . ARG B 25  ? 0.5307 0.3833 1.0235 0.2663  0.0378  0.0953  1   ARG B NH2   
2592 N  N     . PHE B 26  ? 0.3325 0.3392 0.2437 -0.0023 -0.0522 -0.0120 2   PHE B N     
2593 C  CA    . PHE B 26  ? 0.2218 0.3054 0.2045 -0.0411 -0.0668 0.0049  2   PHE B CA    
2594 C  C     . PHE B 26  ? 0.2245 0.3163 0.1567 -0.0275 -0.0635 -0.0342 2   PHE B C     
2595 O  O     . PHE B 26  ? 0.3546 0.3663 0.1189 -0.0545 -0.1028 -0.0980 2   PHE B O     
2596 C  CB    . PHE B 26  ? 0.1915 0.3358 0.1211 -0.0450 -0.0357 0.0271  2   PHE B CB    
2597 C  CG    . PHE B 26  ? 0.2272 0.3533 0.1437 -0.0115 -0.0738 -0.0007 2   PHE B CG    
2598 C  CD1   . PHE B 26  ? 0.3041 0.2803 0.1730 -0.0039 -0.0822 0.0349  2   PHE B CD1   
2599 C  CD2   . PHE B 26  ? 0.2113 0.3881 0.2493 -0.0069 -0.0297 0.0254  2   PHE B CD2   
2600 C  CE1   . PHE B 26  ? 0.3077 0.2880 0.0614 0.0010  -0.0979 -0.0242 2   PHE B CE1   
2601 C  CE2   . PHE B 26  ? 0.2648 0.3480 0.2724 -0.0087 -0.0899 0.0525  2   PHE B CE2   
2602 C  CZ    . PHE B 26  ? 0.3469 0.3155 0.2025 -0.0406 -0.0057 0.0026  2   PHE B CZ    
2603 N  N     . ASP B 27  ? 0.2304 0.3032 0.0953 -0.0526 -0.0901 -0.0243 3   ASP B N     
2604 C  CA    . ASP B 27  ? 0.2729 0.2575 0.1676 -0.0540 -0.0503 -0.0106 3   ASP B CA    
2605 C  C     . ASP B 27  ? 0.2251 0.2592 0.1911 -0.0661 -0.0703 0.0093  3   ASP B C     
2606 O  O     . ASP B 27  ? 0.2809 0.3122 0.1239 -0.0791 -0.1099 0.0073  3   ASP B O     
2607 C  CB    . ASP B 27  ? 0.3636 0.3124 0.0855 -0.0725 -0.0695 0.0052  3   ASP B CB    
2608 C  CG    . ASP B 27  ? 0.3660 0.2958 0.1715 -0.0625 -0.1010 0.0685  3   ASP B CG    
2609 O  OD1   . ASP B 27  ? 0.3164 0.3957 0.1847 -0.0632 -0.1753 0.1347  3   ASP B OD1   
2610 O  OD2   . ASP B 27  ? 0.3779 0.3496 0.1461 -0.0695 -0.1717 0.0641  3   ASP B OD2   
2611 N  N     . VAL B 28  ? 0.2437 0.2947 0.1642 -0.0246 -0.0488 -0.0737 4   VAL B N     
2612 C  CA    . VAL B 28  ? 0.2134 0.2534 0.2185 -0.0115 -0.0208 0.0203  4   VAL B CA    
2613 C  C     . VAL B 28  ? 0.2109 0.2496 0.1892 0.0139  -0.0047 0.0194  4   VAL B C     
2614 O  O     . VAL B 28  ? 0.2736 0.2829 0.1972 0.0460  -0.0302 0.0192  4   VAL B O     
2615 C  CB    . VAL B 28  ? 0.2225 0.2367 0.2353 -0.0358 0.0007  0.0026  4   VAL B CB    
2616 C  CG1   . VAL B 28  ? 0.2493 0.2421 0.2693 -0.0458 -0.0375 0.0235  4   VAL B CG1   
2617 C  CG2   . VAL B 28  ? 0.2285 0.3090 0.2576 -0.0272 0.0128  0.1125  4   VAL B CG2   
2618 N  N     . LEU B 29  ? 0.2092 0.2344 0.1385 0.0130  -0.0268 0.0121  5   LEU B N     
2619 C  CA    . LEU B 29  ? 0.1963 0.2554 0.1015 0.0099  -0.0342 -0.0195 5   LEU B CA    
2620 C  C     . LEU B 29  ? 0.2247 0.2659 0.1258 -0.0092 -0.0370 -0.0387 5   LEU B C     
2621 O  O     . LEU B 29  ? 0.2161 0.2931 0.1015 -0.0166 -0.0987 -0.0732 5   LEU B O     
2622 C  CB    . LEU B 29  ? 0.1791 0.2178 0.0874 0.0138  -0.0542 -0.0203 5   LEU B CB    
2623 C  CG    . LEU B 29  ? 0.1544 0.2861 0.1128 0.0247  -0.0160 -0.0307 5   LEU B CG    
2624 C  CD1   . LEU B 29  ? 0.1319 0.2630 0.0721 -0.0228 -0.0330 -0.0681 5   LEU B CD1   
2625 C  CD2   . LEU B 29  ? 0.1603 0.3648 0.1300 -0.0236 -0.0084 -0.1074 5   LEU B CD2   
2626 N  N     . THR B 30  ? 0.2140 0.2686 0.1258 -0.0259 -0.0369 -0.0250 6   THR B N     
2627 C  CA    . THR B 30  ? 0.2031 0.2393 0.0691 -0.0083 0.0043  -0.0385 6   THR B CA    
2628 C  C     . THR B 30  ? 0.1916 0.2084 0.0407 0.0174  -0.0313 -0.0448 6   THR B C     
2629 O  O     . THR B 30  ? 0.1886 0.2396 0.0439 0.0173  -0.0385 -0.0490 6   THR B O     
2630 C  CB    . THR B 30  ? 0.1808 0.2769 0.0655 -0.0022 0.0095  -0.0052 6   THR B CB    
2631 O  OG1   . THR B 30  ? 0.1995 0.3029 0.0854 -0.0133 -0.0763 -0.0800 6   THR B OG1   
2632 C  CG2   . THR B 30  ? 0.1758 0.2418 0.0348 -0.0091 -0.0362 0.0148  6   THR B CG2   
2633 N  N     . VAL B 31  ? 0.2018 0.2238 0.0294 -0.0179 -0.0205 -0.0162 7   VAL B N     
2634 C  CA    . VAL B 31  ? 0.1798 0.2181 0.0640 0.0019  -0.0654 -0.0066 7   VAL B CA    
2635 C  C     . VAL B 31  ? 0.1612 0.2234 0.0876 0.0032  -0.0392 -0.0203 7   VAL B C     
2636 O  O     . VAL B 31  ? 0.2310 0.2215 0.0310 0.0192  -0.0153 -0.0312 7   VAL B O     
2637 C  CB    . VAL B 31  ? 0.2194 0.1984 0.1105 -0.0123 0.0096  0.0056  7   VAL B CB    
2638 C  CG1   . VAL B 31  ? 0.1983 0.2169 0.1144 -0.0052 -0.0724 -0.0347 7   VAL B CG1   
2639 C  CG2   . VAL B 31  ? 0.2519 0.1988 0.0779 -0.0104 -0.0151 0.0142  7   VAL B CG2   
2640 N  N     . GLY B 32  ? 0.1713 0.2278 0.1036 -0.0075 -0.0519 -0.0385 8   GLY B N     
2641 C  CA    . GLY B 32  ? 0.1489 0.2278 0.0898 0.0053  -0.0490 -0.0406 8   GLY B CA    
2642 C  C     . GLY B 32  ? 0.1288 0.2243 0.1343 0.0218  -0.0401 -0.0189 8   GLY B C     
2643 O  O     . GLY B 32  ? 0.1619 0.2233 0.1567 0.0436  -0.0343 -0.0077 8   GLY B O     
2644 N  N     . ASN B 33  ? 0.1050 0.2051 0.1611 -0.0213 -0.0467 -0.0199 9   ASN B N     
2645 C  CA    . ASN B 33  ? 0.1260 0.1975 0.1410 -0.0085 -0.0588 0.0027  9   ASN B CA    
2646 C  C     . ASN B 33  ? 0.1319 0.2244 0.0705 -0.0004 -0.0674 -0.0218 9   ASN B C     
2647 O  O     . ASN B 33  ? 0.1790 0.2657 0.0514 -0.0271 -0.0630 0.0189  9   ASN B O     
2648 C  CB    . ASN B 33  ? 0.1745 0.1987 0.1640 -0.0025 -0.0762 0.0089  9   ASN B CB    
2649 C  CG    . ASN B 33  ? 0.2064 0.2131 0.1421 -0.0132 -0.0463 -0.0022 9   ASN B CG    
2650 O  OD1   . ASN B 33  ? 0.2427 0.2702 0.1174 -0.0336 -0.0420 -0.0076 9   ASN B OD1   
2651 N  ND2   . ASN B 33  ? 0.2367 0.2519 0.1274 0.0147  -0.0618 0.0192  9   ASN B ND2   
2652 N  N     . ALA B 34  ? 0.1630 0.1536 0.0656 -0.0052 -0.0606 -0.0393 10  ALA B N     
2653 C  CA    . ALA B 34  ? 0.1872 0.1777 0.0808 -0.0100 -0.0459 -0.0188 10  ALA B CA    
2654 C  C     . ALA B 34  ? 0.1916 0.2113 0.0883 -0.0252 -0.0507 -0.0244 10  ALA B C     
2655 O  O     . ALA B 34  ? 0.1981 0.2571 0.0613 -0.0246 -0.0572 -0.0363 10  ALA B O     
2656 C  CB    . ALA B 34  ? 0.1887 0.2168 0.0715 0.0205  -0.0694 -0.0085 10  ALA B CB    
2657 N  N     . ILE B 35  ? 0.1892 0.2021 0.1126 -0.0235 -0.0436 -0.0531 11  ILE B N     
2658 C  CA    . ILE B 35  ? 0.2035 0.1583 0.0882 -0.0219 -0.0425 -0.0212 11  ILE B CA    
2659 C  C     . ILE B 35  ? 0.2040 0.1834 0.1042 -0.0175 -0.0540 0.0066  11  ILE B C     
2660 O  O     . ILE B 35  ? 0.2074 0.2092 0.0639 -0.0298 -0.0807 0.0358  11  ILE B O     
2661 C  CB    . ILE B 35  ? 0.2173 0.1382 0.1035 -0.0215 -0.0404 -0.0347 11  ILE B CB    
2662 C  CG1   . ILE B 35  ? 0.2026 0.1528 0.1113 0.0014  -0.0327 -0.0286 11  ILE B CG1   
2663 C  CG2   . ILE B 35  ? 0.2090 0.1261 0.1312 -0.0069 -0.0816 -0.0529 11  ILE B CG2   
2664 C  CD1   . ILE B 35  ? 0.2120 0.2211 0.0778 0.0147  -0.0233 0.0154  11  ILE B CD1   
2665 N  N     . VAL B 36  ? 0.2122 0.2219 0.0786 -0.0118 -0.0512 0.0426  12  VAL B N     
2666 C  CA    . VAL B 36  ? 0.2103 0.1996 0.0942 0.0118  -0.0286 0.0545  12  VAL B CA    
2667 C  C     . VAL B 36  ? 0.1877 0.1880 0.0652 -0.0295 -0.0777 0.0346  12  VAL B C     
2668 O  O     . VAL B 36  ? 0.2446 0.2049 0.0617 -0.0449 -0.0881 0.0306  12  VAL B O     
2669 C  CB    . VAL B 36  ? 0.2125 0.2146 0.0810 0.0154  -0.0451 0.0333  12  VAL B CB    
2670 C  CG1   . VAL B 36  ? 0.2383 0.2705 0.0891 -0.0443 -0.0476 0.0512  12  VAL B CG1   
2671 C  CG2   . VAL B 36  ? 0.2227 0.2369 0.0697 0.0092  -0.0550 0.0157  12  VAL B CG2   
2672 N  N     . ASP B 37  ? 0.2010 0.2322 0.0531 0.0000  -0.0694 0.0082  13  ASP B N     
2673 C  CA    . ASP B 37  ? 0.1799 0.2376 0.0930 -0.0144 -0.0459 0.0171  13  ASP B CA    
2674 C  C     . ASP B 37  ? 0.2092 0.2184 0.0915 -0.0228 -0.0506 0.0276  13  ASP B C     
2675 O  O     . ASP B 37  ? 0.2504 0.2193 0.0867 -0.0340 -0.0528 0.0214  13  ASP B O     
2676 C  CB    . ASP B 37  ? 0.1830 0.2842 0.1066 -0.0226 -0.0495 0.0304  13  ASP B CB    
2677 C  CG    . ASP B 37  ? 0.2218 0.3045 0.1070 -0.0068 -0.0514 0.0423  13  ASP B CG    
2678 O  OD1   . ASP B 37  ? 0.2813 0.3301 0.0783 0.0232  -0.0456 0.0642  13  ASP B OD1   
2679 O  OD2   . ASP B 37  ? 0.2607 0.3153 0.0555 -0.0478 -0.0832 0.0020  13  ASP B OD2   
2680 N  N     . ILE B 38  ? 0.2060 0.2538 0.1153 -0.0251 -0.0843 0.0083  14  ILE B N     
2681 C  CA    . ILE B 38  ? 0.2195 0.2396 0.0956 -0.0206 -0.0627 0.0178  14  ILE B CA    
2682 C  C     . ILE B 38  ? 0.2194 0.2202 0.1372 -0.0256 -0.0563 0.0112  14  ILE B C     
2683 O  O     . ILE B 38  ? 0.2674 0.2110 0.0895 0.0033  -0.0734 -0.0084 14  ILE B O     
2684 C  CB    . ILE B 38  ? 0.1990 0.2828 0.0928 -0.0061 -0.0647 0.0117  14  ILE B CB    
2685 C  CG1   . ILE B 38  ? 0.2055 0.3224 0.0754 -0.0342 -0.0263 0.0215  14  ILE B CG1   
2686 C  CG2   . ILE B 38  ? 0.1671 0.2926 0.1101 -0.0123 -0.0738 -0.0304 14  ILE B CG2   
2687 C  CD1   . ILE B 38  ? 0.2214 0.3249 0.1812 -0.0913 -0.0725 -0.0350 14  ILE B CD1   
2688 N  N     . ILE B 39  ? 0.1999 0.2684 0.1260 -0.0036 -0.0531 0.0334  15  ILE B N     
2689 C  CA    . ILE B 39  ? 0.2232 0.2607 0.1555 0.0085  -0.0465 -0.0115 15  ILE B CA    
2690 C  C     . ILE B 39  ? 0.2585 0.2326 0.1613 0.0166  -0.0623 -0.0140 15  ILE B C     
2691 O  O     . ILE B 39  ? 0.3029 0.2894 0.1222 -0.0033 -0.0347 0.0309  15  ILE B O     
2692 C  CB    . ILE B 39  ? 0.2337 0.2973 0.1662 -0.0175 -0.0041 -0.0513 15  ILE B CB    
2693 C  CG1   . ILE B 39  ? 0.2575 0.3185 0.1666 -0.0259 -0.0665 -0.0479 15  ILE B CG1   
2694 C  CG2   . ILE B 39  ? 0.2574 0.3105 0.1959 0.0075  0.0060  -0.0376 15  ILE B CG2   
2695 C  CD1   . ILE B 39  ? 0.2462 0.3076 0.1729 -0.0200 0.0054  -0.0079 15  ILE B CD1   
2696 N  N     . SER B 40  ? 0.2495 0.2663 0.1617 0.0360  -0.0494 -0.0345 16  SER B N     
2697 C  CA    . SER B 40  ? 0.2530 0.2700 0.1555 0.0167  -0.0461 -0.0212 16  SER B CA    
2698 C  C     . SER B 40  ? 0.2928 0.2851 0.2000 0.0474  -0.0255 0.0105  16  SER B C     
2699 O  O     . SER B 40  ? 0.3124 0.3381 0.1712 0.0692  -0.0441 0.0021  16  SER B O     
2700 C  CB    . SER B 40  ? 0.2730 0.3561 0.1772 -0.0118 -0.0758 -0.0090 16  SER B CB    
2701 O  OG    . SER B 40  ? 0.4536 0.4902 0.1751 -0.0033 -0.0951 0.0395  16  SER B OG    
2702 N  N     . ARG B 41  ? 0.3066 0.3233 0.2190 0.0478  -0.0053 0.0047  17  ARG B N     
2703 C  CA    . ARG B 41  ? 0.3214 0.2936 0.2280 0.0454  -0.0043 0.0241  17  ARG B CA    
2704 C  C     . ARG B 41  ? 0.3068 0.2827 0.2249 0.0603  -0.0588 0.0314  17  ARG B C     
2705 O  O     . ARG B 41  ? 0.3125 0.4052 0.3411 0.0542  -0.1042 -0.0073 17  ARG B O     
2706 C  CB    . ARG B 41  ? 0.4051 0.4057 0.2759 -0.0116 0.0477  0.0330  17  ARG B CB    
2707 C  CG    . ARG B 41  ? 0.4146 0.5122 0.3459 -0.0663 -0.0219 0.0342  17  ARG B CG    
2708 C  CD    . ARG B 41  ? 0.6538 0.5359 0.2837 -0.1033 -0.0261 -0.0254 17  ARG B CD    
2709 N  NE    . ARG B 41  ? 0.6515 0.6463 0.4274 -0.0582 0.1117  -0.0373 17  ARG B NE    
2710 C  CZ    . ARG B 41  ? 0.7123 0.6629 0.3881 -0.0351 0.0162  -0.0267 17  ARG B CZ    
2711 N  NH1   . ARG B 41  ? 0.7605 0.5417 0.4574 -0.0484 -0.0062 0.2599  17  ARG B NH1   
2712 N  NH2   . ARG B 41  ? 0.7889 0.8086 0.2018 0.0812  0.0510  -0.1424 17  ARG B NH2   
2713 N  N     . CYS B 42  ? 0.3136 0.2592 0.2024 0.0590  -0.0593 -0.0112 18  CYS B N     
2714 C  CA    . CYS B 42  ? 0.3500 0.2846 0.0719 0.0314  -0.1005 0.0029  18  CYS B CA    
2715 C  C     . CYS B 42  ? 0.3542 0.3014 0.1552 0.0125  -0.0699 -0.0536 18  CYS B C     
2716 O  O     . CYS B 42  ? 0.3275 0.3315 0.1443 0.0233  -0.0417 -0.0144 18  CYS B O     
2717 C  CB    . CYS B 42  ? 0.3795 0.3180 0.1607 0.0003  -0.0857 0.0400  18  CYS B CB    
2718 S  SG    . CYS B 42  ? 0.4426 0.3462 0.0827 0.0176  -0.0684 -0.0005 18  CYS B SG    
2719 N  N     . ASN B 43  ? 0.3957 0.2559 0.2995 -0.0081 0.0085  -0.0695 19  ASN B N     
2720 C  CA    . ASN B 43  ? 0.4025 0.3582 0.3146 0.0525  -0.0054 -0.0572 19  ASN B CA    
2721 C  C     . ASN B 43  ? 0.3189 0.3571 0.3543 0.0374  -0.0372 -0.0213 19  ASN B C     
2722 O  O     . ASN B 43  ? 0.3266 0.3387 0.2961 0.0312  -0.0559 -0.0430 19  ASN B O     
2723 C  CB    . ASN B 43  ? 0.4753 0.4616 0.2762 0.0239  -0.0262 -0.0504 19  ASN B CB    
2724 C  CG    . ASN B 43  ? 0.4929 0.5230 0.3306 -0.0130 -0.0095 -0.0518 19  ASN B CG    
2725 O  OD1   . ASN B 43  ? 0.4038 0.4495 0.3607 -0.0589 -0.0368 -0.0760 19  ASN B OD1   
2726 N  ND2   . ASN B 43  ? 0.5658 0.6119 0.3205 -0.0875 -0.0050 0.0675  19  ASN B ND2   
2727 N  N     . ASP B 44  ? 0.3125 0.3984 0.4310 0.0520  -0.0232 -0.0319 20  ASP B N     
2728 C  CA    . ASP B 44  ? 0.3300 0.4270 0.3935 0.0482  -0.0147 -0.0396 20  ASP B CA    
2729 C  C     . ASP B 44  ? 0.3411 0.4016 0.2995 0.0500  -0.0044 -0.0565 20  ASP B C     
2730 O  O     . ASP B 44  ? 0.4045 0.4490 0.1033 0.0849  -0.0902 -0.0961 20  ASP B O     
2731 C  CB    . ASP B 44  ? 0.2960 0.4830 0.2872 0.0204  -0.0273 -0.0585 20  ASP B CB    
2732 C  CG    . ASP B 44  ? 0.3867 0.4497 0.2858 -0.0596 -0.0214 0.0103  20  ASP B CG    
2733 O  OD1   . ASP B 44  ? 0.5654 0.4863 0.0809 0.0268  -0.1258 0.1036  20  ASP B OD1   
2734 O  OD2   . ASP B 44  ? 0.3567 0.4377 0.2485 -0.0357 0.0124  -0.0820 20  ASP B OD2   
2735 N  N     . GLN B 45  ? 0.3546 0.4213 0.3551 0.0337  -0.0530 -0.0784 21  GLN B N     
2736 C  CA    . GLN B 45  ? 0.3297 0.4291 0.2516 0.0256  -0.0243 -0.0932 21  GLN B CA    
2737 C  C     . GLN B 45  ? 0.2990 0.2523 0.0921 -0.0219 -0.0565 -0.0614 21  GLN B C     
2738 O  O     . GLN B 45  ? 0.3403 0.2808 0.0295 -0.0141 -0.0363 -0.0019 21  GLN B O     
2739 C  CB    . GLN B 45  ? 0.4014 0.4216 0.1963 -0.0279 0.0423  -0.0105 21  GLN B CB    
2740 C  CG    . GLN B 45  ? 0.3992 0.4032 0.0320 -0.0135 0.0299  -0.0416 21  GLN B CG    
2741 C  CD    . GLN B 45  ? 0.4869 0.4667 0.1696 0.0514  0.0125  -0.0729 21  GLN B CD    
2742 O  OE1   . GLN B 45  ? 0.4939 0.5919 0.1112 0.0684  0.0422  -0.1035 21  GLN B OE1   
2743 N  NE2   . GLN B 45  ? 0.5765 0.5396 0.2441 -0.0114 0.0086  -0.0700 21  GLN B NE2   
2744 N  N     . PHE B 46  ? 0.3002 0.2929 0.1808 0.0192  -0.0458 -0.1136 22  PHE B N     
2745 C  CA    . PHE B 46  ? 0.2632 0.2671 0.1722 0.0198  -0.0382 -0.0409 22  PHE B CA    
2746 C  C     . PHE B 46  ? 0.2382 0.3302 0.1763 0.0107  -0.0494 -0.0207 22  PHE B C     
2747 O  O     . PHE B 46  ? 0.2550 0.3163 0.1067 0.0091  -0.0512 -0.0116 22  PHE B O     
2748 C  CB    . PHE B 46  ? 0.2281 0.2733 0.2189 0.0317  -0.0549 -0.0113 22  PHE B CB    
2749 C  CG    . PHE B 46  ? 0.2317 0.3596 0.1810 0.0652  -0.0594 -0.0033 22  PHE B CG    
2750 C  CD1   . PHE B 46  ? 0.2379 0.3759 0.1746 0.0570  -0.0723 0.0127  22  PHE B CD1   
2751 C  CD2   . PHE B 46  ? 0.2214 0.3000 0.1802 0.0800  -0.1526 -0.0103 22  PHE B CD2   
2752 C  CE1   . PHE B 46  ? 0.2656 0.3289 0.2175 0.0590  -0.0507 0.0101  22  PHE B CE1   
2753 C  CE2   . PHE B 46  ? 0.2416 0.4068 0.2227 0.0406  -0.0893 -0.0623 22  PHE B CE2   
2754 C  CZ    . PHE B 46  ? 0.2387 0.3887 0.2650 0.0436  -0.0931 -0.0531 22  PHE B CZ    
2755 N  N     . LEU B 47  ? 0.2632 0.2759 0.1705 0.0199  -0.0624 -0.0663 23  LEU B N     
2756 C  CA    . LEU B 47  ? 0.2458 0.2902 0.1812 -0.0035 -0.0584 -0.0478 23  LEU B CA    
2757 C  C     . LEU B 47  ? 0.2495 0.2757 0.1353 0.0271  -0.0628 -0.0132 23  LEU B C     
2758 O  O     . LEU B 47  ? 0.2725 0.3111 0.1979 -0.0535 -0.0525 0.0171  23  LEU B O     
2759 C  CB    . LEU B 47  ? 0.2571 0.2182 0.1417 0.0157  -0.0918 -0.0355 23  LEU B CB    
2760 C  CG    . LEU B 47  ? 0.2091 0.2279 0.1272 0.0140  -0.0479 -0.0158 23  LEU B CG    
2761 C  CD1   . LEU B 47  ? 0.2211 0.2411 0.1139 -0.0035 -0.0659 -0.0043 23  LEU B CD1   
2762 C  CD2   . LEU B 47  ? 0.2459 0.2068 0.0722 0.0134  -0.0608 -0.0374 23  LEU B CD2   
2763 N  N     . ILE B 48  ? 0.3079 0.2511 0.2123 0.0258  -0.0735 -0.0548 24  ILE B N     
2764 C  CA    . ILE B 48  ? 0.3244 0.2832 0.2209 0.0133  -0.0467 -0.0142 24  ILE B CA    
2765 C  C     . ILE B 48  ? 0.3515 0.2308 0.1445 -0.0080 -0.1062 -0.0159 24  ILE B C     
2766 O  O     . ILE B 48  ? 0.4591 0.3415 0.0761 -0.0160 -0.0612 -0.0430 24  ILE B O     
2767 C  CB    . ILE B 48  ? 0.3936 0.2974 0.1990 0.0408  -0.0891 -0.0848 24  ILE B CB    
2768 C  CG1   . ILE B 48  ? 0.3430 0.3029 0.2427 0.0170  -0.0124 -0.0480 24  ILE B CG1   
2769 C  CG2   . ILE B 48  ? 0.4748 0.3131 0.1661 0.0494  -0.0708 -0.0403 24  ILE B CG2   
2770 C  CD1   . ILE B 48  ? 0.4450 0.4338 0.0548 0.0271  -0.0474 -0.1021 24  ILE B CD1   
2771 N  N     . ASP B 49  ? 0.3519 0.2783 0.0829 -0.0230 -0.0840 -0.0213 25  ASP B N     
2772 C  CA    . ASP B 49  ? 0.3289 0.2807 0.1286 0.0237  -0.1054 0.0101  25  ASP B CA    
2773 C  C     . ASP B 49  ? 0.3355 0.2678 0.1364 0.0069  -0.1275 -0.0116 25  ASP B C     
2774 O  O     . ASP B 49  ? 0.3709 0.2715 0.2119 -0.0307 -0.1704 0.0202  25  ASP B O     
2775 C  CB    . ASP B 49  ? 0.3146 0.2588 0.1551 0.0174  -0.1560 -0.0012 25  ASP B CB    
2776 C  CG    . ASP B 49  ? 0.4111 0.3437 0.1484 -0.0161 -0.1266 -0.0207 25  ASP B CG    
2777 O  OD1   . ASP B 49  ? 0.4655 0.4344 0.0451 0.0672  -0.0933 -0.0115 25  ASP B OD1   
2778 O  OD2   . ASP B 49  ? 0.5256 0.4044 0.2490 -0.1169 -0.2191 0.0639  25  ASP B OD2   
2779 N  N     . ASN B 50  ? 0.3277 0.2457 0.1923 0.0183  -0.1078 -0.0146 26  ASN B N     
2780 C  CA    . ASN B 50  ? 0.3256 0.2556 0.1774 0.0281  -0.0807 0.0413  26  ASN B CA    
2781 C  C     . ASN B 50  ? 0.3065 0.2828 0.1633 0.0152  -0.1007 -0.0005 26  ASN B C     
2782 O  O     . ASN B 50  ? 0.3027 0.3205 0.1070 0.0163  -0.1469 0.0248  26  ASN B O     
2783 C  CB    . ASN B 50  ? 0.2883 0.2535 0.1638 0.0110  -0.1008 0.0221  26  ASN B CB    
2784 C  CG    . ASN B 50  ? 0.2618 0.3438 0.1281 0.0340  -0.0888 -0.0378 26  ASN B CG    
2785 O  OD1   . ASN B 50  ? 0.2933 0.4218 0.1185 0.0154  -0.0738 -0.0710 26  ASN B OD1   
2786 N  ND2   . ASN B 50  ? 0.3072 0.2683 0.0968 -0.0093 -0.1011 -0.0846 26  ASN B ND2   
2787 N  N     . GLN B 51  ? 0.3279 0.2541 0.1293 0.0013  -0.1201 -0.0022 27  GLN B N     
2788 C  CA    . GLN B 51  ? 0.3710 0.2334 0.1069 -0.0031 -0.0983 -0.0021 27  GLN B CA    
2789 C  C     . GLN B 51  ? 0.3004 0.2345 0.0834 -0.0097 -0.0849 0.0054  27  GLN B C     
2790 O  O     . GLN B 51  ? 0.4089 0.3908 0.0950 -0.0058 -0.0353 -0.0147 27  GLN B O     
2791 C  CB    . GLN B 51  ? 0.4053 0.3171 0.0390 -0.0241 -0.0647 -0.0237 27  GLN B CB    
2792 C  CG    . GLN B 51  ? 0.4949 0.2998 0.0386 -0.1103 -0.0414 -0.0393 27  GLN B CG    
2793 C  CD    . GLN B 51  ? 0.5409 0.3498 0.2702 -0.1283 0.0196  -0.1157 27  GLN B CD    
2794 O  OE1   . GLN B 51  ? 0.6125 0.5423 0.4196 -0.0181 0.0321  -0.0981 27  GLN B OE1   
2795 N  NE2   . GLN B 51  ? 0.7405 0.3708 0.1516 -0.1922 -0.0058 -0.1891 27  GLN B NE2   
2796 N  N     . ILE B 52  ? 0.2645 0.2332 0.0439 0.0165  -0.0662 0.0031  28  ILE B N     
2797 C  CA    . ILE B 52  ? 0.2688 0.2097 0.1264 0.0114  -0.0567 0.0143  28  ILE B CA    
2798 C  C     . ILE B 52  ? 0.2581 0.2907 0.1245 0.0016  -0.0695 -0.0264 28  ILE B C     
2799 O  O     . ILE B 52  ? 0.2781 0.3213 0.0914 0.0206  -0.0780 -0.0422 28  ILE B O     
2800 C  CB    . ILE B 52  ? 0.2811 0.2093 0.1033 0.0061  -0.0661 0.0145  28  ILE B CB    
2801 C  CG1   . ILE B 52  ? 0.2725 0.2163 0.1048 0.0230  -0.0211 0.0262  28  ILE B CG1   
2802 C  CG2   . ILE B 52  ? 0.2545 0.2481 0.0893 -0.0095 -0.0810 0.0124  28  ILE B CG2   
2803 C  CD1   . ILE B 52  ? 0.3221 0.2525 0.1020 0.0571  0.0080  0.0391  28  ILE B CD1   
2804 N  N     . THR B 53  ? 0.2283 0.3096 0.1388 -0.0111 -0.0947 -0.0423 29  THR B N     
2805 C  CA    . THR B 53  ? 0.2265 0.3057 0.1311 -0.0029 -0.0901 -0.0453 29  THR B CA    
2806 C  C     . THR B 53  ? 0.2284 0.2831 0.1007 0.0263  -0.0916 -0.0030 29  THR B C     
2807 O  O     . THR B 53  ? 0.2406 0.3028 0.1478 -0.0005 -0.1120 -0.0371 29  THR B O     
2808 C  CB    . THR B 53  ? 0.2342 0.3575 0.1481 -0.0033 -0.0720 0.0031  29  THR B CB    
2809 O  OG1   . THR B 53  ? 0.3330 0.3276 0.0432 -0.0095 -0.0710 0.0175  29  THR B OG1   
2810 C  CG2   . THR B 53  ? 0.2252 0.3781 0.2390 0.0488  -0.0447 0.0072  29  THR B CG2   
2811 N  N     . LYS B 54  ? 0.2571 0.2668 0.0606 0.0141  -0.0892 0.0091  30  LYS B N     
2812 C  CA    . LYS B 54  ? 0.2314 0.2931 0.1159 -0.0044 -0.0538 -0.0333 30  LYS B CA    
2813 C  C     . LYS B 54  ? 0.2500 0.2357 0.1467 -0.0044 -0.0696 -0.0245 30  LYS B C     
2814 O  O     . LYS B 54  ? 0.2829 0.3496 0.1466 0.0402  -0.0747 -0.0122 30  LYS B O     
2815 C  CB    . LYS B 54  ? 0.2377 0.2838 0.1429 -0.0019 -0.0344 -0.0175 30  LYS B CB    
2816 C  CG    . LYS B 54  ? 0.3379 0.2281 0.1651 -0.0310 -0.0194 -0.0217 30  LYS B CG    
2817 C  CD    . LYS B 54  ? 0.3879 0.3284 0.2121 -0.0242 0.0453  -0.0272 30  LYS B CD    
2818 C  CE    . LYS B 54  ? 0.3381 0.3960 0.1528 -0.0202 0.0211  -0.0202 30  LYS B CE    
2819 N  NZ    . LYS B 54  ? 0.3507 0.4137 0.0847 0.0014  -0.0551 -0.0155 30  LYS B NZ    
2820 N  N     . ALA B 55  ? 0.3060 0.2593 0.1612 -0.0238 -0.0457 -0.0146 31  ALA B N     
2821 C  CA    . ALA B 55  ? 0.2634 0.2674 0.1777 -0.0112 -0.0376 -0.0217 31  ALA B CA    
2822 C  C     . ALA B 55  ? 0.2662 0.2647 0.1594 -0.0207 -0.0426 0.0215  31  ALA B C     
2823 O  O     . ALA B 55  ? 0.3268 0.3467 0.1924 -0.0602 -0.0432 -0.0250 31  ALA B O     
2824 C  CB    . ALA B 55  ? 0.2737 0.3077 0.1831 0.0081  -0.1053 0.0167  31  ALA B CB    
2825 N  N     . ALA B 56  ? 0.2432 0.2568 0.1375 0.0089  -0.0548 -0.0193 32  ALA B N     
2826 C  CA    . ALA B 56  ? 0.2469 0.2686 0.1470 0.0175  -0.0548 0.0034  32  ALA B CA    
2827 C  C     . ALA B 56  ? 0.2464 0.2945 0.1332 0.0248  -0.0339 -0.0226 32  ALA B C     
2828 O  O     . ALA B 56  ? 0.2224 0.2882 0.1798 -0.0071 -0.0981 -0.0306 32  ALA B O     
2829 C  CB    . ALA B 56  ? 0.3071 0.2797 0.2413 0.0571  -0.0386 0.0662  32  ALA B CB    
2830 N  N     . MSE B 57  ? 0.2618 0.2504 0.1064 0.0195  -0.0714 -0.0265 33  MSE B N     
2831 C  CA    . MSE B 57  ? 0.2419 0.2082 0.1211 0.0023  -0.0871 -0.0338 33  MSE B CA    
2832 C  C     . MSE B 57  ? 0.2091 0.2784 0.1154 -0.0068 -0.0841 0.0068  33  MSE B C     
2833 O  O     . MSE B 57  ? 0.2601 0.3057 0.0758 -0.0097 -0.1082 -0.0083 33  MSE B O     
2834 C  CB    . MSE B 57  ? 0.3051 0.2210 0.1078 0.0059  -0.0768 -0.0312 33  MSE B CB    
2835 C  CG    . MSE B 57  ? 0.3559 0.2779 0.0624 0.0482  -0.0833 -0.0750 33  MSE B CG    
2836 SE SE    . MSE B 57  ? 0.4773 0.4533 0.3009 -0.0110 -0.1081 0.0065  33  MSE B SE    
2837 C  CE    . MSE B 57  ? 0.3577 0.1795 0.2065 -0.0296 0.0870  0.0857  33  MSE B CE    
2838 N  N     . ASN B 58  ? 0.1738 0.2404 0.0640 -0.0024 -0.0527 0.0371  34  ASN B N     
2839 C  CA    . ASN B 58  ? 0.2184 0.2240 0.0851 -0.0156 -0.0725 -0.0019 34  ASN B CA    
2840 C  C     . ASN B 58  ? 0.2370 0.2483 0.1272 -0.0091 -0.0352 0.0034  34  ASN B C     
2841 O  O     . ASN B 58  ? 0.2214 0.2849 0.1151 -0.0233 -0.0844 -0.0019 34  ASN B O     
2842 C  CB    . ASN B 58  ? 0.2083 0.1713 0.1071 0.0059  -0.1159 -0.0090 34  ASN B CB    
2843 C  CG    . ASN B 58  ? 0.2364 0.2336 0.1251 -0.0228 -0.0541 -0.0176 34  ASN B CG    
2844 O  OD1   . ASN B 58  ? 0.2569 0.2444 0.2900 0.0037  0.0112  -0.0015 34  ASN B OD1   
2845 N  ND2   . ASN B 58  ? 0.2493 0.3295 0.0338 -0.0122 -0.0374 0.0279  34  ASN B ND2   
2846 N  N     . LEU B 59  ? 0.2150 0.3113 0.1206 -0.0372 -0.0424 -0.0072 35  LEU B N     
2847 C  CA    . LEU B 59  ? 0.2033 0.2610 0.1127 -0.0501 -0.0530 -0.0198 35  LEU B CA    
2848 C  C     . LEU B 59  ? 0.1794 0.2853 0.1509 -0.0242 -0.0746 -0.0187 35  LEU B C     
2849 O  O     . LEU B 59  ? 0.2684 0.2963 0.0761 0.0004  -0.1109 -0.0069 35  LEU B O     
2850 C  CB    . LEU B 59  ? 0.2315 0.2492 0.1227 -0.0600 -0.0534 0.0148  35  LEU B CB    
2851 C  CG    . LEU B 59  ? 0.2479 0.2472 0.1444 -0.0216 -0.1026 0.0128  35  LEU B CG    
2852 C  CD1   . LEU B 59  ? 0.3416 0.3003 0.1148 -0.0088 -0.0698 -0.0086 35  LEU B CD1   
2853 C  CD2   . LEU B 59  ? 0.3287 0.2492 0.0791 -0.0112 -0.0893 -0.0264 35  LEU B CD2   
2854 N  N     . ILE B 60  ? 0.1872 0.2745 0.1372 -0.0420 -0.0802 -0.0031 36  ILE B N     
2855 C  CA    . ILE B 60  ? 0.1854 0.2463 0.0938 -0.0360 -0.0821 0.0335  36  ILE B CA    
2856 C  C     . ILE B 60  ? 0.2362 0.2509 0.0799 -0.0266 -0.0451 0.0323  36  ILE B C     
2857 O  O     . ILE B 60  ? 0.2785 0.2566 0.0910 -0.0306 -0.0727 0.0189  36  ILE B O     
2858 C  CB    . ILE B 60  ? 0.2280 0.2442 0.0719 0.0017  -0.0666 -0.0133 36  ILE B CB    
2859 C  CG1   . ILE B 60  ? 0.2639 0.2637 0.1058 -0.0247 -0.0968 0.0020  36  ILE B CG1   
2860 C  CG2   . ILE B 60  ? 0.2309 0.3539 0.0632 0.0087  -0.0690 -0.0470 36  ILE B CG2   
2861 C  CD1   . ILE B 60  ? 0.2789 0.2322 0.1177 0.0024  -0.1521 0.0133  36  ILE B CD1   
2862 N  N     . ASP B 61  ? 0.2325 0.3007 0.1189 -0.0348 -0.0349 0.0004  37  ASP B N     
2863 C  CA    . ASP B 61  ? 0.2262 0.3149 0.1475 -0.0194 -0.0413 0.0251  37  ASP B CA    
2864 C  C     . ASP B 61  ? 0.2235 0.3236 0.1927 -0.0090 -0.0458 0.0400  37  ASP B C     
2865 O  O     . ASP B 61  ? 0.2819 0.2931 0.1141 -0.0189 -0.0986 0.0156  37  ASP B O     
2866 C  CB    . ASP B 61  ? 0.3078 0.2897 0.2368 -0.0177 -0.0210 0.0615  37  ASP B CB    
2867 C  CG    . ASP B 61  ? 0.3147 0.2510 0.2510 -0.0622 -0.0171 0.0832  37  ASP B CG    
2868 O  OD1   . ASP B 61  ? 0.2715 0.3910 0.2443 -0.0285 -0.0781 0.0930  37  ASP B OD1   
2869 O  OD2   . ASP B 61  ? 0.4343 0.2706 0.2234 -0.0911 0.0068  0.0846  37  ASP B OD2   
2870 N  N     . ALA B 62  ? 0.2410 0.2833 0.1553 0.0202  -0.0748 0.0205  38  ALA B N     
2871 C  CA    . ALA B 62  ? 0.2404 0.3036 0.1613 0.0109  -0.0647 0.0453  38  ALA B CA    
2872 C  C     . ALA B 62  ? 0.2566 0.3114 0.2136 -0.0288 -0.1116 0.0172  38  ALA B C     
2873 O  O     . ALA B 62  ? 0.2612 0.3853 0.1958 -0.0412 -0.0726 -0.0121 38  ALA B O     
2874 C  CB    . ALA B 62  ? 0.2432 0.3575 0.1179 0.0359  -0.0874 0.0932  38  ALA B CB    
2875 N  N     . GLU B 63  ? 0.2628 0.2905 0.2113 0.0054  -0.1247 0.0164  39  GLU B N     
2876 C  CA    . GLU B 63  ? 0.3220 0.3435 0.1991 -0.0473 -0.0736 -0.0023 39  GLU B CA    
2877 C  C     . GLU B 63  ? 0.2570 0.3197 0.2414 -0.0187 -0.0971 -0.0123 39  GLU B C     
2878 O  O     . GLU B 63  ? 0.3015 0.3318 0.2314 -0.0310 -0.0791 0.0015  39  GLU B O     
2879 C  CB    . GLU B 63  ? 0.3394 0.3418 0.1678 -0.0402 -0.1091 0.0503  39  GLU B CB    
2880 C  CG    . GLU B 63  ? 0.4270 0.3964 0.3089 -0.0781 -0.1343 -0.0448 39  GLU B CG    
2881 C  CD    . GLU B 63  ? 0.5349 0.4166 0.3818 -0.1018 -0.0743 -0.0145 39  GLU B CD    
2882 O  OE1   . GLU B 63  ? 0.5765 0.5054 0.3732 -0.0660 -0.1272 -0.0125 39  GLU B OE1   
2883 O  OE2   . GLU B 63  ? 0.6664 0.6597 0.3351 -0.1330 -0.0538 -0.0730 39  GLU B OE2   
2884 N  N     . ARG B 64  ? 0.2331 0.3453 0.2653 0.0134  -0.0644 0.0115  40  ARG B N     
2885 C  CA    . ARG B 64  ? 0.2368 0.2635 0.2138 -0.0025 -0.0594 -0.0317 40  ARG B CA    
2886 C  C     . ARG B 64  ? 0.2405 0.2886 0.1335 0.0066  -0.0532 -0.0148 40  ARG B C     
2887 O  O     . ARG B 64  ? 0.2959 0.3267 0.0773 -0.0140 -0.0808 0.0192  40  ARG B O     
2888 C  CB    . ARG B 64  ? 0.2326 0.2495 0.2166 -0.0035 -0.0100 0.0525  40  ARG B CB    
2889 C  CG    . ARG B 64  ? 0.2692 0.2901 0.1055 -0.0042 0.0130  0.0728  40  ARG B CG    
2890 C  CD    . ARG B 64  ? 0.2349 0.2841 0.3607 -0.0073 0.0160  -0.0069 40  ARG B CD    
2891 N  NE    . ARG B 64  ? 0.2360 0.4455 0.3407 -0.0314 0.0135  -0.0666 40  ARG B NE    
2892 C  CZ    . ARG B 64  ? 0.3118 0.4044 0.3192 0.0154  -0.0243 -0.0520 40  ARG B CZ    
2893 N  NH1   . ARG B 64  ? 0.3602 0.3666 0.2766 0.0511  -0.0120 -0.1203 40  ARG B NH1   
2894 N  NH2   . ARG B 64  ? 0.3327 0.3436 0.2403 -0.0204 -0.0181 -0.0080 40  ARG B NH2   
2895 N  N     . ALA B 65  ? 0.2679 0.2492 0.2035 -0.0008 -0.0929 -0.0018 41  ALA B N     
2896 C  CA    . ALA B 65  ? 0.2751 0.2446 0.1604 0.0083  -0.0821 0.0051  41  ALA B CA    
2897 C  C     . ALA B 65  ? 0.2635 0.3151 0.1426 -0.0106 -0.0658 0.0019  41  ALA B C     
2898 O  O     . ALA B 65  ? 0.2796 0.2964 0.1127 -0.0318 -0.0808 -0.0186 41  ALA B O     
2899 C  CB    . ALA B 65  ? 0.2879 0.2966 0.0535 -0.0120 -0.0806 0.0344  41  ALA B CB    
2900 N  N     . GLU B 66  ? 0.2594 0.3389 0.1327 -0.0054 -0.0794 -0.0172 42  GLU B N     
2901 C  CA    . GLU B 66  ? 0.2751 0.3792 0.1517 0.0175  -0.0929 0.0137  42  GLU B CA    
2902 C  C     . GLU B 66  ? 0.2776 0.3192 0.1736 -0.0192 -0.1069 -0.0035 42  GLU B C     
2903 O  O     . GLU B 66  ? 0.3144 0.4042 0.1467 -0.0153 -0.0909 -0.0270 42  GLU B O     
2904 C  CB    . GLU B 66  ? 0.2906 0.4123 0.0938 0.0103  -0.1247 0.0179  42  GLU B CB    
2905 C  CG    . GLU B 66  ? 0.4690 0.4191 0.1683 0.0050  -0.2125 -0.1297 42  GLU B CG    
2906 C  CD    . GLU B 66  ? 0.6110 0.4539 0.3125 0.0044  -0.1643 -0.0593 42  GLU B CD    
2907 O  OE1   . GLU B 66  ? 0.5427 0.6987 0.2948 0.0331  -0.3010 -0.0281 42  GLU B OE1   
2908 O  OE2   . GLU B 66  ? 0.6530 0.4154 0.4718 -0.0120 -0.0512 -0.0682 42  GLU B OE2   
2909 N  N     . LEU B 67  ? 0.3053 0.2929 0.2132 -0.0169 -0.0456 -0.0628 43  LEU B N     
2910 C  CA    . LEU B 67  ? 0.3001 0.2158 0.2267 0.0058  -0.0634 -0.0136 43  LEU B CA    
2911 C  C     . LEU B 67  ? 0.2685 0.2345 0.1635 0.0143  -0.0809 -0.0232 43  LEU B C     
2912 O  O     . LEU B 67  ? 0.2861 0.2519 0.1407 -0.0009 -0.1141 -0.0477 43  LEU B O     
2913 C  CB    . LEU B 67  ? 0.3459 0.2458 0.1348 -0.0113 -0.1012 0.0096  43  LEU B CB    
2914 C  CG    . LEU B 67  ? 0.3667 0.3041 0.2331 0.0477  -0.0548 -0.0351 43  LEU B CG    
2915 C  CD1   . LEU B 67  ? 0.3687 0.3508 0.2253 0.0744  -0.0583 0.0200  43  LEU B CD1   
2916 C  CD2   . LEU B 67  ? 0.4524 0.3262 0.3195 -0.0024 -0.1327 0.1132  43  LEU B CD2   
2917 N  N     . LEU B 68  ? 0.2179 0.2083 0.1966 -0.0078 -0.0887 0.0347  44  LEU B N     
2918 C  CA    . LEU B 68  ? 0.2156 0.1966 0.1488 -0.0071 -0.0773 -0.0240 44  LEU B CA    
2919 C  C     . LEU B 68  ? 0.2095 0.2114 0.1028 -0.0094 -0.1125 -0.0345 44  LEU B C     
2920 O  O     . LEU B 68  ? 0.2045 0.2698 0.1276 0.0309  -0.1138 0.0127  44  LEU B O     
2921 C  CB    . LEU B 68  ? 0.2816 0.2869 0.0862 0.0073  -0.0685 -0.0417 44  LEU B CB    
2922 C  CG    . LEU B 68  ? 0.3082 0.3411 0.0918 0.0298  -0.0517 0.0038  44  LEU B CG    
2923 C  CD1   . LEU B 68  ? 0.2910 0.3308 0.1478 -0.0047 -0.0848 0.0055  44  LEU B CD1   
2924 C  CD2   . LEU B 68  ? 0.3840 0.3417 0.0466 0.0342  -0.0862 -0.0218 44  LEU B CD2   
2925 N  N     . TYR B 69  ? 0.2508 0.2007 0.1060 -0.0053 -0.1230 -0.0458 45  TYR B N     
2926 C  CA    . TYR B 69  ? 0.2832 0.2231 0.1142 0.0272  -0.0716 -0.0289 45  TYR B CA    
2927 C  C     . TYR B 69  ? 0.2335 0.2494 0.1247 -0.0001 -0.0825 -0.0105 45  TYR B C     
2928 O  O     . TYR B 69  ? 0.2972 0.2363 0.0934 0.0053  -0.0772 -0.0454 45  TYR B O     
2929 C  CB    . TYR B 69  ? 0.2815 0.2500 0.0987 0.0295  -0.0549 -0.0203 45  TYR B CB    
2930 C  CG    . TYR B 69  ? 0.2243 0.2351 0.0410 0.0067  -0.0336 -0.0469 45  TYR B CG    
2931 C  CD1   . TYR B 69  ? 0.2401 0.2135 0.0357 -0.0060 -0.0461 -0.0086 45  TYR B CD1   
2932 C  CD2   . TYR B 69  ? 0.2477 0.2475 0.0432 0.0269  -0.0610 -0.0232 45  TYR B CD2   
2933 C  CE1   . TYR B 69  ? 0.2593 0.1945 0.0404 0.0357  -0.0485 -0.0362 45  TYR B CE1   
2934 C  CE2   . TYR B 69  ? 0.2515 0.2511 0.0487 -0.0142 -0.0555 -0.0435 45  TYR B CE2   
2935 C  CZ    . TYR B 69  ? 0.2198 0.2577 0.0385 0.0119  -0.0450 -0.0213 45  TYR B CZ    
2936 O  OH    . TYR B 69  ? 0.2714 0.2848 0.1045 0.0160  -0.0972 0.0058  45  TYR B OH    
2937 N  N     . SER B 70  ? 0.2455 0.2507 0.1013 -0.0120 -0.0884 -0.0340 46  SER B N     
2938 C  CA    . SER B 70  ? 0.2618 0.2755 0.1025 -0.0266 -0.0779 -0.0550 46  SER B CA    
2939 C  C     . SER B 70  ? 0.2468 0.2825 0.1278 0.0102  -0.1018 -0.0625 46  SER B C     
2940 O  O     . SER B 70  ? 0.3819 0.3276 0.1122 -0.0335 -0.0898 -0.0759 46  SER B O     
2941 C  CB    . SER B 70  ? 0.2806 0.2792 0.1498 -0.0108 -0.0904 -0.0015 46  SER B CB    
2942 O  OG    . SER B 70  ? 0.3616 0.2791 0.1413 -0.0208 -0.0993 0.0058  46  SER B OG    
2943 N  N     . ARG B 71  ? 0.2638 0.2393 0.0800 -0.0014 -0.0921 -0.0350 47  ARG B N     
2944 C  CA    . ARG B 71  ? 0.2386 0.2242 0.1352 0.0256  -0.0857 0.0145  47  ARG B CA    
2945 C  C     . ARG B 71  ? 0.2415 0.2229 0.1285 0.0338  -0.0476 0.0269  47  ARG B C     
2946 O  O     . ARG B 71  ? 0.2699 0.2872 0.0807 0.0255  -0.0464 0.0129  47  ARG B O     
2947 C  CB    . ARG B 71  ? 0.2549 0.2007 0.1442 0.0114  -0.0480 0.0194  47  ARG B CB    
2948 C  CG    . ARG B 71  ? 0.2461 0.2655 0.0689 -0.0202 -0.0848 -0.0144 47  ARG B CG    
2949 C  CD    . ARG B 71  ? 0.2849 0.2910 0.0621 0.0015  -0.0679 -0.0075 47  ARG B CD    
2950 N  NE    . ARG B 71  ? 0.3415 0.3120 0.0854 -0.0274 -0.0818 -0.0427 47  ARG B NE    
2951 C  CZ    . ARG B 71  ? 0.3308 0.3304 0.1216 -0.0016 -0.0940 -0.0232 47  ARG B CZ    
2952 N  NH1   . ARG B 71  ? 0.3208 0.3901 0.0686 -0.0128 -0.0793 -0.0839 47  ARG B NH1   
2953 N  NH2   . ARG B 71  ? 0.2826 0.3866 0.2163 -0.0011 -0.1125 0.0249  47  ARG B NH2   
2954 N  N     . MSE B 72  ? 0.2657 0.2614 0.0510 0.0047  -0.0715 0.0310  48  MSE B N     
2955 C  CA    . MSE B 72  ? 0.2610 0.1843 0.0944 0.0248  -0.0885 0.0277  48  MSE B CA    
2956 C  C     . MSE B 72  ? 0.2563 0.2210 0.1307 0.0185  -0.0469 0.0682  48  MSE B C     
2957 O  O     . MSE B 72  ? 0.2659 0.2669 0.1472 0.0187  -0.0718 0.0304  48  MSE B O     
2958 C  CB    . MSE B 72  ? 0.2848 0.2247 0.1393 0.0320  -0.0215 0.0076  48  MSE B CB    
2959 C  CG    . MSE B 72  ? 0.2735 0.3119 0.1909 0.0007  -0.0589 0.0619  48  MSE B CG    
2960 SE SE    . MSE B 72  ? 0.5459 0.6589 0.2814 0.0685  -0.1042 -0.0689 48  MSE B SE    
2961 C  CE    . MSE B 72  ? 0.4604 0.4292 0.0723 -0.0157 -0.0762 -0.1137 48  MSE B CE    
2962 N  N     . GLY B 73  ? 0.2651 0.2714 0.1910 0.0178  -0.0131 0.0551  49  GLY B N     
2963 C  CA    . GLY B 73  ? 0.3255 0.2667 0.1687 0.0248  -0.0636 0.0413  49  GLY B CA    
2964 C  C     . GLY B 73  ? 0.3130 0.2713 0.1676 -0.0156 -0.0768 0.0181  49  GLY B C     
2965 O  O     . GLY B 73  ? 0.3243 0.2892 0.1624 -0.0241 -0.0715 0.0214  49  GLY B O     
2966 N  N     . PRO B 74  ? 0.3166 0.2416 0.1357 -0.0002 -0.1627 -0.0004 50  PRO B N     
2967 C  CA    . PRO B 74  ? 0.2844 0.2511 0.1305 -0.0243 -0.1021 -0.0136 50  PRO B CA    
2968 C  C     . PRO B 74  ? 0.2168 0.2841 0.1425 -0.0021 -0.0942 0.0140  50  PRO B C     
2969 O  O     . PRO B 74  ? 0.2342 0.3203 0.1141 0.0062  -0.1154 0.0185  50  PRO B O     
2970 C  CB    . PRO B 74  ? 0.3339 0.2639 0.1339 -0.0111 -0.1040 0.0008  50  PRO B CB    
2971 C  CG    . PRO B 74  ? 0.4184 0.2920 0.1261 -0.0092 -0.0887 -0.0336 50  PRO B CG    
2972 C  CD    . PRO B 74  ? 0.4191 0.3138 0.1511 -0.0013 -0.0630 -0.0294 50  PRO B CD    
2973 N  N     . ALA B 75  ? 0.2489 0.2853 0.1020 -0.0047 -0.0962 0.0277  51  ALA B N     
2974 C  CA    . ALA B 75  ? 0.2175 0.2722 0.1159 -0.0175 -0.0911 0.0320  51  ALA B CA    
2975 C  C     . ALA B 75  ? 0.2230 0.2680 0.1403 0.0024  -0.0893 0.0186  51  ALA B C     
2976 O  O     . ALA B 75  ? 0.3033 0.2868 0.1123 0.0167  -0.1237 0.0195  51  ALA B O     
2977 C  CB    . ALA B 75  ? 0.2376 0.2821 0.1390 -0.0112 -0.0756 0.0367  51  ALA B CB    
2978 N  N     . LEU B 76  ? 0.1983 0.2622 0.1214 -0.0122 -0.0723 0.0407  52  LEU B N     
2979 C  CA    . LEU B 76  ? 0.2106 0.2562 0.1366 0.0023  -0.0512 0.0529  52  LEU B CA    
2980 C  C     . LEU B 76  ? 0.2556 0.2355 0.1322 0.0022  -0.0498 0.0208  52  LEU B C     
2981 O  O     . LEU B 76  ? 0.2761 0.2868 0.1237 0.0085  -0.0704 0.0565  52  LEU B O     
2982 C  CB    . LEU B 76  ? 0.2251 0.3062 0.1328 -0.0111 0.0131  0.0259  52  LEU B CB    
2983 C  CG    . LEU B 76  ? 0.1788 0.3617 0.1354 -0.0225 0.0072  0.0114  52  LEU B CG    
2984 C  CD1   . LEU B 76  ? 0.1883 0.3951 0.0416 -0.0428 0.0378  0.0421  52  LEU B CD1   
2985 C  CD2   . LEU B 76  ? 0.3253 0.3524 0.2377 0.0154  -0.0244 0.0224  52  LEU B CD2   
2986 N  N     . GLU B 77  ? 0.2488 0.2726 0.1157 0.0018  -0.0452 -0.0111 53  GLU B N     
2987 C  CA    . GLU B 77  ? 0.1831 0.2605 0.1007 -0.0093 -0.0793 0.0105  53  GLU B CA    
2988 C  C     . GLU B 77  ? 0.1961 0.2290 0.1061 -0.0132 -0.0575 0.0154  53  GLU B C     
2989 O  O     . GLU B 77  ? 0.2265 0.2453 0.0776 0.0098  -0.0714 0.0390  53  GLU B O     
2990 C  CB    . GLU B 77  ? 0.2008 0.2456 0.1582 -0.0251 -0.0553 -0.0101 53  GLU B CB    
2991 C  CG    . GLU B 77  ? 0.2710 0.2596 0.1511 -0.0566 -0.0723 -0.0100 53  GLU B CG    
2992 C  CD    . GLU B 77  ? 0.3296 0.2414 0.1535 -0.0041 -0.0844 0.0052  53  GLU B CD    
2993 O  OE1   . GLU B 77  ? 0.3410 0.2659 0.1697 -0.0412 -0.0974 -0.0178 53  GLU B OE1   
2994 O  OE2   . GLU B 77  ? 0.2681 0.2964 0.1202 0.0024  -0.1243 0.0329  53  GLU B OE2   
2995 N  N     . ALA B 78  ? 0.1784 0.2321 0.0703 -0.0164 -0.0342 -0.0053 54  ALA B N     
2996 C  CA    . ALA B 78  ? 0.2035 0.2381 0.0701 -0.0385 -0.0338 0.0012  54  ALA B CA    
2997 C  C     . ALA B 78  ? 0.2337 0.2075 0.0718 -0.0184 -0.0575 0.0111  54  ALA B C     
2998 O  O     . ALA B 78  ? 0.2126 0.2338 0.0510 -0.0322 -0.0692 0.0169  54  ALA B O     
2999 C  CB    . ALA B 78  ? 0.2296 0.2538 0.0487 -0.0109 -0.0177 0.0193  54  ALA B CB    
3000 N  N     . SER B 79  ? 0.2732 0.2403 0.0800 -0.0152 -0.0307 0.0015  55  SER B N     
3001 C  CA    . SER B 79  ? 0.2364 0.1995 0.0765 -0.0045 -0.0567 0.0128  55  SER B CA    
3002 C  C     . SER B 79  ? 0.1904 0.2142 0.1163 -0.0123 -0.0431 0.0016  55  SER B C     
3003 O  O     . SER B 79  ? 0.2194 0.2572 0.1177 0.0089  -0.0233 -0.0115 55  SER B O     
3004 C  CB    . SER B 79  ? 0.2144 0.2067 0.1451 0.0137  -0.0685 -0.0049 55  SER B CB    
3005 O  OG    . SER B 79  ? 0.2163 0.2624 0.1848 0.0031  0.0392  -0.0477 55  SER B OG    
3006 N  N     . GLY B 80  ? 0.2343 0.1923 0.1529 0.0153  -0.0709 0.0133  56  GLY B N     
3007 C  CA    . GLY B 80  ? 0.2224 0.1872 0.0875 0.0051  -0.0660 0.0161  56  GLY B CA    
3008 C  C     . GLY B 80  ? 0.2091 0.1571 0.0882 -0.0054 -0.0821 -0.0028 56  GLY B C     
3009 O  O     . GLY B 80  ? 0.2499 0.1742 0.0982 0.0134  -0.0853 -0.0059 56  GLY B O     
3010 N  N     . GLY B 81  ? 0.2197 0.1737 0.0942 -0.0217 -0.0890 0.0196  57  GLY B N     
3011 C  CA    . GLY B 81  ? 0.1870 0.2230 0.0913 -0.0031 -0.0380 0.0356  57  GLY B CA    
3012 C  C     . GLY B 81  ? 0.2013 0.1587 0.0864 -0.0181 -0.0671 -0.0241 57  GLY B C     
3013 O  O     . GLY B 81  ? 0.2124 0.1553 0.1158 -0.0313 -0.1125 -0.0344 57  GLY B O     
3014 N  N     . SER B 82  ? 0.1674 0.1796 0.1158 -0.0070 -0.0776 -0.0331 58  SER B N     
3015 C  CA    A SER B 82  ? 0.1622 0.1664 0.1403 -0.0008 -0.0645 -0.0169 58  SER B CA    
3016 C  CA    B SER B 82  ? 0.1630 0.1774 0.1400 0.0007  -0.0613 -0.0272 58  SER B CA    
3017 C  C     . SER B 82  ? 0.1800 0.1666 0.1514 -0.0280 -0.0456 -0.0150 58  SER B C     
3018 O  O     . SER B 82  ? 0.1742 0.1626 0.0896 -0.0287 -0.0412 -0.0151 58  SER B O     
3019 C  CB    A SER B 82  ? 0.1651 0.1788 0.1503 0.0135  -0.0693 -0.0109 58  SER B CB    
3020 C  CB    B SER B 82  ? 0.2211 0.1790 0.1472 0.0252  -0.0592 -0.0363 58  SER B CB    
3021 O  OG    A SER B 82  ? 0.1635 0.1707 0.1896 0.0124  -0.0686 0.0560  58  SER B OG    
3022 O  OG    B SER B 82  ? 0.2842 0.2538 0.1736 0.0581  -0.0312 -0.0562 58  SER B OG    
3023 N  N     . ALA B 83  ? 0.1924 0.1966 0.1537 -0.0020 -0.0405 -0.0012 59  ALA B N     
3024 C  CA    . ALA B 83  ? 0.2077 0.2126 0.1146 -0.0019 -0.0522 -0.0036 59  ALA B CA    
3025 C  C     . ALA B 83  ? 0.1788 0.2004 0.1353 -0.0106 -0.0443 -0.0126 59  ALA B C     
3026 O  O     . ALA B 83  ? 0.2231 0.1876 0.1593 -0.0231 -0.0832 0.0517  59  ALA B O     
3027 C  CB    . ALA B 83  ? 0.1730 0.2143 0.1632 -0.0343 -0.0257 0.0105  59  ALA B CB    
3028 N  N     . GLY B 84  ? 0.1835 0.2027 0.1438 -0.0126 -0.0582 -0.0155 60  GLY B N     
3029 C  CA    . GLY B 84  ? 0.2061 0.1705 0.1653 -0.0367 -0.0146 -0.0080 60  GLY B CA    
3030 C  C     . GLY B 84  ? 0.2001 0.1713 0.1749 -0.0316 -0.0155 0.0027  60  GLY B C     
3031 O  O     . GLY B 84  ? 0.2046 0.1884 0.1240 -0.0402 -0.0146 -0.0162 60  GLY B O     
3032 N  N     . ASN B 85  ? 0.1678 0.2277 0.1464 -0.0159 -0.0401 0.0024  61  ASN B N     
3033 C  CA    . ASN B 85  ? 0.1667 0.2292 0.1014 -0.0126 -0.0477 0.0128  61  ASN B CA    
3034 C  C     . ASN B 85  ? 0.1626 0.2095 0.1098 -0.0299 -0.0429 0.0433  61  ASN B C     
3035 O  O     . ASN B 85  ? 0.2021 0.1986 0.0694 -0.0326 -0.0526 0.0492  61  ASN B O     
3036 C  CB    . ASN B 85  ? 0.1778 0.1860 0.1485 -0.0287 -0.0625 0.0210  61  ASN B CB    
3037 C  CG    . ASN B 85  ? 0.1741 0.1927 0.1819 -0.0182 -0.0673 0.0002  61  ASN B CG    
3038 O  OD1   . ASN B 85  ? 0.2167 0.2464 0.1337 0.0078  -0.0525 0.0393  61  ASN B OD1   
3039 N  ND2   . ASN B 85  ? 0.2188 0.1861 0.1841 -0.0546 -0.0561 0.0004  61  ASN B ND2   
3040 N  N     . THR B 86  ? 0.1708 0.2469 0.0891 -0.0059 -0.0563 0.0289  62  THR B N     
3041 C  CA    . THR B 86  ? 0.1441 0.2137 0.0964 -0.0197 -0.0375 0.0343  62  THR B CA    
3042 C  C     . THR B 86  ? 0.1672 0.2064 0.0971 -0.0145 -0.0364 0.0474  62  THR B C     
3043 O  O     . THR B 86  ? 0.1922 0.2016 0.0794 -0.0265 -0.0426 0.0561  62  THR B O     
3044 C  CB    . THR B 86  ? 0.1657 0.1940 0.1158 -0.0110 -0.0496 0.0343  62  THR B CB    
3045 O  OG1   . THR B 86  ? 0.1993 0.2318 0.1567 0.0030  -0.0449 0.0254  62  THR B OG1   
3046 C  CG2   . THR B 86  ? 0.1593 0.2445 0.1266 -0.0228 -0.0574 0.0508  62  THR B CG2   
3047 N  N     . ALA B 87  ? 0.1871 0.2028 0.0926 0.0044  -0.0488 0.0419  63  ALA B N     
3048 C  CA    . ALA B 87  ? 0.1720 0.2072 0.1049 0.0329  -0.0334 0.0429  63  ALA B CA    
3049 C  C     . ALA B 87  ? 0.1896 0.1903 0.1141 -0.0034 -0.0289 0.0285  63  ALA B C     
3050 O  O     . ALA B 87  ? 0.1948 0.2103 0.1165 -0.0167 -0.0330 0.0159  63  ALA B O     
3051 C  CB    . ALA B 87  ? 0.1524 0.2164 0.1285 -0.0369 -0.0314 0.0434  63  ALA B CB    
3052 N  N     . ALA B 88  ? 0.2169 0.2202 0.0986 0.0108  -0.0316 0.0347  64  ALA B N     
3053 C  CA    . ALA B 88  ? 0.2084 0.2335 0.0745 -0.0008 -0.0288 0.0199  64  ALA B CA    
3054 C  C     . ALA B 88  ? 0.2075 0.2035 0.0363 -0.0136 -0.0447 0.0006  64  ALA B C     
3055 O  O     . ALA B 88  ? 0.2274 0.2171 0.1644 -0.0273 -0.0729 0.0122  64  ALA B O     
3056 C  CB    . ALA B 88  ? 0.2089 0.2504 0.1372 -0.0721 -0.0777 0.0555  64  ALA B CB    
3057 N  N     . GLY B 89  ? 0.1917 0.2580 0.0611 -0.0003 -0.0765 -0.0120 65  GLY B N     
3058 C  CA    . GLY B 89  ? 0.2022 0.2617 0.1085 -0.0007 -0.0360 0.0207  65  GLY B CA    
3059 C  C     . GLY B 89  ? 0.2041 0.2472 0.0847 -0.0029 -0.0296 0.0262  65  GLY B C     
3060 O  O     . GLY B 89  ? 0.2556 0.2874 0.0491 -0.0436 -0.0529 0.0184  65  GLY B O     
3061 N  N     . VAL B 90  ? 0.2320 0.2431 0.0870 0.0200  -0.0167 -0.0042 66  VAL B N     
3062 C  CA    . VAL B 90  ? 0.2209 0.2156 0.1145 -0.0098 -0.0309 0.0109  66  VAL B CA    
3063 C  C     . VAL B 90  ? 0.1856 0.2164 0.1207 -0.0089 -0.0190 -0.0189 66  VAL B C     
3064 O  O     . VAL B 90  ? 0.2425 0.2551 0.2255 -0.0570 0.0102  -0.0368 66  VAL B O     
3065 C  CB    . VAL B 90  ? 0.2504 0.1496 0.1124 0.0147  -0.0397 0.0186  66  VAL B CB    
3066 C  CG1   . VAL B 90  ? 0.2330 0.1847 0.0831 0.0249  -0.0653 0.0180  66  VAL B CG1   
3067 C  CG2   . VAL B 90  ? 0.2225 0.1666 0.1480 0.0456  -0.0830 -0.0118 66  VAL B CG2   
3068 N  N     . ALA B 91  ? 0.1821 0.1804 0.1372 0.0168  -0.0069 -0.0340 67  ALA B N     
3069 C  CA    . ALA B 91  ? 0.1695 0.2000 0.1653 -0.0078 -0.0227 0.0097  67  ALA B CA    
3070 C  C     . ALA B 91  ? 0.1972 0.1919 0.1506 0.0091  -0.0253 0.0295  67  ALA B C     
3071 O  O     . ALA B 91  ? 0.3035 0.2668 0.1968 -0.0700 -0.0311 0.0657  67  ALA B O     
3072 C  CB    . ALA B 91  ? 0.1626 0.1717 0.0586 -0.0112 -0.0368 -0.0184 67  ALA B CB    
3073 N  N     . ASN B 92  ? 0.2186 0.2909 0.1785 -0.0185 0.0208  -0.0173 68  ASN B N     
3074 C  CA    . ASN B 92  ? 0.2577 0.2917 0.1578 -0.0319 0.0040  -0.0138 68  ASN B CA    
3075 C  C     . ASN B 92  ? 0.2773 0.2399 0.2229 -0.0455 -0.0186 0.0171  68  ASN B C     
3076 O  O     . ASN B 92  ? 0.3655 0.2775 0.1662 -0.0473 0.0264  0.0580  68  ASN B O     
3077 C  CB    . ASN B 92  ? 0.3118 0.2723 0.1892 -0.0034 -0.0326 -0.0163 68  ASN B CB    
3078 C  CG    . ASN B 92  ? 0.3155 0.2655 0.1599 -0.0185 -0.0762 -0.0017 68  ASN B CG    
3079 O  OD1   . ASN B 92  ? 0.3016 0.3361 0.1750 -0.0360 -0.0752 -0.0134 68  ASN B OD1   
3080 N  ND2   . ASN B 92  ? 0.3144 0.3056 0.1927 -0.0202 -0.0625 -0.0477 68  ASN B ND2   
3081 N  N     . LEU B 93  ? 0.2379 0.3275 0.2577 -0.0152 -0.0501 0.0296  69  LEU B N     
3082 C  CA    . LEU B 93  ? 0.2497 0.2213 0.2874 -0.0222 -0.0584 -0.0103 69  LEU B CA    
3083 C  C     . LEU B 93  ? 0.2224 0.2631 0.1886 -0.0334 -0.0595 -0.0096 69  LEU B C     
3084 O  O     . LEU B 93  ? 0.2668 0.2942 0.1866 -0.0828 -0.0463 -0.0276 69  LEU B O     
3085 C  CB    . LEU B 93  ? 0.2963 0.1923 0.2777 -0.0165 -0.0268 -0.0026 69  LEU B CB    
3086 C  CG    . LEU B 93  ? 0.2188 0.1881 0.2118 -0.0586 -0.0147 -0.0034 69  LEU B CG    
3087 C  CD1   . LEU B 93  ? 0.2519 0.1981 0.2635 0.0154  -0.0389 0.0268  69  LEU B CD1   
3088 C  CD2   . LEU B 93  ? 0.2369 0.2694 0.2301 -0.0217 0.0508  -0.0559 69  LEU B CD2   
3089 N  N     . GLY B 94  ? 0.2464 0.2846 0.1708 -0.0381 -0.0625 -0.0431 70  GLY B N     
3090 C  CA    . GLY B 94  ? 0.3305 0.2990 0.2373 -0.0039 -0.0377 -0.0627 70  GLY B CA    
3091 C  C     . GLY B 94  ? 0.3250 0.2797 0.1974 0.0013  -0.1313 0.0220  70  GLY B C     
3092 O  O     . GLY B 94  ? 0.4075 0.3659 0.1802 -0.0070 -0.1066 -0.0003 70  GLY B O     
3093 N  N     . GLY B 95  ? 0.3212 0.3093 0.1669 -0.0044 -0.0733 0.0019  71  GLY B N     
3094 C  CA    . GLY B 95  ? 0.2779 0.3281 0.1768 -0.0093 -0.0194 -0.0571 71  GLY B CA    
3095 C  C     . GLY B 95  ? 0.2671 0.2942 0.1294 -0.0451 -0.0157 -0.0900 71  GLY B C     
3096 O  O     . GLY B 95  ? 0.2599 0.2963 0.1728 0.0056  -0.0442 -0.1016 71  GLY B O     
3097 N  N     . LYS B 96  ? 0.2748 0.2781 0.1054 -0.0392 -0.0362 -0.0382 72  LYS B N     
3098 C  CA    A LYS B 96  ? 0.2665 0.1915 0.1142 -0.0334 -0.0735 -0.0363 72  LYS B CA    
3099 C  CA    B LYS B 96  ? 0.2675 0.1935 0.1042 -0.0354 -0.0679 -0.0418 72  LYS B CA    
3100 C  C     . LYS B 96  ? 0.2568 0.2128 0.1506 -0.0411 -0.0915 -0.0031 72  LYS B C     
3101 O  O     . LYS B 96  ? 0.2885 0.2456 0.1282 -0.0065 -0.0921 -0.0065 72  LYS B O     
3102 C  CB    A LYS B 96  ? 0.2859 0.1691 0.0907 -0.0523 -0.0844 -0.0161 72  LYS B CB    
3103 C  CB    B LYS B 96  ? 0.2604 0.1964 0.0745 -0.0488 -0.0580 -0.0269 72  LYS B CB    
3104 C  CG    A LYS B 96  ? 0.2594 0.1677 0.0705 -0.0082 -0.0801 -0.0014 72  LYS B CG    
3105 C  CG    B LYS B 96  ? 0.2175 0.1922 0.0269 -0.0249 -0.0177 0.0022  72  LYS B CG    
3106 C  CD    A LYS B 96  ? 0.2711 0.2803 0.1542 -0.0558 -0.0499 -0.0464 72  LYS B CD    
3107 C  CD    B LYS B 96  ? 0.2297 0.2130 0.1083 -0.0341 -0.0208 0.0421  72  LYS B CD    
3108 C  CE    A LYS B 96  ? 0.3197 0.2768 0.1946 -0.0355 -0.0983 -0.0612 72  LYS B CE    
3109 C  CE    B LYS B 96  ? 0.1202 0.1829 0.1135 -0.0945 -0.0133 0.0502  72  LYS B CE    
3110 N  NZ    A LYS B 96  ? 0.2727 0.3052 0.3232 -0.0961 -0.0876 -0.1437 72  LYS B NZ    
3111 N  NZ    B LYS B 96  ? 0.1540 0.1831 0.0843 -0.0995 -0.0135 0.0472  72  LYS B NZ    
3112 N  N     . ALA B 97  ? 0.2595 0.1716 0.1409 -0.0197 -0.0854 -0.0486 73  ALA B N     
3113 C  CA    . ALA B 97  ? 0.2328 0.1700 0.0752 -0.0054 -0.0861 -0.0430 73  ALA B CA    
3114 C  C     . ALA B 97  ? 0.2490 0.1981 0.0622 0.0037  -0.0740 -0.0476 73  ALA B C     
3115 O  O     . ALA B 97  ? 0.2730 0.2394 0.0990 0.0249  -0.0556 -0.0793 73  ALA B O     
3116 C  CB    . ALA B 97  ? 0.2480 0.2313 0.1351 -0.0176 0.0231  -0.0828 73  ALA B CB    
3117 N  N     . ALA B 98  ? 0.2100 0.2382 0.0544 0.0009  -0.0556 -0.0516 74  ALA B N     
3118 C  CA    . ALA B 98  ? 0.2240 0.2156 0.0762 0.0065  -0.0235 -0.0524 74  ALA B CA    
3119 C  C     . ALA B 98  ? 0.1863 0.2265 0.1376 -0.0165 -0.0489 -0.0247 74  ALA B C     
3120 O  O     . ALA B 98  ? 0.2031 0.3094 0.0891 0.0168  -0.0990 -0.0095 74  ALA B O     
3121 C  CB    . ALA B 98  ? 0.2884 0.2328 0.0701 0.0163  -0.0057 -0.0306 74  ALA B CB    
3122 N  N     . TYR B 99  ? 0.1928 0.2052 0.1377 -0.0228 -0.0786 -0.0115 75  TYR B N     
3123 C  CA    . TYR B 99  ? 0.1963 0.2003 0.1016 -0.0116 -0.0707 -0.0234 75  TYR B CA    
3124 C  C     . TYR B 99  ? 0.2097 0.1969 0.0787 0.0028  -0.0609 0.0004  75  TYR B C     
3125 O  O     . TYR B 99  ? 0.2274 0.2256 0.0509 0.0149  -0.0562 -0.0149 75  TYR B O     
3126 C  CB    . TYR B 99  ? 0.2294 0.2085 0.0982 0.0060  -0.0702 0.0223  75  TYR B CB    
3127 C  CG    . TYR B 99  ? 0.1967 0.2135 0.1026 0.0061  -0.0613 -0.0071 75  TYR B CG    
3128 C  CD1   . TYR B 99  ? 0.1931 0.1762 0.1389 -0.0067 -0.0932 0.0037  75  TYR B CD1   
3129 C  CD2   . TYR B 99  ? 0.1860 0.2307 0.1585 -0.0142 -0.0420 0.0225  75  TYR B CD2   
3130 C  CE1   . TYR B 99  ? 0.2171 0.1802 0.1765 -0.0197 -0.0556 0.0066  75  TYR B CE1   
3131 C  CE2   . TYR B 99  ? 0.2341 0.2075 0.0942 0.0050  -0.0250 0.0121  75  TYR B CE2   
3132 C  CZ    . TYR B 99  ? 0.2209 0.1667 0.0797 -0.0199 -0.0500 0.0177  75  TYR B CZ    
3133 O  OH    . TYR B 99  ? 0.2442 0.2274 0.0759 -0.0540 -0.0620 -0.0104 75  TYR B OH    
3134 N  N     . PHE B 100 ? 0.2033 0.1835 0.0937 -0.0074 -0.0823 -0.0151 76  PHE B N     
3135 C  CA    . PHE B 100 ? 0.1742 0.1713 0.0969 0.0093  -0.1005 0.0171  76  PHE B CA    
3136 C  C     . PHE B 100 ? 0.1589 0.2040 0.1229 0.0121  -0.0658 -0.0191 76  PHE B C     
3137 O  O     . PHE B 100 ? 0.2031 0.2341 0.0564 0.0285  -0.0724 -0.0296 76  PHE B O     
3138 C  CB    . PHE B 100 ? 0.2091 0.2145 0.0792 -0.0024 -0.0543 0.0068  76  PHE B CB    
3139 C  CG    . PHE B 100 ? 0.2150 0.1711 0.1034 0.0135  -0.0544 0.0073  76  PHE B CG    
3140 C  CD1   . PHE B 100 ? 0.2427 0.1699 0.1068 -0.0081 -0.0497 -0.0138 76  PHE B CD1   
3141 C  CD2   . PHE B 100 ? 0.2717 0.2020 0.0597 -0.0129 -0.0478 -0.0083 76  PHE B CD2   
3142 C  CE1   . PHE B 100 ? 0.2669 0.1974 0.0841 0.0055  -0.0680 -0.0089 76  PHE B CE1   
3143 C  CE2   . PHE B 100 ? 0.2608 0.1572 0.1320 0.0125  0.0022  -0.0560 76  PHE B CE2   
3144 C  CZ    . PHE B 100 ? 0.2633 0.1768 0.0778 0.0351  -0.0370 -0.0024 76  PHE B CZ    
3145 N  N     . GLY B 101 ? 0.1838 0.3073 0.1111 -0.0084 -0.0905 -0.0416 77  GLY B N     
3146 C  CA    . GLY B 101 ? 0.1978 0.2277 0.1053 0.0212  -0.0753 -0.0245 77  GLY B CA    
3147 C  C     . GLY B 101 ? 0.1939 0.2419 0.0874 0.0170  -0.0635 0.0011  77  GLY B C     
3148 O  O     . GLY B 101 ? 0.2696 0.2424 0.0776 0.0112  -0.0588 0.0015  77  GLY B O     
3149 N  N     . ASN B 102 ? 0.1676 0.2830 0.0700 0.0168  -0.0648 0.0469  78  ASN B N     
3150 C  CA    . ASN B 102 ? 0.1517 0.3026 0.1125 -0.0241 -0.0445 0.0205  78  ASN B CA    
3151 C  C     . ASN B 102 ? 0.1778 0.2437 0.1080 -0.0218 -0.0332 0.0078  78  ASN B C     
3152 O  O     . ASN B 102 ? 0.2288 0.2920 0.0575 -0.0176 -0.0780 -0.0167 78  ASN B O     
3153 C  CB    . ASN B 102 ? 0.1740 0.2866 0.0983 -0.0112 -0.0448 0.0298  78  ASN B CB    
3154 C  CG    . ASN B 102 ? 0.1757 0.2216 0.0900 -0.0083 -0.0896 0.0519  78  ASN B CG    
3155 O  OD1   . ASN B 102 ? 0.2073 0.2526 0.1173 -0.0068 -0.0488 0.0290  78  ASN B OD1   
3156 N  ND2   . ASN B 102 ? 0.1862 0.2666 0.1864 -0.0426 -0.0964 0.0486  78  ASN B ND2   
3157 N  N     . VAL B 103 ? 0.1846 0.2605 0.1128 -0.0209 -0.0307 0.0016  79  VAL B N     
3158 C  CA    . VAL B 103 ? 0.1388 0.2418 0.1133 -0.0052 -0.0334 0.0476  79  VAL B CA    
3159 C  C     . VAL B 103 ? 0.1445 0.2759 0.1162 -0.0099 -0.0287 -0.0039 79  VAL B C     
3160 O  O     . VAL B 103 ? 0.2291 0.2873 0.0532 -0.0158 -0.0435 0.0304  79  VAL B O     
3161 C  CB    . VAL B 103 ? 0.1207 0.2193 0.0873 0.0142  -0.0178 0.0257  79  VAL B CB    
3162 C  CG1   . VAL B 103 ? 0.1212 0.2897 0.0791 0.0320  -0.0313 0.0253  79  VAL B CG1   
3163 C  CG2   . VAL B 103 ? 0.1772 0.2222 0.0460 0.0064  -0.0198 0.0259  79  VAL B CG2   
3164 N  N     . ALA B 104 ? 0.1613 0.3017 0.1011 0.0073  -0.0492 0.0337  80  ALA B N     
3165 C  CA    . ALA B 104 ? 0.1648 0.2774 0.0995 0.0075  -0.0207 -0.0033 80  ALA B CA    
3166 C  C     . ALA B 104 ? 0.2046 0.3013 0.1387 0.0213  -0.0277 0.0128  80  ALA B C     
3167 O  O     . ALA B 104 ? 0.2355 0.2990 0.0868 -0.0047 -0.0835 0.0463  80  ALA B O     
3168 C  CB    . ALA B 104 ? 0.1900 0.2916 0.1224 -0.0106 -0.0431 0.0075  80  ALA B CB    
3169 N  N     . ALA B 105 ? 0.2154 0.3082 0.1170 0.0379  -0.0329 -0.0040 81  ALA B N     
3170 C  CA    . ALA B 105 ? 0.2318 0.3066 0.1355 0.0419  -0.0348 -0.0022 81  ALA B CA    
3171 C  C     . ALA B 105 ? 0.2027 0.3367 0.1281 0.0598  -0.0446 0.0296  81  ALA B C     
3172 O  O     . ALA B 105 ? 0.2126 0.4207 0.1560 0.0592  -0.0482 -0.0093 81  ALA B O     
3173 C  CB    . ALA B 105 ? 0.2618 0.3838 0.0527 0.0363  -0.0106 0.0659  81  ALA B CB    
3174 N  N     . ASP B 106 ? 0.2407 0.3049 0.1095 0.0392  -0.0410 -0.0114 82  ASP B N     
3175 C  CA    . ASP B 106 ? 0.2462 0.2830 0.1153 0.0178  -0.0521 -0.0091 82  ASP B CA    
3176 C  C     . ASP B 106 ? 0.2256 0.2856 0.1316 0.0065  -0.0573 -0.0240 82  ASP B C     
3177 O  O     . ASP B 106 ? 0.2165 0.3020 0.1357 0.0015  -0.0773 -0.0118 82  ASP B O     
3178 C  CB    . ASP B 106 ? 0.2494 0.2862 0.1496 0.0163  -0.0554 0.0080  82  ASP B CB    
3179 C  CG    . ASP B 106 ? 0.2492 0.2273 0.1667 -0.0095 -0.0450 0.0489  82  ASP B CG    
3180 O  OD1   . ASP B 106 ? 0.2263 0.3029 0.1872 -0.0038 -0.0666 0.0212  82  ASP B OD1   
3181 O  OD2   . ASP B 106 ? 0.2551 0.2194 0.0994 0.0050  -0.0288 0.0381  82  ASP B OD2   
3182 N  N     . GLN B 107 ? 0.2245 0.2681 0.1156 0.0143  -0.0301 0.0132  83  GLN B N     
3183 C  CA    . GLN B 107 ? 0.2129 0.2990 0.0864 -0.0010 -0.0410 -0.0052 83  GLN B CA    
3184 C  C     . GLN B 107 ? 0.2094 0.2394 0.0664 -0.0247 -0.0535 -0.0031 83  GLN B C     
3185 O  O     . GLN B 107 ? 0.2062 0.2581 0.0743 -0.0262 -0.0546 0.0021  83  GLN B O     
3186 C  CB    . GLN B 107 ? 0.2435 0.2845 0.1126 0.0153  -0.0744 -0.0619 83  GLN B CB    
3187 C  CG    . GLN B 107 ? 0.2253 0.2881 0.1432 0.0004  -0.0587 -0.0129 83  GLN B CG    
3188 C  CD    . GLN B 107 ? 0.2868 0.2311 0.1460 0.0181  -0.0723 -0.0145 83  GLN B CD    
3189 O  OE1   . GLN B 107 ? 0.2861 0.2368 0.1355 0.0374  -0.0852 -0.0010 83  GLN B OE1   
3190 N  NE2   . GLN B 107 ? 0.3313 0.2925 0.1163 0.0174  -0.0830 0.0390  83  GLN B NE2   
3191 N  N     . LEU B 108 ? 0.1964 0.2347 0.1016 0.0006  -0.0555 -0.0482 84  LEU B N     
3192 C  CA    . LEU B 108 ? 0.2040 0.2189 0.1215 0.0041  -0.0579 -0.0156 84  LEU B CA    
3193 C  C     . LEU B 108 ? 0.1833 0.2342 0.1208 -0.0070 -0.0489 -0.0167 84  LEU B C     
3194 O  O     . LEU B 108 ? 0.1960 0.2183 0.1500 -0.0210 -0.0465 -0.0082 84  LEU B O     
3195 C  CB    . LEU B 108 ? 0.2395 0.2166 0.0868 -0.0268 -0.0476 -0.0243 84  LEU B CB    
3196 C  CG    . LEU B 108 ? 0.2565 0.2348 0.1137 -0.0015 -0.0160 -0.0686 84  LEU B CG    
3197 C  CD1   . LEU B 108 ? 0.3230 0.2428 0.2053 -0.0062 -0.0074 -0.0599 84  LEU B CD1   
3198 C  CD2   . LEU B 108 ? 0.3047 0.2950 0.0952 0.0089  -0.0103 -0.0204 84  LEU B CD2   
3199 N  N     . GLY B 109 ? 0.2090 0.2251 0.1114 0.0009  -0.0468 -0.0247 85  GLY B N     
3200 C  CA    . GLY B 109 ? 0.1814 0.2232 0.1162 -0.0262 -0.0621 -0.0125 85  GLY B CA    
3201 C  C     . GLY B 109 ? 0.2108 0.2215 0.1507 -0.0193 -0.0555 0.0033  85  GLY B C     
3202 O  O     . GLY B 109 ? 0.1874 0.2315 0.1710 -0.0339 -0.0463 0.0188  85  GLY B O     
3203 N  N     . ASP B 110 ? 0.2222 0.2271 0.1890 0.0197  -0.0694 -0.0188 86  ASP B N     
3204 C  CA    . ASP B 110 ? 0.2171 0.2449 0.1553 0.0006  -0.0374 -0.0076 86  ASP B CA    
3205 C  C     . ASP B 110 ? 0.2048 0.2186 0.1317 0.0029  -0.0534 0.0034  86  ASP B C     
3206 O  O     . ASP B 110 ? 0.1977 0.2604 0.1709 -0.0070 -0.1037 -0.0009 86  ASP B O     
3207 C  CB    . ASP B 110 ? 0.1743 0.2887 0.2356 0.0068  -0.0473 -0.0259 86  ASP B CB    
3208 C  CG    . ASP B 110 ? 0.2047 0.3671 0.2483 0.0302  -0.0283 -0.0162 86  ASP B CG    
3209 O  OD1   . ASP B 110 ? 0.2842 0.3894 0.2400 0.0722  -0.0365 -0.0468 86  ASP B OD1   
3210 O  OD2   . ASP B 110 ? 0.2260 0.4235 0.3549 -0.0240 -0.0880 0.0792  86  ASP B OD2   
3211 N  N     . ILE B 111 ? 0.1664 0.2535 0.0996 -0.0034 -0.0676 -0.0121 87  ILE B N     
3212 C  CA    . ILE B 111 ? 0.1765 0.2687 0.1210 0.0025  -0.0524 -0.0234 87  ILE B CA    
3213 C  C     . ILE B 111 ? 0.1777 0.2418 0.1276 -0.0121 -0.0506 0.0047  87  ILE B C     
3214 O  O     . ILE B 111 ? 0.2046 0.2594 0.0791 -0.0305 -0.0641 -0.0031 87  ILE B O     
3215 C  CB    . ILE B 111 ? 0.1818 0.2501 0.1507 -0.0017 -0.0625 -0.0364 87  ILE B CB    
3216 C  CG1   . ILE B 111 ? 0.2201 0.2480 0.1525 0.0036  -0.0571 -0.0098 87  ILE B CG1   
3217 C  CG2   . ILE B 111 ? 0.1936 0.2560 0.1586 -0.0240 -0.0600 -0.0497 87  ILE B CG2   
3218 C  CD1   . ILE B 111 ? 0.2912 0.2077 0.2106 -0.0177 -0.0130 -0.0336 87  ILE B CD1   
3219 N  N     . PHE B 112 ? 0.1697 0.2345 0.0813 0.0059  -0.0449 -0.0127 88  PHE B N     
3220 C  CA    . PHE B 112 ? 0.1668 0.1941 0.1023 0.0133  -0.0435 0.0010  88  PHE B CA    
3221 C  C     . PHE B 112 ? 0.1881 0.1942 0.0793 0.0153  -0.0516 0.0077  88  PHE B C     
3222 O  O     . PHE B 112 ? 0.1988 0.2127 0.0987 -0.0011 -0.0528 0.0128  88  PHE B O     
3223 C  CB    . PHE B 112 ? 0.1567 0.1908 0.0806 -0.0084 -0.0414 -0.0218 88  PHE B CB    
3224 C  CG    . PHE B 112 ? 0.1729 0.2043 0.1201 0.0258  -0.0430 0.0013  88  PHE B CG    
3225 C  CD1   . PHE B 112 ? 0.1867 0.1978 0.1183 0.0268  -0.0218 -0.0123 88  PHE B CD1   
3226 C  CD2   . PHE B 112 ? 0.1590 0.2303 0.1234 0.0175  0.0011  -0.0165 88  PHE B CD2   
3227 C  CE1   . PHE B 112 ? 0.1770 0.2376 0.1698 0.0226  -0.0302 0.0093  88  PHE B CE1   
3228 C  CE2   . PHE B 112 ? 0.1934 0.2476 0.1025 0.0065  -0.0077 -0.0076 88  PHE B CE2   
3229 C  CZ    . PHE B 112 ? 0.2289 0.1984 0.1373 0.0096  -0.0312 -0.0188 88  PHE B CZ    
3230 N  N     . THR B 113 ? 0.2075 0.2093 0.0502 0.0272  -0.0577 -0.0003 89  THR B N     
3231 C  CA    . THR B 113 ? 0.2290 0.1861 0.0742 0.0289  -0.0588 0.0013  89  THR B CA    
3232 C  C     . THR B 113 ? 0.2144 0.2294 0.0848 0.0017  -0.0480 -0.0018 89  THR B C     
3233 O  O     . THR B 113 ? 0.2094 0.2625 0.1212 -0.0083 -0.0550 0.0051  89  THR B O     
3234 C  CB    . THR B 113 ? 0.2175 0.2231 0.1107 0.0135  -0.0582 -0.0032 89  THR B CB    
3235 O  OG1   . THR B 113 ? 0.2661 0.2759 0.0913 0.0121  -0.0662 0.0319  89  THR B OG1   
3236 C  CG2   . THR B 113 ? 0.2431 0.2469 0.0926 0.0252  -0.0270 -0.0230 89  THR B CG2   
3237 N  N     . HIS B 114 ? 0.2031 0.2282 0.1008 0.0139  -0.0579 0.0229  90  HIS B N     
3238 C  CA    . HIS B 114 ? 0.2150 0.2708 0.0847 -0.0074 -0.0428 0.0215  90  HIS B CA    
3239 C  C     . HIS B 114 ? 0.2068 0.2207 0.0862 -0.0053 -0.0757 0.0406  90  HIS B C     
3240 O  O     . HIS B 114 ? 0.2038 0.2515 0.0779 -0.0286 -0.0840 0.0580  90  HIS B O     
3241 C  CB    . HIS B 114 ? 0.1883 0.2279 0.0989 0.0056  -0.0598 0.0178  90  HIS B CB    
3242 C  CG    . HIS B 114 ? 0.2385 0.2162 0.1038 -0.0145 -0.0538 0.0118  90  HIS B CG    
3243 N  ND1   . HIS B 114 ? 0.2733 0.2144 0.1249 -0.0232 -0.0746 0.0224  90  HIS B ND1   
3244 C  CD2   . HIS B 114 ? 0.2553 0.2309 0.0780 -0.0080 -0.0562 -0.0078 90  HIS B CD2   
3245 C  CE1   . HIS B 114 ? 0.2612 0.1880 0.1427 -0.0350 -0.0670 -0.0021 90  HIS B CE1   
3246 N  NE2   . HIS B 114 ? 0.2747 0.2137 0.1066 -0.0432 -0.1228 -0.0401 90  HIS B NE2   
3247 N  N     . ASP B 115 ? 0.1903 0.2365 0.0855 -0.0137 -0.0798 0.0255  91  ASP B N     
3248 C  CA    . ASP B 115 ? 0.1857 0.2798 0.1339 -0.0031 -0.0722 0.0124  91  ASP B CA    
3249 C  C     . ASP B 115 ? 0.2011 0.2992 0.1105 -0.0306 -0.0604 -0.0057 91  ASP B C     
3250 O  O     . ASP B 115 ? 0.2205 0.2962 0.0772 -0.0407 -0.0895 -0.0059 91  ASP B O     
3251 C  CB    . ASP B 115 ? 0.1916 0.2881 0.1765 -0.0177 -0.0639 -0.0062 91  ASP B CB    
3252 C  CG    . ASP B 115 ? 0.2550 0.2392 0.1223 0.0091  -0.0329 0.0068  91  ASP B CG    
3253 O  OD1   . ASP B 115 ? 0.2375 0.2614 0.1366 0.0148  -0.0575 0.0127  91  ASP B OD1   
3254 O  OD2   . ASP B 115 ? 0.2898 0.2726 0.1325 -0.0066 -0.0205 -0.0077 91  ASP B OD2   
3255 N  N     . ILE B 116 ? 0.1804 0.2753 0.1241 -0.0168 -0.0705 0.0044  92  ILE B N     
3256 C  CA    . ILE B 116 ? 0.1996 0.2666 0.0828 -0.0053 -0.0484 0.0178  92  ILE B CA    
3257 C  C     . ILE B 116 ? 0.1824 0.2286 0.1302 -0.0075 -0.0512 0.0551  92  ILE B C     
3258 O  O     . ILE B 116 ? 0.2153 0.2596 0.1417 -0.0170 -0.0725 -0.0107 92  ILE B O     
3259 C  CB    . ILE B 116 ? 0.1518 0.2193 0.0965 0.0238  -0.0578 0.0144  92  ILE B CB    
3260 C  CG1   . ILE B 116 ? 0.1748 0.2189 0.1305 0.0225  -0.0764 0.0439  92  ILE B CG1   
3261 C  CG2   . ILE B 116 ? 0.1888 0.2522 0.0869 0.0021  -0.0336 0.0319  92  ILE B CG2   
3262 C  CD1   . ILE B 116 ? 0.2558 0.2085 0.0907 0.0483  -0.0701 0.0358  92  ILE B CD1   
3263 N  N     . ARG B 117 ? 0.2025 0.2371 0.1737 0.0026  -0.0381 0.0146  93  ARG B N     
3264 C  CA    . ARG B 117 ? 0.2202 0.2521 0.1681 0.0042  -0.0384 0.0032  93  ARG B CA    
3265 C  C     . ARG B 117 ? 0.2528 0.2170 0.1302 -0.0158 -0.0526 -0.0285 93  ARG B C     
3266 O  O     . ARG B 117 ? 0.2192 0.2698 0.1634 -0.0319 -0.0765 -0.0323 93  ARG B O     
3267 C  CB    . ARG B 117 ? 0.2013 0.2709 0.1864 0.0010  -0.0822 -0.0007 93  ARG B CB    
3268 C  CG    . ARG B 117 ? 0.2578 0.3033 0.1440 -0.0158 -0.0743 -0.0236 93  ARG B CG    
3269 C  CD    . ARG B 117 ? 0.2728 0.2646 0.1895 0.0223  -0.1202 -0.0120 93  ARG B CD    
3270 N  NE    . ARG B 117 ? 0.2771 0.2803 0.2269 0.0264  -0.0808 -0.0403 93  ARG B NE    
3271 C  CZ    . ARG B 117 ? 0.2889 0.2940 0.2048 0.0322  -0.0229 -0.0123 93  ARG B CZ    
3272 N  NH1   . ARG B 117 ? 0.2661 0.4213 0.2572 0.0521  -0.0110 -0.0259 93  ARG B NH1   
3273 N  NH2   . ARG B 117 ? 0.3247 0.3671 0.0409 0.0136  -0.0199 -0.0099 93  ARG B NH2   
3274 N  N     . ALA B 118 ? 0.2356 0.2783 0.1103 -0.0107 -0.0672 0.0127  94  ALA B N     
3275 C  CA    . ALA B 118 ? 0.2279 0.2991 0.1306 -0.0216 -0.0666 0.0187  94  ALA B CA    
3276 C  C     . ALA B 118 ? 0.2280 0.2573 0.1253 -0.0014 -0.0802 0.0035  94  ALA B C     
3277 O  O     . ALA B 118 ? 0.2602 0.3410 0.1900 -0.0342 -0.0753 0.0432  94  ALA B O     
3278 C  CB    . ALA B 118 ? 0.2670 0.2958 0.1147 -0.0620 -0.0536 0.0251  94  ALA B CB    
3279 N  N     . GLN B 119 ? 0.2456 0.2311 0.1100 0.0140  -0.0494 -0.0138 95  GLN B N     
3280 C  CA    . GLN B 119 ? 0.2349 0.2567 0.1478 -0.0112 -0.0562 -0.0049 95  GLN B CA    
3281 C  C     . GLN B 119 ? 0.2265 0.2656 0.1488 0.0073  -0.0536 -0.0143 95  GLN B C     
3282 O  O     . GLN B 119 ? 0.2398 0.3437 0.1815 -0.0112 -0.0808 -0.0027 95  GLN B O     
3283 C  CB    . GLN B 119 ? 0.2306 0.2758 0.1620 0.0205  -0.0246 -0.0007 95  GLN B CB    
3284 C  CG    . GLN B 119 ? 0.2203 0.3730 0.1681 -0.0110 -0.0953 0.0129  95  GLN B CG    
3285 C  CD    . GLN B 119 ? 0.3064 0.4731 0.2519 -0.0292 -0.0303 0.0330  95  GLN B CD    
3286 O  OE1   . GLN B 119 ? 0.3244 0.5173 0.4216 -0.0735 -0.0022 0.0294  95  GLN B OE1   
3287 N  NE2   . GLN B 119 ? 0.3017 0.5491 0.2330 0.0121  -0.0672 0.0303  95  GLN B NE2   
3288 N  N     . GLY B 120 ? 0.2691 0.2345 0.1268 -0.0079 -0.0344 -0.0065 96  GLY B N     
3289 C  CA    . GLY B 120 ? 0.2066 0.2008 0.1183 -0.0099 -0.0704 0.0217  96  GLY B CA    
3290 C  C     . GLY B 120 ? 0.2172 0.2125 0.1233 -0.0384 -0.0798 0.0236  96  GLY B C     
3291 O  O     . GLY B 120 ? 0.2042 0.2557 0.0932 -0.0249 -0.1016 0.0622  96  GLY B O     
3292 N  N     . VAL B 121 ? 0.2404 0.1894 0.1725 -0.0061 -0.0551 0.0394  97  VAL B N     
3293 C  CA    . VAL B 121 ? 0.1866 0.2033 0.1328 -0.0218 -0.0324 0.0127  97  VAL B CA    
3294 C  C     . VAL B 121 ? 0.1551 0.2729 0.1044 -0.0296 -0.0438 -0.0088 97  VAL B C     
3295 O  O     . VAL B 121 ? 0.1587 0.2733 0.0881 -0.0198 -0.0447 -0.0191 97  VAL B O     
3296 C  CB    . VAL B 121 ? 0.1821 0.2039 0.1803 0.0016  -0.0512 0.0097  97  VAL B CB    
3297 C  CG1   . VAL B 121 ? 0.2228 0.2276 0.1809 -0.0584 -0.0600 -0.0015 97  VAL B CG1   
3298 C  CG2   . VAL B 121 ? 0.1844 0.3015 0.1435 -0.0026 -0.0527 0.0196  97  VAL B CG2   
3299 N  N     . HIS B 122 ? 0.1777 0.2224 0.0981 -0.0192 -0.0375 0.0029  98  HIS B N     
3300 C  CA    . HIS B 122 ? 0.1935 0.2467 0.1265 -0.0160 -0.0257 -0.0021 98  HIS B CA    
3301 C  C     . HIS B 122 ? 0.1643 0.2356 0.1154 0.0049  -0.0278 -0.0024 98  HIS B C     
3302 O  O     . HIS B 122 ? 0.1941 0.2589 0.1030 0.0301  -0.0260 0.0198  98  HIS B O     
3303 C  CB    . HIS B 122 ? 0.2428 0.2552 0.1311 -0.0079 -0.0355 -0.0331 98  HIS B CB    
3304 C  CG    . HIS B 122 ? 0.2670 0.2906 0.1853 -0.0304 -0.0073 -0.0034 98  HIS B CG    
3305 N  ND1   . HIS B 122 ? 0.3128 0.3424 0.2780 0.0111  0.0447  -0.0107 98  HIS B ND1   
3306 C  CD2   . HIS B 122 ? 0.2770 0.2807 0.1441 -0.0084 -0.0233 0.0059  98  HIS B CD2   
3307 C  CE1   . HIS B 122 ? 0.3150 0.3007 0.1294 0.0086  -0.0284 0.0302  98  HIS B CE1   
3308 N  NE2   . HIS B 122 ? 0.2920 0.2897 0.1832 0.0484  -0.0358 0.0198  98  HIS B NE2   
3309 N  N     . TYR B 123 ? 0.1515 0.2731 0.1055 0.0165  -0.0121 -0.0007 99  TYR B N     
3310 C  CA    . TYR B 123 ? 0.2186 0.2433 0.0954 0.0083  -0.0367 -0.0390 99  TYR B CA    
3311 C  C     . TYR B 123 ? 0.2307 0.2411 0.1544 0.0236  -0.0292 -0.0139 99  TYR B C     
3312 O  O     . TYR B 123 ? 0.2245 0.2683 0.1905 0.0352  -0.0779 -0.0413 99  TYR B O     
3313 C  CB    . TYR B 123 ? 0.2013 0.2407 0.1014 0.0063  -0.0954 -0.0413 99  TYR B CB    
3314 C  CG    . TYR B 123 ? 0.1862 0.2272 0.0986 -0.0041 -0.0522 -0.0221 99  TYR B CG    
3315 C  CD1   . TYR B 123 ? 0.2241 0.2201 0.0883 -0.0111 -0.0347 -0.0405 99  TYR B CD1   
3316 C  CD2   . TYR B 123 ? 0.1654 0.3123 0.0961 -0.0077 -0.0410 -0.0121 99  TYR B CD2   
3317 C  CE1   . TYR B 123 ? 0.2189 0.2826 0.0932 -0.0456 -0.0480 -0.0196 99  TYR B CE1   
3318 C  CE2   . TYR B 123 ? 0.2562 0.2748 0.0349 -0.0272 -0.0448 -0.0098 99  TYR B CE2   
3319 C  CZ    . TYR B 123 ? 0.2447 0.2473 0.1517 0.0007  -0.0884 0.0182  99  TYR B CZ    
3320 O  OH    . TYR B 123 ? 0.2323 0.3083 0.1284 -0.0141 -0.1125 -0.0073 99  TYR B OH    
3321 N  N     . GLN B 124 ? 0.2328 0.3128 0.1973 -0.0163 -0.0060 -0.0178 100 GLN B N     
3322 C  CA    A GLN B 124 ? 0.2396 0.2727 0.1950 -0.0108 -0.0118 0.0145  100 GLN B CA    
3323 C  CA    B GLN B 124 ? 0.2418 0.2637 0.1844 -0.0091 -0.0132 0.0114  100 GLN B CA    
3324 C  C     . GLN B 124 ? 0.2438 0.2573 0.1885 -0.0156 -0.0200 -0.0048 100 GLN B C     
3325 O  O     . GLN B 124 ? 0.2255 0.2778 0.2070 -0.0259 -0.0417 -0.0432 100 GLN B O     
3326 C  CB    A GLN B 124 ? 0.2600 0.2555 0.2169 -0.0068 -0.0620 0.0226  100 GLN B CB    
3327 C  CB    B GLN B 124 ? 0.2352 0.2263 0.1976 -0.0070 -0.0372 0.0248  100 GLN B CB    
3328 C  CG    A GLN B 124 ? 0.2000 0.2601 0.2043 0.0085  -0.0553 0.0423  100 GLN B CG    
3329 C  CG    B GLN B 124 ? 0.1576 0.2269 0.1692 0.0014  -0.0070 0.0093  100 GLN B CG    
3330 C  CD    A GLN B 124 ? 0.2545 0.2762 0.1983 -0.0074 -0.0450 0.0453  100 GLN B CD    
3331 C  CD    B GLN B 124 ? 0.1756 0.2239 0.1558 0.0103  0.0218  0.0337  100 GLN B CD    
3332 O  OE1   A GLN B 124 ? 0.2679 0.2990 0.2794 0.0008  -0.0511 0.0747  100 GLN B OE1   
3333 O  OE1   B GLN B 124 ? 0.1708 0.2515 0.1953 -0.0023 0.0550  0.0297  100 GLN B OE1   
3334 N  NE2   A GLN B 124 ? 0.3517 0.3890 0.1358 -0.0256 -0.1645 0.0407  100 GLN B NE2   
3335 N  NE2   B GLN B 124 ? 0.1481 0.2919 0.1578 0.0089  -0.0064 0.0045  100 GLN B NE2   
3336 N  N     . THR B 125 ? 0.2801 0.2359 0.1447 -0.0435 -0.0472 0.0080  101 THR B N     
3337 C  CA    . THR B 125 ? 0.2241 0.2412 0.0988 -0.0325 -0.0458 -0.0234 101 THR B CA    
3338 C  C     . THR B 125 ? 0.2050 0.2965 0.1591 -0.0262 -0.0375 -0.0367 101 THR B C     
3339 O  O     . THR B 125 ? 0.2768 0.3802 0.1787 -0.0218 -0.1215 0.0471  101 THR B O     
3340 C  CB    . THR B 125 ? 0.1677 0.2411 0.1616 -0.0156 -0.0338 0.0222  101 THR B CB    
3341 O  OG1   . THR B 125 ? 0.2045 0.2867 0.1390 -0.0191 -0.0912 0.0110  101 THR B OG1   
3342 C  CG2   . THR B 125 ? 0.2359 0.2211 0.2453 -0.0135 0.0106  0.0144  101 THR B CG2   
3343 N  N     . LYS B 126 ? 0.1758 0.2711 0.2024 -0.0378 -0.0458 -0.0624 102 LYS B N     
3344 C  CA    . LYS B 126 ? 0.2028 0.3009 0.3031 0.0377  -0.0505 -0.0179 102 LYS B CA    
3345 C  C     . LYS B 126 ? 0.2507 0.3118 0.2045 0.0138  -0.0531 0.0051  102 LYS B C     
3346 O  O     . LYS B 126 ? 0.2946 0.3134 0.1050 0.0208  -0.0904 -0.0269 102 LYS B O     
3347 C  CB    . LYS B 126 ? 0.2851 0.2913 0.3218 0.0069  -0.0049 -0.0414 102 LYS B CB    
3348 C  CG    . LYS B 126 ? 0.3059 0.3018 0.4184 -0.0257 -0.0185 -0.0554 102 LYS B CG    
3349 C  CD    . LYS B 126 ? 0.4266 0.2872 0.4036 -0.0353 -0.0511 -0.0746 102 LYS B CD    
3350 C  CE    . LYS B 126 ? 0.4411 0.4150 0.3010 -0.0798 -0.1888 -0.1013 102 LYS B CE    
3351 N  NZ    . LYS B 126 ? 0.3352 0.3929 0.2904 -0.0569 -0.0448 -0.0252 102 LYS B NZ    
3352 N  N     . PRO B 127 ? 0.3004 0.3617 0.1805 0.0157  -0.0352 -0.0226 103 PRO B N     
3353 C  CA    . PRO B 127 ? 0.2649 0.3544 0.1937 0.0052  -0.0205 0.0159  103 PRO B CA    
3354 C  C     . PRO B 127 ? 0.2421 0.2977 0.1596 0.0076  -0.0504 0.0116  103 PRO B C     
3355 O  O     . PRO B 127 ? 0.2748 0.3874 0.1602 -0.0123 -0.0490 -0.0476 103 PRO B O     
3356 C  CB    . PRO B 127 ? 0.2992 0.3128 0.2145 -0.0074 -0.0249 0.0476  103 PRO B CB    
3357 C  CG    . PRO B 127 ? 0.3347 0.3685 0.2552 -0.0570 0.0205  -0.0122 103 PRO B CG    
3358 C  CD    . PRO B 127 ? 0.3432 0.3729 0.2491 -0.0098 -0.0585 0.0107  103 PRO B CD    
3359 N  N     . LYS B 128 ? 0.2309 0.3376 0.1122 -0.0420 -0.0633 0.0364  104 LYS B N     
3360 C  CA    . LYS B 128 ? 0.1947 0.3700 0.2020 -0.0513 -0.0350 0.0015  104 LYS B CA    
3361 C  C     . LYS B 128 ? 0.2335 0.4844 0.1758 -0.0464 -0.0746 0.0632  104 LYS B C     
3362 O  O     . LYS B 128 ? 0.2837 0.5615 0.2796 -0.0382 -0.0018 0.0571  104 LYS B O     
3363 C  CB    . LYS B 128 ? 0.2402 0.4059 0.1818 -0.0416 -0.0665 0.0193  104 LYS B CB    
3364 C  CG    . LYS B 128 ? 0.2608 0.4557 0.2247 -0.0203 -0.1059 0.0146  104 LYS B CG    
3365 C  CD    . LYS B 128 ? 0.2844 0.4606 0.3399 -0.0224 -0.0769 0.0136  104 LYS B CD    
3366 C  CE    . LYS B 128 ? 0.3590 0.4356 0.3187 -0.0477 -0.1024 0.0088  104 LYS B CE    
3367 N  NZ    . LYS B 128 ? 0.3591 0.3922 0.1790 0.0257  -0.1445 0.0521  104 LYS B NZ    
3368 N  N     . GLY B 129 ? 0.1768 0.4581 0.1720 -0.0663 -0.0420 -0.0258 105 GLY B N     
3369 C  CA    . GLY B 129 ? 0.1403 0.4801 0.1837 -0.0459 -0.0307 -0.0102 105 GLY B CA    
3370 C  C     . GLY B 129 ? 0.1662 0.4272 0.1519 -0.0342 -0.0311 0.0335  105 GLY B C     
3371 O  O     . GLY B 129 ? 0.1768 0.4106 0.1379 0.0033  -0.0257 0.0109  105 GLY B O     
3372 N  N     . ALA B 130 ? 0.1670 0.4292 0.1564 -0.0012 -0.0460 0.0298  106 ALA B N     
3373 C  CA    . ALA B 130 ? 0.1652 0.4226 0.1572 0.0278  -0.0532 0.0459  106 ALA B CA    
3374 C  C     . ALA B 130 ? 0.2548 0.4133 0.1895 -0.0022 -0.0404 0.0414  106 ALA B C     
3375 O  O     . ALA B 130 ? 0.2865 0.4682 0.1674 0.0268  -0.0462 0.0762  106 ALA B O     
3376 C  CB    . ALA B 130 ? 0.1766 0.4518 0.2234 0.0656  -0.0750 0.0440  106 ALA B CB    
3377 N  N     . PHE B 131 ? 0.2708 0.3804 0.1791 -0.0044 -0.0653 0.0373  107 PHE B N     
3378 C  CA    . PHE B 131 ? 0.2600 0.3582 0.2066 -0.0379 -0.0674 0.0291  107 PHE B CA    
3379 C  C     . PHE B 131 ? 0.2706 0.3540 0.2052 -0.0116 -0.0507 0.0462  107 PHE B C     
3380 O  O     . PHE B 131 ? 0.2645 0.4260 0.2027 0.0461  -0.0929 0.0255  107 PHE B O     
3381 C  CB    . PHE B 131 ? 0.2607 0.3869 0.2529 -0.0533 -0.0858 0.0378  107 PHE B CB    
3382 C  CG    . PHE B 131 ? 0.3673 0.4043 0.3367 -0.0438 -0.0391 0.0087  107 PHE B CG    
3383 C  CD1   . PHE B 131 ? 0.3691 0.3754 0.3813 -0.0225 -0.0646 0.0084  107 PHE B CD1   
3384 C  CD2   . PHE B 131 ? 0.3900 0.4545 0.3758 -0.0657 -0.0912 -0.0727 107 PHE B CD2   
3385 C  CE1   . PHE B 131 ? 0.4139 0.3690 0.4872 -0.0460 -0.0652 -0.0078 107 PHE B CE1   
3386 C  CE2   . PHE B 131 ? 0.5082 0.4057 0.5063 -0.0875 -0.1069 -0.0015 107 PHE B CE2   
3387 C  CZ    . PHE B 131 ? 0.5757 0.4094 0.4950 -0.0543 -0.0594 -0.0324 107 PHE B CZ    
3388 N  N     . PRO B 132 ? 0.2954 0.3603 0.1961 -0.0076 -0.0451 0.0186  108 PRO B N     
3389 C  CA    . PRO B 132 ? 0.2622 0.3103 0.2048 -0.0306 -0.0517 0.0162  108 PRO B CA    
3390 C  C     . PRO B 132 ? 0.2671 0.2948 0.1689 -0.0210 -0.0354 0.0009  108 PRO B C     
3391 O  O     . PRO B 132 ? 0.2536 0.2787 0.1475 -0.0537 -0.0365 0.0271  108 PRO B O     
3392 C  CB    . PRO B 132 ? 0.2960 0.3012 0.2632 -0.0002 -0.0032 0.0537  108 PRO B CB    
3393 C  CG    . PRO B 132 ? 0.3078 0.3684 0.2184 -0.0019 -0.0595 0.0581  108 PRO B CG    
3394 C  CD    . PRO B 132 ? 0.3190 0.3315 0.2163 -0.0065 -0.0477 0.0584  108 PRO B CD    
3395 N  N     . PRO B 133 ? 0.2467 0.2523 0.1644 -0.0374 -0.0553 0.0118  109 PRO B N     
3396 C  CA    . PRO B 133 ? 0.2098 0.2384 0.1621 -0.0395 -0.0262 -0.0144 109 PRO B CA    
3397 C  C     . PRO B 133 ? 0.2058 0.2101 0.1367 -0.0213 -0.0417 -0.0141 109 PRO B C     
3398 O  O     . PRO B 133 ? 0.2191 0.2319 0.1350 -0.0054 -0.0164 -0.0042 109 PRO B O     
3399 C  CB    . PRO B 133 ? 0.2736 0.2398 0.1624 -0.0152 -0.0272 -0.0327 109 PRO B CB    
3400 C  CG    . PRO B 133 ? 0.2707 0.2441 0.1645 -0.0144 -0.0011 -0.0181 109 PRO B CG    
3401 C  CD    . PRO B 133 ? 0.2906 0.2776 0.1581 -0.0236 -0.0105 -0.0224 109 PRO B CD    
3402 N  N     . THR B 134 ? 0.1657 0.2362 0.1676 -0.0355 -0.0567 0.0000  110 THR B N     
3403 C  CA    . THR B 134 ? 0.1542 0.2150 0.1514 -0.0125 -0.0556 0.0215  110 THR B CA    
3404 C  C     . THR B 134 ? 0.1711 0.2528 0.1241 0.0099  -0.0600 0.0216  110 THR B C     
3405 O  O     . THR B 134 ? 0.2222 0.2447 0.1155 0.0076  -0.0806 0.0298  110 THR B O     
3406 C  CB    . THR B 134 ? 0.1393 0.2121 0.1369 -0.0199 -0.0554 0.0056  110 THR B CB    
3407 O  OG1   . THR B 134 ? 0.2099 0.2355 0.1744 -0.0045 -0.0413 0.0105  110 THR B OG1   
3408 C  CG2   . THR B 134 ? 0.1335 0.2530 0.0918 -0.0048 -0.0583 0.0081  110 THR B CG2   
3409 N  N     . ALA B 135 ? 0.1826 0.2682 0.0821 0.0360  -0.0395 0.0353  111 ALA B N     
3410 C  CA    . ALA B 135 ? 0.1869 0.2192 0.1144 0.0279  -0.0604 0.0437  111 ALA B CA    
3411 C  C     . ALA B 135 ? 0.2020 0.2041 0.1287 0.0072  -0.0453 0.0206  111 ALA B C     
3412 O  O     . ALA B 135 ? 0.2360 0.1875 0.1092 -0.0028 -0.0727 0.0002  111 ALA B O     
3413 C  CB    . ALA B 135 ? 0.1746 0.2224 0.1015 0.0092  -0.0621 -0.0018 111 ALA B CB    
3414 N  N     . ARG B 136 ? 0.2203 0.2165 0.1523 -0.0056 -0.0616 0.0022  112 ARG B N     
3415 C  CA    . ARG B 136 ? 0.1970 0.2186 0.1303 0.0008  -0.0737 -0.0019 112 ARG B CA    
3416 C  C     . ARG B 136 ? 0.1884 0.2004 0.1175 -0.0201 -0.0840 -0.0232 112 ARG B C     
3417 O  O     . ARG B 136 ? 0.2727 0.2409 0.0973 0.0077  -0.0412 0.0014  112 ARG B O     
3418 C  CB    . ARG B 136 ? 0.1998 0.2081 0.1417 -0.0152 -0.0920 -0.0215 112 ARG B CB    
3419 C  CG    . ARG B 136 ? 0.2235 0.2081 0.1339 -0.0413 -0.0835 -0.0032 112 ARG B CG    
3420 C  CD    . ARG B 136 ? 0.2285 0.2724 0.1787 0.0131  -0.0335 -0.0114 112 ARG B CD    
3421 N  NE    . ARG B 136 ? 0.2265 0.2372 0.1905 -0.0006 -0.0317 -0.0186 112 ARG B NE    
3422 C  CZ    . ARG B 136 ? 0.2319 0.2644 0.1726 0.0029  -0.0552 -0.0487 112 ARG B CZ    
3423 N  NH1   . ARG B 136 ? 0.2436 0.3349 0.1828 -0.0083 -0.0933 -0.0453 112 ARG B NH1   
3424 N  NH2   . ARG B 136 ? 0.2380 0.2806 0.1165 0.0098  -0.0771 -0.0376 112 ARG B NH2   
3425 N  N     . SER B 137 ? 0.1893 0.2251 0.1296 -0.0015 -0.0771 -0.0218 113 SER B N     
3426 C  CA    . SER B 137 ? 0.1495 0.2441 0.1277 0.0053  -0.0520 0.0028  113 SER B CA    
3427 C  C     . SER B 137 ? 0.1893 0.2241 0.1299 0.0043  -0.0575 0.0101  113 SER B C     
3428 O  O     . SER B 137 ? 0.1899 0.2437 0.1144 -0.0003 -0.0505 0.0152  113 SER B O     
3429 C  CB    . SER B 137 ? 0.1658 0.2551 0.1043 0.0329  -0.0661 -0.0071 113 SER B CB    
3430 O  OG    . SER B 137 ? 0.2608 0.2456 0.1151 0.0364  -0.0663 -0.0194 113 SER B OG    
3431 N  N     . MSE B 138 ? 0.2560 0.2367 0.1084 0.0104  -0.0540 0.0104  114 MSE B N     
3432 C  CA    . MSE B 138 ? 0.1968 0.2106 0.1307 0.0061  -0.0443 -0.0291 114 MSE B CA    
3433 C  C     . MSE B 138 ? 0.2037 0.1552 0.1058 0.0038  -0.0626 -0.0219 114 MSE B C     
3434 O  O     . MSE B 138 ? 0.2532 0.2026 0.0926 0.0452  -0.0543 0.0136  114 MSE B O     
3435 C  CB    . MSE B 138 ? 0.2433 0.1988 0.1139 0.0211  -0.0982 -0.0206 114 MSE B CB    
3436 C  CG    . MSE B 138 ? 0.3351 0.3309 0.1307 0.0998  -0.1255 0.0816  114 MSE B CG    
3437 SE SE    . MSE B 138 ? 0.6248 0.5350 0.3512 -0.0329 -0.1096 -0.0102 114 MSE B SE    
3438 C  CE    . MSE B 138 ? 0.3061 0.4017 0.3055 -0.0111 -0.1774 0.0524  114 MSE B CE    
3439 N  N     . ILE B 139 ? 0.1957 0.2175 0.0605 0.0010  -0.0591 -0.0290 115 ILE B N     
3440 C  CA    . ILE B 139 ? 0.2136 0.2186 0.1251 0.0389  -0.0322 -0.0377 115 ILE B CA    
3441 C  C     . ILE B 139 ? 0.2971 0.2294 0.1056 0.0362  -0.0481 -0.0116 115 ILE B C     
3442 O  O     . ILE B 139 ? 0.2620 0.2730 0.0959 0.0301  -0.1110 -0.0042 115 ILE B O     
3443 C  CB    . ILE B 139 ? 0.2092 0.2706 0.1144 0.0149  -0.0392 -0.0288 115 ILE B CB    
3444 C  CG1   . ILE B 139 ? 0.2473 0.2180 0.1236 0.0204  -0.0107 -0.0147 115 ILE B CG1   
3445 C  CG2   . ILE B 139 ? 0.1952 0.2917 0.0544 -0.0011 -0.0667 -0.0212 115 ILE B CG2   
3446 C  CD1   . ILE B 139 ? 0.2421 0.2771 0.0553 0.0086  -0.0646 0.0128  115 ILE B CD1   
3447 N  N     . PHE B 140 ? 0.2381 0.2268 0.1270 0.0146  -0.0901 -0.0366 116 PHE B N     
3448 C  CA    . PHE B 140 ? 0.2266 0.2639 0.1655 0.0111  -0.0293 -0.0358 116 PHE B CA    
3449 C  C     . PHE B 140 ? 0.2301 0.3224 0.1815 0.0000  -0.0249 0.0217  116 PHE B C     
3450 O  O     . PHE B 140 ? 0.2610 0.3423 0.1396 0.0363  -0.0572 -0.0319 116 PHE B O     
3451 C  CB    . PHE B 140 ? 0.2421 0.2791 0.0768 -0.0056 -0.0936 -0.0249 116 PHE B CB    
3452 C  CG    . PHE B 140 ? 0.2346 0.2919 0.1383 0.0452  -0.0462 -0.0235 116 PHE B CG    
3453 C  CD1   . PHE B 140 ? 0.2467 0.2848 0.1372 -0.0012 -0.0666 -0.0467 116 PHE B CD1   
3454 C  CD2   . PHE B 140 ? 0.2285 0.2568 0.1429 0.0387  -0.0589 0.0223  116 PHE B CD2   
3455 C  CE1   . PHE B 140 ? 0.2395 0.2836 0.1556 0.0078  -0.0895 -0.0267 116 PHE B CE1   
3456 C  CE2   . PHE B 140 ? 0.2320 0.2929 0.1711 0.0281  -0.0856 0.0252  116 PHE B CE2   
3457 C  CZ    . PHE B 140 ? 0.2828 0.2287 0.1393 0.0023  -0.0914 -0.0112 116 PHE B CZ    
3458 N  N     . VAL B 141 ? 0.2782 0.3398 0.1125 -0.0441 -0.0285 -0.0122 117 VAL B N     
3459 C  CA    . VAL B 141 ? 0.2672 0.3151 0.1298 -0.0055 -0.0310 -0.0015 117 VAL B CA    
3460 C  C     . VAL B 141 ? 0.3163 0.2922 0.1839 0.0193  -0.0161 -0.0104 117 VAL B C     
3461 O  O     . VAL B 141 ? 0.3544 0.3403 0.1689 -0.0100 0.0036  0.0487  117 VAL B O     
3462 C  CB    . VAL B 141 ? 0.2465 0.2944 0.1423 0.0049  0.0018  -0.0378 117 VAL B CB    
3463 C  CG1   . VAL B 141 ? 0.2337 0.3130 0.2420 -0.0192 -0.0463 -0.0464 117 VAL B CG1   
3464 C  CG2   . VAL B 141 ? 0.3214 0.2930 0.1302 0.0069  -0.0895 -0.0846 117 VAL B CG2   
3465 N  N     . THR B 142 ? 0.3242 0.2807 0.1902 0.0255  -0.0012 0.0140  118 THR B N     
3466 C  CA    . THR B 142 ? 0.3125 0.2852 0.1996 0.0216  -0.0266 0.0003  118 THR B CA    
3467 C  C     . THR B 142 ? 0.3498 0.2784 0.2226 0.0115  -0.0138 0.0219  118 THR B C     
3468 O  O     . THR B 142 ? 0.4123 0.3036 0.2466 -0.0451 -0.0010 0.0193  118 THR B O     
3469 C  CB    . THR B 142 ? 0.2965 0.2670 0.1660 0.0016  -0.0510 -0.0376 118 THR B CB    
3470 O  OG1   . THR B 142 ? 0.3226 0.3406 0.1471 0.0418  -0.0515 -0.0107 118 THR B OG1   
3471 C  CG2   . THR B 142 ? 0.2803 0.3383 0.1309 -0.0095 -0.1272 -0.0235 118 THR B CG2   
3472 N  N     . GLU B 143 ? 0.3519 0.3989 0.2313 -0.0094 -0.0378 -0.0349 119 GLU B N     
3473 C  CA    . GLU B 143 ? 0.3800 0.4339 0.1737 -0.0043 -0.0031 -0.0534 119 GLU B CA    
3474 C  C     . GLU B 143 ? 0.3812 0.4323 0.1939 -0.0227 -0.0049 -0.0314 119 GLU B C     
3475 O  O     . GLU B 143 ? 0.4391 0.5005 0.0619 -0.0504 0.0430  -0.0445 119 GLU B O     
3476 C  CB    . GLU B 143 ? 0.4469 0.4616 0.2372 0.0354  -0.0116 -0.1073 119 GLU B CB    
3477 C  CG    . GLU B 143 ? 0.5439 0.6483 0.3483 0.0357  -0.0964 -0.0796 119 GLU B CG    
3478 C  CD    . GLU B 143 ? 0.7025 0.8734 0.2998 0.0673  -0.0293 -0.1773 119 GLU B CD    
3479 O  OE1   . GLU B 143 ? 0.6718 1.0841 0.3937 0.0781  -0.1182 -0.1414 119 GLU B OE1   
3480 O  OE2   . GLU B 143 ? 0.7861 0.9971 0.4008 0.0178  0.1512  -0.0513 119 GLU B OE2   
3481 N  N     . ASP B 144 ? 0.3891 0.4456 0.2942 0.0098  -0.0263 0.0100  120 ASP B N     
3482 C  CA    . ASP B 144 ? 0.3724 0.4003 0.2499 0.0154  -0.0168 -0.0146 120 ASP B CA    
3483 C  C     . ASP B 144 ? 0.3180 0.3932 0.2670 -0.0071 0.0062  -0.0121 120 ASP B C     
3484 O  O     . ASP B 144 ? 0.3154 0.4609 0.2657 -0.0275 0.0105  0.0078  120 ASP B O     
3485 C  CB    . ASP B 144 ? 0.3795 0.3999 0.2689 -0.0144 -0.0208 0.0083  120 ASP B CB    
3486 C  CG    . ASP B 144 ? 0.3616 0.3476 0.1547 0.0085  -0.0419 -0.0339 120 ASP B CG    
3487 O  OD1   . ASP B 144 ? 0.3569 0.3642 0.1187 -0.0165 -0.0008 -0.0604 120 ASP B OD1   
3488 O  OD2   . ASP B 144 ? 0.3743 0.4148 0.1007 0.0016  -0.0270 -0.0034 120 ASP B OD2   
3489 N  N     . GLY B 145 ? 0.3605 0.3218 0.1582 0.0127  0.0004  -0.0080 121 GLY B N     
3490 C  CA    . GLY B 145 ? 0.3198 0.3356 0.2404 -0.0218 0.0078  -0.0460 121 GLY B CA    
3491 C  C     . GLY B 145 ? 0.3512 0.2955 0.2409 -0.0094 -0.0043 -0.0117 121 GLY B C     
3492 O  O     . GLY B 145 ? 0.3376 0.3751 0.2526 0.0031  -0.0246 -0.0597 121 GLY B O     
3493 N  N     . GLU B 146 ? 0.3197 0.3065 0.2570 0.0052  -0.0131 -0.0188 122 GLU B N     
3494 C  CA    . GLU B 146 ? 0.2648 0.3293 0.2513 0.0089  -0.0275 -0.0047 122 GLU B CA    
3495 C  C     . GLU B 146 ? 0.2680 0.3051 0.1986 0.0157  -0.0248 -0.0386 122 GLU B C     
3496 O  O     . GLU B 146 ? 0.3581 0.3503 0.1493 0.0086  -0.0246 -0.0106 122 GLU B O     
3497 C  CB    . GLU B 146 ? 0.2855 0.3279 0.2784 0.0011  -0.0342 -0.0403 122 GLU B CB    
3498 C  CG    . GLU B 146 ? 0.2994 0.3741 0.2784 0.0206  -0.0943 0.0062  122 GLU B CG    
3499 C  CD    . GLU B 146 ? 0.2962 0.4355 0.2623 0.0515  -0.1295 -0.0107 122 GLU B CD    
3500 O  OE1   . GLU B 146 ? 0.3070 0.4522 0.1596 0.0592  -0.1204 0.0358  122 GLU B OE1   
3501 O  OE2   . GLU B 146 ? 0.3409 0.5440 0.3249 0.1781  -0.1971 0.0104  122 GLU B OE2   
3502 N  N     . ARG B 147 ? 0.2472 0.3112 0.1716 0.0050  -0.0400 -0.0161 123 ARG B N     
3503 C  CA    A ARG B 147 ? 0.2382 0.2557 0.1697 -0.0180 -0.0442 -0.0072 123 ARG B CA    
3504 C  CA    B ARG B 147 ? 0.2449 0.2567 0.1541 -0.0112 -0.0344 -0.0103 123 ARG B CA    
3505 C  C     . ARG B 147 ? 0.2269 0.2600 0.1934 -0.0243 -0.0490 0.0008  123 ARG B C     
3506 O  O     . ARG B 147 ? 0.2803 0.3361 0.1852 -0.0010 -0.0585 0.0181  123 ARG B O     
3507 C  CB    A ARG B 147 ? 0.2560 0.2508 0.2009 -0.0199 -0.0654 -0.0016 123 ARG B CB    
3508 C  CB    B ARG B 147 ? 0.2738 0.2547 0.1448 -0.0122 -0.0241 0.0022  123 ARG B CB    
3509 C  CG    A ARG B 147 ? 0.2092 0.2892 0.2153 -0.0081 -0.0255 -0.0098 123 ARG B CG    
3510 C  CG    B ARG B 147 ? 0.2231 0.2870 0.1587 -0.0075 -0.0200 -0.0051 123 ARG B CG    
3511 C  CD    A ARG B 147 ? 0.2286 0.2893 0.1688 -0.0346 -0.0423 0.0041  123 ARG B CD    
3512 C  CD    B ARG B 147 ? 0.2219 0.2326 0.1172 0.0138  -0.0347 0.0065  123 ARG B CD    
3513 N  NE    A ARG B 147 ? 0.2829 0.2709 0.1647 -0.0068 -0.0646 0.0049  123 ARG B NE    
3514 N  NE    B ARG B 147 ? 0.2280 0.1953 0.1258 0.0052  -0.0445 0.0228  123 ARG B NE    
3515 C  CZ    A ARG B 147 ? 0.3201 0.2193 0.1261 0.0029  -0.0575 -0.0277 123 ARG B CZ    
3516 C  CZ    B ARG B 147 ? 0.3006 0.1807 0.1243 -0.0227 -0.0549 0.0155  123 ARG B CZ    
3517 N  NH1   A ARG B 147 ? 0.3107 0.2186 0.0481 0.0084  -0.0732 -0.0126 123 ARG B NH1   
3518 N  NH1   B ARG B 147 ? 0.2991 0.1927 0.0579 -0.0095 -0.0777 0.0159  123 ARG B NH1   
3519 N  NH2   A ARG B 147 ? 0.2306 0.2970 0.1222 0.0667  -0.0706 -0.0387 123 ARG B NH2   
3520 N  NH2   B ARG B 147 ? 0.3234 0.3347 0.1259 -0.0214 -0.0735 0.0561  123 ARG B NH2   
3521 N  N     . SER B 148 ? 0.2386 0.2650 0.1510 -0.0005 -0.0968 0.0113  124 SER B N     
3522 C  CA    . SER B 148 ? 0.1965 0.2412 0.1342 -0.0107 -0.0884 -0.0285 124 SER B CA    
3523 C  C     . SER B 148 ? 0.2221 0.2910 0.1257 0.0190  -0.0719 -0.0448 124 SER B C     
3524 O  O     . SER B 148 ? 0.2430 0.2904 0.1037 -0.0060 -0.0978 -0.0550 124 SER B O     
3525 C  CB    . SER B 148 ? 0.2351 0.2617 0.0799 0.0197  -0.0627 -0.0452 124 SER B CB    
3526 O  OG    . SER B 148 ? 0.2405 0.3179 0.0613 0.0207  -0.0542 -0.0319 124 SER B OG    
3527 N  N     . MSE B 149 ? 0.2040 0.2557 0.0956 0.0026  -0.0983 -0.0004 125 MSE B N     
3528 C  CA    . MSE B 149 ? 0.1823 0.2294 0.1046 -0.0206 -0.0839 -0.0096 125 MSE B CA    
3529 C  C     . MSE B 149 ? 0.1829 0.2416 0.1394 -0.0085 -0.0647 0.0034  125 MSE B C     
3530 O  O     . MSE B 149 ? 0.2191 0.1884 0.1791 -0.0265 -0.0744 -0.0204 125 MSE B O     
3531 C  CB    . MSE B 149 ? 0.1985 0.2706 0.1135 -0.0297 -0.0572 -0.0389 125 MSE B CB    
3532 C  CG    . MSE B 149 ? 0.1998 0.3521 0.1291 -0.0197 -0.0313 0.0391  125 MSE B CG    
3533 SE SE    . MSE B 149 ? 0.5124 0.4643 0.2352 -0.0002 -0.1135 -0.0093 125 MSE B SE    
3534 C  CE    . MSE B 149 ? 0.3012 0.4220 0.1967 -0.0080 -0.0154 0.0163  125 MSE B CE    
3535 N  N     . ASN B 150 ? 0.1698 0.2720 0.0760 -0.0232 -0.0726 -0.0194 126 ASN B N     
3536 C  CA    . ASN B 150 ? 0.1537 0.2545 0.0896 -0.0086 -0.0588 -0.0174 126 ASN B CA    
3537 C  C     . ASN B 150 ? 0.2050 0.2496 0.1013 0.0175  -0.0533 -0.0106 126 ASN B C     
3538 O  O     . ASN B 150 ? 0.1999 0.2488 0.1202 0.0247  -0.0412 -0.0040 126 ASN B O     
3539 C  CB    . ASN B 150 ? 0.1654 0.2498 0.0915 0.0076  -0.0583 -0.0298 126 ASN B CB    
3540 C  CG    . ASN B 150 ? 0.1830 0.2334 0.0637 -0.0105 -0.0631 -0.0479 126 ASN B CG    
3541 O  OD1   . ASN B 150 ? 0.2730 0.2450 0.0516 -0.0085 -0.0566 -0.0522 126 ASN B OD1   
3542 N  ND2   . ASN B 150 ? 0.1695 0.2811 0.0626 0.0043  -0.0724 -0.0181 126 ASN B ND2   
3543 N  N     . THR B 151 ? 0.2136 0.2529 0.1019 0.0084  -0.0282 -0.0049 127 THR B N     
3544 C  CA    . THR B 151 ? 0.1906 0.2132 0.1130 0.0083  -0.0548 0.0054  127 THR B CA    
3545 C  C     . THR B 151 ? 0.1985 0.1766 0.1003 0.0007  -0.0630 -0.0102 127 THR B C     
3546 O  O     . THR B 151 ? 0.2158 0.2129 0.1062 -0.0029 -0.0938 0.0160  127 THR B O     
3547 C  CB    . THR B 151 ? 0.1858 0.2442 0.1364 0.0023  -0.0575 -0.0100 127 THR B CB    
3548 O  OG1   . THR B 151 ? 0.1971 0.2658 0.0932 0.0059  -0.0736 0.0294  127 THR B OG1   
3549 C  CG2   . THR B 151 ? 0.2320 0.2420 0.1484 0.0049  -0.0627 -0.0165 127 THR B CG2   
3550 N  N     . TYR B 152 ? 0.1738 0.2045 0.0884 0.0121  -0.0394 -0.0287 128 TYR B N     
3551 C  CA    . TYR B 152 ? 0.1715 0.2577 0.1282 -0.0070 -0.0364 -0.0097 128 TYR B CA    
3552 C  C     . TYR B 152 ? 0.2317 0.1814 0.1356 -0.0090 -0.0522 0.0268  128 TYR B C     
3553 O  O     . TYR B 152 ? 0.2367 0.1830 0.1426 0.0004  -0.0661 0.0403  128 TYR B O     
3554 C  CB    . TYR B 152 ? 0.1801 0.3199 0.1470 -0.0015 -0.0447 -0.0068 128 TYR B CB    
3555 C  CG    . TYR B 152 ? 0.1779 0.2716 0.1274 0.0051  -0.0584 0.0048  128 TYR B CG    
3556 C  CD1   . TYR B 152 ? 0.1826 0.3108 0.2167 -0.0016 -0.0026 0.0228  128 TYR B CD1   
3557 C  CD2   . TYR B 152 ? 0.2011 0.2740 0.1356 0.0233  -0.0605 0.0221  128 TYR B CD2   
3558 C  CE1   . TYR B 152 ? 0.2092 0.3627 0.2023 0.0154  0.0118  -0.0116 128 TYR B CE1   
3559 C  CE2   . TYR B 152 ? 0.2359 0.3439 0.1594 0.0119  -0.0288 0.0154  128 TYR B CE2   
3560 C  CZ    . TYR B 152 ? 0.2326 0.3491 0.2401 -0.0101 0.0025  0.0018  128 TYR B CZ    
3561 O  OH    . TYR B 152 ? 0.2659 0.4436 0.2955 0.0271  0.0174  -0.0490 128 TYR B OH    
3562 N  N     . LEU B 153 ? 0.2478 0.2493 0.1166 -0.0275 -0.0509 0.0153  129 LEU B N     
3563 C  CA    . LEU B 153 ? 0.2546 0.2017 0.1215 -0.0037 -0.0573 0.0274  129 LEU B CA    
3564 C  C     . LEU B 153 ? 0.2130 0.2118 0.1495 -0.0212 -0.0422 0.0101  129 LEU B C     
3565 O  O     . LEU B 153 ? 0.2237 0.2444 0.1187 -0.0316 -0.0706 0.0008  129 LEU B O     
3566 C  CB    . LEU B 153 ? 0.2396 0.2160 0.1031 -0.0132 -0.0665 0.0179  129 LEU B CB    
3567 C  CG    . LEU B 153 ? 0.2498 0.2344 0.1245 -0.0070 -0.0331 0.0398  129 LEU B CG    
3568 C  CD1   . LEU B 153 ? 0.3008 0.2077 0.1204 -0.0063 -0.0522 0.0290  129 LEU B CD1   
3569 C  CD2   . LEU B 153 ? 0.2121 0.3191 0.1670 -0.0227 -0.0129 0.0124  129 LEU B CD2   
3570 N  N     . GLY B 154 ? 0.2069 0.2730 0.1904 0.0000  -0.0351 -0.0185 130 GLY B N     
3571 C  CA    . GLY B 154 ? 0.1876 0.2603 0.1434 -0.0076 -0.0714 -0.0276 130 GLY B CA    
3572 C  C     . GLY B 154 ? 0.2108 0.2352 0.1367 -0.0333 -0.0549 -0.0118 130 GLY B C     
3573 O  O     . GLY B 154 ? 0.2491 0.2722 0.1471 -0.0445 -0.0675 -0.0003 130 GLY B O     
3574 N  N     . ALA B 155 ? 0.2008 0.2409 0.1091 -0.0372 -0.0660 -0.0398 131 ALA B N     
3575 C  CA    . ALA B 155 ? 0.1960 0.2230 0.1453 0.0030  -0.0475 -0.0434 131 ALA B CA    
3576 C  C     . ALA B 155 ? 0.1907 0.2757 0.1248 0.0213  -0.0378 -0.0139 131 ALA B C     
3577 O  O     . ALA B 155 ? 0.2383 0.2895 0.1277 0.0029  -0.0795 -0.0342 131 ALA B O     
3578 C  CB    . ALA B 155 ? 0.2476 0.2486 0.1066 -0.0066 -0.1052 -0.0132 131 ALA B CB    
3579 N  N     . CYS B 156 ? 0.1770 0.2791 0.0819 0.0077  -0.0487 -0.0234 132 CYS B N     
3580 C  CA    . CYS B 156 ? 0.1563 0.3053 0.1452 0.0275  -0.0393 0.0331  132 CYS B CA    
3581 C  C     . CYS B 156 ? 0.1900 0.3137 0.1233 -0.0164 -0.0515 0.0119  132 CYS B C     
3582 O  O     . CYS B 156 ? 0.2137 0.3391 0.1217 0.0006  -0.0626 -0.0021 132 CYS B O     
3583 C  CB    . CYS B 156 ? 0.2130 0.2774 0.1379 0.0155  -0.0257 0.0114  132 CYS B CB    
3584 S  SG    . CYS B 156 ? 0.2114 0.3263 0.1341 -0.0467 -0.0501 0.0059  132 CYS B SG    
3585 N  N     . VAL B 157 ? 0.2054 0.2521 0.0773 -0.0123 -0.0482 0.0383  133 VAL B N     
3586 C  CA    . VAL B 157 ? 0.2255 0.2614 0.1520 -0.0380 -0.0166 0.0593  133 VAL B CA    
3587 C  C     . VAL B 157 ? 0.2674 0.2538 0.1474 -0.0332 -0.0281 0.0476  133 VAL B C     
3588 O  O     . VAL B 157 ? 0.2822 0.3489 0.1420 -0.0082 -0.0743 0.0878  133 VAL B O     
3589 C  CB    . VAL B 157 ? 0.1848 0.2623 0.1767 -0.0227 -0.0082 0.0537  133 VAL B CB    
3590 C  CG1   . VAL B 157 ? 0.2169 0.2912 0.1276 -0.0634 -0.0164 0.0509  133 VAL B CG1   
3591 C  CG2   . VAL B 157 ? 0.1948 0.2953 0.2063 -0.0178 -0.0572 0.0264  133 VAL B CG2   
3592 N  N     . GLU B 158 ? 0.1971 0.2652 0.1178 -0.0230 -0.0638 0.0360  134 GLU B N     
3593 C  CA    . GLU B 158 ? 0.2209 0.3176 0.2109 -0.0218 -0.0384 -0.0121 134 GLU B CA    
3594 C  C     . GLU B 158 ? 0.2130 0.3538 0.1761 -0.0020 -0.0361 -0.0301 134 GLU B C     
3595 O  O     . GLU B 158 ? 0.2817 0.3816 0.1147 -0.0204 -0.0922 -0.0580 134 GLU B O     
3596 C  CB    . GLU B 158 ? 0.2601 0.3182 0.3234 0.0318  -0.0151 -0.0100 134 GLU B CB    
3597 C  CG    . GLU B 158 ? 0.3162 0.4303 0.3591 0.0009  -0.1035 -0.0608 134 GLU B CG    
3598 C  CD    . GLU B 158 ? 0.4410 0.6143 0.4130 0.0069  -0.1049 0.0747  134 GLU B CD    
3599 O  OE1   . GLU B 158 ? 0.4652 0.7723 0.6156 -0.0607 0.0165  0.0403  134 GLU B OE1   
3600 O  OE2   . GLU B 158 ? 0.6249 0.7699 0.2349 0.0145  -0.1331 0.0997  134 GLU B OE2   
3601 N  N     . LEU B 159 ? 0.1931 0.3355 0.1336 -0.0197 -0.0611 0.0057  135 LEU B N     
3602 C  CA    . LEU B 159 ? 0.1905 0.2799 0.1480 -0.0336 -0.0254 0.0218  135 LEU B CA    
3603 C  C     . LEU B 159 ? 0.2600 0.2547 0.1595 -0.0019 -0.0364 0.0219  135 LEU B C     
3604 O  O     . LEU B 159 ? 0.2759 0.2498 0.1519 -0.0017 -0.0634 0.0056  135 LEU B O     
3605 C  CB    . LEU B 159 ? 0.1615 0.2544 0.2220 -0.0442 -0.0361 0.0328  135 LEU B CB    
3606 C  CG    . LEU B 159 ? 0.2054 0.2567 0.0471 -0.0054 -0.0444 0.0034  135 LEU B CG    
3607 C  CD1   . LEU B 159 ? 0.2501 0.2436 0.0999 -0.0314 -0.0511 -0.0180 135 LEU B CD1   
3608 C  CD2   . LEU B 159 ? 0.2118 0.2758 0.0440 -0.0221 -0.0426 -0.0421 135 LEU B CD2   
3609 N  N     . GLY B 160 ? 0.3010 0.2870 0.1070 -0.0082 -0.0705 0.0394  136 GLY B N     
3610 C  CA    . GLY B 160 ? 0.3658 0.3431 0.0976 -0.0183 -0.0469 0.0337  136 GLY B CA    
3611 C  C     . GLY B 160 ? 0.3639 0.2906 0.1369 -0.0218 -0.0480 0.0460  136 GLY B C     
3612 O  O     . GLY B 160 ? 0.3118 0.3131 0.1081 -0.0169 -0.0517 0.0473  136 GLY B O     
3613 N  N     . PRO B 161 ? 0.3454 0.3255 0.1280 0.0108  -0.0780 0.0360  137 PRO B N     
3614 C  CA    . PRO B 161 ? 0.3782 0.3134 0.1296 -0.0117 -0.0569 0.0507  137 PRO B CA    
3615 C  C     . PRO B 161 ? 0.3164 0.3345 0.1552 -0.0031 -0.0308 0.0164  137 PRO B C     
3616 O  O     . PRO B 161 ? 0.2747 0.3875 0.1217 0.0053  -0.0562 -0.0279 137 PRO B O     
3617 C  CB    . PRO B 161 ? 0.3425 0.2829 0.1269 -0.0451 -0.0451 0.0317  137 PRO B CB    
3618 C  CG    . PRO B 161 ? 0.3767 0.2977 0.1255 0.0118  -0.0084 -0.0011 137 PRO B CG    
3619 C  CD    . PRO B 161 ? 0.3461 0.3228 0.1695 0.0060  -0.0549 0.0102  137 PRO B CD    
3620 N  N     . GLU B 162 ? 0.3332 0.3522 0.1670 0.0118  -0.0617 0.0291  138 GLU B N     
3621 C  CA    . GLU B 162 ? 0.3366 0.3295 0.2729 -0.0047 -0.0405 0.0320  138 GLU B CA    
3622 C  C     . GLU B 162 ? 0.2843 0.2911 0.1591 0.0573  -0.0628 0.0153  138 GLU B C     
3623 O  O     . GLU B 162 ? 0.3378 0.2798 0.2248 0.0214  -0.0379 0.0142  138 GLU B O     
3624 C  CB    . GLU B 162 ? 0.3224 0.4491 0.3403 0.0215  -0.0341 0.0119  138 GLU B CB    
3625 C  CG    . GLU B 162 ? 0.3946 0.4251 0.3866 0.0734  -0.0548 -0.0402 138 GLU B CG    
3626 C  CD    . GLU B 162 ? 0.4964 0.4149 0.3548 0.0300  -0.1708 -0.0130 138 GLU B CD    
3627 O  OE1   . GLU B 162 ? 0.4631 0.3191 0.3281 0.0085  -0.0303 0.0298  138 GLU B OE1   
3628 O  OE2   . GLU B 162 ? 0.4589 0.6859 0.3807 0.0676  -0.3380 -0.0330 138 GLU B OE2   
3629 N  N     . ASP B 163 ? 0.3146 0.2965 0.0734 0.0234  -0.0656 -0.0042 139 ASP B N     
3630 C  CA    . ASP B 163 ? 0.2967 0.2789 0.1617 -0.0243 -0.0488 -0.0106 139 ASP B CA    
3631 C  C     . ASP B 163 ? 0.2646 0.3176 0.1408 0.0096  -0.0653 0.0603  139 ASP B C     
3632 O  O     . ASP B 163 ? 0.3325 0.3427 0.0774 0.0129  -0.0800 0.0961  139 ASP B O     
3633 C  CB    . ASP B 163 ? 0.2594 0.2056 0.1704 -0.0235 -0.0569 -0.0023 139 ASP B CB    
3634 C  CG    . ASP B 163 ? 0.2663 0.2463 0.1615 -0.0109 -0.0785 0.0323  139 ASP B CG    
3635 O  OD1   . ASP B 163 ? 0.2575 0.3503 0.1393 0.0335  -0.0948 0.0091  139 ASP B OD1   
3636 O  OD2   . ASP B 163 ? 0.2906 0.2554 0.1218 -0.0382 -0.1148 0.0891  139 ASP B OD2   
3637 N  N     . VAL B 164 ? 0.2809 0.2257 0.1134 0.0264  -0.0370 0.0315  140 VAL B N     
3638 C  CA    . VAL B 164 ? 0.2901 0.2478 0.1608 0.0078  -0.0274 0.0593  140 VAL B CA    
3639 C  C     . VAL B 164 ? 0.2419 0.2704 0.1240 -0.0020 -0.0399 0.0162  140 VAL B C     
3640 O  O     . VAL B 164 ? 0.3015 0.3293 0.1523 0.0367  -0.0131 -0.0173 140 VAL B O     
3641 C  CB    . VAL B 164 ? 0.2264 0.2377 0.1851 0.0161  -0.0758 0.0356  140 VAL B CB    
3642 C  CG1   . VAL B 164 ? 0.2130 0.3452 0.2119 0.0023  -0.0771 0.0375  140 VAL B CG1   
3643 C  CG2   . VAL B 164 ? 0.2114 0.2402 0.1624 -0.0116 -0.0972 0.0066  140 VAL B CG2   
3644 N  N     . GLU B 165 ? 0.2544 0.2703 0.0480 0.0023  -0.0528 0.0237  141 GLU B N     
3645 C  CA    . GLU B 165 ? 0.2269 0.2629 0.1414 -0.0307 -0.0442 0.0283  141 GLU B CA    
3646 C  C     . GLU B 165 ? 0.2218 0.3038 0.1442 -0.0513 -0.0363 -0.0059 141 GLU B C     
3647 O  O     . GLU B 165 ? 0.2315 0.2746 0.1385 -0.0607 -0.0539 -0.0092 141 GLU B O     
3648 C  CB    . GLU B 165 ? 0.2397 0.3244 0.0835 -0.0546 -0.0377 0.0014  141 GLU B CB    
3649 C  CG    . GLU B 165 ? 0.2484 0.3773 0.1463 -0.0177 -0.0879 0.0631  141 GLU B CG    
3650 C  CD    . GLU B 165 ? 0.3174 0.3118 0.1660 -0.0347 -0.1135 0.0744  141 GLU B CD    
3651 O  OE1   . GLU B 165 ? 0.3709 0.3373 0.1906 -0.0563 -0.1585 0.0423  141 GLU B OE1   
3652 O  OE2   . GLU B 165 ? 0.4261 0.3642 0.1525 0.0260  -0.0887 0.0468  141 GLU B OE2   
3653 N  N     . ALA B 166 ? 0.2540 0.3019 0.1400 -0.0345 -0.0425 -0.0347 142 ALA B N     
3654 C  CA    . ALA B 166 ? 0.2307 0.3787 0.1552 -0.0310 -0.0341 -0.0757 142 ALA B CA    
3655 C  C     . ALA B 166 ? 0.2495 0.3343 0.1201 -0.0141 -0.0238 -0.0429 142 ALA B C     
3656 O  O     . ALA B 166 ? 0.2769 0.3599 0.1010 0.0272  -0.0888 -0.0871 142 ALA B O     
3657 C  CB    . ALA B 166 ? 0.3381 0.3901 0.1303 -0.0524 -0.0325 -0.1847 142 ALA B CB    
3658 N  N     . ASP B 167 ? 0.3189 0.3292 0.1083 -0.0260 -0.0355 -0.0617 143 ASP B N     
3659 C  CA    . ASP B 167 ? 0.3820 0.3220 0.1036 -0.0246 -0.0607 0.0103  143 ASP B CA    
3660 C  C     . ASP B 167 ? 0.3164 0.2951 0.1667 -0.0410 -0.0694 -0.1040 143 ASP B C     
3661 O  O     . ASP B 167 ? 0.3416 0.3355 0.2047 -0.0418 -0.1505 -0.1612 143 ASP B O     
3662 C  CB    . ASP B 167 ? 0.4940 0.3594 0.1005 0.0222  -0.0904 0.0256  143 ASP B CB    
3663 C  CG    . ASP B 167 ? 0.4966 0.4708 0.2529 0.0342  -0.0228 0.0810  143 ASP B CG    
3664 O  OD1   . ASP B 167 ? 0.4794 0.4395 0.2517 0.0563  -0.0968 0.0642  143 ASP B OD1   
3665 O  OD2   . ASP B 167 ? 0.5362 0.5647 0.2846 0.0590  -0.1138 0.0973  143 ASP B OD2   
3666 N  N     . VAL B 168 ? 0.3099 0.2578 0.0673 0.0032  -0.0765 -0.0342 144 VAL B N     
3667 C  CA    . VAL B 168 ? 0.2306 0.3311 0.1514 -0.0382 -0.0456 -0.0392 144 VAL B CA    
3668 C  C     . VAL B 168 ? 0.2258 0.2890 0.1560 -0.0572 -0.0692 -0.0332 144 VAL B C     
3669 O  O     . VAL B 168 ? 0.2337 0.3732 0.0456 -0.0570 -0.0289 -0.0657 144 VAL B O     
3670 C  CB    . VAL B 168 ? 0.2178 0.2606 0.1432 -0.0212 -0.0285 -0.0689 144 VAL B CB    
3671 C  CG1   . VAL B 168 ? 0.2354 0.3823 0.0415 -0.0360 -0.0530 -0.0225 144 VAL B CG1   
3672 C  CG2   . VAL B 168 ? 0.2719 0.2224 0.1630 -0.0094 -0.0305 -0.1095 144 VAL B CG2   
3673 N  N     . VAL B 169 ? 0.2620 0.2671 0.1880 -0.0673 -0.1018 -0.0537 145 VAL B N     
3674 C  CA    . VAL B 169 ? 0.2413 0.2175 0.1418 -0.0487 -0.0194 -0.0889 145 VAL B CA    
3675 C  C     . VAL B 169 ? 0.2312 0.2613 0.1452 -0.0376 -0.0310 -0.0879 145 VAL B C     
3676 O  O     . VAL B 169 ? 0.2360 0.2899 0.0940 0.0098  -0.0830 -0.1012 145 VAL B O     
3677 C  CB    . VAL B 169 ? 0.2424 0.2131 0.0957 -0.0436 -0.0206 -0.0927 145 VAL B CB    
3678 C  CG1   . VAL B 169 ? 0.2700 0.2774 0.0822 0.0028  -0.0337 -0.1012 145 VAL B CG1   
3679 C  CG2   . VAL B 169 ? 0.2368 0.2594 0.1330 -0.0522 -0.0446 -0.0621 145 VAL B CG2   
3680 N  N     . ALA B 170 ? 0.2437 0.3021 0.1206 -0.0406 -0.0329 -0.0905 146 ALA B N     
3681 C  CA    . ALA B 170 ? 0.2493 0.2820 0.1519 -0.0362 -0.0015 -0.1323 146 ALA B CA    
3682 C  C     . ALA B 170 ? 0.2733 0.3422 0.1579 -0.0518 -0.0245 -0.0758 146 ALA B C     
3683 O  O     . ALA B 170 ? 0.2598 0.4341 0.1674 -0.0134 -0.0543 -0.0229 146 ALA B O     
3684 C  CB    . ALA B 170 ? 0.3075 0.3388 0.1217 -0.0159 0.0615  -0.0893 146 ALA B CB    
3685 N  N     . ASP B 171 ? 0.3176 0.3538 0.1994 -0.0204 -0.0203 -0.0363 147 ASP B N     
3686 C  CA    . ASP B 171 ? 0.3230 0.4113 0.1820 -0.0321 -0.0502 0.0018  147 ASP B CA    
3687 C  C     . ASP B 171 ? 0.3167 0.3032 0.1755 -0.0474 -0.0639 0.0084  147 ASP B C     
3688 O  O     . ASP B 171 ? 0.3752 0.3900 0.2990 -0.1051 -0.0266 0.0646  147 ASP B O     
3689 C  CB    . ASP B 171 ? 0.4519 0.3742 0.3762 -0.0041 -0.0186 -0.0152 147 ASP B CB    
3690 C  CG    . ASP B 171 ? 0.4409 0.4491 0.2809 -0.0830 -0.1761 -0.1370 147 ASP B CG    
3691 O  OD1   . ASP B 171 ? 0.5697 0.6260 0.2814 -0.1381 -0.2172 -0.1254 147 ASP B OD1   
3692 O  OD2   . ASP B 171 ? 0.4867 0.4632 0.3432 -0.0569 -0.1890 -0.0860 147 ASP B OD2   
3693 N  N     . ALA B 172 ? 0.2347 0.3379 0.1675 -0.0141 -0.0448 -0.0693 148 ALA B N     
3694 C  CA    . ALA B 172 ? 0.2039 0.2704 0.2223 -0.0010 -0.0218 -0.0529 148 ALA B CA    
3695 C  C     . ALA B 172 ? 0.2211 0.2448 0.1285 -0.0407 -0.0776 -0.0194 148 ALA B C     
3696 O  O     . ALA B 172 ? 0.2894 0.2313 0.1622 -0.0430 -0.0617 -0.0113 148 ALA B O     
3697 C  CB    . ALA B 172 ? 0.1202 0.3372 0.2143 0.0287  -0.0383 -0.0535 148 ALA B CB    
3698 N  N     . LYS B 173 ? 0.2291 0.2010 0.0924 -0.0299 -0.0783 -0.0370 149 LYS B N     
3699 C  CA    . LYS B 173 ? 0.2295 0.2398 0.1343 -0.0291 -0.0695 -0.0431 149 LYS B CA    
3700 C  C     . LYS B 173 ? 0.2557 0.2239 0.1647 -0.0194 -0.0811 -0.0336 149 LYS B C     
3701 O  O     . LYS B 173 ? 0.3345 0.2932 0.1012 -0.1021 -0.0967 -0.0186 149 LYS B O     
3702 C  CB    . LYS B 173 ? 0.2523 0.2106 0.0843 -0.0463 -0.0932 -0.0035 149 LYS B CB    
3703 C  CG    . LYS B 173 ? 0.1982 0.2095 0.0929 -0.0439 -0.0789 -0.0251 149 LYS B CG    
3704 C  CD    . LYS B 173 ? 0.2172 0.2333 0.1682 -0.0163 -0.0094 -0.0341 149 LYS B CD    
3705 C  CE    . LYS B 173 ? 0.3196 0.2596 0.3295 -0.0858 -0.0430 -0.0089 149 LYS B CE    
3706 N  NZ    . LYS B 173 ? 0.3643 0.3785 0.4394 -0.1668 -0.0551 0.0894  149 LYS B NZ    
3707 N  N     . VAL B 174 ? 0.2218 0.2479 0.1705 -0.0310 -0.0576 -0.0656 150 VAL B N     
3708 C  CA    . VAL B 174 ? 0.1800 0.2405 0.1306 -0.0345 -0.0324 0.0048  150 VAL B CA    
3709 C  C     . VAL B 174 ? 0.1927 0.2713 0.1739 -0.0562 -0.0638 0.0468  150 VAL B C     
3710 O  O     . VAL B 174 ? 0.2364 0.3379 0.0657 -0.0585 -0.0491 0.0270  150 VAL B O     
3711 C  CB    . VAL B 174 ? 0.2368 0.2671 0.0466 -0.0088 -0.0539 0.0069  150 VAL B CB    
3712 C  CG1   . VAL B 174 ? 0.2995 0.2778 0.0301 0.0031  -0.0163 -0.0312 150 VAL B CG1   
3713 C  CG2   . VAL B 174 ? 0.2494 0.2736 0.1144 -0.0380 -0.0004 0.0130  150 VAL B CG2   
3714 N  N     . THR B 175 ? 0.1993 0.2620 0.1045 -0.0437 -0.0021 -0.0148 151 THR B N     
3715 C  CA    . THR B 175 ? 0.2114 0.2540 0.1477 -0.0341 -0.0293 -0.0236 151 THR B CA    
3716 C  C     . THR B 175 ? 0.2856 0.2533 0.1118 -0.0179 -0.0587 -0.0241 151 THR B C     
3717 O  O     . THR B 175 ? 0.2940 0.3211 0.1200 0.0014  -0.0970 -0.0187 151 THR B O     
3718 C  CB    . THR B 175 ? 0.2026 0.2447 0.1554 -0.0205 -0.0301 -0.0229 151 THR B CB    
3719 O  OG1   . THR B 175 ? 0.2514 0.2501 0.1986 0.0302  -0.0955 -0.0027 151 THR B OG1   
3720 C  CG2   . THR B 175 ? 0.2596 0.2520 0.0612 -0.0152 -0.0621 -0.0621 151 THR B CG2   
3721 N  N     . TYR B 176 ? 0.2152 0.2981 0.1280 -0.0705 -0.0613 -0.0930 152 TYR B N     
3722 C  CA    . TYR B 176 ? 0.1963 0.2572 0.1841 -0.0118 -0.0114 -0.0306 152 TYR B CA    
3723 C  C     . TYR B 176 ? 0.2277 0.2453 0.1056 0.0004  -0.0584 -0.0356 152 TYR B C     
3724 O  O     . TYR B 176 ? 0.2442 0.2914 0.0878 0.0174  -0.0908 -0.0415 152 TYR B O     
3725 C  CB    . TYR B 176 ? 0.2076 0.2363 0.1167 0.0289  -0.0759 0.0293  152 TYR B CB    
3726 C  CG    . TYR B 176 ? 0.1720 0.2639 0.1147 -0.0044 -0.0362 0.0242  152 TYR B CG    
3727 C  CD1   . TYR B 176 ? 0.1718 0.2207 0.1625 -0.0268 -0.0151 0.0060  152 TYR B CD1   
3728 C  CD2   . TYR B 176 ? 0.2227 0.2747 0.0985 -0.0119 -0.0461 0.0066  152 TYR B CD2   
3729 C  CE1   . TYR B 176 ? 0.2527 0.2903 0.1777 -0.0136 -0.0415 -0.0155 152 TYR B CE1   
3730 C  CE2   . TYR B 176 ? 0.2168 0.2310 0.1166 -0.0042 -0.0449 0.0153  152 TYR B CE2   
3731 C  CZ    . TYR B 176 ? 0.2359 0.2544 0.1718 0.0005  -0.0314 0.0244  152 TYR B CZ    
3732 O  OH    . TYR B 176 ? 0.3008 0.2423 0.1669 0.0031  -0.0839 0.0290  152 TYR B OH    
3733 N  N     . PHE B 177 ? 0.2184 0.2395 0.0476 -0.0301 -0.0621 -0.0124 153 PHE B N     
3734 C  CA    . PHE B 177 ? 0.1804 0.2435 0.1155 -0.0300 -0.0511 0.0355  153 PHE B CA    
3735 C  C     . PHE B 177 ? 0.1711 0.2446 0.1489 -0.0534 -0.0600 0.0058  153 PHE B C     
3736 O  O     . PHE B 177 ? 0.2255 0.2371 0.1132 -0.0237 -0.1317 -0.0005 153 PHE B O     
3737 C  CB    . PHE B 177 ? 0.2217 0.2290 0.1005 -0.0043 -0.0401 0.0301  153 PHE B CB    
3738 C  CG    . PHE B 177 ? 0.2636 0.2070 0.0990 0.0004  -0.0237 0.0335  153 PHE B CG    
3739 C  CD1   . PHE B 177 ? 0.2565 0.2288 0.1296 -0.0250 -0.0258 0.0170  153 PHE B CD1   
3740 C  CD2   . PHE B 177 ? 0.2357 0.1972 0.0921 -0.0077 0.0076  0.0363  153 PHE B CD2   
3741 C  CE1   . PHE B 177 ? 0.2905 0.1918 0.1176 -0.0069 -0.0268 -0.0073 153 PHE B CE1   
3742 C  CE2   . PHE B 177 ? 0.2071 0.1575 0.0970 0.0016  -0.0271 -0.0064 153 PHE B CE2   
3743 C  CZ    . PHE B 177 ? 0.1970 0.1889 0.1040 -0.0027 -0.0091 -0.0227 153 PHE B CZ    
3744 N  N     . GLU B 178 ? 0.1900 0.2135 0.1289 -0.0156 -0.0866 0.0151  154 GLU B N     
3745 C  CA    . GLU B 178 ? 0.1717 0.2222 0.0921 0.0124  -0.0518 0.0104  154 GLU B CA    
3746 C  C     . GLU B 178 ? 0.1848 0.1991 0.0842 0.0238  -0.0587 -0.0135 154 GLU B C     
3747 O  O     . GLU B 178 ? 0.1826 0.2337 0.1194 -0.0007 -0.0652 0.0043  154 GLU B O     
3748 C  CB    . GLU B 178 ? 0.1606 0.2185 0.0986 0.0028  -0.0539 0.0041  154 GLU B CB    
3749 C  CG    . GLU B 178 ? 0.1706 0.1902 0.1368 0.0070  -0.0548 -0.0158 154 GLU B CG    
3750 C  CD    . GLU B 178 ? 0.1703 0.2221 0.1210 -0.0178 -0.0517 0.0123  154 GLU B CD    
3751 O  OE1   . GLU B 178 ? 0.1875 0.2149 0.0747 -0.0196 -0.0633 0.0028  154 GLU B OE1   
3752 O  OE2   . GLU B 178 ? 0.2178 0.2756 0.1653 -0.0053 -0.0538 0.0588  154 GLU B OE2   
3753 N  N     . GLY B 179 ? 0.2182 0.1932 0.1234 0.0367  -0.0789 0.0152  155 GLY B N     
3754 C  CA    . GLY B 179 ? 0.2018 0.2231 0.1482 0.0038  -0.0627 0.0441  155 GLY B CA    
3755 C  C     . GLY B 179 ? 0.1911 0.2370 0.1359 0.0031  -0.0481 0.0319  155 GLY B C     
3756 O  O     . GLY B 179 ? 0.2152 0.2305 0.0922 0.0036  -0.0727 0.0591  155 GLY B O     
3757 N  N     . TYR B 180 ? 0.2156 0.2317 0.1575 0.0107  -0.0768 0.0388  156 TYR B N     
3758 C  CA    . TYR B 180 ? 0.1896 0.2688 0.1502 0.0025  -0.0475 0.0409  156 TYR B CA    
3759 C  C     . TYR B 180 ? 0.1815 0.2215 0.1561 0.0157  -0.0528 0.0303  156 TYR B C     
3760 O  O     . TYR B 180 ? 0.2069 0.2571 0.1647 -0.0047 -0.0562 0.0142  156 TYR B O     
3761 C  CB    . TYR B 180 ? 0.2096 0.2382 0.1354 0.0164  -0.0392 0.0231  156 TYR B CB    
3762 C  CG    . TYR B 180 ? 0.1800 0.2179 0.1748 0.0292  -0.0316 0.0159  156 TYR B CG    
3763 C  CD1   . TYR B 180 ? 0.1525 0.2332 0.1582 -0.0024 -0.0227 -0.0026 156 TYR B CD1   
3764 C  CD2   . TYR B 180 ? 0.1768 0.2494 0.1928 0.0277  -0.0025 0.0132  156 TYR B CD2   
3765 C  CE1   . TYR B 180 ? 0.1691 0.2688 0.1238 -0.0097 -0.0369 0.0009  156 TYR B CE1   
3766 C  CE2   . TYR B 180 ? 0.1920 0.2106 0.1830 0.0277  -0.0155 -0.0105 156 TYR B CE2   
3767 C  CZ    . TYR B 180 ? 0.1851 0.2037 0.1841 -0.0006 -0.0171 -0.0159 156 TYR B CZ    
3768 O  OH    . TYR B 180 ? 0.1764 0.2773 0.1291 0.0127  -0.0645 -0.0433 156 TYR B OH    
3769 N  N     . LEU B 181 ? 0.1938 0.2844 0.1530 0.0224  -0.0623 0.0160  157 LEU B N     
3770 C  CA    . LEU B 181 ? 0.2082 0.2453 0.1576 0.0131  -0.0685 -0.0079 157 LEU B CA    
3771 C  C     . LEU B 181 ? 0.1914 0.2629 0.1209 0.0029  -0.0654 -0.0065 157 LEU B C     
3772 O  O     . LEU B 181 ? 0.2270 0.2992 0.0817 0.0083  -0.0502 0.0062  157 LEU B O     
3773 C  CB    . LEU B 181 ? 0.1841 0.2424 0.2071 -0.0030 -0.0694 -0.0214 157 LEU B CB    
3774 C  CG    . LEU B 181 ? 0.1611 0.2146 0.2028 0.0194  -0.0625 -0.0515 157 LEU B CG    
3775 C  CD1   . LEU B 181 ? 0.2168 0.2900 0.1307 0.0018  -0.1237 -0.0258 157 LEU B CD1   
3776 C  CD2   . LEU B 181 ? 0.1748 0.2974 0.1339 0.0012  -0.0980 -0.0534 157 LEU B CD2   
3777 N  N     . TRP B 182 ? 0.2357 0.2481 0.0597 0.0024  -0.0818 -0.0249 158 TRP B N     
3778 C  CA    . TRP B 182 ? 0.2382 0.2405 0.0826 0.0032  -0.0857 -0.0220 158 TRP B CA    
3779 C  C     . TRP B 182 ? 0.2123 0.2574 0.1191 -0.0185 -0.0766 0.0103  158 TRP B C     
3780 O  O     . TRP B 182 ? 0.2585 0.3015 0.0636 -0.0344 -0.0824 0.0166  158 TRP B O     
3781 C  CB    . TRP B 182 ? 0.2099 0.2743 0.1303 0.0189  -0.0367 -0.0189 158 TRP B CB    
3782 C  CG    . TRP B 182 ? 0.2352 0.2749 0.1224 0.0026  -0.0446 0.0109  158 TRP B CG    
3783 C  CD1   . TRP B 182 ? 0.2938 0.2988 0.1529 -0.0381 -0.0383 0.0366  158 TRP B CD1   
3784 C  CD2   . TRP B 182 ? 0.2798 0.2780 0.1604 0.0032  -0.0390 -0.0021 158 TRP B CD2   
3785 N  NE1   . TRP B 182 ? 0.3459 0.3482 0.1901 -0.0408 -0.0713 0.0168  158 TRP B NE1   
3786 C  CE2   . TRP B 182 ? 0.3492 0.3027 0.1720 -0.0379 -0.0931 -0.0548 158 TRP B CE2   
3787 C  CE3   . TRP B 182 ? 0.2532 0.2559 0.1916 0.0278  -0.0482 -0.0149 158 TRP B CE3   
3788 C  CZ2   . TRP B 182 ? 0.3291 0.2391 0.2105 0.0013  -0.0860 -0.0561 158 TRP B CZ2   
3789 C  CZ3   . TRP B 182 ? 0.3294 0.3401 0.1934 0.0041  -0.0875 -0.0344 158 TRP B CZ3   
3790 C  CH2   . TRP B 182 ? 0.3300 0.2992 0.1851 0.0295  -0.0744 -0.0233 158 TRP B CH2   
3791 N  N     . ASP B 183 ? 0.2169 0.2663 0.1049 -0.0083 -0.0581 -0.0057 159 ASP B N     
3792 C  CA    . ASP B 183 ? 0.2421 0.2594 0.0931 -0.0243 -0.0647 0.0157  159 ASP B CA    
3793 C  C     . ASP B 183 ? 0.2432 0.2748 0.0862 -0.0334 -0.0646 0.0122  159 ASP B C     
3794 O  O     . ASP B 183 ? 0.2839 0.3314 0.1059 -0.0518 -0.0597 0.0309  159 ASP B O     
3795 C  CB    . ASP B 183 ? 0.2451 0.2764 0.0889 -0.0298 -0.0728 0.0009  159 ASP B CB    
3796 C  CG    . ASP B 183 ? 0.2587 0.2704 0.1191 -0.0219 -0.0945 -0.0046 159 ASP B CG    
3797 O  OD1   . ASP B 183 ? 0.2901 0.2570 0.1604 -0.0163 -0.0768 -0.0332 159 ASP B OD1   
3798 O  OD2   . ASP B 183 ? 0.2720 0.3091 0.1333 0.0042  -0.0793 -0.0005 159 ASP B OD2   
3799 N  N     . PRO B 184 ? 0.2407 0.2814 0.1131 -0.0292 -0.0665 0.0145  160 PRO B N     
3800 C  CA    . PRO B 184 ? 0.2537 0.3065 0.1428 -0.0272 -0.0563 -0.0004 160 PRO B CA    
3801 C  C     . PRO B 184 ? 0.2508 0.3467 0.1502 -0.0216 -0.0453 0.0173  160 PRO B C     
3802 O  O     . PRO B 184 ? 0.2704 0.3623 0.1162 -0.0225 -0.0540 -0.0341 160 PRO B O     
3803 C  CB    . PRO B 184 ? 0.2413 0.3069 0.1834 -0.0469 -0.0756 0.0028  160 PRO B CB    
3804 C  CG    . PRO B 184 ? 0.2257 0.2725 0.1909 -0.0196 -0.0343 0.0067  160 PRO B CG    
3805 C  CD    . PRO B 184 ? 0.2612 0.2463 0.1536 -0.0062 -0.0564 0.0225  160 PRO B CD    
3806 N  N     . PRO B 185 ? 0.2668 0.3657 0.1557 0.0042  -0.0354 -0.0146 161 PRO B N     
3807 C  CA    . PRO B 185 ? 0.3102 0.3796 0.2074 -0.0435 0.0328  0.0067  161 PRO B CA    
3808 C  C     . PRO B 185 ? 0.2835 0.3341 0.2303 -0.0082 -0.0116 -0.0005 161 PRO B C     
3809 O  O     . PRO B 185 ? 0.4067 0.4148 0.2453 0.0247  -0.0379 -0.0013 161 PRO B O     
3810 C  CB    . PRO B 185 ? 0.2952 0.3847 0.2998 -0.0279 0.0033  0.0380  161 PRO B CB    
3811 C  CG    . PRO B 185 ? 0.3363 0.4474 0.2736 -0.0176 0.0183  0.0369  161 PRO B CG    
3812 C  CD    . PRO B 185 ? 0.2418 0.4155 0.2194 -0.0063 -0.0377 0.0043  161 PRO B CD    
3813 N  N     . ARG B 186 ? 0.2535 0.3360 0.1394 -0.0106 -0.0306 0.0322  162 ARG B N     
3814 C  CA    A ARG B 186 ? 0.2351 0.3311 0.2149 0.0013  0.0176  -0.0148 162 ARG B CA    
3815 C  CA    B ARG B 186 ? 0.2361 0.3288 0.2122 0.0022  0.0134  -0.0099 162 ARG B CA    
3816 C  C     . ARG B 186 ? 0.2492 0.3015 0.1809 0.0072  0.0118  0.0191  162 ARG B C     
3817 O  O     . ARG B 186 ? 0.2837 0.3747 0.1437 -0.0061 -0.0179 0.0479  162 ARG B O     
3818 C  CB    A ARG B 186 ? 0.2417 0.3802 0.2726 0.0082  0.0369  -0.0457 162 ARG B CB    
3819 C  CB    B ARG B 186 ? 0.2362 0.3731 0.2509 0.0093  0.0251  -0.0266 162 ARG B CB    
3820 C  CG    A ARG B 186 ? 0.2530 0.4054 0.3255 0.0027  0.0512  -0.0238 162 ARG B CG    
3821 C  CG    B ARG B 186 ? 0.2327 0.3798 0.2631 0.0182  0.0054  0.0205  162 ARG B CG    
3822 C  CD    A ARG B 186 ? 0.3224 0.3791 0.3307 0.0306  0.0641  -0.0470 162 ARG B CD    
3823 C  CD    B ARG B 186 ? 0.2711 0.3327 0.2547 0.0422  -0.0075 0.0317  162 ARG B CD    
3824 N  NE    A ARG B 186 ? 0.4113 0.3501 0.3120 -0.0436 0.0428  0.0191  162 ARG B NE    
3825 N  NE    B ARG B 186 ? 0.2516 0.2943 0.2779 0.0280  -0.0079 0.0421  162 ARG B NE    
3826 C  CZ    A ARG B 186 ? 0.3859 0.3429 0.2733 -0.0197 0.0594  0.0299  162 ARG B CZ    
3827 C  CZ    B ARG B 186 ? 0.2905 0.2820 0.2251 -0.0054 -0.0241 0.0747  162 ARG B CZ    
3828 N  NH1   A ARG B 186 ? 0.3552 0.3529 0.3723 0.0023  0.0140  0.0514  162 ARG B NH1   
3829 N  NH1   B ARG B 186 ? 0.3579 0.2533 0.2465 0.0278  -0.0021 0.0912  162 ARG B NH1   
3830 N  NH2   A ARG B 186 ? 0.3864 0.3648 0.2315 0.0038  0.0918  0.0504  162 ARG B NH2   
3831 N  NH2   B ARG B 186 ? 0.3115 0.2814 0.1340 -0.0179 0.0370  0.1309  162 ARG B NH2   
3832 N  N     . ALA B 187 ? 0.2155 0.3547 0.1575 0.0212  -0.0158 0.0446  163 ALA B N     
3833 C  CA    . ALA B 187 ? 0.2343 0.3677 0.1100 0.0065  0.0191  0.0661  163 ALA B CA    
3834 C  C     . ALA B 187 ? 0.2528 0.2968 0.1783 -0.0026 -0.0251 0.0233  163 ALA B C     
3835 O  O     . ALA B 187 ? 0.2969 0.3065 0.1980 0.0013  -0.0161 0.0038  163 ALA B O     
3836 C  CB    . ALA B 187 ? 0.2802 0.4189 0.1126 -0.0283 0.0251  0.0109  163 ALA B CB    
3837 N  N     . LYS B 188 ? 0.2395 0.3003 0.1958 0.0316  -0.0239 0.0091  164 LYS B N     
3838 C  CA    . LYS B 188 ? 0.2664 0.2482 0.1727 0.0472  -0.0254 -0.0271 164 LYS B CA    
3839 C  C     . LYS B 188 ? 0.2479 0.3336 0.1274 -0.0249 -0.0192 -0.0168 164 LYS B C     
3840 O  O     . LYS B 188 ? 0.2574 0.3777 0.1574 -0.0174 -0.0388 -0.0111 164 LYS B O     
3841 C  CB    . LYS B 188 ? 0.3305 0.2363 0.0477 -0.0039 -0.0563 -0.0316 164 LYS B CB    
3842 C  CG    . LYS B 188 ? 0.3214 0.2750 0.2073 -0.0093 -0.0463 -0.0141 164 LYS B CG    
3843 C  CD    . LYS B 188 ? 0.3737 0.2553 0.1817 -0.0593 -0.1101 -0.0090 164 LYS B CD    
3844 C  CE    . LYS B 188 ? 0.3517 0.3197 0.2275 0.0100  -0.0674 -0.0331 164 LYS B CE    
3845 N  NZ    . LYS B 188 ? 0.3558 0.3508 0.1803 -0.0139 -0.1695 0.0206  164 LYS B NZ    
3846 N  N     . GLU B 189 ? 0.2672 0.3139 0.1283 0.0179  -0.0120 -0.0143 165 GLU B N     
3847 C  CA    . GLU B 189 ? 0.2380 0.3266 0.2097 -0.0048 0.0489  -0.0479 165 GLU B CA    
3848 C  C     . GLU B 189 ? 0.2923 0.3153 0.1667 0.0040  0.0046  -0.0355 165 GLU B C     
3849 O  O     . GLU B 189 ? 0.3380 0.3148 0.1679 -0.0427 0.0175  -0.0386 165 GLU B O     
3850 C  CB    . GLU B 189 ? 0.2540 0.2926 0.1457 -0.0533 0.0772  0.0246  165 GLU B CB    
3851 C  CG    . GLU B 189 ? 0.2758 0.3228 0.1188 -0.0872 0.0847  0.0041  165 GLU B CG    
3852 C  CD    . GLU B 189 ? 0.2810 0.4027 0.3349 -0.0687 0.0923  -0.0036 165 GLU B CD    
3853 O  OE1   . GLU B 189 ? 0.3232 0.5003 0.2870 -0.0703 0.0473  -0.0312 165 GLU B OE1   
3854 O  OE2   . GLU B 189 ? 0.3519 0.5106 0.3899 -0.0549 0.1582  -0.0488 165 GLU B OE2   
3855 N  N     . ALA B 190 ? 0.2877 0.3072 0.1961 0.0317  -0.0115 -0.0209 166 ALA B N     
3856 C  CA    . ALA B 190 ? 0.2509 0.3313 0.1660 0.0321  -0.0334 -0.0007 166 ALA B CA    
3857 C  C     . ALA B 190 ? 0.2401 0.2863 0.1563 -0.0112 -0.0038 -0.0042 166 ALA B C     
3858 O  O     . ALA B 190 ? 0.2980 0.2742 0.1539 0.0132  -0.0407 -0.0087 166 ALA B O     
3859 C  CB    . ALA B 190 ? 0.2361 0.2806 0.2078 0.0302  -0.0552 0.0446  166 ALA B CB    
3860 N  N     . ILE B 191 ? 0.2213 0.3065 0.1393 0.0088  -0.0572 0.0119  167 ILE B N     
3861 C  CA    . ILE B 191 ? 0.2129 0.3277 0.1314 0.0170  -0.0601 -0.0076 167 ILE B CA    
3862 C  C     . ILE B 191 ? 0.2445 0.3291 0.1266 0.0034  -0.0622 -0.0087 167 ILE B C     
3863 O  O     . ILE B 191 ? 0.2677 0.3544 0.0584 -0.0036 -0.0789 -0.0482 167 ILE B O     
3864 C  CB    . ILE B 191 ? 0.1915 0.2974 0.1248 -0.0110 -0.0703 -0.0118 167 ILE B CB    
3865 C  CG1   . ILE B 191 ? 0.2519 0.2268 0.1361 -0.0004 -0.0533 0.0264  167 ILE B CG1   
3866 C  CG2   . ILE B 191 ? 0.1703 0.3177 0.0507 -0.0496 -0.0451 0.0258  167 ILE B CG2   
3867 C  CD1   . ILE B 191 ? 0.2361 0.2057 0.0755 -0.0074 -0.0916 -0.0399 167 ILE B CD1   
3868 N  N     . LEU B 192 ? 0.2948 0.3566 0.1152 -0.0342 -0.0673 -0.0213 168 LEU B N     
3869 C  CA    . LEU B 192 ? 0.2962 0.3432 0.1509 -0.0185 -0.1155 0.0292  168 LEU B CA    
3870 C  C     . LEU B 192 ? 0.3030 0.3713 0.1043 -0.0005 -0.0401 0.0272  168 LEU B C     
3871 O  O     . LEU B 192 ? 0.3351 0.4111 0.0258 -0.0014 0.0123  0.0001  168 LEU B O     
3872 C  CB    . LEU B 192 ? 0.3445 0.3392 0.1205 -0.0324 -0.1665 0.0528  168 LEU B CB    
3873 C  CG    . LEU B 192 ? 0.4157 0.3150 0.1538 0.0002  -0.1220 0.1167  168 LEU B CG    
3874 C  CD1   . LEU B 192 ? 0.4883 0.3376 0.1852 -0.0243 -0.1821 0.1727  168 LEU B CD1   
3875 C  CD2   . LEU B 192 ? 0.4275 0.3675 0.3085 0.0424  -0.0566 0.0857  168 LEU B CD2   
3876 N  N     . ASP B 193 ? 0.2951 0.3238 0.0995 -0.0100 -0.0419 -0.0230 169 ASP B N     
3877 C  CA    . ASP B 193 ? 0.3339 0.3100 0.0675 0.0017  -0.0193 0.0169  169 ASP B CA    
3878 C  C     . ASP B 193 ? 0.3121 0.2983 0.1524 -0.0064 -0.0299 -0.0393 169 ASP B C     
3879 O  O     . ASP B 193 ? 0.2816 0.2895 0.2007 -0.0192 -0.0920 -0.0147 169 ASP B O     
3880 C  CB    . ASP B 193 ? 0.3278 0.3355 0.0911 0.0100  -0.0182 0.0177  169 ASP B CB    
3881 C  CG    . ASP B 193 ? 0.2929 0.3902 0.2224 -0.0016 -0.0398 0.0518  169 ASP B CG    
3882 O  OD1   . ASP B 193 ? 0.3986 0.5128 0.1956 -0.0405 0.0166  0.0971  169 ASP B OD1   
3883 O  OD2   . ASP B 193 ? 0.2574 0.4065 0.2468 -0.0193 -0.0209 -0.0036 169 ASP B OD2   
3884 N  N     . CYS B 194 ? 0.2974 0.3237 0.1466 -0.0065 -0.0473 -0.0432 170 CYS B N     
3885 C  CA    . CYS B 194 ? 0.2509 0.3003 0.1864 0.0138  -0.0559 -0.0756 170 CYS B CA    
3886 C  C     . CYS B 194 ? 0.2957 0.2974 0.1587 0.0301  -0.0813 -0.0359 170 CYS B C     
3887 O  O     . CYS B 194 ? 0.3146 0.2866 0.0881 0.0487  -0.1160 0.0073  170 CYS B O     
3888 C  CB    . CYS B 194 ? 0.2522 0.3880 0.1698 0.0331  -0.0666 -0.0141 170 CYS B CB    
3889 S  SG    . CYS B 194 ? 0.3373 0.4433 0.0672 -0.0172 -0.1138 0.0194  170 CYS B SG    
3890 N  N     . ALA B 195 ? 0.2910 0.2966 0.0793 0.0125  -0.1051 -0.0628 171 ALA B N     
3891 C  CA    . ALA B 195 ? 0.2703 0.3293 0.1518 0.0353  -0.0855 -0.0516 171 ALA B CA    
3892 C  C     . ALA B 195 ? 0.2905 0.3474 0.0866 0.0315  -0.0969 0.0077  171 ALA B C     
3893 O  O     . ALA B 195 ? 0.3381 0.4631 0.1847 -0.0027 -0.1080 -0.0233 171 ALA B O     
3894 C  CB    . ALA B 195 ? 0.2729 0.3217 0.1126 -0.0075 -0.1328 -0.0650 171 ALA B CB    
3895 N  N     . ARG B 196 ? 0.3006 0.3293 0.1590 0.0457  -0.0820 0.0267  172 ARG B N     
3896 C  CA    . ARG B 196 ? 0.2995 0.3172 0.1408 0.0286  -0.0758 0.0327  172 ARG B CA    
3897 C  C     . ARG B 196 ? 0.3168 0.3256 0.1805 0.0267  -0.0720 0.0217  172 ARG B C     
3898 O  O     . ARG B 196 ? 0.4131 0.3383 0.0946 -0.0130 -0.0897 0.0967  172 ARG B O     
3899 C  CB    . ARG B 196 ? 0.3122 0.4194 0.1774 0.0178  -0.0847 0.0371  172 ARG B CB    
3900 C  CG    . ARG B 196 ? 0.3600 0.4465 0.1915 -0.0467 -0.0359 -0.0059 172 ARG B CG    
3901 C  CD    . ARG B 196 ? 0.3057 0.5105 0.3631 -0.0231 -0.0566 0.0539  172 ARG B CD    
3902 N  NE    . ARG B 196 ? 0.3063 0.5816 0.4512 -0.0267 -0.0877 0.0560  172 ARG B NE    
3903 C  CZ    . ARG B 196 ? 0.4568 0.3967 0.2879 -0.0002 -0.0505 0.0831  172 ARG B CZ    
3904 N  NH1   . ARG B 196 ? 0.5702 0.4785 0.2353 0.0023  0.0399  -0.0024 172 ARG B NH1   
3905 N  NH2   . ARG B 196 ? 0.4179 0.6394 0.3933 0.0412  -0.0738 0.0520  172 ARG B NH2   
3906 N  N     . ILE B 197 ? 0.2895 0.2973 0.1686 0.0126  -0.0564 0.0257  173 ILE B N     
3907 C  CA    . ILE B 197 ? 0.2563 0.2878 0.2290 0.0350  -0.0430 -0.0163 173 ILE B CA    
3908 C  C     . ILE B 197 ? 0.2714 0.2859 0.1856 0.0098  -0.0430 -0.0288 173 ILE B C     
3909 O  O     . ILE B 197 ? 0.3688 0.2914 0.1826 -0.0421 -0.0476 -0.0034 173 ILE B O     
3910 C  CB    . ILE B 197 ? 0.2547 0.2848 0.1813 0.0082  -0.0168 0.0183  173 ILE B CB    
3911 C  CG1   . ILE B 197 ? 0.2234 0.2949 0.2135 0.0413  -0.0239 0.0056  173 ILE B CG1   
3912 C  CG2   . ILE B 197 ? 0.2438 0.2648 0.1980 -0.0266 -0.0464 -0.0513 173 ILE B CG2   
3913 C  CD1   . ILE B 197 ? 0.1209 0.2857 0.2696 0.0308  0.0213  0.0566  173 ILE B CD1   
3914 N  N     . ALA B 198 ? 0.2358 0.3328 0.1662 0.0197  -0.0370 -0.0144 174 ALA B N     
3915 C  CA    . ALA B 198 ? 0.2762 0.2851 0.1398 0.0024  -0.0073 -0.0379 174 ALA B CA    
3916 C  C     . ALA B 198 ? 0.3002 0.3264 0.1818 0.0353  -0.0293 -0.0165 174 ALA B C     
3917 O  O     . ALA B 198 ? 0.3833 0.3921 0.1059 0.0057  -0.0839 -0.0232 174 ALA B O     
3918 C  CB    . ALA B 198 ? 0.2795 0.2862 0.0581 0.0448  0.0454  0.0331  174 ALA B CB    
3919 N  N     . HIS B 199 ? 0.3418 0.3074 0.1675 0.0135  -0.0597 -0.0487 175 HIS B N     
3920 C  CA    . HIS B 199 ? 0.2929 0.3632 0.2205 0.0249  -0.0528 -0.0217 175 HIS B CA    
3921 C  C     . HIS B 199 ? 0.2655 0.4027 0.1877 0.0014  -0.0737 -0.0206 175 HIS B C     
3922 O  O     . HIS B 199 ? 0.3400 0.5384 0.1225 -0.0606 -0.1069 -0.0245 175 HIS B O     
3923 C  CB    . HIS B 199 ? 0.4040 0.3237 0.2847 -0.0078 -0.0419 -0.0804 175 HIS B CB    
3924 C  CG    . HIS B 199 ? 0.3506 0.3514 0.2577 0.0077  -0.0372 -0.0356 175 HIS B CG    
3925 N  ND1   . HIS B 199 ? 0.5228 0.2947 0.1302 -0.0242 -0.0873 0.0555  175 HIS B ND1   
3926 C  CD2   . HIS B 199 ? 0.4347 0.4530 0.1798 -0.0401 -0.0172 0.0323  175 HIS B CD2   
3927 C  CE1   . HIS B 199 ? 0.5049 0.3477 0.2984 -0.0400 0.0274  0.0722  175 HIS B CE1   
3928 N  NE2   . HIS B 199 ? 0.4413 0.4138 0.1651 -0.0269 0.0335  0.0780  175 HIS B NE2   
3929 N  N     . GLN B 200 ? 0.3136 0.4024 0.0291 -0.0001 -0.0314 -0.0127 176 GLN B N     
3930 C  CA    . GLN B 200 ? 0.3819 0.3515 0.1494 -0.0355 -0.0920 -0.0875 176 GLN B CA    
3931 C  C     . GLN B 200 ? 0.3922 0.3818 0.1483 -0.0275 -0.0973 -0.0106 176 GLN B C     
3932 O  O     . GLN B 200 ? 0.4536 0.3768 0.2103 -0.0769 -0.1332 -0.0233 176 GLN B O     
3933 C  CB    . GLN B 200 ? 0.4077 0.4375 0.1167 -0.0388 -0.0251 -0.1042 176 GLN B CB    
3934 C  CG    . GLN B 200 ? 0.5319 0.3257 0.3346 -0.1054 -0.0893 -0.1402 176 GLN B CG    
3935 C  CD    . GLN B 200 ? 0.5788 0.5794 0.5035 -0.0973 -0.0202 -0.0718 176 GLN B CD    
3936 O  OE1   . GLN B 200 ? 0.5843 0.7906 0.4286 -0.0031 -0.0494 -0.0983 176 GLN B OE1   
3937 N  NE2   . GLN B 200 ? 0.7878 0.5791 0.4084 -0.0943 -0.1489 -0.0818 176 GLN B NE2   
3938 N  N     . HIS B 201 ? 0.3842 0.3477 0.1411 0.0262  -0.1395 -0.0245 177 HIS B N     
3939 C  CA    . HIS B 201 ? 0.2908 0.3520 0.0958 0.0130  -0.1192 -0.0611 177 HIS B CA    
3940 C  C     . HIS B 201 ? 0.3175 0.3080 0.1062 -0.0146 -0.1062 -0.0163 177 HIS B C     
3941 O  O     . HIS B 201 ? 0.3507 0.3272 0.1377 -0.0407 -0.1852 0.0687  177 HIS B O     
3942 C  CB    . HIS B 201 ? 0.2591 0.3059 0.1613 -0.0012 -0.1089 -0.0076 177 HIS B CB    
3943 C  CG    . HIS B 201 ? 0.2944 0.2424 0.1311 0.0154  -0.1085 -0.0481 177 HIS B CG    
3944 N  ND1   . HIS B 201 ? 0.2601 0.2503 0.2715 0.0064  -0.1818 -0.0657 177 HIS B ND1   
3945 C  CD2   . HIS B 201 ? 0.3185 0.2810 0.1891 0.0594  -0.0771 -0.1047 177 HIS B CD2   
3946 C  CE1   . HIS B 201 ? 0.2652 0.2227 0.3920 0.0808  -0.1780 0.0125  177 HIS B CE1   
3947 N  NE2   . HIS B 201 ? 0.2886 0.2567 0.4562 0.0316  -0.0486 -0.1069 177 HIS B NE2   
3948 N  N     . GLY B 202 ? 0.3602 0.3431 0.0730 0.0122  -0.1002 0.0156  178 GLY B N     
3949 C  CA    . GLY B 202 ? 0.3282 0.4106 0.1769 0.0043  -0.1295 0.0266  178 GLY B CA    
3950 C  C     . GLY B 202 ? 0.2550 0.4067 0.1694 -0.0696 -0.1217 0.0545  178 GLY B C     
3951 O  O     . GLY B 202 ? 0.2766 0.5017 0.1139 -0.0357 -0.1016 -0.0050 178 GLY B O     
3952 N  N     . ARG B 203 ? 0.2988 0.2975 0.1045 -0.0441 -0.1017 -0.0278 179 ARG B N     
3953 C  CA    . ARG B 203 ? 0.2289 0.2242 0.1154 0.0281  -0.0487 0.0328  179 ARG B CA    
3954 C  C     . ARG B 203 ? 0.2937 0.1922 0.1270 -0.0325 -0.0917 -0.0296 179 ARG B C     
3955 O  O     . ARG B 203 ? 0.2870 0.2869 0.1011 -0.0164 -0.0942 0.0086  179 ARG B O     
3956 C  CB    . ARG B 203 ? 0.2570 0.2444 0.0651 -0.0157 -0.0950 -0.0067 179 ARG B CB    
3957 C  CG    . ARG B 203 ? 0.3226 0.3003 0.1196 0.0371  -0.1458 -0.0278 179 ARG B CG    
3958 C  CD    . ARG B 203 ? 0.3800 0.2733 0.1873 0.0281  -0.1062 0.0353  179 ARG B CD    
3959 N  NE    . ARG B 203 ? 0.4650 0.3006 0.0805 -0.0040 -0.1251 -0.0723 179 ARG B NE    
3960 C  CZ    . ARG B 203 ? 0.3692 0.3893 0.2870 -0.0713 -0.1586 -0.0242 179 ARG B CZ    
3961 N  NH1   . ARG B 203 ? 0.3647 0.3882 0.4360 -0.0635 -0.2314 -0.0425 179 ARG B NH1   
3962 N  NH2   . ARG B 203 ? 0.3951 0.5426 0.5387 -0.3080 -0.1844 -0.0787 179 ARG B NH2   
3963 N  N     . GLU B 204 ? 0.2855 0.2562 0.1255 0.0397  -0.0648 0.0078  180 GLU B N     
3964 C  CA    . GLU B 204 ? 0.2802 0.2355 0.0614 -0.0242 -0.0738 -0.0112 180 GLU B CA    
3965 C  C     . GLU B 204 ? 0.2277 0.2263 0.1640 -0.0226 -0.0859 -0.0048 180 GLU B C     
3966 O  O     . GLU B 204 ? 0.2928 0.2693 0.0894 -0.0187 -0.1113 -0.0087 180 GLU B O     
3967 C  CB    . GLU B 204 ? 0.2971 0.3287 0.0966 -0.0661 -0.0469 -0.1159 180 GLU B CB    
3968 C  CG    . GLU B 204 ? 0.2580 0.4266 0.2743 -0.0322 -0.1084 -0.1098 180 GLU B CG    
3969 C  CD    . GLU B 204 ? 0.3448 0.4901 0.3856 0.0577  0.0024  -0.0453 180 GLU B CD    
3970 O  OE1   . GLU B 204 ? 0.4391 0.5517 0.5363 0.1739  0.1716  -0.0623 180 GLU B OE1   
3971 O  OE2   . GLU B 204 ? 0.5385 0.5965 0.3605 0.1095  -0.0775 0.0248  180 GLU B OE2   
3972 N  N     . MSE B 205 ? 0.2518 0.2212 0.1686 -0.0196 -0.0364 -0.0127 181 MSE B N     
3973 C  CA    . MSE B 205 ? 0.2597 0.2574 0.1692 -0.0031 -0.0582 -0.0162 181 MSE B CA    
3974 C  C     . MSE B 205 ? 0.2029 0.3037 0.1630 0.0021  -0.0307 0.0024  181 MSE B C     
3975 O  O     . MSE B 205 ? 0.2424 0.2660 0.1083 0.0062  -0.0844 -0.0417 181 MSE B O     
3976 C  CB    . MSE B 205 ? 0.3114 0.3095 0.1983 -0.0031 -0.0133 -0.0135 181 MSE B CB    
3977 C  CG    . MSE B 205 ? 0.3425 0.4663 0.1559 -0.0072 -0.0031 -0.0579 181 MSE B CG    
3978 SE SE    . MSE B 205 ? 0.5479 0.5342 0.3649 0.0143  -0.1422 0.0058  181 MSE B SE    
3979 C  CE    . MSE B 205 ? 0.4046 0.4076 0.2486 0.0862  -0.0772 0.0021  181 MSE B CE    
3980 N  N     . SER B 206 ? 0.2500 0.3012 0.1909 0.0117  -0.0633 -0.0310 182 SER B N     
3981 C  CA    . SER B 206 ? 0.2147 0.2408 0.1713 -0.0203 -0.0212 0.0185  182 SER B CA    
3982 C  C     . SER B 206 ? 0.2303 0.2495 0.1399 0.0042  -0.0502 0.0182  182 SER B C     
3983 O  O     . SER B 206 ? 0.2107 0.2748 0.1593 -0.0312 -0.0741 0.0201  182 SER B O     
3984 C  CB    . SER B 206 ? 0.1979 0.1978 0.2182 -0.0009 -0.0057 0.0216  182 SER B CB    
3985 O  OG    . SER B 206 ? 0.2923 0.1730 0.0720 -0.0292 -0.1058 -0.0145 182 SER B OG    
3986 N  N     . MSE B 207 ? 0.2534 0.2300 0.1050 -0.0148 -0.0355 0.0319  183 MSE B N     
3987 C  CA    . MSE B 207 ? 0.2862 0.2939 0.1261 -0.0101 -0.0668 0.0077  183 MSE B CA    
3988 C  C     . MSE B 207 ? 0.2091 0.3195 0.1348 -0.0171 -0.0708 -0.0005 183 MSE B C     
3989 O  O     . MSE B 207 ? 0.2209 0.2690 0.0725 -0.0051 -0.0724 -0.0312 183 MSE B O     
3990 C  CB    . MSE B 207 ? 0.3507 0.3028 0.1391 -0.0096 -0.0287 -0.0126 183 MSE B CB    
3991 C  CG    . MSE B 207 ? 0.4379 0.3664 0.1647 0.0547  -0.0640 -0.0206 183 MSE B CG    
3992 SE SE    . MSE B 207 ? 0.6378 0.5520 0.3031 -0.0391 -0.0812 0.0585  183 MSE B SE    
3993 C  CE    . MSE B 207 ? 0.4685 0.5166 0.2975 0.0394  -0.0452 -0.0210 183 MSE B CE    
3994 N  N     . THR B 208 ? 0.2367 0.2655 0.1107 -0.0514 -0.0542 0.0056  184 THR B N     
3995 C  CA    . THR B 208 ? 0.2304 0.2570 0.0999 -0.0166 -0.0772 0.0228  184 THR B CA    
3996 C  C     . THR B 208 ? 0.1930 0.2354 0.0623 0.0038  -0.0628 0.0246  184 THR B C     
3997 O  O     . THR B 208 ? 0.2031 0.2797 0.0352 0.0078  -0.0419 -0.0028 184 THR B O     
3998 C  CB    . THR B 208 ? 0.2305 0.2605 0.0975 -0.0169 -0.0464 0.0305  184 THR B CB    
3999 O  OG1   . THR B 208 ? 0.2566 0.2215 0.1134 -0.0442 -0.0230 0.0263  184 THR B OG1   
4000 C  CG2   . THR B 208 ? 0.2448 0.2145 0.0491 0.0062  -0.0706 0.0121  184 THR B CG2   
4001 N  N     . LEU B 209 ? 0.2306 0.2293 0.1180 0.0037  -0.0780 0.0046  185 LEU B N     
4002 C  CA    . LEU B 209 ? 0.2039 0.2233 0.0961 0.0018  -0.0602 0.0025  185 LEU B CA    
4003 C  C     . LEU B 209 ? 0.1876 0.2314 0.1151 -0.0067 -0.0629 -0.0003 185 LEU B C     
4004 O  O     . LEU B 209 ? 0.2264 0.2368 0.0906 -0.0137 -0.0819 -0.0169 185 LEU B O     
4005 C  CB    . LEU B 209 ? 0.1664 0.2498 0.1308 -0.0052 -0.0693 0.0452  185 LEU B CB    
4006 C  CG    . LEU B 209 ? 0.1728 0.2702 0.1205 -0.0111 -0.0645 0.0483  185 LEU B CG    
4007 C  CD1   . LEU B 209 ? 0.2181 0.2633 0.1429 -0.0002 -0.0991 0.0233  185 LEU B CD1   
4008 C  CD2   . LEU B 209 ? 0.2119 0.3472 0.1114 -0.0043 -0.0653 0.0541  185 LEU B CD2   
4009 N  N     . SER B 210 ? 0.1797 0.2403 0.1489 0.0257  -0.0597 0.0171  186 SER B N     
4010 C  CA    . SER B 210 ? 0.1700 0.2391 0.1182 -0.0013 -0.0472 0.0198  186 SER B CA    
4011 C  C     . SER B 210 ? 0.2159 0.2210 0.1375 -0.0034 -0.0471 0.0228  186 SER B C     
4012 O  O     . SER B 210 ? 0.3109 0.2939 0.0965 -0.0049 -0.0860 0.0006  186 SER B O     
4013 C  CB    . SER B 210 ? 0.1556 0.2392 0.1194 0.0050  -0.0776 0.0176  186 SER B CB    
4014 O  OG    . SER B 210 ? 0.2144 0.2782 0.1765 0.0464  -0.0687 0.0018  186 SER B OG    
4015 N  N     . ASP B 211 ? 0.2171 0.2183 0.1299 -0.0114 -0.0685 0.0224  187 ASP B N     
4016 C  CA    . ASP B 211 ? 0.2076 0.2086 0.1894 -0.0221 -0.0428 0.0036  187 ASP B CA    
4017 C  C     . ASP B 211 ? 0.2274 0.2144 0.1766 -0.0049 -0.0199 0.0098  187 ASP B C     
4018 O  O     . ASP B 211 ? 0.2729 0.2871 0.1323 0.0139  -0.0569 0.0008  187 ASP B O     
4019 C  CB    . ASP B 211 ? 0.2340 0.2780 0.1813 -0.0192 -0.0679 -0.0022 187 ASP B CB    
4020 C  CG    . ASP B 211 ? 0.2974 0.2443 0.1906 -0.0068 -0.0487 0.0015  187 ASP B CG    
4021 O  OD1   . ASP B 211 ? 0.2781 0.2710 0.2007 -0.0384 -0.0889 0.0104  187 ASP B OD1   
4022 O  OD2   . ASP B 211 ? 0.3903 0.3452 0.1830 0.0663  -0.0525 0.0016  187 ASP B OD2   
4023 N  N     . SER B 212 ? 0.2364 0.2368 0.1439 0.0044  -0.0283 0.0013  188 SER B N     
4024 C  CA    . SER B 212 ? 0.2307 0.2212 0.1942 0.0069  -0.0186 0.0057  188 SER B CA    
4025 C  C     . SER B 212 ? 0.1778 0.2809 0.1696 0.0168  -0.0584 0.0241  188 SER B C     
4026 O  O     . SER B 212 ? 0.2673 0.3055 0.1413 0.0130  -0.1227 0.0020  188 SER B O     
4027 C  CB    . SER B 212 ? 0.2675 0.3135 0.1488 0.0453  -0.0454 -0.0083 188 SER B CB    
4028 O  OG    . SER B 212 ? 0.3303 0.3435 0.0911 0.0193  -0.0119 0.0131  188 SER B OG    
4029 N  N     . PHE B 213 ? 0.2147 0.2692 0.0837 -0.0053 -0.0764 0.0024  189 PHE B N     
4030 C  CA    . PHE B 213 ? 0.2160 0.2925 0.1169 0.0074  -0.0670 0.0304  189 PHE B CA    
4031 C  C     . PHE B 213 ? 0.2262 0.2555 0.1607 0.0103  -0.0589 0.0147  189 PHE B C     
4032 O  O     . PHE B 213 ? 0.2852 0.3286 0.0703 -0.0610 -0.0853 -0.0256 189 PHE B O     
4033 C  CB    . PHE B 213 ? 0.2007 0.2985 0.1315 0.0199  -0.0631 -0.0063 189 PHE B CB    
4034 C  CG    . PHE B 213 ? 0.2146 0.2950 0.1705 0.0320  -0.0715 -0.0363 189 PHE B CG    
4035 C  CD1   . PHE B 213 ? 0.2175 0.3165 0.1449 0.0406  -0.0588 -0.0208 189 PHE B CD1   
4036 C  CD2   . PHE B 213 ? 0.2546 0.3015 0.2206 0.0284  -0.0371 -0.0085 189 PHE B CD2   
4037 C  CE1   . PHE B 213 ? 0.2763 0.2647 0.1629 0.0346  -0.0911 -0.0632 189 PHE B CE1   
4038 C  CE2   . PHE B 213 ? 0.3055 0.2823 0.1965 0.0148  -0.0658 -0.0406 189 PHE B CE2   
4039 C  CZ    . PHE B 213 ? 0.3120 0.2576 0.1535 0.0436  -0.1038 0.0192  189 PHE B CZ    
4040 N  N     . CYS B 214 ? 0.2223 0.2518 0.1046 0.0375  -0.1031 0.0421  190 CYS B N     
4041 C  CA    . CYS B 214 ? 0.2022 0.2174 0.1179 0.0310  -0.0853 0.0223  190 CYS B CA    
4042 C  C     . CYS B 214 ? 0.1688 0.2038 0.0958 0.0268  -0.0605 0.0194  190 CYS B C     
4043 O  O     . CYS B 214 ? 0.2255 0.2346 0.1077 -0.0001 -0.0355 -0.0009 190 CYS B O     
4044 C  CB    . CYS B 214 ? 0.2382 0.2166 0.0815 0.0459  -0.0826 0.0483  190 CYS B CB    
4045 S  SG    . CYS B 214 ? 0.3286 0.2669 0.0613 0.0151  -0.0945 -0.0092 190 CYS B SG    
4046 N  N     . VAL B 215 ? 0.1807 0.2372 0.0749 0.0416  -0.0513 0.0283  191 VAL B N     
4047 C  CA    . VAL B 215 ? 0.1788 0.2306 0.0956 0.0459  -0.0677 0.0188  191 VAL B CA    
4048 C  C     . VAL B 215 ? 0.2336 0.2549 0.0917 -0.0039 -0.0619 0.0107  191 VAL B C     
4049 O  O     . VAL B 215 ? 0.2585 0.2901 0.0920 0.0154  -0.0859 0.0464  191 VAL B O     
4050 C  CB    . VAL B 215 ? 0.1810 0.1849 0.0825 0.0224  -0.0510 0.0205  191 VAL B CB    
4051 C  CG1   . VAL B 215 ? 0.1772 0.1887 0.0988 0.0101  -0.0654 0.0211  191 VAL B CG1   
4052 C  CG2   . VAL B 215 ? 0.2425 0.2153 0.1802 -0.0357 -0.0874 -0.0095 191 VAL B CG2   
4053 N  N     . ASP B 216 ? 0.2842 0.2506 0.0599 0.0009  -0.0939 0.0112  192 ASP B N     
4054 C  CA    . ASP B 216 ? 0.2679 0.2917 0.0831 -0.0067 -0.1046 0.0611  192 ASP B CA    
4055 C  C     . ASP B 216 ? 0.2924 0.2654 0.1381 0.0129  -0.0798 0.0303  192 ASP B C     
4056 O  O     . ASP B 216 ? 0.3601 0.2369 0.1554 0.0047  -0.0741 0.0367  192 ASP B O     
4057 C  CB    . ASP B 216 ? 0.3146 0.4130 0.1231 -0.0379 -0.1061 -0.0148 192 ASP B CB    
4058 C  CG    . ASP B 216 ? 0.3476 0.4810 0.1440 -0.0378 -0.1218 -0.0665 192 ASP B CG    
4059 O  OD1   . ASP B 216 ? 0.3955 0.5425 0.0716 -0.0132 -0.1162 -0.0671 192 ASP B OD1   
4060 O  OD2   . ASP B 216 ? 0.4028 0.4663 0.1197 -0.0987 -0.1482 -0.0128 192 ASP B OD2   
4061 N  N     . ARG B 217 ? 0.2515 0.2304 0.0813 0.0096  -0.0714 -0.0456 193 ARG B N     
4062 C  CA    . ARG B 217 ? 0.2518 0.1929 0.1190 0.0072  -0.0621 -0.0330 193 ARG B CA    
4063 C  C     . ARG B 217 ? 0.2815 0.1864 0.1155 -0.0236 -0.0803 -0.0194 193 ARG B C     
4064 O  O     . ARG B 217 ? 0.3663 0.2773 0.0598 -0.0410 -0.1053 0.0001  193 ARG B O     
4065 C  CB    . ARG B 217 ? 0.2428 0.1932 0.0975 -0.0154 -0.0482 0.0000  193 ARG B CB    
4066 C  CG    . ARG B 217 ? 0.1788 0.2841 0.1450 -0.0194 -0.0876 -0.0279 193 ARG B CG    
4067 C  CD    . ARG B 217 ? 0.2130 0.2327 0.1032 -0.0418 -0.1039 0.0294  193 ARG B CD    
4068 N  NE    . ARG B 217 ? 0.2378 0.2373 0.1484 -0.0411 -0.0770 0.0086  193 ARG B NE    
4069 C  CZ    . ARG B 217 ? 0.2503 0.2392 0.1649 -0.0270 -0.0419 -0.0033 193 ARG B CZ    
4070 N  NH1   . ARG B 217 ? 0.2392 0.2885 0.0541 0.0083  -0.0775 0.0101  193 ARG B NH1   
4071 N  NH2   . ARG B 217 ? 0.3369 0.2709 0.1991 0.0093  -0.0578 0.0473  193 ARG B NH2   
4072 N  N     . TYR B 218 ? 0.2774 0.1901 0.1077 -0.0189 -0.0936 -0.0258 194 TYR B N     
4073 C  CA    . TYR B 218 ? 0.2560 0.2063 0.1056 -0.0324 -0.0549 -0.0379 194 TYR B CA    
4074 C  C     . TYR B 218 ? 0.2483 0.2309 0.1144 0.0137  -0.0458 0.0169  194 TYR B C     
4075 O  O     . TYR B 218 ? 0.2724 0.2758 0.1011 -0.0135 -0.1207 0.0325  194 TYR B O     
4076 C  CB    . TYR B 218 ? 0.2252 0.2223 0.0296 -0.0329 -0.0247 0.0192  194 TYR B CB    
4077 C  CG    . TYR B 218 ? 0.1965 0.2428 0.1088 -0.0106 -0.0115 0.0322  194 TYR B CG    
4078 C  CD1   . TYR B 218 ? 0.1953 0.2607 0.1212 -0.0173 -0.0121 0.0101  194 TYR B CD1   
4079 C  CD2   . TYR B 218 ? 0.2249 0.2619 0.1145 0.0018  -0.0677 0.0145  194 TYR B CD2   
4080 C  CE1   . TYR B 218 ? 0.2047 0.2757 0.1578 -0.0552 -0.0313 0.0015  194 TYR B CE1   
4081 C  CE2   . TYR B 218 ? 0.2155 0.2890 0.1399 -0.0299 -0.0683 0.0278  194 TYR B CE2   
4082 C  CZ    . TYR B 218 ? 0.2274 0.2993 0.1754 -0.0350 -0.0430 0.0194  194 TYR B CZ    
4083 O  OH    . TYR B 218 ? 0.2710 0.3239 0.1796 -0.0394 -0.0822 0.0535  194 TYR B OH    
4084 N  N     . ARG B 219 ? 0.2743 0.2426 0.0758 0.0249  -0.0430 0.0411  195 ARG B N     
4085 C  CA    . ARG B 219 ? 0.2606 0.3057 0.1518 0.0395  -0.0491 0.0138  195 ARG B CA    
4086 C  C     . ARG B 219 ? 0.3025 0.3031 0.1528 0.0097  -0.0611 0.0298  195 ARG B C     
4087 O  O     . ARG B 219 ? 0.2749 0.2966 0.1523 0.0343  -0.0773 0.0575  195 ARG B O     
4088 C  CB    . ARG B 219 ? 0.2905 0.2754 0.1614 -0.0117 -0.0879 -0.0204 195 ARG B CB    
4089 C  CG    . ARG B 219 ? 0.3005 0.2845 0.2461 0.0849  -0.0074 0.0197  195 ARG B CG    
4090 C  CD    . ARG B 219 ? 0.3914 0.3270 0.1520 0.0628  -0.0343 -0.0551 195 ARG B CD    
4091 N  NE    . ARG B 219 ? 0.3477 0.3476 0.1571 0.0815  -0.0744 0.0362  195 ARG B NE    
4092 C  CZ    . ARG B 219 ? 0.3407 0.3564 0.1970 -0.0221 -0.0246 0.0011  195 ARG B CZ    
4093 N  NH1   . ARG B 219 ? 0.3726 0.3544 0.2119 0.0047  -0.0192 0.0452  195 ARG B NH1   
4094 N  NH2   . ARG B 219 ? 0.3683 0.3304 0.1272 -0.0048 -0.0133 0.0091  195 ARG B NH2   
4095 N  N     . GLY B 220 ? 0.2931 0.3411 0.1386 0.0116  -0.0283 0.0050  196 GLY B N     
4096 C  CA    . GLY B 220 ? 0.3336 0.2873 0.1384 -0.0049 -0.0686 0.0250  196 GLY B CA    
4097 C  C     . GLY B 220 ? 0.2661 0.3129 0.1621 0.0122  -0.0652 0.0178  196 GLY B C     
4098 O  O     . GLY B 220 ? 0.2770 0.2908 0.1465 0.0238  -0.0709 0.0343  196 GLY B O     
4099 N  N     . GLU B 221 ? 0.2723 0.3069 0.0645 -0.0040 -0.0772 -0.0086 197 GLU B N     
4100 C  CA    . GLU B 221 ? 0.2691 0.2850 0.1306 0.0146  -0.0538 0.0376  197 GLU B CA    
4101 C  C     . GLU B 221 ? 0.2235 0.2995 0.1693 0.0107  -0.0403 -0.0081 197 GLU B C     
4102 O  O     . GLU B 221 ? 0.2236 0.3454 0.0837 -0.0033 -0.0809 0.0131  197 GLU B O     
4103 C  CB    . GLU B 221 ? 0.2525 0.3574 0.1164 -0.0279 -0.0665 -0.0496 197 GLU B CB    
4104 C  CG    . GLU B 221 ? 0.3162 0.3410 0.1746 -0.0694 -0.0395 -0.0882 197 GLU B CG    
4105 C  CD    . GLU B 221 ? 0.3338 0.3238 0.2794 -0.0889 -0.0506 -0.0996 197 GLU B CD    
4106 O  OE1   . GLU B 221 ? 0.3173 0.4054 0.2165 -0.1037 -0.0755 -0.0834 197 GLU B OE1   
4107 O  OE2   . GLU B 221 ? 0.3186 0.5524 0.3393 -0.1063 -0.0438 -0.0835 197 GLU B OE2   
4108 N  N     . PHE B 222 ? 0.1963 0.3368 0.1748 0.0023  -0.0419 0.0162  198 PHE B N     
4109 C  CA    . PHE B 222 ? 0.1800 0.3217 0.1520 0.0150  -0.0409 0.0078  198 PHE B CA    
4110 C  C     . PHE B 222 ? 0.1908 0.2275 0.1339 0.0005  -0.0447 0.0055  198 PHE B C     
4111 O  O     . PHE B 222 ? 0.2104 0.2756 0.1490 -0.0328 -0.0709 -0.0005 198 PHE B O     
4112 C  CB    . PHE B 222 ? 0.2016 0.3251 0.1415 0.0264  -0.0602 -0.0241 198 PHE B CB    
4113 C  CG    . PHE B 222 ? 0.1902 0.3123 0.1845 0.0292  -0.0725 -0.0236 198 PHE B CG    
4114 C  CD1   . PHE B 222 ? 0.1765 0.3381 0.1907 0.0200  -0.0729 -0.0118 198 PHE B CD1   
4115 C  CD2   . PHE B 222 ? 0.2211 0.3158 0.1769 0.0118  -0.0769 -0.0107 198 PHE B CD2   
4116 C  CE1   . PHE B 222 ? 0.2134 0.3361 0.1827 0.0066  -0.0816 0.0065  198 PHE B CE1   
4117 C  CE2   . PHE B 222 ? 0.1854 0.2833 0.2195 0.0070  -0.0873 -0.0222 198 PHE B CE2   
4118 C  CZ    . PHE B 222 ? 0.1997 0.3102 0.1861 0.0217  -0.0836 0.0022  198 PHE B CZ    
4119 N  N     . LEU B 223 ? 0.1567 0.2583 0.1294 0.0125  -0.0452 0.0350  199 LEU B N     
4120 C  CA    . LEU B 223 ? 0.1838 0.2554 0.1448 0.0305  -0.0656 0.0228  199 LEU B CA    
4121 C  C     . LEU B 223 ? 0.2109 0.2828 0.1446 0.0119  -0.0736 0.0190  199 LEU B C     
4122 O  O     . LEU B 223 ? 0.2704 0.2858 0.2039 -0.0085 -0.1035 0.0054  199 LEU B O     
4123 C  CB    . LEU B 223 ? 0.2690 0.2552 0.1441 0.0378  -0.1116 0.0028  199 LEU B CB    
4124 C  CG    . LEU B 223 ? 0.2652 0.3147 0.1789 0.0464  -0.0718 0.0176  199 LEU B CG    
4125 C  CD1   . LEU B 223 ? 0.4290 0.3136 0.1705 0.0642  -0.0627 0.0084  199 LEU B CD1   
4126 C  CD2   . LEU B 223 ? 0.2563 0.3773 0.2204 0.0265  -0.0538 -0.0011 199 LEU B CD2   
4127 N  N     . ASP B 224 ? 0.2170 0.2916 0.1334 0.0273  -0.0688 0.0405  200 ASP B N     
4128 C  CA    . ASP B 224 ? 0.2686 0.2997 0.1621 -0.0183 -0.0935 -0.0359 200 ASP B CA    
4129 C  C     . ASP B 224 ? 0.2759 0.2790 0.1397 -0.0058 -0.0777 -0.0032 200 ASP B C     
4130 O  O     . ASP B 224 ? 0.2932 0.3529 0.1914 -0.0451 -0.0955 -0.0467 200 ASP B O     
4131 C  CB    . ASP B 224 ? 0.3033 0.3514 0.2461 -0.0744 -0.0661 -0.0009 200 ASP B CB    
4132 C  CG    . ASP B 224 ? 0.3637 0.5010 0.2222 -0.0354 -0.1088 -0.0155 200 ASP B CG    
4133 O  OD1   . ASP B 224 ? 0.5276 0.5516 0.1075 -0.0523 -0.0733 0.0019  200 ASP B OD1   
4134 O  OD2   . ASP B 224 ? 0.3839 0.5931 0.3341 -0.0134 -0.1724 0.0220  200 ASP B OD2   
4135 N  N     . LEU B 225 ? 0.2657 0.2706 0.1714 0.0194  -0.0720 0.0062  201 LEU B N     
4136 C  CA    . LEU B 225 ? 0.2553 0.2754 0.1325 0.0014  -0.1148 -0.0112 201 LEU B CA    
4137 C  C     . LEU B 225 ? 0.2454 0.2905 0.1310 0.0090  -0.0989 0.0286  201 LEU B C     
4138 O  O     . LEU B 225 ? 0.3268 0.3434 0.1293 0.0609  -0.0844 -0.0141 201 LEU B O     
4139 C  CB    . LEU B 225 ? 0.2035 0.3058 0.1331 -0.0005 -0.1126 -0.0154 201 LEU B CB    
4140 C  CG    . LEU B 225 ? 0.2126 0.3673 0.1340 -0.0172 -0.1309 -0.0642 201 LEU B CG    
4141 C  CD1   . LEU B 225 ? 0.2465 0.4545 0.1785 0.0276  -0.1808 0.0205  201 LEU B CD1   
4142 C  CD2   . LEU B 225 ? 0.2663 0.4456 0.1673 0.0380  -0.0430 -0.0255 201 LEU B CD2   
4143 N  N     . MSE B 226 ? 0.2632 0.2893 0.0773 0.0215  -0.0879 0.0635  202 MSE B N     
4144 C  CA    . MSE B 226 ? 0.2596 0.3366 0.1037 0.0376  -0.0577 0.0671  202 MSE B CA    
4145 C  C     . MSE B 226 ? 0.2653 0.3221 0.1182 0.0381  -0.0866 0.0322  202 MSE B C     
4146 O  O     . MSE B 226 ? 0.3157 0.3695 0.1052 0.0373  -0.0884 -0.0047 202 MSE B O     
4147 C  CB    . MSE B 226 ? 0.3300 0.3551 0.1518 0.0674  -0.0855 0.0336  202 MSE B CB    
4148 C  CG    . MSE B 226 ? 0.3698 0.4738 0.2303 -0.0250 -0.0950 0.1646  202 MSE B CG    
4149 SE SE    . MSE B 226 ? 0.7761 0.8999 0.3130 0.0748  -0.0738 0.0080  202 MSE B SE    
4150 C  CE    . MSE B 226 ? 0.7247 0.8745 0.0756 0.0338  -0.1869 -0.0270 202 MSE B CE    
4151 N  N     . ARG B 227 ? 0.3061 0.3102 0.1249 0.0257  -0.0704 0.0241  203 ARG B N     
4152 C  CA    . ARG B 227 ? 0.3254 0.2787 0.1037 0.0406  -0.0700 -0.0087 203 ARG B CA    
4153 C  C     . ARG B 227 ? 0.3419 0.2951 0.1767 0.0728  -0.0284 -0.0331 203 ARG B C     
4154 O  O     . ARG B 227 ? 0.3724 0.4173 0.1476 0.1093  -0.0779 0.1690  203 ARG B O     
4155 C  CB    . ARG B 227 ? 0.3026 0.2659 0.0648 0.0071  -0.0450 -0.0549 203 ARG B CB    
4156 C  CG    . ARG B 227 ? 0.2349 0.2716 0.0752 0.0491  -0.0971 -0.0565 203 ARG B CG    
4157 C  CD    . ARG B 227 ? 0.2324 0.2819 0.1042 0.0325  -0.1109 -0.0307 203 ARG B CD    
4158 N  NE    . ARG B 227 ? 0.2803 0.3096 0.2224 0.0681  -0.0669 -0.0349 203 ARG B NE    
4159 C  CZ    . ARG B 227 ? 0.2416 0.2862 0.2212 0.0739  -0.0873 -0.0044 203 ARG B CZ    
4160 N  NH1   . ARG B 227 ? 0.2445 0.3700 0.2728 -0.0117 -0.1368 0.0029  203 ARG B NH1   
4161 N  NH2   . ARG B 227 ? 0.2304 0.3828 0.1142 0.0682  -0.1291 0.0074  203 ARG B NH2   
4162 N  N     . SER B 228 ? 0.3281 0.3741 0.1091 0.0607  -0.1033 -0.0151 204 SER B N     
4163 C  CA    . SER B 228 ? 0.3548 0.3291 0.1392 0.0296  -0.0909 -0.0322 204 SER B CA    
4164 C  C     . SER B 228 ? 0.4200 0.3245 0.1184 0.0233  -0.1098 -0.0273 204 SER B C     
4165 O  O     . SER B 228 ? 0.4892 0.3558 0.0640 0.0751  -0.1243 0.0213  204 SER B O     
4166 C  CB    . SER B 228 ? 0.3490 0.3744 0.2306 0.0432  -0.0360 0.0257  204 SER B CB    
4167 O  OG    . SER B 228 ? 0.2882 0.4537 0.2181 -0.0121 -0.1296 -0.0335 204 SER B OG    
4168 N  N     . GLY B 229 ? 0.3739 0.3209 0.1365 -0.0033 -0.1784 0.0180  205 GLY B N     
4169 C  CA    . GLY B 229 ? 0.4666 0.3022 0.0784 0.0260  -0.1528 -0.0170 205 GLY B CA    
4170 C  C     . GLY B 229 ? 0.4093 0.3326 0.2389 0.0468  -0.1163 0.0132  205 GLY B C     
4171 O  O     . GLY B 229 ? 0.4967 0.3826 0.1816 0.0164  -0.1576 0.1008  205 GLY B O     
4172 N  N     . LYS B 230 ? 0.3387 0.3409 0.3246 0.0311  -0.0461 0.0519  206 LYS B N     
4173 C  CA    . LYS B 230 ? 0.3213 0.3743 0.2366 0.0298  -0.0524 0.0111  206 LYS B CA    
4174 C  C     . LYS B 230 ? 0.3271 0.3182 0.2181 0.0192  -0.0794 -0.0143 206 LYS B C     
4175 O  O     . LYS B 230 ? 0.3619 0.4439 0.1084 0.1009  -0.1672 -0.0529 206 LYS B O     
4176 C  CB    . LYS B 230 ? 0.3114 0.4099 0.2586 0.0549  -0.0629 0.0780  206 LYS B CB    
4177 C  CG    . LYS B 230 ? 0.3216 0.4482 0.3160 -0.0001 0.0589  -0.0161 206 LYS B CG    
4178 C  CD    . LYS B 230 ? 0.4004 0.4415 0.3599 -0.0453 0.0669  -0.0002 206 LYS B CD    
4179 C  CE    . LYS B 230 ? 0.4984 0.4311 0.2988 -0.0509 0.0370  -0.0438 206 LYS B CE    
4180 N  NZ    . LYS B 230 ? 0.5556 0.3774 0.1966 -0.0249 0.0550  -0.0973 206 LYS B NZ    
4181 N  N     . VAL B 231 ? 0.2467 0.2830 0.1209 -0.0339 -0.0903 0.0176  207 VAL B N     
4182 C  CA    . VAL B 231 ? 0.2974 0.4261 0.0809 -0.0301 -0.0864 0.0134  207 VAL B CA    
4183 C  C     . VAL B 231 ? 0.2790 0.3813 0.1055 0.0092  -0.0351 0.0155  207 VAL B C     
4184 O  O     . VAL B 231 ? 0.3666 0.4693 0.0927 0.0688  -0.1159 0.0071  207 VAL B O     
4185 C  CB    . VAL B 231 ? 0.3408 0.4440 0.0771 -0.0648 -0.0878 0.0234  207 VAL B CB    
4186 C  CG1   . VAL B 231 ? 0.2876 0.4919 0.0968 -0.0358 -0.0913 0.0243  207 VAL B CG1   
4187 C  CG2   . VAL B 231 ? 0.3373 0.5141 0.0348 -0.0375 -0.0508 -0.0178 207 VAL B CG2   
4188 N  N     . ASP B 232 ? 0.2677 0.3523 0.0854 0.0128  -0.0701 -0.0167 208 ASP B N     
4189 C  CA    . ASP B 232 ? 0.2318 0.3428 0.1751 0.0404  -0.0509 -0.0026 208 ASP B CA    
4190 C  C     . ASP B 232 ? 0.2245 0.3419 0.1585 0.0297  -0.0456 0.0652  208 ASP B C     
4191 O  O     . ASP B 232 ? 0.2508 0.3833 0.1538 0.0634  -0.1100 0.0886  208 ASP B O     
4192 C  CB    . ASP B 232 ? 0.2842 0.3451 0.1627 0.0401  -0.1049 0.0188  208 ASP B CB    
4193 C  CG    . ASP B 232 ? 0.3457 0.3966 0.1772 0.0419  -0.0626 0.0456  208 ASP B CG    
4194 O  OD1   . ASP B 232 ? 0.3595 0.4940 0.1608 0.0702  -0.1247 0.0114  208 ASP B OD1   
4195 O  OD2   . ASP B 232 ? 0.3638 0.3676 0.1692 0.0202  -0.1151 0.0152  208 ASP B OD2   
4196 N  N     . ILE B 233 ? 0.2086 0.3303 0.1415 -0.0041 -0.0482 0.0294  209 ILE B N     
4197 C  CA    . ILE B 233 ? 0.2060 0.2418 0.1638 -0.0209 -0.0459 -0.0144 209 ILE B CA    
4198 C  C     . ILE B 233 ? 0.1983 0.2484 0.1614 -0.0144 -0.0326 -0.0348 209 ILE B C     
4199 O  O     . ILE B 233 ? 0.2070 0.3077 0.1348 -0.0020 -0.0637 -0.0422 209 ILE B O     
4200 C  CB    . ILE B 233 ? 0.2615 0.2247 0.1495 -0.0197 -0.0190 -0.0263 209 ILE B CB    
4201 C  CG1   . ILE B 233 ? 0.2586 0.2417 0.1929 -0.0069 -0.0580 -0.0390 209 ILE B CG1   
4202 C  CG2   . ILE B 233 ? 0.2214 0.2634 0.1151 0.0080  -0.0551 -0.0080 209 ILE B CG2   
4203 C  CD1   . ILE B 233 ? 0.3290 0.2617 0.2957 -0.0001 -0.0960 -0.0102 209 ILE B CD1   
4204 N  N     . VAL B 234 ? 0.2087 0.1674 0.1871 -0.0207 -0.0709 -0.0057 210 VAL B N     
4205 C  CA    A VAL B 234 ? 0.1918 0.2265 0.1533 -0.0265 -0.0685 -0.0171 210 VAL B CA    
4206 C  CA    B VAL B 234 ? 0.1789 0.1590 0.1540 -0.0251 -0.0610 0.0143  210 VAL B CA    
4207 C  C     . VAL B 234 ? 0.1694 0.2429 0.1498 -0.0229 -0.0660 -0.0093 210 VAL B C     
4208 O  O     . VAL B 234 ? 0.1872 0.3073 0.0825 -0.0080 -0.0948 -0.0173 210 VAL B O     
4209 C  CB    A VAL B 234 ? 0.2560 0.2599 0.1983 -0.0122 -0.0449 0.0154  210 VAL B CB    
4210 C  CB    B VAL B 234 ? 0.1279 0.1501 0.1050 -0.0577 -0.0564 -0.0049 210 VAL B CB    
4211 C  CG1   A VAL B 234 ? 0.2099 0.2384 0.2101 -0.0025 -0.0457 0.0245  210 VAL B CG1   
4212 C  CG1   B VAL B 234 ? 0.1485 0.1867 0.1010 -0.0217 -0.0753 0.0122  210 VAL B CG1   
4213 C  CG2   A VAL B 234 ? 0.2748 0.3296 0.1825 -0.0300 -0.0632 0.0234  210 VAL B CG2   
4214 C  CG2   B VAL B 234 ? 0.1268 0.1243 0.1076 -0.0551 -0.0498 -0.0010 210 VAL B CG2   
4215 N  N     . PHE B 235 ? 0.1904 0.2439 0.1288 0.0091  -0.0633 0.0005  211 PHE B N     
4216 C  CA    . PHE B 235 ? 0.1791 0.2205 0.1569 0.0018  -0.0191 0.0328  211 PHE B CA    
4217 C  C     . PHE B 235 ? 0.1896 0.2315 0.1723 0.0069  -0.0416 0.0232  211 PHE B C     
4218 O  O     . PHE B 235 ? 0.1922 0.2707 0.1319 -0.0150 -0.0730 0.0304  211 PHE B O     
4219 C  CB    . PHE B 235 ? 0.2155 0.1984 0.1557 -0.0016 -0.0311 0.0266  211 PHE B CB    
4220 C  CG    . PHE B 235 ? 0.2055 0.1979 0.1514 0.0109  -0.0117 -0.0010 211 PHE B CG    
4221 C  CD1   . PHE B 235 ? 0.2053 0.2240 0.0530 0.0313  -0.0594 0.0291  211 PHE B CD1   
4222 C  CD2   . PHE B 235 ? 0.2333 0.2038 0.1216 0.0080  -0.0210 0.0280  211 PHE B CD2   
4223 C  CE1   . PHE B 235 ? 0.2065 0.2036 0.0841 0.0173  -0.0583 0.0784  211 PHE B CE1   
4224 C  CE2   . PHE B 235 ? 0.2316 0.2050 0.1458 0.0332  -0.0137 -0.0145 211 PHE B CE2   
4225 C  CZ    . PHE B 235 ? 0.1797 0.2809 0.0922 0.0226  -0.0200 0.0008  211 PHE B CZ    
4226 N  N     . ALA B 236 ? 0.2248 0.2427 0.1500 0.0248  -0.0453 0.0057  212 ALA B N     
4227 C  CA    . ALA B 236 ? 0.2632 0.2558 0.1551 0.0025  -0.0695 0.0179  212 ALA B CA    
4228 C  C     . ALA B 236 ? 0.2477 0.3115 0.1837 -0.0259 -0.0588 0.0013  212 ALA B C     
4229 O  O     . ALA B 236 ? 0.2660 0.3668 0.1885 -0.0537 -0.0544 0.0235  212 ALA B O     
4230 C  CB    . ALA B 236 ? 0.2659 0.2399 0.1856 0.0179  -0.0603 0.0155  212 ALA B CB    
4231 N  N     . ASN B 237 ? 0.2925 0.2929 0.1631 -0.0291 -0.0301 -0.0098 213 ASN B N     
4232 C  CA    . ASN B 237 ? 0.2594 0.2782 0.1571 -0.0103 -0.0334 0.0401  213 ASN B CA    
4233 C  C     . ASN B 237 ? 0.2381 0.2597 0.1812 -0.0146 -0.0249 0.0158  213 ASN B C     
4234 O  O     . ASN B 237 ? 0.2056 0.2475 0.1626 -0.0018 -0.0291 0.0113  213 ASN B O     
4235 C  CB    . ASN B 237 ? 0.2327 0.2625 0.1712 0.0233  -0.0308 0.1083  213 ASN B CB    
4236 C  CG    . ASN B 237 ? 0.2753 0.3015 0.2434 -0.0073 -0.0173 0.0454  213 ASN B CG    
4237 O  OD1   . ASN B 237 ? 0.3323 0.3059 0.2148 -0.0212 -0.0053 0.0291  213 ASN B OD1   
4238 N  ND2   . ASN B 237 ? 0.3207 0.4898 0.3157 0.0181  -0.0498 0.0993  213 ASN B ND2   
4239 N  N     . ARG B 238 ? 0.2078 0.2681 0.1894 0.0031  -0.0463 0.0023  214 ARG B N     
4240 C  CA    . ARG B 238 ? 0.2394 0.2570 0.2046 0.0018  -0.0609 -0.0078 214 ARG B CA    
4241 C  C     . ARG B 238 ? 0.2716 0.2628 0.2075 0.0022  -0.0423 0.0295  214 ARG B C     
4242 O  O     . ARG B 238 ? 0.2730 0.2787 0.1673 0.0376  -0.0396 0.0092  214 ARG B O     
4243 C  CB    . ARG B 238 ? 0.2119 0.2971 0.2109 0.0278  -0.0629 0.0029  214 ARG B CB    
4244 C  CG    . ARG B 238 ? 0.3550 0.2828 0.2804 0.0395  -0.0403 -0.0356 214 ARG B CG    
4245 C  CD    . ARG B 238 ? 0.4429 0.4516 0.3491 0.0646  0.0429  -0.0233 214 ARG B CD    
4246 N  NE    . ARG B 238 ? 0.4876 0.6537 0.4819 0.0293  0.0067  -0.0999 214 ARG B NE    
4247 C  CZ    . ARG B 238 ? 0.5640 0.7395 0.3528 0.0598  -0.0779 -0.0257 214 ARG B CZ    
4248 N  NH1   . ARG B 238 ? 0.7475 0.8203 0.1031 -0.0420 -0.0782 -0.0809 214 ARG B NH1   
4249 N  NH2   . ARG B 238 ? 0.6125 0.6825 0.3388 -0.1055 0.0295  0.0059  214 ARG B NH2   
4250 N  N     . GLN B 239 ? 0.2696 0.2848 0.2140 0.0107  -0.0356 0.0196  215 GLN B N     
4251 C  CA    . GLN B 239 ? 0.2663 0.3430 0.1048 -0.0192 -0.0383 -0.0111 215 GLN B CA    
4252 C  C     . GLN B 239 ? 0.2665 0.2733 0.1028 0.0201  -0.0406 0.0173  215 GLN B C     
4253 O  O     . GLN B 239 ? 0.2995 0.2957 0.0785 0.0118  -0.0303 0.0202  215 GLN B O     
4254 C  CB    . GLN B 239 ? 0.2944 0.4170 0.2161 -0.0147 -0.1126 -0.0084 215 GLN B CB    
4255 C  CG    . GLN B 239 ? 0.3921 0.4594 0.2516 -0.0256 -0.0470 -0.0570 215 GLN B CG    
4256 C  CD    . GLN B 239 ? 0.4042 0.5052 0.3386 -0.0361 -0.0684 -0.0070 215 GLN B CD    
4257 O  OE1   . GLN B 239 ? 0.3842 0.4370 0.2737 -0.0253 -0.0251 0.0403  215 GLN B OE1   
4258 N  NE2   . GLN B 239 ? 0.3887 0.7182 0.3638 0.0705  -0.0759 -0.0004 215 GLN B NE2   
4259 N  N     . GLU B 240 ? 0.2450 0.2705 0.0807 0.0220  -0.0842 0.0222  216 GLU B N     
4260 C  CA    . GLU B 240 ? 0.2306 0.2700 0.1519 0.0193  -0.0230 0.0328  216 GLU B CA    
4261 C  C     . GLU B 240 ? 0.2215 0.2850 0.1628 -0.0026 -0.0518 0.0121  216 GLU B C     
4262 O  O     . GLU B 240 ? 0.2444 0.2696 0.1784 -0.0312 -0.0930 0.0305  216 GLU B O     
4263 C  CB    . GLU B 240 ? 0.2170 0.2836 0.2041 0.0380  -0.0240 0.0331  216 GLU B CB    
4264 C  CG    . GLU B 240 ? 0.2510 0.3220 0.2206 0.0487  -0.0511 0.0165  216 GLU B CG    
4265 C  CD    . GLU B 240 ? 0.3093 0.3235 0.2300 0.0131  -0.0851 0.0074  216 GLU B CD    
4266 O  OE1   . GLU B 240 ? 0.3115 0.3525 0.1842 0.0244  -0.0884 -0.0084 216 GLU B OE1   
4267 O  OE2   . GLU B 240 ? 0.3720 0.3840 0.2029 0.0319  -0.0855 0.0068  216 GLU B OE2   
4268 N  N     . ALA B 241 ? 0.2083 0.2827 0.1560 0.0319  -0.0491 0.0350  217 ALA B N     
4269 C  CA    . ALA B 241 ? 0.2128 0.2543 0.1435 0.0131  -0.0488 0.0293  217 ALA B CA    
4270 C  C     . ALA B 241 ? 0.2343 0.2442 0.1590 -0.0015 -0.0319 0.0162  217 ALA B C     
4271 O  O     . ALA B 241 ? 0.2130 0.2523 0.1837 0.0182  -0.0504 0.0516  217 ALA B O     
4272 C  CB    . ALA B 241 ? 0.2260 0.2962 0.1179 -0.0211 -0.0406 0.0045  217 ALA B CB    
4273 N  N     . LEU B 242 ? 0.2636 0.2517 0.1893 0.0215  -0.0124 -0.0070 218 LEU B N     
4274 C  CA    . LEU B 242 ? 0.2602 0.2577 0.1830 0.0258  -0.0044 0.0061  218 LEU B CA    
4275 C  C     . LEU B 242 ? 0.2345 0.2418 0.2298 0.0219  -0.0464 0.0086  218 LEU B C     
4276 O  O     . LEU B 242 ? 0.3372 0.2558 0.2821 0.0451  -0.0337 0.0271  218 LEU B O     
4277 C  CB    . LEU B 242 ? 0.2157 0.3089 0.1998 0.0154  0.0098  -0.0178 218 LEU B CB    
4278 C  CG    . LEU B 242 ? 0.2275 0.3534 0.1418 0.0249  0.0215  -0.0220 218 LEU B CG    
4279 C  CD1   . LEU B 242 ? 0.3106 0.3694 0.1520 -0.0147 0.0111  -0.0531 218 LEU B CD1   
4280 C  CD2   . LEU B 242 ? 0.2863 0.3195 0.1182 0.0194  -0.0054 -0.0343 218 LEU B CD2   
4281 N  N     A SER B 243 ? 0.2190 0.2543 0.1866 0.0262  -0.0127 0.0140  219 SER B N     
4282 N  N     B SER B 243 ? 0.2362 0.2633 0.1901 0.0399  -0.0255 0.0054  219 SER B N     
4283 C  CA    A SER B 243 ? 0.2158 0.2363 0.2358 0.0370  -0.0049 0.0122  219 SER B CA    
4284 C  CA    B SER B 243 ? 0.2293 0.2668 0.2448 0.0561  -0.0201 0.0002  219 SER B CA    
4285 C  C     A SER B 243 ? 0.2422 0.2214 0.2281 0.0221  -0.0224 0.0133  219 SER B C     
4286 C  C     B SER B 243 ? 0.2541 0.2211 0.2365 0.0264  -0.0264 0.0063  219 SER B C     
4287 O  O     A SER B 243 ? 0.2145 0.2904 0.2545 -0.0415 -0.0427 0.0221  219 SER B O     
4288 O  O     B SER B 243 ? 0.2509 0.3109 0.2758 -0.0260 -0.0244 0.0130  219 SER B O     
4289 C  CB    A SER B 243 ? 0.1515 0.2122 0.2127 -0.0181 0.0139  0.0190  219 SER B CB    
4290 C  CB    B SER B 243 ? 0.2392 0.3092 0.2441 0.0418  -0.0547 -0.0295 219 SER B CB    
4291 O  OG    A SER B 243 ? 0.1945 0.1069 0.3150 -0.0581 0.0232  0.0177  219 SER B OG    
4292 O  OG    B SER B 243 ? 0.3141 0.2583 0.2643 0.1199  -0.1117 -0.0791 219 SER B OG    
4293 N  N     . LEU B 244 ? 0.2188 0.2552 0.1856 0.0183  -0.0321 0.0127  220 LEU B N     
4294 C  CA    . LEU B 244 ? 0.2305 0.2257 0.2017 0.0317  -0.0430 -0.0026 220 LEU B CA    
4295 C  C     . LEU B 244 ? 0.2179 0.2710 0.1812 0.0298  -0.0542 0.0221  220 LEU B C     
4296 O  O     . LEU B 244 ? 0.3108 0.3352 0.1066 -0.0268 -0.0981 0.0004  220 LEU B O     
4297 C  CB    . LEU B 244 ? 0.2551 0.2397 0.1766 0.0237  -0.0175 -0.0319 220 LEU B CB    
4298 C  CG    . LEU B 244 ? 0.2358 0.2475 0.1375 -0.0044 -0.0457 -0.0055 220 LEU B CG    
4299 C  CD1   . LEU B 244 ? 0.2460 0.2935 0.1383 0.0492  -0.0149 0.0132  220 LEU B CD1   
4300 C  CD2   . LEU B 244 ? 0.3052 0.2349 0.0508 -0.0281 -0.0184 0.0205  220 LEU B CD2   
4301 N  N     . TYR B 245 ? 0.2173 0.2322 0.2198 0.0321  -0.0791 0.0026  221 TYR B N     
4302 C  CA    . TYR B 245 ? 0.2193 0.2291 0.2363 0.0018  -0.0655 0.0412  221 TYR B CA    
4303 C  C     . TYR B 245 ? 0.2670 0.2467 0.2499 -0.0097 -0.0647 0.0181  221 TYR B C     
4304 O  O     . TYR B 245 ? 0.3101 0.2321 0.3728 0.0079  -0.0826 -0.0289 221 TYR B O     
4305 C  CB    . TYR B 245 ? 0.2286 0.2363 0.1939 0.0071  -0.0874 0.0260  221 TYR B CB    
4306 C  CG    . TYR B 245 ? 0.2179 0.2479 0.1856 0.0242  -0.0668 0.0222  221 TYR B CG    
4307 C  CD1   . TYR B 245 ? 0.3130 0.3103 0.2020 -0.0014 -0.0236 -0.0052 221 TYR B CD1   
4308 C  CD2   . TYR B 245 ? 0.2399 0.2192 0.2499 0.0067  -0.0844 0.0017  221 TYR B CD2   
4309 C  CE1   . TYR B 245 ? 0.2554 0.2761 0.2173 -0.0349 -0.0162 0.0020  221 TYR B CE1   
4310 C  CE2   . TYR B 245 ? 0.2321 0.2238 0.1825 -0.0107 -0.0863 0.0158  221 TYR B CE2   
4311 C  CZ    . TYR B 245 ? 0.2324 0.2901 0.2154 -0.0162 -0.0474 0.0363  221 TYR B CZ    
4312 O  OH    . TYR B 245 ? 0.2491 0.2887 0.2800 -0.0216 -0.0707 0.0502  221 TYR B OH    
4313 N  N     . GLN B 246 ? 0.2583 0.2724 0.2645 -0.0164 -0.0654 0.0108  222 GLN B N     
4314 C  CA    . GLN B 246 ? 0.2527 0.2480 0.2191 0.0113  -0.0440 0.0150  222 GLN B CA    
4315 C  C     . GLN B 246 ? 0.2719 0.2290 0.2267 0.0106  -0.0586 -0.0122 222 GLN B C     
4316 O  O     . GLN B 246 ? 0.3927 0.2451 0.2357 -0.0257 -0.0841 0.0351  222 GLN B O     
4317 C  CB    . GLN B 246 ? 0.2656 0.2168 0.3034 -0.0473 -0.0937 0.0182  222 GLN B CB    
4318 C  CG    . GLN B 246 ? 0.2715 0.3003 0.2220 -0.0123 -0.0778 0.0490  222 GLN B CG    
4319 C  CD    . GLN B 246 ? 0.3691 0.3505 0.3205 -0.0127 -0.0408 0.1148  222 GLN B CD    
4320 O  OE1   . GLN B 246 ? 0.4041 0.4146 0.3068 -0.0500 -0.0510 0.0637  222 GLN B OE1   
4321 N  NE2   . GLN B 246 ? 0.3395 0.3790 0.4185 -0.0492 -0.0333 0.1144  222 GLN B NE2   
4322 N  N     . THR B 247 ? 0.3029 0.2821 0.1625 0.0349  -0.0387 0.0284  223 THR B N     
4323 C  CA    . THR B 247 ? 0.2923 0.2755 0.1599 0.0117  -0.0037 -0.0007 223 THR B CA    
4324 C  C     . THR B 247 ? 0.3103 0.2722 0.1566 0.0036  -0.0315 0.0122  223 THR B C     
4325 O  O     . THR B 247 ? 0.3670 0.3491 0.0918 0.0166  -0.0458 0.0382  223 THR B O     
4326 C  CB    . THR B 247 ? 0.2637 0.2580 0.2115 -0.0137 0.0100  0.0139  223 THR B CB    
4327 O  OG1   . THR B 247 ? 0.2753 0.3460 0.2091 0.0076  0.0078  0.0302  223 THR B OG1   
4328 C  CG2   . THR B 247 ? 0.3023 0.2584 0.1088 0.0096  -0.0525 -0.0049 223 THR B CG2   
4329 N  N     . ASP B 248 ? 0.3289 0.3409 0.2073 0.0199  -0.0214 -0.0067 224 ASP B N     
4330 C  CA    . ASP B 248 ? 0.3475 0.3603 0.2494 -0.0178 -0.0024 0.0449  224 ASP B CA    
4331 C  C     . ASP B 248 ? 0.2927 0.4169 0.1991 0.0322  0.0079  0.0551  224 ASP B C     
4332 O  O     . ASP B 248 ? 0.3762 0.5347 0.1349 -0.0301 -0.0119 0.0546  224 ASP B O     
4333 C  CB    . ASP B 248 ? 0.4818 0.4420 0.3657 0.0009  0.0586  -0.0368 224 ASP B CB    
4334 C  CG    . ASP B 248 ? 0.6520 0.6179 0.4208 -0.0060 -0.0237 -0.0759 224 ASP B CG    
4335 O  OD1   . ASP B 248 ? 0.6616 0.5870 0.2756 -0.0158 -0.0483 -0.1105 224 ASP B OD1   
4336 O  OD2   . ASP B 248 ? 0.7014 0.5714 0.4770 0.0466  0.0735  0.0663  224 ASP B OD2   
4337 N  N     . ASP B 249 ? 0.3258 0.3373 0.2133 0.0428  0.0030  0.0000  225 ASP B N     
4338 C  CA    . ASP B 249 ? 0.3319 0.2996 0.2573 0.0312  -0.0004 0.0717  225 ASP B CA    
4339 C  C     . ASP B 249 ? 0.3038 0.3034 0.2551 0.0118  -0.0042 0.0508  225 ASP B C     
4340 O  O     . ASP B 249 ? 0.3225 0.3734 0.2332 0.0204  -0.0227 0.0606  225 ASP B O     
4341 C  CB    . ASP B 249 ? 0.3031 0.3742 0.2793 0.0738  -0.0245 0.0641  225 ASP B CB    
4342 C  CG    . ASP B 249 ? 0.3530 0.4052 0.3901 0.0402  -0.0683 0.0660  225 ASP B CG    
4343 O  OD1   . ASP B 249 ? 0.3642 0.4418 0.3342 -0.0309 -0.0534 0.0228  225 ASP B OD1   
4344 O  OD2   . ASP B 249 ? 0.3788 0.5521 0.4023 0.0432  -0.1897 0.0382  225 ASP B OD2   
4345 N  N     . PHE B 250 ? 0.2972 0.2674 0.2363 -0.0139 -0.0774 0.0469  226 PHE B N     
4346 C  CA    . PHE B 250 ? 0.3230 0.2624 0.1871 -0.0034 -0.0304 0.0682  226 PHE B CA    
4347 C  C     . PHE B 250 ? 0.2965 0.3178 0.2376 0.0043  -0.0242 0.0189  226 PHE B C     
4348 O  O     . PHE B 250 ? 0.3536 0.3501 0.1434 -0.0042 -0.0430 -0.0026 226 PHE B O     
4349 C  CB    . PHE B 250 ? 0.3420 0.3272 0.1843 -0.0478 0.0237  0.0556  226 PHE B CB    
4350 C  CG    . PHE B 250 ? 0.3270 0.3397 0.2363 -0.0446 -0.0143 0.0347  226 PHE B CG    
4351 C  CD1   . PHE B 250 ? 0.3381 0.3217 0.1831 -0.0124 -0.0303 0.0452  226 PHE B CD1   
4352 C  CD2   . PHE B 250 ? 0.3639 0.3114 0.2628 -0.0514 0.0176  0.0461  226 PHE B CD2   
4353 C  CE1   . PHE B 250 ? 0.3677 0.3198 0.2465 -0.0278 -0.0144 0.0221  226 PHE B CE1   
4354 C  CE2   . PHE B 250 ? 0.3003 0.3409 0.2025 0.0036  -0.0246 0.0296  226 PHE B CE2   
4355 C  CZ    . PHE B 250 ? 0.3058 0.3472 0.1584 -0.0001 -0.0059 0.0208  226 PHE B CZ    
4356 N  N     . GLU B 251 ? 0.3038 0.3406 0.2809 0.0054  -0.0413 0.0669  227 GLU B N     
4357 C  CA    . GLU B 251 ? 0.3121 0.4054 0.3076 0.0033  -0.0507 0.0339  227 GLU B CA    
4358 C  C     . GLU B 251 ? 0.3159 0.3445 0.3146 0.0047  -0.0242 -0.0064 227 GLU B C     
4359 O  O     . GLU B 251 ? 0.3307 0.3623 0.3855 -0.0071 -0.0224 -0.0310 227 GLU B O     
4360 C  CB    . GLU B 251 ? 0.3483 0.4514 0.3916 0.0266  0.0104  -0.0288 227 GLU B CB    
4361 C  CG    . GLU B 251 ? 0.3985 0.4671 0.4377 -0.0458 -0.0253 0.0243  227 GLU B CG    
4362 C  CD    . GLU B 251 ? 0.4885 0.4774 0.3672 -0.0394 -0.1501 0.0401  227 GLU B CD    
4363 O  OE1   . GLU B 251 ? 0.3464 0.5789 0.3792 0.0042  -0.1993 -0.0076 227 GLU B OE1   
4364 O  OE2   . GLU B 251 ? 0.4372 0.5060 0.4237 0.0382  -0.1779 0.1106  227 GLU B OE2   
4365 N  N     . GLU B 252 ? 0.3090 0.3164 0.2906 0.0173  -0.0286 -0.0056 228 GLU B N     
4366 C  CA    . GLU B 252 ? 0.3297 0.2920 0.3167 0.0111  -0.0135 -0.0171 228 GLU B CA    
4367 C  C     . GLU B 252 ? 0.2791 0.2915 0.1834 0.0020  -0.0412 0.0066  228 GLU B C     
4368 O  O     . GLU B 252 ? 0.3055 0.2914 0.1704 -0.0010 -0.0621 0.0010  228 GLU B O     
4369 C  CB    . GLU B 252 ? 0.3074 0.2966 0.3393 0.0121  0.0188  0.0250  228 GLU B CB    
4370 C  CG    . GLU B 252 ? 0.4012 0.3094 0.2312 -0.0138 -0.0397 0.0429  228 GLU B CG    
4371 C  CD    . GLU B 252 ? 0.4022 0.3113 0.3146 -0.0258 -0.0281 0.0912  228 GLU B CD    
4372 O  OE1   . GLU B 252 ? 0.4136 0.4033 0.5196 0.0331  0.0196  0.0236  228 GLU B OE1   
4373 O  OE2   . GLU B 252 ? 0.4961 0.3892 0.2694 -0.0685 0.0133  0.0984  228 GLU B OE2   
4374 N  N     . ALA B 253 ? 0.2599 0.3013 0.1616 0.0276  -0.0137 0.0050  229 ALA B N     
4375 C  CA    . ALA B 253 ? 0.2785 0.2908 0.1204 0.0285  -0.0554 0.0373  229 ALA B CA    
4376 C  C     . ALA B 253 ? 0.2516 0.3075 0.1390 0.0090  -0.0682 0.0280  229 ALA B C     
4377 O  O     . ALA B 253 ? 0.2593 0.3297 0.2314 0.0157  -0.0476 0.0046  229 ALA B O     
4378 C  CB    . ALA B 253 ? 0.2480 0.3279 0.1186 0.0057  -0.0640 -0.0343 229 ALA B CB    
4379 N  N     . LEU B 254 ? 0.2577 0.3038 0.0971 0.0024  -0.0827 0.0226  230 LEU B N     
4380 C  CA    . LEU B 254 ? 0.2338 0.3047 0.1415 -0.0074 -0.0606 0.0311  230 LEU B CA    
4381 C  C     . LEU B 254 ? 0.2504 0.2750 0.1517 0.0008  -0.0818 0.0144  230 LEU B C     
4382 O  O     . LEU B 254 ? 0.2752 0.2886 0.1746 0.0006  -0.0593 0.0118  230 LEU B O     
4383 C  CB    . LEU B 254 ? 0.2358 0.3012 0.1725 0.0020  -0.0570 0.0538  230 LEU B CB    
4384 C  CG    . LEU B 254 ? 0.2798 0.2874 0.1556 0.0194  -0.0346 0.0241  230 LEU B CG    
4385 C  CD1   . LEU B 254 ? 0.2926 0.3176 0.1809 -0.0178 -0.0255 0.0027  230 LEU B CD1   
4386 C  CD2   . LEU B 254 ? 0.2737 0.3162 0.1119 0.0226  -0.1073 0.0307  230 LEU B CD2   
4387 N  N     . ASN B 255 ? 0.2937 0.2875 0.1958 0.0102  -0.0990 0.0255  231 ASN B N     
4388 C  CA    . ASN B 255 ? 0.2775 0.3047 0.1859 -0.0091 -0.0715 0.0336  231 ASN B CA    
4389 C  C     . ASN B 255 ? 0.2649 0.3077 0.2011 -0.0001 -0.0721 0.0119  231 ASN B C     
4390 O  O     . ASN B 255 ? 0.2696 0.3691 0.2099 0.0269  -0.0668 -0.0061 231 ASN B O     
4391 C  CB    . ASN B 255 ? 0.2973 0.3858 0.3246 0.0626  -0.0547 0.0149  231 ASN B CB    
4392 C  CG    . ASN B 255 ? 0.3501 0.3979 0.3206 0.0404  -0.0213 0.0666  231 ASN B CG    
4393 O  OD1   . ASN B 255 ? 0.3330 0.4234 0.2691 0.0503  -0.0942 0.1033  231 ASN B OD1   
4394 N  ND2   . ASN B 255 ? 0.3931 0.4623 0.2678 0.0705  -0.0051 0.0391  231 ASN B ND2   
4395 N  N     . ARG B 256 ? 0.2310 0.3223 0.2144 -0.0034 -0.0315 0.0271  232 ARG B N     
4396 C  CA    . ARG B 256 ? 0.2631 0.2937 0.1997 -0.0142 -0.0113 0.0000  232 ARG B CA    
4397 C  C     . ARG B 256 ? 0.2594 0.2981 0.1616 -0.0082 -0.0159 0.0109  232 ARG B C     
4398 O  O     . ARG B 256 ? 0.2742 0.3266 0.1523 -0.0392 -0.0242 -0.0267 232 ARG B O     
4399 C  CB    . ARG B 256 ? 0.2694 0.2863 0.2020 -0.0077 -0.0128 -0.0061 232 ARG B CB    
4400 C  CG    . ARG B 256 ? 0.3123 0.3217 0.2550 0.0216  -0.0296 -0.0261 232 ARG B CG    
4401 C  CD    . ARG B 256 ? 0.4566 0.3615 0.3929 -0.0042 -0.0338 0.0536  232 ARG B CD    
4402 N  NE    . ARG B 256 ? 0.5565 0.5452 0.2238 -0.0238 -0.1639 -0.0146 232 ARG B NE    
4403 C  CZ    . ARG B 256 ? 0.4876 0.4868 0.4312 -0.0396 -0.2420 -0.0322 232 ARG B CZ    
4404 N  NH1   . ARG B 256 ? 0.5698 0.3628 0.2584 -0.0943 -0.3253 0.1679  232 ARG B NH1   
4405 N  NH2   . ARG B 256 ? 0.7365 0.4312 0.5009 0.1225  -0.5341 -0.1930 232 ARG B NH2   
4406 N  N     . ILE B 257 ? 0.2763 0.2662 0.1844 -0.0122 -0.0390 0.0209  233 ILE B N     
4407 C  CA    . ILE B 257 ? 0.2815 0.2632 0.1208 0.0000  -0.0418 0.0369  233 ILE B CA    
4408 C  C     . ILE B 257 ? 0.2423 0.2855 0.1854 0.0115  -0.0468 0.0233  233 ILE B C     
4409 O  O     . ILE B 257 ? 0.2684 0.3574 0.1825 0.0268  -0.0332 0.0033  233 ILE B O     
4410 C  CB    . ILE B 257 ? 0.2582 0.2919 0.1455 0.0228  -0.0688 0.0515  233 ILE B CB    
4411 C  CG1   . ILE B 257 ? 0.2805 0.3630 0.1160 0.0588  -0.0700 0.0506  233 ILE B CG1   
4412 C  CG2   . ILE B 257 ? 0.2370 0.3467 0.1068 0.0404  -0.0719 0.0488  233 ILE B CG2   
4413 C  CD1   . ILE B 257 ? 0.2654 0.3153 0.1117 0.0967  -0.0661 0.0284  233 ILE B CD1   
4414 N  N     . ALA B 258 ? 0.2421 0.3230 0.1859 -0.0127 -0.0431 0.0030  234 ALA B N     
4415 C  CA    . ALA B 258 ? 0.2563 0.3403 0.2002 -0.0220 -0.0368 -0.0050 234 ALA B CA    
4416 C  C     . ALA B 258 ? 0.2683 0.2685 0.1993 -0.0006 -0.0526 0.0228  234 ALA B C     
4417 O  O     . ALA B 258 ? 0.3162 0.3171 0.1719 -0.0046 -0.0620 0.0108  234 ALA B O     
4418 C  CB    . ALA B 258 ? 0.2488 0.2755 0.1141 -0.0059 -0.0643 -0.0619 234 ALA B CB    
4419 N  N     . ALA B 259 ? 0.2322 0.2923 0.1735 -0.0159 -0.0603 0.0388  235 ALA B N     
4420 C  CA    . ALA B 259 ? 0.2543 0.2716 0.1908 -0.0116 -0.0481 0.0730  235 ALA B CA    
4421 C  C     . ALA B 259 ? 0.2562 0.3529 0.1453 -0.0098 -0.0551 0.0471  235 ALA B C     
4422 O  O     . ALA B 259 ? 0.3192 0.4045 0.1077 -0.0534 -0.1161 0.0551  235 ALA B O     
4423 C  CB    . ALA B 259 ? 0.3403 0.2794 0.2251 0.0126  -0.0501 0.0644  235 ALA B CB    
4424 N  N     . ASP B 260 ? 0.2275 0.2980 0.1448 -0.0119 -0.0507 0.0480  236 ASP B N     
4425 C  CA    . ASP B 260 ? 0.2368 0.2767 0.1673 -0.0072 -0.0232 0.0152  236 ASP B CA    
4426 C  C     . ASP B 260 ? 0.2770 0.2707 0.2035 -0.0050 -0.0557 0.0102  236 ASP B C     
4427 O  O     . ASP B 260 ? 0.3037 0.3342 0.1798 0.0198  -0.0529 -0.0132 236 ASP B O     
4428 C  CB    . ASP B 260 ? 0.3176 0.2807 0.2055 -0.0276 -0.0401 -0.0036 236 ASP B CB    
4429 C  CG    . ASP B 260 ? 0.3554 0.3004 0.2024 -0.0348 -0.0718 0.0264  236 ASP B CG    
4430 O  OD1   . ASP B 260 ? 0.3338 0.4007 0.2056 -0.0252 -0.0674 0.0684  236 ASP B OD1   
4431 O  OD2   . ASP B 260 ? 0.3544 0.3720 0.1500 -0.0583 -0.1193 0.0363  236 ASP B OD2   
4432 N  N     . CYS B 261 ? 0.3050 0.2695 0.1696 -0.0042 -0.0643 0.0061  237 CYS B N     
4433 C  CA    A CYS B 261 ? 0.2772 0.2816 0.2109 0.0057  -0.0608 0.0250  237 CYS B CA    
4434 C  CA    B CYS B 261 ? 0.2855 0.2740 0.1894 0.0016  -0.0596 0.0192  237 CYS B CA    
4435 C  C     . CYS B 261 ? 0.2670 0.2919 0.2407 0.0035  -0.0623 0.0344  237 CYS B C     
4436 O  O     . CYS B 261 ? 0.2745 0.3384 0.4310 0.0096  -0.0460 -0.0056 237 CYS B O     
4437 C  CB    A CYS B 261 ? 0.2619 0.3512 0.2045 0.0197  -0.0492 0.0217  237 CYS B CB    
4438 C  CB    B CYS B 261 ? 0.2791 0.2729 0.1670 -0.0009 -0.0411 -0.0018 237 CYS B CB    
4439 S  SG    A CYS B 261 ? 0.3001 0.4148 0.1269 0.0447  -0.0872 0.0385  237 CYS B SG    
4440 S  SG    B CYS B 261 ? 0.2935 0.2498 0.0413 -0.0111 -0.0654 0.0015  237 CYS B SG    
4441 N  N     . LYS B 262 ? 0.2404 0.2885 0.1166 0.0233  -0.0993 0.0728  238 LYS B N     
4442 C  CA    . LYS B 262 ? 0.2820 0.3133 0.2276 -0.0143 -0.0610 0.0423  238 LYS B CA    
4443 C  C     . LYS B 262 ? 0.2470 0.3440 0.1643 -0.0042 -0.0900 -0.0031 238 LYS B C     
4444 O  O     . LYS B 262 ? 0.2504 0.3316 0.0884 -0.0163 -0.1187 0.0210  238 LYS B O     
4445 C  CB    . LYS B 262 ? 0.3507 0.3797 0.2208 0.0022  -0.0190 0.0039  238 LYS B CB    
4446 C  CG    . LYS B 262 ? 0.4523 0.4846 0.2267 0.0039  -0.0398 0.0384  238 LYS B CG    
4447 C  CD    . LYS B 262 ? 0.5883 0.5074 0.1412 0.0102  -0.0458 0.0078  238 LYS B CD    
4448 C  CE    . LYS B 262 ? 0.4537 0.5290 0.3529 -0.0935 -0.0695 0.0448  238 LYS B CE    
4449 N  NZ    . LYS B 262 ? 0.6664 0.4747 0.2568 -0.1548 -0.3432 0.2232  238 LYS B NZ    
4450 N  N     . ILE B 263 ? 0.2381 0.3054 0.1550 0.0085  -0.0702 0.0237  239 ILE B N     
4451 C  CA    . ILE B 263 ? 0.2150 0.2301 0.1819 -0.0622 -0.0444 -0.0173 239 ILE B CA    
4452 C  C     . ILE B 263 ? 0.1839 0.2673 0.1569 -0.0261 -0.0732 -0.0012 239 ILE B C     
4453 O  O     . ILE B 263 ? 0.1922 0.3548 0.1983 -0.0323 -0.0881 -0.0024 239 ILE B O     
4454 C  CB    . ILE B 263 ? 0.2263 0.2224 0.1488 -0.0445 -0.0493 -0.0228 239 ILE B CB    
4455 C  CG1   . ILE B 263 ? 0.2725 0.2287 0.1390 -0.0319 -0.0795 -0.0221 239 ILE B CG1   
4456 C  CG2   . ILE B 263 ? 0.2642 0.2596 0.1347 -0.0460 -0.0867 0.0312  239 ILE B CG2   
4457 C  CD1   . ILE B 263 ? 0.3015 0.2439 0.1466 0.0130  -0.0740 -0.0403 239 ILE B CD1   
4458 N  N     . ALA B 264 ? 0.2232 0.2670 0.1190 -0.0464 -0.0633 0.0035  240 ALA B N     
4459 C  CA    . ALA B 264 ? 0.2139 0.2832 0.1399 -0.0509 -0.0396 -0.0293 240 ALA B CA    
4460 C  C     . ALA B 264 ? 0.2492 0.2808 0.1480 -0.0511 -0.0637 0.0282  240 ALA B C     
4461 O  O     . ALA B 264 ? 0.2474 0.3489 0.1266 -0.0385 -0.0656 -0.0221 240 ALA B O     
4462 C  CB    . ALA B 264 ? 0.2038 0.2853 0.1116 -0.0592 -0.0825 -0.0286 240 ALA B CB    
4463 N  N     . ALA B 265 ? 0.2325 0.2901 0.1821 -0.0437 -0.0588 0.0538  241 ALA B N     
4464 C  CA    . ALA B 265 ? 0.2333 0.2553 0.1480 -0.0051 -0.0634 0.0215  241 ALA B CA    
4465 C  C     . ALA B 265 ? 0.2048 0.2439 0.1901 -0.0096 -0.0521 0.0097  241 ALA B C     
4466 O  O     . ALA B 265 ? 0.2185 0.2697 0.1835 -0.0437 -0.0977 0.0321  241 ALA B O     
4467 C  CB    . ALA B 265 ? 0.2865 0.2221 0.0835 -0.0219 -0.0516 0.0131  241 ALA B CB    
4468 N  N     . VAL B 266 ? 0.2258 0.2881 0.1928 0.0142  -0.0353 0.0388  242 VAL B N     
4469 C  CA    . VAL B 266 ? 0.2499 0.2723 0.1729 0.0190  -0.0350 0.0459  242 VAL B CA    
4470 C  C     . VAL B 266 ? 0.2212 0.3395 0.1762 0.0012  -0.0250 0.0301  242 VAL B C     
4471 O  O     . VAL B 266 ? 0.2352 0.4138 0.1828 -0.0109 -0.0259 0.0610  242 VAL B O     
4472 C  CB    . VAL B 266 ? 0.3093 0.2690 0.1880 0.0338  -0.0182 0.0470  242 VAL B CB    
4473 C  CG1   . VAL B 266 ? 0.3292 0.3299 0.1198 0.0070  -0.0640 0.0595  242 VAL B CG1   
4474 C  CG2   . VAL B 266 ? 0.3486 0.3133 0.1600 0.0686  -0.0135 -0.0379 242 VAL B CG2   
4475 N  N     . THR B 267 ? 0.2844 0.3507 0.1418 0.0072  -0.0384 0.0682  243 THR B N     
4476 C  CA    . THR B 267 ? 0.2815 0.2921 0.1446 -0.0140 -0.0274 0.0681  243 THR B CA    
4477 C  C     . THR B 267 ? 0.2892 0.3089 0.1847 0.0280  -0.0091 0.0629  243 THR B C     
4478 O  O     . THR B 267 ? 0.3595 0.3181 0.1038 0.0171  -0.0075 0.0558  243 THR B O     
4479 C  CB    . THR B 267 ? 0.2419 0.2888 0.1569 -0.0238 -0.0380 0.0514  243 THR B CB    
4480 O  OG1   . THR B 267 ? 0.2209 0.3106 0.1157 -0.0184 -0.1024 0.0694  243 THR B OG1   
4481 C  CG2   . THR B 267 ? 0.3006 0.2969 0.2433 0.0075  -0.0519 0.0447  243 THR B CG2   
4482 N  N     . MSE B 268 ? 0.2985 0.3764 0.1424 0.0391  -0.0314 0.0447  244 MSE B N     
4483 C  CA    . MSE B 268 ? 0.3386 0.3536 0.1905 0.0395  -0.0405 0.0404  244 MSE B CA    
4484 C  C     . MSE B 268 ? 0.3567 0.3642 0.1876 0.0190  -0.0276 0.0411  244 MSE B C     
4485 O  O     . MSE B 268 ? 0.3556 0.4101 0.1272 0.0212  -0.0291 0.1032  244 MSE B O     
4486 C  CB    . MSE B 268 ? 0.3574 0.4033 0.2326 0.0745  -0.0222 0.0595  244 MSE B CB    
4487 C  CG    . MSE B 268 ? 0.5246 0.4753 0.2398 0.0413  0.0316  0.0720  244 MSE B CG    
4488 SE SE    . MSE B 268 ? 0.6562 0.8282 0.5501 0.0012  -0.0834 0.1737  244 MSE B SE    
4489 C  CE    . MSE B 268 ? 0.4354 0.6263 0.4065 0.0549  0.0070  -0.0045 244 MSE B CE    
4490 N  N     . SER B 269 ? 0.3052 0.3974 0.2102 0.0015  -0.0243 0.0120  245 SER B N     
4491 C  CA    . SER B 269 ? 0.3784 0.4336 0.2294 0.0236  -0.0090 0.0562  245 SER B CA    
4492 C  C     . SER B 269 ? 0.4124 0.4305 0.2538 0.0009  0.0049  0.0447  245 SER B C     
4493 O  O     . SER B 269 ? 0.4278 0.4449 0.1169 0.0078  -0.0977 0.1200  245 SER B O     
4494 C  CB    . SER B 269 ? 0.3913 0.4686 0.2357 -0.0177 0.0128  0.0430  245 SER B CB    
4495 O  OG    . SER B 269 ? 0.3394 0.5979 0.2928 -0.0257 -0.0169 0.0119  245 SER B OG    
4496 N  N     . GLU B 270 ? 0.4071 0.5193 0.3044 -0.0439 0.0424  -0.0116 246 GLU B N     
4497 C  CA    . GLU B 270 ? 0.4047 0.4899 0.3032 -0.0581 0.0024  0.0340  246 GLU B CA    
4498 C  C     . GLU B 270 ? 0.4061 0.4593 0.3060 -0.0197 0.0027  0.0214  246 GLU B C     
4499 O  O     . GLU B 270 ? 0.4533 0.5419 0.1499 -0.0763 -0.0489 0.0343  246 GLU B O     
4500 C  CB    . GLU B 270 ? 0.4733 0.4998 0.3448 -0.0593 0.0107  -0.0160 246 GLU B CB    
4501 C  CG    . GLU B 270 ? 0.4367 0.5319 0.3845 -0.0208 0.0540  -0.0689 246 GLU B CG    
4502 C  CD    . GLU B 270 ? 0.5230 0.5630 0.4912 -0.0432 0.0737  -0.0333 246 GLU B CD    
4503 O  OE1   . GLU B 270 ? 0.4951 0.5867 0.3223 -0.0531 -0.0687 -0.0505 246 GLU B OE1   
4504 O  OE2   . GLU B 270 ? 0.6476 0.6342 0.5449 0.0396  0.0721  0.0050  246 GLU B OE2   
4505 N  N     . ASN B 271 ? 0.4191 0.4729 0.3040 0.0117  0.0213  0.0241  247 ASN B N     
4506 C  CA    . ASN B 271 ? 0.4036 0.4326 0.3640 -0.0547 0.0050  0.0235  247 ASN B CA    
4507 C  C     . ASN B 271 ? 0.3611 0.3740 0.2880 -0.0034 0.0059  0.0823  247 ASN B C     
4508 O  O     . ASN B 271 ? 0.3689 0.4409 0.2821 -0.0412 -0.0115 0.0075  247 ASN B O     
4509 C  CB    . ASN B 271 ? 0.4910 0.4289 0.3694 -0.0236 0.0207  0.0188  247 ASN B CB    
4510 C  CG    . ASN B 271 ? 0.5741 0.4361 0.4897 -0.0134 0.1213  -0.0276 247 ASN B CG    
4511 O  OD1   . ASN B 271 ? 0.5186 0.4669 0.4927 -0.0633 0.0767  -0.0063 247 ASN B OD1   
4512 N  ND2   . ASN B 271 ? 0.7242 0.3507 0.6150 -0.0082 0.1000  -0.1282 247 ASN B ND2   
4513 N  N     . GLY B 272 ? 0.3713 0.3914 0.1899 -0.0005 -0.0188 0.0535  248 GLY B N     
4514 C  CA    . GLY B 272 ? 0.3624 0.4171 0.1159 -0.0173 -0.0807 0.0551  248 GLY B CA    
4515 C  C     . GLY B 272 ? 0.3055 0.3917 0.1792 -0.0181 -0.0048 0.0038  248 GLY B C     
4516 O  O     . GLY B 272 ? 0.3434 0.3997 0.1546 -0.0406 -0.0557 0.0125  248 GLY B O     
4517 N  N     . ALA B 273 ? 0.2773 0.3403 0.1125 0.0316  0.0086  0.0453  249 ALA B N     
4518 C  CA    . ALA B 273 ? 0.2530 0.3515 0.1143 0.0449  0.0010  0.0372  249 ALA B CA    
4519 C  C     . ALA B 273 ? 0.2154 0.3971 0.1900 0.0427  -0.0163 0.0602  249 ALA B C     
4520 O  O     . ALA B 273 ? 0.2391 0.4046 0.1552 0.0151  -0.0155 0.0489  249 ALA B O     
4521 C  CB    . ALA B 273 ? 0.2197 0.3683 0.0796 0.0765  -0.0402 0.0534  249 ALA B CB    
4522 N  N     . VAL B 274 ? 0.2546 0.3388 0.1647 0.0371  -0.0598 0.0508  250 VAL B N     
4523 C  CA    . VAL B 274 ? 0.2601 0.3526 0.1787 0.0035  -0.0663 0.0280  250 VAL B CA    
4524 C  C     . VAL B 274 ? 0.2713 0.3340 0.1746 -0.0065 -0.0630 0.0241  250 VAL B C     
4525 O  O     . VAL B 274 ? 0.2860 0.4048 0.1243 -0.0495 -0.0702 0.0178  250 VAL B O     
4526 C  CB    . VAL B 274 ? 0.2494 0.3732 0.2729 0.0162  -0.0782 0.0306  250 VAL B CB    
4527 C  CG1   . VAL B 274 ? 0.2775 0.3910 0.1934 -0.0139 -0.0873 0.0681  250 VAL B CG1   
4528 C  CG2   . VAL B 274 ? 0.1773 0.4252 0.3113 0.0818  -0.0824 0.0591  250 VAL B CG2   
4529 N  N     . ILE B 275 ? 0.2280 0.3172 0.1748 0.0283  -0.0666 0.0204  251 ILE B N     
4530 C  CA    . ILE B 275 ? 0.1815 0.3072 0.1608 -0.0021 -0.0533 0.0247  251 ILE B CA    
4531 C  C     . ILE B 275 ? 0.1777 0.3154 0.1661 -0.0022 -0.0614 0.0236  251 ILE B C     
4532 O  O     . ILE B 275 ? 0.1860 0.3550 0.2054 0.0216  -0.0957 0.0645  251 ILE B O     
4533 C  CB    . ILE B 275 ? 0.1952 0.3161 0.1557 0.0113  -0.0568 -0.0055 251 ILE B CB    
4534 C  CG1   . ILE B 275 ? 0.2070 0.2923 0.2074 -0.0061 -0.0723 0.0430  251 ILE B CG1   
4535 C  CG2   . ILE B 275 ? 0.1879 0.3478 0.2141 0.0022  -0.0509 -0.0475 251 ILE B CG2   
4536 C  CD1   . ILE B 275 ? 0.2138 0.3472 0.1276 -0.0270 -0.0593 0.0507  251 ILE B CD1   
4537 N  N     . LEU B 276 ? 0.2266 0.2505 0.1946 -0.0231 -0.0718 0.0671  252 LEU B N     
4538 C  CA    . LEU B 276 ? 0.2676 0.2759 0.1628 -0.0227 -0.1092 0.0191  252 LEU B CA    
4539 C  C     . LEU B 276 ? 0.1867 0.3106 0.2155 -0.0046 -0.0707 -0.0085 252 LEU B C     
4540 O  O     . LEU B 276 ? 0.1717 0.3482 0.2261 -0.0138 -0.0822 0.0189  252 LEU B O     
4541 C  CB    . LEU B 276 ? 0.3134 0.2512 0.1481 0.0094  -0.0905 0.0845  252 LEU B CB    
4542 C  CG    . LEU B 276 ? 0.3248 0.3166 0.2435 -0.0070 -0.0375 0.0129  252 LEU B CG    
4543 C  CD1   . LEU B 276 ? 0.3231 0.4138 0.2842 -0.0565 -0.0376 -0.0217 252 LEU B CD1   
4544 C  CD2   . LEU B 276 ? 0.3333 0.3694 0.2831 0.0180  0.0053  0.0735  252 LEU B CD2   
4545 N  N     . LYS B 277 ? 0.2639 0.3778 0.1709 0.0113  -0.0936 -0.0080 253 LYS B N     
4546 C  CA    . LYS B 277 ? 0.2350 0.3153 0.1741 0.0538  -0.0979 -0.0056 253 LYS B CA    
4547 C  C     . LYS B 277 ? 0.2498 0.3638 0.1736 0.0388  -0.1062 0.0255  253 LYS B C     
4548 O  O     . LYS B 277 ? 0.2918 0.4137 0.2228 -0.0178 -0.0679 0.0591  253 LYS B O     
4549 C  CB    . LYS B 277 ? 0.2728 0.3263 0.2032 0.0463  -0.1257 -0.0224 253 LYS B CB    
4550 C  CG    . LYS B 277 ? 0.3902 0.3178 0.1852 -0.0392 -0.1332 -0.0317 253 LYS B CG    
4551 C  CD    . LYS B 277 ? 0.4952 0.3191 0.2691 -0.0159 -0.0880 -0.0758 253 LYS B CD    
4552 C  CE    . LYS B 277 ? 0.5574 0.2817 0.3036 -0.0642 -0.1060 -0.1326 253 LYS B CE    
4553 N  NZ    . LYS B 277 ? 0.6599 0.2987 0.2999 -0.1085 -0.1419 -0.0729 253 LYS B NZ    
4554 N  N     . GLY B 278 ? 0.2669 0.3654 0.1918 0.0207  -0.1328 0.0462  254 GLY B N     
4555 C  CA    . GLY B 278 ? 0.2798 0.3347 0.2844 0.0494  -0.1099 0.0946  254 GLY B CA    
4556 C  C     . GLY B 278 ? 0.2442 0.4207 0.2838 0.0462  -0.1035 0.0718  254 GLY B C     
4557 O  O     . GLY B 278 ? 0.3359 0.4656 0.2949 0.0235  -0.0990 0.0704  254 GLY B O     
4558 N  N     . ARG B 279 ? 0.2790 0.4879 0.3639 -0.0142 -0.0979 0.0616  255 ARG B N     
4559 C  CA    . ARG B 279 ? 0.2629 0.5285 0.2914 -0.0057 -0.1095 0.0537  255 ARG B CA    
4560 C  C     . ARG B 279 ? 0.2783 0.4732 0.2851 0.0026  -0.1017 0.0294  255 ARG B C     
4561 O  O     . ARG B 279 ? 0.2860 0.5850 0.2434 0.0231  -0.0842 0.0335  255 ARG B O     
4562 C  CB    . ARG B 279 ? 0.2681 0.6115 0.4081 0.0378  -0.1421 0.0720  255 ARG B CB    
4563 C  CG    . ARG B 279 ? 0.4138 0.7360 0.3467 0.0356  -0.1908 0.1063  255 ARG B CG    
4564 C  CD    . ARG B 279 ? 0.5054 0.7668 0.4919 0.1766  -0.1907 0.1866  255 ARG B CD    
4565 N  NE    . ARG B 279 ? 0.6913 0.7907 0.4396 0.1351  -0.1789 0.1684  255 ARG B NE    
4566 C  CZ    . ARG B 279 ? 0.8096 0.6124 0.4887 0.1280  0.0171  0.1403  255 ARG B CZ    
4567 N  NH1   . ARG B 279 ? 0.7741 0.7274 0.1347 0.1980  0.0045  0.0201  255 ARG B NH1   
4568 N  NH2   . ARG B 279 ? 0.9182 0.4231 0.7407 0.0659  0.0746  0.1231  255 ARG B NH2   
4569 N  N     . GLU B 280 ? 0.2978 0.4344 0.2673 -0.0484 -0.1028 0.0726  256 GLU B N     
4570 C  CA    . GLU B 280 ? 0.3004 0.4600 0.2260 -0.0063 -0.0513 0.0577  256 GLU B CA    
4571 C  C     . GLU B 280 ? 0.2625 0.4670 0.2655 -0.0240 -0.0472 0.0344  256 GLU B C     
4572 O  O     . GLU B 280 ? 0.2587 0.4281 0.2708 -0.0153 -0.0905 0.0455  256 GLU B O     
4573 C  CB    . GLU B 280 ? 0.3432 0.4769 0.2377 -0.0600 -0.0443 0.0292  256 GLU B CB    
4574 C  CG    . GLU B 280 ? 0.4859 0.5695 0.3129 -0.0889 -0.1108 -0.0179 256 GLU B CG    
4575 C  CD    . GLU B 280 ? 0.5526 0.5826 0.4207 -0.0661 -0.1542 -0.0047 256 GLU B CD    
4576 O  OE1   . GLU B 280 ? 0.3990 0.6081 0.4412 -0.0659 -0.1441 -0.0155 256 GLU B OE1   
4577 O  OE2   . GLU B 280 ? 0.7564 0.8463 0.3808 -0.0809 -0.1865 0.0615  256 GLU B OE2   
4578 N  N     . ARG B 281 ? 0.2026 0.5150 0.2694 0.0299  -0.0563 -0.0065 257 ARG B N     
4579 C  CA    . ARG B 281 ? 0.2581 0.4029 0.2659 0.0426  -0.0579 -0.0035 257 ARG B CA    
4580 C  C     . ARG B 281 ? 0.2384 0.4363 0.2843 0.0382  -0.0746 0.0200  257 ARG B C     
4581 O  O     . ARG B 281 ? 0.2273 0.5122 0.2556 0.0450  -0.0895 0.0511  257 ARG B O     
4582 C  CB    . ARG B 281 ? 0.3522 0.3366 0.3484 0.0019  -0.0435 0.0258  257 ARG B CB    
4583 C  CG    . ARG B 281 ? 0.2866 0.3708 0.3943 -0.0409 0.0069  -0.0049 257 ARG B CG    
4584 C  CD    . ARG B 281 ? 0.3410 0.3869 0.4856 -0.0134 -0.0203 -0.0312 257 ARG B CD    
4585 N  NE    . ARG B 281 ? 0.3851 0.4212 0.5117 0.0355  0.0067  0.0052  257 ARG B NE    
4586 C  CZ    . ARG B 281 ? 0.3426 0.4418 0.4524 0.0133  0.0274  -0.0019 257 ARG B CZ    
4587 N  NH1   . ARG B 281 ? 0.3587 0.5739 0.4374 0.0707  -0.0321 -0.0587 257 ARG B NH1   
4588 N  NH2   . ARG B 281 ? 0.4306 0.5687 0.3263 0.0537  0.0931  0.0423  257 ARG B NH2   
4589 N  N     . TYR B 282 ? 0.2402 0.3840 0.2476 0.0257  -0.0747 -0.0016 258 TYR B N     
4590 C  CA    . TYR B 282 ? 0.2957 0.3919 0.2617 -0.0143 -0.0838 -0.0045 258 TYR B CA    
4591 C  C     . TYR B 282 ? 0.2926 0.4135 0.2136 -0.0118 -0.0843 0.0575  258 TYR B C     
4592 O  O     . TYR B 282 ? 0.2986 0.4274 0.1350 0.0162  -0.1158 0.0503  258 TYR B O     
4593 C  CB    . TYR B 282 ? 0.1710 0.3701 0.3098 0.0020  -0.1058 0.0229  258 TYR B CB    
4594 C  CG    . TYR B 282 ? 0.2754 0.3678 0.3080 -0.0562 -0.0580 -0.0151 258 TYR B CG    
4595 C  CD1   . TYR B 282 ? 0.2794 0.4253 0.3909 -0.0648 -0.0913 -0.0569 258 TYR B CD1   
4596 C  CD2   . TYR B 282 ? 0.3670 0.3846 0.2942 -0.0228 -0.0359 -0.0304 258 TYR B CD2   
4597 C  CE1   . TYR B 282 ? 0.3315 0.5098 0.3408 -0.0438 -0.0851 -0.0364 258 TYR B CE1   
4598 C  CE2   . TYR B 282 ? 0.4031 0.3848 0.3325 -0.0149 -0.0500 -0.0688 258 TYR B CE2   
4599 C  CZ    . TYR B 282 ? 0.3771 0.5110 0.3979 -0.0210 -0.0244 -0.0602 258 TYR B CZ    
4600 O  OH    . TYR B 282 ? 0.5050 0.6624 0.4883 0.0157  -0.0668 -0.2000 258 TYR B OH    
4601 N  N     . TYR B 283 ? 0.3138 0.4034 0.2427 -0.0286 -0.0807 0.0051  259 TYR B N     
4602 C  CA    . TYR B 283 ? 0.2760 0.3500 0.2525 -0.0407 -0.0973 0.0131  259 TYR B CA    
4603 C  C     . TYR B 283 ? 0.2589 0.3463 0.3179 -0.0504 -0.0579 0.0350  259 TYR B C     
4604 O  O     . TYR B 283 ? 0.2688 0.3956 0.3999 -0.0716 -0.0349 0.0587  259 TYR B O     
4605 C  CB    . TYR B 283 ? 0.2897 0.3590 0.2146 -0.0406 -0.0336 0.0609  259 TYR B CB    
4606 C  CG    . TYR B 283 ? 0.3635 0.3341 0.3579 -0.0543 -0.0312 0.0541  259 TYR B CG    
4607 C  CD1   . TYR B 283 ? 0.4222 0.4190 0.3368 -0.0352 -0.0184 0.0760  259 TYR B CD1   
4608 C  CD2   . TYR B 283 ? 0.3353 0.4167 0.4157 -0.1036 0.0055  0.0190  259 TYR B CD2   
4609 C  CE1   . TYR B 283 ? 0.3836 0.4307 0.2541 -0.0086 -0.0063 0.0984  259 TYR B CE1   
4610 C  CE2   . TYR B 283 ? 0.4678 0.4215 0.4712 -0.0564 -0.0144 0.0454  259 TYR B CE2   
4611 C  CZ    . TYR B 283 ? 0.4659 0.4048 0.4439 -0.0122 0.0074  0.0264  259 TYR B CZ    
4612 O  OH    . TYR B 283 ? 0.5519 0.4143 0.5400 0.0444  0.0818  0.0333  259 TYR B OH    
4613 N  N     . VAL B 284 ? 0.2571 0.4021 0.3213 -0.0179 -0.0572 0.0632  260 VAL B N     
4614 C  CA    . VAL B 284 ? 0.3865 0.3731 0.2768 -0.0231 -0.0227 0.0393  260 VAL B CA    
4615 C  C     . VAL B 284 ? 0.4357 0.3489 0.2915 -0.0128 -0.0144 0.0219  260 VAL B C     
4616 O  O     . VAL B 284 ? 0.4233 0.3582 0.1716 -0.0128 -0.0451 0.0228  260 VAL B O     
4617 C  CB    . VAL B 284 ? 0.4432 0.3455 0.3132 0.0029  -0.0279 0.0540  260 VAL B CB    
4618 C  CG1   . VAL B 284 ? 0.4833 0.3626 0.3142 0.0142  -0.0394 0.0589  260 VAL B CG1   
4619 C  CG2   . VAL B 284 ? 0.3913 0.3655 0.3164 0.0301  -0.0441 0.0497  260 VAL B CG2   
4620 N  N     . ASN B 285 ? 0.4484 0.3675 0.3402 -0.0404 0.0485  -0.0100 261 ASN B N     
4621 C  CA    . ASN B 285 ? 0.4691 0.4710 0.3309 -0.0160 0.0200  0.0167  261 ASN B CA    
4622 C  C     . ASN B 285 ? 0.4803 0.4510 0.3230 -0.0514 -0.0227 -0.0001 261 ASN B C     
4623 O  O     . ASN B 285 ? 0.5272 0.4498 0.4021 -0.0823 -0.0122 -0.0278 261 ASN B O     
4624 C  CB    . ASN B 285 ? 0.4878 0.6460 0.4881 -0.0380 0.0628  0.0737  261 ASN B CB    
4625 C  CG    . ASN B 285 ? 0.5333 0.5713 0.6530 0.0039  0.1367  0.1184  261 ASN B CG    
4626 O  OD1   . ASN B 285 ? 0.6741 0.5656 0.7098 0.0844  0.1901  0.0482  261 ASN B OD1   
4627 N  ND2   . ASN B 285 ? 0.6094 0.5638 0.6119 -0.0579 0.2011  0.1545  261 ASN B ND2   
4628 N  N     . ALA B 286 ? 0.3558 0.4637 0.3480 -0.0898 -0.0327 0.0447  262 ALA B N     
4629 C  CA    . ALA B 286 ? 0.4366 0.4785 0.3888 -0.0528 -0.0821 0.0308  262 ALA B CA    
4630 C  C     . ALA B 286 ? 0.4616 0.5505 0.3214 -0.0308 -0.0511 -0.0056 262 ALA B C     
4631 O  O     . ALA B 286 ? 0.3732 0.6509 0.2090 -0.1190 -0.0843 0.0474  262 ALA B O     
4632 C  CB    . ALA B 286 ? 0.4071 0.4607 0.3624 -0.0427 -0.1300 0.0645  262 ALA B CB    
4633 N  N     . ILE B 287 ? 0.6851 0.5451 0.3376 -0.0211 -0.1430 0.0211  263 ILE B N     
4634 C  CA    . ILE B 287 ? 0.6466 0.5965 0.4279 -0.0562 -0.1139 0.0558  263 ILE B CA    
4635 C  C     . ILE B 287 ? 0.5254 0.6885 0.4110 -0.0385 -0.1427 0.0226  263 ILE B C     
4636 O  O     . ILE B 287 ? 0.6090 0.6611 0.4833 -0.0361 -0.0653 0.0415  263 ILE B O     
4637 C  CB    . ILE B 287 ? 0.4932 0.6597 0.4064 -0.0607 -0.2295 0.0102  263 ILE B CB    
4638 C  CG1   . ILE B 287 ? 0.4123 0.6689 0.5058 -0.0664 -0.1598 0.0423  263 ILE B CG1   
4639 C  CG2   . ILE B 287 ? 0.5994 0.6746 0.5170 0.0237  -0.0202 -0.0316 263 ILE B CG2   
4640 C  CD1   . ILE B 287 ? 0.4705 0.6467 0.6534 -0.0818 -0.1416 0.1136  263 ILE B CD1   
4641 N  N     . ARG B 288 ? 0.5875 0.7752 0.5516 -0.0739 -0.0251 -0.0283 264 ARG B N     
4642 C  CA    . ARG B 288 ? 0.5911 0.8216 0.6185 -0.0779 0.0218  -0.0821 264 ARG B CA    
4643 C  C     . ARG B 288 ? 0.6469 0.7679 0.5563 -0.0735 0.0020  -0.0537 264 ARG B C     
4644 O  O     . ARG B 288 ? 0.8185 0.7168 0.7381 -0.0031 -0.0102 -0.1120 264 ARG B O     
4645 C  CB    . ARG B 288 ? 0.5701 0.7445 0.8225 -0.1576 0.0683  -0.1401 264 ARG B CB    
4646 C  CG    . ARG B 288 ? 0.5868 0.7603 1.0174 -0.1238 0.1321  -0.1551 264 ARG B CG    
4647 C  CD    . ARG B 288 ? 0.5228 0.7461 1.0798 -0.0392 0.0564  -0.2226 264 ARG B CD    
4648 N  NE    . ARG B 288 ? 0.5772 0.6533 0.9340 0.0570  0.0922  -0.2270 264 ARG B NE    
4649 C  CZ    . ARG B 288 ? 0.5950 0.7386 0.6938 0.0139  0.0224  -0.1094 264 ARG B CZ    
4650 N  NH1   . ARG B 288 ? 0.7075 0.7709 0.7504 -0.0010 0.1236  -0.1305 264 ARG B NH1   
4651 N  NH2   . ARG B 288 ? 0.5419 0.6634 0.7126 0.0078  -0.0069 -0.0344 264 ARG B NH2   
4652 N  N     . ILE B 289 ? 0.6816 0.9289 0.1929 -0.0998 0.0113  -0.1964 265 ILE B N     
4653 C  CA    . ILE B 289 ? 0.6807 0.9891 0.5545 -0.0692 -0.0460 -0.1050 265 ILE B CA    
4654 C  C     . ILE B 289 ? 0.6060 0.9785 0.5526 -0.0503 -0.0876 -0.0774 265 ILE B C     
4655 O  O     . ILE B 289 ? 0.6142 1.0289 0.5977 -0.0198 -0.0946 -0.0824 265 ILE B O     
4656 C  CB    . ILE B 289 ? 0.6585 0.9216 0.4990 -0.0559 -0.0771 -0.1096 265 ILE B CB    
4657 C  CG1   . ILE B 289 ? 0.8447 0.8175 0.5074 0.0119  -0.0454 -0.1375 265 ILE B CG1   
4658 C  CG2   . ILE B 289 ? 0.6637 0.9627 0.4783 -0.0208 -0.0245 0.0149  265 ILE B CG2   
4659 C  CD1   . ILE B 289 ? 1.1177 0.7657 0.3177 0.0043  -0.4050 -0.3261 265 ILE B CD1   
4660 N  N     . ARG B 290 ? 0.6597 0.9141 0.7424 -0.0342 -0.0184 -0.0094 266 ARG B N     
4661 C  CA    . ARG B 290 ? 0.7882 0.8266 0.7460 -0.0187 0.0250  -0.0052 266 ARG B CA    
4662 C  C     . ARG B 290 ? 0.6744 0.9406 0.6521 -0.0622 0.0648  -0.0306 266 ARG B C     
4663 O  O     . ARG B 290 ? 0.5934 0.9277 0.5240 -0.1600 0.0197  -0.0560 266 ARG B O     
4664 C  CB    . ARG B 290 ? 0.9081 0.7930 1.0132 0.0366  0.0523  -0.0028 266 ARG B CB    
4665 C  CG    . ARG B 290 ? 0.8957 0.8097 1.2290 0.0358  0.0278  -0.0298 266 ARG B CG    
4666 C  CD    . ARG B 290 ? 0.9355 0.7297 1.2292 -0.0549 0.0196  -0.0021 266 ARG B CD    
4667 N  NE    . ARG B 290 ? 0.8735 0.7962 1.1521 -0.0738 -0.0292 -0.0248 266 ARG B NE    
4668 C  CZ    . ARG B 290 ? 0.9078 0.8645 0.9603 -0.0156 -0.1307 -0.0438 266 ARG B CZ    
4669 N  NH1   . ARG B 290 ? 1.0678 1.0251 0.8588 -0.1257 -0.1831 -0.1265 266 ARG B NH1   
4670 N  NH2   . ARG B 290 ? 0.8493 0.8854 1.0133 0.0090  -0.1458 -0.0926 266 ARG B NH2   
4671 N  N     . GLU B 291 ? 0.6256 0.9507 0.6906 -0.0558 0.0100  -0.0080 267 GLU B N     
4672 C  CA    . GLU B 291 ? 0.6487 0.9216 0.6413 -0.0708 0.0950  0.0179  267 GLU B CA    
4673 C  C     . GLU B 291 ? 0.5853 0.7675 0.5692 -0.0855 0.0261  0.0669  267 GLU B C     
4674 O  O     . GLU B 291 ? 0.6305 0.7457 0.4941 -0.1282 0.0902  0.1097  267 GLU B O     
4675 C  CB    . GLU B 291 ? 0.6977 0.9049 0.6828 -0.1073 0.0361  -0.0140 267 GLU B CB    
4676 C  CG    . GLU B 291 ? 0.8765 0.8517 0.6916 -0.1334 -0.0272 0.0072  267 GLU B CG    
4677 C  CD    . GLU B 291 ? 1.1314 0.8718 0.5261 -0.1346 -0.0693 0.1384  267 GLU B CD    
4678 O  OE1   . GLU B 291 ? 1.2317 0.9787 0.9196 -0.2308 -0.0446 0.1137  267 GLU B OE1   
4679 O  OE2   . GLU B 291 ? 1.2465 1.0934 0.1931 -0.0061 -0.0247 0.0854  267 GLU B OE2   
4680 N  N     . VAL B 292 ? 0.4776 0.7177 0.4057 -0.0519 -0.0187 -0.0124 268 VAL B N     
4681 C  CA    . VAL B 292 ? 0.4689 0.5990 0.3985 -0.0659 -0.0219 -0.0553 268 VAL B CA    
4682 C  C     . VAL B 292 ? 0.4715 0.5158 0.3384 -0.0799 -0.0111 -0.1265 268 VAL B C     
4683 O  O     . VAL B 292 ? 0.5654 0.6194 0.3783 -0.0666 -0.0374 -0.2167 268 VAL B O     
4684 C  CB    . VAL B 292 ? 0.3839 0.6527 0.3530 -0.0484 -0.0429 -0.0393 268 VAL B CB    
4685 C  CG1   . VAL B 292 ? 0.3317 0.6104 0.3236 0.0390  -0.0467 -0.1126 268 VAL B CG1   
4686 C  CG2   . VAL B 292 ? 0.3941 0.7131 0.1015 -0.1283 0.0135  -0.2254 268 VAL B CG2   
4687 N  N     . VAL B 293 ? 0.3966 0.5363 0.2073 -0.0938 -0.0195 -0.0721 269 VAL B N     
4688 C  CA    . VAL B 293 ? 0.3953 0.4898 0.2404 -0.0557 -0.0019 0.0245  269 VAL B CA    
4689 C  C     . VAL B 293 ? 0.3530 0.4118 0.1967 -0.0693 -0.0376 -0.0406 269 VAL B C     
4690 O  O     . VAL B 293 ? 0.3449 0.4535 0.1509 -0.0761 -0.0654 -0.0350 269 VAL B O     
4691 C  CB    . VAL B 293 ? 0.3643 0.4677 0.2495 -0.0645 -0.0355 0.0334  269 VAL B CB    
4692 C  CG1   . VAL B 293 ? 0.3784 0.4361 0.2404 -0.0562 -0.0460 0.0321  269 VAL B CG1   
4693 C  CG2   . VAL B 293 ? 0.3406 0.5480 0.3051 -0.0847 -0.0607 0.0739  269 VAL B CG2   
4694 N  N     . ASP B 294 ? 0.3334 0.4418 0.1698 -0.0607 -0.0787 0.0110  270 ASP B N     
4695 C  CA    . ASP B 294 ? 0.3250 0.3943 0.1342 -0.0388 -0.0644 -0.0463 270 ASP B CA    
4696 C  C     . ASP B 294 ? 0.3078 0.2997 0.1336 -0.0203 -0.0638 -0.0326 270 ASP B C     
4697 O  O     . ASP B 294 ? 0.3354 0.3092 0.1184 -0.0079 -0.0602 -0.0287 270 ASP B O     
4698 C  CB    . ASP B 294 ? 0.3467 0.3663 0.1517 -0.0372 -0.0538 -0.0185 270 ASP B CB    
4699 C  CG    . ASP B 294 ? 0.3388 0.3379 0.1862 -0.0107 -0.0379 -0.0218 270 ASP B CG    
4700 O  OD1   . ASP B 294 ? 0.3472 0.3722 0.1071 -0.0328 -0.1169 -0.0305 270 ASP B OD1   
4701 O  OD2   . ASP B 294 ? 0.4331 0.4469 0.1983 0.0552  0.0881  -0.0031 270 ASP B OD2   
4702 N  N     . THR B 295 ? 0.2228 0.3214 0.0978 -0.0016 -0.0461 -0.0422 271 THR B N     
4703 C  CA    . THR B 295 ? 0.2414 0.3440 0.1131 0.0259  -0.0630 -0.0214 271 THR B CA    
4704 C  C     . THR B 295 ? 0.2522 0.3044 0.1476 0.0045  -0.0357 -0.0279 271 THR B C     
4705 O  O     . THR B 295 ? 0.3014 0.3171 0.1600 0.0368  -0.0527 -0.0529 271 THR B O     
4706 C  CB    . THR B 295 ? 0.2732 0.3376 0.1707 0.0041  -0.0331 -0.0065 271 THR B CB    
4707 O  OG1   . THR B 295 ? 0.3141 0.3549 0.1921 -0.0195 -0.0442 -0.0297 271 THR B OG1   
4708 C  CG2   . THR B 295 ? 0.2862 0.4013 0.2136 0.0066  -0.0234 -0.0404 271 THR B CG2   
4709 N  N     . THR B 296 ? 0.2538 0.2755 0.0961 0.0045  -0.0336 -0.0001 272 THR B N     
4710 C  CA    . THR B 296 ? 0.2261 0.2751 0.1407 0.0014  -0.0336 -0.0197 272 THR B CA    
4711 C  C     . THR B 296 ? 0.2426 0.2532 0.1245 -0.0160 -0.0529 0.0085  272 THR B C     
4712 O  O     . THR B 296 ? 0.2615 0.2644 0.0901 -0.0266 -0.0648 -0.0036 272 THR B O     
4713 C  CB    . THR B 296 ? 0.2265 0.2546 0.1926 -0.0276 -0.0539 -0.0393 272 THR B CB    
4714 O  OG1   . THR B 296 ? 0.2551 0.2739 0.1284 -0.0173 -0.0627 -0.0450 272 THR B OG1   
4715 C  CG2   . THR B 296 ? 0.2390 0.3034 0.1658 -0.0080 -0.0646 -0.0607 272 THR B CG2   
4716 N  N     . GLY B 297 ? 0.1997 0.2662 0.1190 -0.0200 -0.0630 -0.0028 273 GLY B N     
4717 C  CA    . GLY B 297 ? 0.1973 0.2221 0.1443 -0.0099 -0.0219 -0.0054 273 GLY B CA    
4718 C  C     . GLY B 297 ? 0.2052 0.1930 0.0915 0.0235  -0.0515 0.0136  273 GLY B C     
4719 O  O     . GLY B 297 ? 0.2398 0.1970 0.0763 0.0272  -0.0916 0.0329  273 GLY B O     
4720 N  N     . ALA B 298 ? 0.1821 0.2550 0.0390 0.0343  -0.0452 0.0023  274 ALA B N     
4721 C  CA    . ALA B 298 ? 0.1864 0.2899 0.0879 0.0092  -0.0719 -0.0189 274 ALA B CA    
4722 C  C     . ALA B 298 ? 0.2212 0.2319 0.0876 0.0179  -0.0733 0.0191  274 ALA B C     
4723 O  O     . ALA B 298 ? 0.2557 0.2327 0.0814 0.0139  -0.1002 0.0173  274 ALA B O     
4724 C  CB    . ALA B 298 ? 0.2152 0.2801 0.0789 -0.0033 -0.0680 -0.0317 274 ALA B CB    
4725 N  N     . GLY B 299 ? 0.2571 0.2526 0.0784 0.0262  -0.0409 0.0240  275 GLY B N     
4726 C  CA    . GLY B 299 ? 0.2698 0.2720 0.0856 0.0542  -0.0726 -0.0017 275 GLY B CA    
4727 C  C     . GLY B 299 ? 0.1871 0.2080 0.1097 0.0100  -0.0422 0.0222  275 GLY B C     
4728 O  O     . GLY B 299 ? 0.1953 0.2207 0.1440 0.0214  -0.0389 -0.0202 275 GLY B O     
4729 N  N     . ASP B 300 ? 0.1639 0.2027 0.1918 0.0383  -0.0049 -0.0069 276 ASP B N     
4730 C  CA    . ASP B 300 ? 0.1425 0.2099 0.1405 0.0296  -0.0346 -0.0240 276 ASP B CA    
4731 C  C     . ASP B 300 ? 0.1912 0.2110 0.1135 0.0108  -0.0185 -0.0047 276 ASP B C     
4732 O  O     . ASP B 300 ? 0.2486 0.2310 0.0847 -0.0223 -0.0360 0.0103  276 ASP B O     
4733 C  CB    . ASP B 300 ? 0.1235 0.2359 0.1332 0.0284  -0.0241 -0.0263 276 ASP B CB    
4734 C  CG    . ASP B 300 ? 0.1717 0.2401 0.1604 0.0195  -0.0623 -0.0088 276 ASP B CG    
4735 O  OD1   . ASP B 300 ? 0.1968 0.2780 0.1593 0.0092  -0.0866 0.0070  276 ASP B OD1   
4736 O  OD2   . ASP B 300 ? 0.1944 0.3013 0.1114 0.0389  -0.0493 0.0006  276 ASP B OD2   
4737 N  N     . LEU B 301 ? 0.1433 0.2198 0.0875 0.0083  -0.0623 0.0329  277 LEU B N     
4738 C  CA    . LEU B 301 ? 0.1423 0.2309 0.1065 0.0058  -0.0526 0.0396  277 LEU B CA    
4739 C  C     . LEU B 301 ? 0.1329 0.2201 0.1059 -0.0040 -0.0437 0.0231  277 LEU B C     
4740 O  O     . LEU B 301 ? 0.2017 0.2105 0.0736 -0.0119 -0.0278 0.0076  277 LEU B O     
4741 C  CB    . LEU B 301 ? 0.1680 0.2044 0.1056 0.0014  -0.0058 0.0250  277 LEU B CB    
4742 C  CG    . LEU B 301 ? 0.1688 0.2166 0.0756 -0.0085 -0.0387 0.0301  277 LEU B CG    
4743 C  CD1   . LEU B 301 ? 0.2526 0.2297 0.1127 -0.0070 -0.0218 0.0100  277 LEU B CD1   
4744 C  CD2   . LEU B 301 ? 0.1793 0.2251 0.0409 -0.0215 -0.0390 0.0272  277 LEU B CD2   
4745 N  N     . PHE B 302 ? 0.1216 0.2483 0.1699 0.0070  -0.0580 0.0619  278 PHE B N     
4746 C  CA    . PHE B 302 ? 0.1340 0.2514 0.0873 0.0288  -0.0431 0.0088  278 PHE B CA    
4747 C  C     . PHE B 302 ? 0.1772 0.2303 0.0922 0.0079  -0.0493 0.0046  278 PHE B C     
4748 O  O     . PHE B 302 ? 0.2510 0.2173 0.0438 -0.0132 -0.0629 0.0173  278 PHE B O     
4749 C  CB    . PHE B 302 ? 0.1624 0.2306 0.0935 0.0005  -0.0665 -0.0105 278 PHE B CB    
4750 C  CG    . PHE B 302 ? 0.1542 0.2379 0.1117 0.0184  -0.0537 0.0256  278 PHE B CG    
4751 C  CD1   . PHE B 302 ? 0.1632 0.2496 0.1712 0.0171  -0.0380 0.0125  278 PHE B CD1   
4752 C  CD2   . PHE B 302 ? 0.1891 0.2566 0.1251 0.0126  -0.0484 0.0525  278 PHE B CD2   
4753 C  CE1   . PHE B 302 ? 0.1949 0.3257 0.1786 -0.0106 -0.0527 0.0590  278 PHE B CE1   
4754 C  CE2   . PHE B 302 ? 0.1688 0.3232 0.1329 -0.0039 -0.0508 0.0235  278 PHE B CE2   
4755 C  CZ    . PHE B 302 ? 0.1702 0.3381 0.1475 0.0061  -0.0596 0.0182  278 PHE B CZ    
4756 N  N     . ALA B 303 ? 0.1598 0.2360 0.0628 0.0092  -0.0698 0.0114  279 ALA B N     
4757 C  CA    . ALA B 303 ? 0.1805 0.1803 0.1235 -0.0004 -0.0336 -0.0254 279 ALA B CA    
4758 C  C     . ALA B 303 ? 0.2081 0.1770 0.0898 0.0145  -0.0668 0.0132  279 ALA B C     
4759 O  O     . ALA B 303 ? 0.2353 0.2422 0.0834 -0.0142 -0.0810 0.0061  279 ALA B O     
4760 C  CB    . ALA B 303 ? 0.1925 0.2456 0.0876 -0.0316 -0.0542 -0.0115 279 ALA B CB    
4761 N  N     . SER B 304 ? 0.1789 0.1795 0.0785 0.0180  -0.0461 0.0179  280 SER B N     
4762 C  CA    . SER B 304 ? 0.1794 0.1759 0.0755 0.0198  -0.0167 0.0429  280 SER B CA    
4763 C  C     . SER B 304 ? 0.1895 0.2400 0.1010 0.0258  -0.0610 0.0281  280 SER B C     
4764 O  O     . SER B 304 ? 0.2535 0.3067 0.0374 0.0233  -0.0498 0.0137  280 SER B O     
4765 C  CB    . SER B 304 ? 0.1730 0.2121 0.0854 0.0256  -0.0177 0.0557  280 SER B CB    
4766 O  OG    . SER B 304 ? 0.1953 0.2494 0.1055 -0.0046 -0.0631 0.0437  280 SER B OG    
4767 N  N     . GLY B 305 ? 0.1713 0.2716 0.0770 0.0334  -0.0654 0.0580  281 GLY B N     
4768 C  CA    . GLY B 305 ? 0.1992 0.2970 0.1104 -0.0054 -0.0308 0.0252  281 GLY B CA    
4769 C  C     . GLY B 305 ? 0.2303 0.2248 0.1347 -0.0312 -0.0608 0.0218  281 GLY B C     
4770 O  O     . GLY B 305 ? 0.2635 0.3300 0.0755 -0.0425 -0.1014 -0.0275 281 GLY B O     
4771 N  N     . PHE B 306 ? 0.2657 0.2583 0.1085 0.0086  -0.0448 0.0612  282 PHE B N     
4772 C  CA    . PHE B 306 ? 0.2446 0.2605 0.1243 -0.0096 -0.0761 0.0405  282 PHE B CA    
4773 C  C     . PHE B 306 ? 0.2334 0.2742 0.1798 -0.0043 -0.0640 0.0237  282 PHE B C     
4774 O  O     . PHE B 306 ? 0.2762 0.2387 0.1328 -0.0221 -0.0619 0.0562  282 PHE B O     
4775 C  CB    . PHE B 306 ? 0.2333 0.2375 0.0989 -0.0381 -0.0804 -0.0323 282 PHE B CB    
4776 C  CG    . PHE B 306 ? 0.2566 0.2531 0.1308 -0.0054 -0.0725 0.0107  282 PHE B CG    
4777 C  CD1   . PHE B 306 ? 0.2750 0.2690 0.1259 -0.0231 -0.0532 0.0412  282 PHE B CD1   
4778 C  CD2   . PHE B 306 ? 0.2378 0.3275 0.2031 -0.0058 -0.0881 -0.0222 282 PHE B CD2   
4779 C  CE1   . PHE B 306 ? 0.2651 0.2942 0.1196 -0.0620 -0.0901 0.0057  282 PHE B CE1   
4780 C  CE2   . PHE B 306 ? 0.2809 0.3271 0.1596 -0.0391 -0.0893 -0.0557 282 PHE B CE2   
4781 C  CZ    . PHE B 306 ? 0.2579 0.3358 0.1100 -0.0566 -0.1086 -0.0193 282 PHE B CZ    
4782 N  N     . LEU B 307 ? 0.2434 0.2772 0.1501 0.0033  -0.0845 0.0045  283 LEU B N     
4783 C  CA    . LEU B 307 ? 0.2189 0.1970 0.2099 0.0156  -0.0417 0.0303  283 LEU B CA    
4784 C  C     . LEU B 307 ? 0.2510 0.1966 0.1083 -0.0161 -0.0076 0.0191  283 LEU B C     
4785 O  O     . LEU B 307 ? 0.2516 0.2249 0.1484 -0.0597 -0.0549 -0.0088 283 LEU B O     
4786 C  CB    . LEU B 307 ? 0.2183 0.2662 0.2200 -0.0199 -0.0990 0.0193  283 LEU B CB    
4787 C  CG    . LEU B 307 ? 0.1704 0.2724 0.2046 -0.0114 -0.1085 0.0418  283 LEU B CG    
4788 C  CD1   . LEU B 307 ? 0.1824 0.3048 0.2331 -0.0261 -0.1721 0.0579  283 LEU B CD1   
4789 C  CD2   . LEU B 307 ? 0.2775 0.2423 0.2076 0.0081  -0.1038 0.0858  283 LEU B CD2   
4790 N  N     . TYR B 308 ? 0.2263 0.1952 0.1057 0.0344  -0.0780 0.0364  284 TYR B N     
4791 C  CA    . TYR B 308 ? 0.2245 0.2422 0.0984 -0.0285 -0.0359 0.0224  284 TYR B CA    
4792 C  C     . TYR B 308 ? 0.2103 0.2618 0.1296 0.0064  -0.0420 0.0323  284 TYR B C     
4793 O  O     . TYR B 308 ? 0.3170 0.2625 0.1743 -0.0292 -0.0227 0.0121  284 TYR B O     
4794 C  CB    . TYR B 308 ? 0.2649 0.2397 0.1375 0.0249  -0.0609 0.0940  284 TYR B CB    
4795 C  CG    . TYR B 308 ? 0.1960 0.2487 0.1814 -0.0178 -0.0445 0.0211  284 TYR B CG    
4796 C  CD1   . TYR B 308 ? 0.2592 0.2366 0.1893 0.0218  -0.0727 0.0835  284 TYR B CD1   
4797 C  CD2   . TYR B 308 ? 0.2198 0.3282 0.1461 -0.0323 -0.0159 0.0044  284 TYR B CD2   
4798 C  CE1   . TYR B 308 ? 0.2418 0.3014 0.2649 -0.0528 -0.0913 0.0638  284 TYR B CE1   
4799 C  CE2   . TYR B 308 ? 0.3535 0.3110 0.3238 -0.0229 -0.0342 0.0230  284 TYR B CE2   
4800 C  CZ    . TYR B 308 ? 0.2680 0.3529 0.2881 -0.0287 -0.0595 -0.0225 284 TYR B CZ    
4801 O  OH    . TYR B 308 ? 0.3223 0.3490 0.3333 -0.0204 -0.1081 -0.0369 284 TYR B OH    
4802 N  N     . GLY B 309 ? 0.2100 0.3121 0.0439 0.0186  -0.0331 0.0566  285 GLY B N     
4803 C  CA    . GLY B 309 ? 0.1968 0.3441 0.1692 0.0004  -0.0381 0.0395  285 GLY B CA    
4804 C  C     . GLY B 309 ? 0.2593 0.2866 0.1686 -0.0418 -0.0610 0.0208  285 GLY B C     
4805 O  O     . GLY B 309 ? 0.2492 0.3812 0.1296 -0.0608 -0.1519 0.0617  285 GLY B O     
4806 N  N     . TYR B 310 ? 0.2399 0.3119 0.1738 -0.0023 -0.0145 0.0503  286 TYR B N     
4807 C  CA    . TYR B 310 ? 0.2537 0.2857 0.1664 -0.0172 -0.0381 0.0345  286 TYR B CA    
4808 C  C     . TYR B 310 ? 0.2582 0.3051 0.1716 -0.0091 -0.0917 0.0275  286 TYR B C     
4809 O  O     . TYR B 310 ? 0.3358 0.3420 0.1773 -0.0590 -0.1573 0.0984  286 TYR B O     
4810 C  CB    . TYR B 310 ? 0.2963 0.2544 0.1242 -0.0058 0.0007  0.0326  286 TYR B CB    
4811 C  CG    . TYR B 310 ? 0.2515 0.2858 0.1338 -0.0198 -0.1167 0.0154  286 TYR B CG    
4812 C  CD1   . TYR B 310 ? 0.2911 0.3166 0.2087 0.0089  -0.1228 -0.0143 286 TYR B CD1   
4813 C  CD2   . TYR B 310 ? 0.2226 0.2975 0.1898 -0.0401 -0.1123 -0.0162 286 TYR B CD2   
4814 C  CE1   . TYR B 310 ? 0.2596 0.3938 0.2096 -0.0316 -0.1438 -0.0161 286 TYR B CE1   
4815 C  CE2   . TYR B 310 ? 0.2835 0.4231 0.2126 -0.0518 -0.0777 0.0243  286 TYR B CE2   
4816 C  CZ    . TYR B 310 ? 0.3039 0.4282 0.2056 -0.0482 -0.1268 -0.0258 286 TYR B CZ    
4817 O  OH    . TYR B 310 ? 0.3948 0.6107 0.1534 -0.1061 -0.1020 -0.0519 286 TYR B OH    
4818 N  N     . THR B 311 ? 0.2441 0.3055 0.0890 0.0002  -0.0737 0.0282  287 THR B N     
4819 C  CA    . THR B 311 ? 0.2324 0.2368 0.1413 -0.0134 -0.1073 0.0165  287 THR B CA    
4820 C  C     . THR B 311 ? 0.2696 0.2604 0.2028 -0.0515 -0.0977 -0.0273 287 THR B C     
4821 O  O     . THR B 311 ? 0.3869 0.2699 0.3452 -0.0489 -0.0892 -0.0809 287 THR B O     
4822 C  CB    . THR B 311 ? 0.2277 0.3006 0.2276 -0.0380 -0.1070 -0.0255 287 THR B CB    
4823 O  OG1   . THR B 311 ? 0.3033 0.3200 0.2352 0.0292  -0.1055 0.0201  287 THR B OG1   
4824 C  CG2   . THR B 311 ? 0.2527 0.3265 0.2325 -0.0557 -0.1034 -0.0013 287 THR B CG2   
4825 N  N     . GLN B 312 ? 0.2094 0.3212 0.2111 -0.0680 -0.0977 -0.0187 288 GLN B N     
4826 C  CA    . GLN B 312 ? 0.2575 0.3305 0.2813 -0.0745 -0.1106 -0.0039 288 GLN B CA    
4827 C  C     . GLN B 312 ? 0.2355 0.3568 0.3145 -0.0192 -0.0909 -0.0138 288 GLN B C     
4828 O  O     . GLN B 312 ? 0.3471 0.4050 0.4315 -0.0686 -0.0743 0.0043  288 GLN B O     
4829 C  CB    . GLN B 312 ? 0.2211 0.3814 0.2937 -0.0210 -0.0711 0.0007  288 GLN B CB    
4830 C  CG    . GLN B 312 ? 0.2189 0.3085 0.2789 -0.0660 -0.1157 -0.0554 288 GLN B CG    
4831 C  CD    . GLN B 312 ? 0.3254 0.3913 0.3990 0.0121  -0.0473 -0.0620 288 GLN B CD    
4832 O  OE1   . GLN B 312 ? 0.4012 0.6037 0.4143 0.0039  0.0695  -0.0659 288 GLN B OE1   
4833 N  NE2   . GLN B 312 ? 0.4108 0.3212 0.4709 0.0172  0.0268  -0.0261 288 GLN B NE2   
4834 N  N     . GLY B 313 ? 0.2838 0.3234 0.2706 0.0062  -0.0630 -0.0534 289 GLY B N     
4835 C  CA    . GLY B 313 ? 0.2379 0.4098 0.3359 0.0016  -0.0533 -0.0588 289 GLY B CA    
4836 C  C     . GLY B 313 ? 0.2455 0.3401 0.2744 -0.0347 -0.0494 -0.0709 289 GLY B C     
4837 O  O     . GLY B 313 ? 0.2842 0.4319 0.3531 -0.0631 -0.0997 -0.0663 289 GLY B O     
4838 N  N     . ARG B 314 ? 0.2729 0.3852 0.2452 -0.0553 -0.0228 -0.0536 290 ARG B N     
4839 C  CA    . ARG B 314 ? 0.2183 0.3880 0.2182 -0.0146 -0.0861 -0.0357 290 ARG B CA    
4840 C  C     . ARG B 314 ? 0.2531 0.3472 0.2348 -0.0420 -0.0384 -0.0167 290 ARG B C     
4841 O  O     . ARG B 314 ? 0.2381 0.3503 0.2659 -0.0260 -0.0331 -0.0020 290 ARG B O     
4842 C  CB    . ARG B 314 ? 0.2933 0.3732 0.1905 -0.0163 -0.0612 -0.0362 290 ARG B CB    
4843 C  CG    . ARG B 314 ? 0.3102 0.4096 0.2270 -0.0327 -0.0938 0.0326  290 ARG B CG    
4844 C  CD    . ARG B 314 ? 0.2749 0.3947 0.2737 -0.0072 -0.0612 0.0766  290 ARG B CD    
4845 N  NE    . ARG B 314 ? 0.3114 0.4868 0.2934 -0.0372 -0.0022 0.0975  290 ARG B NE    
4846 C  CZ    . ARG B 314 ? 0.2628 0.5036 0.2899 -0.0458 -0.0140 0.0750  290 ARG B CZ    
4847 N  NH1   . ARG B 314 ? 0.2353 0.5176 0.3607 -0.0554 -0.0006 0.0345  290 ARG B NH1   
4848 N  NH2   . ARG B 314 ? 0.4033 0.4476 0.1537 -0.0310 -0.0628 0.1831  290 ARG B NH2   
4849 N  N     . SER B 315 ? 0.2764 0.3462 0.2064 -0.0128 -0.0207 0.0085  291 SER B N     
4850 C  CA    . SER B 315 ? 0.2518 0.3130 0.2211 -0.0182 -0.0203 -0.0688 291 SER B CA    
4851 C  C     . SER B 315 ? 0.2139 0.3185 0.1913 -0.0242 -0.0474 -0.0016 291 SER B C     
4852 O  O     . SER B 315 ? 0.2202 0.3475 0.1178 -0.0205 -0.0149 0.0348  291 SER B O     
4853 C  CB    . SER B 315 ? 0.2883 0.3418 0.1584 -0.0719 0.0061  -0.0404 291 SER B CB    
4854 O  OG    . SER B 315 ? 0.2794 0.3978 0.1564 -0.0391 -0.1320 -0.0316 291 SER B OG    
4855 N  N     . LEU B 316 ? 0.2838 0.3023 0.1512 -0.0334 -0.0460 0.0001  292 LEU B N     
4856 C  CA    . LEU B 316 ? 0.2442 0.3015 0.2260 -0.0458 -0.0353 0.0131  292 LEU B CA    
4857 C  C     . LEU B 316 ? 0.2353 0.3166 0.2358 -0.0207 -0.0393 -0.0109 292 LEU B C     
4858 O  O     . LEU B 316 ? 0.2655 0.4220 0.2784 -0.0425 -0.0683 -0.0247 292 LEU B O     
4859 C  CB    . LEU B 316 ? 0.3189 0.3738 0.2181 -0.0335 -0.0530 0.0515  292 LEU B CB    
4860 C  CG    . LEU B 316 ? 0.3373 0.4215 0.2309 0.0133  -0.0500 0.0309  292 LEU B CG    
4861 C  CD1   . LEU B 316 ? 0.3455 0.4318 0.0609 -0.0289 -0.0717 -0.0041 292 LEU B CD1   
4862 C  CD2   . LEU B 316 ? 0.3514 0.4917 0.0756 -0.0163 -0.1279 0.0015  292 LEU B CD2   
4863 N  N     . GLU B 317 ? 0.2448 0.3538 0.1976 0.0026  -0.0349 0.0121  293 GLU B N     
4864 C  CA    . GLU B 317 ? 0.2223 0.3531 0.2000 0.0030  -0.0171 0.0268  293 GLU B CA    
4865 C  C     . GLU B 317 ? 0.2625 0.2862 0.2059 -0.0032 -0.0130 0.0167  293 GLU B C     
4866 O  O     . GLU B 317 ? 0.3239 0.3406 0.2347 -0.0298 -0.0395 -0.0066 293 GLU B O     
4867 C  CB    . GLU B 317 ? 0.2205 0.3603 0.2947 0.0284  -0.0247 -0.0252 293 GLU B CB    
4868 C  CG    . GLU B 317 ? 0.2335 0.4358 0.2909 -0.0050 -0.0076 -0.0412 293 GLU B CG    
4869 C  CD    . GLU B 317 ? 0.2534 0.4604 0.4424 -0.1114 -0.0449 -0.0430 293 GLU B CD    
4870 O  OE1   . GLU B 317 ? 0.2299 0.4986 0.5902 -0.0653 0.0431  0.1126  293 GLU B OE1   
4871 O  OE2   . GLU B 317 ? 0.3075 0.5605 0.5148 -0.0652 0.0096  -0.0667 293 GLU B OE2   
4872 N  N     . ASP B 318 ? 0.2955 0.2828 0.1971 0.0292  -0.0150 0.0305  294 ASP B N     
4873 C  CA    . ASP B 318 ? 0.2517 0.2806 0.1752 -0.0178 -0.0526 0.0335  294 ASP B CA    
4874 C  C     . ASP B 318 ? 0.2376 0.3059 0.1696 -0.0084 -0.0248 0.0258  294 ASP B C     
4875 O  O     . ASP B 318 ? 0.2102 0.3142 0.1953 -0.0230 -0.0379 0.0613  294 ASP B O     
4876 C  CB    . ASP B 318 ? 0.2834 0.2653 0.2602 -0.0104 -0.0999 0.0400  294 ASP B CB    
4877 C  CG    . ASP B 318 ? 0.3338 0.3425 0.3094 -0.0508 -0.0456 0.0531  294 ASP B CG    
4878 O  OD1   . ASP B 318 ? 0.2923 0.3581 0.4199 -0.0481 -0.0385 0.0154  294 ASP B OD1   
4879 O  OD2   . ASP B 318 ? 0.4442 0.4001 0.4072 -0.1134 -0.1262 0.0444  294 ASP B OD2   
4880 N  N     . CYS B 319 ? 0.2112 0.3488 0.2222 -0.0541 -0.0154 0.0252  295 CYS B N     
4881 C  CA    . CYS B 319 ? 0.2218 0.3254 0.1963 -0.0763 -0.0266 0.0496  295 CYS B CA    
4882 C  C     . CYS B 319 ? 0.2147 0.2681 0.1894 -0.0279 0.0062  0.0474  295 CYS B C     
4883 O  O     . CYS B 319 ? 0.1883 0.3256 0.3156 -0.0386 -0.0283 0.0115  295 CYS B O     
4884 C  CB    . CYS B 319 ? 0.2744 0.3265 0.1624 -0.0321 -0.0177 0.0186  295 CYS B CB    
4885 S  SG    . CYS B 319 ? 0.2911 0.3734 0.1348 -0.0367 -0.0516 -0.0008 295 CYS B SG    
4886 N  N     . GLY B 320 ? 0.2322 0.2824 0.1454 -0.0264 -0.0321 -0.0122 296 GLY B N     
4887 C  CA    . GLY B 320 ? 0.2780 0.2756 0.1578 -0.0161 -0.0299 -0.0042 296 GLY B CA    
4888 C  C     . GLY B 320 ? 0.2321 0.2907 0.1803 -0.0454 -0.0395 0.0223  296 GLY B C     
4889 O  O     . GLY B 320 ? 0.2656 0.3415 0.1397 -0.0158 -0.0728 0.0499  296 GLY B O     
4890 N  N     . LYS B 321 ? 0.2215 0.2865 0.2516 -0.0368 -0.0283 0.0043  297 LYS B N     
4891 C  CA    . LYS B 321 ? 0.2012 0.2691 0.2792 -0.0425 -0.0361 0.0128  297 LYS B CA    
4892 C  C     . LYS B 321 ? 0.2021 0.2733 0.1765 -0.0208 -0.0307 -0.0204 297 LYS B C     
4893 O  O     . LYS B 321 ? 0.1783 0.2970 0.1562 -0.0197 -0.0217 0.0221  297 LYS B O     
4894 C  CB    . LYS B 321 ? 0.1750 0.3034 0.3947 -0.0446 -0.0293 0.0748  297 LYS B CB    
4895 C  CG    . LYS B 321 ? 0.1812 0.3280 0.3557 -0.0395 -0.0591 0.0649  297 LYS B CG    
4896 C  CD    . LYS B 321 ? 0.2274 0.3365 0.4993 -0.0754 -0.0748 0.0912  297 LYS B CD    
4897 C  CE    . LYS B 321 ? 0.2883 0.4272 0.5579 -0.0286 -0.1266 0.1173  297 LYS B CE    
4898 N  NZ    . LYS B 321 ? 0.3611 0.5051 0.7236 -0.0978 -0.0926 0.0688  297 LYS B NZ    
4899 N  N     . LEU B 322 ? 0.1492 0.2799 0.1912 -0.0157 -0.0247 0.0106  298 LEU B N     
4900 C  CA    . LEU B 322 ? 0.1794 0.2265 0.1900 0.0013  -0.0107 0.0109  298 LEU B CA    
4901 C  C     . LEU B 322 ? 0.1964 0.1775 0.1690 -0.0002 -0.0071 0.0003  298 LEU B C     
4902 O  O     . LEU B 322 ? 0.1712 0.2626 0.2330 -0.0289 -0.0367 0.0017  298 LEU B O     
4903 C  CB    . LEU B 322 ? 0.2548 0.2182 0.1575 -0.0206 -0.0229 0.0081  298 LEU B CB    
4904 C  CG    . LEU B 322 ? 0.2772 0.2238 0.1564 -0.0374 -0.0008 0.0264  298 LEU B CG    
4905 C  CD1   . LEU B 322 ? 0.2632 0.2928 0.1801 -0.0160 -0.0613 -0.0253 298 LEU B CD1   
4906 C  CD2   . LEU B 322 ? 0.3210 0.2242 0.2864 -0.0135 -0.0544 0.0417  298 LEU B CD2   
4907 N  N     . GLY B 323 ? 0.1939 0.1667 0.1631 -0.0343 -0.0124 -0.0159 299 GLY B N     
4908 C  CA    . GLY B 323 ? 0.2163 0.1927 0.1508 -0.0429 -0.0557 -0.0036 299 GLY B CA    
4909 C  C     . GLY B 323 ? 0.1789 0.2067 0.1630 0.0122  -0.0287 -0.0008 299 GLY B C     
4910 O  O     . GLY B 323 ? 0.2208 0.2769 0.1455 -0.0124 -0.0447 0.0115  299 GLY B O     
4911 N  N     . CYS B 324 ? 0.1746 0.2244 0.1294 0.0250  -0.0575 0.0137  300 CYS B N     
4912 C  CA    . CYS B 324 ? 0.1806 0.2825 0.1428 0.0369  -0.0459 -0.0024 300 CYS B CA    
4913 C  C     . CYS B 324 ? 0.2212 0.2491 0.1563 0.0015  -0.0413 0.0061  300 CYS B C     
4914 O  O     . CYS B 324 ? 0.2404 0.3160 0.1164 0.0045  -0.0243 0.0247  300 CYS B O     
4915 C  CB    . CYS B 324 ? 0.1978 0.3189 0.2271 0.0618  -0.0548 -0.0010 300 CYS B CB    
4916 S  SG    . CYS B 324 ? 0.3013 0.3436 0.2182 0.0141  -0.0839 0.0207  300 CYS B SG    
4917 N  N     . LEU B 325 ? 0.2180 0.2366 0.1500 0.0348  0.0064  0.0206  301 LEU B N     
4918 C  CA    . LEU B 325 ? 0.2372 0.2463 0.1993 0.0169  -0.0466 0.0320  301 LEU B CA    
4919 C  C     . LEU B 325 ? 0.2126 0.3385 0.1489 0.0127  0.0032  0.0242  301 LEU B C     
4920 O  O     . LEU B 325 ? 0.2087 0.3674 0.1699 -0.0248 -0.0437 -0.0332 301 LEU B O     
4921 C  CB    . LEU B 325 ? 0.2444 0.2716 0.1949 -0.0549 -0.0076 0.0369  301 LEU B CB    
4922 C  CG    . LEU B 325 ? 0.3131 0.2268 0.2070 -0.0052 0.0064  -0.0020 301 LEU B CG    
4923 C  CD1   . LEU B 325 ? 0.3022 0.3841 0.1985 -0.0175 0.0257  0.0595  301 LEU B CD1   
4924 C  CD2   . LEU B 325 ? 0.2658 0.2803 0.2127 -0.0263 -0.0524 -0.0095 301 LEU B CD2   
4925 N  N     . ALA B 326 ? 0.1653 0.2848 0.1798 0.0055  0.0068  -0.0141 302 ALA B N     
4926 C  CA    . ALA B 326 ? 0.1681 0.2937 0.1693 -0.0020 0.0040  0.0065  302 ALA B CA    
4927 C  C     . ALA B 326 ? 0.1881 0.2511 0.1489 0.0264  -0.0269 0.0369  302 ALA B C     
4928 O  O     . ALA B 326 ? 0.2138 0.2876 0.0735 -0.0003 0.0004  0.0255  302 ALA B O     
4929 C  CB    . ALA B 326 ? 0.1906 0.2934 0.2052 0.0055  0.0372  -0.0032 302 ALA B CB    
4930 N  N     . ALA B 327 ? 0.2276 0.2179 0.0832 -0.0119 -0.0267 0.0352  303 ALA B N     
4931 C  CA    . ALA B 327 ? 0.2641 0.2298 0.1699 -0.0142 -0.0287 0.0106  303 ALA B CA    
4932 C  C     . ALA B 327 ? 0.2056 0.2837 0.1620 -0.0326 -0.0440 0.0148  303 ALA B C     
4933 O  O     . ALA B 327 ? 0.2476 0.2828 0.0866 -0.0179 -0.0413 0.0213  303 ALA B O     
4934 C  CB    . ALA B 327 ? 0.2557 0.2278 0.1321 -0.0173 -0.1055 -0.0344 303 ALA B CB    
4935 N  N     . GLY B 328 ? 0.2215 0.3263 0.1687 0.0039  0.0260  0.0227  304 GLY B N     
4936 C  CA    . GLY B 328 ? 0.2469 0.3122 0.1091 0.0171  -0.0421 0.0225  304 GLY B CA    
4937 C  C     . GLY B 328 ? 0.2251 0.2662 0.1361 0.0013  -0.0374 0.0271  304 GLY B C     
4938 O  O     . GLY B 328 ? 0.2718 0.4029 0.1510 0.0004  -0.0554 -0.0222 304 GLY B O     
4939 N  N     . ILE B 329 ? 0.2116 0.2408 0.1440 -0.0099 -0.0152 0.0711  305 ILE B N     
4940 C  CA    . ILE B 329 ? 0.2426 0.2287 0.1872 0.0241  -0.0390 0.0370  305 ILE B CA    
4941 C  C     . ILE B 329 ? 0.2428 0.2805 0.1497 0.0166  -0.0341 0.0420  305 ILE B C     
4942 O  O     . ILE B 329 ? 0.3397 0.3062 0.1373 0.0081  -0.0454 0.0347  305 ILE B O     
4943 C  CB    . ILE B 329 ? 0.2441 0.2341 0.1085 0.0108  -0.0232 0.0522  305 ILE B CB    
4944 C  CG1   . ILE B 329 ? 0.2948 0.2612 0.1707 -0.0401 -0.0081 0.0264  305 ILE B CG1   
4945 C  CG2   . ILE B 329 ? 0.2686 0.2300 0.1946 0.0383  -0.0359 0.0281  305 ILE B CG2   
4946 C  CD1   . ILE B 329 ? 0.2901 0.2802 0.1782 -0.0156 0.0034  -0.0021 305 ILE B CD1   
4947 N  N     . VAL B 330 ? 0.2128 0.2901 0.1164 -0.0012 -0.0575 0.0303  306 VAL B N     
4948 C  CA    . VAL B 330 ? 0.2153 0.2829 0.1501 -0.0103 -0.0224 0.0299  306 VAL B CA    
4949 C  C     . VAL B 330 ? 0.2248 0.3001 0.1790 0.0002  -0.0022 0.0035  306 VAL B C     
4950 O  O     . VAL B 330 ? 0.2792 0.3732 0.1782 -0.0053 -0.0474 0.0340  306 VAL B O     
4951 C  CB    . VAL B 330 ? 0.2086 0.2990 0.1729 -0.0151 -0.0041 0.0117  306 VAL B CB    
4952 C  CG1   . VAL B 330 ? 0.2134 0.3072 0.0942 -0.0161 -0.0450 0.0223  306 VAL B CG1   
4953 C  CG2   . VAL B 330 ? 0.2081 0.3398 0.1195 -0.0211 0.0150  -0.0016 306 VAL B CG2   
4954 N  N     . ILE B 331 ? 0.2935 0.2699 0.1432 0.0394  -0.0282 0.0434  307 ILE B N     
4955 C  CA    . ILE B 331 ? 0.2878 0.2939 0.1151 -0.0126 -0.0362 0.0342  307 ILE B CA    
4956 C  C     . ILE B 331 ? 0.3283 0.3217 0.1235 -0.0115 0.0036  0.0194  307 ILE B C     
4957 O  O     . ILE B 331 ? 0.3794 0.3508 0.1297 -0.0475 -0.0447 0.0121  307 ILE B O     
4958 C  CB    . ILE B 331 ? 0.2970 0.2903 0.0929 0.0042  -0.0304 -0.0135 307 ILE B CB    
4959 C  CG1   . ILE B 331 ? 0.3113 0.3187 0.0879 0.0268  -0.0044 -0.0084 307 ILE B CG1   
4960 C  CG2   . ILE B 331 ? 0.3251 0.2934 0.1219 0.0224  0.0201  0.0282  307 ILE B CG2   
4961 C  CD1   . ILE B 331 ? 0.3592 0.2816 0.2758 0.0203  0.0354  -0.0068 307 ILE B CD1   
4962 N  N     . GLN B 332 ? 0.3129 0.3507 0.1460 -0.0157 0.0138  0.0572  308 GLN B N     
4963 C  CA    . GLN B 332 ? 0.3370 0.3873 0.1478 -0.0177 -0.0251 0.0839  308 GLN B CA    
4964 C  C     . GLN B 332 ? 0.3081 0.3966 0.1480 -0.0400 -0.0255 0.0745  308 GLN B C     
4965 O  O     . GLN B 332 ? 0.3620 0.5011 0.1379 0.0063  -0.1096 0.1270  308 GLN B O     
4966 C  CB    . GLN B 332 ? 0.3372 0.4527 0.1500 -0.0438 -0.0435 0.0941  308 GLN B CB    
4967 C  CG    . GLN B 332 ? 0.3130 0.4785 0.3035 -0.0436 -0.0335 0.0079  308 GLN B CG    
4968 C  CD    . GLN B 332 ? 0.3607 0.5708 0.2992 -0.1224 -0.0733 0.0149  308 GLN B CD    
4969 O  OE1   . GLN B 332 ? 0.4975 0.6955 0.2734 -0.1603 -0.0634 -0.0121 308 GLN B OE1   
4970 N  NE2   . GLN B 332 ? 0.4012 0.5639 0.3391 -0.1379 -0.0956 -0.0422 308 GLN B NE2   
4971 N  N     . GLN B 333 ? 0.2738 0.4088 0.1501 -0.0146 -0.0364 0.0177  309 GLN B N     
4972 C  CA    . GLN B 333 ? 0.3166 0.4128 0.1840 -0.0019 -0.0656 0.0830  309 GLN B CA    
4973 C  C     . GLN B 333 ? 0.2979 0.3632 0.1960 0.0122  -0.0796 0.0857  309 GLN B C     
4974 O  O     . GLN B 333 ? 0.3304 0.4281 0.1139 -0.0070 -0.0751 0.0861  309 GLN B O     
4975 C  CB    . GLN B 333 ? 0.3083 0.4218 0.2029 -0.0222 -0.1230 0.0477  309 GLN B CB    
4976 C  CG    . GLN B 333 ? 0.3342 0.3892 0.2099 -0.0047 0.0258  0.0414  309 GLN B CG    
4977 C  CD    . GLN B 333 ? 0.3256 0.3799 0.1857 -0.0278 -0.0062 0.0003  309 GLN B CD    
4978 O  OE1   . GLN B 333 ? 0.3653 0.4000 0.1591 -0.0375 -0.0991 -0.0149 309 GLN B OE1   
4979 N  NE2   . GLN B 333 ? 0.3325 0.3816 0.1293 -0.0208 -0.0107 -0.0094 309 GLN B NE2   
4980 N  N     . ILE B 334 ? 0.2916 0.5248 0.0978 -0.0624 -0.0973 0.0142  310 ILE B N     
4981 C  CA    . ILE B 334 ? 0.2955 0.5175 0.1524 -0.0810 -0.0916 0.0071  310 ILE B CA    
4982 C  C     . ILE B 334 ? 0.3528 0.4603 0.2202 -0.0603 -0.0623 0.0239  310 ILE B C     
4983 O  O     . ILE B 334 ? 0.3944 0.4583 0.2044 -0.0796 -0.1237 0.0412  310 ILE B O     
4984 C  CB    . ILE B 334 ? 0.3100 0.6176 0.2097 -0.0566 -0.1386 -0.0786 310 ILE B CB    
4985 C  CG1   . ILE B 334 ? 0.3111 0.6383 0.2280 -0.0070 -0.1716 -0.1153 310 ILE B CG1   
4986 C  CG2   . ILE B 334 ? 0.3891 0.6318 0.2728 -0.0941 -0.1137 -0.0478 310 ILE B CG2   
4987 C  CD1   . ILE B 334 ? 0.1986 0.6751 0.2495 0.0493  -0.1826 -0.1940 310 ILE B CD1   
4988 N  N     . GLY B 335 ? 0.3213 0.5981 0.1528 -0.0568 -0.0882 0.0464  311 GLY B N     
4989 C  CA    . GLY B 335 ? 0.3143 0.6410 0.2101 -0.0178 -0.0839 0.0072  311 GLY B CA    
4990 C  C     . GLY B 335 ? 0.2652 0.5199 0.1661 -0.0206 -0.0356 0.0757  311 GLY B C     
4991 O  O     . GLY B 335 ? 0.2674 0.5289 0.0898 0.0258  -0.0583 0.0408  311 GLY B O     
4992 N  N     . PRO B 336 ? 0.2026 0.4366 0.1668 -0.0063 -0.0397 0.0240  312 PRO B N     
4993 C  CA    . PRO B 336 ? 0.2443 0.3247 0.1454 -0.0137 -0.0328 0.0177  312 PRO B CA    
4994 C  C     . PRO B 336 ? 0.2333 0.3020 0.1708 -0.0096 -0.0383 0.0329  312 PRO B C     
4995 O  O     . PRO B 336 ? 0.2642 0.3470 0.1558 -0.0183 -0.0428 0.0164  312 PRO B O     
4996 C  CB    . PRO B 336 ? 0.2539 0.3153 0.1063 -0.0193 -0.0209 -0.0129 312 PRO B CB    
4997 C  CG    . PRO B 336 ? 0.2755 0.3022 0.1534 -0.0141 -0.0276 -0.0030 312 PRO B CG    
4998 C  CD    . PRO B 336 ? 0.2103 0.3916 0.1698 -0.0254 -0.0404 0.0427  312 PRO B CD    
4999 N  N     . ARG B 337 ? 0.2776 0.3192 0.1046 -0.0271 -0.0520 0.0569  313 ARG B N     
5000 C  CA    . ARG B 337 ? 0.2974 0.3010 0.2070 -0.0224 -0.0044 0.0543  313 ARG B CA    
5001 C  C     . ARG B 337 ? 0.2433 0.3698 0.2492 -0.0302 -0.0147 0.0815  313 ARG B C     
5002 O  O     . ARG B 337 ? 0.2916 0.4241 0.2468 -0.0316 -0.0496 0.0623  313 ARG B O     
5003 C  CB    . ARG B 337 ? 0.2708 0.3176 0.0934 -0.0204 -0.0536 0.0586  313 ARG B CB    
5004 C  CG    . ARG B 337 ? 0.2674 0.3176 0.0623 -0.0363 -0.0485 0.0258  313 ARG B CG    
5005 C  CD    . ARG B 337 ? 0.2356 0.2904 0.1846 -0.0180 -0.0488 0.0184  313 ARG B CD    
5006 N  NE    . ARG B 337 ? 0.1823 0.2544 0.0855 -0.0278 -0.0802 -0.0472 313 ARG B NE    
5007 C  CZ    . ARG B 337 ? 0.1905 0.1901 0.0710 -0.0258 -0.0700 -0.0398 313 ARG B CZ    
5008 N  NH1   . ARG B 337 ? 0.2028 0.2148 0.1464 -0.0060 -0.0793 0.0171  313 ARG B NH1   
5009 N  NH2   . ARG B 337 ? 0.2303 0.1992 0.0665 -0.0248 -0.0912 0.0012  313 ARG B NH2   
5010 N  N     . PRO B 338 ? 0.2493 0.3446 0.2853 -0.0472 -0.0327 0.0459  314 PRO B N     
5011 C  CA    . PRO B 338 ? 0.2270 0.3361 0.2561 -0.0246 -0.0120 0.0224  314 PRO B CA    
5012 C  C     . PRO B 338 ? 0.2924 0.3441 0.2126 -0.0213 -0.0343 0.0518  314 PRO B C     
5013 O  O     . PRO B 338 ? 0.3916 0.4140 0.2229 0.0620  -0.0219 0.0447  314 PRO B O     
5014 C  CB    . PRO B 338 ? 0.2623 0.3634 0.2369 -0.0260 -0.0404 0.0355  314 PRO B CB    
5015 C  CG    . PRO B 338 ? 0.2724 0.3402 0.2954 -0.0702 -0.0025 0.0393  314 PRO B CG    
5016 C  CD    . PRO B 338 ? 0.2449 0.3942 0.2676 -0.0595 -0.0300 0.0378  314 PRO B CD    
5017 N  N     . MSE B 339 ? 0.3319 0.3436 0.2160 0.0006  -0.0431 0.0640  315 MSE B N     
5018 C  CA    . MSE B 339 ? 0.3403 0.3423 0.2196 -0.0134 -0.0562 0.0839  315 MSE B CA    
5019 C  C     . MSE B 339 ? 0.3638 0.3474 0.2487 -0.0405 -0.1322 0.0757  315 MSE B C     
5020 O  O     . MSE B 339 ? 0.4780 0.3916 0.2469 -0.0523 -0.2030 0.0967  315 MSE B O     
5021 C  CB    . MSE B 339 ? 0.3497 0.4348 0.2618 0.0104  -0.2177 0.1853  315 MSE B CB    
5022 C  CG    . MSE B 339 ? 0.4505 0.4767 0.4794 -0.0214 -0.1231 0.2552  315 MSE B CG    
5023 SE SE    . MSE B 339 ? 0.8400 1.1194 0.6443 -0.0063 -0.2579 0.1661  315 MSE B SE    
5024 C  CE    . MSE B 339 ? 0.5203 0.8022 0.2451 -0.1734 -0.3035 0.2615  315 MSE B CE    
5025 N  N     . THR B 340 ? 0.3616 0.3897 0.1136 -0.0090 -0.0830 0.0790  316 THR B N     
5026 C  CA    . THR B 340 ? 0.4249 0.3981 0.1116 -0.0349 -0.0389 0.1416  316 THR B CA    
5027 C  C     . THR B 340 ? 0.3477 0.3756 0.2256 -0.0289 -0.0830 0.0247  316 THR B C     
5028 O  O     . THR B 340 ? 0.3174 0.4055 0.2384 -0.0208 -0.0822 0.0569  316 THR B O     
5029 C  CB    . THR B 340 ? 0.4796 0.4622 0.1770 -0.0215 0.0032  0.0700  316 THR B CB    
5030 O  OG1   . THR B 340 ? 0.4703 0.5650 0.0374 0.0116  -0.0500 0.0580  316 THR B OG1   
5031 C  CG2   . THR B 340 ? 0.5353 0.4833 0.1569 -0.0751 0.0305  0.1136  316 THR B CG2   
5032 N  N     . SER B 341 ? 0.4203 0.2600 0.3250 0.0027  -0.0168 -0.0321 317 SER B N     
5033 C  CA    . SER B 341 ? 0.3890 0.2437 0.2924 0.0089  -0.0122 -0.0001 317 SER B CA    
5034 C  C     . SER B 341 ? 0.2913 0.3019 0.2348 -0.0487 -0.0012 0.0309  317 SER B C     
5035 O  O     . SER B 341 ? 0.3385 0.3512 0.2835 -0.0535 0.0682  -0.0337 317 SER B O     
5036 C  CB    . SER B 341 ? 0.3715 0.2267 0.2338 0.0308  0.0305  -0.0182 317 SER B CB    
5037 O  OG    . SER B 341 ? 0.3573 0.2847 0.2999 0.0641  -0.0575 -0.0210 317 SER B OG    
5038 N  N     . LEU B 342 ? 0.2921 0.3580 0.1787 -0.0509 -0.0221 -0.0003 318 LEU B N     
5039 C  CA    . LEU B 342 ? 0.2682 0.2799 0.1985 -0.0664 -0.0015 0.0529  318 LEU B CA    
5040 C  C     . LEU B 342 ? 0.2918 0.2678 0.1797 -0.0501 -0.0273 0.0704  318 LEU B C     
5041 O  O     . LEU B 342 ? 0.2925 0.2908 0.2042 -0.0253 -0.0822 0.0837  318 LEU B O     
5042 C  CB    . LEU B 342 ? 0.2627 0.2405 0.2612 -0.0691 -0.0139 0.0788  318 LEU B CB    
5043 C  CG    . LEU B 342 ? 0.2537 0.2217 0.2502 -0.0358 0.0271  0.0010  318 LEU B CG    
5044 C  CD1   . LEU B 342 ? 0.2575 0.2614 0.2407 -0.0600 0.0009  0.0123  318 LEU B CD1   
5045 C  CD2   . LEU B 342 ? 0.2508 0.2372 0.2589 0.0283  -0.0095 0.0080  318 LEU B CD2   
5046 N  N     . SER B 343 ? 0.3481 0.2862 0.1177 -0.0141 -0.0175 0.0890  319 SER B N     
5047 C  CA    . SER B 343 ? 0.3590 0.2860 0.1733 -0.0321 -0.0181 0.0669  319 SER B CA    
5048 C  C     . SER B 343 ? 0.2943 0.3430 0.2079 -0.0240 -0.0168 0.0298  319 SER B C     
5049 O  O     . SER B 343 ? 0.3092 0.3400 0.2161 -0.0270 -0.0447 -0.0053 319 SER B O     
5050 C  CB    . SER B 343 ? 0.3287 0.3699 0.1449 0.0108  -0.0019 0.0666  319 SER B CB    
5051 O  OG    . SER B 343 ? 0.4759 0.3409 0.1709 0.0591  0.0138  0.0714  319 SER B OG    
5052 N  N     . GLU B 344 ? 0.3131 0.3681 0.2019 -0.0156 -0.0190 0.0435  320 GLU B N     
5053 C  CA    . GLU B 344 ? 0.3366 0.3793 0.2585 0.0077  0.0326  0.0199  320 GLU B CA    
5054 C  C     . GLU B 344 ? 0.2970 0.3062 0.2681 -0.0191 -0.0191 0.0483  320 GLU B C     
5055 O  O     . GLU B 344 ? 0.3068 0.3624 0.3402 -0.0610 -0.0269 0.0832  320 GLU B O     
5056 C  CB    . GLU B 344 ? 0.3935 0.3183 0.3261 0.0130  -0.0235 0.0367  320 GLU B CB    
5057 C  CG    . GLU B 344 ? 0.4404 0.3627 0.4065 0.0644  -0.0283 0.0396  320 GLU B CG    
5058 C  CD    . GLU B 344 ? 0.5179 0.4153 0.4933 0.0144  0.0160  -0.0517 320 GLU B CD    
5059 O  OE1   . GLU B 344 ? 0.5316 0.5831 0.6279 -0.0372 0.0622  -0.0238 320 GLU B OE1   
5060 O  OE2   . GLU B 344 ? 0.7272 0.5416 0.3604 -0.0099 -0.1030 -0.1315 320 GLU B OE2   
5061 N  N     . ALA B 345 ? 0.3251 0.2621 0.1606 0.0129  -0.0223 0.0547  321 ALA B N     
5062 C  CA    . ALA B 345 ? 0.2793 0.2220 0.2246 -0.0290 -0.0414 0.0730  321 ALA B CA    
5063 C  C     . ALA B 345 ? 0.2990 0.3123 0.1909 -0.0107 -0.0352 0.0378  321 ALA B C     
5064 O  O     . ALA B 345 ? 0.3091 0.3049 0.1176 0.0074  -0.0630 0.0273  321 ALA B O     
5065 C  CB    . ALA B 345 ? 0.2892 0.2391 0.2393 -0.0319 -0.0591 0.0436  321 ALA B CB    
5066 N  N     . ALA B 346 ? 0.3498 0.2768 0.1849 -0.0151 -0.0313 0.0709  322 ALA B N     
5067 C  CA    . ALA B 346 ? 0.2725 0.3067 0.2359 -0.0281 -0.0362 0.0292  322 ALA B CA    
5068 C  C     . ALA B 346 ? 0.2652 0.2572 0.2877 -0.0095 -0.0399 0.0451  322 ALA B C     
5069 O  O     . ALA B 346 ? 0.2305 0.3463 0.3227 -0.0046 -0.0232 0.0540  322 ALA B O     
5070 C  CB    . ALA B 346 ? 0.3571 0.2413 0.1620 -0.0393 -0.0622 0.1008  322 ALA B CB    
5071 N  N     . LYS B 347 ? 0.3345 0.2804 0.1428 -0.0347 -0.0358 0.0871  323 LYS B N     
5072 C  CA    . LYS B 347 ? 0.3354 0.3193 0.1859 -0.0526 -0.0164 0.0793  323 LYS B CA    
5073 C  C     . LYS B 347 ? 0.2623 0.3151 0.2829 -0.0694 -0.0104 0.0478  323 LYS B C     
5074 O  O     . LYS B 347 ? 0.2248 0.4456 0.3457 -0.0138 -0.0038 0.0314  323 LYS B O     
5075 C  CB    . LYS B 347 ? 0.3533 0.3478 0.3221 -0.0094 -0.0138 0.0442  323 LYS B CB    
5076 C  CG    . LYS B 347 ? 0.4153 0.3744 0.2697 -0.0035 -0.0068 0.0563  323 LYS B CG    
5077 C  CD    . LYS B 347 ? 0.4893 0.4094 0.3431 0.0645  -0.0372 0.0221  323 LYS B CD    
5078 C  CE    . LYS B 347 ? 0.5379 0.4492 0.4026 0.1325  0.0018  0.0527  323 LYS B CE    
5079 N  NZ    . LYS B 347 ? 0.6449 0.6241 0.1166 0.1618  -0.0339 0.1504  323 LYS B NZ    
5080 N  N     . GLN B 348 ? 0.2953 0.3553 0.2724 -0.0306 -0.0144 0.0527  324 GLN B N     
5081 C  CA    . GLN B 348 ? 0.3161 0.3788 0.3114 -0.0275 0.0031  0.0178  324 GLN B CA    
5082 C  C     . GLN B 348 ? 0.2578 0.3493 0.2663 -0.0743 -0.0209 0.0563  324 GLN B C     
5083 O  O     . GLN B 348 ? 0.2961 0.3953 0.2580 -0.0398 -0.0002 0.0739  324 GLN B O     
5084 C  CB    . GLN B 348 ? 0.3326 0.4620 0.3167 -0.0573 -0.0018 -0.0023 324 GLN B CB    
5085 C  CG    . GLN B 348 ? 0.3253 0.4892 0.3698 -0.0220 0.0356  0.0347  324 GLN B CG    
5086 C  CD    . GLN B 348 ? 0.4005 0.6380 0.4087 -0.0636 -0.0022 -0.0083 324 GLN B CD    
5087 O  OE1   . GLN B 348 ? 0.4338 0.7151 0.3801 -0.0462 -0.0255 0.1448  324 GLN B OE1   
5088 N  NE2   . GLN B 348 ? 0.4785 0.5844 0.6238 -0.1556 -0.0209 0.0084  324 GLN B NE2   
5089 N  N     . ALA B 349 ? 0.2982 0.3141 0.1553 -0.0140 -0.0774 0.0570  325 ALA B N     
5090 C  CA    . ALA B 349 ? 0.3023 0.3143 0.2358 -0.0041 -0.0308 0.0606  325 ALA B CA    
5091 C  C     . ALA B 349 ? 0.3551 0.3466 0.2644 0.0103  -0.0642 0.0423  325 ALA B C     
5092 O  O     . ALA B 349 ? 0.3161 0.3865 0.3270 0.0124  -0.0644 0.0686  325 ALA B O     
5093 C  CB    . ALA B 349 ? 0.3206 0.3075 0.2420 0.0013  -0.0790 0.0882  325 ALA B CB    
5094 N  N     . GLY B 350 ? 0.3503 0.3763 0.2859 -0.0329 -0.0738 -0.0026 326 GLY B N     
5095 C  CA    . GLY B 350 ? 0.3687 0.4087 0.2485 -0.0099 -0.0692 -0.0095 326 GLY B CA    
5096 C  C     . GLY B 350 ? 0.3453 0.4263 0.2537 -0.0343 -0.0955 0.0250  326 GLY B C     
5097 O  O     . GLY B 350 ? 0.3959 0.5776 0.1487 0.0382  -0.0444 0.0091  326 GLY B O     
5098 N  N     . LEU B 351 ? 0.3395 0.3625 0.2345 -0.0118 -0.1672 0.0337  327 LEU B N     
5099 C  CA    . LEU B 351 ? 0.3714 0.4241 0.2988 -0.0340 -0.1021 0.0071  327 LEU B CA    
5100 C  C     . LEU B 351 ? 0.4135 0.3919 0.3768 -0.0730 -0.0378 -0.0025 327 LEU B C     
5101 O  O     . LEU B 351 ? 0.5975 0.5087 0.4125 -0.0581 -0.0182 0.0110  327 LEU B O     
5102 C  CB    . LEU B 351 ? 0.4518 0.3455 0.2625 0.0340  -0.1394 -0.0634 327 LEU B CB    
5103 C  CG    . LEU B 351 ? 0.3440 0.3097 0.3670 0.0034  -0.0791 -0.0491 327 LEU B CG    
5104 C  CD1   . LEU B 351 ? 0.3147 0.3554 0.3496 -0.0112 -0.0153 -0.0769 327 LEU B CD1   
5105 C  CD2   . LEU B 351 ? 0.3818 0.2715 0.3686 0.0437  -0.0585 0.0273  327 LEU B CD2   
5106 N  N     . ILE B 352 ? 0.5077 0.3035 0.4132 -0.1529 0.0175  0.0472  328 ILE B N     
5107 C  CA    . ILE B 352 ? 0.5756 0.4192 0.4628 -0.0742 0.0124  0.0102  328 ILE B CA    
5108 C  C     . ILE B 352 ? 0.5894 0.5261 0.4313 -0.1114 0.0030  0.0758  328 ILE B C     
5109 O  O     . ILE B 352 ? 0.7251 0.5874 0.4427 -0.0413 0.1159  0.2527  328 ILE B O     
5110 C  CB    . ILE B 352 ? 0.5442 0.4560 0.5864 -0.1002 -0.0069 0.0110  328 ILE B CB    
5111 C  CG1   . ILE B 352 ? 0.6167 0.3605 0.5052 -0.1254 0.0546  0.2142  328 ILE B CG1   
5112 C  CG2   . ILE B 352 ? 0.5210 0.3197 0.6564 -0.1717 -0.0230 0.0827  328 ILE B CG2   
5113 C  CD1   . ILE B 352 ? 0.7841 0.3442 0.5079 -0.0448 0.0104  0.2392  328 ILE B CD1   
5114 O  "O5'" . ADN C .   ? 0.2929 0.3067 0.1377 0.0085  -0.0479 0.0341  401 ADN A "O5'" 
5115 C  "C5'" . ADN C .   ? 0.2728 0.2561 0.1191 -0.0229 -0.0398 -0.0017 401 ADN A "C5'" 
5116 C  "C4'" . ADN C .   ? 0.2291 0.2321 0.0948 -0.0112 -0.0770 -0.0105 401 ADN A "C4'" 
5117 O  "O4'" . ADN C .   ? 0.2340 0.2445 0.0691 -0.0207 -0.0720 0.0206  401 ADN A "O4'" 
5118 C  "C3'" . ADN C .   ? 0.2323 0.1756 0.1061 -0.0061 -0.0668 0.0168  401 ADN A "C3'" 
5119 O  "O3'" . ADN C .   ? 0.2227 0.1721 0.0825 0.0075  -0.1062 -0.0053 401 ADN A "O3'" 
5120 C  "C2'" . ADN C .   ? 0.2005 0.2440 0.1109 -0.0084 -0.0656 0.0143  401 ADN A "C2'" 
5121 O  "O2'" . ADN C .   ? 0.2518 0.2542 0.0619 -0.0071 -0.0837 0.0386  401 ADN A "O2'" 
5122 C  "C1'" . ADN C .   ? 0.1969 0.2283 0.0915 -0.0033 -0.0537 0.0040  401 ADN A "C1'" 
5123 N  N9    . ADN C .   ? 0.2038 0.2150 0.1411 -0.0086 -0.0690 0.0338  401 ADN A N9    
5124 C  C8    . ADN C .   ? 0.2118 0.2612 0.0829 -0.0004 -0.1025 0.0171  401 ADN A C8    
5125 N  N7    . ADN C .   ? 0.2133 0.2543 0.1332 -0.0080 -0.0716 -0.0004 401 ADN A N7    
5126 C  C5    . ADN C .   ? 0.1978 0.2563 0.1479 -0.0088 -0.0644 -0.0015 401 ADN A C5    
5127 C  C6    . ADN C .   ? 0.2014 0.2277 0.1352 -0.0100 -0.0731 -0.0234 401 ADN A C6    
5128 N  N6    . ADN C .   ? 0.2256 0.2080 0.0984 -0.0024 -0.1001 -0.0148 401 ADN A N6    
5129 N  N1    . ADN C .   ? 0.2265 0.2017 0.1238 -0.0128 -0.0559 -0.0219 401 ADN A N1    
5130 C  C2    . ADN C .   ? 0.1732 0.1966 0.1084 -0.0096 -0.0555 -0.0022 401 ADN A C2    
5131 N  N3    . ADN C .   ? 0.1766 0.2051 0.1253 -0.0297 -0.0778 0.0113  401 ADN A N3    
5132 C  C4    . ADN C .   ? 0.2007 0.2327 0.1237 -0.0259 -0.0743 -0.0134 401 ADN A C4    
5133 O  O8    . E34 D .   ? 0.3467 0.5454 0.1583 0.0091  -0.0587 -0.0400 402 E34 A O8    
5134 C  C4    . E34 D .   ? 0.1643 0.4500 0.1512 -0.0153 -0.0086 -0.0401 402 E34 A C4    
5135 O  O7    . E34 D .   ? 0.1680 0.4311 0.1722 -0.0123 -0.0047 -0.0229 402 E34 A O7    
5136 C  C11   . E34 D .   ? 0.1815 0.3180 0.2026 0.0126  -0.0018 -0.0315 402 E34 A C11   
5137 C  C13   . E34 D .   ? 0.2969 0.2910 0.2696 0.0177  -0.0385 0.0245  402 E34 A C13   
5138 C  C1    . E34 D .   ? 0.1597 0.4125 0.1522 0.0110  -0.0008 0.0005  402 E34 A C1    
5139 C  C3    . E34 D .   ? 0.1449 0.4059 0.1870 0.0268  -0.0277 0.0110  402 E34 A C3    
5140 C  C6    . E34 D .   ? 0.1338 0.4084 0.2014 -0.0212 0.0261  -0.0006 402 E34 A C6    
5141 C  C9    . E34 D .   ? 0.1334 0.4254 0.1680 0.0055  0.0012  0.0264  402 E34 A C9    
5142 N  N12   . E34 D .   ? 0.1491 0.4504 0.2564 -0.0206 -0.0242 -0.0072 402 E34 A N12   
5143 C  C5    . E34 D .   ? 0.1486 0.4326 0.1592 -0.0073 -0.0127 0.0030  402 E34 A C5    
5144 N  N10   . E34 D .   ? 0.2864 0.4659 0.1778 -0.0458 0.0592  -0.0314 402 E34 A N10   
5145 C  C2    . E34 D .   ? 0.1358 0.4341 0.1864 0.0139  0.0266  -0.0029 402 E34 A C2    
5146 S  S     . DMS E .   ? 0.3440 0.4688 0.2297 0.0184  -0.1507 -0.0285 403 DMS A S     
5147 O  O     . DMS E .   ? 0.2987 0.3656 0.2652 0.0402  -0.1460 -0.0321 403 DMS A O     
5148 C  C1    . DMS E .   ? 0.3946 0.4640 0.1928 0.0699  -0.1128 -0.0799 403 DMS A C1    
5149 C  C2    . DMS E .   ? 0.4399 0.4969 0.2236 0.0208  -0.1034 0.0017  403 DMS A C2    
5150 K  K     . K   F .   ? 0.5405 0.6826 0.4261 0.1211  -0.1917 -0.0883 404 K   A K     
5151 O  "O5'" . ADN G .   ? 0.2176 0.2929 0.1777 0.0199  -0.0796 -0.0008 401 ADN B "O5'" 
5152 C  "C5'" . ADN G .   ? 0.1700 0.2731 0.1554 -0.0015 -0.0617 -0.0240 401 ADN B "C5'" 
5153 C  "C4'" . ADN G .   ? 0.1789 0.2508 0.0909 0.0069  -0.0578 0.0015  401 ADN B "C4'" 
5154 O  "O4'" . ADN G .   ? 0.2073 0.2622 0.0627 0.0191  -0.0796 0.0160  401 ADN B "O4'" 
5155 C  "C3'" . ADN G .   ? 0.2068 0.2165 0.0678 0.0058  -0.0630 -0.0142 401 ADN B "C3'" 
5156 O  "O3'" . ADN G .   ? 0.2468 0.2156 0.0489 0.0056  -0.0718 0.0055  401 ADN B "O3'" 
5157 C  "C2'" . ADN G .   ? 0.2166 0.2513 0.0868 0.0217  -0.0570 0.0128  401 ADN B "C2'" 
5158 O  "O2'" . ADN G .   ? 0.2442 0.2385 0.0640 0.0293  -0.0723 -0.0153 401 ADN B "O2'" 
5159 C  "C1'" . ADN G .   ? 0.2001 0.2495 0.1062 0.0091  -0.0621 0.0455  401 ADN B "C1'" 
5160 N  N9    . ADN G .   ? 0.2330 0.2334 0.1076 0.0154  -0.0481 0.0482  401 ADN B N9    
5161 C  C8    . ADN G .   ? 0.2276 0.2557 0.0566 0.0154  -0.0653 0.0434  401 ADN B C8    
5162 N  N7    . ADN G .   ? 0.2281 0.2243 0.1264 -0.0187 -0.0487 0.0192  401 ADN B N7    
5163 C  C5    . ADN G .   ? 0.2432 0.2456 0.1193 -0.0114 -0.0341 0.0219  401 ADN B C5    
5164 C  C6    . ADN G .   ? 0.2266 0.2062 0.1004 -0.0188 -0.0565 0.0000  401 ADN B C6    
5165 N  N6    . ADN G .   ? 0.2359 0.1914 0.0613 -0.0066 -0.0449 -0.0075 401 ADN B N6    
5166 N  N1    . ADN G .   ? 0.1827 0.1908 0.0981 0.0021  -0.0530 -0.0007 401 ADN B N1    
5167 C  C2    . ADN G .   ? 0.2033 0.1992 0.0832 0.0018  -0.0406 0.0356  401 ADN B C2    
5168 N  N3    . ADN G .   ? 0.2230 0.2299 0.0850 0.0334  -0.0250 0.0348  401 ADN B N3    
5169 C  C4    . ADN G .   ? 0.2258 0.2288 0.1072 0.0013  -0.0396 0.0241  401 ADN B C4    
5170 S  S     . DMS H .   ? 0.4849 0.4649 0.2426 -0.0315 -0.0757 -0.0374 402 DMS B S     
5171 O  O     . DMS H .   ? 0.4266 0.3570 0.2504 0.0469  -0.0790 -0.0814 402 DMS B O     
5172 C  C1    . DMS H .   ? 0.4584 0.4453 0.0961 -0.0359 -0.1534 -0.0701 402 DMS B C1    
5173 C  C2    . DMS H .   ? 0.4509 0.3867 0.3237 -0.0334 -0.0589 -0.0366 402 DMS B C2    
5174 S  S     . DMS I .   ? 0.6237 0.6820 0.4864 0.0027  -0.2525 -0.0163 403 DMS B S     
5175 O  O     . DMS I .   ? 0.6484 0.8376 0.5423 -0.1295 -0.3118 -0.0073 403 DMS B O     
5176 C  C1    . DMS I .   ? 0.3709 0.6568 0.3661 -0.0744 -0.3146 0.1594  403 DMS B C1    
5177 C  C2    . DMS I .   ? 0.6447 0.5378 0.5477 -0.0240 -0.2640 0.0194  403 DMS B C2    
5178 K  K     . K   J .   ? 0.6516 0.6410 0.3442 -0.0571 -0.0581 -0.0583 404 K   B K     
5179 O  O     . HOH K .   ? 0.4044 0.2609 0.1893 -0.0789 -0.2489 0.0402  501 HOH A O     
5180 O  O     . HOH K .   ? 0.2339 0.3550 0.1559 0.0250  -0.0977 -0.0176 502 HOH A O     
5181 O  O     . HOH K .   ? 0.3705 0.2427 0.0735 0.0817  -0.1289 -0.0274 503 HOH A O     
5182 O  O     . HOH K .   ? 0.2854 0.3488 0.2051 0.0681  -0.1267 0.0137  504 HOH A O     
5183 O  O     . HOH K .   ? 0.4335 0.4991 0.0536 0.2820  -0.0912 -0.0160 505 HOH A O     
5184 O  O     . HOH K .   ? 0.2474 0.2889 0.1464 0.0233  -0.0122 0.0272  506 HOH A O     
5185 O  O     . HOH K .   ? 0.4149 0.3774 0.1306 0.0155  -0.2021 -0.0211 507 HOH A O     
5186 O  O     . HOH K .   ? 0.3138 0.3307 0.1025 0.0330  -0.1202 -0.0957 508 HOH A O     
5187 O  O     . HOH K .   ? 0.5066 0.4844 0.2625 0.2215  0.0859  0.0980  509 HOH A O     
5188 O  O     . HOH K .   ? 0.5187 0.3315 0.2212 -0.0040 -0.3108 -0.0028 510 HOH A O     
5189 O  O     . HOH K .   ? 0.3878 0.3982 0.2759 0.0010  -0.1141 0.0058  511 HOH A O     
5190 O  O     . HOH K .   ? 0.6030 0.5653 0.0474 0.0337  0.0776  0.0486  512 HOH A O     
5191 O  O     . HOH K .   ? 0.3373 0.6915 0.0480 -0.0151 0.0323  0.1121  513 HOH A O     
5192 O  O     . HOH K .   ? 0.4430 0.3757 0.0679 0.0277  -0.0501 -0.0371 514 HOH A O     
5193 O  O     . HOH K .   ? 0.3811 0.4849 0.2925 -0.0121 -0.1006 -0.0830 515 HOH A O     
5194 O  O     . HOH K .   ? 0.3922 0.3390 0.1817 0.0128  -0.0494 0.0528  516 HOH A O     
5195 O  O     . HOH K .   ? 0.6191 0.2643 0.1783 -0.0370 -0.1814 -0.0076 517 HOH A O     
5196 O  O     . HOH K .   ? 0.2398 0.4499 0.1753 0.0211  -0.1669 0.0755  518 HOH A O     
5197 O  O     . HOH K .   ? 0.4315 0.3286 0.0682 -0.0284 -0.1318 0.0050  519 HOH A O     
5198 O  O     . HOH K .   ? 0.4321 0.6760 0.3185 0.0227  -0.1669 0.0141  520 HOH A O     
5199 O  O     . HOH K .   ? 0.3665 0.2411 0.1663 0.0287  -0.1431 0.0231  521 HOH A O     
5200 O  O     . HOH K .   ? 0.2854 0.3662 0.2478 -0.0381 -0.1588 -0.0842 522 HOH A O     
5201 O  O     . HOH K .   ? 0.4241 0.3486 0.2245 -0.0809 -0.1435 0.1124  523 HOH A O     
5202 O  O     . HOH K .   ? 0.3623 0.4057 0.1916 0.0908  -0.2068 -0.0445 524 HOH A O     
5203 O  O     . HOH K .   ? 0.3133 0.3013 0.1566 0.0359  -0.1651 0.0791  525 HOH A O     
5204 O  O     . HOH K .   ? 0.4326 0.3151 0.1505 0.0750  -0.0620 -0.0448 526 HOH A O     
5205 O  O     . HOH K .   ? 1.0858 0.2742 0.0795 -0.0421 -0.1400 -0.0180 527 HOH A O     
5206 O  O     . HOH K .   ? 0.5496 0.2770 0.3327 -0.1138 0.0267  -0.0229 528 HOH A O     
5207 O  O     . HOH K .   ? 0.3636 0.3712 0.0425 0.0800  -0.0507 0.0440  529 HOH A O     
5208 O  O     . HOH K .   ? 0.2987 0.3649 0.1474 0.0304  -0.0823 -0.0438 530 HOH A O     
5209 O  O     . HOH K .   ? 0.2446 0.5773 0.1727 -0.0133 -0.0126 -0.0997 531 HOH A O     
5210 O  O     . HOH K .   ? 0.4672 0.6119 0.1350 -0.0094 -0.1028 -0.1031 532 HOH A O     
5211 O  O     . HOH K .   ? 0.3640 0.3427 0.1850 -0.0633 -0.1136 -0.0299 533 HOH A O     
5212 O  O     . HOH K .   ? 0.3929 0.4062 0.3921 0.0058  -0.1664 0.0640  534 HOH A O     
5213 O  O     . HOH K .   ? 0.4158 0.7963 0.5434 0.0609  -0.2458 0.1328  535 HOH A O     
5214 O  O     . HOH K .   ? 0.4694 0.4156 0.2970 0.0619  0.0062  0.0481  536 HOH A O     
5215 O  O     . HOH K .   ? 0.5486 0.9928 0.4227 0.0036  -0.1188 0.0393  537 HOH A O     
5216 O  O     . HOH K .   ? 0.4385 0.4775 0.3658 0.1746  -0.0684 -0.1419 538 HOH A O     
5217 O  O     . HOH K .   ? 1.0299 0.3408 0.0981 -0.0883 0.0712  -0.0330 539 HOH A O     
5218 O  O     . HOH K .   ? 0.3941 0.3195 0.2687 0.0670  -0.0503 0.0074  540 HOH A O     
5219 O  O     . HOH K .   ? 0.4870 0.5865 0.1111 0.0274  0.0498  -0.1756 541 HOH A O     
5220 O  O     . HOH K .   ? 0.4833 0.4577 0.0494 0.0550  -0.0751 0.0618  542 HOH A O     
5221 O  O     . HOH K .   ? 0.4860 0.3085 0.3956 0.0119  -0.0135 0.0577  543 HOH A O     
5222 O  O     . HOH K .   ? 0.4913 0.4545 0.2234 0.0579  -0.0722 0.0313  544 HOH A O     
5223 O  O     . HOH K .   ? 0.5055 0.4139 0.3724 0.0979  -0.0666 -0.1264 545 HOH A O     
5224 O  O     . HOH K .   ? 0.6572 0.3133 0.2126 0.0160  -0.3361 0.0408  546 HOH A O     
5225 O  O     . HOH K .   ? 0.4145 0.6492 0.2824 -0.0816 -0.1013 -0.1442 547 HOH A O     
5226 O  O     . HOH K .   ? 0.6427 0.3931 0.2117 0.0616  0.0578  -0.0321 548 HOH A O     
5227 O  O     . HOH K .   ? 0.4353 0.5016 0.1958 0.0152  -0.1775 0.0515  549 HOH A O     
5228 O  O     . HOH K .   ? 0.4027 0.7262 0.2539 -0.0289 -0.2017 0.1068  550 HOH A O     
5229 O  O     . HOH K .   ? 0.5800 0.4420 0.1608 0.0812  -0.2112 0.1183  551 HOH A O     
5230 O  O     . HOH K .   ? 0.5129 0.6078 0.2155 0.0950  0.0229  0.1118  552 HOH A O     
5231 O  O     . HOH K .   ? 0.6237 0.5641 0.0895 0.0156  -0.0097 -0.0340 553 HOH A O     
5232 O  O     . HOH K .   ? 0.5329 0.3807 0.2923 0.1159  -0.1059 0.1244  554 HOH A O     
5233 O  O     . HOH K .   ? 0.4295 0.3867 0.2514 0.0589  -0.0760 -0.0707 555 HOH A O     
5234 O  O     . HOH K .   ? 0.3856 0.4339 0.3514 0.0637  -0.0930 -0.0635 556 HOH A O     
5235 O  O     . HOH K .   ? 0.6300 0.4204 0.2349 0.1326  -0.0033 -0.0057 557 HOH A O     
5236 O  O     . HOH K .   ? 0.8093 0.5109 0.1842 0.0143  -0.1951 0.0953  558 HOH A O     
5237 O  O     . HOH K .   ? 0.4353 0.6971 0.1901 -0.0283 -0.0135 -0.1652 559 HOH A O     
5238 O  O     . HOH K .   ? 0.6196 0.7096 0.4079 -0.0458 0.0285  -0.0245 560 HOH A O     
5239 O  O     . HOH K .   ? 0.3888 0.7772 0.0847 -0.0124 -0.1197 0.0016  561 HOH A O     
5240 O  O     . HOH K .   ? 0.2868 0.6593 0.2719 0.0670  -0.0263 0.2505  562 HOH A O     
5241 O  O     . HOH K .   ? 0.6732 0.2216 0.4066 0.0113  0.0838  0.0183  563 HOH A O     
5242 O  O     . HOH K .   ? 0.7704 0.3389 0.2460 0.0708  0.0097  0.1713  564 HOH A O     
5243 O  O     . HOH K .   ? 0.4419 0.4174 0.2503 -0.0433 -0.1423 -0.0181 565 HOH A O     
5244 O  O     . HOH K .   ? 0.4864 0.4201 0.1256 0.0096  -0.0901 -0.0496 566 HOH A O     
5245 O  O     . HOH K .   ? 0.6159 0.6100 0.1120 0.0708  -0.0999 0.0436  567 HOH A O     
5246 O  O     . HOH K .   ? 0.2267 0.4774 0.4280 0.0371  -0.1557 -0.0778 568 HOH A O     
5247 O  O     . HOH K .   ? 0.8070 0.6145 0.2166 -0.0528 -0.2175 0.0867  569 HOH A O     
5248 O  O     . HOH K .   ? 0.4883 0.4725 0.4401 -0.0163 -0.0490 0.2203  570 HOH A O     
5249 O  O     . HOH K .   ? 0.5081 0.2371 0.1806 0.0391  -0.2677 -0.0595 571 HOH A O     
5250 O  O     . HOH K .   ? 0.4417 0.2924 0.3803 -0.1427 -0.3583 0.2236  572 HOH A O     
5251 O  O     . HOH K .   ? 0.7354 0.5506 0.1060 -0.0514 -0.0725 -0.1903 573 HOH A O     
5252 O  O     . HOH K .   ? 0.3300 0.4725 0.4309 0.0312  -0.0652 0.0528  574 HOH A O     
5253 O  O     . HOH K .   ? 0.3372 0.2811 0.2627 -0.0331 0.0083  0.0313  575 HOH A O     
5254 O  O     . HOH K .   ? 0.7349 0.6124 0.1361 0.0455  -0.2425 0.1119  576 HOH A O     
5255 O  O     . HOH K .   ? 0.5165 0.4095 0.1477 -0.0746 -0.0320 -0.0711 577 HOH A O     
5256 O  O     . HOH K .   ? 0.5076 0.3818 0.4778 0.0917  -0.2034 0.0812  578 HOH A O     
5257 O  O     . HOH K .   ? 0.7385 0.7182 0.1071 -0.0516 0.0592  -0.1670 579 HOH A O     
5258 O  O     . HOH K .   ? 0.5612 0.2259 0.6940 0.1465  0.0845  -0.0506 580 HOH A O     
5259 O  O     . HOH K .   ? 0.4811 0.6877 0.4161 0.0887  -0.2248 0.1021  581 HOH A O     
5260 O  O     . HOH K .   ? 0.5587 0.4106 0.3687 0.0546  0.1227  -0.0284 582 HOH A O     
5261 O  O     . HOH K .   ? 0.7892 0.5701 0.2554 0.1215  -0.2550 0.0850  583 HOH A O     
5262 O  O     . HOH K .   ? 0.5185 0.5575 0.3117 0.0850  -0.1909 0.1571  584 HOH A O     
5263 O  O     . HOH K .   ? 0.8441 0.6324 0.0974 0.0630  -0.2429 -0.0227 585 HOH A O     
5264 O  O     . HOH K .   ? 0.5448 0.8044 0.1591 -0.0540 -0.1632 0.2697  586 HOH A O     
5265 O  O     . HOH K .   ? 0.4410 0.5614 0.2480 0.2291  -0.1353 0.1751  587 HOH A O     
5266 O  O     . HOH K .   ? 0.4033 0.6502 0.1995 -0.0669 -0.0766 -0.0272 588 HOH A O     
5267 O  O     . HOH K .   ? 0.4271 0.4951 0.1178 0.0515  0.0418  0.0284  589 HOH A O     
5268 O  O     . HOH K .   ? 0.3351 0.4470 0.1905 0.0349  -0.0381 0.1953  590 HOH A O     
5269 O  O     . HOH K .   ? 0.3789 0.4500 0.0296 -0.0604 -0.0343 -0.0137 591 HOH A O     
5270 O  O     . HOH K .   ? 0.6753 0.6129 0.6179 -0.0699 -0.0094 -0.0555 592 HOH A O     
5271 O  O     . HOH K .   ? 0.6709 0.6386 0.1320 0.3104  0.0935  -0.0685 593 HOH A O     
5272 O  O     . HOH K .   ? 0.4926 0.6365 0.0672 0.0881  -0.1395 -0.0381 594 HOH A O     
5273 O  O     . HOH K .   ? 0.6921 0.8190 0.0275 -0.0358 -0.0237 -0.0318 595 HOH A O     
5274 O  O     . HOH K .   ? 0.7349 0.5279 0.4640 -0.1022 -0.5077 0.1162  596 HOH A O     
5275 O  O     . HOH K .   ? 1.3281 1.2744 1.1661 0.6411  -0.5694 -0.6432 597 HOH A O     
5276 O  O     . HOH K .   ? 0.5715 0.8017 0.4197 -0.2271 -0.2888 0.2422  598 HOH A O     
5277 O  O     . HOH K .   ? 0.6698 0.4650 0.2401 0.0549  -0.1444 -0.0015 599 HOH A O     
5278 O  O     . HOH K .   ? 0.5224 0.3568 0.2979 -0.0410 -0.0107 -0.0264 600 HOH A O     
5279 O  O     . HOH K .   ? 0.8904 0.9733 0.1260 0.1501  -0.1197 -0.2993 601 HOH A O     
5280 O  O     . HOH K .   ? 0.3662 0.3274 0.4872 -0.0872 -0.0741 0.0033  602 HOH A O     
5281 O  O     . HOH K .   ? 0.8062 0.5967 0.1735 0.0353  -0.3392 -0.0366 603 HOH A O     
5282 O  O     . HOH K .   ? 0.4641 0.5949 0.3006 -0.0349 0.1237  0.1052  604 HOH A O     
5283 O  O     . HOH K .   ? 0.3780 0.4950 0.2161 0.0723  -0.0734 0.0704  605 HOH A O     
5284 O  O     . HOH K .   ? 0.5670 0.7961 0.1187 0.1640  -0.1181 0.1744  606 HOH A O     
5285 O  O     . HOH K .   ? 0.5696 0.4662 0.4479 0.0478  -0.0480 0.0736  607 HOH A O     
5286 O  O     . HOH K .   ? 0.8395 0.6233 0.3674 0.0576  -0.0911 0.0819  608 HOH A O     
5287 O  O     . HOH K .   ? 0.4861 0.4150 0.1743 -0.0544 -0.1691 -0.1003 609 HOH A O     
5288 O  O     . HOH K .   ? 0.6130 0.7448 0.5450 0.2857  -0.3086 -0.0047 610 HOH A O     
5289 O  O     . HOH K .   ? 0.9392 0.3818 0.1205 0.1131  -0.1570 0.0487  611 HOH A O     
5290 O  O     . HOH K .   ? 0.5798 0.5913 0.0926 -0.1950 -0.0587 -0.0155 612 HOH A O     
5291 O  O     . HOH K .   ? 0.7328 0.5979 0.2661 0.0329  -0.1318 0.1341  613 HOH A O     
5292 O  O     . HOH K .   ? 0.4560 0.6501 0.5958 0.0223  0.0098  0.0577  614 HOH A O     
5293 O  O     . HOH K .   ? 0.4053 0.6142 0.3147 0.1291  -0.0813 0.0407  615 HOH A O     
5294 O  O     . HOH K .   ? 0.4573 0.6802 0.1416 -0.1032 -0.0737 -0.2062 616 HOH A O     
5295 O  O     . HOH K .   ? 0.7133 0.7426 0.1258 -0.2591 -0.1442 0.0510  617 HOH A O     
5296 O  O     . HOH K .   ? 0.4596 0.5384 0.3428 -0.1075 -0.1995 -0.0827 618 HOH A O     
5297 O  O     . HOH K .   ? 0.4719 0.6427 0.3411 0.0890  -0.3013 0.1989  619 HOH A O     
5298 O  O     . HOH K .   ? 0.5982 0.2905 0.2224 -0.0090 -0.2517 0.0278  620 HOH A O     
5299 O  O     . HOH K .   ? 0.7391 0.6993 0.1994 -0.0264 -0.1929 -0.2793 621 HOH A O     
5300 O  O     . HOH K .   ? 0.6028 0.4227 0.1166 0.0705  -0.2260 0.0058  622 HOH A O     
5301 O  O     . HOH K .   ? 0.6041 0.3144 0.2869 0.1505  -0.1605 -0.0187 623 HOH A O     
5302 O  O     . HOH K .   ? 0.6796 0.4533 0.2963 0.0047  -0.2168 0.0166  624 HOH A O     
5303 O  O     . HOH K .   ? 0.7163 0.4836 0.1444 -0.0954 -0.1133 -0.1958 625 HOH A O     
5304 O  O     . HOH K .   ? 0.6533 0.8572 0.2004 -0.0634 -0.1679 0.1398  626 HOH A O     
5305 O  O     . HOH K .   ? 0.5393 0.2788 0.1045 0.0029  -0.1588 -0.0190 627 HOH A O     
5306 O  O     . HOH K .   ? 0.4669 0.9815 0.2755 0.1745  -0.0571 0.2310  628 HOH A O     
5307 O  O     . HOH K .   ? 0.4466 0.3607 0.1093 -0.0094 -0.1579 0.0946  629 HOH A O     
5308 O  O     . HOH K .   ? 0.6045 0.5966 0.0393 -0.0772 0.0213  0.0832  630 HOH A O     
5309 O  O     . HOH K .   ? 0.5385 0.5384 0.2468 -0.0058 -0.1089 0.1582  631 HOH A O     
5310 O  O     . HOH K .   ? 0.3726 0.5009 0.9239 0.0888  0.1065  -0.0298 632 HOH A O     
5311 O  O     . HOH K .   ? 1.1