data_4KAL
# 
_entry.id   4KAL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4KAL         
RCSB  RCSB079099   
WWPDB D_1000079099 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB         4E3A          . unspecified 
PDB         4KAD          . unspecified 
PDB         4KAH          . unspecified 
PDB         4KAN          . unspecified 
PDB         4KBE          . unspecified 
TargetTrack NYSGRC-014306 . unspecified 
# 
_pdbx_database_status.entry_id                        4KAL 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-04-22 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Malashkevich, V.N.'                                        1  
'Bhosle, R.'                                                2  
'Toro, R.'                                                  3  
'Hillerich, B.'                                             4  
'Gizzi, A.'                                                 5  
'Garforth, S.'                                              6  
'Kar, A.'                                                   7  
'Chan, M.K.'                                                8  
'Lafluer, J.'                                               9  
'Patel, H.'                                                 10 
'Matikainen, B.'                                            11 
'Chamala, S.'                                               12 
'Lim, S.'                                                   13 
'Celikgil, A.'                                              14 
'Villegas, G.'                                              15 
'Evans, B.'                                                 16 
'Love, J.'                                                  17 
'Fiser, A.'                                                 18 
'Khafizov, K.'                                              19 
'Seidel, R.'                                                20 
'Bonanno, J.B.'                                             21 
'Almo, S.C.'                                                22 
'New York Structural Genomics Research Consortium (NYSGRC)' 23 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of probable sugar kinase protein from Rhizobium etli CFN 42 complexed with quinoline-3-carboxylic acid' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Malashkevich, V.N.' 1 
primary 'Bhosle, R.'         2 
primary 'Toro, R.'           3 
primary 'Seidel, R.'         4 
primary 'Almo, S.C.'         5 
# 
_cell.length_a           51.181 
_cell.length_b           81.219 
_cell.length_c           82.950 
_cell.angle_alpha        90.000 
_cell.angle_beta         98.170 
_cell.angle_gamma        90.000 
_cell.entry_id           4KAL 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         4KAL 
_symmetry.Int_Tables_number                4 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Probable sugar kinase protein' 38849.992 2   ? ? ? ? 
2 non-polymer syn ADENOSINE                       267.241   2   ? ? ? ? 
3 non-polymer syn 'quinoline-3-carboxylic acid'   173.168   2   ? ? ? ? 
4 non-polymer syn 'DIMETHYL SULFOXIDE'            78.133    4   ? ? ? ? 
5 non-polymer syn 'POTASSIUM ION'                 39.098    2   ? ? ? ? 
6 water       nat water                           18.015    552 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)HHHHHHSSGVDLGTENLYFQS(MSE)TRFDVLTVGNAIVDIISRCNDQFLIDNQITKAA(MSE)NLIDAERAELL
YSR(MSE)GPALEASGGSAGNTAAGVANLGGKAAYFGNVAADQLGDIFTHDIRAQGVHYQTKPKGAFPPTARS(MSE)IF
VTEDGERS(MSE)NTYLGACVELGPEDVEADVVADAKVTYFEGYLWDPPRAKEAILDCARIAHQHGRE(MSE)S(MSE)T
LSDSFCVDRYRGEFLDL(MSE)RSGKVDIVFANRQEALSLYQTDDFEEALNRIAADCKIAAVT(MSE)SENGAVILKGRE
RYYVNAIRIREVVDTTGAGDLFASGFLYGYTQGRSLEDCGKLGCLAAGIVIQQIGPRP(MSE)TSLSEAAKQAGLI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMTRFDVLTVGNAIVDIISRCNDQFLIDNQITKAAMNLIDAERAELLYSRMGPALEASG
GSAGNTAAGVANLGGKAAYFGNVAADQLGDIFTHDIRAQGVHYQTKPKGAFPPTARSMIFVTEDGERSMNTYLGACVELG
PEDVEADVVADAKVTYFEGYLWDPPRAKEAILDCARIAHQHGREMSMTLSDSFCVDRYRGEFLDLMRSGKVDIVFANRQE
ALSLYQTDDFEEALNRIAADCKIAAVTMSENGAVILKGRERYYVNAIRIREVVDTTGAGDLFASGFLYGYTQGRSLEDCG
KLGCLAAGIVIQQIGPRPMTSLSEAAKQAGLI
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         NYSGRC-014306 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MSE n 
1 24  THR n 
1 25  ARG n 
1 26  PHE n 
1 27  ASP n 
1 28  VAL n 
1 29  LEU n 
1 30  THR n 
1 31  VAL n 
1 32  GLY n 
1 33  ASN n 
1 34  ALA n 
1 35  ILE n 
1 36  VAL n 
1 37  ASP n 
1 38  ILE n 
1 39  ILE n 
1 40  SER n 
1 41  ARG n 
1 42  CYS n 
1 43  ASN n 
1 44  ASP n 
1 45  GLN n 
1 46  PHE n 
1 47  LEU n 
1 48  ILE n 
1 49  ASP n 
1 50  ASN n 
1 51  GLN n 
1 52  ILE n 
1 53  THR n 
1 54  LYS n 
1 55  ALA n 
1 56  ALA n 
1 57  MSE n 
1 58  ASN n 
1 59  LEU n 
1 60  ILE n 
1 61  ASP n 
1 62  ALA n 
1 63  GLU n 
1 64  ARG n 
1 65  ALA n 
1 66  GLU n 
1 67  LEU n 
1 68  LEU n 
1 69  TYR n 
1 70  SER n 
1 71  ARG n 
1 72  MSE n 
1 73  GLY n 
1 74  PRO n 
1 75  ALA n 
1 76  LEU n 
1 77  GLU n 
1 78  ALA n 
1 79  SER n 
1 80  GLY n 
1 81  GLY n 
1 82  SER n 
1 83  ALA n 
1 84  GLY n 
1 85  ASN n 
1 86  THR n 
1 87  ALA n 
1 88  ALA n 
1 89  GLY n 
1 90  VAL n 
1 91  ALA n 
1 92  ASN n 
1 93  LEU n 
1 94  GLY n 
1 95  GLY n 
1 96  LYS n 
1 97  ALA n 
1 98  ALA n 
1 99  TYR n 
1 100 PHE n 
1 101 GLY n 
1 102 ASN n 
1 103 VAL n 
1 104 ALA n 
1 105 ALA n 
1 106 ASP n 
1 107 GLN n 
1 108 LEU n 
1 109 GLY n 
1 110 ASP n 
1 111 ILE n 
1 112 PHE n 
1 113 THR n 
1 114 HIS n 
1 115 ASP n 
1 116 ILE n 
1 117 ARG n 
1 118 ALA n 
1 119 GLN n 
1 120 GLY n 
1 121 VAL n 
1 122 HIS n 
1 123 TYR n 
1 124 GLN n 
1 125 THR n 
1 126 LYS n 
1 127 PRO n 
1 128 LYS n 
1 129 GLY n 
1 130 ALA n 
1 131 PHE n 
1 132 PRO n 
1 133 PRO n 
1 134 THR n 
1 135 ALA n 
1 136 ARG n 
1 137 SER n 
1 138 MSE n 
1 139 ILE n 
1 140 PHE n 
1 141 VAL n 
1 142 THR n 
1 143 GLU n 
1 144 ASP n 
1 145 GLY n 
1 146 GLU n 
1 147 ARG n 
1 148 SER n 
1 149 MSE n 
1 150 ASN n 
1 151 THR n 
1 152 TYR n 
1 153 LEU n 
1 154 GLY n 
1 155 ALA n 
1 156 CYS n 
1 157 VAL n 
1 158 GLU n 
1 159 LEU n 
1 160 GLY n 
1 161 PRO n 
1 162 GLU n 
1 163 ASP n 
1 164 VAL n 
1 165 GLU n 
1 166 ALA n 
1 167 ASP n 
1 168 VAL n 
1 169 VAL n 
1 170 ALA n 
1 171 ASP n 
1 172 ALA n 
1 173 LYS n 
1 174 VAL n 
1 175 THR n 
1 176 TYR n 
1 177 PHE n 
1 178 GLU n 
1 179 GLY n 
1 180 TYR n 
1 181 LEU n 
1 182 TRP n 
1 183 ASP n 
1 184 PRO n 
1 185 PRO n 
1 186 ARG n 
1 187 ALA n 
1 188 LYS n 
1 189 GLU n 
1 190 ALA n 
1 191 ILE n 
1 192 LEU n 
1 193 ASP n 
1 194 CYS n 
1 195 ALA n 
1 196 ARG n 
1 197 ILE n 
1 198 ALA n 
1 199 HIS n 
1 200 GLN n 
1 201 HIS n 
1 202 GLY n 
1 203 ARG n 
1 204 GLU n 
1 205 MSE n 
1 206 SER n 
1 207 MSE n 
1 208 THR n 
1 209 LEU n 
1 210 SER n 
1 211 ASP n 
1 212 SER n 
1 213 PHE n 
1 214 CYS n 
1 215 VAL n 
1 216 ASP n 
1 217 ARG n 
1 218 TYR n 
1 219 ARG n 
1 220 GLY n 
1 221 GLU n 
1 222 PHE n 
1 223 LEU n 
1 224 ASP n 
1 225 LEU n 
1 226 MSE n 
1 227 ARG n 
1 228 SER n 
1 229 GLY n 
1 230 LYS n 
1 231 VAL n 
1 232 ASP n 
1 233 ILE n 
1 234 VAL n 
1 235 PHE n 
1 236 ALA n 
1 237 ASN n 
1 238 ARG n 
1 239 GLN n 
1 240 GLU n 
1 241 ALA n 
1 242 LEU n 
1 243 SER n 
1 244 LEU n 
1 245 TYR n 
1 246 GLN n 
1 247 THR n 
1 248 ASP n 
1 249 ASP n 
1 250 PHE n 
1 251 GLU n 
1 252 GLU n 
1 253 ALA n 
1 254 LEU n 
1 255 ASN n 
1 256 ARG n 
1 257 ILE n 
1 258 ALA n 
1 259 ALA n 
1 260 ASP n 
1 261 CYS n 
1 262 LYS n 
1 263 ILE n 
1 264 ALA n 
1 265 ALA n 
1 266 VAL n 
1 267 THR n 
1 268 MSE n 
1 269 SER n 
1 270 GLU n 
1 271 ASN n 
1 272 GLY n 
1 273 ALA n 
1 274 VAL n 
1 275 ILE n 
1 276 LEU n 
1 277 LYS n 
1 278 GLY n 
1 279 ARG n 
1 280 GLU n 
1 281 ARG n 
1 282 TYR n 
1 283 TYR n 
1 284 VAL n 
1 285 ASN n 
1 286 ALA n 
1 287 ILE n 
1 288 ARG n 
1 289 ILE n 
1 290 ARG n 
1 291 GLU n 
1 292 VAL n 
1 293 VAL n 
1 294 ASP n 
1 295 THR n 
1 296 THR n 
1 297 GLY n 
1 298 ALA n 
1 299 GLY n 
1 300 ASP n 
1 301 LEU n 
1 302 PHE n 
1 303 ALA n 
1 304 SER n 
1 305 GLY n 
1 306 PHE n 
1 307 LEU n 
1 308 TYR n 
1 309 GLY n 
1 310 TYR n 
1 311 THR n 
1 312 GLN n 
1 313 GLY n 
1 314 ARG n 
1 315 SER n 
1 316 LEU n 
1 317 GLU n 
1 318 ASP n 
1 319 CYS n 
1 320 GLY n 
1 321 LYS n 
1 322 LEU n 
1 323 GLY n 
1 324 CYS n 
1 325 LEU n 
1 326 ALA n 
1 327 ALA n 
1 328 GLY n 
1 329 ILE n 
1 330 VAL n 
1 331 ILE n 
1 332 GLN n 
1 333 GLN n 
1 334 ILE n 
1 335 GLY n 
1 336 PRO n 
1 337 ARG n 
1 338 PRO n 
1 339 MSE n 
1 340 THR n 
1 341 SER n 
1 342 LEU n 
1 343 SER n 
1 344 GLU n 
1 345 ALA n 
1 346 ALA n 
1 347 LYS n 
1 348 GLN n 
1 349 ALA n 
1 350 GLY n 
1 351 LEU n 
1 352 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 RHE_CH00135 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'CFN 42' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rhizobium etli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     347834 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)CODON+RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'BC-PSGX3(BC)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q2KDX6_RHIEC 
_struct_ref.pdbx_db_accession          Q2KDX6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MTRFDVLTVGNAIVDIISRCNDQFLIDNQITKAAMNLIDAERAELLYSRMGPALEASGGSAGNTAAGVANLGGKAAYFGN
VAADQLGDIFTHDIRAQGVHYQTKPKGAFPPTARSMIFVTEDGERSMNTYLGACVELGPEDVEADVVADAKVTYFEGYLW
DPPRAKEAILDCARIAHQHGREMSMTLSDSFCVDRYRGEFLDLMRSGKVDIVFANRQEALSLYQTDDFEEALNRIAADCK
IAAVTMSENGAVILKGRERYYVNAIRIREVVDTTGAGDLFASGFLYGYTQGRSLEDCGKLGCLAAGIVIQQIGPRPMTSL
SEAAKQAGLI
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4KAL A 23 ? 352 ? Q2KDX6 1 ? 330 ? -1 328 
2 1 4KAL B 23 ? 352 ? Q2KDX6 1 ? 330 ? -1 328 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4KAL MSE A 1  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -23 1  
1 4KAL HIS A 2  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -22 2  
1 4KAL HIS A 3  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -21 3  
1 4KAL HIS A 4  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -20 4  
1 4KAL HIS A 5  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -19 5  
1 4KAL HIS A 6  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -18 6  
1 4KAL HIS A 7  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -17 7  
1 4KAL SER A 8  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -16 8  
1 4KAL SER A 9  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -15 9  
1 4KAL GLY A 10 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -14 10 
1 4KAL VAL A 11 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -13 11 
1 4KAL ASP A 12 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -12 12 
1 4KAL LEU A 13 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -11 13 
1 4KAL GLY A 14 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -10 14 
1 4KAL THR A 15 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -9  15 
1 4KAL GLU A 16 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -8  16 
1 4KAL ASN A 17 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -7  17 
1 4KAL LEU A 18 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -6  18 
1 4KAL TYR A 19 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -5  19 
1 4KAL PHE A 20 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -4  20 
1 4KAL GLN A 21 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -3  21 
1 4KAL SER A 22 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -2  22 
2 4KAL MSE B 1  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -23 23 
2 4KAL HIS B 2  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -22 24 
2 4KAL HIS B 3  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -21 25 
2 4KAL HIS B 4  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -20 26 
2 4KAL HIS B 5  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -19 27 
2 4KAL HIS B 6  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -18 28 
2 4KAL HIS B 7  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -17 29 
2 4KAL SER B 8  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -16 30 
2 4KAL SER B 9  ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -15 31 
2 4KAL GLY B 10 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -14 32 
2 4KAL VAL B 11 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -13 33 
2 4KAL ASP B 12 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -12 34 
2 4KAL LEU B 13 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -11 35 
2 4KAL GLY B 14 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -10 36 
2 4KAL THR B 15 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -9  37 
2 4KAL GLU B 16 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -8  38 
2 4KAL ASN B 17 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -7  39 
2 4KAL LEU B 18 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -6  40 
2 4KAL TYR B 19 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -5  41 
2 4KAL PHE B 20 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -4  42 
2 4KAL GLN B 21 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -3  43 
2 4KAL SER B 22 ? UNP Q2KDX6 ? ? 'EXPRESSION TAG' -2  44 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADN non-polymer         . ADENOSINE                     ? 'C10 H13 N5 O4'  267.241 
ALA 'L-peptide linking' y ALANINE                       ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                      ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                    ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'               ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                      ? 'C3 H7 N O2 S'   121.158 
DMS non-polymer         . 'DIMETHYL SULFOXIDE'          ? 'C2 H6 O S'      78.133  
GLN 'L-peptide linking' y GLUTAMINE                     ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'               ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                       ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                     ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                         ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                    ? 'C6 H13 N O2'    131.173 
K   non-polymer         . 'POTASSIUM ION'               ? 'K 1'            39.098  
LEU 'L-peptide linking' y LEUCINE                       ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                        ? 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE              ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE                 ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                       ? 'C5 H9 N O2'     115.130 
Q3C non-polymer         . 'quinoline-3-carboxylic acid' ? 'C10 H7 N O2'    173.168 
SER 'L-peptide linking' y SERINE                        ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                     ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                    ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                      ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                        ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4KAL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.20 
_exptl_crystal.density_percent_sol   44.00 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'0.2M AMMONIUM ACETATE, 0.1M BIS:TRIS:HCL, PH 6.5, 25% PEG3350, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2013-03-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.075 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.075 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4KAL 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.490 
_reflns.number_obs                   100585 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         91.600 
_reflns.pdbx_Rmerge_I_obs            0.073 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.700 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.000 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
1 1  1.490 1.520  58.200 0.556 ? ? 2.600 
1 2  1.520 1.540  66.300 0.526 ? ? 2.600 
1 3  1.540 1.570  72.300 0.460 ? ? 2.700 
1 4  1.570 1.610  79.100 0.424 ? ? 2.800 
1 5  1.610 1.640  86.100 0.401 ? ? 2.800 
1 6  1.640 1.680  91.500 0.366 ? ? 2.900 
1 7  1.680 1.720  95.600 0.337 ? ? 3.000 
1 8  1.720 1.770  98.600 0.287 ? ? 3.000 
1 9  1.770 1.820  98.800 0.249 ? ? 3.100 
1 10 1.820 1.880  99.200 0.213 ? ? 3.100 
1 11 1.880 1.940  99.300 0.175 ? ? 3.100 
1 12 1.940 2.020  99.100 0.146 ? ? 3.100 
1 13 2.020 2.110  99.000 0.124 ? ? 3.100 
1 14 2.110 2.230  99.000 0.106 ? ? 3.100 
1 15 2.230 2.370  99.000 0.096 ? ? 3.100 
1 16 2.370 2.550  98.900 0.085 ? ? 3.100 
1 17 2.550 2.800  98.900 0.076 ? ? 3.100 
1 18 2.800 3.210  98.400 0.065 ? ? 3.100 
1 19 3.210 4.040  97.300 0.050 ? ? 3.100 
1 20 4.040 50.000 96.600 0.044 ? ? 3.100 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4KAL 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     94208 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.12 
_refine.ls_d_res_high                            1.50 
_refine.ls_percent_reflns_obs                    92.46 
_refine.ls_R_factor_obs                          0.16012 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.15857 
_refine.ls_R_factor_R_free                       0.18974 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  4984 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            0.400 
_refine.occupancy_max                            1.000 
_refine.correlation_coeff_Fo_to_Fc               0.968 
_refine.correlation_coeff_Fo_to_Fc_free          0.959 
_refine.B_iso_mean                               24.790 
_refine.aniso_B[1][1]                            0.01 
_refine.aniso_B[2][2]                            -0.16 
_refine.aniso_B[3][3]                            0.15 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.71 
_refine.aniso_B[2][3]                            -0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' 
_refine.pdbx_starting_model                      4E3A 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.019 
_refine.pdbx_overall_ESU_R_Free                  0.016 
_refine.overall_SU_ML                            0.022 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             1.210 
_refine.overall_SU_R_Cruickshank_DPI             0.0198 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5008 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         82 
_refine_hist.number_atoms_solvent             552 
_refine_hist.number_atoms_total               5642 
_refine_hist.d_res_high                       1.50 
_refine_hist.d_res_low                        40.12 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.007  0.019  ? 5255 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.161  1.988  ? 7125 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.349  5.000  ? 686  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.073 23.745 ? 243  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.905 15.000 ? 806  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       14.288 15.000 ? 46   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.077  0.200  ? 797  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.021  ? 4040 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           3.073  3.000  ? 5255 'X-RAY DIFFRACTION' ? 
r_sphericity_free            26.024 5.000  ? 186  'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          11.506 5.000  ? 5529 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.500 
_refine_ls_shell.d_res_low                        1.539 
_refine_ls_shell.number_reflns_R_work             4733 
_refine_ls_shell.R_factor_R_work                  0.254 
_refine_ls_shell.percent_reflns_obs               63.72 
_refine_ls_shell.R_factor_R_free                  0.294 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             247 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  4KAL 
_struct.title                     
'Crystal structure of probable sugar kinase protein from Rhizobium etli CFN 42 complexed with quinoline-3-carboxylic acid' 
_struct.pdbx_descriptor           'Probable sugar kinase protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4KAL 
_struct_keywords.text            
;STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, NYSGRC, PSI-Biology, New York Structural Genomics Research Consortium, TRANSFERASE
;
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 2 ? 
I N N 3 ? 
J N N 4 ? 
K N N 4 ? 
L N N 5 ? 
M N N 6 ? 
N N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 43  ? ASN A 50  ? ASN A 19  ASN A 26  1 ? 8  
HELX_P HELX_P2  2  ASP A 61  ? MSE A 72  ? ASP A 37  MSE A 48  1 ? 12 
HELX_P HELX_P3  3  GLY A 81  ? GLY A 94  ? GLY A 57  GLY A 70  1 ? 14 
HELX_P HELX_P4  4  ASP A 106 ? GLN A 119 ? ASP A 82  GLN A 95  1 ? 14 
HELX_P HELX_P5  5  LEU A 153 ? LEU A 159 ? LEU A 129 LEU A 135 5 ? 7  
HELX_P HELX_P6  6  GLY A 160 ? VAL A 164 ? GLY A 136 VAL A 140 5 ? 5  
HELX_P HELX_P7  7  GLU A 165 ? ASP A 171 ? GLU A 141 ASP A 147 1 ? 7  
HELX_P HELX_P8  8  TYR A 180 ? ASP A 183 ? TYR A 156 ASP A 159 5 ? 4  
HELX_P HELX_P9  9  ARG A 186 ? HIS A 201 ? ARG A 162 HIS A 177 1 ? 16 
HELX_P HELX_P10 10 ASP A 211 ? SER A 228 ? ASP A 187 SER A 204 1 ? 18 
HELX_P HELX_P11 11 ARG A 238 ? TYR A 245 ? ARG A 214 TYR A 221 1 ? 8  
HELX_P HELX_P12 12 ASP A 249 ? CYS A 261 ? ASP A 225 CYS A 237 1 ? 13 
HELX_P HELX_P13 13 SER A 269 ? ASN A 271 ? SER A 245 ASN A 247 5 ? 3  
HELX_P HELX_P14 14 GLY A 297 ? GLN A 312 ? GLY A 273 GLN A 288 1 ? 16 
HELX_P HELX_P15 15 SER A 315 ? ILE A 331 ? SER A 291 ILE A 307 1 ? 17 
HELX_P HELX_P16 16 SER A 341 ? ALA A 349 ? SER A 317 ALA A 325 1 ? 9  
HELX_P HELX_P17 17 ASN B 43  ? ASN B 50  ? ASN B 19  ASN B 26  1 ? 8  
HELX_P HELX_P18 18 ASP B 61  ? MSE B 72  ? ASP B 37  MSE B 48  1 ? 12 
HELX_P HELX_P19 19 GLY B 81  ? GLY B 94  ? GLY B 57  GLY B 70  1 ? 14 
HELX_P HELX_P20 20 ASP B 106 ? GLN B 119 ? ASP B 82  GLN B 95  1 ? 14 
HELX_P HELX_P21 21 LEU B 153 ? LEU B 159 ? LEU B 129 LEU B 135 5 ? 7  
HELX_P HELX_P22 22 GLY B 160 ? VAL B 164 ? GLY B 136 VAL B 140 5 ? 5  
HELX_P HELX_P23 23 GLU B 165 ? ASP B 171 ? GLU B 141 ASP B 147 1 ? 7  
HELX_P HELX_P24 24 TYR B 180 ? ASP B 183 ? TYR B 156 ASP B 159 5 ? 4  
HELX_P HELX_P25 25 ARG B 186 ? HIS B 201 ? ARG B 162 HIS B 177 1 ? 16 
HELX_P HELX_P26 26 ASP B 211 ? SER B 228 ? ASP B 187 SER B 204 1 ? 18 
HELX_P HELX_P27 27 ARG B 238 ? TYR B 245 ? ARG B 214 TYR B 221 1 ? 8  
HELX_P HELX_P28 28 ASP B 249 ? CYS B 261 ? ASP B 225 CYS B 237 1 ? 13 
HELX_P HELX_P29 29 SER B 269 ? ASN B 271 ? SER B 245 ASN B 247 5 ? 3  
HELX_P HELX_P30 30 GLY B 297 ? GLN B 312 ? GLY B 273 GLN B 288 1 ? 16 
HELX_P HELX_P31 31 SER B 315 ? ILE B 331 ? SER B 291 ILE B 307 1 ? 17 
HELX_P HELX_P32 32 SER B 341 ? ALA B 349 ? SER B 317 ALA B 325 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A MSE 23  C   ? ? ? 1_555 A THR 24  N ? ? A MSE -1  A THR 0   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale2  covale ? ? A ALA 56  C   ? ? ? 1_555 A MSE 57  N ? ? A ALA 32  A MSE 33  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale3  covale ? ? A MSE 57  C   ? ? ? 1_555 A ASN 58  N ? ? A MSE 33  A ASN 34  1_555 ? ? ? ? ? ? ? 1.336 ? 
covale4  covale ? ? A ARG 71  C   ? ? ? 1_555 A MSE 72  N ? ? A ARG 47  A MSE 48  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale5  covale ? ? A MSE 72  C   ? ? ? 1_555 A GLY 73  N ? ? A MSE 48  A GLY 49  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale6  covale ? ? A SER 137 C   ? ? ? 1_555 A MSE 138 N ? ? A SER 113 A MSE 114 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale7  covale ? ? A MSE 138 C   ? ? ? 1_555 A ILE 139 N ? ? A MSE 114 A ILE 115 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale8  covale ? ? A SER 148 C   ? ? ? 1_555 A MSE 149 N ? ? A SER 124 A MSE 125 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale9  covale ? ? A MSE 149 C   ? ? ? 1_555 A ASN 150 N ? ? A MSE 125 A ASN 126 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale10 covale ? ? A GLU 204 C   ? ? ? 1_555 A MSE 205 N ? ? A GLU 180 A MSE 181 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale11 covale ? ? A MSE 205 C   ? ? ? 1_555 A SER 206 N ? ? A MSE 181 A SER 182 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale12 covale ? ? A SER 206 C   ? ? ? 1_555 A MSE 207 N ? ? A SER 182 A MSE 183 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale13 covale ? ? A MSE 207 C   ? ? ? 1_555 A THR 208 N ? ? A MSE 183 A THR 184 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale14 covale ? ? A LEU 225 C   ? ? ? 1_555 A MSE 226 N ? ? A LEU 201 A MSE 202 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale15 covale ? ? A MSE 226 C   ? ? ? 1_555 A ARG 227 N ? ? A MSE 202 A ARG 203 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale16 covale ? ? A THR 267 C   ? ? ? 1_555 A MSE 268 N ? ? A THR 243 A MSE 244 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale17 covale ? ? A MSE 268 C   ? ? ? 1_555 A SER 269 N ? ? A MSE 244 A SER 245 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale18 covale ? ? A PRO 338 C   ? ? ? 1_555 A MSE 339 N ? ? A PRO 314 A MSE 315 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale19 covale ? ? A MSE 339 C   ? ? ? 1_555 A THR 340 N ? ? A MSE 315 A THR 316 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale20 covale ? ? B MSE 23  C   ? ? ? 1_555 B THR 24  N ? ? B MSE -1  B THR 0   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale21 covale ? ? B ALA 56  C   ? ? ? 1_555 B MSE 57  N ? ? B ALA 32  B MSE 33  1_555 ? ? ? ? ? ? ? 1.335 ? 
covale22 covale ? ? B MSE 57  C   ? ? ? 1_555 B ASN 58  N ? ? B MSE 33  B ASN 34  1_555 ? ? ? ? ? ? ? 1.337 ? 
covale23 covale ? ? B ARG 71  C   ? ? ? 1_555 B MSE 72  N ? ? B ARG 47  B MSE 48  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale24 covale ? ? B MSE 72  C   ? ? ? 1_555 B GLY 73  N ? ? B MSE 48  B GLY 49  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale25 covale ? ? B SER 137 C   ? ? ? 1_555 B MSE 138 N ? ? B SER 113 B MSE 114 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale26 covale ? ? B MSE 138 C   ? ? ? 1_555 B ILE 139 N ? ? B MSE 114 B ILE 115 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale27 covale ? ? B SER 148 C   ? ? ? 1_555 B MSE 149 N ? ? B SER 124 B MSE 125 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale28 covale ? ? B MSE 149 C   ? ? ? 1_555 B ASN 150 N ? ? B MSE 125 B ASN 126 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale29 covale ? ? B GLU 204 C   ? ? ? 1_555 B MSE 205 N ? ? B GLU 180 B MSE 181 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale30 covale ? ? B MSE 205 C   ? ? ? 1_555 B SER 206 N ? ? B MSE 181 B SER 182 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale31 covale ? ? B SER 206 C   ? ? ? 1_555 B MSE 207 N ? ? B SER 182 B MSE 183 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale32 covale ? ? B MSE 207 C   ? ? ? 1_555 B THR 208 N ? ? B MSE 183 B THR 184 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale33 covale ? ? B LEU 225 C   ? ? ? 1_555 B MSE 226 N ? ? B LEU 201 B MSE 202 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale34 covale ? ? B MSE 226 C   ? ? ? 1_555 B ARG 227 N ? ? B MSE 202 B ARG 203 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale35 covale ? ? B THR 267 C   ? ? ? 1_555 B MSE 268 N ? ? B THR 243 B MSE 244 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale36 covale ? ? B MSE 268 C   ? ? ? 1_555 B SER 269 N ? ? B MSE 244 B SER 245 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale37 covale ? ? B PRO 338 C   ? ? ? 1_555 B MSE 339 N ? ? B PRO 314 B MSE 315 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale38 covale ? ? B MSE 339 C   ? ? ? 1_555 B THR 340 N ? ? B MSE 315 B THR 316 1_555 ? ? ? ? ? ? ? 1.332 ? 
metalc1  metalc ? ? A GLY 335 O   ? ? ? 1_555 G K   .   K ? ? A GLY 311 A K   405 1_555 ? ? ? ? ? ? ? 2.696 ? 
metalc2  metalc ? ? B GLY 335 O   ? ? ? 1_555 L K   .   K ? ? B GLY 311 B K   405 1_555 ? ? ? ? ? ? ? 2.739 ? 
metalc3  metalc ? ? B VAL 330 O   ? ? ? 1_555 L K   .   K ? ? B VAL 306 B K   405 1_555 ? ? ? ? ? ? ? 2.748 ? 
metalc4  metalc ? ? A VAL 330 O   ? ? ? 1_555 G K   .   K ? ? A VAL 306 A K   405 1_555 ? ? ? ? ? ? ? 2.753 ? 
metalc5  metalc ? ? B GLN 333 O   ? ? ? 1_555 L K   .   K ? ? B GLN 309 B K   405 1_555 ? ? ? ? ? ? ? 2.784 ? 
metalc6  metalc ? ? B ASP 294 O   ? ? ? 1_555 L K   .   K ? ? B ASP 270 B K   405 1_555 ? ? ? ? ? ? ? 2.802 ? 
metalc7  metalc ? ? A GLN 333 O   ? ? ? 1_555 G K   .   K ? ? A GLN 309 A K   405 1_555 ? ? ? ? ? ? ? 2.806 ? 
metalc8  metalc ? ? A ASP 294 O   ? ? ? 1_555 G K   .   K ? ? A ASP 270 A K   405 1_555 ? ? ? ? ? ? ? 2.823 ? 
metalc9  metalc ? ? A THR 296 O   ? ? ? 1_555 G K   .   K ? ? A THR 272 A K   405 1_555 ? ? ? ? ? ? ? 2.912 ? 
metalc10 metalc ? ? B THR 296 O   ? ? ? 1_555 L K   .   K ? ? B THR 272 B K   405 1_555 ? ? ? ? ? ? ? 2.935 ? 
metalc11 metalc ? ? B ASP 294 OD2 ? ? ? 1_555 L K   .   K ? ? B ASP 270 B K   405 1_555 ? ? ? ? ? ? ? 3.264 ? 
metalc12 metalc ? ? A ASP 294 OD2 ? ? ? 1_555 G K   .   K ? ? A ASP 270 A K   405 1_555 ? ? ? ? ? ? ? 3.308 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 131 A . ? PHE 107 A PRO 132 A ? PRO 108 A 1 0.61  
2 PHE 131 B . ? PHE 107 B PRO 132 B ? PRO 108 B 1 -0.66 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 5 ? 
C ? 9 ? 
D ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
C 7 8 ? anti-parallel 
C 8 9 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS A 122 ? TYR A 123 ? HIS A 98  TYR A 99  
A 2 ALA A 97  ? PHE A 100 ? ALA A 73  PHE A 76  
A 3 PHE A 26  ? VAL A 31  ? PHE A 2   VAL A 7   
A 4 ALA A 172 ? GLU A 178 ? ALA A 148 GLU A 154 
A 5 GLU A 204 ? THR A 208 ? GLU A 180 THR A 184 
A 6 ILE A 233 ? ASN A 237 ? ILE A 209 ASN A 213 
A 7 ILE A 263 ? THR A 267 ? ILE A 239 THR A 243 
A 8 ALA A 273 ? LYS A 277 ? ALA A 249 LYS A 253 
A 9 GLU A 280 ? VAL A 284 ? GLU A 256 VAL A 260 
B 1 MSE A 57  ? LEU A 59  ? MSE A 33  LEU A 35  
B 2 ARG A 147 ? TYR A 152 ? ARG A 123 TYR A 128 
B 3 ALA A 135 ? VAL A 141 ? ALA A 111 VAL A 117 
B 4 ILE A 35  ? ARG A 41  ? ILE A 11  ARG A 17  
B 5 LEU A 76  ? SER A 79  ? LEU A 52  SER A 55  
C 1 HIS B 122 ? TYR B 123 ? HIS B 98  TYR B 99  
C 2 ALA B 97  ? PHE B 100 ? ALA B 73  PHE B 76  
C 3 PHE B 26  ? VAL B 31  ? PHE B 2   VAL B 7   
C 4 ALA B 172 ? GLU B 178 ? ALA B 148 GLU B 154 
C 5 GLU B 204 ? THR B 208 ? GLU B 180 THR B 184 
C 6 ILE B 233 ? ASN B 237 ? ILE B 209 ASN B 213 
C 7 ILE B 263 ? THR B 267 ? ILE B 239 THR B 243 
C 8 ALA B 273 ? LYS B 277 ? ALA B 249 LYS B 253 
C 9 GLU B 280 ? VAL B 284 ? GLU B 256 VAL B 260 
D 1 MSE B 57  ? LEU B 59  ? MSE B 33  LEU B 35  
D 2 ARG B 147 ? TYR B 152 ? ARG B 123 TYR B 128 
D 3 ALA B 135 ? VAL B 141 ? ALA B 111 VAL B 117 
D 4 ILE B 35  ? ARG B 41  ? ILE B 11  ARG B 17  
D 5 LEU B 76  ? SER B 79  ? LEU B 52  SER B 55  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O HIS A 122 ? O HIS A 98  N ALA A 97  ? N ALA A 73  
A 2 3 O ALA A 98  ? O ALA A 74  N THR A 30  ? N THR A 6   
A 3 4 N LEU A 29  ? N LEU A 5   O TYR A 176 ? O TYR A 152 
A 4 5 N THR A 175 ? N THR A 151 O SER A 206 ? O SER A 182 
A 5 6 N MSE A 207 ? N MSE A 183 O PHE A 235 ? O PHE A 211 
A 6 7 N VAL A 234 ? N VAL A 210 O ALA A 265 ? O ALA A 241 
A 7 8 N ALA A 264 ? N ALA A 240 O LEU A 276 ? O LEU A 252 
A 8 9 N ALA A 273 ? N ALA A 249 O VAL A 284 ? O VAL A 260 
B 1 2 N ASN A 58  ? N ASN A 34  O MSE A 149 ? O MSE A 125 
B 2 3 O ASN A 150 ? O ASN A 126 N MSE A 138 ? N MSE A 114 
B 3 4 O ILE A 139 ? O ILE A 115 N ILE A 38  ? N ILE A 14  
B 4 5 N ASP A 37  ? N ASP A 13  O ALA A 78  ? O ALA A 54  
C 1 2 O HIS B 122 ? O HIS B 98  N ALA B 97  ? N ALA B 73  
C 2 3 O ALA B 98  ? O ALA B 74  N THR B 30  ? N THR B 6   
C 3 4 N LEU B 29  ? N LEU B 5   O TYR B 176 ? O TYR B 152 
C 4 5 N THR B 175 ? N THR B 151 O SER B 206 ? O SER B 182 
C 5 6 N MSE B 207 ? N MSE B 183 O PHE B 235 ? O PHE B 211 
C 6 7 N VAL B 234 ? N VAL B 210 O ALA B 265 ? O ALA B 241 
C 7 8 N ALA B 264 ? N ALA B 240 O LEU B 276 ? O LEU B 252 
C 8 9 N ALA B 273 ? N ALA B 249 O VAL B 284 ? O VAL B 260 
D 1 2 N ASN B 58  ? N ASN B 34  O MSE B 149 ? O MSE B 125 
D 2 3 O ASN B 150 ? O ASN B 126 N MSE B 138 ? N MSE B 114 
D 3 4 O SER B 137 ? O SER B 113 N ILE B 38  ? N ILE B 14  
D 4 5 N ILE B 39  ? N ILE B 15  O LEU B 76  ? O LEU B 52  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE ADN A 401' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE Q3C A 402' 
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE DMS A 403' 
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE DMS A 404' 
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE K A 405'   
AC6 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE ADN B 401' 
AC7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE Q3C B 402' 
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE DMS B 403' 
AC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE DMS B 404' 
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE K B 405'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 20 ASN A 33  ? ASN A 9   . ? 1_555 ? 
2  AC1 20 ILE A 35  ? ILE A 11  . ? 1_555 ? 
3  AC1 20 ASP A 37  ? ASP A 13  . ? 1_555 ? 
4  AC1 20 MSE A 57  ? MSE A 33  . ? 1_555 ? 
5  AC1 20 GLY A 80  ? GLY A 56  . ? 1_555 ? 
6  AC1 20 GLY A 81  ? GLY A 57  . ? 1_555 ? 
7  AC1 20 SER A 82  ? SER A 58  . ? 1_555 ? 
8  AC1 20 ASN A 85  ? ASN A 61  . ? 1_555 ? 
9  AC1 20 MSE A 149 ? MSE A 125 . ? 1_555 ? 
10 AC1 20 THR A 151 ? THR A 127 . ? 1_555 ? 
11 AC1 20 GLU A 178 ? GLU A 154 . ? 1_555 ? 
12 AC1 20 TYR A 180 ? TYR A 156 . ? 1_555 ? 
13 AC1 20 THR A 296 ? THR A 272 . ? 1_555 ? 
14 AC1 20 GLY A 297 ? GLY A 273 . ? 1_555 ? 
15 AC1 20 ASP A 300 ? ASP A 276 . ? 1_555 ? 
16 AC1 20 PRO A 336 ? PRO A 312 . ? 1_555 ? 
17 AC1 20 HOH M .   ? HOH A 503 . ? 1_555 ? 
18 AC1 20 HOH M .   ? HOH A 520 . ? 1_555 ? 
19 AC1 20 HOH M .   ? HOH A 524 . ? 1_555 ? 
20 AC1 20 HOH M .   ? HOH A 547 . ? 1_555 ? 
21 AC2 5  SER A 212 ? SER A 188 . ? 1_555 ? 
22 AC2 5  PHE A 213 ? PHE A 189 . ? 1_555 ? 
23 AC2 5  ASP A 216 ? ASP A 192 . ? 1_555 ? 
24 AC2 5  SER A 243 ? SER A 219 . ? 1_555 ? 
25 AC2 5  GLN A 246 ? GLN A 222 . ? 1_555 ? 
26 AC3 6  ILE A 38  ? ILE A 14  . ? 1_555 ? 
27 AC3 6  ALA A 65  ? ALA A 41  . ? 1_555 ? 
28 AC3 6  GLU A 66  ? GLU A 42  . ? 1_555 ? 
29 AC3 6  TYR A 69  ? TYR A 45  . ? 1_555 ? 
30 AC3 6  ARG A 136 ? ARG A 112 . ? 1_555 ? 
31 AC3 6  DMS F .   ? DMS A 404 . ? 1_555 ? 
32 AC4 2  ARG A 136 ? ARG A 112 . ? 1_555 ? 
33 AC4 2  DMS E .   ? DMS A 403 . ? 1_555 ? 
34 AC5 5  ASP A 294 ? ASP A 270 . ? 1_555 ? 
35 AC5 5  THR A 296 ? THR A 272 . ? 1_555 ? 
36 AC5 5  VAL A 330 ? VAL A 306 . ? 1_555 ? 
37 AC5 5  GLN A 333 ? GLN A 309 . ? 1_555 ? 
38 AC5 5  GLY A 335 ? GLY A 311 . ? 1_555 ? 
39 AC6 20 ASN B 33  ? ASN B 9   . ? 1_555 ? 
40 AC6 20 ILE B 35  ? ILE B 11  . ? 1_555 ? 
41 AC6 20 ASP B 37  ? ASP B 13  . ? 1_555 ? 
42 AC6 20 MSE B 57  ? MSE B 33  . ? 1_555 ? 
43 AC6 20 GLY B 80  ? GLY B 56  . ? 1_555 ? 
44 AC6 20 GLY B 81  ? GLY B 57  . ? 1_555 ? 
45 AC6 20 SER B 82  ? SER B 58  . ? 1_555 ? 
46 AC6 20 ASN B 85  ? ASN B 61  . ? 1_555 ? 
47 AC6 20 MSE B 149 ? MSE B 125 . ? 1_555 ? 
48 AC6 20 THR B 151 ? THR B 127 . ? 1_555 ? 
49 AC6 20 GLU B 178 ? GLU B 154 . ? 1_555 ? 
50 AC6 20 TYR B 180 ? TYR B 156 . ? 1_555 ? 
51 AC6 20 THR B 296 ? THR B 272 . ? 1_555 ? 
52 AC6 20 GLY B 297 ? GLY B 273 . ? 1_555 ? 
53 AC6 20 ASP B 300 ? ASP B 276 . ? 1_555 ? 
54 AC6 20 PRO B 336 ? PRO B 312 . ? 1_555 ? 
55 AC6 20 HOH N .   ? HOH B 501 . ? 1_555 ? 
56 AC6 20 HOH N .   ? HOH B 511 . ? 1_555 ? 
57 AC6 20 HOH N .   ? HOH B 535 . ? 1_555 ? 
58 AC6 20 HOH N .   ? HOH B 551 . ? 1_555 ? 
59 AC7 7  SER B 212 ? SER B 188 . ? 1_555 ? 
60 AC7 7  PHE B 213 ? PHE B 189 . ? 1_555 ? 
61 AC7 7  ASP B 216 ? ASP B 192 . ? 1_555 ? 
62 AC7 7  SER B 243 ? SER B 219 . ? 1_555 ? 
63 AC7 7  GLN B 246 ? GLN B 222 . ? 1_555 ? 
64 AC7 7  HOH N .   ? HOH B 632 . ? 1_555 ? 
65 AC7 7  HOH N .   ? HOH B 723 . ? 1_555 ? 
66 AC8 6  ILE B 38  ? ILE B 14  . ? 1_555 ? 
67 AC8 6  ALA B 65  ? ALA B 41  . ? 1_555 ? 
68 AC8 6  GLU B 66  ? GLU B 42  . ? 1_555 ? 
69 AC8 6  TYR B 69  ? TYR B 45  . ? 1_555 ? 
70 AC8 6  ARG B 136 ? ARG B 112 . ? 1_555 ? 
71 AC8 6  DMS K .   ? DMS B 404 . ? 1_555 ? 
72 AC9 2  ARG B 136 ? ARG B 112 . ? 1_555 ? 
73 AC9 2  DMS J .   ? DMS B 403 . ? 1_555 ? 
74 BC1 5  ASP B 294 ? ASP B 270 . ? 1_555 ? 
75 BC1 5  THR B 296 ? THR B 272 . ? 1_555 ? 
76 BC1 5  VAL B 330 ? VAL B 306 . ? 1_555 ? 
77 BC1 5  GLN B 333 ? GLN B 309 . ? 1_555 ? 
78 BC1 5  GLY B 335 ? GLY B 311 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4KAL 
_atom_sites.fract_transf_matrix[1][1]   0.019539 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002806 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012312 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012179 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
K  
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1    N  N     . MSE A 1 23  ? 75.295 36.896 52.903  1.00 47.40 ? -1  MSE A N     1 
HETATM 2    C  CA    . MSE A 1 23  ? 74.478 36.476 51.727  1.00 47.31 ? -1  MSE A CA    1 
HETATM 3    C  C     . MSE A 1 23  ? 75.256 35.497 50.901  1.00 46.25 ? -1  MSE A C     1 
HETATM 4    O  O     . MSE A 1 23  ? 76.468 35.648 50.717  1.00 47.61 ? -1  MSE A O     1 
HETATM 5    C  CB    . MSE A 1 23  ? 74.147 37.662 50.821  1.00 54.69 ? -1  MSE A CB    1 
HETATM 6    C  CG    . MSE A 1 23  ? 73.757 38.933 51.565  1.00 59.17 ? -1  MSE A CG    1 
HETATM 7    SE SE    . MSE A 1 23  ? 73.744 40.412 50.264  1.00 56.13 ? -1  MSE A SE    1 
HETATM 8    C  CE    . MSE A 1 23  ? 75.565 41.087 50.567  1.00 41.41 ? -1  MSE A CE    1 
ATOM   9    N  N     . THR A 1 24  ? 74.562 34.481 50.393  1.00 45.10 ? 0   THR A N     1 
ATOM   10   C  CA    . THR A 1 24  ? 75.157 33.527 49.457  1.00 40.01 ? 0   THR A CA    1 
ATOM   11   C  C     . THR A 1 24  ? 74.650 33.816 48.053  1.00 41.16 ? 0   THR A C     1 
ATOM   12   O  O     . THR A 1 24  ? 73.549 34.349 47.876  1.00 45.10 ? 0   THR A O     1 
ATOM   13   C  CB    . THR A 1 24  ? 74.844 32.062 49.836  1.00 42.49 ? 0   THR A CB    1 
ATOM   14   O  OG1   . THR A 1 24  ? 73.433 31.903 50.018  1.00 47.65 ? 0   THR A OG1   1 
ATOM   15   C  CG2   . THR A 1 24  ? 75.562 31.674 51.122  1.00 48.56 ? 0   THR A CG2   1 
ATOM   16   N  N     . ARG A 1 25  ? 75.451 33.462 47.053  1.00 33.51 ? 1   ARG A N     1 
ATOM   17   C  CA    . ARG A 1 25  ? 75.104 33.763 45.674  1.00 32.19 ? 1   ARG A CA    1 
ATOM   18   C  C     . ARG A 1 25  ? 73.997 32.856 45.150  1.00 30.44 ? 1   ARG A C     1 
ATOM   19   O  O     . ARG A 1 25  ? 73.135 33.302 44.395  1.00 33.42 ? 1   ARG A O     1 
ATOM   20   C  CB    . ARG A 1 25  ? 76.345 33.721 44.781  1.00 30.38 ? 1   ARG A CB    1 
ATOM   21   C  CG    . ARG A 1 25  ? 77.370 34.797 45.117  1.00 34.78 ? 1   ARG A CG    1 
ATOM   22   C  CD    . ARG A 1 25  ? 78.393 34.956 44.009  1.00 37.19 ? 1   ARG A CD    1 
ATOM   23   N  NE    . ARG A 1 25  ? 79.193 33.748 43.838  1.00 35.45 ? 1   ARG A NE    1 
ATOM   24   C  CZ    . ARG A 1 25  ? 79.686 33.326 42.678  1.00 37.14 ? 1   ARG A CZ    1 
ATOM   25   N  NH1   . ARG A 1 25  ? 80.398 32.208 42.635  1.00 35.52 ? 1   ARG A NH1   1 
ATOM   26   N  NH2   . ARG A 1 25  ? 79.457 34.006 41.560  1.00 42.60 ? 1   ARG A NH2   1 
ATOM   27   N  N     . PHE A 1 26  ? 74.020 31.592 45.571  1.00 27.69 ? 2   PHE A N     1 
ATOM   28   C  CA    . PHE A 1 26  ? 73.068 30.596 45.085  1.00 25.38 ? 2   PHE A CA    1 
ATOM   29   C  C     . PHE A 1 26  ? 72.378 29.830 46.204  1.00 23.37 ? 2   PHE A C     1 
ATOM   30   O  O     . PHE A 1 26  ? 72.988 29.541 47.238  1.00 24.73 ? 2   PHE A O     1 
ATOM   31   C  CB    . PHE A 1 26  ? 73.759 29.613 44.133  1.00 24.47 ? 2   PHE A CB    1 
ATOM   32   C  CG    . PHE A 1 26  ? 74.544 30.282 43.042  1.00 24.20 ? 2   PHE A CG    1 
ATOM   33   C  CD1   . PHE A 1 26  ? 73.899 30.812 41.927  1.00 26.03 ? 2   PHE A CD1   1 
ATOM   34   C  CD2   . PHE A 1 26  ? 75.930 30.406 43.137  1.00 25.32 ? 2   PHE A CD2   1 
ATOM   35   C  CE1   . PHE A 1 26  ? 74.619 31.447 40.930  1.00 24.96 ? 2   PHE A CE1   1 
ATOM   36   C  CE2   . PHE A 1 26  ? 76.654 31.048 42.137  1.00 25.44 ? 2   PHE A CE2   1 
ATOM   37   C  CZ    . PHE A 1 26  ? 75.994 31.564 41.030  1.00 25.69 ? 2   PHE A CZ    1 
ATOM   38   N  N     . ASP A 1 27  ? 71.101 29.522 45.989  1.00 24.50 ? 3   ASP A N     1 
ATOM   39   C  CA    . ASP A 1 27  ? 70.364 28.630 46.876  1.00 22.97 ? 3   ASP A CA    1 
ATOM   40   C  C     . ASP A 1 27  ? 70.648 27.178 46.503  1.00 22.23 ? 3   ASP A C     1 
ATOM   41   O  O     . ASP A 1 27  ? 70.987 26.371 47.360  1.00 22.90 ? 3   ASP A O     1 
ATOM   42   C  CB    . ASP A 1 27  ? 68.862 28.910 46.805  1.00 24.73 ? 3   ASP A CB    1 
ATOM   43   C  CG    . ASP A 1 27  ? 68.508 30.305 47.273  1.00 24.68 ? 3   ASP A CG    1 
ATOM   44   O  OD1   . ASP A 1 27  ? 69.063 30.753 48.299  1.00 29.97 ? 3   ASP A OD1   1 
ATOM   45   O  OD2   . ASP A 1 27  ? 67.668 30.947 46.610  1.00 29.21 ? 3   ASP A OD2   1 
ATOM   46   N  N     . VAL A 1 28  ? 70.534 26.855 45.215  1.00 21.57 ? 4   VAL A N     1 
ATOM   47   C  CA    . VAL A 1 28  ? 70.699 25.481 44.753  1.00 20.96 ? 4   VAL A CA    1 
ATOM   48   C  C     . VAL A 1 28  ? 71.566 25.445 43.499  1.00 19.57 ? 4   VAL A C     1 
ATOM   49   O  O     . VAL A 1 28  ? 71.243 26.087 42.495  1.00 21.94 ? 4   VAL A O     1 
ATOM   50   C  CB    . VAL A 1 28  ? 69.340 24.807 44.437  1.00 21.42 ? 4   VAL A CB    1 
ATOM   51   C  CG1   . VAL A 1 28  ? 69.541 23.344 44.065  1.00 21.42 ? 4   VAL A CG1   1 
ATOM   52   C  CG2   . VAL A 1 28  ? 68.374 24.924 45.612  1.00 21.46 ? 4   VAL A CG2   1 
ATOM   53   N  N     . LEU A 1 29  ? 72.684 24.732 43.590  1.00 19.54 ? 5   LEU A N     1 
ATOM   54   C  CA    . LEU A 1 29  ? 73.447 24.330 42.422  1.00 19.61 ? 5   LEU A CA    1 
ATOM   55   C  C     . LEU A 1 29  ? 73.039 22.897 42.096  1.00 19.29 ? 5   LEU A C     1 
ATOM   56   O  O     . LEU A 1 29  ? 72.988 22.044 42.984  1.00 20.10 ? 5   LEU A O     1 
ATOM   57   C  CB    . LEU A 1 29  ? 74.960 24.404 42.692  1.00 20.40 ? 5   LEU A CB    1 
ATOM   58   C  CG    . LEU A 1 29  ? 75.860 23.600 41.732  1.00 19.71 ? 5   LEU A CG    1 
ATOM   59   C  CD1   . LEU A 1 29  ? 75.865 24.140 40.298  1.00 19.83 ? 5   LEU A CD1   1 
ATOM   60   C  CD2   . LEU A 1 29  ? 77.271 23.523 42.295  1.00 23.49 ? 5   LEU A CD2   1 
ATOM   61   N  N     . THR A 1 30  ? 72.713 22.636 40.836  1.00 19.23 ? 6   THR A N     1 
ATOM   62   C  CA    . THR A 1 30  ? 72.471 21.254 40.423  1.00 17.52 ? 6   THR A CA    1 
ATOM   63   C  C     . THR A 1 30  ? 73.507 20.815 39.393  1.00 18.24 ? 6   THR A C     1 
ATOM   64   O  O     . THR A 1 30  ? 74.062 21.639 38.672  1.00 19.54 ? 6   THR A O     1 
ATOM   65   C  CB    . THR A 1 30  ? 71.053 20.997 39.882  1.00 17.03 ? 6   THR A CB    1 
ATOM   66   O  OG1   . THR A 1 30  ? 70.917 21.594 38.590  1.00 17.80 ? 6   THR A OG1   1 
ATOM   67   C  CG2   . THR A 1 30  ? 69.994 21.557 40.825  1.00 18.55 ? 6   THR A CG2   1 
ATOM   68   N  N     . VAL A 1 31  ? 73.766 19.515 39.350  1.00 18.89 ? 7   VAL A N     1 
ATOM   69   C  CA    . VAL A 1 31  ? 74.765 18.951 38.444  1.00 17.38 ? 7   VAL A CA    1 
ATOM   70   C  C     . VAL A 1 31  ? 74.157 17.713 37.796  1.00 18.51 ? 7   VAL A C     1 
ATOM   71   O  O     . VAL A 1 31  ? 73.640 16.828 38.481  1.00 18.10 ? 7   VAL A O     1 
ATOM   72   C  CB    . VAL A 1 31  ? 76.053 18.543 39.196  1.00 17.18 ? 7   VAL A CB    1 
ATOM   73   C  CG1   . VAL A 1 31  ? 77.143 18.095 38.230  1.00 19.51 ? 7   VAL A CG1   1 
ATOM   74   C  CG2   . VAL A 1 31  ? 76.575 19.671 40.070  1.00 17.74 ? 7   VAL A CG2   1 
ATOM   75   N  N     . GLY A 1 32  ? 74.214 17.641 36.472  1.00 17.89 ? 8   GLY A N     1 
ATOM   76   C  CA    . GLY A 1 32  ? 73.625 16.507 35.793  1.00 17.17 ? 8   GLY A CA    1 
ATOM   77   C  C     . GLY A 1 32  ? 74.009 16.394 34.340  1.00 16.68 ? 8   GLY A C     1 
ATOM   78   O  O     . GLY A 1 32  ? 74.798 17.197 33.836  1.00 18.59 ? 8   GLY A O     1 
ATOM   79   N  N     . ASN A 1 33  ? 73.448 15.374 33.699  1.00 16.85 ? 9   ASN A N     1 
ATOM   80   C  CA    . ASN A 1 33  ? 73.574 15.167 32.265  1.00 15.03 ? 9   ASN A CA    1 
ATOM   81   C  C     . ASN A 1 33  ? 72.747 16.185 31.490  1.00 16.54 ? 9   ASN A C     1 
ATOM   82   O  O     . ASN A 1 33  ? 71.513 16.210 31.586  1.00 17.39 ? 9   ASN A O     1 
ATOM   83   C  CB    . ASN A 1 33  ? 73.151 13.745 31.917  1.00 15.18 ? 9   ASN A CB    1 
ATOM   84   C  CG    . ASN A 1 33  ? 74.099 12.703 32.473  1.00 16.56 ? 9   ASN A CG    1 
ATOM   85   O  OD1   . ASN A 1 33  ? 75.322 12.842 32.375  1.00 18.01 ? 9   ASN A OD1   1 
ATOM   86   N  ND2   . ASN A 1 33  ? 73.538 11.632 33.036  1.00 17.38 ? 9   ASN A ND2   1 
ATOM   87   N  N     . ALA A 1 34  ? 73.424 17.023 30.710  1.00 17.01 ? 10  ALA A N     1 
ATOM   88   C  CA    . ALA A 1 34  ? 72.745 18.062 29.948  1.00 16.10 ? 10  ALA A CA    1 
ATOM   89   C  C     . ALA A 1 34  ? 72.146 17.462 28.678  1.00 16.40 ? 10  ALA A C     1 
ATOM   90   O  O     . ALA A 1 34  ? 72.882 17.020 27.791  1.00 18.41 ? 10  ALA A O     1 
ATOM   91   C  CB    . ALA A 1 34  ? 73.705 19.193 29.616  1.00 17.01 ? 10  ALA A CB    1 
ATOM   92   N  N     . ILE A 1 35  ? 70.813 17.439 28.609  1.00 16.45 ? 11  ILE A N     1 
ATOM   93   C  CA    . ILE A 1 35  ? 70.086 16.675 27.594  1.00 15.66 ? 11  ILE A CA    1 
ATOM   94   C  C     . ILE A 1 35  ? 68.980 17.529 26.980  1.00 16.37 ? 11  ILE A C     1 
ATOM   95   O  O     . ILE A 1 35  ? 68.338 18.321 27.684  1.00 17.82 ? 11  ILE A O     1 
ATOM   96   C  CB    . ILE A 1 35  ? 69.488 15.379 28.214  1.00 16.35 ? 11  ILE A CB    1 
ATOM   97   C  CG1   . ILE A 1 35  ? 70.614 14.434 28.653  1.00 15.99 ? 11  ILE A CG1   1 
ATOM   98   C  CG2   . ILE A 1 35  ? 68.545 14.679 27.238  1.00 16.33 ? 11  ILE A CG2   1 
ATOM   99   C  CD1   . ILE A 1 35  ? 70.199 13.348 29.620  1.00 17.28 ? 11  ILE A CD1   1 
ATOM   100  N  N     . VAL A 1 36  ? 68.789 17.405 25.664  1.00 14.37 ? 12  VAL A N     1 
ATOM   101  C  CA    . VAL A 1 36  ? 67.591 17.913 25.001  1.00 16.08 ? 12  VAL A CA    1 
ATOM   102  C  C     . VAL A 1 36  ? 66.640 16.736 24.759  1.00 15.19 ? 12  VAL A C     1 
ATOM   103  O  O     . VAL A 1 36  ? 67.044 15.682 24.243  1.00 15.50 ? 12  VAL A O     1 
ATOM   104  C  CB    . VAL A 1 36  ? 67.901 18.626 23.655  1.00 16.93 ? 12  VAL A CB    1 
ATOM   105  C  CG1   . VAL A 1 36  ? 66.608 19.058 22.980  1.00 19.10 ? 12  VAL A CG1   1 
ATOM   106  C  CG2   . VAL A 1 36  ? 68.787 19.849 23.885  1.00 17.58 ? 12  VAL A CG2   1 
ATOM   107  N  N     . ASP A 1 37  ? 65.382 16.914 25.154  1.00 16.23 ? 13  ASP A N     1 
ATOM   108  C  CA    . ASP A 1 37  ? 64.364 15.889 24.998  1.00 16.55 ? 13  ASP A CA    1 
ATOM   109  C  C     . ASP A 1 37  ? 63.701 15.979 23.626  1.00 15.18 ? 13  ASP A C     1 
ATOM   110  O  O     . ASP A 1 37  ? 63.446 17.060 23.112  1.00 16.27 ? 13  ASP A O     1 
ATOM   111  C  CB    . ASP A 1 37  ? 63.302 16.039 26.081  1.00 16.22 ? 13  ASP A CB    1 
ATOM   112  C  CG    . ASP A 1 37  ? 63.834 15.738 27.448  1.00 17.82 ? 13  ASP A CG    1 
ATOM   113  O  OD1   . ASP A 1 37  ? 64.916 15.123 27.536  1.00 19.85 ? 13  ASP A OD1   1 
ATOM   114  O  OD2   . ASP A 1 37  ? 63.161 16.096 28.441  1.00 21.72 ? 13  ASP A OD2   1 
ATOM   115  N  N     . ILE A 1 38  ? 63.441 14.812 23.048  1.00 15.08 ? 14  ILE A N     1 
ATOM   116  C  CA    . ILE A 1 38  ? 62.705 14.643 21.801  1.00 15.89 ? 14  ILE A CA    1 
ATOM   117  C  C     . ILE A 1 38  ? 61.508 13.786 22.213  1.00 15.84 ? 14  ILE A C     1 
ATOM   118  O  O     . ILE A 1 38  ? 61.666 12.619 22.579  1.00 16.32 ? 14  ILE A O     1 
ATOM   119  C  CB    . ILE A 1 38  ? 63.575 13.937 20.737  1.00 16.00 ? 14  ILE A CB    1 
ATOM   120  C  CG1   . ILE A 1 38  ? 64.885 14.715 20.524  1.00 18.97 ? 14  ILE A CG1   1 
ATOM   121  C  CG2   . ILE A 1 38  ? 62.817 13.733 19.418  1.00 17.53 ? 14  ILE A CG2   1 
ATOM   122  C  CD1   . ILE A 1 38  ? 65.864 14.030 19.593  1.00 21.70 ? 14  ILE A CD1   1 
ATOM   123  N  N     . ILE A 1 39  ? 60.317 14.384 22.176  1.00 16.27 ? 15  ILE A N     1 
ATOM   124  C  CA    . ILE A 1 39  ? 59.135 13.818 22.851  1.00 17.14 ? 15  ILE A CA    1 
ATOM   125  C  C     . ILE A 1 39  ? 58.040 13.466 21.850  1.00 16.64 ? 15  ILE A C     1 
ATOM   126  O  O     . ILE A 1 39  ? 57.680 14.285 21.014  1.00 17.80 ? 15  ILE A O     1 
ATOM   127  C  CB    . ILE A 1 39  ? 58.557 14.821 23.883  1.00 17.66 ? 15  ILE A CB    1 
ATOM   128  C  CG1   . ILE A 1 39  ? 59.637 15.308 24.862  1.00 19.98 ? 15  ILE A CG1   1 
ATOM   129  C  CG2   . ILE A 1 39  ? 57.358 14.222 24.626  1.00 17.52 ? 15  ILE A CG2   1 
ATOM   130  C  CD1   . ILE A 1 39  ? 59.295 16.621 25.538  1.00 23.35 ? 15  ILE A CD1   1 
ATOM   131  N  N     . SER A 1 40  ? 57.521 12.245 21.938  1.00 17.63 ? 16  SER A N     1 
ATOM   132  C  CA    . SER A 1 40  ? 56.416 11.809 21.097  1.00 19.54 ? 16  SER A CA    1 
ATOM   133  C  C     . SER A 1 40  ? 55.498 10.901 21.906  1.00 19.79 ? 16  SER A C     1 
ATOM   134  O  O     . SER A 1 40  ? 55.893 10.361 22.929  1.00 20.67 ? 16  SER A O     1 
ATOM   135  C  CB    . SER A 1 40  ? 56.936 11.065 19.866  1.00 24.23 ? 16  SER A CB    1 
ATOM   136  O  OG    . SER A 1 40  ? 55.918 10.915 18.893  1.00 30.22 ? 16  SER A OG    1 
ATOM   137  N  N     . ARG A 1 41  ? 54.275 10.744 21.434  1.00 23.04 ? 17  ARG A N     1 
ATOM   138  C  CA    . ARG A 1 41  ? 53.308 9.855  22.041  1.00 22.99 ? 17  ARG A CA    1 
ATOM   139  C  C     . ARG A 1 41  ? 53.404 8.505  21.316  1.00 24.06 ? 17  ARG A C     1 
ATOM   140  O  O     . ARG A 1 41  ? 53.785 8.464  20.156  1.00 28.46 ? 17  ARG A O     1 
ATOM   141  C  CB    . ARG A 1 41  ? 51.934 10.546 21.954  1.00 28.85 ? 17  ARG A CB    1 
ATOM   142  C  CG    . ARG A 1 41  ? 51.999 11.961 22.554  1.00 39.39 ? 17  ARG A CG    1 
ATOM   143  C  CD    . ARG A 1 41  ? 51.531 13.122 21.663  1.00 46.89 ? 17  ARG A CD    1 
ATOM   144  N  NE    . ARG A 1 41  ? 52.549 13.673 20.743  1.00 52.71 ? 17  ARG A NE    1 
ATOM   145  C  CZ    . ARG A 1 41  ? 53.567 14.466 21.084  1.00 52.28 ? 17  ARG A CZ    1 
ATOM   146  N  NH1   . ARG A 1 41  ? 54.395 14.905 20.140  1.00 45.75 ? 17  ARG A NH1   1 
ATOM   147  N  NH2   . ARG A 1 41  ? 53.781 14.816 22.352  1.00 51.57 ? 17  ARG A NH2   1 
ATOM   148  N  N     . CYS A 1 42  ? 53.148 7.401  22.011  1.00 18.80 ? 18  CYS A N     1 
ATOM   149  C  CA    . CYS A 1 42  ? 53.105 6.084  21.352  1.00 19.23 ? 18  CYS A CA    1 
ATOM   150  C  C     . CYS A 1 42  ? 52.052 5.208  22.020  1.00 21.52 ? 18  CYS A C     1 
ATOM   151  O  O     . CYS A 1 42  ? 51.610 5.511  23.136  1.00 20.77 ? 18  CYS A O     1 
ATOM   152  C  CB    . CYS A 1 42  ? 54.478 5.393  21.346  1.00 20.37 ? 18  CYS A CB    1 
ATOM   153  S  SG    . CYS A 1 42  ? 55.050 4.840  22.961  1.00 22.02 ? 18  CYS A SG    1 
ATOM   154  N  N     . ASN A 1 43  ? 51.642 4.143  21.335  1.00 23.28 ? 19  ASN A N     1 
ATOM   155  C  CA    . ASN A 1 43  ? 50.778 3.138  21.953  1.00 27.81 ? 19  ASN A CA    1 
ATOM   156  C  C     . ASN A 1 43  ? 51.598 2.141  22.774  1.00 26.01 ? 19  ASN A C     1 
ATOM   157  O  O     . ASN A 1 43  ? 52.832 2.135  22.719  1.00 23.66 ? 19  ASN A O     1 
ATOM   158  C  CB    . ASN A 1 43  ? 49.856 2.442  20.933  1.00 31.57 ? 19  ASN A CB    1 
ATOM   159  C  CG    . ASN A 1 43  ? 50.605 1.622  19.892  1.00 30.23 ? 19  ASN A CG    1 
ATOM   160  O  OD1   . ASN A 1 43  ? 51.689 1.084  20.144  1.00 28.86 ? 19  ASN A OD1   1 
ATOM   161  N  ND2   . ASN A 1 43  ? 50.001 1.498  18.711  1.00 35.10 ? 19  ASN A ND2   1 
ATOM   162  N  N     . ASP A 1 44  ? 50.902 1.312  23.543  1.00 27.82 ? 20  ASP A N     1 
ATOM   163  C  CA    . ASP A 1 44  ? 51.541 0.373  24.461  1.00 28.49 ? 20  ASP A CA    1 
ATOM   164  C  C     . ASP A 1 44  ? 52.440 -0.629 23.727  1.00 24.10 ? 20  ASP A C     1 
ATOM   165  O  O     . ASP A 1 44  ? 53.550 -0.936 24.176  1.00 25.62 ? 20  ASP A O     1 
ATOM   166  C  CB    . ASP A 1 44  ? 50.469 -0.353 25.289  1.00 30.34 ? 20  ASP A CB    1 
ATOM   167  C  CG    . ASP A 1 44  ? 49.551 0.609  26.037  1.00 33.38 ? 20  ASP A CG    1 
ATOM   168  O  OD1   . ASP A 1 44  ? 49.970 1.755  26.317  1.00 33.76 ? 20  ASP A OD1   1 
ATOM   169  O  OD2   . ASP A 1 44  ? 48.404 0.217  26.353  1.00 37.09 ? 20  ASP A OD2   1 
ATOM   170  N  N     . GLN A 1 45  ? 51.966 -1.097 22.576  1.00 23.39 ? 21  GLN A N     1 
ATOM   171  C  CA    . GLN A 1 45  ? 52.668 -2.110 21.800  1.00 23.50 ? 21  GLN A CA    1 
ATOM   172  C  C     . GLN A 1 45  ? 54.000 -1.617 21.251  1.00 20.14 ? 21  GLN A C     1 
ATOM   173  O  O     . GLN A 1 45  ? 54.909 -2.411 21.066  1.00 22.31 ? 21  GLN A O     1 
ATOM   174  C  CB    . GLN A 1 45  ? 51.785 -2.631 20.662  1.00 25.96 ? 21  GLN A CB    1 
ATOM   175  C  CG    . GLN A 1 45  ? 52.152 -4.026 20.172  1.00 30.04 ? 21  GLN A CG    1 
ATOM   176  C  CD    . GLN A 1 45  ? 52.185 -5.064 21.281  1.00 36.02 ? 21  GLN A CD    1 
ATOM   177  O  OE1   . GLN A 1 45  ? 53.122 -5.857 21.373  1.00 44.46 ? 21  GLN A OE1   1 
ATOM   178  N  NE2   . GLN A 1 45  ? 51.165 -5.062 22.133  1.00 38.20 ? 21  GLN A NE2   1 
ATOM   179  N  N     . PHE A 1 46  ? 54.113 -0.308 21.022  1.00 20.82 ? 22  PHE A N     1 
ATOM   180  C  CA    . PHE A 1 46  ? 55.362 0.272  20.521  1.00 18.67 ? 22  PHE A CA    1 
ATOM   181  C  C     . PHE A 1 46  ? 56.538 -0.029 21.460  1.00 19.14 ? 22  PHE A C     1 
ATOM   182  O  O     . PHE A 1 46  ? 57.630 -0.358 21.001  1.00 20.53 ? 22  PHE A O     1 
ATOM   183  C  CB    . PHE A 1 46  ? 55.222 1.785  20.302  1.00 20.14 ? 22  PHE A CB    1 
ATOM   184  C  CG    . PHE A 1 46  ? 56.468 2.440  19.771  1.00 19.97 ? 22  PHE A CG    1 
ATOM   185  C  CD1   . PHE A 1 46  ? 57.439 2.931  20.638  1.00 19.10 ? 22  PHE A CD1   1 
ATOM   186  C  CD2   . PHE A 1 46  ? 56.658 2.580  18.399  1.00 21.49 ? 22  PHE A CD2   1 
ATOM   187  C  CE1   . PHE A 1 46  ? 58.586 3.534  20.151  1.00 19.59 ? 22  PHE A CE1   1 
ATOM   188  C  CE2   . PHE A 1 46  ? 57.805 3.185  17.901  1.00 21.78 ? 22  PHE A CE2   1 
ATOM   189  C  CZ    . PHE A 1 46  ? 58.761 3.669  18.779  1.00 20.75 ? 22  PHE A CZ    1 
ATOM   190  N  N     . LEU A 1 47  ? 56.309 0.086  22.771  1.00 19.69 ? 23  LEU A N     1 
ATOM   191  C  CA    . LEU A 1 47  ? 57.355 -0.166 23.767  1.00 18.90 ? 23  LEU A CA    1 
ATOM   192  C  C     . LEU A 1 47  ? 57.799 -1.623 23.723  1.00 19.94 ? 23  LEU A C     1 
ATOM   193  O  O     . LEU A 1 47  ? 58.990 -1.923 23.785  1.00 20.66 ? 23  LEU A O     1 
ATOM   194  C  CB    . LEU A 1 47  ? 56.864 0.194  25.177  1.00 18.71 ? 23  LEU A CB    1 
ATOM   195  C  CG    . LEU A 1 47  ? 56.493 1.659  25.421  1.00 17.98 ? 23  LEU A CG    1 
ATOM   196  C  CD1   . LEU A 1 47  ? 56.169 1.831  26.897  1.00 19.25 ? 23  LEU A CD1   1 
ATOM   197  C  CD2   . LEU A 1 47  ? 57.626 2.597  25.027  1.00 19.55 ? 23  LEU A CD2   1 
ATOM   198  N  N     . ILE A 1 48  ? 56.821 -2.517 23.606  1.00 20.99 ? 24  ILE A N     1 
ATOM   199  C  CA    . ILE A 1 48  ? 57.069 -3.952 23.554  1.00 22.68 ? 24  ILE A CA    1 
ATOM   200  C  C     . ILE A 1 48  ? 57.805 -4.317 22.264  1.00 22.57 ? 24  ILE A C     1 
ATOM   201  O  O     . ILE A 1 48  ? 58.819 -5.013 22.314  1.00 25.24 ? 24  ILE A O     1 
ATOM   202  C  CB    . ILE A 1 48  ? 55.754 -4.744 23.710  1.00 24.95 ? 24  ILE A CB    1 
ATOM   203  C  CG1   . ILE A 1 48  ? 55.171 -4.507 25.111  1.00 25.77 ? 24  ILE A CG1   1 
ATOM   204  C  CG2   . ILE A 1 48  ? 55.983 -6.229 23.458  1.00 27.61 ? 24  ILE A CG2   1 
ATOM   205  C  CD1   . ILE A 1 48  ? 53.677 -4.721 25.218  1.00 28.64 ? 24  ILE A CD1   1 
ATOM   206  N  N     . ASP A 1 49  ? 57.317 -3.818 21.126  1.00 21.32 ? 25  ASP A N     1 
ATOM   207  C  CA    . ASP A 1 49  ? 57.927 -4.129 19.829  1.00 21.33 ? 25  ASP A CA    1 
ATOM   208  C  C     . ASP A 1 49  ? 59.374 -3.652 19.742  1.00 22.20 ? 25  ASP A C     1 
ATOM   209  O  O     . ASP A 1 49  ? 60.196 -4.258 19.053  1.00 24.44 ? 25  ASP A O     1 
ATOM   210  C  CB    . ASP A 1 49  ? 57.131 -3.508 18.677  1.00 21.57 ? 25  ASP A CB    1 
ATOM   211  C  CG    . ASP A 1 49  ? 55.740 -4.098 18.529  1.00 24.66 ? 25  ASP A CG    1 
ATOM   212  O  OD1   . ASP A 1 49  ? 55.452 -5.178 19.102  1.00 26.80 ? 25  ASP A OD1   1 
ATOM   213  O  OD2   . ASP A 1 49  ? 54.934 -3.475 17.817  1.00 25.51 ? 25  ASP A OD2   1 
ATOM   214  N  N     . ASN A 1 50  ? 59.678 -2.567 20.451  1.00 19.52 ? 26  ASN A N     1 
ATOM   215  C  CA    . ASN A 1 50  ? 61.008 -1.963 20.409  1.00 20.82 ? 26  ASN A CA    1 
ATOM   216  C  C     . ASN A 1 50  ? 61.869 -2.260 21.621  1.00 20.79 ? 26  ASN A C     1 
ATOM   217  O  O     . ASN A 1 50  ? 62.963 -1.719 21.753  1.00 23.30 ? 26  ASN A O     1 
ATOM   218  C  CB    . ASN A 1 50  ? 60.891 -0.461 20.160  1.00 20.14 ? 26  ASN A CB    1 
ATOM   219  C  CG    . ASN A 1 50  ? 60.466 -0.163 18.738  1.00 20.37 ? 26  ASN A CG    1 
ATOM   220  O  OD1   . ASN A 1 50  ? 61.253 -0.320 17.810  1.00 25.81 ? 26  ASN A OD1   1 
ATOM   221  N  ND2   . ASN A 1 50  ? 59.202 0.214  18.553  1.00 21.06 ? 26  ASN A ND2   1 
ATOM   222  N  N     . GLN A 1 51  ? 61.382 -3.154 22.484  1.00 23.32 ? 27  GLN A N     1 
ATOM   223  C  CA    . GLN A 1 51  ? 62.123 -3.586 23.669  1.00 25.42 ? 27  GLN A CA    1 
ATOM   224  C  C     . GLN A 1 51  ? 62.613 -2.392 24.514  1.00 23.27 ? 27  GLN A C     1 
ATOM   225  O  O     . GLN A 1 51  ? 63.757 -2.358 25.002  1.00 25.57 ? 27  GLN A O     1 
ATOM   226  C  CB    . GLN A 1 51  ? 63.257 -4.539 23.262  1.00 28.75 ? 27  GLN A CB    1 
ATOM   227  C  CG    . GLN A 1 51  ? 62.755 -5.818 22.594  1.00 35.98 ? 27  GLN A CG    1 
ATOM   228  C  CD    . GLN A 1 51  ? 63.855 -6.682 22.000  1.00 44.64 ? 27  GLN A CD    1 
ATOM   229  O  OE1   . GLN A 1 51  ? 64.877 -6.183 21.525  1.00 48.29 ? 27  GLN A OE1   1 
ATOM   230  N  NE2   . GLN A 1 51  ? 63.638 -7.992 22.007  1.00 46.43 ? 27  GLN A NE2   1 
ATOM   231  N  N     . ILE A 1 52  ? 61.722 -1.411 24.666  1.00 18.51 ? 28  ILE A N     1 
ATOM   232  C  CA    . ILE A 1 52  ? 61.957 -0.241 25.515  1.00 18.77 ? 28  ILE A CA    1 
ATOM   233  C  C     . ILE A 1 52  ? 61.355 -0.568 26.873  1.00 17.83 ? 28  ILE A C     1 
ATOM   234  O  O     . ILE A 1 52  ? 60.175 -0.908 26.954  1.00 20.54 ? 28  ILE A O     1 
ATOM   235  C  CB    . ILE A 1 52  ? 61.272 1.031  24.949  1.00 18.43 ? 28  ILE A CB    1 
ATOM   236  C  CG1   . ILE A 1 52  ? 61.877 1.413  23.591  1.00 20.55 ? 28  ILE A CG1   1 
ATOM   237  C  CG2   . ILE A 1 52  ? 61.349 2.192  25.944  1.00 19.05 ? 28  ILE A CG2   1 
ATOM   238  C  CD1   . ILE A 1 52  ? 61.024 2.342  22.752  1.00 19.37 ? 28  ILE A CD1   1 
ATOM   239  N  N     . THR A 1 53  ? 62.153 -0.454 27.928  1.00 17.79 ? 29  THR A N     1 
ATOM   240  C  CA    . THR A 1 53  ? 61.664 -0.711 29.272  1.00 19.49 ? 29  THR A CA    1 
ATOM   241  C  C     . THR A 1 53  ? 60.776 0.455  29.707  1.00 18.19 ? 29  THR A C     1 
ATOM   242  O  O     . THR A 1 53  ? 61.221 1.610  29.776  1.00 18.10 ? 29  THR A O     1 
ATOM   243  C  CB    . THR A 1 53  ? 62.823 -0.929 30.245  1.00 20.78 ? 29  THR A CB    1 
ATOM   244  O  OG1   . THR A 1 53  ? 63.568 -2.080 29.837  1.00 21.65 ? 29  THR A OG1   1 
ATOM   245  C  CG2   . THR A 1 53  ? 62.307 -1.133 31.661  1.00 21.32 ? 29  THR A CG2   1 
ATOM   246  N  N     . LYS A 1 54  ? 59.506 0.157  29.954  1.00 20.39 ? 30  LYS A N     1 
ATOM   247  C  CA    . LYS A 1 54  ? 58.534 1.195  30.261  1.00 18.93 ? 30  LYS A CA    1 
ATOM   248  C  C     . LYS A 1 54  ? 58.882 1.900  31.575  1.00 17.94 ? 30  LYS A C     1 
ATOM   249  O  O     . LYS A 1 54  ? 59.288 1.253  32.546  1.00 20.55 ? 30  LYS A O     1 
ATOM   250  C  CB    . LYS A 1 54  ? 57.117 0.606  30.326  1.00 21.34 ? 30  LYS A CB    1 
ATOM   251  C  CG    . LYS A 1 54  ? 56.047 1.650  30.598  1.00 22.54 ? 30  LYS A CG    1 
ATOM   252  C  CD    . LYS A 1 54  ? 54.635 1.113  30.459  1.00 22.40 ? 30  LYS A CD    1 
ATOM   253  C  CE    . LYS A 1 54  ? 53.619 2.214  30.699  1.00 22.49 ? 30  LYS A CE    1 
ATOM   254  N  NZ    . LYS A 1 54  ? 52.220 1.749  30.505  1.00 23.68 ? 30  LYS A NZ    1 
ATOM   255  N  N     . ALA A 1 55  ? 58.737 3.226  31.576  1.00 18.38 ? 31  ALA A N     1 
ATOM   256  C  CA    . ALA A 1 55  ? 58.906 4.073  32.770  1.00 18.97 ? 31  ALA A CA    1 
ATOM   257  C  C     . ALA A 1 55  ? 60.358 4.259  33.213  1.00 19.29 ? 31  ALA A C     1 
ATOM   258  O  O     . ALA A 1 55  ? 60.628 4.903  34.231  1.00 21.44 ? 31  ALA A O     1 
ATOM   259  C  CB    . ALA A 1 55  ? 58.033 3.583  33.936  1.00 19.95 ? 31  ALA A CB    1 
ATOM   260  N  N     . ALA A 1 56  ? 61.288 3.709  32.439  1.00 18.92 ? 32  ALA A N     1 
ATOM   261  C  CA    . ALA A 1 56  ? 62.698 3.716  32.798  1.00 17.45 ? 32  ALA A CA    1 
ATOM   262  C  C     . ALA A 1 56  ? 63.536 4.599  31.880  1.00 17.28 ? 32  ALA A C     1 
ATOM   263  O  O     . ALA A 1 56  ? 63.092 5.014  30.802  1.00 17.79 ? 32  ALA A O     1 
ATOM   264  C  CB    . ALA A 1 56  ? 63.242 2.295  32.787  1.00 20.47 ? 32  ALA A CB    1 
HETATM 265  N  N     . MSE A 1 57  ? 64.757 4.862  32.327  1.00 18.67 ? 33  MSE A N     1 
HETATM 266  C  CA    . MSE A 1 57  ? 65.777 5.519  31.520  1.00 17.94 ? 33  MSE A CA    1 
HETATM 267  C  C     . MSE A 1 57  ? 66.596 4.410  30.901  1.00 18.33 ? 33  MSE A C     1 
HETATM 268  O  O     . MSE A 1 57  ? 67.276 3.645  31.600  1.00 18.42 ? 33  MSE A O     1 
HETATM 269  C  CB    . MSE A 1 57  ? 66.614 6.404  32.435  1.00 18.53 ? 33  MSE A CB    1 
HETATM 270  C  CG    . MSE A 1 57  ? 67.351 7.473  31.644  1.00 20.69 ? 33  MSE A CG    1 
HETATM 271  SE SE    . MSE A 1 57  ? 68.951 6.723  30.781  1.00 31.93 ? 33  MSE A SE    1 
HETATM 272  C  CE    . MSE A 1 57  ? 69.864 6.164  32.424  1.00 21.13 ? 33  MSE A CE    1 
ATOM   273  N  N     . ASN A 1 58  ? 66.493 4.303  29.573  1.00 18.09 ? 34  ASN A N     1 
ATOM   274  C  CA    . ASN A 1 58  ? 67.177 3.286  28.785  1.00 17.67 ? 34  ASN A CA    1 
ATOM   275  C  C     . ASN A 1 58  ? 68.363 3.941  28.067  1.00 17.65 ? 34  ASN A C     1 
ATOM   276  O  O     . ASN A 1 58  ? 68.160 4.785  27.187  1.00 17.87 ? 34  ASN A O     1 
ATOM   277  C  CB    . ASN A 1 58  ? 66.246 2.722  27.696  1.00 17.26 ? 34  ASN A CB    1 
ATOM   278  C  CG    . ASN A 1 58  ? 65.009 2.003  28.239  1.00 19.83 ? 34  ASN A CG    1 
ATOM   279  O  OD1   . ASN A 1 58  ? 64.957 0.767  28.247  1.00 22.65 ? 34  ASN A OD1   1 
ATOM   280  N  ND2   . ASN A 1 58  ? 63.990 2.767  28.635  1.00 19.49 ? 34  ASN A ND2   1 
ATOM   281  N  N     . LEU A 1 59  ? 69.583 3.565  28.427  1.00 17.49 ? 35  LEU A N     1 
ATOM   282  C  CA    . LEU A 1 59  ? 70.769 4.061  27.709  1.00 16.04 ? 35  LEU A CA    1 
ATOM   283  C  C     . LEU A 1 59  ? 70.887 3.402  26.342  1.00 18.16 ? 35  LEU A C     1 
ATOM   284  O  O     . LEU A 1 59  ? 70.648 2.209  26.197  1.00 21.63 ? 35  LEU A O     1 
ATOM   285  C  CB    . LEU A 1 59  ? 72.058 3.860  28.504  1.00 18.26 ? 35  LEU A CB    1 
ATOM   286  C  CG    . LEU A 1 59  ? 72.214 4.735  29.754  1.00 20.38 ? 35  LEU A CG    1 
ATOM   287  C  CD1   . LEU A 1 59  ? 73.327 4.178  30.629  1.00 24.85 ? 35  LEU A CD1   1 
ATOM   288  C  CD2   . LEU A 1 59  ? 72.472 6.194  29.390  1.00 21.45 ? 35  LEU A CD2   1 
ATOM   289  N  N     . ILE A 1 60  ? 71.247 4.201  25.342  1.00 17.35 ? 36  ILE A N     1 
ATOM   290  C  CA    . ILE A 1 60  ? 71.356 3.730  23.964  1.00 18.93 ? 36  ILE A CA    1 
ATOM   291  C  C     . ILE A 1 60  ? 72.600 4.298  23.295  1.00 19.92 ? 36  ILE A C     1 
ATOM   292  O  O     . ILE A 1 60  ? 73.047 5.402  23.628  1.00 19.28 ? 36  ILE A O     1 
ATOM   293  C  CB    . ILE A 1 60  ? 70.108 4.098  23.117  1.00 17.53 ? 36  ILE A CB    1 
ATOM   294  C  CG1   . ILE A 1 60  ? 69.988 5.626  22.913  1.00 18.61 ? 36  ILE A CG1   1 
ATOM   295  C  CG2   . ILE A 1 60  ? 68.836 3.525  23.756  1.00 21.21 ? 36  ILE A CG2   1 
ATOM   296  C  CD1   . ILE A 1 60  ? 68.772 6.086  22.140  1.00 19.87 ? 36  ILE A CD1   1 
ATOM   297  N  N     . ASP A 1 61  ? 73.146 3.542  22.345  1.00 20.64 ? 37  ASP A N     1 
ATOM   298  C  CA    . ASP A 1 61  ? 74.275 4.037  21.562  1.00 19.95 ? 37  ASP A CA    1 
ATOM   299  C  C     . ASP A 1 61  ? 73.769 4.769  20.317  1.00 22.10 ? 37  ASP A C     1 
ATOM   300  O  O     . ASP A 1 61  ? 72.547 4.908  20.109  1.00 20.83 ? 37  ASP A O     1 
ATOM   301  C  CB    . ASP A 1 61  ? 75.300 2.931  21.240  1.00 20.95 ? 37  ASP A CB    1 
ATOM   302  C  CG    . ASP A 1 61  ? 74.745 1.810  20.354  1.00 23.94 ? 37  ASP A CG    1 
ATOM   303  O  OD1   . ASP A 1 61  ? 73.711 1.978  19.677  1.00 24.75 ? 37  ASP A OD1   1 
ATOM   304  O  OD2   . ASP A 1 61  ? 75.382 0.730  20.330  1.00 28.86 ? 37  ASP A OD2   1 
ATOM   305  N  N     . ALA A 1 62  ? 74.711 5.265  19.521  1.00 22.20 ? 38  ALA A N     1 
ATOM   306  C  CA    . ALA A 1 62  ? 74.410 6.098  18.359  1.00 24.41 ? 38  ALA A CA    1 
ATOM   307  C  C     . ALA A 1 62  ? 73.570 5.355  17.320  1.00 23.19 ? 38  ALA A C     1 
ATOM   308  O  O     . ALA A 1 62  ? 72.616 5.919  16.766  1.00 24.50 ? 38  ALA A O     1 
ATOM   309  C  CB    . ALA A 1 62  ? 75.704 6.613  17.740  1.00 24.98 ? 38  ALA A CB    1 
ATOM   310  N  N     . GLU A 1 63  ? 73.928 4.094  17.072  1.00 23.64 ? 39  GLU A N     1 
ATOM   311  C  CA    . GLU A 1 63  ? 73.214 3.237  16.143  1.00 24.66 ? 39  GLU A CA    1 
ATOM   312  C  C     . GLU A 1 63  ? 71.769 3.033  16.590  1.00 22.23 ? 39  GLU A C     1 
ATOM   313  O  O     . GLU A 1 63  ? 70.849 3.183  15.786  1.00 23.67 ? 39  GLU A O     1 
ATOM   314  C  CB    . GLU A 1 63  ? 73.923 1.885  15.996  1.00 28.52 ? 39  GLU A CB    1 
ATOM   315  C  CG    . GLU A 1 63  ? 73.200 0.887  15.094  1.00 34.26 ? 39  GLU A CG    1 
ATOM   316  C  CD    . GLU A 1 63  ? 73.950 -0.430 14.900  1.00 24.93 ? 39  GLU A CD    1 
ATOM   317  O  OE1   . GLU A 1 63  ? 75.090 -0.553 15.407  1.00 42.71 ? 39  GLU A OE1   1 
ATOM   318  O  OE2   . GLU A 1 63  ? 73.418 -1.306 14.257  1.00 40.78 ? 39  GLU A OE2   1 
ATOM   319  N  N     . ARG A 1 64  ? 71.583 2.710  17.871  1.00 20.84 ? 40  ARG A N     1 
ATOM   320  C  CA    . ARG A 1 64  ? 70.239 2.506  18.416  1.00 18.53 ? 40  ARG A CA    1 
ATOM   321  C  C     . ARG A 1 64  ? 69.430 3.805  18.397  1.00 19.15 ? 40  ARG A C     1 
ATOM   322  O  O     . ARG A 1 64  ? 68.226 3.783  18.136  1.00 21.81 ? 40  ARG A O     1 
ATOM   323  C  CB    . ARG A 1 64  ? 70.273 1.895  19.829  1.00 17.87 ? 40  ARG A CB    1 
ATOM   324  C  CG    . ARG A 1 64  ? 68.865 1.703  20.399  1.00 21.97 ? 40  ARG A CG    1 
ATOM   325  C  CD    . ARG A 1 64  ? 68.698 0.472  21.279  1.00 27.29 ? 40  ARG A CD    1 
ATOM   326  N  NE    . ARG A 1 64  ? 67.361 0.446  21.878  1.00 27.48 ? 40  ARG A NE    1 
ATOM   327  C  CZ    . ARG A 1 64  ? 66.269 -0.080 21.323  1.00 28.35 ? 40  ARG A CZ    1 
ATOM   328  N  NH1   . ARG A 1 64  ? 66.311 -0.675 20.129  1.00 32.97 ? 40  ARG A NH1   1 
ATOM   329  N  NH2   . ARG A 1 64  ? 65.120 -0.022 21.982  1.00 29.99 ? 40  ARG A NH2   1 
ATOM   330  N  N     . ALA A 1 65  ? 70.084 4.935  18.670  1.00 18.62 ? 41  ALA A N     1 
ATOM   331  C  CA    . ALA A 1 65  ? 69.406 6.231  18.568  1.00 18.80 ? 41  ALA A CA    1 
ATOM   332  C  C     . ALA A 1 65  ? 68.845 6.478  17.165  1.00 19.40 ? 41  ALA A C     1 
ATOM   333  O  O     . ALA A 1 65  ? 67.683 6.854  17.020  1.00 18.37 ? 41  ALA A O     1 
ATOM   334  C  CB    . ALA A 1 65  ? 70.308 7.372  19.013  1.00 19.03 ? 41  ALA A CB    1 
ATOM   335  N  N     . GLU A 1 66  ? 69.654 6.208  16.140  1.00 20.65 ? 42  GLU A N     1 
ATOM   336  C  CA    . GLU A 1 66  ? 69.206 6.361  14.752  1.00 20.98 ? 42  GLU A CA    1 
ATOM   337  C  C     . GLU A 1 66  ? 68.023 5.434  14.449  1.00 20.76 ? 42  GLU A C     1 
ATOM   338  O  O     . GLU A 1 66  ? 67.036 5.854  13.848  1.00 21.36 ? 42  GLU A O     1 
ATOM   339  C  CB    . GLU A 1 66  ? 70.360 6.132  13.760  1.00 26.41 ? 42  GLU A CB    1 
ATOM   340  C  CG    . GLU A 1 66  ? 71.456 7.198  13.800  1.00 31.32 ? 42  GLU A CG    1 
ATOM   341  C  CD    . GLU A 1 66  ? 71.022 8.563  13.267  1.00 41.67 ? 42  GLU A CD    1 
ATOM   342  O  OE1   . GLU A 1 66  ? 69.863 8.719  12.819  1.00 46.25 ? 42  GLU A OE1   1 
ATOM   343  O  OE2   . GLU A 1 66  ? 71.854 9.493  13.293  1.00 49.41 ? 42  GLU A OE2   1 
ATOM   344  N  N     . LEU A 1 67  ? 68.109 4.193  14.916  1.00 21.79 ? 43  LEU A N     1 
ATOM   345  C  CA    . LEU A 1 67  ? 67.056 3.218  14.688  1.00 21.64 ? 43  LEU A CA    1 
ATOM   346  C  C     . LEU A 1 67  ? 65.739 3.637  15.355  1.00 19.54 ? 43  LEU A C     1 
ATOM   347  O  O     . LEU A 1 67  ? 64.699 3.690  14.701  1.00 19.05 ? 43  LEU A O     1 
ATOM   348  C  CB    . LEU A 1 67  ? 67.499 1.838  15.174  1.00 22.42 ? 43  LEU A CB    1 
ATOM   349  C  CG    . LEU A 1 67  ? 66.498 0.686  15.124  1.00 25.72 ? 43  LEU A CG    1 
ATOM   350  C  CD1   . LEU A 1 67  ? 66.118 0.383  13.685  1.00 27.50 ? 43  LEU A CD1   1 
ATOM   351  C  CD2   . LEU A 1 67  ? 67.100 -0.538 15.794  1.00 32.93 ? 43  LEU A CD2   1 
ATOM   352  N  N     . LEU A 1 68  ? 65.787 3.956  16.649  1.00 18.36 ? 44  LEU A N     1 
ATOM   353  C  CA    . LEU A 1 68  ? 64.561 4.362  17.348  1.00 18.13 ? 44  LEU A CA    1 
ATOM   354  C  C     . LEU A 1 68  ? 63.966 5.636  16.755  1.00 17.83 ? 44  LEU A C     1 
ATOM   355  O  O     . LEU A 1 68  ? 62.749 5.742  16.588  1.00 17.68 ? 44  LEU A O     1 
ATOM   356  C  CB    . LEU A 1 68  ? 64.793 4.554  18.849  1.00 21.38 ? 44  LEU A CB    1 
ATOM   357  C  CG    . LEU A 1 68  ? 64.902 3.336  19.754  1.00 24.01 ? 44  LEU A CG    1 
ATOM   358  C  CD1   . LEU A 1 68  ? 65.241 3.837  21.146  1.00 22.22 ? 44  LEU A CD1   1 
ATOM   359  C  CD2   . LEU A 1 68  ? 63.608 2.532  19.763  1.00 26.82 ? 44  LEU A CD2   1 
ATOM   360  N  N     . TYR A 1 69  ? 64.820 6.597  16.414  1.00 17.04 ? 45  TYR A N     1 
ATOM   361  C  CA    . TYR A 1 69  ? 64.325 7.835  15.829  1.00 18.20 ? 45  TYR A CA    1 
ATOM   362  C  C     . TYR A 1 69  ? 63.607 7.553  14.504  1.00 17.61 ? 45  TYR A C     1 
ATOM   363  O  O     . TYR A 1 69  ? 62.587 8.176  14.209  1.00 17.87 ? 45  TYR A O     1 
ATOM   364  C  CB    . TYR A 1 69  ? 65.461 8.823  15.612  1.00 18.46 ? 45  TYR A CB    1 
ATOM   365  C  CG    . TYR A 1 69  ? 65.059 10.269 15.400  1.00 17.15 ? 45  TYR A CG    1 
ATOM   366  C  CD1   . TYR A 1 69  ? 64.088 10.900 16.203  1.00 18.15 ? 45  TYR A CD1   1 
ATOM   367  C  CD2   . TYR A 1 69  ? 65.705 11.050 14.429  1.00 17.40 ? 45  TYR A CD2   1 
ATOM   368  C  CE1   . TYR A 1 69  ? 63.760 12.243 16.014  1.00 16.65 ? 45  TYR A CE1   1 
ATOM   369  C  CE2   . TYR A 1 69  ? 65.392 12.390 14.246  1.00 18.11 ? 45  TYR A CE2   1 
ATOM   370  C  CZ    . TYR A 1 69  ? 64.426 12.991 15.036  1.00 16.68 ? 45  TYR A CZ    1 
ATOM   371  O  OH    . TYR A 1 69  ? 64.141 14.325 14.839  1.00 16.77 ? 45  TYR A OH    1 
ATOM   372  N  N     . SER A 1 70  ? 64.119 6.601  13.721  1.00 18.96 ? 46  SER A N     1 
ATOM   373  C  CA    . SER A 1 70  ? 63.483 6.247  12.449  1.00 20.03 ? 46  SER A CA    1 
ATOM   374  C  C     . SER A 1 70  ? 62.051 5.710  12.637  1.00 19.55 ? 46  SER A C     1 
ATOM   375  O  O     . SER A 1 70  ? 61.230 5.796  11.726  1.00 22.15 ? 46  SER A O     1 
ATOM   376  C  CB    . SER A 1 70  ? 64.332 5.238  11.665  1.00 21.69 ? 46  SER A CB    1 
ATOM   377  O  OG    . SER A 1 70  ? 64.159 3.911  12.151  1.00 23.32 ? 46  SER A OG    1 
ATOM   378  N  N     . ARG A 1 71  ? 61.774 5.150  13.822  1.00 18.99 ? 47  ARG A N     1 
ATOM   379  C  CA    . ARG A 1 71  ? 60.464 4.574  14.130  1.00 18.35 ? 47  ARG A CA    1 
ATOM   380  C  C     . ARG A 1 71  ? 59.555 5.526  14.907  1.00 17.94 ? 47  ARG A C     1 
ATOM   381  O  O     . ARG A 1 71  ? 58.353 5.281  15.035  1.00 19.81 ? 47  ARG A O     1 
ATOM   382  C  CB    . ARG A 1 71  ? 60.633 3.271  14.906  1.00 18.45 ? 47  ARG A CB    1 
ATOM   383  C  CG    . ARG A 1 71  ? 61.392 2.215  14.122  1.00 21.49 ? 47  ARG A CG    1 
ATOM   384  C  CD    . ARG A 1 71  ? 61.519 0.928  14.905  1.00 22.09 ? 47  ARG A CD    1 
ATOM   385  N  NE    . ARG A 1 71  ? 61.999 -0.149 14.055  1.00 23.36 ? 47  ARG A NE    1 
ATOM   386  C  CZ    . ARG A 1 71  ? 61.849 -1.439 14.322  1.00 24.21 ? 47  ARG A CZ    1 
ATOM   387  N  NH1   . ARG A 1 71  ? 61.243 -1.823 15.442  1.00 25.89 ? 47  ARG A NH1   1 
ATOM   388  N  NH2   . ARG A 1 71  ? 62.313 -2.344 13.467  1.00 24.56 ? 47  ARG A NH2   1 
HETATM 389  N  N     . MSE A 1 72  ? 60.136 6.606  15.421  1.00 16.80 ? 48  MSE A N     1 
HETATM 390  C  CA    . MSE A 1 72  ? 59.405 7.562  16.238  1.00 17.18 ? 48  MSE A CA    1 
HETATM 391  C  C     . MSE A 1 72  ? 58.537 8.443  15.380  1.00 17.64 ? 48  MSE A C     1 
HETATM 392  O  O     . MSE A 1 72  ? 58.901 8.827  14.267  1.00 18.38 ? 48  MSE A O     1 
HETATM 393  C  CB    . MSE A 1 72  ? 60.436 8.398  16.985  1.00 20.59 ? 48  MSE A CB    1 
HETATM 394  C  CG    . MSE A 1 72  ? 59.741 9.300  17.999  1.00 24.48 ? 48  MSE A CG    1 
HETATM 395  SE SE    . MSE A 1 72  ? 61.158 10.334 18.852  1.00 37.33 ? 48  MSE A SE    1 
HETATM 396  C  CE    . MSE A 1 72  ? 60.458 10.351 20.690  1.00 30.65 ? 48  MSE A CE    1 
ATOM   397  N  N     . GLY A 1 73  ? 57.368 8.793  15.901  1.00 17.74 ? 49  GLY A N     1 
ATOM   398  C  CA    . GLY A 1 73  ? 56.465 9.694  15.218  1.00 18.19 ? 49  GLY A CA    1 
ATOM   399  C  C     . GLY A 1 73  ? 56.969 11.128 15.220  1.00 17.39 ? 49  GLY A C     1 
ATOM   400  O  O     . GLY A 1 73  ? 58.057 11.407 15.722  1.00 17.56 ? 49  GLY A O     1 
ATOM   401  N  N     . PRO A 1 74  ? 56.183 12.051 14.654  1.00 18.66 ? 50  PRO A N     1 
ATOM   402  C  CA    . PRO A 1 74  ? 56.513 13.480 14.745  1.00 18.45 ? 50  PRO A CA    1 
ATOM   403  C  C     . PRO A 1 74  ? 56.698 13.854 16.216  1.00 18.95 ? 50  PRO A C     1 
ATOM   404  O  O     . PRO A 1 74  ? 55.929 13.399 17.070  1.00 21.63 ? 50  PRO A O     1 
ATOM   405  C  CB    . PRO A 1 74  ? 55.268 14.159 14.168  1.00 20.27 ? 50  PRO A CB    1 
ATOM   406  C  CG    . PRO A 1 74  ? 54.682 13.139 13.250  1.00 20.06 ? 50  PRO A CG    1 
ATOM   407  C  CD    . PRO A 1 74  ? 54.927 11.819 13.922  1.00 20.59 ? 50  PRO A CD    1 
ATOM   408  N  N     . ALA A 1 75  ? 57.720 14.646 16.508  1.00 17.53 ? 51  ALA A N     1 
ATOM   409  C  CA    . ALA A 1 75  ? 58.098 14.941 17.890  1.00 16.61 ? 51  ALA A CA    1 
ATOM   410  C  C     . ALA A 1 75  ? 58.135 16.432 18.166  1.00 16.51 ? 51  ALA A C     1 
ATOM   411  O  O     . ALA A 1 75  ? 58.044 17.257 17.257  1.00 17.74 ? 51  ALA A O     1 
ATOM   412  C  CB    . ALA A 1 75  ? 59.448 14.310 18.209  1.00 18.65 ? 51  ALA A CB    1 
ATOM   413  N  N     . LEU A 1 76  ? 58.266 16.781 19.439  1.00 15.75 ? 52  LEU A N     1 
ATOM   414  C  CA    . LEU A 1 76  ? 58.612 18.138 19.805  1.00 18.16 ? 52  LEU A CA    1 
ATOM   415  C  C     . LEU A 1 76  ? 59.885 18.096 20.647  1.00 16.83 ? 52  LEU A C     1 
ATOM   416  O  O     . LEU A 1 76  ? 60.176 17.100 21.313  1.00 16.64 ? 52  LEU A O     1 
ATOM   417  C  CB    . LEU A 1 76  ? 57.466 18.825 20.543  1.00 24.71 ? 52  LEU A CB    1 
ATOM   418  C  CG    . LEU A 1 76  ? 57.091 18.452 21.972  1.00 31.55 ? 52  LEU A CG    1 
ATOM   419  C  CD1   . LEU A 1 76  ? 57.867 19.305 22.966  1.00 32.91 ? 52  LEU A CD1   1 
ATOM   420  C  CD2   . LEU A 1 76  ? 55.594 18.645 22.170  1.00 35.99 ? 52  LEU A CD2   1 
ATOM   421  N  N     . GLU A 1 77  ? 60.658 19.169 20.608  1.00 17.38 ? 53  GLU A N     1 
ATOM   422  C  CA    . GLU A 1 77  ? 61.895 19.208 21.378  1.00 15.82 ? 53  GLU A CA    1 
ATOM   423  C  C     . GLU A 1 77  ? 61.788 20.195 22.519  1.00 15.45 ? 53  GLU A C     1 
ATOM   424  O  O     . GLU A 1 77  ? 61.201 21.272 22.373  1.00 16.22 ? 53  GLU A O     1 
ATOM   425  C  CB    . GLU A 1 77  ? 63.105 19.556 20.505  1.00 15.88 ? 53  GLU A CB    1 
ATOM   426  C  CG    . GLU A 1 77  ? 63.461 18.483 19.484  1.00 18.02 ? 53  GLU A CG    1 
ATOM   427  C  CD    . GLU A 1 77  ? 62.429 18.353 18.377  1.00 18.15 ? 53  GLU A CD    1 
ATOM   428  O  OE1   . GLU A 1 77  ? 62.017 17.225 18.052  1.00 21.35 ? 53  GLU A OE1   1 
ATOM   429  O  OE2   . GLU A 1 77  ? 62.014 19.388 17.825  1.00 17.87 ? 53  GLU A OE2   1 
ATOM   430  N  N     . ALA A 1 78  ? 62.373 19.816 23.648  1.00 15.77 ? 54  ALA A N     1 
ATOM   431  C  CA    . ALA A 1 78  ? 62.407 20.677 24.818  1.00 16.81 ? 54  ALA A CA    1 
ATOM   432  C  C     . ALA A 1 78  ? 63.655 20.364 25.616  1.00 14.47 ? 54  ALA A C     1 
ATOM   433  O  O     . ALA A 1 78  ? 64.023 19.184 25.771  1.00 15.57 ? 54  ALA A O     1 
ATOM   434  C  CB    . ALA A 1 78  ? 61.168 20.444 25.680  1.00 19.07 ? 54  ALA A CB    1 
ATOM   435  N  N     . SER A 1 79  ? 64.309 21.396 26.139  1.00 16.32 ? 55  SER A N     1 
ATOM   436  C  CA    . SER A 1 79  ? 65.461 21.185 27.017  1.00 16.14 ? 55  SER A CA    1 
ATOM   437  C  C     . SER A 1 79  ? 65.045 20.342 28.210  1.00 17.84 ? 55  SER A C     1 
ATOM   438  O  O     . SER A 1 79  ? 63.979 20.574 28.801  1.00 19.98 ? 55  SER A O     1 
ATOM   439  C  CB    . SER A 1 79  ? 66.041 22.506 27.506  1.00 19.07 ? 55  SER A CB    1 
ATOM   440  O  OG    . SER A 1 79  ? 66.733 23.165 26.462  1.00 20.80 ? 55  SER A OG    1 
ATOM   441  N  N     . GLY A 1 80  ? 65.870 19.346 28.513  1.00 17.08 ? 56  GLY A N     1 
ATOM   442  C  CA    . GLY A 1 80  ? 65.619 18.388 29.599  1.00 18.64 ? 56  GLY A CA    1 
ATOM   443  C  C     . GLY A 1 80  ? 66.813 18.237 30.529  1.00 16.30 ? 56  GLY A C     1 
ATOM   444  O  O     . GLY A 1 80  ? 67.445 19.223 30.900  1.00 18.01 ? 56  GLY A O     1 
ATOM   445  N  N     . GLY A 1 81  ? 67.136 17.002 30.895  1.00 15.92 ? 57  GLY A N     1 
ATOM   446  C  CA    . GLY A 1 81  ? 68.163 16.751 31.905  1.00 17.76 ? 57  GLY A CA    1 
ATOM   447  C  C     . GLY A 1 81  ? 67.531 16.875 33.282  1.00 16.91 ? 57  GLY A C     1 
ATOM   448  O  O     . GLY A 1 81  ? 66.995 17.928 33.639  1.00 17.83 ? 57  GLY A O     1 
ATOM   449  N  N     . SER A 1 82  ? 67.569 15.795 34.057  1.00 16.26 ? 58  SER A N     1 
ATOM   450  C  CA    A SER A 1 82  ? 66.875 15.775 35.333  0.50 16.28 ? 58  SER A CA    1 
ATOM   451  C  CA    B SER A 1 82  ? 66.898 15.764 35.360  0.50 17.24 ? 58  SER A CA    1 
ATOM   452  C  C     . SER A 1 82  ? 67.286 16.950 36.230  1.00 16.81 ? 58  SER A C     1 
ATOM   453  O  O     . SER A 1 82  ? 66.425 17.733 36.654  1.00 17.50 ? 58  SER A O     1 
ATOM   454  C  CB    A SER A 1 82  ? 67.071 14.424 36.015  0.50 15.69 ? 58  SER A CB    1 
ATOM   455  C  CB    B SER A 1 82  ? 67.191 14.459 36.098  0.50 20.03 ? 58  SER A CB    1 
ATOM   456  O  OG    A SER A 1 82  ? 66.544 14.439 37.323  0.50 15.43 ? 58  SER A OG    1 
ATOM   457  O  OG    B SER A 1 82  ? 66.273 13.452 35.739  0.50 24.00 ? 58  SER A OG    1 
ATOM   458  N  N     . ALA A 1 83  ? 68.590 17.103 36.471  1.00 16.21 ? 59  ALA A N     1 
ATOM   459  C  CA    . ALA A 1 83  ? 69.105 18.219 37.277  1.00 16.61 ? 59  ALA A CA    1 
ATOM   460  C  C     . ALA A 1 83  ? 68.855 19.579 36.628  1.00 16.89 ? 59  ALA A C     1 
ATOM   461  O  O     . ALA A 1 83  ? 68.639 20.564 37.323  1.00 17.80 ? 59  ALA A O     1 
ATOM   462  C  CB    . ALA A 1 83  ? 70.591 18.037 37.549  1.00 17.73 ? 59  ALA A CB    1 
ATOM   463  N  N     . GLY A 1 84  ? 68.909 19.629 35.295  1.00 16.28 ? 60  GLY A N     1 
ATOM   464  C  CA    . GLY A 1 84  ? 68.595 20.855 34.549  1.00 17.92 ? 60  GLY A CA    1 
ATOM   465  C  C     . GLY A 1 84  ? 67.188 21.321 34.872  1.00 16.56 ? 60  GLY A C     1 
ATOM   466  O  O     . GLY A 1 84  ? 66.970 22.493 35.200  1.00 17.35 ? 60  GLY A O     1 
ATOM   467  N  N     . ASN A 1 85  ? 66.244 20.387 34.766  1.00 16.41 ? 61  ASN A N     1 
ATOM   468  C  CA    . ASN A 1 85  ? 64.847 20.624 35.097  1.00 15.57 ? 61  ASN A CA    1 
ATOM   469  C  C     . ASN A 1 85  ? 64.704 21.107 36.531  1.00 16.34 ? 61  ASN A C     1 
ATOM   470  O  O     . ASN A 1 85  ? 63.995 22.073 36.794  1.00 17.84 ? 61  ASN A O     1 
ATOM   471  C  CB    . ASN A 1 85  ? 64.012 19.362 34.896  1.00 14.75 ? 61  ASN A CB    1 
ATOM   472  C  CG    . ASN A 1 85  ? 64.030 18.866 33.457  1.00 15.09 ? 61  ASN A CG    1 
ATOM   473  O  OD1   . ASN A 1 85  ? 64.262 19.642 32.519  1.00 17.88 ? 61  ASN A OD1   1 
ATOM   474  N  ND2   . ASN A 1 85  ? 63.775 17.575 33.278  1.00 15.38 ? 61  ASN A ND2   1 
ATOM   475  N  N     . THR A 1 86  ? 65.405 20.445 37.447  1.00 14.66 ? 62  THR A N     1 
ATOM   476  C  CA    . THR A 1 86  ? 65.367 20.855 38.857  1.00 16.31 ? 62  THR A CA    1 
ATOM   477  C  C     . THR A 1 86  ? 65.857 22.285 39.063  1.00 18.30 ? 62  THR A C     1 
ATOM   478  O  O     . THR A 1 86  ? 65.205 23.058 39.767  1.00 18.37 ? 62  THR A O     1 
ATOM   479  C  CB    . THR A 1 86  ? 66.117 19.858 39.757  1.00 17.52 ? 62  THR A CB    1 
ATOM   480  O  OG1   . THR A 1 86  ? 65.404 18.620 39.748  1.00 19.04 ? 62  THR A OG1   1 
ATOM   481  C  CG2   . THR A 1 86  ? 66.218 20.381 41.199  1.00 19.19 ? 62  THR A CG2   1 
ATOM   482  N  N     . ALA A 1 87  ? 67.002 22.636 38.476  1.00 18.72 ? 63  ALA A N     1 
ATOM   483  C  CA    . ALA A 1 87  ? 67.506 24.009 38.558  1.00 18.55 ? 63  ALA A CA    1 
ATOM   484  C  C     . ALA A 1 87  ? 66.489 25.006 38.006  1.00 17.63 ? 63  ALA A C     1 
ATOM   485  O  O     . ALA A 1 87  ? 66.195 26.026 38.639  1.00 18.62 ? 63  ALA A O     1 
ATOM   486  C  CB    . ALA A 1 87  ? 68.832 24.137 37.827  1.00 18.91 ? 63  ALA A CB    1 
ATOM   487  N  N     . ALA A 1 88  ? 65.955 24.711 36.820  1.00 18.06 ? 64  ALA A N     1 
ATOM   488  C  CA    . ALA A 1 88  ? 64.965 25.578 36.187  1.00 18.98 ? 64  ALA A CA    1 
ATOM   489  C  C     . ALA A 1 88  ? 63.748 25.789 37.099  1.00 19.06 ? 64  ALA A C     1 
ATOM   490  O  O     . ALA A 1 88  ? 63.228 26.898 37.215  1.00 20.96 ? 64  ALA A O     1 
ATOM   491  C  CB    . ALA A 1 88  ? 64.549 25.001 34.843  1.00 19.69 ? 64  ALA A CB    1 
ATOM   492  N  N     . GLY A 1 89  ? 63.324 24.718 37.766  1.00 18.16 ? 65  GLY A N     1 
ATOM   493  C  CA    . GLY A 1 89  ? 62.180 24.767 38.681  1.00 19.93 ? 65  GLY A CA    1 
ATOM   494  C  C     . GLY A 1 89  ? 62.432 25.630 39.910  1.00 21.22 ? 65  GLY A C     1 
ATOM   495  O  O     . GLY A 1 89  ? 61.545 26.387 40.324  1.00 21.55 ? 65  GLY A O     1 
ATOM   496  N  N     . VAL A 1 90  ? 63.633 25.536 40.486  1.00 20.62 ? 66  VAL A N     1 
ATOM   497  C  CA    . VAL A 1 90  ? 64.038 26.434 41.582  1.00 20.75 ? 66  VAL A CA    1 
ATOM   498  C  C     . VAL A 1 90  ? 63.986 27.895 41.138  1.00 21.90 ? 66  VAL A C     1 
ATOM   499  O  O     . VAL A 1 90  ? 63.422 28.733 41.845  1.00 24.03 ? 66  VAL A O     1 
ATOM   500  C  CB    . VAL A 1 90  ? 65.437 26.099 42.133  1.00 20.75 ? 66  VAL A CB    1 
ATOM   501  C  CG1   . VAL A 1 90  ? 65.907 27.157 43.131  1.00 23.02 ? 66  VAL A CG1   1 
ATOM   502  C  CG2   . VAL A 1 90  ? 65.430 24.720 42.775  1.00 21.78 ? 66  VAL A CG2   1 
ATOM   503  N  N     . ALA A 1 91  ? 64.561 28.191 39.969  1.00 20.46 ? 67  ALA A N     1 
ATOM   504  C  CA    . ALA A 1 91  ? 64.551 29.557 39.428  1.00 20.96 ? 67  ALA A CA    1 
ATOM   505  C  C     . ALA A 1 91  ? 63.121 30.047 39.190  1.00 22.15 ? 67  ALA A C     1 
ATOM   506  O  O     . ALA A 1 91  ? 62.798 31.196 39.503  1.00 24.08 ? 67  ALA A O     1 
ATOM   507  C  CB    . ALA A 1 91  ? 65.374 29.640 38.145  1.00 23.57 ? 67  ALA A CB    1 
ATOM   508  N  N     . ASN A 1 92  ? 62.271 29.167 38.663  1.00 21.24 ? 68  ASN A N     1 
ATOM   509  C  CA    . ASN A 1 92  ? 60.855 29.457 38.427  1.00 22.80 ? 68  ASN A CA    1 
ATOM   510  C  C     . ASN A 1 92  ? 60.156 29.897 39.717  1.00 23.07 ? 68  ASN A C     1 
ATOM   511  O  O     . ASN A 1 92  ? 59.445 30.906 39.731  1.00 27.31 ? 68  ASN A O     1 
ATOM   512  C  CB    . ASN A 1 92  ? 60.168 28.232 37.794  1.00 24.47 ? 68  ASN A CB    1 
ATOM   513  C  CG    . ASN A 1 92  ? 58.773 28.529 37.256  1.00 24.04 ? 68  ASN A CG    1 
ATOM   514  O  OD1   . ASN A 1 92  ? 58.004 29.284 37.850  1.00 27.41 ? 68  ASN A OD1   1 
ATOM   515  N  ND2   . ASN A 1 92  ? 58.426 27.896 36.138  1.00 23.28 ? 68  ASN A ND2   1 
ATOM   516  N  N     . LEU A 1 93  ? 60.406 29.165 40.801  1.00 21.51 ? 69  LEU A N     1 
ATOM   517  C  CA    . LEU A 1 93  ? 59.824 29.474 42.115  1.00 23.48 ? 69  LEU A CA    1 
ATOM   518  C  C     . LEU A 1 93  ? 60.360 30.754 42.758  1.00 24.51 ? 69  LEU A C     1 
ATOM   519  O  O     . LEU A 1 93  ? 59.739 31.293 43.680  1.00 26.57 ? 69  LEU A O     1 
ATOM   520  C  CB    . LEU A 1 93  ? 60.030 28.291 43.065  1.00 21.71 ? 69  LEU A CB    1 
ATOM   521  C  CG    . LEU A 1 93  ? 59.112 27.082 42.887  1.00 21.37 ? 69  LEU A CG    1 
ATOM   522  C  CD1   . LEU A 1 93  ? 59.762 25.798 43.374  1.00 23.28 ? 69  LEU A CD1   1 
ATOM   523  C  CD2   . LEU A 1 93  ? 57.779 27.308 43.591  1.00 24.76 ? 69  LEU A CD2   1 
ATOM   524  N  N     . GLY A 1 94  ? 61.511 31.228 42.284  1.00 23.48 ? 70  GLY A N     1 
ATOM   525  C  CA    . GLY A 1 94  ? 62.082 32.493 42.750  1.00 25.99 ? 70  GLY A CA    1 
ATOM   526  C  C     . GLY A 1 94  ? 63.383 32.343 43.506  1.00 25.74 ? 70  GLY A C     1 
ATOM   527  O  O     . GLY A 1 94  ? 63.923 33.321 44.014  1.00 29.37 ? 70  GLY A O     1 
ATOM   528  N  N     . GLY A 1 95  ? 63.886 31.110 43.577  1.00 24.44 ? 71  GLY A N     1 
ATOM   529  C  CA    . GLY A 1 95  ? 65.176 30.833 44.198  1.00 24.46 ? 71  GLY A CA    1 
ATOM   530  C  C     . GLY A 1 95  ? 66.309 31.128 43.237  1.00 23.98 ? 71  GLY A C     1 
ATOM   531  O  O     . GLY A 1 95  ? 66.085 31.350 42.046  1.00 24.69 ? 71  GLY A O     1 
ATOM   532  N  N     . LYS A 1 96  ? 67.531 31.129 43.748  1.00 23.09 ? 72  LYS A N     1 
ATOM   533  C  CA    . LYS A 1 96  ? 68.691 31.423 42.911  1.00 22.00 ? 72  LYS A CA    1 
ATOM   534  C  C     . LYS A 1 96  ? 69.393 30.120 42.605  1.00 19.55 ? 72  LYS A C     1 
ATOM   535  O  O     . LYS A 1 96  ? 69.860 29.434 43.516  1.00 22.60 ? 72  LYS A O     1 
ATOM   536  C  CB    . LYS A 1 96  ? 69.636 32.412 43.607  1.00 26.63 ? 72  LYS A CB    1 
ATOM   537  C  CG    . LYS A 1 96  ? 68.979 33.715 44.044  1.00 28.52 ? 72  LYS A CG    1 
ATOM   538  C  CD    . LYS A 1 96  ? 68.347 34.482 42.890  1.00 31.58 ? 72  LYS A CD    1 
ATOM   539  C  CE    . LYS A 1 96  ? 67.616 35.721 43.398  1.00 30.27 ? 72  LYS A CE    1 
ATOM   540  N  NZ    . LYS A 1 96  ? 68.365 36.443 44.459  1.00 37.48 ? 72  LYS A NZ    1 
ATOM   541  N  N     . ALA A 1 97  ? 69.451 29.781 41.317  1.00 19.54 ? 73  ALA A N     1 
ATOM   542  C  CA    . ALA A 1 97  ? 69.960 28.479 40.894  1.00 20.82 ? 73  ALA A CA    1 
ATOM   543  C  C     . ALA A 1 97  ? 71.170 28.574 39.962  1.00 20.93 ? 73  ALA A C     1 
ATOM   544  O  O     . ALA A 1 97  ? 71.348 29.575 39.246  1.00 21.59 ? 73  ALA A O     1 
ATOM   545  C  CB    . ALA A 1 97  ? 68.845 27.657 40.260  1.00 20.98 ? 73  ALA A CB    1 
ATOM   546  N  N     . ALA A 1 98  ? 71.997 27.531 39.997  1.00 19.71 ? 74  ALA A N     1 
ATOM   547  C  CA    . ALA A 1 98  ? 73.125 27.367 39.086  1.00 18.78 ? 74  ALA A CA    1 
ATOM   548  C  C     . ALA A 1 98  ? 73.128 25.914 38.593  1.00 20.17 ? 74  ALA A C     1 
ATOM   549  O  O     . ALA A 1 98  ? 72.535 25.036 39.229  1.00 20.68 ? 74  ALA A O     1 
ATOM   550  C  CB    . ALA A 1 98  ? 74.430 27.702 39.789  1.00 21.46 ? 74  ALA A CB    1 
ATOM   551  N  N     . TYR A 1 99  ? 73.782 25.662 37.460  1.00 20.14 ? 75  TYR A N     1 
ATOM   552  C  CA    . TYR A 1 99  ? 73.825 24.324 36.880  1.00 17.71 ? 75  TYR A CA    1 
ATOM   553  C  C     . TYR A 1 99  ? 75.179 24.018 36.271  1.00 17.96 ? 75  TYR A C     1 
ATOM   554  O  O     . TYR A 1 99  ? 75.754 24.880 35.596  1.00 18.64 ? 75  TYR A O     1 
ATOM   555  C  CB    . TYR A 1 99  ? 72.749 24.204 35.801  1.00 19.45 ? 75  TYR A CB    1 
ATOM   556  C  CG    . TYR A 1 99  ? 72.704 22.882 35.068  1.00 19.47 ? 75  TYR A CG    1 
ATOM   557  C  CD1   . TYR A 1 99  ? 72.257 21.730 35.706  1.00 18.07 ? 75  TYR A CD1   1 
ATOM   558  C  CD2   . TYR A 1 99  ? 73.095 22.786 33.732  1.00 20.77 ? 75  TYR A CD2   1 
ATOM   559  C  CE1   . TYR A 1 99  ? 72.193 20.518 35.040  1.00 16.86 ? 75  TYR A CE1   1 
ATOM   560  C  CE2   . TYR A 1 99  ? 73.047 21.571 33.057  1.00 19.96 ? 75  TYR A CE2   1 
ATOM   561  C  CZ    . TYR A 1 99  ? 72.587 20.443 33.712  1.00 18.42 ? 75  TYR A CZ    1 
ATOM   562  O  OH    . TYR A 1 99  ? 72.518 19.228 33.059  1.00 18.47 ? 75  TYR A OH    1 
ATOM   563  N  N     . PHE A 1 100 ? 75.675 22.801 36.504  1.00 17.75 ? 76  PHE A N     1 
ATOM   564  C  CA    . PHE A 1 100 ? 76.833 22.283 35.779  1.00 18.51 ? 76  PHE A CA    1 
ATOM   565  C  C     . PHE A 1 100 ? 76.352 21.133 34.915  1.00 18.65 ? 76  PHE A C     1 
ATOM   566  O  O     . PHE A 1 100 ? 75.696 20.216 35.402  1.00 19.13 ? 76  PHE A O     1 
ATOM   567  C  CB    . PHE A 1 100 ? 77.891 21.701 36.720  1.00 19.12 ? 76  PHE A CB    1 
ATOM   568  C  CG    . PHE A 1 100 ? 78.489 22.673 37.719  1.00 21.66 ? 76  PHE A CG    1 
ATOM   569  C  CD1   . PHE A 1 100 ? 78.437 24.057 37.545  1.00 21.25 ? 76  PHE A CD1   1 
ATOM   570  C  CD2   . PHE A 1 100 ? 79.171 22.170 38.824  1.00 23.92 ? 76  PHE A CD2   1 
ATOM   571  C  CE1   . PHE A 1 100 ? 79.003 24.910 38.488  1.00 22.47 ? 76  PHE A CE1   1 
ATOM   572  C  CE2   . PHE A 1 100 ? 79.754 23.011 39.757  1.00 22.99 ? 76  PHE A CE2   1 
ATOM   573  C  CZ    . PHE A 1 100 ? 79.669 24.385 39.592  1.00 23.17 ? 76  PHE A CZ    1 
ATOM   574  N  N     . GLY A 1 101 ? 76.679 21.167 33.634  1.00 18.68 ? 77  GLY A N     1 
ATOM   575  C  CA    . GLY A 1 101 ? 76.352 20.059 32.750  1.00 17.75 ? 77  GLY A CA    1 
ATOM   576  C  C     . GLY A 1 101 ? 76.956 20.374 31.406  1.00 17.86 ? 77  GLY A C     1 
ATOM   577  O  O     . GLY A 1 101 ? 77.014 21.532 31.015  1.00 19.60 ? 77  GLY A O     1 
ATOM   578  N  N     . ASN A 1 102 ? 77.421 19.347 30.705  1.00 19.36 ? 78  ASN A N     1 
ATOM   579  C  CA    . ASN A 1 102 ? 78.190 19.567 29.480  1.00 18.53 ? 78  ASN A CA    1 
ATOM   580  C  C     . ASN A 1 102 ? 77.432 19.276 28.187  1.00 17.57 ? 78  ASN A C     1 
ATOM   581  O  O     . ASN A 1 102 ? 76.985 18.157 27.969  1.00 19.41 ? 78  ASN A O     1 
ATOM   582  C  CB    . ASN A 1 102 ? 79.492 18.752 29.511  1.00 18.74 ? 78  ASN A CB    1 
ATOM   583  C  CG    . ASN A 1 102 ? 80.434 19.135 28.378  1.00 18.51 ? 78  ASN A CG    1 
ATOM   584  O  OD1   . ASN A 1 102 ? 80.910 20.262 28.323  1.00 19.46 ? 78  ASN A OD1   1 
ATOM   585  N  ND2   . ASN A 1 102 ? 80.690 18.205 27.470  1.00 20.68 ? 78  ASN A ND2   1 
ATOM   586  N  N     . VAL A 1 103 ? 77.308 20.299 27.345  1.00 16.76 ? 79  VAL A N     1 
ATOM   587  C  CA    . VAL A 1 103 ? 76.775 20.164 25.983  1.00 17.89 ? 79  VAL A CA    1 
ATOM   588  C  C     . VAL A 1 103 ? 77.895 20.271 24.945  1.00 18.59 ? 79  VAL A C     1 
ATOM   589  O  O     . VAL A 1 103 ? 79.050 20.577 25.285  1.00 20.58 ? 79  VAL A O     1 
ATOM   590  C  CB    . VAL A 1 103 ? 75.700 21.231 25.685  1.00 16.52 ? 79  VAL A CB    1 
ATOM   591  C  CG1   . VAL A 1 103 ? 74.534 21.100 26.666  1.00 18.95 ? 79  VAL A CG1   1 
ATOM   592  C  CG2   . VAL A 1 103 ? 76.294 22.634 25.715  1.00 18.57 ? 79  VAL A CG2   1 
ATOM   593  N  N     . ALA A 1 104 ? 77.538 20.016 23.684  1.00 17.09 ? 80  ALA A N     1 
ATOM   594  C  CA    . ALA A 1 104 ? 78.449 20.270 22.561  1.00 18.29 ? 80  ALA A CA    1 
ATOM   595  C  C     . ALA A 1 104 ? 78.196 21.651 21.981  1.00 20.30 ? 80  ALA A C     1 
ATOM   596  O  O     . ALA A 1 104 ? 77.162 22.278 22.260  1.00 19.38 ? 80  ALA A O     1 
ATOM   597  C  CB    . ALA A 1 104 ? 78.296 19.205 21.496  1.00 19.34 ? 80  ALA A CB    1 
ATOM   598  N  N     . ALA A 1 105 ? 79.151 22.106 21.169  1.00 19.17 ? 81  ALA A N     1 
ATOM   599  C  CA    . ALA A 1 105 ? 79.057 23.347 20.403  1.00 17.95 ? 81  ALA A CA    1 
ATOM   600  C  C     . ALA A 1 105 ? 78.251 23.072 19.128  1.00 19.44 ? 81  ALA A C     1 
ATOM   601  O  O     . ALA A 1 105 ? 78.779 23.078 18.015  1.00 22.24 ? 81  ALA A O     1 
ATOM   602  C  CB    . ALA A 1 105 ? 80.463 23.870 20.079  1.00 21.09 ? 81  ALA A CB    1 
ATOM   603  N  N     . ASP A 1 106 ? 76.962 22.792 19.304  1.00 19.05 ? 82  ASP A N     1 
ATOM   604  C  CA    . ASP A 1 106 ? 76.069 22.508 18.186  1.00 18.71 ? 82  ASP A CA    1 
ATOM   605  C  C     . ASP A 1 106 ? 74.703 23.139 18.450  1.00 18.69 ? 82  ASP A C     1 
ATOM   606  O  O     . ASP A 1 106 ? 74.521 23.813 19.465  1.00 18.65 ? 82  ASP A O     1 
ATOM   607  C  CB    . ASP A 1 106 ? 75.979 20.990 17.898  1.00 19.22 ? 82  ASP A CB    1 
ATOM   608  C  CG    . ASP A 1 106 ? 75.540 20.156 19.116  1.00 19.90 ? 82  ASP A CG    1 
ATOM   609  O  OD1   . ASP A 1 106 ? 75.050 20.732 20.105  1.00 19.93 ? 82  ASP A OD1   1 
ATOM   610  O  OD2   . ASP A 1 106 ? 75.689 18.916 19.085  1.00 18.44 ? 82  ASP A OD2   1 
ATOM   611  N  N     . GLN A 1 107 ? 73.765 22.944 17.535  1.00 19.28 ? 83  GLN A N     1 
ATOM   612  C  CA    . GLN A 1 107 ? 72.459 23.584 17.638  1.00 17.70 ? 83  GLN A CA    1 
ATOM   613  C  C     . GLN A 1 107 ? 71.688 23.106 18.864  1.00 18.32 ? 83  GLN A C     1 
ATOM   614  O  O     . GLN A 1 107 ? 71.076 23.906 19.568  1.00 19.55 ? 83  GLN A O     1 
ATOM   615  C  CB    . GLN A 1 107 ? 71.663 23.372 16.359  1.00 18.26 ? 83  GLN A CB    1 
ATOM   616  C  CG    . GLN A 1 107 ? 72.181 24.229 15.213  1.00 18.60 ? 83  GLN A CG    1 
ATOM   617  C  CD    . GLN A 1 107 ? 71.578 23.855 13.877  1.00 17.79 ? 83  GLN A CD    1 
ATOM   618  O  OE1   . GLN A 1 107 ? 71.100 22.738 13.683  1.00 18.44 ? 83  GLN A OE1   1 
ATOM   619  N  NE2   . GLN A 1 107 ? 71.600 24.794 12.933  1.00 20.67 ? 83  GLN A NE2   1 
ATOM   620  N  N     . LEU A 1 108 ? 71.747 21.808 19.144  1.00 16.61 ? 84  LEU A N     1 
ATOM   621  C  CA    . LEU A 1 108 ? 71.074 21.273 20.333  1.00 16.96 ? 84  LEU A CA    1 
ATOM   622  C  C     . LEU A 1 108 ? 71.689 21.852 21.604  1.00 17.24 ? 84  LEU A C     1 
ATOM   623  O  O     . LEU A 1 108 ? 70.976 22.191 22.552  1.00 18.46 ? 84  LEU A O     1 
ATOM   624  C  CB    . LEU A 1 108 ? 71.124 19.749 20.359  1.00 16.66 ? 84  LEU A CB    1 
ATOM   625  C  CG    . LEU A 1 108 ? 70.245 19.046 19.313  1.00 20.39 ? 84  LEU A CG    1 
ATOM   626  C  CD1   . LEU A 1 108 ? 70.389 17.539 19.410  1.00 24.59 ? 84  LEU A CD1   1 
ATOM   627  C  CD2   . LEU A 1 108 ? 68.778 19.437 19.448  1.00 24.01 ? 84  LEU A CD2   1 
ATOM   628  N  N     . GLY A 1 109 ? 73.015 21.988 21.621  1.00 16.29 ? 85  GLY A N     1 
ATOM   629  C  CA    . GLY A 1 109 ? 73.677 22.586 22.764  1.00 16.56 ? 85  GLY A CA    1 
ATOM   630  C  C     . GLY A 1 109 ? 73.319 24.055 22.934  1.00 16.60 ? 85  GLY A C     1 
ATOM   631  O  O     . GLY A 1 109 ? 73.251 24.549 24.061  1.00 18.49 ? 85  GLY A O     1 
ATOM   632  N  N     . ASP A 1 110 ? 73.119 24.759 21.821  1.00 16.93 ? 86  ASP A N     1 
ATOM   633  C  CA    . ASP A 1 110 ? 72.743 26.166 21.875  1.00 18.06 ? 86  ASP A CA    1 
ATOM   634  C  C     . ASP A 1 110 ? 71.332 26.316 22.434  1.00 17.75 ? 86  ASP A C     1 
ATOM   635  O  O     . ASP A 1 110 ? 71.055 27.249 23.192  1.00 18.59 ? 86  ASP A O     1 
ATOM   636  C  CB    . ASP A 1 110 ? 72.869 26.812 20.493  1.00 21.58 ? 86  ASP A CB    1 
ATOM   637  C  CG    . ASP A 1 110 ? 74.319 26.961 20.054  1.00 24.40 ? 86  ASP A CG    1 
ATOM   638  O  OD1   . ASP A 1 110 ? 75.221 26.814 20.907  1.00 26.93 ? 86  ASP A OD1   1 
ATOM   639  O  OD2   . ASP A 1 110 ? 74.553 27.221 18.855  1.00 29.55 ? 86  ASP A OD2   1 
ATOM   640  N  N     . ILE A 1 111 ? 70.452 25.394 22.057  1.00 17.15 ? 87  ILE A N     1 
ATOM   641  C  CA    . ILE A 1 111 ? 69.080 25.349 22.598  1.00 17.15 ? 87  ILE A CA    1 
ATOM   642  C  C     . ILE A 1 111 ? 69.116 25.113 24.104  1.00 17.53 ? 87  ILE A C     1 
ATOM   643  O  O     . ILE A 1 111 ? 68.491 25.864 24.870  1.00 17.23 ? 87  ILE A O     1 
ATOM   644  C  CB    . ILE A 1 111 ? 68.231 24.268 21.893  1.00 17.39 ? 87  ILE A CB    1 
ATOM   645  C  CG1   . ILE A 1 111 ? 67.877 24.714 20.468  1.00 19.89 ? 87  ILE A CG1   1 
ATOM   646  C  CG2   . ILE A 1 111 ? 66.974 23.913 22.687  1.00 19.77 ? 87  ILE A CG2   1 
ATOM   647  C  CD1   . ILE A 1 111 ? 67.289 23.600 19.619  1.00 20.85 ? 87  ILE A CD1   1 
ATOM   648  N  N     . PHE A 1 112 ? 69.852 24.086 24.527  1.00 18.52 ? 88  PHE A N     1 
ATOM   649  C  CA    . PHE A 1 112 ? 69.967 23.797 25.951  1.00 15.68 ? 88  PHE A CA    1 
ATOM   650  C  C     . PHE A 1 112 ? 70.476 25.025 26.701  1.00 16.82 ? 88  PHE A C     1 
ATOM   651  O  O     . PHE A 1 112 ? 69.909 25.422 27.721  1.00 17.98 ? 88  PHE A O     1 
ATOM   652  C  CB    . PHE A 1 112 ? 70.876 22.594 26.216  1.00 16.32 ? 88  PHE A CB    1 
ATOM   653  C  CG    . PHE A 1 112 ? 70.893 22.179 27.653  1.00 16.80 ? 88  PHE A CG    1 
ATOM   654  C  CD1   . PHE A 1 112 ? 71.713 22.833 28.556  1.00 17.91 ? 88  PHE A CD1   1 
ATOM   655  C  CD2   . PHE A 1 112 ? 70.066 21.164 28.111  1.00 16.84 ? 88  PHE A CD2   1 
ATOM   656  C  CE1   . PHE A 1 112 ? 71.724 22.485 29.897  1.00 18.74 ? 88  PHE A CE1   1 
ATOM   657  C  CE2   . PHE A 1 112 ? 70.070 20.811 29.456  1.00 18.01 ? 88  PHE A CE2   1 
ATOM   658  C  CZ    . PHE A 1 112 ? 70.898 21.477 30.347  1.00 19.11 ? 88  PHE A CZ    1 
ATOM   659  N  N     . THR A 1 113 ? 71.547 25.622 26.193  1.00 17.10 ? 89  THR A N     1 
ATOM   660  C  CA    . THR A 1 113 ? 72.178 26.759 26.854  1.00 17.26 ? 89  THR A CA    1 
ATOM   661  C  C     . THR A 1 113 ? 71.208 27.921 26.980  1.00 16.83 ? 89  THR A C     1 
ATOM   662  O  O     . THR A 1 113 ? 71.083 28.509 28.056  1.00 17.85 ? 89  THR A O     1 
ATOM   663  C  CB    . THR A 1 113 ? 73.465 27.194 26.126  1.00 18.02 ? 89  THR A CB    1 
ATOM   664  O  OG1   . THR A 1 113 ? 74.388 26.105 26.146  1.00 19.02 ? 89  THR A OG1   1 
ATOM   665  C  CG2   . THR A 1 113 ? 74.107 28.381 26.822  1.00 20.78 ? 89  THR A CG2   1 
ATOM   666  N  N     . HIS A 1 114 ? 70.526 28.247 25.886  1.00 17.25 ? 90  HIS A N     1 
ATOM   667  C  CA    . HIS A 1 114 ? 69.522 29.289 25.912  1.00 18.59 ? 90  HIS A CA    1 
ATOM   668  C  C     . HIS A 1 114 ? 68.433 29.050 26.962  1.00 17.64 ? 90  HIS A C     1 
ATOM   669  O  O     . HIS A 1 114 ? 68.105 29.954 27.717  1.00 20.35 ? 90  HIS A O     1 
ATOM   670  C  CB    . HIS A 1 114 ? 68.844 29.450 24.554  1.00 17.51 ? 90  HIS A CB    1 
ATOM   671  C  CG    . HIS A 1 114 ? 67.604 30.283 24.628  1.00 17.56 ? 90  HIS A CG    1 
ATOM   672  N  ND1   . HIS A 1 114 ? 67.620 31.652 24.484  1.00 19.10 ? 90  HIS A ND1   1 
ATOM   673  C  CD2   . HIS A 1 114 ? 66.326 29.949 24.927  1.00 17.29 ? 90  HIS A CD2   1 
ATOM   674  C  CE1   . HIS A 1 114 ? 66.397 32.122 24.654  1.00 18.54 ? 90  HIS A CE1   1 
ATOM   675  N  NE2   . HIS A 1 114 ? 65.592 31.110 24.924  1.00 19.18 ? 90  HIS A NE2   1 
ATOM   676  N  N     . ASP A 1 115 ? 67.843 27.858 26.972  1.00 17.02 ? 91  ASP A N     1 
ATOM   677  C  CA    . ASP A 1 115 ? 66.640 27.631 27.790  1.00 18.05 ? 91  ASP A CA    1 
ATOM   678  C  C     . ASP A 1 115 ? 66.932 27.726 29.273  1.00 19.36 ? 91  ASP A C     1 
ATOM   679  O  O     . ASP A 1 115 ? 66.134 28.279 30.030  1.00 21.93 ? 91  ASP A O     1 
ATOM   680  C  CB    . ASP A 1 115 ? 65.994 26.283 27.485  1.00 16.76 ? 91  ASP A CB    1 
ATOM   681  C  CG    . ASP A 1 115 ? 65.431 26.214 26.068  1.00 18.86 ? 91  ASP A CG    1 
ATOM   682  O  OD1   . ASP A 1 115 ? 64.980 27.257 25.531  1.00 20.07 ? 91  ASP A OD1   1 
ATOM   683  O  OD2   . ASP A 1 115 ? 65.424 25.112 25.495  1.00 21.02 ? 91  ASP A OD2   1 
ATOM   684  N  N     . ILE A 1 116 ? 68.065 27.174 29.695  1.00 18.69 ? 92  ILE A N     1 
ATOM   685  C  CA    . ILE A 1 116 ? 68.390 27.180 31.116  1.00 18.48 ? 92  ILE A CA    1 
ATOM   686  C  C     . ILE A 1 116 ? 68.774 28.588 31.583  1.00 19.86 ? 92  ILE A C     1 
ATOM   687  O  O     . ILE A 1 116 ? 68.309 29.049 32.637  1.00 19.93 ? 92  ILE A O     1 
ATOM   688  C  CB    . ILE A 1 116 ? 69.418 26.070 31.473  1.00 16.68 ? 92  ILE A CB    1 
ATOM   689  C  CG1   . ILE A 1 116 ? 69.411 25.800 32.981  1.00 20.04 ? 92  ILE A CG1   1 
ATOM   690  C  CG2   . ILE A 1 116 ? 70.822 26.373 30.953  1.00 18.50 ? 92  ILE A CG2   1 
ATOM   691  C  CD1   . ILE A 1 116 ? 69.902 24.421 33.338  1.00 24.31 ? 92  ILE A CD1   1 
ATOM   692  N  N     . ARG A 1 117 ? 69.589 29.285 30.792  1.00 19.31 ? 93  ARG A N     1 
ATOM   693  C  CA    . ARG A 1 117 ? 69.960 30.663 31.110  1.00 19.55 ? 93  ARG A CA    1 
ATOM   694  C  C     . ARG A 1 117 ? 68.747 31.605 31.049  1.00 19.87 ? 93  ARG A C     1 
ATOM   695  O  O     . ARG A 1 117 ? 68.656 32.531 31.860  1.00 21.46 ? 93  ARG A O     1 
ATOM   696  C  CB    . ARG A 1 117 ? 71.089 31.172 30.198  1.00 20.06 ? 93  ARG A CB    1 
ATOM   697  C  CG    . ARG A 1 117 ? 72.406 30.422 30.372  1.00 19.30 ? 93  ARG A CG    1 
ATOM   698  C  CD    . ARG A 1 117 ? 73.530 31.035 29.534  1.00 22.04 ? 93  ARG A CD    1 
ATOM   699  N  NE    . ARG A 1 117 ? 74.072 32.246 30.150  1.00 27.07 ? 93  ARG A NE    1 
ATOM   700  C  CZ    . ARG A 1 117 ? 74.775 33.182 29.514  1.00 24.38 ? 93  ARG A CZ    1 
ATOM   701  N  NH1   . ARG A 1 117 ? 75.024 33.082 28.212  1.00 29.03 ? 93  ARG A NH1   1 
ATOM   702  N  NH2   . ARG A 1 117 ? 75.221 34.235 30.185  1.00 27.88 ? 93  ARG A NH2   1 
ATOM   703  N  N     . ALA A 1 118 ? 67.832 31.376 30.102  1.00 20.41 ? 94  ALA A N     1 
ATOM   704  C  CA    . ALA A 1 118 ? 66.652 32.238 29.944  1.00 21.69 ? 94  ALA A CA    1 
ATOM   705  C  C     . ALA A 1 118 ? 65.698 32.109 31.130  1.00 22.88 ? 94  ALA A C     1 
ATOM   706  O  O     . ALA A 1 118 ? 64.899 33.002 31.387  1.00 26.53 ? 94  ALA A O     1 
ATOM   707  C  CB    . ALA A 1 118 ? 65.924 31.932 28.645  1.00 24.52 ? 94  ALA A CB    1 
ATOM   708  N  N     . GLN A 1 119 ? 65.801 30.997 31.849  1.00 23.02 ? 95  GLN A N     1 
ATOM   709  C  CA    . GLN A 1 119 ? 65.056 30.814 33.081  1.00 22.23 ? 95  GLN A CA    1 
ATOM   710  C  C     . GLN A 1 119 ? 65.717 31.539 34.266  1.00 22.70 ? 95  GLN A C     1 
ATOM   711  O  O     . GLN A 1 119 ? 65.144 31.592 35.353  1.00 25.57 ? 95  GLN A O     1 
ATOM   712  C  CB    . GLN A 1 119 ? 64.912 29.319 33.386  1.00 23.80 ? 95  GLN A CB    1 
ATOM   713  C  CG    . GLN A 1 119 ? 64.079 28.994 34.620  1.00 26.02 ? 95  GLN A CG    1 
ATOM   714  C  CD    . GLN A 1 119 ? 62.664 29.530 34.550  1.00 28.22 ? 95  GLN A CD    1 
ATOM   715  O  OE1   . GLN A 1 119 ? 62.337 30.555 35.163  1.00 32.71 ? 95  GLN A OE1   1 
ATOM   716  N  NE2   . GLN A 1 119 ? 61.812 28.836 33.810  1.00 31.61 ? 95  GLN A NE2   1 
ATOM   717  N  N     . GLY A 1 120 ? 66.913 32.090 34.057  1.00 22.28 ? 96  GLY A N     1 
ATOM   718  C  CA    . GLY A 1 120 ? 67.632 32.808 35.109  1.00 20.06 ? 96  GLY A CA    1 
ATOM   719  C  C     . GLY A 1 120 ? 68.541 31.921 35.953  1.00 20.96 ? 96  GLY A C     1 
ATOM   720  O  O     . GLY A 1 120 ? 68.903 32.277 37.084  1.00 20.57 ? 96  GLY A O     1 
ATOM   721  N  N     . VAL A 1 121 ? 68.903 30.764 35.399  1.00 20.01 ? 97  VAL A N     1 
ATOM   722  C  CA    . VAL A 1 121 ? 69.865 29.866 36.026  1.00 18.64 ? 97  VAL A CA    1 
ATOM   723  C  C     . VAL A 1 121 ? 71.265 30.224 35.538  1.00 19.26 ? 97  VAL A C     1 
ATOM   724  O  O     . VAL A 1 121 ? 71.479 30.399 34.336  1.00 20.79 ? 97  VAL A O     1 
ATOM   725  C  CB    . VAL A 1 121 ? 69.566 28.389 35.689  1.00 18.39 ? 97  VAL A CB    1 
ATOM   726  C  CG1   . VAL A 1 121 ? 70.574 27.451 36.340  1.00 21.79 ? 97  VAL A CG1   1 
ATOM   727  C  CG2   . VAL A 1 121 ? 68.150 28.015 36.107  1.00 19.90 ? 97  VAL A CG2   1 
ATOM   728  N  N     . HIS A 1 122 ? 72.213 30.327 36.466  1.00 18.69 ? 98  HIS A N     1 
ATOM   729  C  CA    . HIS A 1 122 ? 73.624 30.493 36.123  1.00 19.05 ? 98  HIS A CA    1 
ATOM   730  C  C     . HIS A 1 122 ? 74.084 29.212 35.431  1.00 18.57 ? 98  HIS A C     1 
ATOM   731  O  O     . HIS A 1 122 ? 74.037 28.132 36.024  1.00 20.39 ? 98  HIS A O     1 
ATOM   732  C  CB    . HIS A 1 122 ? 74.444 30.735 37.391  1.00 20.58 ? 98  HIS A CB    1 
ATOM   733  C  CG    . HIS A 1 122 ? 75.926 30.636 37.186  1.00 22.12 ? 98  HIS A CG    1 
ATOM   734  N  ND1   . HIS A 1 122 ? 76.750 31.738 37.179  1.00 24.11 ? 98  HIS A ND1   1 
ATOM   735  C  CD2   . HIS A 1 122 ? 76.729 29.567 36.975  1.00 22.47 ? 98  HIS A CD2   1 
ATOM   736  C  CE1   . HIS A 1 122 ? 77.997 31.356 36.979  1.00 23.29 ? 98  HIS A CE1   1 
ATOM   737  N  NE2   . HIS A 1 122 ? 78.012 30.041 36.850  1.00 24.24 ? 98  HIS A NE2   1 
ATOM   738  N  N     . TYR A 1 123 ? 74.515 29.327 34.178  1.00 20.87 ? 99  TYR A N     1 
ATOM   739  C  CA    . TYR A 1 123 ? 75.036 28.178 33.446  1.00 20.00 ? 99  TYR A CA    1 
ATOM   740  C  C     . TYR A 1 123 ? 76.228 28.596 32.596  1.00 21.30 ? 99  TYR A C     1 
ATOM   741  O  O     . TYR A 1 123 ? 76.069 29.326 31.598  1.00 22.75 ? 99  TYR A O     1 
ATOM   742  C  CB    . TYR A 1 123 ? 73.950 27.530 32.581  1.00 19.23 ? 99  TYR A CB    1 
ATOM   743  C  CG    . TYR A 1 123 ? 74.468 26.414 31.705  1.00 19.58 ? 99  TYR A CG    1 
ATOM   744  C  CD1   . TYR A 1 123 ? 75.172 25.336 32.252  1.00 19.89 ? 99  TYR A CD1   1 
ATOM   745  C  CD2   . TYR A 1 123 ? 74.273 26.445 30.323  1.00 20.33 ? 99  TYR A CD2   1 
ATOM   746  C  CE1   . TYR A 1 123 ? 75.645 24.305 31.451  1.00 18.93 ? 99  TYR A CE1   1 
ATOM   747  C  CE2   . TYR A 1 123 ? 74.733 25.422 29.509  1.00 20.62 ? 99  TYR A CE2   1 
ATOM   748  C  CZ    . TYR A 1 123 ? 75.428 24.362 30.077  1.00 18.27 ? 99  TYR A CZ    1 
ATOM   749  O  OH    . TYR A 1 123 ? 75.893 23.356 29.266  1.00 18.59 ? 99  TYR A OH    1 
ATOM   750  N  N     . GLN A 1 124 ? 77.407 28.110 32.984  1.00 22.23 ? 100 GLN A N     1 
ATOM   751  C  CA    . GLN A 1 124 ? 78.661 28.538 32.373  1.00 21.93 ? 100 GLN A CA    1 
ATOM   752  C  C     . GLN A 1 124 ? 79.606 27.400 31.967  1.00 21.14 ? 100 GLN A C     1 
ATOM   753  O  O     . GLN A 1 124 ? 80.773 27.665 31.607  1.00 24.04 ? 100 GLN A O     1 
ATOM   754  C  CB    . GLN A 1 124 ? 79.381 29.528 33.297  1.00 22.36 ? 100 GLN A CB    1 
ATOM   755  C  CG    . GLN A 1 124 ? 78.676 30.870 33.417  1.00 22.44 ? 100 GLN A CG    1 
ATOM   756  C  CD    . GLN A 1 124 ? 78.776 31.708 32.160  1.00 25.21 ? 100 GLN A CD    1 
ATOM   757  O  OE1   . GLN A 1 124 ? 79.846 32.212 31.826  1.00 29.89 ? 100 GLN A OE1   1 
ATOM   758  N  NE2   . GLN A 1 124 ? 77.653 31.889 31.473  1.00 28.53 ? 100 GLN A NE2   1 
ATOM   759  N  N     . THR A 1 125 ? 79.119 26.153 32.017  1.00 22.07 ? 101 THR A N     1 
ATOM   760  C  CA    . THR A 1 125 ? 79.904 25.001 31.560  1.00 22.40 ? 101 THR A CA    1 
ATOM   761  C  C     . THR A 1 125 ? 80.192 25.156 30.071  1.00 25.61 ? 101 THR A C     1 
ATOM   762  O  O     . THR A 1 125 ? 79.267 25.273 29.258  1.00 26.83 ? 101 THR A O     1 
ATOM   763  C  CB    . THR A 1 125 ? 79.191 23.656 31.802  1.00 21.45 ? 101 THR A CB    1 
ATOM   764  O  OG1   . THR A 1 125 ? 78.652 23.622 33.126  1.00 22.59 ? 101 THR A OG1   1 
ATOM   765  C  CG2   . THR A 1 125 ? 80.152 22.488 31.613  1.00 21.20 ? 101 THR A CG2   1 
ATOM   766  N  N     . LYS A 1 126 ? 81.485 25.176 29.737  1.00 25.00 ? 102 LYS A N     1 
ATOM   767  C  CA    . LYS A 1 126 ? 81.938 25.406 28.375  1.00 28.56 ? 102 LYS A CA    1 
ATOM   768  C  C     . LYS A 1 126 ? 81.971 24.113 27.573  1.00 23.91 ? 102 LYS A C     1 
ATOM   769  O  O     . LYS A 1 126 ? 82.545 23.126 28.026  1.00 25.11 ? 102 LYS A O     1 
ATOM   770  C  CB    . LYS A 1 126 ? 83.343 26.022 28.376  1.00 30.14 ? 102 LYS A CB    1 
ATOM   771  C  CG    . LYS A 1 126 ? 83.512 27.280 29.220  1.00 31.97 ? 102 LYS A CG    1 
ATOM   772  C  CD    . LYS A 1 126 ? 82.643 28.424 28.719  1.00 35.43 ? 102 LYS A CD    1 
ATOM   773  C  CE    . LYS A 1 126 ? 82.936 29.721 29.463  1.00 42.55 ? 102 LYS A CE    1 
ATOM   774  N  NZ    . LYS A 1 126 ? 82.621 29.644 30.920  1.00 41.95 ? 102 LYS A NZ    1 
ATOM   775  N  N     . PRO A 1 127 ? 81.378 24.124 26.366  1.00 25.78 ? 103 PRO A N     1 
ATOM   776  C  CA    . PRO A 1 127 ? 81.486 22.995 25.444  1.00 25.54 ? 103 PRO A CA    1 
ATOM   777  C  C     . PRO A 1 127 ? 82.933 22.743 25.031  1.00 26.04 ? 103 PRO A C     1 
ATOM   778  O  O     . PRO A 1 127 ? 83.717 23.694 24.958  1.00 28.90 ? 103 PRO A O     1 
ATOM   779  C  CB    . PRO A 1 127 ? 80.665 23.441 24.232  1.00 25.25 ? 103 PRO A CB    1 
ATOM   780  C  CG    . PRO A 1 127 ? 80.434 24.904 24.394  1.00 30.71 ? 103 PRO A CG    1 
ATOM   781  C  CD    . PRO A 1 127 ? 80.458 25.158 25.869  1.00 30.05 ? 103 PRO A CD    1 
ATOM   782  N  N     . LYS A 1 128 ? 83.272 21.476 24.776  1.00 24.63 ? 104 LYS A N     1 
ATOM   783  C  CA    . LYS A 1 128 ? 84.642 21.076 24.431  1.00 26.02 ? 104 LYS A CA    1 
ATOM   784  C  C     . LYS A 1 128 ? 84.860 20.842 22.932  1.00 30.98 ? 104 LYS A C     1 
ATOM   785  O  O     . LYS A 1 128 ? 85.886 20.291 22.528  1.00 42.47 ? 104 LYS A O     1 
ATOM   786  C  CB    . LYS A 1 128 ? 85.059 19.834 25.226  1.00 30.91 ? 104 LYS A CB    1 
ATOM   787  C  CG    . LYS A 1 128 ? 85.168 20.049 26.729  1.00 34.28 ? 104 LYS A CG    1 
ATOM   788  C  CD    . LYS A 1 128 ? 83.990 19.431 27.461  1.00 33.28 ? 104 LYS A CD    1 
ATOM   789  C  CE    . LYS A 1 128 ? 84.102 19.614 28.965  1.00 32.04 ? 104 LYS A CE    1 
ATOM   790  N  NZ    . LYS A 1 128 ? 83.681 20.970 29.419  1.00 30.86 ? 104 LYS A NZ    1 
ATOM   791  N  N     . GLY A 1 129 ? 83.912 21.291 22.120  1.00 26.67 ? 105 GLY A N     1 
ATOM   792  C  CA    . GLY A 1 129 ? 83.894 21.006 20.686  1.00 25.69 ? 105 GLY A CA    1 
ATOM   793  C  C     . GLY A 1 129 ? 82.504 20.572 20.262  1.00 25.74 ? 105 GLY A C     1 
ATOM   794  O  O     . GLY A 1 129 ? 81.583 20.540 21.080  1.00 25.21 ? 105 GLY A O     1 
ATOM   795  N  N     . ALA A 1 130 ? 82.354 20.219 18.989  1.00 24.69 ? 106 ALA A N     1 
ATOM   796  C  CA    . ALA A 1 130 ? 81.060 19.813 18.455  1.00 21.89 ? 106 ALA A CA    1 
ATOM   797  C  C     . ALA A 1 130 ? 80.806 18.308 18.573  1.00 24.56 ? 106 ALA A C     1 
ATOM   798  O  O     . ALA A 1 130 ? 79.663 17.861 18.436  1.00 24.22 ? 106 ALA A O     1 
ATOM   799  C  CB    . ALA A 1 130 ? 80.915 20.280 17.011  1.00 24.36 ? 106 ALA A CB    1 
ATOM   800  N  N     . PHE A 1 131 ? 81.862 17.540 18.854  1.00 23.93 ? 107 PHE A N     1 
ATOM   801  C  CA    . PHE A 1 131 ? 81.764 16.082 18.911  1.00 23.37 ? 107 PHE A CA    1 
ATOM   802  C  C     . PHE A 1 131 ? 82.460 15.505 20.143  1.00 23.62 ? 107 PHE A C     1 
ATOM   803  O  O     . PHE A 1 131 ? 83.588 15.906 20.460  1.00 25.21 ? 107 PHE A O     1 
ATOM   804  C  CB    . PHE A 1 131 ? 82.282 15.450 17.611  1.00 26.01 ? 107 PHE A CB    1 
ATOM   805  C  CG    . PHE A 1 131 ? 81.635 16.019 16.385  1.00 27.58 ? 107 PHE A CG    1 
ATOM   806  C  CD1   . PHE A 1 131 ? 80.385 15.561 15.969  1.00 30.59 ? 107 PHE A CD1   1 
ATOM   807  C  CD2   . PHE A 1 131 ? 82.237 17.063 15.680  1.00 30.08 ? 107 PHE A CD2   1 
ATOM   808  C  CE1   . PHE A 1 131 ? 79.764 16.102 14.851  1.00 32.30 ? 107 PHE A CE1   1 
ATOM   809  C  CE2   . PHE A 1 131 ? 81.620 17.609 14.563  1.00 33.00 ? 107 PHE A CE2   1 
ATOM   810  C  CZ    . PHE A 1 131 ? 80.381 17.130 14.150  1.00 34.04 ? 107 PHE A CZ    1 
ATOM   811  N  N     . PRO A 1 132 ? 81.788 14.573 20.858  1.00 24.51 ? 108 PRO A N     1 
ATOM   812  C  CA    . PRO A 1 132 ? 80.450 14.022 20.591  1.00 23.03 ? 108 PRO A CA    1 
ATOM   813  C  C     . PRO A 1 132 ? 79.366 15.094 20.669  1.00 21.02 ? 108 PRO A C     1 
ATOM   814  O  O     . PRO A 1 132 ? 79.540 16.082 21.390  1.00 20.02 ? 108 PRO A O     1 
ATOM   815  C  CB    . PRO A 1 132 ? 80.250 12.999 21.725  1.00 24.71 ? 108 PRO A CB    1 
ATOM   816  C  CG    . PRO A 1 132 ? 81.601 12.773 22.308  1.00 29.35 ? 108 PRO A CG    1 
ATOM   817  C  CD    . PRO A 1 132 ? 82.344 14.054 22.120  1.00 27.50 ? 108 PRO A CD    1 
ATOM   818  N  N     . PRO A 1 133 ? 78.249 14.897 19.943  1.00 20.90 ? 109 PRO A N     1 
ATOM   819  C  CA    . PRO A 1 133 ? 77.201 15.926 19.907  1.00 19.68 ? 109 PRO A CA    1 
ATOM   820  C  C     . PRO A 1 133 ? 76.427 15.976 21.217  1.00 18.10 ? 109 PRO A C     1 
ATOM   821  O  O     . PRO A 1 133 ? 76.581 15.091 22.057  1.00 19.43 ? 109 PRO A O     1 
ATOM   822  C  CB    . PRO A 1 133 ? 76.294 15.463 18.772  1.00 21.04 ? 109 PRO A CB    1 
ATOM   823  C  CG    . PRO A 1 133 ? 76.450 13.983 18.771  1.00 23.54 ? 109 PRO A CG    1 
ATOM   824  C  CD    . PRO A 1 133 ? 77.887 13.720 19.124  1.00 24.25 ? 109 PRO A CD    1 
ATOM   825  N  N     . THR A 1 134 ? 75.622 17.017 21.380  1.00 17.04 ? 110 THR A N     1 
ATOM   826  C  CA    . THR A 1 134 ? 74.840 17.204 22.599  1.00 16.22 ? 110 THR A CA    1 
ATOM   827  C  C     . THR A 1 134 ? 73.929 16.002 22.841  1.00 16.74 ? 110 THR A C     1 
ATOM   828  O  O     . THR A 1 134 ? 73.325 15.463 21.910  1.00 16.32 ? 110 THR A O     1 
ATOM   829  C  CB    . THR A 1 134 ? 74.028 18.510 22.511  1.00 15.72 ? 110 THR A CB    1 
ATOM   830  O  OG1   . THR A 1 134 ? 74.936 19.614 22.464  1.00 17.66 ? 110 THR A OG1   1 
ATOM   831  C  CG2   . THR A 1 134 ? 73.105 18.698 23.731  1.00 17.95 ? 110 THR A CG2   1 
ATOM   832  N  N     . ALA A 1 135 ? 73.856 15.572 24.102  1.00 15.45 ? 111 ALA A N     1 
ATOM   833  C  CA    . ALA A 1 135 ? 72.988 14.468 24.488  1.00 15.30 ? 111 ALA A CA    1 
ATOM   834  C  C     . ALA A 1 135 ? 71.538 14.741 24.128  1.00 15.27 ? 111 ALA A C     1 
ATOM   835  O  O     . ALA A 1 135 ? 71.061 15.875 24.185  1.00 16.86 ? 111 ALA A O     1 
ATOM   836  C  CB    . ALA A 1 135 ? 73.102 14.217 25.974  1.00 15.26 ? 111 ALA A CB    1 
ATOM   837  N  N     . ARG A 1 136 ? 70.839 13.679 23.759  1.00 15.29 ? 112 ARG A N     1 
ATOM   838  C  CA    . ARG A 1 136 ? 69.396 13.757 23.533  1.00 16.34 ? 112 ARG A CA    1 
ATOM   839  C  C     . ARG A 1 136 ? 68.712 12.513 24.080  1.00 15.38 ? 112 ARG A C     1 
ATOM   840  O  O     . ARG A 1 136 ? 69.326 11.437 24.178  1.00 17.35 ? 112 ARG A O     1 
ATOM   841  C  CB    . ARG A 1 136 ? 69.059 14.019 22.049  1.00 16.14 ? 112 ARG A CB    1 
ATOM   842  C  CG    . ARG A 1 136 ? 69.222 12.818 21.114  1.00 17.71 ? 112 ARG A CG    1 
ATOM   843  C  CD    . ARG A 1 136 ? 70.670 12.358 20.959  1.00 20.10 ? 112 ARG A CD    1 
ATOM   844  N  NE    . ARG A 1 136 ? 71.601 13.436 20.617  1.00 19.51 ? 112 ARG A NE    1 
ATOM   845  C  CZ    . ARG A 1 136 ? 71.919 13.787 19.373  1.00 19.97 ? 112 ARG A CZ    1 
ATOM   846  N  NH1   . ARG A 1 136 ? 71.372 13.158 18.340  1.00 20.90 ? 112 ARG A NH1   1 
ATOM   847  N  NH2   . ARG A 1 136 ? 72.780 14.776 19.165  1.00 22.08 ? 112 ARG A NH2   1 
ATOM   848  N  N     . SER A 1 137 ? 67.446 12.679 24.469  1.00 15.79 ? 113 SER A N     1 
ATOM   849  C  CA    . SER A 1 137 ? 66.653 11.574 24.985  1.00 16.80 ? 113 SER A CA    1 
ATOM   850  C  C     . SER A 1 137 ? 65.336 11.515 24.247  1.00 15.28 ? 113 SER A C     1 
ATOM   851  O  O     . SER A 1 137 ? 64.585 12.483 24.229  1.00 15.84 ? 113 SER A O     1 
ATOM   852  C  CB    . SER A 1 137 ? 66.379 11.749 26.486  1.00 15.42 ? 113 SER A CB    1 
ATOM   853  O  OG    . SER A 1 137 ? 65.848 10.536 26.998  1.00 16.14 ? 113 SER A OG    1 
HETATM 854  N  N     . MSE A 1 138 ? 65.067 10.377 23.620  1.00 16.73 ? 114 MSE A N     1 
HETATM 855  C  CA    . MSE A 1 138 ? 63.789 10.156 22.969  1.00 16.62 ? 114 MSE A CA    1 
HETATM 856  C  C     . MSE A 1 138 ? 62.862 9.630  24.016  1.00 16.08 ? 114 MSE A C     1 
HETATM 857  O  O     . MSE A 1 138 ? 63.067 8.542  24.564  1.00 14.78 ? 114 MSE A O     1 
HETATM 858  C  CB    . MSE A 1 138 ? 63.964 9.220  21.788  1.00 18.34 ? 114 MSE A CB    1 
HETATM 859  C  CG    . MSE A 1 138 ? 64.495 10.046 20.630  1.00 24.09 ? 114 MSE A CG    1 
HETATM 860  SE SE    . MSE A 1 138 ? 64.933 8.734  19.254  1.00 37.00 ? 114 MSE A SE    1 
HETATM 861  C  CE    . MSE A 1 138 ? 66.647 8.104  19.986  1.00 24.67 ? 114 MSE A CE    1 
ATOM   862  N  N     . ILE A 1 139 ? 61.848 10.432 24.313  1.00 16.35 ? 115 ILE A N     1 
ATOM   863  C  CA    . ILE A 1 139 ? 60.903 10.125 25.380  1.00 17.45 ? 115 ILE A CA    1 
ATOM   864  C  C     . ILE A 1 139 ? 59.560 9.793  24.751  1.00 16.36 ? 115 ILE A C     1 
ATOM   865  O  O     . ILE A 1 139 ? 58.964 10.616 24.041  1.00 17.40 ? 115 ILE A O     1 
ATOM   866  C  CB    . ILE A 1 139 ? 60.763 11.298 26.362  1.00 16.49 ? 115 ILE A CB    1 
ATOM   867  C  CG1   . ILE A 1 139 ? 62.137 11.682 26.938  1.00 19.15 ? 115 ILE A CG1   1 
ATOM   868  C  CG2   . ILE A 1 139 ? 59.752 10.954 27.466  1.00 17.62 ? 115 ILE A CG2   1 
ATOM   869  C  CD1   . ILE A 1 139 ? 62.097 12.729 28.035  1.00 17.19 ? 115 ILE A CD1   1 
ATOM   870  N  N     . PHE A 1 140 ? 59.092 8.581  25.027  1.00 15.50 ? 116 PHE A N     1 
ATOM   871  C  CA    . PHE A 1 140 ? 57.830 8.094  24.513  1.00 16.20 ? 116 PHE A CA    1 
ATOM   872  C  C     . PHE A 1 140 ? 56.813 8.131  25.637  1.00 17.00 ? 116 PHE A C     1 
ATOM   873  O  O     . PHE A 1 140 ? 57.036 7.543  26.698  1.00 17.80 ? 116 PHE A O     1 
ATOM   874  C  CB    . PHE A 1 140 ? 57.988 6.684  23.936  1.00 17.59 ? 116 PHE A CB    1 
ATOM   875  C  CG    . PHE A 1 140 ? 58.900 6.620  22.747  1.00 16.89 ? 116 PHE A CG    1 
ATOM   876  C  CD1   . PHE A 1 140 ? 58.412 6.878  21.467  1.00 18.70 ? 116 PHE A CD1   1 
ATOM   877  C  CD2   . PHE A 1 140 ? 60.255 6.322  22.909  1.00 17.66 ? 116 PHE A CD2   1 
ATOM   878  C  CE1   . PHE A 1 140 ? 59.264 6.842  20.378  1.00 18.67 ? 116 PHE A CE1   1 
ATOM   879  C  CE2   . PHE A 1 140 ? 61.110 6.274  21.817  1.00 20.21 ? 116 PHE A CE2   1 
ATOM   880  C  CZ    . PHE A 1 140 ? 60.608 6.533  20.552  1.00 18.53 ? 116 PHE A CZ    1 
ATOM   881  N  N     . VAL A 1 141 ? 55.730 8.865  25.405  1.00 19.22 ? 117 VAL A N     1 
ATOM   882  C  CA    . VAL A 1 141 ? 54.667 9.025  26.399  1.00 18.31 ? 117 VAL A CA    1 
ATOM   883  C  C     . VAL A 1 141 ? 53.480 8.163  25.991  1.00 19.63 ? 117 VAL A C     1 
ATOM   884  O  O     . VAL A 1 141 ? 52.947 8.302  24.887  1.00 21.14 ? 117 VAL A O     1 
ATOM   885  C  CB    . VAL A 1 141 ? 54.245 10.501 26.534  1.00 19.01 ? 117 VAL A CB    1 
ATOM   886  C  CG1   . VAL A 1 141 ? 53.167 10.666 27.602  1.00 21.88 ? 117 VAL A CG1   1 
ATOM   887  C  CG2   . VAL A 1 141 ? 55.460 11.368 26.847  1.00 19.44 ? 117 VAL A CG2   1 
ATOM   888  N  N     . THR A 1 142 ? 53.096 7.241  26.872  1.00 19.40 ? 118 THR A N     1 
ATOM   889  C  CA    . THR A 1 142 ? 51.983 6.325  26.590  1.00 20.37 ? 118 THR A CA    1 
ATOM   890  C  C     . THR A 1 142 ? 50.653 6.961  27.026  1.00 21.55 ? 118 THR A C     1 
ATOM   891  O  O     . THR A 1 142 ? 50.656 8.023  27.639  1.00 22.98 ? 118 THR A O     1 
ATOM   892  C  CB    . THR A 1 142 ? 52.222 4.922  27.214  1.00 21.43 ? 118 THR A CB    1 
ATOM   893  O  OG1   . THR A 1 142 ? 52.839 5.053  28.500  1.00 20.02 ? 118 THR A OG1   1 
ATOM   894  C  CG2   . THR A 1 142 ? 53.153 4.094  26.335  1.00 22.56 ? 118 THR A CG2   1 
ATOM   895  N  N     . GLU A 1 143 ? 49.529 6.326  26.691  1.00 24.67 ? 119 GLU A N     1 
ATOM   896  C  CA    . GLU A 1 143 ? 48.190 6.890  26.951  1.00 26.33 ? 119 GLU A CA    1 
ATOM   897  C  C     . GLU A 1 143 ? 47.915 7.161  28.434  1.00 25.07 ? 119 GLU A C     1 
ATOM   898  O  O     . GLU A 1 143 ? 47.169 8.087  28.782  1.00 28.88 ? 119 GLU A O     1 
ATOM   899  C  CB    . GLU A 1 143 ? 47.103 5.996  26.346  1.00 29.00 ? 119 GLU A CB    1 
ATOM   900  C  CG    . GLU A 1 143 ? 47.095 5.998  24.820  1.00 37.72 ? 119 GLU A CG    1 
ATOM   901  C  CD    . GLU A 1 143 ? 46.097 5.025  24.215  1.00 49.99 ? 119 GLU A CD    1 
ATOM   902  O  OE1   . GLU A 1 143 ? 46.394 4.480  23.129  1.00 57.95 ? 119 GLU A OE1   1 
ATOM   903  O  OE2   . GLU A 1 143 ? 45.017 4.802  24.810  1.00 59.05 ? 119 GLU A OE2   1 
ATOM   904  N  N     . ASP A 1 144 ? 48.540 6.360  29.292  1.00 22.85 ? 120 ASP A N     1 
ATOM   905  C  CA    . ASP A 1 144 ? 48.474 6.538  30.744  1.00 22.32 ? 120 ASP A CA    1 
ATOM   906  C  C     . ASP A 1 144 ? 49.331 7.691  31.277  1.00 23.63 ? 120 ASP A C     1 
ATOM   907  O  O     . ASP A 1 144 ? 49.307 7.975  32.476  1.00 24.86 ? 120 ASP A O     1 
ATOM   908  C  CB    . ASP A 1 144 ? 48.844 5.229  31.461  1.00 25.40 ? 120 ASP A CB    1 
ATOM   909  C  CG    . ASP A 1 144 ? 50.258 4.723  31.118  1.00 24.74 ? 120 ASP A CG    1 
ATOM   910  O  OD1   . ASP A 1 144 ? 51.030 5.423  30.421  1.00 23.00 ? 120 ASP A OD1   1 
ATOM   911  O  OD2   . ASP A 1 144 ? 50.599 3.601  31.552  1.00 24.33 ? 120 ASP A OD2   1 
ATOM   912  N  N     . GLY A 1 145 ? 50.094 8.343  30.392  1.00 22.59 ? 121 GLY A N     1 
ATOM   913  C  CA    . GLY A 1 145 ? 50.947 9.475  30.771  1.00 22.99 ? 121 GLY A CA    1 
ATOM   914  C  C     . GLY A 1 145 ? 52.338 9.089  31.264  1.00 21.14 ? 121 GLY A C     1 
ATOM   915  O  O     . GLY A 1 145 ? 53.156 9.952  31.583  1.00 21.23 ? 121 GLY A O     1 
ATOM   916  N  N     . GLU A 1 146 ? 52.611 7.787  31.359  1.00 20.58 ? 122 GLU A N     1 
ATOM   917  C  CA    . GLU A 1 146 ? 53.946 7.327  31.709  1.00 20.55 ? 122 GLU A CA    1 
ATOM   918  C  C     . GLU A 1 146 ? 54.929 7.683  30.605  1.00 19.12 ? 122 GLU A C     1 
ATOM   919  O  O     . GLU A 1 146 ? 54.550 7.758  29.427  1.00 20.39 ? 122 GLU A O     1 
ATOM   920  C  CB    . GLU A 1 146 ? 53.978 5.820  31.978  1.00 20.95 ? 122 GLU A CB    1 
ATOM   921  C  CG    . GLU A 1 146 ? 55.251 5.383  32.683  1.00 24.18 ? 122 GLU A CG    1 
ATOM   922  C  CD    . GLU A 1 146 ? 55.526 6.211  33.926  1.00 27.64 ? 122 GLU A CD    1 
ATOM   923  O  OE1   . GLU A 1 146 ? 56.298 7.204  33.841  1.00 23.21 ? 122 GLU A OE1   1 
ATOM   924  O  OE2   . GLU A 1 146 ? 54.943 5.882  34.980  1.00 35.68 ? 122 GLU A OE2   1 
ATOM   925  N  N     . ARG A 1 147 ? 56.162 7.937  31.015  1.00 20.18 ? 123 ARG A N     1 
ATOM   926  C  CA    A ARG A 1 147 ? 57.258 8.264  30.088  0.50 18.61 ? 123 ARG A CA    1 
ATOM   927  C  CA    B ARG A 1 147 ? 57.256 8.267  30.096  0.50 18.70 ? 123 ARG A CA    1 
ATOM   928  C  C     . ARG A 1 147 ? 58.446 7.250  30.116  1.00 17.86 ? 123 ARG A C     1 
ATOM   929  O  O     . ARG A 1 147 ? 58.912 6.760  31.177  1.00 18.35 ? 123 ARG A O     1 
ATOM   930  C  CB    A ARG A 1 147 ? 57.754 9.701  30.313  0.50 18.80 ? 123 ARG A CB    1 
ATOM   931  C  CB    B ARG A 1 147 ? 57.756 9.669  30.413  0.50 19.27 ? 123 ARG A CB    1 
ATOM   932  C  CG    A ARG A 1 147 ? 59.053 9.867  31.099  0.50 19.45 ? 123 ARG A CG    1 
ATOM   933  C  CG    B ARG A 1 147 ? 58.289 9.829  31.832  0.50 19.19 ? 123 ARG A CG    1 
ATOM   934  C  CD    A ARG A 1 147 ? 58.835 9.672  32.577  0.50 19.03 ? 123 ARG A CD    1 
ATOM   935  C  CD    B ARG A 1 147 ? 59.788 9.894  31.770  0.50 17.50 ? 123 ARG A CD    1 
ATOM   936  N  NE    A ARG A 1 147 ? 60.043 9.821  33.385  0.50 18.95 ? 123 ARG A NE    1 
ATOM   937  N  NE    B ARG A 1 147 ? 60.482 9.907  33.047  0.50 17.94 ? 123 ARG A NE    1 
ATOM   938  C  CZ    A ARG A 1 147 ? 60.891 8.840  33.668  0.50 16.63 ? 123 ARG A CZ    1 
ATOM   939  C  CZ    B ARG A 1 147 ? 60.986 8.829  33.624  0.50 17.51 ? 123 ARG A CZ    1 
ATOM   940  N  NH1   A ARG A 1 147 ? 60.724 7.639  33.141  0.50 18.97 ? 123 ARG A NH1   1 
ATOM   941  N  NH1   B ARG A 1 147 ? 60.802 7.642  33.075  0.50 18.61 ? 123 ARG A NH1   1 
ATOM   942  N  NH2   A ARG A 1 147 ? 61.916 9.085  34.462  0.50 17.24 ? 123 ARG A NH2   1 
ATOM   943  N  NH2   B ARG A 1 147 ? 61.671 8.949  34.743  0.50 21.27 ? 123 ARG A NH2   1 
ATOM   944  N  N     . SER A 1 148 ? 58.864 6.896  28.906  1.00 17.84 ? 124 SER A N     1 
ATOM   945  C  CA    . SER A 1 148 ? 59.911 5.918  28.779  1.00 18.29 ? 124 SER A CA    1 
ATOM   946  C  C     . SER A 1 148 ? 61.004 6.563  27.957  1.00 17.79 ? 124 SER A C     1 
ATOM   947  O  O     . SER A 1 148 ? 60.767 6.977  26.810  1.00 17.85 ? 124 SER A O     1 
ATOM   948  C  CB    . SER A 1 148 ? 59.378 4.648  28.123  1.00 18.41 ? 124 SER A CB    1 
ATOM   949  O  OG    . SER A 1 148 ? 58.233 4.177  28.824  1.00 18.25 ? 124 SER A OG    1 
HETATM 950  N  N     . MSE A 1 149 ? 62.184 6.677  28.557  1.00 16.66 ? 125 MSE A N     1 
HETATM 951  C  CA    . MSE A 1 149 ? 63.245 7.524  27.992  1.00 15.80 ? 125 MSE A CA    1 
HETATM 952  C  C     . MSE A 1 149 ? 64.338 6.699  27.392  1.00 17.32 ? 125 MSE A C     1 
HETATM 953  O  O     . MSE A 1 149 ? 64.671 5.628  27.902  1.00 17.04 ? 125 MSE A O     1 
HETATM 954  C  CB    . MSE A 1 149 ? 63.832 8.429  29.066  1.00 17.02 ? 125 MSE A CB    1 
HETATM 955  C  CG    . MSE A 1 149 ? 62.690 9.077  29.836  1.00 19.98 ? 125 MSE A CG    1 
HETATM 956  SE SE    . MSE A 1 149 ? 63.375 10.581 30.862  1.00 31.26 ? 125 MSE A SE    1 
HETATM 957  C  CE    . MSE A 1 149 ? 64.314 9.509  32.208  1.00 24.28 ? 125 MSE A CE    1 
ATOM   958  N  N     . ASN A 1 150 ? 64.901 7.201  26.289  1.00 16.53 ? 126 ASN A N     1 
ATOM   959  C  CA    . ASN A 1 150 ? 65.951 6.488  25.563  1.00 16.19 ? 126 ASN A CA    1 
ATOM   960  C  C     . ASN A 1 150 ? 67.068 7.456  25.232  1.00 15.67 ? 126 ASN A C     1 
ATOM   961  O  O     . ASN A 1 150 ? 66.922 8.317  24.345  1.00 15.56 ? 126 ASN A O     1 
ATOM   962  C  CB    . ASN A 1 150 ? 65.366 5.854  24.315  1.00 15.76 ? 126 ASN A CB    1 
ATOM   963  C  CG    . ASN A 1 150 ? 64.214 4.923  24.644  1.00 14.66 ? 126 ASN A CG    1 
ATOM   964  O  OD1   . ASN A 1 150 ? 64.418 3.723  24.892  1.00 16.76 ? 126 ASN A OD1   1 
ATOM   965  N  ND2   . ASN A 1 150 ? 63.003 5.478  24.712  1.00 17.62 ? 126 ASN A ND2   1 
ATOM   966  N  N     . THR A 1 151 ? 68.150 7.360  25.996  1.00 16.53 ? 127 THR A N     1 
ATOM   967  C  CA    . THR A 1 151 ? 69.104 8.453  26.104  1.00 14.70 ? 127 THR A CA    1 
ATOM   968  C  C     . THR A 1 151 ? 70.465 8.122  25.524  1.00 15.53 ? 127 THR A C     1 
ATOM   969  O  O     . THR A 1 151 ? 71.100 7.149  25.925  1.00 17.15 ? 127 THR A O     1 
ATOM   970  C  CB    . THR A 1 151 ? 69.282 8.850  27.587  1.00 14.63 ? 127 THR A CB    1 
ATOM   971  O  OG1   . THR A 1 151 ? 68.001 9.208  28.125  1.00 17.01 ? 127 THR A OG1   1 
ATOM   972  C  CG2   . THR A 1 151 ? 70.251 10.045 27.747  1.00 15.89 ? 127 THR A CG2   1 
ATOM   973  N  N     . TYR A 1 152 ? 70.873 8.938  24.551  1.00 15.30 ? 128 TYR A N     1 
ATOM   974  C  CA    . TYR A 1 152 ? 72.233 8.905  24.034  1.00 14.91 ? 128 TYR A CA    1 
ATOM   975  C  C     . TYR A 1 152 ? 73.014 10.006 24.727  1.00 16.13 ? 128 TYR A C     1 
ATOM   976  O  O     . TYR A 1 152 ? 72.713 11.190 24.550  1.00 17.57 ? 128 TYR A O     1 
ATOM   977  C  CB    . TYR A 1 152 ? 72.235 9.085  22.512  1.00 17.46 ? 128 TYR A CB    1 
ATOM   978  C  CG    . TYR A 1 152 ? 73.606 9.331  21.921  1.00 19.75 ? 128 TYR A CG    1 
ATOM   979  C  CD1   . TYR A 1 152 ? 74.528 8.299  21.783  1.00 26.13 ? 128 TYR A CD1   1 
ATOM   980  C  CD2   . TYR A 1 152 ? 73.972 10.604 21.494  1.00 22.05 ? 128 TYR A CD2   1 
ATOM   981  C  CE1   . TYR A 1 152 ? 75.790 8.535  21.248  1.00 29.21 ? 128 TYR A CE1   1 
ATOM   982  C  CE2   . TYR A 1 152 ? 75.227 10.852 20.958  1.00 25.61 ? 128 TYR A CE2   1 
ATOM   983  C  CZ    . TYR A 1 152 ? 76.128 9.815  20.830  1.00 26.68 ? 128 TYR A CZ    1 
ATOM   984  O  OH    . TYR A 1 152 ? 77.373 10.076 20.298  1.00 32.69 ? 128 TYR A OH    1 
ATOM   985  N  N     . LEU A 1 153 ? 74.008 9.615  25.516  1.00 17.24 ? 129 LEU A N     1 
ATOM   986  C  CA    . LEU A 1 153 ? 74.707 10.558 26.374  1.00 17.46 ? 129 LEU A CA    1 
ATOM   987  C  C     . LEU A 1 153 ? 75.604 11.574 25.640  1.00 18.00 ? 129 LEU A C     1 
ATOM   988  O  O     . LEU A 1 153 ? 75.842 12.666 26.145  1.00 17.70 ? 129 LEU A O     1 
ATOM   989  C  CB    . LEU A 1 153 ? 75.501 9.833  27.468  1.00 19.30 ? 129 LEU A CB    1 
ATOM   990  C  CG    . LEU A 1 153 ? 74.682 9.213  28.606  1.00 21.86 ? 129 LEU A CG    1 
ATOM   991  C  CD1   . LEU A 1 153 ? 75.564 8.401  29.542  1.00 22.85 ? 129 LEU A CD1   1 
ATOM   992  C  CD2   . LEU A 1 153 ? 73.947 10.306 29.364  1.00 22.71 ? 129 LEU A CD2   1 
ATOM   993  N  N     . GLY A 1 154 ? 76.090 11.227 24.452  1.00 18.82 ? 130 GLY A N     1 
ATOM   994  C  CA    . GLY A 1 154 ? 76.899 12.176 23.671  1.00 20.43 ? 130 GLY A CA    1 
ATOM   995  C  C     . GLY A 1 154 ? 77.913 12.964 24.499  1.00 19.19 ? 130 GLY A C     1 
ATOM   996  O  O     . GLY A 1 154 ? 78.684 12.376 25.269  1.00 19.28 ? 130 GLY A O     1 
ATOM   997  N  N     . ALA A 1 155 ? 77.880 14.294 24.378  1.00 20.40 ? 131 ALA A N     1 
ATOM   998  C  CA    . ALA A 1 155 ? 78.827 15.165 25.069  1.00 17.02 ? 131 ALA A CA    1 
ATOM   999  C  C     . ALA A 1 155 ? 78.803 15.073 26.615  1.00 17.73 ? 131 ALA A C     1 
ATOM   1000 O  O     . ALA A 1 155 ? 79.736 15.534 27.277  1.00 18.49 ? 131 ALA A O     1 
ATOM   1001 C  CB    . ALA A 1 155 ? 78.628 16.609 24.623  1.00 19.90 ? 131 ALA A CB    1 
ATOM   1002 N  N     . CYS A 1 156 ? 77.758 14.468 27.185  1.00 17.64 ? 132 CYS A N     1 
ATOM   1003 C  CA    . CYS A 1 156 ? 77.741 14.237 28.644  1.00 17.61 ? 132 CYS A CA    1 
ATOM   1004 C  C     . CYS A 1 156 ? 78.919 13.395 29.160  1.00 19.86 ? 132 CYS A C     1 
ATOM   1005 O  O     . CYS A 1 156 ? 79.298 13.505 30.324  1.00 20.61 ? 132 CYS A O     1 
ATOM   1006 C  CB    . CYS A 1 156 ? 76.429 13.581 29.082  1.00 19.02 ? 132 CYS A CB    1 
ATOM   1007 S  SG    . CYS A 1 156 ? 75.019 14.692 28.979  1.00 19.15 ? 132 CYS A SG    1 
ATOM   1008 N  N     . VAL A 1 157 ? 79.508 12.569 28.300  1.00 19.43 ? 133 VAL A N     1 
ATOM   1009 C  CA    . VAL A 1 157 ? 80.625 11.715 28.728  1.00 21.12 ? 133 VAL A CA    1 
ATOM   1010 C  C     . VAL A 1 157 ? 81.880 12.527 29.052  1.00 21.69 ? 133 VAL A C     1 
ATOM   1011 O  O     . VAL A 1 157 ? 82.827 12.016 29.647  1.00 23.25 ? 133 VAL A O     1 
ATOM   1012 C  CB    . VAL A 1 157 ? 80.948 10.596 27.705  1.00 22.16 ? 133 VAL A CB    1 
ATOM   1013 C  CG1   . VAL A 1 157 ? 79.739 9.692  27.511  1.00 23.38 ? 133 VAL A CG1   1 
ATOM   1014 C  CG2   . VAL A 1 157 ? 81.402 11.186 26.373  1.00 23.39 ? 133 VAL A CG2   1 
ATOM   1015 N  N     . GLU A 1 158 ? 81.877 13.801 28.658  1.00 23.35 ? 134 GLU A N     1 
ATOM   1016 C  CA    . GLU A 1 158 ? 83.044 14.671 28.844  1.00 25.43 ? 134 GLU A CA    1 
ATOM   1017 C  C     . GLU A 1 158 ? 83.011 15.561 30.100  1.00 23.07 ? 134 GLU A C     1 
ATOM   1018 O  O     . GLU A 1 158 ? 84.005 16.236 30.414  1.00 27.02 ? 134 GLU A O     1 
ATOM   1019 C  CB    . GLU A 1 158 ? 83.324 15.486 27.570  1.00 28.96 ? 134 GLU A CB    1 
ATOM   1020 C  CG    . GLU A 1 158 ? 83.279 14.628 26.311  1.00 35.31 ? 134 GLU A CG    1 
ATOM   1021 C  CD    . GLU A 1 158 ? 84.248 15.062 25.231  1.00 39.54 ? 134 GLU A CD    1 
ATOM   1022 O  OE1   . GLU A 1 158 ? 84.491 16.276 25.080  1.00 40.81 ? 134 GLU A OE1   1 
ATOM   1023 O  OE2   . GLU A 1 158 ? 84.754 14.173 24.516  1.00 39.38 ? 134 GLU A OE2   1 
ATOM   1024 N  N     . LEU A 1 159 ? 81.883 15.548 30.824  1.00 20.05 ? 135 LEU A N     1 
ATOM   1025 C  CA    . LEU A 1 159 ? 81.780 16.270 32.098  1.00 19.37 ? 135 LEU A CA    1 
ATOM   1026 C  C     . LEU A 1 159 ? 82.785 15.695 33.093  1.00 20.31 ? 135 LEU A C     1 
ATOM   1027 O  O     . LEU A 1 159 ? 82.821 14.489 33.336  1.00 22.05 ? 135 LEU A O     1 
ATOM   1028 C  CB    . LEU A 1 159 ? 80.361 16.185 32.685  1.00 19.52 ? 135 LEU A CB    1 
ATOM   1029 C  CG    . LEU A 1 159 ? 80.151 17.126 33.892  1.00 18.93 ? 135 LEU A CG    1 
ATOM   1030 C  CD1   . LEU A 1 159 ? 80.049 18.586 33.473  1.00 20.44 ? 135 LEU A CD1   1 
ATOM   1031 C  CD2   . LEU A 1 159 ? 78.935 16.738 34.727  1.00 20.88 ? 135 LEU A CD2   1 
ATOM   1032 N  N     . GLY A 1 160 ? 83.609 16.563 33.662  1.00 21.86 ? 136 GLY A N     1 
ATOM   1033 C  CA    . GLY A 1 160 ? 84.673 16.124 34.563  1.00 23.52 ? 136 GLY A CA    1 
ATOM   1034 C  C     . GLY A 1 160 ? 85.038 17.170 35.597  1.00 25.90 ? 136 GLY A C     1 
ATOM   1035 O  O     . GLY A 1 160 ? 84.426 18.246 35.627  1.00 25.26 ? 136 GLY A O     1 
ATOM   1036 N  N     . PRO A 1 161 ? 86.051 16.873 36.445  1.00 25.40 ? 137 PRO A N     1 
ATOM   1037 C  CA    . PRO A 1 161 ? 86.455 17.826 37.488  1.00 26.07 ? 137 PRO A CA    1 
ATOM   1038 C  C     . PRO A 1 161 ? 86.806 19.217 36.956  1.00 24.50 ? 137 PRO A C     1 
ATOM   1039 O  O     . PRO A 1 161 ? 86.685 20.185 37.696  1.00 26.89 ? 137 PRO A O     1 
ATOM   1040 C  CB    . PRO A 1 161 ? 87.694 17.176 38.111  1.00 26.34 ? 137 PRO A CB    1 
ATOM   1041 C  CG    . PRO A 1 161 ? 87.567 15.733 37.793  1.00 26.93 ? 137 PRO A CG    1 
ATOM   1042 C  CD    . PRO A 1 161 ? 86.881 15.654 36.461  1.00 26.48 ? 137 PRO A CD    1 
ATOM   1043 N  N     . GLU A 1 162 ? 87.222 19.306 35.689  1.00 25.53 ? 138 GLU A N     1 
ATOM   1044 C  CA    . GLU A 1 162 ? 87.556 20.589 35.044  1.00 26.46 ? 138 GLU A CA    1 
ATOM   1045 C  C     . GLU A 1 162 ? 86.345 21.538 34.968  1.00 25.38 ? 138 GLU A C     1 
ATOM   1046 O  O     . GLU A 1 162 ? 86.496 22.756 34.846  1.00 28.79 ? 138 GLU A O     1 
ATOM   1047 C  CB    . GLU A 1 162 ? 88.176 20.353 33.650  1.00 31.68 ? 138 GLU A CB    1 
ATOM   1048 C  CG    . GLU A 1 162 ? 87.245 19.776 32.565  1.00 36.30 ? 138 GLU A CG    1 
ATOM   1049 C  CD    . GLU A 1 162 ? 87.018 18.251 32.615  1.00 28.24 ? 138 GLU A CD    1 
ATOM   1050 O  OE1   . GLU A 1 162 ? 87.460 17.612 33.610  1.00 33.41 ? 138 GLU A OE1   1 
ATOM   1051 O  OE2   . GLU A 1 162 ? 86.431 17.719 31.687  1.00 41.89 ? 138 GLU A OE2   1 
ATOM   1052 N  N     . ASP A 1 163 ? 85.151 20.961 35.069  1.00 24.01 ? 139 ASP A N     1 
ATOM   1053 C  CA    . ASP A 1 163 ? 83.898 21.696 34.934  1.00 23.06 ? 139 ASP A CA    1 
ATOM   1054 C  C     . ASP A 1 163 ? 83.325 22.162 36.269  1.00 23.11 ? 139 ASP A C     1 
ATOM   1055 O  O     . ASP A 1 163 ? 82.254 22.769 36.304  1.00 25.32 ? 139 ASP A O     1 
ATOM   1056 C  CB    . ASP A 1 163 ? 82.872 20.837 34.190  1.00 23.55 ? 139 ASP A CB    1 
ATOM   1057 C  CG    . ASP A 1 163 ? 83.310 20.507 32.782  1.00 21.64 ? 139 ASP A CG    1 
ATOM   1058 O  OD1   . ASP A 1 163 ? 83.523 21.459 32.000  1.00 26.01 ? 139 ASP A OD1   1 
ATOM   1059 O  OD2   . ASP A 1 163 ? 83.427 19.304 32.460  1.00 23.94 ? 139 ASP A OD2   1 
ATOM   1060 N  N     . VAL A 1 164 ? 84.032 21.889 37.360  1.00 21.64 ? 140 VAL A N     1 
ATOM   1061 C  CA    . VAL A 1 164 ? 83.587 22.354 38.671  1.00 20.97 ? 140 VAL A CA    1 
ATOM   1062 C  C     . VAL A 1 164 ? 84.002 23.809 38.865  1.00 21.71 ? 140 VAL A C     1 
ATOM   1063 O  O     . VAL A 1 164 ? 85.189 24.119 38.925  1.00 25.95 ? 140 VAL A O     1 
ATOM   1064 C  CB    . VAL A 1 164 ? 84.135 21.486 39.823  1.00 23.03 ? 140 VAL A CB    1 
ATOM   1065 C  CG1   . VAL A 1 164 ? 83.684 22.035 41.168  1.00 25.49 ? 140 VAL A CG1   1 
ATOM   1066 C  CG2   . VAL A 1 164 ? 83.711 20.030 39.657  1.00 24.85 ? 140 VAL A CG2   1 
ATOM   1067 N  N     . GLU A 1 165 ? 83.013 24.698 38.932  1.00 22.26 ? 141 GLU A N     1 
ATOM   1068 C  CA    . GLU A 1 165 ? 83.258 26.092 39.260  1.00 23.47 ? 141 GLU A CA    1 
ATOM   1069 C  C     . GLU A 1 165 ? 83.250 26.144 40.779  1.00 22.59 ? 141 GLU A C     1 
ATOM   1070 O  O     . GLU A 1 165 ? 82.185 26.263 41.403  1.00 24.92 ? 141 GLU A O     1 
ATOM   1071 C  CB    . GLU A 1 165 ? 82.176 26.998 38.657  1.00 25.04 ? 141 GLU A CB    1 
ATOM   1072 C  CG    . GLU A 1 165 ? 82.079 26.939 37.139  1.00 25.06 ? 141 GLU A CG    1 
ATOM   1073 C  CD    . GLU A 1 165 ? 80.744 27.439 36.602  1.00 28.39 ? 141 GLU A CD    1 
ATOM   1074 O  OE1   . GLU A 1 165 ? 80.266 28.511 37.028  1.00 28.14 ? 141 GLU A OE1   1 
ATOM   1075 O  OE2   . GLU A 1 165 ? 80.169 26.760 35.733  1.00 28.41 ? 141 GLU A OE2   1 
ATOM   1076 N  N     . ALA A 1 166 ? 84.439 26.021 41.368  1.00 24.83 ? 142 ALA A N     1 
ATOM   1077 C  CA    . ALA A 1 166 ? 84.583 25.893 42.815  1.00 24.11 ? 142 ALA A CA    1 
ATOM   1078 C  C     . ALA A 1 166 ? 83.939 27.040 43.593  1.00 25.73 ? 142 ALA A C     1 
ATOM   1079 O  O     . ALA A 1 166 ? 83.369 26.813 44.664  1.00 26.22 ? 142 ALA A O     1 
ATOM   1080 C  CB    . ALA A 1 166 ? 86.049 25.749 43.195  1.00 27.64 ? 142 ALA A CB    1 
ATOM   1081 N  N     . ASP A 1 167 ? 84.025 28.261 43.055  1.00 26.62 ? 143 ASP A N     1 
ATOM   1082 C  CA    . ASP A 1 167 ? 83.393 29.430 43.682  1.00 27.22 ? 143 ASP A CA    1 
ATOM   1083 C  C     . ASP A 1 167 ? 81.868 29.290 43.767  1.00 27.52 ? 143 ASP A C     1 
ATOM   1084 O  O     . ASP A 1 167 ? 81.253 29.732 44.737  1.00 27.21 ? 143 ASP A O     1 
ATOM   1085 C  CB    . ASP A 1 167 ? 83.771 30.718 42.941  1.00 30.87 ? 143 ASP A CB    1 
ATOM   1086 C  CG    . ASP A 1 167 ? 83.344 30.705 41.473  1.00 35.91 ? 143 ASP A CG    1 
ATOM   1087 O  OD1   . ASP A 1 167 ? 83.748 29.776 40.733  1.00 38.39 ? 143 ASP A OD1   1 
ATOM   1088 O  OD2   . ASP A 1 167 ? 82.604 31.628 41.061  1.00 42.64 ? 143 ASP A OD2   1 
ATOM   1089 N  N     . VAL A 1 168 ? 81.267 28.675 42.751  1.00 24.69 ? 144 VAL A N     1 
ATOM   1090 C  CA    . VAL A 1 168 ? 79.822 28.464 42.718  1.00 23.65 ? 144 VAL A CA    1 
ATOM   1091 C  C     . VAL A 1 168 ? 79.414 27.423 43.769  1.00 23.70 ? 144 VAL A C     1 
ATOM   1092 O  O     . VAL A 1 168 ? 78.445 27.633 44.516  1.00 26.35 ? 144 VAL A O     1 
ATOM   1093 C  CB    . VAL A 1 168 ? 79.344 28.046 41.303  1.00 23.77 ? 144 VAL A CB    1 
ATOM   1094 C  CG1   . VAL A 1 168 ? 77.868 27.674 41.313  1.00 24.45 ? 144 VAL A CG1   1 
ATOM   1095 C  CG2   . VAL A 1 168 ? 79.626 29.157 40.306  1.00 27.72 ? 144 VAL A CG2   1 
ATOM   1096 N  N     . VAL A 1 169 ? 80.158 26.317 43.842  1.00 22.98 ? 145 VAL A N     1 
ATOM   1097 C  CA    . VAL A 1 169 ? 79.903 25.289 44.857  1.00 23.15 ? 145 VAL A CA    1 
ATOM   1098 C  C     . VAL A 1 169 ? 80.064 25.886 46.262  1.00 23.49 ? 145 VAL A C     1 
ATOM   1099 O  O     . VAL A 1 169 ? 79.213 25.680 47.122  1.00 24.84 ? 145 VAL A O     1 
ATOM   1100 C  CB    . VAL A 1 169 ? 80.831 24.063 44.716  1.00 21.92 ? 145 VAL A CB    1 
ATOM   1101 C  CG1   . VAL A 1 169 ? 80.461 23.003 45.752  1.00 25.46 ? 145 VAL A CG1   1 
ATOM   1102 C  CG2   . VAL A 1 169 ? 80.780 23.478 43.304  1.00 23.54 ? 145 VAL A CG2   1 
ATOM   1103 N  N     . ALA A 1 170 ? 81.130 26.657 46.471  1.00 24.43 ? 146 ALA A N     1 
ATOM   1104 C  CA    . ALA A 1 170 ? 81.391 27.291 47.769  1.00 25.28 ? 146 ALA A CA    1 
ATOM   1105 C  C     . ALA A 1 170 ? 80.260 28.228 48.192  1.00 27.81 ? 146 ALA A C     1 
ATOM   1106 O  O     . ALA A 1 170 ? 79.963 28.340 49.391  1.00 29.34 ? 146 ALA A O     1 
ATOM   1107 C  CB    . ALA A 1 170 ? 82.707 28.055 47.732  1.00 27.86 ? 146 ALA A CB    1 
ATOM   1108 N  N     . ASP A 1 171 ? 79.642 28.889 47.204  1.00 25.99 ? 147 ASP A N     1 
ATOM   1109 C  CA    . ASP A 1 171 ? 78.618 29.918 47.444  1.00 26.28 ? 147 ASP A CA    1 
ATOM   1110 C  C     . ASP A 1 171 ? 77.175 29.437 47.260  1.00 26.00 ? 147 ASP A C     1 
ATOM   1111 O  O     . ASP A 1 171 ? 76.250 30.251 47.184  1.00 27.75 ? 147 ASP A O     1 
ATOM   1112 C  CB    . ASP A 1 171 ? 78.881 31.159 46.569  1.00 30.23 ? 147 ASP A CB    1 
ATOM   1113 C  CG    . ASP A 1 171 ? 80.266 31.774 46.799  1.00 26.85 ? 147 ASP A CG    1 
ATOM   1114 O  OD1   . ASP A 1 171 ? 80.928 31.456 47.818  1.00 32.36 ? 147 ASP A OD1   1 
ATOM   1115 O  OD2   . ASP A 1 171 ? 80.700 32.572 45.947  1.00 32.58 ? 147 ASP A OD2   1 
ATOM   1116 N  N     . ALA A 1 172 ? 76.980 28.121 47.184  1.00 25.73 ? 148 ALA A N     1 
ATOM   1117 C  CA    . ALA A 1 172 ? 75.636 27.559 47.066  1.00 22.87 ? 148 ALA A CA    1 
ATOM   1118 C  C     . ALA A 1 172 ? 75.217 26.829 48.341  1.00 22.51 ? 148 ALA A C     1 
ATOM   1119 O  O     . ALA A 1 172 ? 75.941 25.979 48.850  1.00 25.23 ? 148 ALA A O     1 
ATOM   1120 C  CB    . ALA A 1 172 ? 75.535 26.621 45.866  1.00 21.66 ? 148 ALA A CB    1 
ATOM   1121 N  N     . LYS A 1 173 ? 74.021 27.147 48.826  1.00 23.07 ? 149 LYS A N     1 
ATOM   1122 C  CA    . LYS A 1 173 ? 73.492 26.553 50.053  1.00 23.78 ? 149 LYS A CA    1 
ATOM   1123 C  C     . LYS A 1 173 ? 73.395 25.032 49.938  1.00 22.86 ? 149 LYS A C     1 
ATOM   1124 O  O     . LYS A 1 173 ? 73.784 24.307 50.860  1.00 24.51 ? 149 LYS A O     1 
ATOM   1125 C  CB    . LYS A 1 173 ? 72.119 27.128 50.391  1.00 24.44 ? 149 LYS A CB    1 
ATOM   1126 C  CG    . LYS A 1 173 ? 72.106 28.616 50.707  1.00 23.91 ? 149 LYS A CG    1 
ATOM   1127 C  CD    . LYS A 1 173 ? 70.680 29.054 50.983  1.00 30.09 ? 149 LYS A CD    1 
ATOM   1128 C  CE    . LYS A 1 173 ? 70.582 30.542 51.259  1.00 33.31 ? 149 LYS A CE    1 
ATOM   1129 N  NZ    . LYS A 1 173 ? 69.148 30.940 51.293  1.00 35.42 ? 149 LYS A NZ    1 
ATOM   1130 N  N     . VAL A 1 174 ? 72.880 24.556 48.802  1.00 22.94 ? 150 VAL A N     1 
ATOM   1131 C  CA    . VAL A 1 174 ? 72.781 23.122 48.540  1.00 21.93 ? 150 VAL A CA    1 
ATOM   1132 C  C     . VAL A 1 174 ? 73.336 22.841 47.155  1.00 21.90 ? 150 VAL A C     1 
ATOM   1133 O  O     . VAL A 1 174 ? 73.060 23.592 46.223  1.00 20.58 ? 150 VAL A O     1 
ATOM   1134 C  CB    . VAL A 1 174 ? 71.317 22.599 48.639  1.00 22.58 ? 150 VAL A CB    1 
ATOM   1135 C  CG1   . VAL A 1 174 ? 71.223 21.121 48.272  1.00 22.82 ? 150 VAL A CG1   1 
ATOM   1136 C  CG2   . VAL A 1 174 ? 70.743 22.839 50.030  1.00 25.61 ? 150 VAL A CG2   1 
ATOM   1137 N  N     . THR A 1 175 ? 74.143 21.787 47.046  1.00 20.92 ? 151 THR A N     1 
ATOM   1138 C  CA    . THR A 1 175 ? 74.534 21.233 45.754  1.00 19.54 ? 151 THR A CA    1 
ATOM   1139 C  C     . THR A 1 175 ? 73.865 19.879 45.599  1.00 19.53 ? 151 THR A C     1 
ATOM   1140 O  O     . THR A 1 175 ? 74.061 18.979 46.415  1.00 20.73 ? 151 THR A O     1 
ATOM   1141 C  CB    . THR A 1 175 ? 76.068 21.118 45.619  1.00 20.56 ? 151 THR A CB    1 
ATOM   1142 O  OG1   . THR A 1 175 ? 76.634 22.428 45.607  1.00 22.26 ? 151 THR A OG1   1 
ATOM   1143 C  CG2   . THR A 1 175 ? 76.470 20.400 44.333  1.00 21.69 ? 151 THR A CG2   1 
ATOM   1144 N  N     . TYR A 1 176 ? 73.113 19.743 44.512  1.00 20.02 ? 152 TYR A N     1 
ATOM   1145 C  CA    . TYR A 1 176 ? 72.274 18.587 44.222  1.00 17.84 ? 152 TYR A CA    1 
ATOM   1146 C  C     . TYR A 1 176 ? 72.714 17.944 42.918  1.00 18.56 ? 152 TYR A C     1 
ATOM   1147 O  O     . TYR A 1 176 ? 72.976 18.634 41.929  1.00 20.78 ? 152 TYR A O     1 
ATOM   1148 C  CB    . TYR A 1 176 ? 70.821 19.057 44.144  1.00 20.42 ? 152 TYR A CB    1 
ATOM   1149 C  CG    . TYR A 1 176 ? 69.788 18.126 43.539  1.00 18.95 ? 152 TYR A CG    1 
ATOM   1150 C  CD1   . TYR A 1 176 ? 69.545 18.104 42.155  1.00 19.11 ? 152 TYR A CD1   1 
ATOM   1151 C  CD2   . TYR A 1 176 ? 68.984 17.331 44.355  1.00 18.37 ? 152 TYR A CD2   1 
ATOM   1152 C  CE1   . TYR A 1 176 ? 68.568 17.287 41.611  1.00 19.14 ? 152 TYR A CE1   1 
ATOM   1153 C  CE2   . TYR A 1 176 ? 67.996 16.512 43.818  1.00 18.95 ? 152 TYR A CE2   1 
ATOM   1154 C  CZ    . TYR A 1 176 ? 67.797 16.489 42.444  1.00 18.29 ? 152 TYR A CZ    1 
ATOM   1155 O  OH    . TYR A 1 176 ? 66.819 15.703 41.902  1.00 18.67 ? 152 TYR A OH    1 
ATOM   1156 N  N     . PHE A 1 177 ? 72.793 16.619 42.918  1.00 17.71 ? 153 PHE A N     1 
ATOM   1157 C  CA    . PHE A 1 177 ? 73.259 15.908 41.733  1.00 17.42 ? 153 PHE A CA    1 
ATOM   1158 C  C     . PHE A 1 177 ? 72.484 14.632 41.446  1.00 18.42 ? 153 PHE A C     1 
ATOM   1159 O  O     . PHE A 1 177 ? 71.846 14.064 42.333  1.00 18.33 ? 153 PHE A O     1 
ATOM   1160 C  CB    . PHE A 1 177 ? 74.760 15.631 41.828  1.00 17.84 ? 153 PHE A CB    1 
ATOM   1161 C  CG    . PHE A 1 177 ? 75.134 14.595 42.859  1.00 18.60 ? 153 PHE A CG    1 
ATOM   1162 C  CD1   . PHE A 1 177 ? 75.372 14.964 44.180  1.00 20.64 ? 153 PHE A CD1   1 
ATOM   1163 C  CD2   . PHE A 1 177 ? 75.265 13.246 42.510  1.00 19.20 ? 153 PHE A CD2   1 
ATOM   1164 C  CE1   . PHE A 1 177 ? 75.712 14.012 45.132  1.00 21.92 ? 153 PHE A CE1   1 
ATOM   1165 C  CE2   . PHE A 1 177 ? 75.613 12.297 43.457  1.00 18.08 ? 153 PHE A CE2   1 
ATOM   1166 C  CZ    . PHE A 1 177 ? 75.838 12.679 44.773  1.00 19.84 ? 153 PHE A CZ    1 
ATOM   1167 N  N     . GLU A 1 178 ? 72.554 14.188 40.190  1.00 17.80 ? 154 GLU A N     1 
ATOM   1168 C  CA    . GLU A 1 178 ? 71.852 12.995 39.733  1.00 17.45 ? 154 GLU A CA    1 
ATOM   1169 C  C     . GLU A 1 178 ? 72.664 11.723 39.950  1.00 16.76 ? 154 GLU A C     1 
ATOM   1170 O  O     . GLU A 1 178 ? 73.864 11.682 39.649  1.00 16.76 ? 154 GLU A O     1 
ATOM   1171 C  CB    . GLU A 1 178 ? 71.590 13.070 38.226  1.00 16.71 ? 154 GLU A CB    1 
ATOM   1172 C  CG    . GLU A 1 178 ? 70.935 14.328 37.697  1.00 18.58 ? 154 GLU A CG    1 
ATOM   1173 C  CD    . GLU A 1 178 ? 71.082 14.450 36.187  1.00 17.70 ? 154 GLU A CD    1 
ATOM   1174 O  OE1   . GLU A 1 178 ? 71.952 13.748 35.614  1.00 17.68 ? 154 GLU A OE1   1 
ATOM   1175 O  OE2   . GLU A 1 178 ? 70.343 15.235 35.575  1.00 18.25 ? 154 GLU A OE2   1 
ATOM   1176 N  N     . GLY A 1 179 ? 71.998 10.678 40.444  1.00 17.11 ? 155 GLY A N     1 
ATOM   1177 C  CA    . GLY A 1 179 ? 72.535 9.325  40.367  1.00 16.31 ? 155 GLY A CA    1 
ATOM   1178 C  C     . GLY A 1 179 ? 72.914 8.965  38.934  1.00 17.08 ? 155 GLY A C     1 
ATOM   1179 O  O     . GLY A 1 179 ? 73.882 8.237  38.716  1.00 17.62 ? 155 GLY A O     1 
ATOM   1180 N  N     . TYR A 1 180 ? 72.180 9.521  37.970  1.00 16.22 ? 156 TYR A N     1 
ATOM   1181 C  CA    . TYR A 1 180 ? 72.456 9.316  36.529  1.00 14.77 ? 156 TYR A CA    1 
ATOM   1182 C  C     . TYR A 1 180 ? 73.910 9.662  36.164  1.00 16.40 ? 156 TYR A C     1 
ATOM   1183 O  O     . TYR A 1 180 ? 74.424 9.191  35.143  1.00 18.05 ? 156 TYR A O     1 
ATOM   1184 C  CB    . TYR A 1 180 ? 71.546 10.178 35.666  1.00 15.65 ? 156 TYR A CB    1 
ATOM   1185 C  CG    . TYR A 1 180 ? 70.093 9.771  35.522  1.00 15.31 ? 156 TYR A CG    1 
ATOM   1186 C  CD1   . TYR A 1 180 ? 69.702 8.452  35.239  1.00 15.25 ? 156 TYR A CD1   1 
ATOM   1187 C  CD2   . TYR A 1 180 ? 69.100 10.745 35.603  1.00 16.49 ? 156 TYR A CD2   1 
ATOM   1188 C  CE1   . TYR A 1 180 ? 68.353 8.136  35.055  1.00 18.10 ? 156 TYR A CE1   1 
ATOM   1189 C  CE2   . TYR A 1 180 ? 67.762 10.441 35.424  1.00 17.29 ? 156 TYR A CE2   1 
ATOM   1190 C  CZ    . TYR A 1 180 ? 67.389 9.140  35.147  1.00 17.24 ? 156 TYR A CZ    1 
ATOM   1191 O  OH    . TYR A 1 180 ? 66.051 8.857  34.966  1.00 17.42 ? 156 TYR A OH    1 
ATOM   1192 N  N     . LEU A 1 181 ? 74.553 10.520 36.948  1.00 17.14 ? 157 LEU A N     1 
ATOM   1193 C  CA    . LEU A 1 181 ? 75.945 10.891 36.666  1.00 16.62 ? 157 LEU A CA    1 
ATOM   1194 C  C     . LEU A 1 181 ? 76.948 9.752  36.800  1.00 18.75 ? 157 LEU A C     1 
ATOM   1195 O  O     . LEU A 1 181 ? 78.102 9.904  36.380  1.00 19.05 ? 157 LEU A O     1 
ATOM   1196 C  CB    . LEU A 1 181 ? 76.382 12.075 37.531  1.00 16.85 ? 157 LEU A CB    1 
ATOM   1197 C  CG    . LEU A 1 181 ? 75.810 13.434 37.111  1.00 17.05 ? 157 LEU A CG    1 
ATOM   1198 C  CD1   . LEU A 1 181 ? 76.227 14.475 38.133  1.00 19.84 ? 157 LEU A CD1   1 
ATOM   1199 C  CD2   . LEU A 1 181 ? 76.246 13.840 35.703  1.00 19.22 ? 157 LEU A CD2   1 
ATOM   1200 N  N     . TRP A 1 182 ? 76.526 8.632  37.392  1.00 17.36 ? 158 TRP A N     1 
ATOM   1201 C  CA    . TRP A 1 182 ? 77.421 7.489  37.556  1.00 19.70 ? 158 TRP A CA    1 
ATOM   1202 C  C     . TRP A 1 182 ? 77.614 6.690  36.254  1.00 19.40 ? 158 TRP A C     1 
ATOM   1203 O  O     . TRP A 1 182 ? 78.543 5.903  36.140  1.00 20.09 ? 158 TRP A O     1 
ATOM   1204 C  CB    . TRP A 1 182 ? 77.013 6.621  38.756  1.00 18.44 ? 158 TRP A CB    1 
ATOM   1205 C  CG    . TRP A 1 182 ? 77.842 6.883  39.970  1.00 18.74 ? 158 TRP A CG    1 
ATOM   1206 C  CD1   . TRP A 1 182 ? 78.641 5.984  40.619  1.00 22.15 ? 158 TRP A CD1   1 
ATOM   1207 C  CD2   . TRP A 1 182 ? 78.002 8.131  40.662  1.00 20.15 ? 158 TRP A CD2   1 
ATOM   1208 N  NE1   . TRP A 1 182 ? 79.265 6.580  41.687  1.00 22.59 ? 158 TRP A NE1   1 
ATOM   1209 C  CE2   . TRP A 1 182 ? 78.901 7.901  41.735  1.00 23.93 ? 158 TRP A CE2   1 
ATOM   1210 C  CE3   . TRP A 1 182 ? 77.465 9.415  40.493  1.00 21.90 ? 158 TRP A CE3   1 
ATOM   1211 C  CZ2   . TRP A 1 182 ? 79.283 8.915  42.626  1.00 22.53 ? 158 TRP A CZ2   1 
ATOM   1212 C  CZ3   . TRP A 1 182 ? 77.849 10.417 41.381  1.00 21.82 ? 158 TRP A CZ3   1 
ATOM   1213 C  CH2   . TRP A 1 182 ? 78.744 10.160 42.434  1.00 22.82 ? 158 TRP A CH2   1 
ATOM   1214 N  N     . ASP A 1 183 ? 76.775 6.950  35.257  1.00 18.11 ? 159 ASP A N     1 
ATOM   1215 C  CA    . ASP A 1 183 ? 76.929 6.309  33.935  1.00 19.68 ? 159 ASP A CA    1 
ATOM   1216 C  C     . ASP A 1 183 ? 78.114 6.851  33.114  1.00 20.88 ? 159 ASP A C     1 
ATOM   1217 O  O     . ASP A 1 183 ? 78.976 6.058  32.690  1.00 23.16 ? 159 ASP A O     1 
ATOM   1218 C  CB    . ASP A 1 183 ? 75.617 6.307  33.131  1.00 20.68 ? 159 ASP A CB    1 
ATOM   1219 C  CG    . ASP A 1 183 ? 74.593 5.320  33.669  1.00 19.36 ? 159 ASP A CG    1 
ATOM   1220 O  OD1   . ASP A 1 183 ? 74.943 4.147  33.928  1.00 17.47 ? 159 ASP A OD1   1 
ATOM   1221 O  OD2   . ASP A 1 183 ? 73.417 5.696  33.795  1.00 21.13 ? 159 ASP A OD2   1 
ATOM   1222 N  N     . PRO A 1 184 ? 78.170 8.186  32.873  1.00 19.67 ? 160 PRO A N     1 
ATOM   1223 C  CA    . PRO A 1 184 ? 79.371 8.718  32.213  1.00 20.83 ? 160 PRO A CA    1 
ATOM   1224 C  C     . PRO A 1 184 ? 80.606 8.474  33.067  1.00 22.53 ? 160 PRO A C     1 
ATOM   1225 O  O     . PRO A 1 184 ? 80.484 8.318  34.282  1.00 26.52 ? 160 PRO A O     1 
ATOM   1226 C  CB    . PRO A 1 184 ? 79.085 10.225 32.083  1.00 21.58 ? 160 PRO A CB    1 
ATOM   1227 C  CG    . PRO A 1 184 ? 77.961 10.508 33.028  1.00 22.13 ? 160 PRO A CG    1 
ATOM   1228 C  CD    . PRO A 1 184 ? 77.165 9.244  33.095  1.00 20.26 ? 160 PRO A CD    1 
ATOM   1229 N  N     . PRO A 1 185 ? 81.795 8.432  32.442  1.00 25.35 ? 161 PRO A N     1 
ATOM   1230 C  CA    . PRO A 1 185 ? 82.971 7.913  33.140  1.00 25.23 ? 161 PRO A CA    1 
ATOM   1231 C  C     . PRO A 1 185 ? 83.581 8.806  34.222  1.00 23.93 ? 161 PRO A C     1 
ATOM   1232 O  O     . PRO A 1 185 ? 84.017 8.288  35.265  1.00 29.60 ? 161 PRO A O     1 
ATOM   1233 C  CB    . PRO A 1 185 ? 83.988 7.709  32.007  1.00 26.73 ? 161 PRO A CB    1 
ATOM   1234 C  CG    . PRO A 1 185 ? 83.590 8.687  30.955  1.00 26.73 ? 161 PRO A CG    1 
ATOM   1235 C  CD    . PRO A 1 185 ? 82.088 8.797  31.041  1.00 24.85 ? 161 PRO A CD    1 
ATOM   1236 N  N     . ARG A 1 186 ? 83.610 10.119 33.995  1.00 23.75 ? 162 ARG A N     1 
ATOM   1237 C  CA    A ARG A 1 186 ? 84.367 11.017 34.863  0.50 25.69 ? 162 ARG A CA    1 
ATOM   1238 C  CA    B ARG A 1 186 ? 84.368 11.019 34.864  0.50 25.29 ? 162 ARG A CA    1 
ATOM   1239 C  C     . ARG A 1 186 ? 83.521 11.959 35.719  1.00 23.57 ? 162 ARG A C     1 
ATOM   1240 O  O     . ARG A 1 186 ? 84.054 12.665 36.574  1.00 24.30 ? 162 ARG A O     1 
ATOM   1241 C  CB    A ARG A 1 186 ? 85.393 11.814 34.045  0.50 27.94 ? 162 ARG A CB    1 
ATOM   1242 C  CB    B ARG A 1 186 ? 85.399 11.819 34.050  0.50 26.70 ? 162 ARG A CB    1 
ATOM   1243 C  CG    A ARG A 1 186 ? 86.363 10.951 33.250  0.50 30.67 ? 162 ARG A CG    1 
ATOM   1244 C  CG    B ARG A 1 186 ? 86.510 10.967 33.453  0.50 26.88 ? 162 ARG A CG    1 
ATOM   1245 C  CD    A ARG A 1 186 ? 87.664 11.690 32.994  0.50 32.93 ? 162 ARG A CD    1 
ATOM   1246 C  CD    B ARG A 1 186 ? 87.600 11.811 32.809  0.50 28.76 ? 162 ARG A CD    1 
ATOM   1247 N  NE    A ARG A 1 186 ? 88.352 11.992 34.245  0.50 33.76 ? 162 ARG A NE    1 
ATOM   1248 N  NE    B ARG A 1 186 ? 87.069 12.777 31.851  0.50 28.40 ? 162 ARG A NE    1 
ATOM   1249 C  CZ    A ARG A 1 186 ? 89.316 12.897 34.375  0.50 29.47 ? 162 ARG A CZ    1 
ATOM   1250 C  CZ    B ARG A 1 186 ? 87.175 14.097 31.976  0.50 29.10 ? 162 ARG A CZ    1 
ATOM   1251 N  NH1   A ARG A 1 186 ? 89.718 13.606 33.330  0.50 33.02 ? 162 ARG A NH1   1 
ATOM   1252 N  NH1   B ARG A 1 186 ? 86.656 14.896 31.051  0.50 31.89 ? 162 ARG A NH1   1 
ATOM   1253 N  NH2   A ARG A 1 186 ? 89.876 13.097 35.556  0.50 27.02 ? 162 ARG A NH2   1 
ATOM   1254 N  NH2   B ARG A 1 186 ? 87.810 14.619 33.018  0.50 31.08 ? 162 ARG A NH2   1 
ATOM   1255 N  N     . ALA A 1 187 ? 82.206 11.962 35.516  1.00 23.75 ? 163 ALA A N     1 
ATOM   1256 C  CA    . ALA A 1 187 ? 81.367 12.904 36.258  1.00 19.99 ? 163 ALA A CA    1 
ATOM   1257 C  C     . ALA A 1 187 ? 81.415 12.707 37.776  1.00 22.26 ? 163 ALA A C     1 
ATOM   1258 O  O     . ALA A 1 187 ? 81.321 13.679 38.529  1.00 22.85 ? 163 ALA A O     1 
ATOM   1259 C  CB    . ALA A 1 187 ? 79.935 12.862 35.769  1.00 21.48 ? 163 ALA A CB    1 
ATOM   1260 N  N     . LYS A 1 188 ? 81.551 11.457 38.216  1.00 20.70 ? 164 LYS A N     1 
ATOM   1261 C  CA    . LYS A 1 188 ? 81.644 11.153 39.648  1.00 21.29 ? 164 LYS A CA    1 
ATOM   1262 C  C     . LYS A 1 188 ? 82.820 11.861 40.330  1.00 22.92 ? 164 LYS A C     1 
ATOM   1263 O  O     . LYS A 1 188 ? 82.714 12.247 41.499  1.00 24.54 ? 164 LYS A O     1 
ATOM   1264 C  CB    . LYS A 1 188 ? 81.714 9.637  39.889  1.00 24.16 ? 164 LYS A CB    1 
ATOM   1265 C  CG    . LYS A 1 188 ? 82.956 8.943  39.337  1.00 25.71 ? 164 LYS A CG    1 
ATOM   1266 C  CD    . LYS A 1 188 ? 82.994 7.453  39.667  1.00 31.10 ? 164 LYS A CD    1 
ATOM   1267 C  CE    . LYS A 1 188 ? 81.824 6.695  39.064  1.00 33.37 ? 164 LYS A CE    1 
ATOM   1268 N  NZ    . LYS A 1 188 ? 81.798 6.726  37.572  1.00 40.44 ? 164 LYS A NZ    1 
ATOM   1269 N  N     . GLU A 1 189 ? 83.930 12.036 39.609  1.00 24.48 ? 165 GLU A N     1 
ATOM   1270 C  CA    . GLU A 1 189 ? 85.089 12.760 40.147  1.00 24.84 ? 165 GLU A CA    1 
ATOM   1271 C  C     . GLU A 1 189 ? 84.731 14.222 40.404  1.00 24.49 ? 165 GLU A C     1 
ATOM   1272 O  O     . GLU A 1 189 ? 85.134 14.786 41.413  1.00 26.17 ? 165 GLU A O     1 
ATOM   1273 C  CB    . GLU A 1 189 ? 86.286 12.691 39.195  1.00 26.06 ? 165 GLU A CB    1 
ATOM   1274 C  CG    . GLU A 1 189 ? 86.737 11.289 38.810  1.00 28.90 ? 165 GLU A CG    1 
ATOM   1275 C  CD    . GLU A 1 189 ? 87.733 11.303 37.665  1.00 35.93 ? 165 GLU A CD    1 
ATOM   1276 O  OE1   . GLU A 1 189 ? 87.757 10.333 36.881  1.00 40.66 ? 165 GLU A OE1   1 
ATOM   1277 O  OE2   . GLU A 1 189 ? 88.486 12.292 37.535  1.00 39.22 ? 165 GLU A OE2   1 
ATOM   1278 N  N     . ALA A 1 190 ? 83.968 14.826 39.493  1.00 24.91 ? 166 ALA A N     1 
ATOM   1279 C  CA    . ALA A 1 190 ? 83.479 16.187 39.698  1.00 22.56 ? 166 ALA A CA    1 
ATOM   1280 C  C     . ALA A 1 190 ? 82.573 16.260 40.918  1.00 22.12 ? 166 ALA A C     1 
ATOM   1281 O  O     . ALA A 1 190 ? 82.658 17.202 41.694  1.00 24.31 ? 166 ALA A O     1 
ATOM   1282 C  CB    . ALA A 1 190 ? 82.758 16.691 38.465  1.00 20.56 ? 166 ALA A CB    1 
ATOM   1283 N  N     . ILE A 1 191 ? 81.725 15.248 41.095  1.00 21.33 ? 167 ILE A N     1 
ATOM   1284 C  CA    . ILE A 1 191 ? 80.831 15.205 42.256  1.00 22.80 ? 167 ILE A CA    1 
ATOM   1285 C  C     . ILE A 1 191 ? 81.589 15.077 43.580  1.00 22.83 ? 167 ILE A C     1 
ATOM   1286 O  O     . ILE A 1 191 ? 81.243 15.740 44.565  1.00 25.26 ? 167 ILE A O     1 
ATOM   1287 C  CB    . ILE A 1 191 ? 79.758 14.106 42.118  1.00 21.37 ? 167 ILE A CB    1 
ATOM   1288 C  CG1   . ILE A 1 191 ? 78.822 14.426 40.943  1.00 20.48 ? 167 ILE A CG1   1 
ATOM   1289 C  CG2   . ILE A 1 191 ? 78.971 13.947 43.419  1.00 20.76 ? 167 ILE A CG2   1 
ATOM   1290 C  CD1   . ILE A 1 191 ? 78.190 15.809 40.978  1.00 18.86 ? 167 ILE A CD1   1 
ATOM   1291 N  N     . LEU A 1 192 ? 82.630 14.249 43.603  1.00 25.15 ? 168 LEU A N     1 
ATOM   1292 C  CA    . LEU A 1 192 ? 83.466 14.134 44.802  1.00 25.28 ? 168 LEU A CA    1 
ATOM   1293 C  C     . LEU A 1 192 ? 84.154 15.460 45.152  1.00 24.28 ? 168 LEU A C     1 
ATOM   1294 O  O     . LEU A 1 192 ? 84.279 15.810 46.327  1.00 27.87 ? 168 LEU A O     1 
ATOM   1295 C  CB    . LEU A 1 192 ? 84.484 12.995 44.677  1.00 26.55 ? 168 LEU A CB    1 
ATOM   1296 C  CG    . LEU A 1 192 ? 83.921 11.571 44.594  1.00 30.28 ? 168 LEU A CG    1 
ATOM   1297 C  CD1   . LEU A 1 192 ? 85.039 10.537 44.618  1.00 33.85 ? 168 LEU A CD1   1 
ATOM   1298 C  CD2   . LEU A 1 192 ? 82.911 11.295 45.700  1.00 32.69 ? 168 LEU A CD2   1 
ATOM   1299 N  N     . ASP A 1 193 ? 84.570 16.206 44.132  1.00 23.33 ? 169 ASP A N     1 
ATOM   1300 C  CA    . ASP A 1 193 ? 85.141 17.536 44.332  1.00 24.73 ? 169 ASP A CA    1 
ATOM   1301 C  C     . ASP A 1 193 ? 84.101 18.515 44.884  1.00 26.87 ? 169 ASP A C     1 
ATOM   1302 O  O     . ASP A 1 193 ? 84.402 19.295 45.792  1.00 26.26 ? 169 ASP A O     1 
ATOM   1303 C  CB    . ASP A 1 193 ? 85.745 18.070 43.032  1.00 29.47 ? 169 ASP A CB    1 
ATOM   1304 C  CG    . ASP A 1 193 ? 87.063 17.405 42.676  1.00 30.31 ? 169 ASP A CG    1 
ATOM   1305 O  OD1   . ASP A 1 193 ? 87.693 16.785 43.560  1.00 35.33 ? 169 ASP A OD1   1 
ATOM   1306 O  OD2   . ASP A 1 193 ? 87.481 17.516 41.505  1.00 32.55 ? 169 ASP A OD2   1 
ATOM   1307 N  N     . CYS A 1 194 ? 82.885 18.462 44.339  1.00 27.75 ? 170 CYS A N     1 
ATOM   1308 C  CA    . CYS A 1 194 ? 81.767 19.260 44.844  1.00 25.65 ? 170 CYS A CA    1 
ATOM   1309 C  C     . CYS A 1 194 ? 81.485 18.984 46.314  1.00 23.97 ? 170 CYS A C     1 
ATOM   1310 O  O     . CYS A 1 194 ? 81.332 19.920 47.098  1.00 24.07 ? 170 CYS A O     1 
ATOM   1311 C  CB    . CYS A 1 194 ? 80.497 19.033 44.021  1.00 25.36 ? 170 CYS A CB    1 
ATOM   1312 S  SG    . CYS A 1 194 ? 80.563 19.707 42.350  1.00 25.64 ? 170 CYS A SG    1 
ATOM   1313 N  N     . ALA A 1 195 ? 81.440 17.707 46.690  1.00 23.56 ? 171 ALA A N     1 
ATOM   1314 C  CA    . ALA A 1 195 ? 81.163 17.320 48.077  1.00 24.34 ? 171 ALA A CA    1 
ATOM   1315 C  C     . ALA A 1 195 ? 82.210 17.876 49.028  1.00 24.87 ? 171 ALA A C     1 
ATOM   1316 O  O     . ALA A 1 195 ? 81.867 18.400 50.091  1.00 27.34 ? 171 ALA A O     1 
ATOM   1317 C  CB    . ALA A 1 195 ? 81.071 15.810 48.212  1.00 26.79 ? 171 ALA A CB    1 
ATOM   1318 N  N     . ARG A 1 196 ? 83.479 17.779 48.628  1.00 24.89 ? 172 ARG A N     1 
ATOM   1319 C  CA    . ARG A 1 196 ? 84.579 18.341 49.408  1.00 25.48 ? 172 ARG A CA    1 
ATOM   1320 C  C     . ARG A 1 196 ? 84.418 19.852 49.591  1.00 26.81 ? 172 ARG A C     1 
ATOM   1321 O  O     . ARG A 1 196 ? 84.494 20.357 50.721  1.00 29.61 ? 172 ARG A O     1 
ATOM   1322 C  CB    . ARG A 1 196 ? 85.930 18.020 48.755  1.00 28.45 ? 172 ARG A CB    1 
ATOM   1323 C  CG    . ARG A 1 196 ? 87.144 18.576 49.492  1.00 31.98 ? 172 ARG A CG    1 
ATOM   1324 C  CD    . ARG A 1 196 ? 88.450 18.211 48.792  1.00 35.47 ? 172 ARG A CD    1 
ATOM   1325 N  NE    . ARG A 1 196 ? 88.347 18.307 47.331  1.00 39.25 ? 172 ARG A NE    1 
ATOM   1326 C  CZ    . ARG A 1 196 ? 88.586 19.408 46.619  1.00 43.19 ? 172 ARG A CZ    1 
ATOM   1327 N  NH1   . ARG A 1 196 ? 88.954 20.538 47.215  1.00 46.44 ? 172 ARG A NH1   1 
ATOM   1328 N  NH2   . ARG A 1 196 ? 88.459 19.376 45.300  1.00 42.34 ? 172 ARG A NH2   1 
ATOM   1329 N  N     . ILE A 1 197 ? 84.191 20.561 48.486  1.00 25.06 ? 173 ILE A N     1 
ATOM   1330 C  CA    . ILE A 1 197 ? 84.128 22.021 48.518  1.00 25.40 ? 173 ILE A CA    1 
ATOM   1331 C  C     . ILE A 1 197 ? 82.898 22.458 49.314  1.00 25.69 ? 173 ILE A C     1 
ATOM   1332 O  O     . ILE A 1 197 ? 82.995 23.337 50.180  1.00 28.73 ? 173 ILE A O     1 
ATOM   1333 C  CB    . ILE A 1 197 ? 84.122 22.649 47.101  1.00 25.42 ? 173 ILE A CB    1 
ATOM   1334 C  CG1   . ILE A 1 197 ? 85.450 22.387 46.381  1.00 24.55 ? 173 ILE A CG1   1 
ATOM   1335 C  CG2   . ILE A 1 197 ? 83.843 24.145 47.169  1.00 28.25 ? 173 ILE A CG2   1 
ATOM   1336 C  CD1   . ILE A 1 197 ? 85.371 22.510 44.870  1.00 27.24 ? 173 ILE A CD1   1 
ATOM   1337 N  N     . ALA A 1 198 ? 81.759 21.828 49.033  1.00 26.11 ? 174 ALA A N     1 
ATOM   1338 C  CA    . ALA A 1 198 ? 80.501 22.153 49.706  1.00 24.53 ? 174 ALA A CA    1 
ATOM   1339 C  C     . ALA A 1 198 ? 80.627 22.002 51.213  1.00 26.30 ? 174 ALA A C     1 
ATOM   1340 O  O     . ALA A 1 198 ? 80.282 22.918 51.969  1.00 28.03 ? 174 ALA A O     1 
ATOM   1341 C  CB    . ALA A 1 198 ? 79.366 21.288 49.177  1.00 24.91 ? 174 ALA A CB    1 
ATOM   1342 N  N     . HIS A 1 199 ? 81.135 20.855 51.652  1.00 26.42 ? 175 HIS A N     1 
ATOM   1343 C  CA    . HIS A 1 199 ? 81.261 20.608 53.086  1.00 27.02 ? 175 HIS A CA    1 
ATOM   1344 C  C     . HIS A 1 199 ? 82.335 21.450 53.782  1.00 28.96 ? 175 HIS A C     1 
ATOM   1345 O  O     . HIS A 1 199 ? 82.175 21.814 54.955  1.00 32.31 ? 175 HIS A O     1 
ATOM   1346 C  CB    . HIS A 1 199 ? 81.407 19.112 53.370  1.00 29.31 ? 175 HIS A CB    1 
ATOM   1347 C  CG    . HIS A 1 199 ? 80.138 18.341 53.168  1.00 30.35 ? 175 HIS A CG    1 
ATOM   1348 N  ND1   . HIS A 1 199 ? 80.117 17.039 52.714  1.00 32.75 ? 175 HIS A ND1   1 
ATOM   1349 C  CD2   . HIS A 1 199 ? 78.843 18.694 53.354  1.00 27.90 ? 175 HIS A CD2   1 
ATOM   1350 C  CE1   . HIS A 1 199 ? 78.865 16.623 52.638  1.00 29.45 ? 175 HIS A CE1   1 
ATOM   1351 N  NE2   . HIS A 1 199 ? 78.073 17.611 53.016  1.00 27.33 ? 175 HIS A NE2   1 
ATOM   1352 N  N     . GLN A 1 200 ? 83.403 21.799 53.064  1.00 27.95 ? 176 GLN A N     1 
ATOM   1353 C  CA    . GLN A 1 200 ? 84.413 22.727 53.608  1.00 29.43 ? 176 GLN A CA    1 
ATOM   1354 C  C     . GLN A 1 200 ? 83.820 24.118 53.880  1.00 31.79 ? 176 GLN A C     1 
ATOM   1355 O  O     . GLN A 1 200 ? 84.240 24.818 54.810  1.00 34.69 ? 176 GLN A O     1 
ATOM   1356 C  CB    . GLN A 1 200 ? 85.619 22.852 52.667  1.00 34.89 ? 176 GLN A CB    1 
ATOM   1357 C  CG    . GLN A 1 200 ? 86.629 21.718 52.781  1.00 41.06 ? 176 GLN A CG    1 
ATOM   1358 C  CD    . GLN A 1 200 ? 87.897 21.951 51.976  1.00 45.95 ? 176 GLN A CD    1 
ATOM   1359 O  OE1   . GLN A 1 200 ? 88.070 22.996 51.342  1.00 52.53 ? 176 GLN A OE1   1 
ATOM   1360 N  NE2   . GLN A 1 200 ? 88.798 20.972 52.003  1.00 51.00 ? 176 GLN A NE2   1 
ATOM   1361 N  N     . HIS A 1 201 ? 82.837 24.503 53.071  1.00 32.46 ? 177 HIS A N     1 
ATOM   1362 C  CA    . HIS A 1 201 ? 82.191 25.804 53.206  1.00 30.88 ? 177 HIS A CA    1 
ATOM   1363 C  C     . HIS A 1 201 ? 80.866 25.735 53.986  1.00 31.74 ? 177 HIS A C     1 
ATOM   1364 O  O     . HIS A 1 201 ? 80.078 26.684 53.974  1.00 36.54 ? 177 HIS A O     1 
ATOM   1365 C  CB    . HIS A 1 201 ? 82.018 26.451 51.821  1.00 30.11 ? 177 HIS A CB    1 
ATOM   1366 C  CG    . HIS A 1 201 ? 83.308 26.892 51.198  1.00 28.93 ? 177 HIS A CG    1 
ATOM   1367 N  ND1   . HIS A 1 201 ? 83.740 28.201 51.227  1.00 34.14 ? 177 HIS A ND1   1 
ATOM   1368 C  CD2   . HIS A 1 201 ? 84.272 26.193 50.553  1.00 31.77 ? 177 HIS A CD2   1 
ATOM   1369 C  CE1   . HIS A 1 201 ? 84.908 28.292 50.615  1.00 33.40 ? 177 HIS A CE1   1 
ATOM   1370 N  NE2   . HIS A 1 201 ? 85.256 27.087 50.202  1.00 34.37 ? 177 HIS A NE2   1 
ATOM   1371 N  N     . GLY A 1 202 ? 80.640 24.617 54.676  1.00 29.75 ? 178 GLY A N     1 
ATOM   1372 C  CA    . GLY A 1 202 ? 79.455 24.443 55.531  1.00 32.79 ? 178 GLY A CA    1 
ATOM   1373 C  C     . GLY A 1 202 ? 78.126 24.289 54.809  1.00 32.64 ? 178 GLY A C     1 
ATOM   1374 O  O     . GLY A 1 202 ? 77.059 24.501 55.395  1.00 32.38 ? 178 GLY A O     1 
ATOM   1375 N  N     . ARG A 1 203 ? 78.192 23.920 53.534  1.00 29.34 ? 179 ARG A N     1 
ATOM   1376 C  CA    . ARG A 1 203 ? 77.003 23.758 52.707  1.00 26.93 ? 179 ARG A CA    1 
ATOM   1377 C  C     . ARG A 1 203 ? 76.498 22.315 52.793  1.00 26.51 ? 179 ARG A C     1 
ATOM   1378 O  O     . ARG A 1 203 ? 77.131 21.459 53.429  1.00 27.67 ? 179 ARG A O     1 
ATOM   1379 C  CB    . ARG A 1 203 ? 77.316 24.137 51.252  1.00 27.36 ? 179 ARG A CB    1 
ATOM   1380 C  CG    . ARG A 1 203 ? 78.131 25.424 51.096  1.00 28.97 ? 179 ARG A CG    1 
ATOM   1381 C  CD    . ARG A 1 203 ? 77.446 26.635 51.714  1.00 27.89 ? 179 ARG A CD    1 
ATOM   1382 N  NE    . ARG A 1 203 ? 78.151 27.876 51.406  1.00 30.67 ? 179 ARG A NE    1 
ATOM   1383 C  CZ    . ARG A 1 203 ? 77.937 29.030 52.033  1.00 33.47 ? 179 ARG A CZ    1 
ATOM   1384 N  NH1   . ARG A 1 203 ? 78.620 30.114 51.692  1.00 39.21 ? 179 ARG A NH1   1 
ATOM   1385 N  NH2   . ARG A 1 203 ? 77.035 29.101 53.004  1.00 38.00 ? 179 ARG A NH2   1 
ATOM   1386 N  N     . GLU A 1 204 ? 75.356 22.052 52.166  1.00 24.26 ? 180 GLU A N     1 
ATOM   1387 C  CA    . GLU A 1 204 ? 74.797 20.706 52.144  1.00 23.34 ? 180 GLU A CA    1 
ATOM   1388 C  C     . GLU A 1 204 ? 74.775 20.094 50.753  1.00 23.81 ? 180 GLU A C     1 
ATOM   1389 O  O     . GLU A 1 204 ? 74.614 20.794 49.755  1.00 26.40 ? 180 GLU A O     1 
ATOM   1390 C  CB    . GLU A 1 204 ? 73.414 20.672 52.790  1.00 27.92 ? 180 GLU A CB    1 
ATOM   1391 C  CG    . GLU A 1 204 ? 73.535 20.708 54.306  1.00 31.85 ? 180 GLU A CG    1 
ATOM   1392 C  CD    . GLU A 1 204 ? 72.218 20.566 55.031  1.00 38.43 ? 180 GLU A CD    1 
ATOM   1393 O  OE1   . GLU A 1 204 ? 72.096 19.631 55.852  1.00 44.83 ? 180 GLU A OE1   1 
ATOM   1394 O  OE2   . GLU A 1 204 ? 71.318 21.390 54.792  1.00 41.84 ? 180 GLU A OE2   1 
HETATM 1395 N  N     . MSE A 1 205 ? 74.985 18.781 50.711  1.00 22.07 ? 181 MSE A N     1 
HETATM 1396 C  CA    . MSE A 1 205 ? 74.967 18.008 49.473  1.00 21.67 ? 181 MSE A CA    1 
HETATM 1397 C  C     . MSE A 1 205 ? 73.708 17.193 49.368  1.00 21.71 ? 181 MSE A C     1 
HETATM 1398 O  O     . MSE A 1 205 ? 73.198 16.660 50.362  1.00 19.93 ? 181 MSE A O     1 
HETATM 1399 C  CB    . MSE A 1 205 ? 76.110 17.004 49.486  1.00 24.81 ? 181 MSE A CB    1 
HETATM 1400 C  CG    . MSE A 1 205 ? 77.488 17.642 49.414  1.00 30.65 ? 181 MSE A CG    1 
HETATM 1401 SE SE    . MSE A 1 205 ? 77.729 18.505 47.666  1.00 41.81 ? 181 MSE A SE    1 
HETATM 1402 C  CE    . MSE A 1 205 ? 77.490 16.958 46.472  1.00 30.51 ? 181 MSE A CE    1 
ATOM   1403 N  N     . SER A 1 206 ? 73.207 17.048 48.147  1.00 19.42 ? 182 SER A N     1 
ATOM   1404 C  CA    . SER A 1 206 ? 71.988 16.301 47.932  1.00 19.68 ? 182 SER A CA    1 
ATOM   1405 C  C     . SER A 1 206 ? 72.084 15.478 46.669  1.00 19.30 ? 182 SER A C     1 
ATOM   1406 O  O     . SER A 1 206 ? 72.769 15.867 45.717  1.00 19.02 ? 182 SER A O     1 
ATOM   1407 C  CB    . SER A 1 206 ? 70.794 17.251 47.846  1.00 18.88 ? 182 SER A CB    1 
ATOM   1408 O  OG    . SER A 1 206 ? 69.577 16.545 47.668  1.00 20.03 ? 182 SER A OG    1 
HETATM 1409 N  N     . MSE A 1 207 ? 71.423 14.327 46.673  1.00 18.57 ? 183 MSE A N     1 
HETATM 1410 C  CA    . MSE A 1 207 ? 71.314 13.526 45.452  1.00 20.55 ? 183 MSE A CA    1 
HETATM 1411 C  C     . MSE A 1 207 ? 69.942 12.959 45.227  1.00 20.02 ? 183 MSE A C     1 
HETATM 1412 O  O     . MSE A 1 207 ? 69.147 12.794 46.153  1.00 22.15 ? 183 MSE A O     1 
HETATM 1413 C  CB    . MSE A 1 207 ? 72.353 12.420 45.456  1.00 24.20 ? 183 MSE A CB    1 
HETATM 1414 C  CG    . MSE A 1 207 ? 71.788 11.123 46.008  1.00 30.77 ? 183 MSE A CG    1 
HETATM 1415 SE SE    . MSE A 1 207 ? 73.190 9.766  45.856  1.00 40.81 ? 183 MSE A SE    1 
HETATM 1416 C  CE    . MSE A 1 207 ? 73.202 9.482  43.908  1.00 35.04 ? 183 MSE A CE    1 
ATOM   1417 N  N     . THR A 1 208 ? 69.651 12.673 43.967  1.00 18.56 ? 184 THR A N     1 
ATOM   1418 C  CA    . THR A 1 208 ? 68.498 11.865 43.621  1.00 18.29 ? 184 THR A CA    1 
ATOM   1419 C  C     . THR A 1 208 ? 68.969 10.506 43.120  1.00 17.94 ? 184 THR A C     1 
ATOM   1420 O  O     . THR A 1 208 ? 69.996 10.390 42.440  1.00 20.68 ? 184 THR A O     1 
ATOM   1421 C  CB    . THR A 1 208 ? 67.583 12.537 42.573  1.00 20.55 ? 184 THR A CB    1 
ATOM   1422 O  OG1   . THR A 1 208 ? 66.585 11.594 42.145  1.00 19.47 ? 184 THR A OG1   1 
ATOM   1423 C  CG2   . THR A 1 208 ? 68.390 13.037 41.352  1.00 21.04 ? 184 THR A CG2   1 
ATOM   1424 N  N     . LEU A 1 209 ? 68.225 9.477  43.491  1.00 18.08 ? 185 LEU A N     1 
ATOM   1425 C  CA    . LEU A 1 209 ? 68.531 8.122  43.051  1.00 16.95 ? 185 LEU A CA    1 
ATOM   1426 C  C     . LEU A 1 209 ? 68.221 7.909  41.561  1.00 17.42 ? 185 LEU A C     1 
ATOM   1427 O  O     . LEU A 1 209 ? 68.617 6.882  40.986  1.00 17.95 ? 185 LEU A O     1 
ATOM   1428 C  CB    . LEU A 1 209 ? 67.775 7.107  43.905  1.00 17.82 ? 185 LEU A CB    1 
ATOM   1429 C  CG    . LEU A 1 209 ? 68.152 7.085  45.392  1.00 19.50 ? 185 LEU A CG    1 
ATOM   1430 C  CD1   . LEU A 1 209 ? 67.477 5.917  46.094  1.00 20.75 ? 185 LEU A CD1   1 
ATOM   1431 C  CD2   . LEU A 1 209 ? 69.661 7.009  45.586  1.00 20.66 ? 185 LEU A CD2   1 
ATOM   1432 N  N     . SER A 1 210 ? 67.482 8.859  40.971  1.00 16.94 ? 186 SER A N     1 
ATOM   1433 C  CA    . SER A 1 210 ? 67.271 8.985  39.516  1.00 16.24 ? 186 SER A CA    1 
ATOM   1434 C  C     . SER A 1 210 ? 66.367 7.956  38.845  1.00 17.51 ? 186 SER A C     1 
ATOM   1435 O  O     . SER A 1 210 ? 65.390 8.313  38.188  1.00 19.69 ? 186 SER A O     1 
ATOM   1436 C  CB    . SER A 1 210 ? 68.608 9.057  38.771  1.00 16.84 ? 186 SER A CB    1 
ATOM   1437 O  OG    . SER A 1 210 ? 69.320 10.233 39.110  1.00 17.63 ? 186 SER A OG    1 
ATOM   1438 N  N     . ASP A 1 211 ? 66.705 6.677  38.989  1.00 18.29 ? 187 ASP A N     1 
ATOM   1439 C  CA    . ASP A 1 211 ? 66.021 5.628  38.241  1.00 19.88 ? 187 ASP A CA    1 
ATOM   1440 C  C     . ASP A 1 211 ? 66.362 4.286  38.873  1.00 18.48 ? 187 ASP A C     1 
ATOM   1441 O  O     . ASP A 1 211 ? 67.502 4.095  39.294  1.00 18.40 ? 187 ASP A O     1 
ATOM   1442 C  CB    . ASP A 1 211 ? 66.462 5.692  36.765  1.00 19.75 ? 187 ASP A CB    1 
ATOM   1443 C  CG    . ASP A 1 211 ? 65.959 4.524  35.937  1.00 18.77 ? 187 ASP A CG    1 
ATOM   1444 O  OD1   . ASP A 1 211 ? 66.625 3.464  35.949  1.00 21.32 ? 187 ASP A OD1   1 
ATOM   1445 O  OD2   . ASP A 1 211 ? 64.917 4.669  35.268  1.00 20.35 ? 187 ASP A OD2   1 
ATOM   1446 N  N     . SER A 1 212 ? 65.389 3.370  38.931  1.00 18.10 ? 188 SER A N     1 
ATOM   1447 C  CA    . SER A 1 212 ? 65.566 2.099  39.664  1.00 19.26 ? 188 SER A CA    1 
ATOM   1448 C  C     . SER A 1 212 ? 66.653 1.209  39.070  1.00 17.68 ? 188 SER A C     1 
ATOM   1449 O  O     . SER A 1 212 ? 67.345 0.511  39.806  1.00 19.45 ? 188 SER A O     1 
ATOM   1450 C  CB    . SER A 1 212 ? 64.240 1.331  39.789  1.00 20.05 ? 188 SER A CB    1 
ATOM   1451 O  OG    . SER A 1 212 ? 63.736 0.940  38.520  1.00 21.24 ? 188 SER A OG    1 
ATOM   1452 N  N     . PHE A 1 213 ? 66.792 1.232  37.740  1.00 18.34 ? 189 PHE A N     1 
ATOM   1453 C  CA    . PHE A 1 213 ? 67.879 0.506  37.082  1.00 18.52 ? 189 PHE A CA    1 
ATOM   1454 C  C     . PHE A 1 213 ? 69.226 1.182  37.290  1.00 18.32 ? 189 PHE A C     1 
ATOM   1455 O  O     . PHE A 1 213 ? 70.240 0.490  37.425  1.00 20.31 ? 189 PHE A O     1 
ATOM   1456 C  CB    . PHE A 1 213 ? 67.614 0.296  35.590  1.00 17.76 ? 189 PHE A CB    1 
ATOM   1457 C  CG    . PHE A 1 213 ? 66.405 -0.554 35.300  1.00 18.79 ? 189 PHE A CG    1 
ATOM   1458 C  CD1   . PHE A 1 213 ? 65.131 0.008  35.271  1.00 19.81 ? 189 PHE A CD1   1 
ATOM   1459 C  CD2   . PHE A 1 213 ? 66.540 -1.928 35.073  1.00 22.18 ? 189 PHE A CD2   1 
ATOM   1460 C  CE1   . PHE A 1 213 ? 64.013 -0.777 35.013  1.00 22.67 ? 189 PHE A CE1   1 
ATOM   1461 C  CE2   . PHE A 1 213 ? 65.428 -2.716 34.811  1.00 22.00 ? 189 PHE A CE2   1 
ATOM   1462 C  CZ    . PHE A 1 213 ? 64.163 -2.142 34.779  1.00 22.53 ? 189 PHE A CZ    1 
ATOM   1463 N  N     . CYS A 1 214 ? 69.236 2.520  37.334  1.00 17.99 ? 190 CYS A N     1 
ATOM   1464 C  CA    . CYS A 1 214 ? 70.439 3.261  37.715  1.00 17.39 ? 190 CYS A CA    1 
ATOM   1465 C  C     . CYS A 1 214 ? 70.886 2.867  39.141  1.00 17.93 ? 190 CYS A C     1 
ATOM   1466 O  O     . CYS A 1 214 ? 72.063 2.601  39.377  1.00 18.54 ? 190 CYS A O     1 
ATOM   1467 C  CB    . CYS A 1 214 ? 70.192 4.771  37.613  1.00 19.65 ? 190 CYS A CB    1 
ATOM   1468 S  SG    . CYS A 1 214 ? 71.637 5.802  37.964  1.00 20.50 ? 190 CYS A SG    1 
ATOM   1469 N  N     . VAL A 1 215 ? 69.935 2.807  40.070  1.00 19.65 ? 191 VAL A N     1 
ATOM   1470 C  CA    . VAL A 1 215 ? 70.200 2.306  41.421  1.00 20.56 ? 191 VAL A CA    1 
ATOM   1471 C  C     . VAL A 1 215 ? 70.809 0.898  41.368  1.00 19.03 ? 191 VAL A C     1 
ATOM   1472 O  O     . VAL A 1 215 ? 71.782 0.625  42.062  1.00 18.88 ? 191 VAL A O     1 
ATOM   1473 C  CB    . VAL A 1 215 ? 68.934 2.338  42.328  1.00 18.16 ? 191 VAL A CB    1 
ATOM   1474 C  CG1   . VAL A 1 215 ? 69.180 1.577  43.629  1.00 19.88 ? 191 VAL A CG1   1 
ATOM   1475 C  CG2   . VAL A 1 215 ? 68.510 3.773  42.608  1.00 18.08 ? 191 VAL A CG2   1 
ATOM   1476 N  N     . ASP A 1 216 ? 70.256 0.020  40.528  1.00 19.63 ? 192 ASP A N     1 
ATOM   1477 C  CA    . ASP A 1 216 ? 70.752 -1.348 40.429  1.00 20.64 ? 192 ASP A CA    1 
ATOM   1478 C  C     . ASP A 1 216 ? 72.190 -1.379 39.937  1.00 21.65 ? 192 ASP A C     1 
ATOM   1479 O  O     . ASP A 1 216 ? 72.974 -2.182 40.406  1.00 21.83 ? 192 ASP A O     1 
ATOM   1480 C  CB    . ASP A 1 216 ? 69.868 -2.187 39.522  1.00 22.00 ? 192 ASP A CB    1 
ATOM   1481 C  CG    . ASP A 1 216 ? 70.342 -3.621 39.422  1.00 27.12 ? 192 ASP A CG    1 
ATOM   1482 O  OD1   . ASP A 1 216 ? 70.365 -4.306 40.465  1.00 28.34 ? 192 ASP A OD1   1 
ATOM   1483 O  OD2   . ASP A 1 216 ? 70.706 -4.054 38.309  1.00 31.51 ? 192 ASP A OD2   1 
ATOM   1484 N  N     . ARG A 1 217 ? 72.531 -0.473 39.022  1.00 18.95 ? 193 ARG A N     1 
ATOM   1485 C  CA    . ARG A 1 217 ? 73.899 -0.378 38.530  1.00 19.59 ? 193 ARG A CA    1 
ATOM   1486 C  C     . ARG A 1 217 ? 74.920 0.115  39.565  1.00 19.74 ? 193 ARG A C     1 
ATOM   1487 O  O     . ARG A 1 217 ? 76.079 -0.313 39.544  1.00 22.43 ? 193 ARG A O     1 
ATOM   1488 C  CB    . ARG A 1 217 ? 73.956 0.491  37.275  1.00 20.20 ? 193 ARG A CB    1 
ATOM   1489 C  CG    . ARG A 1 217 ? 73.198 -0.110 36.114  1.00 21.61 ? 193 ARG A CG    1 
ATOM   1490 C  CD    . ARG A 1 217 ? 73.537 0.577  34.802  1.00 20.57 ? 193 ARG A CD    1 
ATOM   1491 N  NE    . ARG A 1 217 ? 73.065 1.960  34.685  1.00 18.71 ? 193 ARG A NE    1 
ATOM   1492 C  CZ    . ARG A 1 217 ? 71.810 2.318  34.398  1.00 17.92 ? 193 ARG A CZ    1 
ATOM   1493 N  NH1   . ARG A 1 217 ? 70.863 1.401  34.249  1.00 19.28 ? 193 ARG A NH1   1 
ATOM   1494 N  NH2   . ARG A 1 217 ? 71.490 3.610  34.285  1.00 19.24 ? 193 ARG A NH2   1 
ATOM   1495 N  N     . TYR A 1 218 ? 74.494 1.009  40.460  1.00 21.43 ? 194 TYR A N     1 
ATOM   1496 C  CA    . TYR A 1 218 ? 75.410 1.713  41.366  1.00 20.13 ? 194 TYR A CA    1 
ATOM   1497 C  C     . TYR A 1 218 ? 75.002 1.617  42.834  1.00 19.54 ? 194 TYR A C     1 
ATOM   1498 O  O     . TYR A 1 218 ? 75.372 2.462  43.638  1.00 22.26 ? 194 TYR A O     1 
ATOM   1499 C  CB    . TYR A 1 218 ? 75.603 3.186  40.920  1.00 20.41 ? 194 TYR A CB    1 
ATOM   1500 C  CG    . TYR A 1 218 ? 75.982 3.248  39.471  1.00 20.29 ? 194 TYR A CG    1 
ATOM   1501 C  CD1   . TYR A 1 218 ? 77.219 2.769  39.044  1.00 21.82 ? 194 TYR A CD1   1 
ATOM   1502 C  CD2   . TYR A 1 218 ? 75.078 3.696  38.516  1.00 18.75 ? 194 TYR A CD2   1 
ATOM   1503 C  CE1   . TYR A 1 218 ? 77.555 2.764  37.702  1.00 21.61 ? 194 TYR A CE1   1 
ATOM   1504 C  CE2   . TYR A 1 218 ? 75.407 3.701  37.170  1.00 20.99 ? 194 TYR A CE2   1 
ATOM   1505 C  CZ    . TYR A 1 218 ? 76.651 3.234  36.779  1.00 19.70 ? 194 TYR A CZ    1 
ATOM   1506 O  OH    . TYR A 1 218 ? 76.971 3.214  35.447  1.00 19.43 ? 194 TYR A OH    1 
ATOM   1507 N  N     . ARG A 1 219 ? 74.302 0.536  43.176  1.00 20.94 ? 195 ARG A N     1 
ATOM   1508 C  CA    . ARG A 1 219 ? 73.740 0.346  44.514  1.00 21.05 ? 195 ARG A CA    1 
ATOM   1509 C  C     . ARG A 1 219 ? 74.766 0.589  45.634  1.00 21.55 ? 195 ARG A C     1 
ATOM   1510 O  O     . ARG A 1 219 ? 74.543 1.408  46.534  1.00 22.42 ? 195 ARG A O     1 
ATOM   1511 C  CB    . ARG A 1 219 ? 73.134 -1.057 44.614  1.00 22.78 ? 195 ARG A CB    1 
ATOM   1512 C  CG    . ARG A 1 219 ? 72.432 -1.353 45.921  1.00 25.16 ? 195 ARG A CG    1 
ATOM   1513 C  CD    . ARG A 1 219 ? 71.710 -2.687 45.859  1.00 25.76 ? 195 ARG A CD    1 
ATOM   1514 N  NE    . ARG A 1 219 ? 70.544 -2.620 44.985  1.00 24.31 ? 195 ARG A NE    1 
ATOM   1515 C  CZ    . ARG A 1 219 ? 70.438 -3.190 43.788  1.00 22.80 ? 195 ARG A CZ    1 
ATOM   1516 N  NH1   . ARG A 1 219 ? 69.314 -3.040 43.106  1.00 21.00 ? 195 ARG A NH1   1 
ATOM   1517 N  NH2   . ARG A 1 219 ? 71.437 -3.912 43.273  1.00 23.54 ? 195 ARG A NH2   1 
ATOM   1518 N  N     . GLY A 1 220 ? 75.889 -0.123 45.574  1.00 22.47 ? 196 GLY A N     1 
ATOM   1519 C  CA    . GLY A 1 220 ? 76.940 -0.005 46.592  1.00 23.09 ? 196 GLY A CA    1 
ATOM   1520 C  C     . GLY A 1 220 ? 77.531 1.395  46.650  1.00 23.35 ? 196 GLY A C     1 
ATOM   1521 O  O     . GLY A 1 220 ? 77.761 1.941  47.732  1.00 24.06 ? 196 GLY A O     1 
ATOM   1522 N  N     . GLU A 1 221 ? 77.763 1.985  45.480  1.00 24.37 ? 197 GLU A N     1 
ATOM   1523 C  CA    . GLU A 1 221 ? 78.333 3.320  45.409  1.00 23.28 ? 197 GLU A CA    1 
ATOM   1524 C  C     . GLU A 1 221 ? 77.395 4.370  46.000  1.00 23.19 ? 197 GLU A C     1 
ATOM   1525 O  O     . GLU A 1 221 ? 77.850 5.265  46.713  1.00 23.51 ? 197 GLU A O     1 
ATOM   1526 C  CB    . GLU A 1 221 ? 78.716 3.674  43.969  1.00 23.29 ? 197 GLU A CB    1 
ATOM   1527 C  CG    . GLU A 1 221 ? 80.038 3.045  43.535  1.00 30.88 ? 197 GLU A CG    1 
ATOM   1528 C  CD    . GLU A 1 221 ? 80.376 3.318  42.083  1.00 39.65 ? 197 GLU A CD    1 
ATOM   1529 O  OE1   . GLU A 1 221 ? 79.847 2.606  41.200  1.00 43.51 ? 197 GLU A OE1   1 
ATOM   1530 O  OE2   . GLU A 1 221 ? 81.189 4.233  41.824  1.00 51.84 ? 197 GLU A OE2   1 
ATOM   1531 N  N     . PHE A 1 222 ? 76.094 4.246  45.725  1.00 21.57 ? 198 PHE A N     1 
ATOM   1532 C  CA    . PHE A 1 222 ? 75.113 5.194  46.256  1.00 20.33 ? 198 PHE A CA    1 
ATOM   1533 C  C     . PHE A 1 222 ? 74.990 5.094  47.778  1.00 20.41 ? 198 PHE A C     1 
ATOM   1534 O  O     . PHE A 1 222 ? 74.979 6.127  48.459  1.00 21.85 ? 198 PHE A O     1 
ATOM   1535 C  CB    . PHE A 1 222 ? 73.730 5.052  45.600  1.00 20.44 ? 198 PHE A CB    1 
ATOM   1536 C  CG    . PHE A 1 222 ? 73.675 5.428  44.126  1.00 19.97 ? 198 PHE A CG    1 
ATOM   1537 C  CD1   . PHE A 1 222 ? 74.731 6.088  43.495  1.00 21.38 ? 198 PHE A CD1   1 
ATOM   1538 C  CD2   . PHE A 1 222 ? 72.526 5.147  43.377  1.00 21.34 ? 198 PHE A CD2   1 
ATOM   1539 C  CE1   . PHE A 1 222 ? 74.646 6.448  42.146  1.00 19.82 ? 198 PHE A CE1   1 
ATOM   1540 C  CE2   . PHE A 1 222 ? 72.438 5.499  42.031  1.00 21.16 ? 198 PHE A CE2   1 
ATOM   1541 C  CZ    . PHE A 1 222 ? 73.504 6.150  41.420  1.00 19.54 ? 198 PHE A CZ    1 
ATOM   1542 N  N     . LEU A 1 223 ? 74.898 3.860  48.298  1.00 20.51 ? 199 LEU A N     1 
ATOM   1543 C  CA    . LEU A 1 223 ? 74.860 3.616  49.754  1.00 20.63 ? 199 LEU A CA    1 
ATOM   1544 C  C     . LEU A 1 223 ? 76.077 4.220  50.443  1.00 21.98 ? 199 LEU A C     1 
ATOM   1545 O  O     . LEU A 1 223 ? 75.957 4.825  51.512  1.00 25.10 ? 199 LEU A O     1 
ATOM   1546 C  CB    . LEU A 1 223 ? 74.761 2.117  50.073  1.00 21.50 ? 199 LEU A CB    1 
ATOM   1547 C  CG    . LEU A 1 223 ? 73.406 1.461  49.786  1.00 24.51 ? 199 LEU A CG    1 
ATOM   1548 C  CD1   . LEU A 1 223 ? 73.527 -0.056 49.806  1.00 27.94 ? 199 LEU A CD1   1 
ATOM   1549 C  CD2   . LEU A 1 223 ? 72.328 1.940  50.751  1.00 27.47 ? 199 LEU A CD2   1 
ATOM   1550 N  N     . ASP A 1 224 ? 77.244 4.070  49.817  1.00 22.01 ? 200 ASP A N     1 
ATOM   1551 C  CA    . ASP A 1 224 ? 78.480 4.631  50.354  1.00 24.91 ? 200 ASP A CA    1 
ATOM   1552 C  C     . ASP A 1 224 ? 78.465 6.160  50.371  1.00 23.81 ? 200 ASP A C     1 
ATOM   1553 O  O     . ASP A 1 224 ? 78.912 6.769  51.341  1.00 25.31 ? 200 ASP A O     1 
ATOM   1554 C  CB    . ASP A 1 224 ? 79.704 4.136  49.576  1.00 27.20 ? 200 ASP A CB    1 
ATOM   1555 C  CG    . ASP A 1 224 ? 81.001 4.694  50.129  1.00 32.89 ? 200 ASP A CG    1 
ATOM   1556 O  OD1   . ASP A 1 224 ? 81.322 4.397  51.298  1.00 36.07 ? 200 ASP A OD1   1 
ATOM   1557 O  OD2   . ASP A 1 224 ? 81.693 5.437  49.397  1.00 40.54 ? 200 ASP A OD2   1 
ATOM   1558 N  N     . LEU A 1 225 ? 77.954 6.780  49.307  1.00 22.46 ? 201 LEU A N     1 
ATOM   1559 C  CA    . LEU A 1 225 ? 77.827 8.243  49.294  1.00 22.96 ? 201 LEU A CA    1 
ATOM   1560 C  C     . LEU A 1 225 ? 77.048 8.737  50.515  1.00 23.76 ? 201 LEU A C     1 
ATOM   1561 O  O     . LEU A 1 225 ? 77.415 9.748  51.129  1.00 24.18 ? 201 LEU A O     1 
ATOM   1562 C  CB    . LEU A 1 225 ? 77.177 8.754  48.002  1.00 22.39 ? 201 LEU A CB    1 
ATOM   1563 C  CG    . LEU A 1 225 ? 77.966 8.632  46.700  1.00 22.33 ? 201 LEU A CG    1 
ATOM   1564 C  CD1   . LEU A 1 225 ? 77.017 8.924  45.551  1.00 22.71 ? 201 LEU A CD1   1 
ATOM   1565 C  CD2   . LEU A 1 225 ? 79.172 9.568  46.664  1.00 24.33 ? 201 LEU A CD2   1 
HETATM 1566 N  N     . MSE A 1 226 ? 75.988 8.010  50.870  1.00 23.65 ? 202 MSE A N     1 
HETATM 1567 C  CA    . MSE A 1 226 ? 75.130 8.399  51.996  1.00 25.43 ? 202 MSE A CA    1 
HETATM 1568 C  C     . MSE A 1 226 ? 75.780 8.108  53.324  1.00 23.68 ? 202 MSE A C     1 
HETATM 1569 O  O     . MSE A 1 226 ? 75.829 8.974  54.209  1.00 25.53 ? 202 MSE A O     1 
HETATM 1570 C  CB    . MSE A 1 226 ? 73.798 7.662  51.919  1.00 25.06 ? 202 MSE A CB    1 
HETATM 1571 C  CG    . MSE A 1 226 ? 72.907 8.187  50.801  1.00 32.01 ? 202 MSE A CG    1 
HETATM 1572 SE SE    . MSE A 1 226 ? 71.597 6.815  50.275  1.00 62.81 ? 202 MSE A SE    1 
HETATM 1573 C  CE    . MSE A 1 226 ? 70.304 6.949  51.747  1.00 63.70 ? 202 MSE A CE    1 
ATOM   1574 N  N     . ARG A 1 227 ? 76.310 6.896  53.471  1.00 24.15 ? 203 ARG A N     1 
ATOM   1575 C  CA    . ARG A 1 227 ? 76.879 6.446  54.748  1.00 22.81 ? 203 ARG A CA    1 
ATOM   1576 C  C     . ARG A 1 227 ? 78.166 7.170  55.134  1.00 24.21 ? 203 ARG A C     1 
ATOM   1577 O  O     . ARG A 1 227 ? 78.451 7.343  56.317  1.00 27.77 ? 203 ARG A O     1 
ATOM   1578 C  CB    . ARG A 1 227 ? 77.093 4.925  54.736  1.00 21.82 ? 203 ARG A CB    1 
ATOM   1579 C  CG    . ARG A 1 227 ? 75.784 4.146  54.740  1.00 22.80 ? 203 ARG A CG    1 
ATOM   1580 C  CD    . ARG A 1 227 ? 75.980 2.642  54.615  1.00 23.23 ? 203 ARG A CD    1 
ATOM   1581 N  NE    . ARG A 1 227 ? 74.686 1.971  54.576  1.00 23.67 ? 203 ARG A NE    1 
ATOM   1582 C  CZ    . ARG A 1 227 ? 74.475 0.735  54.136  1.00 23.97 ? 203 ARG A CZ    1 
ATOM   1583 N  NH1   . ARG A 1 227 ? 75.487 -0.009 53.701  1.00 26.33 ? 203 ARG A NH1   1 
ATOM   1584 N  NH2   . ARG A 1 227 ? 73.242 0.240  54.141  1.00 25.05 ? 203 ARG A NH2   1 
ATOM   1585 N  N     . SER A 1 228 ? 78.939 7.580  54.133  1.00 25.30 ? 204 SER A N     1 
ATOM   1586 C  CA    . SER A 1 228 ? 80.185 8.309  54.354  1.00 25.78 ? 204 SER A CA    1 
ATOM   1587 C  C     . SER A 1 228 ? 79.927 9.796  54.600  1.00 28.68 ? 204 SER A C     1 
ATOM   1588 O  O     . SER A 1 228 ? 80.848 10.544 54.937  1.00 34.61 ? 204 SER A O     1 
ATOM   1589 C  CB    . SER A 1 228 ? 81.126 8.140  53.165  1.00 26.79 ? 204 SER A CB    1 
ATOM   1590 O  OG    . SER A 1 228 ? 80.642 8.862  52.043  1.00 27.97 ? 204 SER A OG    1 
ATOM   1591 N  N     . GLY A 1 229 ? 78.676 10.216 54.417  1.00 26.76 ? 205 GLY A N     1 
ATOM   1592 C  CA    . GLY A 1 229 ? 78.276 11.596 54.670  1.00 29.56 ? 205 GLY A CA    1 
ATOM   1593 C  C     . GLY A 1 229 ? 78.533 12.557 53.521  1.00 27.77 ? 205 GLY A C     1 
ATOM   1594 O  O     . GLY A 1 229 ? 78.430 13.772 53.697  1.00 29.92 ? 205 GLY A O     1 
ATOM   1595 N  N     . LYS A 1 230 ? 78.854 12.026 52.340  1.00 26.79 ? 206 LYS A N     1 
ATOM   1596 C  CA    . LYS A 1 230 ? 79.084 12.865 51.161  1.00 27.15 ? 206 LYS A CA    1 
ATOM   1597 C  C     . LYS A 1 230 ? 77.773 13.457 50.662  1.00 25.61 ? 206 LYS A C     1 
ATOM   1598 O  O     . LYS A 1 230 ? 77.756 14.518 50.042  1.00 28.76 ? 206 LYS A O     1 
ATOM   1599 C  CB    . LYS A 1 230 ? 79.784 12.074 50.047  1.00 27.59 ? 206 LYS A CB    1 
ATOM   1600 C  CG    . LYS A 1 230 ? 81.252 11.788 50.330  1.00 30.23 ? 206 LYS A CG    1 
ATOM   1601 C  CD    . LYS A 1 230 ? 81.893 10.973 49.216  1.00 32.53 ? 206 LYS A CD    1 
ATOM   1602 C  CE    . LYS A 1 230 ? 83.365 10.694 49.500  1.00 34.18 ? 206 LYS A CE    1 
ATOM   1603 N  NZ    . LYS A 1 230 ? 83.552 9.804  50.677  1.00 37.94 ? 206 LYS A NZ    1 
ATOM   1604 N  N     . VAL A 1 231 ? 76.680 12.758 50.956  1.00 25.43 ? 207 VAL A N     1 
ATOM   1605 C  CA    . VAL A 1 231 ? 75.326 13.210 50.660  1.00 25.09 ? 207 VAL A CA    1 
ATOM   1606 C  C     . VAL A 1 231 ? 74.544 13.373 51.963  1.00 25.33 ? 207 VAL A C     1 
ATOM   1607 O  O     . VAL A 1 231 ? 74.526 12.467 52.802  1.00 28.36 ? 207 VAL A O     1 
ATOM   1608 C  CB    . VAL A 1 231 ? 74.599 12.230 49.705  1.00 25.21 ? 207 VAL A CB    1 
ATOM   1609 C  CG1   . VAL A 1 231 ? 73.130 12.596 49.560  1.00 28.33 ? 207 VAL A CG1   1 
ATOM   1610 C  CG2   . VAL A 1 231 ? 75.273 12.221 48.344  1.00 25.82 ? 207 VAL A CG2   1 
ATOM   1611 N  N     . ASP A 1 232 ? 73.900 14.528 52.113  1.00 25.47 ? 208 ASP A N     1 
ATOM   1612 C  CA    . ASP A 1 232 ? 73.116 14.857 53.312  1.00 25.02 ? 208 ASP A CA    1 
ATOM   1613 C  C     . ASP A 1 232 ? 71.613 14.666 53.126  1.00 26.11 ? 208 ASP A C     1 
ATOM   1614 O  O     . ASP A 1 232 ? 70.908 14.343 54.074  1.00 30.73 ? 208 ASP A O     1 
ATOM   1615 C  CB    . ASP A 1 232 ? 73.373 16.307 53.730  1.00 23.80 ? 208 ASP A CB    1 
ATOM   1616 C  CG    . ASP A 1 232 ? 74.846 16.607 53.931  1.00 26.56 ? 208 ASP A CG    1 
ATOM   1617 O  OD1   . ASP A 1 232 ? 75.447 16.059 54.879  1.00 32.72 ? 208 ASP A OD1   1 
ATOM   1618 O  OD2   . ASP A 1 232 ? 75.402 17.402 53.146  1.00 27.26 ? 208 ASP A OD2   1 
ATOM   1619 N  N     . ILE A 1 233 ? 71.119 14.904 51.912  1.00 23.96 ? 209 ILE A N     1 
ATOM   1620 C  CA    . ILE A 1 233 ? 69.684 14.859 51.625  1.00 24.17 ? 209 ILE A CA    1 
ATOM   1621 C  C     . ILE A 1 233 ? 69.482 13.997 50.382  1.00 23.47 ? 209 ILE A C     1 
ATOM   1622 O  O     . ILE A 1 233 ? 70.056 14.297 49.328  1.00 24.51 ? 209 ILE A O     1 
ATOM   1623 C  CB    . ILE A 1 233 ? 69.085 16.272 51.370  1.00 24.65 ? 209 ILE A CB    1 
ATOM   1624 C  CG1   . ILE A 1 233 ? 69.305 17.198 52.576  1.00 23.24 ? 209 ILE A CG1   1 
ATOM   1625 C  CG2   . ILE A 1 233 ? 67.596 16.174 51.046  1.00 25.84 ? 209 ILE A CG2   1 
ATOM   1626 C  CD1   . ILE A 1 233 ? 69.101 18.671 52.276  1.00 24.75 ? 209 ILE A CD1   1 
ATOM   1627 N  N     . VAL A 1 234 ? 68.676 12.939 50.502  1.00 21.67 ? 210 VAL A N     1 
ATOM   1628 C  CA    A VAL A 1 234 ? 68.439 12.010 49.383  0.60 19.94 ? 210 VAL A CA    1 
ATOM   1629 C  CA    B VAL A 1 234 ? 68.445 12.023 49.379  0.40 19.38 ? 210 VAL A CA    1 
ATOM   1630 C  C     . VAL A 1 234 ? 66.992 12.045 48.903  1.00 20.87 ? 210 VAL A C     1 
ATOM   1631 O  O     . VAL A 1 234 ? 66.067 12.041 49.708  1.00 21.64 ? 210 VAL A O     1 
ATOM   1632 C  CB    A VAL A 1 234 ? 68.818 10.552 49.739  0.60 20.86 ? 210 VAL A CB    1 
ATOM   1633 C  CB    B VAL A 1 234 ? 68.925 10.579 49.690  0.40 19.33 ? 210 VAL A CB    1 
ATOM   1634 C  CG1   A VAL A 1 234 ? 68.531 9.614  48.570  0.60 18.95 ? 210 VAL A CG1   1 
ATOM   1635 C  CG1   B VAL A 1 234 ? 68.065 9.913  50.756  0.40 17.50 ? 210 VAL A CG1   1 
ATOM   1636 C  CG2   A VAL A 1 234 ? 70.284 10.456 50.119  0.60 23.45 ? 210 VAL A CG2   1 
ATOM   1637 C  CG2   B VAL A 1 234 ? 68.957 9.732  48.424  0.40 19.35 ? 210 VAL A CG2   1 
ATOM   1638 N  N     . PHE A 1 235 ? 66.811 12.066 47.579  1.00 19.84 ? 211 PHE A N     1 
ATOM   1639 C  CA    . PHE A 1 235 ? 65.499 11.993 46.970  1.00 19.54 ? 211 PHE A CA    1 
ATOM   1640 C  C     . PHE A 1 235 ? 65.355 10.644 46.308  1.00 19.23 ? 211 PHE A C     1 
ATOM   1641 O  O     . PHE A 1 235 ? 66.275 10.169 45.648  1.00 20.62 ? 211 PHE A O     1 
ATOM   1642 C  CB    . PHE A 1 235 ? 65.315 13.089 45.918  1.00 18.42 ? 211 PHE A CB    1 
ATOM   1643 C  CG    . PHE A 1 235 ? 65.239 14.468 46.493  1.00 18.95 ? 211 PHE A CG    1 
ATOM   1644 C  CD1   . PHE A 1 235 ? 66.401 15.173 46.808  1.00 19.36 ? 211 PHE A CD1   1 
ATOM   1645 C  CD2   . PHE A 1 235 ? 64.005 15.065 46.716  1.00 20.10 ? 211 PHE A CD2   1 
ATOM   1646 C  CE1   . PHE A 1 235 ? 66.333 16.449 47.348  1.00 20.16 ? 211 PHE A CE1   1 
ATOM   1647 C  CE2   . PHE A 1 235 ? 63.928 16.347 47.254  1.00 19.05 ? 211 PHE A CE2   1 
ATOM   1648 C  CZ    . PHE A 1 235 ? 65.093 17.038 47.566  1.00 18.81 ? 211 PHE A CZ    1 
ATOM   1649 N  N     . ALA A 1 236 ? 64.197 10.029 46.509  1.00 20.89 ? 212 ALA A N     1 
ATOM   1650 C  CA    . ALA A 1 236 ? 63.894 8.720  45.940  1.00 21.33 ? 212 ALA A CA    1 
ATOM   1651 C  C     . ALA A 1 236 ? 62.407 8.653  45.629  1.00 22.61 ? 212 ALA A C     1 
ATOM   1652 O  O     . ALA A 1 236 ? 61.611 9.367  46.245  1.00 24.39 ? 212 ALA A O     1 
ATOM   1653 C  CB    . ALA A 1 236 ? 64.268 7.619  46.925  1.00 24.41 ? 212 ALA A CB    1 
ATOM   1654 N  N     . ASN A 1 237 ? 62.029 7.832  44.652  1.00 21.08 ? 213 ASN A N     1 
ATOM   1655 C  CA    . ASN A 1 237 ? 60.636 7.396  44.569  1.00 20.82 ? 213 ASN A CA    1 
ATOM   1656 C  C     . ASN A 1 237 ? 60.511 5.980  45.133  1.00 22.85 ? 213 ASN A C     1 
ATOM   1657 O  O     . ASN A 1 237 ? 61.516 5.369  45.522  1.00 22.70 ? 213 ASN A O     1 
ATOM   1658 C  CB    . ASN A 1 237 ? 60.055 7.520  43.150  1.00 21.88 ? 213 ASN A CB    1 
ATOM   1659 C  CG    . ASN A 1 237 ? 60.802 6.692  42.123  1.00 23.06 ? 213 ASN A CG    1 
ATOM   1660 O  OD1   . ASN A 1 237 ? 61.486 5.730  42.452  1.00 23.13 ? 213 ASN A OD1   1 
ATOM   1661 N  ND2   . ASN A 1 237 ? 60.655 7.062  40.861  1.00 26.27 ? 213 ASN A ND2   1 
ATOM   1662 N  N     . ARG A 1 238 ? 59.287 5.467  45.184  1.00 23.42 ? 214 ARG A N     1 
ATOM   1663 C  CA    . ARG A 1 238 ? 59.055 4.125  45.714  1.00 23.08 ? 214 ARG A CA    1 
ATOM   1664 C  C     . ARG A 1 238 ? 59.937 3.073  45.026  1.00 23.39 ? 214 ARG A C     1 
ATOM   1665 O  O     . ARG A 1 238 ? 60.597 2.266  45.691  1.00 25.31 ? 214 ARG A O     1 
ATOM   1666 C  CB    . ARG A 1 238 ? 57.574 3.743  45.593  1.00 27.63 ? 214 ARG A CB    1 
ATOM   1667 C  CG    . ARG A 1 238 ? 57.169 2.456  46.304  1.00 32.86 ? 214 ARG A CG    1 
ATOM   1668 C  CD    . ARG A 1 238 ? 55.679 2.185  46.108  1.00 37.88 ? 214 ARG A CD    1 
ATOM   1669 N  NE    . ARG A 1 238 ? 55.065 1.532  47.273  1.00 47.32 ? 214 ARG A NE    1 
ATOM   1670 C  CZ    . ARG A 1 238 ? 54.163 2.111  48.073  1.00 50.94 ? 214 ARG A CZ    1 
ATOM   1671 N  NH1   . ARG A 1 238 ? 53.755 3.359  47.836  1.00 52.29 ? 214 ARG A NH1   1 
ATOM   1672 N  NH2   . ARG A 1 238 ? 53.660 1.448  49.101  1.00 41.55 ? 214 ARG A NH2   1 
ATOM   1673 N  N     . GLN A 1 239 ? 59.943 3.097  43.695  1.00 22.66 ? 215 GLN A N     1 
ATOM   1674 C  CA    . GLN A 1 239 ? 60.652 2.095  42.904  1.00 23.80 ? 215 GLN A CA    1 
ATOM   1675 C  C     . GLN A 1 239 ? 62.159 2.131  43.179  1.00 21.04 ? 215 GLN A C     1 
ATOM   1676 O  O     . GLN A 1 239 ? 62.813 1.092  43.302  1.00 23.81 ? 215 GLN A O     1 
ATOM   1677 C  CB    . GLN A 1 239 ? 60.374 2.296  41.410  1.00 27.60 ? 215 GLN A CB    1 
ATOM   1678 C  CG    . GLN A 1 239 ? 58.899 2.182  41.019  1.00 27.51 ? 215 GLN A CG    1 
ATOM   1679 C  CD    . GLN A 1 239 ? 58.170 3.520  40.978  1.00 33.25 ? 215 GLN A CD    1 
ATOM   1680 O  OE1   . GLN A 1 239 ? 58.315 4.360  41.869  1.00 29.72 ? 215 GLN A OE1   1 
ATOM   1681 N  NE2   . GLN A 1 239 ? 57.370 3.718  39.938  1.00 44.14 ? 215 GLN A NE2   1 
ATOM   1682 N  N     . GLU A 1 240 ? 62.694 3.339  43.317  1.00 20.12 ? 216 GLU A N     1 
ATOM   1683 C  CA    . GLU A 1 240 ? 64.119 3.529  43.588  1.00 19.79 ? 216 GLU A CA    1 
ATOM   1684 C  C     . GLU A 1 240 ? 64.508 3.061  44.989  1.00 20.83 ? 216 GLU A C     1 
ATOM   1685 O  O     . GLU A 1 240 ? 65.579 2.475  45.182  1.00 22.20 ? 216 GLU A O     1 
ATOM   1686 C  CB    . GLU A 1 240 ? 64.526 4.991  43.404  1.00 18.47 ? 216 GLU A CB    1 
ATOM   1687 C  CG    . GLU A 1 240 ? 64.562 5.415  41.943  1.00 19.68 ? 216 GLU A CG    1 
ATOM   1688 C  CD    . GLU A 1 240 ? 64.331 6.904  41.766  1.00 23.59 ? 216 GLU A CD    1 
ATOM   1689 O  OE1   . GLU A 1 240 ? 64.351 7.642  42.776  1.00 24.84 ? 216 GLU A OE1   1 
ATOM   1690 O  OE2   . GLU A 1 240 ? 64.123 7.331  40.615  1.00 26.35 ? 216 GLU A OE2   1 
ATOM   1691 N  N     . ALA A 1 241 ? 63.639 3.335  45.964  1.00 23.16 ? 217 ALA A N     1 
ATOM   1692 C  CA    . ALA A 1 241 ? 63.882 2.930  47.344  1.00 23.37 ? 217 ALA A CA    1 
ATOM   1693 C  C     . ALA A 1 241 ? 63.851 1.412  47.457  1.00 22.87 ? 217 ALA A C     1 
ATOM   1694 O  O     . ALA A 1 241 ? 64.672 0.822  48.158  1.00 24.23 ? 217 ALA A O     1 
ATOM   1695 C  CB    . ALA A 1 241 ? 62.862 3.563  48.275  1.00 23.43 ? 217 ALA A CB    1 
ATOM   1696 N  N     . LEU A 1 242 ? 62.906 0.783  46.757  1.00 22.55 ? 218 LEU A N     1 
ATOM   1697 C  CA    . LEU A 1 242 ? 62.812 -0.680 46.764  1.00 21.95 ? 218 LEU A CA    1 
ATOM   1698 C  C     . LEU A 1 242 ? 64.016 -1.340 46.083  1.00 23.45 ? 218 LEU A C     1 
ATOM   1699 O  O     . LEU A 1 242 ? 64.480 -2.388 46.515  1.00 25.56 ? 218 LEU A O     1 
ATOM   1700 C  CB    . LEU A 1 242 ? 61.508 -1.161 46.122  1.00 23.45 ? 218 LEU A CB    1 
ATOM   1701 C  CG    . LEU A 1 242 ? 60.201 -0.803 46.841  1.00 26.00 ? 218 LEU A CG    1 
ATOM   1702 C  CD1   . LEU A 1 242 ? 59.012 -1.246 46.000  1.00 28.27 ? 218 LEU A CD1   1 
ATOM   1703 C  CD2   . LEU A 1 242 ? 60.160 -1.423 48.234  1.00 26.89 ? 218 LEU A CD2   1 
ATOM   1704 N  N     A SER A 1 243 ? 64.490 -0.719 45.006  0.50 22.67 ? 219 SER A N     1 
ATOM   1705 N  N     B SER A 1 243 ? 64.511 -0.721 45.019  0.50 23.66 ? 219 SER A N     1 
ATOM   1706 C  CA    A SER A 1 243 ? 65.677 -1.185 44.298  0.50 20.81 ? 219 SER A CA    1 
ATOM   1707 C  CA    B SER A 1 243 ? 65.691 -1.231 44.333  0.50 23.11 ? 219 SER A CA    1 
ATOM   1708 C  C     A SER A 1 243 ? 66.927 -1.049 45.163  0.50 21.24 ? 219 SER A C     1 
ATOM   1709 C  C     B SER A 1 243 ? 66.945 -1.057 45.174  0.50 22.12 ? 219 SER A C     1 
ATOM   1710 O  O     A SER A 1 243 ? 67.755 -1.957 45.198  0.50 22.84 ? 219 SER A O     1 
ATOM   1711 O  O     B SER A 1 243 ? 67.798 -1.942 45.203  0.50 23.72 ? 219 SER A O     1 
ATOM   1712 C  CB    A SER A 1 243 ? 65.850 -0.425 42.977  0.50 19.00 ? 219 SER A CB    1 
ATOM   1713 C  CB    B SER A 1 243 ? 65.849 -0.544 42.983  0.50 26.02 ? 219 SER A CB    1 
ATOM   1714 O  OG    A SER A 1 243 ? 67.016 -0.858 42.294  0.50 15.42 ? 219 SER A OG    1 
ATOM   1715 O  OG    B SER A 1 243 ? 64.651 -0.678 42.255  0.50 28.22 ? 219 SER A OG    1 
ATOM   1716 N  N     . LEU A 1 244 ? 67.045 0.078  45.865  1.00 22.16 ? 220 LEU A N     1 
ATOM   1717 C  CA    . LEU A 1 244 ? 68.222 0.370  46.701  1.00 21.26 ? 220 LEU A CA    1 
ATOM   1718 C  C     . LEU A 1 244 ? 68.479 -0.712 47.748  1.00 21.40 ? 220 LEU A C     1 
ATOM   1719 O  O     . LEU A 1 244 ? 69.616 -1.118 47.957  1.00 23.75 ? 220 LEU A O     1 
ATOM   1720 C  CB    . LEU A 1 244 ? 68.105 1.761  47.358  1.00 22.32 ? 220 LEU A CB    1 
ATOM   1721 C  CG    . LEU A 1 244 ? 69.285 2.303  48.180  1.00 23.37 ? 220 LEU A CG    1 
ATOM   1722 C  CD1   . LEU A 1 244 ? 70.550 2.444  47.343  1.00 24.38 ? 220 LEU A CD1   1 
ATOM   1723 C  CD2   . LEU A 1 244 ? 68.925 3.631  48.824  1.00 21.71 ? 220 LEU A CD2   1 
ATOM   1724 N  N     . TYR A 1 245 ? 67.410 -1.193 48.366  1.00 21.13 ? 221 TYR A N     1 
ATOM   1725 C  CA    . TYR A 1 245 ? 67.540 -2.204 49.406  1.00 21.02 ? 221 TYR A CA    1 
ATOM   1726 C  C     . TYR A 1 245 ? 67.113 -3.594 48.938  1.00 22.61 ? 221 TYR A C     1 
ATOM   1727 O  O     . TYR A 1 245 ? 67.044 -4.521 49.738  1.00 25.06 ? 221 TYR A O     1 
ATOM   1728 C  CB    . TYR A 1 245 ? 66.811 -1.749 50.677  1.00 23.83 ? 221 TYR A CB    1 
ATOM   1729 C  CG    . TYR A 1 245 ? 67.393 -0.446 51.175  1.00 23.25 ? 221 TYR A CG    1 
ATOM   1730 C  CD1   . TYR A 1 245 ? 68.665 -0.409 51.754  1.00 26.88 ? 221 TYR A CD1   1 
ATOM   1731 C  CD2   . TYR A 1 245 ? 66.712 0.762  51.010  1.00 23.95 ? 221 TYR A CD2   1 
ATOM   1732 C  CE1   . TYR A 1 245 ? 69.226 0.781  52.186  1.00 26.07 ? 221 TYR A CE1   1 
ATOM   1733 C  CE2   . TYR A 1 245 ? 67.266 1.962  51.442  1.00 25.32 ? 221 TYR A CE2   1 
ATOM   1734 C  CZ    . TYR A 1 245 ? 68.527 1.967  52.023  1.00 23.01 ? 221 TYR A CZ    1 
ATOM   1735 O  OH    . TYR A 1 245 ? 69.098 3.137  52.462  1.00 24.75 ? 221 TYR A OH    1 
ATOM   1736 N  N     . GLN A 1 246 ? 66.865 -3.734 47.632  1.00 19.94 ? 222 GLN A N     1 
ATOM   1737 C  CA    . GLN A 1 246 ? 66.518 -5.016 47.002  1.00 21.47 ? 222 GLN A CA    1 
ATOM   1738 C  C     . GLN A 1 246 ? 65.417 -5.742 47.762  1.00 22.26 ? 222 GLN A C     1 
ATOM   1739 O  O     . GLN A 1 246 ? 65.547 -6.915 48.135  1.00 25.36 ? 222 GLN A O     1 
ATOM   1740 C  CB    . GLN A 1 246 ? 67.763 -5.898 46.851  1.00 22.65 ? 222 GLN A CB    1 
ATOM   1741 C  CG    . GLN A 1 246 ? 68.912 -5.205 46.144  1.00 24.14 ? 222 GLN A CG    1 
ATOM   1742 C  CD    . GLN A 1 246 ? 70.138 -6.086 46.009  1.00 25.39 ? 222 GLN A CD    1 
ATOM   1743 O  OE1   . GLN A 1 246 ? 70.960 -6.187 46.926  1.00 27.16 ? 222 GLN A OE1   1 
ATOM   1744 N  NE2   . GLN A 1 246 ? 70.270 -6.729 44.860  1.00 27.03 ? 222 GLN A NE2   1 
ATOM   1745 N  N     . THR A 1 247 ? 64.336 -5.015 48.005  1.00 23.99 ? 223 THR A N     1 
ATOM   1746 C  CA    . THR A 1 247 ? 63.253 -5.492 48.834  1.00 25.07 ? 223 THR A CA    1 
ATOM   1747 C  C     . THR A 1 247 ? 61.901 -5.232 48.172  1.00 25.62 ? 223 THR A C     1 
ATOM   1748 O  O     . THR A 1 247 ? 61.772 -4.343 47.319  1.00 28.34 ? 223 THR A O     1 
ATOM   1749 C  CB    . THR A 1 247 ? 63.306 -4.844 50.236  1.00 24.61 ? 223 THR A CB    1 
ATOM   1750 O  OG1   . THR A 1 247 ? 62.238 -5.356 51.039  1.00 27.92 ? 223 THR A OG1   1 
ATOM   1751 C  CG2   . THR A 1 247 ? 63.180 -3.323 50.141  1.00 25.48 ? 223 THR A CG2   1 
ATOM   1752 N  N     . ASP A 1 248 ? 60.906 -6.026 48.558  1.00 28.90 ? 224 ASP A N     1 
ATOM   1753 C  CA    . ASP A 1 248 ? 59.513 -5.765 48.190  1.00 32.20 ? 224 ASP A CA    1 
ATOM   1754 C  C     . ASP A 1 248 ? 58.738 -5.101 49.340  1.00 30.11 ? 224 ASP A C     1 
ATOM   1755 O  O     . ASP A 1 248 ? 57.532 -4.873 49.236  1.00 34.52 ? 224 ASP A O     1 
ATOM   1756 C  CB    . ASP A 1 248 ? 58.807 -7.045 47.697  1.00 36.51 ? 224 ASP A CB    1 
ATOM   1757 C  CG    . ASP A 1 248 ? 59.031 -8.247 48.609  1.00 40.16 ? 224 ASP A CG    1 
ATOM   1758 O  OD1   . ASP A 1 248 ? 58.894 -8.111 49.843  1.00 41.42 ? 224 ASP A OD1   1 
ATOM   1759 O  OD2   . ASP A 1 248 ? 59.327 -9.344 48.080  1.00 40.81 ? 224 ASP A OD2   1 
ATOM   1760 N  N     . ASP A 1 249 ? 59.449 -4.771 50.416  1.00 29.29 ? 225 ASP A N     1 
ATOM   1761 C  CA    . ASP A 1 249 ? 58.844 -4.208 51.622  1.00 31.60 ? 225 ASP A CA    1 
ATOM   1762 C  C     . ASP A 1 249 ? 59.143 -2.711 51.722  1.00 30.22 ? 225 ASP A C     1 
ATOM   1763 O  O     . ASP A 1 249 ? 60.258 -2.315 52.073  1.00 29.38 ? 225 ASP A O     1 
ATOM   1764 C  CB    . ASP A 1 249 ? 59.369 -4.949 52.863  1.00 34.02 ? 225 ASP A CB    1 
ATOM   1765 C  CG    . ASP A 1 249 ? 58.584 -4.627 54.129  1.00 37.39 ? 225 ASP A CG    1 
ATOM   1766 O  OD1   . ASP A 1 249 ? 57.891 -3.589 54.185  1.00 37.69 ? 225 ASP A OD1   1 
ATOM   1767 O  OD2   . ASP A 1 249 ? 58.668 -5.423 55.086  1.00 41.03 ? 225 ASP A OD2   1 
ATOM   1768 N  N     . PHE A 1 250 ? 58.142 -1.885 51.421  1.00 29.22 ? 226 PHE A N     1 
ATOM   1769 C  CA    . PHE A 1 250 ? 58.324 -0.427 51.407  1.00 26.60 ? 226 PHE A CA    1 
ATOM   1770 C  C     . PHE A 1 250 ? 58.635 0.159  52.785  1.00 26.82 ? 226 PHE A C     1 
ATOM   1771 O  O     . PHE A 1 250 ? 59.424 1.091  52.901  1.00 27.20 ? 226 PHE A O     1 
ATOM   1772 C  CB    . PHE A 1 250 ? 57.120 0.281  50.770  1.00 27.49 ? 226 PHE A CB    1 
ATOM   1773 C  CG    . PHE A 1 250 ? 57.313 1.764  50.578  1.00 28.07 ? 226 PHE A CG    1 
ATOM   1774 C  CD1   . PHE A 1 250 ? 58.336 2.257  49.761  1.00 26.52 ? 226 PHE A CD1   1 
ATOM   1775 C  CD2   . PHE A 1 250 ? 56.463 2.673  51.205  1.00 30.30 ? 226 PHE A CD2   1 
ATOM   1776 C  CE1   . PHE A 1 250 ? 58.504 3.624  49.584  1.00 27.17 ? 226 PHE A CE1   1 
ATOM   1777 C  CE2   . PHE A 1 250 ? 56.629 4.037  51.030  1.00 30.78 ? 226 PHE A CE2   1 
ATOM   1778 C  CZ    . PHE A 1 250 ? 57.649 4.514  50.218  1.00 28.68 ? 226 PHE A CZ    1 
ATOM   1779 N  N     . GLU A 1 251 ? 58.030 -0.393 53.830  1.00 28.08 ? 227 GLU A N     1 
ATOM   1780 C  CA    . GLU A 1 251 ? 58.325 0.077  55.179  1.00 31.66 ? 227 GLU A CA    1 
ATOM   1781 C  C     . GLU A 1 251 ? 59.780 -0.181 55.567  1.00 29.00 ? 227 GLU A C     1 
ATOM   1782 O  O     . GLU A 1 251 ? 60.415 0.668  56.192  1.00 32.75 ? 227 GLU A O     1 
ATOM   1783 C  CB    . GLU A 1 251 ? 57.339 -0.494 56.205  1.00 36.40 ? 227 GLU A CB    1 
ATOM   1784 C  CG    . GLU A 1 251 ? 55.919 0.054  56.060  1.00 38.30 ? 227 GLU A CG    1 
ATOM   1785 C  CD    . GLU A 1 251 ? 55.824 1.571  56.207  1.00 29.21 ? 227 GLU A CD    1 
ATOM   1786 O  OE1   . GLU A 1 251 ? 56.557 2.146  57.047  1.00 38.80 ? 227 GLU A OE1   1 
ATOM   1787 O  OE2   . GLU A 1 251 ? 55.012 2.182  55.508  1.00 34.24 ? 227 GLU A OE2   1 
ATOM   1788 N  N     . GLU A 1 252 ? 60.307 -1.339 55.167  1.00 29.04 ? 228 GLU A N     1 
ATOM   1789 C  CA    . GLU A 1 252 ? 61.731 -1.646 55.332  1.00 28.41 ? 228 GLU A CA    1 
ATOM   1790 C  C     . GLU A 1 252 ? 62.608 -0.626 54.602  1.00 25.74 ? 228 GLU A C     1 
ATOM   1791 O  O     . GLU A 1 252 ? 63.565 -0.094 55.172  1.00 26.90 ? 228 GLU A O     1 
ATOM   1792 C  CB    . GLU A 1 252 ? 62.042 -3.061 54.835  1.00 30.31 ? 228 GLU A CB    1 
ATOM   1793 C  CG    . GLU A 1 252 ? 63.500 -3.473 54.987  1.00 31.27 ? 228 GLU A CG    1 
ATOM   1794 C  CD    . GLU A 1 252 ? 63.859 -4.692 54.153  1.00 36.87 ? 228 GLU A CD    1 
ATOM   1795 O  OE1   . GLU A 1 252 ? 62.936 -5.405 53.705  1.00 43.85 ? 228 GLU A OE1   1 
ATOM   1796 O  OE2   . GLU A 1 252 ? 65.067 -4.934 53.940  1.00 37.27 ? 228 GLU A OE2   1 
ATOM   1797 N  N     . ALA A 1 253 ? 62.277 -0.356 53.340  1.00 24.10 ? 229 ALA A N     1 
ATOM   1798 C  CA    . ALA A 1 253 ? 63.013 0.644  52.577  1.00 23.64 ? 229 ALA A CA    1 
ATOM   1799 C  C     . ALA A 1 253 ? 63.028 2.012  53.264  1.00 22.72 ? 229 ALA A C     1 
ATOM   1800 O  O     . ALA A 1 253 ? 64.073 2.644  53.324  1.00 24.18 ? 229 ALA A O     1 
ATOM   1801 C  CB    . ALA A 1 253 ? 62.468 0.745  51.164  1.00 24.29 ? 229 ALA A CB    1 
ATOM   1802 N  N     . LEU A 1 254 ? 61.887 2.448  53.804  1.00 25.20 ? 230 LEU A N     1 
ATOM   1803 C  CA    . LEU A 1 254 ? 61.823 3.729  54.527  1.00 25.67 ? 230 LEU A CA    1 
ATOM   1804 C  C     . LEU A 1 254 ? 62.689 3.733  55.786  1.00 26.99 ? 230 LEU A C     1 
ATOM   1805 O  O     . LEU A 1 254 ? 63.418 4.688  56.046  1.00 27.61 ? 230 LEU A O     1 
ATOM   1806 C  CB    . LEU A 1 254 ? 60.378 4.109  54.884  1.00 24.89 ? 230 LEU A CB    1 
ATOM   1807 C  CG    . LEU A 1 254 ? 59.406 4.426  53.743  1.00 26.75 ? 230 LEU A CG    1 
ATOM   1808 C  CD1   . LEU A 1 254 ? 58.028 4.786  54.287  1.00 30.98 ? 230 LEU A CD1   1 
ATOM   1809 C  CD2   . LEU A 1 254 ? 59.931 5.546  52.851  1.00 27.24 ? 230 LEU A CD2   1 
ATOM   1810 N  N     . ASN A 1 255 ? 62.609 2.659  56.566  1.00 28.79 ? 231 ASN A N     1 
ATOM   1811 C  CA    . ASN A 1 255 ? 63.427 2.560  57.760  1.00 28.74 ? 231 ASN A CA    1 
ATOM   1812 C  C     . ASN A 1 255 ? 64.919 2.550  57.422  1.00 28.03 ? 231 ASN A C     1 
ATOM   1813 O  O     . ASN A 1 255 ? 65.722 3.209  58.087  1.00 30.44 ? 231 ASN A O     1 
ATOM   1814 C  CB    . ASN A 1 255 ? 63.031 1.334  58.590  1.00 31.33 ? 231 ASN A CB    1 
ATOM   1815 C  CG    . ASN A 1 255 ? 61.659 1.482  59.227  1.00 35.38 ? 231 ASN A CG    1 
ATOM   1816 O  OD1   . ASN A 1 255 ? 61.305 2.549  59.728  1.00 35.52 ? 231 ASN A OD1   1 
ATOM   1817 N  ND2   . ASN A 1 255 ? 60.883 0.409  59.213  1.00 42.36 ? 231 ASN A ND2   1 
ATOM   1818 N  N     . ARG A 1 256 ? 65.279 1.820  56.368  1.00 26.29 ? 232 ARG A N     1 
ATOM   1819 C  CA    . ARG A 1 256 ? 66.682 1.723  55.965  1.00 26.86 ? 232 ARG A CA    1 
ATOM   1820 C  C     . ARG A 1 256 ? 67.221 3.033  55.402  1.00 23.53 ? 232 ARG A C     1 
ATOM   1821 O  O     . ARG A 1 256 ? 68.335 3.443  55.748  1.00 25.77 ? 232 ARG A O     1 
ATOM   1822 C  CB    . ARG A 1 256 ? 66.904 0.567  54.988  1.00 27.11 ? 232 ARG A CB    1 
ATOM   1823 C  CG    . ARG A 1 256 ? 66.740 -0.797 55.642  1.00 27.79 ? 232 ARG A CG    1 
ATOM   1824 C  CD    . ARG A 1 256 ? 67.207 -1.929 54.747  1.00 28.17 ? 232 ARG A CD    1 
ATOM   1825 N  NE    . ARG A 1 256 ? 68.663 -1.970 54.632  1.00 35.11 ? 232 ARG A NE    1 
ATOM   1826 C  CZ    . ARG A 1 256 ? 69.335 -2.875 53.926  1.00 39.34 ? 232 ARG A CZ    1 
ATOM   1827 N  NH1   . ARG A 1 256 ? 68.685 -3.822 53.258  1.00 43.09 ? 232 ARG A NH1   1 
ATOM   1828 N  NH2   . ARG A 1 256 ? 70.662 -2.829 53.881  1.00 45.96 ? 232 ARG A NH2   1 
ATOM   1829 N  N     . ILE A 1 257 ? 66.432 3.698  54.554  1.00 24.39 ? 233 ILE A N     1 
ATOM   1830 C  CA    . ILE A 1 257 ? 66.866 4.973  53.997  1.00 24.25 ? 233 ILE A CA    1 
ATOM   1831 C  C     . ILE A 1 257 ? 67.039 6.054  55.077  1.00 23.25 ? 233 ILE A C     1 
ATOM   1832 O  O     . ILE A 1 257 ? 67.982 6.843  55.020  1.00 25.28 ? 233 ILE A O     1 
ATOM   1833 C  CB    . ILE A 1 257 ? 65.999 5.432  52.800  1.00 21.91 ? 233 ILE A CB    1 
ATOM   1834 C  CG1   . ILE A 1 257 ? 66.828 6.328  51.874  1.00 23.36 ? 233 ILE A CG1   1 
ATOM   1835 C  CG2   . ILE A 1 257 ? 64.696 6.084  53.259  1.00 22.69 ? 233 ILE A CG2   1 
ATOM   1836 C  CD1   . ILE A 1 257 ? 66.243 6.517  50.489  1.00 22.03 ? 233 ILE A CD1   1 
ATOM   1837 N  N     . ALA A 1 258 ? 66.156 6.060  56.073  1.00 24.66 ? 234 ALA A N     1 
ATOM   1838 C  CA    . ALA A 1 258 ? 66.265 7.003  57.193  1.00 25.52 ? 234 ALA A CA    1 
ATOM   1839 C  C     . ALA A 1 258 ? 67.538 6.753  58.028  1.00 25.94 ? 234 ALA A C     1 
ATOM   1840 O  O     . ALA A 1 258 ? 68.100 7.681  58.625  1.00 28.85 ? 234 ALA A O     1 
ATOM   1841 C  CB    . ALA A 1 258 ? 65.016 6.926  58.064  1.00 26.56 ? 234 ALA A CB    1 
ATOM   1842 N  N     . ALA A 1 259 ? 67.998 5.503  58.039  1.00 24.59 ? 235 ALA A N     1 
ATOM   1843 C  CA    . ALA A 1 259 ? 69.215 5.125  58.764  1.00 25.08 ? 235 ALA A CA    1 
ATOM   1844 C  C     . ALA A 1 259 ? 70.482 5.507  57.996  1.00 25.37 ? 235 ALA A C     1 
ATOM   1845 O  O     . ALA A 1 259 ? 71.543 5.694  58.591  1.00 27.56 ? 235 ALA A O     1 
ATOM   1846 C  CB    . ALA A 1 259 ? 69.212 3.638  59.088  1.00 26.85 ? 235 ALA A CB    1 
ATOM   1847 N  N     . ASP A 1 260 ? 70.354 5.641  56.676  1.00 24.64 ? 236 ASP A N     1 
ATOM   1848 C  CA    . ASP A 1 260 ? 71.510 5.861  55.800  1.00 23.31 ? 236 ASP A CA    1 
ATOM   1849 C  C     . ASP A 1 260 ? 71.819 7.324  55.435  1.00 23.39 ? 236 ASP A C     1 
ATOM   1850 O  O     . ASP A 1 260 ? 72.951 7.634  55.056  1.00 26.37 ? 236 ASP A O     1 
ATOM   1851 C  CB    . ASP A 1 260 ? 71.374 5.000  54.535  1.00 22.65 ? 236 ASP A CB    1 
ATOM   1852 C  CG    . ASP A 1 260 ? 71.674 3.520  54.793  1.00 23.66 ? 236 ASP A CG    1 
ATOM   1853 O  OD1   . ASP A 1 260 ? 72.465 3.203  55.714  1.00 28.12 ? 236 ASP A OD1   1 
ATOM   1854 O  OD2   . ASP A 1 260 ? 71.121 2.671  54.068  1.00 26.79 ? 236 ASP A OD2   1 
ATOM   1855 N  N     . CYS A 1 261 ? 70.835 8.215  55.565  1.00 22.77 ? 237 CYS A N     1 
ATOM   1856 C  CA    A CYS A 1 261 ? 71.043 9.623  55.232  0.60 24.59 ? 237 CYS A CA    1 
ATOM   1857 C  CA    B CYS A 1 261 ? 70.990 9.623  55.187  0.40 23.51 ? 237 CYS A CA    1 
ATOM   1858 C  C     . CYS A 1 261 ? 70.336 10.527 56.231  1.00 25.90 ? 237 CYS A C     1 
ATOM   1859 O  O     . CYS A 1 261 ? 69.351 10.125 56.852  1.00 27.94 ? 237 CYS A O     1 
ATOM   1860 C  CB    A CYS A 1 261 ? 70.541 9.920  53.822  0.60 24.71 ? 237 CYS A CB    1 
ATOM   1861 C  CB    B CYS A 1 261 ? 70.351 9.864  53.814  0.40 21.47 ? 237 CYS A CB    1 
ATOM   1862 S  SG    A CYS A 1 261 ? 68.750 9.801  53.692  0.60 27.25 ? 237 CYS A SG    1 
ATOM   1863 S  SG    B CYS A 1 261 ? 70.988 11.283 52.893  0.40 19.43 ? 237 CYS A SG    1 
ATOM   1864 N  N     . LYS A 1 262 ? 70.862 11.745 56.394  1.00 24.50 ? 238 LYS A N     1 
ATOM   1865 C  CA    . LYS A 1 262 ? 70.329 12.706 57.374  1.00 25.82 ? 238 LYS A CA    1 
ATOM   1866 C  C     . LYS A 1 262 ? 68.872 13.057 57.078  1.00 25.48 ? 238 LYS A C     1 
ATOM   1867 O  O     . LYS A 1 262 ? 68.018 13.017 57.965  1.00 27.11 ? 238 LYS A O     1 
ATOM   1868 C  CB    . LYS A 1 262 ? 71.196 13.965 57.441  1.00 28.63 ? 238 LYS A CB    1 
ATOM   1869 C  CG    . LYS A 1 262 ? 72.510 13.763 58.186  1.00 34.03 ? 238 LYS A CG    1 
ATOM   1870 C  CD    . LYS A 1 262 ? 73.330 15.045 58.221  1.00 40.15 ? 238 LYS A CD    1 
ATOM   1871 C  CE    . LYS A 1 262 ? 74.808 14.751 58.022  1.00 44.32 ? 238 LYS A CE    1 
ATOM   1872 N  NZ    . LYS A 1 262 ? 75.057 14.104 56.702  1.00 42.55 ? 238 LYS A NZ    1 
ATOM   1873 N  N     . ILE A 1 263 ? 68.590 13.388 55.822  1.00 25.07 ? 239 ILE A N     1 
ATOM   1874 C  CA    . ILE A 1 263 ? 67.221 13.623 55.389  1.00 23.08 ? 239 ILE A CA    1 
ATOM   1875 C  C     . ILE A 1 263 ? 66.949 12.839 54.112  1.00 22.09 ? 239 ILE A C     1 
ATOM   1876 O  O     . ILE A 1 263 ? 67.779 12.816 53.203  1.00 23.58 ? 239 ILE A O     1 
ATOM   1877 C  CB    . ILE A 1 263 ? 66.934 15.126 55.165  1.00 22.73 ? 239 ILE A CB    1 
ATOM   1878 C  CG1   . ILE A 1 263 ? 67.095 15.894 56.487  1.00 23.41 ? 239 ILE A CG1   1 
ATOM   1879 C  CG2   . ILE A 1 263 ? 65.540 15.328 54.584  1.00 24.25 ? 239 ILE A CG2   1 
ATOM   1880 C  CD1   . ILE A 1 263 ? 67.079 17.403 56.347  1.00 26.44 ? 239 ILE A CD1   1 
ATOM   1881 N  N     . ALA A 1 264 ? 65.787 12.193 54.065  1.00 22.29 ? 240 ALA A N     1 
ATOM   1882 C  CA    . ALA A 1 264 ? 65.312 11.518 52.860  1.00 21.65 ? 240 ALA A CA    1 
ATOM   1883 C  C     . ALA A 1 264 ? 63.928 12.018 52.472  1.00 25.36 ? 240 ALA A C     1 
ATOM   1884 O  O     . ALA A 1 264 ? 63.033 12.144 53.312  1.00 26.63 ? 240 ALA A O     1 
ATOM   1885 C  CB    . ALA A 1 264 ? 65.290 10.006 53.048  1.00 23.06 ? 240 ALA A CB    1 
ATOM   1886 N  N     . ALA A 1 265 ? 63.759 12.310 51.187  1.00 23.26 ? 241 ALA A N     1 
ATOM   1887 C  CA    . ALA A 1 265 ? 62.465 12.705 50.651  1.00 22.96 ? 241 ALA A CA    1 
ATOM   1888 C  C     . ALA A 1 265 ? 62.039 11.613 49.686  1.00 23.41 ? 241 ALA A C     1 
ATOM   1889 O  O     . ALA A 1 265 ? 62.700 11.378 48.670  1.00 23.59 ? 241 ALA A O     1 
ATOM   1890 C  CB    . ALA A 1 265 ? 62.561 14.061 49.958  1.00 21.25 ? 241 ALA A CB    1 
ATOM   1891 N  N     . VAL A 1 266 ? 60.964 10.909 50.024  1.00 23.52 ? 242 VAL A N     1 
ATOM   1892 C  CA    . VAL A 1 266 ? 60.535 9.760  49.232  1.00 22.62 ? 242 VAL A CA    1 
ATOM   1893 C  C     . VAL A 1 266 ? 59.169 10.005 48.618  1.00 22.72 ? 242 VAL A C     1 
ATOM   1894 O  O     . VAL A 1 266 ? 58.177 10.182 49.329  1.00 27.58 ? 242 VAL A O     1 
ATOM   1895 C  CB    . VAL A 1 266 ? 60.552 8.444  50.049  1.00 23.86 ? 242 VAL A CB    1 
ATOM   1896 C  CG1   . VAL A 1 266 ? 60.201 7.248  49.167  1.00 24.50 ? 242 VAL A CG1   1 
ATOM   1897 C  CG2   . VAL A 1 266 ? 61.919 8.249  50.686  1.00 24.18 ? 242 VAL A CG2   1 
ATOM   1898 N  N     . THR A 1 267 ? 59.121 10.006 47.289  1.00 22.93 ? 243 THR A N     1 
ATOM   1899 C  CA    . THR A 1 267 ? 57.874 10.285 46.579  1.00 24.17 ? 243 THR A CA    1 
ATOM   1900 C  C     . THR A 1 267 ? 57.126 8.992  46.277  1.00 23.79 ? 243 THR A C     1 
ATOM   1901 O  O     . THR A 1 267 ? 57.742 7.932  46.141  1.00 26.00 ? 243 THR A O     1 
ATOM   1902 C  CB    . THR A 1 267 ? 58.113 11.067 45.275  1.00 25.58 ? 243 THR A CB    1 
ATOM   1903 O  OG1   . THR A 1 267 ? 58.923 10.285 44.394  1.00 25.78 ? 243 THR A OG1   1 
ATOM   1904 C  CG2   . THR A 1 267 ? 58.819 12.382 45.568  1.00 26.73 ? 243 THR A CG2   1 
HETATM 1905 N  N     . MSE A 1 268 ? 55.797 9.079  46.190  1.00 25.88 ? 244 MSE A N     1 
HETATM 1906 C  CA    . MSE A 1 268 ? 54.953 7.898  45.996  1.00 28.41 ? 244 MSE A CA    1 
HETATM 1907 C  C     . MSE A 1 268 ? 53.847 8.188  45.018  1.00 28.15 ? 244 MSE A C     1 
HETATM 1908 O  O     . MSE A 1 268 ? 52.701 7.756  45.212  1.00 29.89 ? 244 MSE A O     1 
HETATM 1909 C  CB    . MSE A 1 268 ? 54.355 7.429  47.324  1.00 34.54 ? 244 MSE A CB    1 
HETATM 1910 C  CG    . MSE A 1 268 ? 55.405 7.224  48.411  1.00 40.40 ? 244 MSE A CG    1 
HETATM 1911 SE SE    . MSE A 1 268 ? 54.495 6.934  50.131  1.00 58.81 ? 244 MSE A SE    1 
HETATM 1912 C  CE    . MSE A 1 268 ? 53.868 8.766  50.482  1.00 49.89 ? 244 MSE A CE    1 
ATOM   1913 N  N     . SER A 1 269 ? 54.192 8.908  43.950  1.00 29.88 ? 245 SER A N     1 
ATOM   1914 C  CA    . SER A 1 269 ? 53.268 9.233  42.861  1.00 29.76 ? 245 SER A CA    1 
ATOM   1915 C  C     . SER A 1 269 ? 51.972 9.865  43.387  1.00 30.16 ? 245 SER A C     1 
ATOM   1916 O  O     . SER A 1 269 ? 52.025 10.871 44.095  1.00 29.84 ? 245 SER A O     1 
ATOM   1917 C  CB    . SER A 1 269 ? 52.994 7.997  41.989  1.00 33.20 ? 245 SER A CB    1 
ATOM   1918 O  OG    . SER A 1 269 ? 54.205 7.403  41.548  1.00 38.01 ? 245 SER A OG    1 
ATOM   1919 N  N     . GLU A 1 270 ? 50.827 9.260  43.070  1.00 33.11 ? 246 GLU A N     1 
ATOM   1920 C  CA    . GLU A 1 270 ? 49.521 9.797  43.467  1.00 31.52 ? 246 GLU A CA    1 
ATOM   1921 C  C     . GLU A 1 270 ? 49.282 9.727  44.981  1.00 31.54 ? 246 GLU A C     1 
ATOM   1922 O  O     . GLU A 1 270 ? 48.317 10.303 45.495  1.00 33.25 ? 246 GLU A O     1 
ATOM   1923 C  CB    . GLU A 1 270 ? 48.384 9.111  42.693  1.00 33.13 ? 246 GLU A CB    1 
ATOM   1924 C  CG    . GLU A 1 270 ? 48.035 7.703  43.159  1.00 34.70 ? 246 GLU A CG    1 
ATOM   1925 C  CD    . GLU A 1 270 ? 48.890 6.610  42.531  1.00 38.91 ? 246 GLU A CD    1 
ATOM   1926 O  OE1   . GLU A 1 270 ? 49.940 6.913  41.919  1.00 37.73 ? 246 GLU A OE1   1 
ATOM   1927 O  OE2   . GLU A 1 270 ? 48.503 5.430  42.653  1.00 44.41 ? 246 GLU A OE2   1 
ATOM   1928 N  N     . ASN A 1 271 ? 50.165 9.024  45.686  1.00 31.21 ? 247 ASN A N     1 
ATOM   1929 C  CA    . ASN A 1 271 ? 50.094 8.936  47.143  1.00 32.51 ? 247 ASN A CA    1 
ATOM   1930 C  C     . ASN A 1 271 ? 50.939 9.986  47.861  1.00 29.27 ? 247 ASN A C     1 
ATOM   1931 O  O     . ASN A 1 271 ? 51.100 9.940  49.081  1.00 35.01 ? 247 ASN A O     1 
ATOM   1932 C  CB    . ASN A 1 271 ? 50.459 7.526  47.618  1.00 36.62 ? 247 ASN A CB    1 
ATOM   1933 C  CG    . ASN A 1 271 ? 49.413 6.495  47.239  1.00 42.99 ? 247 ASN A CG    1 
ATOM   1934 O  OD1   . ASN A 1 271 ? 48.214 6.719  47.404  1.00 47.30 ? 247 ASN A OD1   1 
ATOM   1935 N  ND2   . ASN A 1 271 ? 49.864 5.353  46.734  1.00 47.57 ? 247 ASN A ND2   1 
ATOM   1936 N  N     . GLY A 1 272 ? 51.468 10.937 47.098  1.00 28.84 ? 248 GLY A N     1 
ATOM   1937 C  CA    . GLY A 1 272 ? 52.168 12.079 47.667  1.00 26.52 ? 248 GLY A CA    1 
ATOM   1938 C  C     . GLY A 1 272 ? 53.620 11.775 47.958  1.00 27.44 ? 248 GLY A C     1 
ATOM   1939 O  O     . GLY A 1 272 ? 54.327 11.243 47.111  1.00 29.35 ? 248 GLY A O     1 
ATOM   1940 N  N     . ALA A 1 273 ? 54.060 12.114 49.166  1.00 26.15 ? 249 ALA A N     1 
ATOM   1941 C  CA    . ALA A 1 273 ? 55.447 11.919 49.573  1.00 25.62 ? 249 ALA A CA    1 
ATOM   1942 C  C     . ALA A 1 273 ? 55.578 11.754 51.086  1.00 26.21 ? 249 ALA A C     1 
ATOM   1943 O  O     . ALA A 1 273 ? 54.653 12.067 51.837  1.00 27.90 ? 249 ALA A O     1 
ATOM   1944 C  CB    . ALA A 1 273 ? 56.313 13.074 49.086  1.00 27.77 ? 249 ALA A CB    1 
ATOM   1945 N  N     . VAL A 1 274 ? 56.723 11.234 51.514  1.00 24.82 ? 250 VAL A N     1 
ATOM   1946 C  CA    . VAL A 1 274 ? 57.066 11.179 52.932  1.00 25.45 ? 250 VAL A CA    1 
ATOM   1947 C  C     . VAL A 1 274 ? 58.485 11.712 53.125  1.00 25.27 ? 250 VAL A C     1 
ATOM   1948 O  O     . VAL A 1 274 ? 59.402 11.348 52.385  1.00 25.30 ? 250 VAL A O     1 
ATOM   1949 C  CB    . VAL A 1 274 ? 56.837 9.766  53.549  1.00 26.12 ? 250 VAL A CB    1 
ATOM   1950 C  CG1   . VAL A 1 274 ? 57.657 8.689  52.848  1.00 26.18 ? 250 VAL A CG1   1 
ATOM   1951 C  CG2   . VAL A 1 274 ? 57.103 9.768  55.055  1.00 29.64 ? 250 VAL A CG2   1 
ATOM   1952 N  N     . ILE A 1 275 ? 58.641 12.616 54.090  1.00 23.63 ? 251 ILE A N     1 
ATOM   1953 C  CA    . ILE A 1 275 ? 59.938 13.198 54.402  1.00 23.42 ? 251 ILE A CA    1 
ATOM   1954 C  C     . ILE A 1 275 ? 60.433 12.602 55.717  1.00 26.45 ? 251 ILE A C     1 
ATOM   1955 O  O     . ILE A 1 275 ? 59.729 12.632 56.733  1.00 27.89 ? 251 ILE A O     1 
ATOM   1956 C  CB    . ILE A 1 275 ? 59.897 14.745 54.508  1.00 23.46 ? 251 ILE A CB    1 
ATOM   1957 C  CG1   . ILE A 1 275 ? 59.030 15.393 53.404  1.00 22.95 ? 251 ILE A CG1   1 
ATOM   1958 C  CG2   . ILE A 1 275 ? 61.310 15.310 54.534  1.00 25.27 ? 251 ILE A CG2   1 
ATOM   1959 C  CD1   . ILE A 1 275 ? 59.415 15.045 51.969  1.00 23.19 ? 251 ILE A CD1   1 
ATOM   1960 N  N     . LEU A 1 276 ? 61.651 12.074 55.688  1.00 25.90 ? 252 LEU A N     1 
ATOM   1961 C  CA    . LEU A 1 276 ? 62.222 11.367 56.823  1.00 24.42 ? 252 LEU A CA    1 
ATOM   1962 C  C     . LEU A 1 276 ? 63.450 12.098 57.352  1.00 25.28 ? 252 LEU A C     1 
ATOM   1963 O  O     . LEU A 1 276 ? 64.304 12.529 56.577  1.00 24.65 ? 252 LEU A O     1 
ATOM   1964 C  CB    . LEU A 1 276 ? 62.592 9.930  56.422  1.00 26.32 ? 252 LEU A CB    1 
ATOM   1965 C  CG    . LEU A 1 276 ? 61.449 9.032  55.933  1.00 32.19 ? 252 LEU A CG    1 
ATOM   1966 C  CD1   . LEU A 1 276 ? 61.366 9.038  54.414  1.00 33.41 ? 252 LEU A CD1   1 
ATOM   1967 C  CD2   . LEU A 1 276 ? 61.617 7.611  56.443  1.00 38.06 ? 252 LEU A CD2   1 
ATOM   1968 N  N     . LYS A 1 277 ? 63.521 12.258 58.674  1.00 25.74 ? 253 LYS A N     1 
ATOM   1969 C  CA    . LYS A 1 277 ? 64.698 12.820 59.334  1.00 26.34 ? 253 LYS A CA    1 
ATOM   1970 C  C     . LYS A 1 277 ? 64.872 12.145 60.687  1.00 29.11 ? 253 LYS A C     1 
ATOM   1971 O  O     . LYS A 1 277 ? 64.162 12.462 61.652  1.00 31.07 ? 253 LYS A O     1 
ATOM   1972 C  CB    . LYS A 1 277 ? 64.596 14.342 59.498  1.00 26.78 ? 253 LYS A CB    1 
ATOM   1973 C  CG    . LYS A 1 277 ? 65.855 14.954 60.097  1.00 27.96 ? 253 LYS A CG    1 
ATOM   1974 C  CD    . LYS A 1 277 ? 65.736 16.446 60.359  1.00 28.14 ? 253 LYS A CD    1 
ATOM   1975 C  CE    . LYS A 1 277 ? 66.964 16.939 61.104  1.00 32.41 ? 253 LYS A CE    1 
ATOM   1976 N  NZ    . LYS A 1 277 ? 66.948 18.415 61.286  1.00 38.38 ? 253 LYS A NZ    1 
ATOM   1977 N  N     . GLY A 1 278 ? 65.817 11.213 60.761  1.00 30.53 ? 254 GLY A N     1 
ATOM   1978 C  CA    . GLY A 1 278 ? 65.997 10.423 61.973  1.00 28.48 ? 254 GLY A CA    1 
ATOM   1979 C  C     . GLY A 1 278 ? 64.764 9.566  62.170  1.00 30.01 ? 254 GLY A C     1 
ATOM   1980 O  O     . GLY A 1 278 ? 64.456 8.710  61.337  1.00 35.77 ? 254 GLY A O     1 
ATOM   1981 N  N     . ARG A 1 279 ? 64.042 9.818  63.258  1.00 32.14 ? 255 ARG A N     1 
ATOM   1982 C  CA    . ARG A 1 279 ? 62.775 9.137  63.516  1.00 34.06 ? 255 ARG A CA    1 
ATOM   1983 C  C     . ARG A 1 279 ? 61.552 9.966  63.111  1.00 31.41 ? 255 ARG A C     1 
ATOM   1984 O  O     . ARG A 1 279 ? 60.422 9.477  63.168  1.00 34.39 ? 255 ARG A O     1 
ATOM   1985 C  CB    . ARG A 1 279 ? 62.690 8.693  64.982  1.00 30.83 ? 255 ARG A CB    1 
ATOM   1986 C  CG    . ARG A 1 279 ? 63.704 7.632  65.339  1.00 40.15 ? 255 ARG A CG    1 
ATOM   1987 C  CD    . ARG A 1 279 ? 63.717 7.305  66.830  1.00 47.25 ? 255 ARG A CD    1 
ATOM   1988 N  NE    . ARG A 1 279 ? 64.607 6.191  67.142  1.00 68.11 ? 255 ARG A NE    1 
ATOM   1989 C  CZ    . ARG A 1 279 ? 65.792 6.304  67.765  1.00 66.13 ? 255 ARG A CZ    1 
ATOM   1990 N  NH1   . ARG A 1 279 ? 66.246 7.503  68.149  1.00 77.66 ? 255 ARG A NH1   1 
ATOM   1991 N  NH2   . ARG A 1 279 ? 66.526 5.221  68.006  1.00 80.47 ? 255 ARG A NH2   1 
ATOM   1992 N  N     . GLU A 1 280 ? 61.784 11.209 62.694  1.00 33.49 ? 256 GLU A N     1 
ATOM   1993 C  CA    . GLU A 1 280 ? 60.705 12.082 62.233  1.00 33.26 ? 256 GLU A CA    1 
ATOM   1994 C  C     . GLU A 1 280 ? 60.196 11.600 60.879  1.00 32.37 ? 256 GLU A C     1 
ATOM   1995 O  O     . GLU A 1 280 ? 60.988 11.226 60.008  1.00 32.91 ? 256 GLU A O     1 
ATOM   1996 C  CB    . GLU A 1 280 ? 61.176 13.536 62.107  1.00 34.72 ? 256 GLU A CB    1 
ATOM   1997 C  CG    . GLU A 1 280 ? 61.787 14.153 63.359  1.00 38.63 ? 256 GLU A CG    1 
ATOM   1998 C  CD    . GLU A 1 280 ? 62.505 15.463 63.071  1.00 40.26 ? 256 GLU A CD    1 
ATOM   1999 O  OE1   . GLU A 1 280 ? 62.012 16.256 62.236  1.00 40.79 ? 256 GLU A OE1   1 
ATOM   2000 O  OE2   . GLU A 1 280 ? 63.566 15.705 63.682  1.00 50.69 ? 256 GLU A OE2   1 
ATOM   2001 N  N     . ARG A 1 281 ? 58.876 11.586 60.723  1.00 31.40 ? 257 ARG A N     1 
ATOM   2002 C  CA    . ARG A 1 281 ? 58.242 11.280 59.443  1.00 29.60 ? 257 ARG A CA    1 
ATOM   2003 C  C     . ARG A 1 281 ? 57.166 12.312 59.163  1.00 30.49 ? 257 ARG A C     1 
ATOM   2004 O  O     . ARG A 1 281 ? 56.314 12.574 60.019  1.00 33.04 ? 257 ARG A O     1 
ATOM   2005 C  CB    . ARG A 1 281 ? 57.615 9.885  59.452  1.00 33.26 ? 257 ARG A CB    1 
ATOM   2006 C  CG    . ARG A 1 281 ? 58.566 8.728  59.195  1.00 32.97 ? 257 ARG A CG    1 
ATOM   2007 C  CD    . ARG A 1 281 ? 57.762 7.502  58.784  1.00 39.54 ? 257 ARG A CD    1 
ATOM   2008 N  NE    . ARG A 1 281 ? 58.543 6.267  58.788  1.00 40.16 ? 257 ARG A NE    1 
ATOM   2009 C  CZ    . ARG A 1 281 ? 58.083 5.085  58.381  1.00 41.88 ? 257 ARG A CZ    1 
ATOM   2010 N  NH1   . ARG A 1 281 ? 56.842 4.962  57.920  1.00 46.22 ? 257 ARG A NH1   1 
ATOM   2011 N  NH2   . ARG A 1 281 ? 58.868 4.019  58.431  1.00 40.98 ? 257 ARG A NH2   1 
ATOM   2012 N  N     . TYR A 1 282 ? 57.212 12.900 57.970  1.00 28.39 ? 258 TYR A N     1 
ATOM   2013 C  CA    . TYR A 1 282 ? 56.224 13.900 57.559  1.00 27.88 ? 258 TYR A CA    1 
ATOM   2014 C  C     . TYR A 1 282 ? 55.549 13.485 56.262  1.00 28.41 ? 258 TYR A C     1 
ATOM   2015 O  O     . TYR A 1 282 ? 56.180 13.469 55.201  1.00 32.98 ? 258 TYR A O     1 
ATOM   2016 C  CB    . TYR A 1 282 ? 56.859 15.295 57.423  1.00 31.78 ? 258 TYR A CB    1 
ATOM   2017 C  CG    . TYR A 1 282 ? 57.569 15.754 58.675  1.00 32.49 ? 258 TYR A CG    1 
ATOM   2018 C  CD1   . TYR A 1 282 ? 56.853 16.277 59.756  1.00 33.69 ? 258 TYR A CD1   1 
ATOM   2019 C  CD2   . TYR A 1 282 ? 58.956 15.656 58.789  1.00 31.51 ? 258 TYR A CD2   1 
ATOM   2020 C  CE1   . TYR A 1 282 ? 57.498 16.689 60.911  1.00 36.88 ? 258 TYR A CE1   1 
ATOM   2021 C  CE2   . TYR A 1 282 ? 59.611 16.063 59.944  1.00 36.80 ? 258 TYR A CE2   1 
ATOM   2022 C  CZ    . TYR A 1 282 ? 58.877 16.580 61.000  1.00 37.92 ? 258 TYR A CZ    1 
ATOM   2023 O  OH    . TYR A 1 282 ? 59.517 16.991 62.146  1.00 42.52 ? 258 TYR A OH    1 
ATOM   2024 N  N     . TYR A 1 283 ? 54.267 13.139 56.357  1.00 29.57 ? 259 TYR A N     1 
ATOM   2025 C  CA    . TYR A 1 283 ? 53.494 12.714 55.194  1.00 28.84 ? 259 TYR A CA    1 
ATOM   2026 C  C     . TYR A 1 283 ? 52.838 13.912 54.525  1.00 28.24 ? 259 TYR A C     1 
ATOM   2027 O  O     . TYR A 1 283 ? 52.320 14.808 55.199  1.00 29.72 ? 259 TYR A O     1 
ATOM   2028 C  CB    . TYR A 1 283 ? 52.455 11.655 55.578  1.00 31.27 ? 259 TYR A CB    1 
ATOM   2029 C  CG    . TYR A 1 283 ? 53.034 10.265 55.789  1.00 34.15 ? 259 TYR A CG    1 
ATOM   2030 C  CD1   . TYR A 1 283 ? 53.508 9.865  57.040  1.00 38.39 ? 259 TYR A CD1   1 
ATOM   2031 C  CD2   . TYR A 1 283 ? 53.109 9.349  54.732  1.00 34.07 ? 259 TYR A CD2   1 
ATOM   2032 C  CE1   . TYR A 1 283 ? 54.041 8.596  57.235  1.00 40.78 ? 259 TYR A CE1   1 
ATOM   2033 C  CE2   . TYR A 1 283 ? 53.637 8.077  54.918  1.00 38.90 ? 259 TYR A CE2   1 
ATOM   2034 C  CZ    . TYR A 1 283 ? 54.101 7.705  56.170  1.00 42.78 ? 259 TYR A CZ    1 
ATOM   2035 O  OH    . TYR A 1 283 ? 54.626 6.445  56.363  1.00 46.51 ? 259 TYR A OH    1 
ATOM   2036 N  N     . VAL A 1 284 ? 52.908 13.940 53.196  1.00 28.34 ? 260 VAL A N     1 
ATOM   2037 C  CA    . VAL A 1 284 ? 52.345 15.027 52.401  1.00 29.86 ? 260 VAL A CA    1 
ATOM   2038 C  C     . VAL A 1 284 ? 51.542 14.453 51.232  1.00 29.79 ? 260 VAL A C     1 
ATOM   2039 O  O     . VAL A 1 284 ? 51.987 13.518 50.561  1.00 30.54 ? 260 VAL A O     1 
ATOM   2040 C  CB    . VAL A 1 284 ? 53.438 16.002 51.891  1.00 31.69 ? 260 VAL A CB    1 
ATOM   2041 C  CG1   . VAL A 1 284 ? 52.853 17.017 50.924  1.00 32.58 ? 260 VAL A CG1   1 
ATOM   2042 C  CG2   . VAL A 1 284 ? 54.098 16.733 53.054  1.00 31.97 ? 260 VAL A CG2   1 
ATOM   2043 N  N     . ASN A 1 285 ? 50.355 15.017 51.005  1.00 29.19 ? 261 ASN A N     1 
ATOM   2044 C  CA    . ASN A 1 285 ? 49.460 14.562 49.946  1.00 27.52 ? 261 ASN A CA    1 
ATOM   2045 C  C     . ASN A 1 285 ? 49.832 15.105 48.573  1.00 28.64 ? 261 ASN A C     1 
ATOM   2046 O  O     . ASN A 1 285 ? 50.365 16.214 48.451  1.00 29.17 ? 261 ASN A O     1 
ATOM   2047 C  CB    . ASN A 1 285 ? 48.014 14.954 50.258  1.00 28.81 ? 261 ASN A CB    1 
ATOM   2048 C  CG    . ASN A 1 285 ? 47.483 14.284 51.509  1.00 24.69 ? 261 ASN A CG    1 
ATOM   2049 O  OD1   . ASN A 1 285 ? 47.774 13.118 51.777  1.00 33.01 ? 261 ASN A OD1   1 
ATOM   2050 N  ND2   . ASN A 1 285 ? 46.686 15.014 52.272  1.00 29.96 ? 261 ASN A ND2   1 
ATOM   2051 N  N     . ALA A 1 286 ? 49.533 14.323 47.541  1.00 30.89 ? 262 ALA A N     1 
ATOM   2052 C  CA    . ALA A 1 286 ? 49.611 14.809 46.169  1.00 28.35 ? 262 ALA A CA    1 
ATOM   2053 C  C     . ALA A 1 286 ? 48.508 15.842 45.966  1.00 27.88 ? 262 ALA A C     1 
ATOM   2054 O  O     . ALA A 1 286 ? 47.465 15.788 46.633  1.00 31.37 ? 262 ALA A O     1 
ATOM   2055 C  CB    . ALA A 1 286 ? 49.444 13.658 45.193  1.00 29.45 ? 262 ALA A CB    1 
ATOM   2056 N  N     . ILE A 1 287 ? 48.731 16.788 45.057  1.00 29.20 ? 263 ILE A N     1 
ATOM   2057 C  CA    . ILE A 1 287 ? 47.705 17.788 44.749  1.00 29.91 ? 263 ILE A CA    1 
ATOM   2058 C  C     . ILE A 1 287 ? 46.644 17.176 43.831  1.00 30.91 ? 263 ILE A C     1 
ATOM   2059 O  O     . ILE A 1 287 ? 46.883 16.144 43.195  1.00 32.42 ? 263 ILE A O     1 
ATOM   2060 C  CB    . ILE A 1 287 ? 48.292 19.086 44.130  1.00 29.39 ? 263 ILE A CB    1 
ATOM   2061 C  CG1   . ILE A 1 287 ? 48.889 18.823 42.740  1.00 26.36 ? 263 ILE A CG1   1 
ATOM   2062 C  CG2   . ILE A 1 287 ? 49.315 19.717 45.065  1.00 30.59 ? 263 ILE A CG2   1 
ATOM   2063 C  CD1   . ILE A 1 287 ? 49.043 20.064 41.882  1.00 27.62 ? 263 ILE A CD1   1 
ATOM   2064 N  N     . ARG A 1 288 ? 45.472 17.803 43.777  1.00 31.15 ? 264 ARG A N     1 
ATOM   2065 C  CA    . ARG A 1 288 ? 44.441 17.394 42.839  1.00 35.21 ? 264 ARG A CA    1 
ATOM   2066 C  C     . ARG A 1 288 ? 44.859 17.850 41.445  1.00 35.42 ? 264 ARG A C     1 
ATOM   2067 O  O     . ARG A 1 288 ? 45.291 18.992 41.258  1.00 34.81 ? 264 ARG A O     1 
ATOM   2068 C  CB    . ARG A 1 288 ? 43.077 17.975 43.227  1.00 38.01 ? 264 ARG A CB    1 
ATOM   2069 C  CG    . ARG A 1 288 ? 41.914 17.436 42.406  1.00 48.02 ? 264 ARG A CG    1 
ATOM   2070 C  CD    . ARG A 1 288 ? 40.653 17.301 43.243  1.00 60.04 ? 264 ARG A CD    1 
ATOM   2071 N  NE    . ARG A 1 288 ? 40.719 16.148 44.142  1.00 78.70 ? 264 ARG A NE    1 
ATOM   2072 C  CZ    . ARG A 1 288 ? 39.777 15.817 45.021  1.00 79.20 ? 264 ARG A CZ    1 
ATOM   2073 N  NH1   . ARG A 1 288 ? 38.674 16.547 45.137  1.00 84.62 ? 264 ARG A NH1   1 
ATOM   2074 N  NH2   . ARG A 1 288 ? 39.937 14.750 45.788  1.00 76.17 ? 264 ARG A NH2   1 
ATOM   2075 N  N     . ILE A 1 289 ? 44.762 16.941 40.481  1.00 38.41 ? 265 ILE A N     1 
ATOM   2076 C  CA    . ILE A 1 289 ? 45.149 17.240 39.105  1.00 39.03 ? 265 ILE A CA    1 
ATOM   2077 C  C     . ILE A 1 289 ? 43.994 17.016 38.131  1.00 38.02 ? 265 ILE A C     1 
ATOM   2078 O  O     . ILE A 1 289 ? 43.113 16.184 38.375  1.00 38.97 ? 265 ILE A O     1 
ATOM   2079 C  CB    . ILE A 1 289 ? 46.399 16.435 38.666  1.00 38.06 ? 265 ILE A CB    1 
ATOM   2080 C  CG1   . ILE A 1 289 ? 46.162 14.927 38.822  1.00 39.12 ? 265 ILE A CG1   1 
ATOM   2081 C  CG2   . ILE A 1 289 ? 47.627 16.883 39.455  1.00 38.17 ? 265 ILE A CG2   1 
ATOM   2082 C  CD1   . ILE A 1 289 ? 47.168 14.067 38.093  1.00 37.14 ? 265 ILE A CD1   1 
ATOM   2083 N  N     . ARG A 1 290 ? 44.002 17.770 37.035  1.00 36.85 ? 266 ARG A N     1 
ATOM   2084 C  CA    . ARG A 1 290 ? 43.037 17.581 35.953  1.00 39.03 ? 266 ARG A CA    1 
ATOM   2085 C  C     . ARG A 1 290 ? 43.189 16.203 35.306  1.00 40.17 ? 266 ARG A C     1 
ATOM   2086 O  O     . ARG A 1 290 ? 42.211 15.467 35.161  1.00 41.63 ? 266 ARG A O     1 
ATOM   2087 C  CB    . ARG A 1 290 ? 43.190 18.677 34.894  1.00 44.20 ? 266 ARG A CB    1 
ATOM   2088 C  CG    . ARG A 1 290 ? 42.787 20.067 35.362  1.00 55.13 ? 266 ARG A CG    1 
ATOM   2089 C  CD    . ARG A 1 290 ? 43.019 21.101 34.273  1.00 66.07 ? 266 ARG A CD    1 
ATOM   2090 N  NE    . ARG A 1 290 ? 42.641 22.446 34.704  1.00 77.12 ? 266 ARG A NE    1 
ATOM   2091 C  CZ    . ARG A 1 290 ? 42.674 23.527 33.927  1.00 88.44 ? 266 ARG A CZ    1 
ATOM   2092 N  NH1   . ARG A 1 290 ? 43.071 23.438 32.663  1.00 86.14 ? 266 ARG A NH1   1 
ATOM   2093 N  NH2   . ARG A 1 290 ? 42.308 24.704 34.417  1.00 89.19 ? 266 ARG A NH2   1 
ATOM   2094 N  N     . GLU A 1 291 ? 44.425 15.861 34.940  1.00 37.89 ? 267 GLU A N     1 
ATOM   2095 C  CA    . GLU A 1 291 ? 44.733 14.635 34.205  1.00 37.72 ? 267 GLU A CA    1 
ATOM   2096 C  C     . GLU A 1 291 ? 46.249 14.449 34.165  1.00 35.09 ? 267 GLU A C     1 
ATOM   2097 O  O     . GLU A 1 291 ? 46.989 15.434 34.147  1.00 35.99 ? 267 GLU A O     1 
ATOM   2098 C  CB    . GLU A 1 291 ? 44.178 14.739 32.777  1.00 43.06 ? 267 GLU A CB    1 
ATOM   2099 C  CG    . GLU A 1 291 ? 44.432 13.541 31.872  1.00 46.89 ? 267 GLU A CG    1 
ATOM   2100 C  CD    . GLU A 1 291 ? 44.169 13.847 30.406  1.00 53.94 ? 267 GLU A CD    1 
ATOM   2101 O  OE1   . GLU A 1 291 ? 43.987 12.889 29.627  1.00 61.44 ? 267 GLU A OE1   1 
ATOM   2102 O  OE2   . GLU A 1 291 ? 44.146 15.040 30.028  1.00 54.09 ? 267 GLU A OE2   1 
ATOM   2103 N  N     . VAL A 1 292 ? 46.708 13.197 34.165  1.00 30.51 ? 268 VAL A N     1 
ATOM   2104 C  CA    . VAL A 1 292 ? 48.132 12.905 33.944  1.00 26.93 ? 268 VAL A CA    1 
ATOM   2105 C  C     . VAL A 1 292 ? 48.421 12.948 32.441  1.00 28.32 ? 268 VAL A C     1 
ATOM   2106 O  O     . VAL A 1 292 ? 48.150 11.987 31.718  1.00 32.90 ? 268 VAL A O     1 
ATOM   2107 C  CB    . VAL A 1 292 ? 48.563 11.535 34.526  1.00 29.13 ? 268 VAL A CB    1 
ATOM   2108 C  CG1   . VAL A 1 292 ? 50.060 11.334 34.342  1.00 29.11 ? 268 VAL A CG1   1 
ATOM   2109 C  CG2   . VAL A 1 292 ? 48.205 11.424 36.003  1.00 32.14 ? 268 VAL A CG2   1 
ATOM   2110 N  N     . VAL A 1 293 ? 48.967 14.074 31.984  1.00 25.28 ? 269 VAL A N     1 
ATOM   2111 C  CA    . VAL A 1 293 ? 49.277 14.299 30.569  1.00 23.43 ? 269 VAL A CA    1 
ATOM   2112 C  C     . VAL A 1 293 ? 50.618 13.642 30.214  1.00 22.96 ? 269 VAL A C     1 
ATOM   2113 O  O     . VAL A 1 293 ? 50.741 12.950 29.190  1.00 23.58 ? 269 VAL A O     1 
ATOM   2114 C  CB    . VAL A 1 293 ? 49.325 15.820 30.262  1.00 26.04 ? 269 VAL A CB    1 
ATOM   2115 C  CG1   . VAL A 1 293 ? 49.799 16.098 28.840  1.00 25.66 ? 269 VAL A CG1   1 
ATOM   2116 C  CG2   . VAL A 1 293 ? 47.966 16.461 30.498  1.00 27.33 ? 269 VAL A CG2   1 
ATOM   2117 N  N     . ASP A 1 294 ? 51.606 13.835 31.081  1.00 22.66 ? 270 ASP A N     1 
ATOM   2118 C  CA    . ASP A 1 294 ? 52.974 13.384 30.825  1.00 23.22 ? 270 ASP A CA    1 
ATOM   2119 C  C     . ASP A 1 294 ? 53.753 13.488 32.131  1.00 20.11 ? 270 ASP A C     1 
ATOM   2120 O  O     . ASP A 1 294 ? 53.987 14.588 32.632  1.00 21.33 ? 270 ASP A O     1 
ATOM   2121 C  CB    . ASP A 1 294 ? 53.589 14.245 29.711  1.00 21.90 ? 270 ASP A CB    1 
ATOM   2122 C  CG    . ASP A 1 294 ? 55.106 14.095 29.581  1.00 22.23 ? 270 ASP A CG    1 
ATOM   2123 O  OD1   . ASP A 1 294 ? 55.675 13.060 29.973  1.00 22.32 ? 270 ASP A OD1   1 
ATOM   2124 O  OD2   . ASP A 1 294 ? 55.725 15.054 29.069  1.00 26.61 ? 270 ASP A OD2   1 
ATOM   2125 N  N     . THR A 1 295 ? 54.141 12.343 32.687  1.00 18.83 ? 271 THR A N     1 
ATOM   2126 C  CA    . THR A 1 295 ? 54.846 12.324 33.965  1.00 18.60 ? 271 THR A CA    1 
ATOM   2127 C  C     . THR A 1 295 ? 56.296 12.810 33.895  1.00 18.19 ? 271 THR A C     1 
ATOM   2128 O  O     . THR A 1 295 ? 56.943 12.903 34.922  1.00 19.82 ? 271 THR A O     1 
ATOM   2129 C  CB    . THR A 1 295 ? 54.865 10.918 34.596  1.00 20.65 ? 271 THR A CB    1 
ATOM   2130 O  OG1   . THR A 1 295 ? 55.537 10.006 33.714  1.00 22.35 ? 271 THR A OG1   1 
ATOM   2131 C  CG2   . THR A 1 295 ? 53.459 10.427 34.883  1.00 24.08 ? 271 THR A CG2   1 
ATOM   2132 N  N     . THR A 1 296 ? 56.802 13.120 32.699  1.00 18.84 ? 272 THR A N     1 
ATOM   2133 C  CA    . THR A 1 296 ? 58.187 13.583 32.569  1.00 17.16 ? 272 THR A CA    1 
ATOM   2134 C  C     . THR A 1 296 ? 58.480 14.803 33.441  1.00 18.75 ? 272 THR A C     1 
ATOM   2135 O  O     . THR A 1 296 ? 57.797 15.823 33.337  1.00 20.63 ? 272 THR A O     1 
ATOM   2136 C  CB    . THR A 1 296 ? 58.548 13.920 31.106  1.00 17.30 ? 272 THR A CB    1 
ATOM   2137 O  OG1   . THR A 1 296 ? 58.201 12.825 30.253  1.00 21.06 ? 272 THR A OG1   1 
ATOM   2138 C  CG2   . THR A 1 296 ? 60.035 14.194 30.976  1.00 19.15 ? 272 THR A CG2   1 
ATOM   2139 N  N     . GLY A 1 297 ? 59.503 14.692 34.288  1.00 17.76 ? 273 GLY A N     1 
ATOM   2140 C  CA    . GLY A 1 297 ? 59.912 15.783 35.162  1.00 18.09 ? 273 GLY A CA    1 
ATOM   2141 C  C     . GLY A 1 297 ? 59.284 15.801 36.544  1.00 18.46 ? 273 GLY A C     1 
ATOM   2142 O  O     . GLY A 1 297 ? 59.632 16.661 37.356  1.00 17.42 ? 273 GLY A O     1 
ATOM   2143 N  N     . ALA A 1 298 ? 58.377 14.862 36.821  1.00 18.66 ? 274 ALA A N     1 
ATOM   2144 C  CA    . ALA A 1 298 ? 57.665 14.847 38.121  1.00 19.66 ? 274 ALA A CA    1 
ATOM   2145 C  C     . ALA A 1 298 ? 58.624 14.845 39.314  1.00 18.12 ? 274 ALA A C     1 
ATOM   2146 O  O     . ALA A 1 298 ? 58.535 15.712 40.185  1.00 18.59 ? 274 ALA A O     1 
ATOM   2147 C  CB    . ALA A 1 298 ? 56.720 13.665 38.210  1.00 21.14 ? 274 ALA A CB    1 
ATOM   2148 N  N     . GLY A 1 299 ? 59.553 13.892 39.341  1.00 17.45 ? 275 GLY A N     1 
ATOM   2149 C  CA    . GLY A 1 299 ? 60.540 13.831 40.413  1.00 18.78 ? 275 GLY A CA    1 
ATOM   2150 C  C     . GLY A 1 299 ? 61.478 15.029 40.427  1.00 17.44 ? 275 GLY A C     1 
ATOM   2151 O  O     . GLY A 1 299 ? 61.870 15.516 41.486  1.00 19.02 ? 275 GLY A O     1 
ATOM   2152 N  N     . ASP A 1 300 ? 61.844 15.507 39.238  1.00 17.37 ? 276 ASP A N     1 
ATOM   2153 C  CA    . ASP A 1 300 ? 62.744 16.650 39.109  1.00 17.75 ? 276 ASP A CA    1 
ATOM   2154 C  C     . ASP A 1 300 ? 62.155 17.878 39.772  1.00 17.18 ? 276 ASP A C     1 
ATOM   2155 O  O     . ASP A 1 300 ? 62.844 18.590 40.502  1.00 17.37 ? 276 ASP A O     1 
ATOM   2156 C  CB    . ASP A 1 300 ? 63.014 16.975 37.636  1.00 17.35 ? 276 ASP A CB    1 
ATOM   2157 C  CG    . ASP A 1 300 ? 63.531 15.791 36.857  1.00 17.85 ? 276 ASP A CG    1 
ATOM   2158 O  OD1   . ASP A 1 300 ? 64.073 14.856 37.484  1.00 19.00 ? 276 ASP A OD1   1 
ATOM   2159 O  OD2   . ASP A 1 300 ? 63.400 15.808 35.613  1.00 18.22 ? 276 ASP A OD2   1 
ATOM   2160 N  N     . LEU A 1 301 ? 60.866 18.095 39.520  1.00 16.80 ? 277 LEU A N     1 
ATOM   2161 C  CA    . LEU A 1 301 ? 60.163 19.272 40.018  1.00 17.74 ? 277 LEU A CA    1 
ATOM   2162 C  C     . LEU A 1 301 ? 59.761 19.125 41.488  1.00 17.74 ? 277 LEU A C     1 
ATOM   2163 O  O     . LEU A 1 301 ? 59.720 20.119 42.208  1.00 17.95 ? 277 LEU A O     1 
ATOM   2164 C  CB    . LEU A 1 301 ? 58.981 19.650 39.112  1.00 17.84 ? 277 LEU A CB    1 
ATOM   2165 C  CG    . LEU A 1 301 ? 59.331 20.588 37.941  1.00 17.18 ? 277 LEU A CG    1 
ATOM   2166 C  CD1   . LEU A 1 301 ? 59.748 21.967 38.437  1.00 18.44 ? 277 LEU A CD1   1 
ATOM   2167 C  CD2   . LEU A 1 301 ? 60.410 20.020 37.018  1.00 19.53 ? 277 LEU A CD2   1 
ATOM   2168 N  N     . PHE A 1 302 ? 59.507 17.894 41.937  1.00 16.87 ? 278 PHE A N     1 
ATOM   2169 C  CA    . PHE A 1 302 ? 59.399 17.651 43.378  1.00 16.65 ? 278 PHE A CA    1 
ATOM   2170 C  C     . PHE A 1 302 ? 60.652 18.159 44.093  1.00 19.14 ? 278 PHE A C     1 
ATOM   2171 O  O     . PHE A 1 302 ? 60.559 18.845 45.113  1.00 20.31 ? 278 PHE A O     1 
ATOM   2172 C  CB    . PHE A 1 302 ? 59.184 16.176 43.717  1.00 17.66 ? 278 PHE A CB    1 
ATOM   2173 C  CG    . PHE A 1 302 ? 59.072 15.927 45.200  1.00 19.07 ? 278 PHE A CG    1 
ATOM   2174 C  CD1   . PHE A 1 302 ? 57.835 16.030 45.831  1.00 20.61 ? 278 PHE A CD1   1 
ATOM   2175 C  CD2   . PHE A 1 302 ? 60.203 15.652 45.972  1.00 20.36 ? 278 PHE A CD2   1 
ATOM   2176 C  CE1   . PHE A 1 302 ? 57.730 15.846 47.204  1.00 22.26 ? 278 PHE A CE1   1 
ATOM   2177 C  CE2   . PHE A 1 302 ? 60.104 15.471 47.354  1.00 21.99 ? 278 PHE A CE2   1 
ATOM   2178 C  CZ    . PHE A 1 302 ? 58.861 15.555 47.961  1.00 22.76 ? 278 PHE A CZ    1 
ATOM   2179 N  N     . ALA A 1 303 ? 61.825 17.812 43.566  1.00 18.67 ? 279 ALA A N     1 
ATOM   2180 C  CA    . ALA A 1 303 ? 63.093 18.290 44.118  1.00 18.36 ? 279 ALA A CA    1 
ATOM   2181 C  C     . ALA A 1 303 ? 63.230 19.817 44.053  1.00 18.59 ? 279 ALA A C     1 
ATOM   2182 O  O     . ALA A 1 303 ? 63.718 20.427 44.993  1.00 21.22 ? 279 ALA A O     1 
ATOM   2183 C  CB    . ALA A 1 303 ? 64.273 17.598 43.442  1.00 19.77 ? 279 ALA A CB    1 
ATOM   2184 N  N     . SER A 1 304 ? 62.790 20.431 42.956  1.00 17.53 ? 280 SER A N     1 
ATOM   2185 C  CA    . SER A 1 304 ? 62.727 21.890 42.873  1.00 19.36 ? 280 SER A CA    1 
ATOM   2186 C  C     . SER A 1 304 ? 61.938 22.492 44.032  1.00 19.17 ? 280 SER A C     1 
ATOM   2187 O  O     . SER A 1 304 ? 62.428 23.376 44.737  1.00 19.75 ? 280 SER A O     1 
ATOM   2188 C  CB    . SER A 1 304 ? 62.063 22.315 41.573  1.00 18.70 ? 280 SER A CB    1 
ATOM   2189 O  OG    . SER A 1 304 ? 62.862 21.985 40.444  1.00 19.17 ? 280 SER A OG    1 
ATOM   2190 N  N     . GLY A 1 305 ? 60.705 22.019 44.212  1.00 19.09 ? 281 GLY A N     1 
ATOM   2191 C  CA    . GLY A 1 305 ? 59.831 22.571 45.259  1.00 22.02 ? 281 GLY A CA    1 
ATOM   2192 C  C     . GLY A 1 305 ? 60.433 22.345 46.636  1.00 22.27 ? 281 GLY A C     1 
ATOM   2193 O  O     . GLY A 1 305 ? 60.506 23.263 47.465  1.00 21.83 ? 281 GLY A O     1 
ATOM   2194 N  N     . PHE A 1 306 ? 60.903 21.122 46.871  1.00 20.58 ? 282 PHE A N     1 
ATOM   2195 C  CA    . PHE A 1 306 ? 61.517 20.778 48.153  1.00 20.06 ? 282 PHE A CA    1 
ATOM   2196 C  C     . PHE A 1 306 ? 62.750 21.629 48.478  1.00 21.05 ? 282 PHE A C     1 
ATOM   2197 O  O     . PHE A 1 306 ? 62.875 22.162 49.592  1.00 23.29 ? 282 PHE A O     1 
ATOM   2198 C  CB    . PHE A 1 306 ? 61.879 19.283 48.221  1.00 19.11 ? 282 PHE A CB    1 
ATOM   2199 C  CG    . PHE A 1 306 ? 62.277 18.829 49.606  1.00 20.86 ? 282 PHE A CG    1 
ATOM   2200 C  CD1   . PHE A 1 306 ? 63.547 19.120 50.109  1.00 21.99 ? 282 PHE A CD1   1 
ATOM   2201 C  CD2   . PHE A 1 306 ? 61.380 18.134 50.423  1.00 22.53 ? 282 PHE A CD2   1 
ATOM   2202 C  CE1   . PHE A 1 306 ? 63.919 18.737 51.391  1.00 24.12 ? 282 PHE A CE1   1 
ATOM   2203 C  CE2   . PHE A 1 306 ? 61.750 17.753 51.711  1.00 24.62 ? 282 PHE A CE2   1 
ATOM   2204 C  CZ    . PHE A 1 306 ? 63.021 18.047 52.188  1.00 25.58 ? 282 PHE A CZ    1 
ATOM   2205 N  N     . LEU A 1 307 ? 63.670 21.748 47.521  1.00 21.61 ? 283 LEU A N     1 
ATOM   2206 C  CA    . LEU A 1 307 ? 64.930 22.441 47.767  1.00 20.57 ? 283 LEU A CA    1 
ATOM   2207 C  C     . LEU A 1 307 ? 64.755 23.950 47.842  1.00 21.52 ? 283 LEU A C     1 
ATOM   2208 O  O     . LEU A 1 307 ? 65.531 24.623 48.519  1.00 22.58 ? 283 LEU A O     1 
ATOM   2209 C  CB    . LEU A 1 307 ? 65.984 22.069 46.719  1.00 20.00 ? 283 LEU A CB    1 
ATOM   2210 C  CG    . LEU A 1 307 ? 66.484 20.621 46.777  1.00 21.36 ? 283 LEU A CG    1 
ATOM   2211 C  CD1   . LEU A 1 307 ? 67.360 20.320 45.570  1.00 25.80 ? 283 LEU A CD1   1 
ATOM   2212 C  CD2   . LEU A 1 307 ? 67.232 20.343 48.080  1.00 26.71 ? 283 LEU A CD2   1 
ATOM   2213 N  N     . TYR A 1 308 ? 63.750 24.465 47.129  1.00 21.53 ? 284 TYR A N     1 
ATOM   2214 C  CA    . TYR A 1 308 ? 63.367 25.867 47.237  1.00 23.28 ? 284 TYR A CA    1 
ATOM   2215 C  C     . TYR A 1 308 ? 62.912 26.125 48.661  1.00 24.90 ? 284 TYR A C     1 
ATOM   2216 O  O     . TYR A 1 308 ? 63.439 27.008 49.338  1.00 25.68 ? 284 TYR A O     1 
ATOM   2217 C  CB    . TYR A 1 308 ? 62.244 26.224 46.258  1.00 22.22 ? 284 TYR A CB    1 
ATOM   2218 C  CG    . TYR A 1 308 ? 61.608 27.570 46.532  1.00 23.59 ? 284 TYR A CG    1 
ATOM   2219 C  CD1   . TYR A 1 308 ? 62.237 28.754 46.139  1.00 23.46 ? 284 TYR A CD1   1 
ATOM   2220 C  CD2   . TYR A 1 308 ? 60.376 27.660 47.182  1.00 26.64 ? 284 TYR A CD2   1 
ATOM   2221 C  CE1   . TYR A 1 308 ? 61.657 29.988 46.389  1.00 26.80 ? 284 TYR A CE1   1 
ATOM   2222 C  CE2   . TYR A 1 308 ? 59.794 28.893 47.445  1.00 30.32 ? 284 TYR A CE2   1 
ATOM   2223 C  CZ    . TYR A 1 308 ? 60.435 30.049 47.041  1.00 29.18 ? 284 TYR A CZ    1 
ATOM   2224 O  OH    . TYR A 1 308 ? 59.856 31.269 47.293  1.00 34.83 ? 284 TYR A OH    1 
ATOM   2225 N  N     . GLY A 1 309 ? 61.929 25.344 49.103  1.00 24.43 ? 285 GLY A N     1 
ATOM   2226 C  CA    . GLY A 1 309 ? 61.441 25.443 50.469  1.00 25.16 ? 285 GLY A CA    1 
ATOM   2227 C  C     . GLY A 1 309 ? 62.585 25.355 51.458  1.00 26.09 ? 285 GLY A C     1 
ATOM   2228 O  O     . GLY A 1 309 ? 62.698 26.188 52.363  1.00 28.83 ? 285 GLY A O     1 
ATOM   2229 N  N     . TYR A 1 310 ? 63.456 24.363 51.262  1.00 22.61 ? 286 TYR A N     1 
ATOM   2230 C  CA    . TYR A 1 310 ? 64.544 24.069 52.207  1.00 25.67 ? 286 TYR A CA    1 
ATOM   2231 C  C     . TYR A 1 310 ? 65.516 25.232 52.377  1.00 25.05 ? 286 TYR A C     1 
ATOM   2232 O  O     . TYR A 1 310 ? 65.878 25.598 53.503  1.00 26.71 ? 286 TYR A O     1 
ATOM   2233 C  CB    . TYR A 1 310 ? 65.291 22.810 51.763  1.00 25.54 ? 286 TYR A CB    1 
ATOM   2234 C  CG    . TYR A 1 310 ? 66.268 22.265 52.777  1.00 22.97 ? 286 TYR A CG    1 
ATOM   2235 C  CD1   . TYR A 1 310 ? 65.823 21.501 53.854  1.00 24.76 ? 286 TYR A CD1   1 
ATOM   2236 C  CD2   . TYR A 1 310 ? 67.636 22.499 52.658  1.00 21.50 ? 286 TYR A CD2   1 
ATOM   2237 C  CE1   . TYR A 1 310 ? 66.708 20.989 54.785  1.00 27.68 ? 286 TYR A CE1   1 
ATOM   2238 C  CE2   . TYR A 1 310 ? 68.532 21.984 53.583  1.00 26.13 ? 286 TYR A CE2   1 
ATOM   2239 C  CZ    . TYR A 1 310 ? 68.060 21.232 54.648  1.00 27.46 ? 286 TYR A CZ    1 
ATOM   2240 O  OH    . TYR A 1 310 ? 68.924 20.714 55.586  1.00 31.95 ? 286 TYR A OH    1 
ATOM   2241 N  N     . THR A 1 311 ? 65.919 25.813 51.251  1.00 26.00 ? 287 THR A N     1 
ATOM   2242 C  CA    . THR A 1 311 ? 66.818 26.957 51.240  1.00 26.67 ? 287 THR A CA    1 
ATOM   2243 C  C     . THR A 1 311 ? 66.128 28.275 51.635  1.00 27.16 ? 287 THR A C     1 
ATOM   2244 O  O     . THR A 1 311 ? 66.796 29.291 51.813  1.00 31.45 ? 287 THR A O     1 
ATOM   2245 C  CB    . THR A 1 311 ? 67.503 27.102 49.868  1.00 26.03 ? 287 THR A CB    1 
ATOM   2246 O  OG1   . THR A 1 311 ? 66.511 27.146 48.836  1.00 26.79 ? 287 THR A OG1   1 
ATOM   2247 C  CG2   . THR A 1 311 ? 68.454 25.923 49.621  1.00 23.15 ? 287 THR A CG2   1 
ATOM   2248 N  N     . GLN A 1 312 ? 64.803 28.249 51.772  1.00 26.14 ? 288 GLN A N     1 
ATOM   2249 C  CA    . GLN A 1 312 ? 64.048 29.399 52.282  1.00 30.38 ? 288 GLN A CA    1 
ATOM   2250 C  C     . GLN A 1 312 ? 63.771 29.251 53.782  1.00 34.29 ? 288 GLN A C     1 
ATOM   2251 O  O     . GLN A 1 312 ? 63.082 30.083 54.377  1.00 38.11 ? 288 GLN A O     1 
ATOM   2252 C  CB    . GLN A 1 312 ? 62.729 29.588 51.512  1.00 30.40 ? 288 GLN A CB    1 
ATOM   2253 C  CG    . GLN A 1 312 ? 62.868 29.989 50.048  1.00 33.86 ? 288 GLN A CG    1 
ATOM   2254 C  CD    . GLN A 1 312 ? 63.588 31.311 49.838  1.00 34.94 ? 288 GLN A CD    1 
ATOM   2255 O  OE1   . GLN A 1 312 ? 64.564 31.382 49.091  1.00 42.69 ? 288 GLN A OE1   1 
ATOM   2256 N  NE2   . GLN A 1 312 ? 63.111 32.362 50.490  1.00 37.92 ? 288 GLN A NE2   1 
ATOM   2257 N  N     . GLY A 1 313 ? 64.306 28.190 54.383  1.00 31.32 ? 289 GLY A N     1 
ATOM   2258 C  CA    . GLY A 1 313 ? 64.155 27.943 55.823  1.00 31.03 ? 289 GLY A CA    1 
ATOM   2259 C  C     . GLY A 1 313 ? 62.806 27.383 56.246  1.00 29.44 ? 289 GLY A C     1 
ATOM   2260 O  O     . GLY A 1 313 ? 62.444 27.439 57.427  1.00 31.88 ? 289 GLY A O     1 
ATOM   2261 N  N     . ARG A 1 314 ? 62.065 26.830 55.291  1.00 29.36 ? 290 ARG A N     1 
ATOM   2262 C  CA    . ARG A 1 314 ? 60.734 26.275 55.556  1.00 27.48 ? 290 ARG A CA    1 
ATOM   2263 C  C     . ARG A 1 314 ? 60.806 24.938 56.296  1.00 28.87 ? 290 ARG A C     1 
ATOM   2264 O  O     . ARG A 1 314 ? 61.830 24.258 56.260  1.00 27.05 ? 290 ARG A O     1 
ATOM   2265 C  CB    . ARG A 1 314 ? 59.947 26.121 54.248  1.00 27.58 ? 290 ARG A CB    1 
ATOM   2266 C  CG    . ARG A 1 314 ? 59.771 27.413 53.449  1.00 26.75 ? 290 ARG A CG    1 
ATOM   2267 C  CD    . ARG A 1 314 ? 58.924 28.443 54.194  1.00 28.56 ? 290 ARG A CD    1 
ATOM   2268 N  NE    . ARG A 1 314 ? 57.563 27.961 54.434  1.00 28.62 ? 290 ARG A NE    1 
ATOM   2269 C  CZ    . ARG A 1 314 ? 56.547 28.114 53.590  1.00 31.91 ? 290 ARG A CZ    1 
ATOM   2270 N  NH1   . ARG A 1 314 ? 55.350 27.630 53.898  1.00 33.57 ? 290 ARG A NH1   1 
ATOM   2271 N  NH2   . ARG A 1 314 ? 56.721 28.754 52.441  1.00 36.76 ? 290 ARG A NH2   1 
ATOM   2272 N  N     . SER A 1 315 ? 59.719 24.572 56.974  1.00 29.11 ? 291 SER A N     1 
ATOM   2273 C  CA    . SER A 1 315 ? 59.617 23.268 57.631  1.00 28.04 ? 291 SER A CA    1 
ATOM   2274 C  C     . SER A 1 315 ? 59.725 22.134 56.608  1.00 28.95 ? 291 SER A C     1 
ATOM   2275 O  O     . SER A 1 315 ? 59.391 22.314 55.433  1.00 27.83 ? 291 SER A O     1 
ATOM   2276 C  CB    . SER A 1 315 ? 58.295 23.146 58.393  1.00 29.53 ? 291 SER A CB    1 
ATOM   2277 O  OG    . SER A 1 315 ? 57.198 22.997 57.503  1.00 29.20 ? 291 SER A OG    1 
ATOM   2278 N  N     . LEU A 1 316 ? 60.174 20.963 57.057  1.00 30.12 ? 292 LEU A N     1 
ATOM   2279 C  CA    . LEU A 1 316 ? 60.277 19.805 56.168  1.00 28.81 ? 292 LEU A CA    1 
ATOM   2280 C  C     . LEU A 1 316 ? 58.931 19.446 55.535  1.00 27.81 ? 292 LEU A C     1 
ATOM   2281 O  O     . LEU A 1 316 ? 58.871 19.075 54.353  1.00 26.64 ? 292 LEU A O     1 
ATOM   2282 C  CB    . LEU A 1 316 ? 60.882 18.600 56.897  1.00 28.20 ? 292 LEU A CB    1 
ATOM   2283 C  CG    . LEU A 1 316 ? 62.363 18.702 57.283  1.00 29.35 ? 292 LEU A CG    1 
ATOM   2284 C  CD1   . LEU A 1 316 ? 62.812 17.418 57.958  1.00 32.78 ? 292 LEU A CD1   1 
ATOM   2285 C  CD2   . LEU A 1 316 ? 63.241 18.996 56.074  1.00 31.73 ? 292 LEU A CD2   1 
ATOM   2286 N  N     . GLU A 1 317 ? 57.852 19.579 56.306  1.00 26.14 ? 293 GLU A N     1 
ATOM   2287 C  CA    . GLU A 1 317 ? 56.515 19.329 55.776  1.00 25.68 ? 293 GLU A CA    1 
ATOM   2288 C  C     . GLU A 1 317 ? 56.176 20.309 54.649  1.00 26.29 ? 293 GLU A C     1 
ATOM   2289 O  O     . GLU A 1 317 ? 55.702 19.894 53.587  1.00 28.36 ? 293 GLU A O     1 
ATOM   2290 C  CB    . GLU A 1 317 ? 55.453 19.385 56.880  1.00 28.01 ? 293 GLU A CB    1 
ATOM   2291 C  CG    . GLU A 1 317 ? 54.086 18.901 56.420  1.00 31.06 ? 293 GLU A CG    1 
ATOM   2292 C  CD    . GLU A 1 317 ? 52.967 19.238 57.382  1.00 39.66 ? 293 GLU A CD    1 
ATOM   2293 O  OE1   . GLU A 1 317 ? 51.869 18.662 57.231  1.00 42.43 ? 293 GLU A OE1   1 
ATOM   2294 O  OE2   . GLU A 1 317 ? 53.177 20.077 58.282  1.00 47.19 ? 293 GLU A OE2   1 
ATOM   2295 N  N     . ASP A 1 318 ? 56.436 21.598 54.882  1.00 25.17 ? 294 ASP A N     1 
ATOM   2296 C  CA    . ASP A 1 318 ? 56.229 22.638 53.870  1.00 26.44 ? 294 ASP A CA    1 
ATOM   2297 C  C     . ASP A 1 318 ? 57.119 22.474 52.632  1.00 25.84 ? 294 ASP A C     1 
ATOM   2298 O  O     . ASP A 1 318 ? 56.713 22.841 51.534  1.00 26.59 ? 294 ASP A O     1 
ATOM   2299 C  CB    . ASP A 1 318 ? 56.368 24.042 54.474  1.00 26.16 ? 294 ASP A CB    1 
ATOM   2300 C  CG    . ASP A 1 318 ? 55.122 24.473 55.231  1.00 29.00 ? 294 ASP A CG    1 
ATOM   2301 O  OD1   . ASP A 1 318 ? 54.085 23.787 55.104  1.00 31.68 ? 294 ASP A OD1   1 
ATOM   2302 O  OD2   . ASP A 1 318 ? 55.177 25.491 55.957  1.00 30.02 ? 294 ASP A OD2   1 
ATOM   2303 N  N     . CYS A 1 319 ? 58.321 21.930 52.812  1.00 24.43 ? 295 CYS A N     1 
ATOM   2304 C  CA    . CYS A 1 319 ? 59.177 21.595 51.671  1.00 24.79 ? 295 CYS A CA    1 
ATOM   2305 C  C     . CYS A 1 319 ? 58.499 20.504 50.849  1.00 24.58 ? 295 CYS A C     1 
ATOM   2306 O  O     . CYS A 1 319 ? 58.429 20.606 49.628  1.00 24.52 ? 295 CYS A O     1 
ATOM   2307 C  CB    . CYS A 1 319 ? 60.573 21.165 52.130  1.00 26.84 ? 295 CYS A CB    1 
ATOM   2308 S  SG    . CYS A 1 319 ? 61.496 22.465 52.982  1.00 26.03 ? 295 CYS A SG    1 
ATOM   2309 N  N     . GLY A 1 320 ? 57.980 19.479 51.531  1.00 25.01 ? 296 GLY A N     1 
ATOM   2310 C  CA    . GLY A 1 320 ? 57.187 18.421 50.893  1.00 24.65 ? 296 GLY A CA    1 
ATOM   2311 C  C     . GLY A 1 320 ? 55.983 18.936 50.118  1.00 24.80 ? 296 GLY A C     1 
ATOM   2312 O  O     . GLY A 1 320 ? 55.720 18.498 48.993  1.00 25.51 ? 296 GLY A O     1 
ATOM   2313 N  N     . LYS A 1 321 ? 55.252 19.874 50.720  1.00 23.30 ? 297 LYS A N     1 
ATOM   2314 C  CA    . LYS A 1 321 ? 54.088 20.485 50.075  1.00 26.04 ? 297 LYS A CA    1 
ATOM   2315 C  C     . LYS A 1 321 ? 54.479 21.257 48.809  1.00 24.98 ? 297 LYS A C     1 
ATOM   2316 O  O     . LYS A 1 321 ? 53.807 21.153 47.776  1.00 23.29 ? 297 LYS A O     1 
ATOM   2317 C  CB    . LYS A 1 321 ? 53.322 21.384 51.060  1.00 26.48 ? 297 LYS A CB    1 
ATOM   2318 C  CG    . LYS A 1 321 ? 52.562 20.615 52.136  1.00 27.04 ? 297 LYS A CG    1 
ATOM   2319 C  CD    . LYS A 1 321 ? 51.821 21.543 53.086  1.00 26.67 ? 297 LYS A CD    1 
ATOM   2320 C  CE    . LYS A 1 321 ? 51.055 20.729 54.107  1.00 19.18 ? 297 LYS A CE    1 
ATOM   2321 N  NZ    . LYS A 1 321 ? 50.223 21.558 55.012  1.00 22.71 ? 297 LYS A NZ    1 
ATOM   2322 N  N     . LEU A 1 322 ? 55.571 22.015 48.890  1.00 24.34 ? 298 LEU A N     1 
ATOM   2323 C  CA    . LEU A 1 322 ? 56.069 22.759 47.733  1.00 24.52 ? 298 LEU A CA    1 
ATOM   2324 C  C     . LEU A 1 322 ? 56.500 21.810 46.625  1.00 22.80 ? 298 LEU A C     1 
ATOM   2325 O  O     . LEU A 1 322 ? 56.220 22.059 45.444  1.00 22.02 ? 298 LEU A O     1 
ATOM   2326 C  CB    . LEU A 1 322 ? 57.210 23.691 48.126  1.00 22.73 ? 298 LEU A CB    1 
ATOM   2327 C  CG    . LEU A 1 322 ? 56.762 24.958 48.862  1.00 23.18 ? 298 LEU A CG    1 
ATOM   2328 C  CD1   . LEU A 1 322 ? 57.915 25.551 49.656  1.00 27.00 ? 298 LEU A CD1   1 
ATOM   2329 C  CD2   . LEU A 1 322 ? 56.188 25.960 47.871  1.00 24.61 ? 298 LEU A CD2   1 
ATOM   2330 N  N     . GLY A 1 323 ? 57.145 20.709 47.015  1.00 20.96 ? 299 GLY A N     1 
ATOM   2331 C  CA    . GLY A 1 323 ? 57.517 19.660 46.059  1.00 21.85 ? 299 GLY A CA    1 
ATOM   2332 C  C     . GLY A 1 323 ? 56.322 19.022 45.367  1.00 21.99 ? 299 GLY A C     1 
ATOM   2333 O  O     . GLY A 1 323 ? 56.294 18.896 44.130  1.00 20.74 ? 299 GLY A O     1 
ATOM   2334 N  N     . CYS A 1 324 ? 55.317 18.625 46.149  1.00 22.43 ? 300 CYS A N     1 
ATOM   2335 C  CA    . CYS A 1 324 ? 54.098 18.058 45.572  1.00 23.34 ? 300 CYS A CA    1 
ATOM   2336 C  C     . CYS A 1 324 ? 53.357 19.024 44.638  1.00 22.05 ? 300 CYS A C     1 
ATOM   2337 O  O     . CYS A 1 324 ? 52.806 18.598 43.616  1.00 22.97 ? 300 CYS A O     1 
ATOM   2338 C  CB    . CYS A 1 324 ? 53.166 17.511 46.656  1.00 26.19 ? 300 CYS A CB    1 
ATOM   2339 S  SG    . CYS A 1 324 ? 53.799 16.020 47.452  1.00 28.90 ? 300 CYS A SG    1 
ATOM   2340 N  N     . LEU A 1 325 ? 53.360 20.315 44.982  1.00 21.16 ? 301 LEU A N     1 
ATOM   2341 C  CA    . LEU A 1 325 ? 52.791 21.348 44.112  1.00 23.11 ? 301 LEU A CA    1 
ATOM   2342 C  C     . LEU A 1 325 ? 53.506 21.397 42.756  1.00 23.15 ? 301 LEU A C     1 
ATOM   2343 O  O     . LEU A 1 325 ? 52.857 21.253 41.722  1.00 22.35 ? 301 LEU A O     1 
ATOM   2344 C  CB    . LEU A 1 325 ? 52.786 22.734 44.786  1.00 23.58 ? 301 LEU A CB    1 
ATOM   2345 C  CG    . LEU A 1 325 ? 52.246 23.870 43.907  1.00 24.78 ? 301 LEU A CG    1 
ATOM   2346 C  CD1   . LEU A 1 325 ? 50.798 23.615 43.510  1.00 27.70 ? 301 LEU A CD1   1 
ATOM   2347 C  CD2   . LEU A 1 325 ? 52.385 25.216 44.601  1.00 29.05 ? 301 LEU A CD2   1 
ATOM   2348 N  N     . ALA A 1 326 ? 54.830 21.570 42.777  1.00 20.97 ? 302 ALA A N     1 
ATOM   2349 C  CA    . ALA A 1 326 ? 55.612 21.671 41.538  1.00 20.86 ? 302 ALA A CA    1 
ATOM   2350 C  C     . ALA A 1 326 ? 55.479 20.413 40.679  1.00 20.28 ? 302 ALA A C     1 
ATOM   2351 O  O     . ALA A 1 326 ? 55.284 20.495 39.457  1.00 20.15 ? 302 ALA A O     1 
ATOM   2352 C  CB    . ALA A 1 326 ? 57.067 21.975 41.840  1.00 19.96 ? 302 ALA A CB    1 
ATOM   2353 N  N     . ALA A 1 327 ? 55.553 19.253 41.323  1.00 19.81 ? 303 ALA A N     1 
ATOM   2354 C  CA    . ALA A 1 327 ? 55.416 17.976 40.627  1.00 21.24 ? 303 ALA A CA    1 
ATOM   2355 C  C     . ALA A 1 327 ? 54.044 17.834 39.978  1.00 21.85 ? 303 ALA A C     1 
ATOM   2356 O  O     . ALA A 1 327 ? 53.935 17.419 38.818  1.00 22.13 ? 303 ALA A O     1 
ATOM   2357 C  CB    . ALA A 1 327 ? 55.674 16.819 41.576  1.00 22.53 ? 303 ALA A CB    1 
ATOM   2358 N  N     . GLY A 1 328 ? 52.998 18.152 40.739  1.00 21.70 ? 304 GLY A N     1 
ATOM   2359 C  CA    . GLY A 1 328 ? 51.625 18.079 40.248  1.00 24.21 ? 304 GLY A CA    1 
ATOM   2360 C  C     . GLY A 1 328 ? 51.368 18.995 39.060  1.00 21.23 ? 304 GLY A C     1 
ATOM   2361 O  O     . GLY A 1 328 ? 50.593 18.652 38.169  1.00 21.37 ? 304 GLY A O     1 
ATOM   2362 N  N     . ILE A 1 329 ? 52.015 20.159 39.050  1.00 19.89 ? 305 ILE A N     1 
ATOM   2363 C  CA    . ILE A 1 329 ? 51.891 21.080 37.925  1.00 21.38 ? 305 ILE A CA    1 
ATOM   2364 C  C     . ILE A 1 329 ? 52.555 20.510 36.671  1.00 21.31 ? 305 ILE A C     1 
ATOM   2365 O  O     . ILE A 1 329 ? 51.940 20.503 35.595  1.00 22.51 ? 305 ILE A O     1 
ATOM   2366 C  CB    . ILE A 1 329 ? 52.420 22.489 38.270  1.00 23.58 ? 305 ILE A CB    1 
ATOM   2367 C  CG1   . ILE A 1 329 ? 51.487 23.135 39.296  1.00 23.98 ? 305 ILE A CG1   1 
ATOM   2368 C  CG2   . ILE A 1 329 ? 52.510 23.370 37.025  1.00 25.85 ? 305 ILE A CG2   1 
ATOM   2369 C  CD1   . ILE A 1 329 ? 52.083 24.332 39.997  1.00 25.73 ? 305 ILE A CD1   1 
ATOM   2370 N  N     . VAL A 1 330 ? 53.786 20.008 36.815  1.00 20.41 ? 306 VAL A N     1 
ATOM   2371 C  CA    . VAL A 1 330 ? 54.532 19.560 35.632  1.00 19.61 ? 306 VAL A CA    1 
ATOM   2372 C  C     . VAL A 1 330 ? 53.902 18.371 34.900  1.00 20.58 ? 306 VAL A C     1 
ATOM   2373 O  O     . VAL A 1 330 ? 54.021 18.264 33.672  1.00 21.50 ? 306 VAL A O     1 
ATOM   2374 C  CB    . VAL A 1 330 ? 56.046 19.361 35.901  1.00 17.85 ? 306 VAL A CB    1 
ATOM   2375 C  CG1   . VAL A 1 330 ? 56.331 18.003 36.534  1.00 19.45 ? 306 VAL A CG1   1 
ATOM   2376 C  CG2   . VAL A 1 330 ? 56.816 19.545 34.597  1.00 19.17 ? 306 VAL A CG2   1 
ATOM   2377 N  N     . ILE A 1 331 ? 53.238 17.476 35.631  1.00 22.08 ? 307 ILE A N     1 
ATOM   2378 C  CA    . ILE A 1 331 ? 52.651 16.287 35.011  1.00 22.33 ? 307 ILE A CA    1 
ATOM   2379 C  C     . ILE A 1 331 ? 51.371 16.591 34.223  1.00 21.67 ? 307 ILE A C     1 
ATOM   2380 O  O     . ILE A 1 331 ? 50.869 15.734 33.495  1.00 22.35 ? 307 ILE A O     1 
ATOM   2381 C  CB    . ILE A 1 331 ? 52.434 15.123 36.011  1.00 23.02 ? 307 ILE A CB    1 
ATOM   2382 C  CG1   . ILE A 1 331 ? 51.349 15.453 37.047  1.00 23.72 ? 307 ILE A CG1   1 
ATOM   2383 C  CG2   . ILE A 1 331 ? 53.743 14.745 36.680  1.00 24.01 ? 307 ILE A CG2   1 
ATOM   2384 C  CD1   . ILE A 1 331 ? 50.965 14.259 37.911  1.00 26.99 ? 307 ILE A CD1   1 
ATOM   2385 N  N     . GLN A 1 332 ? 50.865 17.820 34.349  1.00 21.14 ? 308 GLN A N     1 
ATOM   2386 C  CA    . GLN A 1 332 ? 49.656 18.225 33.641  1.00 22.43 ? 308 GLN A CA    1 
ATOM   2387 C  C     . GLN A 1 332 ? 49.956 18.926 32.319  1.00 23.40 ? 308 GLN A C     1 
ATOM   2388 O  O     . GLN A 1 332 ? 49.058 19.480 31.695  1.00 27.49 ? 308 GLN A O     1 
ATOM   2389 C  CB    . GLN A 1 332 ? 48.780 19.100 34.539  1.00 26.28 ? 308 GLN A CB    1 
ATOM   2390 C  CG    . GLN A 1 332 ? 48.284 18.365 35.770  1.00 27.31 ? 308 GLN A CG    1 
ATOM   2391 C  CD    . GLN A 1 332 ? 47.407 19.236 36.642  1.00 27.07 ? 308 GLN A CD    1 
ATOM   2392 O  OE1   . GLN A 1 332 ? 46.221 19.421 36.364  1.00 33.68 ? 308 GLN A OE1   1 
ATOM   2393 N  NE2   . GLN A 1 332 ? 47.988 19.781 37.702  1.00 27.12 ? 308 GLN A NE2   1 
ATOM   2394 N  N     . GLN A 1 333 ? 51.220 18.877 31.893  1.00 22.55 ? 309 GLN A N     1 
ATOM   2395 C  CA    . GLN A 1 333 ? 51.635 19.481 30.622  1.00 21.96 ? 309 GLN A CA    1 
ATOM   2396 C  C     . GLN A 1 333 ? 52.584 18.528 29.898  1.00 24.71 ? 309 GLN A C     1 
ATOM   2397 O  O     . GLN A 1 333 ? 53.171 17.645 30.522  1.00 23.33 ? 309 GLN A O     1 
ATOM   2398 C  CB    . GLN A 1 333 ? 52.342 20.827 30.862  1.00 22.77 ? 309 GLN A CB    1 
ATOM   2399 C  CG    . GLN A 1 333 ? 53.554 20.768 31.787  1.00 25.99 ? 309 GLN A CG    1 
ATOM   2400 C  CD    . GLN A 1 333 ? 54.516 21.923 31.601  1.00 24.29 ? 309 GLN A CD    1 
ATOM   2401 O  OE1   . GLN A 1 333 ? 54.146 23.086 31.762  1.00 25.63 ? 309 GLN A OE1   1 
ATOM   2402 N  NE2   . GLN A 1 333 ? 55.773 21.607 31.277  1.00 24.96 ? 309 GLN A NE2   1 
ATOM   2403 N  N     . ILE A 1 334 ? 52.721 18.694 28.586  1.00 26.53 ? 310 ILE A N     1 
ATOM   2404 C  CA    . ILE A 1 334 ? 53.767 17.994 27.839  1.00 25.23 ? 310 ILE A CA    1 
ATOM   2405 C  C     . ILE A 1 334 ? 55.084 18.725 28.076  1.00 25.54 ? 310 ILE A C     1 
ATOM   2406 O  O     . ILE A 1 334 ? 55.137 19.954 28.017  1.00 27.12 ? 310 ILE A O     1 
ATOM   2407 C  CB    . ILE A 1 334 ? 53.458 17.944 26.328  1.00 28.75 ? 310 ILE A CB    1 
ATOM   2408 C  CG1   . ILE A 1 334 ? 52.116 17.255 26.090  1.00 29.27 ? 310 ILE A CG1   1 
ATOM   2409 C  CG2   . ILE A 1 334 ? 54.569 17.224 25.563  1.00 32.62 ? 310 ILE A CG2   1 
ATOM   2410 C  CD1   . ILE A 1 334 ? 51.517 17.552 24.732  1.00 30.55 ? 310 ILE A CD1   1 
ATOM   2411 N  N     . GLY A 1 335 ? 56.138 17.968 28.365  1.00 26.36 ? 311 GLY A N     1 
ATOM   2412 C  CA    . GLY A 1 335 ? 57.470 18.547 28.539  1.00 25.20 ? 311 GLY A CA    1 
ATOM   2413 C  C     . GLY A 1 335 ? 57.895 18.696 29.987  1.00 23.75 ? 311 GLY A C     1 
ATOM   2414 O  O     . GLY A 1 335 ? 57.054 18.817 30.877  1.00 25.06 ? 311 GLY A O     1 
ATOM   2415 N  N     . PRO A 1 336 ? 59.208 18.689 30.232  1.00 21.88 ? 312 PRO A N     1 
ATOM   2416 C  CA    . PRO A 1 336 ? 59.743 18.491 31.567  1.00 18.36 ? 312 PRO A CA    1 
ATOM   2417 C  C     . PRO A 1 336 ? 59.864 19.726 32.457  1.00 17.78 ? 312 PRO A C     1 
ATOM   2418 O  O     . PRO A 1 336 ? 60.181 19.587 33.638  1.00 20.58 ? 312 PRO A O     1 
ATOM   2419 C  CB    . PRO A 1 336 ? 61.142 17.943 31.282  1.00 20.92 ? 312 PRO A CB    1 
ATOM   2420 C  CG    . PRO A 1 336 ? 61.532 18.642 30.024  1.00 23.60 ? 312 PRO A CG    1 
ATOM   2421 C  CD    . PRO A 1 336 ? 60.272 18.706 29.209  1.00 24.73 ? 312 PRO A CD    1 
ATOM   2422 N  N     . ARG A 1 337 ? 59.666 20.915 31.900  1.00 19.22 ? 313 ARG A N     1 
ATOM   2423 C  CA    . ARG A 1 337 ? 59.839 22.154 32.657  1.00 19.70 ? 313 ARG A CA    1 
ATOM   2424 C  C     . ARG A 1 337 ? 58.557 22.965 32.603  1.00 21.69 ? 313 ARG A C     1 
ATOM   2425 O  O     . ARG A 1 337 ? 58.074 23.273 31.517  1.00 23.40 ? 313 ARG A O     1 
ATOM   2426 C  CB    . ARG A 1 337 ? 61.021 22.963 32.116  1.00 19.81 ? 313 ARG A CB    1 
ATOM   2427 C  CG    . ARG A 1 337 ? 62.356 22.255 32.263  1.00 18.66 ? 313 ARG A CG    1 
ATOM   2428 C  CD    . ARG A 1 337 ? 63.524 23.099 31.794  1.00 18.40 ? 313 ARG A CD    1 
ATOM   2429 N  NE    . ARG A 1 337 ? 64.756 22.310 31.717  1.00 17.48 ? 313 ARG A NE    1 
ATOM   2430 C  CZ    . ARG A 1 337 ? 65.925 22.780 31.275  1.00 18.47 ? 313 ARG A CZ    1 
ATOM   2431 N  NH1   . ARG A 1 337 ? 66.036 24.042 30.861  1.00 18.70 ? 313 ARG A NH1   1 
ATOM   2432 N  NH2   . ARG A 1 337 ? 66.982 21.987 31.229  1.00 19.13 ? 313 ARG A NH2   1 
ATOM   2433 N  N     . PRO A 1 338 ? 57.991 23.304 33.776  1.00 20.38 ? 314 PRO A N     1 
ATOM   2434 C  CA    . PRO A 1 338 ? 56.703 24.007 33.797  1.00 20.18 ? 314 PRO A CA    1 
ATOM   2435 C  C     . PRO A 1 338 ? 56.707 25.292 32.976  1.00 21.97 ? 314 PRO A C     1 
ATOM   2436 O  O     . PRO A 1 338 ? 57.626 26.104 33.092  1.00 24.27 ? 314 PRO A O     1 
ATOM   2437 C  CB    . PRO A 1 338 ? 56.508 24.331 35.284  1.00 20.73 ? 314 PRO A CB    1 
ATOM   2438 C  CG    . PRO A 1 338 ? 57.218 23.234 35.975  1.00 21.03 ? 314 PRO A CG    1 
ATOM   2439 C  CD    . PRO A 1 338 ? 58.427 22.925 35.133  1.00 20.22 ? 314 PRO A CD    1 
HETATM 2440 N  N     . MSE A 1 339 ? 55.677 25.453 32.151  1.00 25.26 ? 315 MSE A N     1 
HETATM 2441 C  CA    . MSE A 1 339 ? 55.553 26.613 31.258  1.00 26.78 ? 315 MSE A CA    1 
HETATM 2442 C  C     . MSE A 1 339 ? 54.792 27.735 31.909  1.00 28.16 ? 315 MSE A C     1 
HETATM 2443 O  O     . MSE A 1 339 ? 54.606 28.799 31.316  1.00 33.38 ? 315 MSE A O     1 
HETATM 2444 C  CB    . MSE A 1 339 ? 54.876 26.179 29.961  1.00 30.49 ? 315 MSE A CB    1 
HETATM 2445 C  CG    . MSE A 1 339 ? 55.838 25.346 29.127  1.00 39.85 ? 315 MSE A CG    1 
HETATM 2446 SE SE    . MSE A 1 339 ? 54.875 24.668 27.551  1.00 60.89 ? 315 MSE A SE    1 
HETATM 2447 C  CE    . MSE A 1 339 ? 53.900 23.176 28.388  1.00 43.43 ? 315 MSE A CE    1 
ATOM   2448 N  N     . THR A 1 340 ? 54.343 27.501 33.138  1.00 26.19 ? 316 THR A N     1 
ATOM   2449 C  CA    . THR A 1 340 ? 53.588 28.486 33.896  1.00 25.79 ? 316 THR A CA    1 
ATOM   2450 C  C     . THR A 1 340 ? 54.399 28.880 35.128  1.00 25.97 ? 316 THR A C     1 
ATOM   2451 O  O     . THR A 1 340 ? 55.414 28.247 35.438  1.00 26.60 ? 316 THR A O     1 
ATOM   2452 C  CB    . THR A 1 340 ? 52.213 27.936 34.318  1.00 28.55 ? 316 THR A CB    1 
ATOM   2453 O  OG1   . THR A 1 340 ? 52.390 26.687 35.000  1.00 26.16 ? 316 THR A OG1   1 
ATOM   2454 C  CG2   . THR A 1 340 ? 51.327 27.711 33.092  1.00 31.85 ? 316 THR A CG2   1 
ATOM   2455 N  N     . SER A 1 341 ? 53.969 29.926 35.823  1.00 27.99 ? 317 SER A N     1 
ATOM   2456 C  CA    . SER A 1 341 ? 54.706 30.400 36.989  1.00 26.26 ? 317 SER A CA    1 
ATOM   2457 C  C     . SER A 1 341 ? 54.443 29.546 38.217  1.00 25.94 ? 317 SER A C     1 
ATOM   2458 O  O     . SER A 1 341 ? 53.305 29.453 38.703  1.00 26.53 ? 317 SER A O     1 
ATOM   2459 C  CB    . SER A 1 341 ? 54.370 31.859 37.290  1.00 27.33 ? 317 SER A CB    1 
ATOM   2460 O  OG    . SER A 1 341 ? 54.998 32.289 38.492  1.00 29.52 ? 317 SER A OG    1 
ATOM   2461 N  N     . LEU A 1 342 ? 55.502 28.916 38.709  1.00 26.01 ? 318 LEU A N     1 
ATOM   2462 C  CA    . LEU A 1 342 ? 55.412 28.135 39.933  1.00 26.34 ? 318 LEU A CA    1 
ATOM   2463 C  C     . LEU A 1 342 ? 55.267 29.012 41.166  1.00 28.02 ? 318 LEU A C     1 
ATOM   2464 O  O     . LEU A 1 342 ? 54.589 28.625 42.118  1.00 28.74 ? 318 LEU A O     1 
ATOM   2465 C  CB    . LEU A 1 342 ? 56.624 27.226 40.090  1.00 25.39 ? 318 LEU A CB    1 
ATOM   2466 C  CG    . LEU A 1 342 ? 56.839 26.128 39.052  1.00 23.66 ? 318 LEU A CG    1 
ATOM   2467 C  CD1   . LEU A 1 342 ? 58.121 25.391 39.393  1.00 23.91 ? 318 LEU A CD1   1 
ATOM   2468 C  CD2   . LEU A 1 342 ? 55.663 25.172 38.976  1.00 22.84 ? 318 LEU A CD2   1 
ATOM   2469 N  N     . SER A 1 343 ? 55.904 30.182 41.149  1.00 28.34 ? 319 SER A N     1 
ATOM   2470 C  CA    . SER A 1 343 ? 55.770 31.136 42.250  1.00 28.64 ? 319 SER A CA    1 
ATOM   2471 C  C     . SER A 1 343 ? 54.316 31.596 42.402  1.00 29.85 ? 319 SER A C     1 
ATOM   2472 O  O     . SER A 1 343 ? 53.794 31.656 43.513  1.00 31.29 ? 319 SER A O     1 
ATOM   2473 C  CB    . SER A 1 343 ? 56.707 32.332 42.060  1.00 32.25 ? 319 SER A CB    1 
ATOM   2474 O  OG    . SER A 1 343 ? 56.384 33.055 40.889  1.00 37.15 ? 319 SER A OG    1 
ATOM   2475 N  N     . GLU A 1 344 ? 53.661 31.903 41.283  1.00 26.53 ? 320 GLU A N     1 
ATOM   2476 C  CA    . GLU A 1 344 ? 52.245 32.281 41.302  1.00 30.07 ? 320 GLU A CA    1 
ATOM   2477 C  C     . GLU A 1 344 ? 51.352 31.158 41.826  1.00 31.01 ? 320 GLU A C     1 
ATOM   2478 O  O     . GLU A 1 344 ? 50.445 31.405 42.622  1.00 32.48 ? 320 GLU A O     1 
ATOM   2479 C  CB    . GLU A 1 344 ? 51.777 32.766 39.922  1.00 33.57 ? 320 GLU A CB    1 
ATOM   2480 C  CG    . GLU A 1 344 ? 52.244 34.172 39.568  1.00 40.09 ? 320 GLU A CG    1 
ATOM   2481 C  CD    . GLU A 1 344 ? 51.750 35.229 40.546  1.00 46.82 ? 320 GLU A CD    1 
ATOM   2482 O  OE1   . GLU A 1 344 ? 50.568 35.170 40.956  1.00 47.80 ? 320 GLU A OE1   1 
ATOM   2483 O  OE2   . GLU A 1 344 ? 52.544 36.124 40.906  1.00 52.29 ? 320 GLU A OE2   1 
ATOM   2484 N  N     . ALA A 1 345 ? 51.630 29.926 41.406  1.00 28.28 ? 321 ALA A N     1 
ATOM   2485 C  CA    . ALA A 1 345 ? 50.856 28.768 41.863  1.00 28.90 ? 321 ALA A CA    1 
ATOM   2486 C  C     . ALA A 1 345 ? 51.041 28.537 43.361  1.00 30.47 ? 321 ALA A C     1 
ATOM   2487 O  O     . ALA A 1 345 ? 50.074 28.234 44.073  1.00 32.64 ? 321 ALA A O     1 
ATOM   2488 C  CB    . ALA A 1 345 ? 51.237 27.525 41.079  1.00 30.11 ? 321 ALA A CB    1 
ATOM   2489 N  N     . ALA A 1 346 ? 52.280 28.694 43.827  1.00 28.24 ? 322 ALA A N     1 
ATOM   2490 C  CA    . ALA A 1 346 ? 52.611 28.597 45.251  1.00 28.89 ? 322 ALA A CA    1 
ATOM   2491 C  C     . ALA A 1 346 ? 51.862 29.655 46.058  1.00 32.27 ? 322 ALA A C     1 
ATOM   2492 O  O     . ALA A 1 346 ? 51.303 29.352 47.115  1.00 32.72 ? 322 ALA A O     1 
ATOM   2493 C  CB    . ALA A 1 346 ? 54.116 28.721 45.465  1.00 28.83 ? 322 ALA A CB    1 
ATOM   2494 N  N     . LYS A 1 347 ? 51.842 30.886 45.544  1.00 31.99 ? 323 LYS A N     1 
ATOM   2495 C  CA    . LYS A 1 347 ? 51.125 31.991 46.187  1.00 32.81 ? 323 LYS A CA    1 
ATOM   2496 C  C     . LYS A 1 347 ? 49.634 31.682 46.301  1.00 33.43 ? 323 LYS A C     1 
ATOM   2497 O  O     . LYS A 1 347 ? 49.031 31.871 47.363  1.00 38.06 ? 323 LYS A O     1 
ATOM   2498 C  CB    . LYS A 1 347 ? 51.343 33.304 45.429  1.00 35.54 ? 323 LYS A CB    1 
ATOM   2499 C  CG    . LYS A 1 347 ? 52.705 33.946 45.649  1.00 39.57 ? 323 LYS A CG    1 
ATOM   2500 C  CD    . LYS A 1 347 ? 52.838 35.234 44.848  1.00 47.73 ? 323 LYS A CD    1 
ATOM   2501 C  CE    . LYS A 1 347 ? 54.248 35.799 44.927  1.00 52.92 ? 323 LYS A CE    1 
ATOM   2502 N  NZ    . LYS A 1 347 ? 54.427 36.977 44.031  1.00 58.62 ? 323 LYS A NZ    1 
ATOM   2503 N  N     . GLN A 1 348 ? 49.053 31.196 45.210  1.00 34.72 ? 324 GLN A N     1 
ATOM   2504 C  CA    . GLN A 1 348 ? 47.641 30.850 45.151  1.00 35.77 ? 324 GLN A CA    1 
ATOM   2505 C  C     . GLN A 1 348 ? 47.294 29.683 46.067  1.00 36.24 ? 324 GLN A C     1 
ATOM   2506 O  O     . GLN A 1 348 ? 46.235 29.666 46.688  1.00 40.76 ? 324 GLN A O     1 
ATOM   2507 C  CB    . GLN A 1 348 ? 47.252 30.521 43.715  1.00 37.64 ? 324 GLN A CB    1 
ATOM   2508 C  CG    . GLN A 1 348 ? 45.768 30.639 43.423  1.00 39.24 ? 324 GLN A CG    1 
ATOM   2509 C  CD    . GLN A 1 348 ? 45.484 31.413 42.147  1.00 28.48 ? 324 GLN A CD    1 
ATOM   2510 O  OE1   . GLN A 1 348 ? 46.332 32.140 41.642  1.00 33.43 ? 324 GLN A OE1   1 
ATOM   2511 N  NE2   . GLN A 1 348 ? 44.275 31.252 41.622  1.00 37.93 ? 324 GLN A NE2   1 
ATOM   2512 N  N     . ALA A 1 349 ? 48.193 28.710 46.150  1.00 35.66 ? 325 ALA A N     1 
ATOM   2513 C  CA    . ALA A 1 349 ? 47.986 27.527 46.985  1.00 35.45 ? 325 ALA A CA    1 
ATOM   2514 C  C     . ALA A 1 349 ? 48.198 27.816 48.475  1.00 36.23 ? 325 ALA A C     1 
ATOM   2515 O  O     . ALA A 1 349 ? 47.966 26.949 49.319  1.00 38.52 ? 325 ALA A O     1 
ATOM   2516 C  CB    . ALA A 1 349 ? 48.889 26.390 46.528  1.00 32.91 ? 325 ALA A CB    1 
ATOM   2517 N  N     . GLY A 1 350 ? 48.636 29.034 48.789  1.00 36.84 ? 326 GLY A N     1 
ATOM   2518 C  CA    . GLY A 1 350 ? 48.872 29.438 50.173  1.00 36.39 ? 326 GLY A CA    1 
ATOM   2519 C  C     . GLY A 1 350 ? 50.167 28.911 50.768  1.00 39.30 ? 326 GLY A C     1 
ATOM   2520 O  O     . GLY A 1 350 ? 50.341 28.921 51.986  1.00 41.98 ? 326 GLY A O     1 
ATOM   2521 N  N     . LEU A 1 351 ? 51.074 28.449 49.907  1.00 37.73 ? 327 LEU A N     1 
ATOM   2522 C  CA    . LEU A 1 351 ? 52.403 28.009 50.333  1.00 33.26 ? 327 LEU A CA    1 
ATOM   2523 C  C     . LEU A 1 351 ? 53.408 29.154 50.246  1.00 39.97 ? 327 LEU A C     1 
ATOM   2524 O  O     . LEU A 1 351 ? 54.433 29.143 50.932  1.00 42.14 ? 327 LEU A O     1 
ATOM   2525 C  CB    . LEU A 1 351 ? 52.872 26.809 49.502  1.00 32.18 ? 327 LEU A CB    1 
ATOM   2526 C  CG    . LEU A 1 351 ? 51.976 25.564 49.479  1.00 32.19 ? 327 LEU A CG    1 
ATOM   2527 C  CD1   . LEU A 1 351 ? 52.542 24.524 48.525  1.00 32.25 ? 327 LEU A CD1   1 
ATOM   2528 C  CD2   . LEU A 1 351 ? 51.788 24.965 50.868  1.00 34.15 ? 327 LEU A CD2   1 
ATOM   2529 N  N     . ILE A 1 352 ? 53.101 30.119 49.377  1.00 47.15 ? 328 ILE A N     1 
ATOM   2530 C  CA    . ILE A 1 352 ? 53.793 31.412 49.270  1.00 46.71 ? 328 ILE A CA    1 
ATOM   2531 C  C     . ILE A 1 352 ? 55.314 31.295 49.226  1.00 46.41 ? 328 ILE A C     1 
ATOM   2532 O  O     . ILE A 1 352 ? 55.948 31.762 48.281  1.00 51.87 ? 328 ILE A O     1 
ATOM   2533 C  CB    . ILE A 1 352 ? 53.346 32.386 50.392  1.00 41.08 ? 328 ILE A CB    1 
ATOM   2534 C  CG1   . ILE A 1 352 ? 51.810 32.418 50.491  1.00 35.80 ? 328 ILE A CG1   1 
ATOM   2535 C  CG2   . ILE A 1 352 ? 53.967 33.768 50.206  1.00 40.36 ? 328 ILE A CG2   1 
ATOM   2536 C  CD1   . ILE A 1 352 ? 51.112 33.499 49.700  1.00 35.29 ? 328 ILE A CD1   1 
HETATM 2537 N  N     . MSE B 1 23  ? 45.204 5.750  -11.120 1.00 40.94 ? -1  MSE B N     1 
HETATM 2538 C  CA    . MSE B 1 23  ? 45.504 6.259  -9.754  1.00 42.89 ? -1  MSE B CA    1 
HETATM 2539 C  C     . MSE B 1 23  ? 46.614 7.251  -9.852  1.00 41.63 ? -1  MSE B C     1 
HETATM 2540 O  O     . MSE B 1 23  ? 47.436 7.195  -10.769 1.00 45.81 ? -1  MSE B O     1 
HETATM 2541 C  CB    . MSE B 1 23  ? 45.982 5.132  -8.846  1.00 46.96 ? -1  MSE B CB    1 
HETATM 2542 C  CG    . MSE B 1 23  ? 44.985 3.985  -8.776  1.00 51.41 ? -1  MSE B CG    1 
HETATM 2543 SE SE    . MSE B 1 23  ? 45.915 2.439  -7.998  1.00 58.64 ? -1  MSE B SE    1 
HETATM 2544 C  CE    . MSE B 1 23  ? 46.822 1.790  -9.619  1.00 41.55 ? -1  MSE B CE    1 
ATOM   2545 N  N     . THR B 1 24  ? 46.643 8.167  -8.890  1.00 41.98 ? 0   THR B N     1 
ATOM   2546 C  CA    . THR B 1 24  ? 47.679 9.182  -8.794  1.00 39.92 ? 0   THR B CA    1 
ATOM   2547 C  C     . THR B 1 24  ? 48.521 8.863  -7.559  1.00 36.77 ? 0   THR B C     1 
ATOM   2548 O  O     . THR B 1 24  ? 48.037 8.211  -6.631  1.00 42.36 ? 0   THR B O     1 
ATOM   2549 C  CB    . THR B 1 24  ? 47.036 10.586 -8.714  1.00 42.00 ? 0   THR B CB    1 
ATOM   2550 O  OG1   . THR B 1 24  ? 47.984 11.587 -9.097  1.00 49.48 ? 0   THR B OG1   1 
ATOM   2551 C  CG2   . THR B 1 24  ? 46.517 10.872 -7.315  1.00 37.28 ? 0   THR B CG2   1 
ATOM   2552 N  N     . ARG B 1 25  ? 49.777 9.301  -7.532  1.00 26.88 ? 1   ARG B N     1 
ATOM   2553 C  CA    . ARG B 1 25  ? 50.617 8.992  -6.388  1.00 26.62 ? 1   ARG B CA    1 
ATOM   2554 C  C     . ARG B 1 25  ? 50.320 9.897  -5.197  1.00 21.91 ? 1   ARG B C     1 
ATOM   2555 O  O     . ARG B 1 25  ? 50.422 9.458  -4.053  1.00 24.17 ? 1   ARG B O     1 
ATOM   2556 C  CB    . ARG B 1 25  ? 52.100 9.038  -6.742  1.00 25.91 ? 1   ARG B CB    1 
ATOM   2557 C  CG    . ARG B 1 25  ? 52.574 7.848  -7.566  1.00 29.44 ? 1   ARG B CG    1 
ATOM   2558 C  CD    . ARG B 1 25  ? 54.088 7.778  -7.579  1.00 34.87 ? 1   ARG B CD    1 
ATOM   2559 N  NE    . ARG B 1 25  ? 54.668 8.981  -8.169  1.00 32.85 ? 1   ARG B NE    1 
ATOM   2560 C  CZ    . ARG B 1 25  ? 55.866 9.469  -7.864  1.00 34.86 ? 1   ARG B CZ    1 
ATOM   2561 N  NH1   . ARG B 1 25  ? 56.295 10.573 -8.461  1.00 33.85 ? 1   ARG B NH1   1 
ATOM   2562 N  NH2   . ARG B 1 25  ? 56.635 8.863  -6.965  1.00 39.35 ? 1   ARG B NH2   1 
ATOM   2563 N  N     . PHE B 1 26  ? 49.974 11.156 -5.465  1.00 20.14 ? 2   PHE B N     1 
ATOM   2564 C  CA    . PHE B 1 26  ? 49.764 12.139 -4.394  1.00 20.50 ? 2   PHE B CA    1 
ATOM   2565 C  C     . PHE B 1 26  ? 48.462 12.895 -4.549  1.00 19.01 ? 2   PHE B C     1 
ATOM   2566 O  O     . PHE B 1 26  ? 48.043 13.236 -5.654  1.00 18.65 ? 2   PHE B O     1 
ATOM   2567 C  CB    . PHE B 1 26  ? 50.933 13.130 -4.315  1.00 19.12 ? 2   PHE B CB    1 
ATOM   2568 C  CG    . PHE B 1 26  ? 52.268 12.462 -4.165  1.00 17.97 ? 2   PHE B CG    1 
ATOM   2569 C  CD1   . PHE B 1 26  ? 52.678 11.951 -2.937  1.00 17.58 ? 2   PHE B CD1   1 
ATOM   2570 C  CD2   . PHE B 1 26  ? 53.094 12.291 -5.274  1.00 18.90 ? 2   PHE B CD2   1 
ATOM   2571 C  CE1   . PHE B 1 26  ? 53.898 11.321 -2.808  1.00 19.69 ? 2   PHE B CE1   1 
ATOM   2572 C  CE2   . PHE B 1 26  ? 54.317 11.654 -5.152  1.00 21.33 ? 2   PHE B CE2   1 
ATOM   2573 C  CZ    . PHE B 1 26  ? 54.714 11.156 -3.919  1.00 20.59 ? 2   PHE B CZ    1 
ATOM   2574 N  N     . ASP B 1 27  ? 47.827 13.164 -3.419  1.00 19.03 ? 3   ASP B N     1 
ATOM   2575 C  CA    . ASP B 1 27  ? 46.686 14.045 -3.405  1.00 18.89 ? 3   ASP B CA    1 
ATOM   2576 C  C     . ASP B 1 27  ? 47.167 15.487 -3.417  1.00 19.37 ? 3   ASP B C     1 
ATOM   2577 O  O     . ASP B 1 27  ? 46.690 16.288 -4.223  1.00 16.41 ? 3   ASP B O     1 
ATOM   2578 C  CB    . ASP B 1 27  ? 45.822 13.783 -2.174  1.00 20.17 ? 3   ASP B CB    1 
ATOM   2579 C  CG    . ASP B 1 27  ? 45.195 12.405 -2.191  1.00 18.87 ? 3   ASP B CG    1 
ATOM   2580 O  OD1   . ASP B 1 27  ? 44.723 11.971 -3.272  1.00 23.20 ? 3   ASP B OD1   1 
ATOM   2581 O  OD2   . ASP B 1 27  ? 45.171 11.761 -1.121  1.00 19.91 ? 3   ASP B OD2   1 
ATOM   2582 N  N     . VAL B 1 28  ? 48.109 15.804 -2.526  1.00 15.88 ? 4   VAL B N     1 
ATOM   2583 C  CA    . VAL B 1 28  ? 48.568 17.178 -2.360  1.00 15.56 ? 4   VAL B CA    1 
ATOM   2584 C  C     . VAL B 1 28  ? 50.082 17.241 -2.217  1.00 14.74 ? 4   VAL B C     1 
ATOM   2585 O  O     . VAL B 1 28  ? 50.660 16.635 -1.328  1.00 15.18 ? 4   VAL B O     1 
ATOM   2586 C  CB    . VAL B 1 28  ? 47.958 17.861 -1.114  1.00 17.09 ? 4   VAL B CB    1 
ATOM   2587 C  CG1   . VAL B 1 28  ? 48.365 19.324 -1.067  1.00 17.77 ? 4   VAL B CG1   1 
ATOM   2588 C  CG2   . VAL B 1 28  ? 46.437 17.759 -1.099  1.00 17.53 ? 4   VAL B CG2   1 
ATOM   2589 N  N     . LEU B 1 29  ? 50.703 18.004 -3.105  1.00 16.37 ? 5   LEU B N     1 
ATOM   2590 C  CA    . LEU B 1 29  ? 52.089 18.394 -2.973  1.00 15.18 ? 5   LEU B CA    1 
ATOM   2591 C  C     . LEU B 1 29  ? 52.068 19.811 -2.457  1.00 14.83 ? 5   LEU B C     1 
ATOM   2592 O  O     . LEU B 1 29  ? 51.384 20.670 -3.022  1.00 14.54 ? 5   LEU B O     1 
ATOM   2593 C  CB    . LEU B 1 29  ? 52.787 18.368 -4.336  1.00 15.38 ? 5   LEU B CB    1 
ATOM   2594 C  CG    . LEU B 1 29  ? 54.128 19.124 -4.413  1.00 15.59 ? 5   LEU B CG    1 
ATOM   2595 C  CD1   . LEU B 1 29  ? 55.222 18.536 -3.530  1.00 15.22 ? 5   LEU B CD1   1 
ATOM   2596 C  CD2   . LEU B 1 29  ? 54.578 19.184 -5.870  1.00 17.28 ? 5   LEU B CD2   1 
ATOM   2597 N  N     . THR B 1 30  ? 52.796 20.057 -1.376  1.00 13.88 ? 6   THR B N     1 
ATOM   2598 C  CA    . THR B 1 30  ? 52.980 21.431 -0.938  1.00 12.94 ? 6   THR B CA    1 
ATOM   2599 C  C     . THR B 1 30  ? 54.426 21.880 -1.084  1.00 12.14 ? 6   THR B C     1 
ATOM   2600 O  O     . THR B 1 30  ? 55.344 21.067 -1.022  1.00 14.65 ? 6   THR B O     1 
ATOM   2601 C  CB    . THR B 1 30  ? 52.500 21.721 0.503   1.00 13.67 ? 6   THR B CB    1 
ATOM   2602 O  OG1   . THR B 1 30  ? 53.391 21.147 1.452   1.00 13.79 ? 6   THR B OG1   1 
ATOM   2603 C  CG2   . THR B 1 30  ? 51.073 21.196 0.723   1.00 15.00 ? 6   THR B CG2   1 
ATOM   2604 N  N     . VAL B 1 31  ? 54.610 23.191 -1.236  1.00 12.02 ? 7   VAL B N     1 
ATOM   2605 C  CA    . VAL B 1 31  ? 55.942 23.772 -1.430  1.00 12.78 ? 7   VAL B CA    1 
ATOM   2606 C  C     . VAL B 1 31  ? 56.049 25.019 -0.549  1.00 14.00 ? 7   VAL B C     1 
ATOM   2607 O  O     . VAL B 1 31  ? 55.162 25.892 -0.589  1.00 15.08 ? 7   VAL B O     1 
ATOM   2608 C  CB    . VAL B 1 31  ? 56.167 24.160 -2.903  1.00 12.78 ? 7   VAL B CB    1 
ATOM   2609 C  CG1   . VAL B 1 31  ? 57.603 24.657 -3.110  1.00 14.69 ? 7   VAL B CG1   1 
ATOM   2610 C  CG2   . VAL B 1 31  ? 55.871 22.995 -3.840  1.00 13.98 ? 7   VAL B CG2   1 
ATOM   2611 N  N     . GLY B 1 32  ? 57.115 25.113 0.248   1.00 14.46 ? 8   GLY B N     1 
ATOM   2612 C  CA    . GLY B 1 32  ? 57.248 26.246 1.145   1.00 14.16 ? 8   GLY B CA    1 
ATOM   2613 C  C     . GLY B 1 32  ? 58.624 26.370 1.753   1.00 14.72 ? 8   GLY B C     1 
ATOM   2614 O  O     . GLY B 1 32  ? 59.514 25.573 1.459   1.00 16.34 ? 8   GLY B O     1 
ATOM   2615 N  N     . ASN B 1 33  ? 58.770 27.375 2.610   1.00 14.93 ? 9   ASN B N     1 
ATOM   2616 C  CA    . ASN B 1 33  ? 59.948 27.596 3.422   1.00 13.30 ? 9   ASN B CA    1 
ATOM   2617 C  C     . ASN B 1 33  ? 60.014 26.579 4.550   1.00 13.75 ? 9   ASN B C     1 
ATOM   2618 O  O     . ASN B 1 33  ? 59.131 26.551 5.418   1.00 15.90 ? 9   ASN B O     1 
ATOM   2619 C  CB    . ASN B 1 33  ? 59.925 29.022 3.974   1.00 14.88 ? 9   ASN B CB    1 
ATOM   2620 C  CG    . ASN B 1 33  ? 60.081 30.070 2.879   1.00 16.10 ? 9   ASN B CG    1 
ATOM   2621 O  OD1   . ASN B 1 33  ? 60.932 29.930 1.990   1.00 16.38 ? 9   ASN B OD1   1 
ATOM   2622 N  ND2   . ASN B 1 33  ? 59.282 31.122 2.942   1.00 14.50 ? 9   ASN B ND2   1 
ATOM   2623 N  N     . ALA B 1 34  ? 61.045 25.732 4.530   1.00 12.09 ? 10  ALA B N     1 
ATOM   2624 C  CA    . ALA B 1 34  ? 61.202 24.691 5.548   1.00 12.95 ? 10  ALA B CA    1 
ATOM   2625 C  C     . ALA B 1 34  ? 61.781 25.319 6.817   1.00 14.60 ? 10  ALA B C     1 
ATOM   2626 O  O     . ALA B 1 34  ? 62.936 25.775 6.846   1.00 16.53 ? 10  ALA B O     1 
ATOM   2627 C  CB    . ALA B 1 34  ? 62.068 23.550 5.037   1.00 15.76 ? 10  ALA B CB    1 
ATOM   2628 N  N     . ILE B 1 35  ? 60.974 25.337 7.879   1.00 13.41 ? 11  ILE B N     1 
ATOM   2629 C  CA    . ILE B 1 35  ? 61.315 26.084 9.084   1.00 13.09 ? 11  ILE B CA    1 
ATOM   2630 C  C     . ILE B 1 35  ? 61.085 25.225 10.322  1.00 13.95 ? 11  ILE B C     1 
ATOM   2631 O  O     . ILE B 1 35  ? 60.103 24.463 10.359  1.00 14.77 ? 11  ILE B O     1 
ATOM   2632 C  CB    . ILE B 1 35  ? 60.455 27.378 9.178   1.00 14.12 ? 11  ILE B CB    1 
ATOM   2633 C  CG1   . ILE B 1 35  ? 60.790 28.364 8.037   1.00 15.01 ? 11  ILE B CG1   1 
ATOM   2634 C  CG2   . ILE B 1 35  ? 60.590 28.064 10.525  1.00 16.68 ? 11  ILE B CG2   1 
ATOM   2635 C  CD1   . ILE B 1 35  ? 59.702 29.383 7.742   1.00 14.62 ? 11  ILE B CD1   1 
ATOM   2636 N  N     . VAL B 1 36  ? 61.968 25.379 11.318  1.00 14.37 ? 12  VAL B N     1 
ATOM   2637 C  CA    . VAL B 1 36  ? 61.745 24.852 12.686  1.00 13.76 ? 12  VAL B CA    1 
ATOM   2638 C  C     . VAL B 1 36  ? 61.320 26.024 13.575  1.00 13.57 ? 12  VAL B C     1 
ATOM   2639 O  O     . VAL B 1 36  ? 61.977 27.065 13.600  1.00 15.02 ? 12  VAL B O     1 
ATOM   2640 C  CB    . VAL B 1 36  ? 62.983 24.135 13.280  1.00 15.55 ? 12  VAL B CB    1 
ATOM   2641 C  CG1   . VAL B 1 36  ? 62.719 23.718 14.722  1.00 18.73 ? 12  VAL B CG1   1 
ATOM   2642 C  CG2   . VAL B 1 36  ? 63.338 22.893 12.464  1.00 17.67 ? 12  VAL B CG2   1 
ATOM   2643 N  N     . ASP B 1 37  ? 60.192 25.870 14.276  1.00 14.18 ? 13  ASP B N     1 
ATOM   2644 C  CA    . ASP B 1 37  ? 59.701 26.922 15.160  1.00 13.25 ? 13  ASP B CA    1 
ATOM   2645 C  C     . ASP B 1 37  ? 60.320 26.813 16.535  1.00 12.64 ? 13  ASP B C     1 
ATOM   2646 O  O     . ASP B 1 37  ? 60.527 25.706 17.052  1.00 14.92 ? 13  ASP B O     1 
ATOM   2647 C  CB    . ASP B 1 37  ? 58.184 26.824 15.332  1.00 14.47 ? 13  ASP B CB    1 
ATOM   2648 C  CG    . ASP B 1 37  ? 57.439 27.064 14.047  1.00 17.69 ? 13  ASP B CG    1 
ATOM   2649 O  OD1   . ASP B 1 37  ? 58.025 27.698 13.143  1.00 18.65 ? 13  ASP B OD1   1 
ATOM   2650 O  OD2   . ASP B 1 37  ? 56.269 26.646 13.944  1.00 18.40 ? 13  ASP B OD2   1 
ATOM   2651 N  N     . ILE B 1 38  ? 60.585 27.983 17.106  1.00 15.48 ? 14  ILE B N     1 
ATOM   2652 C  CA    . ILE B 1 38  ? 61.074 28.143 18.465  1.00 14.68 ? 14  ILE B CA    1 
ATOM   2653 C  C     . ILE B 1 38  ? 59.994 28.982 19.133  1.00 15.25 ? 14  ILE B C     1 
ATOM   2654 O  O     . ILE B 1 38  ? 59.815 30.157 18.799  1.00 16.19 ? 14  ILE B O     1 
ATOM   2655 C  CB    . ILE B 1 38  ? 62.449 28.845 18.494  1.00 15.29 ? 14  ILE B CB    1 
ATOM   2656 C  CG1   . ILE B 1 38  ? 63.467 28.033 17.686  1.00 17.14 ? 14  ILE B CG1   1 
ATOM   2657 C  CG2   . ILE B 1 38  ? 62.929 29.028 19.926  1.00 15.19 ? 14  ILE B CG2   1 
ATOM   2658 C  CD1   . ILE B 1 38  ? 64.743 28.790 17.389  1.00 19.79 ? 14  ILE B CD1   1 
ATOM   2659 N  N     . ILE B 1 39  ? 59.264 28.363 20.060  1.00 15.28 ? 15  ILE B N     1 
ATOM   2660 C  CA    . ILE B 1 39  ? 58.003 28.937 20.569  1.00 15.12 ? 15  ILE B CA    1 
ATOM   2661 C  C     . ILE B 1 39  ? 58.094 29.287 22.051  1.00 14.82 ? 15  ILE B C     1 
ATOM   2662 O  O     . ILE B 1 39  ? 58.532 28.472 22.868  1.00 16.82 ? 15  ILE B O     1 
ATOM   2663 C  CB    . ILE B 1 39  ? 56.836 27.949 20.379  1.00 16.14 ? 15  ILE B CB    1 
ATOM   2664 C  CG1   . ILE B 1 39  ? 56.767 27.469 18.923  1.00 16.33 ? 15  ILE B CG1   1 
ATOM   2665 C  CG2   . ILE B 1 39  ? 55.507 28.581 20.789  1.00 18.23 ? 15  ILE B CG2   1 
ATOM   2666 C  CD1   . ILE B 1 39  ? 56.005 26.171 18.734  1.00 23.36 ? 15  ILE B CD1   1 
ATOM   2667 N  N     . SER B 1 40  ? 57.671 30.504 22.392  1.00 16.57 ? 16  SER B N     1 
ATOM   2668 C  CA    . SER B 1 40  ? 57.616 30.931 23.785  1.00 16.52 ? 16  SER B CA    1 
ATOM   2669 C  C     . SER B 1 40  ? 56.424 31.852 24.005  1.00 18.89 ? 16  SER B C     1 
ATOM   2670 O  O     . SER B 1 40  ? 55.839 32.384 23.067  1.00 20.21 ? 16  SER B O     1 
ATOM   2671 C  CB    . SER B 1 40  ? 58.928 31.622 24.173  1.00 20.29 ? 16  SER B CB    1 
ATOM   2672 O  OG    . SER B 1 40  ? 59.040 31.792 25.580  1.00 25.84 ? 16  SER B OG    1 
ATOM   2673 N  N     . ARG B 1 41  ? 56.071 32.043 25.260  1.00 20.86 ? 17  ARG B N     1 
ATOM   2674 C  CA    . ARG B 1 41  ? 54.999 32.957 25.597  1.00 20.97 ? 17  ARG B CA    1 
ATOM   2675 C  C     . ARG B 1 41  ? 55.615 34.299 25.945  1.00 21.45 ? 17  ARG B C     1 
ATOM   2676 O  O     . ARG B 1 41  ? 56.747 34.350 26.381  1.00 27.05 ? 17  ARG B O     1 
ATOM   2677 C  CB    . ARG B 1 41  ? 54.140 32.396 26.750  1.00 26.90 ? 17  ARG B CB    1 
ATOM   2678 C  CG    . ARG B 1 41  ? 54.815 31.376 27.671  1.00 43.82 ? 17  ARG B CG    1 
ATOM   2679 C  CD    . ARG B 1 41  ? 54.579 29.918 27.260  1.00 51.78 ? 17  ARG B CD    1 
ATOM   2680 N  NE    . ARG B 1 41  ? 55.786 29.236 26.768  1.00 51.78 ? 17  ARG B NE    1 
ATOM   2681 C  CZ    . ARG B 1 41  ? 55.791 28.287 25.830  1.00 49.21 ? 17  ARG B CZ    1 
ATOM   2682 N  NH1   . ARG B 1 41  ? 54.656 27.902 25.249  1.00 57.64 ? 17  ARG B NH1   1 
ATOM   2683 N  NH2   . ARG B 1 41  ? 56.934 27.730 25.455  1.00 46.57 ? 17  ARG B NH2   1 
ATOM   2684 N  N     . CYS B 1 42  ? 54.890 35.384 25.710  1.00 20.27 ? 18  CYS B N     1 
ATOM   2685 C  CA    . CYS B 1 42  ? 55.337 36.696 26.178  1.00 21.71 ? 18  CYS B CA    1 
ATOM   2686 C  C     . CYS B 1 42  ? 54.158 37.570 26.553  1.00 22.33 ? 18  CYS B C     1 
ATOM   2687 O  O     . CYS B 1 42  ? 53.021 37.255 26.213  1.00 20.64 ? 18  CYS B O     1 
ATOM   2688 C  CB    . CYS B 1 42  ? 56.206 37.412 25.134  1.00 23.32 ? 18  CYS B CB    1 
ATOM   2689 S  SG    . CYS B 1 42  ? 55.356 37.973 23.637  1.00 22.34 ? 18  CYS B SG    1 
ATOM   2690 N  N     . ASN B 1 43  ? 54.436 38.650 27.281  1.00 26.34 ? 19  ASN B N     1 
ATOM   2691 C  CA    . ASN B 1 43  ? 53.421 39.669 27.532  1.00 29.10 ? 19  ASN B CA    1 
ATOM   2692 C  C     . ASN B 1 43  ? 53.288 40.637 26.351  1.00 27.50 ? 19  ASN B C     1 
ATOM   2693 O  O     . ASN B 1 43  ? 54.105 40.623 25.417  1.00 26.33 ? 19  ASN B O     1 
ATOM   2694 C  CB    . ASN B 1 43  ? 53.647 40.406 28.871  1.00 32.78 ? 19  ASN B CB    1 
ATOM   2695 C  CG    . ASN B 1 43  ? 54.967 41.161 28.933  1.00 32.75 ? 19  ASN B CG    1 
ATOM   2696 O  OD1   . ASN B 1 43  ? 55.515 41.580 27.915  1.00 30.88 ? 19  ASN B OD1   1 
ATOM   2697 N  ND2   . ASN B 1 43  ? 55.468 41.367 30.151  1.00 35.61 ? 19  ASN B ND2   1 
ATOM   2698 N  N     . ASP B 1 44  ? 52.253 41.467 26.396  1.00 29.01 ? 20  ASP B N     1 
ATOM   2699 C  CA    . ASP B 1 44  ? 51.959 42.411 25.329  1.00 30.95 ? 20  ASP B CA    1 
ATOM   2700 C  C     . ASP B 1 44  ? 53.090 43.427 25.163  1.00 24.81 ? 20  ASP B C     1 
ATOM   2701 O  O     . ASP B 1 44  ? 53.458 43.778 24.044  1.00 24.29 ? 20  ASP B O     1 
ATOM   2702 C  CB    . ASP B 1 44  ? 50.630 43.118 25.615  1.00 37.17 ? 20  ASP B CB    1 
ATOM   2703 C  CG    . ASP B 1 44  ? 49.509 42.142 25.974  1.00 39.51 ? 20  ASP B CG    1 
ATOM   2704 O  OD1   . ASP B 1 44  ? 49.520 40.996 25.471  1.00 37.32 ? 20  ASP B OD1   1 
ATOM   2705 O  OD2   . ASP B 1 44  ? 48.614 42.522 26.761  1.00 39.76 ? 20  ASP B OD2   1 
ATOM   2706 N  N     . GLN B 1 45  ? 53.651 43.880 26.279  1.00 23.90 ? 21  GLN B N     1 
ATOM   2707 C  CA    . GLN B 1 45  ? 54.716 44.880 26.241  1.00 27.26 ? 21  GLN B CA    1 
ATOM   2708 C  C     . GLN B 1 45  ? 55.998 44.386 25.550  1.00 22.19 ? 21  GLN B C     1 
ATOM   2709 O  O     . GLN B 1 45  ? 56.726 45.179 24.967  1.00 24.35 ? 21  GLN B O     1 
ATOM   2710 C  CB    . GLN B 1 45  ? 55.006 45.407 27.654  1.00 29.44 ? 21  GLN B CB    1 
ATOM   2711 C  CG    . GLN B 1 45  ? 55.746 46.738 27.702  1.00 33.49 ? 21  GLN B CG    1 
ATOM   2712 C  CD    . GLN B 1 45  ? 55.060 47.858 26.931  1.00 34.96 ? 21  GLN B CD    1 
ATOM   2713 O  OE1   . GLN B 1 45  ? 55.713 48.612 26.212  1.00 44.33 ? 21  GLN B OE1   1 
ATOM   2714 N  NE2   . GLN B 1 45  ? 53.746 47.972 27.076  1.00 34.41 ? 21  GLN B NE2   1 
ATOM   2715 N  N     . PHE B 1 46  ? 56.269 43.083 25.611  1.00 21.05 ? 22  PHE B N     1 
ATOM   2716 C  CA    . PHE B 1 46  ? 57.452 42.519 24.948  1.00 21.50 ? 22  PHE B CA    1 
ATOM   2717 C  C     . PHE B 1 46  ? 57.484 42.823 23.439  1.00 19.47 ? 22  PHE B C     1 
ATOM   2718 O  O     . PHE B 1 46  ? 58.535 43.172 22.889  1.00 20.91 ? 22  PHE B O     1 
ATOM   2719 C  CB    . PHE B 1 46  ? 57.552 41.010 25.207  1.00 21.56 ? 22  PHE B CB    1 
ATOM   2720 C  CG    . PHE B 1 46  ? 58.760 40.361 24.579  1.00 20.78 ? 22  PHE B CG    1 
ATOM   2721 C  CD1   . PHE B 1 46  ? 59.957 40.273 25.275  1.00 22.64 ? 22  PHE B CD1   1 
ATOM   2722 C  CD2   . PHE B 1 46  ? 58.694 39.831 23.291  1.00 20.57 ? 22  PHE B CD2   1 
ATOM   2723 C  CE1   . PHE B 1 46  ? 61.071 39.670 24.699  1.00 23.08 ? 22  PHE B CE1   1 
ATOM   2724 C  CE2   . PHE B 1 46  ? 59.805 39.248 22.711  1.00 22.50 ? 22  PHE B CE2   1 
ATOM   2725 C  CZ    . PHE B 1 46  ? 60.990 39.164 23.413  1.00 22.91 ? 22  PHE B CZ    1 
ATOM   2726 N  N     . LEU B 1 47  ? 56.338 42.683 22.783  1.00 18.66 ? 23  LEU B N     1 
ATOM   2727 C  CA    . LEU B 1 47  ? 56.227 42.965 21.350  1.00 18.26 ? 23  LEU B CA    1 
ATOM   2728 C  C     . LEU B 1 47  ? 56.533 44.426 21.033  1.00 19.67 ? 23  LEU B C     1 
ATOM   2729 O  O     . LEU B 1 47  ? 57.240 44.722 20.069  1.00 23.25 ? 23  LEU B O     1 
ATOM   2730 C  CB    . LEU B 1 47  ? 54.836 42.593 20.830  1.00 19.90 ? 23  LEU B CB    1 
ATOM   2731 C  CG    . LEU B 1 47  ? 54.464 41.106 20.938  1.00 18.61 ? 23  LEU B CG    1 
ATOM   2732 C  CD1   . LEU B 1 47  ? 53.089 40.849 20.327  1.00 19.88 ? 23  LEU B CD1   1 
ATOM   2733 C  CD2   . LEU B 1 47  ? 55.514 40.189 20.311  1.00 17.69 ? 23  LEU B CD2   1 
ATOM   2734 N  N     . ILE B 1 48  ? 56.004 45.333 21.854  1.00 21.32 ? 24  ILE B N     1 
ATOM   2735 C  CA    . ILE B 1 48  ? 56.218 46.764 21.670  1.00 22.42 ? 24  ILE B CA    1 
ATOM   2736 C  C     . ILE B 1 48  ? 57.688 47.103 21.909  1.00 21.66 ? 24  ILE B C     1 
ATOM   2737 O  O     . ILE B 1 48  ? 58.302 47.815 21.106  1.00 23.34 ? 24  ILE B O     1 
ATOM   2738 C  CB    . ILE B 1 48  ? 55.314 47.586 22.612  1.00 23.96 ? 24  ILE B CB    1 
ATOM   2739 C  CG1   . ILE B 1 48  ? 53.839 47.269 22.335  1.00 23.45 ? 24  ILE B CG1   1 
ATOM   2740 C  CG2   . ILE B 1 48  ? 55.599 49.079 22.468  1.00 23.59 ? 24  ILE B CG2   1 
ATOM   2741 C  CD1   . ILE B 1 48  ? 52.887 47.697 23.431  1.00 28.81 ? 24  ILE B CD1   1 
ATOM   2742 N  N     . ASP B 1 49  ? 58.252 46.582 23.001  1.00 21.39 ? 25  ASP B N     1 
ATOM   2743 C  CA    . ASP B 1 49  ? 59.638 46.878 23.361  1.00 21.88 ? 25  ASP B CA    1 
ATOM   2744 C  C     . ASP B 1 49  ? 60.624 46.447 22.286  1.00 22.31 ? 25  ASP B C     1 
ATOM   2745 O  O     . ASP B 1 49  ? 61.653 47.092 22.089  1.00 25.00 ? 25  ASP B O     1 
ATOM   2746 C  CB    . ASP B 1 49  ? 60.017 46.227 24.698  1.00 24.59 ? 25  ASP B CB    1 
ATOM   2747 C  CG    . ASP B 1 49  ? 59.304 46.847 25.885  1.00 27.76 ? 25  ASP B CG    1 
ATOM   2748 O  OD1   . ASP B 1 49  ? 58.741 47.956 25.764  1.00 28.93 ? 25  ASP B OD1   1 
ATOM   2749 O  OD2   . ASP B 1 49  ? 59.327 46.214 26.957  1.00 32.17 ? 25  ASP B OD2   1 
ATOM   2750 N  N     . ASN B 1 50  ? 60.304 45.341 21.609  1.00 21.16 ? 26  ASN B N     1 
ATOM   2751 C  CA    . ASN B 1 50  ? 61.188 44.760 20.602  1.00 21.39 ? 26  ASN B CA    1 
ATOM   2752 C  C     . ASN B 1 50  ? 60.760 45.042 19.171  1.00 20.88 ? 26  ASN B C     1 
ATOM   2753 O  O     . ASN B 1 50  ? 61.326 44.473 18.229  1.00 23.73 ? 26  ASN B O     1 
ATOM   2754 C  CB    . ASN B 1 50  ? 61.347 43.264 20.845  1.00 20.56 ? 26  ASN B CB    1 
ATOM   2755 C  CG    . ASN B 1 50  ? 62.173 42.989 22.075  1.00 21.23 ? 26  ASN B CG    1 
ATOM   2756 O  OD1   . ASN B 1 50  ? 63.399 43.140 22.058  1.00 23.68 ? 26  ASN B OD1   1 
ATOM   2757 N  ND2   . ASN B 1 50  ? 61.506 42.619 23.168  1.00 22.04 ? 26  ASN B ND2   1 
ATOM   2758 N  N     . GLN B 1 51  ? 59.749 45.900 19.023  1.00 23.53 ? 27  GLN B N     1 
ATOM   2759 C  CA    . GLN B 1 51  ? 59.264 46.359 17.718  1.00 22.98 ? 27  GLN B CA    1 
ATOM   2760 C  C     . GLN B 1 51  ? 58.915 45.184 16.789  1.00 21.90 ? 27  GLN B C     1 
ATOM   2761 O  O     . GLN B 1 51  ? 59.245 45.171 15.594  1.00 25.75 ? 27  GLN B O     1 
ATOM   2762 C  CB    . GLN B 1 51  ? 60.264 47.345 17.094  1.00 27.01 ? 27  GLN B CB    1 
ATOM   2763 C  CG    . GLN B 1 51  ? 60.398 48.620 17.919  1.00 29.17 ? 27  GLN B CG    1 
ATOM   2764 C  CD    . GLN B 1 51  ? 61.332 49.654 17.317  1.00 39.79 ? 27  GLN B CD    1 
ATOM   2765 O  OE1   . GLN B 1 51  ? 62.136 49.355 16.433  1.00 48.46 ? 27  GLN B OE1   1 
ATOM   2766 N  NE2   . GLN B 1 51  ? 61.233 50.885 17.807  1.00 46.30 ? 27  GLN B NE2   1 
ATOM   2767 N  N     . ILE B 1 52  ? 58.225 44.206 17.369  1.00 18.15 ? 28  ILE B N     1 
ATOM   2768 C  CA    . ILE B 1 52  ? 57.720 43.032 16.657  1.00 18.21 ? 28  ILE B CA    1 
ATOM   2769 C  C     . ILE B 1 52  ? 56.283 43.329 16.268  1.00 18.61 ? 28  ILE B C     1 
ATOM   2770 O  O     . ILE B 1 52  ? 55.462 43.648 17.123  1.00 21.67 ? 28  ILE B O     1 
ATOM   2771 C  CB    . ILE B 1 52  ? 57.767 41.765 17.571  1.00 17.05 ? 28  ILE B CB    1 
ATOM   2772 C  CG1   . ILE B 1 52  ? 59.213 41.408 17.970  1.00 18.35 ? 28  ILE B CG1   1 
ATOM   2773 C  CG2   . ILE B 1 52  ? 57.077 40.573 16.908  1.00 18.47 ? 28  ILE B CG2   1 
ATOM   2774 C  CD1   . ILE B 1 52  ? 59.342 40.403 19.110  1.00 17.11 ? 28  ILE B CD1   1 
ATOM   2775 N  N     . THR B 1 53  ? 55.969 43.256 14.979  1.00 19.00 ? 29  THR B N     1 
ATOM   2776 C  CA    . THR B 1 53  ? 54.606 43.498 14.539  1.00 18.43 ? 29  THR B CA    1 
ATOM   2777 C  C     . THR B 1 53  ? 53.730 42.314 14.983  1.00 19.13 ? 29  THR B C     1 
ATOM   2778 O  O     . THR B 1 53  ? 53.980 41.161 14.608  1.00 19.61 ? 29  THR B O     1 
ATOM   2779 C  CB    . THR B 1 53  ? 54.544 43.708 13.005  1.00 18.81 ? 29  THR B CB    1 
ATOM   2780 O  OG1   . THR B 1 53  ? 55.355 44.834 12.638  1.00 22.99 ? 29  THR B OG1   1 
ATOM   2781 C  CG2   . THR B 1 53  ? 53.110 43.949 12.538  1.00 20.35 ? 29  THR B CG2   1 
ATOM   2782 N  N     . LYS B 1 54  ? 52.714 42.609 15.797  1.00 20.75 ? 30  LYS B N     1 
ATOM   2783 C  CA    . LYS B 1 54  ? 51.839 41.575 16.335  1.00 19.28 ? 30  LYS B CA    1 
ATOM   2784 C  C     . LYS B 1 54  ? 51.047 40.867 15.231  1.00 18.50 ? 30  LYS B C     1 
ATOM   2785 O  O     . LYS B 1 54  ? 50.554 41.500 14.294  1.00 20.30 ? 30  LYS B O     1 
ATOM   2786 C  CB    . LYS B 1 54  ? 50.887 42.144 17.400  1.00 20.83 ? 30  LYS B CB    1 
ATOM   2787 C  CG    . LYS B 1 54  ? 50.060 41.077 18.109  1.00 19.74 ? 30  LYS B CG    1 
ATOM   2788 C  CD    . LYS B 1 54  ? 49.354 41.600 19.356  1.00 22.31 ? 30  LYS B CD    1 
ATOM   2789 C  CE    . LYS B 1 54  ? 48.447 40.521 19.934  1.00 23.31 ? 30  LYS B CE    1 
ATOM   2790 N  NZ    . LYS B 1 54  ? 47.741 40.989 21.167  1.00 23.34 ? 30  LYS B NZ    1 
ATOM   2791 N  N     . ALA B 1 55  ? 50.954 39.545 15.365  1.00 17.76 ? 31  ALA B N     1 
ATOM   2792 C  CA    . ALA B 1 55  ? 50.168 38.671 14.483  1.00 17.42 ? 31  ALA B CA    1 
ATOM   2793 C  C     . ALA B 1 55  ? 50.733 38.490 13.084  1.00 15.98 ? 31  ALA B C     1 
ATOM   2794 O  O     . ALA B 1 55  ? 50.103 37.859 12.237  1.00 18.18 ? 31  ALA B O     1 
ATOM   2795 C  CB    . ALA B 1 55  ? 48.693 39.095 14.423  1.00 18.04 ? 31  ALA B CB    1 
ATOM   2796 N  N     . ALA B 1 56  ? 51.948 38.989 12.869  1.00 16.31 ? 32  ALA B N     1 
ATOM   2797 C  CA    . ALA B 1 56  ? 52.519 38.994 11.523  1.00 15.73 ? 32  ALA B CA    1 
ATOM   2798 C  C     . ALA B 1 56  ? 53.786 38.143 11.457  1.00 15.64 ? 32  ALA B C     1 
ATOM   2799 O  O     . ALA B 1 56  ? 54.346 37.728 12.480  1.00 16.28 ? 32  ALA B O     1 
ATOM   2800 C  CB    . ALA B 1 56  ? 52.817 40.428 11.101  1.00 18.56 ? 32  ALA B CB    1 
HETATM 2801 N  N     . MSE B 1 57  ? 54.198 37.855 10.220  1.00 15.55 ? 33  MSE B N     1 
HETATM 2802 C  CA    . MSE B 1 57  ? 55.483 37.242 9.953   1.00 15.43 ? 33  MSE B CA    1 
HETATM 2803 C  C     . MSE B 1 57  ? 56.463 38.372 9.732   1.00 16.15 ? 33  MSE B C     1 
HETATM 2804 O  O     . MSE B 1 57  ? 56.324 39.143 8.761   1.00 17.09 ? 33  MSE B O     1 
HETATM 2805 C  CB    . MSE B 1 57  ? 55.307 36.363 8.715   1.00 17.58 ? 33  MSE B CB    1 
HETATM 2806 C  CG    . MSE B 1 57  ? 56.383 35.314 8.586   1.00 20.52 ? 33  MSE B CG    1 
HETATM 2807 SE SE    . MSE B 1 57  ? 58.057 36.111 7.959   1.00 30.29 ? 33  MSE B SE    1 
HETATM 2808 C  CE    . MSE B 1 57  ? 57.564 36.548 6.112   1.00 18.95 ? 33  MSE B CE    1 
ATOM   2809 N  N     . ASN B 1 58  ? 57.422 38.508 10.654  1.00 15.52 ? 34  ASN B N     1 
ATOM   2810 C  CA    . ASN B 1 58  ? 58.472 39.520 10.607  1.00 14.52 ? 34  ASN B CA    1 
ATOM   2811 C  C     . ASN B 1 58  ? 59.760 38.835 10.144  1.00 15.89 ? 34  ASN B C     1 
ATOM   2812 O  O     . ASN B 1 58  ? 60.308 37.995 10.865  1.00 17.55 ? 34  ASN B O     1 
ATOM   2813 C  CB    . ASN B 1 58  ? 58.729 40.101 12.014  1.00 15.44 ? 34  ASN B CB    1 
ATOM   2814 C  CG    . ASN B 1 58  ? 57.517 40.803 12.616  1.00 17.43 ? 34  ASN B CG    1 
ATOM   2815 O  OD1   . ASN B 1 58  ? 57.459 42.034 12.662  1.00 20.32 ? 34  ASN B OD1   1 
ATOM   2816 N  ND2   . ASN B 1 58  ? 56.566 40.021 13.125  1.00 16.83 ? 34  ASN B ND2   1 
ATOM   2817 N  N     . LEU B 1 59  ? 60.239 39.181 8.949   1.00 15.96 ? 35  LEU B N     1 
ATOM   2818 C  CA    . LEU B 1 59  ? 61.550 38.689 8.500   1.00 14.82 ? 35  LEU B CA    1 
ATOM   2819 C  C     . LEU B 1 59  ? 62.690 39.327 9.274   1.00 17.39 ? 35  LEU B C     1 
ATOM   2820 O  O     . LEU B 1 59  ? 62.688 40.527 9.523   1.00 19.05 ? 35  LEU B O     1 
ATOM   2821 C  CB    . LEU B 1 59  ? 61.744 38.940 7.003   1.00 17.44 ? 35  LEU B CB    1 
ATOM   2822 C  CG    . LEU B 1 59  ? 60.942 38.076 6.041   1.00 19.37 ? 35  LEU B CG    1 
ATOM   2823 C  CD1   . LEU B 1 59  ? 61.066 38.610 4.618   1.00 22.79 ? 35  LEU B CD1   1 
ATOM   2824 C  CD2   . LEU B 1 59  ? 61.386 36.622 6.113   1.00 19.73 ? 35  LEU B CD2   1 
ATOM   2825 N  N     . ILE B 1 60  ? 63.676 38.518 9.630   1.00 17.31 ? 36  ILE B N     1 
ATOM   2826 C  CA    . ILE B 1 60  ? 64.826 39.006 10.387  1.00 19.16 ? 36  ILE B CA    1 
ATOM   2827 C  C     . ILE B 1 60  ? 66.153 38.458 9.836   1.00 19.16 ? 36  ILE B C     1 
ATOM   2828 O  O     . ILE B 1 60  ? 66.203 37.351 9.267   1.00 19.41 ? 36  ILE B O     1 
ATOM   2829 C  CB    . ILE B 1 60  ? 64.694 38.684 11.901  1.00 18.90 ? 36  ILE B CB    1 
ATOM   2830 C  CG1   . ILE B 1 60  ? 64.725 37.168 12.130  1.00 19.54 ? 36  ILE B CG1   1 
ATOM   2831 C  CG2   . ILE B 1 60  ? 63.422 39.303 12.496  1.00 21.92 ? 36  ILE B CG2   1 
ATOM   2832 C  CD1   . ILE B 1 60  ? 64.654 36.735 13.580  1.00 19.95 ? 36  ILE B CD1   1 
ATOM   2833 N  N     . ASP B 1 61  ? 67.222 39.239 9.988   1.00 19.52 ? 37  ASP B N     1 
ATOM   2834 C  CA    . ASP B 1 61  ? 68.551 38.743 9.631   1.00 19.37 ? 37  ASP B CA    1 
ATOM   2835 C  C     . ASP B 1 61  ? 69.218 37.966 10.778  1.00 20.71 ? 37  ASP B C     1 
ATOM   2836 O  O     . ASP B 1 61  ? 68.639 37.815 11.863  1.00 21.64 ? 37  ASP B O     1 
ATOM   2837 C  CB    . ASP B 1 61  ? 69.452 39.867 9.081   1.00 20.28 ? 37  ASP B CB    1 
ATOM   2838 C  CG    . ASP B 1 61  ? 69.791 40.939 10.108  1.00 22.09 ? 37  ASP B CG    1 
ATOM   2839 O  OD1   . ASP B 1 61  ? 69.658 40.719 11.338  1.00 22.94 ? 37  ASP B OD1   1 
ATOM   2840 O  OD2   . ASP B 1 61  ? 70.217 42.034 9.664   1.00 24.90 ? 37  ASP B OD2   1 
ATOM   2841 N  N     . ALA B 1 62  ? 70.431 37.466 10.538  1.00 20.04 ? 38  ALA B N     1 
ATOM   2842 C  CA    . ALA B 1 62  ? 71.117 36.602 11.504  1.00 20.21 ? 38  ALA B CA    1 
ATOM   2843 C  C     . ALA B 1 62  ? 71.376 37.337 12.821  1.00 21.65 ? 38  ALA B C     1 
ATOM   2844 O  O     . ALA B 1 62  ? 71.208 36.762 13.903  1.00 22.93 ? 38  ALA B O     1 
ATOM   2845 C  CB    . ALA B 1 62  ? 72.425 36.078 10.920  1.00 25.98 ? 38  ALA B CB    1 
ATOM   2846 N  N     . GLU B 1 63  ? 71.781 38.605 12.719  1.00 23.65 ? 39  GLU B N     1 
ATOM   2847 C  CA    . GLU B 1 63  ? 72.089 39.425 13.887  1.00 25.53 ? 39  GLU B CA    1 
ATOM   2848 C  C     . GLU B 1 63  ? 70.849 39.666 14.741  1.00 24.59 ? 39  GLU B C     1 
ATOM   2849 O  O     . GLU B 1 63  ? 70.902 39.521 15.969  1.00 23.33 ? 39  GLU B O     1 
ATOM   2850 C  CB    . GLU B 1 63  ? 72.722 40.760 13.471  1.00 28.53 ? 39  GLU B CB    1 
ATOM   2851 C  CG    . GLU B 1 63  ? 72.988 41.718 14.629  1.00 33.80 ? 39  GLU B CG    1 
ATOM   2852 C  CD    . GLU B 1 63  ? 73.651 43.026 14.219  1.00 42.23 ? 39  GLU B CD    1 
ATOM   2853 O  OE1   . GLU B 1 63  ? 73.782 43.316 13.009  1.00 46.20 ? 39  GLU B OE1   1 
ATOM   2854 O  OE2   . GLU B 1 63  ? 74.042 43.777 15.132  1.00 45.98 ? 39  GLU B OE2   1 
ATOM   2855 N  N     . ARG B 1 64  ? 69.739 40.020 14.092  1.00 21.68 ? 40  ARG B N     1 
ATOM   2856 C  CA    . ARG B 1 64  ? 68.479 40.223 14.812  1.00 20.98 ? 40  ARG B CA    1 
ATOM   2857 C  C     . ARG B 1 64  ? 67.973 38.921 15.426  1.00 20.84 ? 40  ARG B C     1 
ATOM   2858 O  O     . ARG B 1 64  ? 67.418 38.922 16.527  1.00 20.27 ? 40  ARG B O     1 
ATOM   2859 C  CB    . ARG B 1 64  ? 67.409 40.853 13.920  1.00 20.39 ? 40  ARG B CB    1 
ATOM   2860 C  CG    . ARG B 1 64  ? 66.083 41.042 14.648  1.00 23.95 ? 40  ARG B CG    1 
ATOM   2861 C  CD    . ARG B 1 64  ? 65.289 42.249 14.191  1.00 27.94 ? 40  ARG B CD    1 
ATOM   2862 N  NE    . ARG B 1 64  ? 63.974 42.266 14.829  1.00 29.59 ? 40  ARG B NE    1 
ATOM   2863 C  CZ    . ARG B 1 64  ? 63.689 42.828 16.004  1.00 31.73 ? 40  ARG B CZ    1 
ATOM   2864 N  NH1   . ARG B 1 64  ? 64.625 43.454 16.717  1.00 34.89 ? 40  ARG B NH1   1 
ATOM   2865 N  NH2   . ARG B 1 64  ? 62.446 42.762 16.468  1.00 28.70 ? 40  ARG B NH2   1 
ATOM   2866 N  N     . ALA B 1 65  ? 68.164 37.810 14.720  1.00 18.74 ? 41  ALA B N     1 
ATOM   2867 C  CA    . ALA B 1 65  ? 67.812 36.503 15.278  1.00 18.13 ? 41  ALA B CA    1 
ATOM   2868 C  C     . ALA B 1 65  ? 68.536 36.254 16.602  1.00 19.27 ? 41  ALA B C     1 
ATOM   2869 O  O     . ALA B 1 65  ? 67.909 35.867 17.583  1.00 20.32 ? 41  ALA B O     1 
ATOM   2870 C  CB    . ALA B 1 65  ? 68.092 35.386 14.279  1.00 18.24 ? 41  ALA B CB    1 
ATOM   2871 N  N     . GLU B 1 66  ? 69.851 36.482 16.628  1.00 19.59 ? 42  GLU B N     1 
ATOM   2872 C  CA    . GLU B 1 66  ? 70.650 36.313 17.840  1.00 20.22 ? 42  GLU B CA    1 
ATOM   2873 C  C     . GLU B 1 66  ? 70.143 37.232 18.946  1.00 20.24 ? 42  GLU B C     1 
ATOM   2874 O  O     . GLU B 1 66  ? 69.996 36.804 20.098  1.00 22.31 ? 42  GLU B O     1 
ATOM   2875 C  CB    . GLU B 1 66  ? 72.133 36.582 17.558  1.00 24.86 ? 42  GLU B CB    1 
ATOM   2876 C  CG    . GLU B 1 66  ? 72.797 35.566 16.637  1.00 32.13 ? 42  GLU B CG    1 
ATOM   2877 C  CD    . GLU B 1 66  ? 73.493 34.448 17.389  1.00 42.94 ? 42  GLU B CD    1 
ATOM   2878 O  OE1   . GLU B 1 66  ? 74.117 34.728 18.438  1.00 51.61 ? 42  GLU B OE1   1 
ATOM   2879 O  OE2   . GLU B 1 66  ? 73.427 33.288 16.928  1.00 48.28 ? 42  GLU B OE2   1 
ATOM   2880 N  N     . LEU B 1 67  ? 69.871 38.485 18.589  1.00 21.69 ? 43  LEU B N     1 
ATOM   2881 C  CA    . LEU B 1 67  ? 69.362 39.474 19.538  1.00 21.87 ? 43  LEU B CA    1 
ATOM   2882 C  C     . LEU B 1 67  ? 68.021 39.055 20.139  1.00 19.14 ? 43  LEU B C     1 
ATOM   2883 O  O     . LEU B 1 67  ? 67.886 39.025 21.364  1.00 19.36 ? 43  LEU B O     1 
ATOM   2884 C  CB    . LEU B 1 67  ? 69.263 40.869 18.894  1.00 24.57 ? 43  LEU B CB    1 
ATOM   2885 C  CG    . LEU B 1 67  ? 68.864 42.095 19.743  1.00 27.33 ? 43  LEU B CG    1 
ATOM   2886 C  CD1   . LEU B 1 67  ? 67.382 42.123 20.102  1.00 26.72 ? 43  LEU B CD1   1 
ATOM   2887 C  CD2   . LEU B 1 67  ? 69.719 42.290 20.989  1.00 32.10 ? 43  LEU B CD2   1 
ATOM   2888 N  N     . LEU B 1 68  ? 67.042 38.728 19.303  1.00 20.06 ? 44  LEU B N     1 
ATOM   2889 C  CA    . LEU B 1 68  ? 65.718 38.362 19.826  1.00 18.84 ? 44  LEU B CA    1 
ATOM   2890 C  C     . LEU B 1 68  ? 65.771 37.096 20.690  1.00 20.25 ? 44  LEU B C     1 
ATOM   2891 O  O     . LEU B 1 68  ? 65.141 37.025 21.747  1.00 20.98 ? 44  LEU B O     1 
ATOM   2892 C  CB    . LEU B 1 68  ? 64.690 38.196 18.706  1.00 19.81 ? 44  LEU B CB    1 
ATOM   2893 C  CG    . LEU B 1 68  ? 64.054 39.425 18.063  1.00 24.19 ? 44  LEU B CG    1 
ATOM   2894 C  CD1   . LEU B 1 68  ? 63.109 38.965 16.965  1.00 26.03 ? 44  LEU B CD1   1 
ATOM   2895 C  CD2   . LEU B 1 68  ? 63.316 40.262 19.096  1.00 28.46 ? 44  LEU B CD2   1 
ATOM   2896 N  N     . TYR B 1 69  ? 66.536 36.106 20.245  1.00 18.70 ? 45  TYR B N     1 
ATOM   2897 C  CA    . TYR B 1 69  ? 66.689 34.868 20.994  1.00 17.20 ? 45  TYR B CA    1 
ATOM   2898 C  C     . TYR B 1 69  ? 67.246 35.174 22.389  1.00 17.62 ? 45  TYR B C     1 
ATOM   2899 O  O     . TYR B 1 69  ? 66.819 34.568 23.372  1.00 17.99 ? 45  TYR B O     1 
ATOM   2900 C  CB    . TYR B 1 69  ? 67.598 33.902 20.242  1.00 19.10 ? 45  TYR B CB    1 
ATOM   2901 C  CG    . TYR B 1 69  ? 67.515 32.465 20.691  1.00 16.90 ? 45  TYR B CG    1 
ATOM   2902 C  CD1   . TYR B 1 69  ? 66.281 31.848 20.966  1.00 18.19 ? 45  TYR B CD1   1 
ATOM   2903 C  CD2   . TYR B 1 69  ? 68.672 31.686 20.794  1.00 17.35 ? 45  TYR B CD2   1 
ATOM   2904 C  CE1   . TYR B 1 69  ? 66.214 30.504 21.353  1.00 17.23 ? 45  TYR B CE1   1 
ATOM   2905 C  CE2   . TYR B 1 69  ? 68.615 30.345 21.167  1.00 18.93 ? 45  TYR B CE2   1 
ATOM   2906 C  CZ    . TYR B 1 69  ? 67.385 29.755 21.448  1.00 17.07 ? 45  TYR B CZ    1 
ATOM   2907 O  OH    . TYR B 1 69  ? 67.337 28.420 21.821  1.00 19.69 ? 45  TYR B OH    1 
ATOM   2908 N  N     . SER B 1 70  ? 68.185 36.122 22.487  1.00 19.03 ? 46  SER B N     1 
ATOM   2909 C  CA    . SER B 1 70  ? 68.798 36.467 23.775  1.00 21.52 ? 46  SER B CA    1 
ATOM   2910 C  C     . SER B 1 70  ? 67.776 37.028 24.762  1.00 20.20 ? 46  SER B C     1 
ATOM   2911 O  O     . SER B 1 70  ? 67.975 36.958 25.987  1.00 23.27 ? 46  SER B O     1 
ATOM   2912 C  CB    . SER B 1 70  ? 69.984 37.429 23.592  1.00 21.44 ? 46  SER B CB    1 
ATOM   2913 O  OG    . SER B 1 70  ? 69.575 38.777 23.390  1.00 23.46 ? 46  SER B OG    1 
ATOM   2914 N  N     . ARG B 1 71  ? 66.691 37.585 24.222  1.00 20.07 ? 47  ARG B N     1 
ATOM   2915 C  CA    . ARG B 1 71  ? 65.629 38.162 25.034  1.00 20.31 ? 47  ARG B CA    1 
ATOM   2916 C  C     . ARG B 1 71  ? 64.444 37.237 25.240  1.00 20.90 ? 47  ARG B C     1 
ATOM   2917 O  O     . ARG B 1 71  ? 63.562 37.537 26.046  1.00 22.81 ? 47  ARG B O     1 
ATOM   2918 C  CB    . ARG B 1 71  ? 65.157 39.473 24.427  1.00 19.05 ? 47  ARG B CB    1 
ATOM   2919 C  CG    . ARG B 1 71  ? 66.280 40.482 24.322  1.00 20.25 ? 47  ARG B CG    1 
ATOM   2920 C  CD    . ARG B 1 71  ? 65.786 41.793 23.766  1.00 20.70 ? 47  ARG B CD    1 
ATOM   2921 N  NE    . ARG B 1 71  ? 66.828 42.803 23.838  1.00 22.84 ? 47  ARG B NE    1 
ATOM   2922 C  CZ    . ARG B 1 71  ? 66.597 44.103 23.736  1.00 23.97 ? 47  ARG B CZ    1 
ATOM   2923 N  NH1   . ARG B 1 71  ? 65.356 44.551 23.560  1.00 26.41 ? 47  ARG B NH1   1 
ATOM   2924 N  NH2   . ARG B 1 71  ? 67.603 44.958 23.825  1.00 24.16 ? 47  ARG B NH2   1 
HETATM 2925 N  N     . MSE B 1 72  ? 64.414 36.133 24.497  1.00 18.84 ? 48  MSE B N     1 
HETATM 2926 C  CA    . MSE B 1 72  ? 63.299 35.208 24.546  1.00 18.34 ? 48  MSE B CA    1 
HETATM 2927 C  C     . MSE B 1 72  ? 63.427 34.328 25.761  1.00 18.35 ? 48  MSE B C     1 
HETATM 2928 O  O     . MSE B 1 72  ? 64.529 33.938 26.160  1.00 19.23 ? 48  MSE B O     1 
HETATM 2929 C  CB    . MSE B 1 72  ? 63.342 34.345 23.301  1.00 19.86 ? 48  MSE B CB    1 
HETATM 2930 C  CG    . MSE B 1 72  ? 62.145 33.408 23.236  1.00 25.62 ? 48  MSE B CG    1 
HETATM 2931 SE SE    . MSE B 1 72  ? 62.378 32.436 21.561  1.00 39.98 ? 48  MSE B SE    1 
HETATM 2932 C  CE    . MSE B 1 72  ? 60.514 32.461 20.934  1.00 27.03 ? 48  MSE B CE    1 
ATOM   2933 N  N     . GLY B 1 73  ? 62.281 34.005 26.352  1.00 19.03 ? 49  GLY B N     1 
ATOM   2934 C  CA    . GLY B 1 73  ? 62.229 33.095 27.478  1.00 19.13 ? 49  GLY B CA    1 
ATOM   2935 C  C     . GLY B 1 73  ? 62.515 31.653 27.079  1.00 18.09 ? 49  GLY B C     1 
ATOM   2936 O  O     . GLY B 1 73  ? 62.765 31.354 25.893  1.00 19.27 ? 49  GLY B O     1 
ATOM   2937 N  N     . PRO B 1 74  ? 62.470 30.733 28.053  1.00 17.44 ? 50  PRO B N     1 
ATOM   2938 C  CA    . PRO B 1 74  ? 62.571 29.305 27.746  1.00 18.86 ? 50  PRO B CA    1 
ATOM   2939 C  C     . PRO B 1 74  ? 61.552 28.922 26.680  1.00 19.14 ? 50  PRO B C     1 
ATOM   2940 O  O     . PRO B 1 74  ? 60.412 29.401 26.710  1.00 20.02 ? 50  PRO B O     1 
ATOM   2941 C  CB    . PRO B 1 74  ? 62.220 28.645 29.078  1.00 20.13 ? 50  PRO B CB    1 
ATOM   2942 C  CG    . PRO B 1 74  ? 62.634 29.638 30.099  1.00 20.55 ? 50  PRO B CG    1 
ATOM   2943 C  CD    . PRO B 1 74  ? 62.335 30.980 29.501  1.00 19.62 ? 50  PRO B CD    1 
ATOM   2944 N  N     . ALA B 1 75  ? 61.965 28.065 25.747  1.00 18.47 ? 51  ALA B N     1 
ATOM   2945 C  CA    . ALA B 1 75  ? 61.169 27.793 24.550  1.00 17.15 ? 51  ALA B CA    1 
ATOM   2946 C  C     . ALA B 1 75  ? 61.011 26.299 24.295  1.00 17.88 ? 51  ALA B C     1 
ATOM   2947 O  O     . ALA B 1 75  ? 61.693 25.474 24.922  1.00 19.77 ? 51  ALA B O     1 
ATOM   2948 C  CB    . ALA B 1 75  ? 61.798 28.484 23.346  1.00 18.06 ? 51  ALA B CB    1 
ATOM   2949 N  N     . LEU B 1 76  ? 60.091 25.968 23.392  1.00 14.36 ? 52  LEU B N     1 
ATOM   2950 C  CA    . LEU B 1 76  ? 59.950 24.624 22.861  1.00 15.84 ? 52  LEU B CA    1 
ATOM   2951 C  C     . LEU B 1 76  ? 60.205 24.710 21.369  1.00 14.69 ? 52  LEU B C     1 
ATOM   2952 O  O     . LEU B 1 76  ? 59.942 25.743 20.736  1.00 16.58 ? 52  LEU B O     1 
ATOM   2953 C  CB    . LEU B 1 76  ? 58.540 24.091 23.084  1.00 22.38 ? 52  LEU B CB    1 
ATOM   2954 C  CG    . LEU B 1 76  ? 57.971 24.071 24.501  1.00 26.74 ? 52  LEU B CG    1 
ATOM   2955 C  CD1   . LEU B 1 76  ? 56.467 23.880 24.411  1.00 34.10 ? 52  LEU B CD1   1 
ATOM   2956 C  CD2   . LEU B 1 76  ? 58.615 22.999 25.369  1.00 34.12 ? 52  LEU B CD2   1 
ATOM   2957 N  N     . GLU B 1 77  ? 60.728 23.626 20.809  1.00 15.25 ? 53  GLU B N     1 
ATOM   2958 C  CA    . GLU B 1 77  ? 60.902 23.556 19.366  1.00 15.30 ? 53  GLU B CA    1 
ATOM   2959 C  C     . GLU B 1 77  ? 59.970 22.554 18.731  1.00 14.29 ? 53  GLU B C     1 
ATOM   2960 O  O     . GLU B 1 77  ? 59.729 21.478 19.273  1.00 16.03 ? 53  GLU B O     1 
ATOM   2961 C  CB    . GLU B 1 77  ? 62.351 23.249 18.966  1.00 15.84 ? 53  GLU B CB    1 
ATOM   2962 C  CG    . GLU B 1 77  ? 63.354 24.319 19.358  1.00 16.13 ? 53  GLU B CG    1 
ATOM   2963 C  CD    . GLU B 1 77  ? 63.535 24.436 20.864  1.00 15.35 ? 53  GLU B CD    1 
ATOM   2964 O  OE1   . GLU B 1 77  ? 63.468 25.562 21.377  1.00 18.71 ? 53  GLU B OE1   1 
ATOM   2965 O  OE2   . GLU B 1 77  ? 63.708 23.397 21.531  1.00 17.35 ? 53  GLU B OE2   1 
ATOM   2966 N  N     . ALA B 1 78  ? 59.481 22.909 17.550  1.00 13.46 ? 54  ALA B N     1 
ATOM   2967 C  CA    . ALA B 1 78  ? 58.600 22.044 16.788  1.00 13.48 ? 54  ALA B CA    1 
ATOM   2968 C  C     . ALA B 1 78  ? 58.739 22.375 15.330  1.00 13.01 ? 54  ALA B C     1 
ATOM   2969 O  O     . ALA B 1 78  ? 58.763 23.553 14.972  1.00 14.46 ? 54  ALA B O     1 
ATOM   2970 C  CB    . ALA B 1 78  ? 57.147 22.234 17.210  1.00 16.69 ? 54  ALA B CB    1 
ATOM   2971 N  N     . SER B 1 79  ? 58.789 21.344 14.495  1.00 12.82 ? 55  SER B N     1 
ATOM   2972 C  CA    . SER B 1 79  ? 58.805 21.564 13.047  1.00 13.60 ? 55  SER B CA    1 
ATOM   2973 C  C     . SER B 1 79  ? 57.637 22.436 12.609  1.00 15.47 ? 55  SER B C     1 
ATOM   2974 O  O     . SER B 1 79  ? 56.479 22.226 13.037  1.00 16.75 ? 55  SER B O     1 
ATOM   2975 C  CB    . SER B 1 79  ? 58.809 20.235 12.277  1.00 16.46 ? 55  SER B CB    1 
ATOM   2976 O  OG    . SER B 1 79  ? 60.065 19.598 12.383  1.00 18.99 ? 55  SER B OG    1 
ATOM   2977 N  N     . GLY B 1 80  ? 57.945 23.390 11.729  1.00 15.11 ? 56  GLY B N     1 
ATOM   2978 C  CA    . GLY B 1 80  ? 56.991 24.370 11.234  1.00 15.95 ? 56  GLY B CA    1 
ATOM   2979 C  C     . GLY B 1 80  ? 57.012 24.494 9.717   1.00 12.27 ? 56  GLY B C     1 
ATOM   2980 O  O     . GLY B 1 80  ? 57.129 23.499 8.998   1.00 14.17 ? 56  GLY B O     1 
ATOM   2981 N  N     . GLY B 1 81  ? 56.942 25.728 9.246   1.00 12.37 ? 57  GLY B N     1 
ATOM   2982 C  CA    . GLY B 1 81  ? 56.810 26.007 7.825   1.00 13.73 ? 57  GLY B CA    1 
ATOM   2983 C  C     . GLY B 1 81  ? 55.339 25.887 7.449   1.00 12.85 ? 57  GLY B C     1 
ATOM   2984 O  O     . GLY B 1 81  ? 54.740 24.838 7.606   1.00 14.55 ? 57  GLY B O     1 
ATOM   2985 N  N     . SER B 1 82  ? 54.753 26.967 6.956   1.00 13.21 ? 58  SER B N     1 
ATOM   2986 C  CA    A SER B 1 82  ? 53.330 26.975 6.638   0.50 12.96 ? 58  SER B CA    1 
ATOM   2987 C  CA    B SER B 1 82  ? 53.321 26.980 6.612   0.50 13.35 ? 58  SER B CA    1 
ATOM   2988 C  C     . SER B 1 82  ? 52.889 25.780 5.762   1.00 13.71 ? 58  SER B C     1 
ATOM   2989 O  O     . SER B 1 82  ? 52.021 24.985 6.155   1.00 13.26 ? 58  SER B O     1 
ATOM   2990 C  CB    A SER B 1 82  ? 52.961 28.312 6.002   0.50 14.17 ? 58  SER B CB    1 
ATOM   2991 C  CB    B SER B 1 82  ? 52.957 28.282 5.900   0.50 16.57 ? 58  SER B CB    1 
ATOM   2992 O  OG    A SER B 1 82  ? 51.587 28.337 5.690   0.50 13.61 ? 58  SER B OG    1 
ATOM   2993 O  OG    B SER B 1 82  ? 52.591 29.280 6.823   0.50 20.44 ? 58  SER B OG    1 
ATOM   2994 N  N     . ALA B 1 83  ? 53.504 25.628 4.594   1.00 14.61 ? 59  ALA B N     1 
ATOM   2995 C  CA    . ALA B 1 83  ? 53.195 24.511 3.711   1.00 13.57 ? 59  ALA B CA    1 
ATOM   2996 C  C     . ALA B 1 83  ? 53.589 23.149 4.281   1.00 13.49 ? 59  ALA B C     1 
ATOM   2997 O  O     . ALA B 1 83  ? 52.939 22.162 3.984   1.00 14.92 ? 59  ALA B O     1 
ATOM   2998 C  CB    . ALA B 1 83  ? 53.859 24.714 2.363   1.00 14.97 ? 59  ALA B CB    1 
ATOM   2999 N  N     . GLY B 1 84  ? 54.665 23.098 5.073   1.00 13.88 ? 60  GLY B N     1 
ATOM   3000 C  CA    . GLY B 1 84  ? 55.047 21.875 5.787   1.00 13.91 ? 60  GLY B CA    1 
ATOM   3001 C  C     . GLY B 1 84  ? 53.906 21.425 6.697   1.00 13.49 ? 60  GLY B C     1 
ATOM   3002 O  O     . GLY B 1 84  ? 53.504 20.251 6.675   1.00 14.54 ? 60  GLY B O     1 
ATOM   3003 N  N     . ASN B 1 85  ? 53.379 22.370 7.472   1.00 14.01 ? 61  ASN B N     1 
ATOM   3004 C  CA    . ASN B 1 85  ? 52.228 22.089 8.352   1.00 13.86 ? 61  ASN B CA    1 
ATOM   3005 C  C     . ASN B 1 85  ? 51.029 21.605 7.554   1.00 13.26 ? 61  ASN B C     1 
ATOM   3006 O  O     . ASN B 1 85  ? 50.379 20.620 7.915   1.00 14.65 ? 61  ASN B O     1 
ATOM   3007 C  CB    . ASN B 1 85  ? 51.825 23.334 9.145   1.00 13.07 ? 61  ASN B CB    1 
ATOM   3008 C  CG    . ASN B 1 85  ? 52.946 23.864 10.035  1.00 14.32 ? 61  ASN B CG    1 
ATOM   3009 O  OD1   . ASN B 1 85  ? 53.818 23.121 10.467  1.00 14.60 ? 61  ASN B OD1   1 
ATOM   3010 N  ND2   . ASN B 1 85  ? 52.909 25.161 10.325  1.00 13.80 ? 61  ASN B ND2   1 
ATOM   3011 N  N     . THR B 1 86  ? 50.757 22.260 6.423   1.00 13.83 ? 62  THR B N     1 
ATOM   3012 C  CA    . THR B 1 86  ? 49.633 21.859 5.574   1.00 12.82 ? 62  THR B CA    1 
ATOM   3013 C  C     . THR B 1 86  ? 49.807 20.423 5.052   1.00 13.54 ? 62  THR B C     1 
ATOM   3014 O  O     . THR B 1 86  ? 48.866 19.633 5.097   1.00 13.63 ? 62  THR B O     1 
ATOM   3015 C  CB    . THR B 1 86  ? 49.411 22.864 4.436   1.00 13.80 ? 62  THR B CB    1 
ATOM   3016 O  OG1   . THR B 1 86  ? 48.970 24.098 5.014   1.00 14.63 ? 62  THR B OG1   1 
ATOM   3017 C  CG2   . THR B 1 86  ? 48.356 22.356 3.431   1.00 15.65 ? 62  THR B CG2   1 
ATOM   3018 N  N     . ALA B 1 87  ? 51.007 20.074 4.572   1.00 14.38 ? 63  ALA B N     1 
ATOM   3019 C  CA    . ALA B 1 87  ? 51.272 18.706 4.127   1.00 12.65 ? 63  ALA B CA    1 
ATOM   3020 C  C     . ALA B 1 87  ? 51.070 17.686 5.266   1.00 12.11 ? 63  ALA B C     1 
ATOM   3021 O  O     . ALA B 1 87  ? 50.458 16.633 5.055   1.00 13.56 ? 63  ALA B O     1 
ATOM   3022 C  CB    . ALA B 1 87  ? 52.695 18.594 3.594   1.00 14.06 ? 63  ALA B CB    1 
ATOM   3023 N  N     . ALA B 1 88  ? 51.577 18.019 6.453   1.00 14.11 ? 64  ALA B N     1 
ATOM   3024 C  CA    . ALA B 1 88  ? 51.458 17.141 7.626   1.00 13.44 ? 64  ALA B CA    1 
ATOM   3025 C  C     . ALA B 1 88  ? 49.977 16.928 7.927   1.00 14.73 ? 64  ALA B C     1 
ATOM   3026 O  O     . ALA B 1 88  ? 49.562 15.825 8.244   1.00 15.73 ? 64  ALA B O     1 
ATOM   3027 C  CB    . ALA B 1 88  ? 52.163 17.754 8.836   1.00 15.21 ? 64  ALA B CB    1 
ATOM   3028 N  N     . GLY B 1 89  ? 49.202 18.001 7.829   1.00 14.03 ? 65  GLY B N     1 
ATOM   3029 C  CA    . GLY B 1 89  ? 47.763 17.927 8.099   1.00 15.11 ? 65  GLY B CA    1 
ATOM   3030 C  C     . GLY B 1 89  ? 46.983 17.032 7.155   1.00 15.60 ? 65  GLY B C     1 
ATOM   3031 O  O     . GLY B 1 89  ? 46.086 16.279 7.570   1.00 17.46 ? 65  GLY B O     1 
ATOM   3032 N  N     . VAL B 1 90  ? 47.296 17.132 5.866   1.00 14.10 ? 66  VAL B N     1 
ATOM   3033 C  CA    . VAL B 1 90  ? 46.724 16.248 4.850   1.00 14.26 ? 66  VAL B CA    1 
ATOM   3034 C  C     . VAL B 1 90  ? 47.046 14.781 5.133   1.00 15.02 ? 66  VAL B C     1 
ATOM   3035 O  O     . VAL B 1 90  ? 46.160 13.933 5.079   1.00 17.07 ? 66  VAL B O     1 
ATOM   3036 C  CB    . VAL B 1 90  ? 47.217 16.638 3.441   1.00 15.22 ? 66  VAL B CB    1 
ATOM   3037 C  CG1   . VAL B 1 90  ? 46.845 15.599 2.391   1.00 16.55 ? 66  VAL B CG1   1 
ATOM   3038 C  CG2   . VAL B 1 90  ? 46.722 18.025 3.046   1.00 16.31 ? 66  VAL B CG2   1 
ATOM   3039 N  N     . ALA B 1 91  ? 48.310 14.482 5.433   1.00 13.72 ? 67  ALA B N     1 
ATOM   3040 C  CA    . ALA B 1 91  ? 48.707 13.119 5.800   1.00 14.96 ? 67  ALA B CA    1 
ATOM   3041 C  C     . ALA B 1 91  ? 47.968 12.625 7.054   1.00 16.00 ? 67  ALA B C     1 
ATOM   3042 O  O     . ALA B 1 91  ? 47.477 11.505 7.088   1.00 18.79 ? 67  ALA B O     1 
ATOM   3043 C  CB    . ALA B 1 91  ? 50.209 13.013 5.976   1.00 17.92 ? 67  ALA B CB    1 
ATOM   3044 N  N     . ASN B 1 92  ? 47.865 13.491 8.051   1.00 16.78 ? 68  ASN B N     1 
ATOM   3045 C  CA    . ASN B 1 92  ? 47.185 13.172 9.314   1.00 18.06 ? 68  ASN B CA    1 
ATOM   3046 C  C     . ASN B 1 92  ? 45.721 12.784 9.053   1.00 16.90 ? 68  ASN B C     1 
ATOM   3047 O  O     . ASN B 1 92  ? 45.236 11.757 9.566   1.00 18.61 ? 68  ASN B O     1 
ATOM   3048 C  CB    . ASN B 1 92  ? 47.322 14.362 10.273  1.00 17.72 ? 68  ASN B CB    1 
ATOM   3049 C  CG    . ASN B 1 92  ? 46.769 14.087 11.658  1.00 21.17 ? 68  ASN B CG    1 
ATOM   3050 O  OD1   . ASN B 1 92  ? 45.806 13.346 11.820  1.00 23.01 ? 68  ASN B OD1   1 
ATOM   3051 N  ND2   . ASN B 1 92  ? 47.342 14.739 12.658  1.00 21.24 ? 68  ASN B ND2   1 
ATOM   3052 N  N     . LEU B 1 93  ? 45.050 13.554 8.197   1.00 17.24 ? 69  LEU B N     1 
ATOM   3053 C  CA    . LEU B 1 93  ? 43.670 13.248 7.767   1.00 18.15 ? 69  LEU B CA    1 
ATOM   3054 C  C     . LEU B 1 93  ? 43.532 11.940 6.962   1.00 17.86 ? 69  LEU B C     1 
ATOM   3055 O  O     . LEU B 1 93  ? 42.432 11.406 6.833   1.00 20.30 ? 69  LEU B O     1 
ATOM   3056 C  CB    . LEU B 1 93  ? 43.072 14.416 6.966   1.00 19.06 ? 69  LEU B CB    1 
ATOM   3057 C  CG    . LEU B 1 93  ? 42.569 15.614 7.782   1.00 18.41 ? 69  LEU B CG    1 
ATOM   3058 C  CD1   . LEU B 1 93  ? 42.543 16.890 6.951   1.00 20.01 ? 69  LEU B CD1   1 
ATOM   3059 C  CD2   . LEU B 1 93  ? 41.180 15.344 8.351   1.00 20.85 ? 69  LEU B CD2   1 
ATOM   3060 N  N     . GLY B 1 94  ? 44.636 11.453 6.392   1.00 18.00 ? 70  GLY B N     1 
ATOM   3061 C  CA    . GLY B 1 94  ? 44.623 10.193 5.631   1.00 18.34 ? 70  GLY B CA    1 
ATOM   3062 C  C     . GLY B 1 94  ? 44.870 10.353 4.140   1.00 19.01 ? 70  GLY B C     1 
ATOM   3063 O  O     . GLY B 1 94  ? 44.845 9.382  3.392   1.00 22.38 ? 70  GLY B O     1 
ATOM   3064 N  N     . GLY B 1 95  ? 45.124 11.586 3.715   1.00 17.42 ? 71  GLY B N     1 
ATOM   3065 C  CA    . GLY B 1 95  ? 45.422 11.878 2.307   1.00 16.25 ? 71  GLY B CA    1 
ATOM   3066 C  C     . GLY B 1 95  ? 46.889 11.588 2.042   1.00 16.14 ? 71  GLY B C     1 
ATOM   3067 O  O     . GLY B 1 95  ? 47.665 11.373 2.962   1.00 17.36 ? 71  GLY B O     1 
ATOM   3068 N  N     . LYS B 1 96  ? 47.263 11.597 0.771   1.00 17.24 ? 72  LYS B N     1 
ATOM   3069 C  CA    . LYS B 1 96  ? 48.638 11.289 0.391   1.00 16.47 ? 72  LYS B CA    1 
ATOM   3070 C  C     . LYS B 1 96  ? 49.314 12.592 0.057   1.00 17.08 ? 72  LYS B C     1 
ATOM   3071 O  O     . LYS B 1 96  ? 48.882 13.300 -0.856  1.00 17.74 ? 72  LYS B O     1 
ATOM   3072 C  CB    . LYS B 1 96  ? 48.663 10.342 -0.815  1.00 18.79 ? 72  LYS B CB    1 
ATOM   3073 C  CG    . LYS B 1 96  ? 47.818 9.085  -0.652  1.00 22.20 ? 72  LYS B CG    1 
ATOM   3074 C  CD    . LYS B 1 96  ? 48.521 8.011  0.147   1.00 30.36 ? 72  LYS B CD    1 
ATOM   3075 C  CE    . LYS B 1 96  ? 48.407 8.200  1.642   1.00 34.22 ? 72  LYS B CE    1 
ATOM   3076 N  NZ    . LYS B 1 96  ? 49.016 7.043  2.348   1.00 45.20 ? 72  LYS B NZ    1 
ATOM   3077 N  N     . ALA B 1 97  ? 50.380 12.901 0.793   1.00 16.82 ? 73  ALA B N     1 
ATOM   3078 C  CA    . ALA B 1 97  ? 51.014 14.201 0.651   1.00 15.34 ? 73  ALA B CA    1 
ATOM   3079 C  C     . ALA B 1 97  ? 52.512 14.115 0.342   1.00 14.46 ? 73  ALA B C     1 
ATOM   3080 O  O     . ALA B 1 97  ? 53.173 13.129 0.691   1.00 16.37 ? 73  ALA B O     1 
ATOM   3081 C  CB    . ALA B 1 97  ? 50.780 15.030 1.900   1.00 16.73 ? 73  ALA B CB    1 
ATOM   3082 N  N     . ALA B 1 98  ? 53.013 15.157 -0.328  1.00 15.58 ? 74  ALA B N     1 
ATOM   3083 C  CA    . ALA B 1 98  ? 54.435 15.353 -0.586  1.00 13.86 ? 74  ALA B CA    1 
ATOM   3084 C  C     . ALA B 1 98  ? 54.799 16.807 -0.264  1.00 14.66 ? 74  ALA B C     1 
ATOM   3085 O  O     . ALA B 1 98  ? 53.920 17.687 -0.236  1.00 16.33 ? 74  ALA B O     1 
ATOM   3086 C  CB    . ALA B 1 98  ? 54.743 15.061 -2.050  1.00 15.40 ? 74  ALA B CB    1 
ATOM   3087 N  N     . TYR B 1 99  ? 56.087 17.073 -0.045  1.00 15.67 ? 75  TYR B N     1 
ATOM   3088 C  CA    . TYR B 1 99  ? 56.536 18.412 0.296   1.00 13.70 ? 75  TYR B CA    1 
ATOM   3089 C  C     . TYR B 1 99  ? 57.875 18.723 -0.354  1.00 14.07 ? 75  TYR B C     1 
ATOM   3090 O  O     . TYR B 1 99  ? 58.759 17.863 -0.350  1.00 15.58 ? 75  TYR B O     1 
ATOM   3091 C  CB    . TYR B 1 99  ? 56.688 18.517 1.811   1.00 14.28 ? 75  TYR B CB    1 
ATOM   3092 C  CG    . TYR B 1 99  ? 57.224 19.838 2.306   1.00 14.72 ? 75  TYR B CG    1 
ATOM   3093 C  CD1   . TYR B 1 99  ? 56.441 20.985 2.251   1.00 13.62 ? 75  TYR B CD1   1 
ATOM   3094 C  CD2   . TYR B 1 99  ? 58.516 19.933 2.833   1.00 15.13 ? 75  TYR B CD2   1 
ATOM   3095 C  CE1   . TYR B 1 99  ? 56.916 22.198 2.734   1.00 14.16 ? 75  TYR B CE1   1 
ATOM   3096 C  CE2   . TYR B 1 99  ? 59.016 21.143 3.311   1.00 12.47 ? 75  TYR B CE2   1 
ATOM   3097 C  CZ    . TYR B 1 99  ? 58.216 22.272 3.267   1.00 12.74 ? 75  TYR B CZ    1 
ATOM   3098 O  OH    . TYR B 1 99  ? 58.742 23.454 3.736   1.00 16.00 ? 75  TYR B OH    1 
ATOM   3099 N  N     . PHE B 1 100 ? 58.005 19.939 -0.896  1.00 14.30 ? 76  PHE B N     1 
ATOM   3100 C  CA    . PHE B 1 100 ? 59.308 20.470 -1.309  1.00 13.10 ? 76  PHE B CA    1 
ATOM   3101 C  C     . PHE B 1 100 ? 59.673 21.633 -0.389  1.00 14.26 ? 76  PHE B C     1 
ATOM   3102 O  O     . PHE B 1 100 ? 58.892 22.559 -0.217  1.00 15.28 ? 76  PHE B O     1 
ATOM   3103 C  CB    . PHE B 1 100 ? 59.317 21.028 -2.751  1.00 13.36 ? 76  PHE B CB    1 
ATOM   3104 C  CG    . PHE B 1 100 ? 58.953 20.053 -3.857  1.00 14.10 ? 76  PHE B CG    1 
ATOM   3105 C  CD1   . PHE B 1 100 ? 59.008 18.666 -3.722  1.00 14.73 ? 76  PHE B CD1   1 
ATOM   3106 C  CD2   . PHE B 1 100 ? 58.565 20.577 -5.086  1.00 15.31 ? 76  PHE B CD2   1 
ATOM   3107 C  CE1   . PHE B 1 100 ? 58.663 17.835 -4.790  1.00 15.77 ? 76  PHE B CE1   1 
ATOM   3108 C  CE2   . PHE B 1 100 ? 58.223 19.756 -6.150  1.00 14.43 ? 76  PHE B CE2   1 
ATOM   3109 C  CZ    . PHE B 1 100 ? 58.269 18.387 -6.004  1.00 15.02 ? 76  PHE B CZ    1 
ATOM   3110 N  N     . GLY B 1 101 ? 60.890 21.617 0.136   1.00 15.52 ? 77  GLY B N     1 
ATOM   3111 C  CA    . GLY B 1 101 ? 61.397 22.700 0.973   1.00 14.98 ? 77  GLY B CA    1 
ATOM   3112 C  C     . GLY B 1 101 ? 62.825 22.381 1.355   1.00 14.20 ? 77  GLY B C     1 
ATOM   3113 O  O     . GLY B 1 101 ? 63.174 21.215 1.529   1.00 14.81 ? 77  GLY B O     1 
ATOM   3114 N  N     . ASN B 1 102 ? 63.647 23.412 1.498   1.00 14.96 ? 78  ASN B N     1 
ATOM   3115 C  CA    . ASN B 1 102 ? 65.082 23.201 1.679   1.00 14.83 ? 78  ASN B CA    1 
ATOM   3116 C  C     . ASN B 1 102 ? 65.562 23.511 3.080   1.00 12.96 ? 78  ASN B C     1 
ATOM   3117 O  O     . ASN B 1 102 ? 65.450 24.649 3.546   1.00 15.54 ? 78  ASN B O     1 
ATOM   3118 C  CB    . ASN B 1 102 ? 65.859 24.047 0.683   1.00 15.95 ? 78  ASN B CB    1 
ATOM   3119 C  CG    . ASN B 1 102 ? 67.326 23.656 0.628   1.00 15.54 ? 78  ASN B CG    1 
ATOM   3120 O  OD1   . ASN B 1 102 ? 67.643 22.532 0.264   1.00 16.56 ? 78  ASN B OD1   1 
ATOM   3121 N  ND2   . ASN B 1 102 ? 68.213 24.560 1.031   1.00 17.79 ? 78  ASN B ND2   1 
ATOM   3122 N  N     . VAL B 1 103 ? 66.133 22.499 3.730   1.00 14.63 ? 79  VAL B N     1 
ATOM   3123 C  CA    . VAL B 1 103 ? 66.823 22.669 4.997   1.00 14.48 ? 79  VAL B CA    1 
ATOM   3124 C  C     . VAL B 1 103 ? 68.337 22.582 4.797   1.00 15.28 ? 79  VAL B C     1 
ATOM   3125 O  O     . VAL B 1 103 ? 68.804 22.306 3.679   1.00 17.24 ? 79  VAL B O     1 
ATOM   3126 C  CB    . VAL B 1 103 ? 66.382 21.616 6.036   1.00 15.03 ? 79  VAL B CB    1 
ATOM   3127 C  CG1   . VAL B 1 103 ? 64.894 21.774 6.348   1.00 16.40 ? 79  VAL B CG1   1 
ATOM   3128 C  CG2   . VAL B 1 103 ? 66.708 20.187 5.593   1.00 16.68 ? 79  VAL B CG2   1 
ATOM   3129 N  N     . ALA B 1 104 ? 69.083 22.836 5.864   1.00 16.36 ? 80  ALA B N     1 
ATOM   3130 C  CA    . ALA B 1 104 ? 70.535 22.601 5.869   1.00 15.11 ? 80  ALA B CA    1 
ATOM   3131 C  C     . ALA B 1 104 ? 70.890 21.217 6.430   1.00 16.70 ? 80  ALA B C     1 
ATOM   3132 O  O     . ALA B 1 104 ? 70.077 20.565 7.074   1.00 16.76 ? 80  ALA B O     1 
ATOM   3133 C  CB    . ALA B 1 104 ? 71.240 23.695 6.654   1.00 17.13 ? 80  ALA B CB    1 
ATOM   3134 N  N     . ALA B 1 105 ? 72.117 20.764 6.176   1.00 16.36 ? 81  ALA B N     1 
ATOM   3135 C  CA    . ALA B 1 105 ? 72.633 19.527 6.754   1.00 18.75 ? 81  ALA B CA    1 
ATOM   3136 C  C     . ALA B 1 105 ? 73.109 19.833 8.177   1.00 20.06 ? 81  ALA B C     1 
ATOM   3137 O  O     . ALA B 1 105 ? 74.304 19.898 8.458   1.00 23.29 ? 81  ALA B O     1 
ATOM   3138 C  CB    . ALA B 1 105 ? 73.768 18.984 5.893   1.00 23.74 ? 81  ALA B CB    1 
ATOM   3139 N  N     . ASP B 1 106 ? 72.150 20.060 9.066   1.00 18.96 ? 82  ASP B N     1 
ATOM   3140 C  CA    . ASP B 1 106 ? 72.441 20.351 10.468  1.00 17.15 ? 82  ASP B CA    1 
ATOM   3141 C  C     . ASP B 1 106 ? 71.362 19.707 11.342  1.00 16.82 ? 82  ASP B C     1 
ATOM   3142 O  O     . ASP B 1 106 ? 70.476 19.040 10.827  1.00 17.03 ? 82  ASP B O     1 
ATOM   3143 C  CB    . ASP B 1 106 ? 72.580 21.870 10.717  1.00 17.79 ? 82  ASP B CB    1 
ATOM   3144 C  CG    . ASP B 1 106 ? 71.322 22.674 10.326  1.00 17.70 ? 82  ASP B CG    1 
ATOM   3145 O  OD1   . ASP B 1 106 ? 70.240 22.077 10.097  1.00 18.36 ? 82  ASP B OD1   1 
ATOM   3146 O  OD2   . ASP B 1 106 ? 71.413 23.920 10.252  1.00 18.34 ? 82  ASP B OD2   1 
ATOM   3147 N  N     . GLN B 1 107 ? 71.461 19.889 12.654  1.00 17.51 ? 83  GLN B N     1 
ATOM   3148 C  CA    . GLN B 1 107 ? 70.553 19.208 13.585  1.00 16.96 ? 83  GLN B CA    1 
ATOM   3149 C  C     . GLN B 1 107 ? 69.113 19.670 13.442  1.00 15.27 ? 83  GLN B C     1 
ATOM   3150 O  O     . GLN B 1 107 ? 68.187 18.850 13.499  1.00 16.62 ? 83  GLN B O     1 
ATOM   3151 C  CB    . GLN B 1 107 ? 71.028 19.367 15.020  1.00 16.77 ? 83  GLN B CB    1 
ATOM   3152 C  CG    . GLN B 1 107 ? 72.285 18.558 15.315  1.00 17.59 ? 83  GLN B CG    1 
ATOM   3153 C  CD    . GLN B 1 107 ? 72.945 18.927 16.635  1.00 17.38 ? 83  GLN B CD    1 
ATOM   3154 O  OE1   . GLN B 1 107 ? 72.820 20.059 17.110  1.00 17.30 ? 83  GLN B OE1   1 
ATOM   3155 N  NE2   . GLN B 1 107 ? 73.684 17.980 17.223  1.00 19.79 ? 83  GLN B NE2   1 
ATOM   3156 N  N     . LEU B 1 108 ? 68.918 20.973 13.233  1.00 15.41 ? 84  LEU B N     1 
ATOM   3157 C  CA    . LEU B 1 108 ? 67.563 21.489 12.972  1.00 15.54 ? 84  LEU B CA    1 
ATOM   3158 C  C     . LEU B 1 108 ? 66.951 20.917 11.676  1.00 17.06 ? 84  LEU B C     1 
ATOM   3159 O  O     . LEU B 1 108 ? 65.761 20.632 11.606  1.00 16.60 ? 84  LEU B O     1 
ATOM   3160 C  CB    . LEU B 1 108 ? 67.541 23.014 12.934  1.00 15.71 ? 84  LEU B CB    1 
ATOM   3161 C  CG    . LEU B 1 108 ? 67.734 23.782 14.241  1.00 18.56 ? 84  LEU B CG    1 
ATOM   3162 C  CD1   . LEU B 1 108 ? 67.747 25.282 13.975  1.00 23.62 ? 84  LEU B CD1   1 
ATOM   3163 C  CD2   . LEU B 1 108 ? 66.667 23.409 15.262  1.00 23.44 ? 84  LEU B CD2   1 
ATOM   3164 N  N     . GLY B 1 109 ? 67.779 20.767 10.651  1.00 15.22 ? 85  GLY B N     1 
ATOM   3165 C  CA    . GLY B 1 109 ? 67.353 20.164 9.399   1.00 14.33 ? 85  GLY B CA    1 
ATOM   3166 C  C     . GLY B 1 109 ? 67.010 18.697 9.572   1.00 16.03 ? 85  GLY B C     1 
ATOM   3167 O  O     . GLY B 1 109 ? 66.051 18.203 8.961   1.00 16.55 ? 85  GLY B O     1 
ATOM   3168 N  N     . ASP B 1 110 ? 67.779 18.001 10.416  1.00 16.87 ? 86  ASP B N     1 
ATOM   3169 C  CA    . ASP B 1 110 ? 67.507 16.599 10.748  1.00 16.89 ? 86  ASP B CA    1 
ATOM   3170 C  C     . ASP B 1 110 ? 66.146 16.469 11.453  1.00 15.95 ? 86  ASP B C     1 
ATOM   3171 O  O     . ASP B 1 110 ? 65.369 15.570 11.157  1.00 16.73 ? 86  ASP B O     1 
ATOM   3172 C  CB    . ASP B 1 110 ? 68.611 16.005 11.623  1.00 20.81 ? 86  ASP B CB    1 
ATOM   3173 C  CG    . ASP B 1 110 ? 69.939 15.871 10.893  1.00 23.47 ? 86  ASP B CG    1 
ATOM   3174 O  OD1   . ASP B 1 110 ? 69.962 15.954 9.649   1.00 24.09 ? 86  ASP B OD1   1 
ATOM   3175 O  OD2   . ASP B 1 110 ? 70.960 15.674 11.583  1.00 27.18 ? 86  ASP B OD2   1 
ATOM   3176 N  N     . ILE B 1 111 ? 65.876 17.382 12.382  1.00 15.30 ? 87  ILE B N     1 
ATOM   3177 C  CA    . ILE B 1 111 ? 64.574 17.413 13.065  1.00 14.67 ? 87  ILE B CA    1 
ATOM   3178 C  C     . ILE B 1 111 ? 63.444 17.628 12.056  1.00 16.34 ? 87  ILE B C     1 
ATOM   3179 O  O     . ILE B 1 111 ? 62.459 16.862 12.024  1.00 16.20 ? 87  ILE B O     1 
ATOM   3180 C  CB    . ILE B 1 111 ? 64.539 18.490 14.166  1.00 15.98 ? 87  ILE B CB    1 
ATOM   3181 C  CG1   . ILE B 1 111 ? 65.347 18.047 15.393  1.00 17.81 ? 87  ILE B CG1   1 
ATOM   3182 C  CG2   . ILE B 1 111 ? 63.100 18.797 14.568  1.00 18.04 ? 87  ILE B CG2   1 
ATOM   3183 C  CD1   . ILE B 1 111 ? 65.652 19.181 16.351  1.00 19.82 ? 87  ILE B CD1   1 
ATOM   3184 N  N     . PHE B 1 112 ? 63.589 18.650 11.208  1.00 16.70 ? 88  PHE B N     1 
ATOM   3185 C  CA    . PHE B 1 112 ? 62.555 18.946 10.225  1.00 14.84 ? 88  PHE B CA    1 
ATOM   3186 C  C     . PHE B 1 112 ? 62.288 17.727 9.311   1.00 14.42 ? 88  PHE B C     1 
ATOM   3187 O  O     . PHE B 1 112 ? 61.150 17.316 9.104   1.00 14.42 ? 88  PHE B O     1 
ATOM   3188 C  CB    . PHE B 1 112 ? 62.929 20.160 9.377   1.00 15.57 ? 88  PHE B CB    1 
ATOM   3189 C  CG    . PHE B 1 112 ? 61.833 20.581 8.459   1.00 14.79 ? 88  PHE B CG    1 
ATOM   3190 C  CD1   . PHE B 1 112 ? 61.670 19.945 7.232   1.00 16.10 ? 88  PHE B CD1   1 
ATOM   3191 C  CD2   . PHE B 1 112 ? 60.934 21.585 8.816   1.00 14.76 ? 88  PHE B CD2   1 
ATOM   3192 C  CE1   . PHE B 1 112 ? 60.638 20.288 6.378   1.00 15.57 ? 88  PHE B CE1   1 
ATOM   3193 C  CE2   . PHE B 1 112 ? 59.891 21.932 7.967   1.00 14.60 ? 88  PHE B CE2   1 
ATOM   3194 C  CZ    . PHE B 1 112 ? 59.738 21.286 6.743   1.00 13.57 ? 88  PHE B CZ    1 
ATOM   3195 N  N     . THR B 1 113 ? 63.362 17.154 8.777   1.00 14.48 ? 89  THR B N     1 
ATOM   3196 C  CA    . THR B 1 113 ? 63.275 15.978 7.924   1.00 14.73 ? 89  THR B CA    1 
ATOM   3197 C  C     . THR B 1 113 ? 62.546 14.827 8.621   1.00 14.25 ? 89  THR B C     1 
ATOM   3198 O  O     . THR B 1 113 ? 61.648 14.202 8.022   1.00 15.85 ? 89  THR B O     1 
ATOM   3199 C  CB    . THR B 1 113 ? 64.668 15.541 7.420   1.00 15.16 ? 89  THR B CB    1 
ATOM   3200 O  OG1   . THR B 1 113 ? 65.252 16.619 6.678   1.00 17.61 ? 89  THR B OG1   1 
ATOM   3201 C  CG2   . THR B 1 113 ? 64.556 14.315 6.521   1.00 15.85 ? 89  THR B CG2   1 
ATOM   3202 N  N     . HIS B 1 114 ? 62.884 14.596 9.896   1.00 14.81 ? 90  HIS B N     1 
ATOM   3203 C  CA    . HIS B 1 114 ? 62.313 13.479 10.621  1.00 15.80 ? 90  HIS B CA    1 
ATOM   3204 C  C     . HIS B 1 114 ? 60.819 13.699 10.773  1.00 14.71 ? 90  HIS B C     1 
ATOM   3205 O  O     . HIS B 1 114 ? 60.028 12.789 10.513  1.00 14.85 ? 90  HIS B O     1 
ATOM   3206 C  CB    . HIS B 1 114 ? 62.909 13.289 12.014  1.00 15.75 ? 90  HIS B CB    1 
ATOM   3207 C  CG    . HIS B 1 114 ? 62.037 12.453 12.900  1.00 15.96 ? 90  HIS B CG    1 
ATOM   3208 N  ND1   . HIS B 1 114 ? 62.169 11.084 13.003  1.00 17.45 ? 90  HIS B ND1   1 
ATOM   3209 C  CD2   . HIS B 1 114 ? 60.958 12.786 13.651  1.00 15.71 ? 90  HIS B CD2   1 
ATOM   3210 C  CE1   . HIS B 1 114 ? 61.231 10.616 13.810  1.00 17.20 ? 90  HIS B CE1   1 
ATOM   3211 N  NE2   . HIS B 1 114 ? 60.480 11.627 14.211  1.00 16.60 ? 90  HIS B NE2   1 
ATOM   3212 N  N     . ASP B 1 115 ? 60.447 14.900 11.203  1.00 15.04 ? 91  ASP B N     1 
ATOM   3213 C  CA    . ASP B 1 115 ? 59.053 15.139 11.592  1.00 15.69 ? 91  ASP B CA    1 
ATOM   3214 C  C     . ASP B 1 115 ? 58.082 15.029 10.431  1.00 16.42 ? 91  ASP B C     1 
ATOM   3215 O  O     . ASP B 1 115 ? 56.981 14.472 10.575  1.00 17.76 ? 91  ASP B O     1 
ATOM   3216 C  CB    . ASP B 1 115 ? 58.894 16.492 12.279  1.00 16.55 ? 91  ASP B CB    1 
ATOM   3217 C  CG    . ASP B 1 115 ? 59.554 16.545 13.649  1.00 17.34 ? 91  ASP B CG    1 
ATOM   3218 O  OD1   . ASP B 1 115 ? 59.626 15.501 14.329  1.00 19.35 ? 91  ASP B OD1   1 
ATOM   3219 O  OD2   . ASP B 1 115 ? 60.005 17.640 14.049  1.00 20.90 ? 91  ASP B OD2   1 
ATOM   3220 N  N     . ILE B 1 116 ? 58.471 15.574 9.281   1.00 15.71 ? 92  ILE B N     1 
ATOM   3221 C  CA    . ILE B 1 116 ? 57.583 15.560 8.133   1.00 15.67 ? 92  ILE B CA    1 
ATOM   3222 C  C     . ILE B 1 116 ? 57.480 14.141 7.550   1.00 15.00 ? 92  ILE B C     1 
ATOM   3223 O  O     . ILE B 1 116 ? 56.381 13.670 7.227   1.00 17.50 ? 92  ILE B O     1 
ATOM   3224 C  CB    . ILE B 1 116 ? 57.937 16.661 7.093   1.00 17.00 ? 92  ILE B CB    1 
ATOM   3225 C  CG1   . ILE B 1 116 ? 56.748 16.930 6.151   1.00 19.74 ? 92  ILE B CG1   1 
ATOM   3226 C  CG2   . ILE B 1 116 ? 59.259 16.369 6.369   1.00 16.41 ? 92  ILE B CG2   1 
ATOM   3227 C  CD1   . ILE B 1 116 ? 56.800 18.275 5.453   1.00 20.48 ? 92  ILE B CD1   1 
ATOM   3228 N  N     . ARG B 1 117 ? 58.611 13.439 7.487   1.00 15.66 ? 93  ARG B N     1 
ATOM   3229 C  CA    . ARG B 1 117 ? 58.606 12.074 6.967   1.00 15.98 ? 93  ARG B CA    1 
ATOM   3230 C  C     . ARG B 1 117 ? 57.853 11.145 7.925   1.00 15.95 ? 93  ARG B C     1 
ATOM   3231 O  O     . ARG B 1 117 ? 57.187 10.214 7.488   1.00 17.79 ? 93  ARG B O     1 
ATOM   3232 C  CB    . ARG B 1 117 ? 60.041 11.569 6.724   1.00 16.34 ? 93  ARG B CB    1 
ATOM   3233 C  CG    . ARG B 1 117 ? 60.729 12.284 5.564   1.00 16.73 ? 93  ARG B CG    1 
ATOM   3234 C  CD    . ARG B 1 117 ? 62.066 11.649 5.225   1.00 17.56 ? 93  ARG B CD    1 
ATOM   3235 N  NE    . ARG B 1 117 ? 61.870 10.466 4.392   1.00 21.70 ? 93  ARG B NE    1 
ATOM   3236 C  CZ    . ARG B 1 117 ? 62.737 9.469  4.244   1.00 21.27 ? 93  ARG B CZ    1 
ATOM   3237 N  NH1   . ARG B 1 117 ? 63.901 9.457  4.898   1.00 24.92 ? 93  ARG B NH1   1 
ATOM   3238 N  NH2   . ARG B 1 117 ? 62.420 8.461  3.437   1.00 23.29 ? 93  ARG B NH2   1 
ATOM   3239 N  N     . ALA B 1 118 ? 57.960 11.415 9.228   1.00 17.25 ? 94  ALA B N     1 
ATOM   3240 C  CA    . ALA B 1 118 ? 57.354 10.548 10.247  1.00 17.25 ? 94  ALA B CA    1 
ATOM   3241 C  C     . ALA B 1 118 ? 55.833 10.622 10.194  1.00 18.20 ? 94  ALA B C     1 
ATOM   3242 O  O     . ALA B 1 118 ? 55.158 9.672  10.571  1.00 22.08 ? 94  ALA B O     1 
ATOM   3243 C  CB    . ALA B 1 118 ? 57.830 10.934 11.631  1.00 17.13 ? 94  ALA B CB    1 
ATOM   3244 N  N     . GLN B 1 119 ? 55.314 11.746 9.703   1.00 17.13 ? 95  GLN B N     1 
ATOM   3245 C  CA    . GLN B 1 119 ? 53.880 11.931 9.490   1.00 17.46 ? 95  GLN B CA    1 
ATOM   3246 C  C     . GLN B 1 119 ? 53.370 11.207 8.230   1.00 17.90 ? 95  GLN B C     1 
ATOM   3247 O  O     . GLN B 1 119 ? 52.167 11.134 8.004   1.00 19.30 ? 95  GLN B O     1 
ATOM   3248 C  CB    . GLN B 1 119 ? 53.548 13.427 9.406   1.00 16.87 ? 95  GLN B CB    1 
ATOM   3249 C  CG    . GLN B 1 119 ? 52.071 13.786 9.343   1.00 21.06 ? 95  GLN B CG    1 
ATOM   3250 C  CD    . GLN B 1 119 ? 51.231 13.147 10.436  1.00 25.69 ? 95  GLN B CD    1 
ATOM   3251 O  OE1   . GLN B 1 119 ? 50.490 12.179 10.190  1.00 28.32 ? 95  GLN B OE1   1 
ATOM   3252 N  NE2   . GLN B 1 119 ? 51.333 13.684 11.647  1.00 27.09 ? 95  GLN B NE2   1 
ATOM   3253 N  N     . GLY B 1 120 ? 54.284 10.688 7.417   1.00 18.57 ? 96  GLY B N     1 
ATOM   3254 C  CA    . GLY B 1 120 ? 53.942 9.950  6.207   1.00 17.46 ? 96  GLY B CA    1 
ATOM   3255 C  C     . GLY B 1 120 ? 53.865 10.826 4.975   1.00 16.61 ? 96  GLY B C     1 
ATOM   3256 O  O     . GLY B 1 120 ? 53.194 10.471 4.013   1.00 19.48 ? 96  GLY B O     1 
ATOM   3257 N  N     . VAL B 1 121 ? 54.546 11.973 5.027   1.00 16.03 ? 97  VAL B N     1 
ATOM   3258 C  CA    . VAL B 1 121 ? 54.687 12.868 3.872   1.00 14.66 ? 97  VAL B CA    1 
ATOM   3259 C  C     . VAL B 1 121 ? 55.965 12.538 3.097   1.00 15.94 ? 97  VAL B C     1 
ATOM   3260 O  O     . VAL B 1 121 ? 57.028 12.397 3.686   1.00 18.02 ? 97  VAL B O     1 
ATOM   3261 C  CB    . VAL B 1 121 ? 54.760 14.331 4.331   1.00 15.35 ? 97  VAL B CB    1 
ATOM   3262 C  CG1   . VAL B 1 121 ? 54.920 15.274 3.142   1.00 17.01 ? 97  VAL B CG1   1 
ATOM   3263 C  CG2   . VAL B 1 121 ? 53.506 14.684 5.122   1.00 17.05 ? 97  VAL B CG2   1 
ATOM   3264 N  N     . HIS B 1 122 ? 55.839 12.414 1.773   1.00 15.68 ? 98  HIS B N     1 
ATOM   3265 C  CA    . HIS B 1 122 ? 57.004 12.244 0.910   1.00 16.17 ? 98  HIS B CA    1 
ATOM   3266 C  C     . HIS B 1 122 ? 57.847 13.508 0.989   1.00 15.70 ? 98  HIS B C     1 
ATOM   3267 O  O     . HIS B 1 122 ? 57.372 14.592 0.644   1.00 16.22 ? 98  HIS B O     1 
ATOM   3268 C  CB    . HIS B 1 122 ? 56.542 12.002 -0.534  1.00 17.19 ? 98  HIS B CB    1 
ATOM   3269 C  CG    . HIS B 1 122 ? 57.634 12.110 -1.558  1.00 18.37 ? 98  HIS B CG    1 
ATOM   3270 N  ND1   . HIS B 1 122 ? 58.134 11.016 -2.229  1.00 18.70 ? 98  HIS B ND1   1 
ATOM   3271 C  CD2   . HIS B 1 122 ? 58.313 13.183 -2.028  1.00 18.21 ? 98  HIS B CD2   1 
ATOM   3272 C  CE1   . HIS B 1 122 ? 59.079 11.409 -3.067  1.00 19.94 ? 98  HIS B CE1   1 
ATOM   3273 N  NE2   . HIS B 1 122 ? 59.208 12.721 -2.964  1.00 19.33 ? 98  HIS B NE2   1 
ATOM   3274 N  N     . TYR B 1 123 ? 59.096 13.370 1.438   1.00 16.55 ? 99  TYR B N     1 
ATOM   3275 C  CA    . TYR B 1 123 ? 60.000 14.502 1.540   1.00 14.56 ? 99  TYR B CA    1 
ATOM   3276 C  C     . TYR B 1 123 ? 61.418 14.094 1.179   1.00 15.76 ? 99  TYR B C     1 
ATOM   3277 O  O     . TYR B 1 123 ? 62.064 13.371 1.925   1.00 15.61 ? 99  TYR B O     1 
ATOM   3278 C  CB    . TYR B 1 123 ? 59.972 15.140 2.935   1.00 16.09 ? 99  TYR B CB    1 
ATOM   3279 C  CG    . TYR B 1 123 ? 60.969 16.278 3.085   1.00 15.78 ? 99  TYR B CG    1 
ATOM   3280 C  CD1   . TYR B 1 123 ? 60.959 17.361 2.194   1.00 15.03 ? 99  TYR B CD1   1 
ATOM   3281 C  CD2   . TYR B 1 123 ? 61.908 16.277 4.110   1.00 16.44 ? 99  TYR B CD2   1 
ATOM   3282 C  CE1   . TYR B 1 123 ? 61.876 18.404 2.322   1.00 16.21 ? 99  TYR B CE1   1 
ATOM   3283 C  CE2   . TYR B 1 123 ? 62.821 17.320 4.259   1.00 17.10 ? 99  TYR B CE2   1 
ATOM   3284 C  CZ    . TYR B 1 123 ? 62.799 18.380 3.365   1.00 16.28 ? 99  TYR B CZ    1 
ATOM   3285 O  OH    . TYR B 1 123 ? 63.710 19.395 3.504   1.00 18.95 ? 99  TYR B OH    1 
ATOM   3286 N  N     . GLN B 1 124 ? 61.868 14.602 0.033   1.00 16.75 ? 100 GLN B N     1 
ATOM   3287 C  CA    . GLN B 1 124 ? 63.132 14.168 -0.562  1.00 15.92 ? 100 GLN B CA    1 
ATOM   3288 C  C     . GLN B 1 124 ? 64.066 15.312 -0.989  1.00 17.23 ? 100 GLN B C     1 
ATOM   3289 O  O     . GLN B 1 124 ? 65.121 15.059 -1.589  1.00 19.75 ? 100 GLN B O     1 
ATOM   3290 C  CB    . GLN B 1 124 ? 62.840 13.241 -1.745  1.00 17.31 ? 100 GLN B CB    1 
ATOM   3291 C  CG    . GLN B 1 124 ? 62.294 11.876 -1.359  1.00 18.01 ? 100 GLN B CG    1 
ATOM   3292 C  CD    . GLN B 1 124 ? 63.343 10.996 -0.730  1.00 19.45 ? 100 GLN B CD    1 
ATOM   3293 O  OE1   . GLN B 1 124 ? 64.195 10.443 -1.432  1.00 23.19 ? 100 GLN B OE1   1 
ATOM   3294 N  NE2   . GLN B 1 124 ? 63.289 10.843 0.591   1.00 17.97 ? 100 GLN B NE2   1 
ATOM   3295 N  N     . THR B 1 125 ? 63.714 16.557 -0.665  1.00 16.77 ? 101 THR B N     1 
ATOM   3296 C  CA    . THR B 1 125 ? 64.579 17.696 -0.998  1.00 18.33 ? 101 THR B CA    1 
ATOM   3297 C  C     . THR B 1 125 ? 65.917 17.559 -0.281  1.00 19.79 ? 101 THR B C     1 
ATOM   3298 O  O     . THR B 1 125 ? 65.969 17.421 0.940   1.00 22.21 ? 101 THR B O     1 
ATOM   3299 C  CB    . THR B 1 125 ? 63.944 19.039 -0.618  1.00 17.72 ? 101 THR B CB    1 
ATOM   3300 O  OG1   . THR B 1 125 ? 62.569 19.030 -1.001  1.00 16.21 ? 101 THR B OG1   1 
ATOM   3301 C  CG2   . THR B 1 125 ? 64.641 20.201 -1.324  1.00 18.20 ? 101 THR B CG2   1 
ATOM   3302 N  N     . LYS B 1 126 ? 66.996 17.590 -1.056  1.00 21.19 ? 102 LYS B N     1 
ATOM   3303 C  CA    . LYS B 1 126 ? 68.338 17.384 -0.527  1.00 22.76 ? 102 LYS B CA    1 
ATOM   3304 C  C     . LYS B 1 126 ? 68.976 18.672 0.011   1.00 18.39 ? 102 LYS B C     1 
ATOM   3305 O  O     . LYS B 1 126 ? 68.988 19.678 -0.679  1.00 20.35 ? 102 LYS B O     1 
ATOM   3306 C  CB    . LYS B 1 126 ? 69.228 16.784 -1.627  1.00 23.11 ? 102 LYS B CB    1 
ATOM   3307 C  CG    . LYS B 1 126 ? 68.666 15.538 -2.303  1.00 26.54 ? 102 LYS B CG    1 
ATOM   3308 C  CD    . LYS B 1 126 ? 68.442 14.400 -1.316  1.00 31.78 ? 102 LYS B CD    1 
ATOM   3309 C  CE    . LYS B 1 126 ? 68.132 13.082 -2.021  1.00 41.05 ? 102 LYS B CE    1 
ATOM   3310 N  NZ    . LYS B 1 126 ? 66.772 13.028 -2.632  1.00 36.53 ? 102 LYS B NZ    1 
ATOM   3311 N  N     . PRO B 1 127 ? 69.524 18.640 1.246   1.00 22.33 ? 103 PRO B N     1 
ATOM   3312 C  CA    . PRO B 1 127 ? 70.251 19.808 1.741   1.00 21.17 ? 103 PRO B CA    1 
ATOM   3313 C  C     . PRO B 1 127 ? 71.485 20.083 0.874   1.00 21.15 ? 103 PRO B C     1 
ATOM   3314 O  O     . PRO B 1 127 ? 72.051 19.145 0.307   1.00 21.34 ? 103 PRO B O     1 
ATOM   3315 C  CB    . PRO B 1 127 ? 70.653 19.413 3.165   1.00 24.86 ? 103 PRO B CB    1 
ATOM   3316 C  CG    . PRO B 1 127 ? 69.765 18.265 3.527   1.00 28.92 ? 103 PRO B CG    1 
ATOM   3317 C  CD    . PRO B 1 127 ? 69.451 17.560 2.245   1.00 26.14 ? 103 PRO B CD    1 
ATOM   3318 N  N     . LYS B 1 128 ? 71.865 21.352 0.760   1.00 21.58 ? 104 LYS B N     1 
ATOM   3319 C  CA    . LYS B 1 128 ? 72.979 21.761 -0.123  1.00 22.99 ? 104 LYS B CA    1 
ATOM   3320 C  C     . LYS B 1 128 ? 74.276 22.036 0.628   1.00 29.14 ? 104 LYS B C     1 
ATOM   3321 O  O     . LYS B 1 128 ? 75.329 22.245 0.016   1.00 33.55 ? 104 LYS B O     1 
ATOM   3322 C  CB    . LYS B 1 128 ? 72.567 22.969 -0.960  1.00 23.82 ? 104 LYS B CB    1 
ATOM   3323 C  CG    . LYS B 1 128 ? 71.443 22.642 -1.937  1.00 28.53 ? 104 LYS B CG    1 
ATOM   3324 C  CD    . LYS B 1 128 ? 70.273 23.598 -1.815  1.00 33.06 ? 104 LYS B CD    1 
ATOM   3325 C  CE    . LYS B 1 128 ? 69.128 23.210 -2.744  1.00 29.65 ? 104 LYS B CE    1 
ATOM   3326 N  NZ    . LYS B 1 128 ? 68.638 21.813 -2.542  1.00 25.33 ? 104 LYS B NZ    1 
ATOM   3327 N  N     . GLY B 1 129 ? 74.200 22.011 1.956   1.00 27.04 ? 105 GLY B N     1 
ATOM   3328 C  CA    . GLY B 1 129 ? 75.343 22.310 2.814   1.00 25.51 ? 105 GLY B CA    1 
ATOM   3329 C  C     . GLY B 1 129 ? 74.867 22.655 4.206   1.00 24.61 ? 105 GLY B C     1 
ATOM   3330 O  O     . GLY B 1 129 ? 73.670 22.534 4.491   1.00 22.03 ? 105 GLY B O     1 
ATOM   3331 N  N     . ALA B 1 130 ? 75.794 23.091 5.053   1.00 24.96 ? 106 ALA B N     1 
ATOM   3332 C  CA    . ALA B 1 130 ? 75.506 23.436 6.452   1.00 21.52 ? 106 ALA B CA    1 
ATOM   3333 C  C     . ALA B 1 130 ? 75.241 24.928 6.666   1.00 23.72 ? 106 ALA B C     1 
ATOM   3334 O  O     . ALA B 1 130 ? 74.717 25.321 7.712   1.00 29.25 ? 106 ALA B O     1 
ATOM   3335 C  CB    . ALA B 1 130 ? 76.632 22.955 7.361   1.00 25.62 ? 106 ALA B CB    1 
ATOM   3336 N  N     . PHE B 1 131 ? 75.616 25.755 5.683   1.00 21.14 ? 107 PHE B N     1 
ATOM   3337 C  CA    . PHE B 1 131 ? 75.399 27.200 5.719   1.00 22.16 ? 107 PHE B CA    1 
ATOM   3338 C  C     . PHE B 1 131 ? 74.837 27.676 4.379   1.00 23.91 ? 107 PHE B C     1 
ATOM   3339 O  O     . PHE B 1 131 ? 75.350 27.288 3.332   1.00 26.94 ? 107 PHE B O     1 
ATOM   3340 C  CB    . PHE B 1 131 ? 76.679 27.994 6.037   1.00 25.04 ? 107 PHE B CB    1 
ATOM   3341 C  CG    . PHE B 1 131 ? 76.429 29.475 6.246   1.00 26.06 ? 107 PHE B CG    1 
ATOM   3342 C  CD1   . PHE B 1 131 ? 76.328 30.351 5.156   1.00 24.92 ? 107 PHE B CD1   1 
ATOM   3343 C  CD2   . PHE B 1 131 ? 76.252 29.989 7.527   1.00 27.57 ? 107 PHE B CD2   1 
ATOM   3344 C  CE1   . PHE B 1 131 ? 76.061 31.698 5.346   1.00 25.74 ? 107 PHE B CE1   1 
ATOM   3345 C  CE2   . PHE B 1 131 ? 75.989 31.340 7.721   1.00 30.88 ? 107 PHE B CE2   1 
ATOM   3346 C  CZ    . PHE B 1 131 ? 75.896 32.194 6.631   1.00 31.95 ? 107 PHE B CZ    1 
ATOM   3347 N  N     . PRO B 1 132 ? 73.790 28.525 4.409   1.00 23.46 ? 108 PRO B N     1 
ATOM   3348 C  CA    . PRO B 1 132 ? 73.126 29.028 5.619   1.00 22.95 ? 108 PRO B CA    1 
ATOM   3349 C  C     . PRO B 1 132 ? 72.446 27.888 6.386   1.00 18.49 ? 108 PRO B C     1 
ATOM   3350 O  O     . PRO B 1 132 ? 72.108 26.862 5.782   1.00 17.09 ? 108 PRO B O     1 
ATOM   3351 C  CB    . PRO B 1 132 ? 72.088 30.021 5.077   1.00 23.14 ? 108 PRO B CB    1 
ATOM   3352 C  CG    . PRO B 1 132 ? 72.436 30.251 3.644   1.00 26.95 ? 108 PRO B CG    1 
ATOM   3353 C  CD    . PRO B 1 132 ? 73.141 29.017 3.181   1.00 26.75 ? 108 PRO B CD    1 
ATOM   3354 N  N     . PRO B 1 133 ? 72.287 28.048 7.715   1.00 17.19 ? 109 PRO B N     1 
ATOM   3355 C  CA    . PRO B 1 133 ? 71.706 26.965 8.496   1.00 16.00 ? 109 PRO B CA    1 
ATOM   3356 C  C     . PRO B 1 133 ? 70.204 26.898 8.277   1.00 16.29 ? 109 PRO B C     1 
ATOM   3357 O  O     . PRO B 1 133 ? 69.632 27.783 7.653   1.00 16.53 ? 109 PRO B O     1 
ATOM   3358 C  CB    . PRO B 1 133 ? 72.018 27.362 9.938   1.00 17.25 ? 109 PRO B CB    1 
ATOM   3359 C  CG    . PRO B 1 133 ? 72.047 28.843 9.906   1.00 19.80 ? 109 PRO B CG    1 
ATOM   3360 C  CD    . PRO B 1 133 ? 72.559 29.240 8.540   1.00 20.07 ? 109 PRO B CD    1 
ATOM   3361 N  N     . THR B 1 134 ? 69.596 25.832 8.780   1.00 15.97 ? 110 THR B N     1 
ATOM   3362 C  CA    . THR B 1 134 ? 68.150 25.619 8.647   1.00 15.37 ? 110 THR B CA    1 
ATOM   3363 C  C     . THR B 1 134 ? 67.350 26.801 9.198   1.00 16.38 ? 110 THR B C     1 
ATOM   3364 O  O     . THR B 1 134 ? 67.671 27.326 10.264  1.00 16.83 ? 110 THR B O     1 
ATOM   3365 C  CB    . THR B 1 134 ? 67.753 24.283 9.300   1.00 14.53 ? 110 THR B CB    1 
ATOM   3366 O  OG1   . THR B 1 134 ? 68.373 23.210 8.581   1.00 15.38 ? 110 THR B OG1   1 
ATOM   3367 C  CG2   . THR B 1 134 ? 66.231 24.079 9.308   1.00 15.48 ? 110 THR B CG2   1 
ATOM   3368 N  N     . ALA B 1 135 ? 66.329 27.219 8.447   1.00 15.93 ? 111 ALA B N     1 
ATOM   3369 C  CA    . ALA B 1 135 ? 65.486 28.355 8.839   1.00 15.17 ? 111 ALA B CA    1 
ATOM   3370 C  C     . ALA B 1 135 ? 64.841 28.060 10.178  1.00 14.44 ? 111 ALA B C     1 
ATOM   3371 O  O     . ALA B 1 135 ? 64.506 26.906 10.477  1.00 15.79 ? 111 ALA B O     1 
ATOM   3372 C  CB    . ALA B 1 135 ? 64.403 28.619 7.821   1.00 15.91 ? 111 ALA B CB    1 
ATOM   3373 N  N     . ARG B 1 136 ? 64.703 29.112 10.975  1.00 16.08 ? 112 ARG B N     1 
ATOM   3374 C  CA    . ARG B 1 136 ? 63.957 29.028 12.223  1.00 17.22 ? 112 ARG B CA    1 
ATOM   3375 C  C     . ARG B 1 136 ? 63.102 30.270 12.435  1.00 16.24 ? 112 ARG B C     1 
ATOM   3376 O  O     . ARG B 1 136 ? 63.398 31.347 11.913  1.00 17.29 ? 112 ARG B O     1 
ATOM   3377 C  CB    . ARG B 1 136 ? 64.886 28.755 13.412  1.00 16.70 ? 112 ARG B CB    1 
ATOM   3378 C  CG    . ARG B 1 136 ? 65.703 29.953 13.892  1.00 17.18 ? 112 ARG B CG    1 
ATOM   3379 C  CD    . ARG B 1 136 ? 66.729 30.454 12.872  1.00 19.28 ? 112 ARG B CD    1 
ATOM   3380 N  NE    . ARG B 1 136 ? 67.598 29.389 12.378  1.00 20.23 ? 112 ARG B NE    1 
ATOM   3381 C  CZ    . ARG B 1 136 ? 68.768 29.043 12.923  1.00 20.89 ? 112 ARG B CZ    1 
ATOM   3382 N  NH1   . ARG B 1 136 ? 69.227 29.668 14.008  1.00 20.37 ? 112 ARG B NH1   1 
ATOM   3383 N  NH2   . ARG B 1 136 ? 69.482 28.056 12.387  1.00 20.50 ? 112 ARG B NH2   1 
ATOM   3384 N  N     . SER B 1 137 ? 61.992 30.091 13.145  1.00 15.28 ? 113 SER B N     1 
ATOM   3385 C  CA    . SER B 1 137 ? 61.084 31.188 13.410  1.00 14.83 ? 113 SER B CA    1 
ATOM   3386 C  C     . SER B 1 137 ? 60.845 31.239 14.904  1.00 14.08 ? 113 SER B C     1 
ATOM   3387 O  O     . SER B 1 137 ? 60.404 30.239 15.490  1.00 15.72 ? 113 SER B O     1 
ATOM   3388 C  CB    . SER B 1 137 ? 59.750 31.033 12.672  1.00 14.39 ? 113 SER B CB    1 
ATOM   3389 O  OG    . SER B 1 137 ? 59.029 32.247 12.740  1.00 18.16 ? 113 SER B OG    1 
HETATM 3390 N  N     . MSE B 1 138 ? 61.161 32.388 15.499  1.00 13.27 ? 114 MSE B N     1 
HETATM 3391 C  CA    . MSE B 1 138 ? 60.890 32.644 16.906  1.00 14.63 ? 114 MSE B CA    1 
HETATM 3392 C  C     . MSE B 1 138 ? 59.487 33.166 16.960  1.00 14.65 ? 114 MSE B C     1 
HETATM 3393 O  O     . MSE B 1 138 ? 59.181 34.258 16.481  1.00 14.29 ? 114 MSE B O     1 
HETATM 3394 C  CB    . MSE B 1 138 ? 61.910 33.589 17.501  1.00 16.38 ? 114 MSE B CB    1 
HETATM 3395 C  CG    . MSE B 1 138 ? 63.163 32.765 17.746  1.00 21.27 ? 114 MSE B CG    1 
HETATM 3396 SE SE    . MSE B 1 138 ? 64.495 34.068 18.301  1.00 37.96 ? 114 MSE B SE    1 
HETATM 3397 C  CE    . MSE B 1 138 ? 64.952 34.654 16.481  1.00 30.41 ? 114 MSE B CE    1 
ATOM   3398 N  N     . ILE B 1 139 ? 58.614 32.347 17.530  1.00 15.15 ? 115 ILE B N     1 
ATOM   3399 C  CA    . ILE B 1 139 ? 57.196 32.624 17.591  1.00 15.13 ? 115 ILE B CA    1 
ATOM   3400 C  C     . ILE B 1 139 ? 56.829 32.941 19.029  1.00 15.34 ? 115 ILE B C     1 
ATOM   3401 O  O     . ILE B 1 139 ? 57.018 32.119 19.923  1.00 16.88 ? 115 ILE B O     1 
ATOM   3402 C  CB    . ILE B 1 139 ? 56.351 31.445 17.076  1.00 14.90 ? 115 ILE B CB    1 
ATOM   3403 C  CG1   . ILE B 1 139 ? 56.782 31.066 15.645  1.00 15.73 ? 115 ILE B CG1   1 
ATOM   3404 C  CG2   . ILE B 1 139 ? 54.864 31.784 17.123  1.00 16.27 ? 115 ILE B CG2   1 
ATOM   3405 C  CD1   . ILE B 1 139 ? 55.916 30.025 14.981  1.00 15.34 ? 115 ILE B CD1   1 
ATOM   3406 N  N     . PHE B 1 140 ? 56.314 34.153 19.220  1.00 16.00 ? 116 PHE B N     1 
ATOM   3407 C  CA    . PHE B 1 140 ? 55.903 34.643 20.527  1.00 15.56 ? 116 PHE B CA    1 
ATOM   3408 C  C     . PHE B 1 140 ? 54.389 34.608 20.593  1.00 16.40 ? 116 PHE B C     1 
ATOM   3409 O  O     . PHE B 1 140 ? 53.704 35.219 19.769  1.00 17.19 ? 116 PHE B O     1 
ATOM   3410 C  CB    . PHE B 1 140 ? 56.435 36.062 20.772  1.00 14.90 ? 116 PHE B CB    1 
ATOM   3411 C  CG    . PHE B 1 140 ? 57.943 36.138 20.826  1.00 15.92 ? 116 PHE B CG    1 
ATOM   3412 C  CD1   . PHE B 1 140 ? 58.644 35.919 22.020  1.00 16.75 ? 116 PHE B CD1   1 
ATOM   3413 C  CD2   . PHE B 1 140 ? 58.665 36.395 19.662  1.00 17.93 ? 116 PHE B CD2   1 
ATOM   3414 C  CE1   . PHE B 1 140 ? 60.032 35.968 22.044  1.00 16.56 ? 116 PHE B CE1   1 
ATOM   3415 C  CE2   . PHE B 1 140 ? 60.050 36.440 19.685  1.00 19.71 ? 116 PHE B CE2   1 
ATOM   3416 C  CZ    . PHE B 1 140 ? 60.734 36.222 20.869  1.00 18.46 ? 116 PHE B CZ    1 
ATOM   3417 N  N     . VAL B 1 141 ? 53.882 33.859 21.571  1.00 16.47 ? 117 VAL B N     1 
ATOM   3418 C  CA    . VAL B 1 141 ? 52.447 33.706 21.765  1.00 16.56 ? 117 VAL B CA    1 
ATOM   3419 C  C     . VAL B 1 141 ? 52.016 34.565 22.954  1.00 17.42 ? 117 VAL B C     1 
ATOM   3420 O  O     . VAL B 1 141 ? 52.515 34.391 24.077  1.00 19.69 ? 117 VAL B O     1 
ATOM   3421 C  CB    . VAL B 1 141 ? 52.052 32.234 22.008  1.00 17.25 ? 117 VAL B CB    1 
ATOM   3422 C  CG1   . VAL B 1 141 ? 50.546 32.125 22.160  1.00 20.26 ? 117 VAL B CG1   1 
ATOM   3423 C  CG2   . VAL B 1 141 ? 52.539 31.327 20.879  1.00 18.25 ? 117 VAL B CG2   1 
ATOM   3424 N  N     . THR B 1 142 ? 51.114 35.505 22.693  1.00 18.23 ? 118 THR B N     1 
ATOM   3425 C  CA    . THR B 1 142 ? 50.620 36.410 23.722  1.00 20.82 ? 118 THR B CA    1 
ATOM   3426 C  C     . THR B 1 142 ? 49.426 35.762 24.442  1.00 23.01 ? 118 THR B C     1 
ATOM   3427 O  O     . THR B 1 142 ? 48.941 34.705 24.017  1.00 23.08 ? 118 THR B O     1 
ATOM   3428 C  CB    . THR B 1 142 ? 50.256 37.796 23.136  1.00 20.46 ? 118 THR B CB    1 
ATOM   3429 O  OG1   . THR B 1 142 ? 49.676 37.643 21.832  1.00 20.60 ? 118 THR B OG1   1 
ATOM   3430 C  CG2   . THR B 1 142 ? 51.511 38.659 23.008  1.00 23.82 ? 118 THR B CG2   1 
ATOM   3431 N  N     . GLU B 1 143 ? 48.967 36.392 25.529  1.00 26.20 ? 119 GLU B N     1 
ATOM   3432 C  CA    . GLU B 1 143 ? 47.919 35.825 26.396  1.00 26.58 ? 119 GLU B CA    1 
ATOM   3433 C  C     . GLU B 1 143 ? 46.601 35.555 25.669  1.00 26.19 ? 119 GLU B C     1 
ATOM   3434 O  O     . GLU B 1 143 ? 45.858 34.642 26.042  1.00 29.67 ? 119 GLU B O     1 
ATOM   3435 C  CB    . GLU B 1 143 ? 47.672 36.728 27.609  1.00 32.61 ? 119 GLU B CB    1 
ATOM   3436 C  CG    . GLU B 1 143 ? 48.823 36.791 28.603  1.00 43.24 ? 119 GLU B CG    1 
ATOM   3437 C  CD    . GLU B 1 143 ? 48.657 37.896 29.634  1.00 54.07 ? 119 GLU B CD    1 
ATOM   3438 O  OE1   . GLU B 1 143 ? 49.664 38.569 29.948  1.00 60.09 ? 119 GLU B OE1   1 
ATOM   3439 O  OE2   . GLU B 1 143 ? 47.525 38.097 30.131  1.00 59.60 ? 119 GLU B OE2   1 
ATOM   3440 N  N     . ASP B 1 144 ? 46.326 36.337 24.627  1.00 26.15 ? 120 ASP B N     1 
ATOM   3441 C  CA    . ASP B 1 144 ? 45.129 36.156 23.809  1.00 27.10 ? 120 ASP B CA    1 
ATOM   3442 C  C     . ASP B 1 144 ? 45.237 35.001 22.806  1.00 24.36 ? 120 ASP B C     1 
ATOM   3443 O  O     . ASP B 1 144 ? 44.282 34.707 22.082  1.00 25.58 ? 120 ASP B O     1 
ATOM   3444 C  CB    . ASP B 1 144 ? 44.790 37.454 23.073  1.00 26.92 ? 120 ASP B CB    1 
ATOM   3445 C  CG    . ASP B 1 144 ? 45.947 37.982 22.227  1.00 24.94 ? 120 ASP B CG    1 
ATOM   3446 O  OD1   . ASP B 1 144 ? 46.997 37.301 22.107  1.00 22.94 ? 120 ASP B OD1   1 
ATOM   3447 O  OD2   . ASP B 1 144 ? 45.782 39.084 21.665  1.00 24.98 ? 120 ASP B OD2   1 
ATOM   3448 N  N     . GLY B 1 145 ? 46.405 34.365 22.764  1.00 23.77 ? 121 GLY B N     1 
ATOM   3449 C  CA    . GLY B 1 145 ? 46.636 33.226 21.890  1.00 22.44 ? 121 GLY B CA    1 
ATOM   3450 C  C     . GLY B 1 145 ? 47.122 33.615 20.508  1.00 21.16 ? 121 GLY B C     1 
ATOM   3451 O  O     . GLY B 1 145 ? 47.354 32.741 19.672  1.00 22.61 ? 121 GLY B O     1 
ATOM   3452 N  N     . GLU B 1 146 ? 47.275 34.916 20.260  1.00 21.49 ? 122 GLU B N     1 
ATOM   3453 C  CA    . GLU B 1 146 ? 47.860 35.376 19.000  1.00 19.41 ? 122 GLU B CA    1 
ATOM   3454 C  C     . GLU B 1 146 ? 49.328 35.007 18.934  1.00 18.55 ? 122 GLU B C     1 
ATOM   3455 O  O     . GLU B 1 146 ? 50.010 34.902 19.960  1.00 19.07 ? 122 GLU B O     1 
ATOM   3456 C  CB    . GLU B 1 146 ? 47.693 36.883 18.806  1.00 20.05 ? 122 GLU B CB    1 
ATOM   3457 C  CG    . GLU B 1 146 ? 47.953 37.330 17.370  1.00 24.03 ? 122 GLU B CG    1 
ATOM   3458 C  CD    . GLU B 1 146 ? 47.142 36.536 16.355  1.00 27.42 ? 122 GLU B CD    1 
ATOM   3459 O  OE1   . GLU B 1 146 ? 47.691 35.586 15.718  1.00 22.65 ? 122 GLU B OE1   1 
ATOM   3460 O  OE2   . GLU B 1 146 ? 45.938 36.843 16.216  1.00 31.07 ? 122 GLU B OE2   1 
ATOM   3461 N  N     . ARG B 1 147 ? 49.774 34.766 17.713  1.00 17.64 ? 123 ARG B N     1 
ATOM   3462 C  CA    A ARG B 1 147 ? 51.189 34.427 17.473  0.50 16.55 ? 123 ARG B CA    1 
ATOM   3463 C  CA    B ARG B 1 147 ? 51.176 34.419 17.466  0.50 16.58 ? 123 ARG B CA    1 
ATOM   3464 C  C     . ARG B 1 147 ? 51.924 35.449 16.537  1.00 16.87 ? 123 ARG B C     1 
ATOM   3465 O  O     . ARG B 1 147 ? 51.381 35.939 15.508  1.00 17.56 ? 123 ARG B O     1 
ATOM   3466 C  CB    A ARG B 1 147 ? 51.321 32.988 16.951  0.50 16.83 ? 123 ARG B CB    1 
ATOM   3467 C  CB    B ARG B 1 147 ? 51.213 33.026 16.861  0.50 17.47 ? 123 ARG B CB    1 
ATOM   3468 C  CG    A ARG B 1 147 ? 51.567 32.819 15.453  0.50 16.99 ? 123 ARG B CG    1 
ATOM   3469 C  CG    B ARG B 1 147 ? 50.414 32.897 15.569  0.50 17.47 ? 123 ARG B CG    1 
ATOM   3470 C  CD    A ARG B 1 147 ? 50.303 33.000 14.658  0.50 16.87 ? 123 ARG B CD    1 
ATOM   3471 C  CD    B ARG B 1 147 ? 51.418 32.790 14.461  0.50 16.69 ? 123 ARG B CD    1 
ATOM   3472 N  NE    A ARG B 1 147 ? 50.447 32.858 13.208  0.50 16.78 ? 123 ARG B NE    1 
ATOM   3473 N  NE    B ARG B 1 147 ? 50.895 32.792 13.106  0.50 15.31 ? 123 ARG B NE    1 
ATOM   3474 C  CZ    A ARG B 1 147 ? 50.752 33.843 12.376  0.50 13.27 ? 123 ARG B CZ    1 
ATOM   3475 C  CZ    B ARG B 1 147 ? 50.842 33.860 12.330  0.50 15.73 ? 123 ARG B CZ    1 
ATOM   3476 N  NH1   A ARG B 1 147 ? 51.060 35.044 12.823  0.50 17.35 ? 123 ARG B NH1   1 
ATOM   3477 N  NH1   B ARG B 1 147 ? 51.194 35.043 12.795  0.50 17.20 ? 123 ARG B NH1   1 
ATOM   3478 N  NH2   A ARG B 1 147 ? 50.754 33.605 11.083  0.50 13.01 ? 123 ARG B NH2   1 
ATOM   3479 N  NH2   B ARG B 1 147 ? 50.433 33.731 11.085  0.50 18.84 ? 123 ARG B NH2   1 
ATOM   3480 N  N     . SER B 1 148 ? 53.128 35.835 16.965  1.00 16.82 ? 124 SER B N     1 
ATOM   3481 C  CA    . SER B 1 148 ? 53.898 36.837 16.228  1.00 16.54 ? 124 SER B CA    1 
ATOM   3482 C  C     . SER B 1 148 ? 55.233 36.197 15.916  1.00 14.69 ? 124 SER B C     1 
ATOM   3483 O  O     . SER B 1 148 ? 55.972 35.792 16.812  1.00 15.46 ? 124 SER B O     1 
ATOM   3484 C  CB    . SER B 1 148 ? 54.081 38.107 17.052  1.00 17.38 ? 124 SER B CB    1 
ATOM   3485 O  OG    . SER B 1 148 ? 52.818 38.614 17.476  1.00 17.89 ? 124 SER B OG    1 
HETATM 3486 N  N     . MSE B 1 149 ? 55.501 36.054 14.622  1.00 15.10 ? 125 MSE B N     1 
HETATM 3487 C  CA    . MSE B 1 149 ? 56.609 35.224 14.177  1.00 15.18 ? 125 MSE B CA    1 
HETATM 3488 C  C     . MSE B 1 149 ? 57.761 36.053 13.699  1.00 14.22 ? 125 MSE B C     1 
HETATM 3489 O  O     . MSE B 1 149 ? 57.572 37.097 13.051  1.00 15.51 ? 125 MSE B O     1 
HETATM 3490 C  CB    . MSE B 1 149 ? 56.149 34.304 13.051  1.00 15.09 ? 125 MSE B CB    1 
HETATM 3491 C  CG    . MSE B 1 149 ? 54.807 33.682 13.414  1.00 18.32 ? 125 MSE B CG    1 
HETATM 3492 SE SE    . MSE B 1 149 ? 54.485 32.174 12.222  1.00 29.70 ? 125 MSE B SE    1 
HETATM 3493 C  CE    . MSE B 1 149 ? 54.161 33.169 10.570  1.00 17.71 ? 125 MSE B CE    1 
ATOM   3494 N  N     . ASN B 1 150 ? 58.972 35.567 13.980  1.00 14.08 ? 126 ASN B N     1 
ATOM   3495 C  CA    . ASN B 1 150 ? 60.203 36.286 13.622  1.00 15.49 ? 126 ASN B CA    1 
ATOM   3496 C  C     . ASN B 1 150 ? 61.152 35.301 12.963  1.00 15.01 ? 126 ASN B C     1 
ATOM   3497 O  O     . ASN B 1 150 ? 61.730 34.456 13.630  1.00 14.11 ? 126 ASN B O     1 
ATOM   3498 C  CB    . ASN B 1 150 ? 60.807 36.959 14.854  1.00 15.17 ? 126 ASN B CB    1 
ATOM   3499 C  CG    . ASN B 1 150 ? 59.819 37.907 15.529  1.00 16.03 ? 126 ASN B CG    1 
ATOM   3500 O  OD1   . ASN B 1 150 ? 59.750 39.105 15.211  1.00 17.56 ? 126 ASN B OD1   1 
ATOM   3501 N  ND2   . ASN B 1 150 ? 59.010 37.363 16.425  1.00 17.19 ? 126 ASN B ND2   1 
ATOM   3502 N  N     . THR B 1 151 ? 61.243 35.392 11.631  1.00 14.25 ? 127 THR B N     1 
ATOM   3503 C  CA    . THR B 1 151 ? 61.757 34.305 10.826  1.00 13.79 ? 127 THR B CA    1 
ATOM   3504 C  C     . THR B 1 151 ? 63.076 34.670 10.166  1.00 13.55 ? 127 THR B C     1 
ATOM   3505 O  O     . THR B 1 151 ? 63.146 35.654 9.389   1.00 15.34 ? 127 THR B O     1 
ATOM   3506 C  CB    . THR B 1 151 ? 60.760 33.955 9.727   1.00 13.43 ? 127 THR B CB    1 
ATOM   3507 O  OG1   . THR B 1 151 ? 59.517 33.563 10.337  1.00 14.77 ? 127 THR B OG1   1 
ATOM   3508 C  CG2   . THR B 1 151 ? 61.282 32.811 8.855   1.00 13.73 ? 127 THR B CG2   1 
ATOM   3509 N  N     . TYR B 1 152 ? 64.084 33.858 10.462  1.00 14.20 ? 128 TYR B N     1 
ATOM   3510 C  CA    . TYR B 1 152 ? 65.369 33.899 9.758   1.00 15.57 ? 128 TYR B CA    1 
ATOM   3511 C  C     . TYR B 1 152 ? 65.332 32.792 8.708   1.00 14.15 ? 128 TYR B C     1 
ATOM   3512 O  O     . TYR B 1 152 ? 65.297 31.610 9.039   1.00 14.96 ? 128 TYR B O     1 
ATOM   3513 C  CB    . TYR B 1 152 ? 66.547 33.727 10.718  1.00 17.43 ? 128 TYR B CB    1 
ATOM   3514 C  CG    . TYR B 1 152 ? 67.858 33.498 10.011  1.00 17.07 ? 128 TYR B CG    1 
ATOM   3515 C  CD1   . TYR B 1 152 ? 68.466 34.523 9.275   1.00 21.06 ? 128 TYR B CD1   1 
ATOM   3516 C  CD2   . TYR B 1 152 ? 68.478 32.261 10.053  1.00 19.72 ? 128 TYR B CD2   1 
ATOM   3517 C  CE1   . TYR B 1 152 ? 69.671 34.306 8.616   1.00 23.62 ? 128 TYR B CE1   1 
ATOM   3518 C  CE2   . TYR B 1 152 ? 69.686 32.040 9.406   1.00 22.14 ? 128 TYR B CE2   1 
ATOM   3519 C  CZ    . TYR B 1 152 ? 70.268 33.058 8.682   1.00 22.07 ? 128 TYR B CZ    1 
ATOM   3520 O  OH    . TYR B 1 152 ? 71.469 32.819 8.041   1.00 25.78 ? 128 TYR B OH    1 
ATOM   3521 N  N     . LEU B 1 153 ? 65.295 33.184 7.437   1.00 15.42 ? 129 LEU B N     1 
ATOM   3522 C  CA    . LEU B 1 153 ? 65.112 32.234 6.340   1.00 16.21 ? 129 LEU B CA    1 
ATOM   3523 C  C     . LEU B 1 153 ? 66.238 31.220 6.123   1.00 15.63 ? 129 LEU B C     1 
ATOM   3524 O  O     . LEU B 1 153 ? 65.994 30.139 5.592   1.00 15.70 ? 129 LEU B O     1 
ATOM   3525 C  CB    . LEU B 1 153 ? 64.843 32.962 5.023   1.00 17.03 ? 129 LEU B CB    1 
ATOM   3526 C  CG    . LEU B 1 153 ? 63.483 33.639 4.891   1.00 19.48 ? 129 LEU B CG    1 
ATOM   3527 C  CD1   . LEU B 1 153 ? 63.396 34.493 3.628   1.00 24.00 ? 129 LEU B CD1   1 
ATOM   3528 C  CD2   . LEU B 1 153 ? 62.388 32.584 4.883   1.00 22.39 ? 129 LEU B CD2   1 
ATOM   3529 N  N     . GLY B 1 154 ? 67.468 31.569 6.487   1.00 15.64 ? 130 GLY B N     1 
ATOM   3530 C  CA    . GLY B 1 154 ? 68.572 30.617 6.389   1.00 17.14 ? 130 GLY B CA    1 
ATOM   3531 C  C     . GLY B 1 154 ? 68.578 29.863 5.071   1.00 15.36 ? 130 GLY B C     1 
ATOM   3532 O  O     . GLY B 1 154 ? 68.513 30.474 3.995   1.00 18.10 ? 130 GLY B O     1 
ATOM   3533 N  N     . ALA B 1 155 ? 68.622 28.537 5.155   1.00 14.86 ? 131 ALA B N     1 
ATOM   3534 C  CA    . ALA B 1 155 ? 68.727 27.661 3.981   1.00 15.05 ? 131 ALA B CA    1 
ATOM   3535 C  C     . ALA B 1 155 ? 67.560 27.756 2.989   1.00 16.49 ? 131 ALA B C     1 
ATOM   3536 O  O     . ALA B 1 155 ? 67.667 27.284 1.843   1.00 17.36 ? 131 ALA B O     1 
ATOM   3537 C  CB    . ALA B 1 155 ? 68.936 26.223 4.417   1.00 16.45 ? 131 ALA B CB    1 
ATOM   3538 N  N     . CYS B 1 156 ? 66.441 28.348 3.410   1.00 17.35 ? 132 CYS B N     1 
ATOM   3539 C  CA    . CYS B 1 156 ? 65.301 28.533 2.513   1.00 17.53 ? 132 CYS B CA    1 
ATOM   3540 C  C     . CYS B 1 156 ? 65.672 29.362 1.280   1.00 17.23 ? 132 CYS B C     1 
ATOM   3541 O  O     . CYS B 1 156 ? 65.056 29.220 0.225   1.00 18.37 ? 132 CYS B O     1 
ATOM   3542 C  CB    . CYS B 1 156 ? 64.116 29.193 3.229   1.00 16.36 ? 132 CYS B CB    1 
ATOM   3543 S  SG    . CYS B 1 156 ? 63.334 28.085 4.427   1.00 17.92 ? 132 CYS B SG    1 
ATOM   3544 N  N     . VAL B 1 157 ? 66.675 30.229 1.417   1.00 18.73 ? 133 VAL B N     1 
ATOM   3545 C  CA    . VAL B 1 157 ? 67.078 31.084 0.302   1.00 20.66 ? 133 VAL B CA    1 
ATOM   3546 C  C     . VAL B 1 157 ? 67.633 30.270 -0.873  1.00 18.13 ? 133 VAL B C     1 
ATOM   3547 O  O     . VAL B 1 157 ? 67.743 30.785 -1.990  1.00 20.82 ? 133 VAL B O     1 
ATOM   3548 C  CB    . VAL B 1 157 ? 68.061 32.205 0.723   1.00 20.20 ? 133 VAL B CB    1 
ATOM   3549 C  CG1   . VAL B 1 157 ? 67.447 33.084 1.804   1.00 20.89 ? 133 VAL B CG1   1 
ATOM   3550 C  CG2   . VAL B 1 157 ? 69.409 31.641 1.159   1.00 20.41 ? 133 VAL B CG2   1 
ATOM   3551 N  N     . GLU B 1 158 ? 67.933 28.993 -0.623  1.00 17.81 ? 134 GLU B N     1 
ATOM   3552 C  CA    . GLU B 1 158 ? 68.570 28.126 -1.621  1.00 20.21 ? 134 GLU B CA    1 
ATOM   3553 C  C     . GLU B 1 158 ? 67.589 27.307 -2.452  1.00 20.59 ? 134 GLU B C     1 
ATOM   3554 O  O     . GLU B 1 158 ? 67.980 26.679 -3.434  1.00 22.99 ? 134 GLU B O     1 
ATOM   3555 C  CB    . GLU B 1 158 ? 69.635 27.238 -0.970  1.00 23.65 ? 134 GLU B CB    1 
ATOM   3556 C  CG    . GLU B 1 158 ? 70.595 28.036 -0.099  1.00 30.26 ? 134 GLU B CG    1 
ATOM   3557 C  CD    . GLU B 1 158 ? 72.048 27.647 -0.272  1.00 40.18 ? 134 GLU B CD    1 
ATOM   3558 O  OE1   . GLU B 1 158 ? 72.904 28.552 -0.183  1.00 40.63 ? 134 GLU B OE1   1 
ATOM   3559 O  OE2   . GLU B 1 158 ? 72.337 26.452 -0.492  1.00 51.03 ? 134 GLU B OE2   1 
ATOM   3560 N  N     . LEU B 1 159 ? 66.308 27.316 -2.077  1.00 17.88 ? 135 LEU B N     1 
ATOM   3561 C  CA    . LEU B 1 159 ? 65.317 26.567 -2.821  1.00 16.86 ? 135 LEU B CA    1 
ATOM   3562 C  C     . LEU B 1 159 ? 65.184 27.157 -4.223  1.00 16.10 ? 135 LEU B C     1 
ATOM   3563 O  O     . LEU B 1 159 ? 65.048 28.372 -4.392  1.00 18.65 ? 135 LEU B O     1 
ATOM   3564 C  CB    . LEU B 1 159 ? 63.957 26.632 -2.106  1.00 16.10 ? 135 LEU B CB    1 
ATOM   3565 C  CG    . LEU B 1 159 ? 62.901 25.718 -2.718  1.00 16.40 ? 135 LEU B CG    1 
ATOM   3566 C  CD1   . LEU B 1 159 ? 63.117 24.253 -2.371  1.00 16.20 ? 135 LEU B CD1   1 
ATOM   3567 C  CD2   . LEU B 1 159 ? 61.524 26.181 -2.272  1.00 16.45 ? 135 LEU B CD2   1 
ATOM   3568 N  N     . GLY B 1 160 ? 65.249 26.295 -5.228  1.00 19.59 ? 136 GLY B N     1 
ATOM   3569 C  CA    . GLY B 1 160 ? 65.073 26.746 -6.598  1.00 19.27 ? 136 GLY B CA    1 
ATOM   3570 C  C     . GLY B 1 160 ? 64.599 25.649 -7.531  1.00 16.99 ? 136 GLY B C     1 
ATOM   3571 O  O     . GLY B 1 160 ? 64.251 24.548 -7.081  1.00 18.24 ? 136 GLY B O     1 
ATOM   3572 N  N     . PRO B 1 161 ? 64.604 25.926 -8.853  1.00 19.03 ? 137 PRO B N     1 
ATOM   3573 C  CA    . PRO B 1 161 ? 64.131 24.953 -9.851  1.00 20.14 ? 137 PRO B CA    1 
ATOM   3574 C  C     . PRO B 1 161 ? 64.740 23.547 -9.732  1.00 19.91 ? 137 PRO B C     1 
ATOM   3575 O  O     . PRO B 1 161 ? 64.058 22.564 -10.030 1.00 21.16 ? 137 PRO B O     1 
ATOM   3576 C  CB    . PRO B 1 161 ? 64.526 25.589 -11.190 1.00 21.18 ? 137 PRO B CB    1 
ATOM   3577 C  CG    . PRO B 1 161 ? 64.600 27.048 -10.917 1.00 23.25 ? 137 PRO B CG    1 
ATOM   3578 C  CD    . PRO B 1 161 ? 64.986 27.213 -9.469  1.00 22.63 ? 137 PRO B CD    1 
ATOM   3579 N  N     . GLU B 1 162 ? 65.993 23.460 -9.276  1.00 21.48 ? 138 GLU B N     1 
ATOM   3580 C  CA    . GLU B 1 162 ? 66.695 22.182 -9.110  1.00 22.43 ? 138 GLU B CA    1 
ATOM   3581 C  C     . GLU B 1 162 ? 66.017 21.241 -8.093  1.00 21.99 ? 138 GLU B C     1 
ATOM   3582 O  O     . GLU B 1 162 ? 66.263 20.030 -8.087  1.00 21.32 ? 138 GLU B O     1 
ATOM   3583 C  CB    . GLU B 1 162 ? 68.184 22.420 -8.769  1.00 25.82 ? 138 GLU B CB    1 
ATOM   3584 C  CG    . GLU B 1 162 ? 68.472 23.183 -7.466  1.00 29.45 ? 138 GLU B CG    1 
ATOM   3585 C  CD    . GLU B 1 162 ? 68.465 24.712 -7.589  1.00 30.24 ? 138 GLU B CD    1 
ATOM   3586 O  OE1   . GLU B 1 162 ? 67.895 25.279 -8.542  1.00 23.65 ? 138 GLU B OE1   1 
ATOM   3587 O  OE2   . GLU B 1 162 ? 69.029 25.377 -6.694  1.00 41.56 ? 138 GLU B OE2   1 
ATOM   3588 N  N     . ASP B 1 163 ? 65.127 21.810 -7.277  1.00 21.61 ? 139 ASP B N     1 
ATOM   3589 C  CA    . ASP B 1 163 ? 64.424 21.078 -6.219  1.00 21.03 ? 139 ASP B CA    1 
ATOM   3590 C  C     . ASP B 1 163 ? 63.024 20.625 -6.631  1.00 19.38 ? 139 ASP B C     1 
ATOM   3591 O  O     . ASP B 1 163 ? 62.304 20.016 -5.833  1.00 20.10 ? 139 ASP B O     1 
ATOM   3592 C  CB    . ASP B 1 163 ? 64.354 21.952 -4.968  1.00 19.23 ? 139 ASP B CB    1 
ATOM   3593 C  CG    . ASP B 1 163 ? 65.722 22.303 -4.452  1.00 18.88 ? 139 ASP B CG    1 
ATOM   3594 O  OD1   . ASP B 1 163 ? 66.474 21.345 -4.169  1.00 21.04 ? 139 ASP B OD1   1 
ATOM   3595 O  OD2   . ASP B 1 163 ? 66.044 23.513 -4.367  1.00 19.19 ? 139 ASP B OD2   1 
ATOM   3596 N  N     . VAL B 1 164 ? 62.639 20.916 -7.869  1.00 18.46 ? 140 VAL B N     1 
ATOM   3597 C  CA    . VAL B 1 164 ? 61.381 20.425 -8.400  1.00 18.80 ? 140 VAL B CA    1 
ATOM   3598 C  C     . VAL B 1 164 ? 61.548 18.969 -8.838  1.00 20.34 ? 140 VAL B C     1 
ATOM   3599 O  O     . VAL B 1 164 ? 62.315 18.664 -9.761  1.00 23.77 ? 140 VAL B O     1 
ATOM   3600 C  CB    . VAL B 1 164 ? 60.877 21.298 -9.572  1.00 18.74 ? 140 VAL B CB    1 
ATOM   3601 C  CG1   . VAL B 1 164 ? 59.623 20.698 -10.195 1.00 19.92 ? 140 VAL B CG1   1 
ATOM   3602 C  CG2   . VAL B 1 164 ? 60.630 22.727 -9.104  1.00 19.96 ? 140 VAL B CG2   1 
ATOM   3603 N  N     . GLU B 1 165 ? 60.871 18.071 -8.126  1.00 18.87 ? 141 GLU B N     1 
ATOM   3604 C  CA    . GLU B 1 165 ? 60.764 16.672 -8.503  1.00 17.67 ? 141 GLU B CA    1 
ATOM   3605 C  C     . GLU B 1 165 ? 59.607 16.597 -9.487  1.00 19.85 ? 141 GLU B C     1 
ATOM   3606 O  O     . GLU B 1 165 ? 58.435 16.528 -9.099  1.00 19.25 ? 141 GLU B O     1 
ATOM   3607 C  CB    . GLU B 1 165 ? 60.542 15.765 -7.275  1.00 19.57 ? 141 GLU B CB    1 
ATOM   3608 C  CG    . GLU B 1 165 ? 61.648 15.839 -6.232  1.00 21.58 ? 141 GLU B CG    1 
ATOM   3609 C  CD    . GLU B 1 165 ? 61.231 15.289 -4.881  1.00 20.12 ? 141 GLU B CD    1 
ATOM   3610 O  OE1   . GLU B 1 165 ? 60.697 14.161 -4.827  1.00 20.93 ? 141 GLU B OE1   1 
ATOM   3611 O  OE2   . GLU B 1 165 ? 61.454 15.983 -3.863  1.00 20.05 ? 141 GLU B OE2   1 
ATOM   3612 N  N     . ALA B 1 166 ? 59.934 16.655 -10.775 1.00 20.26 ? 142 ALA B N     1 
ATOM   3613 C  CA    . ALA B 1 166 ? 58.911 16.801 -11.806 1.00 21.20 ? 142 ALA B CA    1 
ATOM   3614 C  C     . ALA B 1 166 ? 57.869 15.686 -11.797 1.00 20.18 ? 142 ALA B C     1 
ATOM   3615 O  O     . ALA B 1 166 ? 56.686 15.956 -12.027 1.00 21.86 ? 142 ALA B O     1 
ATOM   3616 C  CB    . ALA B 1 166 ? 59.549 16.931 -13.184 1.00 23.22 ? 142 ALA B CB    1 
ATOM   3617 N  N     . ASP B 1 167 ? 58.296 14.451 -11.516 1.00 20.86 ? 143 ASP B N     1 
ATOM   3618 C  CA    A ASP B 1 167 ? 57.387 13.304 -11.448 0.50 22.09 ? 143 ASP B CA    1 
ATOM   3619 C  CA    B ASP B 1 167 ? 57.366 13.326 -11.472 0.50 22.18 ? 143 ASP B CA    1 
ATOM   3620 C  C     . ASP B 1 167 ? 56.371 13.477 -10.322 1.00 22.35 ? 143 ASP B C     1 
ATOM   3621 O  O     . ASP B 1 167 ? 55.221 13.040 -10.427 1.00 23.73 ? 143 ASP B O     1 
ATOM   3622 C  CB    A ASP B 1 167 ? 58.171 11.997 -11.264 0.50 24.33 ? 143 ASP B CB    1 
ATOM   3623 C  CB    B ASP B 1 167 ? 58.119 12.001 -11.364 0.50 25.72 ? 143 ASP B CB    1 
ATOM   3624 C  CG    A ASP B 1 167 ? 59.010 11.984 -9.989  0.50 27.25 ? 143 ASP B CG    1 
ATOM   3625 C  CG    B ASP B 1 167 ? 58.989 11.726 -12.574 0.50 31.31 ? 143 ASP B CG    1 
ATOM   3626 O  OD1   A ASP B 1 167 ? 59.731 12.973 -9.737  0.50 29.05 ? 143 ASP B OD1   1 
ATOM   3627 O  OD1   B ASP B 1 167 ? 58.854 12.450 -13.586 0.50 32.62 ? 143 ASP B OD1   1 
ATOM   3628 O  OD2   A ASP B 1 167 ? 58.948 10.987 -9.237  0.50 31.76 ? 143 ASP B OD2   1 
ATOM   3629 O  OD2   B ASP B 1 167 ? 59.803 10.782 -12.512 0.50 29.96 ? 143 ASP B OD2   1 
ATOM   3630 N  N     . VAL B 1 168 ? 56.808 14.102 -9.232  1.00 19.28 ? 144 VAL B N     1 
ATOM   3631 C  CA    . VAL B 1 168 ? 55.915 14.324 -8.087  1.00 19.51 ? 144 VAL B CA    1 
ATOM   3632 C  C     . VAL B 1 168 ? 54.816 15.339 -8.438  1.00 18.51 ? 144 VAL B C     1 
ATOM   3633 O  O     . VAL B 1 168 ? 53.619 15.089 -8.191  1.00 18.87 ? 144 VAL B O     1 
ATOM   3634 C  CB    . VAL B 1 168 ? 56.684 14.726 -6.806  1.00 18.82 ? 144 VAL B CB    1 
ATOM   3635 C  CG1   . VAL B 1 168 ? 55.697 15.107 -5.705  1.00 20.04 ? 144 VAL B CG1   1 
ATOM   3636 C  CG2   . VAL B 1 168 ? 57.585 13.586 -6.347  1.00 19.08 ? 144 VAL B CG2   1 
ATOM   3637 N  N     . VAL B 1 169 ? 55.207 16.462 -9.040  1.00 18.35 ? 145 VAL B N     1 
ATOM   3638 C  CA    . VAL B 1 169 ? 54.245 17.470 -9.489  1.00 16.88 ? 145 VAL B CA    1 
ATOM   3639 C  C     . VAL B 1 169 ? 53.269 16.852 -10.495 1.00 18.55 ? 145 VAL B C     1 
ATOM   3640 O  O     . VAL B 1 169 ? 52.058 17.012 -10.368 1.00 19.46 ? 145 VAL B O     1 
ATOM   3641 C  CB    . VAL B 1 169 ? 54.912 18.710 -10.144 1.00 15.93 ? 145 VAL B CB    1 
ATOM   3642 C  CG1   . VAL B 1 169 ? 53.864 19.763 -10.490 1.00 18.20 ? 145 VAL B CG1   1 
ATOM   3643 C  CG2   . VAL B 1 169 ? 55.992 19.324 -9.252  1.00 17.18 ? 145 VAL B CG2   1 
ATOM   3644 N  N     . ALA B 1 170 ? 53.806 16.138 -11.488 1.00 20.13 ? 146 ALA B N     1 
ATOM   3645 C  CA    . ALA B 1 170 ? 52.995 15.459 -12.497 1.00 20.38 ? 146 ALA B CA    1 
ATOM   3646 C  C     . ALA B 1 170 ? 51.942 14.508 -11.891 1.00 20.50 ? 146 ALA B C     1 
ATOM   3647 O  O     . ALA B 1 170 ? 50.837 14.362 -12.442 1.00 23.37 ? 146 ALA B O     1 
ATOM   3648 C  CB    . ALA B 1 170 ? 53.896 14.712 -13.488 1.00 19.49 ? 146 ALA B CB    1 
ATOM   3649 N  N     . ASP B 1 171 ? 52.293 13.888 -10.757 1.00 19.36 ? 147 ASP B N     1 
ATOM   3650 C  CA    . ASP B 1 171 ? 51.485 12.836 -10.118 1.00 20.27 ? 147 ASP B CA    1 
ATOM   3651 C  C     . ASP B 1 171 ? 50.715 13.310 -8.872  1.00 19.78 ? 147 ASP B C     1 
ATOM   3652 O  O     . ASP B 1 171 ? 50.254 12.478 -8.087  1.00 22.47 ? 147 ASP B O     1 
ATOM   3653 C  CB    . ASP B 1 171 ? 52.376 11.655 -9.702  1.00 22.94 ? 147 ASP B CB    1 
ATOM   3654 C  CG    . ASP B 1 171 ? 53.069 10.986 -10.878 1.00 24.90 ? 147 ASP B CG    1 
ATOM   3655 O  OD1   . ASP B 1 171 ? 52.737 11.294 -12.044 1.00 27.98 ? 147 ASP B OD1   1 
ATOM   3656 O  OD2   . ASP B 1 171 ? 53.969 10.161 -10.620 1.00 27.46 ? 147 ASP B OD2   1 
ATOM   3657 N  N     . ALA B 1 172 ? 50.568 14.625 -8.707  1.00 18.51 ? 148 ALA B N     1 
ATOM   3658 C  CA    . ALA B 1 172 ? 49.846 15.189 -7.545  1.00 16.23 ? 148 ALA B CA    1 
ATOM   3659 C  C     . ALA B 1 172 ? 48.566 15.880 -8.010  1.00 16.70 ? 148 ALA B C     1 
ATOM   3660 O  O     . ALA B 1 172 ? 48.596 16.727 -8.910  1.00 17.03 ? 148 ALA B O     1 
ATOM   3661 C  CB    . ALA B 1 172 ? 50.725 16.174 -6.782  1.00 17.22 ? 148 ALA B CB    1 
ATOM   3662 N  N     . LYS B 1 173 ? 47.432 15.539 -7.401  1.00 17.79 ? 149 LYS B N     1 
ATOM   3663 C  CA    . LYS B 1 173 ? 46.165 16.139 -7.794  1.00 16.93 ? 149 LYS B CA    1 
ATOM   3664 C  C     . LYS B 1 173 ? 46.208 17.658 -7.645  1.00 15.44 ? 149 LYS B C     1 
ATOM   3665 O  O     . LYS B 1 173 ? 45.743 18.371 -8.534  1.00 17.08 ? 149 LYS B O     1 
ATOM   3666 C  CB    . LYS B 1 173 ? 44.993 15.574 -6.989  1.00 16.66 ? 149 LYS B CB    1 
ATOM   3667 C  CG    . LYS B 1 173 ? 44.732 14.092 -7.195  1.00 19.43 ? 149 LYS B CG    1 
ATOM   3668 C  CD    . LYS B 1 173 ? 43.612 13.603 -6.290  1.00 23.97 ? 149 LYS B CD    1 
ATOM   3669 C  CE    . LYS B 1 173 ? 43.344 12.119 -6.466  1.00 27.04 ? 149 LYS B CE    1 
ATOM   3670 N  NZ    . LYS B 1 173 ? 42.680 11.535 -5.264  1.00 32.19 ? 149 LYS B NZ    1 
ATOM   3671 N  N     . VAL B 1 174 ? 46.744 18.148 -6.524  1.00 15.67 ? 150 VAL B N     1 
ATOM   3672 C  CA    . VAL B 1 174 ? 46.910 19.585 -6.310  1.00 15.78 ? 150 VAL B CA    1 
ATOM   3673 C  C     . VAL B 1 174 ? 48.355 19.862 -5.867  1.00 16.59 ? 150 VAL B C     1 
ATOM   3674 O  O     . VAL B 1 174 ? 48.886 19.151 -5.013  1.00 17.32 ? 150 VAL B O     1 
ATOM   3675 C  CB    . VAL B 1 174 ? 45.953 20.138 -5.217  1.00 18.06 ? 150 VAL B CB    1 
ATOM   3676 C  CG1   . VAL B 1 174 ? 46.174 21.632 -5.023  1.00 18.25 ? 150 VAL B CG1   1 
ATOM   3677 C  CG2   . VAL B 1 174 ? 44.497 19.877 -5.570  1.00 18.64 ? 150 VAL B CG2   1 
ATOM   3678 N  N     . THR B 1 175 ? 48.965 20.908 -6.431  1.00 18.36 ? 151 THR B N     1 
ATOM   3679 C  CA    . THR B 1 175 ? 50.208 21.478 -5.920  1.00 16.53 ? 151 THR B CA    1 
ATOM   3680 C  C     . THR B 1 175 ? 49.888 22.836 -5.311  1.00 14.73 ? 151 THR B C     1 
ATOM   3681 O  O     . THR B 1 175 ? 49.345 23.725 -5.984  1.00 15.69 ? 151 THR B O     1 
ATOM   3682 C  CB    . THR B 1 175 ? 51.303 21.595 -7.024  1.00 15.59 ? 151 THR B CB    1 
ATOM   3683 O  OG1   . THR B 1 175 ? 51.716 20.281 -7.425  1.00 16.30 ? 151 THR B OG1   1 
ATOM   3684 C  CG2   . THR B 1 175 ? 52.518 22.348 -6.521  1.00 18.54 ? 151 THR B CG2   1 
ATOM   3685 N  N     . TYR B 1 176 ? 50.197 22.957 -4.019  1.00 14.93 ? 152 TYR B N     1 
ATOM   3686 C  CA    . TYR B 1 176 ? 49.897 24.128 -3.212  1.00 15.36 ? 152 TYR B CA    1 
ATOM   3687 C  C     . TYR B 1 176 ? 51.190 24.760 -2.732  1.00 15.26 ? 152 TYR B C     1 
ATOM   3688 O  O     . TYR B 1 176 ? 52.112 24.056 -2.310  1.00 15.78 ? 152 TYR B O     1 
ATOM   3689 C  CB    . TYR B 1 176 ? 49.055 23.666 -2.027  1.00 17.36 ? 152 TYR B CB    1 
ATOM   3690 C  CG    . TYR B 1 176 ? 48.858 24.600 -0.851  1.00 14.81 ? 152 TYR B CG    1 
ATOM   3691 C  CD1   . TYR B 1 176 ? 47.747 25.436 -0.785  1.00 14.84 ? 152 TYR B CD1   1 
ATOM   3692 C  CD2   . TYR B 1 176 ? 49.734 24.581 0.245   1.00 15.28 ? 152 TYR B CD2   1 
ATOM   3693 C  CE1   . TYR B 1 176 ? 47.536 26.257 0.319   1.00 16.04 ? 152 TYR B CE1   1 
ATOM   3694 C  CE2   . TYR B 1 176 ? 49.522 25.391 1.361   1.00 15.07 ? 152 TYR B CE2   1 
ATOM   3695 C  CZ    . TYR B 1 176 ? 48.407 26.229 1.393   1.00 14.77 ? 152 TYR B CZ    1 
ATOM   3696 O  OH    . TYR B 1 176 ? 48.189 27.032 2.502   1.00 13.92 ? 152 TYR B OH    1 
ATOM   3697 N  N     . PHE B 1 177 ? 51.245 26.088 -2.774  1.00 14.94 ? 153 PHE B N     1 
ATOM   3698 C  CA    . PHE B 1 177 ? 52.453 26.804 -2.356  1.00 15.83 ? 153 PHE B CA    1 
ATOM   3699 C  C     . PHE B 1 177 ? 52.174 28.094 -1.578  1.00 16.02 ? 153 PHE B C     1 
ATOM   3700 O  O     . PHE B 1 177 ? 51.070 28.655 -1.657  1.00 15.47 ? 153 PHE B O     1 
ATOM   3701 C  CB    . PHE B 1 177 ? 53.345 27.079 -3.579  1.00 16.05 ? 153 PHE B CB    1 
ATOM   3702 C  CG    . PHE B 1 177 ? 52.781 28.102 -4.527  1.00 14.36 ? 153 PHE B CG    1 
ATOM   3703 C  CD1   . PHE B 1 177 ? 51.895 27.728 -5.547  1.00 17.06 ? 153 PHE B CD1   1 
ATOM   3704 C  CD2   . PHE B 1 177 ? 53.092 29.453 -4.385  1.00 14.60 ? 153 PHE B CD2   1 
ATOM   3705 C  CE1   . PHE B 1 177 ? 51.355 28.678 -6.413  1.00 16.69 ? 153 PHE B CE1   1 
ATOM   3706 C  CE2   . PHE B 1 177 ? 52.538 30.405 -5.237  1.00 14.58 ? 153 PHE B CE2   1 
ATOM   3707 C  CZ    . PHE B 1 177 ? 51.674 30.017 -6.250  1.00 15.86 ? 153 PHE B CZ    1 
ATOM   3708 N  N     . GLU B 1 178 ? 53.172 28.530 -0.815  1.00 14.63 ? 154 GLU B N     1 
ATOM   3709 C  CA    . GLU B 1 178 ? 53.082 29.762 -0.031  1.00 13.33 ? 154 GLU B CA    1 
ATOM   3710 C  C     . GLU B 1 178 ? 53.403 31.037 -0.796  1.00 14.40 ? 154 GLU B C     1 
ATOM   3711 O  O     . GLU B 1 178 ? 54.438 31.117 -1.483  1.00 15.45 ? 154 GLU B O     1 
ATOM   3712 C  CB    . GLU B 1 178 ? 54.015 29.724 1.181   1.00 13.12 ? 154 GLU B CB    1 
ATOM   3713 C  CG    . GLU B 1 178 ? 54.039 28.450 2.005   1.00 15.88 ? 154 GLU B CG    1 
ATOM   3714 C  CD    . GLU B 1 178 ? 55.304 28.314 2.834   1.00 15.18 ? 154 GLU B CD    1 
ATOM   3715 O  OE1   . GLU B 1 178 ? 56.330 28.967 2.530   1.00 14.61 ? 154 GLU B OE1   1 
ATOM   3716 O  OE2   . GLU B 1 178 ? 55.302 27.542 3.800   1.00 15.23 ? 154 GLU B OE2   1 
ATOM   3717 N  N     . GLY B 1 179 ? 52.560 32.051 -0.603  1.00 14.53 ? 155 GLY B N     1 
ATOM   3718 C  CA    . GLY B 1 179 ? 52.927 33.433 -0.880  1.00 15.30 ? 155 GLY B CA    1 
ATOM   3719 C  C     . GLY B 1 179 ? 54.282 33.805 -0.280  1.00 14.64 ? 155 GLY B C     1 
ATOM   3720 O  O     . GLY B 1 179 ? 55.029 34.585 -0.869  1.00 16.62 ? 155 GLY B O     1 
ATOM   3721 N  N     . TYR B 1 180 ? 54.607 33.219 0.878   1.00 14.89 ? 156 TYR B N     1 
ATOM   3722 C  CA    . TYR B 1 180 ? 55.870 33.442 1.576   1.00 15.03 ? 156 TYR B CA    1 
ATOM   3723 C  C     . TYR B 1 180 ? 57.075 33.124 0.690   1.00 15.03 ? 156 TYR B C     1 
ATOM   3724 O  O     . TYR B 1 180 ? 58.186 33.606 0.963   1.00 15.54 ? 156 TYR B O     1 
ATOM   3725 C  CB    . TYR B 1 180 ? 55.951 32.572 2.824   1.00 15.31 ? 156 TYR B CB    1 
ATOM   3726 C  CG    . TYR B 1 180 ? 55.133 32.973 4.041   1.00 15.54 ? 156 TYR B CG    1 
ATOM   3727 C  CD1   . TYR B 1 180 ? 55.104 34.290 4.519   1.00 15.92 ? 156 TYR B CD1   1 
ATOM   3728 C  CD2   . TYR B 1 180 ? 54.440 31.992 4.758   1.00 15.95 ? 156 TYR B CD2   1 
ATOM   3729 C  CE1   . TYR B 1 180 ? 54.385 34.615 5.671   1.00 16.21 ? 156 TYR B CE1   1 
ATOM   3730 C  CE2   . TYR B 1 180 ? 53.736 32.306 5.922   1.00 14.15 ? 156 TYR B CE2   1 
ATOM   3731 C  CZ    . TYR B 1 180 ? 53.710 33.607 6.368   1.00 15.67 ? 156 TYR B CZ    1 
ATOM   3732 O  OH    . TYR B 1 180 ? 53.010 33.911 7.534   1.00 16.50 ? 156 TYR B OH    1 
ATOM   3733 N  N     . LEU B 1 181 ? 56.865 32.297 -0.341  1.00 14.21 ? 157 LEU B N     1 
ATOM   3734 C  CA    . LEU B 1 181 ? 57.980 31.907 -1.225  1.00 14.89 ? 157 LEU B CA    1 
ATOM   3735 C  C     . LEU B 1 181 ? 58.485 33.060 -2.095  1.00 16.32 ? 157 LEU B C     1 
ATOM   3736 O  O     . LEU B 1 181 ? 59.537 32.943 -2.740  1.00 17.01 ? 157 LEU B O     1 
ATOM   3737 C  CB    . LEU B 1 181 ? 57.616 30.687 -2.083  1.00 15.04 ? 157 LEU B CB    1 
ATOM   3738 C  CG    . LEU B 1 181 ? 57.562 29.357 -1.332  1.00 15.00 ? 157 LEU B CG    1 
ATOM   3739 C  CD1   . LEU B 1 181 ? 57.035 28.303 -2.298  1.00 16.94 ? 157 LEU B CD1   1 
ATOM   3740 C  CD2   . LEU B 1 181 ? 58.938 28.970 -0.774  1.00 15.81 ? 157 LEU B CD2   1 
ATOM   3741 N  N     . TRP B 1 182 ? 57.763 34.176 -2.095  1.00 15.53 ? 158 TRP B N     1 
ATOM   3742 C  CA    . TRP B 1 182 ? 58.181 35.334 -2.889  1.00 16.61 ? 158 TRP B CA    1 
ATOM   3743 C  C     . TRP B 1 182 ? 59.302 36.139 -2.210  1.00 17.11 ? 158 TRP B C     1 
ATOM   3744 O  O     . TRP B 1 182 ? 59.941 36.969 -2.843  1.00 18.44 ? 158 TRP B O     1 
ATOM   3745 C  CB    . TRP B 1 182 ? 56.980 36.190 -3.342  1.00 16.58 ? 158 TRP B CB    1 
ATOM   3746 C  CG    . TRP B 1 182 ? 56.585 35.928 -4.787  1.00 15.42 ? 158 TRP B CG    1 
ATOM   3747 C  CD1   . TRP B 1 182 ? 56.562 36.838 -5.797  1.00 19.17 ? 158 TRP B CD1   1 
ATOM   3748 C  CD2   . TRP B 1 182 ? 56.212 34.676 -5.368  1.00 15.13 ? 158 TRP B CD2   1 
ATOM   3749 N  NE1   . TRP B 1 182 ? 56.195 36.243 -6.981  1.00 18.99 ? 158 TRP B NE1   1 
ATOM   3750 C  CE2   . TRP B 1 182 ? 55.974 34.907 -6.751  1.00 17.63 ? 158 TRP B CE2   1 
ATOM   3751 C  CE3   . TRP B 1 182 ? 56.054 33.380 -4.864  1.00 17.41 ? 158 TRP B CE3   1 
ATOM   3752 C  CZ2   . TRP B 1 182 ? 55.575 33.878 -7.627  1.00 17.35 ? 158 TRP B CZ2   1 
ATOM   3753 C  CZ3   . TRP B 1 182 ? 55.663 32.369 -5.726  1.00 18.01 ? 158 TRP B CZ3   1 
ATOM   3754 C  CH2   . TRP B 1 182 ? 55.424 32.622 -7.093  1.00 17.48 ? 158 TRP B CH2   1 
ATOM   3755 N  N     . ASP B 1 183 ? 59.561 35.874 -0.931  1.00 16.27 ? 159 ASP B N     1 
ATOM   3756 C  CA    . ASP B 1 183 ? 60.663 36.529 -0.229  1.00 15.85 ? 159 ASP B CA    1 
ATOM   3757 C  C     . ASP B 1 183 ? 62.055 35.994 -0.613  1.00 16.75 ? 159 ASP B C     1 
ATOM   3758 O  O     . ASP B 1 183 ? 62.916 36.797 -1.005  1.00 20.59 ? 159 ASP B O     1 
ATOM   3759 C  CB    . ASP B 1 183 ? 60.455 36.521 1.295   1.00 17.04 ? 159 ASP B CB    1 
ATOM   3760 C  CG    . ASP B 1 183 ? 59.387 37.493 1.739   1.00 18.00 ? 159 ASP B CG    1 
ATOM   3761 O  OD1   . ASP B 1 183 ? 59.404 38.666 1.294   1.00 17.86 ? 159 ASP B OD1   1 
ATOM   3762 O  OD2   . ASP B 1 183 ? 58.528 37.083 2.562   1.00 18.97 ? 159 ASP B OD2   1 
ATOM   3763 N  N     . PRO B 1 184 ? 62.281 34.662 -0.525  1.00 16.38 ? 160 PRO B N     1 
ATOM   3764 C  CA    . PRO B 1 184 ? 63.580 34.150 -0.993  1.00 16.44 ? 160 PRO B CA    1 
ATOM   3765 C  C     . PRO B 1 184 ? 63.730 34.360 -2.492  1.00 18.68 ? 160 PRO B C     1 
ATOM   3766 O  O     . PRO B 1 184 ? 62.735 34.482 -3.177  1.00 21.47 ? 160 PRO B O     1 
ATOM   3767 C  CB    . PRO B 1 184 ? 63.524 32.648 -0.654  1.00 17.10 ? 160 PRO B CB    1 
ATOM   3768 C  CG    . PRO B 1 184 ? 62.074 32.339 -0.473  1.00 17.97 ? 160 PRO B CG    1 
ATOM   3769 C  CD    . PRO B 1 184 ? 61.488 33.584 0.107   1.00 16.06 ? 160 PRO B CD    1 
ATOM   3770 N  N     . PRO B 1 185 ? 64.973 34.403 -2.998  1.00 21.38 ? 161 PRO B N     1 
ATOM   3771 C  CA    . PRO B 1 185 ? 65.161 34.914 -4.356  1.00 22.68 ? 161 PRO B CA    1 
ATOM   3772 C  C     . PRO B 1 185 ? 64.680 34.024 -5.503  1.00 20.37 ? 161 PRO B C     1 
ATOM   3773 O  O     . PRO B 1 185 ? 64.133 34.536 -6.479  1.00 27.09 ? 161 PRO B O     1 
ATOM   3774 C  CB    . PRO B 1 185 ? 66.682 35.121 -4.441  1.00 23.91 ? 161 PRO B CB    1 
ATOM   3775 C  CG    . PRO B 1 185 ? 67.245 34.138 -3.477  1.00 26.13 ? 161 PRO B CG    1 
ATOM   3776 C  CD    . PRO B 1 185 ? 66.252 34.057 -2.351  1.00 25.47 ? 161 PRO B CD    1 
ATOM   3777 N  N     . ARG B 1 186 ? 64.868 32.713 -5.392  1.00 18.37 ? 162 ARG B N     1 
ATOM   3778 C  CA    . ARG B 1 186 ? 64.706 31.840 -6.549  1.00 20.48 ? 162 ARG B CA    1 
ATOM   3779 C  C     . ARG B 1 186 ? 63.541 30.878 -6.439  1.00 18.73 ? 162 ARG B C     1 
ATOM   3780 O  O     . ARG B 1 186 ? 63.253 30.141 -7.378  1.00 19.20 ? 162 ARG B O     1 
ATOM   3781 C  CB    . ARG B 1 186 ? 66.003 31.067 -6.808  1.00 24.58 ? 162 ARG B CB    1 
ATOM   3782 C  CG    . ARG B 1 186 ? 67.159 31.960 -7.242  1.00 30.53 ? 162 ARG B CG    1 
ATOM   3783 C  CD    . ARG B 1 186 ? 68.503 31.246 -7.201  1.00 37.61 ? 162 ARG B CD    1 
ATOM   3784 N  NE    . ARG B 1 186 ? 68.520 30.058 -8.047  1.00 43.91 ? 162 ARG B NE    1 
ATOM   3785 C  CZ    . ARG B 1 186 ? 68.592 28.805 -7.601  1.00 38.87 ? 162 ARG B CZ    1 
ATOM   3786 N  NH1   . ARG B 1 186 ? 68.682 28.542 -6.300  1.00 38.24 ? 162 ARG B NH1   1 
ATOM   3787 N  NH2   . ARG B 1 186 ? 68.586 27.806 -8.469  1.00 35.11 ? 162 ARG B NH2   1 
ATOM   3788 N  N     . ALA B 1 187 ? 62.876 30.864 -5.289  1.00 19.02 ? 163 ALA B N     1 
ATOM   3789 C  CA    . ALA B 1 187 ? 61.769 29.937 -5.106  1.00 17.83 ? 163 ALA B CA    1 
ATOM   3790 C  C     . ALA B 1 187 ? 60.661 30.121 -6.148  1.00 16.64 ? 163 ALA B C     1 
ATOM   3791 O  O     . ALA B 1 187 ? 60.077 29.139 -6.597  1.00 17.70 ? 163 ALA B O     1 
ATOM   3792 C  CB    . ALA B 1 187 ? 61.204 30.043 -3.695  1.00 17.97 ? 163 ALA B CB    1 
ATOM   3793 N  N     . LYS B 1 188 ? 60.397 31.369 -6.543  1.00 17.61 ? 164 LYS B N     1 
ATOM   3794 C  CA    . LYS B 1 188 ? 59.352 31.660 -7.527  1.00 17.13 ? 164 LYS B CA    1 
ATOM   3795 C  C     . LYS B 1 188 ? 59.587 30.935 -8.858  1.00 18.20 ? 164 LYS B C     1 
ATOM   3796 O  O     . LYS B 1 188 ? 58.638 30.531 -9.523  1.00 19.67 ? 164 LYS B O     1 
ATOM   3797 C  CB    . LYS B 1 188 ? 59.197 33.163 -7.736  1.00 18.42 ? 164 LYS B CB    1 
ATOM   3798 C  CG    . LYS B 1 188 ? 60.404 33.842 -8.377  1.00 21.18 ? 164 LYS B CG    1 
ATOM   3799 C  CD    . LYS B 1 188 ? 60.138 35.298 -8.732  1.00 26.77 ? 164 LYS B CD    1 
ATOM   3800 C  CE    . LYS B 1 188 ? 59.777 36.121 -7.510  1.00 30.79 ? 164 LYS B CE    1 
ATOM   3801 N  NZ    . LYS B 1 188 ? 60.912 36.220 -6.551  1.00 36.13 ? 164 LYS B NZ    1 
ATOM   3802 N  N     . GLU B 1 189 ? 60.856 30.779 -9.237  1.00 19.69 ? 165 GLU B N     1 
ATOM   3803 C  CA    . GLU B 1 189 ? 61.195 30.023 -10.444 1.00 21.09 ? 165 GLU B CA    1 
ATOM   3804 C  C     . GLU B 1 189 ? 60.776 28.564 -10.317 1.00 18.47 ? 165 GLU B C     1 
ATOM   3805 O  O     . GLU B 1 189 ? 60.283 27.978 -11.277 1.00 21.73 ? 165 GLU B O     1 
ATOM   3806 C  CB    . GLU B 1 189 ? 62.692 30.080 -10.742 1.00 22.81 ? 165 GLU B CB    1 
ATOM   3807 C  CG    . GLU B 1 189 ? 63.310 31.467 -10.722 1.00 25.30 ? 165 GLU B CG    1 
ATOM   3808 C  CD    . GLU B 1 189 ? 64.829 31.416 -10.737 1.00 31.72 ? 165 GLU B CD    1 
ATOM   3809 O  OE1   . GLU B 1 189 ? 65.457 32.363 -10.232 1.00 33.41 ? 165 GLU B OE1   1 
ATOM   3810 O  OE2   . GLU B 1 189 ? 65.397 30.421 -11.239 1.00 34.63 ? 165 GLU B OE2   1 
ATOM   3811 N  N     . ALA B 1 190 ? 60.999 27.964 -9.144  1.00 18.37 ? 166 ALA B N     1 
ATOM   3812 C  CA    . ALA B 1 190 ? 60.531 26.597 -8.902  1.00 18.68 ? 166 ALA B CA    1 
ATOM   3813 C  C     . ALA B 1 190 ? 59.009 26.540 -9.023  1.00 16.73 ? 166 ALA B C     1 
ATOM   3814 O  O     . ALA B 1 190 ? 58.468 25.601 -9.601  1.00 18.51 ? 166 ALA B O     1 
ATOM   3815 C  CB    . ALA B 1 190 ? 60.964 26.102 -7.537  1.00 16.96 ? 166 ALA B CB    1 
ATOM   3816 N  N     . ILE B 1 191 ? 58.323 27.557 -8.499  1.00 17.55 ? 167 ILE B N     1 
ATOM   3817 C  CA    . ILE B 1 191 ? 56.851 27.575 -8.534  1.00 18.21 ? 167 ILE B CA    1 
ATOM   3818 C  C     . ILE B 1 191 ? 56.307 27.678 -9.951  1.00 18.20 ? 167 ILE B C     1 
ATOM   3819 O  O     . ILE B 1 191 ? 55.353 26.982 -10.302 1.00 19.66 ? 167 ILE B O     1 
ATOM   3820 C  CB    . ILE B 1 191 ? 56.253 28.680 -7.634  1.00 17.69 ? 167 ILE B CB    1 
ATOM   3821 C  CG1   . ILE B 1 191 ? 56.568 28.366 -6.168  1.00 15.42 ? 167 ILE B CG1   1 
ATOM   3822 C  CG2   . ILE B 1 191 ? 54.749 28.843 -7.857  1.00 17.49 ? 167 ILE B CG2   1 
ATOM   3823 C  CD1   . ILE B 1 191 ? 56.261 26.944 -5.747  1.00 18.10 ? 167 ILE B CD1   1 
ATOM   3824 N  N     . LEU B 1 192 ? 56.927 28.529 -10.763 1.00 19.65 ? 168 LEU B N     1 
ATOM   3825 C  CA    . LEU B 1 192 ? 56.531 28.644 -12.166 1.00 20.94 ? 168 LEU B CA    1 
ATOM   3826 C  C     . LEU B 1 192 ? 56.736 27.321 -12.916 1.00 20.31 ? 168 LEU B C     1 
ATOM   3827 O  O     . LEU B 1 192 ? 55.886 26.932 -13.721 1.00 21.47 ? 168 LEU B O     1 
ATOM   3828 C  CB    . LEU B 1 192 ? 57.247 29.809 -12.854 1.00 23.54 ? 168 LEU B CB    1 
ATOM   3829 C  CG    . LEU B 1 192 ? 56.864 31.216 -12.367 1.00 25.21 ? 168 LEU B CG    1 
ATOM   3830 C  CD1   . LEU B 1 192 ? 57.528 32.285 -13.222 1.00 29.91 ? 168 LEU B CD1   1 
ATOM   3831 C  CD2   . LEU B 1 192 ? 55.358 31.435 -12.334 1.00 29.19 ? 168 LEU B CD2   1 
ATOM   3832 N  N     . ASP B 1 193 ? 57.831 26.615 -12.611 1.00 20.22 ? 169 ASP B N     1 
ATOM   3833 C  CA    . ASP B 1 193 ? 58.046 25.269 -13.156 1.00 19.45 ? 169 ASP B CA    1 
ATOM   3834 C  C     . ASP B 1 193 ? 56.952 24.284 -12.712 1.00 19.43 ? 169 ASP B C     1 
ATOM   3835 O  O     . ASP B 1 193 ? 56.424 23.539 -13.535 1.00 21.27 ? 169 ASP B O     1 
ATOM   3836 C  CB    . ASP B 1 193 ? 59.436 24.729 -12.814 1.00 23.36 ? 169 ASP B CB    1 
ATOM   3837 C  CG    . ASP B 1 193 ? 60.560 25.446 -13.558 1.00 27.89 ? 169 ASP B CG    1 
ATOM   3838 O  OD1   . ASP B 1 193 ? 60.306 26.093 -14.601 1.00 32.08 ? 169 ASP B OD1   1 
ATOM   3839 O  OD2   . ASP B 1 193 ? 61.716 25.344 -13.097 1.00 28.72 ? 169 ASP B OD2   1 
ATOM   3840 N  N     . CYS B 1 194 ? 56.603 24.303 -11.422 1.00 20.15 ? 170 CYS B N     1 
ATOM   3841 C  CA    . CYS B 1 194 ? 55.507 23.478 -10.903 1.00 19.34 ? 170 CYS B CA    1 
ATOM   3842 C  C     . CYS B 1 194 ? 54.196 23.750 -11.623 1.00 18.44 ? 170 CYS B C     1 
ATOM   3843 O  O     . CYS B 1 194 ? 53.495 22.809 -11.991 1.00 19.08 ? 170 CYS B O     1 
ATOM   3844 C  CB    . CYS B 1 194 ? 55.296 23.706 -9.399  1.00 19.54 ? 170 CYS B CB    1 
ATOM   3845 S  SG    . CYS B 1 194 ? 56.625 23.078 -8.363  1.00 20.41 ? 170 CYS B SG    1 
ATOM   3846 N  N     . ALA B 1 195 ? 53.869 25.030 -11.810 1.00 19.20 ? 171 ALA B N     1 
ATOM   3847 C  CA    . ALA B 1 195 ? 52.629 25.442 -12.478 1.00 19.33 ? 171 ALA B CA    1 
ATOM   3848 C  C     . ALA B 1 195 ? 52.558 24.859 -13.883 1.00 20.09 ? 171 ALA B C     1 
ATOM   3849 O  O     . ALA B 1 195 ? 51.535 24.293 -14.273 1.00 22.88 ? 171 ALA B O     1 
ATOM   3850 C  CB    . ALA B 1 195 ? 52.527 26.956 -12.525 1.00 19.44 ? 171 ALA B CB    1 
ATOM   3851 N  N     . ARG B 1 196 ? 53.670 24.956 -14.613 1.00 18.92 ? 172 ARG B N     1 
ATOM   3852 C  CA    A ARG B 1 196 ? 53.728 24.430 -15.973 0.50 20.96 ? 172 ARG B CA    1 
ATOM   3853 C  CA    B ARG B 1 196 ? 53.745 24.421 -15.978 0.50 20.58 ? 172 ARG B CA    1 
ATOM   3854 C  C     . ARG B 1 196 ? 53.469 22.920 -15.994 1.00 20.89 ? 172 ARG B C     1 
ATOM   3855 O  O     . ARG B 1 196 ? 52.613 22.450 -16.742 1.00 25.11 ? 172 ARG B O     1 
ATOM   3856 C  CB    A ARG B 1 196 ? 55.077 24.758 -16.614 0.50 22.50 ? 172 ARG B CB    1 
ATOM   3857 C  CB    B ARG B 1 196 ? 55.117 24.699 -16.608 0.50 20.93 ? 172 ARG B CB    1 
ATOM   3858 C  CG    A ARG B 1 196 ? 55.062 24.718 -18.133 0.50 23.83 ? 172 ARG B CG    1 
ATOM   3859 C  CG    B ARG B 1 196 ? 55.301 24.066 -17.984 0.50 21.13 ? 172 ARG B CG    1 
ATOM   3860 C  CD    A ARG B 1 196 ? 56.327 25.340 -18.700 0.50 24.13 ? 172 ARG B CD    1 
ATOM   3861 C  CD    B ARG B 1 196 ? 56.699 24.305 -18.533 0.50 24.15 ? 172 ARG B CD    1 
ATOM   3862 N  NE    A ARG B 1 196 ? 57.520 24.786 -18.073 0.50 24.94 ? 172 ARG B NE    1 
ATOM   3863 N  NE    B ARG B 1 196 ? 57.726 23.935 -17.566 0.50 24.48 ? 172 ARG B NE    1 
ATOM   3864 C  CZ    A ARG B 1 196 ? 58.241 25.408 -17.145 0.50 23.94 ? 172 ARG B CZ    1 
ATOM   3865 C  CZ    B ARG B 1 196 ? 58.171 22.699 -17.381 0.50 16.61 ? 172 ARG B CZ    1 
ATOM   3866 N  NH1   A ARG B 1 196 ? 57.905 26.627 -16.739 0.50 27.52 ? 172 ARG B NH1   1 
ATOM   3867 N  NH1   B ARG B 1 196 ? 57.677 21.704 -18.080 0.50 23.14 ? 172 ARG B NH1   1 
ATOM   3868 N  NH2   A ARG B 1 196 ? 59.307 24.815 -16.635 0.50 26.39 ? 172 ARG B NH2   1 
ATOM   3869 N  NH2   B ARG B 1 196 ? 59.103 22.472 -16.469 0.50 23.89 ? 172 ARG B NH2   1 
ATOM   3870 N  N     . ILE B 1 197 ? 54.209 22.171 -15.173 1.00 17.30 ? 173 ILE B N     1 
ATOM   3871 C  CA    . ILE B 1 197 ? 54.077 20.712 -15.109 1.00 17.82 ? 173 ILE B CA    1 
ATOM   3872 C  C     . ILE B 1 197 ? 52.681 20.283 -14.650 1.00 18.13 ? 173 ILE B C     1 
ATOM   3873 O  O     . ILE B 1 197 ? 52.064 19.417 -15.251 1.00 21.43 ? 173 ILE B O     1 
ATOM   3874 C  CB    . ILE B 1 197 ? 55.139 20.098 -14.176 1.00 19.27 ? 173 ILE B CB    1 
ATOM   3875 C  CG1   . ILE B 1 197 ? 56.559 20.386 -14.708 1.00 21.52 ? 173 ILE B CG1   1 
ATOM   3876 C  CG2   . ILE B 1 197 ? 54.928 18.599 -14.001 1.00 18.64 ? 173 ILE B CG2   1 
ATOM   3877 C  CD1   . ILE B 1 197 ? 57.626 20.285 -13.630 1.00 21.95 ? 173 ILE B CD1   1 
ATOM   3878 N  N     . ALA B 1 198 ? 52.208 20.882 -13.562 1.00 18.70 ? 174 ALA B N     1 
ATOM   3879 C  CA    . ALA B 1 198 ? 50.877 20.562 -13.048 1.00 18.35 ? 174 ALA B CA    1 
ATOM   3880 C  C     . ALA B 1 198 ? 49.808 20.713 -14.113 1.00 18.56 ? 174 ALA B C     1 
ATOM   3881 O  O     . ALA B 1 198 ? 49.029 19.789 -14.375 1.00 23.09 ? 174 ALA B O     1 
ATOM   3882 C  CB    . ALA B 1 198 ? 50.553 21.450 -11.870 1.00 16.92 ? 174 ALA B CB    1 
ATOM   3883 N  N     . HIS B 1 199 ? 49.786 21.882 -14.743 1.00 21.00 ? 175 HIS B N     1 
ATOM   3884 C  CA    . HIS B 1 199 ? 48.777 22.163 -15.742 1.00 22.73 ? 175 HIS B CA    1 
ATOM   3885 C  C     . HIS B 1 199 ? 48.916 21.308 -17.009 1.00 23.75 ? 175 HIS B C     1 
ATOM   3886 O  O     . HIS B 1 199 ? 47.913 20.903 -17.595 1.00 27.30 ? 175 HIS B O     1 
ATOM   3887 C  CB    . HIS B 1 199 ? 48.734 23.655 -16.024 1.00 24.15 ? 175 HIS B CB    1 
ATOM   3888 C  CG    . HIS B 1 199 ? 48.073 24.440 -14.934 1.00 23.14 ? 175 HIS B CG    1 
ATOM   3889 N  ND1   . HIS B 1 199 ? 48.431 25.732 -14.619 1.00 25.50 ? 175 HIS B ND1   1 
ATOM   3890 C  CD2   . HIS B 1 199 ? 47.082 24.101 -14.073 1.00 23.96 ? 175 HIS B CD2   1 
ATOM   3891 C  CE1   . HIS B 1 199 ? 47.668 26.167 -13.629 1.00 24.32 ? 175 HIS B CE1   1 
ATOM   3892 N  NE2   . HIS B 1 199 ? 46.845 25.194 -13.278 1.00 22.47 ? 175 HIS B NE2   1 
ATOM   3893 N  N     . GLN B 1 200 ? 50.150 20.994 -17.402 1.00 22.87 ? 176 GLN B N     1 
ATOM   3894 C  CA    . GLN B 1 200 ? 50.364 20.076 -18.534 1.00 23.85 ? 176 GLN B CA    1 
ATOM   3895 C  C     . GLN B 1 200 ? 49.786 18.685 -18.259 1.00 24.36 ? 176 GLN B C     1 
ATOM   3896 O  O     . GLN B 1 200 ? 49.377 17.965 -19.176 1.00 28.69 ? 176 GLN B O     1 
ATOM   3897 C  CB    . GLN B 1 200 ? 51.851 19.969 -18.881 1.00 28.56 ? 176 GLN B CB    1 
ATOM   3898 C  CG    . GLN B 1 200 ? 52.375 21.121 -19.724 1.00 35.47 ? 176 GLN B CG    1 
ATOM   3899 C  CD    . GLN B 1 200 ? 53.847 20.984 -20.076 1.00 39.66 ? 176 GLN B CD    1 
ATOM   3900 O  OE1   . GLN B 1 200 ? 54.482 19.960 -19.800 1.00 43.05 ? 176 GLN B OE1   1 
ATOM   3901 N  NE2   . GLN B 1 200 ? 54.399 22.023 -20.692 1.00 41.02 ? 176 GLN B NE2   1 
ATOM   3902 N  N     . HIS B 1 201 ? 49.743 18.319 -16.982 1.00 24.33 ? 177 HIS B N     1 
ATOM   3903 C  CA    . HIS B 1 201 ? 49.250 17.014 -16.572 1.00 22.39 ? 177 HIS B CA    1 
ATOM   3904 C  C     . HIS B 1 201 ? 47.806 17.069 -16.065 1.00 24.57 ? 177 HIS B C     1 
ATOM   3905 O  O     . HIS B 1 201 ? 47.305 16.097 -15.495 1.00 27.82 ? 177 HIS B O     1 
ATOM   3906 C  CB    . HIS B 1 201 ? 50.202 16.416 -15.528 1.00 23.73 ? 177 HIS B CB    1 
ATOM   3907 C  CG    . HIS B 1 201 ? 51.454 15.849 -16.121 1.00 23.47 ? 177 HIS B CG    1 
ATOM   3908 N  ND1   . HIS B 1 201 ? 52.550 16.624 -16.440 1.00 26.68 ? 177 HIS B ND1   1 
ATOM   3909 C  CD2   . HIS B 1 201 ? 51.769 14.584 -16.490 1.00 25.24 ? 177 HIS B CD2   1 
ATOM   3910 C  CE1   . HIS B 1 201 ? 53.491 15.858 -16.965 1.00 28.67 ? 177 HIS B CE1   1 
ATOM   3911 N  NE2   . HIS B 1 201 ? 53.041 14.616 -17.007 1.00 29.71 ? 177 HIS B NE2   1 
ATOM   3912 N  N     . GLY B 1 202 ? 47.141 18.203 -16.300 1.00 24.21 ? 178 GLY B N     1 
ATOM   3913 C  CA    . GLY B 1 202 ? 45.729 18.389 -15.942 1.00 25.08 ? 178 GLY B CA    1 
ATOM   3914 C  C     . GLY B 1 202 ? 45.457 18.479 -14.451 1.00 24.82 ? 178 GLY B C     1 
ATOM   3915 O  O     . GLY B 1 202 ? 44.338 18.205 -13.992 1.00 24.62 ? 178 GLY B O     1 
ATOM   3916 N  N     . ARG B 1 203 ? 46.477 18.871 -13.700 1.00 22.62 ? 179 ARG B N     1 
ATOM   3917 C  CA    . ARG B 1 203 ? 46.371 18.989 -12.244 1.00 19.00 ? 179 ARG B CA    1 
ATOM   3918 C  C     . ARG B 1 203 ? 45.969 20.428 -11.916 1.00 17.88 ? 179 ARG B C     1 
ATOM   3919 O  O     . ARG B 1 203 ? 45.862 21.271 -12.811 1.00 21.39 ? 179 ARG B O     1 
ATOM   3920 C  CB    . ARG B 1 203 ? 47.698 18.610 -11.559 1.00 18.55 ? 179 ARG B CB    1 
ATOM   3921 C  CG    . ARG B 1 203 ? 48.315 17.298 -12.040 1.00 21.54 ? 179 ARG B CG    1 
ATOM   3922 C  CD    . ARG B 1 203 ? 47.366 16.117 -11.913 1.00 21.38 ? 179 ARG B CD    1 
ATOM   3923 N  NE    . ARG B 1 203 ? 48.049 14.860 -12.221 1.00 22.38 ? 179 ARG B NE    1 
ATOM   3924 C  CZ    . ARG B 1 203 ? 47.441 13.687 -12.376 1.00 29.26 ? 179 ARG B CZ    1 
ATOM   3925 N  NH1   . ARG B 1 203 ? 48.155 12.605 -12.660 1.00 34.30 ? 179 ARG B NH1   1 
ATOM   3926 N  NH2   . ARG B 1 203 ? 46.118 13.587 -12.262 1.00 35.54 ? 179 ARG B NH2   1 
ATOM   3927 N  N     . GLU B 1 204 ? 45.783 20.711 -10.632 1.00 18.07 ? 180 GLU B N     1 
ATOM   3928 C  CA    . GLU B 1 204 ? 45.442 22.053 -10.207 1.00 20.73 ? 180 GLU B CA    1 
ATOM   3929 C  C     . GLU B 1 204 ? 46.494 22.656 -9.302  1.00 16.93 ? 180 GLU B C     1 
ATOM   3930 O  O     . GLU B 1 204 ? 47.197 21.950 -8.593  1.00 18.70 ? 180 GLU B O     1 
ATOM   3931 C  CB    . GLU B 1 204 ? 44.062 22.076 -9.556  1.00 23.15 ? 180 GLU B CB    1 
ATOM   3932 C  CG    . GLU B 1 204 ? 42.949 22.117 -10.592 1.00 25.64 ? 180 GLU B CG    1 
ATOM   3933 C  CD    . GLU B 1 204 ? 41.566 22.072 -9.983  1.00 34.55 ? 180 GLU B CD    1 
ATOM   3934 O  OE1   . GLU B 1 204 ? 40.762 22.975 -10.281 1.00 41.43 ? 180 GLU B OE1   1 
ATOM   3935 O  OE2   . GLU B 1 204 ? 41.288 21.134 -9.214  1.00 38.73 ? 180 GLU B OE2   1 
HETATM 3936 N  N     . MSE B 1 205 ? 46.605 23.976 -9.371  1.00 18.75 ? 181 MSE B N     1 
HETATM 3937 C  CA    . MSE B 1 205 ? 47.581 24.731 -8.605  1.00 20.21 ? 181 MSE B CA    1 
HETATM 3938 C  C     . MSE B 1 205 ? 46.855 25.552 -7.583  1.00 17.54 ? 181 MSE B C     1 
HETATM 3939 O  O     . MSE B 1 205 ? 45.790 26.120 -7.866  1.00 17.22 ? 181 MSE B O     1 
HETATM 3940 C  CB    . MSE B 1 205 ? 48.251 25.737 -9.530  1.00 21.91 ? 181 MSE B CB    1 
HETATM 3941 C  CG    . MSE B 1 205 ? 49.241 25.130 -10.524 1.00 26.12 ? 181 MSE B CG    1 
HETATM 3942 SE SE    . MSE B 1 205 ? 50.716 24.238 -9.578  1.00 34.16 ? 181 MSE B SE    1 
HETATM 3943 C  CE    . MSE B 1 205 ? 51.373 25.764 -8.540  1.00 21.68 ? 181 MSE B CE    1 
ATOM   3944 N  N     . SER B 1 206 ? 47.434 25.642 -6.392  1.00 16.49 ? 182 SER B N     1 
ATOM   3945 C  CA    . SER B 1 206 ? 46.829 26.407 -5.325  1.00 16.07 ? 182 SER B CA    1 
ATOM   3946 C  C     . SER B 1 206 ? 47.868 27.241 -4.586  1.00 15.19 ? 182 SER B C     1 
ATOM   3947 O  O     . SER B 1 206 ? 49.039 26.856 -4.497  1.00 15.89 ? 182 SER B O     1 
ATOM   3948 C  CB    . SER B 1 206 ? 46.097 25.467 -4.360  1.00 16.81 ? 182 SER B CB    1 
ATOM   3949 O  OG    . SER B 1 206 ? 45.561 26.179 -3.270  1.00 17.54 ? 182 SER B OG    1 
HETATM 3950 N  N     . MSE B 1 207 ? 47.439 28.399 -4.082  1.00 15.84 ? 183 MSE B N     1 
HETATM 3951 C  CA    . MSE B 1 207 ? 48.300 29.209 -3.245  1.00 16.91 ? 183 MSE B CA    1 
HETATM 3952 C  C     . MSE B 1 207 ? 47.598 29.748 -2.038  1.00 16.44 ? 183 MSE B C     1 
HETATM 3953 O  O     . MSE B 1 207 ? 46.368 29.906 -2.023  1.00 16.68 ? 183 MSE B O     1 
HETATM 3954 C  CB    . MSE B 1 207 ? 48.942 30.323 -4.063  1.00 21.69 ? 183 MSE B CB    1 
HETATM 3955 C  CG    . MSE B 1 207 ? 48.238 31.647 -3.844  1.00 25.81 ? 183 MSE B CG    1 
HETATM 3956 SE SE    . MSE B 1 207 ? 49.175 32.967 -4.936  1.00 37.19 ? 183 MSE B SE    1 
HETATM 3957 C  CE    . MSE B 1 207 ? 50.577 33.383 -3.620  1.00 33.81 ? 183 MSE B CE    1 
ATOM   3958 N  N     . THR B 1 208 ? 48.388 30.002 -1.008  1.00 14.08 ? 184 THR B N     1 
ATOM   3959 C  CA    . THR B 1 208 ? 47.934 30.835 0.089   1.00 14.08 ? 184 THR B CA    1 
ATOM   3960 C  C     . THR B 1 208 ? 48.595 32.206 0.050   1.00 13.52 ? 184 THR B C     1 
ATOM   3961 O  O     . THR B 1 208 ? 49.795 32.335 -0.260  1.00 14.80 ? 184 THR B O     1 
ATOM   3962 C  CB    . THR B 1 208 ? 48.181 30.162 1.446   1.00 14.81 ? 184 THR B CB    1 
ATOM   3963 O  OG1   . THR B 1 208 ? 47.828 31.093 2.484   1.00 17.40 ? 184 THR B OG1   1 
ATOM   3964 C  CG2   . THR B 1 208 ? 49.649 29.738 1.600   1.00 14.90 ? 184 THR B CG2   1 
ATOM   3965 N  N     . LEU B 1 209 ? 47.813 33.236 0.366   1.00 13.92 ? 185 LEU B N     1 
ATOM   3966 C  CA    . LEU B 1 209 ? 48.334 34.607 0.466   1.00 14.12 ? 185 LEU B CA    1 
ATOM   3967 C  C     . LEU B 1 209 ? 49.296 34.824 1.655   1.00 14.53 ? 185 LEU B C     1 
ATOM   3968 O  O     . LEU B 1 209 ? 49.998 35.839 1.722   1.00 15.35 ? 185 LEU B O     1 
ATOM   3969 C  CB    . LEU B 1 209 ? 47.180 35.610 0.498   1.00 15.30 ? 185 LEU B CB    1 
ATOM   3970 C  CG    . LEU B 1 209 ? 46.278 35.601 -0.733  1.00 16.46 ? 185 LEU B CG    1 
ATOM   3971 C  CD1   . LEU B 1 209 ? 45.242 36.702 -0.612  1.00 17.55 ? 185 LEU B CD1   1 
ATOM   3972 C  CD2   . LEU B 1 209 ? 47.086 35.786 -2.012  1.00 19.60 ? 185 LEU B CD2   1 
ATOM   3973 N  N     . SER B 1 210 ? 49.284 33.867 2.594   1.00 14.92 ? 186 SER B N     1 
ATOM   3974 C  CA    . SER B 1 210 ? 50.251 33.733 3.689   1.00 14.34 ? 186 SER B CA    1 
ATOM   3975 C  C     . SER B 1 210 ? 50.181 34.763 4.816   1.00 14.32 ? 186 SER B C     1 
ATOM   3976 O  O     . SER B 1 210 ? 50.126 34.383 5.996   1.00 16.14 ? 186 SER B O     1 
ATOM   3977 C  CB    . SER B 1 210 ? 51.701 33.697 3.147   1.00 14.26 ? 186 SER B CB    1 
ATOM   3978 O  OG    . SER B 1 210 ? 51.943 32.508 2.416   1.00 15.00 ? 186 SER B OG    1 
ATOM   3979 N  N     . ASP B 1 211 ? 50.242 36.051 4.479   1.00 14.31 ? 187 ASP B N     1 
ATOM   3980 C  CA    . ASP B 1 211 ? 50.398 37.092 5.497   1.00 14.16 ? 187 ASP B CA    1 
ATOM   3981 C  C     . ASP B 1 211 ? 50.105 38.434 4.846   1.00 14.98 ? 187 ASP B C     1 
ATOM   3982 O  O     . ASP B 1 211 ? 50.449 38.631 3.688   1.00 16.14 ? 187 ASP B O     1 
ATOM   3983 C  CB    . ASP B 1 211 ? 51.828 37.057 6.075   1.00 15.37 ? 187 ASP B CB    1 
ATOM   3984 C  CG    . ASP B 1 211 ? 52.128 38.226 6.998   1.00 17.38 ? 187 ASP B CG    1 
ATOM   3985 O  OD1   . ASP B 1 211 ? 52.532 39.299 6.505   1.00 21.66 ? 187 ASP B OD1   1 
ATOM   3986 O  OD2   . ASP B 1 211 ? 52.009 38.066 8.235   1.00 19.68 ? 187 ASP B OD2   1 
ATOM   3987 N  N     . SER B 1 212 ? 49.458 39.345 5.576   1.00 15.55 ? 188 SER B N     1 
ATOM   3988 C  CA    . SER B 1 212 ? 48.981 40.593 4.982   1.00 16.68 ? 188 SER B CA    1 
ATOM   3989 C  C     . SER B 1 212 ? 50.111 41.513 4.533   1.00 15.81 ? 188 SER B C     1 
ATOM   3990 O  O     . SER B 1 212 ? 49.924 42.253 3.580   1.00 16.13 ? 188 SER B O     1 
ATOM   3991 C  CB    . SER B 1 212 ? 48.022 41.342 5.916   1.00 18.06 ? 188 SER B CB    1 
ATOM   3992 O  OG    . SER B 1 212 ? 48.668 41.738 7.109   1.00 19.43 ? 188 SER B OG    1 
ATOM   3993 N  N     . PHE B 1 213 ? 51.261 41.464 5.215   1.00 15.48 ? 189 PHE B N     1 
ATOM   3994 C  CA    . PHE B 1 213 ? 52.448 42.235 4.803   1.00 16.92 ? 189 PHE B CA    1 
ATOM   3995 C  C     . PHE B 1 213 ? 53.142 41.570 3.626   1.00 16.10 ? 189 PHE B C     1 
ATOM   3996 O  O     . PHE B 1 213 ? 53.668 42.253 2.754   1.00 18.69 ? 189 PHE B O     1 
ATOM   3997 C  CB    . PHE B 1 213 ? 53.415 42.445 5.968   1.00 18.32 ? 189 PHE B CB    1 
ATOM   3998 C  CG    . PHE B 1 213 ? 52.844 43.292 7.069   1.00 18.21 ? 189 PHE B CG    1 
ATOM   3999 C  CD1   . PHE B 1 213 ? 52.067 42.717 8.072   1.00 19.02 ? 189 PHE B CD1   1 
ATOM   4000 C  CD2   . PHE B 1 213 ? 53.045 44.674 7.082   1.00 18.36 ? 189 PHE B CD2   1 
ATOM   4001 C  CE1   . PHE B 1 213 ? 51.525 43.501 9.085   1.00 20.70 ? 189 PHE B CE1   1 
ATOM   4002 C  CE2   . PHE B 1 213 ? 52.508 45.461 8.099   1.00 19.66 ? 189 PHE B CE2   1 
ATOM   4003 C  CZ    . PHE B 1 213 ? 51.750 44.870 9.105   1.00 20.91 ? 189 PHE B CZ    1 
ATOM   4004 N  N     . CYS B 1 214 ? 53.122 40.240 3.595   1.00 14.30 ? 190 CYS B N     1 
ATOM   4005 C  CA    . CYS B 1 214 ? 53.580 39.498 2.424   1.00 15.85 ? 190 CYS B CA    1 
ATOM   4006 C  C     . CYS B 1 214 ? 52.777 39.916 1.184   1.00 16.61 ? 190 CYS B C     1 
ATOM   4007 O  O     . CYS B 1 214 ? 53.351 40.211 0.130   1.00 16.68 ? 190 CYS B O     1 
ATOM   4008 C  CB    . CYS B 1 214 ? 53.498 37.984 2.672   1.00 15.91 ? 190 CYS B CB    1 
ATOM   4009 S  SG    . CYS B 1 214 ? 54.169 36.984 1.319   1.00 18.23 ? 190 CYS B SG    1 
ATOM   4010 N  N     . VAL B 1 215 ? 51.452 39.967 1.320   1.00 15.47 ? 191 VAL B N     1 
ATOM   4011 C  CA    . VAL B 1 215 ? 50.577 40.444 0.249   1.00 14.53 ? 191 VAL B CA    1 
ATOM   4012 C  C     . VAL B 1 215 ? 50.984 41.857 -0.173  1.00 15.63 ? 191 VAL B C     1 
ATOM   4013 O  O     . VAL B 1 215 ? 51.050 42.165 -1.375  1.00 17.17 ? 191 VAL B O     1 
ATOM   4014 C  CB    . VAL B 1 215 ? 49.076 40.413 0.660   1.00 14.82 ? 191 VAL B CB    1 
ATOM   4015 C  CG1   . VAL B 1 215 ? 48.195 41.097 -0.379  1.00 16.63 ? 191 VAL B CG1   1 
ATOM   4016 C  CG2   . VAL B 1 215 ? 48.607 38.984 0.885   1.00 16.32 ? 191 VAL B CG2   1 
ATOM   4017 N  N     . ASP B 1 216 ? 51.240 42.721 0.802   1.00 17.46 ? 192 ASP B N     1 
ATOM   4018 C  CA    . ASP B 1 216 ? 51.638 44.092 0.506   1.00 19.10 ? 192 ASP B CA    1 
ATOM   4019 C  C     . ASP B 1 216 ? 52.952 44.136 -0.306  1.00 17.89 ? 192 ASP B C     1 
ATOM   4020 O  O     . ASP B 1 216 ? 53.083 44.946 -1.246  1.00 18.12 ? 192 ASP B O     1 
ATOM   4021 C  CB    . ASP B 1 216 ? 51.759 44.878 1.804   1.00 20.68 ? 192 ASP B CB    1 
ATOM   4022 C  CG    . ASP B 1 216 ? 52.011 46.343 1.567   1.00 24.90 ? 192 ASP B CG    1 
ATOM   4023 O  OD1   . ASP B 1 216 ? 51.165 46.997 0.915   1.00 24.09 ? 192 ASP B OD1   1 
ATOM   4024 O  OD2   . ASP B 1 216 ? 53.057 46.831 2.036   1.00 30.61 ? 192 ASP B OD2   1 
ATOM   4025 N  N     . ARG B 1 217 ? 53.879 43.229 0.000   1.00 16.78 ? 193 ARG B N     1 
ATOM   4026 C  CA    . ARG B 1 217 ? 55.161 43.181 -0.730  1.00 16.88 ? 193 ARG B CA    1 
ATOM   4027 C  C     . ARG B 1 217 ? 54.981 42.722 -2.173  1.00 18.85 ? 193 ARG B C     1 
ATOM   4028 O  O     . ARG B 1 217 ? 55.707 43.186 -3.063  1.00 20.64 ? 193 ARG B O     1 
ATOM   4029 C  CB    . ARG B 1 217 ? 56.193 42.306 -0.026  1.00 17.69 ? 193 ARG B CB    1 
ATOM   4030 C  CG    . ARG B 1 217 ? 56.623 42.857 1.308   1.00 17.65 ? 193 ARG B CG    1 
ATOM   4031 C  CD    . ARG B 1 217 ? 57.852 42.149 1.865   1.00 18.10 ? 193 ARG B CD    1 
ATOM   4032 N  NE    . ARG B 1 217 ? 57.628 40.771 2.326   1.00 19.03 ? 193 ARG B NE    1 
ATOM   4033 C  CZ    . ARG B 1 217 ? 57.030 40.423 3.466   1.00 18.37 ? 193 ARG B CZ    1 
ATOM   4034 N  NH1   . ARG B 1 217 ? 56.573 41.353 4.306   1.00 17.75 ? 193 ARG B NH1   1 
ATOM   4035 N  NH2   . ARG B 1 217 ? 56.928 39.135 3.783   1.00 17.78 ? 193 ARG B NH2   1 
ATOM   4036 N  N     . TYR B 1 218 ? 54.010 41.838 -2.408  1.00 17.89 ? 194 TYR B N     1 
ATOM   4037 C  CA    . TYR B 1 218 ? 53.905 41.117 -3.694  1.00 15.80 ? 194 TYR B CA    1 
ATOM   4038 C  C     . TYR B 1 218 ? 52.510 41.193 -4.318  1.00 15.73 ? 194 TYR B C     1 
ATOM   4039 O  O     . TYR B 1 218 ? 52.110 40.328 -5.095  1.00 17.55 ? 194 TYR B O     1 
ATOM   4040 C  CB    . TYR B 1 218 ? 54.352 39.655 -3.507  1.00 17.39 ? 194 TYR B CB    1 
ATOM   4041 C  CG    . TYR B 1 218 ? 55.725 39.587 -2.918  1.00 17.22 ? 194 TYR B CG    1 
ATOM   4042 C  CD1   . TYR B 1 218 ? 56.824 40.107 -3.610  1.00 17.58 ? 194 TYR B CD1   1 
ATOM   4043 C  CD2   . TYR B 1 218 ? 55.929 39.105 -1.618  1.00 18.23 ? 194 TYR B CD2   1 
ATOM   4044 C  CE1   . TYR B 1 218 ? 58.093 40.086 -3.055  1.00 19.39 ? 194 TYR B CE1   1 
ATOM   4045 C  CE2   . TYR B 1 218 ? 57.195 39.081 -1.053  1.00 19.66 ? 194 TYR B CE2   1 
ATOM   4046 C  CZ    . TYR B 1 218 ? 58.276 39.586 -1.773  1.00 20.27 ? 194 TYR B CZ    1 
ATOM   4047 O  OH    . TYR B 1 218 ? 59.534 39.585 -1.219  1.00 21.13 ? 194 TYR B OH    1 
ATOM   4048 N  N     . ARG B 1 219 ? 51.810 42.282 -4.023  1.00 17.09 ? 195 ARG B N     1 
ATOM   4049 C  CA    . ARG B 1 219 ? 50.424 42.456 -4.431  1.00 17.44 ? 195 ARG B CA    1 
ATOM   4050 C  C     . ARG B 1 219 ? 50.177 42.211 -5.927  1.00 18.67 ? 195 ARG B C     1 
ATOM   4051 O  O     . ARG B 1 219 ? 49.326 41.397 -6.303  1.00 19.02 ? 195 ARG B O     1 
ATOM   4052 C  CB    . ARG B 1 219 ? 49.941 43.845 -4.022  1.00 18.77 ? 195 ARG B CB    1 
ATOM   4053 C  CG    . ARG B 1 219 ? 48.451 44.064 -4.214  1.00 20.92 ? 195 ARG B CG    1 
ATOM   4054 C  CD    . ARG B 1 219 ? 48.016 45.409 -3.645  1.00 18.74 ? 195 ARG B CD    1 
ATOM   4055 N  NE    . ARG B 1 219 ? 47.935 45.373 -2.184  1.00 20.30 ? 195 ARG B NE    1 
ATOM   4056 C  CZ    . ARG B 1 219 ? 48.818 45.909 -1.339  1.00 20.14 ? 195 ARG B CZ    1 
ATOM   4057 N  NH1   . ARG B 1 219 ? 48.624 45.797 -0.025  1.00 22.39 ? 195 ARG B NH1   1 
ATOM   4058 N  NH2   . ARG B 1 219 ? 49.905 46.540 -1.780  1.00 20.74 ? 195 ARG B NH2   1 
ATOM   4059 N  N     . GLY B 1 220 ? 50.930 42.913 -6.771  1.00 18.84 ? 196 GLY B N     1 
ATOM   4060 C  CA    . GLY B 1 220 ? 50.767 42.784 -8.224  1.00 18.56 ? 196 GLY B CA    1 
ATOM   4061 C  C     . GLY B 1 220 ? 51.136 41.398 -8.724  1.00 19.48 ? 196 GLY B C     1 
ATOM   4062 O  O     . GLY B 1 220 ? 50.473 40.863 -9.612  1.00 20.25 ? 196 GLY B O     1 
ATOM   4063 N  N     . GLU B 1 221 ? 52.187 40.815 -8.144  1.00 20.07 ? 197 GLU B N     1 
ATOM   4064 C  CA    . GLU B 1 221 ? 52.625 39.482 -8.548  1.00 19.39 ? 197 GLU B CA    1 
ATOM   4065 C  C     . GLU B 1 221 ? 51.582 38.419 -8.211  1.00 19.66 ? 197 GLU B C     1 
ATOM   4066 O  O     . GLU B 1 221 ? 51.284 37.545 -9.033  1.00 18.36 ? 197 GLU B O     1 
ATOM   4067 C  CB    . GLU B 1 221 ? 53.994 39.155 -7.961  1.00 19.87 ? 197 GLU B CB    1 
ATOM   4068 C  CG    . GLU B 1 221 ? 55.095 39.905 -8.703  1.00 25.69 ? 197 GLU B CG    1 
ATOM   4069 C  CD    . GLU B 1 221 ? 56.362 40.058 -7.906  1.00 34.98 ? 197 GLU B CD    1 
ATOM   4070 O  OE1   . GLU B 1 221 ? 56.637 41.183 -7.439  1.00 45.77 ? 197 GLU B OE1   1 
ATOM   4071 O  OE2   . GLU B 1 221 ? 57.081 39.055 -7.747  1.00 40.95 ? 197 GLU B OE2   1 
ATOM   4072 N  N     . PHE B 1 222 ? 51.004 38.533 -7.010  1.00 18.35 ? 198 PHE B N     1 
ATOM   4073 C  CA    . PHE B 1 222 ? 49.954 37.612 -6.579  1.00 18.20 ? 198 PHE B CA    1 
ATOM   4074 C  C     . PHE B 1 222 ? 48.685 37.698 -7.449  1.00 16.77 ? 198 PHE B C     1 
ATOM   4075 O  O     . PHE B 1 222 ? 48.123 36.668 -7.845  1.00 18.05 ? 198 PHE B O     1 
ATOM   4076 C  CB    . PHE B 1 222 ? 49.613 37.822 -5.101  1.00 17.49 ? 198 PHE B CB    1 
ATOM   4077 C  CG    . PHE B 1 222 ? 50.696 37.398 -4.132  1.00 17.42 ? 198 PHE B CG    1 
ATOM   4078 C  CD1   . PHE B 1 222 ? 51.873 36.748 -4.552  1.00 17.32 ? 198 PHE B CD1   1 
ATOM   4079 C  CD2   . PHE B 1 222 ? 50.522 37.625 -2.770  1.00 17.46 ? 198 PHE B CD2   1 
ATOM   4080 C  CE1   . PHE B 1 222 ? 52.844 36.351 -3.636  1.00 16.76 ? 198 PHE B CE1   1 
ATOM   4081 C  CE2   . PHE B 1 222 ? 51.494 37.244 -1.853  1.00 17.83 ? 198 PHE B CE2   1 
ATOM   4082 C  CZ    . PHE B 1 222 ? 52.660 36.600 -2.283  1.00 17.28 ? 198 PHE B CZ    1 
ATOM   4083 N  N     . LEU B 1 223 ? 48.237 38.926 -7.733  1.00 16.50 ? 199 LEU B N     1 
ATOM   4084 C  CA    . LEU B 1 223 ? 47.123 39.157 -8.654  1.00 17.11 ? 199 LEU B CA    1 
ATOM   4085 C  C     . LEU B 1 223 ? 47.402 38.532 -10.022 1.00 17.71 ? 199 LEU B C     1 
ATOM   4086 O  O     . LEU B 1 223 ? 46.520 37.911 -10.612 1.00 19.76 ? 199 LEU B O     1 
ATOM   4087 C  CB    . LEU B 1 223 ? 46.805 40.660 -8.781  1.00 18.80 ? 199 LEU B CB    1 
ATOM   4088 C  CG    . LEU B 1 223 ? 46.162 41.279 -7.535  1.00 20.94 ? 199 LEU B CG    1 
ATOM   4089 C  CD1   . LEU B 1 223 ? 46.061 42.781 -7.723  1.00 25.78 ? 199 LEU B CD1   1 
ATOM   4090 C  CD2   . LEU B 1 223 ? 44.798 40.662 -7.220  1.00 25.29 ? 199 LEU B CD2   1 
ATOM   4091 N  N     . ASP B 1 224 ? 48.642 38.673 -10.498 1.00 18.96 ? 200 ASP B N     1 
ATOM   4092 C  CA    . ASP B 1 224 ? 49.011 38.129 -11.814 1.00 20.87 ? 200 ASP B CA    1 
ATOM   4093 C  C     . ASP B 1 224 ? 48.972 36.595 -11.833 1.00 19.10 ? 200 ASP B C     1 
ATOM   4094 O  O     . ASP B 1 224 ? 48.528 35.985 -12.813 1.00 21.29 ? 200 ASP B O     1 
ATOM   4095 C  CB    . ASP B 1 224 ? 50.392 38.646 -12.240 1.00 21.14 ? 200 ASP B CB    1 
ATOM   4096 C  CG    . ASP B 1 224 ? 50.852 38.065 -13.558 1.00 28.06 ? 200 ASP B CG    1 
ATOM   4097 O  OD1   . ASP B 1 224 ? 50.186 38.316 -14.578 1.00 33.03 ? 200 ASP B OD1   1 
ATOM   4098 O  OD2   . ASP B 1 224 ? 51.887 37.365 -13.570 1.00 39.33 ? 200 ASP B OD2   1 
ATOM   4099 N  N     . LEU B 1 225 ? 49.429 35.972 -10.748 1.00 18.66 ? 201 LEU B N     1 
ATOM   4100 C  CA    . LEU B 1 225 ? 49.344 34.518 -10.604 1.00 16.41 ? 201 LEU B CA    1 
ATOM   4101 C  C     . LEU B 1 225 ? 47.914 34.017 -10.780 1.00 17.95 ? 201 LEU B C     1 
ATOM   4102 O  O     . LEU B 1 225 ? 47.687 33.018 -11.465 1.00 18.59 ? 201 LEU B O     1 
ATOM   4103 C  CB    . LEU B 1 225 ? 49.908 34.061 -9.250  1.00 17.25 ? 201 LEU B CB    1 
ATOM   4104 C  CG    . LEU B 1 225 ? 51.430 34.142 -9.104  1.00 17.30 ? 201 LEU B CG    1 
ATOM   4105 C  CD1   . LEU B 1 225 ? 51.847 33.933 -7.653  1.00 19.53 ? 201 LEU B CD1   1 
ATOM   4106 C  CD2   . LEU B 1 225 ? 52.140 33.158 -10.023 1.00 24.14 ? 201 LEU B CD2   1 
HETATM 4107 N  N     . MSE B 1 226 ? 46.966 34.721 -10.153 1.00 18.72 ? 202 MSE B N     1 
HETATM 4108 C  CA    . MSE B 1 226 ? 45.544 34.359 -10.204 1.00 20.19 ? 202 MSE B CA    1 
HETATM 4109 C  C     . MSE B 1 226 ? 44.972 34.634 -11.575 1.00 19.45 ? 202 MSE B C     1 
HETATM 4110 O  O     . MSE B 1 226 ? 44.434 33.730 -12.218 1.00 21.58 ? 202 MSE B O     1 
HETATM 4111 C  CB    . MSE B 1 226 ? 44.776 35.109 -9.117  1.00 21.93 ? 202 MSE B CB    1 
HETATM 4112 C  CG    . MSE B 1 226 ? 45.151 34.605 -7.729  1.00 27.38 ? 202 MSE B CG    1 
HETATM 4113 SE SE    . MSE B 1 226 ? 44.632 35.916 -6.357  1.00 55.89 ? 202 MSE B SE    1 
HETATM 4114 C  CE    . MSE B 1 226 ? 42.674 35.846 -6.490  1.00 44.21 ? 202 MSE B CE    1 
ATOM   4115 N  N     . ARG B 1 227 ? 45.124 35.869 -12.051 1.00 19.27 ? 203 ARG B N     1 
ATOM   4116 C  CA    . ARG B 1 227 ? 44.546 36.294 -13.344 1.00 20.94 ? 203 ARG B CA    1 
ATOM   4117 C  C     . ARG B 1 227 ? 45.081 35.559 -14.588 1.00 21.76 ? 203 ARG B C     1 
ATOM   4118 O  O     . ARG B 1 227 ? 44.339 35.343 -15.546 1.00 27.23 ? 203 ARG B O     1 
ATOM   4119 C  CB    . ARG B 1 227 ? 44.661 37.809 -13.516 1.00 19.27 ? 203 ARG B CB    1 
ATOM   4120 C  CG    . ARG B 1 227 ? 43.845 38.565 -12.479 1.00 18.83 ? 203 ARG B CG    1 
ATOM   4121 C  CD    . ARG B 1 227 ? 44.035 40.068 -12.542 1.00 20.81 ? 203 ARG B CD    1 
ATOM   4122 N  NE    . ARG B 1 227 ? 43.202 40.726 -11.537 1.00 20.17 ? 203 ARG B NE    1 
ATOM   4123 C  CZ    . ARG B 1 227 ? 43.367 41.974 -11.114 1.00 22.59 ? 203 ARG B CZ    1 
ATOM   4124 N  NH1   . ARG B 1 227 ? 44.346 42.722 -11.606 1.00 24.15 ? 203 ARG B NH1   1 
ATOM   4125 N  NH2   . ARG B 1 227 ? 42.556 42.478 -10.189 1.00 25.26 ? 203 ARG B NH2   1 
ATOM   4126 N  N     . SER B 1 228 ? 46.364 35.206 -14.575 1.00 22.68 ? 204 SER B N     1 
ATOM   4127 C  CA    . SER B 1 228 ? 46.973 34.440 -15.663 1.00 23.36 ? 204 SER B CA    1 
ATOM   4128 C  C     . SER B 1 228 ? 46.614 32.960 -15.605 1.00 24.60 ? 204 SER B C     1 
ATOM   4129 O  O     . SER B 1 228 ? 46.915 32.203 -16.534 1.00 28.84 ? 204 SER B O     1 
ATOM   4130 C  CB    . SER B 1 228 ? 48.489 34.611 -15.653 1.00 24.69 ? 204 SER B CB    1 
ATOM   4131 O  OG    . SER B 1 228 ? 49.063 33.915 -14.560 1.00 25.92 ? 204 SER B OG    1 
ATOM   4132 N  N     . GLY B 1 229 ? 45.974 32.555 -14.510 1.00 24.32 ? 205 GLY B N     1 
ATOM   4133 C  CA    . GLY B 1 229 ? 45.551 31.174 -14.327 1.00 24.54 ? 205 GLY B CA    1 
ATOM   4134 C  C     . GLY B 1 229 ? 46.652 30.235 -13.866 1.00 24.12 ? 205 GLY B C     1 
ATOM   4135 O  O     . GLY B 1 229 ? 46.484 29.009 -13.916 1.00 24.30 ? 205 GLY B O     1 
ATOM   4136 N  N     . LYS B 1 230 ? 47.774 30.780 -13.386 1.00 21.65 ? 206 LYS B N     1 
ATOM   4137 C  CA    . LYS B 1 230 ? 48.822 29.916 -12.840 1.00 22.82 ? 206 LYS B CA    1 
ATOM   4138 C  C     . LYS B 1 230 ? 48.351 29.296 -11.528 1.00 23.16 ? 206 LYS B C     1 
ATOM   4139 O  O     . LYS B 1 230 ? 48.781 28.205 -11.170 1.00 23.60 ? 206 LYS B O     1 
ATOM   4140 C  CB    . LYS B 1 230 ? 50.142 30.669 -12.673 1.00 25.77 ? 206 LYS B CB    1 
ATOM   4141 C  CG    . LYS B 1 230 ? 50.786 30.978 -14.012 1.00 28.35 ? 206 LYS B CG    1 
ATOM   4142 C  CD    . LYS B 1 230 ? 52.054 31.796 -13.858 1.00 28.65 ? 206 LYS B CD    1 
ATOM   4143 C  CE    . LYS B 1 230 ? 52.626 32.165 -15.218 1.00 32.50 ? 206 LYS B CE    1 
ATOM   4144 N  NZ    . LYS B 1 230 ? 51.764 33.139 -15.942 1.00 34.79 ? 206 LYS B NZ    1 
ATOM   4145 N  N     . VAL B 1 231 ? 47.450 30.000 -10.840 1.00 21.21 ? 207 VAL B N     1 
ATOM   4146 C  CA    A VAL B 1 231 ? 46.818 29.523 -9.606  0.50 17.89 ? 207 VAL B CA    1 
ATOM   4147 C  CA    B VAL B 1 231 ? 46.825 29.443 -9.641  0.50 19.09 ? 207 VAL B CA    1 
ATOM   4148 C  C     . VAL B 1 231 ? 45.314 29.348 -9.821  1.00 18.59 ? 207 VAL B C     1 
ATOM   4149 O  O     . VAL B 1 231 ? 44.657 30.280 -10.276 1.00 22.34 ? 207 VAL B O     1 
ATOM   4150 C  CB    A VAL B 1 231 ? 47.072 30.522 -8.458  0.50 17.23 ? 207 VAL B CB    1 
ATOM   4151 C  CB    B VAL B 1 231 ? 47.234 30.172 -8.332  0.50 20.75 ? 207 VAL B CB    1 
ATOM   4152 C  CG1   A VAL B 1 231 ? 46.137 30.276 -7.280  0.50 17.65 ? 207 VAL B CG1   1 
ATOM   4153 C  CG1   B VAL B 1 231 ? 46.983 31.665 -8.415  0.50 21.31 ? 207 VAL B CG1   1 
ATOM   4154 C  CG2   A VAL B 1 231 ? 48.524 30.440 -8.017  0.50 13.62 ? 207 VAL B CG2   1 
ATOM   4155 C  CG2   B VAL B 1 231 ? 46.509 29.586 -7.130  0.50 20.25 ? 207 VAL B CG2   1 
ATOM   4156 N  N     . ASP B 1 232 ? 44.800 28.157 -9.507  1.00 17.28 ? 208 ASP B N     1 
ATOM   4157 C  CA    . ASP B 1 232 ? 43.380 27.809 -9.640  1.00 18.67 ? 208 ASP B CA    1 
ATOM   4158 C  C     . ASP B 1 232 ? 42.583 28.013 -8.356  1.00 18.54 ? 208 ASP B C     1 
ATOM   4159 O  O     . ASP B 1 232 ? 41.398 28.335 -8.425  1.00 23.30 ? 208 ASP B O     1 
ATOM   4160 C  CB    . ASP B 1 232 ? 43.241 26.350 -10.084 1.00 21.60 ? 208 ASP B CB    1 
ATOM   4161 C  CG    . ASP B 1 232 ? 44.012 26.057 -11.349 1.00 21.22 ? 208 ASP B CG    1 
ATOM   4162 O  OD1   . ASP B 1 232 ? 43.626 26.607 -12.397 1.00 25.83 ? 208 ASP B OD1   1 
ATOM   4163 O  OD2   . ASP B 1 232 ? 45.007 25.288 -11.297 1.00 22.60 ? 208 ASP B OD2   1 
ATOM   4164 N  N     . ILE B 1 233 ? 43.211 27.753 -7.207  1.00 17.71 ? 209 ILE B N     1 
ATOM   4165 C  CA    . ILE B 1 233 ? 42.552 27.820 -5.887  1.00 17.04 ? 209 ILE B CA    1 
ATOM   4166 C  C     . ILE B 1 233 ? 43.376 28.672 -4.931  1.00 18.03 ? 209 ILE B C     1 
ATOM   4167 O  O     . ILE B 1 233 ? 44.543 28.356 -4.679  1.00 17.72 ? 209 ILE B O     1 
ATOM   4168 C  CB    . ILE B 1 233 ? 42.401 26.413 -5.263  1.00 17.85 ? 209 ILE B CB    1 
ATOM   4169 C  CG1   . ILE B 1 233 ? 41.726 25.440 -6.228  1.00 18.06 ? 209 ILE B CG1   1 
ATOM   4170 C  CG2   . ILE B 1 233 ? 41.683 26.478 -3.914  1.00 17.74 ? 209 ILE B CG2   1 
ATOM   4171 C  CD1   . ILE B 1 233 ? 41.949 23.986 -5.884  1.00 21.22 ? 209 ILE B CD1   1 
ATOM   4172 N  N     . VAL B 1 234 ? 42.781 29.736 -4.396  1.00 16.96 ? 210 VAL B N     1 
ATOM   4173 C  CA    A VAL B 1 234 ? 43.484 30.664 -3.499  0.60 17.39 ? 210 VAL B CA    1 
ATOM   4174 C  CA    B VAL B 1 234 ? 43.502 30.630 -3.496  0.40 16.00 ? 210 VAL B CA    1 
ATOM   4175 C  C     . VAL B 1 234 ? 42.912 30.597 -2.092  1.00 16.58 ? 210 VAL B C     1 
ATOM   4176 O  O     . VAL B 1 234 ? 41.685 30.580 -1.926  1.00 17.09 ? 210 VAL B O     1 
ATOM   4177 C  CB    A VAL B 1 234 ? 43.380 32.129 -3.997  0.60 18.64 ? 210 VAL B CB    1 
ATOM   4178 C  CB    B VAL B 1 234 ? 43.558 32.084 -4.042  0.40 14.37 ? 210 VAL B CB    1 
ATOM   4179 C  CG1   A VAL B 1 234 ? 44.135 33.104 -3.093  0.60 17.75 ? 210 VAL B CG1   1 
ATOM   4180 C  CG1   B VAL B 1 234 ? 42.158 32.688 -4.160  0.40 12.35 ? 210 VAL B CG1   1 
ATOM   4181 C  CG2   A VAL B 1 234 ? 43.873 32.247 -5.429  0.60 21.23 ? 210 VAL B CG2   1 
ATOM   4182 C  CG2   B VAL B 1 234 ? 44.473 32.968 -3.195  0.40 15.75 ? 210 VAL B CG2   1 
ATOM   4183 N  N     . PHE B 1 235 ? 43.804 30.567 -1.110  1.00 15.72 ? 211 PHE B N     1 
ATOM   4184 C  CA    . PHE B 1 235 ? 43.468 30.668 0.307   1.00 14.75 ? 211 PHE B CA    1 
ATOM   4185 C  C     . PHE B 1 235 ? 43.849 32.055 0.815   1.00 16.30 ? 211 PHE B C     1 
ATOM   4186 O  O     . PHE B 1 235 ? 44.955 32.542 0.571   1.00 16.09 ? 211 PHE B O     1 
ATOM   4187 C  CB    . PHE B 1 235 ? 44.201 29.595 1.123   1.00 14.11 ? 211 PHE B CB    1 
ATOM   4188 C  CG    . PHE B 1 235 ? 43.715 28.204 0.844   1.00 15.41 ? 211 PHE B CG    1 
ATOM   4189 C  CD1   . PHE B 1 235 ? 44.205 27.483 -0.248  1.00 15.72 ? 211 PHE B CD1   1 
ATOM   4190 C  CD2   . PHE B 1 235 ? 42.715 27.628 1.634   1.00 17.21 ? 211 PHE B CD2   1 
ATOM   4191 C  CE1   . PHE B 1 235 ? 43.732 26.212 -0.526  1.00 16.86 ? 211 PHE B CE1   1 
ATOM   4192 C  CE2   . PHE B 1 235 ? 42.237 26.356 1.359   1.00 17.22 ? 211 PHE B CE2   1 
ATOM   4193 C  CZ    . PHE B 1 235 ? 42.739 25.648 0.274   1.00 16.27 ? 211 PHE B CZ    1 
ATOM   4194 N  N     . ALA B 1 236 ? 42.928 32.675 1.539   1.00 17.18 ? 212 ALA B N     1 
ATOM   4195 C  CA    . ALA B 1 236 ? 43.164 33.951 2.181   1.00 17.38 ? 212 ALA B CA    1 
ATOM   4196 C  C     . ALA B 1 236 ? 42.433 33.999 3.509   1.00 19.38 ? 212 ALA B C     1 
ATOM   4197 O  O     . ALA B 1 236 ? 41.425 33.312 3.688   1.00 21.66 ? 212 ALA B O     1 
ATOM   4198 C  CB    . ALA B 1 236 ? 42.677 35.075 1.287   1.00 19.41 ? 212 ALA B CB    1 
ATOM   4199 N  N     . ASN B 1 237 ? 42.939 34.795 4.441   1.00 18.62 ? 213 ASN B N     1 
ATOM   4200 C  CA    . ASN B 1 237 ? 42.121 35.230 5.564   1.00 18.58 ? 213 ASN B CA    1 
ATOM   4201 C  C     . ASN B 1 237 ? 41.609 36.660 5.310   1.00 19.47 ? 213 ASN B C     1 
ATOM   4202 O  O     . ASN B 1 237 ? 41.936 37.280 4.286   1.00 17.50 ? 213 ASN B O     1 
ATOM   4203 C  CB    . ASN B 1 237 ? 42.859 35.094 6.902   1.00 18.09 ? 213 ASN B CB    1 
ATOM   4204 C  CG    . ASN B 1 237 ? 44.102 35.970 6.994   1.00 19.40 ? 213 ASN B CG    1 
ATOM   4205 O  OD1   . ASN B 1 237 ? 44.270 36.935 6.249   1.00 18.79 ? 213 ASN B OD1   1 
ATOM   4206 N  ND2   . ASN B 1 237 ? 44.966 35.644 7.938   1.00 23.00 ? 213 ASN B ND2   1 
ATOM   4207 N  N     . ARG B 1 238 ? 40.788 37.172 6.225   1.00 19.49 ? 214 ARG B N     1 
ATOM   4208 C  CA    . ARG B 1 238 ? 40.215 38.502 6.076   1.00 20.13 ? 214 ARG B CA    1 
ATOM   4209 C  C     . ARG B 1 238 ? 41.290 39.566 5.867   1.00 19.42 ? 214 ARG B C     1 
ATOM   4210 O  O     . ARG B 1 238 ? 41.156 40.421 4.976   1.00 20.37 ? 214 ARG B O     1 
ATOM   4211 C  CB    . ARG B 1 238 ? 39.336 38.851 7.285   1.00 22.34 ? 214 ARG B CB    1 
ATOM   4212 C  CG    . ARG B 1 238 ? 38.845 40.291 7.318   1.00 26.06 ? 214 ARG B CG    1 
ATOM   4213 C  CD    . ARG B 1 238 ? 38.035 40.561 8.575   1.00 33.46 ? 214 ARG B CD    1 
ATOM   4214 N  NE    . ARG B 1 238 ? 36.604 40.373 8.342   1.00 44.57 ? 214 ARG B NE    1 
ATOM   4215 C  CZ    . ARG B 1 238 ? 35.770 41.340 7.969   1.00 47.35 ? 214 ARG B CZ    1 
ATOM   4216 N  NH1   . ARG B 1 238 ? 36.212 42.580 7.784   1.00 48.28 ? 214 ARG B NH1   1 
ATOM   4217 N  NH2   . ARG B 1 238 ? 34.485 41.070 7.783   1.00 50.10 ? 214 ARG B NH2   1 
ATOM   4218 N  N     . GLN B 1 239 ? 42.341 39.505 6.686   1.00 19.40 ? 215 GLN B N     1 
ATOM   4219 C  CA    . GLN B 1 239 ? 43.407 40.506 6.688   1.00 19.50 ? 215 GLN B CA    1 
ATOM   4220 C  C     . GLN B 1 239 ? 44.154 40.503 5.345   1.00 18.23 ? 215 GLN B C     1 
ATOM   4221 O  O     . GLN B 1 239 ? 44.426 41.561 4.774   1.00 20.08 ? 215 GLN B O     1 
ATOM   4222 C  CB    . GLN B 1 239 ? 44.367 40.268 7.859   1.00 23.80 ? 215 GLN B CB    1 
ATOM   4223 C  CG    . GLN B 1 239 ? 43.744 40.415 9.252   1.00 28.03 ? 215 GLN B CG    1 
ATOM   4224 C  CD    . GLN B 1 239 ? 43.274 39.103 9.884   1.00 31.90 ? 215 GLN B CD    1 
ATOM   4225 O  OE1   . GLN B 1 239 ? 42.761 38.204 9.212   1.00 25.26 ? 215 GLN B OE1   1 
ATOM   4226 N  NE2   . GLN B 1 239 ? 43.439 39.001 11.202  1.00 38.77 ? 215 GLN B NE2   1 
ATOM   4227 N  N     . GLU B 1 240 ? 44.425 39.306 4.833   1.00 17.96 ? 216 GLU B N     1 
ATOM   4228 C  CA    . GLU B 1 240 ? 45.092 39.150 3.528   1.00 16.76 ? 216 GLU B CA    1 
ATOM   4229 C  C     . GLU B 1 240 ? 44.232 39.644 2.373   1.00 16.27 ? 216 GLU B C     1 
ATOM   4230 O  O     . GLU B 1 240 ? 44.743 40.293 1.444   1.00 18.69 ? 216 GLU B O     1 
ATOM   4231 C  CB    . GLU B 1 240 ? 45.505 37.707 3.295   1.00 17.69 ? 216 GLU B CB    1 
ATOM   4232 C  CG    . GLU B 1 240 ? 46.644 37.263 4.194   1.00 20.51 ? 216 GLU B CG    1 
ATOM   4233 C  CD    . GLU B 1 240 ? 46.587 35.789 4.528   1.00 20.89 ? 216 GLU B CD    1 
ATOM   4234 O  OE1   . GLU B 1 240 ? 45.845 35.041 3.865   1.00 21.97 ? 216 GLU B OE1   1 
ATOM   4235 O  OE2   . GLU B 1 240 ? 47.290 35.380 5.463   1.00 23.94 ? 216 GLU B OE2   1 
ATOM   4236 N  N     . ALA B 1 241 ? 42.930 39.347 2.421   1.00 16.69 ? 217 ALA B N     1 
ATOM   4237 C  CA    . ALA B 1 241 ? 42.005 39.752 1.361   1.00 18.63 ? 217 ALA B CA    1 
ATOM   4238 C  C     . ALA B 1 241 ? 41.861 41.271 1.320   1.00 17.77 ? 217 ALA B C     1 
ATOM   4239 O  O     . ALA B 1 241 ? 41.848 41.872 0.241   1.00 19.62 ? 217 ALA B O     1 
ATOM   4240 C  CB    . ALA B 1 241 ? 40.645 39.095 1.548   1.00 20.19 ? 217 ALA B CB    1 
ATOM   4241 N  N     . LEU B 1 242 ? 41.757 41.885 2.498   1.00 17.11 ? 218 LEU B N     1 
ATOM   4242 C  CA    . LEU B 1 242 ? 41.701 43.352 2.605   1.00 18.56 ? 218 LEU B CA    1 
ATOM   4243 C  C     . LEU B 1 242 ? 42.991 44.002 2.110   1.00 19.53 ? 218 LEU B C     1 
ATOM   4244 O  O     . LEU B 1 242 ? 42.957 45.059 1.463   1.00 22.12 ? 218 LEU B O     1 
ATOM   4245 C  CB    . LEU B 1 242 ? 41.400 43.798 4.046   1.00 20.22 ? 218 LEU B CB    1 
ATOM   4246 C  CG    . LEU B 1 242 ? 39.996 43.442 4.568   1.00 21.55 ? 218 LEU B CG    1 
ATOM   4247 C  CD1   . LEU B 1 242 ? 39.855 43.846 6.036   1.00 24.29 ? 218 LEU B CD1   1 
ATOM   4248 C  CD2   . LEU B 1 242 ? 38.886 44.045 3.717   1.00 21.56 ? 218 LEU B CD2   1 
ATOM   4249 N  N     A SER B 1 243 ? 44.122 43.384 2.434   0.50 18.30 ? 219 SER B N     1 
ATOM   4250 N  N     B SER B 1 243 ? 44.116 43.367 2.415   0.50 18.97 ? 219 SER B N     1 
ATOM   4251 C  CA    A SER B 1 243 ? 45.413 43.860 1.957   0.50 17.82 ? 219 SER B CA    1 
ATOM   4252 C  CA    B SER B 1 243 ? 45.419 43.835 1.965   0.50 19.82 ? 219 SER B CA    1 
ATOM   4253 C  C     A SER B 1 243 ? 45.503 43.739 0.433   0.50 18.04 ? 219 SER B C     1 
ATOM   4254 C  C     B SER B 1 243 ? 45.577 43.699 0.450   0.50 18.92 ? 219 SER B C     1 
ATOM   4255 O  O     A SER B 1 243 ? 45.908 44.686 -0.243  0.50 18.44 ? 219 SER B O     1 
ATOM   4256 O  O     B SER B 1 243 ? 46.109 44.597 -0.202  0.50 20.21 ? 219 SER B O     1 
ATOM   4257 C  CB    A SER B 1 243 ? 46.564 43.122 2.635   0.50 16.16 ? 219 SER B CB    1 
ATOM   4258 C  CB    B SER B 1 243 ? 46.522 43.094 2.707   0.50 22.20 ? 219 SER B CB    1 
ATOM   4259 O  OG    A SER B 1 243 ? 47.803 43.653 2.197   0.50 13.97 ? 219 SER B OG    1 
ATOM   4260 O  OG    B SER B 1 243 ? 46.373 43.311 4.094   0.50 24.13 ? 219 SER B OG    1 
ATOM   4261 N  N     . LEU B 1 244 ? 45.088 42.594 -0.101  1.00 17.85 ? 220 LEU B N     1 
ATOM   4262 C  CA    . LEU B 1 244 ? 45.181 42.328 -1.557  1.00 15.79 ? 220 LEU B CA    1 
ATOM   4263 C  C     . LEU B 1 244 ? 44.521 43.432 -2.407  1.00 17.76 ? 220 LEU B C     1 
ATOM   4264 O  O     . LEU B 1 244 ? 45.091 43.881 -3.404  1.00 20.09 ? 220 LEU B O     1 
ATOM   4265 C  CB    . LEU B 1 244 ? 44.621 40.936 -1.895  1.00 15.80 ? 220 LEU B CB    1 
ATOM   4266 C  CG    . LEU B 1 244 ? 44.743 40.478 -3.352  1.00 17.21 ? 220 LEU B CG    1 
ATOM   4267 C  CD1   . LEU B 1 244 ? 46.203 40.482 -3.769  1.00 18.85 ? 220 LEU B CD1   1 
ATOM   4268 C  CD2   . LEU B 1 244 ? 44.126 39.110 -3.559  1.00 17.71 ? 220 LEU B CD2   1 
ATOM   4269 N  N     . TYR B 1 245 ? 43.331 43.869 -2.004  1.00 17.63 ? 221 TYR B N     1 
ATOM   4270 C  CA    . TYR B 1 245 ? 42.596 44.887 -2.738  1.00 17.59 ? 221 TYR B CA    1 
ATOM   4271 C  C     . TYR B 1 245 ? 42.643 46.281 -2.086  1.00 20.03 ? 221 TYR B C     1 
ATOM   4272 O  O     . TYR B 1 245 ? 41.954 47.194 -2.548  1.00 23.20 ? 221 TYR B O     1 
ATOM   4273 C  CB    . TYR B 1 245 ? 41.165 44.402 -3.004  1.00 20.54 ? 221 TYR B CB    1 
ATOM   4274 C  CG    . TYR B 1 245 ? 41.188 43.109 -3.786  1.00 18.11 ? 221 TYR B CG    1 
ATOM   4275 C  CD1   . TYR B 1 245 ? 41.509 43.092 -5.145  1.00 21.60 ? 221 TYR B CD1   1 
ATOM   4276 C  CD2   . TYR B 1 245 ? 40.928 41.894 -3.163  1.00 19.05 ? 221 TYR B CD2   1 
ATOM   4277 C  CE1   . TYR B 1 245 ? 41.562 41.903 -5.853  1.00 21.76 ? 221 TYR B CE1   1 
ATOM   4278 C  CE2   . TYR B 1 245 ? 40.974 40.700 -3.867  1.00 18.45 ? 221 TYR B CE2   1 
ATOM   4279 C  CZ    . TYR B 1 245 ? 41.290 40.713 -5.212  1.00 18.78 ? 221 TYR B CZ    1 
ATOM   4280 O  OH    . TYR B 1 245 ? 41.336 39.540 -5.907  1.00 21.13 ? 221 TYR B OH    1 
ATOM   4281 N  N     . GLN B 1 246 ? 43.459 46.429 -1.034  1.00 19.76 ? 222 GLN B N     1 
ATOM   4282 C  CA    . GLN B 1 246 ? 43.740 47.717 -0.377  1.00 19.43 ? 222 GLN B CA    1 
ATOM   4283 C  C     . GLN B 1 246 ? 42.459 48.432 0.006   1.00 20.46 ? 222 GLN B C     1 
ATOM   4284 O  O     . GLN B 1 246 ? 42.240 49.603 -0.323  1.00 21.90 ? 222 GLN B O     1 
ATOM   4285 C  CB    . GLN B 1 246 ? 44.599 48.594 -1.285  1.00 19.15 ? 222 GLN B CB    1 
ATOM   4286 C  CG    . GLN B 1 246 ? 45.944 47.967 -1.591  1.00 20.76 ? 222 GLN B CG    1 
ATOM   4287 C  CD    . GLN B 1 246 ? 46.797 48.827 -2.487  1.00 23.42 ? 222 GLN B CD    1 
ATOM   4288 O  OE1   . GLN B 1 246 ? 46.593 48.878 -3.707  1.00 27.51 ? 222 GLN B OE1   1 
ATOM   4289 N  NE2   . GLN B 1 246 ? 47.756 49.513 -1.893  1.00 24.49 ? 222 GLN B NE2   1 
ATOM   4290 N  N     . THR B 1 247 ? 41.607 47.692 0.703   1.00 21.80 ? 223 THR B N     1 
ATOM   4291 C  CA    . THR B 1 247 ? 40.261 48.133 0.994   1.00 22.48 ? 223 THR B CA    1 
ATOM   4292 C  C     . THR B 1 247 ? 39.941 47.800 2.447   1.00 23.43 ? 223 THR B C     1 
ATOM   4293 O  O     . THR B 1 247 ? 40.550 46.898 3.033   1.00 23.36 ? 223 THR B O     1 
ATOM   4294 C  CB    . THR B 1 247 ? 39.238 47.476 0.034   1.00 22.36 ? 223 THR B CB    1 
ATOM   4295 O  OG1   . THR B 1 247 ? 37.923 47.980 0.299   1.00 24.40 ? 223 THR B OG1   1 
ATOM   4296 C  CG2   . THR B 1 247 ? 39.242 45.940 0.158   1.00 24.06 ? 223 THR B CG2   1 
ATOM   4297 N  N     . ASP B 1 248 ? 39.003 48.544 3.025   1.00 26.29 ? 224 ASP B N     1 
ATOM   4298 C  CA    . ASP B 1 248 ? 38.409 48.160 4.300   1.00 27.69 ? 224 ASP B CA    1 
ATOM   4299 C  C     . ASP B 1 248 ? 37.042 47.494 4.094   1.00 25.35 ? 224 ASP B C     1 
ATOM   4300 O  O     . ASP B 1 248 ? 36.386 47.099 5.063   1.00 29.65 ? 224 ASP B O     1 
ATOM   4301 C  CB    . ASP B 1 248 ? 38.307 49.357 5.258   1.00 35.66 ? 224 ASP B CB    1 
ATOM   4302 C  CG    . ASP B 1 248 ? 37.755 50.608 4.594   1.00 46.35 ? 224 ASP B CG    1 
ATOM   4303 O  OD1   . ASP B 1 248 ? 36.667 50.548 3.983   1.00 46.83 ? 224 ASP B OD1   1 
ATOM   4304 O  OD2   . ASP B 1 248 ? 38.413 51.666 4.701   1.00 60.36 ? 224 ASP B OD2   1 
ATOM   4305 N  N     . ASP B 1 249 ? 36.622 47.369 2.835   1.00 24.08 ? 225 ASP B N     1 
ATOM   4306 C  CA    . ASP B 1 249 ? 35.342 46.749 2.501   1.00 25.93 ? 225 ASP B CA    1 
ATOM   4307 C  C     . ASP B 1 249 ? 35.515 45.257 2.218   1.00 25.28 ? 225 ASP B C     1 
ATOM   4308 O  O     . ASP B 1 249 ? 35.890 44.863 1.107   1.00 26.29 ? 225 ASP B O     1 
ATOM   4309 C  CB    . ASP B 1 249 ? 34.706 47.454 1.295   1.00 27.86 ? 225 ASP B CB    1 
ATOM   4310 C  CG    . ASP B 1 249 ? 33.248 47.056 1.061   1.00 33.71 ? 225 ASP B CG    1 
ATOM   4311 O  OD1   . ASP B 1 249 ? 32.798 45.984 1.529   1.00 34.65 ? 225 ASP B OD1   1 
ATOM   4312 O  OD2   . ASP B 1 249 ? 32.543 47.830 0.377   1.00 38.86 ? 225 ASP B OD2   1 
ATOM   4313 N  N     . PHE B 1 250 ? 35.220 44.434 3.223   1.00 20.93 ? 226 PHE B N     1 
ATOM   4314 C  CA    . PHE B 1 250 ? 35.312 42.978 3.070   1.00 19.59 ? 226 PHE B CA    1 
ATOM   4315 C  C     . PHE B 1 250 ? 34.431 42.409 1.957   1.00 22.22 ? 226 PHE B C     1 
ATOM   4316 O  O     . PHE B 1 250 ? 34.828 41.477 1.268   1.00 22.70 ? 226 PHE B O     1 
ATOM   4317 C  CB    . PHE B 1 250 ? 35.035 42.257 4.395   1.00 22.22 ? 226 PHE B CB    1 
ATOM   4318 C  CG    . PHE B 1 250 ? 35.342 40.781 4.367   1.00 24.56 ? 226 PHE B CG    1 
ATOM   4319 C  CD1   . PHE B 1 250 ? 36.631 40.323 4.085   1.00 21.81 ? 226 PHE B CD1   1 
ATOM   4320 C  CD2   . PHE B 1 250 ? 34.348 39.845 4.633   1.00 25.66 ? 226 PHE B CD2   1 
ATOM   4321 C  CE1   . PHE B 1 250 ? 36.914 38.962 4.061   1.00 24.34 ? 226 PHE B CE1   1 
ATOM   4322 C  CE2   . PHE B 1 250 ? 34.630 38.484 4.620   1.00 26.40 ? 226 PHE B CE2   1 
ATOM   4323 C  CZ    . PHE B 1 250 ? 35.913 38.045 4.334   1.00 24.58 ? 226 PHE B CZ    1 
ATOM   4324 N  N     . GLU B 1 251 ? 33.234 42.965 1.784   1.00 24.86 ? 227 GLU B N     1 
ATOM   4325 C  CA    . GLU B 1 251 ? 32.364 42.533 0.695   1.00 25.05 ? 227 GLU B CA    1 
ATOM   4326 C  C     . GLU B 1 251 ? 32.969 42.788 -0.681  1.00 22.47 ? 227 GLU B C     1 
ATOM   4327 O  O     . GLU B 1 251 ? 32.859 41.935 -1.565  1.00 26.18 ? 227 GLU B O     1 
ATOM   4328 C  CB    . GLU B 1 251 ? 30.952 43.125 0.816   1.00 29.30 ? 227 GLU B CB    1 
ATOM   4329 C  CG    . GLU B 1 251 ? 30.173 42.581 2.006   1.00 35.01 ? 227 GLU B CG    1 
ATOM   4330 C  CD    . GLU B 1 251 ? 30.044 41.063 2.001   1.00 40.49 ? 227 GLU B CD    1 
ATOM   4331 O  OE1   . GLU B 1 251 ? 29.792 40.482 0.922   1.00 39.30 ? 227 GLU B OE1   1 
ATOM   4332 O  OE2   . GLU B 1 251 ? 30.189 40.450 3.084   1.00 44.53 ? 227 GLU B OE2   1 
ATOM   4333 N  N     . GLU B 1 252 ? 33.617 43.943 -0.855  1.00 24.50 ? 228 GLU B N     1 
ATOM   4334 C  CA    . GLU B 1 252 ? 34.330 44.234 -2.106  1.00 24.40 ? 228 GLU B CA    1 
ATOM   4335 C  C     . GLU B 1 252 ? 35.437 43.206 -2.312  1.00 21.33 ? 228 GLU B C     1 
ATOM   4336 O  O     . GLU B 1 252 ? 35.570 42.641 -3.404  1.00 22.40 ? 228 GLU B O     1 
ATOM   4337 C  CB    . GLU B 1 252 ? 34.914 45.650 -2.113  1.00 25.86 ? 228 GLU B CB    1 
ATOM   4338 C  CG    . GLU B 1 252 ? 35.834 45.930 -3.299  1.00 29.22 ? 228 GLU B CG    1 
ATOM   4339 C  CD    . GLU B 1 252 ? 36.695 47.164 -3.108  1.00 32.71 ? 228 GLU B CD    1 
ATOM   4340 O  OE1   . GLU B 1 252 ? 36.299 48.043 -2.322  1.00 36.83 ? 228 GLU B OE1   1 
ATOM   4341 O  OE2   . GLU B 1 252 ? 37.771 47.255 -3.741  1.00 33.74 ? 228 GLU B OE2   1 
ATOM   4342 N  N     . ALA B 1 253 ? 36.212 42.963 -1.252  1.00 22.61 ? 229 ALA B N     1 
ATOM   4343 C  CA    . ALA B 1 253 ? 37.306 41.986 -1.279  1.00 21.35 ? 229 ALA B CA    1 
ATOM   4344 C  C     . ALA B 1 253 ? 36.816 40.601 -1.707  1.00 20.46 ? 229 ALA B C     1 
ATOM   4345 O  O     . ALA B 1 253 ? 37.446 39.959 -2.543  1.00 20.99 ? 229 ALA B O     1 
ATOM   4346 C  CB    . ALA B 1 253 ? 38.017 41.926 0.068   1.00 19.25 ? 229 ALA B CB    1 
ATOM   4347 N  N     . LEU B 1 254 ? 35.686 40.142 -1.156  1.00 19.69 ? 230 LEU B N     1 
ATOM   4348 C  CA    . LEU B 1 254 ? 35.100 38.858 -1.581  1.00 19.89 ? 230 LEU B CA    1 
ATOM   4349 C  C     . LEU B 1 254 ? 34.697 38.811 -3.059  1.00 18.93 ? 230 LEU B C     1 
ATOM   4350 O  O     . LEU B 1 254 ? 34.999 37.843 -3.746  1.00 22.91 ? 230 LEU B O     1 
ATOM   4351 C  CB    . LEU B 1 254 ? 33.908 38.472 -0.705  1.00 19.56 ? 230 LEU B CB    1 
ATOM   4352 C  CG    . LEU B 1 254 ? 34.220 38.117 0.744   1.00 19.98 ? 230 LEU B CG    1 
ATOM   4353 C  CD1   . LEU B 1 254 ? 32.941 37.676 1.431   1.00 23.43 ? 230 LEU B CD1   1 
ATOM   4354 C  CD2   . LEU B 1 254 ? 35.259 37.006 0.828   1.00 19.92 ? 230 LEU B CD2   1 
ATOM   4355 N  N     . ASN B 1 255 ? 34.030 39.864 -3.537  1.00 20.14 ? 231 ASN B N     1 
ATOM   4356 C  CA    . ASN B 1 255 ? 33.625 39.964 -4.939  1.00 21.89 ? 231 ASN B CA    1 
ATOM   4357 C  C     . ASN B 1 255 ? 34.836 39.978 -5.868  1.00 21.77 ? 231 ASN B C     1 
ATOM   4358 O  O     . ASN B 1 255 ? 34.845 39.307 -6.908  1.00 22.12 ? 231 ASN B O     1 
ATOM   4359 C  CB    . ASN B 1 255 ? 32.767 41.213 -5.162  1.00 26.15 ? 231 ASN B CB    1 
ATOM   4360 C  CG    . ASN B 1 255 ? 31.380 41.092 -4.545  1.00 29.08 ? 231 ASN B CG    1 
ATOM   4361 O  OD1   . ASN B 1 255 ? 30.798 40.011 -4.499  1.00 31.71 ? 231 ASN B OD1   1 
ATOM   4362 N  ND2   . ASN B 1 255 ? 30.844 42.211 -4.076  1.00 32.39 ? 231 ASN B ND2   1 
ATOM   4363 N  N     . ARG B 1 256 ? 35.866 40.722 -5.478  1.00 21.10 ? 232 ARG B N     1 
ATOM   4364 C  CA    . ARG B 1 256 ? 37.059 40.851 -6.322  1.00 21.40 ? 232 ARG B CA    1 
ATOM   4365 C  C     . ARG B 1 256 ? 37.852 39.545 -6.384  1.00 18.53 ? 232 ARG B C     1 
ATOM   4366 O  O     . ARG B 1 256 ? 38.264 39.108 -7.472  1.00 20.36 ? 232 ARG B O     1 
ATOM   4367 C  CB    . ARG B 1 256 ? 37.926 42.026 -5.866  1.00 22.73 ? 232 ARG B CB    1 
ATOM   4368 C  CG    . ARG B 1 256 ? 37.308 43.374 -6.221  1.00 23.64 ? 232 ARG B CG    1 
ATOM   4369 C  CD    . ARG B 1 256 ? 38.222 44.556 -5.936  1.00 26.52 ? 232 ARG B CD    1 
ATOM   4370 N  NE    . ARG B 1 256 ? 39.325 44.674 -6.886  1.00 31.75 ? 232 ARG B NE    1 
ATOM   4371 C  CZ    . ARG B 1 256 ? 40.212 45.669 -6.886  1.00 37.79 ? 232 ARG B CZ    1 
ATOM   4372 N  NH1   . ARG B 1 256 ? 40.132 46.639 -5.980  1.00 40.71 ? 232 ARG B NH1   1 
ATOM   4373 N  NH2   . ARG B 1 256 ? 41.186 45.688 -7.788  1.00 46.17 ? 232 ARG B NH2   1 
ATOM   4374 N  N     . ILE B 1 257 ? 38.039 38.902 -5.231  1.00 19.68 ? 233 ILE B N     1 
ATOM   4375 C  CA    . ILE B 1 257 ? 38.773 37.639 -5.185  1.00 18.38 ? 233 ILE B CA    1 
ATOM   4376 C  C     . ILE B 1 257 ? 38.048 36.542 -5.981  1.00 17.63 ? 233 ILE B C     1 
ATOM   4377 O  O     . ILE B 1 257 ? 38.686 35.754 -6.669  1.00 20.47 ? 233 ILE B O     1 
ATOM   4378 C  CB    . ILE B 1 257 ? 39.141 37.228 -3.740  1.00 18.40 ? 233 ILE B CB    1 
ATOM   4379 C  CG1   . ILE B 1 257 ? 40.418 36.390 -3.739  1.00 18.89 ? 233 ILE B CG1   1 
ATOM   4380 C  CG2   . ILE B 1 257 ? 37.973 36.524 -3.036  1.00 19.36 ? 233 ILE B CG2   1 
ATOM   4381 C  CD1   . ILE B 1 257 ? 41.015 36.199 -2.359  1.00 19.39 ? 233 ILE B CD1   1 
ATOM   4382 N  N     . ALA B 1 258 ? 36.712 36.533 -5.932  1.00 18.77 ? 234 ALA B N     1 
ATOM   4383 C  CA    . ALA B 1 258 ? 35.926 35.580 -6.717  1.00 19.12 ? 234 ALA B CA    1 
ATOM   4384 C  C     . ALA B 1 258 ? 36.108 35.799 -8.229  1.00 18.83 ? 234 ALA B C     1 
ATOM   4385 O  O     . ALA B 1 258 ? 36.073 34.847 -9.013  1.00 21.51 ? 234 ALA B O     1 
ATOM   4386 C  CB    . ALA B 1 258 ? 34.449 35.661 -6.335  1.00 19.30 ? 234 ALA B CB    1 
ATOM   4387 N  N     . ALA B 1 259 ? 36.319 37.056 -8.613  1.00 18.64 ? 235 ALA B N     1 
ATOM   4388 C  CA    . ALA B 1 259 ? 36.508 37.431 -10.014 1.00 18.42 ? 235 ALA B CA    1 
ATOM   4389 C  C     . ALA B 1 259 ? 37.927 37.082 -10.489 1.00 19.44 ? 235 ALA B C     1 
ATOM   4390 O  O     . ALA B 1 259 ? 38.152 36.856 -11.690 1.00 22.16 ? 235 ALA B O     1 
ATOM   4391 C  CB    . ALA B 1 259 ? 36.228 38.917 -10.198 1.00 20.38 ? 235 ALA B CB    1 
ATOM   4392 N  N     . ASP B 1 260 ? 38.864 37.001 -9.546  1.00 17.75 ? 236 ASP B N     1 
ATOM   4393 C  CA    . ASP B 1 260 ? 40.296 36.841 -9.874  1.00 19.22 ? 236 ASP B CA    1 
ATOM   4394 C  C     . ASP B 1 260 ? 40.822 35.400 -9.899  1.00 20.47 ? 236 ASP B C     1 
ATOM   4395 O  O     . ASP B 1 260 ? 41.883 35.136 -10.475 1.00 22.71 ? 236 ASP B O     1 
ATOM   4396 C  CB    . ASP B 1 260 ? 41.166 37.719 -8.959  1.00 20.32 ? 236 ASP B CB    1 
ATOM   4397 C  CG    . ASP B 1 260 ? 41.085 39.196 -9.324  1.00 19.95 ? 236 ASP B CG    1 
ATOM   4398 O  OD1   . ASP B 1 260 ? 40.777 39.489 -10.501 1.00 23.60 ? 236 ASP B OD1   1 
ATOM   4399 O  OD2   . ASP B 1 260 ? 41.327 40.063 -8.446  1.00 21.43 ? 236 ASP B OD2   1 
ATOM   4400 N  N     . CYS B 1 261 ? 40.082 34.470 -9.301  1.00 20.11 ? 237 CYS B N     1 
ATOM   4401 C  CA    A CYS B 1 261 ? 40.512 33.076 -9.265  0.60 19.75 ? 237 CYS B CA    1 
ATOM   4402 C  CA    B CYS B 1 261 ? 40.512 33.079 -9.164  0.40 18.18 ? 237 CYS B CA    1 
ATOM   4403 C  C     . CYS B 1 261 ? 39.312 32.144 -9.324  1.00 19.45 ? 237 CYS B C     1 
ATOM   4404 O  O     . CYS B 1 261 ? 38.184 32.530 -8.972  1.00 23.89 ? 237 CYS B O     1 
ATOM   4405 C  CB    A CYS B 1 261 ? 41.347 32.795 -8.020  0.60 23.10 ? 237 CYS B CB    1 
ATOM   4406 C  CB    B CYS B 1 261 ? 41.168 32.878 -7.794  0.40 17.34 ? 237 CYS B CB    1 
ATOM   4407 S  SG    A CYS B 1 261 ? 40.349 32.821 -6.528  0.60 27.13 ? 237 CYS B SG    1 
ATOM   4408 S  SG    B CYS B 1 261 ? 42.266 31.452 -7.688  0.40 15.93 ? 237 CYS B SG    1 
ATOM   4409 N  N     . LYS B 1 262 ? 39.547 30.921 -9.807  1.00 18.69 ? 238 LYS B N     1 
ATOM   4410 C  CA    . LYS B 1 262 ? 38.452 29.959 -10.026 1.00 20.22 ? 238 LYS B CA    1 
ATOM   4411 C  C     . LYS B 1 262 ? 37.744 29.582 -8.728  1.00 19.55 ? 238 LYS B C     1 
ATOM   4412 O  O     . LYS B 1 262 ? 36.511 29.584 -8.666  1.00 20.42 ? 238 LYS B O     1 
ATOM   4413 C  CB    . LYS B 1 262 ? 38.937 28.707 -10.763 1.00 24.43 ? 238 LYS B CB    1 
ATOM   4414 C  CG    . LYS B 1 262 ? 39.256 28.919 -12.235 1.00 30.59 ? 238 LYS B CG    1 
ATOM   4415 C  CD    . LYS B 1 262 ? 39.722 27.621 -12.868 1.00 33.03 ? 238 LYS B CD    1 
ATOM   4416 C  CE    . LYS B 1 262 ? 40.819 27.874 -13.887 1.00 35.57 ? 238 LYS B CE    1 
ATOM   4417 N  NZ    . LYS B 1 262 ? 42.003 28.504 -13.239 1.00 35.43 ? 238 LYS B NZ    1 
ATOM   4418 N  N     . ILE B 1 263 ? 38.526 29.249 -7.708  1.00 18.28 ? 239 ILE B N     1 
ATOM   4419 C  CA    . ILE B 1 263 ? 37.992 28.981 -6.374  1.00 17.80 ? 239 ILE B CA    1 
ATOM   4420 C  C     . ILE B 1 263 ? 38.794 29.771 -5.347  1.00 17.41 ? 239 ILE B C     1 
ATOM   4421 O  O     . ILE B 1 263 ? 40.022 29.816 -5.420  1.00 18.29 ? 239 ILE B O     1 
ATOM   4422 C  CB    . ILE B 1 263 ? 38.039 27.481 -6.024  1.00 18.58 ? 239 ILE B CB    1 
ATOM   4423 C  CG1   . ILE B 1 263 ? 37.100 26.682 -6.932  1.00 20.64 ? 239 ILE B CG1   1 
ATOM   4424 C  CG2   . ILE B 1 263 ? 37.656 27.257 -4.565  1.00 18.87 ? 239 ILE B CG2   1 
ATOM   4425 C  CD1   . ILE B 1 263 ? 37.353 25.188 -6.942  1.00 22.21 ? 239 ILE B CD1   1 
ATOM   4426 N  N     . ALA B 1 264 ? 38.092 30.435 -4.431  1.00 16.20 ? 240 ALA B N     1 
ATOM   4427 C  CA    . ALA B 1 264 ? 38.720 31.121 -3.303  1.00 16.08 ? 240 ALA B CA    1 
ATOM   4428 C  C     . ALA B 1 264 ? 38.162 30.621 -1.985  1.00 18.11 ? 240 ALA B C     1 
ATOM   4429 O  O     . ALA B 1 264 ? 36.937 30.496 -1.819  1.00 19.17 ? 240 ALA B O     1 
ATOM   4430 C  CB    . ALA B 1 264 ? 38.553 32.634 -3.408  1.00 16.95 ? 240 ALA B CB    1 
ATOM   4431 N  N     . ALA B 1 265 ? 39.057 30.337 -1.050  1.00 16.85 ? 241 ALA B N     1 
ATOM   4432 C  CA    . ALA B 1 265 ? 38.650 29.929 0.285   1.00 16.26 ? 241 ALA B CA    1 
ATOM   4433 C  C     . ALA B 1 265 ? 39.130 30.994 1.246   1.00 17.08 ? 241 ALA B C     1 
ATOM   4434 O  O     . ALA B 1 265 ? 40.341 31.214 1.394   1.00 20.76 ? 241 ALA B O     1 
ATOM   4435 C  CB    . ALA B 1 265 ? 39.212 28.566 0.636   1.00 17.01 ? 241 ALA B CB    1 
ATOM   4436 N  N     . VAL B 1 266 ? 38.178 31.703 1.851   1.00 18.05 ? 242 VAL B N     1 
ATOM   4437 C  CA    . VAL B 1 266 ? 38.493 32.852 2.688   1.00 17.16 ? 242 VAL B CA    1 
ATOM   4438 C  C     . VAL B 1 266 ? 38.073 32.619 4.137   1.00 17.48 ? 242 VAL B C     1 
ATOM   4439 O  O     . VAL B 1 266 ? 36.892 32.411 4.432   1.00 21.80 ? 242 VAL B O     1 
ATOM   4440 C  CB    . VAL B 1 266 ? 37.865 34.144 2.140   1.00 18.32 ? 242 VAL B CB    1 
ATOM   4441 C  CG1   . VAL B 1 266 ? 38.282 35.334 2.992   1.00 20.77 ? 242 VAL B CG1   1 
ATOM   4442 C  CG2   . VAL B 1 266 ? 38.250 34.352 0.677   1.00 20.23 ? 242 VAL B CG2   1 
ATOM   4443 N  N     . THR B 1 267 ? 39.056 32.643 5.027   1.00 17.91 ? 243 THR B N     1 
ATOM   4444 C  CA    . THR B 1 267 ? 38.828 32.351 6.441   1.00 17.50 ? 243 THR B CA    1 
ATOM   4445 C  C     . THR B 1 267 ? 38.595 33.630 7.215   1.00 20.71 ? 243 THR B C     1 
ATOM   4446 O  O     . THR B 1 267 ? 39.146 34.681 6.875   1.00 19.99 ? 243 THR B O     1 
ATOM   4447 C  CB    . THR B 1 267 ? 39.986 31.552 7.076   1.00 18.29 ? 243 THR B CB    1 
ATOM   4448 O  OG1   . THR B 1 267 ? 41.203 32.310 7.013   1.00 19.98 ? 243 THR B OG1   1 
ATOM   4449 C  CG2   . THR B 1 267 ? 40.183 30.209 6.348   1.00 20.94 ? 243 THR B CG2   1 
HETATM 4450 N  N     . MSE B 1 268 ? 37.749 33.545 8.242   1.00 21.52 ? 244 MSE B N     1 
HETATM 4451 C  CA    . MSE B 1 268 ? 37.397 34.711 9.051   1.00 23.90 ? 244 MSE B CA    1 
HETATM 4452 C  C     . MSE B 1 268 ? 37.501 34.400 10.525  1.00 25.27 ? 244 MSE B C     1 
HETATM 4453 O  O     . MSE B 1 268 ? 36.632 34.796 11.310  1.00 27.89 ? 244 MSE B O     1 
HETATM 4454 C  CB    . MSE B 1 268 ? 35.983 35.182 8.687   1.00 24.35 ? 244 MSE B CB    1 
HETATM 4455 C  CG    . MSE B 1 268 ? 35.838 35.441 7.186   1.00 29.09 ? 244 MSE B CG    1 
HETATM 4456 SE SE    . MSE B 1 268 ? 33.939 35.577 6.700   1.00 53.31 ? 244 MSE B SE    1 
HETATM 4457 C  CE    . MSE B 1 268 ? 33.325 33.746 7.070   1.00 41.45 ? 244 MSE B CE    1 
ATOM   4458 N  N     . SER B 1 269 ? 38.568 33.695 10.912  1.00 24.39 ? 245 SER B N     1 
ATOM   4459 C  CA    . SER B 1 269 ? 38.844 33.359 12.311  1.00 24.21 ? 245 SER B CA    1 
ATOM   4460 C  C     . SER B 1 269 ? 37.612 32.743 12.983  1.00 25.81 ? 245 SER B C     1 
ATOM   4461 O  O     . SER B 1 269 ? 37.081 31.742 12.488  1.00 25.77 ? 245 SER B O     1 
ATOM   4462 C  CB    . SER B 1 269 ? 39.365 34.581 13.072  1.00 28.38 ? 245 SER B CB    1 
ATOM   4463 O  OG    . SER B 1 269 ? 40.536 35.093 12.460  1.00 35.84 ? 245 SER B OG    1 
ATOM   4464 N  N     . GLU B 1 270 ? 37.146 33.346 14.079  1.00 28.89 ? 246 GLU B N     1 
ATOM   4465 C  CA    . GLU B 1 270 ? 35.991 32.816 14.821  1.00 29.61 ? 246 GLU B CA    1 
ATOM   4466 C  C     . GLU B 1 270 ? 34.681 32.866 14.022  1.00 28.51 ? 246 GLU B C     1 
ATOM   4467 O  O     . GLU B 1 270 ? 33.730 32.139 14.338  1.00 29.62 ? 246 GLU B O     1 
ATOM   4468 C  CB    . GLU B 1 270 ? 35.839 33.500 16.187  1.00 31.37 ? 246 GLU B CB    1 
ATOM   4469 C  CG    . GLU B 1 270 ? 35.242 34.901 16.154  1.00 34.77 ? 246 GLU B CG    1 
ATOM   4470 C  CD    . GLU B 1 270 ? 36.270 36.005 15.956  1.00 40.06 ? 246 GLU B CD    1 
ATOM   4471 O  OE1   . GLU B 1 270 ? 37.388 35.736 15.465  1.00 39.59 ? 246 GLU B OE1   1 
ATOM   4472 O  OE2   . GLU B 1 270 ? 35.952 37.162 16.298  1.00 48.07 ? 246 GLU B OE2   1 
ATOM   4473 N  N     . ASN B 1 271 ? 34.643 33.692 12.979  1.00 27.93 ? 247 ASN B N     1 
ATOM   4474 C  CA    . ASN B 1 271 ? 33.468 33.787 12.115  1.00 28.81 ? 247 ASN B CA    1 
ATOM   4475 C  C     . ASN B 1 271 ? 33.403 32.698 11.039  1.00 29.38 ? 247 ASN B C     1 
ATOM   4476 O  O     . ASN B 1 271 ? 32.497 32.709 10.203  1.00 32.80 ? 247 ASN B O     1 
ATOM   4477 C  CB    . ASN B 1 271 ? 33.362 35.177 11.468  1.00 31.35 ? 247 ASN B CB    1 
ATOM   4478 C  CG    . ASN B 1 271 ? 33.052 36.277 12.469  1.00 37.72 ? 247 ASN B CG    1 
ATOM   4479 O  OD1   . ASN B 1 271 ? 32.630 36.016 13.596  1.00 42.60 ? 247 ASN B OD1   1 
ATOM   4480 N  ND2   . ASN B 1 271 ? 33.249 37.523 12.051  1.00 44.15 ? 247 ASN B ND2   1 
ATOM   4481 N  N     . GLY B 1 272 ? 34.353 31.763 11.064  1.00 23.84 ? 248 GLY B N     1 
ATOM   4482 C  CA    . GLY B 1 272 ? 34.329 30.623 10.161  1.00 24.90 ? 248 GLY B CA    1 
ATOM   4483 C  C     . GLY B 1 272 ? 35.039 30.892 8.852   1.00 21.25 ? 248 GLY B C     1 
ATOM   4484 O  O     . GLY B 1 272 ? 36.157 31.410 8.846   1.00 25.22 ? 248 GLY B O     1 
ATOM   4485 N  N     . ALA B 1 273 ? 34.389 30.522 7.751   1.00 19.66 ? 249 ALA B N     1 
ATOM   4486 C  CA    . ALA B 1 273 ? 34.981 30.660 6.416   1.00 20.15 ? 249 ALA B CA    1 
ATOM   4487 C  C     . ALA B 1 273 ? 33.921 30.786 5.335   1.00 21.14 ? 249 ALA B C     1 
ATOM   4488 O  O     . ALA B 1 273 ? 32.746 30.488 5.563   1.00 21.82 ? 249 ALA B O     1 
ATOM   4489 C  CB    . ALA B 1 273 ? 35.926 29.494 6.113   1.00 21.65 ? 249 ALA B CB    1 
ATOM   4490 N  N     . VAL B 1 274 ? 34.339 31.250 4.160   1.00 20.50 ? 250 VAL B N     1 
ATOM   4491 C  CA    . VAL B 1 274 ? 33.459 31.312 3.002   1.00 20.61 ? 250 VAL B CA    1 
ATOM   4492 C  C     . VAL B 1 274 ? 34.207 30.799 1.779   1.00 20.66 ? 250 VAL B C     1 
ATOM   4493 O  O     . VAL B 1 274 ? 35.357 31.188 1.542   1.00 22.16 ? 250 VAL B O     1 
ATOM   4494 C  CB    . VAL B 1 274 ? 32.896 32.740 2.773   1.00 22.53 ? 250 VAL B CB    1 
ATOM   4495 C  CG1   . VAL B 1 274 ? 34.008 33.775 2.601   1.00 25.36 ? 250 VAL B CG1   1 
ATOM   4496 C  CG2   . VAL B 1 274 ? 31.915 32.768 1.598   1.00 25.15 ? 250 VAL B CG2   1 
ATOM   4497 N  N     . ILE B 1 275 ? 33.577 29.892 1.042   1.00 19.24 ? 251 ILE B N     1 
ATOM   4498 C  CA    . ILE B 1 275 ? 34.172 29.352 -0.185  1.00 19.50 ? 251 ILE B CA    1 
ATOM   4499 C  C     . ILE B 1 275 ? 33.457 29.972 -1.380  1.00 20.63 ? 251 ILE B C     1 
ATOM   4500 O  O     . ILE B 1 275 ? 32.217 29.988 -1.450  1.00 21.51 ? 251 ILE B O     1 
ATOM   4501 C  CB    . ILE B 1 275 ? 34.119 27.805 -0.259  1.00 20.03 ? 251 ILE B CB    1 
ATOM   4502 C  CG1   . ILE B 1 275 ? 34.406 27.149 1.112   1.00 21.54 ? 251 ILE B CG1   1 
ATOM   4503 C  CG2   . ILE B 1 275 ? 35.020 27.286 -1.377  1.00 21.34 ? 251 ILE B CG2   1 
ATOM   4504 C  CD1   . ILE B 1 275 ? 35.716 27.519 1.787   1.00 20.94 ? 251 ILE B CD1   1 
ATOM   4505 N  N     . LEU B 1 276 ? 34.247 30.483 -2.320  1.00 20.28 ? 252 LEU B N     1 
ATOM   4506 C  CA    . LEU B 1 276 ? 33.720 31.183 -3.482  1.00 20.09 ? 252 LEU B CA    1 
ATOM   4507 C  C     . LEU B 1 276 ? 34.097 30.458 -4.766  1.00 20.55 ? 252 LEU B C     1 
ATOM   4508 O  O     . LEU B 1 276 ? 35.241 30.064 -4.945  1.00 22.01 ? 252 LEU B O     1 
ATOM   4509 C  CB    . LEU B 1 276 ? 34.208 32.644 -3.519  1.00 22.35 ? 252 LEU B CB    1 
ATOM   4510 C  CG    . LEU B 1 276 ? 33.865 33.498 -2.285  1.00 25.54 ? 252 LEU B CG    1 
ATOM   4511 C  CD1   . LEU B 1 276 ? 35.091 33.651 -1.400  1.00 31.20 ? 252 LEU B CD1   1 
ATOM   4512 C  CD2   . LEU B 1 276 ? 33.314 34.863 -2.681  1.00 30.88 ? 252 LEU B CD2   1 
ATOM   4513 N  N     . LYS B 1 277 ? 33.122 30.283 -5.651  1.00 21.70 ? 253 LYS B N     1 
ATOM   4514 C  CA    . LYS B 1 277 ? 33.369 29.768 -6.995  1.00 21.03 ? 253 LYS B CA    1 
ATOM   4515 C  C     . LYS B 1 277 ? 32.415 30.459 -7.955  1.00 23.90 ? 253 LYS B C     1 
ATOM   4516 O  O     . LYS B 1 277 ? 31.212 30.187 -7.953  1.00 26.27 ? 253 LYS B O     1 
ATOM   4517 C  CB    . LYS B 1 277 ? 33.204 28.254 -7.058  1.00 20.10 ? 253 LYS B CB    1 
ATOM   4518 C  CG    . LYS B 1 277 ? 33.571 27.680 -8.425  1.00 23.18 ? 253 LYS B CG    1 
ATOM   4519 C  CD    . LYS B 1 277 ? 33.349 26.183 -8.516  1.00 27.14 ? 253 LYS B CD    1 
ATOM   4520 C  CE    . LYS B 1 277 ? 33.536 25.702 -9.944  1.00 28.69 ? 253 LYS B CE    1 
ATOM   4521 N  NZ    . LYS B 1 277 ? 33.243 24.250 -10.045 1.00 33.96 ? 253 LYS B NZ    1 
ATOM   4522 N  N     . GLY B 1 278 ? 32.953 31.364 -8.769  1.00 24.77 ? 254 GLY B N     1 
ATOM   4523 C  CA    . GLY B 1 278 ? 32.124 32.180 -9.651  1.00 25.97 ? 254 GLY B CA    1 
ATOM   4524 C  C     . GLY B 1 278 ? 31.151 33.007 -8.830  1.00 26.30 ? 254 GLY B C     1 
ATOM   4525 O  O     . GLY B 1 278 ? 31.565 33.873 -8.056  1.00 25.29 ? 254 GLY B O     1 
ATOM   4526 N  N     . ARG B 1 279 ? 29.861 32.715 -8.976  1.00 27.38 ? 255 ARG B N     1 
ATOM   4527 C  CA    . ARG B 1 279 ? 28.812 33.419 -8.234  1.00 29.08 ? 255 ARG B CA    1 
ATOM   4528 C  C     . ARG B 1 279 ? 28.400 32.644 -6.987  1.00 28.98 ? 255 ARG B C     1 
ATOM   4529 O  O     . ARG B 1 279 ? 27.672 33.173 -6.138  1.00 33.58 ? 255 ARG B O     1 
ATOM   4530 C  CB    . ARG B 1 279 ? 27.585 33.658 -9.119  1.00 35.30 ? 255 ARG B CB    1 
ATOM   4531 C  CG    . ARG B 1 279 ? 27.759 34.733 -10.180 1.00 40.05 ? 255 ARG B CG    1 
ATOM   4532 C  CD    . ARG B 1 279 ? 26.464 34.943 -10.944 1.00 48.00 ? 255 ARG B CD    1 
ATOM   4533 N  NE    . ARG B 1 279 ? 26.615 35.892 -12.049 1.00 54.64 ? 255 ARG B NE    1 
ATOM   4534 C  CZ    . ARG B 1 279 ? 26.900 35.551 -13.303 1.00 56.61 ? 255 ARG B CZ    1 
ATOM   4535 N  NH1   . ARG B 1 279 ? 27.071 34.276 -13.632 1.00 62.04 ? 255 ARG B NH1   1 
ATOM   4536 N  NH2   . ARG B 1 279 ? 27.016 36.488 -14.234 1.00 60.90 ? 255 ARG B NH2   1 
ATOM   4537 N  N     . GLU B 1 280 ? 28.862 31.397 -6.893  1.00 25.86 ? 256 GLU B N     1 
ATOM   4538 C  CA    . GLU B 1 280 ? 28.571 30.520 -5.756  1.00 26.76 ? 256 GLU B CA    1 
ATOM   4539 C  C     . GLU B 1 280 ? 29.315 30.978 -4.502  1.00 25.62 ? 256 GLU B C     1 
ATOM   4540 O  O     . GLU B 1 280 ? 30.507 31.317 -4.559  1.00 26.28 ? 256 GLU B O     1 
ATOM   4541 C  CB    . GLU B 1 280 ? 28.980 29.074 -6.059  1.00 28.46 ? 256 GLU B CB    1 
ATOM   4542 C  CG    . GLU B 1 280 ? 28.366 28.440 -7.305  1.00 33.53 ? 256 GLU B CG    1 
ATOM   4543 C  CD    . GLU B 1 280 ? 29.080 27.162 -7.742  1.00 37.21 ? 256 GLU B CD    1 
ATOM   4544 O  OE1   . GLU B 1 280 ? 29.457 26.332 -6.882  1.00 35.53 ? 256 GLU B OE1   1 
ATOM   4545 O  OE2   . GLU B 1 280 ? 29.262 26.979 -8.966  1.00 46.76 ? 256 GLU B OE2   1 
ATOM   4546 N  N     . ARG B 1 281 ? 28.611 30.988 -3.373  1.00 24.62 ? 257 ARG B N     1 
ATOM   4547 C  CA    . ARG B 1 281 ? 29.220 31.221 -2.060  1.00 22.23 ? 257 ARG B CA    1 
ATOM   4548 C  C     . ARG B 1 281 ? 28.754 30.172 -1.060  1.00 23.77 ? 257 ARG B C     1 
ATOM   4549 O  O     . ARG B 1 281 ? 27.547 29.916 -0.934  1.00 25.88 ? 257 ARG B O     1 
ATOM   4550 C  CB    . ARG B 1 281 ? 28.879 32.610 -1.517  1.00 21.13 ? 257 ARG B CB    1 
ATOM   4551 C  CG    . ARG B 1 281 ? 29.574 33.768 -2.205  1.00 29.07 ? 257 ARG B CG    1 
ATOM   4552 C  CD    . ARG B 1 281 ? 29.461 35.017 -1.348  1.00 32.54 ? 257 ARG B CD    1 
ATOM   4553 N  NE    . ARG B 1 281 ? 29.915 36.213 -2.048  1.00 37.77 ? 257 ARG B NE    1 
ATOM   4554 C  CZ    . ARG B 1 281 ? 29.973 37.428 -1.509  1.00 36.75 ? 257 ARG B CZ    1 
ATOM   4555 N  NH1   . ARG B 1 281 ? 29.610 37.630 -0.245  1.00 40.60 ? 257 ARG B NH1   1 
ATOM   4556 N  NH2   . ARG B 1 281 ? 30.397 38.449 -2.239  1.00 38.79 ? 257 ARG B NH2   1 
ATOM   4557 N  N     . TYR B 1 282 ? 29.711 29.577 -0.353  1.00 22.59 ? 258 TYR B N     1 
ATOM   4558 C  CA    . TYR B 1 282 ? 29.408 28.568 0.665   1.00 22.58 ? 258 TYR B CA    1 
ATOM   4559 C  C     . TYR B 1 282 ? 30.022 28.958 2.000   1.00 24.47 ? 258 TYR B C     1 
ATOM   4560 O  O     . TYR B 1 282 ? 31.241 28.923 2.169   1.00 24.86 ? 258 TYR B O     1 
ATOM   4561 C  CB    . TYR B 1 282 ? 29.886 27.173 0.226   1.00 22.46 ? 258 TYR B CB    1 
ATOM   4562 C  CG    . TYR B 1 282 ? 29.392 26.770 -1.144  1.00 23.57 ? 258 TYR B CG    1 
ATOM   4563 C  CD1   . TYR B 1 282 ? 28.115 26.227 -1.317  1.00 26.75 ? 258 TYR B CD1   1 
ATOM   4564 C  CD2   . TYR B 1 282 ? 30.190 26.946 -2.277  1.00 26.18 ? 258 TYR B CD2   1 
ATOM   4565 C  CE1   . TYR B 1 282 ? 27.652 25.872 -2.569  1.00 27.63 ? 258 TYR B CE1   1 
ATOM   4566 C  CE2   . TYR B 1 282 ? 29.735 26.589 -3.539  1.00 27.18 ? 258 TYR B CE2   1 
ATOM   4567 C  CZ    . TYR B 1 282 ? 28.466 26.057 -3.679  1.00 29.07 ? 258 TYR B CZ    1 
ATOM   4568 O  OH    . TYR B 1 282 ? 28.011 25.702 -4.923  1.00 33.67 ? 258 TYR B OH    1 
ATOM   4569 N  N     . TYR B 1 283 ? 29.167 29.356 2.939   1.00 23.11 ? 259 TYR B N     1 
ATOM   4570 C  CA    . TYR B 1 283 ? 29.602 29.742 4.276   1.00 22.64 ? 259 TYR B CA    1 
ATOM   4571 C  C     . TYR B 1 283 ? 29.674 28.536 5.193   1.00 22.46 ? 259 TYR B C     1 
ATOM   4572 O  O     . TYR B 1 283 ? 28.827 27.635 5.136   1.00 24.50 ? 259 TYR B O     1 
ATOM   4573 C  CB    . TYR B 1 283 ? 28.682 30.816 4.880   1.00 22.56 ? 259 TYR B CB    1 
ATOM   4574 C  CG    . TYR B 1 283 ? 28.805 32.181 4.233   1.00 24.64 ? 259 TYR B CG    1 
ATOM   4575 C  CD1   . TYR B 1 283 ? 28.111 32.488 3.059   1.00 27.39 ? 259 TYR B CD1   1 
ATOM   4576 C  CD2   . TYR B 1 283 ? 29.625 33.165 4.792   1.00 23.50 ? 259 TYR B CD2   1 
ATOM   4577 C  CE1   . TYR B 1 283 ? 28.230 33.736 2.460   1.00 26.62 ? 259 TYR B CE1   1 
ATOM   4578 C  CE2   . TYR B 1 283 ? 29.752 34.416 4.206   1.00 27.63 ? 259 TYR B CE2   1 
ATOM   4579 C  CZ    . TYR B 1 283 ? 29.052 34.698 3.045   1.00 30.01 ? 259 TYR B CZ    1 
ATOM   4580 O  OH    . TYR B 1 283 ? 29.190 35.936 2.466   1.00 35.96 ? 259 TYR B OH    1 
ATOM   4581 N  N     . VAL B 1 284 ? 30.703 28.524 6.029   1.00 21.57 ? 260 VAL B N     1 
ATOM   4582 C  CA    . VAL B 1 284 ? 30.911 27.457 6.996   1.00 23.64 ? 260 VAL B CA    1 
ATOM   4583 C  C     . VAL B 1 284 ? 31.193 28.080 8.355   1.00 25.06 ? 260 VAL B C     1 
ATOM   4584 O  O     . VAL B 1 284 ? 31.918 29.068 8.457   1.00 24.06 ? 260 VAL B O     1 
ATOM   4585 C  CB    . VAL B 1 284 ? 32.074 26.526 6.579   1.00 27.37 ? 260 VAL B CB    1 
ATOM   4586 C  CG1   . VAL B 1 284 ? 32.406 25.537 7.688   1.00 30.63 ? 260 VAL B CG1   1 
ATOM   4587 C  CG2   . VAL B 1 284 ? 31.728 25.780 5.298   1.00 29.81 ? 260 VAL B CG2   1 
ATOM   4588 N  N     . ASN B 1 285 ? 30.611 27.495 9.395   1.00 27.12 ? 261 ASN B N     1 
ATOM   4589 C  CA    . ASN B 1 285 ? 30.841 27.958 10.754  1.00 28.79 ? 261 ASN B CA    1 
ATOM   4590 C  C     . ASN B 1 285 ? 32.159 27.450 11.337  1.00 30.28 ? 261 ASN B C     1 
ATOM   4591 O  O     . ASN B 1 285 ? 32.596 26.331 11.047  1.00 29.13 ? 261 ASN B O     1 
ATOM   4592 C  CB    . ASN B 1 285 ? 29.671 27.553 11.653  1.00 35.03 ? 261 ASN B CB    1 
ATOM   4593 C  CG    . ASN B 1 285 ? 28.373 28.247 11.275  1.00 43.47 ? 261 ASN B CG    1 
ATOM   4594 O  OD1   . ASN B 1 285 ? 28.335 29.461 11.069  1.00 42.20 ? 261 ASN B OD1   1 
ATOM   4595 N  ND2   . ASN B 1 285 ? 27.296 27.474 11.189  1.00 57.71 ? 261 ASN B ND2   1 
ATOM   4596 N  N     . ALA B 1 286 ? 32.788 28.276 12.165  1.00 30.53 ? 262 ALA B N     1 
ATOM   4597 C  CA    . ALA B 1 286 ? 33.956 27.847 12.921  1.00 34.01 ? 262 ALA B CA    1 
ATOM   4598 C  C     . ALA B 1 286 ? 33.508 26.969 14.082  1.00 34.61 ? 262 ALA B C     1 
ATOM   4599 O  O     . ALA B 1 286 ? 32.356 27.035 14.517  1.00 35.53 ? 262 ALA B O     1 
ATOM   4600 C  CB    . ALA B 1 286 ? 34.745 29.044 13.428  1.00 34.13 ? 262 ALA B CB    1 
ATOM   4601 N  N     . ILE B 1 287 ? 34.419 26.133 14.567  1.00 39.65 ? 263 ILE B N     1 
ATOM   4602 C  CA    . ILE B 1 287 ? 34.160 25.321 15.748  1.00 42.23 ? 263 ILE B CA    1 
ATOM   4603 C  C     . ILE B 1 287 ? 34.123 26.251 16.963  1.00 41.39 ? 263 ILE B C     1 
ATOM   4604 O  O     . ILE B 1 287 ? 34.923 27.183 17.059  1.00 42.20 ? 263 ILE B O     1 
ATOM   4605 C  CB    . ILE B 1 287 ? 35.213 24.186 15.879  1.00 43.32 ? 263 ILE B CB    1 
ATOM   4606 C  CG1   . ILE B 1 287 ? 34.744 22.926 15.135  1.00 39.77 ? 263 ILE B CG1   1 
ATOM   4607 C  CG2   . ILE B 1 287 ? 35.487 23.826 17.334  1.00 46.64 ? 263 ILE B CG2   1 
ATOM   4608 C  CD1   . ILE B 1 287 ? 34.631 23.059 13.629  1.00 34.08 ? 263 ILE B CD1   1 
ATOM   4609 N  N     . ARG B 1 288 ? 33.162 26.039 17.859  1.00 44.51 ? 264 ARG B N     1 
ATOM   4610 C  CA    . ARG B 1 288 ? 33.156 26.774 19.122  1.00 46.57 ? 264 ARG B CA    1 
ATOM   4611 C  C     . ARG B 1 288 ? 34.317 26.316 19.996  1.00 47.61 ? 264 ARG B C     1 
ATOM   4612 O  O     . ARG B 1 288 ? 34.431 25.136 20.332  1.00 51.61 ? 264 ARG B O     1 
ATOM   4613 C  CB    . ARG B 1 288 ? 31.818 26.653 19.855  1.00 46.51 ? 264 ARG B CB    1 
ATOM   4614 C  CG    . ARG B 1 288 ? 31.120 27.992 20.045  1.00 47.07 ? 264 ARG B CG    1 
ATOM   4615 C  CD    . ARG B 1 288 ? 29.750 27.832 20.683  1.00 40.91 ? 264 ARG B CD    1 
ATOM   4616 N  NE    . ARG B 1 288 ? 28.743 27.440 19.702  1.00 45.01 ? 264 ARG B NE    1 
ATOM   4617 C  CZ    . ARG B 1 288 ? 27.487 27.110 20.002  1.00 40.44 ? 264 ARG B CZ    1 
ATOM   4618 N  NH1   . ARG B 1 288 ? 27.068 27.131 21.262  1.00 41.17 ? 264 ARG B NH1   1 
ATOM   4619 N  NH2   . ARG B 1 288 ? 26.646 26.761 19.039  1.00 43.74 ? 264 ARG B NH2   1 
ATOM   4620 N  N     . ILE B 1 289 ? 35.185 27.263 20.335  1.00 52.81 ? 265 ILE B N     1 
ATOM   4621 C  CA    . ILE B 1 289 ? 36.429 26.962 21.036  1.00 56.58 ? 265 ILE B CA    1 
ATOM   4622 C  C     . ILE B 1 289 ? 36.292 27.246 22.527  1.00 62.18 ? 265 ILE B C     1 
ATOM   4623 O  O     . ILE B 1 289 ? 35.793 28.304 22.921  1.00 68.15 ? 265 ILE B O     1 
ATOM   4624 C  CB    . ILE B 1 289 ? 37.616 27.761 20.441  1.00 51.98 ? 265 ILE B CB    1 
ATOM   4625 C  CG1   . ILE B 1 289 ? 37.720 27.547 18.922  1.00 48.27 ? 265 ILE B CG1   1 
ATOM   4626 C  CG2   . ILE B 1 289 ? 38.927 27.405 21.134  1.00 51.74 ? 265 ILE B CG2   1 
ATOM   4627 C  CD1   . ILE B 1 289 ? 38.144 26.155 18.491  1.00 45.27 ? 265 ILE B CD1   1 
ATOM   4628 N  N     . ARG B 1 290 ? 36.727 26.287 23.344  1.00 65.18 ? 266 ARG B N     1 
ATOM   4629 C  CA    . ARG B 1 290 ? 36.763 26.443 24.798  1.00 65.86 ? 266 ARG B CA    1 
ATOM   4630 C  C     . ARG B 1 290 ? 37.702 27.590 25.179  1.00 61.02 ? 266 ARG B C     1 
ATOM   4631 O  O     . ARG B 1 290 ? 37.304 28.525 25.877  1.00 62.17 ? 266 ARG B O     1 
ATOM   4632 C  CB    . ARG B 1 290 ? 37.214 25.144 25.478  1.00 73.70 ? 266 ARG B CB    1 
ATOM   4633 C  CG    . ARG B 1 290 ? 36.614 23.870 24.898  1.00 79.77 ? 266 ARG B CG    1 
ATOM   4634 C  CD    . ARG B 1 290 ? 37.041 22.651 25.699  1.00 79.40 ? 266 ARG B CD    1 
ATOM   4635 N  NE    . ARG B 1 290 ? 37.042 21.432 24.891  1.00 72.73 ? 266 ARG B NE    1 
ATOM   4636 C  CZ    . ARG B 1 290 ? 37.323 20.215 25.356  1.00 66.96 ? 266 ARG B CZ    1 
ATOM   4637 N  NH1   . ARG B 1 290 ? 37.619 20.033 26.639  1.00 64.57 ? 266 ARG B NH1   1 
ATOM   4638 N  NH2   . ARG B 1 290 ? 37.298 19.173 24.535  1.00 65.92 ? 266 ARG B NH2   1 
ATOM   4639 N  N     . GLU B 1 291 ? 38.943 27.507 24.703  1.00 57.90 ? 267 GLU B N     1 
ATOM   4640 C  CA    . GLU B 1 291 ? 39.952 28.537 24.930  1.00 52.89 ? 267 GLU B CA    1 
ATOM   4641 C  C     . GLU B 1 291 ? 40.989 28.506 23.810  1.00 46.91 ? 267 GLU B C     1 
ATOM   4642 O  O     . GLU B 1 291 ? 41.485 27.436 23.443  1.00 46.05 ? 267 GLU B O     1 
ATOM   4643 C  CB    . GLU B 1 291 ? 40.638 28.335 26.284  1.00 55.19 ? 267 GLU B CB    1 
ATOM   4644 C  CG    . GLU B 1 291 ? 41.482 29.516 26.737  1.00 57.29 ? 267 GLU B CG    1 
ATOM   4645 C  CD    . GLU B 1 291 ? 42.530 29.127 27.760  1.00 64.02 ? 267 GLU B CD    1 
ATOM   4646 O  OE1   . GLU B 1 291 ? 42.489 29.667 28.884  1.00 75.10 ? 267 GLU B OE1   1 
ATOM   4647 O  OE2   . GLU B 1 291 ? 43.393 28.279 27.441  1.00 62.78 ? 267 GLU B OE2   1 
ATOM   4648 N  N     . VAL B 1 292 ? 41.306 29.679 23.268  1.00 42.53 ? 268 VAL B N     1 
ATOM   4649 C  CA    . VAL B 1 292 ? 42.318 29.792 22.214  1.00 37.12 ? 268 VAL B CA    1 
ATOM   4650 C  C     . VAL B 1 292 ? 43.710 29.768 22.844  1.00 34.91 ? 268 VAL B C     1 
ATOM   4651 O  O     . VAL B 1 292 ? 44.141 30.739 23.477  1.00 35.93 ? 268 VAL B O     1 
ATOM   4652 C  CB    . VAL B 1 292 ? 42.121 31.057 21.346  1.00 35.99 ? 268 VAL B CB    1 
ATOM   4653 C  CG1   . VAL B 1 292 ? 43.253 31.205 20.343  1.00 37.45 ? 268 VAL B CG1   1 
ATOM   4654 C  CG2   . VAL B 1 292 ? 40.782 31.012 20.622  1.00 33.63 ? 268 VAL B CG2   1 
ATOM   4655 N  N     . VAL B 1 293 ? 44.399 28.646 22.663  1.00 26.17 ? 269 VAL B N     1 
ATOM   4656 C  CA    . VAL B 1 293 ? 45.706 28.407 23.265  1.00 25.83 ? 269 VAL B CA    1 
ATOM   4657 C  C     . VAL B 1 293 ? 46.835 29.091 22.486  1.00 23.10 ? 269 VAL B C     1 
ATOM   4658 O  O     . VAL B 1 293 ? 47.655 29.817 23.057  1.00 21.91 ? 269 VAL B O     1 
ATOM   4659 C  CB    . VAL B 1 293 ? 45.967 26.884 23.388  1.00 26.90 ? 269 VAL B CB    1 
ATOM   4660 C  CG1   . VAL B 1 293 ? 47.410 26.594 23.777  1.00 29.74 ? 269 VAL B CG1   1 
ATOM   4661 C  CG2   . VAL B 1 293 ? 45.002 26.260 24.400  1.00 29.26 ? 269 VAL B CG2   1 
ATOM   4662 N  N     . ASP B 1 294 ? 46.845 28.865 21.173  1.00 22.99 ? 270 ASP B N     1 
ATOM   4663 C  CA    . ASP B 1 294 ? 47.916 29.316 20.290  1.00 22.46 ? 270 ASP B CA    1 
ATOM   4664 C  C     . ASP B 1 294 ? 47.403 29.221 18.849  1.00 17.12 ? 270 ASP B C     1 
ATOM   4665 O  O     . ASP B 1 294 ? 47.176 28.119 18.345  1.00 19.61 ? 270 ASP B O     1 
ATOM   4666 C  CB    . ASP B 1 294 ? 49.150 28.424 20.505  1.00 20.55 ? 270 ASP B CB    1 
ATOM   4667 C  CG    . ASP B 1 294 ? 50.230 28.606 19.431  1.00 20.64 ? 270 ASP B CG    1 
ATOM   4668 O  OD1   . ASP B 1 294 ? 50.272 29.656 18.769  1.00 21.43 ? 270 ASP B OD1   1 
ATOM   4669 O  OD2   . ASP B 1 294 ? 51.028 27.663 19.250  1.00 25.50 ? 270 ASP B OD2   1 
ATOM   4670 N  N     . THR B 1 295 ? 47.224 30.364 18.189  1.00 18.13 ? 271 THR B N     1 
ATOM   4671 C  CA    . THR B 1 295 ? 46.688 30.399 16.822  1.00 19.21 ? 271 THR B CA    1 
ATOM   4672 C  C     . THR B 1 295 ? 47.652 29.878 15.748  1.00 16.10 ? 271 THR B C     1 
ATOM   4673 O  O     . THR B 1 295 ? 47.240 29.719 14.599  1.00 17.10 ? 271 THR B O     1 
ATOM   4674 C  CB    . THR B 1 295 ? 46.213 31.806 16.403  1.00 20.57 ? 271 THR B CB    1 
ATOM   4675 O  OG1   . THR B 1 295 ? 47.306 32.725 16.489  1.00 22.49 ? 271 THR B OG1   1 
ATOM   4676 C  CG2   . THR B 1 295 ? 45.060 32.285 17.300  1.00 23.09 ? 271 THR B CG2   1 
ATOM   4677 N  N     . THR B 1 296 ? 48.908 29.619 16.111  1.00 17.27 ? 272 THR B N     1 
ATOM   4678 C  CA    . THR B 1 296 ? 49.895 29.160 15.122  1.00 15.95 ? 272 THR B CA    1 
ATOM   4679 C  C     . THR B 1 296 ? 49.389 27.949 14.345  1.00 13.93 ? 272 THR B C     1 
ATOM   4680 O  O     . THR B 1 296 ? 49.032 26.932 14.926  1.00 16.66 ? 272 THR B O     1 
ATOM   4681 C  CB    . THR B 1 296 ? 51.254 28.796 15.766  1.00 17.16 ? 272 THR B CB    1 
ATOM   4682 O  OG1   . THR B 1 296 ? 51.728 29.874 16.584  1.00 18.52 ? 272 THR B OG1   1 
ATOM   4683 C  CG2   . THR B 1 296 ? 52.303 28.468 14.697  1.00 18.68 ? 272 THR B CG2   1 
ATOM   4684 N  N     . GLY B 1 297 ? 49.377 28.059 13.024  1.00 16.05 ? 273 GLY B N     1 
ATOM   4685 C  CA    . GLY B 1 297 ? 49.007 26.937 12.176  1.00 14.36 ? 273 GLY B CA    1 
ATOM   4686 C  C     . GLY B 1 297 ? 47.542 26.884 11.768  1.00 15.08 ? 273 GLY B C     1 
ATOM   4687 O  O     . GLY B 1 297 ? 47.145 26.015 10.986  1.00 14.11 ? 273 GLY B O     1 
ATOM   4688 N  N     . ALA B 1 298 ? 46.739 27.830 12.259  1.00 16.20 ? 274 ALA B N     1 
ATOM   4689 C  CA    . ALA B 1 298 ? 45.300 27.806 11.976  1.00 16.05 ? 274 ALA B CA    1 
ATOM   4690 C  C     . ALA B 1 298 ? 45.008 27.792 10.474  1.00 15.42 ? 274 ALA B C     1 
ATOM   4691 O  O     . ALA B 1 298 ? 44.319 26.895 9.975   1.00 16.47 ? 274 ALA B O     1 
ATOM   4692 C  CB    . ALA B 1 298 ? 44.576 28.960 12.649  1.00 18.34 ? 274 ALA B CB    1 
ATOM   4693 N  N     . GLY B 1 299 ? 45.550 28.777 9.762   1.00 15.54 ? 275 GLY B N     1 
ATOM   4694 C  CA    . GLY B 1 299 ? 45.360 28.886 8.314   1.00 17.01 ? 275 GLY B CA    1 
ATOM   4695 C  C     . GLY B 1 299 ? 45.952 27.677 7.586   1.00 14.68 ? 275 GLY B C     1 
ATOM   4696 O  O     . GLY B 1 299 ? 45.365 27.160 6.621   1.00 14.91 ? 275 GLY B O     1 
ATOM   4697 N  N     . ASP B 1 300 ? 47.118 27.217 8.048   1.00 15.72 ? 276 ASP B N     1 
ATOM   4698 C  CA    . ASP B 1 300 ? 47.773 26.064 7.419   1.00 14.69 ? 276 ASP B CA    1 
ATOM   4699 C  C     . ASP B 1 300 ? 46.901 24.822 7.443   1.00 14.89 ? 276 ASP B C     1 
ATOM   4700 O  O     . ASP B 1 300 ? 46.787 24.097 6.441   1.00 14.33 ? 276 ASP B O     1 
ATOM   4701 C  CB    . ASP B 1 300 ? 49.092 25.738 8.107   1.00 15.28 ? 276 ASP B CB    1 
ATOM   4702 C  CG    . ASP B 1 300 ? 50.005 26.938 8.237   1.00 14.71 ? 276 ASP B CG    1 
ATOM   4703 O  OD1   . ASP B 1 300 ? 49.888 27.879 7.419   1.00 16.78 ? 276 ASP B OD1   1 
ATOM   4704 O  OD2   . ASP B 1 300 ? 50.842 26.914 9.145   1.00 14.08 ? 276 ASP B OD2   1 
ATOM   4705 N  N     . LEU B 1 301 ? 46.315 24.574 8.621   1.00 14.18 ? 277 LEU B N     1 
ATOM   4706 C  CA    . LEU B 1 301 ? 45.456 23.417 8.833   1.00 14.09 ? 277 LEU B CA    1 
ATOM   4707 C  C     . LEU B 1 301 ? 44.056 23.566 8.214   1.00 12.56 ? 277 LEU B C     1 
ATOM   4708 O  O     . LEU B 1 301 ? 43.483 22.571 7.779   1.00 13.56 ? 277 LEU B O     1 
ATOM   4709 C  CB    . LEU B 1 301 ? 45.405 23.028 10.312  1.00 13.23 ? 277 LEU B CB    1 
ATOM   4710 C  CG    . LEU B 1 301 ? 46.531 22.122 10.814  1.00 12.99 ? 277 LEU B CG    1 
ATOM   4711 C  CD1   . LEU B 1 301 ? 46.451 20.735 10.183  1.00 14.08 ? 277 LEU B CD1   1 
ATOM   4712 C  CD2   . LEU B 1 301 ? 47.909 22.717 10.550  1.00 14.51 ? 277 LEU B CD2   1 
ATOM   4713 N  N     . PHE B 1 302 ? 43.531 24.789 8.124   1.00 13.90 ? 278 PHE B N     1 
ATOM   4714 C  CA    . PHE B 1 302 ? 42.352 25.009 7.294   1.00 13.98 ? 278 PHE B CA    1 
ATOM   4715 C  C     . PHE B 1 302 ? 42.628 24.521 5.855   1.00 13.85 ? 278 PHE B C     1 
ATOM   4716 O  O     . PHE B 1 302 ? 41.857 23.789 5.259   1.00 15.33 ? 278 PHE B O     1 
ATOM   4717 C  CB    . PHE B 1 302 ? 41.894 26.472 7.287   1.00 14.48 ? 278 PHE B CB    1 
ATOM   4718 C  CG    . PHE B 1 302 ? 40.719 26.701 6.393   1.00 17.24 ? 278 PHE B CG    1 
ATOM   4719 C  CD1   . PHE B 1 302 ? 39.420 26.559 6.875   1.00 17.09 ? 278 PHE B CD1   1 
ATOM   4720 C  CD2   . PHE B 1 302 ? 40.905 26.996 5.042   1.00 16.33 ? 278 PHE B CD2   1 
ATOM   4721 C  CE1   . PHE B 1 302 ? 38.343 26.732 6.037   1.00 17.44 ? 278 PHE B CE1   1 
ATOM   4722 C  CE2   . PHE B 1 302 ? 39.834 27.165 4.199   1.00 18.01 ? 278 PHE B CE2   1 
ATOM   4723 C  CZ    . PHE B 1 302 ? 38.544 27.032 4.692   1.00 17.52 ? 278 PHE B CZ    1 
ATOM   4724 N  N     . ALA B 1 303 ? 43.797 24.877 5.333   1.00 14.80 ? 279 ALA B N     1 
ATOM   4725 C  CA    . ALA B 1 303 ? 44.141 24.411 4.007   1.00 14.64 ? 279 ALA B CA    1 
ATOM   4726 C  C     . ALA B 1 303 ? 44.281 22.884 3.945   1.00 13.70 ? 279 ALA B C     1 
ATOM   4727 O  O     . ALA B 1 303 ? 43.883 22.281 2.953   1.00 14.56 ? 279 ALA B O     1 
ATOM   4728 C  CB    . ALA B 1 303 ? 45.406 25.098 3.529   1.00 14.56 ? 279 ALA B CB    1 
ATOM   4729 N  N     . SER B 1 304 ? 44.847 22.261 4.988   1.00 13.26 ? 280 SER B N     1 
ATOM   4730 C  CA    . SER B 1 304 ? 44.916 20.794 5.053   1.00 12.19 ? 280 SER B CA    1 
ATOM   4731 C  C     . SER B 1 304 ? 43.530 20.183 4.877   1.00 13.93 ? 280 SER B C     1 
ATOM   4732 O  O     . SER B 1 304 ? 43.328 19.304 4.043   1.00 15.87 ? 280 SER B O     1 
ATOM   4733 C  CB    . SER B 1 304 ? 45.485 20.343 6.395   1.00 13.91 ? 280 SER B CB    1 
ATOM   4734 O  OG    . SER B 1 304 ? 46.837 20.712 6.528   1.00 13.73 ? 280 SER B OG    1 
ATOM   4735 N  N     . GLY B 1 305 ? 42.585 20.658 5.684   1.00 15.33 ? 281 GLY B N     1 
ATOM   4736 C  CA    . GLY B 1 305 ? 41.240 20.092 5.693   1.00 15.46 ? 281 GLY B CA    1 
ATOM   4737 C  C     . GLY B 1 305 ? 40.556 20.292 4.362   1.00 15.96 ? 281 GLY B C     1 
ATOM   4738 O  O     . GLY B 1 305 ? 39.973 19.352 3.789   1.00 17.41 ? 281 GLY B O     1 
ATOM   4739 N  N     . PHE B 1 306 ? 40.654 21.529 3.867   1.00 13.09 ? 282 PHE B N     1 
ATOM   4740 C  CA    . PHE B 1 306 ? 40.052 21.881 2.592   1.00 15.30 ? 282 PHE B CA    1 
ATOM   4741 C  C     . PHE B 1 306 ? 40.582 21.011 1.456   1.00 15.71 ? 282 PHE B C     1 
ATOM   4742 O  O     . PHE B 1 306 ? 39.817 20.438 0.671   1.00 18.68 ? 282 PHE B O     1 
ATOM   4743 C  CB    . PHE B 1 306 ? 40.221 23.369 2.258   1.00 15.18 ? 282 PHE B CB    1 
ATOM   4744 C  CG    . PHE B 1 306 ? 39.470 23.784 1.031   1.00 16.32 ? 282 PHE B CG    1 
ATOM   4745 C  CD1   . PHE B 1 306 ? 39.972 23.498 -0.245  1.00 16.82 ? 282 PHE B CD1   1 
ATOM   4746 C  CD2   . PHE B 1 306 ? 38.215 24.390 1.134   1.00 16.85 ? 282 PHE B CD2   1 
ATOM   4747 C  CE1   . PHE B 1 306 ? 39.272 23.848 -1.385  1.00 18.30 ? 282 PHE B CE1   1 
ATOM   4748 C  CE2   . PHE B 1 306 ? 37.514 24.749 -0.010  1.00 20.35 ? 282 PHE B CE2   1 
ATOM   4749 C  CZ    . PHE B 1 306 ? 38.036 24.466 -1.270  1.00 19.70 ? 282 PHE B CZ    1 
ATOM   4750 N  N     . LEU B 1 307 ? 41.905 20.933 1.364   1.00 15.42 ? 283 LEU B N     1 
ATOM   4751 C  CA    . LEU B 1 307 ? 42.528 20.229 0.252   1.00 15.48 ? 283 LEU B CA    1 
ATOM   4752 C  C     . LEU B 1 307 ? 42.366 18.716 0.349   1.00 14.34 ? 283 LEU B C     1 
ATOM   4753 O  O     . LEU B 1 307 ? 42.245 18.031 -0.667  1.00 16.45 ? 283 LEU B O     1 
ATOM   4754 C  CB    . LEU B 1 307 ? 44.002 20.613 0.150   1.00 14.95 ? 283 LEU B CB    1 
ATOM   4755 C  CG    . LEU B 1 307 ? 44.252 22.050 -0.331  1.00 16.40 ? 283 LEU B CG    1 
ATOM   4756 C  CD1   . LEU B 1 307 ? 45.738 22.391 -0.229  1.00 18.78 ? 283 LEU B CD1   1 
ATOM   4757 C  CD2   . LEU B 1 307 ? 43.717 22.253 -1.746  1.00 20.59 ? 283 LEU B CD2   1 
ATOM   4758 N  N     . TYR B 1 308 ? 42.325 18.195 1.570   1.00 15.16 ? 284 TYR B N     1 
ATOM   4759 C  CA    . TYR B 1 308 ? 42.021 16.772 1.761   1.00 16.59 ? 284 TYR B CA    1 
ATOM   4760 C  C     . TYR B 1 308 ? 40.610 16.500 1.220   1.00 16.42 ? 284 TYR B C     1 
ATOM   4761 O  O     . TYR B 1 308 ? 40.411 15.594 0.422   1.00 18.84 ? 284 TYR B O     1 
ATOM   4762 C  CB    . TYR B 1 308 ? 42.139 16.346 3.229   1.00 16.08 ? 284 TYR B CB    1 
ATOM   4763 C  CG    . TYR B 1 308 ? 41.502 15.006 3.507   1.00 17.82 ? 284 TYR B CG    1 
ATOM   4764 C  CD1   . TYR B 1 308 ? 42.171 13.821 3.220   1.00 21.31 ? 284 TYR B CD1   1 
ATOM   4765 C  CD2   . TYR B 1 308 ? 40.208 14.924 4.048   1.00 21.34 ? 284 TYR B CD2   1 
ATOM   4766 C  CE1   . TYR B 1 308 ? 41.581 12.592 3.457   1.00 22.75 ? 284 TYR B CE1   1 
ATOM   4767 C  CE2   . TYR B 1 308 ? 39.611 13.695 4.289   1.00 24.75 ? 284 TYR B CE2   1 
ATOM   4768 C  CZ    . TYR B 1 308 ? 40.305 12.536 3.995   1.00 25.29 ? 284 TYR B CZ    1 
ATOM   4769 O  OH    . TYR B 1 308 ? 39.733 11.310 4.235   1.00 30.55 ? 284 TYR B OH    1 
ATOM   4770 N  N     . GLY B 1 309 ? 39.638 17.310 1.636   1.00 18.10 ? 285 GLY B N     1 
ATOM   4771 C  CA    . GLY B 1 309 ? 38.266 17.160 1.134   1.00 18.41 ? 285 GLY B CA    1 
ATOM   4772 C  C     . GLY B 1 309 ? 38.196 17.319 -0.381  1.00 19.55 ? 285 GLY B C     1 
ATOM   4773 O  O     . GLY B 1 309 ? 37.528 16.547 -1.059  1.00 22.08 ? 285 GLY B O     1 
ATOM   4774 N  N     . TYR B 1 310 ? 38.914 18.310 -0.913  1.00 16.96 ? 286 TYR B N     1 
ATOM   4775 C  CA    . TYR B 1 310 ? 38.852 18.624 -2.357  1.00 18.85 ? 286 TYR B CA    1 
ATOM   4776 C  C     . TYR B 1 310 ? 39.341 17.449 -3.205  1.00 19.52 ? 286 TYR B C     1 
ATOM   4777 O  O     . TYR B 1 310 ? 38.717 17.069 -4.214  1.00 21.85 ? 286 TYR B O     1 
ATOM   4778 C  CB    . TYR B 1 310 ? 39.677 19.877 -2.652  1.00 18.67 ? 286 TYR B CB    1 
ATOM   4779 C  CG    . TYR B 1 310 ? 39.503 20.417 -4.045  1.00 18.14 ? 286 TYR B CG    1 
ATOM   4780 C  CD1   . TYR B 1 310 ? 38.402 21.208 -4.376  1.00 20.97 ? 286 TYR B CD1   1 
ATOM   4781 C  CD2   . TYR B 1 310 ? 40.445 20.158 -5.031  1.00 21.14 ? 286 TYR B CD2   1 
ATOM   4782 C  CE1   . TYR B 1 310 ? 38.239 21.713 -5.655  1.00 23.68 ? 286 TYR B CE1   1 
ATOM   4783 C  CE2   . TYR B 1 310 ? 40.295 20.671 -6.315  1.00 23.45 ? 286 TYR B CE2   1 
ATOM   4784 C  CZ    . TYR B 1 310 ? 39.188 21.442 -6.623  1.00 24.27 ? 286 TYR B CZ    1 
ATOM   4785 O  OH    . TYR B 1 310 ? 39.023 21.956 -7.892  1.00 26.59 ? 286 TYR B OH    1 
ATOM   4786 N  N     . THR B 1 311 ? 40.448 16.860 -2.768  1.00 19.73 ? 287 THR B N     1 
ATOM   4787 C  CA    . THR B 1 311 ? 41.059 15.752 -3.490  1.00 20.61 ? 287 THR B CA    1 
ATOM   4788 C  C     . THR B 1 311 ? 40.384 14.401 -3.237  1.00 22.15 ? 287 THR B C     1 
ATOM   4789 O  O     . THR B 1 311 ? 40.736 13.403 -3.871  1.00 26.34 ? 287 THR B O     1 
ATOM   4790 C  CB    . THR B 1 311 ? 42.577 15.684 -3.247  1.00 19.54 ? 287 THR B CB    1 
ATOM   4791 O  OG1   . THR B 1 311 ? 42.841 15.516 -1.850  1.00 20.62 ? 287 THR B OG1   1 
ATOM   4792 C  CG2   . THR B 1 311 ? 43.238 16.970 -3.734  1.00 19.48 ? 287 THR B CG2   1 
ATOM   4793 N  N     . GLN B 1 312 ? 39.420 14.379 -2.316  1.00 22.15 ? 288 GLN B N     1 
ATOM   4794 C  CA    . GLN B 1 312 ? 38.543 13.223 -2.128  1.00 24.37 ? 288 GLN B CA    1 
ATOM   4795 C  C     . GLN B 1 312 ? 37.207 13.414 -2.861  1.00 24.82 ? 288 GLN B C     1 
ATOM   4796 O  O     . GLN B 1 312 ? 36.308 12.581 -2.743  1.00 29.62 ? 288 GLN B O     1 
ATOM   4797 C  CB    . GLN B 1 312 ? 38.291 12.965 -0.632  1.00 23.37 ? 288 GLN B CB    1 
ATOM   4798 C  CG    . GLN B 1 312 ? 39.522 12.623 0.202   1.00 26.10 ? 288 GLN B CG    1 
ATOM   4799 C  CD    . GLN B 1 312 ? 40.154 11.292 -0.158  1.00 32.67 ? 288 GLN B CD    1 
ATOM   4800 O  OE1   . GLN B 1 312 ? 41.372 11.192 -0.306  1.00 35.83 ? 288 GLN B OE1   1 
ATOM   4801 N  NE2   . GLN B 1 312 ? 39.333 10.264 -0.298  1.00 35.54 ? 288 GLN B NE2   1 
ATOM   4802 N  N     . GLY B 1 313 ? 37.078 14.508 -3.616  1.00 24.25 ? 289 GLY B N     1 
ATOM   4803 C  CA    . GLY B 1 313 ? 35.856 14.788 -4.379  1.00 27.13 ? 289 GLY B CA    1 
ATOM   4804 C  C     . GLY B 1 313 ? 34.668 15.274 -3.559  1.00 24.49 ? 289 GLY B C     1 
ATOM   4805 O  O     . GLY B 1 313 ? 33.510 15.086 -3.952  1.00 28.57 ? 289 GLY B O     1 
ATOM   4806 N  N     . ARG B 1 314 ? 34.943 15.907 -2.423  1.00 21.89 ? 290 ARG B N     1 
ATOM   4807 C  CA    . ARG B 1 314 ? 33.870 16.377 -1.548  1.00 21.64 ? 290 ARG B CA    1 
ATOM   4808 C  C     . ARG B 1 314 ? 33.330 17.715 -2.038  1.00 21.15 ? 290 ARG B C     1 
ATOM   4809 O  O     . ARG B 1 314 ? 34.008 18.427 -2.771  1.00 23.37 ? 290 ARG B O     1 
ATOM   4810 C  CB    . ARG B 1 314 ? 34.356 16.485 -0.100  1.00 22.03 ? 290 ARG B CB    1 
ATOM   4811 C  CG    . ARG B 1 314 ? 34.896 15.182 0.471   1.00 25.96 ? 290 ARG B CG    1 
ATOM   4812 C  CD    . ARG B 1 314 ? 33.811 14.119 0.567   1.00 26.88 ? 290 ARG B CD    1 
ATOM   4813 N  NE    . ARG B 1 314 ? 32.806 14.480 1.565   1.00 29.54 ? 290 ARG B NE    1 
ATOM   4814 C  CZ    . ARG B 1 314 ? 32.960 14.312 2.874   1.00 31.93 ? 290 ARG B CZ    1 
ATOM   4815 N  NH1   . ARG B 1 314 ? 31.992 14.670 3.709   1.00 35.69 ? 290 ARG B NH1   1 
ATOM   4816 N  NH2   . ARG B 1 314 ? 34.078 13.778 3.347   1.00 32.54 ? 290 ARG B NH2   1 
ATOM   4817 N  N     . SER B 1 315 ? 32.102 18.050 -1.643  1.00 21.62 ? 291 SER B N     1 
ATOM   4818 C  CA    . SER B 1 315 ? 31.512 19.346 -1.966  1.00 21.46 ? 291 SER B CA    1 
ATOM   4819 C  C     . SER B 1 315 ? 32.353 20.494 -1.385  1.00 19.54 ? 291 SER B C     1 
ATOM   4820 O  O     . SER B 1 315 ? 33.026 20.330 -0.363  1.00 19.51 ? 291 SER B O     1 
ATOM   4821 C  CB    . SER B 1 315 ? 30.084 19.436 -1.411  1.00 20.63 ? 291 SER B CB    1 
ATOM   4822 O  OG    . SER B 1 315 ? 30.113 19.572 0.003   1.00 22.70 ? 291 SER B OG    1 
ATOM   4823 N  N     . LEU B 1 316 ? 32.313 21.659 -2.026  1.00 20.91 ? 292 LEU B N     1 
ATOM   4824 C  CA    . LEU B 1 316 ? 33.041 22.822 -1.512  1.00 19.79 ? 292 LEU B CA    1 
ATOM   4825 C  C     . LEU B 1 316 ? 32.687 23.151 -0.063  1.00 19.22 ? 292 LEU B C     1 
ATOM   4826 O  O     . LEU B 1 316 ? 33.568 23.487 0.728   1.00 20.32 ? 292 LEU B O     1 
ATOM   4827 C  CB    . LEU B 1 316 ? 32.855 24.032 -2.426  1.00 20.93 ? 292 LEU B CB    1 
ATOM   4828 C  CG    . LEU B 1 316 ? 33.486 23.902 -3.822  1.00 25.63 ? 292 LEU B CG    1 
ATOM   4829 C  CD1   . LEU B 1 316 ? 33.133 25.108 -4.670  1.00 26.60 ? 292 LEU B CD1   1 
ATOM   4830 C  CD2   . LEU B 1 316 ? 34.997 23.722 -3.757  1.00 27.04 ? 292 LEU B CD2   1 
ATOM   4831 N  N     . GLU B 1 317 ? 31.402 23.028 0.293   1.00 19.04 ? 293 GLU B N     1 
ATOM   4832 C  CA    . GLU B 1 317 ? 31.013 23.238 1.683   1.00 18.65 ? 293 GLU B CA    1 
ATOM   4833 C  C     . GLU B 1 317 ? 31.673 22.234 2.631   1.00 17.51 ? 293 GLU B C     1 
ATOM   4834 O  O     . GLU B 1 317 ? 32.132 22.614 3.714   1.00 19.40 ? 293 GLU B O     1 
ATOM   4835 C  CB    . GLU B 1 317 ? 29.491 23.211 1.880   1.00 22.46 ? 293 GLU B CB    1 
ATOM   4836 C  CG    . GLU B 1 317 ? 29.089 23.645 3.283   1.00 24.30 ? 293 GLU B CG    1 
ATOM   4837 C  CD    . GLU B 1 317 ? 27.645 23.320 3.629   1.00 27.85 ? 293 GLU B CD    1 
ATOM   4838 O  OE1   . GLU B 1 317 ? 27.281 22.130 3.640   1.00 31.68 ? 293 GLU B OE1   1 
ATOM   4839 O  OE2   . GLU B 1 317 ? 26.872 24.255 3.901   1.00 31.73 ? 293 GLU B OE2   1 
ATOM   4840 N  N     . ASP B 1 318 ? 31.710 20.960 2.238   1.00 18.59 ? 294 ASP B N     1 
ATOM   4841 C  CA    . ASP B 1 318 ? 32.311 19.948 3.094   1.00 18.54 ? 294 ASP B CA    1 
ATOM   4842 C  C     . ASP B 1 318 ? 33.831 20.114 3.202   1.00 16.50 ? 294 ASP B C     1 
ATOM   4843 O  O     . ASP B 1 318 ? 34.425 19.804 4.229   1.00 17.71 ? 294 ASP B O     1 
ATOM   4844 C  CB    . ASP B 1 318 ? 31.978 18.540 2.604   1.00 21.02 ? 294 ASP B CB    1 
ATOM   4845 C  CG    . ASP B 1 318 ? 30.600 18.078 3.042   1.00 23.11 ? 294 ASP B CG    1 
ATOM   4846 O  OD1   . ASP B 1 318 ? 29.963 18.763 3.874   1.00 24.40 ? 294 ASP B OD1   1 
ATOM   4847 O  OD2   . ASP B 1 318 ? 30.165 17.011 2.574   1.00 28.37 ? 294 ASP B OD2   1 
ATOM   4848 N  N     . CYS B 1 319 ? 34.447 20.613 2.129   1.00 16.26 ? 295 CYS B N     1 
ATOM   4849 C  CA    . CYS B 1 319 ? 35.870 20.971 2.178   1.00 16.64 ? 295 CYS B CA    1 
ATOM   4850 C  C     . CYS B 1 319 ? 36.094 22.073 3.215   1.00 15.93 ? 295 CYS B C     1 
ATOM   4851 O  O     . CYS B 1 319 ? 37.018 21.998 4.012   1.00 17.38 ? 295 CYS B O     1 
ATOM   4852 C  CB    . CYS B 1 319 ? 36.351 21.440 0.807   1.00 17.90 ? 295 CYS B CB    1 
ATOM   4853 S  SG    . CYS B 1 319 ? 36.339 20.194 -0.492  1.00 20.45 ? 295 CYS B SG    1 
ATOM   4854 N  N     . GLY B 1 320 ? 35.243 23.100 3.185   1.00 16.22 ? 296 GLY B N     1 
ATOM   4855 C  CA    . GLY B 1 320 ? 35.270 24.145 4.188   1.00 16.12 ? 296 GLY B CA    1 
ATOM   4856 C  C     . GLY B 1 320 ? 35.052 23.599 5.593   1.00 16.55 ? 296 GLY B C     1 
ATOM   4857 O  O     . GLY B 1 320 ? 35.725 24.009 6.538   1.00 16.78 ? 296 GLY B O     1 
ATOM   4858 N  N     . LYS B 1 321 ? 34.090 22.682 5.747   1.00 16.42 ? 297 LYS B N     1 
ATOM   4859 C  CA    . LYS B 1 321 ? 33.890 22.079 7.065   1.00 17.92 ? 297 LYS B CA    1 
ATOM   4860 C  C     . LYS B 1 321 ? 35.126 21.341 7.600   1.00 16.45 ? 297 LYS B C     1 
ATOM   4861 O  O     . LYS B 1 321 ? 35.492 21.473 8.772   1.00 17.88 ? 297 LYS B O     1 
ATOM   4862 C  CB    . LYS B 1 321 ? 32.689 21.134 7.052   1.00 19.40 ? 297 LYS B CB    1 
ATOM   4863 C  CG    . LYS B 1 321 ? 31.331 21.791 6.924   1.00 21.58 ? 297 LYS B CG    1 
ATOM   4864 C  CD    . LYS B 1 321 ? 30.276 20.711 7.089   1.00 26.38 ? 297 LYS B CD    1 
ATOM   4865 C  CE    . LYS B 1 321 ? 28.893 21.201 6.728   1.00 30.95 ? 297 LYS B CE    1 
ATOM   4866 N  NZ    . LYS B 1 321 ? 27.884 20.163 7.041   1.00 39.99 ? 297 LYS B NZ    1 
ATOM   4867 N  N     . LEU B 1 322 ? 35.743 20.543 6.731   1.00 16.17 ? 298 LEU B N     1 
ATOM   4868 C  CA    . LEU B 1 322 ? 36.954 19.823 7.109   1.00 16.96 ? 298 LEU B CA    1 
ATOM   4869 C  C     . LEU B 1 322 ? 38.082 20.801 7.478   1.00 15.15 ? 298 LEU B C     1 
ATOM   4870 O  O     . LEU B 1 322 ? 38.798 20.587 8.451   1.00 15.96 ? 298 LEU B O     1 
ATOM   4871 C  CB    . LEU B 1 322 ? 37.399 18.871 5.996   1.00 17.60 ? 298 LEU B CB    1 
ATOM   4872 C  CG    . LEU B 1 322 ? 36.627 17.558 5.824   1.00 17.48 ? 298 LEU B CG    1 
ATOM   4873 C  CD1   . LEU B 1 322 ? 36.718 17.049 4.394   1.00 18.51 ? 298 LEU B CD1   1 
ATOM   4874 C  CD2   . LEU B 1 322 ? 37.106 16.507 6.806   1.00 18.02 ? 298 LEU B CD2   1 
ATOM   4875 N  N     . GLY B 1 323 ? 38.219 21.881 6.714   1.00 15.62 ? 299 GLY B N     1 
ATOM   4876 C  CA    . GLY B 1 323 ? 39.196 22.925 7.023   1.00 15.47 ? 299 GLY B CA    1 
ATOM   4877 C  C     . GLY B 1 323 ? 38.964 23.558 8.382   1.00 14.36 ? 299 GLY B C     1 
ATOM   4878 O  O     . GLY B 1 323 ? 39.886 23.683 9.178   1.00 15.59 ? 299 GLY B O     1 
ATOM   4879 N  N     . CYS B 1 324 ? 37.709 23.919 8.668   1.00 15.31 ? 300 CYS B N     1 
ATOM   4880 C  CA    . CYS B 1 324 ? 37.409 24.501 9.981   1.00 15.38 ? 300 CYS B CA    1 
ATOM   4881 C  C     . CYS B 1 324 ? 37.643 23.541 11.148  1.00 14.52 ? 300 CYS B C     1 
ATOM   4882 O  O     . CYS B 1 324 ? 38.049 23.958 12.233  1.00 15.99 ? 300 CYS B O     1 
ATOM   4883 C  CB    . CYS B 1 324 ? 35.982 25.057 10.024  1.00 16.97 ? 300 CYS B CB    1 
ATOM   4884 S  SG    . CYS B 1 324 ? 35.765 26.572 9.067   1.00 21.92 ? 300 CYS B SG    1 
ATOM   4885 N  N     . LEU B 1 325 ? 37.379 22.258 10.917  1.00 14.46 ? 301 LEU B N     1 
ATOM   4886 C  CA    . LEU B 1 325 ? 37.582 21.247 11.948  1.00 16.48 ? 301 LEU B CA    1 
ATOM   4887 C  C     . LEU B 1 325 ? 39.075 21.176 12.296  1.00 16.59 ? 301 LEU B C     1 
ATOM   4888 O  O     . LEU B 1 325 ? 39.469 21.265 13.462  1.00 17.82 ? 301 LEU B O     1 
ATOM   4889 C  CB    . LEU B 1 325 ? 37.053 19.885 11.487  1.00 17.36 ? 301 LEU B CB    1 
ATOM   4890 C  CG    . LEU B 1 325 ? 37.344 18.715 12.433  1.00 20.91 ? 301 LEU B CG    1 
ATOM   4891 C  CD1   . LEU B 1 325 ? 36.606 18.883 13.755  1.00 25.22 ? 301 LEU B CD1   1 
ATOM   4892 C  CD2   . LEU B 1 325 ? 36.952 17.406 11.781  1.00 25.01 ? 301 LEU B CD2   1 
ATOM   4893 N  N     . ALA B 1 326 ? 39.905 21.063 11.266  1.00 16.27 ? 302 ALA B N     1 
ATOM   4894 C  CA    . ALA B 1 326 ? 41.345 20.959 11.469  1.00 16.90 ? 302 ALA B CA    1 
ATOM   4895 C  C     . ALA B 1 326 ? 41.961 22.216 12.119  1.00 15.88 ? 302 ALA B C     1 
ATOM   4896 O  O     . ALA B 1 326 ? 42.801 22.122 13.020  1.00 15.98 ? 302 ALA B O     1 
ATOM   4897 C  CB    . ALA B 1 326 ? 42.020 20.653 10.141  1.00 16.51 ? 302 ALA B CB    1 
ATOM   4898 N  N     . ALA B 1 327 ? 41.513 23.383 11.666  1.00 14.65 ? 303 ALA B N     1 
ATOM   4899 C  CA    . ALA B 1 327 ? 41.987 24.645 12.208  1.00 15.65 ? 303 ALA B CA    1 
ATOM   4900 C  C     . ALA B 1 327 ? 41.599 24.787 13.679  1.00 16.02 ? 303 ALA B C     1 
ATOM   4901 O  O     . ALA B 1 327 ? 42.404 25.213 14.498  1.00 17.50 ? 303 ALA B O     1 
ATOM   4902 C  CB    . ALA B 1 327 ? 41.444 25.806 11.393  1.00 19.03 ? 303 ALA B CB    1 
ATOM   4903 N  N     . GLY B 1 328 ? 40.341 24.452 13.989  1.00 15.36 ? 304 GLY B N     1 
ATOM   4904 C  CA    . GLY B 1 328 ? 39.861 24.515 15.369  1.00 18.12 ? 304 GLY B CA    1 
ATOM   4905 C  C     . GLY B 1 328 ? 40.632 23.614 16.317  1.00 16.27 ? 304 GLY B C     1 
ATOM   4906 O  O     . GLY B 1 328 ? 40.857 23.966 17.479  1.00 18.94 ? 304 GLY B O     1 
ATOM   4907 N  N     . ILE B 1 329 ? 41.037 22.442 15.827  1.00 16.13 ? 305 ILE B N     1 
ATOM   4908 C  CA    . ILE B 1 329 ? 41.861 21.533 16.623  1.00 16.47 ? 305 ILE B CA    1 
ATOM   4909 C  C     . ILE B 1 329 ? 43.266 22.097 16.878  1.00 17.04 ? 305 ILE B C     1 
ATOM   4910 O  O     . ILE B 1 329 ? 43.736 22.093 18.014  1.00 19.04 ? 305 ILE B O     1 
ATOM   4911 C  CB    . ILE B 1 329 ? 41.902 20.124 15.984  1.00 17.83 ? 305 ILE B CB    1 
ATOM   4912 C  CG1   . ILE B 1 329 ? 40.525 19.478 16.104  1.00 18.70 ? 305 ILE B CG1   1 
ATOM   4913 C  CG2   . ILE B 1 329 ? 42.989 19.249 16.605  1.00 18.83 ? 305 ILE B CG2   1 
ATOM   4914 C  CD1   . ILE B 1 329 ? 40.320 18.314 15.169  1.00 19.24 ? 305 ILE B CD1   1 
ATOM   4915 N  N     . VAL B 1 330 ? 43.919 22.618 15.837  1.00 17.04 ? 306 VAL B N     1 
ATOM   4916 C  CA    . VAL B 1 330 ? 45.304 23.071 16.003  1.00 17.72 ? 306 VAL B CA    1 
ATOM   4917 C  C     . VAL B 1 330 ? 45.440 24.281 16.943  1.00 18.25 ? 306 VAL B C     1 
ATOM   4918 O  O     . VAL B 1 330 ? 46.459 24.430 17.613  1.00 21.02 ? 306 VAL B O     1 
ATOM   4919 C  CB    . VAL B 1 330 ? 46.025 23.275 14.651  1.00 17.04 ? 306 VAL B CB    1 
ATOM   4920 C  CG1   . VAL B 1 330 ? 45.689 24.613 14.022  1.00 18.34 ? 306 VAL B CG1   1 
ATOM   4921 C  CG2   . VAL B 1 330 ? 47.528 23.116 14.841  1.00 16.85 ? 306 VAL B CG2   1 
ATOM   4922 N  N     . ILE B 1 331 ? 44.406 25.124 17.024  1.00 18.05 ? 307 ILE B N     1 
ATOM   4923 C  CA    . ILE B 1 331 ? 44.499 26.326 17.869  1.00 18.60 ? 307 ILE B CA    1 
ATOM   4924 C  C     . ILE B 1 331 ? 44.272 26.050 19.354  1.00 17.98 ? 307 ILE B C     1 
ATOM   4925 O  O     . ILE B 1 331 ? 44.482 26.925 20.194  1.00 21.10 ? 307 ILE B O     1 
ATOM   4926 C  CB    . ILE B 1 331 ? 43.610 27.489 17.367  1.00 20.31 ? 307 ILE B CB    1 
ATOM   4927 C  CG1   . ILE B 1 331 ? 42.122 27.203 17.595  1.00 19.66 ? 307 ILE B CG1   1 
ATOM   4928 C  CG2   . ILE B 1 331 ? 43.908 27.768 15.901  1.00 21.00 ? 307 ILE B CG2   1 
ATOM   4929 C  CD1   . ILE B 1 331 ? 41.208 28.348 17.186  1.00 24.02 ? 307 ILE B CD1   1 
ATOM   4930 N  N     . GLN B 1 332 ? 43.850 24.823 19.659  1.00 19.35 ? 308 GLN B N     1 
ATOM   4931 C  CA    . GLN B 1 332 ? 43.667 24.388 21.051  1.00 20.77 ? 308 GLN B CA    1 
ATOM   4932 C  C     . GLN B 1 332 ? 44.891 23.678 21.636  1.00 21.77 ? 308 GLN B C     1 
ATOM   4933 O  O     . GLN B 1 332 ? 44.820 23.115 22.721  1.00 23.74 ? 308 GLN B O     1 
ATOM   4934 C  CB    . GLN B 1 332 ? 42.414 23.515 21.186  1.00 23.72 ? 308 GLN B CB    1 
ATOM   4935 C  CG    . GLN B 1 332 ? 41.133 24.225 20.787  1.00 26.55 ? 308 GLN B CG    1 
ATOM   4936 C  CD    . GLN B 1 332 ? 39.911 23.342 20.924  1.00 30.36 ? 308 GLN B CD    1 
ATOM   4937 O  OE1   . GLN B 1 332 ? 39.411 23.121 22.029  1.00 36.55 ? 308 GLN B OE1   1 
ATOM   4938 N  NE2   . GLN B 1 332 ? 39.418 22.836 19.801  1.00 30.35 ? 308 GLN B NE2   1 
ATOM   4939 N  N     . GLN B 1 333 ? 46.014 23.723 20.912  1.00 20.70 ? 309 GLN B N     1 
ATOM   4940 C  CA    . GLN B 1 333 ? 47.276 23.156 21.370  1.00 19.26 ? 309 GLN B CA    1 
ATOM   4941 C  C     . GLN B 1 333 ? 48.424 24.118 21.094  1.00 22.05 ? 309 GLN B C     1 
ATOM   4942 O  O     . GLN B 1 333 ? 48.299 25.026 20.263  1.00 21.75 ? 309 GLN B O     1 
ATOM   4943 C  CB    . GLN B 1 333 ? 47.544 21.804 20.701  1.00 20.37 ? 309 GLN B CB    1 
ATOM   4944 C  CG    . GLN B 1 333 ? 47.580 21.868 19.181  1.00 21.01 ? 309 GLN B CG    1 
ATOM   4945 C  CD    . GLN B 1 333 ? 48.348 20.726 18.562  1.00 23.09 ? 309 GLN B CD    1 
ATOM   4946 O  OE1   . GLN B 1 333 ? 47.975 19.557 18.700  1.00 24.30 ? 309 GLN B OE1   1 
ATOM   4947 N  NE2   . GLN B 1 333 ? 49.439 21.059 17.863  1.00 24.54 ? 309 GLN B NE2   1 
ATOM   4948 N  N     . ILE B 1 334 ? 49.530 23.922 21.798  1.00 23.53 ? 310 ILE B N     1 
ATOM   4949 C  CA    . ILE B 1 334 ? 50.768 24.640 21.511  1.00 22.75 ? 310 ILE B CA    1 
ATOM   4950 C  C     . ILE B 1 334 ? 51.456 23.960 20.324  1.00 25.10 ? 310 ILE B C     1 
ATOM   4951 O  O     . ILE B 1 334 ? 51.552 22.735 20.276  1.00 25.26 ? 310 ILE B O     1 
ATOM   4952 C  CB    . ILE B 1 334 ? 51.712 24.662 22.731  1.00 27.16 ? 310 ILE B CB    1 
ATOM   4953 C  CG1   . ILE B 1 334 ? 51.048 25.403 23.898  1.00 31.54 ? 310 ILE B CG1   1 
ATOM   4954 C  CG2   . ILE B 1 334 ? 53.056 25.288 22.362  1.00 29.69 ? 310 ILE B CG2   1 
ATOM   4955 C  CD1   . ILE B 1 334 ? 51.715 25.180 25.240  1.00 34.75 ? 310 ILE B CD1   1 
ATOM   4956 N  N     . GLY B 1 335 ? 51.903 24.755 19.358  1.00 25.57 ? 311 GLY B N     1 
ATOM   4957 C  CA    . GLY B 1 335 ? 52.634 24.217 18.218  1.00 25.07 ? 311 GLY B CA    1 
ATOM   4958 C  C     . GLY B 1 335 ? 51.776 24.040 16.981  1.00 22.33 ? 311 GLY B C     1 
ATOM   4959 O  O     . GLY B 1 335 ? 50.546 23.919 17.069  1.00 20.61 ? 311 GLY B O     1 
ATOM   4960 N  N     . PRO B 1 336 ? 52.412 24.021 15.805  1.00 20.61 ? 312 PRO B N     1 
ATOM   4961 C  CA    . PRO B 1 336 ? 51.690 24.188 14.546  1.00 18.88 ? 312 PRO B CA    1 
ATOM   4962 C  C     . PRO B 1 336 ? 51.096 22.945 13.895  1.00 17.72 ? 312 PRO B C     1 
ATOM   4963 O  O     . PRO B 1 336 ? 50.349 23.080 12.922  1.00 19.98 ? 312 PRO B O     1 
ATOM   4964 C  CB    . PRO B 1 336 ? 52.768 24.764 13.627  1.00 20.18 ? 312 PRO B CB    1 
ATOM   4965 C  CG    . PRO B 1 336 ? 54.021 24.152 14.116  1.00 21.11 ? 312 PRO B CG    1 
ATOM   4966 C  CD    . PRO B 1 336 ? 53.872 24.008 15.606  1.00 20.52 ? 312 PRO B CD    1 
ATOM   4967 N  N     . ARG B 1 337 ? 51.448 21.757 14.379  1.00 16.62 ? 313 ARG B N     1 
ATOM   4968 C  CA    . ARG B 1 337 ? 50.978 20.528 13.757  1.00 18.62 ? 313 ARG B CA    1 
ATOM   4969 C  C     . ARG B 1 337 ? 50.208 19.697 14.773  1.00 19.24 ? 313 ARG B C     1 
ATOM   4970 O  O     . ARG B 1 337 ? 50.741 19.385 15.832  1.00 20.03 ? 313 ARG B O     1 
ATOM   4971 C  CB    . ARG B 1 337 ? 52.152 19.746 13.171  1.00 18.66 ? 313 ARG B CB    1 
ATOM   4972 C  CG    . ARG B 1 337 ? 52.863 20.478 12.044  1.00 16.90 ? 313 ARG B CG    1 
ATOM   4973 C  CD    . ARG B 1 337 ? 53.969 19.643 11.444  1.00 16.12 ? 313 ARG B CD    1 
ATOM   4974 N  NE    . ARG B 1 337 ? 54.809 20.432 10.546  1.00 15.47 ? 313 ARG B NE    1 
ATOM   4975 C  CZ    . ARG B 1 337 ? 55.891 19.949 9.943   1.00 15.43 ? 313 ARG B CZ    1 
ATOM   4976 N  NH1   . ARG B 1 337 ? 56.250 18.684 10.135  1.00 15.92 ? 313 ARG B NH1   1 
ATOM   4977 N  NH2   . ARG B 1 337 ? 56.613 20.741 9.158   1.00 17.94 ? 313 ARG B NH2   1 
ATOM   4978 N  N     . PRO B 1 338 ? 48.931 19.374 14.465  1.00 19.07 ? 314 PRO B N     1 
ATOM   4979 C  CA    . PRO B 1 338 ? 48.105 18.665 15.440  1.00 20.03 ? 314 PRO B CA    1 
ATOM   4980 C  C     . PRO B 1 338 ? 48.761 17.391 15.951  1.00 19.13 ? 314 PRO B C     1 
ATOM   4981 O  O     . PRO B 1 338 ? 49.231 16.566 15.159  1.00 21.80 ? 314 PRO B O     1 
ATOM   4982 C  CB    . PRO B 1 338 ? 46.854 18.321 14.639  1.00 19.99 ? 314 PRO B CB    1 
ATOM   4983 C  CG    . PRO B 1 338 ? 46.735 19.441 13.674  1.00 19.14 ? 314 PRO B CG    1 
ATOM   4984 C  CD    . PRO B 1 338 ? 48.157 19.743 13.264  1.00 18.64 ? 314 PRO B CD    1 
HETATM 4985 N  N     . MSE B 1 339 ? 48.789 17.246 17.273  1.00 21.08 ? 315 MSE B N     1 
HETATM 4986 C  CA    . MSE B 1 339 ? 49.356 16.063 17.939  1.00 23.39 ? 315 MSE B CA    1 
HETATM 4987 C  C     . MSE B 1 339 ? 48.358 14.933 18.072  1.00 24.64 ? 315 MSE B C     1 
HETATM 4988 O  O     . MSE B 1 339 ? 48.723 13.823 18.471  1.00 30.01 ? 315 MSE B O     1 
HETATM 4989 C  CB    . MSE B 1 339 ? 49.921 16.476 19.302  1.00 29.57 ? 315 MSE B CB    1 
HETATM 4990 C  CG    . MSE B 1 339 ? 51.145 17.363 19.090  1.00 35.21 ? 315 MSE B CG    1 
HETATM 4991 SE SE    . MSE B 1 339 ? 51.807 18.023 20.822  1.00 58.08 ? 315 MSE B SE    1 
HETATM 4992 C  CE    . MSE B 1 339 ? 50.531 19.493 21.126  1.00 40.36 ? 315 MSE B CE    1 
ATOM   4993 N  N     . THR B 1 340 ? 47.098 15.216 17.746  1.00 23.02 ? 316 THR B N     1 
ATOM   4994 C  CA    . THR B 1 340 ? 46.008 14.235 17.781  1.00 21.69 ? 316 THR B CA    1 
ATOM   4995 C  C     . THR B 1 340 ? 45.604 13.800 16.374  1.00 23.56 ? 316 THR B C     1 
ATOM   4996 O  O     . THR B 1 340 ? 46.039 14.394 15.380  1.00 24.67 ? 316 THR B O     1 
ATOM   4997 C  CB    . THR B 1 340 ? 44.758 14.807 18.481  1.00 24.24 ? 316 THR B CB    1 
ATOM   4998 O  OG1   . THR B 1 340 ? 44.460 16.099 17.936  1.00 26.97 ? 316 THR B OG1   1 
ATOM   4999 C  CG2   . THR B 1 340 ? 44.973 14.914 19.989  1.00 28.15 ? 316 THR B CG2   1 
ATOM   5000 N  N     . SER B 1 341 ? 44.755 12.780 16.290  1.00 22.67 ? 317 SER B N     1 
ATOM   5001 C  CA    . SER B 1 341 ? 44.335 12.255 15.000  1.00 20.04 ? 317 SER B CA    1 
ATOM   5002 C  C     . SER B 1 341 ? 43.226 13.096 14.387  1.00 21.11 ? 317 SER B C     1 
ATOM   5003 O  O     . SER B 1 341 ? 42.103 13.162 14.918  1.00 20.89 ? 317 SER B O     1 
ATOM   5004 C  CB    . SER B 1 341 ? 43.875 10.802 15.118  1.00 22.15 ? 317 SER B CB    1 
ATOM   5005 O  OG    . SER B 1 341 ? 43.358 10.352 13.881  1.00 22.43 ? 317 SER B OG    1 
ATOM   5006 N  N     . LEU B 1 342 ? 43.543 13.746 13.271  1.00 20.14 ? 318 LEU B N     1 
ATOM   5007 C  CA    . LEU B 1 342 ? 42.547 14.491 12.503  1.00 20.74 ? 318 LEU B CA    1 
ATOM   5008 C  C     . LEU B 1 342 ? 41.515 13.578 11.852  1.00 19.35 ? 318 LEU B C     1 
ATOM   5009 O  O     . LEU B 1 342 ? 40.331 13.945 11.764  1.00 19.32 ? 318 LEU B O     1 
ATOM   5010 C  CB    . LEU B 1 342 ? 43.219 15.363 11.442  1.00 19.51 ? 318 LEU B CB    1 
ATOM   5011 C  CG    . LEU B 1 342 ? 44.079 16.492 11.986  1.00 18.15 ? 318 LEU B CG    1 
ATOM   5012 C  CD1   . LEU B 1 342 ? 44.653 17.267 10.822  1.00 18.63 ? 318 LEU B CD1   1 
ATOM   5013 C  CD2   . LEU B 1 342 ? 43.264 17.420 12.872  1.00 17.64 ? 318 LEU B CD2   1 
ATOM   5014 N  N     . SER B 1 343 ? 41.955 12.407 11.378  1.00 19.96 ? 319 SER B N     1 
ATOM   5015 C  CA    . SER B 1 343 ? 41.042 11.441 10.763  1.00 21.56 ? 319 SER B CA    1 
ATOM   5016 C  C     . SER B 1 343 ? 40.000 10.958 11.777  1.00 21.44 ? 319 SER B C     1 
ATOM   5017 O  O     . SER B 1 343 ? 38.813 10.899 11.449  1.00 22.77 ? 319 SER B O     1 
ATOM   5018 C  CB    . SER B 1 343 ? 41.800 10.264 10.139  1.00 22.63 ? 319 SER B CB    1 
ATOM   5019 O  OG    . SER B 1 343 ? 42.596 9.606  11.101  1.00 26.78 ? 319 SER B OG    1 
ATOM   5020 N  N     . GLU B 1 344 ? 40.436 10.651 13.003  1.00 20.52 ? 320 GLU B N     1 
ATOM   5021 C  CA    . GLU B 1 344 ? 39.485 10.281 14.073  1.00 23.04 ? 320 GLU B CA    1 
ATOM   5022 C  C     . GLU B 1 344 ? 38.497 11.400 14.378  1.00 21.59 ? 320 GLU B C     1 
ATOM   5023 O  O     . GLU B 1 344 ? 37.292 11.157 14.526  1.00 22.78 ? 320 GLU B O     1 
ATOM   5024 C  CB    . GLU B 1 344 ? 40.196 9.845  15.365  1.00 21.26 ? 320 GLU B CB    1 
ATOM   5025 C  CG    . GLU B 1 344 ? 40.905 8.490  15.290  1.00 27.17 ? 320 GLU B CG    1 
ATOM   5026 C  CD    . GLU B 1 344 ? 39.976 7.337  14.932  1.00 37.57 ? 320 GLU B CD    1 
ATOM   5027 O  OE1   . GLU B 1 344 ? 38.870 7.238  15.510  1.00 41.20 ? 320 GLU B OE1   1 
ATOM   5028 O  OE2   . GLU B 1 344 ? 40.356 6.517  14.071  1.00 47.34 ? 320 GLU B OE2   1 
ATOM   5029 N  N     . ALA B 1 345 ? 39.005 12.627 14.457  1.00 19.74 ? 321 ALA B N     1 
ATOM   5030 C  CA    . ALA B 1 345 ? 38.154 13.781 14.723  1.00 20.67 ? 321 ALA B CA    1 
ATOM   5031 C  C     . ALA B 1 345 ? 37.126 13.953 13.595  1.00 20.26 ? 321 ALA B C     1 
ATOM   5032 O  O     . ALA B 1 345 ? 35.935 14.195 13.849  1.00 19.95 ? 321 ALA B O     1 
ATOM   5033 C  CB    . ALA B 1 345 ? 39.000 15.034 14.881  1.00 21.46 ? 321 ALA B CB    1 
ATOM   5034 N  N     . ALA B 1 346 ? 37.574 13.820 12.344  1.00 18.79 ? 322 ALA B N     1 
ATOM   5035 C  CA    . ALA B 1 346 ? 36.677 13.950 11.194  1.00 19.86 ? 322 ALA B CA    1 
ATOM   5036 C  C     . ALA B 1 346 ? 35.583 12.875 11.191  1.00 20.43 ? 322 ALA B C     1 
ATOM   5037 O  O     . ALA B 1 346 ? 34.431 13.157 10.838  1.00 25.15 ? 322 ALA B O     1 
ATOM   5038 C  CB    . ALA B 1 346 ? 37.457 13.926 9.890   1.00 21.49 ? 322 ALA B CB    1 
ATOM   5039 N  N     . LYS B 1 347 ? 35.953 11.653 11.584  1.00 21.34 ? 323 LYS B N     1 
ATOM   5040 C  CA    . LYS B 1 347 ? 35.005 10.546 11.702  1.00 22.95 ? 323 LYS B CA    1 
ATOM   5041 C  C     . LYS B 1 347 ? 33.948 10.838 12.771  1.00 21.57 ? 323 LYS B C     1 
ATOM   5042 O  O     . LYS B 1 347 ? 32.744 10.658 12.519  1.00 24.39 ? 323 LYS B O     1 
ATOM   5043 C  CB    . LYS B 1 347 ? 35.740 9.233  11.989  1.00 23.29 ? 323 LYS B CB    1 
ATOM   5044 C  CG    . LYS B 1 347 ? 36.591 8.737  10.826  1.00 27.07 ? 323 LYS B CG    1 
ATOM   5045 C  CD    . LYS B 1 347 ? 37.284 7.428  11.167  1.00 32.95 ? 323 LYS B CD    1 
ATOM   5046 C  CE    . LYS B 1 347 ? 38.319 7.041  10.113  1.00 39.25 ? 323 LYS B CE    1 
ATOM   5047 N  NZ    . LYS B 1 347 ? 38.990 5.744  10.403  1.00 55.20 ? 323 LYS B NZ    1 
ATOM   5048 N  N     . GLN B 1 348 ? 34.392 11.318 13.937  1.00 20.75 ? 324 GLN B N     1 
ATOM   5049 C  CA    . GLN B 1 348 ? 33.466 11.684 15.019  1.00 22.89 ? 324 GLN B CA    1 
ATOM   5050 C  C     . GLN B 1 348 ? 32.497 12.779 14.558  1.00 22.59 ? 324 GLN B C     1 
ATOM   5051 O  O     . GLN B 1 348 ? 31.311 12.787 14.945  1.00 23.89 ? 324 GLN B O     1 
ATOM   5052 C  CB    . GLN B 1 348 ? 34.230 12.109 16.281  1.00 23.16 ? 324 GLN B CB    1 
ATOM   5053 C  CG    . GLN B 1 348 ? 33.350 12.484 17.475  1.00 25.30 ? 324 GLN B CG    1 
ATOM   5054 C  CD    . GLN B 1 348 ? 34.134 13.034 18.658  1.00 27.98 ? 324 GLN B CD    1 
ATOM   5055 O  OE1   . GLN B 1 348 ? 34.084 12.482 19.759  1.00 35.73 ? 324 GLN B OE1   1 
ATOM   5056 N  NE2   . GLN B 1 348 ? 34.854 14.127 18.439  1.00 32.90 ? 324 GLN B NE2   1 
ATOM   5057 N  N     . ALA B 1 349 ? 33.006 13.675 13.710  1.00 22.67 ? 325 ALA B N     1 
ATOM   5058 C  CA    . ALA B 1 349 ? 32.251 14.820 13.177  1.00 24.55 ? 325 ALA B CA    1 
ATOM   5059 C  C     . ALA B 1 349 ? 31.334 14.466 11.998  1.00 24.00 ? 325 ALA B C     1 
ATOM   5060 O  O     . ALA B 1 349 ? 30.649 15.337 11.446  1.00 27.57 ? 325 ALA B O     1 
ATOM   5061 C  CB    . ALA B 1 349 ? 33.215 15.931 12.779  1.00 24.42 ? 325 ALA B CB    1 
ATOM   5062 N  N     . GLY B 1 350 ? 31.330 13.194 11.608  1.00 24.93 ? 326 GLY B N     1 
ATOM   5063 C  CA    . GLY B 1 350 ? 30.547 12.727 10.465  1.00 27.33 ? 326 GLY B CA    1 
ATOM   5064 C  C     . GLY B 1 350 ? 31.014 13.286 9.132   1.00 29.20 ? 326 GLY B C     1 
ATOM   5065 O  O     . GLY B 1 350 ? 30.255 13.304 8.162   1.00 33.88 ? 326 GLY B O     1 
ATOM   5066 N  N     . LEU B 1 351 ? 32.261 13.758 9.090   1.00 29.60 ? 327 LEU B N     1 
ATOM   5067 C  CA    . LEU B 1 351 ? 32.841 14.270 7.855   1.00 30.38 ? 327 LEU B CA    1 
ATOM   5068 C  C     . LEU B 1 351 ? 33.612 13.146 7.179   1.00 35.48 ? 327 LEU B C     1 
ATOM   5069 O  O     . LEU B 1 351 ? 33.791 13.151 5.962   1.00 39.43 ? 327 LEU B O     1 
ATOM   5070 C  CB    . LEU B 1 351 ? 33.740 15.489 8.126   1.00 27.18 ? 327 LEU B CB    1 
ATOM   5071 C  CG    . LEU B 1 351 ? 33.076 16.749 8.716   1.00 26.95 ? 327 LEU B CG    1 
ATOM   5072 C  CD1   . LEU B 1 351 ? 34.106 17.836 9.006   1.00 24.17 ? 327 LEU B CD1   1 
ATOM   5073 C  CD2   . LEU B 1 351 ? 31.985 17.286 7.799   1.00 29.28 ? 327 LEU B CD2   1 
ATOM   5074 N  N     . ILE B 1 352 ? 34.047 12.189 8.002   1.00 38.77 ? 328 ILE B N     1 
ATOM   5075 C  CA    . ILE B 1 352 ? 34.670 10.924 7.589   1.00 43.58 ? 328 ILE B CA    1 
ATOM   5076 C  C     . ILE B 1 352 ? 35.862 11.109 6.652   1.00 45.32 ? 328 ILE B C     1 
ATOM   5077 O  O     . ILE B 1 352 ? 36.959 11.443 7.101   1.00 55.77 ? 328 ILE B O     1 
ATOM   5078 C  CB    . ILE B 1 352 ? 33.634 9.927  6.994   1.00 43.10 ? 328 ILE B CB    1 
ATOM   5079 C  CG1   . ILE B 1 352 ? 32.319 9.931  7.803   1.00 45.19 ? 328 ILE B CG1   1 
ATOM   5080 C  CG2   . ILE B 1 352 ? 34.217 8.523  6.879   1.00 41.56 ? 328 ILE B CG2   1 
ATOM   5081 C  CD1   . ILE B 1 352 ? 32.407 9.422  9.230   1.00 51.43 ? 328 ILE B CD1   1 
HETATM 5082 O  "O5'" . ADN C 2 .   ? 63.141 13.357 34.665  1.00 18.85 ? 401 ADN A "O5'" 1 
HETATM 5083 C  "C5'" . ADN C 2 .   ? 62.826 13.575 33.277  1.00 16.06 ? 401 ADN A "C5'" 1 
HETATM 5084 C  "C4'" . ADN C 2 .   ? 64.085 14.039 32.560  1.00 14.42 ? 401 ADN A "C4'" 1 
HETATM 5085 O  "O4'" . ADN C 2 .   ? 65.076 13.022 32.617  1.00 16.50 ? 401 ADN A "O4'" 1 
HETATM 5086 C  "C3'" . ADN C 2 .   ? 63.891 14.350 31.069  1.00 13.98 ? 401 ADN A "C3'" 1 
HETATM 5087 O  "O3'" . ADN C 2 .   ? 63.790 15.761 30.862  1.00 16.63 ? 401 ADN A "O3'" 1 
HETATM 5088 C  "C2'" . ADN C 2 .   ? 65.169 13.806 30.438  1.00 15.59 ? 401 ADN A "C2'" 1 
HETATM 5089 O  "O2'" . ADN C 2 .   ? 65.906 14.787 29.730  1.00 17.13 ? 401 ADN A "O2'" 1 
HETATM 5090 C  "C1'" . ADN C 2 .   ? 66.015 13.399 31.623  1.00 16.38 ? 401 ADN A "C1'" 1 
HETATM 5091 N  N9    . ADN C 2 .   ? 66.939 12.283 31.361  1.00 15.29 ? 401 ADN A N9    1 
HETATM 5092 C  C8    . ADN C 2 .   ? 66.783 11.227 30.547  1.00 16.16 ? 401 ADN A C8    1 
HETATM 5093 N  N7    . ADN C 2 .   ? 67.872 10.425 30.584  1.00 17.54 ? 401 ADN A N7    1 
HETATM 5094 C  C5    . ADN C 2 .   ? 68.727 10.975 31.463  1.00 17.27 ? 401 ADN A C5    1 
HETATM 5095 C  C6    . ADN C 2 .   ? 70.078 10.672 31.954  1.00 16.65 ? 401 ADN A C6    1 
HETATM 5096 N  N6    . ADN C 2 .   ? 70.710 9.550  31.563  1.00 16.83 ? 401 ADN A N6    1 
HETATM 5097 N  N1    . ADN C 2 .   ? 70.635 11.526 32.840  1.00 16.39 ? 401 ADN A N1    1 
HETATM 5098 C  C2    . ADN C 2 .   ? 70.005 12.651 33.258  1.00 14.84 ? 401 ADN A C2    1 
HETATM 5099 N  N3    . ADN C 2 .   ? 68.775 12.999 32.848  1.00 15.97 ? 401 ADN A N3    1 
HETATM 5100 C  C4    . ADN C 2 .   ? 68.118 12.217 31.955  1.00 16.42 ? 401 ADN A C4    1 
HETATM 5101 O  O13   . Q3C D 3 .   ? 67.210 -6.578 43.513  1.00 21.90 ? 402 Q3C A O13   1 
HETATM 5102 C  C11   . Q3C D 3 .   ? 66.047 -6.114 43.463  1.00 19.45 ? 402 Q3C A C11   1 
HETATM 5103 O  O12   . Q3C D 3 .   ? 65.221 -6.468 44.304  1.00 21.49 ? 402 Q3C A O12   1 
HETATM 5104 C  C7    . Q3C D 3 .   ? 65.645 -5.110 42.419  1.00 18.54 ? 402 Q3C A C7    1 
HETATM 5105 C  C3    . Q3C D 3 .   ? 66.484 -4.979 41.331  1.00 20.65 ? 402 Q3C A C3    1 
HETATM 5106 C  C9    . Q3C D 3 .   ? 64.481 -4.318 42.476  1.00 20.31 ? 402 Q3C A C9    1 
HETATM 5107 N  N5    . Q3C D 3 .   ? 64.184 -3.409 41.517  1.00 19.99 ? 402 Q3C A N5    1 
HETATM 5108 C  C2    . Q3C D 3 .   ? 65.004 -3.276 40.433  1.00 19.56 ? 402 Q3C A C2    1 
HETATM 5109 C  C6    . Q3C D 3 .   ? 64.693 -2.366 39.426  1.00 18.55 ? 402 Q3C A C6    1 
HETATM 5110 C  C10   . Q3C D 3 .   ? 65.571 -2.247 38.342  1.00 17.84 ? 402 Q3C A C10   1 
HETATM 5111 C  C8    . Q3C D 3 .   ? 66.713 -3.062 38.267  1.00 18.56 ? 402 Q3C A C8    1 
HETATM 5112 C  C4    . Q3C D 3 .   ? 67.021 -3.966 39.264  1.00 19.57 ? 402 Q3C A C4    1 
HETATM 5113 C  C1    . Q3C D 3 .   ? 66.156 -4.065 40.347  1.00 19.61 ? 402 Q3C A C1    1 
HETATM 5114 S  S     . DMS E 4 .   ? 68.629 10.516 17.442  1.00 28.17 ? 403 DMS A S     1 
HETATM 5115 O  O     . DMS E 4 .   ? 69.866 10.764 18.194  1.00 25.16 ? 403 DMS A O     1 
HETATM 5116 C  C1    . DMS E 4 .   ? 67.741 11.958 17.328  1.00 28.31 ? 403 DMS A C1    1 
HETATM 5117 C  C2    . DMS E 4 .   ? 69.008 10.258 15.798  1.00 32.70 ? 403 DMS A C2    1 
HETATM 5118 S  S     . DMS F 4 .   ? 74.033 11.155 17.348  1.00 45.90 ? 404 DMS A S     1 
HETATM 5119 O  O     . DMS F 4 .   ? 73.336 11.779 16.203  1.00 54.39 ? 404 DMS A O     1 
HETATM 5120 C  C1    . DMS F 4 .   ? 73.123 9.812  17.878  1.00 37.18 ? 404 DMS A C1    1 
HETATM 5121 C  C2    . DMS F 4 .   ? 75.437 10.359 16.787  1.00 44.76 ? 404 DMS A C2    1 
HETATM 5122 K  K     . K   G 5 .   ? 55.507 16.834 31.849  1.00 37.82 ? 405 K   A K     1 
HETATM 5123 O  "O5'" . ADN H 2 .   ? 51.424 29.428 10.021  1.00 16.02 ? 401 ADN B "O5'" 1 
HETATM 5124 C  "C5'" . ADN H 2 .   ? 52.294 29.076 11.100  1.00 14.34 ? 401 ADN B "C5'" 1 
HETATM 5125 C  "C4'" . ADN H 2 .   ? 53.665 28.672 10.574  1.00 14.01 ? 401 ADN B "C4'" 1 
HETATM 5126 O  "O4'" . ADN H 2 .   ? 54.222 29.726 9.778   1.00 15.09 ? 401 ADN B "O4'" 1 
HETATM 5127 C  "C3'" . ADN H 2 .   ? 54.699 28.390 11.661  1.00 13.84 ? 401 ADN B "C3'" 1 
HETATM 5128 O  "O3'" . ADN H 2 .   ? 54.773 26.987 11.897  1.00 14.80 ? 401 ADN B "O3'" 1 
HETATM 5129 C  "C2'" . ADN H 2 .   ? 56.009 28.923 11.059  1.00 14.21 ? 401 ADN B "C2'" 1 
HETATM 5130 O  "O2'" . ADN H 2 .   ? 57.056 27.970 10.919  1.00 16.62 ? 401 ADN B "O2'" 1 
HETATM 5131 C  "C1'" . ADN H 2 .   ? 55.584 29.339 9.667   1.00 14.54 ? 401 ADN B "C1'" 1 
HETATM 5132 N  N9    . ADN H 2 .   ? 56.395 30.451 9.124   1.00 13.72 ? 401 ADN B N9    1 
HETATM 5133 C  C8    . ADN H 2 .   ? 56.916 31.519 9.758   1.00 16.28 ? 401 ADN B C8    1 
HETATM 5134 N  N7    . ADN H 2 .   ? 57.557 32.340 8.893   1.00 15.72 ? 401 ADN B N7    1 
HETATM 5135 C  C5    . ADN H 2 .   ? 57.440 31.786 7.670   1.00 13.64 ? 401 ADN B C5    1 
HETATM 5136 C  C6    . ADN H 2 .   ? 57.888 32.117 6.307   1.00 14.40 ? 401 ADN B C6    1 
HETATM 5137 N  N6    . ADN H 2 .   ? 58.621 33.220 6.059   1.00 14.87 ? 401 ADN B N6    1 
HETATM 5138 N  N1    . ADN H 2 .   ? 57.562 31.252 5.335   1.00 14.30 ? 401 ADN B N1    1 
HETATM 5139 C  C2    . ADN H 2 .   ? 56.827 30.140 5.535   1.00 14.27 ? 401 ADN B C2    1 
HETATM 5140 N  N3    . ADN H 2 .   ? 56.393 29.764 6.748   1.00 12.59 ? 401 ADN B N3    1 
HETATM 5141 C  C4    . ADN H 2 .   ? 56.652 30.549 7.811   1.00 13.33 ? 401 ADN B C4    1 
HETATM 5142 O  O13   . Q3C I 3 .   ? 46.783 49.329 1.377   1.00 21.23 ? 402 Q3C B O13   1 
HETATM 5143 C  C11   . Q3C I 3 .   ? 46.088 48.837 2.296   1.00 19.33 ? 402 Q3C B C11   1 
HETATM 5144 O  O12   . Q3C I 3 .   ? 44.984 49.257 2.454   1.00 19.28 ? 402 Q3C B O12   1 
HETATM 5145 C  C7    . Q3C I 3 .   ? 46.618 47.798 3.236   1.00 18.80 ? 402 Q3C B C7    1 
HETATM 5146 C  C3    . Q3C I 3 .   ? 47.980 47.708 3.336   1.00 19.69 ? 402 Q3C B C3    1 
HETATM 5147 C  C9    . Q3C I 3 .   ? 45.829 46.937 4.015   1.00 18.61 ? 402 Q3C B C9    1 
HETATM 5148 N  N5    . Q3C I 3 .   ? 46.395 46.045 4.847   1.00 18.93 ? 402 Q3C B N5    1 
HETATM 5149 C  C2    . Q3C I 3 .   ? 47.739 45.945 4.941   1.00 18.22 ? 402 Q3C B C2    1 
HETATM 5150 C  C6    . Q3C I 3 .   ? 48.341 45.041 5.787   1.00 17.89 ? 402 Q3C B C6    1 
HETATM 5151 C  C10   . Q3C I 3 .   ? 49.715 44.980 5.850   1.00 17.29 ? 402 Q3C B C10   1 
HETATM 5152 C  C8    . Q3C I 3 .   ? 50.517 45.838 5.095   1.00 17.99 ? 402 Q3C B C8    1 
HETATM 5153 C  C4    . Q3C I 3 .   ? 49.920 46.743 4.255   1.00 18.27 ? 402 Q3C B C4    1 
HETATM 5154 C  C1    . Q3C I 3 .   ? 48.542 46.790 4.186   1.00 18.34 ? 402 Q3C B C1    1 
HETATM 5155 S  S     . DMS J 4 .   ? 68.347 32.246 16.731  1.00 31.31 ? 403 DMS B S     1 
HETATM 5156 O  O     . DMS J 4 .   ? 68.308 32.013 15.271  1.00 27.66 ? 403 DMS B O     1 
HETATM 5157 C  C1    . DMS J 4 .   ? 67.673 30.878 17.489  1.00 26.89 ? 403 DMS B C1    1 
HETATM 5158 C  C2    . DMS J 4 .   ? 69.967 32.136 17.242  1.00 38.67 ? 403 DMS B C2    1 
HETATM 5159 S  S     . DMS K 4 .   ? 71.924 31.737 12.715  1.00 52.22 ? 404 DMS B S     1 
HETATM 5160 O  O     . DMS K 4 .   ? 72.411 31.227 14.017  1.00 56.37 ? 404 DMS B O     1 
HETATM 5161 C  C1    . DMS K 4 .   ? 70.975 33.130 12.985  1.00 45.37 ? 404 DMS B C1    1 
HETATM 5162 C  C2    . DMS K 4 .   ? 73.230 32.415 11.846  1.00 51.84 ? 404 DMS B C2    1 
HETATM 5163 K  K     . K   L 5 .   ? 48.770 25.916 17.667  1.00 36.16 ? 405 K   B K     1 
HETATM 5164 O  O     . HOH M 6 .   ? 75.092 16.976 26.310  1.00 22.36 ? 501 HOH A O     1 
HETATM 5165 O  O     . HOH M 6 .   ? 55.939 5.389  28.202  1.00 22.48 ? 502 HOH A O     1 
HETATM 5166 O  O     . HOH M 6 .   ? 72.942 8.300  32.924  1.00 19.53 ? 503 HOH A O     1 
HETATM 5167 O  O     . HOH M 6 .   ? 80.736 9.116  36.757  1.00 25.65 ? 504 HOH A O     1 
HETATM 5168 O  O     . HOH M 6 .   ? 56.374 7.789  18.479  1.00 24.87 ? 505 HOH A O     1 
HETATM 5169 O  O     . HOH M 6 .   ? 68.393 23.743 29.302  1.00 21.77 ? 506 HOH A O     1 
HETATM 5170 O  O     . HOH M 6 .   ? 77.509 26.931 35.457  1.00 25.55 ? 507 HOH A O     1 
HETATM 5171 O  O     . HOH M 6 .   ? 70.648 17.362 33.936  1.00 19.84 ? 508 HOH A O     1 
HETATM 5172 O  O     . HOH M 6 .   ? 62.643 4.207  38.688  1.00 31.38 ? 509 HOH A O     1 
HETATM 5173 O  O     . HOH M 6 .   ? 77.332 23.807 47.802  1.00 27.98 ? 510 HOH A O     1 
HETATM 5174 O  O     . HOH M 6 .   ? 82.153 12.022 32.367  1.00 28.64 ? 511 HOH A O     1 
HETATM 5175 O  O     . HOH M 6 .   ? 63.721 23.780 24.113  1.00 20.20 ? 512 HOH A O     1 
HETATM 5176 O  O     . HOH M 6 .   ? 58.993 22.099 28.781  1.00 32.23 ? 513 HOH A O     1 
HETATM 5177 O  O     . HOH M 6 .   ? 57.831 0.233  15.929  1.00 25.87 ? 514 HOH A O     1 
HETATM 5178 O  O     . HOH M 6 .   ? 66.567 16.106 39.337  1.00 21.02 ? 515 HOH A O     1 
HETATM 5179 O  O     . HOH M 6 .   ? 49.730 4.208  24.952  1.00 30.54 ? 516 HOH A O     1 
HETATM 5180 O  O     . HOH M 6 .   ? 77.325 18.142 16.969  1.00 22.14 ? 517 HOH A O     1 
HETATM 5181 O  O     . HOH M 6 .   ? 67.470 -8.614 49.067  1.00 28.16 ? 518 HOH A O     1 
HETATM 5182 O  O     . HOH M 6 .   ? 68.548 3.404  34.012  1.00 22.48 ? 519 HOH A O     1 
HETATM 5183 O  O     . HOH M 6 .   ? 60.628 12.114 34.928  1.00 20.80 ? 520 HOH A O     1 
HETATM 5184 O  O     . HOH M 6 .   ? 50.525 5.563  17.138  1.00 57.51 ? 521 HOH A O     1 
HETATM 5185 O  O     . HOH M 6 .   ? 79.068 22.524 28.032  1.00 23.68 ? 522 HOH A O     1 
HETATM 5186 O  O     . HOH M 6 .   ? 66.027 1.504  24.223  1.00 28.44 ? 523 HOH A O     1 
HETATM 5187 O  O     . HOH M 6 .   ? 64.260 10.907 35.394  1.00 20.43 ? 524 HOH A O     1 
HETATM 5188 O  O     . HOH M 6 .   ? 74.634 6.869  25.606  1.00 25.81 ? 525 HOH A O     1 
HETATM 5189 O  O     . HOH M 6 .   ? 62.018 15.407 15.949  1.00 21.11 ? 526 HOH A O     1 
HETATM 5190 O  O     . HOH M 6 .   ? 61.990 22.535 28.577  1.00 22.37 ? 527 HOH A O     1 
HETATM 5191 O  O     . HOH M 6 .   ? 72.195 0.720  22.502  1.00 29.36 ? 528 HOH A O     1 
HETATM 5192 O  O     . HOH M 6 .   ? 67.466 12.109 38.291  1.00 23.13 ? 529 HOH A O     1 
HETATM 5193 O  O     . HOH M 6 .   ? 81.352 19.299 24.829  1.00 26.07 ? 530 HOH A O     1 
HETATM 5194 O  O     . HOH M 6 .   ? 81.522 17.675 22.545  1.00 27.96 ? 531 HOH A O     1 
HETATM 5195 O  O     . HOH M 6 .   ? 66.818 8.157  12.201  1.00 27.98 ? 532 HOH A O     1 
HETATM 5196 O  O     . HOH M 6 .   ? 77.581 5.446  20.388  1.00 37.42 ? 533 HOH A O     1 
HETATM 5197 O  O     . HOH M 6 .   ? 51.019 20.761 48.034  1.00 30.70 ? 534 HOH A O     1 
HETATM 5198 O  O     . HOH M 6 .   ? 75.846 24.553 14.397  1.00 39.43 ? 535 HOH A O     1 
HETATM 5199 O  O     . HOH M 6 .   ? 59.462 11.474 38.014  1.00 34.57 ? 536 HOH A O     1 
HETATM 5200 O  O     . HOH M 6 .   ? 63.604 7.061  35.466  1.00 30.59 ? 537 HOH A O     1 
HETATM 5201 O  O     . HOH M 6 .   ? 58.274 14.774 28.040  1.00 32.34 ? 538 HOH A O     1 
HETATM 5202 O  O     . HOH M 6 .   ? 60.905 20.742 59.912  1.00 39.52 ? 539 HOH A O     1 
HETATM 5203 O  O     . HOH M 6 .   ? 67.998 31.260 39.480  1.00 31.09 ? 540 HOH A O     1 
HETATM 5204 O  O     . HOH M 6 .   ? 56.760 6.356  43.280  1.00 32.53 ? 541 HOH A O     1 
HETATM 5205 O  O     . HOH M 6 .   ? 51.208 16.333 43.635  1.00 31.61 ? 542 HOH A O     1 
HETATM 5206 O  O     . HOH M 6 .   ? 57.819 32.228 37.842  1.00 36.66 ? 543 HOH A O     1 
HETATM 5207 O  O     . HOH M 6 .   ? 84.420 13.940 48.459  1.00 37.93 ? 544 HOH A O     1 
HETATM 5208 O  O     . HOH M 6 .   ? 72.433 29.654 22.948  1.00 30.80 ? 545 HOH A O     1 
HETATM 5209 O  O     . HOH M 6 .   ? 57.566 26.622 56.880  1.00 33.26 ? 546 HOH A O     1 
HETATM 5210 O  O     . HOH M 6 .   ? 61.705 13.114 37.312  1.00 29.54 ? 547 HOH A O     1 
HETATM 5211 O  O     . HOH M 6 .   ? 53.987 11.375 17.059  1.00 40.27 ? 548 HOH A O     1 
HETATM 5212 O  O     . HOH M 6 .   ? 77.421 6.472  58.626  1.00 32.12 ? 549 HOH A O     1 
HETATM 5213 O  O     . HOH M 6 .   ? 59.230 7.834  11.753  1.00 27.95 ? 550 HOH A O     1 
HETATM 5214 O  O     . HOH M 6 .   ? 84.791 18.233 19.036  1.00 33.21 ? 551 HOH A O     1 
HETATM 5215 O  O     . HOH M 6 .   ? 77.602 19.909 14.706  1.00 30.56 ? 552 HOH A O     1 
HETATM 5216 O  O     . HOH M 6 .   ? 76.529 25.017 22.731  1.00 26.07 ? 553 HOH A O     1 
HETATM 5217 O  O     . HOH M 6 .   ? 62.538 13.886 43.694  1.00 26.66 ? 554 HOH A O     1 
HETATM 5218 O  O     . HOH M 6 .   ? 80.655 24.335 34.798  1.00 26.89 ? 555 HOH A O     1 
HETATM 5219 O  O     . HOH M 6 .   ? 79.088 9.863  23.912  1.00 34.38 ? 556 HOH A O     1 
HETATM 5220 O  O     . HOH M 6 .   ? 76.562 2.942  17.812  1.00 37.37 ? 557 HOH A O     1 
HETATM 5221 O  O     . HOH M 6 .   ? 65.463 3.978  60.623  1.00 39.65 ? 558 HOH A O     1 
HETATM 5222 O  O     . HOH M 6 .   ? 77.125 7.919  24.380  1.00 38.55 ? 559 HOH A O     1 
HETATM 5223 O  O     . HOH M 6 .   ? 66.800 33.267 47.603  1.00 37.78 ? 560 HOH A O     1 
HETATM 5224 O  O     . HOH M 6 .   ? 52.758 4.069  18.506  1.00 28.39 ? 561 HOH A O     1 
HETATM 5225 O  O     . HOH M 6 .   ? 70.049 33.078 23.776  1.00 33.63 ? 562 HOH A O     1 
HETATM 5226 O  O     . HOH M 6 .   ? 83.451 24.246 31.978  1.00 30.85 ? 563 HOH A O     1 
HETATM 5227 O  O     . HOH M 6 .   ? 60.142 26.012 34.620  1.00 30.34 ? 564 HOH A O     1 
HETATM 5228 O  O     . HOH M 6 .   ? 70.041 -7.589 49.178  1.00 31.99 ? 565 HOH A O     1 
HETATM 5229 O  O     . HOH M 6 .   ? 87.366 20.032 40.388  1.00 38.96 ? 566 HOH A O     1 
HETATM 5230 O  O     . HOH M 6 .   ? 56.482 17.542 14.781  1.00 23.45 ? 567 HOH A O     1 
HETATM 5231 O  O     . HOH M 6 .   ? 48.177 11.924 47.930  1.00 38.80 ? 568 HOH A O     1 
HETATM 5232 O  O     . HOH M 6 .   ? 56.940 9.087  42.706  1.00 28.36 ? 569 HOH A O     1 
HETATM 5233 O  O     . HOH M 6 .   ? 78.941 2.921  19.681  1.00 45.15 ? 570 HOH A O     1 
HETATM 5234 O  O     . HOH M 6 .   ? 83.018 25.833 34.031  1.00 33.97 ? 571 HOH A O     1 
HETATM 5235 O  O     . HOH M 6 .   ? 68.933 32.798 27.371  1.00 36.67 ? 572 HOH A O     1 
HETATM 5236 O  O     . HOH M 6 .   ? 77.490 14.454 32.344  1.00 21.51 ? 573 HOH A O     1 
HETATM 5237 O  O     . HOH M 6 .   ? 76.443 16.904 31.666  1.00 21.80 ? 574 HOH A O     1 
HETATM 5238 O  O     . HOH M 6 .   ? 75.096 22.122 15.025  1.00 34.54 ? 575 HOH A O     1 
HETATM 5239 O  O     . HOH M 6 .   ? 64.519 26.341 31.449  1.00 25.75 ? 576 HOH A O     1 
HETATM 5240 O  O     . HOH M 6 .   ? 65.427 35.665 29.722  1.00 42.75 ? 577 HOH A O     1 
HETATM 5241 O  O     . HOH M 6 .   ? 49.075 3.413  28.490  1.00 32.24 ? 578 HOH A O     1 
HETATM 5242 O  O     . HOH M 6 .   ? 77.816 21.062 56.114  1.00 49.58 ? 579 HOH A O     1 
HETATM 5243 O  O     . HOH M 6 .   ? 52.401 15.529 58.424  1.00 42.79 ? 580 HOH A O     1 
HETATM 5244 O  O     . HOH M 6 .   ? 71.024 -1.548 34.085  1.00 32.96 ? 581 HOH A O     1 
HETATM 5245 O  O     . HOH M 6 .   ? 72.964 -0.436 18.437  1.00 36.40 ? 582 HOH A O     1 
HETATM 5246 O  O     . HOH M 6 .   ? 78.400 -0.189 54.543  1.00 41.88 ? 583 HOH A O     1 
HETATM 5247 O  O     . HOH M 6 .   ? 51.037 20.827 27.437  1.00 40.78 ? 584 HOH A O     1 
HETATM 5248 O  O     . HOH M 6 .   ? 66.974 10.218 58.476  1.00 33.73 ? 585 HOH A O     1 
HETATM 5249 O  O     . HOH M 6 .   ? 81.901 13.123 54.417  1.00 42.64 ? 586 HOH A O     1 
HETATM 5250 O  O     . HOH M 6 .   ? 81.123 6.208  43.962  1.00 38.02 ? 587 HOH A O     1 
HETATM 5251 O  O     . HOH M 6 .   ? 73.587 11.880 55.515  1.00 36.50 ? 588 HOH A O     1 
HETATM 5252 O  O     . HOH M 6 .   ? 60.140 26.211 30.573  1.00 46.37 ? 589 HOH A O     1 
HETATM 5253 O  O     . HOH M 6 .   ? 64.715 13.798 42.185  1.00 26.10 ? 590 HOH A O     1 
HETATM 5254 O  O     . HOH M 6 .   ? 84.474 20.731 17.221  1.00 37.56 ? 591 HOH A O     1 
HETATM 5255 O  O     . HOH M 6 .   ? 78.023 22.566 15.322  1.00 32.20 ? 592 HOH A O     1 
HETATM 5256 O  O     . HOH M 6 .   ? 62.185 26.845 32.457  1.00 27.63 ? 593 HOH A O     1 
HETATM 5257 O  O     . HOH M 6 .   ? 58.429 -2.565 30.203  1.00 30.78 ? 594 HOH A O     1 
HETATM 5258 O  O     . HOH M 6 .   ? 73.573 15.179 16.403  1.00 29.98 ? 595 HOH A O     1 
HETATM 5259 O  O     . HOH M 6 .   ? 68.476 -1.842 18.691  1.00 38.31 ? 596 HOH A O     1 
HETATM 5260 O  O     . HOH M 6 .   ? 76.926 -1.659 43.485  1.00 33.92 ? 597 HOH A O     1 
HETATM 5261 O  O     . HOH M 6 .   ? 81.360 1.248  46.298  1.00 48.04 ? 598 HOH A O     1 
HETATM 5262 O  O     . HOH M 6 .   ? 75.246 -2.991 41.776  1.00 32.88 ? 599 HOH A O     1 
HETATM 5263 O  O     . HOH M 6 .   ? 47.299 1.773  23.674  1.00 44.45 ? 600 HOH A O     1 
HETATM 5264 O  O     . HOH M 6 .   ? 74.032 -4.822 44.135  1.00 35.80 ? 601 HOH A O     1 
HETATM 5265 O  O     . HOH M 6 .   ? 70.381 -0.518 17.077  1.00 31.67 ? 602 HOH A O     1 
HETATM 5266 O  O     . HOH M 6 .   ? 49.069 -0.800 21.754  1.00 40.45 ? 603 HOH A O     1 
HETATM 5267 O  O     . HOH M 6 .   ? 77.245 28.939 28.968  1.00 39.22 ? 604 HOH A O     1 
HETATM 5268 O  O     . HOH M 6 .   ? 70.290 -7.117 55.218  1.00 49.94 ? 605 HOH A O     1 
HETATM 5269 O  O     . HOH M 6 .   ? 63.411 10.140 40.432  1.00 33.51 ? 606 HOH A O     1 
HETATM 5270 O  O     . HOH M 6 .   ? 58.599 29.948 32.774  1.00 55.61 ? 607 HOH A O     1 
HETATM 5271 O  O     . HOH M 6 .   ? 80.591 5.911  46.644  1.00 29.01 ? 608 HOH A O     1 
HETATM 5272 O  O     . HOH M 6 .   ? 66.502 6.785  63.535  1.00 43.41 ? 609 HOH A O     1 
HETATM 5273 O  O     . HOH M 6 .   ? 52.224 24.436 33.254  1.00 36.60 ? 610 HOH A O     1 
HETATM 5274 O  O     . HOH M 6 .   ? 53.233 0.421  17.866  1.00 33.65 ? 611 HOH A O     1 
HETATM 5275 O  O     . HOH M 6 .   ? 57.921 7.829  35.899  1.00 38.38 ? 612 HOH A O     1 
HETATM 5276 O  O     . HOH M 6 .   ? 51.901 31.497 34.546  1.00 37.83 ? 613 HOH A O     1 
HETATM 5277 O  O     . HOH M 6 .   ? 59.743 -7.571 21.353  1.00 45.90 ? 614 HOH A O     1 
HETATM 5278 O  O     . HOH M 6 .   ? 87.621 28.103 45.541  1.00 51.68 ? 615 HOH A O     1 
HETATM 5279 O  O     . HOH M 6 .   ? 68.956 13.295 60.605  1.00 38.49 ? 616 HOH A O     1 
HETATM 5280 O  O     . HOH M 6 .   ? 63.849 22.611 58.098  1.00 45.76 ? 617 HOH A O     1 
HETATM 5281 O  O     . HOH M 6 .   ? 78.362 0.265  49.885  1.00 31.19 ? 618 HOH A O     1 
HETATM 5282 O  O     . HOH M 6 .   ? 75.175 35.901 56.046  1.00 50.91 ? 619 HOH A O     1 
HETATM 5283 O  O     . HOH M 6 .   ? 55.604 -1.246 47.960  1.00 46.90 ? 620 HOH A O     1 
HETATM 5284 O  O     . HOH M 6 .   ? 78.908 10.302 58.044  1.00 45.44 ? 621 HOH A O     1 
HETATM 5285 O  O     . HOH M 6 .   ? 64.874 10.994 37.967  1.00 27.88 ? 622 HOH A O     1 
HETATM 5286 O  O     . HOH M 6 .   ? 63.696 -1.728 18.184  1.00 34.15 ? 623 HOH A O     1 
HETATM 5287 O  O     . HOH M 6 .   ? 81.758 15.083 52.306  1.00 40.89 ? 624 HOH A O     1 
HETATM 5288 O  O     . HOH M 6 .   ? 62.161 34.260 46.647  1.00 45.12 ? 625 HOH A O     1 
HETATM 5289 O  O     . HOH M 6 .   ? 82.126 30.832 51.827  1.00 47.24 ? 626 HOH A O     1 
HETATM 5290 O  O     . HOH M 6 .   ? 64.102 12.995 39.639  1.00 27.17 ? 627 HOH A O     1 
HETATM 5291 O  O     . HOH M 6 .   ? 77.960 -0.981 37.200  1.00 42.23 ? 628 HOH A O     1 
HETATM 5292 O  O     . HOH M 6 .   ? 78.945 1.799  52.365  1.00 42.01 ? 629 HOH A O     1 
HETATM 5293 O  O     . HOH M 6 .   ? 77.320 5.326  23.207  1.00 42.64 ? 630 HOH A O     1 
HETATM 5294 O  O     . HOH M 6 .   ? 72.348 0.255  30.933  1.00 46.46 ? 631 HOH A O     1 
HETATM 5295 O  O     . HOH M 6 .   ? 77.376 0.442  34.790  1.00 37.93 ? 632 HOH A O     1 
HETATM 5296 O  O     . HOH M 6 .   ? 74.753 27.456 53.896  1.00 42.10 ? 633 HOH A O     1 
HETATM 5297 O  O     . HOH M 6 .   ? 84.136 15.054 50.936  1.00 42.02 ? 634 HOH A O     1 
HETATM 5298 O  O     . HOH M 6 .   ? 54.959 1.202  33.986  1.00 40.85 ? 635 HOH A O     1 
HETATM 5299 O  O     . HOH M 6 .   ? 48.593 30.066 39.250  1.00 44.27 ? 636 HOH A O     1 
HETATM 5300 O  O     . HOH M 6 .   ? 55.579 -1.811 28.110  1.00 39.74 ? 637 HOH A O     1 
HETATM 5301 O  O     . HOH M 6 .   ? 58.082 -2.658 27.296  1.00 34.46 ? 638 HOH A O     1 
HETATM 5302 O  O     . HOH M 6 .   ? 85.013 25.027 35.790  1.00 35.58 ? 639 HOH A O     1 
HETATM 5303 O  O     . HOH M 6 .   ? 69.357 -6.778 40.331  1.00 29.10 ? 640 HOH A O     1 
HETATM 5304 O  O     . HOH M 6 .   ? 65.419 29.159 47.178  1.00 35.05 ? 641 HOH A O     1 
HETATM 5305 O  O     . HOH M 6 .   ? 75.341 -2.409 52.235  1.00 38.59 ? 642 HOH A O     1 
HETATM 5306 O  O     . HOH M 6 .   ? 78.102 0.818  42.997  1.00 32.10 ? 643 HOH A O     1 
HETATM 5307 O  O     . HOH M 6 .   ? 61.776 -1.172 41.928  1.00 37.34 ? 644 HOH A O     1 
HETATM 5308 O  O     . HOH M 6 .   ? 70.788 33.465 47.355  1.00 56.47 ? 645 HOH A O     1 
HETATM 5309 O  O     . HOH M 6 .   ? 63.490 -8.037 53.303  1.00 43.22 ? 646 HOH A O     1 
HETATM 5310 O  O     . HOH M 6 .   ? 86.184 27.114 37.278  1.00 44.68 ? 647 HOH A O     1 
HETATM 5311 O  O     . HOH M 6 .   ? 57.315 -5.772 44.970  1.00 52.66 ? 648 HOH A O     1 
HETATM 5312 O  O     . HOH M 6 .   ? 62.027 8.565  59.744  1.00 33.09 ? 649 HOH A O     1 
HETATM 5313 O  O     . HOH M 6 .   ? 59.846 -6.298 24.599  1.00 41.89 ? 650 HOH A O     1 
HETATM 5314 O  O     . HOH M 6 .   ? 69.633 25.717 53.762  1.00 51.24 ? 651 HOH A O     1 
HETATM 5315 O  O     . HOH M 6 .   ? 80.614 36.567 41.755  1.00 45.24 ? 652 HOH A O     1 
HETATM 5316 O  O     . HOH M 6 .   ? 61.462 -0.432 38.970  1.00 34.11 ? 653 HOH A O     1 
HETATM 5317 O  O     . HOH M 6 .   ? 50.375 22.294 34.195  1.00 35.77 ? 654 HOH A O     1 
HETATM 5318 O  O     . HOH M 6 .   ? 53.404 -1.118 26.828  1.00 36.02 ? 655 HOH A O     1 
HETATM 5319 O  O     . HOH M 6 .   ? 52.100 1.043  27.877  1.00 29.91 ? 656 HOH A O     1 
HETATM 5320 O  O     . HOH M 6 .   ? 86.091 8.198  37.200  1.00 39.70 ? 657 HOH A O     1 
HETATM 5321 O  O     . HOH M 6 .   ? 80.142 -0.880 44.796  1.00 51.58 ? 658 HOH A O     1 
HETATM 5322 O  O     . HOH M 6 .   ? 58.075 19.838 59.308  1.00 37.18 ? 659 HOH A O     1 
HETATM 5323 O  O     . HOH M 6 .   ? 79.768 31.885 54.906  1.00 48.56 ? 660 HOH A O     1 
HETATM 5324 O  O     . HOH M 6 .   ? 52.290 27.812 54.026  1.00 45.10 ? 661 HOH A O     1 
HETATM 5325 O  O     . HOH M 6 .   ? 85.336 18.773 53.048  1.00 42.81 ? 662 HOH A O     1 
HETATM 5326 O  O     . HOH M 6 .   ? 69.314 0.307  27.795  1.00 33.45 ? 663 HOH A O     1 
HETATM 5327 O  O     . HOH M 6 .   ? 70.120 1.861  30.697  1.00 39.67 ? 664 HOH A O     1 
HETATM 5328 O  O     . HOH M 6 .   ? 64.142 10.393 43.135  1.00 29.16 ? 665 HOH A O     1 
HETATM 5329 O  O     . HOH M 6 .   ? 89.918 13.405 39.731  1.00 45.27 ? 666 HOH A O     1 
HETATM 5330 O  O     . HOH M 6 .   ? 52.964 31.730 53.659  1.00 56.31 ? 667 HOH A O     1 
HETATM 5331 O  O     . HOH M 6 .   ? 68.608 3.565  11.393  1.00 43.40 ? 668 HOH A O     1 
HETATM 5332 O  O     . HOH M 6 .   ? 60.769 -2.966 34.237  1.00 45.73 ? 669 HOH A O     1 
HETATM 5333 O  O     . HOH M 6 .   ? 78.514 33.166 49.301  1.00 49.97 ? 670 HOH A O     1 
HETATM 5334 O  O     . HOH M 6 .   ? 89.111 22.811 45.509  1.00 42.21 ? 671 HOH A O     1 
HETATM 5335 O  O     . HOH M 6 .   ? 85.527 27.887 54.406  1.00 51.27 ? 672 HOH A O     1 
HETATM 5336 O  O     . HOH M 6 .   ? 54.431 -9.335 25.190  1.00 48.02 ? 673 HOH A O     1 
HETATM 5337 O  O     . HOH M 6 .   ? 64.634 -2.735 27.530  1.00 38.94 ? 674 HOH A O     1 
HETATM 5338 O  O     . HOH M 6 .   ? 75.367 28.653 23.265  1.00 39.46 ? 675 HOH A O     1 
HETATM 5339 O  O     . HOH M 6 .   ? 61.087 5.466  59.310  1.00 43.02 ? 676 HOH A O     1 
HETATM 5340 O  O     . HOH M 6 .   ? 52.254 4.463  45.794  1.00 48.42 ? 677 HOH A O     1 
HETATM 5341 O  O     . HOH M 6 .   ? 64.666 24.450 55.885  1.00 37.99 ? 678 HOH A O     1 
HETATM 5342 O  O     . HOH M 6 .   ? 55.456 -0.915 17.023  1.00 33.08 ? 679 HOH A O     1 
HETATM 5343 O  O     . HOH M 6 .   ? 60.369 10.480 40.956  1.00 35.13 ? 680 HOH A O     1 
HETATM 5344 O  O     . HOH M 6 .   ? 61.300 11.368 43.318  1.00 38.35 ? 681 HOH A O     1 
HETATM 5345 O  O     . HOH M 6 .   ? 79.879 37.805 44.647  1.00 52.68 ? 682 HOH A O     1 
HETATM 5346 O  O     . HOH M 6 .   ? 49.881 8.533  24.331  1.00 39.97 ? 683 HOH A O     1 
HETATM 5347 O  O     . HOH M 6 .   ? 72.661 -2.951 52.116  1.00 44.23 ? 684 HOH A O     1 
HETATM 5348 O  O     . HOH M 6 .   ? 80.423 4.455  37.504  1.00 35.47 ? 685 HOH A O     1 
HETATM 5349 O  O     . HOH M 6 .   ? 66.970 14.838 16.073  1.00 32.02 ? 686 HOH A O     1 
HETATM 5350 O  O     . HOH M 6 .   ? 77.210 4.261  29.842  1.00 49.22 ? 687 HOH A O     1 
HETATM 5351 O  O     . HOH M 6 .   ? 79.009 6.560  29.258  1.00 52.70 ? 688 HOH A O     1 
HETATM 5352 O  O     . HOH M 6 .   ? 57.166 31.738 34.710  1.00 54.52 ? 689 HOH A O     1 
HETATM 5353 O  O     . HOH M 6 .   ? 48.354 -1.551 18.942  1.00 47.87 ? 690 HOH A O     1 
HETATM 5354 O  O     . HOH M 6 .   ? 71.063 27.562 16.269  1.00 43.28 ? 691 HOH A O     1 
HETATM 5355 O  O     . HOH M 6 .   ? 72.163 5.525  61.196  1.00 35.34 ? 692 HOH A O     1 
HETATM 5356 O  O     . HOH M 6 .   ? 73.119 9.111  58.643  1.00 53.60 ? 693 HOH A O     1 
HETATM 5357 O  O     . HOH M 6 .   ? 51.300 20.346 60.357  1.00 53.15 ? 694 HOH A O     1 
HETATM 5358 O  O     . HOH M 6 .   ? 49.185 19.346 58.282  1.00 57.74 ? 695 HOH A O     1 
HETATM 5359 O  O     . HOH M 6 .   ? 70.636 32.373 39.881  1.00 31.28 ? 696 HOH A O     1 
HETATM 5360 O  O     . HOH M 6 .   ? 69.778 25.801 17.642  1.00 34.05 ? 697 HOH A O     1 
HETATM 5361 O  O     . HOH M 6 .   ? 86.899 26.712 40.037  1.00 34.33 ? 698 HOH A O     1 
HETATM 5362 O  O     . HOH M 6 .   ? 63.090 2.451  36.169  1.00 30.84 ? 699 HOH A O     1 
HETATM 5363 O  O     . HOH M 6 .   ? 65.274 33.249 40.150  1.00 35.45 ? 700 HOH A O     1 
HETATM 5364 O  O     . HOH M 6 .   ? 71.171 -2.630 49.917  1.00 32.29 ? 701 HOH A O     1 
HETATM 5365 O  O     . HOH M 6 .   ? 73.149 -4.146 48.837  1.00 42.34 ? 702 HOH A O     1 
HETATM 5366 O  O     . HOH M 6 .   ? 70.697 2.544  13.097  1.00 33.14 ? 703 HOH A O     1 
HETATM 5367 O  O     . HOH M 6 .   ? 65.163 -3.049 16.225  1.00 40.08 ? 704 HOH A O     1 
HETATM 5368 O  O     . HOH M 6 .   ? 73.263 24.911 53.468  1.00 36.30 ? 705 HOH A O     1 
HETATM 5369 O  O     . HOH M 6 .   ? 58.111 10.594 36.049  1.00 37.35 ? 706 HOH A O     1 
HETATM 5370 O  O     . HOH M 6 .   ? 46.167 19.326 31.976  1.00 39.68 ? 707 HOH A O     1 
HETATM 5371 O  O     . HOH M 6 .   ? 51.824 25.240 54.874  1.00 40.61 ? 708 HOH A O     1 
HETATM 5372 O  O     . HOH M 6 .   ? 75.142 -4.273 46.804  1.00 50.63 ? 709 HOH A O     1 
HETATM 5373 O  O     . HOH M 6 .   ? 64.348 11.599 65.299  1.00 38.03 ? 710 HOH A O     1 
HETATM 5374 O  O     . HOH M 6 .   ? 61.588 10.158 38.341  1.00 35.65 ? 711 HOH A O     1 
HETATM 5375 O  O     . HOH M 6 .   ? 49.800 17.463 52.610  1.00 41.27 ? 712 HOH A O     1 
HETATM 5376 O  O     . HOH M 6 .   ? 57.085 12.907 63.091  1.00 51.38 ? 713 HOH A O     1 
HETATM 5377 O  O     . HOH M 6 .   ? 63.204 5.680  61.114  1.00 43.58 ? 714 HOH A O     1 
HETATM 5378 O  O     . HOH M 6 .   ? 63.790 -2.641 59.015  1.00 52.93 ? 715 HOH A O     1 
HETATM 5379 O  O     . HOH M 6 .   ? 82.200 30.547 37.177  1.00 41.25 ? 716 HOH A O     1 
HETATM 5380 O  O     . HOH M 6 .   ? 75.196 0.500  31.155  1.00 45.94 ? 717 HOH A O     1 
HETATM 5381 O  O     . HOH M 6 .   ? 75.693 4.891  27.290  1.00 35.74 ? 718 HOH A O     1 
HETATM 5382 O  O     . HOH M 6 .   ? 74.809 2.735  25.646  1.00 47.30 ? 719 HOH A O     1 
HETATM 5383 O  O     . HOH M 6 .   ? 77.638 2.821  24.592  1.00 47.97 ? 720 HOH A O     1 
HETATM 5384 O  O     . HOH M 6 .   ? 83.706 11.041 53.313  1.00 44.04 ? 721 HOH A O     1 
HETATM 5385 O  O     . HOH M 6 .   ? 83.594 5.454  52.504  1.00 36.33 ? 722 HOH A O     1 
HETATM 5386 O  O     . HOH M 6 .   ? 68.119 0.052  59.518  1.00 48.68 ? 723 HOH A O     1 
HETATM 5387 O  O     . HOH M 6 .   ? 60.831 1.087  34.845  1.00 31.63 ? 724 HOH A O     1 
HETATM 5388 O  O     . HOH M 6 .   ? 59.143 1.417  37.126  1.00 40.64 ? 725 HOH A O     1 
HETATM 5389 O  O     . HOH M 6 .   ? 54.195 4.868  43.690  1.00 42.87 ? 726 HOH A O     1 
HETATM 5390 O  O     . HOH M 6 .   ? 51.345 10.539 51.853  1.00 48.15 ? 727 HOH A O     1 
HETATM 5391 O  O     . HOH M 6 .   ? 55.419 20.075 60.253  1.00 45.44 ? 728 HOH A O     1 
HETATM 5392 O  O     . HOH M 6 .   ? 65.724 19.750 59.105  1.00 46.94 ? 729 HOH A O     1 
HETATM 5393 O  O     . HOH M 6 .   ? 68.262 20.640 58.076  1.00 44.04 ? 730 HOH A O     1 
HETATM 5394 O  O     . HOH M 6 .   ? 69.865 17.295 58.621  1.00 41.73 ? 731 HOH A O     1 
HETATM 5395 O  O     . HOH M 6 .   ? 75.988 18.808 56.864  1.00 49.92 ? 732 HOH A O     1 
HETATM 5396 O  O     . HOH M 6 .   ? 84.292 19.164 55.781  1.00 52.88 ? 733 HOH A O     1 
HETATM 5397 O  O     . HOH M 6 .   ? 56.841 -7.778 19.519  1.00 42.75 ? 734 HOH A O     1 
HETATM 5398 O  O     . HOH M 6 .   ? 53.566 -7.415 18.926  1.00 40.30 ? 735 HOH A O     1 
HETATM 5399 O  O     . HOH M 6 .   ? 52.009 -3.343 28.015  1.00 48.31 ? 736 HOH A O     1 
HETATM 5400 O  O     . HOH M 6 .   ? 47.527 -2.344 25.651  1.00 45.84 ? 737 HOH A O     1 
HETATM 5401 O  O     . HOH M 6 .   ? 54.683 5.780  17.275  1.00 35.94 ? 738 HOH A O     1 
HETATM 5402 O  O     . HOH M 6 .   ? 56.621 2.446  14.720  1.00 43.21 ? 739 HOH A O     1 
HETATM 5403 O  O     . HOH M 6 .   ? 62.946 34.805 30.399  1.00 44.54 ? 740 HOH A O     1 
HETATM 5404 O  O     . HOH M 6 .   ? 70.245 0.714  55.821  1.00 42.39 ? 741 HOH A O     1 
HETATM 5405 O  O     . HOH M 6 .   ? 75.607 25.865 16.715  1.00 43.42 ? 742 HOH A O     1 
HETATM 5406 O  O     . HOH M 6 .   ? 70.283 -5.753 53.028  1.00 43.52 ? 743 HOH A O     1 
HETATM 5407 O  O     . HOH M 6 .   ? 72.171 31.414 25.094  1.00 39.87 ? 744 HOH A O     1 
HETATM 5408 O  O     . HOH M 6 .   ? 80.501 33.681 52.720  1.00 53.28 ? 745 HOH A O     1 
HETATM 5409 O  O     . HOH M 6 .   ? 61.536 -4.788 26.966  1.00 46.33 ? 746 HOH A O     1 
HETATM 5410 O  O     . HOH M 6 .   ? 76.057 32.210 54.494  1.00 42.51 ? 747 HOH A O     1 
HETATM 5411 O  O     . HOH M 6 .   ? 43.104 12.751 37.738  1.00 52.45 ? 748 HOH A O     1 
HETATM 5412 O  O     . HOH M 6 .   ? 44.009 14.169 41.622  1.00 45.28 ? 749 HOH A O     1 
HETATM 5413 O  O     . HOH M 6 .   ? 51.069 7.343  34.934  1.00 48.96 ? 750 HOH A O     1 
HETATM 5414 O  O     . HOH M 6 .   ? 66.786 -5.191 56.618  1.00 41.83 ? 751 HOH A O     1 
HETATM 5415 O  O     . HOH M 6 .   ? 67.883 13.752 63.084  1.00 44.39 ? 752 HOH A O     1 
HETATM 5416 O  O     . HOH M 6 .   ? 44.458 18.138 29.999  1.00 49.18 ? 753 HOH A O     1 
HETATM 5417 O  O     . HOH N 6 .   ? 58.897 34.493 3.528   1.00 18.77 ? 501 HOH B O     1 
HETATM 5418 O  O     . HOH N 6 .   ? 65.523 25.823 6.017   1.00 19.37 ? 502 HOH B O     1 
HETATM 5419 O  O     . HOH N 6 .   ? 51.876 37.423 19.706  1.00 21.29 ? 503 HOH B O     1 
HETATM 5420 O  O     . HOH N 6 .   ? 56.800 25.362 4.566   1.00 16.45 ? 504 HOH B O     1 
HETATM 5421 O  O     . HOH N 6 .   ? 59.017 18.946 9.398   1.00 19.11 ? 505 HOH B O     1 
HETATM 5422 O  O     . HOH N 6 .   ? 47.935 38.233 7.677   1.00 28.02 ? 506 HOH B O     1 
HETATM 5423 O  O     . HOH N 6 .   ? 60.087 15.811 -1.678  1.00 20.28 ? 507 HOH B O     1 
HETATM 5424 O  O     . HOH N 6 .   ? 50.302 18.995 -9.331  1.00 22.46 ? 508 HOH B O     1 
HETATM 5425 O  O     . HOH N 6 .   ? 53.444 20.639 16.765  1.00 32.64 ? 509 HOH B O     1 
HETATM 5426 O  O     . HOH N 6 .   ? 59.951 18.988 16.220  1.00 18.39 ? 510 HOH B O     1 
HETATM 5427 O  O     . HOH N 6 .   ? 49.576 30.588 11.785  1.00 21.39 ? 511 HOH B O     1 
HETATM 5428 O  O     . HOH N 6 .   ? 50.484 38.431 26.504  1.00 32.97 ? 512 HOH B O     1 
HETATM 5429 O  O     . HOH N 6 .   ? 51.348 30.590 4.318   1.00 19.67 ? 513 HOH B O     1 
HETATM 5430 O  O     . HOH N 6 .   ? 50.060 26.573 4.367   1.00 17.56 ? 514 HOH B O     1 
HETATM 5431 O  O     . HOH N 6 .   ? 43.229 13.590 0.243   1.00 29.17 ? 515 HOH B O     1 
HETATM 5432 O  O     . HOH N 6 .   ? 66.746 20.310 1.949   1.00 20.62 ? 516 HOH B O     1 
HETATM 5433 O  O     . HOH N 6 .   ? 55.234 39.393 6.265   1.00 21.30 ? 517 HOH B O     1 
HETATM 5434 O  O     . HOH N 6 .   ? 44.270 50.222 -4.464  1.00 27.28 ? 518 HOH B O     1 
HETATM 5435 O  O     . HOH N 6 .   ? 70.693 23.553 2.233   1.00 21.82 ? 519 HOH B O     1 
HETATM 5436 O  O     . HOH N 6 .   ? 55.524 20.109 14.674  1.00 22.20 ? 520 HOH B O     1 
HETATM 5437 O  O     . HOH N 6 .   ? 65.683 36.018 6.744   1.00 23.75 ? 521 HOH B O     1 
HETATM 5438 O  O     . HOH N 6 .   ? 65.132 30.930 -3.178  1.00 25.07 ? 522 HOH B O     1 
HETATM 5439 O  O     . HOH N 6 .   ? 42.602 51.238 -2.415  1.00 23.52 ? 523 HOH B O     1 
HETATM 5440 O  O     . HOH N 6 .   ? 74.295 20.589 13.169  1.00 29.95 ? 524 HOH B O     1 
HETATM 5441 O  O     . HOH N 6 .   ? 60.930 33.675 -5.012  1.00 22.30 ? 525 HOH B O     1 
HETATM 5442 O  O     . HOH N 6 .   ? 72.244 25.456 3.421   1.00 30.84 ? 526 HOH B O     1 
HETATM 5443 O  O     . HOH N 6 .   ? 74.067 24.708 10.195  1.00 22.84 ? 527 HOH B O     1 
HETATM 5444 O  O     . HOH N 6 .   ? 62.686 18.377 -3.661  1.00 22.37 ? 528 HOH B O     1 
HETATM 5445 O  O     . HOH N 6 .   ? 73.071 39.757 10.180  1.00 33.41 ? 529 HOH B O     1 
HETATM 5446 O  O     . HOH N 6 .   ? 64.197 9.716  11.509  1.00 29.73 ? 530 HOH B O     1 
HETATM 5447 O  O     . HOH N 6 .   ? 53.215 36.909 -11.015 1.00 29.76 ? 531 HOH B O     1 
HETATM 5448 O  O     . HOH N 6 .   ? 30.460 22.015 -4.367  1.00 33.84 ? 532 HOH B O     1 
HETATM 5449 O  O     . HOH N 6 .   ? 46.895 30.952 10.919  1.00 30.95 ? 533 HOH B O     1 
HETATM 5450 O  O     . HOH N 6 .   ? 30.517 31.913 8.106   1.00 40.88 ? 534 HOH B O     1 
HETATM 5451 O  O     . HOH N 6 .   ? 51.626 31.840 8.661   1.00 21.19 ? 535 HOH B O     1 
HETATM 5452 O  O     . HOH N 6 .   ? 71.536 37.249 7.804   1.00 29.82 ? 536 HOH B O     1 
HETATM 5453 O  O     . HOH N 6 .   ? 40.780 36.311 9.534   1.00 29.36 ? 537 HOH B O     1 
HETATM 5454 O  O     . HOH N 6 .   ? 69.762 33.063 4.580   1.00 26.62 ? 538 HOH B O     1 
HETATM 5455 O  O     . HOH N 6 .   ? 52.074 15.994 15.016  1.00 34.72 ? 539 HOH B O     1 
HETATM 5456 O  O     . HOH N 6 .   ? 46.669 28.871 3.897   1.00 23.21 ? 540 HOH B O     1 
HETATM 5457 O  O     . HOH N 6 .   ? 43.990 15.336 -11.236 1.00 38.64 ? 541 HOH B O     1 
HETATM 5458 O  O     . HOH N 6 .   ? 50.919 47.275 -4.497  1.00 34.25 ? 542 HOH B O     1 
HETATM 5459 O  O     . HOH N 6 .   ? 31.580 30.813 13.022  1.00 35.55 ? 543 HOH B O     1 
HETATM 5460 O  O     . HOH N 6 .   ? 76.097 23.263 11.456  1.00 34.44 ? 544 HOH B O     1 
HETATM 5461 O  O     . HOH N 6 .   ? 44.222 28.763 4.687   1.00 23.16 ? 545 HOH B O     1 
HETATM 5462 O  O     . HOH N 6 .   ? 49.660 16.655 12.229  1.00 25.53 ? 546 HOH B O     1 
HETATM 5463 O  O     . HOH N 6 .   ? 35.489 32.325 -8.144  1.00 26.87 ? 547 HOH B O     1 
HETATM 5464 O  O     . HOH N 6 .   ? 33.617 21.848 10.716  1.00 25.86 ? 548 HOH B O     1 
HETATM 5465 O  O     . HOH N 6 .   ? 65.077 27.335 22.766  1.00 21.00 ? 549 HOH B O     1 
HETATM 5466 O  O     . HOH N 6 .   ? 66.447 13.174 10.175  1.00 26.82 ? 550 HOH B O     1 
HETATM 5467 O  O     . HOH N 6 .   ? 48.504 29.549 9.354   1.00 27.05 ? 551 HOH B O     1 
HETATM 5468 O  O     . HOH N 6 .   ? 54.922 16.403 10.914  1.00 24.45 ? 552 HOH B O     1 
HETATM 5469 O  O     . HOH N 6 .   ? 37.188 30.889 23.395  1.00 68.59 ? 553 HOH B O     1 
HETATM 5470 O  O     . HOH N 6 .   ? 44.465 11.160 18.647  1.00 35.89 ? 554 HOH B O     1 
HETATM 5471 O  O     . HOH N 6 .   ? 41.149 33.508 9.602   1.00 25.55 ? 555 HOH B O     1 
HETATM 5472 O  O     . HOH N 6 .   ? 43.299 17.805 -9.729  1.00 34.18 ? 556 HOH B O     1 
HETATM 5473 O  O     . HOH N 6 .   ? 64.754 17.169 -4.907  1.00 27.20 ? 557 HOH B O     1 
HETATM 5474 O  O     . HOH N 6 .   ? 62.545 16.043 -11.763 1.00 30.78 ? 558 HOH B O     1 
HETATM 5475 O  O     . HOH N 6 .   ? 66.817 18.677 -3.855  1.00 26.86 ? 559 HOH B O     1 
HETATM 5476 O  O     . HOH N 6 .   ? 54.322 28.779 -15.148 1.00 31.00 ? 560 HOH B O     1 
HETATM 5477 O  O     . HOH N 6 .   ? 48.021 9.553  5.084   1.00 33.48 ? 561 HOH B O     1 
HETATM 5478 O  O     . HOH N 6 .   ? 45.510 32.309 3.778   1.00 25.18 ? 562 HOH B O     1 
HETATM 5479 O  O     . HOH N 6 .   ? 45.426 10.431 12.031  1.00 29.05 ? 563 HOH B O     1 
HETATM 5480 O  O     . HOH N 6 .   ? 27.973 25.258 6.399   1.00 37.29 ? 564 HOH B O     1 
HETATM 5481 O  O     . HOH N 6 .   ? 64.644 11.397 9.229   1.00 30.81 ? 565 HOH B O     1 
HETATM 5482 O  O     . HOH N 6 .   ? 41.940 36.182 -16.260 1.00 27.99 ? 566 HOH B O     1 
HETATM 5483 O  O     . HOH N 6 .   ? 32.618 38.521 -8.326  1.00 29.98 ? 567 HOH B O     1 
HETATM 5484 O  O     . HOH N 6 .   ? 50.543 49.473 1.700   1.00 26.95 ? 568 HOH B O     1 
HETATM 5485 O  O     . HOH N 6 .   ? 69.279 17.818 7.347   1.00 25.37 ? 569 HOH B O     1 
HETATM 5486 O  O     . HOH N 6 .   ? 28.590 17.453 5.946   1.00 31.57 ? 570 HOH B O     1 
HETATM 5487 O  O     . HOH N 6 .   ? 74.894 18.398 2.221   1.00 40.22 ? 571 HOH B O     1 
HETATM 5488 O  O     . HOH N 6 .   ? 43.927 9.381  -1.166  1.00 32.66 ? 572 HOH B O     1 
HETATM 5489 O  O     . HOH N 6 .   ? 62.570 22.818 -12.293 1.00 31.05 ? 573 HOH B O     1 
HETATM 5490 O  O     . HOH N 6 .   ? 52.140 10.367 0.809   1.00 30.94 ? 574 HOH B O     1 
HETATM 5491 O  O     . HOH N 6 .   ? 31.202 33.946 -5.229  1.00 27.91 ? 575 HOH B O     1 
HETATM 5492 O  O     . HOH N 6 .   ? 50.823 11.422 3.065   1.00 31.40 ? 576 HOH B O     1 
HETATM 5493 O  O     . HOH N 6 .   ? 30.636 16.106 0.028   1.00 33.42 ? 577 HOH B O     1 
HETATM 5494 O  O     . HOH N 6 .   ? 49.520 41.647 11.704  1.00 33.51 ? 578 HOH B O     1 
HETATM 5495 O  O     . HOH N 6 .   ? 49.128 42.567 -11.399 1.00 30.05 ? 579 HOH B O     1 
HETATM 5496 O  O     . HOH N 6 .   ? 47.778 39.420 -14.450 1.00 34.63 ? 580 HOH B O     1 
HETATM 5497 O  O     . HOH N 6 .   ? 71.014 34.529 21.426  1.00 31.20 ? 581 HOH B O     1 
HETATM 5498 O  O     . HOH N 6 .   ? 50.885 35.802 9.270   1.00 30.42 ? 582 HOH B O     1 
HETATM 5499 O  O     . HOH N 6 .   ? 43.526 31.291 5.693   1.00 30.10 ? 583 HOH B O     1 
HETATM 5500 O  O     . HOH N 6 .   ? 57.368 38.782 28.125  1.00 32.56 ? 584 HOH B O     1 
HETATM 5501 O  O     . HOH N 6 .   ? 36.006 18.057 -4.893  1.00 34.36 ? 585 HOH B O     1 
HETATM 5502 O  O     . HOH N 6 .   ? 49.425 21.779 23.732  1.00 39.02 ? 586 HOH B O     1 
HETATM 5503 O  O     . HOH N 6 .   ? 66.816 34.902 27.437  1.00 32.74 ? 587 HOH B O     1 
HETATM 5504 O  O     . HOH N 6 .   ? 48.191 29.714 6.194   1.00 26.57 ? 588 HOH B O     1 
HETATM 5505 O  O     . HOH N 6 .   ? 38.737 40.779 -11.626 1.00 35.95 ? 589 HOH B O     1 
HETATM 5506 O  O     . HOH N 6 .   ? 36.623 50.517 -1.835  1.00 39.94 ? 590 HOH B O     1 
HETATM 5507 O  O     . HOH N 6 .   ? 37.205 26.389 13.619  1.00 33.01 ? 591 HOH B O     1 
HETATM 5508 O  O     . HOH N 6 .   ? 48.409 12.614 15.095  1.00 45.48 ? 592 HOH B O     1 
HETATM 5509 O  O     . HOH N 6 .   ? 62.286 25.865 1.523   1.00 19.90 ? 593 HOH B O     1 
HETATM 5510 O  O     . HOH N 6 .   ? 62.400 28.291 0.318   1.00 19.89 ? 594 HOH B O     1 
HETATM 5511 O  O     . HOH N 6 .   ? 46.926 32.158 13.063  1.00 33.45 ? 595 HOH B O     1 
HETATM 5512 O  O     . HOH N 6 .   ? 76.123 20.645 10.596  1.00 31.35 ? 596 HOH B O     1 
HETATM 5513 O  O     . HOH N 6 .   ? 59.722 35.001 25.488  1.00 26.98 ? 597 HOH B O     1 
HETATM 5514 O  O     . HOH N 6 .   ? 51.147 34.266 26.758  1.00 39.98 ? 598 HOH B O     1 
HETATM 5515 O  O     . HOH N 6 .   ? 51.978 45.420 16.529  1.00 34.80 ? 599 HOH B O     1 
HETATM 5516 O  O     . HOH N 6 .   ? 35.144 29.520 -11.125 1.00 30.95 ? 600 HOH B O     1 
HETATM 5517 O  O     . HOH N 6 .   ? 49.856 31.708 6.569   1.00 27.33 ? 601 HOH B O     1 
HETATM 5518 O  O     . HOH N 6 .   ? 49.854 19.669 10.629  1.00 30.00 ? 602 HOH B O     1 
HETATM 5519 O  O     . HOH N 6 .   ? 26.674 35.538 5.961   1.00 56.81 ? 603 HOH B O     1 
HETATM 5520 O  O     . HOH N 6 .   ? 44.170 21.465 -15.134 1.00 39.23 ? 604 HOH B O     1 
HETATM 5521 O  O     . HOH N 6 .   ? 64.458 17.799 -7.571  1.00 32.19 ? 605 HOH B O     1 
HETATM 5522 O  O     . HOH N 6 .   ? 68.241 14.083 8.127   1.00 33.66 ? 606 HOH B O     1 
HETATM 5523 O  O     . HOH N 6 .   ? 63.509 26.940 -14.264 1.00 41.52 ? 607 HOH B O     1 
HETATM 5524 O  O     . HOH N 6 .   ? 47.308 39.472 24.774  1.00 29.11 ? 608 HOH B O     1 
HETATM 5525 O  O     . HOH N 6 .   ? 42.036 8.837  -5.373  1.00 44.46 ? 609 HOH B O     1 
HETATM 5526 O  O     . HOH N 6 .   ? 45.671 18.325 19.491  1.00 33.49 ? 610 HOH B O     1 
HETATM 5527 O  O     . HOH N 6 .   ? 28.747 30.900 -10.783 1.00 39.45 ? 611 HOH B O     1 
HETATM 5528 O  O     . HOH N 6 .   ? 37.576 21.695 15.511  1.00 32.22 ? 612 HOH B O     1 
HETATM 5529 O  O     . HOH N 6 .   ? 29.146 22.965 -1.589  1.00 33.48 ? 613 HOH B O     1 
HETATM 5530 O  O     . HOH N 6 .   ? 37.548 46.327 7.564   1.00 43.85 ? 614 HOH B O     1 
HETATM 5531 O  O     . HOH N 6 .   ? 25.335 29.795 -3.214  1.00 44.22 ? 615 HOH B O     1 
HETATM 5532 O  O     . HOH N 6 .   ? 63.082 9.740  -8.985  1.00 51.24 ? 616 HOH B O     1 
HETATM 5533 O  O     . HOH N 6 .   ? 35.787 38.050 11.066  1.00 46.76 ? 617 HOH B O     1 
HETATM 5534 O  O     . HOH N 6 .   ? 38.701 37.754 10.957  1.00 44.41 ? 618 HOH B O     1 
HETATM 5535 O  O     . HOH N 6 .   ? 52.588 15.898 12.132  1.00 25.37 ? 619 HOH B O     1 
HETATM 5536 O  O     . HOH N 6 .   ? 61.204 41.345 14.459  1.00 27.61 ? 620 HOH B O     1 
HETATM 5537 O  O     . HOH N 6 .   ? 40.949 48.825 -7.468  1.00 72.97 ? 621 HOH B O     1 
HETATM 5538 O  O     . HOH N 6 .   ? 53.321 44.460 -6.246  1.00 32.12 ? 622 HOH B O     1 
HETATM 5539 O  O     . HOH N 6 .   ? 62.695 42.615 25.840  1.00 28.49 ? 623 HOH B O     1 
HETATM 5540 O  O     . HOH N 6 .   ? 41.495 7.688  2.093   1.00 56.40 ? 624 HOH B O     1 
HETATM 5541 O  O     . HOH N 6 .   ? 60.183 38.192 -5.185  1.00 30.44 ? 625 HOH B O     1 
HETATM 5542 O  O     . HOH N 6 .   ? 67.315 44.448 16.439  1.00 48.45 ? 626 HOH B O     1 
HETATM 5543 O  O     . HOH N 6 .   ? 74.117 25.412 1.353   1.00 40.55 ? 627 HOH B O     1 
HETATM 5544 O  O     . HOH N 6 .   ? 34.949 42.178 -9.774  1.00 43.33 ? 628 HOH B O     1 
HETATM 5545 O  O     . HOH N 6 .   ? 55.984 36.866 -9.803  1.00 38.85 ? 629 HOH B O     1 
HETATM 5546 O  O     . HOH N 6 .   ? 50.191 41.282 29.128  1.00 52.20 ? 630 HOH B O     1 
HETATM 5547 O  O     . HOH N 6 .   ? 66.484 41.987 10.733  1.00 28.23 ? 631 HOH B O     1 
HETATM 5548 O  O     . HOH N 6 .   ? 44.908 43.865 6.374   1.00 30.55 ? 632 HOH B O     1 
HETATM 5549 O  O     . HOH N 6 .   ? 48.602 23.466 -19.890 1.00 44.46 ? 633 HOH B O     1 
HETATM 5550 O  O     . HOH N 6 .   ? 72.089 32.934 19.485  1.00 34.25 ? 634 HOH B O     1 
HETATM 5551 O  O     . HOH N 6 .   ? 70.668 24.606 -5.041  1.00 41.06 ? 635 HOH B O     1 
HETATM 5552 O  O     . HOH N 6 .   ? 70.114 43.170 12.655  1.00 35.51 ? 636 HOH B O     1 
HETATM 5553 O  O     . HOH N 6 .   ? 57.049 49.119 18.930  1.00 38.64 ? 637 HOH B O     1 
HETATM 5554 O  O     . HOH N 6 .   ? 49.063 5.103  3.867   1.00 29.35 ? 638 HOH B O     1 
HETATM 5555 O  O     . HOH N 6 .   ? 68.416 12.274 12.135  1.00 32.51 ? 639 HOH B O     1 
HETATM 5556 O  O     . HOH N 6 .   ? 34.036 20.083 -5.613  1.00 44.25 ? 640 HOH B O     1 
HETATM 5557 O  O     . HOH N 6 .   ? 42.039 47.132 5.633   1.00 39.86 ? 641 HOH B O     1 
HETATM 5558 O  O     . HOH N 6 .   ? 49.775 27.712 -15.584 1.00 37.63 ? 642 HOH B O     1 
HETATM 5559 O  O     . HOH N 6 .   ? 26.962 12.411 15.806  1.00 44.25 ? 643 HOH B O     1 
HETATM 5560 O  O     . HOH N 6 .   ? 59.481 37.056 27.496  1.00 38.40 ? 644 HOH B O     1 
HETATM 5561 O  O     . HOH N 6 .   ? 69.838 43.118 15.575  1.00 38.48 ? 645 HOH B O     1 
HETATM 5562 O  O     . HOH N 6 .   ? 68.050 35.182 5.437   1.00 33.02 ? 646 HOH B O     1 
HETATM 5563 O  O     . HOH N 6 .   ? 52.178 27.991 -16.633 1.00 36.00 ? 647 HOH B O     1 
HETATM 5564 O  O     . HOH N 6 .   ? 68.940 18.037 -5.384  1.00 38.70 ? 648 HOH B O     1 
HETATM 5565 O  O     . HOH N 6 .   ? 33.075 35.760 -10.050 1.00 43.87 ? 649 HOH B O     1 
HETATM 5566 O  O     . HOH N 6 .   ? 60.977 9.559  9.945   1.00 45.48 ? 650 HOH B O     1 
HETATM 5567 O  O     . HOH N 6 .   ? 47.621 32.525 8.885   1.00 35.31 ? 651 HOH B O     1 
HETATM 5568 O  O     . HOH N 6 .   ? 43.698 35.269 19.085  1.00 48.68 ? 652 HOH B O     1 
HETATM 5569 O  O     . HOH N 6 .   ? 51.747 44.723 19.923  1.00 39.07 ? 653 HOH B O     1 
HETATM 5570 O  O     . HOH N 6 .   ? 60.963 50.292 21.398  1.00 58.37 ? 654 HOH B O     1 
HETATM 5571 O  O     . HOH N 6 .   ? 47.152 32.676 6.081   1.00 33.83 ? 655 HOH B O     1 
HETATM 5572 O  O     . HOH N 6 .   ? 62.599 25.271 27.725  1.00 24.38 ? 656 HOH B O     1 
HETATM 5573 O  O     . HOH N 6 .   ? 67.959 9.619  8.204   1.00 52.38 ? 657 HOH B O     1 
HETATM 5574 O  O     . HOH N 6 .   ? 48.318 29.669 -17.239 1.00 43.99 ? 658 HOH B O     1 
HETATM 5575 O  O     . HOH N 6 .   ? 31.166 42.263 5.302   1.00 53.40 ? 659 HOH B O     1 
HETATM 5576 O  O     . HOH N 6 .   ? 67.892 44.533 11.561  1.00 40.74 ? 660 HOH B O     1 
HETATM 5577 O  O     . HOH N 6 .   ? 27.498 20.008 0.821   1.00 39.43 ? 661 HOH B O     1 
HETATM 5578 O  O     . HOH N 6 .   ? 75.979 16.383 15.145  1.00 31.86 ? 662 HOH B O     1 
HETATM 5579 O  O     . HOH N 6 .   ? 60.199 42.427 5.109   1.00 44.42 ? 663 HOH B O     1 
HETATM 5580 O  O     . HOH N 6 .   ? 43.894 20.275 20.031  1.00 32.79 ? 664 HOH B O     1 
HETATM 5581 O  O     . HOH N 6 .   ? 43.597 9.831  -11.066 1.00 45.49 ? 665 HOH B O     1 
HETATM 5582 O  O     . HOH N 6 .   ? 56.862 44.383 4.266   1.00 28.95 ? 666 HOH B O     1 
HETATM 5583 O  O     . HOH N 6 .   ? 52.521 5.962  9.543   1.00 46.54 ? 667 HOH B O     1 
HETATM 5584 O  O     . HOH N 6 .   ? 43.447 33.028 -17.457 1.00 56.01 ? 668 HOH B O     1 
HETATM 5585 O  O     . HOH N 6 .   ? 42.082 30.694 -11.337 1.00 33.30 ? 669 HOH B O     1 
HETATM 5586 O  O     . HOH N 6 .   ? 64.636 13.985 3.005   1.00 38.09 ? 670 HOH B O     1 
HETATM 5587 O  O     . HOH N 6 .   ? 46.068 10.781 -15.667 1.00 49.17 ? 671 HOH B O     1 
HETATM 5588 O  O     . HOH N 6 .   ? 44.391 4.503  -13.124 1.00 41.84 ? 672 HOH B O     1 
HETATM 5589 O  O     . HOH N 6 .   ? 50.676 7.281  -11.473 1.00 53.46 ? 673 HOH B O     1 
HETATM 5590 O  O     . HOH N 6 .   ? 38.520 16.409 -7.009  1.00 46.44 ? 674 HOH B O     1 
HETATM 5591 O  O     . HOH N 6 .   ? 51.527 24.290 -18.799 1.00 40.30 ? 675 HOH B O     1 
HETATM 5592 O  O     . HOH N 6 .   ? 67.083 45.715 20.010  1.00 36.80 ? 676 HOH B O     1 
HETATM 5593 O  O     . HOH N 6 .   ? 59.170 40.216 -6.568  1.00 41.74 ? 677 HOH B O     1 
HETATM 5594 O  O     . HOH N 6 .   ? 26.317 29.242 2.297   1.00 40.00 ? 678 HOH B O     1 
HETATM 5595 O  O     . HOH N 6 .   ? 44.732 27.051 -14.905 1.00 38.91 ? 679 HOH B O     1 
HETATM 5596 O  O     . HOH N 6 .   ? 45.508 45.183 -10.478 1.00 40.17 ? 680 HOH B O     1 
HETATM 5597 O  O     . HOH N 6 .   ? 59.731 40.455 31.379  1.00 47.33 ? 681 HOH B O     1 
HETATM 5598 O  O     . HOH N 6 .   ? 46.658 46.951 -6.518  1.00 40.41 ? 682 HOH B O     1 
HETATM 5599 O  O     . HOH N 6 .   ? 44.777 32.207 8.192   1.00 33.23 ? 683 HOH B O     1 
HETATM 5600 O  O     . HOH N 6 .   ? 60.209 42.413 -1.188  1.00 37.98 ? 684 HOH B O     1 
HETATM 5601 O  O     . HOH N 6 .   ? 38.291 12.635 18.065  1.00 41.02 ? 685 HOH B O     1 
HETATM 5602 O  O     . HOH N 6 .   ? 47.150 41.507 -12.955 1.00 33.85 ? 686 HOH B O     1 
HETATM 5603 O  O     . HOH N 6 .   ? 54.137 39.345 -11.943 1.00 42.66 ? 687 HOH B O     1 
HETATM 5604 O  O     . HOH N 6 .   ? 48.567 9.725  -11.970 1.00 47.32 ? 688 HOH B O     1 
HETATM 5605 O  O     . HOH N 6 .   ? 72.465 16.573 8.347   1.00 38.13 ? 689 HOH B O     1 
HETATM 5606 O  O     . HOH N 6 .   ? 54.282 43.771 -9.633  1.00 52.93 ? 690 HOH B O     1 
HETATM 5607 O  O     . HOH N 6 .   ? 44.438 45.328 -5.807  1.00 33.82 ? 691 HOH B O     1 
HETATM 5608 O  O     . HOH N 6 .   ? 73.408 17.020 11.453  1.00 37.97 ? 692 HOH B O     1 
HETATM 5609 O  O     . HOH N 6 .   ? 43.458 19.795 -18.780 1.00 54.42 ? 693 HOH B O     1 
HETATM 5610 O  O     . HOH N 6 .   ? 54.017 45.491 18.725  1.00 32.71 ? 694 HOH B O     1 
HETATM 5611 O  O     . HOH N 6 .   ? 51.223 43.751 -12.747 1.00 46.24 ? 695 HOH B O     1 
HETATM 5612 O  O     . HOH N 6 .   ? 50.076 37.402 -17.036 1.00 40.87 ? 696 HOH B O     1 
HETATM 5613 O  O     . HOH N 6 .   ? 59.283 19.784 -17.195 1.00 35.95 ? 697 HOH B O     1 
HETATM 5614 O  O     . HOH N 6 .   ? 61.064 12.200 -6.560  1.00 33.73 ? 698 HOH B O     1 
HETATM 5615 O  O     . HOH N 6 .   ? 52.268 43.716 28.884  1.00 41.79 ? 699 HOH B O     1 
HETATM 5616 O  O     . HOH N 6 .   ? 60.563 42.476 9.610   1.00 29.66 ? 700 HOH B O     1 
HETATM 5617 O  O     . HOH N 6 .   ? 73.102 40.021 17.677  1.00 37.24 ? 701 HOH B O     1 
HETATM 5618 O  O     . HOH N 6 .   ? 46.840 43.112 8.695   1.00 36.98 ? 702 HOH B O     1 
HETATM 5619 O  O     . HOH N 6 .   ? 54.346 42.015 -6.817  1.00 27.50 ? 703 HOH B O     1 
HETATM 5620 O  O     . HOH N 6 .   ? 53.571 28.272 18.023  1.00 32.03 ? 704 HOH B O     1 
HETATM 5621 O  O     . HOH N 6 .   ? 56.618 36.438 29.663  1.00 52.09 ? 705 HOH B O     1 
HETATM 5622 O  O     . HOH N 6 .   ? 51.336 43.875 22.368  1.00 36.09 ? 706 HOH B O     1 
HETATM 5623 O  O     . HOH N 6 .   ? 49.726 41.658 22.822  1.00 29.55 ? 707 HOH B O     1 
HETATM 5624 O  O     . HOH N 6 .   ? 46.746 9.179  -4.315  1.00 45.28 ? 708 HOH B O     1 
HETATM 5625 O  O     . HOH N 6 .   ? 54.647 11.115 -14.457 1.00 41.80 ? 709 HOH B O     1 
HETATM 5626 O  O     . HOH N 6 .   ? 31.144 45.099 -3.033  1.00 48.35 ? 710 HOH B O     1 
HETATM 5627 O  O     . HOH N 6 .   ? 57.253 14.636 -15.402 1.00 47.22 ? 711 HOH B O     1 
HETATM 5628 O  O     . HOH N 6 .   ? 64.508 15.835 -9.550  1.00 35.06 ? 712 HOH B O     1 
HETATM 5629 O  O     . HOH N 6 .   ? 27.478 16.544 2.771   1.00 44.00 ? 713 HOH B O     1 
HETATM 5630 O  O     . HOH N 6 .   ? 53.314 41.973 -11.572 1.00 46.99 ? 714 HOH B O     1 
HETATM 5631 O  O     . HOH N 6 .   ? 30.154 24.326 -10.005 1.00 46.49 ? 715 HOH B O     1 
HETATM 5632 O  O     . HOH N 6 .   ? 63.278 47.254 19.425  1.00 39.03 ? 716 HOH B O     1 
HETATM 5633 O  O     . HOH N 6 .   ? 30.871 42.224 -8.133  1.00 49.66 ? 717 HOH B O     1 
HETATM 5634 O  O     . HOH N 6 .   ? 56.301 7.194  11.674  1.00 40.28 ? 718 HOH B O     1 
HETATM 5635 O  O     . HOH N 6 .   ? 68.523 27.828 18.718  1.00 39.86 ? 719 HOH B O     1 
HETATM 5636 O  O     . HOH N 6 .   ? 49.227 45.808 18.824  1.00 44.17 ? 720 HOH B O     1 
HETATM 5637 O  O     . HOH N 6 .   ? 49.179 45.661 22.852  1.00 49.69 ? 721 HOH B O     1 
HETATM 5638 O  O     . HOH N 6 .   ? 31.325 11.376 4.644   1.00 49.91 ? 722 HOH B O     1 
HETATM 5639 O  O     . HOH N 6 .   ? 43.553 49.354 4.871   1.00 45.16 ? 723 HOH B O     1 
HETATM 5640 O  O     . HOH N 6 .   ? 60.829 28.973 -13.831 1.00 36.85 ? 724 HOH B O     1 
HETATM 5641 O  O     . HOH N 6 .   ? 61.236 31.828 -14.195 1.00 44.90 ? 725 HOH B O     1 
HETATM 5642 O  O     . HOH N 6 .   ? 64.617 29.542 -13.865 1.00 39.80 ? 726 HOH B O     1 
HETATM 5643 O  O     . HOH N 6 .   ? 64.432 19.621 -11.414 1.00 39.15 ? 727 HOH B O     1 
HETATM 5644 O  O     . HOH N 6 .   ? 61.159 20.558 -14.120 1.00 45.24 ? 728 HOH B O     1 
HETATM 5645 O  O     . HOH N 6 .   ? 72.090 27.687 13.589  1.00 27.41 ? 729 HOH B O     1 
HETATM 5646 O  O     . HOH N 6 .   ? 53.876 8.369  13.114  1.00 50.79 ? 730 HOH B O     1 
HETATM 5647 O  O     . HOH N 6 .   ? 46.081 15.987 -18.827 1.00 44.61 ? 731 HOH B O     1 
HETATM 5648 O  O     . HOH N 6 .   ? 65.738 36.412 0.842   1.00 41.58 ? 732 HOH B O     1 
HETATM 5649 O  O     . HOH N 6 .   ? 63.968 38.181 2.166   1.00 47.49 ? 733 HOH B O     1 
HETATM 5650 O  O     . HOH N 6 .   ? 32.522 28.936 -11.804 1.00 36.35 ? 734 HOH B O     1 
HETATM 5651 O  O     . HOH N 6 .   ? 35.976 26.931 -12.343 1.00 37.99 ? 735 HOH B O     1 
HETATM 5652 O  O     . HOH N 6 .   ? 57.031 43.523 -5.574  1.00 36.29 ? 736 HOH B O     1 
HETATM 5653 O  O     . HOH N 6 .   ? 41.034 16.888 -7.415  1.00 45.10 ? 737 HOH B O     1 
HETATM 5654 O  O     . HOH N 6 .   ? 72.114 30.373 20.110  1.00 34.63 ? 738 HOH B O     1 
HETATM 5655 O  O     . HOH N 6 .   ? 67.934 29.326 -10.659 1.00 38.16 ? 739 HOH B O     1 
HETATM 5656 O  O     . HOH N 6 .   ? 60.505 33.422 -11.922 1.00 41.63 ? 740 HOH B O     1 
HETATM 5657 O  O     . HOH N 6 .   ? 64.245 34.555 -9.423  1.00 34.59 ? 741 HOH B O     1 
HETATM 5658 O  O     . HOH N 6 .   ? 57.365 45.769 -1.146  1.00 42.22 ? 742 HOH B O     1 
HETATM 5659 O  O     . HOH N 6 .   ? 64.907 38.106 4.950   1.00 34.65 ? 743 HOH B O     1 
HETATM 5660 O  O     . HOH N 6 .   ? 41.289 8.931  6.997   1.00 39.61 ? 744 HOH B O     1 
HETATM 5661 O  O     . HOH N 6 .   ? 74.672 28.343 12.746  1.00 48.57 ? 745 HOH B O     1 
HETATM 5662 O  O     . HOH N 6 .   ? 52.082 35.829 29.162  1.00 53.26 ? 746 HOH B O     1 
HETATM 5663 O  O     . HOH N 6 .   ? 72.972 39.022 20.341  1.00 46.41 ? 747 HOH B O     1 
HETATM 5664 O  O     . HOH N 6 .   ? 66.208 17.080 3.630   1.00 46.87 ? 748 HOH B O     1 
HETATM 5665 O  O     . HOH N 6 .   ? 51.043 12.690 14.723  1.00 54.74 ? 749 HOH B O     1 
HETATM 5666 O  O     . HOH N 6 .   ? 47.676 39.605 9.377   1.00 27.25 ? 750 HOH B O     1 
HETATM 5667 O  O     . HOH N 6 .   ? 36.417 37.251 -13.636 1.00 31.62 ? 751 HOH B O     1 
HETATM 5668 O  O     . HOH N 6 .   ? 30.655 18.130 11.211  1.00 32.21 ? 752 HOH B O     1 
HETATM 5669 O  O     . HOH N 6 .   ? 41.356 9.294  4.316   1.00 42.90 ? 753 HOH B O     1 
HETATM 5670 O  O     . HOH N 6 .   ? 29.442 10.333 6.531   1.00 52.91 ? 754 HOH B O     1 
HETATM 5671 O  O     . HOH N 6 .   ? 32.621 45.195 -5.650  1.00 54.12 ? 755 HOH B O     1 
HETATM 5672 O  O     . HOH N 6 .   ? 50.045 40.163 9.211   1.00 33.16 ? 756 HOH B O     1 
HETATM 5673 O  O     . HOH N 6 .   ? 35.180 15.711 16.092  1.00 31.89 ? 757 HOH B O     1 
HETATM 5674 O  O     . HOH N 6 .   ? 48.172 19.326 23.899  1.00 42.89 ? 758 HOH B O     1 
HETATM 5675 O  O     . HOH N 6 .   ? 29.780 12.211 17.438  1.00 35.03 ? 759 HOH B O     1 
HETATM 5676 O  O     . HOH N 6 .   ? 28.317 25.455 8.773   1.00 40.51 ? 760 HOH B O     1 
HETATM 5677 O  O     . HOH N 6 .   ? 61.855 40.197 1.596   1.00 34.59 ? 761 HOH B O     1 
HETATM 5678 O  O     . HOH N 6 .   ? 41.871 32.934 -12.921 1.00 32.83 ? 762 HOH B O     1 
HETATM 5679 O  O     . HOH N 6 .   ? 76.573 18.691 7.819   1.00 34.76 ? 763 HOH B O     1 
HETATM 5680 O  O     . HOH N 6 .   ? 68.825 16.868 15.696  1.00 28.77 ? 764 HOH B O     1 
HETATM 5681 O  O     . HOH N 6 .   ? 40.996 32.227 24.696  1.00 48.13 ? 765 HOH B O     1 
HETATM 5682 O  O     . HOH N 6 .   ? 70.853 15.520 14.391  1.00 37.09 ? 766 HOH B O     1 
HETATM 5683 O  O     . HOH N 6 .   ? 65.722 48.129 20.904  1.00 43.57 ? 767 HOH B O     1 
HETATM 5684 O  O     . HOH N 6 .   ? 58.350 32.845 28.630  1.00 41.88 ? 768 HOH B O     1 
HETATM 5685 O  O     . HOH N 6 .   ? 33.908 38.355 -12.754 1.00 43.01 ? 769 HOH B O     1 
HETATM 5686 O  O     . HOH N 6 .   ? 39.552 34.343 -13.121 1.00 50.70 ? 770 HOH B O     1 
HETATM 5687 O  O     . HOH N 6 .   ? 58.853 40.921 7.180   1.00 34.52 ? 771 HOH B O     1 
HETATM 5688 O  O     . HOH N 6 .   ? 39.879 42.689 -8.711  1.00 35.85 ? 772 HOH B O     1 
HETATM 5689 O  O     . HOH N 6 .   ? 66.607 13.599 1.290   1.00 45.63 ? 773 HOH B O     1 
HETATM 5690 O  O     . HOH N 6 .   ? 57.029 47.065 15.027  1.00 44.88 ? 774 HOH B O     1 
HETATM 5691 O  O     . HOH N 6 .   ? 46.858 9.166  8.895   1.00 37.47 ? 775 HOH B O     1 
HETATM 5692 O  O     . HOH N 6 .   ? 72.297 26.336 -3.363  1.00 44.68 ? 776 HOH B O     1 
HETATM 5693 O  O     . HOH N 6 .   ? 71.458 28.873 -4.211  1.00 44.28 ? 777 HOH B O     1 
HETATM 5694 O  O     . HOH N 6 .   ? 57.630 35.249 -11.208 1.00 42.21 ? 778 HOH B O     1 
HETATM 5695 O  O     . HOH N 6 .   ? 55.284 35.487 -14.558 1.00 45.40 ? 779 HOH B O     1 
HETATM 5696 O  O     . HOH N 6 .   ? 46.555 40.860 17.056  1.00 44.41 ? 780 HOH B O     1 
HETATM 5697 O  O     . HOH N 6 .   ? 70.178 20.434 -4.059  1.00 39.61 ? 781 HOH B O     1 
HETATM 5698 O  O     . HOH N 6 .   ? 64.502 44.604 19.855  1.00 36.06 ? 782 HOH B O     1 
HETATM 5699 O  O     . HOH N 6 .   ? 41.431 7.174  11.621  1.00 38.82 ? 783 HOH B O     1 
HETATM 5700 O  O     . HOH N 6 .   ? 54.002 39.701 32.283  1.00 48.79 ? 784 HOH B O     1 
HETATM 5701 O  O     . HOH N 6 .   ? 54.765 44.895 3.303   1.00 34.21 ? 785 HOH B O     1 
HETATM 5702 O  O     . HOH N 6 .   ? 25.053 35.210 3.517   1.00 54.88 ? 786 HOH B O     1 
HETATM 5703 O  O     . HOH N 6 .   ? 48.157 35.709 8.011   1.00 40.08 ? 787 HOH B O     1 
HETATM 5704 O  O     . HOH N 6 .   ? 48.809 10.605 11.907  1.00 43.93 ? 788 HOH B O     1 
HETATM 5705 O  O     . HOH N 6 .   ? 53.279 46.203 -8.295  1.00 47.82 ? 789 HOH B O     1 
HETATM 5706 O  O     . HOH N 6 .   ? 49.321 46.858 -6.837  1.00 44.18 ? 790 HOH B O     1 
HETATM 5707 O  O     . HOH N 6 .   ? 69.104 37.583 6.305   1.00 38.93 ? 791 HOH B O     1 
HETATM 5708 O  O     . HOH N 6 .   ? 75.177 18.039 13.095  1.00 41.41 ? 792 HOH B O     1 
HETATM 5709 O  O     . HOH N 6 .   ? 45.993 20.931 24.157  1.00 45.06 ? 793 HOH B O     1 
HETATM 5710 O  O     . HOH N 6 .   ? 41.304 19.330 20.596  1.00 48.05 ? 794 HOH B O     1 
HETATM 5711 O  O     . HOH N 6 .   ? 37.167 33.419 -12.014 1.00 44.67 ? 795 HOH B O     1 
HETATM 5712 O  O     . HOH N 6 .   ? 40.751 9.460  -8.041  1.00 47.81 ? 796 HOH B O     1 
HETATM 5713 O  O     . HOH N 6 .   ? 32.724 20.006 12.378  1.00 38.56 ? 797 HOH B O     1 
HETATM 5714 O  O     . HOH N 6 .   ? 27.532 21.157 9.607   1.00 43.41 ? 798 HOH B O     1 
HETATM 5715 O  O     . HOH N 6 .   ? 64.607 40.823 5.237   1.00 47.00 ? 799 HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N     . MSE A 23  ? 0.7131 0.5459 0.5417 -0.0667 -0.1039 -0.1496 -1  MSE A N     
2    C  CA    . MSE A 23  ? 0.6385 0.6228 0.5362 -0.0836 -0.1037 -0.0843 -1  MSE A CA    
3    C  C     . MSE A 23  ? 0.5769 0.5522 0.6281 -0.0815 -0.0443 -0.0044 -1  MSE A C     
4    O  O     . MSE A 23  ? 0.5433 0.6738 0.5915 -0.0523 -0.1389 0.1186  -1  MSE A O     
5    C  CB    . MSE A 23  ? 0.7509 0.6452 0.6818 -0.0483 -0.0996 -0.0340 -1  MSE A CB    
6    C  CG    . MSE A 23  ? 0.8340 0.6679 0.7462 -0.0067 -0.0236 -0.0378 -1  MSE A CG    
7    SE SE    . MSE A 23  ? 0.8021 0.6850 0.6457 -0.0565 0.0296  -0.0964 -1  MSE A SE    
8    C  CE    . MSE A 23  ? 0.7497 0.4278 0.3958 0.0928  -0.1779 -0.1693 -1  MSE A CE    
9    N  N     . THR A 24  ? 0.5659 0.5393 0.6083 -0.0507 0.0138  -0.0559 0   THR A N     
10   C  CA    . THR A 24  ? 0.4790 0.4943 0.5469 -0.1484 -0.0151 -0.0728 0   THR A CA    
11   C  C     . THR A 24  ? 0.4615 0.5852 0.5171 -0.0021 0.0832  -0.0234 0   THR A C     
12   O  O     . THR A 24  ? 0.5910 0.5758 0.5468 0.1037  0.0272  0.0242  0   THR A O     
13   C  CB    . THR A 24  ? 0.5990 0.4767 0.5385 -0.0829 -0.0303 -0.0410 0   THR A CB    
14   O  OG1   . THR A 24  ? 0.6097 0.5524 0.6484 -0.0442 0.0298  -0.0435 0   THR A OG1   
15   C  CG2   . THR A 24  ? 0.7066 0.5768 0.5615 -0.0432 0.0047  0.0884  0   THR A CG2   
16   N  N     . ARG A 25  ? 0.3982 0.4682 0.4067 -0.0596 -0.0107 -0.0648 1   ARG A N     
17   C  CA    . ARG A 25  ? 0.4383 0.3541 0.4307 -0.0142 -0.0144 -0.0415 1   ARG A CA    
18   C  C     . ARG A 25  ? 0.4323 0.3351 0.3890 0.0094  -0.0441 -0.0044 1   ARG A C     
19   O  O     . ARG A 25  ? 0.5278 0.3005 0.4415 0.0365  -0.1246 -0.0514 1   ARG A O     
20   C  CB    . ARG A 25  ? 0.4513 0.3163 0.3866 0.0248  -0.0215 -0.0119 1   ARG A CB    
21   C  CG    . ARG A 25  ? 0.5101 0.3805 0.4308 -0.0273 -0.0140 -0.0361 1   ARG A CG    
22   C  CD    . ARG A 25  ? 0.4656 0.3995 0.5479 -0.0069 0.0219  0.0123  1   ARG A CD    
23   N  NE    . ARG A 25  ? 0.4410 0.3524 0.5534 -0.0300 0.0150  0.0715  1   ARG A NE    
24   C  CZ    . ARG A 25  ? 0.4682 0.4494 0.4933 -0.0350 -0.0523 0.0601  1   ARG A CZ    
25   N  NH1   . ARG A 25  ? 0.4643 0.3767 0.5085 -0.0824 -0.0723 0.0390  1   ARG A NH1   
26   N  NH2   . ARG A 25  ? 0.5563 0.5071 0.5552 -0.1124 -0.0210 0.1605  1   ARG A NH2   
27   N  N     . PHE A 26  ? 0.4337 0.3309 0.2873 0.0230  -0.0382 -0.0268 2   PHE A N     
28   C  CA    . PHE A 26  ? 0.3944 0.2839 0.2861 0.0436  0.0206  -0.0409 2   PHE A CA    
29   C  C     . PHE A 26  ? 0.3473 0.2876 0.2528 0.0508  -0.0264 -0.0332 2   PHE A C     
30   O  O     . PHE A 26  ? 0.4026 0.3220 0.2148 0.0367  -0.0012 -0.0099 2   PHE A O     
31   C  CB    . PHE A 26  ? 0.4462 0.2331 0.2503 0.0350  0.0231  -0.0268 2   PHE A CB    
32   C  CG    . PHE A 26  ? 0.3810 0.2645 0.2739 0.0373  0.0222  -0.0193 2   PHE A CG    
33   C  CD1   . PHE A 26  ? 0.3971 0.3026 0.2890 0.0464  0.0087  -0.0150 2   PHE A CD1   
34   C  CD2   . PHE A 26  ? 0.3792 0.3195 0.2632 0.0504  -0.0128 0.0023  2   PHE A CD2   
35   C  CE1   . PHE A 26  ? 0.4100 0.2854 0.2529 0.0414  -0.0045 -0.0328 2   PHE A CE1   
36   C  CE2   . PHE A 26  ? 0.3888 0.3365 0.2413 0.0494  0.0289  -0.0521 2   PHE A CE2   
37   C  CZ    . PHE A 26  ? 0.4119 0.2943 0.2700 0.0456  -0.0076 -0.0679 2   PHE A CZ    
38   N  N     . ASP A 27  ? 0.3804 0.3120 0.2382 -0.0011 -0.0052 -0.0270 3   ASP A N     
39   C  CA    . ASP A 27  ? 0.3597 0.2611 0.2519 0.0080  0.0074  -0.0611 3   ASP A CA    
40   C  C     . ASP A 27  ? 0.3583 0.2624 0.2238 0.0224  -0.0072 -0.0581 3   ASP A C     
41   O  O     . ASP A 27  ? 0.3727 0.2829 0.2142 0.0510  0.0010  -0.0742 3   ASP A O     
42   C  CB    . ASP A 27  ? 0.3879 0.3116 0.2400 0.0763  0.0383  -0.0531 3   ASP A CB    
43   C  CG    . ASP A 27  ? 0.3818 0.3044 0.2514 0.0455  0.0308  -0.0663 3   ASP A CG    
44   O  OD1   . ASP A 27  ? 0.5095 0.3463 0.2829 0.0373  -0.0164 -0.0946 3   ASP A OD1   
45   O  OD2   . ASP A 27  ? 0.4633 0.3686 0.2779 0.0714  0.0363  0.0275  3   ASP A OD2   
46   N  N     . VAL A 28  ? 0.3426 0.2605 0.2163 -0.0025 0.0058  -0.0401 4   VAL A N     
47   C  CA    . VAL A 28  ? 0.3210 0.2511 0.2243 0.0384  0.0523  -0.0020 4   VAL A CA    
48   C  C     . VAL A 28  ? 0.3116 0.2281 0.2039 0.0117  0.0332  -0.0255 4   VAL A C     
49   O  O     . VAL A 28  ? 0.3298 0.2539 0.2498 0.0527  0.0177  -0.0101 4   VAL A O     
50   C  CB    . VAL A 28  ? 0.3242 0.2762 0.2135 0.0388  0.0458  -0.0131 4   VAL A CB    
51   C  CG1   . VAL A 28  ? 0.3328 0.2544 0.2266 0.0055  0.0233  0.0067  4   VAL A CG1   
52   C  CG2   . VAL A 28  ? 0.3371 0.2950 0.1830 -0.0045 0.0446  0.0528  4   VAL A CG2   
53   N  N     . LEU A 29  ? 0.2965 0.2516 0.1941 -0.0059 0.0200  -0.0065 5   LEU A N     
54   C  CA    . LEU A 29  ? 0.2687 0.2430 0.2332 -0.0044 0.0352  -0.0210 5   LEU A CA    
55   C  C     . LEU A 29  ? 0.2826 0.2355 0.2147 0.0158  0.0164  -0.0131 5   LEU A C     
56   O  O     . LEU A 29  ? 0.3129 0.2157 0.2348 0.0185  -0.0202 -0.0077 5   LEU A O     
57   C  CB    . LEU A 29  ? 0.2846 0.2430 0.2474 -0.0359 0.0256  -0.0326 5   LEU A CB    
58   C  CG    . LEU A 29  ? 0.2844 0.2404 0.2239 0.0080  0.0116  -0.0020 5   LEU A CG    
59   C  CD1   . LEU A 29  ? 0.2897 0.2655 0.1981 0.0152  0.0108  -0.0339 5   LEU A CD1   
60   C  CD2   . LEU A 29  ? 0.2820 0.3220 0.2883 0.0109  0.0062  -0.0633 5   LEU A CD2   
61   N  N     . THR A 30  ? 0.2640 0.2268 0.2398 -0.0119 -0.0026 -0.0512 6   THR A N     
62   C  CA    . THR A 30  ? 0.2425 0.2060 0.2171 0.0278  0.0181  -0.0439 6   THR A CA    
63   C  C     . THR A 30  ? 0.2314 0.2482 0.2133 0.0112  0.0304  -0.0244 6   THR A C     
64   O  O     . THR A 30  ? 0.2672 0.2324 0.2426 -0.0010 0.0294  -0.0190 6   THR A O     
65   C  CB    . THR A 30  ? 0.2212 0.2122 0.2136 0.0336  0.0373  -0.0026 6   THR A CB    
66   O  OG1   . THR A 30  ? 0.2360 0.2453 0.1949 0.0102  0.0151  -0.0022 6   THR A OG1   
67   C  CG2   . THR A 30  ? 0.2500 0.2681 0.1864 0.0344  0.0444  -0.0171 6   THR A CG2   
68   N  N     . VAL A 31  ? 0.2421 0.2506 0.2250 0.0053  0.0361  -0.0239 7   VAL A N     
69   C  CA    . VAL A 31  ? 0.2396 0.2164 0.2043 0.0240  0.0162  -0.0134 7   VAL A CA    
70   C  C     . VAL A 31  ? 0.2755 0.2265 0.2013 0.0014  0.0196  -0.0094 7   VAL A C     
71   O  O     . VAL A 31  ? 0.2515 0.2151 0.2211 0.0049  0.0184  -0.0075 7   VAL A O     
72   C  CB    . VAL A 31  ? 0.2162 0.2028 0.2335 0.0122  0.0113  -0.0236 7   VAL A CB    
73   C  CG1   . VAL A 31  ? 0.2611 0.2153 0.2646 0.0196  0.0522  -0.0155 7   VAL A CG1   
74   C  CG2   . VAL A 31  ? 0.2055 0.2400 0.2284 0.0035  0.0034  -0.0342 7   VAL A CG2   
75   N  N     . GLY A 32  ? 0.2117 0.2663 0.2013 0.0065  0.0134  -0.0348 8   GLY A N     
76   C  CA    . GLY A 32  ? 0.2412 0.2250 0.1861 0.0035  0.0488  -0.0188 8   GLY A CA    
77   C  C     . GLY A 32  ? 0.2311 0.2427 0.1597 -0.0143 0.0094  0.0344  8   GLY A C     
78   O  O     . GLY A 32  ? 0.1925 0.2659 0.2476 -0.0366 0.0422  -0.0115 8   GLY A O     
79   N  N     . ASN A 33  ? 0.2241 0.2503 0.1656 -0.0039 0.0452  0.0022  9   ASN A N     
80   C  CA    . ASN A 33  ? 0.1977 0.1996 0.1736 -0.0002 0.0365  -0.0119 9   ASN A CA    
81   C  C     . ASN A 33  ? 0.1808 0.2340 0.2133 -0.0066 0.0207  0.0098  9   ASN A C     
82   O  O     . ASN A 33  ? 0.1790 0.2673 0.2142 -0.0001 0.0248  0.0163  9   ASN A O     
83   C  CB    . ASN A 33  ? 0.1968 0.2004 0.1793 0.0037  0.0549  -0.0175 9   ASN A CB    
84   C  CG    . ASN A 33  ? 0.1981 0.2096 0.2214 -0.0117 0.0167  -0.0048 9   ASN A CG    
85   O  OD1   . ASN A 33  ? 0.1976 0.2614 0.2253 0.0188  0.0478  0.0247  9   ASN A OD1   
86   N  ND2   . ASN A 33  ? 0.1855 0.2275 0.2473 -0.0036 0.0539  0.0075  9   ASN A ND2   
87   N  N     . ALA A 34  ? 0.2187 0.2272 0.2003 0.0102  0.0377  0.0170  10  ALA A N     
88   C  CA    . ALA A 34  ? 0.2068 0.2171 0.1878 -0.0104 0.0195  0.0091  10  ALA A CA    
89   C  C     . ALA A 34  ? 0.1877 0.2206 0.2145 -0.0043 0.0149  -0.0150 10  ALA A C     
90   O  O     . ALA A 34  ? 0.2167 0.2648 0.2178 -0.0062 0.0489  -0.0059 10  ALA A O     
91   C  CB    . ALA A 34  ? 0.1904 0.2257 0.2299 0.0144  0.0802  0.0359  10  ALA A CB    
92   N  N     . ILE A 35  ? 0.1840 0.2099 0.2310 -0.0129 0.0170  0.0001  11  ILE A N     
93   C  CA    . ILE A 35  ? 0.1991 0.1892 0.2066 -0.0080 0.0193  0.0224  11  ILE A CA    
94   C  C     . ILE A 35  ? 0.1793 0.2384 0.2040 0.0015  0.0021  -0.0014 11  ILE A C     
95   O  O     . ILE A 35  ? 0.2211 0.2490 0.2068 0.0057  0.0339  0.0012  11  ILE A O     
96   C  CB    . ILE A 35  ? 0.2329 0.1911 0.1969 -0.0023 0.0217  0.0364  11  ILE A CB    
97   C  CG1   . ILE A 35  ? 0.2201 0.1967 0.1904 0.0010  0.0377  0.0234  11  ILE A CG1   
98   C  CG2   . ILE A 35  ? 0.2077 0.2201 0.1927 -0.0181 0.0444  0.0298  11  ILE A CG2   
99   C  CD1   . ILE A 35  ? 0.2374 0.2210 0.1980 -0.0026 0.0376  0.0364  11  ILE A CD1   
100  N  N     . VAL A 36  ? 0.1612 0.1924 0.1922 -0.0111 0.0227  0.0055  12  VAL A N     
101  C  CA    . VAL A 36  ? 0.2074 0.2153 0.1881 0.0063  0.0138  0.0325  12  VAL A CA    
102  C  C     . VAL A 36  ? 0.1962 0.1892 0.1916 0.0173  0.0407  0.0104  12  VAL A C     
103  O  O     . VAL A 36  ? 0.1946 0.2097 0.1844 0.0090  0.0714  -0.0031 12  VAL A O     
104  C  CB    . VAL A 36  ? 0.2199 0.2233 0.2000 -0.0276 0.0282  0.0328  12  VAL A CB    
105  C  CG1   . VAL A 36  ? 0.2129 0.2667 0.2459 -0.0007 0.0297  0.0260  12  VAL A CG1   
106  C  CG2   . VAL A 36  ? 0.2109 0.2111 0.2457 -0.0302 0.0699  0.0395  12  VAL A CG2   
107  N  N     . ASP A 37  ? 0.1785 0.2368 0.2011 0.0138  0.0132  -0.0069 13  ASP A N     
108  C  CA    . ASP A 37  ? 0.2414 0.2167 0.1706 -0.0006 0.0298  -0.0230 13  ASP A CA    
109  C  C     . ASP A 37  ? 0.1860 0.1948 0.1957 0.0165  0.0163  0.0013  13  ASP A C     
110  O  O     . ASP A 37  ? 0.1836 0.2069 0.2277 0.0205  0.0324  0.0102  13  ASP A O     
111  C  CB    . ASP A 37  ? 0.1976 0.2249 0.1935 0.0129  0.0191  -0.0297 13  ASP A CB    
112  C  CG    . ASP A 37  ? 0.2253 0.2461 0.2055 0.0025  0.0334  0.0296  13  ASP A CG    
113  O  OD1   . ASP A 37  ? 0.2369 0.2934 0.2238 0.0294  0.0689  0.0336  13  ASP A OD1   
114  O  OD2   . ASP A 37  ? 0.2927 0.2829 0.2493 0.0359  0.0613  -0.0139 13  ASP A OD2   
115  N  N     . ILE A 38  ? 0.1763 0.2064 0.1899 -0.0172 0.0500  -0.0056 14  ILE A N     
116  C  CA    . ILE A 38  ? 0.2058 0.1992 0.1984 -0.0149 0.0377  -0.0140 14  ILE A CA    
117  C  C     . ILE A 38  ? 0.1796 0.1937 0.2283 -0.0021 0.0289  -0.0131 14  ILE A C     
118  O  O     . ILE A 38  ? 0.1959 0.2107 0.2135 -0.0032 0.0491  0.0213  14  ILE A O     
119  C  CB    . ILE A 38  ? 0.1852 0.2370 0.1856 -0.0087 0.0368  -0.0032 14  ILE A CB    
120  C  CG1   . ILE A 38  ? 0.1657 0.3046 0.2504 -0.0076 0.0477  -0.0196 14  ILE A CG1   
121  C  CG2   . ILE A 38  ? 0.2006 0.2581 0.2071 -0.0041 0.0238  -0.0340 14  ILE A CG2   
122  C  CD1   . ILE A 38  ? 0.2976 0.2720 0.2548 0.0599  0.0667  -0.0166 14  ILE A CD1   
123  N  N     . ILE A 39  ? 0.1829 0.2226 0.2124 0.0100  0.0475  -0.0195 15  ILE A N     
124  C  CA    . ILE A 39  ? 0.2378 0.2151 0.1983 -0.0316 0.0369  0.0191  15  ILE A CA    
125  C  C     . ILE A 39  ? 0.1931 0.2278 0.2111 -0.0081 0.0497  0.0167  15  ILE A C     
126  O  O     . ILE A 39  ? 0.1870 0.2608 0.2285 0.0052  0.0525  0.0380  15  ILE A O     
127  C  CB    . ILE A 39  ? 0.1949 0.2357 0.2404 -0.0273 0.0583  0.0060  15  ILE A CB    
128  C  CG1   . ILE A 39  ? 0.2259 0.2686 0.2645 -0.0018 0.0396  -0.0295 15  ILE A CG1   
129  C  CG2   . ILE A 39  ? 0.2058 0.2550 0.2048 -0.0368 0.0554  0.0020  15  ILE A CG2   
130  C  CD1   . ILE A 39  ? 0.2602 0.3316 0.2952 -0.0048 0.0634  -0.0954 15  ILE A CD1   
131  N  N     . SER A 40  ? 0.2009 0.2463 0.2226 -0.0333 0.0619  0.0150  16  SER A N     
132  C  CA    . SER A 40  ? 0.2403 0.2498 0.2522 -0.0118 0.0254  0.0129  16  SER A CA    
133  C  C     . SER A 40  ? 0.2227 0.2623 0.2666 -0.0015 0.0092  0.0464  16  SER A C     
134  O  O     . SER A 40  ? 0.1753 0.3317 0.2781 0.0054  0.0054  0.0563  16  SER A O     
135  C  CB    . SER A 40  ? 0.2926 0.3325 0.2954 0.0027  0.0452  -0.0360 16  SER A CB    
136  O  OG    . SER A 40  ? 0.3430 0.4813 0.3238 -0.0261 0.0285  -0.0520 16  SER A OG    
137  N  N     . ARG A 41  ? 0.2511 0.2907 0.3336 -0.0374 -0.0121 0.0340  17  ARG A N     
138  C  CA    . ARG A 41  ? 0.2604 0.2834 0.3295 -0.0200 0.0023  0.0317  17  ARG A CA    
139  C  C     . ARG A 41  ? 0.3321 0.2816 0.3004 -0.0406 0.0275  0.0417  17  ARG A C     
140  O  O     . ARG A 41  ? 0.4599 0.3457 0.2756 -0.0633 0.0070  0.0270  17  ARG A O     
141  C  CB    . ARG A 41  ? 0.2316 0.4011 0.4632 -0.0172 -0.0398 -0.0429 17  ARG A CB    
142  C  CG    . ARG A 41  ? 0.4844 0.4105 0.6016 0.0601  0.0499  -0.0793 17  ARG A CG    
143  C  CD    . ARG A 41  ? 0.6348 0.5428 0.6039 0.1133  0.0622  -0.0323 17  ARG A CD    
144  N  NE    . ARG A 41  ? 0.6488 0.7083 0.6453 0.0546  0.0534  0.0053  17  ARG A NE    
145  C  CZ    . ARG A 41  ? 0.7178 0.6325 0.6358 0.0437  0.0493  -0.0708 17  ARG A CZ    
146  N  NH1   . ARG A 41  ? 0.6292 0.3756 0.7332 0.1006  0.1010  -0.1450 17  ARG A NH1   
147  N  NH2   . ARG A 41  ? 0.7016 0.6186 0.6390 0.0457  0.0373  -0.0633 17  ARG A NH2   
148  N  N     . CYS A 42  ? 0.1851 0.2484 0.2807 -0.0518 0.0281  -0.0025 18  CYS A N     
149  C  CA    . CYS A 42  ? 0.1970 0.2624 0.2713 -0.0359 -0.0006 -0.0098 18  CYS A CA    
150  C  C     . CYS A 42  ? 0.2444 0.3119 0.2614 -0.0394 0.0533  -0.0128 18  CYS A C     
151  O  O     . CYS A 42  ? 0.2308 0.3142 0.2442 -0.0427 0.0770  0.0369  18  CYS A O     
152  C  CB    . CYS A 42  ? 0.2217 0.2676 0.2844 -0.0232 -0.0058 -0.0226 18  CYS A CB    
153  S  SG    . CYS A 42  ? 0.2557 0.2985 0.2823 -0.0236 0.0260  0.0179  18  CYS A SG    
154  N  N     . ASN A 43  ? 0.2386 0.2876 0.3582 -0.0398 0.0503  -0.0200 19  ASN A N     
155  C  CA    . ASN A 43  ? 0.3455 0.3334 0.3776 -0.0563 0.0672  0.0271  19  ASN A CA    
156  C  C     . ASN A 43  ? 0.3132 0.3330 0.3418 -0.0524 0.0601  0.0064  19  ASN A C     
157  O  O     . ASN A 43  ? 0.3096 0.2733 0.3158 -0.0418 0.0821  -0.0300 19  ASN A O     
158  C  CB    . ASN A 43  ? 0.3196 0.4224 0.4573 -0.0204 0.0332  -0.0208 19  ASN A CB    
159  C  CG    . ASN A 43  ? 0.3530 0.3889 0.4066 -0.0274 -0.0208 -0.0417 19  ASN A CG    
160  O  OD1   . ASN A 43  ? 0.3289 0.3859 0.3816 -0.0351 0.0236  -0.0355 19  ASN A OD1   
161  N  ND2   . ASN A 43  ? 0.3531 0.5295 0.4508 -0.0213 -0.0494 -0.0645 19  ASN A ND2   
162  N  N     . ASP A 44  ? 0.3734 0.3261 0.3573 -0.0437 0.1145  -0.0006 20  ASP A N     
163  C  CA    . ASP A 44  ? 0.3361 0.3854 0.3608 -0.0273 0.1121  0.0167  20  ASP A CA    
164  C  C     . ASP A 44  ? 0.3076 0.3109 0.2972 -0.0581 0.0490  0.0087  20  ASP A C     
165  O  O     . ASP A 44  ? 0.2895 0.3499 0.3339 -0.0621 0.0597  0.0046  20  ASP A O     
166  C  CB    . ASP A 44  ? 0.3904 0.3374 0.4247 -0.1045 0.1097  -0.0117 20  ASP A CB    
167  C  CG    . ASP A 44  ? 0.3830 0.4378 0.4474 -0.0455 0.1037  0.0008  20  ASP A CG    
168  O  OD1   . ASP A 44  ? 0.3650 0.4890 0.4286 -0.0977 0.1240  0.0081  20  ASP A OD1   
169  O  OD2   . ASP A 44  ? 0.4097 0.5243 0.4751 -0.0490 0.1362  0.0373  20  ASP A OD2   
170  N  N     . GLN A 45  ? 0.2680 0.3083 0.3124 -0.0788 0.0709  -0.0115 21  GLN A N     
171  C  CA    . GLN A 45  ? 0.2500 0.3173 0.3254 -0.0583 0.0456  -0.0151 21  GLN A CA    
172  C  C     . GLN A 45  ? 0.2422 0.2441 0.2789 -0.0392 0.0398  -0.0282 21  GLN A C     
173  O  O     . GLN A 45  ? 0.2567 0.2922 0.2987 -0.0176 0.0621  -0.0355 21  GLN A O     
174  C  CB    . GLN A 45  ? 0.2637 0.3977 0.3247 -0.0492 0.0246  -0.0226 21  GLN A CB    
175  C  CG    . GLN A 45  ? 0.3461 0.4052 0.3899 -0.0257 0.0621  -0.0109 21  GLN A CG    
176  C  CD    . GLN A 45  ? 0.4689 0.3681 0.5315 -0.0895 0.0673  0.0478  21  GLN A CD    
177  O  OE1   . GLN A 45  ? 0.5851 0.4314 0.6726 -0.0208 0.0475  0.1342  21  GLN A OE1   
178  N  NE2   . GLN A 45  ? 0.4700 0.4520 0.5290 -0.1285 0.0687  -0.0507 21  GLN A NE2   
179  N  N     . PHE A 46  ? 0.2529 0.2582 0.2799 -0.0556 0.0272  -0.0175 22  PHE A N     
180  C  CA    . PHE A 46  ? 0.2501 0.2318 0.2272 -0.0349 0.0371  -0.0160 22  PHE A CA    
181  C  C     . PHE A 46  ? 0.2675 0.2292 0.2305 -0.0282 0.0216  -0.0232 22  PHE A C     
182  O  O     . PHE A 46  ? 0.2682 0.2383 0.2735 -0.0022 0.0149  -0.0280 22  PHE A O     
183  C  CB    . PHE A 46  ? 0.2743 0.2427 0.2479 -0.0243 0.0351  0.0011  22  PHE A CB    
184  C  CG    . PHE A 46  ? 0.2533 0.2593 0.2462 -0.0144 0.0183  0.0236  22  PHE A CG    
185  C  CD1   . PHE A 46  ? 0.2523 0.2324 0.2410 -0.0448 0.0396  0.0350  22  PHE A CD1   
186  C  CD2   . PHE A 46  ? 0.2521 0.3185 0.2459 -0.0255 0.0231  0.0033  22  PHE A CD2   
187  C  CE1   . PHE A 46  ? 0.2284 0.2561 0.2597 -0.0287 0.0493  0.0204  22  PHE A CE1   
188  C  CE2   . PHE A 46  ? 0.2773 0.2923 0.2577 -0.0345 0.0408  -0.0017 22  PHE A CE2   
189  C  CZ    . PHE A 46  ? 0.2462 0.2857 0.2562 -0.0353 0.0415  0.0181  22  PHE A CZ    
190  N  N     . LEU A 47  ? 0.2914 0.2322 0.2245 -0.0057 0.0176  -0.0098 23  LEU A N     
191  C  CA    . LEU A 47  ? 0.2886 0.2477 0.1817 -0.0140 0.0320  -0.0304 23  LEU A CA    
192  C  C     . LEU A 47  ? 0.2591 0.2424 0.2559 -0.0285 0.0223  -0.0069 23  LEU A C     
193  O  O     . LEU A 47  ? 0.2708 0.2831 0.2308 0.0013  0.0396  0.0186  23  LEU A O     
194  C  CB    . LEU A 47  ? 0.3086 0.2214 0.1808 -0.0263 0.0557  -0.0054 23  LEU A CB    
195  C  CG    . LEU A 47  ? 0.2544 0.2333 0.1953 -0.0187 0.0609  -0.0148 23  LEU A CG    
196  C  CD1   . LEU A 47  ? 0.2629 0.2709 0.1975 -0.0167 0.0839  -0.0025 23  LEU A CD1   
197  C  CD2   . LEU A 47  ? 0.1861 0.2308 0.3258 -0.0130 0.0114  -0.0301 23  LEU A CD2   
198  N  N     . ILE A 48  ? 0.2855 0.2484 0.2634 -0.0571 0.0492  0.0050  24  ILE A N     
199  C  CA    . ILE A 48  ? 0.3263 0.2702 0.2652 -0.0157 0.0365  -0.0228 24  ILE A CA    
200  C  C     . ILE A 48  ? 0.3444 0.2682 0.2448 -0.0075 0.0216  -0.0145 24  ILE A C     
201  O  O     . ILE A 48  ? 0.3338 0.3026 0.3227 -0.0153 0.0289  -0.0104 24  ILE A O     
202  C  CB    . ILE A 48  ? 0.3427 0.2934 0.3117 -0.0247 0.0345  -0.0076 24  ILE A CB    
203  C  CG1   . ILE A 48  ? 0.3580 0.2997 0.3213 -0.0295 0.0614  0.0058  24  ILE A CG1   
204  C  CG2   . ILE A 48  ? 0.4190 0.2855 0.3442 -0.0245 0.0415  -0.0046 24  ILE A CG2   
205  C  CD1   . ILE A 48  ? 0.3549 0.3664 0.3665 -0.0062 0.0691  -0.0235 24  ILE A CD1   
206  N  N     . ASP A 49  ? 0.3164 0.2388 0.2547 -0.0098 0.0184  -0.0233 25  ASP A N     
207  C  CA    . ASP A 49  ? 0.3199 0.2463 0.2440 -0.0041 0.0084  -0.0212 25  ASP A CA    
208  C  C     . ASP A 49  ? 0.3132 0.2444 0.2855 -0.0041 -0.0028 -0.0346 25  ASP A C     
209  O  O     . ASP A 49  ? 0.3425 0.2914 0.2945 0.0169  0.0029  -0.0525 25  ASP A O     
210  C  CB    . ASP A 49  ? 0.3019 0.2574 0.2603 -0.0100 -0.0043 -0.0231 25  ASP A CB    
211  C  CG    . ASP A 49  ? 0.3066 0.3303 0.3000 -0.0256 0.0019  -0.0165 25  ASP A CG    
212  O  OD1   . ASP A 49  ? 0.3300 0.3630 0.3252 -0.0658 0.0630  -0.0101 25  ASP A OD1   
213  O  OD2   . ASP A 49  ? 0.3305 0.3882 0.2504 0.0138  -0.0025 -0.0657 25  ASP A OD2   
214  N  N     . ASN A 50  ? 0.2578 0.2517 0.2321 -0.0205 -0.0068 -0.0139 26  ASN A N     
215  C  CA    . ASN A 50  ? 0.2598 0.2548 0.2764 -0.0237 -0.0005 -0.0376 26  ASN A CA    
216  C  C     . ASN A 50  ? 0.3176 0.2308 0.2412 0.0227  0.0101  -0.0536 26  ASN A C     
217  O  O     . ASN A 50  ? 0.3184 0.2698 0.2967 0.0230  -0.0140 -0.0528 26  ASN A O     
218  C  CB    . ASN A 50  ? 0.2575 0.2761 0.2314 -0.0103 -0.0061 0.0000  26  ASN A CB    
219  C  CG    . ASN A 50  ? 0.2558 0.2949 0.2231 0.0048  0.0099  0.0089  26  ASN A CG    
220  O  OD1   . ASN A 50  ? 0.3577 0.3467 0.2762 -0.0188 0.0811  -0.0383 26  ASN A OD1   
221  N  ND2   . ASN A 50  ? 0.2546 0.3155 0.2300 0.0211  0.0404  -0.0197 26  ASN A ND2   
222  N  N     . GLN A 51  ? 0.3798 0.2724 0.2336 0.0047  -0.0052 -0.0343 27  GLN A N     
223  C  CA    . GLN A 51  ? 0.3734 0.3175 0.2749 -0.0053 -0.0417 -0.0240 27  GLN A CA    
224  C  C     . GLN A 51  ? 0.3310 0.2778 0.2752 0.0417  -0.0001 -0.0371 27  GLN A C     
225  O  O     . GLN A 51  ? 0.3105 0.3256 0.3351 0.0361  0.0380  -0.0808 27  GLN A O     
226  C  CB    . GLN A 51  ? 0.4008 0.3708 0.3205 0.0156  -0.0368 -0.0706 27  GLN A CB    
227  C  CG    . GLN A 51  ? 0.5532 0.4068 0.4071 0.0116  -0.0103 -0.1528 27  GLN A CG    
228  C  CD    . GLN A 51  ? 0.6255 0.5270 0.5436 0.0507  0.0714  -0.1781 27  GLN A CD    
229  O  OE1   . GLN A 51  ? 0.5841 0.5680 0.6826 0.0898  0.0656  -0.1107 27  GLN A OE1   
230  N  NE2   . GLN A 51  ? 0.7733 0.5470 0.4437 0.0319  0.0895  -0.1567 27  GLN A NE2   
231  N  N     . ILE A 52  ? 0.2660 0.2317 0.2054 -0.0127 0.0270  -0.0155 28  ILE A N     
232  C  CA    . ILE A 52  ? 0.2817 0.2309 0.2005 -0.0107 0.0379  -0.0159 28  ILE A CA    
233  C  C     . ILE A 52  ? 0.2476 0.2303 0.1995 -0.0119 0.0295  -0.0100 28  ILE A C     
234  O  O     . ILE A 52  ? 0.2583 0.3082 0.2139 -0.0405 0.0141  0.0016  28  ILE A O     
235  C  CB    . ILE A 52  ? 0.2770 0.2262 0.1967 -0.0118 0.0258  -0.0288 28  ILE A CB    
236  C  CG1   . ILE A 52  ? 0.2888 0.2595 0.2324 -0.0062 0.0374  0.0261  28  ILE A CG1   
237  C  CG2   . ILE A 52  ? 0.2784 0.2242 0.2210 -0.0121 0.0377  -0.0418 28  ILE A CG2   
238  C  CD1   . ILE A 52  ? 0.2476 0.2436 0.2446 -0.0125 0.0408  0.0112  28  ILE A CD1   
239  N  N     . THR A 53  ? 0.2293 0.2429 0.2035 0.0090  0.0441  0.0109  29  THR A N     
240  C  CA    . THR A 53  ? 0.2972 0.2414 0.2018 -0.0036 0.0471  0.0200  29  THR A CA    
241  C  C     . THR A 53  ? 0.2595 0.2578 0.1738 -0.0086 0.0338  0.0006  29  THR A C     
242  O  O     . THR A 53  ? 0.2413 0.2494 0.1968 -0.0035 0.0517  -0.0074 29  THR A O     
243  C  CB    . THR A 53  ? 0.2826 0.2626 0.2443 0.0107  0.0465  0.0292  29  THR A CB    
244  O  OG1   . THR A 53  ? 0.2616 0.2934 0.2674 0.0204  0.0484  0.0109  29  THR A OG1   
245  C  CG2   . THR A 53  ? 0.3115 0.2531 0.2454 -0.0012 0.0513  0.0487  29  THR A CG2   
246  N  N     . LYS A 54  ? 0.2627 0.2788 0.2332 -0.0100 0.0326  0.0009  30  LYS A N     
247  C  CA    . LYS A 54  ? 0.2393 0.2591 0.2206 -0.0284 0.0270  -0.0025 30  LYS A CA    
248  C  C     . LYS A 54  ? 0.2030 0.2329 0.2454 -0.0253 0.0113  -0.0123 30  LYS A C     
249  O  O     . LYS A 54  ? 0.2539 0.2846 0.2421 0.0000  0.0229  0.0047  30  LYS A O     
250  C  CB    . LYS A 54  ? 0.2404 0.2888 0.2815 -0.0386 0.0184  -0.0144 30  LYS A CB    
251  C  CG    . LYS A 54  ? 0.2828 0.2681 0.3053 -0.0283 0.0541  0.0002  30  LYS A CG    
252  C  CD    . LYS A 54  ? 0.2795 0.2844 0.2870 -0.0324 0.0498  -0.0127 30  LYS A CD    
253  C  CE    . LYS A 54  ? 0.2645 0.3152 0.2745 -0.0201 0.0594  0.0261  30  LYS A CE    
254  N  NZ    . LYS A 54  ? 0.2692 0.3658 0.2644 -0.0256 0.0705  -0.0166 30  LYS A NZ    
255  N  N     . ALA A 55  ? 0.1910 0.2313 0.2759 -0.0507 0.0553  -0.0198 31  ALA A N     
256  C  CA    . ALA A 55  ? 0.2231 0.2554 0.2420 -0.0476 0.0506  -0.0101 31  ALA A CA    
257  C  C     . ALA A 55  ? 0.2394 0.2502 0.2432 0.0046  0.0048  -0.0156 31  ALA A C     
258  O  O     . ALA A 55  ? 0.3179 0.2754 0.2212 -0.0183 0.0354  -0.0242 31  ALA A O     
259  C  CB    . ALA A 55  ? 0.2460 0.2901 0.2218 -0.0156 0.0734  -0.0286 31  ALA A CB    
260  N  N     . ALA A 56  ? 0.2267 0.2704 0.2217 -0.0510 0.0361  -0.0114 32  ALA A N     
261  C  CA    . ALA A 56  ? 0.2289 0.2294 0.2047 -0.0023 0.0390  -0.0164 32  ALA A CA    
262  C  C     . ALA A 56  ? 0.2185 0.2257 0.2123 0.0131  0.0159  0.0153  32  ALA A C     
263  O  O     . ALA A 56  ? 0.2194 0.2510 0.2052 0.0057  0.0280  0.0225  32  ALA A O     
264  C  CB    . ALA A 56  ? 0.2628 0.2512 0.2636 0.0348  0.0389  -0.0117 32  ALA A CB    
265  N  N     . MSE A 57  ? 0.2195 0.2321 0.2574 -0.0248 0.0206  0.0192  33  MSE A N     
266  C  CA    . MSE A 57  ? 0.2687 0.2185 0.1942 -0.0248 0.0215  0.0210  33  MSE A CA    
267  C  C     . MSE A 57  ? 0.2429 0.2458 0.2075 -0.0120 0.0251  0.0188  33  MSE A C     
268  O  O     . MSE A 57  ? 0.2480 0.2432 0.2086 -0.0013 0.0399  0.0021  33  MSE A O     
269  C  CB    . MSE A 57  ? 0.2387 0.2332 0.2320 -0.0173 0.0013  0.0216  33  MSE A CB    
270  C  CG    . MSE A 57  ? 0.2963 0.2390 0.2505 -0.0333 -0.0304 0.0539  33  MSE A CG    
271  SE SE    . MSE A 57  ? 0.4280 0.4113 0.3738 0.0305  0.0007  -0.0035 33  MSE A SE    
272  C  CE    . MSE A 57  ? 0.2362 0.2529 0.3135 -0.0173 0.0316  -0.0036 33  MSE A CE    
273  N  N     . ASN A 58  ? 0.2646 0.2092 0.2132 0.0009  -0.0023 0.0011  34  ASN A N     
274  C  CA    . ASN A 58  ? 0.2468 0.2172 0.2072 -0.0226 0.0248  0.0026  34  ASN A CA    
275  C  C     . ASN A 58  ? 0.2493 0.2154 0.2059 0.0068  0.0484  0.0034  34  ASN A C     
276  O  O     . ASN A 58  ? 0.2213 0.2412 0.2164 0.0208  0.0647  0.0238  34  ASN A O     
277  C  CB    . ASN A 58  ? 0.2420 0.1990 0.2144 -0.0175 0.0257  -0.0242 34  ASN A CB    
278  C  CG    . ASN A 58  ? 0.2527 0.2540 0.2467 -0.0117 0.0307  0.0166  34  ASN A CG    
279  O  OD1   . ASN A 58  ? 0.3523 0.2586 0.2497 0.0055  0.0421  -0.0188 34  ASN A OD1   
280  N  ND2   . ASN A 58  ? 0.2672 0.2288 0.2444 0.0068  -0.0116 0.0161  34  ASN A ND2   
281  N  N     . LEU A 59  ? 0.2316 0.2115 0.2213 0.0067  0.0567  -0.0316 35  LEU A N     
282  C  CA    . LEU A 59  ? 0.2195 0.1808 0.2091 0.0148  0.0272  0.0039  35  LEU A CA    
283  C  C     . LEU A 59  ? 0.2672 0.2264 0.1961 0.0192  0.0378  0.0090  35  LEU A C     
284  O  O     . LEU A 59  ? 0.3093 0.2470 0.2655 0.0074  0.0602  -0.0134 35  LEU A O     
285  C  CB    . LEU A 59  ? 0.2628 0.2189 0.2120 0.0404  -0.0050 -0.0152 35  LEU A CB    
286  C  CG    . LEU A 59  ? 0.2787 0.2665 0.2291 0.0506  0.0041  -0.0475 35  LEU A CG    
287  C  CD1   . LEU A 59  ? 0.2764 0.3923 0.2754 0.0814  -0.0008 -0.0361 35  LEU A CD1   
288  C  CD2   . LEU A 59  ? 0.2943 0.2932 0.2274 0.0366  0.0684  -0.0210 35  LEU A CD2   
289  N  N     . ILE A 60  ? 0.2290 0.2134 0.2166 0.0396  0.0316  0.0245  36  ILE A N     
290  C  CA    . ILE A 60  ? 0.2318 0.2676 0.2197 0.0034  0.0410  0.0081  36  ILE A CA    
291  C  C     . ILE A 60  ? 0.2127 0.2652 0.2786 -0.0040 0.0399  -0.0154 36  ILE A C     
292  O  O     . ILE A 60  ? 0.2163 0.2612 0.2549 0.0266  0.0462  -0.0279 36  ILE A O     
293  C  CB    . ILE A 60  ? 0.2510 0.2200 0.1948 0.0007  0.0347  0.0135  36  ILE A CB    
294  C  CG1   . ILE A 60  ? 0.2487 0.2234 0.2350 0.0516  0.0133  0.0041  36  ILE A CG1   
295  C  CG2   . ILE A 60  ? 0.2879 0.3013 0.2166 -0.0361 0.0714  0.0033  36  ILE A CG2   
296  C  CD1   . ILE A 60  ? 0.2500 0.2618 0.2431 0.0473  -0.0037 -0.0137 36  ILE A CD1   
297  N  N     . ASP A 61  ? 0.2395 0.2933 0.2514 0.0294  0.0714  0.0285  37  ASP A N     
298  C  CA    . ASP A 61  ? 0.2217 0.2752 0.2608 0.0317  0.0617  0.0205  37  ASP A CA    
299  C  C     . ASP A 61  ? 0.2376 0.3253 0.2766 0.0247  0.0267  0.0324  37  ASP A C     
300  O  O     . ASP A 61  ? 0.2296 0.2934 0.2681 0.0117  0.0559  0.0174  37  ASP A O     
301  C  CB    . ASP A 61  ? 0.2843 0.2538 0.2578 0.0450  0.0676  0.0090  37  ASP A CB    
302  C  CG    . ASP A 61  ? 0.3104 0.2611 0.3379 0.0618  0.0226  -0.0118 37  ASP A CG    
303  O  OD1   . ASP A 61  ? 0.2950 0.3390 0.3061 0.0561  0.0526  0.0016  37  ASP A OD1   
304  O  OD2   . ASP A 61  ? 0.3401 0.3081 0.4480 0.1154  0.0718  -0.1003 37  ASP A OD2   
305  N  N     . ALA A 62  ? 0.2745 0.3227 0.2462 0.0405  0.0652  0.0029  38  ALA A N     
306  C  CA    . ALA A 62  ? 0.2731 0.3563 0.2979 0.0121  0.0271  0.0386  38  ALA A CA    
307  C  C     . ALA A 62  ? 0.2625 0.3303 0.2882 0.0188  0.0690  0.0119  38  ALA A C     
308  O  O     . ALA A 62  ? 0.2751 0.3798 0.2759 0.0417  0.0656  -0.0102 38  ALA A O     
309  C  CB    . ALA A 62  ? 0.3253 0.3131 0.3107 0.0134  0.0739  0.0479  38  ALA A CB    
310  N  N     . GLU A 63  ? 0.2438 0.3362 0.3183 0.0055  0.1307  -0.0009 39  GLU A N     
311  C  CA    . GLU A 63  ? 0.2416 0.3347 0.3606 0.0496  0.0903  -0.0162 39  GLU A CA    
312  C  C     . GLU A 63  ? 0.2459 0.3177 0.2809 0.0366  0.0701  0.0116  39  GLU A C     
313  O  O     . GLU A 63  ? 0.2776 0.3370 0.2847 0.0488  0.0612  0.0079  39  GLU A O     
314  C  CB    . GLU A 63  ? 0.3638 0.3534 0.3663 0.0941  0.0647  -0.0629 39  GLU A CB    
315  C  CG    . GLU A 63  ? 0.4177 0.4508 0.4330 -0.0067 0.0673  -0.0817 39  GLU A CG    
316  C  CD    . GLU A 63  ? 0.4342 0.2796 0.2331 -0.1676 -0.0352 -0.1516 39  GLU A CD    
317  O  OE1   . GLU A 63  ? 0.4948 0.6205 0.5072 0.0138  -0.0284 -0.0588 39  GLU A OE1   
318  O  OE2   . GLU A 63  ? 0.6962 0.4404 0.4127 -0.2580 -0.0495 -0.2382 39  GLU A OE2   
319  N  N     . ARG A 64  ? 0.2485 0.2839 0.2595 0.0660  0.0932  -0.0328 40  ARG A N     
320  C  CA    . ARG A 64  ? 0.2501 0.2570 0.1970 0.0280  0.0630  0.0043  40  ARG A CA    
321  C  C     . ARG A 64  ? 0.2564 0.2446 0.2265 0.0111  0.0264  0.0097  40  ARG A C     
322  O  O     . ARG A 64  ? 0.2651 0.2764 0.2872 -0.0078 0.0112  -0.0423 40  ARG A O     
323  C  CB    . ARG A 64  ? 0.2147 0.2651 0.1991 0.0675  0.0335  0.0021  40  ARG A CB    
324  C  CG    . ARG A 64  ? 0.2660 0.3014 0.2672 0.0862  0.1184  0.0006  40  ARG A CG    
325  C  CD    . ARG A 64  ? 0.3612 0.3021 0.3732 0.0627  0.1164  0.0278  40  ARG A CD    
326  N  NE    . ARG A 64  ? 0.3573 0.2943 0.3922 0.0325  0.1074  -0.0422 40  ARG A NE    
327  C  CZ    . ARG A 64  ? 0.4147 0.2770 0.3855 0.0160  0.0881  -0.1011 40  ARG A CZ    
328  N  NH1   . ARG A 64  ? 0.4868 0.3777 0.3881 -0.0715 0.1595  -0.1132 40  ARG A NH1   
329  N  NH2   . ARG A 64  ? 0.3613 0.3456 0.4323 -0.0154 0.0511  -0.0523 40  ARG A NH2   
330  N  N     . ALA A 65  ? 0.2441 0.2354 0.2277 0.0116  0.0402  0.0135  41  ALA A N     
331  C  CA    . ALA A 65  ? 0.2339 0.2513 0.2289 0.0212  0.0141  0.0013  41  ALA A CA    
332  C  C     . ALA A 65  ? 0.2536 0.2604 0.2228 0.0223  0.0200  0.0051  41  ALA A C     
333  O  O     . ALA A 65  ? 0.2484 0.2633 0.1862 0.0234  0.0510  -0.0216 41  ALA A O     
334  C  CB    . ALA A 65  ? 0.2251 0.2823 0.2156 -0.0104 0.0450  0.0002  41  ALA A CB    
335  N  N     . GLU A 66  ? 0.2494 0.2921 0.2429 0.0217  0.0241  -0.0234 42  GLU A N     
336  C  CA    . GLU A 66  ? 0.2559 0.3047 0.2365 0.0253  0.0354  -0.0220 42  GLU A CA    
337  C  C     . GLU A 66  ? 0.2768 0.2857 0.2262 0.0153  0.0419  -0.0120 42  GLU A C     
338  O  O     . GLU A 66  ? 0.2695 0.3126 0.2293 -0.0039 0.0496  0.0020  42  GLU A O     
339  C  CB    . GLU A 66  ? 0.3457 0.4274 0.2301 0.0144  0.0832  -0.0296 42  GLU A CB    
340  C  CG    . GLU A 66  ? 0.4381 0.4948 0.2570 -0.0543 0.0323  -0.0339 42  GLU A CG    
341  C  CD    . GLU A 66  ? 0.5785 0.5187 0.4859 -0.0577 -0.0183 0.0144  42  GLU A CD    
342  O  OE1   . GLU A 66  ? 0.5714 0.6555 0.5302 -0.0731 -0.0260 -0.0068 42  GLU A OE1   
343  O  OE2   . GLU A 66  ? 0.6642 0.5417 0.6713 -0.1077 -0.0166 0.0161  42  GLU A OE2   
344  N  N     . LEU A 67  ? 0.3153 0.2620 0.2504 0.0346  0.0453  -0.0537 43  LEU A N     
345  C  CA    . LEU A 67  ? 0.2972 0.2489 0.2758 0.0368  0.0389  -0.0067 43  LEU A CA    
346  C  C     . LEU A 67  ? 0.2746 0.2380 0.2297 0.0098  0.0204  -0.0086 43  LEU A C     
347  O  O     . LEU A 67  ? 0.2919 0.2344 0.1974 -0.0186 0.0286  -0.0178 43  LEU A O     
348  C  CB    . LEU A 67  ? 0.3165 0.2378 0.2973 0.0376  0.0329  -0.0150 43  LEU A CB    
349  C  CG    . LEU A 67  ? 0.3659 0.3032 0.3080 -0.0141 -0.0249 -0.0202 43  LEU A CG    
350  C  CD1   . LEU A 67  ? 0.3659 0.3668 0.3121 0.0003  -0.0563 -0.0076 43  LEU A CD1   
351  C  CD2   . LEU A 67  ? 0.4764 0.3345 0.4400 0.0459  -0.0440 -0.0117 43  LEU A CD2   
352  N  N     . LEU A 68  ? 0.2529 0.2186 0.2261 0.0341  0.0329  -0.0103 44  LEU A N     
353  C  CA    . LEU A 68  ? 0.2319 0.2502 0.2067 0.0035  0.0287  -0.0158 44  LEU A CA    
354  C  C     . LEU A 68  ? 0.2269 0.2301 0.2203 -0.0150 0.0299  -0.0160 44  LEU A C     
355  O  O     . LEU A 68  ? 0.2242 0.2463 0.2012 0.0047  0.0514  0.0343  44  LEU A O     
356  C  CB    . LEU A 68  ? 0.3046 0.2869 0.2207 -0.0375 -0.0271 -0.0101 44  LEU A CB    
357  C  CG    . LEU A 68  ? 0.2941 0.3483 0.2696 -0.0214 0.0168  0.0356  44  LEU A CG    
358  C  CD1   . LEU A 68  ? 0.2588 0.3254 0.2601 -0.0581 0.0553  0.0311  44  LEU A CD1   
359  C  CD2   . LEU A 68  ? 0.3249 0.4239 0.2702 -0.0696 0.0371  -0.0517 44  LEU A CD2   
360  N  N     . TYR A 69  ? 0.2382 0.2055 0.2036 -0.0043 0.0307  -0.0369 45  TYR A N     
361  C  CA    . TYR A 69  ? 0.2580 0.2419 0.1916 -0.0262 0.0171  0.0171  45  TYR A CA    
362  C  C     . TYR A 69  ? 0.2437 0.2317 0.1935 -0.0076 0.0154  -0.0063 45  TYR A C     
363  O  O     . TYR A 69  ? 0.2273 0.2518 0.1995 -0.0103 0.0360  0.0215  45  TYR A O     
364  C  CB    . TYR A 69  ? 0.2657 0.2378 0.1979 -0.0178 0.0721  0.0268  45  TYR A CB    
365  C  CG    . TYR A 69  ? 0.2318 0.2291 0.1905 -0.0065 0.0543  0.0013  45  TYR A CG    
366  C  CD1   . TYR A 69  ? 0.2313 0.2369 0.2211 0.0282  0.0477  0.0106  45  TYR A CD1   
367  C  CD2   . TYR A 69  ? 0.2341 0.2336 0.1933 -0.0019 0.0381  0.0265  45  TYR A CD2   
368  C  CE1   . TYR A 69  ? 0.2068 0.2336 0.1921 0.0056  0.0447  0.0291  45  TYR A CE1   
369  C  CE2   . TYR A 69  ? 0.2346 0.2335 0.2198 0.0083  0.0542  0.0030  45  TYR A CE2   
370  C  CZ    . TYR A 69  ? 0.2094 0.2300 0.1942 -0.0097 0.0491  0.0157  45  TYR A CZ    
371  O  OH    . TYR A 69  ? 0.2003 0.2463 0.1905 -0.0243 0.0946  0.0155  45  TYR A OH    
372  N  N     . SER A 70  ? 0.2682 0.2498 0.2022 -0.0017 0.0464  -0.0030 46  SER A N     
373  C  CA    . SER A 70  ? 0.2560 0.2780 0.2269 0.0086  0.0194  0.0000  46  SER A CA    
374  C  C     . SER A 70  ? 0.2808 0.2556 0.2063 -0.0295 0.0212  0.0125  46  SER A C     
375  O  O     . SER A 70  ? 0.3005 0.2841 0.2569 -0.0095 0.0135  0.0227  46  SER A O     
376  C  CB    . SER A 70  ? 0.3269 0.2729 0.2242 0.0019  0.0339  -0.0293 46  SER A CB    
377  O  OG    . SER A 70  ? 0.3253 0.2777 0.2830 0.0008  0.0388  -0.0072 46  SER A OG    
378  N  N     . ARG A 71  ? 0.2594 0.2537 0.2082 -0.0305 0.0286  0.0109  47  ARG A N     
379  C  CA    . ARG A 71  ? 0.2567 0.2270 0.2132 -0.0063 0.0436  0.0256  47  ARG A CA    
380  C  C     . ARG A 71  ? 0.2299 0.2321 0.2197 -0.0136 0.0279  0.0148  47  ARG A C     
381  O  O     . ARG A 71  ? 0.2430 0.2599 0.2498 -0.0386 0.0450  -0.0096 47  ARG A O     
382  C  CB    . ARG A 71  ? 0.2605 0.2309 0.2093 0.0146  0.0681  0.0259  47  ARG A CB    
383  C  CG    . ARG A 71  ? 0.3237 0.2602 0.2324 0.0319  0.0472  -0.0284 47  ARG A CG    
384  C  CD    . ARG A 71  ? 0.3161 0.2724 0.2508 -0.0022 0.0610  -0.0100 47  ARG A CD    
385  N  NE    . ARG A 71  ? 0.3115 0.2931 0.2828 -0.0157 0.0449  -0.0459 47  ARG A NE    
386  C  CZ    . ARG A 71  ? 0.3406 0.2908 0.2883 -0.0431 0.0475  -0.0407 47  ARG A CZ    
387  N  NH1   . ARG A 71  ? 0.3865 0.3313 0.2658 -0.0297 0.0461  -0.0362 47  ARG A NH1   
388  N  NH2   . ARG A 71  ? 0.3173 0.3394 0.2764 -0.0524 0.0706  -0.0509 47  ARG A NH2   
389  N  N     . MSE A 72  ? 0.2273 0.2046 0.2064 -0.0052 0.0643  0.0197  48  MSE A N     
390  C  CA    . MSE A 72  ? 0.2337 0.2024 0.2165 -0.0171 0.0759  0.0200  48  MSE A CA    
391  C  C     . MSE A 72  ? 0.2360 0.2326 0.2014 0.0098  0.0573  -0.0081 48  MSE A C     
392  O  O     . MSE A 72  ? 0.2354 0.2533 0.2095 0.0011  0.0449  0.0266  48  MSE A O     
393  C  CB    . MSE A 72  ? 0.2476 0.2956 0.2390 -0.0076 0.0281  0.0023  48  MSE A CB    
394  C  CG    . MSE A 72  ? 0.3416 0.3516 0.2370 0.0101  0.0590  -0.0024 48  MSE A CG    
395  SE SE    . MSE A 72  ? 0.4873 0.5196 0.4115 -0.0806 0.0294  -0.0265 48  MSE A SE    
396  C  CE    . MSE A 72  ? 0.4352 0.3780 0.3511 -0.0144 -0.0032 -0.1246 48  MSE A CE    
397  N  N     . GLY A 73  ? 0.1879 0.2661 0.2200 -0.0085 0.0333  0.0324  49  GLY A N     
398  C  CA    . GLY A 73  ? 0.2052 0.2414 0.2443 -0.0094 0.0166  0.0242  49  GLY A CA    
399  C  C     . GLY A 73  ? 0.2283 0.2365 0.1956 0.0032  0.0229  0.0064  49  GLY A C     
400  O  O     . GLY A 73  ? 0.1962 0.2434 0.2276 0.0087  0.0408  0.0092  49  GLY A O     
401  N  N     . PRO A 74  ? 0.2160 0.2305 0.2624 0.0216  0.0283  -0.0106 50  PRO A N     
402  C  CA    . PRO A 74  ? 0.2352 0.2360 0.2298 -0.0081 0.0006  -0.0080 50  PRO A CA    
403  C  C     . PRO A 74  ? 0.2435 0.2505 0.2260 0.0021  0.0197  -0.0017 50  PRO A C     
404  O  O     . PRO A 74  ? 0.2654 0.2693 0.2869 -0.0530 0.0405  -0.0023 50  PRO A O     
405  C  CB    . PRO A 74  ? 0.2382 0.2830 0.2489 -0.0071 -0.0127 -0.0207 50  PRO A CB    
406  C  CG    . PRO A 74  ? 0.2396 0.2340 0.2883 -0.0055 -0.0200 -0.0092 50  PRO A CG    
407  C  CD    . PRO A 74  ? 0.2407 0.2540 0.2874 0.0334  -0.0202 -0.0043 50  PRO A CD    
408  N  N     . ALA A 75  ? 0.2097 0.2590 0.1971 0.0181  0.0304  -0.0094 51  ALA A N     
409  C  CA    . ALA A 75  ? 0.2146 0.2143 0.2019 -0.0029 0.0313  0.0003  51  ALA A CA    
410  C  C     . ALA A 75  ? 0.2094 0.2153 0.2025 0.0011  0.0244  -0.0004 51  ALA A C     
411  O  O     . ALA A 75  ? 0.2324 0.2381 0.2033 0.0002  0.0393  0.0150  51  ALA A O     
412  C  CB    . ALA A 75  ? 0.1972 0.3007 0.2106 0.0113  0.0552  -0.0178 51  ALA A CB    
413  N  N     . LEU A 76  ? 0.1695 0.2251 0.2037 -0.0257 0.0407  -0.0145 52  LEU A N     
414  C  CA    . LEU A 76  ? 0.2091 0.2222 0.2583 -0.0064 0.0254  -0.0227 52  LEU A CA    
415  C  C     . LEU A 76  ? 0.2044 0.1945 0.2405 0.0249  0.0275  0.0044  52  LEU A C     
416  O  O     . LEU A 76  ? 0.2090 0.2357 0.1875 -0.0112 0.0242  0.0372  52  LEU A O     
417  C  CB    . LEU A 76  ? 0.2531 0.3097 0.3760 0.0494  0.0608  -0.0267 52  LEU A CB    
418  C  CG    . LEU A 76  ? 0.3902 0.4166 0.3918 0.0119  0.0425  0.0097  52  LEU A CG    
419  C  CD1   . LEU A 76  ? 0.3806 0.4044 0.4653 -0.0422 0.0651  -0.0113 52  LEU A CD1   
420  C  CD2   . LEU A 76  ? 0.3986 0.4581 0.5106 -0.0089 0.1170  0.0312  52  LEU A CD2   
421  N  N     . GLU A 77  ? 0.2327 0.1997 0.2278 0.0128  0.0355  -0.0100 53  GLU A N     
422  C  CA    . GLU A 77  ? 0.2134 0.1813 0.2063 0.0057  0.0427  0.0087  53  GLU A CA    
423  C  C     . GLU A 77  ? 0.2068 0.2217 0.1585 -0.0063 0.0537  0.0227  53  GLU A C     
424  O  O     . GLU A 77  ? 0.2108 0.2375 0.1679 0.0028  0.0619  0.0056  53  GLU A O     
425  C  CB    . GLU A 77  ? 0.2077 0.1827 0.2128 0.0110  0.0375  0.0286  53  GLU A CB    
426  C  CG    . GLU A 77  ? 0.2281 0.2325 0.2241 -0.0005 0.0518  -0.0068 53  GLU A CG    
427  C  CD    . GLU A 77  ? 0.2322 0.2381 0.2193 0.0079  0.0540  0.0150  53  GLU A CD    
428  O  OE1   . GLU A 77  ? 0.3076 0.2402 0.2632 -0.0086 0.0889  0.0029  53  GLU A OE1   
429  O  OE2   . GLU A 77  ? 0.2451 0.2513 0.1822 0.0160  0.0562  0.0264  53  GLU A OE2   
430  N  N     . ALA A 78  ? 0.1712 0.2400 0.1877 0.0159  0.0395  0.0227  54  ALA A N     
431  C  CA    . ALA A 78  ? 0.1852 0.2575 0.1960 -0.0139 0.0332  0.0085  54  ALA A CA    
432  C  C     . ALA A 78  ? 0.2075 0.2087 0.1334 0.0035  0.0346  0.0050  54  ALA A C     
433  O  O     . ALA A 78  ? 0.2045 0.2160 0.1710 0.0279  0.0201  -0.0015 54  ALA A O     
434  C  CB    . ALA A 78  ? 0.2098 0.3112 0.2035 0.0118  0.0623  0.0104  54  ALA A CB    
435  N  N     . SER A 79  ? 0.2046 0.2186 0.1968 -0.0137 0.0208  0.0092  55  SER A N     
436  C  CA    . SER A 79  ? 0.2146 0.2131 0.1856 -0.0221 0.0165  0.0170  55  SER A CA    
437  C  C     . SER A 79  ? 0.2717 0.2312 0.1746 0.0071  0.0309  0.0208  55  SER A C     
438  O  O     . SER A 79  ? 0.2626 0.2751 0.2212 0.0246  0.0219  0.0100  55  SER A O     
439  C  CB    . SER A 79  ? 0.2681 0.2122 0.2441 -0.0289 0.0144  0.0079  55  SER A CB    
440  O  OG    . SER A 79  ? 0.1943 0.2580 0.3377 0.0023  0.0831  0.0200  55  SER A OG    
441  N  N     . GLY A 80  ? 0.2250 0.2244 0.1994 0.0040  0.0302  0.0052  56  GLY A N     
442  C  CA    . GLY A 80  ? 0.2499 0.2306 0.2278 0.0506  0.0054  0.0420  56  GLY A CA    
443  C  C     . GLY A 80  ? 0.1944 0.2195 0.2055 0.0296  0.0448  0.0044  56  GLY A C     
444  O  O     . GLY A 80  ? 0.2367 0.2267 0.2206 0.0214  0.0360  -0.0171 56  GLY A O     
445  N  N     . GLY A 81  ? 0.2036 0.2256 0.1756 -0.0016 0.0572  0.0403  57  GLY A N     
446  C  CA    . GLY A 81  ? 0.2325 0.2436 0.1986 0.0176  0.0276  0.0177  57  GLY A CA    
447  C  C     . GLY A 81  ? 0.2506 0.2066 0.1853 0.0319  0.0187  0.0358  57  GLY A C     
448  O  O     . GLY A 81  ? 0.2364 0.2244 0.2165 0.0145  0.0230  -0.0054 57  GLY A O     
449  N  N     . SER A 82  ? 0.2468 0.2114 0.1595 0.0075  0.0128  0.0314  58  SER A N     
450  C  CA    A SER A 82  ? 0.2239 0.2097 0.1849 0.0050  0.0313  0.0158  58  SER A CA    
451  C  CA    B SER A 82  ? 0.2385 0.2277 0.1886 0.0031  0.0392  0.0033  58  SER A CA    
452  C  C     . SER A 82  ? 0.2004 0.2286 0.2096 0.0130  0.0218  -0.0025 58  SER A C     
453  O  O     . SER A 82  ? 0.2296 0.2358 0.1995 0.0204  0.0383  -0.0141 58  SER A O     
454  C  CB    A SER A 82  ? 0.2181 0.1869 0.1910 0.0193  0.0468  -0.0062 58  SER A CB    
455  C  CB    B SER A 82  ? 0.2919 0.2175 0.2513 0.0355  0.0627  0.0031  58  SER A CB    
456  O  OG    A SER A 82  ? 0.2364 0.1735 0.1760 0.0458  0.0350  -0.0253 58  SER A OG    
457  O  OG    B SER A 82  ? 0.3175 0.2748 0.3195 0.0279  0.0416  -0.0539 58  SER A OG    
458  N  N     . ALA A 83  ? 0.2122 0.2058 0.1980 -0.0080 -0.0020 0.0062  59  ALA A N     
459  C  CA    . ALA A 83  ? 0.2092 0.2197 0.2020 -0.0026 0.0103  -0.0112 59  ALA A CA    
460  C  C     . ALA A 83  ? 0.2068 0.2362 0.1986 0.0204  0.0189  -0.0089 59  ALA A C     
461  O  O     . ALA A 83  ? 0.2105 0.2383 0.2275 -0.0006 0.0228  -0.0283 59  ALA A O     
462  C  CB    . ALA A 83  ? 0.2054 0.2115 0.2566 0.0198  0.0333  -0.0215 59  ALA A CB    
463  N  N     . GLY A 84  ? 0.1931 0.2346 0.1906 0.0079  0.0356  0.0358  60  GLY A N     
464  C  CA    . GLY A 84  ? 0.2136 0.1892 0.2778 0.0362  0.0420  0.0172  60  GLY A CA    
465  C  C     . GLY A 84  ? 0.2118 0.1919 0.2255 0.0323  0.0198  -0.0087 60  GLY A C     
466  O  O     . GLY A 84  ? 0.2315 0.1982 0.2294 0.0275  0.0522  -0.0165 60  GLY A O     
467  N  N     . ASN A 85  ? 0.1702 0.2580 0.1952 0.0179  0.0446  0.0005  61  ASN A N     
468  C  CA    . ASN A 85  ? 0.1703 0.2244 0.1969 0.0148  0.0425  -0.0207 61  ASN A CA    
469  C  C     . ASN A 85  ? 0.2241 0.2212 0.1752 0.0315  0.0356  0.0164  61  ASN A C     
470  O  O     . ASN A 85  ? 0.2481 0.2235 0.2060 0.0255  0.0624  -0.0169 61  ASN A O     
471  C  CB    . ASN A 85  ? 0.2034 0.1983 0.1587 0.0181  0.0662  -0.0246 61  ASN A CB    
472  C  CG    . ASN A 85  ? 0.1926 0.2130 0.1676 0.0231  0.0407  -0.0367 61  ASN A CG    
473  O  OD1   . ASN A 85  ? 0.2275 0.2584 0.1932 0.0475  0.0631  -0.0091 61  ASN A OD1   
474  N  ND2   . ASN A 85  ? 0.1856 0.2119 0.1868 0.0226  0.0523  -0.0319 61  ASN A ND2   
475  N  N     . THR A 86  ? 0.1945 0.2018 0.1607 0.0098  0.0332  -0.0002 62  THR A N     
476  C  CA    . THR A 86  ? 0.2359 0.2150 0.1685 0.0260  0.0401  -0.0160 62  THR A CA    
477  C  C     . THR A 86  ? 0.2595 0.2139 0.2217 0.0156  0.0224  0.0089  62  THR A C     
478  O  O     . THR A 86  ? 0.2351 0.2164 0.2463 0.0034  0.0413  0.0059  62  THR A O     
479  C  CB    . THR A 86  ? 0.2952 0.2304 0.1400 0.0152  0.0429  -0.0014 62  THR A CB    
480  O  OG1   . THR A 86  ? 0.3149 0.2459 0.1624 0.0018  0.0446  -0.0116 62  THR A OG1   
481  C  CG2   . THR A 86  ? 0.3163 0.2545 0.1580 0.0227  0.0665  -0.0329 62  THR A CG2   
482  N  N     . ALA A 87  ? 0.2572 0.2182 0.2358 0.0023  0.0172  0.0039  63  ALA A N     
483  C  CA    . ALA A 87  ? 0.2356 0.2289 0.2401 0.0020  0.0246  -0.0038 63  ALA A CA    
484  C  C     . ALA A 87  ? 0.2604 0.2088 0.2004 -0.0076 0.0035  -0.0013 63  ALA A C     
485  O  O     . ALA A 87  ? 0.2579 0.2292 0.2202 0.0073  0.0616  -0.0042 63  ALA A O     
486  C  CB    . ALA A 87  ? 0.2396 0.2364 0.2425 0.0193  0.0435  -0.0341 63  ALA A CB    
487  N  N     . ALA A 88  ? 0.2683 0.2342 0.1835 0.0166  0.0020  0.0039  64  ALA A N     
488  C  CA    . ALA A 88  ? 0.2545 0.2636 0.2029 0.0430  0.0228  0.0027  64  ALA A CA    
489  C  C     . ALA A 88  ? 0.2596 0.2440 0.2203 0.0205  0.0373  0.0119  64  ALA A C     
490  O  O     . ALA A 88  ? 0.3299 0.2501 0.2163 0.0339  0.0380  0.0152  64  ALA A O     
491  C  CB    . ALA A 88  ? 0.2941 0.2283 0.2255 0.0143  -0.0060 0.0109  64  ALA A CB    
492  N  N     . GLY A 89  ? 0.2531 0.2311 0.2058 0.0204  0.0234  0.0060  65  GLY A N     
493  C  CA    . GLY A 89  ? 0.3136 0.2584 0.1852 0.0155  0.0492  0.0132  65  GLY A CA    
494  C  C     . GLY A 89  ? 0.2912 0.2684 0.2464 0.0040  0.0160  -0.0196 65  GLY A C     
495  O  O     . GLY A 89  ? 0.2970 0.2548 0.2668 0.0172  0.0305  0.0210  65  GLY A O     
496  N  N     . VAL A 90  ? 0.3016 0.2272 0.2546 -0.0126 0.0067  -0.0130 66  VAL A N     
497  C  CA    . VAL A 90  ? 0.3018 0.2357 0.2509 0.0004  0.0186  -0.0156 66  VAL A CA    
498  C  C     . VAL A 90  ? 0.3189 0.2463 0.2666 0.0261  0.0425  0.0092  66  VAL A C     
499  O  O     . VAL A 90  ? 0.3651 0.2925 0.2552 0.0284  0.0417  -0.0287 66  VAL A O     
500  C  CB    . VAL A 90  ? 0.3240 0.2102 0.2542 0.0114  -0.0051 -0.0241 66  VAL A CB    
501  C  CG1   . VAL A 90  ? 0.3214 0.2792 0.2740 -0.0013 -0.0229 -0.0538 66  VAL A CG1   
502  C  CG2   . VAL A 90  ? 0.3142 0.2273 0.2860 0.0038  0.0027  0.0119  66  VAL A CG2   
503  N  N     . ALA A 91  ? 0.3157 0.2284 0.2332 0.0189  0.0125  0.0031  67  ALA A N     
504  C  CA    . ALA A 91  ? 0.3492 0.1836 0.2636 0.0436  0.0220  -0.0483 67  ALA A CA    
505  C  C     . ALA A 91  ? 0.3349 0.2384 0.2681 0.0367  0.0258  -0.0282 67  ALA A C     
506  O  O     . ALA A 91  ? 0.3603 0.2460 0.3084 0.0592  0.0452  -0.0465 67  ALA A O     
507  C  CB    . ALA A 91  ? 0.3994 0.2139 0.2822 0.0223  0.0455  0.0135  67  ALA A CB    
508  N  N     . ASN A 92  ? 0.2988 0.2432 0.2649 0.0255  0.0210  0.0302  68  ASN A N     
509  C  CA    . ASN A 92  ? 0.3030 0.2839 0.2794 0.0623  0.0286  -0.0508 68  ASN A CA    
510  C  C     . ASN A 92  ? 0.3265 0.2967 0.2534 0.0585  0.0278  -0.0222 68  ASN A C     
511  O  O     . ASN A 92  ? 0.4140 0.3051 0.3183 0.0941  0.0160  -0.0215 68  ASN A O     
512  C  CB    . ASN A 92  ? 0.2974 0.3142 0.3180 -0.0049 0.0381  -0.0146 68  ASN A CB    
513  C  CG    . ASN A 92  ? 0.3137 0.2883 0.3112 0.0198  0.0351  -0.0227 68  ASN A CG    
514  O  OD1   . ASN A 92  ? 0.3203 0.3376 0.3835 0.0762  0.0336  -0.0285 68  ASN A OD1   
515  N  ND2   . ASN A 92  ? 0.2896 0.3049 0.2897 0.0221  0.0281  -0.0088 68  ASN A ND2   
516  N  N     . LEU A 93  ? 0.3084 0.2664 0.2425 0.0445  0.0526  -0.0323 69  LEU A N     
517  C  CA    . LEU A 93  ? 0.3762 0.2760 0.2399 0.0474  0.0643  -0.0246 69  LEU A CA    
518  C  C     . LEU A 93  ? 0.3513 0.2815 0.2984 0.0411  0.0599  -0.0275 69  LEU A C     
519  O  O     . LEU A 93  ? 0.3927 0.3178 0.2987 0.0777  0.0888  0.0017  69  LEU A O     
520  C  CB    . LEU A 93  ? 0.3177 0.2783 0.2289 0.0512  0.0570  -0.0196 69  LEU A CB    
521  C  CG    . LEU A 93  ? 0.2624 0.2915 0.2578 0.0574  0.0353  0.0150  69  LEU A CG    
522  C  CD1   . LEU A 93  ? 0.3600 0.2574 0.2668 0.0265  0.0721  0.0677  69  LEU A CD1   
523  C  CD2   . LEU A 93  ? 0.3164 0.3583 0.2658 0.0519  0.0945  0.0213  69  LEU A CD2   
524  N  N     . GLY A 94  ? 0.3443 0.2497 0.2979 0.0425  0.0439  -0.0197 70  GLY A N     
525  C  CA    . GLY A 94  ? 0.3569 0.2505 0.3798 0.0424  0.0360  -0.0283 70  GLY A CA    
526  C  C     . GLY A 94  ? 0.3971 0.2732 0.3075 0.0492  0.0286  -0.0061 70  GLY A C     
527  O  O     . GLY A 94  ? 0.4789 0.3103 0.3265 0.0453  0.0116  -0.0229 70  GLY A O     
528  N  N     . GLY A 95  ? 0.3699 0.2830 0.2758 0.0687  0.0284  -0.0384 71  GLY A N     
529  C  CA    . GLY A 95  ? 0.3587 0.2904 0.2803 0.0659  0.0420  -0.0527 71  GLY A CA    
530  C  C     . GLY A 95  ? 0.3312 0.2682 0.3116 0.0408  0.0220  -0.0100 71  GLY A C     
531  O  O     . GLY A 95  ? 0.3721 0.2798 0.2859 0.0381  0.0253  -0.0529 71  GLY A O     
532  N  N     . LYS A 96  ? 0.3244 0.2520 0.3007 0.0162  0.0326  -0.0033 72  LYS A N     
533  C  CA    . LYS A 96  ? 0.3212 0.2422 0.2721 0.0174  0.0353  -0.0442 72  LYS A CA    
534  C  C     . LYS A 96  ? 0.2815 0.2337 0.2277 0.0168  0.0071  -0.0034 72  LYS A C     
535  O  O     . LYS A 96  ? 0.3665 0.2799 0.2123 0.0124  0.0209  0.0181  72  LYS A O     
536  C  CB    . LYS A 96  ? 0.3886 0.2891 0.3340 -0.0403 0.0223  -0.0419 72  LYS A CB    
537  C  CG    . LYS A 96  ? 0.3967 0.2667 0.4202 -0.0506 0.1223  0.0179  72  LYS A CG    
538  C  CD    . LYS A 96  ? 0.4364 0.3623 0.4010 -0.0844 0.0578  -0.0243 72  LYS A CD    
539  C  CE    . LYS A 96  ? 0.4288 0.4198 0.3013 -0.0882 0.0381  -0.0776 72  LYS A CE    
540  N  NZ    . LYS A 96  ? 0.5546 0.5777 0.2918 -0.1686 -0.0071 -0.0564 72  LYS A NZ    
541  N  N     . ALA A 97  ? 0.2940 0.2177 0.2307 0.0147  0.0153  -0.0140 73  ALA A N     
542  C  CA    . ALA A 97  ? 0.3023 0.2456 0.2431 0.0291  0.0238  -0.0279 73  ALA A CA    
543  C  C     . ALA A 97  ? 0.2875 0.2490 0.2586 0.0319  0.0227  -0.0143 73  ALA A C     
544  O  O     . ALA A 97  ? 0.3638 0.2405 0.2161 0.0218  0.0130  -0.0362 73  ALA A O     
545  C  CB    . ALA A 97  ? 0.3039 0.2642 0.2290 0.0088  0.0708  -0.0536 73  ALA A CB    
546  N  N     . ALA A 98  ? 0.2553 0.2532 0.2402 0.0195  0.0151  -0.0179 74  ALA A N     
547  C  CA    . ALA A 98  ? 0.2453 0.2145 0.2537 0.0027  0.0184  -0.0095 74  ALA A CA    
548  C  C     . ALA A 98  ? 0.2810 0.2303 0.2549 -0.0064 0.0181  -0.0371 74  ALA A C     
549  O  O     . ALA A 98  ? 0.3113 0.2377 0.2368 -0.0120 0.0256  -0.0548 74  ALA A O     
550  C  CB    . ALA A 98  ? 0.3035 0.2648 0.2471 -0.0047 -0.0255 0.0001  74  ALA A CB    
551  N  N     . TYR A 99  ? 0.2969 0.2116 0.2567 -0.0016 0.0164  -0.0498 75  TYR A N     
552  C  CA    . TYR A 99  ? 0.2475 0.1898 0.2356 -0.0278 0.0132  -0.0226 75  TYR A CA    
553  C  C     . TYR A 99  ? 0.2352 0.2095 0.2376 -0.0164 0.0109  0.0058  75  TYR A C     
554  O  O     . TYR A 99  ? 0.2391 0.2043 0.2647 -0.0320 0.0153  -0.0016 75  TYR A O     
555  C  CB    . TYR A 99  ? 0.2880 0.2194 0.2314 -0.0013 -0.0045 -0.0208 75  TYR A CB    
556  C  CG    . TYR A 99  ? 0.2762 0.2147 0.2489 -0.0418 0.0255  -0.0177 75  TYR A CG    
557  C  CD1   . TYR A 99  ? 0.2246 0.2171 0.2445 -0.0096 0.0413  0.0025  75  TYR A CD1   
558  C  CD2   . TYR A 99  ? 0.2964 0.2441 0.2486 0.0033  0.0247  -0.0014 75  TYR A CD2   
559  C  CE1   . TYR A 99  ? 0.1927 0.2266 0.2213 -0.0053 0.0326  0.0000  75  TYR A CE1   
560  C  CE2   . TYR A 99  ? 0.2529 0.2307 0.2748 -0.0254 -0.0182 0.0047  75  TYR A CE2   
561  C  CZ    . TYR A 99  ? 0.2510 0.2281 0.2205 -0.0005 0.0323  -0.0163 75  TYR A CZ    
562  O  OH    . TYR A 99  ? 0.2591 0.2340 0.2083 0.0087  0.0268  -0.0217 75  TYR A OH    
563  N  N     . PHE A 100 ? 0.2325 0.2319 0.2098 -0.0048 0.0194  -0.0034 76  PHE A N     
564  C  CA    . PHE A 100 ? 0.2101 0.2394 0.2535 0.0177  -0.0114 -0.0037 76  PHE A CA    
565  C  C     . PHE A 100 ? 0.2390 0.2388 0.2306 -0.0135 0.0102  0.0064  76  PHE A C     
566  O  O     . PHE A 100 ? 0.2609 0.2310 0.2349 -0.0175 0.0172  0.0147  76  PHE A O     
567  C  CB    . PHE A 100 ? 0.1856 0.2712 0.2694 0.0112  -0.0288 -0.0135 76  PHE A CB    
568  C  CG    . PHE A 100 ? 0.2721 0.2562 0.2947 0.0020  -0.0121 -0.0370 76  PHE A CG    
569  C  CD1   . PHE A 100 ? 0.2695 0.2573 0.2806 -0.0314 -0.0268 -0.0129 76  PHE A CD1   
570  C  CD2   . PHE A 100 ? 0.2973 0.3006 0.3108 -0.0070 -0.0196 -0.0135 76  PHE A CD2   
571  C  CE1   . PHE A 100 ? 0.3012 0.2603 0.2921 -0.0168 -0.0345 -0.0277 76  PHE A CE1   
572  C  CE2   . PHE A 100 ? 0.3031 0.2511 0.3193 -0.0106 -0.0058 -0.0068 76  PHE A CE2   
573  C  CZ    . PHE A 100 ? 0.3733 0.2386 0.2684 -0.0179 -0.0227 -0.0263 76  PHE A CZ    
574  N  N     . GLY A 101 ? 0.2470 0.2271 0.2356 -0.0196 0.0267  -0.0032 77  GLY A N     
575  C  CA    . GLY A 101 ? 0.2537 0.2259 0.1947 0.0031  0.0242  0.0079  77  GLY A CA    
576  C  C     . GLY A 101 ? 0.2139 0.2373 0.2272 -0.0169 0.0443  0.0225  77  GLY A C     
577  O  O     . GLY A 101 ? 0.2471 0.2214 0.2762 0.0073  0.0030  0.0067  77  GLY A O     
578  N  N     . ASN A 102 ? 0.2610 0.2427 0.2320 -0.0211 0.0419  0.0019  78  ASN A N     
579  C  CA    . ASN A 102 ? 0.2448 0.2492 0.2098 0.0116  0.0263  0.0005  78  ASN A CA    
580  C  C     . ASN A 102 ? 0.2057 0.2506 0.2110 0.0275  0.0332  0.0064  78  ASN A C     
581  O  O     . ASN A 102 ? 0.1965 0.2739 0.2668 0.0022  0.0118  -0.0057 78  ASN A O     
582  C  CB    . ASN A 102 ? 0.2249 0.2947 0.1922 0.0127  0.0508  0.0196  78  ASN A CB    
583  C  CG    . ASN A 102 ? 0.1998 0.2512 0.2523 0.0047  0.0716  0.0161  78  ASN A CG    
584  O  OD1   . ASN A 102 ? 0.2284 0.2520 0.2588 0.0010  0.0644  0.0016  78  ASN A OD1   
585  N  ND2   . ASN A 102 ? 0.2325 0.2800 0.2733 0.0194  0.0385  -0.0103 78  ASN A ND2   
586  N  N     . VAL A 103 ? 0.1958 0.2296 0.2110 0.0229  0.0329  -0.0027 79  VAL A N     
587  C  CA    . VAL A 103 ? 0.2068 0.2580 0.2148 0.0139  0.0281  0.0132  79  VAL A CA    
588  C  C     . VAL A 103 ? 0.2003 0.2676 0.2383 -0.0382 0.0288  -0.0189 79  VAL A C     
589  O  O     . VAL A 103 ? 0.1805 0.3244 0.2770 -0.0061 0.0333  -0.0122 79  VAL A O     
590  C  CB    . VAL A 103 ? 0.1702 0.2332 0.2241 -0.0123 0.0513  0.0249  79  VAL A CB    
591  C  CG1   . VAL A 103 ? 0.2140 0.2938 0.2122 -0.0164 0.0734  0.0287  79  VAL A CG1   
592  C  CG2   . VAL A 103 ? 0.2406 0.2066 0.2580 0.0113  0.0506  -0.0100 79  VAL A CG2   
593  N  N     . ALA A 104 ? 0.2189 0.2248 0.2056 -0.0312 0.0562  0.0186  80  ALA A N     
594  C  CA    . ALA A 104 ? 0.2213 0.2478 0.2258 -0.0014 0.0773  0.0128  80  ALA A CA    
595  C  C     . ALA A 104 ? 0.2280 0.2803 0.2628 0.0238  0.0736  0.0337  80  ALA A C     
596  O  O     . ALA A 104 ? 0.1884 0.3052 0.2425 0.0055  0.0663  0.0344  80  ALA A O     
597  C  CB    . ALA A 104 ? 0.1870 0.2776 0.2701 0.0113  0.0491  -0.0198 80  ALA A CB    
598  N  N     . ALA A 105 ? 0.2066 0.2520 0.2696 -0.0055 0.0536  0.0348  81  ALA A N     
599  C  CA    . ALA A 105 ? 0.1524 0.2762 0.2531 -0.0223 0.0507  0.0482  81  ALA A CA    
600  C  C     . ALA A 105 ? 0.2036 0.3252 0.2098 -0.0400 0.0746  0.0478  81  ALA A C     
601  O  O     . ALA A 105 ? 0.2157 0.3894 0.2398 -0.0080 0.1139  0.0284  81  ALA A O     
602  C  CB    . ALA A 105 ? 0.1668 0.3538 0.2807 -0.0561 0.0512  0.0340  81  ALA A CB    
603  N  N     . ASP A 106 ? 0.1783 0.2864 0.2591 -0.0037 0.0661  -0.0044 82  ASP A N     
604  C  CA    . ASP A 106 ? 0.2082 0.2614 0.2412 0.0228  0.0587  0.0167  82  ASP A CA    
605  C  C     . ASP A 106 ? 0.2016 0.2693 0.2389 0.0156  0.0435  0.0003  82  ASP A C     
606  O  O     . ASP A 106 ? 0.1955 0.2749 0.2379 -0.0115 0.0695  0.0028  82  ASP A O     
607  C  CB    . ASP A 106 ? 0.2423 0.2514 0.2364 0.0309  0.0613  0.0200  82  ASP A CB    
608  C  CG    . ASP A 106 ? 0.2556 0.2610 0.2395 0.0088  0.0506  0.0208  82  ASP A CG    
609  O  OD1   . ASP A 106 ? 0.2116 0.2878 0.2578 -0.0059 0.0897  0.0251  82  ASP A OD1   
610  O  OD2   . ASP A 106 ? 0.1848 0.2601 0.2558 -0.0081 0.0746  0.0055  82  ASP A OD2   
611  N  N     . GLN A 107 ? 0.2203 0.2656 0.2466 0.0344  0.0269  0.0026  83  GLN A N     
612  C  CA    . GLN A 107 ? 0.2067 0.2466 0.2190 0.0105  0.0378  0.0055  83  GLN A CA    
613  C  C     . GLN A 107 ? 0.2340 0.2308 0.2310 0.0001  0.0397  0.0205  83  GLN A C     
614  O  O     . GLN A 107 ? 0.2567 0.2081 0.2777 0.0046  0.0343  0.0068  83  GLN A O     
615  C  CB    . GLN A 107 ? 0.2457 0.2596 0.1883 0.0155  0.0382  0.0405  83  GLN A CB    
616  C  CG    . GLN A 107 ? 0.2634 0.2585 0.1846 -0.0107 0.0383  0.0308  83  GLN A CG    
617  C  CD    . GLN A 107 ? 0.2006 0.2565 0.2189 -0.0229 0.0222  0.0204  83  GLN A CD    
618  O  OE1   . GLN A 107 ? 0.2340 0.2512 0.2154 -0.0437 0.0797  0.0367  83  GLN A OE1   
619  N  NE2   . GLN A 107 ? 0.2259 0.2903 0.2690 -0.0111 0.0536  0.0601  83  GLN A NE2   
620  N  N     . LEU A 108 ? 0.1886 0.2293 0.2129 0.0062  0.0531  0.0220  84  LEU A N     
621  C  CA    . LEU A 108 ? 0.1973 0.2359 0.2112 -0.0170 0.0498  0.0170  84  LEU A CA    
622  C  C     . LEU A 108 ? 0.1837 0.2469 0.2242 -0.0052 0.0440  -0.0032 84  LEU A C     
623  O  O     . LEU A 108 ? 0.2088 0.2558 0.2367 0.0062  0.0594  -0.0062 84  LEU A O     
624  C  CB    . LEU A 108 ? 0.1948 0.2306 0.2075 -0.0015 0.0686  -0.0150 84  LEU A CB    
625  C  CG    . LEU A 108 ? 0.2202 0.2762 0.2781 -0.0544 0.0146  0.0149  84  LEU A CG    
626  C  CD1   . LEU A 108 ? 0.2910 0.2755 0.3677 -0.0353 0.0237  -0.0233 84  LEU A CD1   
627  C  CD2   . LEU A 108 ? 0.2374 0.3198 0.3548 -0.0136 -0.0021 -0.0191 84  LEU A CD2   
628  N  N     . GLY A 109 ? 0.1828 0.2245 0.2114 -0.0155 0.0387  -0.0015 85  GLY A N     
629  C  CA    . GLY A 109 ? 0.1787 0.2197 0.2305 0.0061  0.0453  -0.0274 85  GLY A CA    
630  C  C     . GLY A 109 ? 0.1823 0.2144 0.2340 0.0110  0.0218  0.0096  85  GLY A C     
631  O  O     . GLY A 109 ? 0.2277 0.2395 0.2352 -0.0033 0.0483  0.0051  85  GLY A O     
632  N  N     . ASP A 110 ? 0.1821 0.2308 0.2301 0.0107  0.0369  0.0125  86  ASP A N     
633  C  CA    . ASP A 110 ? 0.1864 0.2464 0.2534 0.0444  0.0360  0.0372  86  ASP A CA    
634  C  C     . ASP A 110 ? 0.1894 0.2269 0.2582 0.0166  0.0444  0.0197  86  ASP A C     
635  O  O     . ASP A 110 ? 0.2495 0.2366 0.2202 -0.0139 0.0429  0.0154  86  ASP A O     
636  C  CB    . ASP A 110 ? 0.2678 0.2885 0.2634 0.0141  0.0634  0.0432  86  ASP A CB    
637  C  CG    . ASP A 110 ? 0.3004 0.3189 0.3076 0.0090  0.1168  0.0368  86  ASP A CG    
638  O  OD1   . ASP A 110 ? 0.3011 0.3042 0.4177 -0.0381 0.0940  0.0698  86  ASP A OD1   
639  O  OD2   . ASP A 110 ? 0.4339 0.3619 0.3268 0.0603  0.1996  0.0436  86  ASP A OD2   
640  N  N     . ILE A 111 ? 0.1956 0.2398 0.2161 0.0037  0.0450  0.0207  87  ILE A N     
641  C  CA    . ILE A 111 ? 0.1817 0.2539 0.2159 -0.0138 0.0257  0.0165  87  ILE A CA    
642  C  C     . ILE A 111 ? 0.2139 0.2340 0.2180 0.0103  0.0264  -0.0035 87  ILE A C     
643  O  O     . ILE A 111 ? 0.2399 0.2067 0.2080 0.0003  0.0341  0.0024  87  ILE A O     
644  C  CB    . ILE A 111 ? 0.2364 0.2304 0.1937 -0.0070 0.0415  -0.0079 87  ILE A CB    
645  C  CG1   . ILE A 111 ? 0.2623 0.2776 0.2157 0.0184  0.0194  0.0008  87  ILE A CG1   
646  C  CG2   . ILE A 111 ? 0.2491 0.2596 0.2425 -0.0066 0.0581  0.0125  87  ILE A CG2   
647  C  CD1   . ILE A 111 ? 0.3167 0.2588 0.2168 0.0547  0.0826  -0.0659 87  ILE A CD1   
648  N  N     . PHE A 112 ? 0.2580 0.2410 0.2045 0.0030  0.0128  0.0225  88  PHE A N     
649  C  CA    . PHE A 112 ? 0.2014 0.1864 0.2077 -0.0050 0.0138  0.0178  88  PHE A CA    
650  C  C     . PHE A 112 ? 0.2153 0.2041 0.2194 0.0022  0.0322  -0.0172 88  PHE A C     
651  O  O     . PHE A 112 ? 0.2250 0.2484 0.2098 -0.0078 0.0646  0.0164  88  PHE A O     
652  C  CB    . PHE A 112 ? 0.1926 0.2067 0.2207 0.0084  0.0464  0.0424  88  PHE A CB    
653  C  CG    . PHE A 112 ? 0.2350 0.2002 0.2029 0.0066  0.0271  0.0039  88  PHE A CG    
654  C  CD1   . PHE A 112 ? 0.2374 0.2343 0.2088 0.0104  0.0086  0.0037  88  PHE A CD1   
655  C  CD2   . PHE A 112 ? 0.2223 0.2123 0.2050 0.0038  0.0229  0.0104  88  PHE A CD2   
656  C  CE1   . PHE A 112 ? 0.2569 0.2337 0.2214 0.0253  0.0132  0.0220  88  PHE A CE1   
657  C  CE2   . PHE A 112 ? 0.2552 0.2322 0.1966 0.0201  -0.0023 -0.0082 88  PHE A CE2   
658  C  CZ    . PHE A 112 ? 0.2585 0.2460 0.2215 0.0001  0.0086  -0.0068 88  PHE A CZ    
659  N  N     . THR A 113 ? 0.2252 0.2222 0.2023 -0.0149 0.0267  -0.0013 89  THR A N     
660  C  CA    . THR A 113 ? 0.2013 0.2199 0.2346 -0.0123 0.0340  -0.0141 89  THR A CA    
661  C  C     . THR A 113 ? 0.2357 0.2030 0.2005 -0.0045 -0.0055 -0.0120 89  THR A C     
662  O  O     . THR A 113 ? 0.2495 0.2365 0.1918 -0.0121 0.0274  -0.0108 89  THR A O     
663  C  CB    . THR A 113 ? 0.2283 0.2148 0.2414 -0.0246 0.0452  0.0084  89  THR A CB    
664  O  OG1   . THR A 113 ? 0.2269 0.2596 0.2362 0.0058  0.0488  -0.0147 89  THR A OG1   
665  C  CG2   . THR A 113 ? 0.2779 0.2177 0.2938 -0.0254 0.0312  -0.0157 89  THR A CG2   
666  N  N     . HIS A 114 ? 0.2357 0.2223 0.1971 0.0254  0.0197  0.0286  90  HIS A N     
667  C  CA    . HIS A 114 ? 0.2367 0.2553 0.2142 0.0364  0.0143  0.0235  90  HIS A CA    
668  C  C     . HIS A 114 ? 0.2446 0.2157 0.2100 -0.0135 0.0050  0.0079  90  HIS A C     
669  O  O     . HIS A 114 ? 0.2668 0.2760 0.2304 0.0261  0.0334  -0.0122 90  HIS A O     
670  C  CB    . HIS A 114 ? 0.1865 0.2479 0.2308 0.0069  -0.0006 0.0070  90  HIS A CB    
671  C  CG    . HIS A 114 ? 0.2188 0.2326 0.2155 0.0243  -0.0010 0.0079  90  HIS A CG    
672  N  ND1   . HIS A 114 ? 0.2373 0.2366 0.2516 0.0266  0.0293  0.0079  90  HIS A ND1   
673  C  CD2   . HIS A 114 ? 0.2483 0.2334 0.1752 -0.0020 0.0217  0.0262  90  HIS A CD2   
674  C  CE1   . HIS A 114 ? 0.2315 0.2395 0.2334 0.0234  0.0168  -0.0245 90  HIS A CE1   
675  N  NE2   . HIS A 114 ? 0.2832 0.2503 0.1950 0.0193  0.0349  0.0069  90  HIS A NE2   
676  N  N     . ASP A 115 ? 0.2557 0.2001 0.1908 -0.0048 0.0259  0.0202  91  ASP A N     
677  C  CA    . ASP A 115 ? 0.2345 0.2166 0.2344 -0.0015 0.0260  -0.0034 91  ASP A CA    
678  C  C     . ASP A 115 ? 0.2644 0.2266 0.2444 0.0391  -0.0110 0.0052  91  ASP A C     
679  O  O     . ASP A 115 ? 0.2822 0.2758 0.2753 0.0360  0.0175  -0.0132 91  ASP A O     
680  C  CB    . ASP A 115 ? 0.2157 0.2373 0.1837 -0.0155 0.0249  0.0048  91  ASP A CB    
681  C  CG    . ASP A 115 ? 0.2422 0.2733 0.2010 0.0210  0.0000  0.0032  91  ASP A CG    
682  O  OD1   . ASP A 115 ? 0.2601 0.2515 0.2506 0.0340  0.0395  0.0038  91  ASP A OD1   
683  O  OD2   . ASP A 115 ? 0.2365 0.2793 0.2826 -0.0063 0.0336  -0.0145 91  ASP A OD2   
684  N  N     . ILE A 116 ? 0.2448 0.2467 0.2186 0.0150  -0.0138 0.0076  92  ILE A N     
685  C  CA    . ILE A 116 ? 0.2615 0.2264 0.2141 0.0370  -0.0049 -0.0051 92  ILE A CA    
686  C  C     . ILE A 116 ? 0.2915 0.2356 0.2273 0.0141  0.0088  -0.0105 92  ILE A C     
687  O  O     . ILE A 116 ? 0.2735 0.2587 0.2247 0.0251  0.0211  0.0054  92  ILE A O     
688  C  CB    . ILE A 116 ? 0.2125 0.2373 0.1838 0.0097  0.0166  0.0427  92  ILE A CB    
689  C  CG1   . ILE A 116 ? 0.3396 0.2385 0.1833 0.0216  -0.0160 0.0385  92  ILE A CG1   
690  C  CG2   . ILE A 116 ? 0.2077 0.2528 0.2422 -0.0085 0.0272  -0.0130 92  ILE A CG2   
691  C  CD1   . ILE A 116 ? 0.3934 0.2556 0.2746 0.0096  -0.0236 0.1046  92  ILE A CD1   
692  N  N     . ARG A 117 ? 0.2740 0.2075 0.2519 0.0132  0.0055  -0.0179 93  ARG A N     
693  C  CA    . ARG A 117 ? 0.2898 0.2104 0.2423 0.0032  0.0223  -0.0169 93  ARG A CA    
694  C  C     . ARG A 117 ? 0.2674 0.2505 0.2368 0.0069  -0.0025 -0.0043 93  ARG A C     
695  O  O     . ARG A 117 ? 0.3160 0.2875 0.2116 0.0144  0.0512  -0.0129 93  ARG A O     
696  C  CB    . ARG A 117 ? 0.2916 0.2264 0.2442 -0.0254 0.0095  -0.0082 93  ARG A CB    
697  C  CG    . ARG A 117 ? 0.2826 0.2455 0.2050 -0.0225 0.0372  -0.0014 93  ARG A CG    
698  C  CD    . ARG A 117 ? 0.3689 0.2948 0.1736 -0.0610 0.0515  0.0307  93  ARG A CD    
699  N  NE    . ARG A 117 ? 0.3925 0.3328 0.3032 -0.0611 0.0087  0.0000  93  ARG A NE    
700  C  CZ    . ARG A 117 ? 0.3297 0.3080 0.2887 -0.0520 0.0037  -0.0232 93  ARG A CZ    
701  N  NH1   . ARG A 117 ? 0.2872 0.4994 0.3163 -0.0219 0.0946  0.0162  93  ARG A NH1   
702  N  NH2   . ARG A 117 ? 0.3883 0.3345 0.3365 -0.0666 0.0294  -0.0703 93  ARG A NH2   
703  N  N     . ALA A 118 ? 0.2652 0.2515 0.2585 0.0390  -0.0192 0.0124  94  ALA A N     
704  C  CA    . ALA A 118 ? 0.2907 0.3026 0.2306 0.0682  -0.0206 0.0337  94  ALA A CA    
705  C  C     . ALA A 118 ? 0.3238 0.3064 0.2391 0.0522  -0.0039 0.0086  94  ALA A C     
706  O  O     . ALA A 118 ? 0.3598 0.3865 0.2616 0.0887  0.0290  -0.0171 94  ALA A O     
707  C  CB    . ALA A 118 ? 0.2973 0.3601 0.2740 0.0926  -0.0469 -0.0095 94  ALA A CB    
708  N  N     . GLN A 119 ? 0.3311 0.3095 0.2341 0.0013  0.0081  0.0167  95  GLN A N     
709  C  CA    . GLN A 119 ? 0.3016 0.3028 0.2401 0.0263  0.0107  0.0172  95  GLN A CA    
710  C  C     . GLN A 119 ? 0.3110 0.2728 0.2786 0.0141  0.0118  -0.0008 95  GLN A C     
711  O  O     . GLN A 119 ? 0.4139 0.2712 0.2861 0.0454  0.0505  -0.0070 95  GLN A O     
712  C  CB    . GLN A 119 ? 0.3417 0.3086 0.2540 0.0039  0.0469  -0.0052 95  GLN A CB    
713  C  CG    . GLN A 119 ? 0.3792 0.3980 0.2112 -0.0086 0.0425  -0.0435 95  GLN A CG    
714  C  CD    . GLN A 119 ? 0.3841 0.4210 0.2668 -0.0045 0.0492  -0.0663 95  GLN A CD    
715  O  OE1   . GLN A 119 ? 0.4130 0.4328 0.3970 0.0765  0.0759  -0.0512 95  GLN A OE1   
716  N  NE2   . GLN A 119 ? 0.3633 0.5233 0.3142 -0.0789 0.0592  -0.0494 95  GLN A NE2   
717  N  N     . GLY A 120 ? 0.3010 0.2631 0.2824 0.0087  -0.0397 0.0175  96  GLY A N     
718  C  CA    . GLY A 120 ? 0.3025 0.2330 0.2265 0.0144  0.0152  -0.0016 96  GLY A CA    
719  C  C     . GLY A 120 ? 0.3213 0.2243 0.2508 0.0055  -0.0068 -0.0058 96  GLY A C     
720  O  O     . GLY A 120 ? 0.2889 0.2677 0.2249 0.0088  0.0307  0.0069  96  GLY A O     
721  N  N     . VAL A 121 ? 0.2870 0.2160 0.2570 0.0023  0.0182  0.0082  97  VAL A N     
722  C  CA    . VAL A 121 ? 0.2947 0.2321 0.1812 0.0078  0.0200  -0.0155 97  VAL A CA    
723  C  C     . VAL A 121 ? 0.2787 0.2335 0.2193 -0.0026 0.0055  -0.0124 97  VAL A C     
724  O  O     . VAL A 121 ? 0.3094 0.2724 0.2078 0.0134  0.0026  0.0059  97  VAL A O     
725  C  CB    . VAL A 121 ? 0.2713 0.2201 0.2070 -0.0008 0.0290  0.0103  97  VAL A CB    
726  C  CG1   . VAL A 121 ? 0.3267 0.2229 0.2782 0.0195  -0.0024 0.0095  97  VAL A CG1   
727  C  CG2   . VAL A 121 ? 0.2588 0.2877 0.2096 0.0172  0.0270  0.0406  97  VAL A CG2   
728  N  N     . HIS A 122 ? 0.2485 0.2186 0.2429 0.0195  0.0126  -0.0409 98  HIS A N     
729  C  CA    . HIS A 122 ? 0.2392 0.2255 0.2589 -0.0146 -0.0277 -0.0338 98  HIS A CA    
730  C  C     . HIS A 122 ? 0.2637 0.2127 0.2291 0.0000  -0.0041 -0.0021 98  HIS A C     
731  O  O     . HIS A 122 ? 0.2823 0.2264 0.2657 0.0074  0.0088  0.0132  98  HIS A O     
732  C  CB    . HIS A 122 ? 0.2890 0.2770 0.2156 0.0124  -0.0268 0.0046  98  HIS A CB    
733  C  CG    . HIS A 122 ? 0.2883 0.3131 0.2391 0.0183  -0.0293 0.0196  98  HIS A CG    
734  N  ND1   . HIS A 122 ? 0.3277 0.3146 0.2736 0.0051  0.0150  -0.0310 98  HIS A ND1   
735  C  CD2   . HIS A 122 ? 0.3138 0.2790 0.2608 0.0009  -0.0086 0.0083  98  HIS A CD2   
736  C  CE1   . HIS A 122 ? 0.3263 0.3026 0.2558 0.0255  -0.0269 -0.0258 98  HIS A CE1   
737  N  NE2   . HIS A 122 ? 0.3219 0.3010 0.2980 -0.0115 -0.0231 -0.0226 98  HIS A NE2   
738  N  N     . TYR A 123 ? 0.2893 0.2614 0.2421 0.0092  0.0170  -0.0246 99  TYR A N     
739  C  CA    . TYR A 123 ? 0.3019 0.2168 0.2411 -0.0170 0.0172  -0.0115 99  TYR A CA    
740  C  C     . TYR A 123 ? 0.2525 0.2697 0.2868 0.0036  0.0030  0.0121  99  TYR A C     
741  O  O     . TYR A 123 ? 0.3319 0.2303 0.3021 0.0062  0.0125  0.0114  99  TYR A O     
742  C  CB    . TYR A 123 ? 0.2538 0.2382 0.2385 -0.0070 0.0323  0.0000  99  TYR A CB    
743  C  CG    . TYR A 123 ? 0.2533 0.2222 0.2684 -0.0182 0.0276  -0.0099 99  TYR A CG    
744  C  CD1   . TYR A 123 ? 0.2660 0.2486 0.2409 -0.0102 0.0283  0.0023  99  TYR A CD1   
745  C  CD2   . TYR A 123 ? 0.2552 0.2556 0.2615 -0.0091 0.0239  -0.0024 99  TYR A CD2   
746  C  CE1   . TYR A 123 ? 0.2422 0.2366 0.2403 -0.0439 0.0374  -0.0082 99  TYR A CE1   
747  C  CE2   . TYR A 123 ? 0.2556 0.2044 0.3231 0.0079  0.0202  0.0115  99  TYR A CE2   
748  C  CZ    . TYR A 123 ? 0.2395 0.2049 0.2495 -0.0155 -0.0037 -0.0009 99  TYR A CZ    
749  O  OH    . TYR A 123 ? 0.2425 0.2311 0.2326 -0.0218 0.0466  0.0002  99  TYR A OH    
750  N  N     . GLN A 124 ? 0.2455 0.2510 0.3480 0.0067  -0.0027 -0.0324 100 GLN A N     
751  C  CA    . GLN A 124 ? 0.2618 0.2772 0.2941 -0.0027 0.0003  -0.0253 100 GLN A CA    
752  C  C     . GLN A 124 ? 0.2448 0.2535 0.3047 -0.0171 -0.0011 -0.0127 100 GLN A C     
753  O  O     . GLN A 124 ? 0.2553 0.2847 0.3732 -0.0066 0.0372  -0.0067 100 GLN A O     
754  C  CB    . GLN A 124 ? 0.3063 0.2633 0.2797 -0.0036 0.0195  -0.0331 100 GLN A CB    
755  C  CG    . GLN A 124 ? 0.3305 0.2462 0.2756 -0.0148 0.0419  -0.0366 100 GLN A CG    
756  C  CD    . GLN A 124 ? 0.3454 0.2755 0.3367 -0.0139 0.0599  0.0158  100 GLN A CD    
757  O  OE1   . GLN A 124 ? 0.3319 0.3695 0.4341 0.0003  0.1067  0.0417  100 GLN A OE1   
758  N  NE2   . GLN A 124 ? 0.4031 0.3669 0.3136 -0.0215 0.0216  0.0407  100 GLN A NE2   
759  N  N     . THR A 125 ? 0.2579 0.2492 0.3313 -0.0068 -0.0155 -0.0245 101 THR A N     
760  C  CA    . THR A 125 ? 0.2583 0.2625 0.3303 -0.0096 0.0127  -0.0234 101 THR A CA    
761  C  C     . THR A 125 ? 0.2836 0.3537 0.3356 -0.0273 0.0280  -0.0137 101 THR A C     
762  O  O     . THR A 125 ? 0.3118 0.4112 0.2963 -0.0086 0.0537  0.0186  101 THR A O     
763  C  CB    . THR A 125 ? 0.2794 0.2547 0.2807 0.0091  0.0187  0.0116  101 THR A CB    
764  O  OG1   . THR A 125 ? 0.3110 0.2763 0.2707 -0.0127 0.0092  -0.0206 101 THR A OG1   
765  C  CG2   . THR A 125 ? 0.2902 0.2300 0.2852 0.0002  0.0187  0.0210  101 THR A CG2   
766  N  N     . LYS A 126 ? 0.2930 0.2923 0.3645 -0.0698 0.0555  -0.0193 102 LYS A N     
767  C  CA    . LYS A 126 ? 0.3492 0.3558 0.3798 -0.0521 0.0727  -0.0092 102 LYS A CA    
768  C  C     . LYS A 126 ? 0.2349 0.3167 0.3567 -0.0729 0.0755  0.0226  102 LYS A C     
769  O  O     . LYS A 126 ? 0.2427 0.3401 0.3709 -0.0447 0.0723  0.0218  102 LYS A O     
770  C  CB    . LYS A 126 ? 0.3435 0.4111 0.3904 -0.0631 -0.0026 -0.0028 102 LYS A CB    
771  C  CG    . LYS A 126 ? 0.3733 0.3502 0.4908 -0.0804 0.0064  0.0116  102 LYS A CG    
772  C  CD    . LYS A 126 ? 0.3958 0.3545 0.5955 -0.0485 0.0574  0.0394  102 LYS A CD    
773  C  CE    . LYS A 126 ? 0.6367 0.4806 0.4993 -0.0507 0.0860  -0.0520 102 LYS A CE    
774  N  NZ    . LYS A 126 ? 0.5890 0.5027 0.5020 -0.0864 0.1199  -0.0741 102 LYS A NZ    
775  N  N     . PRO A 127 ? 0.2557 0.3522 0.3714 -0.0498 0.0679  0.0116  103 PRO A N     
776  C  CA    . PRO A 127 ? 0.2713 0.3742 0.3249 -0.0369 0.0725  0.0079  103 PRO A CA    
777  C  C     . PRO A 127 ? 0.2571 0.3438 0.3883 -0.0536 0.0605  0.0070  103 PRO A C     
778  O  O     . PRO A 127 ? 0.2564 0.4046 0.4370 -0.0813 0.1202  0.0248  103 PRO A O     
779  C  CB    . PRO A 127 ? 0.2936 0.3248 0.3408 -0.0752 0.0565  0.0465  103 PRO A CB    
780  C  CG    . PRO A 127 ? 0.3915 0.3698 0.4053 0.0100  0.1069  0.0009  103 PRO A CG    
781  C  CD    . PRO A 127 ? 0.3700 0.3802 0.3915 0.0048  0.0546  0.0400  103 PRO A CD    
782  N  N     . LYS A 128 ? 0.2133 0.3575 0.3649 -0.0382 0.0782  -0.0027 104 LYS A N     
783  C  CA    . LYS A 128 ? 0.2237 0.4195 0.3451 -0.0259 0.0796  -0.0128 104 LYS A CA    
784  C  C     . LYS A 128 ? 0.2991 0.5409 0.3369 0.0503  0.0771  0.0118  104 LYS A C     
785  O  O     . LYS A 128 ? 0.4351 0.6736 0.5049 0.1478  0.1428  -0.0635 104 LYS A O     
786  C  CB    . LYS A 128 ? 0.3033 0.4629 0.4082 0.0314  0.0464  -0.0063 104 LYS A CB    
787  C  CG    . LYS A 128 ? 0.3360 0.5602 0.4060 -0.0577 -0.0204 0.0185  104 LYS A CG    
788  C  CD    . LYS A 128 ? 0.3991 0.5021 0.3633 -0.0242 0.0262  0.0064  104 LYS A CD    
789  C  CE    . LYS A 128 ? 0.4209 0.4312 0.3651 0.0278  -0.0148 -0.0149 104 LYS A CE    
790  N  NZ    . LYS A 128 ? 0.3600 0.4132 0.3992 0.0118  -0.0068 0.0072  104 LYS A NZ    
791  N  N     . GLY A 129 ? 0.1995 0.4974 0.3163 -0.0290 0.0827  -0.0353 105 GLY A N     
792  C  CA    . GLY A 129 ? 0.2036 0.4495 0.3228 0.0090  0.1075  -0.0371 105 GLY A CA    
793  C  C     . GLY A 129 ? 0.2764 0.3766 0.3250 -0.0160 0.0224  -0.0219 105 GLY A C     
794  O  O     . GLY A 129 ? 0.2742 0.3492 0.3343 -0.0125 0.0301  -0.0084 105 GLY A O     
795  N  N     . ALA A 130 ? 0.2457 0.3793 0.3131 -0.0063 -0.0052 0.0100  106 ALA A N     
796  C  CA    . ALA A 130 ? 0.2204 0.3129 0.2982 -0.0092 0.0297  0.0363  106 ALA A CA    
797  C  C     . ALA A 130 ? 0.2816 0.3098 0.3417 0.0086  0.0290  0.0223  106 ALA A C     
798  O  O     . ALA A 130 ? 0.2515 0.3735 0.2949 0.0182  0.0706  0.0402  106 ALA A O     
799  C  CB    . ALA A 130 ? 0.2926 0.3178 0.3150 -0.0062 0.0485  0.0677  106 ALA A CB    
800  N  N     . PHE A 131 ? 0.2817 0.3403 0.2871 0.0179  0.0517  0.0473  107 PHE A N     
801  C  CA    . PHE A 131 ? 0.2878 0.3341 0.2658 0.0090  0.0644  -0.0090 107 PHE A CA    
802  C  C     . PHE A 131 ? 0.2653 0.3137 0.3184 -0.0009 0.0406  0.0157  107 PHE A C     
803  O  O     . PHE A 131 ? 0.2271 0.4206 0.3099 0.0089  0.0617  0.0378  107 PHE A O     
804  C  CB    . PHE A 131 ? 0.3176 0.4310 0.2394 0.0026  0.0743  -0.0065 107 PHE A CB    
805  C  CG    . PHE A 131 ? 0.3509 0.3832 0.3136 0.0189  0.0174  -0.0077 107 PHE A CG    
806  C  CD1   . PHE A 131 ? 0.3558 0.4322 0.3740 0.0151  -0.0061 -0.0473 107 PHE A CD1   
807  C  CD2   . PHE A 131 ? 0.3631 0.4235 0.3563 0.0063  0.0565  0.0038  107 PHE A CD2   
808  C  CE1   . PHE A 131 ? 0.3751 0.4666 0.3854 0.0054  0.0251  0.0136  107 PHE A CE1   
809  C  CE2   . PHE A 131 ? 0.4648 0.4183 0.3708 -0.0145 0.0488  0.0555  107 PHE A CE2   
810  C  CZ    . PHE A 131 ? 0.4449 0.4788 0.3696 0.0088  0.0511  0.0321  107 PHE A CZ    
811  N  N     . PRO A 132 ? 0.2415 0.3486 0.3412 0.0242  0.0675  0.0398  108 PRO A N     
812  C  CA    . PRO A 132 ? 0.2673 0.2954 0.3121 0.0241  0.0419  0.0623  108 PRO A CA    
813  C  C     . PRO A 132 ? 0.2513 0.3013 0.2459 0.0098  0.0590  0.0112  108 PRO A C     
814  O  O     . PRO A 132 ? 0.2020 0.2690 0.2896 0.0158  0.0537  0.0249  108 PRO A O     
815  C  CB    . PRO A 132 ? 0.2980 0.2895 0.3512 0.0467  0.0732  0.0806  108 PRO A CB    
816  C  CG    . PRO A 132 ? 0.3230 0.3997 0.3923 0.0030  0.0218  0.0665  108 PRO A CG    
817  C  CD    . PRO A 132 ? 0.3198 0.3588 0.3661 0.0341  0.0336  0.0460  108 PRO A CD    
818  N  N     . PRO A 133 ? 0.2247 0.3008 0.2685 0.0455  0.0654  -0.0178 109 PRO A N     
819  C  CA    . PRO A 133 ? 0.2161 0.3044 0.2272 0.0436  0.0683  -0.0073 109 PRO A CA    
820  C  C     . PRO A 133 ? 0.2098 0.2545 0.2232 0.0185  0.0639  0.0012  109 PRO A C     
821  O  O     . PRO A 133 ? 0.2216 0.2831 0.2335 0.0385  0.0732  0.0114  109 PRO A O     
822  C  CB    . PRO A 133 ? 0.2600 0.2744 0.2648 0.0053  0.0497  -0.0212 109 PRO A CB    
823  C  CG    . PRO A 133 ? 0.2765 0.2729 0.3447 0.0161  0.0360  -0.0189 109 PRO A CG    
824  C  CD    . PRO A 133 ? 0.2875 0.2829 0.3507 0.0333  0.0315  -0.0170 109 PRO A CD    
825  N  N     . THR A 134 ? 0.1844 0.2614 0.2013 0.0113  0.0773  0.0091  110 THR A N     
826  C  CA    . THR A 134 ? 0.2219 0.2135 0.1808 0.0308  0.0621  -0.0192 110 THR A CA    
827  C  C     . THR A 134 ? 0.2121 0.2472 0.1765 0.0112  0.0571  -0.0012 110 THR A C     
828  O  O     . THR A 134 ? 0.1912 0.2579 0.1709 -0.0004 0.0673  0.0044  110 THR A O     
829  C  CB    . THR A 134 ? 0.2087 0.1907 0.1977 0.0118  0.0763  0.0042  110 THR A CB    
830  O  OG1   . THR A 134 ? 0.1886 0.2373 0.2450 -0.0127 0.0668  -0.0137 110 THR A OG1   
831  C  CG2   . THR A 134 ? 0.2232 0.2616 0.1971 0.0373  0.0746  -0.0145 110 THR A CG2   
832  N  N     . ALA A 135 ? 0.1980 0.1935 0.1953 -0.0005 0.0702  0.0173  111 ALA A N     
833  C  CA    . ALA A 135 ? 0.1807 0.2099 0.1904 -0.0227 0.0312  0.0062  111 ALA A CA    
834  C  C     . ALA A 135 ? 0.1903 0.2013 0.1883 -0.0019 0.0348  0.0149  111 ALA A C     
835  O  O     . ALA A 135 ? 0.2303 0.2058 0.2045 -0.0025 0.0514  0.0089  111 ALA A O     
836  C  CB    . ALA A 135 ? 0.1634 0.2451 0.1712 -0.0057 0.0672  -0.0119 111 ALA A CB    
837  N  N     . ARG A 136 ? 0.1554 0.2200 0.2055 -0.0050 0.0509  -0.0151 112 ARG A N     
838  C  CA    . ARG A 136 ? 0.1702 0.2562 0.1943 -0.0143 0.0157  0.0184  112 ARG A CA    
839  C  C     . ARG A 136 ? 0.1832 0.2162 0.1848 0.0065  0.0313  -0.0076 112 ARG A C     
840  O  O     . ARG A 136 ? 0.1757 0.2238 0.2598 0.0027  0.0400  0.0125  112 ARG A O     
841  C  CB    . ARG A 136 ? 0.1915 0.2334 0.1882 0.0023  0.0210  -0.0131 112 ARG A CB    
842  C  CG    . ARG A 136 ? 0.2388 0.2122 0.2218 -0.0066 0.0319  -0.0181 112 ARG A CG    
843  C  CD    . ARG A 136 ? 0.2342 0.2843 0.2449 -0.0116 0.0301  -0.0239 112 ARG A CD    
844  N  NE    . ARG A 136 ? 0.2375 0.2747 0.2290 -0.0001 0.0576  -0.0320 112 ARG A NE    
845  C  CZ    . ARG A 136 ? 0.2866 0.2551 0.2169 -0.0243 0.0209  -0.0168 112 ARG A CZ    
846  N  NH1   . ARG A 136 ? 0.2714 0.3014 0.2213 -0.0605 0.0682  -0.0435 112 ARG A NH1   
847  N  NH2   . ARG A 136 ? 0.3097 0.3028 0.2264 -0.0390 0.0647  0.0105  112 ARG A NH2   
848  N  N     . SER A 137 ? 0.1860 0.2242 0.1895 0.0023  0.0383  -0.0157 113 SER A N     
849  C  CA    . SER A 137 ? 0.2378 0.2300 0.1704 -0.0091 0.0360  -0.0082 113 SER A CA    
850  C  C     . SER A 137 ? 0.2184 0.2004 0.1615 -0.0015 0.0485  0.0121  113 SER A C     
851  O  O     . SER A 137 ? 0.2017 0.2105 0.1894 -0.0043 0.0349  0.0102  113 SER A O     
852  C  CB    . SER A 137 ? 0.2151 0.1854 0.1854 0.0144  0.0748  -0.0112 113 SER A CB    
853  O  OG    . SER A 137 ? 0.2260 0.2182 0.1691 -0.0202 0.0512  0.0071  113 SER A OG    
854  N  N     . MSE A 138 ? 0.2223 0.2205 0.1929 -0.0141 0.0279  -0.0034 114 MSE A N     
855  C  CA    . MSE A 138 ? 0.2170 0.1983 0.2162 -0.0361 0.0317  0.0129  114 MSE A CA    
856  C  C     . MSE A 138 ? 0.2083 0.2146 0.1881 -0.0047 0.0318  0.0128  114 MSE A C     
857  O  O     . MSE A 138 ? 0.1691 0.2210 0.1714 0.0116  0.0638  0.0161  114 MSE A O     
858  C  CB    . MSE A 138 ? 0.2759 0.1897 0.2312 -0.0159 -0.0308 0.0012  114 MSE A CB    
859  C  CG    . MSE A 138 ? 0.3208 0.3012 0.2931 -0.0147 -0.0080 0.0681  114 MSE A CG    
860  SE SE    . MSE A 138 ? 0.4955 0.4713 0.4388 0.0249  0.0027  -0.0215 114 MSE A SE    
861  C  CE    . MSE A 138 ? 0.4365 0.2936 0.2072 0.0550  0.1098  0.0027  114 MSE A CE    
862  N  N     . ILE A 139 ? 0.2139 0.2154 0.1919 -0.0190 0.0407  0.0101  115 ILE A N     
863  C  CA    . ILE A 139 ? 0.2245 0.2447 0.1938 -0.0408 0.0428  0.0103  115 ILE A CA    
864  C  C     . ILE A 139 ? 0.2056 0.2163 0.1994 0.0089  0.0426  0.0146  115 ILE A C     
865  O  O     . ILE A 139 ? 0.2147 0.2474 0.1991 0.0000  0.0319  0.0232  115 ILE A O     
866  C  CB    . ILE A 139 ? 0.2176 0.2282 0.1805 -0.0353 0.0518  0.0252  115 ILE A CB    
867  C  CG1   . ILE A 139 ? 0.2357 0.2355 0.2563 -0.0308 0.0289  0.0061  115 ILE A CG1   
868  C  CG2   . ILE A 139 ? 0.2512 0.2499 0.1684 -0.0088 0.0701  0.0280  115 ILE A CG2   
869  C  CD1   . ILE A 139 ? 0.2077 0.2540 0.1915 -0.0317 0.0855  0.0264  115 ILE A CD1   
870  N  N     . PHE A 140 ? 0.2005 0.2122 0.1759 0.0008  0.0530  -0.0042 116 PHE A N     
871  C  CA    . PHE A 140 ? 0.2269 0.2308 0.1577 0.0042  0.0306  0.0138  116 PHE A CA    
872  C  C     . PHE A 140 ? 0.2011 0.2465 0.1981 0.0146  0.0408  0.0121  116 PHE A C     
873  O  O     . PHE A 140 ? 0.2076 0.2496 0.2191 -0.0043 0.0327  0.0350  116 PHE A O     
874  C  CB    . PHE A 140 ? 0.2728 0.2042 0.1912 -0.0545 0.0517  0.0196  116 PHE A CB    
875  C  CG    . PHE A 140 ? 0.2390 0.2042 0.1983 -0.0272 0.0386  0.0357  116 PHE A CG    
876  C  CD1   . PHE A 140 ? 0.2464 0.2406 0.2234 -0.0123 0.0204  0.0271  116 PHE A CD1   
877  C  CD2   . PHE A 140 ? 0.2429 0.2281 0.1996 -0.0230 0.0194  -0.0010 116 PHE A CD2   
878  C  CE1   . PHE A 140 ? 0.2515 0.2248 0.2329 -0.0140 0.0298  0.0158  116 PHE A CE1   
879  C  CE2   . PHE A 140 ? 0.2987 0.2780 0.1910 -0.0051 0.0289  0.0432  116 PHE A CE2   
880  C  CZ    . PHE A 140 ? 0.2643 0.2255 0.2140 0.0107  0.0007  0.0464  116 PHE A CZ    
881  N  N     . VAL A 141 ? 0.1890 0.3007 0.2405 0.0212  0.0423  -0.0041 117 VAL A N     
882  C  CA    . VAL A 141 ? 0.2109 0.2348 0.2500 -0.0013 0.0614  -0.0082 117 VAL A CA    
883  C  C     . VAL A 141 ? 0.2443 0.2413 0.2600 -0.0063 0.0084  0.0062  117 VAL A C     
884  O  O     . VAL A 141 ? 0.2498 0.2847 0.2686 -0.0244 0.0029  0.0033  117 VAL A O     
885  C  CB    . VAL A 141 ? 0.2021 0.2500 0.2700 0.0163  0.0331  -0.0271 117 VAL A CB    
886  C  CG1   . VAL A 141 ? 0.2705 0.3018 0.2590 -0.0166 0.0746  0.0174  117 VAL A CG1   
887  C  CG2   . VAL A 141 ? 0.2552 0.2536 0.2299 -0.0135 -0.0028 0.0071  117 VAL A CG2   
888  N  N     . THR A 142 ? 0.2243 0.2554 0.2573 -0.0205 0.0627  -0.0078 118 THR A N     
889  C  CA    . THR A 142 ? 0.2409 0.2707 0.2620 -0.0367 0.0615  0.0170  118 THR A CA    
890  C  C     . THR A 142 ? 0.2591 0.2816 0.2779 -0.0052 0.0370  0.0172  118 THR A C     
891  O  O     . THR A 142 ? 0.2612 0.3053 0.3065 -0.0091 0.0508  -0.0067 118 THR A O     
892  C  CB    . THR A 142 ? 0.2610 0.2677 0.2855 -0.0084 0.0407  0.0045  118 THR A CB    
893  O  OG1   . THR A 142 ? 0.2167 0.2825 0.2611 -0.0293 0.0706  0.0233  118 THR A OG1   
894  C  CG2   . THR A 142 ? 0.2898 0.2975 0.2697 -0.0085 0.0416  -0.0189 118 THR A CG2   
895  N  N     . GLU A 143 ? 0.2465 0.3474 0.3434 -0.0147 0.0174  0.0381  119 GLU A N     
896  C  CA    . GLU A 143 ? 0.2648 0.3975 0.3380 -0.0126 0.0303  -0.0005 119 GLU A CA    
897  C  C     . GLU A 143 ? 0.2544 0.3542 0.3438 -0.0039 0.0516  0.0090  119 GLU A C     
898  O  O     . GLU A 143 ? 0.2683 0.3938 0.4351 0.0421  0.0581  0.0488  119 GLU A O     
899  C  CB    . GLU A 143 ? 0.3178 0.4480 0.3361 -0.0510 0.0276  -0.0374 119 GLU A CB    
900  C  CG    . GLU A 143 ? 0.4818 0.6025 0.3486 -0.0523 -0.0065 -0.0991 119 GLU A CG    
901  C  CD    . GLU A 143 ? 0.5377 0.8069 0.5546 -0.2199 0.0097  -0.1081 119 GLU A CD    
902  O  OE1   . GLU A 143 ? 0.7804 0.8691 0.5521 -0.2113 0.1044  -0.0887 119 GLU A OE1   
903  O  OE2   . GLU A 143 ? 0.3415 1.0703 0.8317 -0.1213 -0.0492 -0.0604 119 GLU A OE2   
904  N  N     . ASP A 144 ? 0.1966 0.3739 0.2974 -0.0412 0.0415  -0.0068 120 ASP A N     
905  C  CA    . ASP A 144 ? 0.1814 0.3704 0.2963 -0.0142 0.1035  -0.0040 120 ASP A CA    
906  C  C     . ASP A 144 ? 0.2487 0.3439 0.3050 -0.0066 0.0748  -0.0127 120 ASP A C     
907  O  O     . ASP A 144 ? 0.2446 0.3960 0.3037 0.0019  0.1545  0.0043  120 ASP A O     
908  C  CB    . ASP A 144 ? 0.2747 0.3440 0.3464 -0.0046 0.0899  -0.0076 120 ASP A CB    
909  C  CG    . ASP A 144 ? 0.2790 0.3437 0.3173 0.0053  0.0864  0.0099  120 ASP A CG    
910  O  OD1   . ASP A 144 ? 0.2187 0.3086 0.3465 -0.0028 0.0711  -0.0250 120 ASP A OD1   
911  O  OD2   . ASP A 144 ? 0.3140 0.3422 0.2680 0.0019  0.1282  0.0113  120 ASP A OD2   
912  N  N     . GLY A 145 ? 0.2223 0.3149 0.3210 -0.0106 0.0706  -0.0260 121 GLY A N     
913  C  CA    . GLY A 145 ? 0.2532 0.2918 0.3284 0.0022  0.0634  -0.0271 121 GLY A CA    
914  C  C     . GLY A 145 ? 0.2414 0.2517 0.3099 -0.0126 0.0642  -0.0317 121 GLY A C     
915  O  O     . GLY A 145 ? 0.2290 0.2843 0.2932 -0.0124 0.1026  -0.0503 121 GLY A O     
916  N  N     . GLU A 146 ? 0.2472 0.2626 0.2721 0.0107  0.0517  -0.0088 122 GLU A N     
917  C  CA    . GLU A 146 ? 0.2477 0.2799 0.2532 0.0213  0.0757  -0.0044 122 GLU A CA    
918  C  C     . GLU A 146 ? 0.2272 0.2614 0.2378 -0.0059 0.0422  0.0037  122 GLU A C     
919  O  O     . GLU A 146 ? 0.2073 0.3267 0.2407 -0.0094 0.0421  -0.0176 122 GLU A O     
920  C  CB    . GLU A 146 ? 0.2262 0.2882 0.2816 0.0084  0.0485  0.0025  122 GLU A CB    
921  C  CG    . GLU A 146 ? 0.2482 0.3602 0.3102 0.0223  0.0405  0.0230  122 GLU A CG    
922  C  CD    . GLU A 146 ? 0.3580 0.3978 0.2942 -0.0676 0.0536  0.0353  122 GLU A CD    
923  O  OE1   . GLU A 146 ? 0.2950 0.3474 0.2391 -0.0180 0.0806  0.0231  122 GLU A OE1   
924  O  OE2   . GLU A 146 ? 0.5272 0.5371 0.2913 -0.0826 0.1053  0.0528  122 GLU A OE2   
925  N  N     . ARG A 147 ? 0.2302 0.2808 0.2557 -0.0214 0.0591  -0.0065 123 ARG A N     
926  C  CA    A ARG A 147 ? 0.2335 0.2484 0.2250 0.0058  0.0503  0.0028  123 ARG A CA    
927  C  CA    B ARG A 147 ? 0.2297 0.2510 0.2296 0.0041  0.0491  0.0038  123 ARG A CA    
928  C  C     . ARG A 147 ? 0.2204 0.2412 0.2170 -0.0004 0.0320  -0.0153 123 ARG A C     
929  O  O     . ARG A 147 ? 0.2141 0.2718 0.2113 0.0278  0.0448  0.0044  123 ARG A O     
930  C  CB    A ARG A 147 ? 0.2699 0.2358 0.2082 0.0204  0.0533  -0.0110 123 ARG A CB    
931  C  CB    B ARG A 147 ? 0.2626 0.2417 0.2277 0.0143  0.0476  -0.0071 123 ARG A CB    
932  C  CG    A ARG A 147 ? 0.2592 0.2666 0.2130 0.0122  0.0592  -0.0024 123 ARG A CG    
933  C  CG    B ARG A 147 ? 0.1997 0.2738 0.2553 -0.0035 0.0175  0.0101  123 ARG A CG    
934  C  CD    A ARG A 147 ? 0.2556 0.2601 0.2073 0.0111  0.0241  -0.0057 123 ARG A CD    
935  C  CD    B ARG A 147 ? 0.2011 0.2549 0.2088 -0.0009 0.0275  0.0086  123 ARG A CD    
936  N  NE    A ARG A 147 ? 0.2448 0.2469 0.2281 0.0229  0.0221  0.0019  123 ARG A NE    
937  N  NE    B ARG A 147 ? 0.2318 0.2307 0.2190 0.0172  0.0139  0.0154  123 ARG A NE    
938  C  CZ    A ARG A 147 ? 0.2379 0.2097 0.1841 -0.0017 0.0598  0.0222  123 ARG A CZ    
939  C  CZ    B ARG A 147 ? 0.2726 0.1766 0.2158 0.0165  0.0440  -0.0135 123 ARG A CZ    
940  N  NH1   A ARG A 147 ? 0.2587 0.2351 0.2268 -0.0159 0.0604  0.0040  123 ARG A NH1   
941  N  NH1   B ARG A 147 ? 0.2996 0.2145 0.1930 -0.0184 0.0320  -0.0260 123 ARG A NH1   
942  N  NH2   A ARG A 147 ? 0.2608 0.2328 0.1614 -0.0398 0.0695  0.0340  123 ARG A NH2   
943  N  NH2   B ARG A 147 ? 0.3117 0.2813 0.2151 0.0652  0.0358  -0.0218 123 ARG A NH2   
944  N  N     . SER A 148 ? 0.2208 0.2368 0.2200 -0.0014 0.0448  -0.0048 124 SER A N     
945  C  CA    . SER A 148 ? 0.1998 0.2331 0.2618 -0.0126 0.0457  0.0058  124 SER A CA    
946  C  C     . SER A 148 ? 0.2233 0.2399 0.2126 -0.0223 0.0178  0.0368  124 SER A C     
947  O  O     . SER A 148 ? 0.2240 0.2424 0.2116 0.0143  0.0103  0.0284  124 SER A O     
948  C  CB    . SER A 148 ? 0.2191 0.2439 0.2364 -0.0413 0.0439  0.0137  124 SER A CB    
949  O  OG    . SER A 148 ? 0.2143 0.2613 0.2176 -0.0227 0.0594  -0.0008 124 SER A OG    
950  N  N     . MSE A 149 ? 0.2237 0.2347 0.1744 -0.0111 0.0279  0.0206  125 MSE A N     
951  C  CA    . MSE A 149 ? 0.1991 0.2287 0.1723 -0.0018 0.0206  0.0236  125 MSE A CA    
952  C  C     . MSE A 149 ? 0.2237 0.2315 0.2029 0.0203  0.0241  0.0253  125 MSE A C     
953  O  O     . MSE A 149 ? 0.2257 0.2058 0.2157 0.0280  0.0327  0.0084  125 MSE A O     
954  C  CB    . MSE A 149 ? 0.1925 0.2535 0.2006 -0.0012 0.0388  -0.0091 125 MSE A CB    
955  C  CG    . MSE A 149 ? 0.2265 0.3077 0.2249 0.0625  0.0407  0.0178  125 MSE A CG    
956  SE SE    . MSE A 149 ? 0.4342 0.3768 0.3766 0.0014  -0.0111 0.0016  125 MSE A SE    
957  C  CE    . MSE A 149 ? 0.3116 0.2943 0.3166 -0.0120 0.0409  0.0092  125 MSE A CE    
958  N  N     . ASN A 150 ? 0.2108 0.2195 0.1974 0.0318  0.0238  0.0158  126 ASN A N     
959  C  CA    . ASN A 150 ? 0.2126 0.2180 0.1844 -0.0010 0.0328  -0.0005 126 ASN A CA    
960  C  C     . ASN A 150 ? 0.2069 0.2141 0.1744 0.0016  0.0438  0.0001  126 ASN A C     
961  O  O     . ASN A 150 ? 0.1752 0.2246 0.1913 -0.0069 0.0518  0.0192  126 ASN A O     
962  C  CB    . ASN A 150 ? 0.1987 0.1882 0.2117 -0.0247 0.0221  -0.0047 126 ASN A CB    
963  C  CG    . ASN A 150 ? 0.1714 0.2193 0.1664 -0.0296 0.0149  -0.0266 126 ASN A CG    
964  O  OD1   . ASN A 150 ? 0.1944 0.2285 0.2138 0.0000  0.0647  -0.0232 126 ASN A OD1   
965  N  ND2   . ASN A 150 ? 0.2334 0.2569 0.1791 0.0377  0.0164  0.0037  126 ASN A ND2   
966  N  N     . THR A 151 ? 0.2008 0.2220 0.2049 -0.0050 0.0447  -0.0204 127 THR A N     
967  C  CA    . THR A 151 ? 0.1638 0.2233 0.1711 0.0055  0.0351  0.0000  127 THR A CA    
968  C  C     . THR A 151 ? 0.1831 0.2130 0.1938 0.0383  0.0482  0.0258  127 THR A C     
969  O  O     . THR A 151 ? 0.2058 0.2226 0.2230 0.0392  0.0191  0.0215  127 THR A O     
970  C  CB    . THR A 151 ? 0.1753 0.1979 0.1824 0.0087  0.0135  -0.0129 127 THR A CB    
971  O  OG1   . THR A 151 ? 0.1828 0.2387 0.2246 0.0429  0.0270  0.0137  127 THR A OG1   
972  C  CG2   . THR A 151 ? 0.1782 0.2192 0.2064 -0.0115 0.0591  -0.0206 127 THR A CG2   
973  N  N     . TYR A 152 ? 0.1447 0.2293 0.2071 0.0017  0.0756  0.0046  128 TYR A N     
974  C  CA    . TYR A 152 ? 0.1394 0.2207 0.2064 0.0194  0.0663  -0.0011 128 TYR A CA    
975  C  C     . TYR A 152 ? 0.1935 0.2072 0.2122 0.0133  0.0610  0.0064  128 TYR A C     
976  O  O     . TYR A 152 ? 0.2122 0.2088 0.2465 0.0144  0.0498  0.0274  128 TYR A O     
977  C  CB    . TYR A 152 ? 0.1948 0.2582 0.2104 0.0015  0.0632  0.0196  128 TYR A CB    
978  C  CG    . TYR A 152 ? 0.2008 0.2931 0.2563 -0.0074 0.0737  0.0148  128 TYR A CG    
979  C  CD1   . TYR A 152 ? 0.3064 0.3061 0.3802 0.0431  0.0736  0.0319  128 TYR A CD1   
980  C  CD2   . TYR A 152 ? 0.2677 0.2925 0.2774 -0.0320 0.0660  0.0030  128 TYR A CD2   
981  C  CE1   . TYR A 152 ? 0.3072 0.3907 0.4119 0.0275  0.0808  0.0377  128 TYR A CE1   
982  C  CE2   . TYR A 152 ? 0.2565 0.3892 0.3272 -0.0199 0.0687  -0.0099 128 TYR A CE2   
983  C  CZ    . TYR A 152 ? 0.3037 0.3871 0.3228 0.0098  0.0499  0.0084  128 TYR A CZ    
984  O  OH    . TYR A 152 ? 0.2983 0.4774 0.4664 -0.0116 0.0659  0.0077  128 TYR A OH    
985  N  N     . LEU A 153 ? 0.2101 0.2442 0.2006 -0.0006 0.0437  -0.0089 129 LEU A N     
986  C  CA    . LEU A 153 ? 0.2111 0.2322 0.2199 -0.0259 0.0260  0.0102  129 LEU A CA    
987  C  C     . LEU A 153 ? 0.2254 0.2399 0.2186 -0.0309 0.0504  -0.0004 129 LEU A C     
988  O  O     . LEU A 153 ? 0.2135 0.2439 0.2149 0.0025  0.0594  -0.0175 129 LEU A O     
989  C  CB    . LEU A 153 ? 0.2487 0.3009 0.1835 -0.0181 0.0109  0.0044  129 LEU A CB    
990  C  CG    . LEU A 153 ? 0.2731 0.3174 0.2399 -0.0068 0.0432  0.0361  129 LEU A CG    
991  C  CD1   . LEU A 153 ? 0.2392 0.3221 0.3065 0.0155  0.0368  0.0333  129 LEU A CD1   
992  C  CD2   . LEU A 153 ? 0.2718 0.3773 0.2138 -0.0414 0.0847  -0.0067 129 LEU A CD2   
993  N  N     . GLY A 154 ? 0.2279 0.2695 0.2177 -0.0205 0.0437  -0.0090 130 GLY A N     
994  C  CA    . GLY A 154 ? 0.2390 0.2737 0.2632 -0.0356 0.0620  -0.0121 130 GLY A CA    
995  C  C     . GLY A 154 ? 0.2467 0.2455 0.2367 0.0051  0.0389  -0.0163 130 GLY A C     
996  O  O     . GLY A 154 ? 0.2521 0.2731 0.2074 0.0159  0.0547  -0.0031 130 GLY A O     
997  N  N     . ALA A 155 ? 0.2471 0.2642 0.2638 -0.0036 0.0742  -0.0052 131 ALA A N     
998  C  CA    . ALA A 155 ? 0.2162 0.2335 0.1966 0.0048  0.1032  0.0111  131 ALA A CA    
999  C  C     . ALA A 155 ? 0.2239 0.2535 0.1960 -0.0056 0.0487  0.0051  131 ALA A C     
1000 O  O     . ALA A 155 ? 0.2062 0.2893 0.2067 0.0139  0.0542  0.0028  131 ALA A O     
1001 C  CB    . ALA A 155 ? 0.2831 0.2198 0.2531 -0.0024 0.0878  0.0034  131 ALA A CB    
1002 N  N     . CYS A 156 ? 0.2196 0.2450 0.2057 -0.0169 0.0216  0.0208  132 CYS A N     
1003 C  CA    . CYS A 156 ? 0.2024 0.2725 0.1941 -0.0021 0.0265  -0.0028 132 CYS A CA    
1004 C  C     . CYS A 156 ? 0.2365 0.2579 0.2598 0.0166  0.0142  -0.0048 132 CYS A C     
1005 O  O     . CYS A 156 ? 0.2448 0.2956 0.2424 0.0326  0.0283  -0.0047 132 CYS A O     
1006 C  CB    . CYS A 156 ? 0.1989 0.3120 0.2114 0.0088  0.0600  -0.0217 132 CYS A CB    
1007 S  SG    . CYS A 156 ? 0.2306 0.2644 0.2327 0.0103  0.0499  0.0028  132 CYS A SG    
1008 N  N     . VAL A 157 ? 0.2271 0.2482 0.2626 -0.0046 0.0439  0.0087  133 VAL A N     
1009 C  CA    . VAL A 157 ? 0.2680 0.2642 0.2701 0.0263  0.0093  -0.0266 133 VAL A CA    
1010 C  C     . VAL A 157 ? 0.2405 0.3096 0.2738 0.0364  0.0037  -0.0239 133 VAL A C     
1011 O  O     . VAL A 157 ? 0.2400 0.3572 0.2860 0.0736  0.0201  -0.0179 133 VAL A O     
1012 C  CB    . VAL A 157 ? 0.2794 0.2891 0.2733 0.0491  0.0191  -0.0307 133 VAL A CB    
1013 C  CG1   . VAL A 157 ? 0.3245 0.2572 0.3064 0.0250  0.0254  -0.0162 133 VAL A CG1   
1014 C  CG2   . VAL A 157 ? 0.2477 0.3406 0.3004 0.0351  0.0444  -0.0134 133 VAL A CG2   
1015 N  N     . GLU A 158 ? 0.2498 0.3128 0.3245 0.0290  0.0165  0.0007  134 GLU A N     
1016 C  CA    . GLU A 158 ? 0.2738 0.3531 0.3391 -0.0072 0.0437  -0.0178 134 GLU A CA    
1017 C  C     . GLU A 158 ? 0.2158 0.3178 0.3426 -0.0227 0.0368  -0.0195 134 GLU A C     
1018 O  O     . GLU A 158 ? 0.2913 0.4067 0.3285 -0.0560 -0.0012 -0.0616 134 GLU A O     
1019 C  CB    . GLU A 158 ? 0.3125 0.4499 0.3377 -0.0493 0.0389  -0.0043 134 GLU A CB    
1020 C  CG    . GLU A 158 ? 0.4352 0.5397 0.3668 -0.0492 0.0699  -0.0555 134 GLU A CG    
1021 C  CD    . GLU A 158 ? 0.3687 0.6334 0.5001 -0.0460 0.1097  -0.0277 134 GLU A CD    
1022 O  OE1   . GLU A 158 ? 0.3616 0.6067 0.5822 0.0028  0.1672  -0.0829 134 GLU A OE1   
1023 O  OE2   . GLU A 158 ? 0.4327 0.5783 0.4850 0.0042  0.1210  0.0548  134 GLU A OE2   
1024 N  N     . LEU A 159 ? 0.2274 0.2831 0.2511 0.0077  0.0227  -0.0078 135 LEU A N     
1025 C  CA    . LEU A 159 ? 0.1732 0.3005 0.2620 -0.0383 0.0219  -0.0222 135 LEU A CA    
1026 C  C     . LEU A 159 ? 0.2148 0.2814 0.2754 -0.0244 0.0159  -0.0129 135 LEU A C     
1027 O  O     . LEU A 159 ? 0.2654 0.2780 0.2941 0.0047  0.0171  -0.0043 135 LEU A O     
1028 C  CB    . LEU A 159 ? 0.1858 0.2910 0.2645 -0.0200 0.0378  0.0017  135 LEU A CB    
1029 C  CG    . LEU A 159 ? 0.2176 0.2524 0.2493 -0.0189 0.0306  0.0160  135 LEU A CG    
1030 C  CD1   . LEU A 159 ? 0.2313 0.2390 0.3060 -0.0128 0.0303  -0.0159 135 LEU A CD1   
1031 C  CD2   . LEU A 159 ? 0.2421 0.2469 0.3043 -0.0003 0.0735  0.0170  135 LEU A CD2   
1032 N  N     . GLY A 160 ? 0.2492 0.3223 0.2590 -0.0331 0.0009  -0.0384 136 GLY A N     
1033 C  CA    . GLY A 160 ? 0.2276 0.3403 0.3258 -0.0557 -0.0202 0.0050  136 GLY A CA    
1034 C  C     . GLY A 160 ? 0.3044 0.3623 0.3173 0.0009  -0.0510 -0.0051 136 GLY A C     
1035 O  O     . GLY A 160 ? 0.2599 0.3736 0.3260 0.0019  -0.0233 0.0009  136 GLY A O     
1036 N  N     . PRO A 161 ? 0.2573 0.3322 0.3755 -0.0141 -0.0348 0.0454  137 PRO A N     
1037 C  CA    . PRO A 161 ? 0.2690 0.3510 0.3706 0.0060  -0.0444 0.0328  137 PRO A CA    
1038 C  C     . PRO A 161 ? 0.2394 0.3582 0.3329 -0.0282 -0.0464 0.0076  137 PRO A C     
1039 O  O     . PRO A 161 ? 0.2480 0.3572 0.4163 -0.0277 -0.0162 -0.0127 137 PRO A O     
1040 C  CB    . PRO A 161 ? 0.3128 0.3286 0.3592 0.0188  -0.0516 0.0561  137 PRO A CB    
1041 C  CG    . PRO A 161 ? 0.2799 0.3488 0.3945 -0.0117 -0.0739 -0.0018 137 PRO A CG    
1042 C  CD    . PRO A 161 ? 0.2622 0.3708 0.3731 0.0066  -0.0448 0.0017  137 PRO A CD    
1043 N  N     . GLU A 162 ? 0.2979 0.3368 0.3350 -0.0217 -0.0234 0.0086  138 GLU A N     
1044 C  CA    . GLU A 162 ? 0.3211 0.3502 0.3340 0.0029  -0.0577 0.0294  138 GLU A CA    
1045 C  C     . GLU A 162 ? 0.2733 0.3267 0.3641 -0.0305 -0.0141 -0.0087 138 GLU A C     
1046 O  O     . GLU A 162 ? 0.3661 0.3377 0.3901 -0.0511 -0.0041 -0.0185 138 GLU A O     
1047 C  CB    . GLU A 162 ? 0.3987 0.4123 0.3923 -0.0432 0.0240  0.0318  138 GLU A CB    
1048 C  CG    . GLU A 162 ? 0.4598 0.4790 0.4403 -0.1507 0.0349  -0.0162 138 GLU A CG    
1049 C  CD    . GLU A 162 ? 0.3919 0.5443 0.1365 -0.3937 -0.0648 0.0099  138 GLU A CD    
1050 O  OE1   . GLU A 162 ? 0.4197 0.4954 0.3541 -0.0543 0.0117  0.0571  138 GLU A OE1   
1051 O  OE2   . GLU A 162 ? 0.7001 0.7239 0.1675 -0.4838 -0.0164 -0.0205 138 GLU A OE2   
1052 N  N     . ASP A 163 ? 0.2544 0.3115 0.3462 -0.0179 -0.0313 0.0063  139 ASP A N     
1053 C  CA    . ASP A 163 ? 0.2752 0.3051 0.2957 0.0113  0.0284  -0.0160 139 ASP A CA    
1054 C  C     . ASP A 163 ? 0.2891 0.3310 0.2579 -0.0241 0.0057  -0.0074 139 ASP A C     
1055 O  O     . ASP A 163 ? 0.3204 0.3591 0.2825 0.0063  -0.0029 -0.0337 139 ASP A O     
1056 C  CB    . ASP A 163 ? 0.2788 0.3312 0.2845 0.0133  0.0268  -0.0198 139 ASP A CB    
1057 C  CG    . ASP A 163 ? 0.2057 0.3205 0.2960 -0.0123 0.0344  -0.0233 139 ASP A CG    
1058 O  OD1   . ASP A 163 ? 0.3021 0.3751 0.3110 0.0026  0.0489  0.0235  139 ASP A OD1   
1059 O  OD2   . ASP A 163 ? 0.1998 0.3320 0.3778 -0.0212 0.0532  -0.0304 139 ASP A OD2   
1060 N  N     . VAL A 164 ? 0.2698 0.2648 0.2874 -0.0412 -0.0143 -0.0154 140 VAL A N     
1061 C  CA    . VAL A 164 ? 0.2498 0.2532 0.2936 -0.0346 0.0143  0.0062  140 VAL A CA    
1062 C  C     . VAL A 164 ? 0.2449 0.2457 0.3340 -0.0083 -0.0075 -0.0133 140 VAL A C     
1063 O  O     . VAL A 164 ? 0.2545 0.3636 0.3679 -0.0471 0.0323  -0.0351 140 VAL A O     
1064 C  CB    . VAL A 164 ? 0.2963 0.2880 0.2906 0.0015  0.0148  0.0037  140 VAL A CB    
1065 C  CG1   . VAL A 164 ? 0.3098 0.3563 0.3023 0.0285  0.0299  0.0000  140 VAL A CG1   
1066 C  CG2   . VAL A 164 ? 0.2997 0.3075 0.3367 -0.0312 0.1013  -0.0272 140 VAL A CG2   
1067 N  N     . GLU A 165 ? 0.2977 0.2647 0.2832 0.0217  0.0175  -0.0211 141 GLU A N     
1068 C  CA    . GLU A 165 ? 0.3259 0.2783 0.2876 -0.0049 -0.0221 -0.0270 141 GLU A CA    
1069 C  C     . GLU A 165 ? 0.2956 0.2760 0.2863 -0.0013 -0.0361 -0.0033 141 GLU A C     
1070 O  O     . GLU A 165 ? 0.3153 0.3229 0.3084 -0.0215 -0.0215 -0.0335 141 GLU A O     
1071 C  CB    . GLU A 165 ? 0.3520 0.2669 0.3324 -0.0179 -0.0405 -0.0151 141 GLU A CB    
1072 C  CG    . GLU A 165 ? 0.3604 0.2613 0.3304 -0.0159 -0.0201 -0.0457 141 GLU A CG    
1073 C  CD    . GLU A 165 ? 0.3871 0.3424 0.3491 0.0229  -0.0222 -0.0325 141 GLU A CD    
1074 O  OE1   . GLU A 165 ? 0.3693 0.3048 0.3948 -0.0150 -0.0377 -0.0475 141 GLU A OE1   
1075 O  OE2   . GLU A 165 ? 0.3162 0.3184 0.4449 -0.0126 -0.0405 -0.0197 141 GLU A OE2   
1076 N  N     . ALA A 166 ? 0.3128 0.3133 0.3174 -0.0011 -0.0450 0.0278  142 ALA A N     
1077 C  CA    . ALA A 166 ? 0.2641 0.3425 0.3092 0.0027  -0.0526 -0.0092 142 ALA A CA    
1078 C  C     . ALA A 166 ? 0.3303 0.3134 0.3339 -0.0098 -0.0305 -0.0102 142 ALA A C     
1079 O  O     . ALA A 166 ? 0.3554 0.3182 0.3226 -0.0357 -0.0421 0.0014  142 ALA A O     
1080 C  CB    . ALA A 166 ? 0.2722 0.4230 0.3546 0.0026  -0.0737 0.0203  142 ALA A CB    
1081 N  N     . ASP A 167 ? 0.3678 0.2912 0.3522 0.0266  -0.0590 -0.0247 143 ASP A N     
1082 C  CA    . ASP A 167 ? 0.3645 0.3119 0.3575 0.0154  -0.0283 -0.0320 143 ASP A CA    
1083 C  C     . ASP A 167 ? 0.3772 0.3509 0.3175 -0.0209 -0.0253 -0.0420 143 ASP A C     
1084 O  O     . ASP A 167 ? 0.4587 0.3171 0.2580 -0.0543 -0.0213 -0.0281 143 ASP A O     
1085 C  CB    . ASP A 167 ? 0.4150 0.3665 0.3913 -0.0464 0.0226  -0.0155 143 ASP A CB    
1086 C  CG    . ASP A 167 ? 0.4952 0.4440 0.4249 -0.0056 -0.0381 0.0275  143 ASP A CG    
1087 O  OD1   . ASP A 167 ? 0.5864 0.3838 0.4883 -0.0496 0.0101  0.0293  143 ASP A OD1   
1088 O  OD2   . ASP A 167 ? 0.4886 0.5272 0.6041 0.0205  -0.0884 0.0612  143 ASP A OD2   
1089 N  N     . VAL A 168 ? 0.3141 0.3086 0.3153 -0.0210 -0.0391 -0.0044 144 VAL A N     
1090 C  CA    . VAL A 168 ? 0.3170 0.3005 0.2810 -0.0345 -0.0504 -0.0230 144 VAL A CA    
1091 C  C     . VAL A 168 ? 0.3244 0.2896 0.2862 -0.0022 -0.0350 -0.0168 144 VAL A C     
1092 O  O     . VAL A 168 ? 0.4072 0.3184 0.2754 -0.0112 0.0131  -0.0427 144 VAL A O     
1093 C  CB    . VAL A 168 ? 0.3033 0.3111 0.2888 -0.0306 -0.0677 -0.0086 144 VAL A CB    
1094 C  CG1   . VAL A 168 ? 0.3166 0.2661 0.3461 -0.0446 -0.0588 -0.0286 144 VAL A CG1   
1095 C  CG2   . VAL A 168 ? 0.3739 0.2640 0.4152 -0.0315 -0.0384 0.0157  144 VAL A CG2   
1096 N  N     . VAL A 169 ? 0.3442 0.3080 0.2209 0.0187  -0.0238 -0.0687 145 VAL A N     
1097 C  CA    . VAL A 169 ? 0.3046 0.2634 0.3116 -0.0118 -0.0250 -0.0535 145 VAL A CA    
1098 C  C     . VAL A 169 ? 0.3296 0.2899 0.2728 -0.0157 -0.0223 -0.0150 145 VAL A C     
1099 O  O     . VAL A 169 ? 0.3726 0.2884 0.2826 -0.0235 0.0007  -0.0167 145 VAL A O     
1100 C  CB    . VAL A 169 ? 0.3359 0.2452 0.2517 -0.0007 -0.0355 -0.0131 145 VAL A CB    
1101 C  CG1   . VAL A 169 ? 0.3750 0.3022 0.2901 0.0084  -0.0196 0.0393  145 VAL A CG1   
1102 C  CG2   . VAL A 169 ? 0.3002 0.2781 0.3159 0.0266  -0.0259 -0.0952 145 VAL A CG2   
1103 N  N     . ALA A 170 ? 0.3629 0.3048 0.2604 -0.0320 -0.0420 -0.0552 146 ALA A N     
1104 C  CA    . ALA A 170 ? 0.3633 0.3358 0.2612 -0.0444 -0.0427 -0.0580 146 ALA A CA    
1105 C  C     . ALA A 170 ? 0.4167 0.3176 0.3223 0.0149  -0.0698 -0.0191 146 ALA A C     
1106 O  O     . ALA A 170 ? 0.4321 0.3333 0.3492 0.0039  -0.0557 -0.0662 146 ALA A O     
1107 C  CB    . ALA A 170 ? 0.3691 0.3614 0.3278 -0.0656 -0.0760 -0.0761 146 ALA A CB    
1108 N  N     . ASP A 171 ? 0.3960 0.2646 0.3267 -0.0185 -0.0689 -0.0143 147 ASP A N     
1109 C  CA    . ASP A 171 ? 0.3696 0.2838 0.3450 -0.0205 -0.0688 0.0057  147 ASP A CA    
1110 C  C     . ASP A 171 ? 0.3615 0.2851 0.3413 -0.0224 -0.0290 0.0075  147 ASP A C     
1111 O  O     . ASP A 171 ? 0.3744 0.3154 0.3644 -0.0045 -0.0234 0.0032  147 ASP A O     
1112 C  CB    . ASP A 171 ? 0.4099 0.3256 0.4130 -0.0627 -0.0465 0.0400  147 ASP A CB    
1113 C  CG    . ASP A 171 ? 0.5446 0.2943 0.1810 -0.2226 0.0398  0.0421  147 ASP A CG    
1114 O  OD1   . ASP A 171 ? 0.5284 0.3975 0.3037 -0.0527 -0.0484 -0.0713 147 ASP A OD1   
1115 O  OD2   . ASP A 171 ? 0.6403 0.3297 0.2677 -0.2660 0.0677  0.0849  147 ASP A OD2   
1116 N  N     . ALA A 172 ? 0.3675 0.2975 0.3126 -0.0572 -0.0235 0.0062  148 ALA A N     
1117 C  CA    . ALA A 172 ? 0.3408 0.2626 0.2656 -0.0356 0.0267  -0.0571 148 ALA A CA    
1118 C  C     . ALA A 172 ? 0.3173 0.2882 0.2497 0.0009  -0.0222 -0.0238 148 ALA A C     
1119 O  O     . ALA A 172 ? 0.3724 0.2926 0.2936 0.0102  -0.0435 -0.0286 148 ALA A O     
1120 C  CB    . ALA A 172 ? 0.3234 0.2296 0.2699 0.0031  0.0226  -0.0563 148 ALA A CB    
1121 N  N     . LYS A 173 ? 0.3502 0.2729 0.2536 0.0272  0.0116  -0.0309 149 LYS A N     
1122 C  CA    . LYS A 173 ? 0.3919 0.2663 0.2451 -0.0085 0.0000  -0.0414 149 LYS A CA    
1123 C  C     . LYS A 173 ? 0.3812 0.2569 0.2302 0.0074  -0.0199 -0.0152 149 LYS A C     
1124 O  O     . LYS A 173 ? 0.4105 0.2764 0.2442 0.0646  -0.0276 -0.0324 149 LYS A O     
1125 C  CB    . LYS A 173 ? 0.3845 0.2463 0.2977 -0.0165 -0.0112 -0.0602 149 LYS A CB    
1126 C  CG    . LYS A 173 ? 0.3826 0.2289 0.2966 -0.0111 0.0472  -0.0238 149 LYS A CG    
1127 C  CD    . LYS A 173 ? 0.3921 0.3345 0.4164 0.0556  -0.0029 -0.0167 149 LYS A CD    
1128 C  CE    . LYS A 173 ? 0.4837 0.3519 0.4297 0.0508  0.0261  -0.0674 149 LYS A CE    
1129 N  NZ    . LYS A 173 ? 0.5152 0.4233 0.4070 0.0975  0.1121  -0.1617 149 LYS A NZ    
1130 N  N     . VAL A 174 ? 0.3478 0.2811 0.2426 0.0026  -0.0071 -0.0321 150 VAL A N     
1131 C  CA    . VAL A 174 ? 0.3260 0.2766 0.2304 0.0038  -0.0041 -0.0163 150 VAL A CA    
1132 C  C     . VAL A 174 ? 0.3379 0.2616 0.2325 0.0192  -0.0091 -0.0249 150 VAL A C     
1133 O  O     . VAL A 174 ? 0.3319 0.2688 0.1811 0.0179  0.0250  -0.0318 150 VAL A O     
1134 C  CB    . VAL A 174 ? 0.3269 0.3022 0.2287 -0.0039 0.0092  -0.0145 150 VAL A CB    
1135 C  CG1   . VAL A 174 ? 0.3295 0.3201 0.2174 -0.0308 0.0538  -0.0260 150 VAL A CG1   
1136 C  CG2   . VAL A 174 ? 0.3745 0.3594 0.2391 0.0096  0.0295  -0.0076 150 VAL A CG2   
1137 N  N     . THR A 175 ? 0.3564 0.2370 0.2012 0.0012  0.0128  -0.0445 151 THR A N     
1138 C  CA    . THR A 175 ? 0.2920 0.2580 0.1923 0.0038  0.0077  -0.0321 151 THR A CA    
1139 C  C     . THR A 175 ? 0.3132 0.2170 0.2117 0.0324  -0.0025 -0.0152 151 THR A C     
1140 O  O     . THR A 175 ? 0.3365 0.2478 0.2033 0.0058  0.0079  -0.0027 151 THR A O     
1141 C  CB    . THR A 175 ? 0.2901 0.2768 0.2141 0.0112  0.0081  -0.0015 151 THR A CB    
1142 O  OG1   . THR A 175 ? 0.3125 0.2823 0.2507 -0.0065 -0.0238 -0.0216 151 THR A OG1   
1143 C  CG2   . THR A 175 ? 0.3126 0.2450 0.2666 0.0086  0.0104  -0.0468 151 THR A CG2   
1144 N  N     . TYR A 176 ? 0.3132 0.2241 0.2233 0.0061  -0.0092 -0.0212 152 TYR A N     
1145 C  CA    . TYR A 176 ? 0.2441 0.2208 0.2127 0.0193  0.0173  -0.0072 152 TYR A CA    
1146 C  C     . TYR A 176 ? 0.2669 0.2250 0.2133 0.0036  0.0095  -0.0206 152 TYR A C     
1147 O  O     . TYR A 176 ? 0.3168 0.2428 0.2297 -0.0041 0.0278  -0.0152 152 TYR A O     
1148 C  CB    . TYR A 176 ? 0.2464 0.2705 0.2590 0.0328  0.0141  -0.0149 152 TYR A CB    
1149 C  CG    . TYR A 176 ? 0.2505 0.2560 0.2132 0.0245  0.0343  -0.0146 152 TYR A CG    
1150 C  CD1   . TYR A 176 ? 0.2830 0.2237 0.2194 0.0261  0.0162  -0.0182 152 TYR A CD1   
1151 C  CD2   . TYR A 176 ? 0.2740 0.2005 0.2234 0.0252  0.0306  -0.0163 152 TYR A CD2   
1152 C  CE1   . TYR A 176 ? 0.2703 0.2297 0.2273 0.0134  0.0343  0.0113  152 TYR A CE1   
1153 C  CE2   . TYR A 176 ? 0.2890 0.2105 0.2203 0.0082  0.0520  -0.0332 152 TYR A CE2   
1154 C  CZ    . TYR A 176 ? 0.2696 0.1909 0.2342 0.0112  0.0238  0.0030  152 TYR A CZ    
1155 O  OH    . TYR A 176 ? 0.2684 0.2184 0.2224 0.0183  0.0425  -0.0153 152 TYR A OH    
1156 N  N     . PHE A 177 ? 0.2369 0.2284 0.2076 0.0142  0.0077  -0.0471 153 PHE A N     
1157 C  CA    . PHE A 177 ? 0.2340 0.2140 0.2138 0.0157  0.0200  -0.0397 153 PHE A CA    
1158 C  C     . PHE A 177 ? 0.2710 0.2257 0.2032 -0.0039 0.0166  -0.0433 153 PHE A C     
1159 O  O     . PHE A 177 ? 0.2514 0.2198 0.2249 0.0227  0.0191  -0.0253 153 PHE A O     
1160 C  CB    . PHE A 177 ? 0.2180 0.2535 0.2063 -0.0083 0.0384  0.0197  153 PHE A CB    
1161 C  CG    . PHE A 177 ? 0.2773 0.2301 0.1992 -0.0098 0.0106  -0.0024 153 PHE A CG    
1162 C  CD1   . PHE A 177 ? 0.2813 0.2969 0.2060 0.0180  0.0124  -0.0315 153 PHE A CD1   
1163 C  CD2   . PHE A 177 ? 0.2526 0.2288 0.2480 0.0308  0.0383  0.0114  153 PHE A CD2   
1164 C  CE1   . PHE A 177 ? 0.2931 0.2740 0.2656 0.0284  0.0164  -0.0168 153 PHE A CE1   
1165 C  CE2   . PHE A 177 ? 0.2240 0.2487 0.2142 0.0305  0.0170  -0.0071 153 PHE A CE2   
1166 C  CZ    . PHE A 177 ? 0.2604 0.2752 0.2181 0.0067  0.0303  -0.0103 153 PHE A CZ    
1167 N  N     . GLU A 178 ? 0.2479 0.2622 0.1659 0.0085  -0.0024 -0.0091 154 GLU A N     
1168 C  CA    . GLU A 178 ? 0.2349 0.2389 0.1889 0.0130  0.0019  0.0039  154 GLU A CA    
1169 C  C     . GLU A 178 ? 0.2438 0.1989 0.1939 -0.0135 0.0114  0.0028  154 GLU A C     
1170 O  O     . GLU A 178 ? 0.2510 0.2157 0.1701 0.0162  0.0131  -0.0276 154 GLU A O     
1171 C  CB    . GLU A 178 ? 0.2369 0.2158 0.1820 0.0188  0.0073  0.0020  154 GLU A CB    
1172 C  CG    . GLU A 178 ? 0.2765 0.2122 0.2171 0.0389  0.0216  0.0030  154 GLU A CG    
1173 C  CD    . GLU A 178 ? 0.2396 0.2054 0.2272 0.0019  0.0278  0.0103  154 GLU A CD    
1174 O  OE1   . GLU A 178 ? 0.2064 0.2531 0.2120 0.0109  0.0150  -0.0020 154 GLU A OE1   
1175 O  OE2   . GLU A 178 ? 0.2418 0.2294 0.2220 0.0286  0.0308  -0.0160 154 GLU A OE2   
1176 N  N     . GLY A 179 ? 0.2639 0.1744 0.2117 0.0085  0.0005  0.0295  155 GLY A N     
1177 C  CA    . GLY A 179 ? 0.2594 0.1854 0.1748 0.0206  0.0220  -0.0014 155 GLY A CA    
1178 C  C     . GLY A 179 ? 0.2409 0.2142 0.1938 0.0296  0.0213  -0.0262 155 GLY A C     
1179 O  O     . GLY A 179 ? 0.2404 0.2295 0.1994 0.0414  0.0391  0.0018  155 GLY A O     
1180 N  N     . TYR A 180 ? 0.2251 0.2195 0.1717 0.0128  0.0427  -0.0061 156 TYR A N     
1181 C  CA    . TYR A 180 ? 0.1869 0.2048 0.1694 0.0152  0.0385  0.0088  156 TYR A CA    
1182 C  C     . TYR A 180 ? 0.1890 0.2061 0.2277 0.0050  0.0385  -0.0107 156 TYR A C     
1183 O  O     . TYR A 180 ? 0.2151 0.2212 0.2494 0.0313  0.0541  -0.0286 156 TYR A O     
1184 C  CB    . TYR A 180 ? 0.2064 0.2101 0.1781 0.0072  0.0387  0.0139  156 TYR A CB    
1185 C  CG    . TYR A 180 ? 0.2133 0.2039 0.1645 -0.0040 0.0274  0.0213  156 TYR A CG    
1186 C  CD1   . TYR A 180 ? 0.1920 0.2133 0.1740 -0.0141 0.0601  0.0140  156 TYR A CD1   
1187 C  CD2   . TYR A 180 ? 0.2139 0.2143 0.1982 0.0066  0.0408  0.0162  156 TYR A CD2   
1188 C  CE1   . TYR A 180 ? 0.1927 0.2482 0.2465 -0.0023 0.0500  0.0048  156 TYR A CE1   
1189 C  CE2   . TYR A 180 ? 0.2162 0.2205 0.2199 -0.0140 0.0565  0.0265  156 TYR A CE2   
1190 C  CZ    . TYR A 180 ? 0.2149 0.2256 0.2144 -0.0055 0.0398  -0.0016 156 TYR A CZ    
1191 O  OH    . TYR A 180 ? 0.2082 0.2628 0.1907 0.0140  0.0477  -0.0057 156 TYR A OH    
1192 N  N     . LEU A 181 ? 0.1822 0.2324 0.2363 0.0031  0.0259  -0.0027 157 LEU A N     
1193 C  CA    . LEU A 181 ? 0.1826 0.2258 0.2230 0.0000  0.0257  -0.0202 157 LEU A CA    
1194 C  C     . LEU A 181 ? 0.2347 0.2243 0.2531 0.0141  0.0444  0.0122  157 LEU A C     
1195 O  O     . LEU A 181 ? 0.2154 0.2395 0.2688 0.0039  0.0219  -0.0075 157 LEU A O     
1196 C  CB    . LEU A 181 ? 0.2005 0.2285 0.2109 0.0070  0.0211  -0.0187 157 LEU A CB    
1197 C  CG    . LEU A 181 ? 0.2522 0.2222 0.1734 0.0163  0.0560  -0.0184 157 LEU A CG    
1198 C  CD1   . LEU A 181 ? 0.2776 0.2448 0.2312 0.0504  0.0271  -0.0615 157 LEU A CD1   
1199 C  CD2   . LEU A 181 ? 0.2581 0.2804 0.1917 -0.0174 0.0427  0.0320  157 LEU A CD2   
1200 N  N     . TRP A 182 ? 0.2478 0.2045 0.2074 0.0212  0.0270  -0.0013 158 TRP A N     
1201 C  CA    . TRP A 182 ? 0.2694 0.2357 0.2433 0.0411  0.0352  0.0094  158 TRP A CA    
1202 C  C     . TRP A 182 ? 0.2635 0.2379 0.2354 0.0232  -0.0043 0.0032  158 TRP A C     
1203 O  O     . TRP A 182 ? 0.2701 0.2577 0.2356 0.0262  0.0243  -0.0205 158 TRP A O     
1204 C  CB    . TRP A 182 ? 0.2166 0.2402 0.2435 0.0315  0.0151  0.0085  158 TRP A CB    
1205 C  CG    . TRP A 182 ? 0.2433 0.2311 0.2374 0.0087  0.0222  -0.0117 158 TRP A CG    
1206 C  CD1   . TRP A 182 ? 0.2753 0.2984 0.2678 0.0217  -0.0042 0.0253  158 TRP A CD1   
1207 C  CD2   . TRP A 182 ? 0.2473 0.2451 0.2732 0.0129  0.0238  -0.0366 158 TRP A CD2   
1208 N  NE1   . TRP A 182 ? 0.2904 0.3010 0.2669 -0.0194 0.0449  -0.0062 158 TRP A NE1   
1209 C  CE2   . TRP A 182 ? 0.3628 0.2982 0.2482 -0.0131 0.0017  -0.0163 158 TRP A CE2   
1210 C  CE3   . TRP A 182 ? 0.3117 0.2533 0.2670 0.0128  0.0119  -0.0120 158 TRP A CE3   
1211 C  CZ2   . TRP A 182 ? 0.3981 0.2795 0.1782 0.0184  0.0057  0.0095  158 TRP A CZ2   
1212 C  CZ3   . TRP A 182 ? 0.3360 0.2596 0.2332 -0.0129 0.0199  0.0051  158 TRP A CZ3   
1213 C  CH2   . TRP A 182 ? 0.3379 0.2861 0.2428 0.0237  0.0121  -0.0208 158 TRP A CH2   
1214 N  N     . ASP A 183 ? 0.2378 0.2495 0.2005 0.0066  0.0175  0.0044  159 ASP A N     
1215 C  CA    . ASP A 183 ? 0.2773 0.2411 0.2292 0.0005  0.0066  -0.0210 159 ASP A CA    
1216 C  C     . ASP A 183 ? 0.2688 0.2717 0.2525 0.0431  0.0252  0.0025  159 ASP A C     
1217 O  O     . ASP A 183 ? 0.2654 0.3054 0.3092 0.0540  0.0561  0.0130  159 ASP A O     
1218 C  CB    . ASP A 183 ? 0.2546 0.2540 0.2770 0.0104  0.0152  0.0230  159 ASP A CB    
1219 C  CG    . ASP A 183 ? 0.2443 0.2360 0.2551 0.0079  0.0087  -0.0083 159 ASP A CG    
1220 O  OD1   . ASP A 183 ? 0.2018 0.2287 0.2333 0.0064  0.0507  0.0066  159 ASP A OD1   
1221 O  OD2   . ASP A 183 ? 0.2562 0.2486 0.2977 0.0180  0.0187  -0.0331 159 ASP A OD2   
1222 N  N     . PRO A 184 ? 0.2500 0.2782 0.2192 0.0083  0.0511  0.0080  160 PRO A N     
1223 C  CA    . PRO A 184 ? 0.2474 0.2449 0.2987 0.0090  0.0632  0.0177  160 PRO A CA    
1224 C  C     . PRO A 184 ? 0.2610 0.3008 0.2941 -0.0017 0.0432  -0.0060 160 PRO A C     
1225 O  O     . PRO A 184 ? 0.2971 0.4165 0.2937 0.0020  0.0440  -0.0167 160 PRO A O     
1226 C  CB    . PRO A 184 ? 0.2409 0.2455 0.3335 0.0120  0.0955  0.0288  160 PRO A CB    
1227 C  CG    . PRO A 184 ? 0.2568 0.2934 0.2904 -0.0221 0.0878  0.0007  160 PRO A CG    
1228 C  CD    . PRO A 184 ? 0.2581 0.2462 0.2656 0.0063  0.0342  0.0206  160 PRO A CD    
1229 N  N     . PRO A 185 ? 0.2608 0.3836 0.3188 0.0153  0.0478  -0.0251 161 PRO A N     
1230 C  CA    . PRO A 185 ? 0.3001 0.3711 0.2871 0.0490  0.0454  -0.0420 161 PRO A CA    
1231 C  C     . PRO A 185 ? 0.2821 0.3201 0.3069 0.0374  0.0005  0.0018  161 PRO A C     
1232 O  O     . PRO A 185 ? 0.3640 0.3539 0.4066 0.0296  -0.0814 0.0471  161 PRO A O     
1233 C  CB    . PRO A 185 ? 0.2235 0.4242 0.3679 0.0738  0.0640  -0.0221 161 PRO A CB    
1234 C  CG    . PRO A 185 ? 0.2245 0.3897 0.4013 0.0339  0.0432  -0.0191 161 PRO A CG    
1235 C  CD    . PRO A 185 ? 0.2264 0.4008 0.3169 0.0309  0.0365  -0.0237 161 PRO A CD    
1236 N  N     . ARG A 186 ? 0.2288 0.3200 0.3534 0.0318  0.0389  -0.0302 162 ARG A N     
1237 C  CA    A ARG A 186 ? 0.2672 0.3361 0.3726 0.0147  0.0240  -0.0322 162 ARG A CA    
1238 C  CA    B ARG A 186 ? 0.2621 0.3314 0.3672 0.0104  0.0280  -0.0262 162 ARG A CA    
1239 C  C     . ARG A 186 ? 0.2545 0.3110 0.3300 0.0314  0.0003  -0.0003 162 ARG A C     
1240 O  O     . ARG A 186 ? 0.2326 0.3180 0.3724 0.0392  -0.0088 -0.0172 162 ARG A O     
1241 C  CB    A ARG A 186 ? 0.2607 0.3805 0.4204 -0.0110 0.0366  -0.0382 162 ARG A CB    
1242 C  CB    B ARG A 186 ? 0.2547 0.3588 0.4008 -0.0157 0.0338  -0.0369 162 ARG A CB    
1243 C  CG    A ARG A 186 ? 0.3357 0.3804 0.4491 0.0219  0.0392  -0.0584 162 ARG A CG    
1244 C  CG    B ARG A 186 ? 0.2967 0.3243 0.4001 -0.0085 0.0460  -0.0309 162 ARG A CG    
1245 C  CD    A ARG A 186 ? 0.3458 0.4298 0.4753 0.0044  0.0557  -0.0567 162 ARG A CD    
1246 C  CD    B ARG A 186 ? 0.2810 0.3602 0.4515 -0.0169 0.0387  -0.0032 162 ARG A CD    
1247 N  NE    A ARG A 186 ? 0.3664 0.4406 0.4754 0.0236  0.0487  -0.0663 162 ARG A NE    
1248 N  NE    B ARG A 186 ? 0.2463 0.3596 0.4730 -0.0549 0.0356  0.0255  162 ARG A NE    
1249 C  CZ    A ARG A 186 ? 0.3116 0.3927 0.4153 0.0754  0.0479  -0.0695 162 ARG A CZ    
1250 C  CZ    B ARG A 186 ? 0.3705 0.3511 0.3838 -0.0159 -0.0037 0.0110  162 ARG A CZ    
1251 N  NH1   A ARG A 186 ? 0.4095 0.4257 0.4191 0.0783  0.0518  -0.0474 162 ARG A NH1   
1252 N  NH1   B ARG A 186 ? 0.4034 0.3965 0.4118 -0.0140 -0.0016 0.0545  162 ARG A NH1   
1253 N  NH2   A ARG A 186 ? 0.2984 0.3247 0.4034 0.0915  0.0752  -0.1253 162 ARG A NH2   
1254 N  NH2   B ARG A 186 ? 0.4719 0.3181 0.3907 -0.0257 0.0123  -0.0396 162 ARG A NH2   
1255 N  N     . ALA A 187 ? 0.2520 0.2993 0.3508 0.0351  0.0431  0.0347  163 ALA A N     
1256 C  CA    . ALA A 187 ? 0.2074 0.2648 0.2871 -0.0135 0.0251  0.0263  163 ALA A CA    
1257 C  C     . ALA A 187 ? 0.2807 0.2719 0.2929 0.0230  -0.0185 0.0150  163 ALA A C     
1258 O  O     . ALA A 187 ? 0.2590 0.2891 0.3201 0.0028  0.0002  -0.0106 163 ALA A O     
1259 C  CB    . ALA A 187 ? 0.2323 0.3218 0.2619 0.0150  -0.0226 0.0196  163 ALA A CB    
1260 N  N     . LYS A 188 ? 0.2250 0.2815 0.2798 0.0193  -0.0046 0.0255  164 LYS A N     
1261 C  CA    . LYS A 188 ? 0.2451 0.2936 0.2701 0.0093  0.0126  0.0022  164 LYS A CA    
1262 C  C     . LYS A 188 ? 0.2633 0.2979 0.3094 0.0086  -0.0134 -0.0053 164 LYS A C     
1263 O  O     . LYS A 188 ? 0.3008 0.3342 0.2972 0.0095  -0.0386 -0.0102 164 LYS A O     
1264 C  CB    . LYS A 188 ? 0.2912 0.3018 0.3250 0.0129  0.0061  0.0388  164 LYS A CB    
1265 C  CG    . LYS A 188 ? 0.3095 0.3068 0.3602 0.0169  0.0225  0.0206  164 LYS A CG    
1266 C  CD    . LYS A 188 ? 0.4161 0.3245 0.4410 0.0712  0.0496  0.0441  164 LYS A CD    
1267 C  CE    . LYS A 188 ? 0.3932 0.4088 0.4656 0.0788  0.0621  0.0172  164 LYS A CE    
1268 N  NZ    . LYS A 188 ? 0.4890 0.5779 0.4695 0.1028  0.1092  -0.0197 164 LYS A NZ    
1269 N  N     . GLU A 189 ? 0.2853 0.3068 0.3379 -0.0223 0.0004  0.0101  165 GLU A N     
1270 C  CA    . GLU A 189 ? 0.2516 0.3223 0.3698 -0.0004 0.0035  0.0079  165 GLU A CA    
1271 C  C     . GLU A 189 ? 0.2345 0.3354 0.3604 0.0197  -0.0039 0.0015  165 GLU A C     
1272 O  O     . GLU A 189 ? 0.2614 0.3428 0.3899 -0.0083 -0.0134 -0.0122 165 GLU A O     
1273 C  CB    . GLU A 189 ? 0.2355 0.3322 0.4223 0.0271  0.0162  0.0051  165 GLU A CB    
1274 C  CG    . GLU A 189 ? 0.2768 0.3531 0.4680 0.0502  0.0025  -0.0181 165 GLU A CG    
1275 C  CD    . GLU A 189 ? 0.3372 0.4872 0.5406 0.0427  0.0626  -0.0524 165 GLU A CD    
1276 O  OE1   . GLU A 189 ? 0.4314 0.5309 0.5824 -0.0076 0.0552  -0.0945 165 GLU A OE1   
1277 O  OE2   . GLU A 189 ? 0.3855 0.5199 0.5847 0.0008  0.0765  -0.0941 165 GLU A OE2   
1278 N  N     . ALA A 190 ? 0.2593 0.3053 0.3817 -0.0065 -0.0073 0.0278  166 ALA A N     
1279 C  CA    . ALA A 190 ? 0.2390 0.3166 0.3016 -0.0162 0.0031  0.0078  166 ALA A CA    
1280 C  C     . ALA A 190 ? 0.2753 0.2878 0.2772 -0.0070 -0.0061 0.0043  166 ALA A C     
1281 O  O     . ALA A 190 ? 0.2908 0.2806 0.3521 0.0076  -0.0277 -0.0288 166 ALA A O     
1282 C  CB    . ALA A 190 ? 0.2355 0.2844 0.2614 -0.0152 0.0187  -0.0064 166 ALA A CB    
1283 N  N     . ILE A 191 ? 0.2728 0.2520 0.2856 0.0122  0.0025  0.0059  167 ILE A N     
1284 C  CA    . ILE A 191 ? 0.3136 0.2947 0.2577 -0.0366 -0.0019 0.0224  167 ILE A CA    
1285 C  C     . ILE A 191 ? 0.2712 0.2974 0.2988 0.0047  -0.0216 0.0060  167 ILE A C     
1286 O  O     . ILE A 191 ? 0.3377 0.3111 0.3108 -0.0123 -0.0221 -0.0257 167 ILE A O     
1287 C  CB    . ILE A 191 ? 0.2650 0.3225 0.2243 -0.0230 0.0040  0.0308  167 ILE A CB    
1288 C  CG1   . ILE A 191 ? 0.2687 0.2493 0.2599 0.0034  -0.0077 0.0521  167 ILE A CG1   
1289 C  CG2   . ILE A 191 ? 0.2549 0.3100 0.2237 0.0275  0.0220  -0.0031 167 ILE A CG2   
1290 C  CD1   . ILE A 191 ? 0.2224 0.2448 0.2492 -0.0216 0.0561  0.0313  167 ILE A CD1   
1291 N  N     . LEU A 192 ? 0.3154 0.3237 0.3164 0.0416  -0.0541 0.0295  168 LEU A N     
1292 C  CA    . LEU A 192 ? 0.3175 0.3467 0.2963 0.0242  -0.0453 0.0133  168 LEU A CA    
1293 C  C     . LEU A 192 ? 0.2726 0.3236 0.3262 0.0419  -0.0347 0.0111  168 LEU A C     
1294 O  O     . LEU A 192 ? 0.3588 0.3300 0.3698 0.0273  -0.0907 -0.0426 168 LEU A O     
1295 C  CB    . LEU A 192 ? 0.3489 0.3440 0.3159 0.0349  -0.0646 0.0045  168 LEU A CB    
1296 C  CG    . LEU A 192 ? 0.4108 0.3223 0.4172 0.0422  -0.0017 0.0071  168 LEU A CG    
1297 C  CD1   . LEU A 192 ? 0.4198 0.3494 0.5169 0.0558  0.0137  0.0743  168 LEU A CD1   
1298 C  CD2   . LEU A 192 ? 0.4389 0.3549 0.4482 0.0239  0.0140  0.0242  168 LEU A CD2   
1299 N  N     . ASP A 193 ? 0.2611 0.2979 0.3271 0.0348  -0.0220 -0.0034 169 ASP A N     
1300 C  CA    . ASP A 193 ? 0.2718 0.3085 0.3593 0.0209  -0.0731 0.0226  169 ASP A CA    
1301 C  C     . ASP A 193 ? 0.3434 0.3053 0.3720 0.0140  -0.0622 -0.0356 169 ASP A C     
1302 O  O     . ASP A 193 ? 0.3744 0.3466 0.2767 0.0121  -0.0314 -0.0178 169 ASP A O     
1303 C  CB    . ASP A 193 ? 0.3771 0.3656 0.3769 -0.0303 -0.0571 0.0461  169 ASP A CB    
1304 C  CG    . ASP A 193 ? 0.4107 0.3754 0.3655 -0.0204 -0.0404 0.0359  169 ASP A CG    
1305 O  OD1   . ASP A 193 ? 0.4510 0.4487 0.4424 0.0234  -0.0785 0.0591  169 ASP A OD1   
1306 O  OD2   . ASP A 193 ? 0.4040 0.4459 0.3866 -0.0396 0.0037  0.0243  169 ASP A OD2   
1307 N  N     . CYS A 194 ? 0.3309 0.3593 0.3639 0.0104  -0.0458 0.0090  170 CYS A N     
1308 C  CA    . CYS A 194 ? 0.3217 0.3506 0.3023 -0.0041 -0.0649 -0.0170 170 CYS A CA    
1309 C  C     . CYS A 194 ? 0.3214 0.2867 0.3025 -0.0216 -0.0510 -0.0356 170 CYS A C     
1310 O  O     . CYS A 194 ? 0.3562 0.2759 0.2821 -0.0097 -0.0481 -0.0313 170 CYS A O     
1311 C  CB    . CYS A 194 ? 0.3008 0.3634 0.2993 0.0091  -0.0535 -0.0024 170 CYS A CB    
1312 S  SG    . CYS A 194 ? 0.3469 0.3125 0.3147 0.0116  -0.0424 -0.0070 170 CYS A SG    
1313 N  N     . ALA A 195 ? 0.3324 0.2934 0.2691 0.0146  -0.0612 -0.0161 171 ALA A N     
1314 C  CA    . ALA A 195 ? 0.3223 0.3034 0.2990 -0.0321 -0.0447 0.0199  171 ALA A CA    
1315 C  C     . ALA A 195 ? 0.3180 0.3118 0.3150 -0.0163 -0.0564 0.0118  171 ALA A C     
1316 O  O     . ALA A 195 ? 0.3918 0.3273 0.3195 0.0024  -0.0539 0.0125  171 ALA A O     
1317 C  CB    . ALA A 195 ? 0.4537 0.3002 0.2637 -0.0532 -0.0413 -0.0109 171 ALA A CB    
1318 N  N     . ARG A 196 ? 0.3222 0.2914 0.3320 0.0411  -0.0676 0.0298  172 ARG A N     
1319 C  CA    . ARG A 196 ? 0.3242 0.3089 0.3350 0.0176  -0.0564 0.0257  172 ARG A CA    
1320 C  C     . ARG A 196 ? 0.3835 0.3200 0.3148 0.0017  -0.0506 -0.0139 172 ARG A C     
1321 O  O     . ARG A 196 ? 0.4400 0.3540 0.3308 -0.0047 -0.0760 -0.0338 172 ARG A O     
1322 C  CB    . ARG A 196 ? 0.3112 0.3881 0.3815 0.0262  -0.0611 0.0128  172 ARG A CB    
1323 C  CG    . ARG A 196 ? 0.3508 0.4378 0.4264 -0.0005 -0.0823 -0.0187 172 ARG A CG    
1324 C  CD    . ARG A 196 ? 0.3395 0.5877 0.4201 0.0490  -0.1079 -0.0084 172 ARG A CD    
1325 N  NE    . ARG A 196 ? 0.4418 0.6202 0.4290 0.0270  -0.0192 0.0732  172 ARG A NE    
1326 C  CZ    . ARG A 196 ? 0.5167 0.5928 0.5314 -0.0761 0.0072  0.0378  172 ARG A CZ    
1327 N  NH1   . ARG A 196 ? 0.4998 0.5986 0.6658 -0.0595 0.0017  -0.0186 172 ARG A NH1   
1328 N  NH2   . ARG A 196 ? 0.4001 0.6964 0.5123 -0.1616 0.0578  0.1488  172 ARG A NH2   
1329 N  N     . ILE A 197 ? 0.2961 0.2862 0.3698 -0.0198 -0.0526 0.0128  173 ILE A N     
1330 C  CA    . ILE A 197 ? 0.3613 0.2819 0.3217 0.0209  -0.0227 0.0178  173 ILE A CA    
1331 C  C     . ILE A 197 ? 0.3336 0.3303 0.3121 -0.0008 -0.0448 -0.0228 173 ILE A C     
1332 O  O     . ILE A 197 ? 0.3929 0.3247 0.3738 -0.0201 -0.0839 -0.0494 173 ILE A O     
1333 C  CB    . ILE A 197 ? 0.3511 0.3117 0.3028 0.0034  -0.0466 0.0053  173 ILE A CB    
1334 C  CG1   . ILE A 197 ? 0.3295 0.3100 0.2933 -0.0213 -0.0473 0.0500  173 ILE A CG1   
1335 C  CG2   . ILE A 197 ? 0.4102 0.3311 0.3321 0.0358  -0.0425 -0.0226 173 ILE A CG2   
1336 C  CD1   . ILE A 197 ? 0.4039 0.3474 0.2836 0.0205  -0.0281 -0.0212 173 ILE A CD1   
1337 N  N     . ALA A 198 ? 0.3258 0.3626 0.3034 -0.0236 -0.0167 0.0298  174 ALA A N     
1338 C  CA    . ALA A 198 ? 0.3212 0.2943 0.3162 -0.0446 -0.0385 -0.0484 174 ALA A CA    
1339 C  C     . ALA A 198 ? 0.3885 0.2866 0.3242 -0.0319 -0.0300 -0.0113 174 ALA A C     
1340 O  O     . ALA A 198 ? 0.4338 0.3619 0.2690 -0.0263 -0.0582 -0.0525 174 ALA A O     
1341 C  CB    . ALA A 198 ? 0.3645 0.2815 0.3004 -0.0442 -0.0738 -0.0499 174 ALA A CB    
1342 N  N     . HIS A 199 ? 0.3684 0.3401 0.2952 -0.0478 -0.0808 0.0340  175 HIS A N     
1343 C  CA    . HIS A 199 ? 0.4051 0.3408 0.2807 -0.0381 -0.0292 0.0186  175 HIS A CA    
1344 C  C     . HIS A 199 ? 0.4353 0.3550 0.3101 -0.0332 -0.0402 -0.0262 175 HIS A C     
1345 O  O     . HIS A 199 ? 0.5400 0.3700 0.3175 0.0143  -0.0485 -0.0561 175 HIS A O     
1346 C  CB    . HIS A 199 ? 0.4365 0.3538 0.3234 -0.0220 0.0020  0.0625  175 HIS A CB    
1347 C  CG    . HIS A 199 ? 0.4383 0.3385 0.3762 0.0074  -0.0670 0.0286  175 HIS A CG    
1348 N  ND1   . HIS A 199 ? 0.4434 0.3437 0.4572 -0.0317 -0.1066 0.0123  175 HIS A ND1   
1349 C  CD2   . HIS A 199 ? 0.4283 0.3277 0.3039 -0.0199 -0.0581 0.0313  175 HIS A CD2   
1350 C  CE1   . HIS A 199 ? 0.4155 0.3442 0.3590 -0.0042 -0.0565 0.0454  175 HIS A CE1   
1351 N  NE2   . HIS A 199 ? 0.4354 0.3386 0.2643 -0.0358 -0.0118 0.0268  175 HIS A NE2   
1352 N  N     . GLN A 200 ? 0.3983 0.3581 0.3053 -0.0465 -0.0727 -0.0259 176 GLN A N     
1353 C  CA    . GLN A 200 ? 0.4492 0.3784 0.2906 -0.0424 -0.1144 -0.0682 176 GLN A CA    
1354 C  C     . GLN A 200 ? 0.5016 0.3762 0.3299 -0.0341 -0.0958 -0.0267 176 GLN A C     
1355 O  O     . GLN A 200 ? 0.5681 0.3867 0.3631 0.0107  -0.1380 -0.0529 176 GLN A O     
1356 C  CB    . GLN A 200 ? 0.4760 0.4735 0.3759 -0.0272 -0.0785 0.0077  176 GLN A CB    
1357 C  CG    . GLN A 200 ? 0.5469 0.5044 0.5086 0.0066  -0.1085 0.0217  176 GLN A CG    
1358 C  CD    . GLN A 200 ? 0.6072 0.5738 0.5648 0.0293  -0.0491 0.0647  176 GLN A CD    
1359 O  OE1   . GLN A 200 ? 0.7438 0.6941 0.5576 -0.0166 -0.0399 0.1455  176 GLN A OE1   
1360 N  NE2   . GLN A 200 ? 0.7030 0.5544 0.6801 0.0554  -0.1327 0.0516  176 GLN A NE2   
1361 N  N     . HIS A 201 ? 0.4839 0.4058 0.3436 -0.0263 -0.0676 0.0251  177 HIS A N     
1362 C  CA    . HIS A 201 ? 0.4513 0.4045 0.3175 -0.0405 -0.0714 -0.0108 177 HIS A CA    
1363 C  C     . HIS A 201 ? 0.4787 0.4093 0.3176 -0.0296 -0.0592 -0.0504 177 HIS A C     
1364 O  O     . HIS A 201 ? 0.5539 0.4173 0.4172 0.0181  -0.0855 -0.1093 177 HIS A O     
1365 C  CB    . HIS A 201 ? 0.4366 0.3970 0.3103 -0.0401 -0.0536 -0.0168 177 HIS A CB    
1366 C  CG    . HIS A 201 ? 0.3780 0.3321 0.3891 -0.0263 -0.0832 -0.0519 177 HIS A CG    
1367 N  ND1   . HIS A 201 ? 0.4295 0.3890 0.4784 -0.1193 -0.0907 -0.0755 177 HIS A ND1   
1368 C  CD2   . HIS A 201 ? 0.4507 0.4001 0.3561 0.0236  -0.0392 -0.0022 177 HIS A CD2   
1369 C  CE1   . HIS A 201 ? 0.4759 0.4117 0.3812 -0.0975 -0.0686 -0.0584 177 HIS A CE1   
1370 N  NE2   . HIS A 201 ? 0.5060 0.4440 0.3559 -0.0285 -0.0398 -0.0384 177 HIS A NE2   
1371 N  N     . GLY A 202 ? 0.4895 0.4334 0.2074 -0.0773 -0.0637 -0.0783 178 GLY A N     
1372 C  CA    . GLY A 202 ? 0.4939 0.4712 0.2808 -0.0453 -0.0296 -0.0652 178 GLY A CA    
1373 C  C     . GLY A 202 ? 0.4823 0.4377 0.3202 -0.0049 -0.0362 -0.0431 178 GLY A C     
1374 O  O     . GLY A 202 ? 0.4931 0.4547 0.2822 -0.0109 -0.0468 -0.0614 178 GLY A O     
1375 N  N     . ARG A 203 ? 0.4450 0.3370 0.3327 -0.0073 -0.0884 -0.0587 179 ARG A N     
1376 C  CA    . ARG A 203 ? 0.4042 0.3261 0.2927 -0.0259 -0.0560 0.0262  179 ARG A CA    
1377 C  C     . ARG A 203 ? 0.4033 0.3101 0.2939 -0.0188 -0.0538 0.0023  179 ARG A C     
1378 O  O     . ARG A 203 ? 0.4626 0.2340 0.3546 -0.0026 -0.0573 -0.0420 179 ARG A O     
1379 C  CB    . ARG A 203 ? 0.3989 0.3594 0.2811 -0.0382 -0.0417 0.0032  179 ARG A CB    
1380 C  CG    . ARG A 203 ? 0.4467 0.3377 0.3164 -0.0423 -0.0452 -0.0351 179 ARG A CG    
1381 C  CD    . ARG A 203 ? 0.4692 0.3390 0.2515 -0.0274 -0.0850 -0.0251 179 ARG A CD    
1382 N  NE    . ARG A 203 ? 0.4751 0.3369 0.3530 -0.0507 -0.0689 -0.0920 179 ARG A NE    
1383 C  CZ    . ARG A 203 ? 0.4982 0.3476 0.4257 -0.0350 0.0481  -0.0910 179 ARG A CZ    
1384 N  NH1   . ARG A 203 ? 0.5847 0.3978 0.5069 -0.0561 0.0927  -0.0199 179 ARG A NH1   
1385 N  NH2   . ARG A 203 ? 0.5680 0.4528 0.4228 -0.0262 0.0780  -0.1189 179 ARG A NH2   
1386 N  N     . GLU A 204 ? 0.4176 0.2806 0.2234 0.0008  -0.0397 -0.0206 180 GLU A N     
1387 C  CA    . GLU A 204 ? 0.3709 0.2980 0.2177 -0.0212 -0.0439 -0.0324 180 GLU A CA    
1388 C  C     . GLU A 204 ? 0.3968 0.2699 0.2377 0.0309  -0.0312 -0.0487 180 GLU A C     
1389 O  O     . GLU A 204 ? 0.4333 0.2803 0.2893 0.0318  -0.0339 -0.0080 180 GLU A O     
1390 C  CB    . GLU A 204 ? 0.4005 0.4057 0.2546 -0.0147 -0.0231 -0.0035 180 GLU A CB    
1391 C  CG    . GLU A 204 ? 0.4761 0.4736 0.2601 -0.0568 -0.0979 -0.0121 180 GLU A CG    
1392 C  CD    . GLU A 204 ? 0.5284 0.5604 0.3712 -0.0129 -0.0212 -0.0101 180 GLU A CD    
1393 O  OE1   . GLU A 204 ? 0.5224 0.6452 0.5355 -0.0230 0.0213  0.1014  180 GLU A OE1   
1394 O  OE2   . GLU A 204 ? 0.5158 0.7432 0.3305 0.0767  -0.0368 -0.0700 180 GLU A OE2   
1395 N  N     . MSE A 205 ? 0.3402 0.2505 0.2476 -0.0065 -0.0315 -0.0202 181 MSE A N     
1396 C  CA    . MSE A 205 ? 0.3276 0.2734 0.2221 0.0087  -0.0215 -0.0118 181 MSE A CA    
1397 C  C     . MSE A 205 ? 0.3349 0.2951 0.1947 -0.0095 0.0118  -0.0105 181 MSE A C     
1398 O  O     . MSE A 205 ? 0.3195 0.2621 0.1757 0.0225  0.0220  -0.0243 181 MSE A O     
1399 C  CB    . MSE A 205 ? 0.4073 0.2712 0.2639 0.0501  -0.0491 -0.0323 181 MSE A CB    
1400 C  CG    . MSE A 205 ? 0.4111 0.3434 0.4102 0.0391  -0.0891 -0.0105 181 MSE A CG    
1401 SE SE    . MSE A 205 ? 0.6704 0.4444 0.4735 -0.0114 -0.1340 0.0232  181 MSE A SE    
1402 C  CE    . MSE A 205 ? 0.4619 0.4909 0.2064 -0.0370 -0.0912 0.0429  181 MSE A CE    
1403 N  N     . SER A 206 ? 0.3124 0.2087 0.2169 -0.0015 -0.0093 -0.0044 182 SER A N     
1404 C  CA    . SER A 206 ? 0.2826 0.2524 0.2126 0.0070  0.0412  -0.0514 182 SER A CA    
1405 C  C     . SER A 206 ? 0.3098 0.2308 0.1924 -0.0098 0.0330  -0.0311 182 SER A C     
1406 O  O     . SER A 206 ? 0.2961 0.2299 0.1965 0.0272  0.0431  -0.0180 182 SER A O     
1407 C  CB    . SER A 206 ? 0.2827 0.2243 0.2102 -0.0040 0.0291  0.0370  182 SER A CB    
1408 O  OG    . SER A 206 ? 0.2883 0.2726 0.2001 -0.0067 0.0263  -0.0080 182 SER A OG    
1409 N  N     . MSE A 207 ? 0.2967 0.2448 0.1639 -0.0202 0.0035  -0.0163 183 MSE A N     
1410 C  CA    . MSE A 207 ? 0.3196 0.2665 0.1946 -0.0116 0.0046  -0.0475 183 MSE A CA    
1411 C  C     . MSE A 207 ? 0.3152 0.2129 0.2324 -0.0013 0.0202  -0.0619 183 MSE A C     
1412 O  O     . MSE A 207 ? 0.3280 0.2755 0.2381 -0.0269 0.0107  -0.0184 183 MSE A O     
1413 C  CB    . MSE A 207 ? 0.3044 0.3420 0.2730 0.0140  0.0466  -0.0587 183 MSE A CB    
1414 C  CG    . MSE A 207 ? 0.4265 0.3875 0.3551 -0.0094 0.0058  0.0237  183 MSE A CG    
1415 SE SE    . MSE A 207 ? 0.5681 0.4701 0.5121 0.0663  -0.0568 -0.0024 183 MSE A SE    
1416 C  CE    . MSE A 207 ? 0.4256 0.4245 0.4810 0.0603  -0.1089 -0.0271 183 MSE A CE    
1417 N  N     . THR A 208 ? 0.2462 0.2389 0.2200 0.0214  -0.0109 -0.0138 184 THR A N     
1418 C  CA    . THR A 208 ? 0.2453 0.2428 0.2066 0.0124  0.0268  -0.0173 184 THR A CA    
1419 C  C     . THR A 208 ? 0.2413 0.2224 0.2177 0.0053  0.0067  0.0027  184 THR A C     
1420 O  O     . THR A 208 ? 0.2648 0.2695 0.2512 0.0183  0.0282  -0.0224 184 THR A O     
1421 C  CB    . THR A 208 ? 0.2558 0.2814 0.2434 0.0308  0.0317  0.0076  184 THR A CB    
1422 O  OG1   . THR A 208 ? 0.2225 0.2588 0.2581 0.0381  0.0788  -0.0132 184 THR A OG1   
1423 C  CG2   . THR A 208 ? 0.2790 0.2840 0.2362 0.0238  0.0400  -0.0030 184 THR A CG2   
1424 N  N     . LEU A 209 ? 0.2535 0.1898 0.2434 0.0121  0.0016  -0.0112 185 LEU A N     
1425 C  CA    . LEU A 209 ? 0.2336 0.1980 0.2122 0.0170  0.0139  -0.0109 185 LEU A CA    
1426 C  C     . LEU A 209 ? 0.2506 0.2153 0.1956 0.0267  0.0241  0.0112  185 LEU A C     
1427 O  O     . LEU A 209 ? 0.2685 0.2075 0.2057 0.0201  0.0211  0.0187  185 LEU A O     
1428 C  CB    . LEU A 209 ? 0.2800 0.2203 0.1765 0.0224  0.0292  -0.0043 185 LEU A CB    
1429 C  CG    . LEU A 209 ? 0.2839 0.2697 0.1870 0.0177  0.0092  0.0079  185 LEU A CG    
1430 C  CD1   . LEU A 209 ? 0.2833 0.2921 0.2130 0.0168  0.0802  -0.0036 185 LEU A CD1   
1431 C  CD2   . LEU A 209 ? 0.2839 0.3175 0.1833 0.0432  0.0005  0.0333  185 LEU A CD2   
1432 N  N     . SER A 210 ? 0.2251 0.2414 0.1771 0.0222  0.0270  0.0138  186 SER A N     
1433 C  CA    . SER A 210 ? 0.2168 0.2170 0.1832 0.0071  0.0151  0.0122  186 SER A CA    
1434 C  C     . SER A 210 ? 0.2733 0.1960 0.1958 0.0245  0.0109  -0.0312 186 SER A C     
1435 O  O     . SER A 210 ? 0.2911 0.2199 0.2370 0.0331  -0.0048 -0.0265 186 SER A O     
1436 C  CB    . SER A 210 ? 0.2245 0.2044 0.2107 0.0109  0.0374  -0.0102 186 SER A CB    
1437 O  OG    . SER A 210 ? 0.2447 0.2275 0.1974 0.0016  0.0383  -0.0434 186 SER A OG    
1438 N  N     . ASP A 211 ? 0.2718 0.2116 0.2113 0.0361  0.0250  0.0125  187 ASP A N     
1439 C  CA    . ASP A 211 ? 0.2939 0.2323 0.2288 -0.0148 0.0313  0.0298  187 ASP A CA    
1440 C  C     . ASP A 211 ? 0.2446 0.2241 0.2333 -0.0135 0.0311  0.0174  187 ASP A C     
1441 O  O     . ASP A 211 ? 0.2780 0.2322 0.1886 0.0200  0.0106  -0.0042 187 ASP A O     
1442 C  CB    . ASP A 211 ? 0.3136 0.2209 0.2157 0.0040  0.0225  0.0000  187 ASP A CB    
1443 C  CG    . ASP A 211 ? 0.2699 0.2288 0.2141 -0.0139 0.0328  0.0075  187 ASP A CG    
1444 O  OD1   . ASP A 211 ? 0.3120 0.2552 0.2428 0.0234  0.0543  0.0179  187 ASP A OD1   
1445 O  OD2   . ASP A 211 ? 0.3285 0.2432 0.2011 0.0036  0.0008  -0.0010 187 ASP A OD2   
1446 N  N     . SER A 212 ? 0.2475 0.2194 0.2208 -0.0101 0.0346  0.0286  188 SER A N     
1447 C  CA    . SER A 212 ? 0.2585 0.2103 0.2629 0.0058  0.0076  0.0241  188 SER A CA    
1448 C  C     . SER A 212 ? 0.2322 0.2298 0.2095 -0.0131 -0.0100 0.0017  188 SER A C     
1449 O  O     . SER A 212 ? 0.2603 0.2402 0.2384 0.0123  0.0309  0.0377  188 SER A O     
1450 C  CB    . SER A 212 ? 0.2741 0.2307 0.2569 -0.0128 -0.0489 0.0637  188 SER A CB    
1451 O  OG    . SER A 212 ? 0.2804 0.3109 0.2154 -0.0322 0.0360  0.0022  188 SER A OG    
1452 N  N     . PHE A 213 ? 0.2479 0.2311 0.2177 0.0119  0.0355  -0.0223 189 PHE A N     
1453 C  CA    . PHE A 213 ? 0.2484 0.2505 0.2049 0.0340  0.0149  -0.0226 189 PHE A CA    
1454 C  C     . PHE A 213 ? 0.2839 0.2104 0.2016 0.0017  0.0280  -0.0202 189 PHE A C     
1455 O  O     . PHE A 213 ? 0.2845 0.2673 0.2196 0.0153  0.0191  0.0017  189 PHE A O     
1456 C  CB    . PHE A 213 ? 0.2304 0.2606 0.1838 -0.0013 0.0510  -0.0105 189 PHE A CB    
1457 C  CG    . PHE A 213 ? 0.2673 0.2475 0.1991 -0.0214 0.0294  0.0091  189 PHE A CG    
1458 C  CD1   . PHE A 213 ? 0.2717 0.3019 0.1788 -0.0092 0.0271  0.0399  189 PHE A CD1   
1459 C  CD2   . PHE A 213 ? 0.3212 0.2410 0.2803 -0.0239 -0.0010 0.0245  189 PHE A CD2   
1460 C  CE1   . PHE A 213 ? 0.3201 0.2588 0.2825 -0.0156 0.0114  0.0107  189 PHE A CE1   
1461 C  CE2   . PHE A 213 ? 0.3272 0.2009 0.3076 -0.0159 -0.0263 0.0122  189 PHE A CE2   
1462 C  CZ    . PHE A 213 ? 0.3163 0.2475 0.2922 -0.0088 -0.0140 0.0323  189 PHE A CZ    
1463 N  N     . CYS A 214 ? 0.2791 0.2204 0.1839 -0.0184 0.0217  -0.0035 190 CYS A N     
1464 C  CA    . CYS A 214 ? 0.2383 0.1998 0.2224 -0.0074 0.0223  0.0493  190 CYS A CA    
1465 C  C     . CYS A 214 ? 0.2677 0.1938 0.2195 0.0107  0.0055  0.0167  190 CYS A C     
1466 O  O     . CYS A 214 ? 0.2687 0.2263 0.2093 0.0185  0.0175  0.0163  190 CYS A O     
1467 C  CB    . CYS A 214 ? 0.2452 0.2062 0.2952 0.0148  0.0139  0.0269  190 CYS A CB    
1468 S  SG    . CYS A 214 ? 0.2660 0.2410 0.2717 -0.0002 0.0005  0.0165  190 CYS A SG    
1469 N  N     . VAL A 215 ? 0.2804 0.2227 0.2433 0.0257  0.0221  0.0103  191 VAL A N     
1470 C  CA    . VAL A 215 ? 0.2937 0.2433 0.2442 0.0237  0.0450  0.0288  191 VAL A CA    
1471 C  C     . VAL A 215 ? 0.2665 0.2380 0.2184 0.0122  -0.0046 0.0112  191 VAL A C     
1472 O  O     . VAL A 215 ? 0.2688 0.2564 0.1920 0.0453  0.0131  0.0139  191 VAL A O     
1473 C  CB    . VAL A 215 ? 0.2809 0.2022 0.2068 0.0516  0.0227  0.0093  191 VAL A CB    
1474 C  CG1   . VAL A 215 ? 0.2792 0.2574 0.2185 0.0271  0.0003  0.0326  191 VAL A CG1   
1475 C  CG2   . VAL A 215 ? 0.2804 0.1946 0.2120 0.0153  0.0453  -0.0179 191 VAL A CG2   
1476 N  N     . ASP A 216 ? 0.2991 0.2328 0.2140 0.0306  0.0113  -0.0180 192 ASP A N     
1477 C  CA    . ASP A 216 ? 0.2930 0.2484 0.2425 0.0404  0.0170  0.0012  192 ASP A CA    
1478 C  C     . ASP A 216 ? 0.2942 0.2427 0.2855 0.0391  0.0127  0.0217  192 ASP A C     
1479 O  O     . ASP A 216 ? 0.2997 0.2899 0.2399 0.1038  0.0242  -0.0396 192 ASP A O     
1480 C  CB    . ASP A 216 ? 0.3231 0.2579 0.2547 0.0214  0.0268  -0.0188 192 ASP A CB    
1481 C  CG    . ASP A 216 ? 0.4456 0.2767 0.3078 0.0694  0.0269  0.0137  192 ASP A CG    
1482 O  OD1   . ASP A 216 ? 0.4447 0.3332 0.2987 0.0232  0.0517  0.0402  192 ASP A OD1   
1483 O  OD2   . ASP A 216 ? 0.5165 0.3578 0.3226 0.1288  0.0220  -0.0207 192 ASP A OD2   
1484 N  N     . ARG A 217 ? 0.2684 0.2130 0.2386 0.0005  -0.0058 -0.0229 193 ARG A N     
1485 C  CA    . ARG A 217 ? 0.2833 0.2257 0.2352 -0.0121 0.0066  0.0157  193 ARG A CA    
1486 C  C     . ARG A 217 ? 0.2682 0.2355 0.2460 0.0167  -0.0055 0.0035  193 ARG A C     
1487 O  O     . ARG A 217 ? 0.2916 0.2852 0.2753 0.0474  -0.0045 -0.0079 193 ARG A O     
1488 C  CB    . ARG A 217 ? 0.2745 0.2511 0.2417 -0.0063 0.0427  0.0274  193 ARG A CB    
1489 C  CG    . ARG A 217 ? 0.2970 0.2982 0.2258 0.0259  0.0596  -0.0074 193 ARG A CG    
1490 C  CD    . ARG A 217 ? 0.2965 0.2509 0.2341 0.0650  0.0632  0.0020  193 ARG A CD    
1491 N  NE    . ARG A 217 ? 0.2448 0.2317 0.2342 0.0311  0.0469  -0.0116 193 ARG A NE    
1492 C  CZ    . ARG A 217 ? 0.2465 0.2170 0.2173 0.0281  0.0306  0.0034  193 ARG A CZ    
1493 N  NH1   . ARG A 217 ? 0.2600 0.2505 0.2220 0.0205  0.0235  -0.0208 193 ARG A NH1   
1494 N  NH2   . ARG A 217 ? 0.2006 0.2350 0.2952 0.0356  0.0390  0.0520  193 ARG A NH2   
1495 N  N     . TYR A 218 ? 0.2974 0.2546 0.2620 0.0145  0.0131  -0.0104 194 TYR A N     
1496 C  CA    . TYR A 218 ? 0.2981 0.2215 0.2453 0.0309  0.0133  -0.0043 194 TYR A CA    
1497 C  C     . TYR A 218 ? 0.2810 0.2237 0.2376 0.0253  -0.0029 0.0138  194 TYR A C     
1498 O  O     . TYR A 218 ? 0.2939 0.2635 0.2885 -0.0160 -0.0158 -0.0023 194 TYR A O     
1499 C  CB    . TYR A 218 ? 0.3079 0.2241 0.2434 0.0459  0.0084  0.0095  194 TYR A CB    
1500 C  CG    . TYR A 218 ? 0.2578 0.2607 0.2521 0.0116  0.0093  0.0302  194 TYR A CG    
1501 C  CD1   . TYR A 218 ? 0.2841 0.3024 0.2426 0.0360  0.0184  0.0135  194 TYR A CD1   
1502 C  CD2   . TYR A 218 ? 0.2717 0.2348 0.2056 0.0028  0.0179  0.0108  194 TYR A CD2   
1503 C  CE1   . TYR A 218 ? 0.2493 0.3205 0.2511 0.0334  0.0351  0.0104  194 TYR A CE1   
1504 C  CE2   . TYR A 218 ? 0.2819 0.3020 0.2135 -0.0011 0.0390  -0.0179 194 TYR A CE2   
1505 C  CZ    . TYR A 218 ? 0.2924 0.2585 0.1975 0.0136  0.0220  -0.0107 194 TYR A CZ    
1506 O  OH    . TYR A 218 ? 0.2712 0.2629 0.2040 0.0328  0.0447  0.0083  194 TYR A OH    
1507 N  N     . ARG A 219 ? 0.3104 0.2663 0.2187 0.0045  -0.0084 0.0566  195 ARG A N     
1508 C  CA    . ARG A 219 ? 0.3125 0.2574 0.2295 0.0002  -0.0007 0.0622  195 ARG A CA    
1509 C  C     . ARG A 219 ? 0.2871 0.2552 0.2762 0.0240  -0.0086 0.0250  195 ARG A C     
1510 O  O     . ARG A 219 ? 0.3209 0.2670 0.2640 0.0413  -0.0195 0.0142  195 ARG A O     
1511 C  CB    . ARG A 219 ? 0.3101 0.2506 0.3046 0.0060  -0.0083 0.0297  195 ARG A CB    
1512 C  CG    . ARG A 219 ? 0.3268 0.2954 0.3337 -0.0039 0.0193  0.0392  195 ARG A CG    
1513 C  CD    . ARG A 219 ? 0.3294 0.2888 0.3606 0.0010  0.0029  0.0105  195 ARG A CD    
1514 N  NE    . ARG A 219 ? 0.3563 0.2618 0.3053 0.0170  0.0142  0.0415  195 ARG A NE    
1515 C  CZ    . ARG A 219 ? 0.3165 0.2099 0.3398 0.0533  0.0184  0.0156  195 ARG A CZ    
1516 N  NH1   . ARG A 219 ? 0.2929 0.2274 0.2774 0.0264  0.0477  -0.0295 195 ARG A NH1   
1517 N  NH2   . ARG A 219 ? 0.3325 0.1859 0.3760 0.0382  0.0650  0.0428  195 ARG A NH2   
1518 N  N     . GLY A 220 ? 0.2707 0.2952 0.2877 0.0312  -0.0073 0.0206  196 GLY A N     
1519 C  CA    . GLY A 220 ? 0.3434 0.2538 0.2799 0.0170  -0.0443 0.0124  196 GLY A CA    
1520 C  C     . GLY A 220 ? 0.3324 0.2608 0.2941 0.0141  -0.0215 0.0198  196 GLY A C     
1521 O  O     . GLY A 220 ? 0.3295 0.2963 0.2882 0.0420  -0.0451 0.0285  196 GLY A O     
1522 N  N     . GLU A 221 ? 0.3326 0.2846 0.3085 0.0223  0.0161  0.0196  197 GLU A N     
1523 C  CA    . GLU A 221 ? 0.3257 0.2618 0.2968 0.0452  0.0296  0.0321  197 GLU A CA    
1524 C  C     . GLU A 221 ? 0.3044 0.2898 0.2865 0.0280  0.0178  -0.0109 197 GLU A C     
1525 O  O     . GLU A 221 ? 0.2951 0.2854 0.3128 0.0016  -0.0131 0.0195  197 GLU A O     
1526 C  CB    . GLU A 221 ? 0.3422 0.2500 0.2927 0.0108  0.0382  0.0068  197 GLU A CB    
1527 C  CG    . GLU A 221 ? 0.3527 0.3609 0.4594 0.0583  0.0292  -0.0287 197 GLU A CG    
1528 C  CD    . GLU A 221 ? 0.4679 0.5628 0.4757 0.0522  0.0383  -0.0331 197 GLU A CD    
1529 O  OE1   . GLU A 221 ? 0.4168 0.6296 0.6064 0.0670  -0.0110 -0.1026 197 GLU A OE1   
1530 O  OE2   . GLU A 221 ? 0.6075 0.6199 0.7422 -0.0061 0.0223  0.0621  197 GLU A OE2   
1531 N  N     . PHE A 222 ? 0.3085 0.2690 0.2417 0.0101  0.0088  0.0060  198 PHE A N     
1532 C  CA    . PHE A 222 ? 0.2714 0.2904 0.2104 0.0225  -0.0116 0.0285  198 PHE A CA    
1533 C  C     . PHE A 222 ? 0.3080 0.2508 0.2166 0.0327  0.0102  0.0366  198 PHE A C     
1534 O  O     . PHE A 222 ? 0.3202 0.2872 0.2226 0.0464  0.0320  0.0078  198 PHE A O     
1535 C  CB    . PHE A 222 ? 0.2745 0.2759 0.2260 0.0163  -0.0221 0.0429  198 PHE A CB    
1536 C  CG    . PHE A 222 ? 0.2910 0.2559 0.2116 0.0260  -0.0087 0.0100  198 PHE A CG    
1537 C  CD1   . PHE A 222 ? 0.3225 0.2736 0.2160 0.0242  -0.0024 0.0487  198 PHE A CD1   
1538 C  CD2   . PHE A 222 ? 0.3271 0.2517 0.2319 0.0105  -0.0203 -0.0302 198 PHE A CD2   
1539 C  CE1   . PHE A 222 ? 0.3242 0.2326 0.1960 0.0497  0.0193  0.0035  198 PHE A CE1   
1540 C  CE2   . PHE A 222 ? 0.2959 0.2602 0.2476 -0.0056 0.0170  -0.0004 198 PHE A CE2   
1541 C  CZ    . PHE A 222 ? 0.3046 0.2243 0.2133 0.0316  0.0398  0.0058  198 PHE A CZ    
1542 N  N     . LEU A 223 ? 0.2924 0.2700 0.2166 0.0126  0.0058  0.0433  199 LEU A N     
1543 C  CA    . LEU A 223 ? 0.3144 0.2551 0.2143 -0.0002 0.0180  0.0235  199 LEU A CA    
1544 C  C     . LEU A 223 ? 0.3080 0.2806 0.2462 0.0232  -0.0123 0.0270  199 LEU A C     
1545 O  O     . LEU A 223 ? 0.3820 0.3381 0.2334 -0.0430 0.0164  0.0169  199 LEU A O     
1546 C  CB    . LEU A 223 ? 0.3483 0.2702 0.1981 -0.0267 -0.0076 0.0256  199 LEU A CB    
1547 C  CG    . LEU A 223 ? 0.3251 0.3349 0.2712 -0.0286 0.0099  0.0370  199 LEU A CG    
1548 C  CD1   . LEU A 223 ? 0.3202 0.3379 0.4035 -0.0010 -0.0427 0.0160  199 LEU A CD1   
1549 C  CD2   . LEU A 223 ? 0.3520 0.3745 0.3172 -0.0395 0.0562  0.0203  199 LEU A CD2   
1550 N  N     . ASP A 224 ? 0.3145 0.2620 0.2595 0.0118  0.0061  0.0604  200 ASP A N     
1551 C  CA    . ASP A 224 ? 0.3370 0.2927 0.3165 -0.0036 0.0054  -0.0045 200 ASP A CA    
1552 C  C     . ASP A 224 ? 0.3253 0.2909 0.2885 0.0288  -0.0359 0.0048  200 ASP A C     
1553 O  O     . ASP A 224 ? 0.3200 0.3561 0.2857 0.0069  -0.0268 -0.0126 200 ASP A O     
1554 C  CB    . ASP A 224 ? 0.3559 0.3614 0.3159 0.0495  -0.0161 -0.0389 200 ASP A CB    
1555 C  CG    . ASP A 224 ? 0.3423 0.4680 0.4391 0.0135  -0.0062 -0.0033 200 ASP A CG    
1556 O  OD1   . ASP A 224 ? 0.3933 0.5458 0.4314 0.1028  -0.0172 -0.0571 200 ASP A OD1   
1557 O  OD2   . ASP A 224 ? 0.4323 0.5521 0.5555 -0.0551 0.0627  0.0006  200 ASP A OD2   
1558 N  N     . LEU A 225 ? 0.3464 0.2533 0.2534 0.0154  0.0084  0.0162  201 LEU A N     
1559 C  CA    . LEU A 225 ? 0.3549 0.2526 0.2646 0.0367  0.0100  0.0526  201 LEU A CA    
1560 C  C     . LEU A 225 ? 0.3228 0.2793 0.3005 0.0165  0.0055  -0.0020 201 LEU A C     
1561 O  O     . LEU A 225 ? 0.3221 0.3133 0.2830 0.0004  -0.0039 -0.0141 201 LEU A O     
1562 C  CB    . LEU A 225 ? 0.3489 0.2588 0.2428 0.0048  0.0111  0.0330  201 LEU A CB    
1563 C  CG    . LEU A 225 ? 0.3253 0.2830 0.2401 0.0004  -0.0058 -0.0069 201 LEU A CG    
1564 C  CD1   . LEU A 225 ? 0.3403 0.3238 0.1988 0.0357  0.0335  0.0662  201 LEU A CD1   
1565 C  CD2   . LEU A 225 ? 0.3514 0.2783 0.2947 -0.0117 0.0565  -0.0679 201 LEU A CD2   
1566 N  N     . MSE A 226 ? 0.3688 0.2936 0.2360 0.0167  0.0212  0.0625  202 MSE A N     
1567 C  CA    . MSE A 226 ? 0.3656 0.3540 0.2465 0.0278  0.0203  0.0504  202 MSE A CA    
1568 C  C     . MSE A 226 ? 0.3640 0.2721 0.2635 0.0091  -0.0179 0.0108  202 MSE A C     
1569 O  O     . MSE A 226 ? 0.4206 0.3244 0.2250 -0.0025 -0.0373 -0.0010 202 MSE A O     
1570 C  CB    . MSE A 226 ? 0.4000 0.3218 0.2301 0.0064  -0.0239 0.0981  202 MSE A CB    
1571 C  CG    . MSE A 226 ? 0.4948 0.4627 0.2587 0.0687  -0.0149 0.1857  202 MSE A CG    
1572 SE SE    . MSE A 226 ? 0.6588 0.9788 0.7487 -0.1777 -0.2056 0.2355  202 MSE A SE    
1573 C  CE    . MSE A 226 ? 0.7822 0.8493 0.7887 -0.0223 -0.1199 0.0601  202 MSE A CE    
1574 N  N     . ARG A 227 ? 0.3750 0.2914 0.2509 0.0165  -0.0287 0.0466  203 ARG A N     
1575 C  CA    . ARG A 227 ? 0.3406 0.2719 0.2539 0.0375  -0.0272 0.0390  203 ARG A CA    
1576 C  C     . ARG A 227 ? 0.3831 0.2610 0.2756 0.0130  -0.0203 0.0161  203 ARG A C     
1577 O  O     . ARG A 227 ? 0.4292 0.3250 0.3006 0.0392  -0.0607 -0.0107 203 ARG A O     
1578 C  CB    . ARG A 227 ? 0.3584 0.2680 0.2024 0.0067  -0.0066 0.0225  203 ARG A CB    
1579 C  CG    . ARG A 227 ? 0.3524 0.2859 0.2276 0.0070  0.0123  0.0295  203 ARG A CG    
1580 C  CD    . ARG A 227 ? 0.3501 0.2871 0.2452 0.0058  0.0208  0.0341  203 ARG A CD    
1581 N  NE    . ARG A 227 ? 0.3355 0.3203 0.2435 0.0140  0.0050  0.0223  203 ARG A NE    
1582 C  CZ    . ARG A 227 ? 0.3167 0.3096 0.2844 -0.0102 0.0109  0.0460  203 ARG A CZ    
1583 N  NH1   . ARG A 227 ? 0.4112 0.2785 0.3105 0.0585  -0.0262 0.0200  203 ARG A NH1   
1584 N  NH2   . ARG A 227 ? 0.3334 0.3755 0.2426 -0.0476 0.0298  0.0524  203 ARG A NH2   
1585 N  N     . SER A 228 ? 0.3649 0.3273 0.2691 0.0490  -0.0207 0.0475  204 SER A N     
1586 C  CA    . SER A 228 ? 0.3976 0.3154 0.2662 0.0459  -0.0516 0.0019  204 SER A CA    
1587 C  C     . SER A 228 ? 0.4449 0.3033 0.3415 0.0604  -0.0608 0.0444  204 SER A C     
1588 O  O     . SER A 228 ? 0.4890 0.3746 0.4511 0.0320  -0.1077 0.0615  204 SER A O     
1589 C  CB    . SER A 228 ? 0.3732 0.3165 0.3281 0.0223  -0.0101 0.0373  204 SER A CB    
1590 O  OG    . SER A 228 ? 0.4512 0.2683 0.3431 0.0075  -0.0610 0.0207  204 SER A OG    
1591 N  N     . GLY A 229 ? 0.4065 0.3204 0.2897 0.0334  -0.0263 0.0091  205 GLY A N     
1592 C  CA    . GLY A 229 ? 0.4204 0.3271 0.3756 0.0731  -0.0408 0.0334  205 GLY A CA    
1593 C  C     . GLY A 229 ? 0.4211 0.2990 0.3350 0.0410  -0.0568 -0.0005 205 GLY A C     
1594 O  O     . GLY A 229 ? 0.4811 0.2939 0.3616 -0.0086 -0.0408 -0.0302 205 GLY A O     
1595 N  N     . LYS A 230 ? 0.3397 0.3342 0.3439 0.0405  -0.0143 0.0191  206 LYS A N     
1596 C  CA    . LYS A 230 ? 0.3596 0.3509 0.3209 0.0202  -0.0371 0.0051  206 LYS A CA    
1597 C  C     . LYS A 230 ? 0.3591 0.2866 0.3270 -0.0042 -0.0355 0.0149  206 LYS A C     
1598 O  O     . LYS A 230 ? 0.3986 0.3293 0.3646 0.0254  0.0111  0.0610  206 LYS A O     
1599 C  CB    . LYS A 230 ? 0.3819 0.3065 0.3595 0.0649  -0.0181 0.0306  206 LYS A CB    
1600 C  CG    . LYS A 230 ? 0.3880 0.3571 0.4034 0.0663  -0.0323 0.0499  206 LYS A CG    
1601 C  CD    . LYS A 230 ? 0.4456 0.3429 0.4474 0.0936  -0.0625 0.0116  206 LYS A CD    
1602 C  CE    . LYS A 230 ? 0.4168 0.3732 0.5085 0.0789  0.0042  0.0416  206 LYS A CE    
1603 N  NZ    . LYS A 230 ? 0.5232 0.3516 0.5667 0.0318  0.0563  0.0834  206 LYS A NZ    
1604 N  N     . VAL A 231 ? 0.3483 0.3391 0.2787 -0.0201 -0.0362 0.0171  207 VAL A N     
1605 C  CA    . VAL A 231 ? 0.3683 0.3215 0.2632 0.0029  -0.0375 0.0185  207 VAL A CA    
1606 C  C     . VAL A 231 ? 0.4002 0.2997 0.2622 0.0289  -0.0407 0.0204  207 VAL A C     
1607 O  O     . VAL A 231 ? 0.4729 0.3138 0.2907 0.0073  -0.0153 0.0455  207 VAL A O     
1608 C  CB    . VAL A 231 ? 0.3230 0.3835 0.2514 -0.0021 -0.0204 0.0045  207 VAL A CB    
1609 C  CG1   . VAL A 231 ? 0.3475 0.3762 0.3527 0.0333  -0.0481 0.0192  207 VAL A CG1   
1610 C  CG2   . VAL A 231 ? 0.3593 0.3627 0.2591 0.0295  0.0016  0.0409  207 VAL A CG2   
1611 N  N     . ASP A 232 ? 0.4006 0.3187 0.2483 0.0494  -0.0504 0.0225  208 ASP A N     
1612 C  CA    . ASP A 232 ? 0.4098 0.3097 0.2310 0.0178  -0.0434 0.0278  208 ASP A CA    
1613 C  C     . ASP A 232 ? 0.4041 0.3170 0.2709 0.0423  -0.0290 0.0328  208 ASP A C     
1614 O  O     . ASP A 232 ? 0.4781 0.4269 0.2625 0.0333  -0.0167 0.0618  208 ASP A O     
1615 C  CB    . ASP A 232 ? 0.3813 0.3196 0.2033 0.0152  -0.0197 0.0136  208 ASP A CB    
1616 C  CG    . ASP A 232 ? 0.3834 0.3509 0.2745 0.0024  -0.0636 0.0490  208 ASP A CG    
1617 O  OD1   . ASP A 232 ? 0.5080 0.4318 0.3034 -0.0080 -0.1426 0.0472  208 ASP A OD1   
1618 O  OD2   . ASP A 232 ? 0.3819 0.3801 0.2737 0.0145  -0.0354 0.0447  208 ASP A OD2   
1619 N  N     . ILE A 233 ? 0.3818 0.2774 0.2511 0.0535  -0.0188 0.0019  209 ILE A N     
1620 C  CA    . ILE A 233 ? 0.3834 0.2928 0.2419 0.0128  0.0004  -0.0299 209 ILE A CA    
1621 C  C     . ILE A 233 ? 0.3403 0.2969 0.2543 -0.0028 0.0137  -0.0437 209 ILE A C     
1622 O  O     . ILE A 233 ? 0.3640 0.2840 0.2833 0.0012  0.0253  0.0104  209 ILE A O     
1623 C  CB    . ILE A 233 ? 0.3790 0.2946 0.2630 0.0175  -0.0114 -0.0323 209 ILE A CB    
1624 C  CG1   . ILE A 233 ? 0.3779 0.2789 0.2261 0.0181  0.0032  -0.0095 209 ILE A CG1   
1625 C  CG2   . ILE A 233 ? 0.3709 0.2796 0.3313 0.0204  0.0081  -0.0215 209 ILE A CG2   
1626 C  CD1   . ILE A 233 ? 0.4156 0.3007 0.2240 0.0329  0.0812  0.0237  209 ILE A CD1   
1627 N  N     . VAL A 234 ? 0.3380 0.2700 0.2152 0.0133  -0.0064 -0.0342 210 VAL A N     
1628 C  CA    A VAL A 234 ? 0.3022 0.2584 0.1967 0.0206  0.0257  -0.0290 210 VAL A CA    
1629 C  CA    B VAL A 234 ? 0.3031 0.2358 0.1970 0.0244  0.0225  -0.0189 210 VAL A CA    
1630 C  C     . VAL A 234 ? 0.2952 0.2908 0.2067 0.0210  0.0324  -0.0070 210 VAL A C     
1631 O  O     . VAL A 234 ? 0.3128 0.2954 0.2138 0.0213  0.0484  0.0060  210 VAL A O     
1632 C  CB    A VAL A 234 ? 0.2913 0.2700 0.2312 0.0371  0.0283  -0.0242 210 VAL A CB    
1633 C  CB    B VAL A 234 ? 0.2914 0.2415 0.2014 0.0334  0.0284  -0.0128 210 VAL A CB    
1634 C  CG1   A VAL A 234 ? 0.2556 0.2506 0.2136 -0.0006 0.0655  -0.0081 210 VAL A CG1   
1635 C  CG1   B VAL A 234 ? 0.3012 0.1531 0.2105 0.0285  0.0286  -0.0280 210 VAL A CG1   
1636 C  CG2   A VAL A 234 ? 0.3025 0.3071 0.2811 -0.0166 -0.0115 -0.0463 210 VAL A CG2   
1637 C  CG2   B VAL A 234 ? 0.2936 0.2551 0.1864 0.0252  0.0185  -0.0078 210 VAL A CG2   
1638 N  N     . PHE A 235 ? 0.2935 0.2547 0.2056 0.0344  0.0030  -0.0049 211 PHE A N     
1639 C  CA    . PHE A 235 ? 0.2791 0.2398 0.2233 0.0290  0.0250  0.0177  211 PHE A CA    
1640 C  C     . PHE A 235 ? 0.2688 0.2282 0.2337 0.0326  0.0133  0.0296  211 PHE A C     
1641 O  O     . PHE A 235 ? 0.2982 0.2380 0.2470 0.0251  0.0453  0.0117  211 PHE A O     
1642 C  CB    . PHE A 235 ? 0.2449 0.2246 0.2304 0.0427  0.0295  0.0162  211 PHE A CB    
1643 C  CG    . PHE A 235 ? 0.2737 0.2380 0.2081 0.0371  0.0414  0.0019  211 PHE A CG    
1644 C  CD1   . PHE A 235 ? 0.3066 0.2282 0.2006 0.0036  0.0347  0.0183  211 PHE A CD1   
1645 C  CD2   . PHE A 235 ? 0.2638 0.2751 0.2248 0.0298  0.0549  -0.0031 211 PHE A CD2   
1646 C  CE1   . PHE A 235 ? 0.2812 0.2301 0.2545 0.0596  0.0297  0.0087  211 PHE A CE1   
1647 C  CE2   . PHE A 235 ? 0.3064 0.2304 0.1867 -0.0013 0.0632  0.0367  211 PHE A CE2   
1648 C  CZ    . PHE A 235 ? 0.2515 0.2998 0.1632 0.0370  0.0497  -0.0060 211 PHE A CZ    
1649 N  N     . ALA A 236 ? 0.2880 0.2566 0.2490 0.0058  0.0418  -0.0076 212 ALA A N     
1650 C  CA    . ALA A 236 ? 0.2828 0.2319 0.2955 0.0000  0.0573  0.0165  212 ALA A CA    
1651 C  C     . ALA A 236 ? 0.2957 0.2858 0.2775 0.0156  0.0297  -0.0191 212 ALA A C     
1652 O  O     . ALA A 236 ? 0.2867 0.3731 0.2667 0.0009  0.1131  0.0027  212 ALA A O     
1653 C  CB    . ALA A 236 ? 0.3347 0.3125 0.2802 0.0340  0.0450  0.0365  212 ALA A CB    
1654 N  N     . ASN A 237 ? 0.2690 0.2391 0.2928 0.0086  0.0304  -0.0053 213 ASN A N     
1655 C  CA    . ASN A 237 ? 0.2679 0.2474 0.2758 0.0175  0.0177  0.0108  213 ASN A CA    
1656 C  C     . ASN A 237 ? 0.2790 0.2689 0.3202 -0.0166 0.0269  0.0338  213 ASN A C     
1657 O  O     . ASN A 237 ? 0.2691 0.2869 0.3064 -0.0017 0.0554  0.0188  213 ASN A O     
1658 C  CB    . ASN A 237 ? 0.3015 0.2615 0.2680 0.0042  0.0315  0.0511  213 ASN A CB    
1659 C  CG    . ASN A 237 ? 0.3237 0.2764 0.2760 0.0253  0.0288  0.0541  213 ASN A CG    
1660 O  OD1   . ASN A 237 ? 0.3014 0.2707 0.3066 0.0456  0.0497  0.0206  213 ASN A OD1   
1661 N  ND2   . ASN A 237 ? 0.3583 0.3535 0.2861 -0.0292 0.0475  0.1048  213 ASN A ND2   
1662 N  N     . ARG A 238 ? 0.2953 0.2295 0.3649 -0.0299 0.0434  0.0410  214 ARG A N     
1663 C  CA    . ARG A 238 ? 0.3186 0.2117 0.3466 -0.0324 0.0494  0.0238  214 ARG A CA    
1664 C  C     . ARG A 238 ? 0.3065 0.3003 0.2819 0.0163  0.0072  0.0189  214 ARG A C     
1665 O  O     . ARG A 238 ? 0.2988 0.3035 0.3593 -0.0063 0.0099  0.0720  214 ARG A O     
1666 C  CB    . ARG A 238 ? 0.3257 0.3473 0.3766 -0.0497 0.0363  0.0216  214 ARG A CB    
1667 C  CG    . ARG A 238 ? 0.4274 0.3317 0.4894 -0.0168 -0.0440 0.0821  214 ARG A CG    
1668 C  CD    . ARG A 238 ? 0.4457 0.3902 0.6031 -0.0910 -0.0091 0.1075  214 ARG A CD    
1669 N  NE    . ARG A 238 ? 0.6206 0.6374 0.5398 -0.1005 0.0745  0.0946  214 ARG A NE    
1670 C  CZ    . ARG A 238 ? 0.9505 0.6898 0.2951 -0.1838 0.2670  0.2075  214 ARG A CZ    
1671 N  NH1   . ARG A 238 ? 0.8516 0.6036 0.5315 -0.1769 0.1000  0.0280  214 ARG A NH1   
1672 N  NH2   . ARG A 238 ? 0.8406 0.5721 0.1659 -0.6020 0.1278  0.0108  214 ARG A NH2   
1673 N  N     . GLN A 239 ? 0.3072 0.2751 0.2783 -0.0102 0.0174  0.0044  215 GLN A N     
1674 C  CA    . GLN A 239 ? 0.2854 0.3319 0.2867 -0.0051 0.0148  -0.0232 215 GLN A CA    
1675 C  C     . GLN A 239 ? 0.2811 0.2628 0.2552 0.0063  0.0058  -0.0040 215 GLN A C     
1676 O  O     . GLN A 239 ? 0.3516 0.2603 0.2928 0.0168  0.0315  0.0357  215 GLN A O     
1677 C  CB    . GLN A 239 ? 0.3294 0.4194 0.2997 0.0137  -0.0337 -0.0402 215 GLN A CB    
1678 C  CG    . GLN A 239 ? 0.3014 0.4491 0.2948 -0.0214 0.0268  -0.0188 215 GLN A CG    
1679 C  CD    . GLN A 239 ? 0.4449 0.4418 0.3766 0.0025  0.0409  -0.0152 215 GLN A CD    
1680 O  OE1   . GLN A 239 ? 0.4247 0.3253 0.3792 -0.0063 0.0237  0.0385  215 GLN A OE1   
1681 N  NE2   . GLN A 239 ? 0.5379 0.6245 0.5147 0.1120  -0.0494 -0.0033 215 GLN A NE2   
1682 N  N     . GLU A 240 ? 0.2649 0.2516 0.2477 0.0056  0.0063  0.0160  216 GLU A N     
1683 C  CA    . GLU A 240 ? 0.2568 0.2228 0.2724 0.0050  0.0024  0.0217  216 GLU A CA    
1684 C  C     . GLU A 240 ? 0.2829 0.2551 0.2533 0.0066  0.0076  0.0136  216 GLU A C     
1685 O  O     . GLU A 240 ? 0.2932 0.2932 0.2568 0.0252  0.0386  0.0316  216 GLU A O     
1686 C  CB    . GLU A 240 ? 0.2772 0.2083 0.2160 0.0391  0.0338  0.0331  216 GLU A CB    
1687 C  CG    . GLU A 240 ? 0.2882 0.2440 0.2154 0.0079  0.0285  0.0405  216 GLU A CG    
1688 C  CD    . GLU A 240 ? 0.3242 0.2498 0.3221 0.0063  0.0218  0.0328  216 GLU A CD    
1689 O  OE1   . GLU A 240 ? 0.2823 0.3140 0.3475 0.0032  0.0401  -0.0086 216 GLU A OE1   
1690 O  OE2   . GLU A 240 ? 0.3214 0.3581 0.3214 0.0174  -0.0229 0.0261  216 GLU A OE2   
1691 N  N     . ALA A 241 ? 0.2999 0.2901 0.2899 0.0201  0.0289  0.0009  217 ALA A N     
1692 C  CA    . ALA A 241 ? 0.3096 0.2826 0.2956 0.0493  0.0427  0.0001  217 ALA A CA    
1693 C  C     . ALA A 241 ? 0.2779 0.2890 0.3018 0.0000  0.0272  0.0219  217 ALA A C     
1694 O  O     . ALA A 241 ? 0.3501 0.2968 0.2734 -0.0003 0.0328  0.0774  217 ALA A O     
1695 C  CB    . ALA A 241 ? 0.3284 0.2532 0.3085 0.0544  0.0612  0.0084  217 ALA A CB    
1696 N  N     . LEU A 242 ? 0.3042 0.2277 0.3246 -0.0015 0.0309  0.0101  218 LEU A N     
1697 C  CA    . LEU A 242 ? 0.3042 0.2223 0.3072 -0.0036 0.0410  -0.0111 218 LEU A CA    
1698 C  C     . LEU A 242 ? 0.2861 0.2771 0.3278 0.0110  0.0482  0.0318  218 LEU A C     
1699 O  O     . LEU A 242 ? 0.3052 0.2934 0.3726 0.0249  0.0232  0.0362  218 LEU A O     
1700 C  CB    . LEU A 242 ? 0.3100 0.2667 0.3142 -0.0131 0.0346  0.0101  218 LEU A CB    
1701 C  CG    . LEU A 242 ? 0.3228 0.3141 0.3507 0.0178  0.0433  0.0199  218 LEU A CG    
1702 C  CD1   . LEU A 242 ? 0.3363 0.3616 0.3760 0.0336  0.0359  -0.0290 218 LEU A CD1   
1703 C  CD2   . LEU A 242 ? 0.3799 0.2796 0.3619 0.0386  0.0652  0.0235  218 LEU A CD2   
1704 N  N     A SER A 243 ? 0.3036 0.2503 0.3073 0.0329  0.0573  0.0152  219 SER A N     
1705 N  N     B SER A 243 ? 0.3207 0.2645 0.3137 0.0249  0.0589  0.0215  219 SER A N     
1706 C  CA    A SER A 243 ? 0.2820 0.2587 0.2499 0.0229  0.0348  0.0352  219 SER A CA    
1707 C  CA    B SER A 243 ? 0.3015 0.2986 0.2780 0.0183  0.0412  0.0311  219 SER A CA    
1708 C  C     A SER A 243 ? 0.2946 0.2624 0.2499 -0.0140 0.0326  0.0351  219 SER A C     
1709 C  C     B SER A 243 ? 0.3125 0.2645 0.2635 -0.0115 0.0420  0.0299  219 SER A C     
1710 O  O     A SER A 243 ? 0.3184 0.3008 0.2483 0.0179  0.0166  0.0564  219 SER A O     
1711 O  O     B SER A 243 ? 0.3351 0.2979 0.2679 0.0181  0.0255  0.0396  219 SER A O     
1712 C  CB    A SER A 243 ? 0.2511 0.2525 0.2180 0.0372  0.0351  0.0113  219 SER A CB    
1713 C  CB    B SER A 243 ? 0.3674 0.3596 0.2617 -0.0048 0.0680  0.0243  219 SER A CB    
1714 O  OG    A SER A 243 ? 0.2549 0.1295 0.2015 0.0530  0.0114  0.0074  219 SER A OG    
1715 O  OG    B SER A 243 ? 0.3732 0.3864 0.3124 -0.0322 0.0605  0.0332  219 SER A OG    
1716 N  N     . LEU A 244 ? 0.3103 0.2822 0.2494 -0.0215 0.0186  0.0188  220 LEU A N     
1717 C  CA    . LEU A 244 ? 0.3329 0.2234 0.2513 0.0026  -0.0136 0.0312  220 LEU A CA    
1718 C  C     . LEU A 244 ? 0.3127 0.2948 0.2054 -0.0169 0.0190  0.0543  220 LEU A C     
1719 O  O     . LEU A 244 ? 0.3431 0.2991 0.2600 0.0375  0.0510  0.0750  220 LEU A O     
1720 C  CB    . LEU A 244 ? 0.3080 0.2255 0.3144 0.0100  0.0195  0.0152  220 LEU A CB    
1721 C  CG    . LEU A 244 ? 0.3150 0.2743 0.2983 0.0017  0.0205  0.0173  220 LEU A CG    
1722 C  CD1   . LEU A 244 ? 0.2999 0.2978 0.3283 0.0406  0.0292  0.0055  220 LEU A CD1   
1723 C  CD2   . LEU A 244 ? 0.2640 0.2544 0.3064 -0.0040 0.0396  0.0346  220 LEU A CD2   
1724 N  N     . TYR A 245 ? 0.3032 0.2428 0.2568 -0.0181 0.0278  0.0370  221 TYR A N     
1725 C  CA    . TYR A 245 ? 0.3349 0.2594 0.2042 0.0153  0.0582  0.0212  221 TYR A CA    
1726 C  C     . TYR A 245 ? 0.3261 0.2762 0.2566 0.0016  0.0294  0.0083  221 TYR A C     
1727 O  O     . TYR A 245 ? 0.4033 0.3118 0.2370 -0.0311 0.0729  0.0308  221 TYR A O     
1728 C  CB    . TYR A 245 ? 0.3701 0.2741 0.2611 0.0019  0.0939  -0.0296 221 TYR A CB    
1729 C  CG    . TYR A 245 ? 0.3511 0.2694 0.2628 -0.0310 0.0758  0.0148  221 TYR A CG    
1730 C  CD1   . TYR A 245 ? 0.3589 0.3019 0.3602 -0.0246 0.0435  0.0189  221 TYR A CD1   
1731 C  CD2   . TYR A 245 ? 0.3153 0.3237 0.2707 0.0005  0.0810  0.0422  221 TYR A CD2   
1732 C  CE1   . TYR A 245 ? 0.3707 0.2527 0.3670 0.0021  0.0528  0.0351  221 TYR A CE1   
1733 C  CE2   . TYR A 245 ? 0.3242 0.3642 0.2737 -0.0026 0.0362  0.0093  221 TYR A CE2   
1734 C  CZ    . TYR A 245 ? 0.3135 0.3086 0.2518 0.0252  0.0472  0.0291  221 TYR A CZ    
1735 O  OH    . TYR A 245 ? 0.3487 0.3084 0.2832 0.0405  0.0313  0.0119  221 TYR A OH    
1736 N  N     . GLN A 246 ? 0.2641 0.2473 0.2460 0.0097  0.0610  0.0121  222 GLN A N     
1737 C  CA    . GLN A 246 ? 0.3108 0.2512 0.2534 0.0037  0.0370  0.0113  222 GLN A CA    
1738 C  C     . GLN A 246 ? 0.3132 0.2196 0.3128 -0.0116 0.0192  0.0267  222 GLN A C     
1739 O  O     . GLN A 246 ? 0.3758 0.2162 0.3715 -0.0139 0.0611  0.0383  222 GLN A O     
1740 C  CB    . GLN A 246 ? 0.3184 0.2357 0.3063 0.0011  0.0360  0.0065  222 GLN A CB    
1741 C  CG    . GLN A 246 ? 0.3608 0.2463 0.3098 0.0015  0.0437  0.0630  222 GLN A CG    
1742 C  CD    . GLN A 246 ? 0.3936 0.2396 0.3314 0.0348  -0.0076 0.1017  222 GLN A CD    
1743 O  OE1   . GLN A 246 ? 0.3818 0.3085 0.3416 0.0410  -0.0044 0.0850  222 GLN A OE1   
1744 N  NE2   . GLN A 246 ? 0.4156 0.2519 0.3592 0.0246  0.0330  0.0816  222 GLN A NE2   
1745 N  N     . THR A 247 ? 0.3435 0.2547 0.3130 0.0124  0.0426  0.0094  223 THR A N     
1746 C  CA    . THR A 247 ? 0.3324 0.2820 0.3380 -0.0182 0.0299  0.0065  223 THR A CA    
1747 C  C     . THR A 247 ? 0.3615 0.2920 0.3200 0.0074  0.0098  0.0129  223 THR A C     
1748 O  O     . THR A 247 ? 0.3770 0.3510 0.3487 -0.0011 0.0338  0.0567  223 THR A O     
1749 C  CB    . THR A 247 ? 0.3434 0.2585 0.3331 -0.0147 0.0433  0.0176  223 THR A CB    
1750 O  OG1   . THR A 247 ? 0.3662 0.3006 0.3937 -0.0159 0.0562  0.0908  223 THR A OG1   
1751 C  CG2   . THR A 247 ? 0.3288 0.2712 0.3681 0.0645  0.0627  0.0056  223 THR A CG2   
1752 N  N     . ASP A 248 ? 0.3781 0.3489 0.3711 -0.0155 0.0384  0.0096  224 ASP A N     
1753 C  CA    . ASP A 248 ? 0.3849 0.4516 0.3868 -0.0124 0.0079  0.0071  224 ASP A CA    
1754 C  C     . ASP A 248 ? 0.3897 0.4203 0.3340 -0.0363 0.0215  0.0537  224 ASP A C     
1755 O  O     . ASP A 248 ? 0.3798 0.4963 0.4354 -0.0468 0.0338  0.0566  224 ASP A O     
1756 C  CB    . ASP A 248 ? 0.4238 0.4578 0.5056 -0.0287 -0.0195 0.0188  224 ASP A CB    
1757 C  CG    . ASP A 248 ? 0.4868 0.5278 0.5113 -0.0351 0.0158  0.0692  224 ASP A CG    
1758 O  OD1   . ASP A 248 ? 0.5136 0.5401 0.5201 -0.0087 0.0008  -0.0007 224 ASP A OD1   
1759 O  OD2   . ASP A 248 ? 0.4298 0.5788 0.5417 0.0404  -0.0158 0.0676  224 ASP A OD2   
1760 N  N     . ASP A 249 ? 0.4119 0.3338 0.3670 -0.0585 0.0171  0.0479  225 ASP A N     
1761 C  CA    . ASP A 249 ? 0.4291 0.3752 0.3961 -0.0191 0.0396  0.0491  225 ASP A CA    
1762 C  C     . ASP A 249 ? 0.3826 0.3657 0.3998 0.0138  0.0502  0.0341  225 ASP A C     
1763 O  O     . ASP A 249 ? 0.3404 0.4268 0.3490 0.0262  0.0812  0.0472  225 ASP A O     
1764 C  CB    . ASP A 249 ? 0.4962 0.4065 0.3897 0.0008  0.0646  0.0764  225 ASP A CB    
1765 C  CG    . ASP A 249 ? 0.5190 0.4551 0.4463 0.0145  0.1051  0.0565  225 ASP A CG    
1766 O  OD1   . ASP A 249 ? 0.5994 0.3738 0.4586 -0.0180 0.1226  0.0765  225 ASP A OD1   
1767 O  OD2   . ASP A 249 ? 0.5355 0.5783 0.4452 0.0263  0.1292  0.0993  225 ASP A OD2   
1768 N  N     . PHE A 250 ? 0.3470 0.3558 0.4072 0.0030  0.0850  0.0468  226 PHE A N     
1769 C  CA    . PHE A 250 ? 0.3362 0.3410 0.3335 0.0282  0.0361  0.0104  226 PHE A CA    
1770 C  C     . PHE A 250 ? 0.3481 0.3635 0.3073 0.0170  0.0349  0.0450  226 PHE A C     
1771 O  O     . PHE A 250 ? 0.3497 0.3445 0.3392 0.0243  0.0571  0.0606  226 PHE A O     
1772 C  CB    . PHE A 250 ? 0.3380 0.3497 0.3566 -0.0025 0.0033  0.0307  226 PHE A CB    
1773 C  CG    . PHE A 250 ? 0.3541 0.3600 0.3525 0.0002  0.0448  0.0736  226 PHE A CG    
1774 C  CD1   . PHE A 250 ? 0.3553 0.3101 0.3420 0.0007  0.0619  0.0274  226 PHE A CD1   
1775 C  CD2   . PHE A 250 ? 0.4030 0.3365 0.4115 0.0166  0.0663  0.0825  226 PHE A CD2   
1776 C  CE1   . PHE A 250 ? 0.3659 0.3171 0.3492 -0.0059 0.0495  0.0398  226 PHE A CE1   
1777 C  CE2   . PHE A 250 ? 0.3731 0.3311 0.4654 0.0490  0.0425  0.1025  226 PHE A CE2   
1778 C  CZ    . PHE A 250 ? 0.3663 0.3089 0.4144 0.0349  0.0327  0.0643  226 PHE A CZ    
1779 N  N     . GLU A 251 ? 0.3470 0.3442 0.3755 -0.0177 0.0611  0.0595  227 GLU A N     
1780 C  CA    . GLU A 251 ? 0.3877 0.4386 0.3766 -0.0186 0.0839  0.0158  227 GLU A CA    
1781 C  C     . GLU A 251 ? 0.4268 0.3592 0.3158 0.0190  0.0511  0.0400  227 GLU A C     
1782 O  O     . GLU A 251 ? 0.4479 0.4400 0.3564 -0.0210 0.0650  0.0053  227 GLU A O     
1783 C  CB    . GLU A 251 ? 0.4502 0.5105 0.4221 -0.0382 0.1028  0.0659  227 GLU A CB    
1784 C  CG    . GLU A 251 ? 0.5393 0.4476 0.4682 0.0585  0.0675  0.0604  227 GLU A CG    
1785 C  CD    . GLU A 251 ? 0.3697 0.4609 0.2791 0.1281  -0.0230 0.0584  227 GLU A CD    
1786 O  OE1   . GLU A 251 ? 0.4854 0.5696 0.4191 0.0091  0.0165  -0.0878 227 GLU A OE1   
1787 O  OE2   . GLU A 251 ? 0.4338 0.5318 0.3353 0.1806  -0.0410 0.0669  227 GLU A OE2   
1788 N  N     . GLU A 252 ? 0.3908 0.3708 0.3415 0.0199  0.0586  0.0387  228 GLU A N     
1789 C  CA    . GLU A 252 ? 0.4035 0.3436 0.3320 0.0326  0.0328  0.0577  228 GLU A CA    
1790 C  C     . GLU A 252 ? 0.3789 0.3124 0.2866 0.0472  0.0235  0.0344  228 GLU A C     
1791 O  O     . GLU A 252 ? 0.3706 0.3197 0.3315 0.0227  0.0408  0.0506  228 GLU A O     
1792 C  CB    . GLU A 252 ? 0.4425 0.3523 0.3569 0.0109  0.0486  0.0332  228 GLU A CB    
1793 C  CG    . GLU A 252 ? 0.4633 0.3381 0.3866 0.0473  0.0371  0.0189  228 GLU A CG    
1794 C  CD    . GLU A 252 ? 0.4869 0.3770 0.5369 0.0838  0.0096  -0.0554 228 GLU A CD    
1795 O  OE1   . GLU A 252 ? 0.6098 0.4049 0.6514 0.0132  0.0208  -0.1100 228 GLU A OE1   
1796 O  OE2   . GLU A 252 ? 0.5028 0.3718 0.5412 0.1517  -0.0153 -0.1353 228 GLU A OE2   
1797 N  N     . ALA A 253 ? 0.3347 0.3095 0.2714 0.0296  0.0568  0.0261  229 ALA A N     
1798 C  CA    . ALA A 253 ? 0.3342 0.2982 0.2657 0.0123  0.0383  0.0142  229 ALA A CA    
1799 C  C     . ALA A 253 ? 0.3206 0.2820 0.2606 0.0209  0.0384  0.0293  229 ALA A C     
1800 O  O     . ALA A 253 ? 0.3394 0.2790 0.3003 -0.0021 0.0518  0.0011  229 ALA A O     
1801 C  CB    . ALA A 253 ? 0.3446 0.3386 0.2395 0.0082  0.0607  0.0141  229 ALA A CB    
1802 N  N     . LEU A 254 ? 0.3322 0.3343 0.2908 0.0290  0.0587  0.0313  230 LEU A N     
1803 C  CA    . LEU A 254 ? 0.3102 0.3363 0.3287 0.0213  0.0495  0.0132  230 LEU A CA    
1804 C  C     . LEU A 254 ? 0.3577 0.3526 0.3149 0.0371  0.0476  0.0226  230 LEU A C     
1805 O  O     . LEU A 254 ? 0.3831 0.3606 0.3051 0.0449  0.0407  0.0157  230 LEU A O     
1806 C  CB    . LEU A 254 ? 0.3330 0.3208 0.2919 0.0301  0.0866  0.0255  230 LEU A CB    
1807 C  CG    . LEU A 254 ? 0.3339 0.3263 0.3559 0.0448  0.0611  0.0500  230 LEU A CG    
1808 C  CD1   . LEU A 254 ? 0.3439 0.3895 0.4435 0.0751  0.0639  0.0078  230 LEU A CD1   
1809 C  CD2   . LEU A 254 ? 0.3668 0.3735 0.2944 0.0209  0.0570  0.0539  230 LEU A CD2   
1810 N  N     . ASN A 255 ? 0.3960 0.3789 0.3186 0.0622  0.0379  0.0312  231 ASN A N     
1811 C  CA    . ASN A 255 ? 0.3840 0.3938 0.3140 0.0772  0.0401  0.0705  231 ASN A CA    
1812 C  C     . ASN A 255 ? 0.3854 0.3797 0.2998 0.0200  0.0445  0.0403  231 ASN A C     
1813 O  O     . ASN A 255 ? 0.3924 0.4050 0.3589 0.0032  0.0440  0.0411  231 ASN A O     
1814 C  CB    . ASN A 255 ? 0.4194 0.4076 0.3631 0.0333  0.0139  0.0846  231 ASN A CB    
1815 C  CG    . ASN A 255 ? 0.4531 0.4926 0.3984 0.0210  0.0466  0.0589  231 ASN A CG    
1816 O  OD1   . ASN A 255 ? 0.5140 0.4794 0.3561 0.0003  0.0516  0.0530  231 ASN A OD1   
1817 N  ND2   . ASN A 255 ? 0.5549 0.5282 0.5260 -0.0377 0.0709  0.0363  231 ASN A ND2   
1818 N  N     . ARG A 256 ? 0.3650 0.3331 0.3004 0.0429  0.0365  0.0620  232 ARG A N     
1819 C  CA    . ARG A 256 ? 0.3726 0.3233 0.3245 0.0352  0.0483  0.0423  232 ARG A CA    
1820 C  C     . ARG A 256 ? 0.3700 0.3202 0.2036 0.0218  -0.0054 0.0291  232 ARG A C     
1821 O  O     . ARG A 256 ? 0.3776 0.3323 0.2692 0.0250  -0.0148 0.0368  232 ARG A O     
1822 C  CB    . ARG A 256 ? 0.3758 0.2998 0.3543 0.0405  0.0243  0.0380  232 ARG A CB    
1823 C  CG    . ARG A 256 ? 0.4222 0.3028 0.3309 0.0752  0.0789  0.0396  232 ARG A CG    
1824 C  CD    . ARG A 256 ? 0.4750 0.3182 0.2769 0.0358  0.1044  0.0341  232 ARG A CD    
1825 N  NE    . ARG A 256 ? 0.4797 0.4070 0.4470 0.0028  0.0703  0.0604  232 ARG A NE    
1826 C  CZ    . ARG A 256 ? 0.5546 0.4636 0.4763 0.0352  0.0613  0.0163  232 ARG A CZ    
1827 N  NH1   . ARG A 256 ? 0.6558 0.4675 0.5137 -0.0371 0.0051  0.0747  232 ARG A NH1   
1828 N  NH2   . ARG A 256 ? 0.5681 0.5914 0.5869 -0.0105 0.0997  0.0630  232 ARG A NH2   
1829 N  N     . ILE A 257 ? 0.3520 0.2964 0.2780 0.0450  -0.0012 0.0296  233 ILE A N     
1830 C  CA    . ILE A 257 ? 0.3714 0.3041 0.2458 0.0462  0.0000  0.0297  233 ILE A CA    
1831 C  C     . ILE A 257 ? 0.3559 0.2992 0.2283 0.0346  0.0172  0.0379  233 ILE A C     
1832 O  O     . ILE A 257 ? 0.3335 0.3332 0.2936 0.0258  0.0190  0.0213  233 ILE A O     
1833 C  CB    . ILE A 257 ? 0.3088 0.2881 0.2352 0.0319  0.0249  0.0413  233 ILE A CB    
1834 C  CG1   . ILE A 257 ? 0.3606 0.2880 0.2387 0.0047  0.0119  0.0463  233 ILE A CG1   
1835 C  CG2   . ILE A 257 ? 0.2932 0.3444 0.2241 0.0384  0.0270  0.0595  233 ILE A CG2   
1836 C  CD1   . ILE A 257 ? 0.3034 0.2783 0.2551 0.0346  -0.0082 0.0066  233 ILE A CD1   
1837 N  N     . ALA A 258 ? 0.3617 0.3334 0.2416 0.0262  0.0303  0.0173  234 ALA A N     
1838 C  CA    . ALA A 258 ? 0.3675 0.3407 0.2614 -0.0034 0.0187  0.0064  234 ALA A CA    
1839 C  C     . ALA A 258 ? 0.4067 0.3064 0.2724 0.0197  0.0043  0.0299  234 ALA A C     
1840 O  O     . ALA A 258 ? 0.4313 0.3324 0.3323 0.0147  -0.0159 0.0131  234 ALA A O     
1841 C  CB    . ALA A 258 ? 0.3275 0.3813 0.3003 -0.0007 0.0038  0.0182  234 ALA A CB    
1842 N  N     . ALA A 259 ? 0.3630 0.3307 0.2405 0.0533  0.0211  0.0607  235 ALA A N     
1843 C  CA    . ALA A 259 ? 0.3676 0.3032 0.2819 0.0508  0.0054  0.0602  235 ALA A CA    
1844 C  C     . ALA A 259 ? 0.3957 0.3056 0.2625 0.0339  0.0131  0.0590  235 ALA A C     
1845 O  O     . ALA A 259 ? 0.3930 0.3622 0.2919 0.0593  0.0121  0.0396  235 ALA A O     
1846 C  CB    . ALA A 259 ? 0.4429 0.2948 0.2823 0.0632  0.0284  0.0314  235 ALA A CB    
1847 N  N     . ASP A 260 ? 0.3872 0.3006 0.2482 0.0183  0.0240  0.0357  236 ASP A N     
1848 C  CA    . ASP A 260 ? 0.3443 0.2782 0.2632 0.0004  0.0024  -0.0039 236 ASP A CA    
1849 C  C     . ASP A 260 ? 0.3593 0.2749 0.2542 0.0163  -0.0034 0.0092  236 ASP A C     
1850 O  O     . ASP A 260 ? 0.3981 0.2853 0.3186 0.0054  0.0451  0.0293  236 ASP A O     
1851 C  CB    . ASP A 260 ? 0.3239 0.2622 0.2744 0.0019  0.0117  -0.0073 236 ASP A CB    
1852 C  CG    . ASP A 260 ? 0.3394 0.2893 0.2701 0.0528  0.0001  0.0031  236 ASP A CG    
1853 O  OD1   . ASP A 260 ? 0.4243 0.3853 0.2586 0.0437  -0.0188 0.0529  236 ASP A OD1   
1854 O  OD2   . ASP A 260 ? 0.3902 0.3132 0.3145 0.0463  0.0222  -0.0292 236 ASP A OD2   
1855 N  N     . CYS A 261 ? 0.3552 0.2767 0.2330 0.0120  0.0099  0.0193  237 CYS A N     
1856 C  CA    A CYS A 261 ? 0.4096 0.2817 0.2429 0.0152  0.0076  0.0224  237 CYS A CA    
1857 C  CA    B CYS A 261 ? 0.3902 0.2827 0.2202 0.0112  -0.0084 0.0254  237 CYS A CA    
1858 C  C     . CYS A 261 ? 0.4004 0.3075 0.2761 0.0128  0.0339  0.0108  237 CYS A C     
1859 O  O     . CYS A 261 ? 0.4168 0.3305 0.3142 0.0337  0.0749  0.0246  237 CYS A O     
1860 C  CB    A CYS A 261 ? 0.3865 0.3189 0.2333 0.0109  0.0032  -0.0097 237 CYS A CB    
1861 C  CB    B CYS A 261 ? 0.3503 0.2605 0.2046 -0.0048 -0.0022 -0.0063 237 CYS A CB    
1862 S  SG    A CYS A 261 ? 0.3854 0.3630 0.2869 0.0090  0.0446  -0.0119 237 CYS A SG    
1863 S  SG    B CYS A 261 ? 0.3433 0.2562 0.1387 0.0245  0.0125  -0.0139 237 CYS A SG    
1864 N  N     . LYS A 262 ? 0.3956 0.3168 0.2184 0.0166  0.0033  -0.0092 238 LYS A N     
1865 C  CA    . LYS A 262 ? 0.3894 0.3085 0.2830 0.0186  0.0261  -0.0146 238 LYS A CA    
1866 C  C     . LYS A 262 ? 0.3931 0.3194 0.2554 0.0398  0.0409  0.0023  238 LYS A C     
1867 O  O     . LYS A 262 ? 0.4895 0.3277 0.2126 0.0255  0.0689  0.0177  238 LYS A O     
1868 C  CB    . LYS A 262 ? 0.4172 0.3684 0.3021 -0.0299 0.0003  -0.0070 238 LYS A CB    
1869 C  CG    . LYS A 262 ? 0.4460 0.4301 0.4166 -0.0328 -0.0477 0.0108  238 LYS A CG    
1870 C  CD    . LYS A 262 ? 0.5506 0.3747 0.6002 -0.0137 -0.0977 -0.1305 238 LYS A CD    
1871 C  CE    . LYS A 262 ? 0.5687 0.5340 0.5812 -0.0213 -0.0211 -0.0671 238 LYS A CE    
1872 N  NZ    . LYS A 262 ? 0.6309 0.5514 0.4344 -0.0386 -0.1063 0.0267  238 LYS A NZ    
1873 N  N     . ILE A 263 ? 0.3712 0.3109 0.2704 0.0380  0.0175  0.0212  239 ILE A N     
1874 C  CA    . ILE A 263 ? 0.3649 0.2694 0.2425 -0.0028 0.0093  -0.0033 239 ILE A CA    
1875 C  C     . ILE A 263 ? 0.3389 0.2954 0.2050 0.0115  0.0162  0.0078  239 ILE A C     
1876 O  O     . ILE A 263 ? 0.3297 0.3161 0.2498 0.0299  0.0362  -0.0046 239 ILE A O     
1877 C  CB    . ILE A 263 ? 0.3756 0.2757 0.2121 0.0272  0.0418  -0.0051 239 ILE A CB    
1878 C  CG1   . ILE A 263 ? 0.3918 0.2609 0.2367 0.0299  0.0306  -0.0254 239 ILE A CG1   
1879 C  CG2   . ILE A 263 ? 0.3633 0.3322 0.2256 0.0358  0.0598  -0.0140 239 ILE A CG2   
1880 C  CD1   . ILE A 263 ? 0.4558 0.2614 0.2873 0.0435  0.0475  -0.0218 239 ILE A CD1   
1881 N  N     . ALA A 264 ? 0.3429 0.3142 0.1895 0.0049  0.0112  -0.0112 240 ALA A N     
1882 C  CA    . ALA A 264 ? 0.3186 0.2965 0.2073 -0.0016 0.0059  -0.0106 240 ALA A CA    
1883 C  C     . ALA A 264 ? 0.3443 0.3795 0.2395 0.0455  0.0182  0.0368  240 ALA A C     
1884 O  O     . ALA A 264 ? 0.3848 0.4101 0.2167 0.0244  0.0327  0.0443  240 ALA A O     
1885 C  CB    . ALA A 264 ? 0.3282 0.3040 0.2438 0.0128  0.0594  0.0017  240 ALA A CB    
1886 N  N     . ALA A 265 ? 0.3262 0.3288 0.2287 0.0464  0.0124  0.0233  241 ALA A N     
1887 C  CA    . ALA A 265 ? 0.3183 0.2984 0.2553 0.0415  0.0285  0.0236  241 ALA A CA    
1888 C  C     . ALA A 265 ? 0.3215 0.3132 0.2547 0.0171  0.0602  0.0138  241 ALA A C     
1889 O  O     . ALA A 265 ? 0.3447 0.2965 0.2551 0.0103  0.0805  0.0137  241 ALA A O     
1890 C  CB    . ALA A 265 ? 0.3042 0.2866 0.2165 0.0250  0.1013  -0.0009 241 ALA A CB    
1891 N  N     . VAL A 266 ? 0.3115 0.3251 0.2569 0.0180  0.0631  0.0048  242 VAL A N     
1892 C  CA    . VAL A 266 ? 0.3048 0.2935 0.2610 0.0174  0.0430  0.0362  242 VAL A CA    
1893 C  C     . VAL A 266 ? 0.3140 0.2849 0.2642 0.0440  0.0400  0.0437  242 VAL A C     
1894 O  O     . VAL A 266 ? 0.3372 0.4443 0.2662 0.0338  0.0616  0.0160  242 VAL A O     
1895 C  CB    . VAL A 266 ? 0.3424 0.2896 0.2746 0.0153  0.0193  0.0373  242 VAL A CB    
1896 C  CG1   . VAL A 266 ? 0.3206 0.3361 0.2741 0.0323  0.0073  0.0089  242 VAL A CG1   
1897 C  CG2   . VAL A 266 ? 0.3554 0.2898 0.2734 0.0674  0.0273  0.0521  242 VAL A CG2   
1898 N  N     . THR A 267 ? 0.2904 0.3211 0.2597 0.0319  0.0468  0.0101  243 THR A N     
1899 C  CA    . THR A 267 ? 0.3195 0.3525 0.2462 0.0241  0.0189  0.0384  243 THR A CA    
1900 C  C     . THR A 267 ? 0.3034 0.3254 0.2751 0.0340  0.0379  0.0554  243 THR A C     
1901 O  O     . THR A 267 ? 0.3778 0.3219 0.2881 0.0407  0.0689  0.0137  243 THR A O     
1902 C  CB    . THR A 267 ? 0.3567 0.3559 0.2590 0.0615  0.0582  0.0437  243 THR A CB    
1903 O  OG1   . THR A 267 ? 0.4106 0.3075 0.2614 0.0354  0.0398  -0.0148 243 THR A OG1   
1904 C  CG2   . THR A 267 ? 0.3797 0.3786 0.2570 0.0159  0.0826  0.0679  243 THR A CG2   
1905 N  N     . MSE A 268 ? 0.3042 0.3902 0.2889 0.0573  0.0407  0.0166  244 MSE A N     
1906 C  CA    . MSE A 268 ? 0.3513 0.4069 0.3212 0.0337  0.0539  0.0089  244 MSE A CA    
1907 C  C     . MSE A 268 ? 0.3337 0.3751 0.3608 0.0161  0.0389  -0.0014 244 MSE A C     
1908 O  O     . MSE A 268 ? 0.3446 0.3923 0.3988 0.0056  0.0409  0.0370  244 MSE A O     
1909 C  CB    . MSE A 268 ? 0.4360 0.5244 0.3517 0.0179  0.0865  0.0355  244 MSE A CB    
1910 C  CG    . MSE A 268 ? 0.5092 0.5368 0.4887 0.0648  -0.0082 0.0572  244 MSE A CG    
1911 SE SE    . MSE A 268 ? 0.7805 0.8692 0.5849 0.0874  0.0622  0.1640  244 MSE A SE    
1912 C  CE    . MSE A 268 ? 0.6085 0.7902 0.4966 0.0099  0.0511  0.1318  244 MSE A CE    
1913 N  N     . SER A 269 ? 0.3688 0.3805 0.3859 0.0261  0.0503  0.0117  245 SER A N     
1914 C  CA    . SER A 269 ? 0.3395 0.4067 0.3845 0.0290  0.0564  0.0000  245 SER A CA    
1915 C  C     . SER A 269 ? 0.3427 0.3989 0.4043 0.0414  0.0494  0.0180  245 SER A C     
1916 O  O     . SER A 269 ? 0.3638 0.3977 0.3721 0.0345  0.1107  0.0276  245 SER A O     
1917 C  CB    . SER A 269 ? 0.3611 0.4479 0.4525 0.0334  0.0291  -0.0435 245 SER A CB    
1918 O  OG    . SER A 269 ? 0.4111 0.5835 0.4496 0.0231  0.1066  -0.1119 245 SER A OG    
1919 N  N     . GLU A 270 ? 0.3588 0.4692 0.4297 -0.0093 0.0871  0.0171  246 GLU A N     
1920 C  CA    . GLU A 270 ? 0.3338 0.4824 0.3813 -0.0121 0.0474  0.0082  246 GLU A CA    
1921 C  C     . GLU A 270 ? 0.3492 0.4598 0.3892 0.0051  0.0636  0.0155  246 GLU A C     
1922 O  O     . GLU A 270 ? 0.3463 0.4977 0.4193 0.0244  0.0734  0.0430  246 GLU A O     
1923 C  CB    . GLU A 270 ? 0.3365 0.4890 0.4330 -0.0448 0.0710  -0.0072 246 GLU A CB    
1924 C  CG    . GLU A 270 ? 0.3450 0.4552 0.5181 -0.0277 0.0589  -0.0239 246 GLU A CG    
1925 C  CD    . GLU A 270 ? 0.3771 0.4950 0.6061 -0.0161 0.1032  -0.0419 246 GLU A CD    
1926 O  OE1   . GLU A 270 ? 0.3976 0.5522 0.4835 -0.0182 0.0930  -0.0289 246 GLU A OE1   
1927 O  OE2   . GLU A 270 ? 0.4194 0.5061 0.7619 -0.0468 0.0955  -0.0657 246 GLU A OE2   
1928 N  N     . ASN A 271 ? 0.3112 0.4537 0.4206 0.0260  0.0833  -0.0080 247 ASN A N     
1929 C  CA    . ASN A 271 ? 0.3618 0.4508 0.4225 0.0297  0.0532  -0.0152 247 ASN A CA    
1930 C  C     . ASN A 271 ? 0.3200 0.3702 0.4217 0.0709  0.0680  -0.0114 247 ASN A C     
1931 O  O     . ASN A 271 ? 0.3720 0.5290 0.4291 0.0248  0.0307  -0.0044 247 ASN A O     
1932 C  CB    . ASN A 271 ? 0.4401 0.4626 0.4888 0.0111  0.0624  0.0403  247 ASN A CB    
1933 C  CG    . ASN A 271 ? 0.4805 0.5360 0.6168 -0.0527 0.0602  0.0405  247 ASN A CG    
1934 O  OD1   . ASN A 271 ? 0.5085 0.6083 0.6801 0.0233  0.0369  0.0076  247 ASN A OD1   
1935 N  ND2   . ASN A 271 ? 0.5884 0.5357 0.6831 -0.0825 0.0963  0.0057  247 ASN A ND2   
1936 N  N     . GLY A 272 ? 0.2882 0.4019 0.4057 0.0423  0.0598  -0.0189 248 GLY A N     
1937 C  CA    . GLY A 272 ? 0.3220 0.3921 0.2932 0.0174  0.0495  0.0250  248 GLY A CA    
1938 C  C     . GLY A 272 ? 0.3172 0.3813 0.3439 0.0009  0.0372  -0.0136 248 GLY A C     
1939 O  O     . GLY A 272 ? 0.3140 0.4210 0.3802 0.0335  0.0426  -0.0242 248 GLY A O     
1940 N  N     . ALA A 273 ? 0.2969 0.3822 0.3145 0.0177  0.0603  -0.0039 249 ALA A N     
1941 C  CA    . ALA A 273 ? 0.3203 0.3584 0.2947 0.0155  0.0278  0.0440  249 ALA A CA    
1942 C  C     . ALA A 273 ? 0.3332 0.3682 0.2943 0.0457  0.0631  0.0483  249 ALA A C     
1943 O  O     . ALA A 273 ? 0.3317 0.3437 0.3843 0.0979  0.0708  0.0143  249 ALA A O     
1944 C  CB    . ALA A 273 ? 0.3045 0.3950 0.3555 -0.0063 0.0353  0.0517  249 ALA A CB    
1945 N  N     . VAL A 274 ? 0.3290 0.3147 0.2993 0.0169  0.0540  0.0605  250 VAL A N     
1946 C  CA    . VAL A 274 ? 0.3187 0.3476 0.3005 0.0773  0.0603  0.0112  250 VAL A CA    
1947 C  C     . VAL A 274 ? 0.3499 0.3226 0.2877 0.0440  0.0766  -0.0153 250 VAL A C     
1948 O  O     . VAL A 274 ? 0.3610 0.3733 0.2267 0.0473  0.0694  -0.0233 250 VAL A O     
1949 C  CB    . VAL A 274 ? 0.3734 0.3651 0.2536 0.0552  0.0764  0.0046  250 VAL A CB    
1950 C  CG1   . VAL A 274 ? 0.3412 0.3020 0.3512 0.0656  0.0606  0.0353  250 VAL A CG1   
1951 C  CG2   . VAL A 274 ? 0.4367 0.4409 0.2486 0.0657  0.0748  0.0389  250 VAL A CG2   
1952 N  N     . ILE A 275 ? 0.3528 0.3305 0.2145 0.0039  0.0905  0.0109  251 ILE A N     
1953 C  CA    . ILE A 275 ? 0.3570 0.3016 0.2310 0.0340  0.0587  -0.0215 251 ILE A CA    
1954 C  C     . ILE A 275 ? 0.3466 0.4012 0.2572 0.0465  0.0440  0.0105  251 ILE A C     
1955 O  O     . ILE A 275 ? 0.4270 0.3897 0.2430 0.0776  0.0671  -0.0237 251 ILE A O     
1956 C  CB    . ILE A 275 ? 0.3580 0.2962 0.2372 0.0202  0.0506  0.0142  251 ILE A CB    
1957 C  CG1   . ILE A 275 ? 0.3879 0.3179 0.1659 0.0335  0.0579  -0.0210 251 ILE A CG1   
1958 C  CG2   . ILE A 275 ? 0.3292 0.3719 0.2589 0.0320  0.0535  -0.0132 251 ILE A CG2   
1959 C  CD1   . ILE A 275 ? 0.3876 0.3092 0.1841 0.0468  0.0809  -0.0336 251 ILE A CD1   
1960 N  N     . LEU A 276 ? 0.3766 0.3537 0.2537 0.0753  0.0271  0.0346  252 LEU A N     
1961 C  CA    . LEU A 276 ? 0.3998 0.2930 0.2350 0.0549  0.0320  0.0247  252 LEU A CA    
1962 C  C     . LEU A 276 ? 0.3880 0.3522 0.2201 0.0402  0.0288  0.0166  252 LEU A C     
1963 O  O     . LEU A 276 ? 0.4134 0.3254 0.1978 0.0434  0.0575  -0.0234 252 LEU A O     
1964 C  CB    . LEU A 276 ? 0.4568 0.2764 0.2666 0.0553  -0.0049 0.0417  252 LEU A CB    
1965 C  CG    . LEU A 276 ? 0.4488 0.4115 0.3626 0.0330  -0.0203 -0.0094 252 LEU A CG    
1966 C  CD1   . LEU A 276 ? 0.4591 0.4514 0.3587 0.0761  0.0283  0.0216  252 LEU A CD1   
1967 C  CD2   . LEU A 276 ? 0.4974 0.4284 0.5201 0.0553  0.0197  0.0140  252 LEU A CD2   
1968 N  N     . LYS A 277 ? 0.4110 0.3585 0.2083 0.0299  0.0461  0.0469  253 LYS A N     
1969 C  CA    . LYS A 277 ? 0.4510 0.3128 0.2369 0.0186  0.0390  0.0398  253 LYS A CA    
1970 C  C     . LYS A 277 ? 0.5026 0.3447 0.2587 0.0482  0.0558  0.0718  253 LYS A C     
1971 O  O     . LYS A 277 ? 0.5489 0.3614 0.2702 0.0699  0.0567  0.0010  253 LYS A O     
1972 C  CB    . LYS A 277 ? 0.4627 0.3235 0.2311 0.0189  0.0712  -0.0098 253 LYS A CB    
1973 C  CG    . LYS A 277 ? 0.4701 0.3365 0.2556 0.0233  0.0631  -0.0220 253 LYS A CG    
1974 C  CD    . LYS A 277 ? 0.4490 0.3315 0.2885 -0.0029 0.0580  -0.0322 253 LYS A CD    
1975 C  CE    . LYS A 277 ? 0.5012 0.3582 0.3719 -0.0492 0.0333  -0.0667 253 LYS A CE    
1976 N  NZ    . LYS A 277 ? 0.6761 0.3695 0.4124 -0.0143 0.0412  -0.0959 253 LYS A NZ    
1977 N  N     . GLY A 278 ? 0.5048 0.4188 0.2363 0.0712  -0.0061 0.0655  254 GLY A N     
1978 C  CA    . GLY A 278 ? 0.4755 0.3638 0.2426 0.0353  0.0169  0.0695  254 GLY A CA    
1979 C  C     . GLY A 278 ? 0.4898 0.3984 0.2521 0.0145  0.0004  0.0703  254 GLY A C     
1980 O  O     . GLY A 278 ? 0.6252 0.4296 0.3041 0.0155  0.0051  0.0265  254 GLY A O     
1981 N  N     . ARG A 279 ? 0.4799 0.3995 0.3416 0.0327  0.0552  0.0747  255 ARG A N     
1982 C  CA    . ARG A 279 ? 0.4851 0.3575 0.4515 -0.0043 -0.0181 0.0653  255 ARG A CA    
1983 C  C     . ARG A 279 ? 0.4421 0.4312 0.3200 0.0198  0.0361  -0.0127 255 ARG A C     
1984 O  O     . ARG A 279 ? 0.4471 0.4964 0.3632 0.0116  0.0649  -0.0175 255 ARG A O     
1985 C  CB    . ARG A 279 ? 0.3239 0.2904 0.5569 0.0223  -0.0547 0.1652  255 ARG A CB    
1986 C  CG    . ARG A 279 ? 0.3440 0.3132 0.8682 0.0289  -0.1453 0.2506  255 ARG A CG    
1987 C  CD    . ARG A 279 ? 0.3909 0.3988 1.0053 0.0635  -0.1936 0.3689  255 ARG A CD    
1988 N  NE    . ARG A 279 ? 0.4815 0.5367 1.5694 0.0864  -0.2690 0.4630  255 ARG A NE    
1989 C  CZ    . ARG A 279 ? 0.4832 0.5174 1.5119 0.1215  -0.3756 0.4504  255 ARG A CZ    
1990 N  NH1   . ARG A 279 ? 0.5528 0.7823 1.6157 -0.1815 -0.1758 0.2951  255 ARG A NH1   
1991 N  NH2   . ARG A 279 ? 0.6529 0.5834 1.8210 0.2288  -0.3004 0.3305  255 ARG A NH2   
1992 N  N     . GLU A 280 ? 0.5286 0.4632 0.2805 0.0217  0.0707  0.0245  256 GLU A N     
1993 C  CA    . GLU A 280 ? 0.4986 0.4961 0.2689 0.0314  0.0870  -0.0073 256 GLU A CA    
1994 C  C     . GLU A 280 ? 0.4209 0.5207 0.2880 0.0405  0.0552  0.0138  256 GLU A C     
1995 O  O     . GLU A 280 ? 0.4837 0.4930 0.2738 0.0801  0.0731  0.0352  256 GLU A O     
1996 C  CB    . GLU A 280 ? 0.5446 0.4812 0.2934 0.0376  0.0821  -0.0617 256 GLU A CB    
1997 C  CG    . GLU A 280 ? 0.5938 0.5129 0.3608 0.0281  0.0303  -0.0864 256 GLU A CG    
1998 C  CD    . GLU A 280 ? 0.5965 0.5479 0.3851 0.0078  0.0136  -0.0648 256 GLU A CD    
1999 O  OE1   . GLU A 280 ? 0.6391 0.6026 0.3080 0.0073  0.0062  -0.0723 256 GLU A OE1   
2000 O  OE2   . GLU A 280 ? 0.6010 0.7978 0.5270 0.0301  -0.0401 -0.0365 256 GLU A OE2   
2001 N  N     . ARG A 281 ? 0.4056 0.5271 0.2603 0.0331  0.1067  0.0320  257 ARG A N     
2002 C  CA    . ARG A 281 ? 0.4072 0.4164 0.3011 0.0006  0.0843  0.0261  257 ARG A CA    
2003 C  C     . ARG A 281 ? 0.4266 0.4619 0.2697 0.0353  0.0998  0.0430  257 ARG A C     
2004 O  O     . ARG A 281 ? 0.4697 0.5486 0.2368 0.0754  0.1146  0.0894  257 ARG A O     
2005 C  CB    . ARG A 281 ? 0.4547 0.4111 0.3976 -0.0071 0.0993  0.0369  257 ARG A CB    
2006 C  CG    . ARG A 281 ? 0.4084 0.4334 0.4108 -0.0267 0.1298  0.0156  257 ARG A CG    
2007 C  CD    . ARG A 281 ? 0.5126 0.5035 0.4861 -0.0911 0.1029  -0.0060 257 ARG A CD    
2008 N  NE    . ARG A 281 ? 0.5557 0.5392 0.4308 -0.0682 0.1233  0.0563  257 ARG A NE    
2009 C  CZ    . ARG A 281 ? 0.5466 0.5796 0.4650 -0.0462 0.1259  -0.0181 257 ARG A CZ    
2010 N  NH1   . ARG A 281 ? 0.5888 0.7026 0.4646 -0.0796 0.0842  -0.0691 257 ARG A NH1   
2011 N  NH2   . ARG A 281 ? 0.3857 0.7034 0.4679 -0.0262 0.1923  0.0387  257 ARG A NH2   
2012 N  N     . TYR A 282 ? 0.4277 0.3538 0.2971 0.0867  0.0935  0.0568  258 TYR A N     
2013 C  CA    . TYR A 282 ? 0.3489 0.3807 0.3296 0.0649  0.0832  0.0547  258 TYR A CA    
2014 C  C     . TYR A 282 ? 0.3502 0.3830 0.3459 0.0563  0.0706  0.0541  258 TYR A C     
2015 O  O     . TYR A 282 ? 0.4354 0.4782 0.3392 0.0944  0.0939  0.0018  258 TYR A O     
2016 C  CB    . TYR A 282 ? 0.4217 0.4220 0.3636 0.0029  0.0554  0.0123  258 TYR A CB    
2017 C  CG    . TYR A 282 ? 0.4377 0.4727 0.3239 0.0290  0.0684  0.0063  258 TYR A CG    
2018 C  CD1   . TYR A 282 ? 0.4692 0.4492 0.3617 0.0240  0.0949  -0.0104 258 TYR A CD1   
2019 C  CD2   . TYR A 282 ? 0.4374 0.4804 0.2793 0.0692  0.0848  -0.0175 258 TYR A CD2   
2020 C  CE1   . TYR A 282 ? 0.4698 0.4942 0.4373 -0.0290 0.0528  -0.0194 258 TYR A CE1   
2021 C  CE2   . TYR A 282 ? 0.5102 0.5171 0.3709 0.0044  0.0269  -0.0468 258 TYR A CE2   
2022 C  CZ    . TYR A 282 ? 0.4805 0.5626 0.3977 0.0125  0.0279  -0.0567 258 TYR A CZ    
2023 O  OH    . TYR A 282 ? 0.5151 0.7051 0.3953 0.0502  0.0087  -0.0782 258 TYR A OH    
2024 N  N     . TYR A 283 ? 0.3896 0.3959 0.3380 -0.0129 0.0899  0.0405  259 TYR A N     
2025 C  CA    . TYR A 283 ? 0.3709 0.3526 0.3720 -0.0135 0.0791  0.0239  259 TYR A CA    
2026 C  C     . TYR A 283 ? 0.3968 0.4063 0.2700 0.0192  0.0785  0.0111  259 TYR A C     
2027 O  O     . TYR A 283 ? 0.3644 0.4598 0.3049 0.0612  0.1140  0.0124  259 TYR A O     
2028 C  CB    . TYR A 283 ? 0.3943 0.3702 0.4236 -0.0362 0.0741  0.0285  259 TYR A CB    
2029 C  CG    . TYR A 283 ? 0.4385 0.4206 0.4383 0.0172  0.0441  0.0223  259 TYR A CG    
2030 C  CD1   . TYR A 283 ? 0.5282 0.4883 0.4419 -0.0059 0.0450  0.0636  259 TYR A CD1   
2031 C  CD2   . TYR A 283 ? 0.4633 0.4532 0.3781 -0.0042 0.0872  0.0406  259 TYR A CD2   
2032 C  CE1   . TYR A 283 ? 0.5891 0.5034 0.4569 0.0178  0.0327  0.0763  259 TYR A CE1   
2033 C  CE2   . TYR A 283 ? 0.5072 0.4820 0.4888 0.0140  0.0719  0.0620  259 TYR A CE2   
2034 C  CZ    . TYR A 283 ? 0.6134 0.5023 0.5095 0.0284  0.0335  0.0618  259 TYR A CZ    
2035 O  OH    . TYR A 283 ? 0.6017 0.5337 0.6317 0.0228  0.0732  0.1606  259 TYR A OH    
2036 N  N     . VAL A 284 ? 0.3893 0.4258 0.2614 -0.0218 0.0710  0.0596  260 VAL A N     
2037 C  CA    . VAL A 284 ? 0.3377 0.4185 0.3782 0.0287  0.0291  0.0278  260 VAL A CA    
2038 C  C     . VAL A 284 ? 0.3525 0.4011 0.3782 0.0407  0.0484  -0.0093 260 VAL A C     
2039 O  O     . VAL A 284 ? 0.3865 0.4198 0.3539 0.0581  0.0951  0.0189  260 VAL A O     
2040 C  CB    . VAL A 284 ? 0.4276 0.4037 0.3727 -0.0189 0.0185  0.0158  260 VAL A CB    
2041 C  CG1   . VAL A 284 ? 0.4607 0.4748 0.3021 0.0338  0.0376  0.0004  260 VAL A CG1   
2042 C  CG2   . VAL A 284 ? 0.4419 0.4469 0.3259 -0.0046 0.0612  -0.0081 260 VAL A CG2   
2043 N  N     . ASN A 285 ? 0.3455 0.4276 0.3360 0.0446  0.0508  0.0100  261 ASN A N     
2044 C  CA    . ASN A 285 ? 0.2970 0.4112 0.3373 0.0289  0.0921  -0.0186 261 ASN A CA    
2045 C  C     . ASN A 285 ? 0.3223 0.4416 0.3240 0.0335  0.0816  -0.0162 261 ASN A C     
2046 O  O     . ASN A 285 ? 0.3561 0.4186 0.3336 0.0439  0.1293  -0.0429 261 ASN A O     
2047 C  CB    . ASN A 285 ? 0.3135 0.4641 0.3168 0.0586  0.1056  0.0235  261 ASN A CB    
2048 C  CG    . ASN A 285 ? 0.2708 0.3962 0.2709 0.1604  0.1454  -0.0263 261 ASN A CG    
2049 O  OD1   . ASN A 285 ? 0.4230 0.4031 0.4279 0.1076  0.1667  0.0566  261 ASN A OD1   
2050 N  ND2   . ASN A 285 ? 0.3277 0.4520 0.3586 0.1572  0.2041  -0.0551 261 ASN A ND2   
2051 N  N     . ALA A 286 ? 0.3630 0.4789 0.3317 0.0617  0.0506  -0.0156 262 ALA A N     
2052 C  CA    . ALA A 286 ? 0.3286 0.4296 0.3189 0.0598  0.0693  -0.0285 262 ALA A CA    
2053 C  C     . ALA A 286 ? 0.3232 0.4077 0.3283 0.0371  0.0645  0.0191  262 ALA A C     
2054 O  O     . ALA A 286 ? 0.3619 0.4987 0.3313 0.0561  0.0993  0.0015  262 ALA A O     
2055 C  CB    . ALA A 286 ? 0.3302 0.4465 0.3423 0.0529  0.0231  -0.0390 262 ALA A CB    
2056 N  N     . ILE A 287 ? 0.3567 0.3954 0.3574 0.0402  0.0791  0.0242  263 ILE A N     
2057 C  CA    . ILE A 287 ? 0.3667 0.4011 0.3684 0.0479  0.0700  -0.0002 263 ILE A CA    
2058 C  C     . ILE A 287 ? 0.3485 0.4565 0.3694 0.0332  0.0786  0.0018  263 ILE A C     
2059 O  O     . ILE A 287 ? 0.3832 0.4403 0.4079 -0.0287 0.0968  -0.0009 263 ILE A O     
2060 C  CB    . ILE A 287 ? 0.3923 0.4157 0.3084 0.0374  0.1005  -0.0111 263 ILE A CB    
2061 C  CG1   . ILE A 287 ? 0.3190 0.3589 0.3236 0.0563  0.1085  0.0005  263 ILE A CG1   
2062 C  CG2   . ILE A 287 ? 0.4013 0.4514 0.3096 0.0169  0.0867  0.0210  263 ILE A CG2   
2063 C  CD1   . ILE A 287 ? 0.3394 0.3864 0.3236 0.0454  0.1365  0.0121  263 ILE A CD1   
2064 N  N     . ARG A 288 ? 0.3664 0.5022 0.3148 0.0715  0.1284  -0.0278 264 ARG A N     
2065 C  CA    . ARG A 288 ? 0.3869 0.5078 0.4430 0.0440  0.0643  -0.0074 264 ARG A CA    
2066 C  C     . ARG A 288 ? 0.3938 0.5243 0.4276 0.0374  0.0509  -0.0208 264 ARG A C     
2067 O  O     . ARG A 288 ? 0.3795 0.5691 0.3740 0.0072  0.1003  0.0056  264 ARG A O     
2068 C  CB    . ARG A 288 ? 0.4088 0.5476 0.4877 0.0608  0.0625  -0.0798 264 ARG A CB    
2069 C  CG    . ARG A 288 ? 0.5370 0.7217 0.5657 -0.0069 -0.0322 -0.0505 264 ARG A CG    
2070 C  CD    . ARG A 288 ? 0.7287 0.8817 0.6706 -0.0477 0.1047  0.1057  264 ARG A CD    
2071 N  NE    . ARG A 288 ? 1.0834 0.9951 0.9117 -0.0166 0.0402  0.2663  264 ARG A NE    
2072 C  CZ    . ARG A 288 ? 1.2939 0.9105 0.8045 0.0501  -0.0079 0.6158  264 ARG A CZ    
2073 N  NH1   . ARG A 288 ? 1.1156 1.0755 1.0240 -0.0461 -0.0359 0.4240  264 ARG A NH1   
2074 N  NH2   . ARG A 288 ? 1.4145 0.8022 0.6774 0.2696  -0.0883 0.4411  264 ARG A NH2   
2075 N  N     . ILE A 289 ? 0.4651 0.5312 0.4631 0.0141  0.0044  -0.0270 265 ILE A N     
2076 C  CA    . ILE A 289 ? 0.4299 0.5656 0.4872 -0.0106 0.0546  -0.0435 265 ILE A CA    
2077 C  C     . ILE A 289 ? 0.4058 0.5464 0.4924 -0.0286 0.0662  -0.0099 265 ILE A C     
2078 O  O     . ILE A 289 ? 0.3676 0.5765 0.5367 -0.0388 0.0330  -0.0020 265 ILE A O     
2079 C  CB    . ILE A 289 ? 0.4416 0.4776 0.5268 -0.0191 0.0145  -0.0583 265 ILE A CB    
2080 C  CG1   . ILE A 289 ? 0.5067 0.4695 0.5100 -0.0101 0.0173  -0.0538 265 ILE A CG1   
2081 C  CG2   . ILE A 289 ? 0.4718 0.4979 0.4803 -0.0183 0.0037  -0.0736 265 ILE A CG2   
2082 C  CD1   . ILE A 289 ? 0.4366 0.4928 0.4817 -0.0130 -0.0398 -0.0675 265 ILE A CD1   
2083 N  N     . ARG A 290 ? 0.3966 0.5398 0.4637 0.0187  0.0778  -0.0329 266 ARG A N     
2084 C  CA    . ARG A 290 ? 0.3627 0.5629 0.5570 0.0027  0.0474  -0.0268 266 ARG A CA    
2085 C  C     . ARG A 290 ? 0.3602 0.5801 0.5857 0.0198  0.0777  -0.0428 266 ARG A C     
2086 O  O     . ARG A 290 ? 0.2549 0.7033 0.6233 0.0292  0.1289  -0.0344 266 ARG A O     
2087 C  CB    . ARG A 290 ? 0.4072 0.6043 0.6678 0.0098  0.1147  0.0408  266 ARG A CB    
2088 C  CG    . ARG A 290 ? 0.6473 0.6500 0.7972 0.0586  0.1376  -0.0121 266 ARG A CG    
2089 C  CD    . ARG A 290 ? 0.7502 0.8774 0.8825 0.0559  0.2294  0.1151  266 ARG A CD    
2090 N  NE    . ARG A 290 ? 0.9576 0.9224 1.0500 0.0461  0.2502  0.0139  266 ARG A NE    
2091 C  CZ    . ARG A 290 ? 1.1680 1.0012 1.1909 0.0478  0.2592  0.1082  266 ARG A CZ    
2092 N  NH1   . ARG A 290 ? 1.1409 0.8847 1.2473 0.1141  0.3228  0.0890  266 ARG A NH1   
2093 N  NH2   . ARG A 290 ? 1.2582 1.1753 0.9552 0.1296  0.3501  0.0311  266 ARG A NH2   
2094 N  N     . GLU A 291 ? 0.3622 0.5502 0.5270 0.0090  0.0918  -0.0083 267 GLU A N     
2095 C  CA    . GLU A 291 ? 0.3463 0.5631 0.5236 0.0337  0.0524  -0.0225 267 GLU A CA    
2096 C  C     . GLU A 291 ? 0.3413 0.4968 0.4952 0.0209  0.0477  -0.0292 267 GLU A C     
2097 O  O     . GLU A 291 ? 0.3197 0.5499 0.4978 0.0074  0.0459  -0.0845 267 GLU A O     
2098 C  CB    . GLU A 291 ? 0.4180 0.6713 0.5465 0.0301  0.0118  -0.0324 267 GLU A CB    
2099 C  CG    . GLU A 291 ? 0.5268 0.6379 0.6170 0.0501  -0.0243 -0.0391 267 GLU A CG    
2100 C  CD    . GLU A 291 ? 0.7031 0.7108 0.6353 0.0363  -0.0523 -0.0099 267 GLU A CD    
2101 O  OE1   . GLU A 291 ? 0.8096 0.8070 0.7178 0.0370  -0.1000 -0.0879 267 GLU A OE1   
2102 O  OE2   . GLU A 291 ? 0.6386 0.7140 0.7023 -0.0298 -0.0184 0.0061  267 GLU A OE2   
2103 N  N     . VAL A 292 ? 0.2242 0.4978 0.4371 0.0021  0.0860  -0.0235 268 VAL A N     
2104 C  CA    . VAL A 292 ? 0.2471 0.4187 0.3573 0.0609  0.0603  -0.0125 268 VAL A CA    
2105 C  C     . VAL A 292 ? 0.3155 0.4071 0.3531 -0.0163 0.0532  -0.0419 268 VAL A C     
2106 O  O     . VAL A 292 ? 0.4327 0.4425 0.3748 -0.0373 0.0450  -0.0716 268 VAL A O     
2107 C  CB    . VAL A 292 ? 0.2767 0.4257 0.4042 0.0783  0.0454  -0.0139 268 VAL A CB    
2108 C  CG1   . VAL A 292 ? 0.2848 0.3929 0.4283 0.0720  0.0927  -0.0277 268 VAL A CG1   
2109 C  CG2   . VAL A 292 ? 0.3333 0.4937 0.3940 0.0374  0.0251  -0.0302 268 VAL A CG2   
2110 N  N     . VAL A 293 ? 0.2798 0.3839 0.2968 0.0165  0.0301  -0.0161 269 VAL A N     
2111 C  CA    . VAL A 293 ? 0.2287 0.3555 0.3059 0.0398  0.0274  0.0001  269 VAL A CA    
2112 C  C     . VAL A 293 ? 0.2410 0.3310 0.3003 0.0455  0.0140  -0.0275 269 VAL A C     
2113 O  O     . VAL A 293 ? 0.2405 0.3728 0.2826 0.0240  0.0167  -0.0305 269 VAL A O     
2114 C  CB    . VAL A 293 ? 0.2926 0.3543 0.3424 0.0568  0.0618  -0.0029 269 VAL A CB    
2115 C  CG1   . VAL A 293 ? 0.2291 0.4096 0.3363 0.0748  0.0416  0.0189  269 VAL A CG1   
2116 C  CG2   . VAL A 293 ? 0.2812 0.3818 0.3752 0.0446  0.0990  0.0627  269 VAL A CG2   
2117 N  N     . ASP A 294 ? 0.2228 0.3655 0.2727 0.0180  0.0395  0.0005  270 ASP A N     
2118 C  CA    . ASP A 294 ? 0.2238 0.3650 0.2935 0.0179  0.0256  0.0065  270 ASP A CA    
2119 C  C     . ASP A 294 ? 0.1988 0.2824 0.2828 0.0104  0.0407  0.0138  270 ASP A C     
2120 O  O     . ASP A 294 ? 0.2226 0.2904 0.2974 0.0490  0.0639  -0.0256 270 ASP A O     
2121 C  CB    . ASP A 294 ? 0.2523 0.3252 0.2543 0.0255  0.0099  -0.0041 270 ASP A CB    
2122 C  CG    . ASP A 294 ? 0.2620 0.2972 0.2854 -0.0057 0.0476  0.0266  270 ASP A CG    
2123 O  OD1   . ASP A 294 ? 0.2617 0.3235 0.2628 0.0238  0.0362  0.0064  270 ASP A OD1   
2124 O  OD2   . ASP A 294 ? 0.3096 0.4060 0.2952 -0.0488 0.1081  0.0671  270 ASP A OD2   
2125 N  N     . THR A 295 ? 0.2000 0.2715 0.2438 -0.0253 0.0508  0.0254  271 THR A N     
2126 C  CA    . THR A 295 ? 0.1844 0.2640 0.2581 -0.0148 0.0377  0.0263  271 THR A CA    
2127 C  C     . THR A 295 ? 0.1811 0.2713 0.2387 -0.0077 0.0583  0.0192  271 THR A C     
2128 O  O     . THR A 295 ? 0.2172 0.3018 0.2339 -0.0022 0.0587  0.0095  271 THR A O     
2129 C  CB    . THR A 295 ? 0.2647 0.2514 0.2682 -0.0045 0.0416  0.0116  271 THR A CB    
2130 O  OG1   . THR A 295 ? 0.2982 0.2784 0.2726 0.0299  0.0295  0.0006  271 THR A OG1   
2131 C  CG2   . THR A 295 ? 0.2754 0.3660 0.2734 -0.0253 0.0588  0.0066  271 THR A CG2   
2132 N  N     . THR A 296 ? 0.2104 0.2824 0.2230 0.0141  0.0511  0.0262  272 THR A N     
2133 C  CA    . THR A 296 ? 0.2135 0.2466 0.1919 0.0101  0.0550  0.0029  272 THR A CA    
2134 C  C     . THR A 296 ? 0.2312 0.2621 0.2191 -0.0032 0.0298  0.0016  272 THR A C     
2135 O  O     . THR A 296 ? 0.2434 0.2906 0.2497 0.0173  -0.0038 0.0041  272 THR A O     
2136 C  CB    . THR A 296 ? 0.2185 0.2465 0.1920 0.0071  0.0426  0.0153  272 THR A CB    
2137 O  OG1   . THR A 296 ? 0.2905 0.2616 0.2480 -0.0162 0.0585  -0.0091 272 THR A OG1   
2138 C  CG2   . THR A 296 ? 0.2110 0.2945 0.2218 0.0005  0.0226  -0.0369 272 THR A CG2   
2139 N  N     . GLY A 297 ? 0.2147 0.2598 0.2002 -0.0009 0.0442  0.0116  273 GLY A N     
2140 C  CA    . GLY A 297 ? 0.1920 0.2528 0.2426 0.0218  0.0403  -0.0022 273 GLY A CA    
2141 C  C     . GLY A 297 ? 0.2394 0.2302 0.2316 0.0021  0.0349  0.0000  273 GLY A C     
2142 O  O     . GLY A 297 ? 0.2307 0.2348 0.1961 0.0215  0.0506  0.0000  273 GLY A O     
2143 N  N     . ALA A 298 ? 0.2412 0.2499 0.2177 0.0117  0.0569  0.0207  274 ALA A N     
2144 C  CA    . ALA A 298 ? 0.2696 0.2737 0.2035 0.0043  0.0509  0.0098  274 ALA A CA    
2145 C  C     . ALA A 298 ? 0.2383 0.2309 0.2190 0.0030  0.0453  0.0216  274 ALA A C     
2146 O  O     . ALA A 298 ? 0.2547 0.2394 0.2122 0.0101  0.0582  0.0146  274 ALA A O     
2147 C  CB    . ALA A 298 ? 0.2316 0.3286 0.2430 -0.0185 0.0756  0.0025  274 ALA A CB    
2148 N  N     . GLY A 299 ? 0.2253 0.2427 0.1949 0.0041  0.0383  -0.0033 275 GLY A N     
2149 C  CA    . GLY A 299 ? 0.2590 0.2386 0.2158 -0.0003 0.0104  -0.0026 275 GLY A CA    
2150 C  C     . GLY A 299 ? 0.2340 0.2177 0.2109 0.0156  0.0394  -0.0006 275 GLY A C     
2151 O  O     . GLY A 299 ? 0.2706 0.2680 0.1837 0.0200  0.0396  0.0248  275 GLY A O     
2152 N  N     . ASP A 300 ? 0.2436 0.1944 0.2218 0.0207  0.0481  0.0129  276 ASP A N     
2153 C  CA    . ASP A 300 ? 0.2791 0.2070 0.1881 -0.0009 0.0432  0.0025  276 ASP A CA    
2154 C  C     . ASP A 300 ? 0.2369 0.2202 0.1955 0.0123  0.0261  0.0101  276 ASP A C     
2155 O  O     . ASP A 300 ? 0.2395 0.2358 0.1844 0.0002  0.0535  -0.0006 276 ASP A O     
2156 C  CB    . ASP A 300 ? 0.2615 0.2185 0.1791 0.0023  0.0536  -0.0171 276 ASP A CB    
2157 C  CG    . ASP A 300 ? 0.2333 0.2188 0.2259 0.0166  0.0173  -0.0327 276 ASP A CG    
2158 O  OD1   . ASP A 300 ? 0.2811 0.2548 0.1858 0.0217  0.0345  0.0033  276 ASP A OD1   
2159 O  OD2   . ASP A 300 ? 0.2031 0.2683 0.2206 0.0171  0.0603  0.0029  276 ASP A OD2   
2160 N  N     . LEU A 301 ? 0.2197 0.2172 0.2014 0.0155  0.0595  0.0100  277 LEU A N     
2161 C  CA    . LEU A 301 ? 0.2463 0.2413 0.1862 0.0393  0.0664  0.0092  277 LEU A CA    
2162 C  C     . LEU A 301 ? 0.2754 0.2303 0.1683 0.0285  0.0373  -0.0030 277 LEU A C     
2163 O  O     . LEU A 301 ? 0.2506 0.2312 0.2002 0.0414  0.0568  -0.0138 277 LEU A O     
2164 C  CB    . LEU A 301 ? 0.2393 0.2523 0.1861 0.0701  0.0882  0.0084  277 LEU A CB    
2165 C  CG    . LEU A 301 ? 0.2300 0.1975 0.2253 0.0596  0.0828  0.0069  277 LEU A CG    
2166 C  CD1   . LEU A 301 ? 0.2376 0.2213 0.2417 0.0386  0.0820  -0.0170 277 LEU A CD1   
2167 C  CD2   . LEU A 301 ? 0.2138 0.2855 0.2428 0.0559  0.0796  -0.0262 277 LEU A CD2   
2168 N  N     . PHE A 302 ? 0.2405 0.2398 0.1606 0.0362  0.0438  -0.0028 278 PHE A N     
2169 C  CA    . PHE A 302 ? 0.2460 0.2179 0.1686 0.0487  0.0469  0.0089  278 PHE A CA    
2170 C  C     . PHE A 302 ? 0.2476 0.2528 0.2266 0.0314  0.0455  -0.0045 278 PHE A C     
2171 O  O     . PHE A 302 ? 0.2775 0.2636 0.2306 0.0199  0.0567  -0.0154 278 PHE A O     
2172 C  CB    . PHE A 302 ? 0.2516 0.2246 0.1947 0.0293  0.0476  0.0142  278 PHE A CB    
2173 C  CG    . PHE A 302 ? 0.2678 0.2572 0.1993 0.0124  0.0571  0.0200  278 PHE A CG    
2174 C  CD1   . PHE A 302 ? 0.2460 0.3042 0.2325 0.0196  0.0457  0.0181  278 PHE A CD1   
2175 C  CD2   . PHE A 302 ? 0.3129 0.2632 0.1973 0.0146  0.0331  0.0167  278 PHE A CD2   
2176 C  CE1   . PHE A 302 ? 0.2946 0.3320 0.2190 0.0246  0.0464  -0.0213 278 PHE A CE1   
2177 C  CE2   . PHE A 302 ? 0.3201 0.3069 0.2084 0.0057  0.0544  0.0329  278 PHE A CE2   
2178 C  CZ    . PHE A 302 ? 0.3063 0.3426 0.2157 0.0100  0.0395  -0.0070 278 PHE A CZ    
2179 N  N     . ALA A 303 ? 0.2354 0.2564 0.2172 0.0380  0.0436  0.0196  279 ALA A N     
2180 C  CA    . ALA A 303 ? 0.2705 0.2267 0.2001 0.0214  0.0459  -0.0229 279 ALA A CA    
2181 C  C     . ALA A 303 ? 0.2747 0.2267 0.2047 0.0226  0.0229  0.0157  279 ALA A C     
2182 O  O     . ALA A 303 ? 0.3667 0.2553 0.1841 0.0289  0.0328  -0.0203 279 ALA A O     
2183 C  CB    . ALA A 303 ? 0.2632 0.2911 0.1969 0.0446  0.0452  -0.0102 279 ALA A CB    
2184 N  N     . SER A 304 ? 0.2583 0.2276 0.1801 0.0255  0.0608  0.0199  280 SER A N     
2185 C  CA    . SER A 304 ? 0.2884 0.2269 0.2201 0.0345  0.0652  0.0259  280 SER A CA    
2186 C  C     . SER A 304 ? 0.2669 0.2552 0.2061 0.0128  0.0397  -0.0026 280 SER A C     
2187 O  O     . SER A 304 ? 0.3060 0.2421 0.2022 0.0338  0.0555  -0.0247 280 SER A O     
2188 C  CB    . SER A 304 ? 0.2325 0.2550 0.2229 0.0472  0.0568  0.0016  280 SER A CB    
2189 O  OG    . SER A 304 ? 0.3064 0.2173 0.2046 0.0338  0.0769  -0.0111 280 SER A OG    
2190 N  N     . GLY A 305 ? 0.2603 0.2679 0.1969 0.0319  0.0629  0.0022  281 GLY A N     
2191 C  CA    . GLY A 305 ? 0.2903 0.3163 0.2299 0.0706  0.0794  -0.0085 281 GLY A CA    
2192 C  C     . GLY A 305 ? 0.3257 0.2609 0.2595 0.0319  0.0283  -0.0272 281 GLY A C     
2193 O  O     . GLY A 305 ? 0.3267 0.2851 0.2176 0.0656  0.0710  -0.0349 281 GLY A O     
2194 N  N     . PHE A 306 ? 0.3302 0.2494 0.2020 0.0109  0.0092  0.0039  282 PHE A N     
2195 C  CA    . PHE A 306 ? 0.3221 0.2399 0.2000 0.0407  0.0238  0.0138  282 PHE A CA    
2196 C  C     . PHE A 306 ? 0.3005 0.2895 0.2095 0.0306  0.0422  -0.0015 282 PHE A C     
2197 O  O     . PHE A 306 ? 0.3826 0.2961 0.2062 0.0341  0.0703  -0.0101 282 PHE A O     
2198 C  CB    . PHE A 306 ? 0.2890 0.2237 0.2130 0.0133  0.0542  0.0361  282 PHE A CB    
2199 C  CG    . PHE A 306 ? 0.3114 0.2633 0.2177 0.0494  0.0257  0.0104  282 PHE A CG    
2200 C  CD1   . PHE A 306 ? 0.3167 0.2774 0.2414 0.0889  -0.0033 0.0029  282 PHE A CD1   
2201 C  CD2   . PHE A 306 ? 0.3278 0.2559 0.2723 0.0580  0.0434  0.0144  282 PHE A CD2   
2202 C  CE1   . PHE A 306 ? 0.3436 0.3482 0.2246 0.0674  0.0036  -0.0086 282 PHE A CE1   
2203 C  CE2   . PHE A 306 ? 0.3527 0.3082 0.2744 0.1132  0.0423  0.0028  282 PHE A CE2   
2204 C  CZ    . PHE A 306 ? 0.3913 0.3365 0.2440 0.0676  0.0459  -0.0190 282 PHE A CZ    
2205 N  N     . LEU A 307 ? 0.3105 0.2797 0.2308 0.0186  0.0620  -0.0144 283 LEU A N     
2206 C  CA    . LEU A 307 ? 0.3156 0.2608 0.2048 0.0227  0.0497  -0.0174 283 LEU A CA    
2207 C  C     . LEU A 307 ? 0.3248 0.2611 0.2316 0.0251  0.0362  -0.0002 283 LEU A C     
2208 O  O     . LEU A 307 ? 0.3321 0.2826 0.2432 0.0032  0.0410  0.0025  283 LEU A O     
2209 C  CB    . LEU A 307 ? 0.2797 0.2255 0.2546 0.0500  0.0400  -0.0302 283 LEU A CB    
2210 C  CG    . LEU A 307 ? 0.3297 0.2238 0.2580 0.0534  0.0140  -0.0136 283 LEU A CG    
2211 C  CD1   . LEU A 307 ? 0.3815 0.2554 0.3432 0.0437  0.0975  -0.0002 283 LEU A CD1   
2212 C  CD2   . LEU A 307 ? 0.3553 0.3208 0.3386 0.0718  -0.0469 0.0249  283 LEU A CD2   
2213 N  N     . TYR A 308 ? 0.3259 0.2515 0.2405 0.0428  0.0515  0.0135  284 TYR A N     
2214 C  CA    . TYR A 308 ? 0.3694 0.2691 0.2461 0.0673  0.0321  -0.0071 284 TYR A CA    
2215 C  C     . TYR A 308 ? 0.3870 0.3078 0.2509 0.0108  0.0493  -0.0219 284 TYR A C     
2216 O  O     . TYR A 308 ? 0.4330 0.3179 0.2247 0.0362  0.0440  -0.0462 284 TYR A O     
2217 C  CB    . TYR A 308 ? 0.3327 0.2545 0.2568 0.0680  0.0362  -0.0220 284 TYR A CB    
2218 C  CG    . TYR A 308 ? 0.3719 0.2794 0.2450 0.0829  0.0600  -0.0466 284 TYR A CG    
2219 C  CD1   . TYR A 308 ? 0.3900 0.2880 0.2131 0.0647  0.0379  -0.0545 284 TYR A CD1   
2220 C  CD2   . TYR A 308 ? 0.3866 0.3459 0.2795 0.0826  0.0797  -0.0204 284 TYR A CD2   
2221 C  CE1   . TYR A 308 ? 0.4291 0.3099 0.2793 0.0977  0.0768  -0.0353 284 TYR A CE1   
2222 C  CE2   . TYR A 308 ? 0.4146 0.3550 0.3823 0.0938  0.0895  -0.0344 284 TYR A CE2   
2223 C  CZ    . TYR A 308 ? 0.3930 0.3312 0.3844 0.0672  0.0681  -0.1062 284 TYR A CZ    
2224 O  OH    . TYR A 308 ? 0.4909 0.3425 0.4899 0.0981  0.0806  -0.1310 284 TYR A OH    
2225 N  N     . GLY A 309 ? 0.3549 0.2738 0.2993 0.0415  0.0570  -0.0383 285 GLY A N     
2226 C  CA    . GLY A 309 ? 0.3736 0.3170 0.2651 0.0242  0.0353  0.0050  285 GLY A CA    
2227 C  C     . GLY A 309 ? 0.3863 0.2985 0.3063 0.0385  0.0100  -0.0306 285 GLY A C     
2228 O  O     . GLY A 309 ? 0.4925 0.3414 0.2614 0.0106  0.0473  -0.0351 285 GLY A O     
2229 N  N     . TYR A 310 ? 0.3797 0.2653 0.2138 0.0157  0.0267  -0.0502 286 TYR A N     
2230 C  CA    . TYR A 310 ? 0.3677 0.2993 0.3080 0.0322  0.0082  -0.0328 286 TYR A CA    
2231 C  C     . TYR A 310 ? 0.3953 0.2982 0.2580 0.0232  -0.0012 -0.0408 286 TYR A C     
2232 O  O     . TYR A 310 ? 0.4773 0.3025 0.2350 0.0761  0.0021  -0.0373 286 TYR A O     
2233 C  CB    . TYR A 310 ? 0.4125 0.3072 0.2506 0.0512  0.0262  -0.0273 286 TYR A CB    
2234 C  CG    . TYR A 310 ? 0.3436 0.2919 0.2372 0.0331  0.0486  -0.0404 286 TYR A CG    
2235 C  CD1   . TYR A 310 ? 0.3858 0.3080 0.2469 0.0273  0.0411  -0.0206 286 TYR A CD1   
2236 C  CD2   . TYR A 310 ? 0.3341 0.2942 0.1883 0.0466  0.0491  -0.0013 286 TYR A CD2   
2237 C  CE1   . TYR A 310 ? 0.4250 0.3585 0.2682 0.0212  0.0015  -0.0206 286 TYR A CE1   
2238 C  CE2   . TYR A 310 ? 0.3465 0.3791 0.2670 0.0560  0.0014  -0.0002 286 TYR A CE2   
2239 C  CZ    . TYR A 310 ? 0.4128 0.3537 0.2768 0.0532  0.0163  -0.0035 286 TYR A CZ    
2240 O  OH    . TYR A 310 ? 0.4582 0.5049 0.2508 0.0611  -0.0104 -0.0250 286 TYR A OH    
2241 N  N     . THR A 311 ? 0.4061 0.3043 0.2773 0.0122  0.0468  -0.0612 287 THR A N     
2242 C  CA    . THR A 311 ? 0.3833 0.3152 0.3146 0.0089  0.0615  -0.0327 287 THR A CA    
2243 C  C     . THR A 311 ? 0.4182 0.3243 0.2896 0.0280  0.0288  -0.0322 287 THR A C     
2244 O  O     . THR A 311 ? 0.5222 0.3335 0.3392 -0.0045 0.0673  -0.0758 287 THR A O     
2245 C  CB    . THR A 311 ? 0.3949 0.2936 0.3005 0.0480  0.0461  -0.0277 287 THR A CB    
2246 O  OG1   . THR A 311 ? 0.4649 0.2702 0.2825 0.0085  0.0195  -0.0266 287 THR A OG1   
2247 C  CG2   . THR A 311 ? 0.3856 0.2634 0.2304 0.0182  0.0122  -0.1082 287 THR A CG2   
2248 N  N     . GLN A 312 ? 0.4275 0.2912 0.2742 0.0539  0.0466  -0.0536 288 GLN A N     
2249 C  CA    . GLN A 312 ? 0.4820 0.3555 0.3169 0.0955  0.0743  -0.0692 288 GLN A CA    
2250 C  C     . GLN A 312 ? 0.5665 0.4202 0.3158 0.0640  0.0656  -0.0558 288 GLN A C     
2251 O  O     . GLN A 312 ? 0.6306 0.4681 0.3492 0.1071  0.0994  -0.0552 288 GLN A O     
2252 C  CB    . GLN A 312 ? 0.4650 0.3246 0.3653 0.1013  0.0737  -0.1204 288 GLN A CB    
2253 C  CG    . GLN A 312 ? 0.5481 0.3376 0.4007 0.0328  0.0566  -0.0610 288 GLN A CG    
2254 C  CD    . GLN A 312 ? 0.5921 0.3240 0.4113 0.0240  0.0422  -0.0839 288 GLN A CD    
2255 O  OE1   . GLN A 312 ? 0.5665 0.4893 0.5661 -0.0017 0.0726  -0.0549 288 GLN A OE1   
2256 N  NE2   . GLN A 312 ? 0.7085 0.3704 0.3619 0.0255  0.0787  -0.1114 288 GLN A NE2   
2257 N  N     . GLY A 313 ? 0.5031 0.3957 0.2909 0.0191  0.0610  -0.0603 289 GLY A N     
2258 C  CA    . GLY A 313 ? 0.4551 0.4228 0.3009 0.0236  0.0623  -0.0251 289 GLY A CA    
2259 C  C     . GLY A 313 ? 0.4540 0.4138 0.2504 0.0209  0.0631  -0.0509 289 GLY A C     
2260 O  O     . GLY A 313 ? 0.5078 0.4727 0.2305 0.0268  0.0531  -0.0803 289 GLY A O     
2261 N  N     . ARG A 314 ? 0.4365 0.4041 0.2746 -0.0020 0.0764  -0.0590 290 ARG A N     
2262 C  CA    . ARG A 314 ? 0.4110 0.3778 0.2553 0.0282  0.0798  -0.0888 290 ARG A CA    
2263 C  C     . ARG A 314 ? 0.3988 0.4254 0.2725 0.0226  0.0635  -0.0384 290 ARG A C     
2264 O  O     . ARG A 314 ? 0.4061 0.4031 0.2184 0.0209  0.0652  -0.0234 290 ARG A O     
2265 C  CB    . ARG A 314 ? 0.4332 0.3596 0.2550 0.0245  0.0586  0.0244  290 ARG A CB    
2266 C  CG    . ARG A 314 ? 0.4441 0.3226 0.2498 0.0390  0.1136  0.0047  290 ARG A CG    
2267 C  CD    . ARG A 314 ? 0.4266 0.3253 0.3329 0.0617  0.0671  -0.0360 290 ARG A CD    
2268 N  NE    . ARG A 314 ? 0.4300 0.3268 0.3306 0.0609  0.1037  -0.0574 290 ARG A NE    
2269 C  CZ    . ARG A 314 ? 0.4509 0.3884 0.3728 0.0488  0.0733  -0.0277 290 ARG A CZ    
2270 N  NH1   . ARG A 314 ? 0.4319 0.3838 0.4598 0.0697  0.0702  0.0280  290 ARG A NH1   
2271 N  NH2   . ARG A 314 ? 0.5518 0.4337 0.4108 0.0466  0.0851  0.0203  290 ARG A NH2   
2272 N  N     . SER A 315 ? 0.4029 0.3897 0.3135 0.0109  0.0493  0.0062  291 SER A N     
2273 C  CA    . SER A 315 ? 0.4214 0.3601 0.2839 0.0286  0.0476  -0.0287 291 SER A CA    
2274 C  C     . SER A 315 ? 0.4679 0.3567 0.2754 0.0297  0.0321  -0.0259 291 SER A C     
2275 O  O     . SER A 315 ? 0.4281 0.3742 0.2548 0.0109  0.0591  -0.0388 291 SER A O     
2276 C  CB    . SER A 315 ? 0.3956 0.3678 0.3586 0.0154  0.0445  -0.0128 291 SER A CB    
2277 O  OG    . SER A 315 ? 0.4287 0.4128 0.2678 -0.0328 0.0818  -0.0229 291 SER A OG    
2278 N  N     . LEU A 316 ? 0.4985 0.3531 0.2926 0.0430  0.0316  -0.0416 292 LEU A N     
2279 C  CA    . LEU A 316 ? 0.4523 0.3575 0.2845 0.0300  0.0199  -0.0449 292 LEU A CA    
2280 C  C     . LEU A 316 ? 0.3977 0.3986 0.2601 0.0388  0.0688  -0.0431 292 LEU A C     
2281 O  O     . LEU A 316 ? 0.4169 0.3680 0.2273 0.0443  0.1439  -0.0243 292 LEU A O     
2282 C  CB    . LEU A 316 ? 0.4403 0.3657 0.2655 0.0760  0.0512  -0.0630 292 LEU A CB    
2283 C  CG    . LEU A 316 ? 0.4519 0.4113 0.2519 0.0756  0.0380  -0.0661 292 LEU A CG    
2284 C  CD1   . LEU A 316 ? 0.5393 0.4194 0.2866 0.1245  0.0111  -0.0779 292 LEU A CD1   
2285 C  CD2   . LEU A 316 ? 0.4122 0.5141 0.2790 0.0845  0.0585  -0.0794 292 LEU A CD2   
2286 N  N     . GLU A 317 ? 0.3946 0.3590 0.2394 0.0331  0.0673  0.0081  293 GLU A N     
2287 C  CA    . GLU A 317 ? 0.3585 0.3651 0.2520 0.0357  0.1040  -0.0283 293 GLU A CA    
2288 C  C     . GLU A 317 ? 0.3715 0.3420 0.2851 0.0262  0.0610  -0.0393 293 GLU A C     
2289 O  O     . GLU A 317 ? 0.3916 0.3871 0.2989 0.0270  0.0514  -0.0500 293 GLU A O     
2290 C  CB    . GLU A 317 ? 0.4167 0.4407 0.2065 0.0449  0.1074  -0.0399 293 GLU A CB    
2291 C  CG    . GLU A 317 ? 0.4462 0.4692 0.2647 0.0028  0.0956  -0.0344 293 GLU A CG    
2292 C  CD    . GLU A 317 ? 0.4755 0.6348 0.3963 0.0115  0.1466  -0.1149 293 GLU A CD    
2293 O  OE1   . GLU A 317 ? 0.4929 0.7098 0.4094 -0.0449 0.2815  -0.1466 293 GLU A OE1   
2294 O  OE2   . GLU A 317 ? 0.5780 0.7728 0.4420 -0.0270 0.0931  -0.1782 293 GLU A OE2   
2295 N  N     . ASP A 318 ? 0.3936 0.3397 0.2228 0.0595  0.0562  -0.0871 294 ASP A N     
2296 C  CA    . ASP A 318 ? 0.3689 0.3741 0.2614 0.0392  0.0969  -0.0356 294 ASP A CA    
2297 C  C     . ASP A 318 ? 0.3671 0.3619 0.2527 0.0678  0.0867  -0.0308 294 ASP A C     
2298 O  O     . ASP A 318 ? 0.3445 0.4262 0.2393 0.0912  0.0932  -0.0364 294 ASP A O     
2299 C  CB    . ASP A 318 ? 0.3618 0.3535 0.2787 0.0779  0.1082  -0.0164 294 ASP A CB    
2300 C  CG    . ASP A 318 ? 0.3827 0.4066 0.3125 0.0611  0.1310  -0.0802 294 ASP A CG    
2301 O  OD1   . ASP A 318 ? 0.4044 0.4638 0.3352 0.0338  0.1742  -0.0907 294 ASP A OD1   
2302 O  OD2   . ASP A 318 ? 0.4526 0.4434 0.2446 0.0715  0.2224  -0.0854 294 ASP A OD2   
2303 N  N     . CYS A 319 ? 0.3606 0.3182 0.2491 0.0491  0.0919  -0.0512 295 CYS A N     
2304 C  CA    . CYS A 319 ? 0.3308 0.3560 0.2550 0.0470  0.0890  -0.0382 295 CYS A CA    
2305 C  C     . CYS A 319 ? 0.3483 0.3521 0.2334 0.0244  0.0761  -0.0097 295 CYS A C     
2306 O  O     . CYS A 319 ? 0.3494 0.3615 0.2205 0.0229  0.0700  -0.0416 295 CYS A O     
2307 C  CB    . CYS A 319 ? 0.3517 0.3743 0.2935 0.0338  0.0537  -0.0151 295 CYS A CB    
2308 S  SG    . CYS A 319 ? 0.3974 0.3595 0.2319 0.0294  0.0676  -0.0157 295 CYS A SG    
2309 N  N     . GLY A 320 ? 0.3643 0.3177 0.2681 0.0279  0.0934  -0.0263 296 GLY A N     
2310 C  CA    . GLY A 320 ? 0.3477 0.3322 0.2566 0.0187  0.0573  0.0064  296 GLY A CA    
2311 C  C     . GLY A 320 ? 0.3403 0.3029 0.2991 0.0524  0.0744  -0.0208 296 GLY A C     
2312 O  O     . GLY A 320 ? 0.3225 0.3441 0.3026 0.0497  0.0411  -0.0127 296 GLY A O     
2313 N  N     . LYS A 321 ? 0.3076 0.3710 0.2066 0.0629  0.1242  0.0055  297 LYS A N     
2314 C  CA    . LYS A 321 ? 0.3565 0.3531 0.2795 0.0704  0.0624  -0.0183 297 LYS A CA    
2315 C  C     . LYS A 321 ? 0.3127 0.3243 0.3121 0.0378  0.0829  -0.0256 297 LYS A C     
2316 O  O     . LYS A 321 ? 0.2993 0.3026 0.2829 0.0520  0.1271  -0.0393 297 LYS A O     
2317 C  CB    . LYS A 321 ? 0.4206 0.2822 0.3034 0.0550  0.0701  -0.0246 297 LYS A CB    
2318 C  CG    . LYS A 321 ? 0.4051 0.3143 0.3078 0.0405  0.0667  -0.0308 297 LYS A CG    
2319 C  CD    . LYS A 321 ? 0.3797 0.3412 0.2924 0.0251  0.1281  0.0129  297 LYS A CD    
2320 C  CE    . LYS A 321 ? 0.2508 0.2807 0.1973 0.1083  0.1143  -0.0378 297 LYS A CE    
2321 N  NZ    . LYS A 321 ? 0.3066 0.3413 0.2147 0.1325  0.1448  -0.0482 297 LYS A NZ    
2322 N  N     . LEU A 322 ? 0.3145 0.3286 0.2817 0.0338  0.0909  -0.0308 298 LEU A N     
2323 C  CA    . LEU A 322 ? 0.3391 0.3184 0.2741 0.0412  0.0875  -0.0351 298 LEU A CA    
2324 C  C     . LEU A 322 ? 0.3492 0.2756 0.2412 0.0671  0.0415  -0.0106 298 LEU A C     
2325 O  O     . LEU A 322 ? 0.3091 0.3239 0.2036 0.0542  0.0901  -0.0241 298 LEU A O     
2326 C  CB    . LEU A 322 ? 0.3698 0.2500 0.2437 0.0663  0.0560  -0.0548 298 LEU A CB    
2327 C  CG    . LEU A 322 ? 0.3384 0.2656 0.2767 0.0946  0.0621  -0.0555 298 LEU A CG    
2328 C  CD1   . LEU A 322 ? 0.3821 0.3075 0.3360 0.0834  0.0269  -0.0775 298 LEU A CD1   
2329 C  CD2   . LEU A 322 ? 0.3427 0.2826 0.3098 0.0595  0.0884  0.0096  298 LEU A CD2   
2330 N  N     . GLY A 323 ? 0.2852 0.2565 0.2545 0.0513  0.0650  -0.0350 299 GLY A N     
2331 C  CA    . GLY A 323 ? 0.3247 0.2825 0.2230 0.0637  0.0510  -0.0407 299 GLY A CA    
2332 C  C     . GLY A 323 ? 0.2972 0.3188 0.2194 0.0474  0.0748  -0.0314 299 GLY A C     
2333 O  O     . GLY A 323 ? 0.2762 0.2970 0.2145 0.0784  0.0653  -0.0239 299 GLY A O     
2334 N  N     . CYS A 324 ? 0.2742 0.3095 0.2683 0.0744  0.0693  0.0172  300 CYS A N     
2335 C  CA    . CYS A 324 ? 0.2986 0.3012 0.2869 0.0356  0.0812  0.0019  300 CYS A CA    
2336 C  C     . CYS A 324 ? 0.2626 0.3095 0.2658 0.0215  0.0705  -0.0110 300 CYS A C     
2337 O  O     . CYS A 324 ? 0.2431 0.3605 0.2691 0.0504  0.0785  -0.0183 300 CYS A O     
2338 C  CB    . CYS A 324 ? 0.3149 0.3869 0.2930 0.0484  0.1017  0.0123  300 CYS A CB    
2339 S  SG    . CYS A 324 ? 0.4006 0.4070 0.2903 0.0332  0.0786  0.0555  300 CYS A SG    
2340 N  N     . LEU A 325 ? 0.2613 0.3054 0.2370 0.0473  0.0959  -0.0059 301 LEU A N     
2341 C  CA    . LEU A 325 ? 0.3132 0.2911 0.2735 0.0556  0.0823  -0.0012 301 LEU A CA    
2342 C  C     . LEU A 325 ? 0.2745 0.3339 0.2710 0.0205  0.0601  -0.0039 301 LEU A C     
2343 O  O     . LEU A 325 ? 0.2906 0.3168 0.2415 0.0531  0.0831  -0.0333 301 LEU A O     
2344 C  CB    . LEU A 325 ? 0.3249 0.3116 0.2594 0.0752  0.0928  -0.0145 301 LEU A CB    
2345 C  CG    . LEU A 325 ? 0.3261 0.3091 0.3061 0.0757  0.0678  -0.0093 301 LEU A CG    
2346 C  CD1   . LEU A 325 ? 0.3104 0.4067 0.3353 0.0951  0.0729  0.0072  301 LEU A CD1   
2347 C  CD2   . LEU A 325 ? 0.4311 0.3438 0.3286 0.0502  0.0871  -0.0407 301 LEU A CD2   
2348 N  N     . ALA A 326 ? 0.2568 0.3014 0.2385 0.0615  0.1038  -0.0017 302 ALA A N     
2349 C  CA    . ALA A 326 ? 0.2748 0.3093 0.2083 0.0247  0.0805  -0.0243 302 ALA A CA    
2350 C  C     . ALA A 326 ? 0.2614 0.2784 0.2306 0.0308  0.0442  -0.0116 302 ALA A C     
2351 O  O     . ALA A 326 ? 0.2636 0.2930 0.2086 0.0225  0.0891  0.0006  302 ALA A O     
2352 C  CB    . ALA A 326 ? 0.2622 0.2587 0.2374 0.0252  0.0875  -0.0318 302 ALA A CB    
2353 N  N     . ALA A 327 ? 0.2202 0.2636 0.2689 0.0129  0.0638  -0.0096 303 ALA A N     
2354 C  CA    . ALA A 327 ? 0.2575 0.2502 0.2993 0.0291  0.0522  -0.0102 303 ALA A CA    
2355 C  C     . ALA A 327 ? 0.2681 0.2831 0.2789 0.0188  0.0465  -0.0105 303 ALA A C     
2356 O  O     . ALA A 327 ? 0.2666 0.3253 0.2487 0.0099  0.1052  0.0013  303 ALA A O     
2357 C  CB    . ALA A 327 ? 0.2738 0.2843 0.2978 0.0536  0.0408  0.0019  303 ALA A CB    
2358 N  N     . GLY A 328 ? 0.2514 0.2739 0.2990 0.0147  0.0561  0.0112  304 GLY A N     
2359 C  CA    . GLY A 328 ? 0.2957 0.3430 0.2809 0.0037  0.0072  0.0435  304 GLY A CA    
2360 C  C     . GLY A 328 ? 0.2505 0.2910 0.2651 0.0190  0.0459  0.0177  304 GLY A C     
2361 O  O     . GLY A 328 ? 0.2509 0.3194 0.2414 0.0320  0.0852  -0.0345 304 GLY A O     
2362 N  N     . ILE A 329 ? 0.2219 0.2671 0.2665 0.0503  0.0519  -0.0182 305 ILE A N     
2363 C  CA    . ILE A 329 ? 0.2437 0.2687 0.2997 0.0875  0.0616  -0.0040 305 ILE A CA    
2364 C  C     . ILE A 329 ? 0.2403 0.2990 0.2703 0.0521  0.0347  -0.0251 305 ILE A C     
2365 O  O     . ILE A 329 ? 0.2569 0.3163 0.2819 0.0453  0.0359  -0.0344 305 ILE A O     
2366 C  CB    . ILE A 329 ? 0.2981 0.3003 0.2975 0.0436  0.0625  0.0029  305 ILE A CB    
2367 C  CG1   . ILE A 329 ? 0.3134 0.3193 0.2784 0.0358  0.0554  -0.0210 305 ILE A CG1   
2368 C  CG2   . ILE A 329 ? 0.3676 0.3071 0.3073 0.0157  0.0607  0.0122  305 ILE A CG2   
2369 C  CD1   . ILE A 329 ? 0.4002 0.3054 0.2718 0.0454  0.0670  -0.0457 305 ILE A CD1   
2370 N  N     . VAL A 330 ? 0.2397 0.3152 0.2204 0.0576  0.0450  -0.0333 306 VAL A N     
2371 C  CA    . VAL A 330 ? 0.2354 0.2912 0.2183 0.0531  0.0536  -0.0149 306 VAL A CA    
2372 C  C     . VAL A 330 ? 0.2565 0.2835 0.2418 0.0313  0.0451  0.0042  306 VAL A C     
2373 O  O     . VAL A 330 ? 0.2887 0.3014 0.2268 0.0096  0.0373  0.0508  306 VAL A O     
2374 C  CB    . VAL A 330 ? 0.2302 0.2453 0.2025 0.0305  0.0579  0.0074  306 VAL A CB    
2375 C  CG1   . VAL A 330 ? 0.2948 0.2438 0.2003 0.0566  0.0623  -0.0107 306 VAL A CG1   
2376 C  CG2   . VAL A 330 ? 0.2239 0.2926 0.2119 0.0264  0.0609  0.0227  306 VAL A CG2   
2377 N  N     . ILE A 331 ? 0.2628 0.2778 0.2983 0.0324  0.0692  0.0012  307 ILE A N     
2378 C  CA    . ILE A 331 ? 0.2267 0.2947 0.3270 0.0370  0.0346  0.0101  307 ILE A CA    
2379 C  C     . ILE A 331 ? 0.2504 0.2843 0.2886 0.0307  0.0226  0.0055  307 ILE A C     
2380 O  O     . ILE A 331 ? 0.2221 0.3018 0.3253 0.0199  0.0339  -0.0065 307 ILE A O     
2381 C  CB    . ILE A 331 ? 0.2657 0.3314 0.2775 0.0367  0.0647  0.0062  307 ILE A CB    
2382 C  CG1   . ILE A 331 ? 0.2682 0.3196 0.3134 0.0385  0.0937  0.0454  307 ILE A CG1   
2383 C  CG2   . ILE A 331 ? 0.2771 0.3409 0.2940 0.0254  0.0540  0.0338  307 ILE A CG2   
2384 C  CD1   . ILE A 331 ? 0.3414 0.2946 0.3894 0.0107  0.0694  0.0580  307 ILE A CD1   
2385 N  N     . GLN A 332 ? 0.2255 0.2983 0.2792 0.0438  0.0641  -0.0213 308 GLN A N     
2386 C  CA    . GLN A 332 ? 0.2822 0.3109 0.2589 0.0516  0.0471  0.0123  308 GLN A CA    
2387 C  C     . GLN A 332 ? 0.2519 0.3691 0.2681 0.0480  0.0377  0.0399  308 GLN A C     
2388 O  O     . GLN A 332 ? 0.3139 0.4171 0.3132 0.1167  0.0219  0.0220  308 GLN A O     
2389 C  CB    . GLN A 332 ? 0.2961 0.3883 0.3141 0.0873  0.0503  -0.0189 308 GLN A CB    
2390 C  CG    . GLN A 332 ? 0.3262 0.4024 0.3088 0.0240  0.0356  -0.0312 308 GLN A CG    
2391 C  CD    . GLN A 332 ? 0.2617 0.4183 0.3485 0.0572  0.0327  0.0059  308 GLN A CD    
2392 O  OE1   . GLN A 332 ? 0.2790 0.5780 0.4225 0.0585  -0.0114 0.0271  308 GLN A OE1   
2393 N  NE2   . GLN A 332 ? 0.2656 0.4318 0.3328 0.0472  0.0316  0.0318  308 GLN A NE2   
2394 N  N     . GLN A 333 ? 0.2635 0.3196 0.2736 0.0348  0.0605  0.0233  309 GLN A N     
2395 C  CA    . GLN A 333 ? 0.2762 0.3202 0.2380 0.0453  0.0197  0.0201  309 GLN A CA    
2396 C  C     . GLN A 333 ? 0.3125 0.3562 0.2702 0.0574  0.0568  0.0134  309 GLN A C     
2397 O  O     . GLN A 333 ? 0.2892 0.3508 0.2463 0.0356  0.0520  0.0067  309 GLN A O     
2398 C  CB    . GLN A 333 ? 0.2783 0.3057 0.2811 0.0586  0.0443  -0.0172 309 GLN A CB    
2399 C  CG    . GLN A 333 ? 0.3562 0.3184 0.3128 0.0417  -0.0077 0.0395  309 GLN A CG    
2400 C  CD    . GLN A 333 ? 0.2767 0.3485 0.2974 0.0586  0.0186  0.0201  309 GLN A CD    
2401 O  OE1   . GLN A 333 ? 0.2767 0.3515 0.3453 0.0682  0.0391  0.0253  309 GLN A OE1   
2402 N  NE2   . GLN A 333 ? 0.2865 0.3425 0.3193 0.0441  0.0524  -0.0009 309 GLN A NE2   
2403 N  N     . ILE A 334 ? 0.3302 0.4036 0.2739 0.0401  0.0386  0.0418  310 ILE A N     
2404 C  CA    . ILE A 334 ? 0.3174 0.3591 0.2819 0.0534  -0.0082 0.0265  310 ILE A CA    
2405 C  C     . ILE A 334 ? 0.3259 0.3725 0.2719 0.0372  0.0270  -0.0263 310 ILE A C     
2406 O  O     . ILE A 334 ? 0.2881 0.3748 0.3674 0.0046  0.0776  -0.0070 310 ILE A O     
2407 C  CB    . ILE A 334 ? 0.3621 0.4432 0.2868 0.0129  -0.0230 -0.0113 310 ILE A CB    
2408 C  CG1   . ILE A 334 ? 0.3532 0.4795 0.2793 -0.0027 -0.0235 0.0637  310 ILE A CG1   
2409 C  CG2   . ILE A 334 ? 0.3971 0.5230 0.3193 0.0100  0.0334  -0.0237 310 ILE A CG2   
2410 C  CD1   . ILE A 334 ? 0.3983 0.5426 0.2198 -0.0204 0.0156  0.0605  310 ILE A CD1   
2411 N  N     . GLY A 335 ? 0.3355 0.3873 0.2784 0.0398  0.0060  -0.0247 311 GLY A N     
2412 C  CA    . GLY A 335 ? 0.2897 0.4135 0.2543 0.0538  0.0317  -0.0069 311 GLY A CA    
2413 C  C     . GLY A 335 ? 0.2425 0.3940 0.2657 0.0157  0.0242  0.0121  311 GLY A C     
2414 O  O     . GLY A 335 ? 0.2447 0.4261 0.2813 0.0331  0.0356  -0.0017 311 GLY A O     
2415 N  N     . PRO A 336 ? 0.2425 0.3527 0.2360 0.0169  0.0314  0.0085  312 PRO A N     
2416 C  CA    . PRO A 336 ? 0.1866 0.2735 0.2374 0.0232  0.0307  0.0089  312 PRO A CA    
2417 C  C     . PRO A 336 ? 0.1846 0.2446 0.2463 0.0479  0.0535  0.0197  312 PRO A C     
2418 O  O     . PRO A 336 ? 0.2387 0.3158 0.2274 0.0367  0.0800  0.0266  312 PRO A O     
2419 C  CB    . PRO A 336 ? 0.2104 0.2979 0.2864 0.0521  0.0344  -0.0145 312 PRO A CB    
2420 C  CG    . PRO A 336 ? 0.2582 0.3304 0.3078 0.0468  0.0780  -0.0055 312 PRO A CG    
2421 C  CD    . PRO A 336 ? 0.2803 0.3718 0.2872 0.0147  0.0785  0.0357  312 PRO A CD    
2422 N  N     . ARG A 337 ? 0.2168 0.2411 0.2720 0.0092  0.0727  0.0432  313 ARG A N     
2423 C  CA    . ARG A 337 ? 0.2197 0.2675 0.2611 0.0278  0.0422  0.0304  313 ARG A CA    
2424 C  C     . ARG A 337 ? 0.2590 0.3140 0.2511 0.0739  0.0356  0.0191  313 ARG A C     
2425 O  O     . ARG A 337 ? 0.2754 0.3361 0.2775 0.0995  0.0167  0.0538  313 ARG A O     
2426 C  CB    . ARG A 337 ? 0.2496 0.2612 0.2420 0.0226  0.0483  0.0479  313 ARG A CB    
2427 C  CG    . ARG A 337 ? 0.2505 0.2279 0.2304 0.0230  0.0480  0.0073  313 ARG A CG    
2428 C  CD    . ARG A 337 ? 0.2575 0.2265 0.2152 0.0221  0.0545  0.0013  313 ARG A CD    
2429 N  NE    . ARG A 337 ? 0.2187 0.2486 0.1968 -0.0002 0.0273  -0.0473 313 ARG A NE    
2430 C  CZ    . ARG A 337 ? 0.2510 0.2331 0.2176 -0.0095 0.0407  -0.0019 313 ARG A CZ    
2431 N  NH1   . ARG A 337 ? 0.2848 0.2328 0.1927 -0.0193 0.0908  -0.0005 313 ARG A NH1   
2432 N  NH2   . ARG A 337 ? 0.2794 0.2253 0.2222 0.0059  0.0131  0.0131  313 ARG A NH2   
2433 N  N     . PRO A 338 ? 0.2165 0.3130 0.2449 0.0618  0.0307  0.0269  314 PRO A N     
2434 C  CA    . PRO A 338 ? 0.2494 0.2954 0.2216 0.0890  0.0523  0.0066  314 PRO A CA    
2435 C  C     . PRO A 338 ? 0.2987 0.2682 0.2676 0.0651  0.0714  -0.0053 314 PRO A C     
2436 O  O     . PRO A 338 ? 0.3052 0.3102 0.3067 0.0372  0.0674  0.0189  314 PRO A O     
2437 C  CB    . PRO A 338 ? 0.2627 0.3031 0.2217 0.0575  0.0632  0.0021  314 PRO A CB    
2438 C  CG    . PRO A 338 ? 0.2838 0.3014 0.2137 0.0600  0.0668  0.0079  314 PRO A CG    
2439 C  CD    . PRO A 338 ? 0.2310 0.3129 0.2240 0.0568  0.0290  -0.0167 314 PRO A CD    
2440 N  N     . MSE A 339 ? 0.3580 0.3189 0.2829 0.1005  0.0461  0.0182  315 MSE A N     
2441 C  CA    . MSE A 339 ? 0.3670 0.2981 0.3521 0.0851  0.0284  0.0399  315 MSE A CA    
2442 C  C     . MSE A 339 ? 0.4502 0.2916 0.3283 0.0579  0.0630  0.0182  315 MSE A C     
2443 O  O     . MSE A 339 ? 0.5461 0.3713 0.3508 0.1501  0.0870  0.0706  315 MSE A O     
2444 C  CB    . MSE A 339 ? 0.3951 0.3964 0.3669 0.0766  0.0002  0.0755  315 MSE A CB    
2445 C  CG    . MSE A 339 ? 0.5514 0.4526 0.5101 0.1392  0.0512  0.0274  315 MSE A CG    
2446 SE SE    . MSE A 339 ? 0.9577 0.7499 0.6057 0.0538  -0.1152 0.0544  315 MSE A SE    
2447 C  CE    . MSE A 339 ? 0.5817 0.6547 0.4134 0.1590  -0.0527 -0.0100 315 MSE A CE    
2448 N  N     . THR A 340 ? 0.3803 0.3084 0.3065 0.0635  0.0159  0.0210  316 THR A N     
2449 C  CA    . THR A 340 ? 0.3476 0.2996 0.3324 0.0537  0.0008  0.0110  316 THR A CA    
2450 C  C     . THR A 340 ? 0.3823 0.2975 0.3066 0.0667  -0.0003 0.0134  316 THR A C     
2451 O  O     . THR A 340 ? 0.3501 0.3426 0.3177 0.0890  0.0751  0.0238  316 THR A O     
2452 C  CB    . THR A 340 ? 0.3502 0.3433 0.3911 0.0405  0.0131  0.0283  316 THR A CB    
2453 O  OG1   . THR A 340 ? 0.3280 0.3637 0.3020 0.0133  0.0873  0.0434  316 THR A OG1   
2454 C  CG2   . THR A 340 ? 0.3088 0.4303 0.4710 0.0219  -0.0051 -0.0220 316 THR A CG2   
2455 N  N     . SER A 341 ? 0.3106 0.3686 0.3839 0.1005  0.0480  -0.0130 317 SER A N     
2456 C  CA    . SER A 341 ? 0.3180 0.2922 0.3875 0.1220  0.0714  -0.0438 317 SER A CA    
2457 C  C     . SER A 341 ? 0.3062 0.3337 0.3454 0.1045  0.0338  -0.0512 317 SER A C     
2458 O  O     . SER A 341 ? 0.3039 0.3497 0.3543 0.0931  0.0437  -0.0775 317 SER A O     
2459 C  CB    . SER A 341 ? 0.4060 0.2508 0.3813 0.0968  0.0080  -0.0176 317 SER A CB    
2460 O  OG    . SER A 341 ? 0.4944 0.2800 0.3470 0.0721  0.0373  -0.0321 317 SER A OG    
2461 N  N     . LEU A 342 ? 0.2949 0.3439 0.3492 0.1185  0.0884  -0.0033 318 LEU A N     
2462 C  CA    . LEU A 342 ? 0.3339 0.3335 0.3331 0.1085  0.0337  -0.0103 318 LEU A CA    
2463 C  C     . LEU A 342 ? 0.3773 0.2973 0.3897 0.0874  0.0578  -0.0353 318 LEU A C     
2464 O  O     . LEU A 342 ? 0.3888 0.3685 0.3344 0.1393  0.0764  -0.0667 318 LEU A O     
2465 C  CB    . LEU A 342 ? 0.3459 0.2740 0.3446 0.0982  0.0596  0.0005  318 LEU A CB    
2466 C  CG    . LEU A 342 ? 0.2689 0.2764 0.3534 0.0296  0.0397  -0.0239 318 LEU A CG    
2467 C  CD1   . LEU A 342 ? 0.2508 0.2980 0.3593 0.0244  0.0631  0.0254  318 LEU A CD1   
2468 C  CD2   . LEU A 342 ? 0.2592 0.2684 0.3402 0.0279  0.1011  0.0138  318 LEU A CD2   
2469 N  N     . SER A 343 ? 0.4183 0.2865 0.3717 0.0801  0.0434  -0.0537 319 SER A N     
2470 C  CA    . SER A 343 ? 0.4140 0.3399 0.3342 0.0801  0.0469  -0.0562 319 SER A CA    
2471 C  C     . SER A 343 ? 0.4262 0.3639 0.3441 0.1103  0.0404  -0.0181 319 SER A C     
2472 O  O     . SER A 343 ? 0.5045 0.3444 0.3399 0.1721  0.0482  -0.0721 319 SER A O     
2473 C  CB    . SER A 343 ? 0.4318 0.3456 0.4479 0.0719  0.0718  -0.0676 319 SER A CB    
2474 O  OG    . SER A 343 ? 0.5033 0.5012 0.4071 0.0999  0.0859  -0.0741 319 SER A OG    
2475 N  N     . GLU A 344 ? 0.3647 0.3065 0.3366 0.1202  0.0526  -0.0431 320 GLU A N     
2476 C  CA    . GLU A 344 ? 0.3602 0.3604 0.4217 0.1120  0.0202  0.0086  320 GLU A CA    
2477 C  C     . GLU A 344 ? 0.4172 0.3669 0.3939 0.0961  0.0398  -0.0038 320 GLU A C     
2478 O  O     . GLU A 344 ? 0.4454 0.3856 0.4027 0.1071  0.0707  0.0185  320 GLU A O     
2479 C  CB    . GLU A 344 ? 0.4093 0.4341 0.4321 0.1192  0.0242  0.0402  320 GLU A CB    
2480 C  CG    . GLU A 344 ? 0.4048 0.4881 0.6302 0.0419  0.0709  0.0339  320 GLU A CG    
2481 C  CD    . GLU A 344 ? 0.5533 0.5291 0.6963 0.0476  0.0079  -0.0501 320 GLU A CD    
2482 O  OE1   . GLU A 344 ? 0.5586 0.6033 0.6541 0.1412  0.0037  0.0506  320 GLU A OE1   
2483 O  OE2   . GLU A 344 ? 0.6246 0.5861 0.7758 0.0233  -0.0341 -0.1376 320 GLU A OE2   
2484 N  N     . ALA A 345 ? 0.4228 0.3451 0.3064 0.0664  0.0335  0.0101  321 ALA A N     
2485 C  CA    . ALA A 345 ? 0.4428 0.2823 0.3729 0.0930  0.0363  -0.0124 321 ALA A CA    
2486 C  C     . ALA A 345 ? 0.3924 0.3914 0.3739 0.0823  0.0320  -0.0213 321 ALA A C     
2487 O  O     . ALA A 345 ? 0.4054 0.4315 0.4033 0.1066  0.0575  0.0215  321 ALA A O     
2488 C  CB    . ALA A 345 ? 0.4447 0.3586 0.3408 0.1157  0.0402  -0.0528 321 ALA A CB    
2489 N  N     . ALA A 346 ? 0.3589 0.3630 0.3509 0.1198  0.0522  -0.0382 322 ALA A N     
2490 C  CA    . ALA A 346 ? 0.3359 0.4195 0.3420 0.0989  0.0767  -0.0242 322 ALA A CA    
2491 C  C     . ALA A 346 ? 0.4634 0.3879 0.3747 0.1155  0.0905  -0.0283 322 ALA A C     
2492 O  O     . ALA A 346 ? 0.4210 0.4538 0.3684 0.1860  0.1133  -0.0382 322 ALA A O     
2493 C  CB    . ALA A 346 ? 0.3544 0.4225 0.3183 0.0744  0.0437  -0.0360 322 ALA A CB    
2494 N  N     . LYS A 347 ? 0.4660 0.3878 0.3616 0.1516  0.0498  -0.0219 323 LYS A N     
2495 C  CA    . LYS A 347 ? 0.4428 0.4068 0.3967 0.1666  0.0610  -0.0154 323 LYS A CA    
2496 C  C     . LYS A 347 ? 0.4396 0.4195 0.4108 0.1792  0.0719  -0.0342 323 LYS A C     
2497 O  O     . LYS A 347 ? 0.4913 0.5322 0.4225 0.1993  0.1046  -0.0015 323 LYS A O     
2498 C  CB    . LYS A 347 ? 0.4719 0.3961 0.4823 0.1453  0.0817  -0.0145 323 LYS A CB    
2499 C  CG    . LYS A 347 ? 0.5242 0.4321 0.5471 0.0964  0.0573  -0.0325 323 LYS A CG    
2500 C  CD    . LYS A 347 ? 0.6576 0.4720 0.6839 -0.0275 0.0713  0.0172  323 LYS A CD    
2501 C  CE    . LYS A 347 ? 0.6895 0.5805 0.7406 -0.0790 0.0553  0.0181  323 LYS A CE    
2502 N  NZ    . LYS A 347 ? 0.9281 0.6294 0.6694 -0.0460 0.0749  0.0220  323 LYS A NZ    
2503 N  N     . GLN A 348 ? 0.4407 0.4346 0.4438 0.1373  0.0518  -0.0106 324 GLN A N     
2504 C  CA    . GLN A 348 ? 0.4434 0.4102 0.5053 0.1241  0.1009  -0.0369 324 GLN A CA    
2505 C  C     . GLN A 348 ? 0.4238 0.4565 0.4964 0.1206  0.0875  -0.0080 324 GLN A C     
2506 O  O     . GLN A 348 ? 0.4446 0.5221 0.5820 0.1474  0.1294  -0.0229 324 GLN A O     
2507 C  CB    . GLN A 348 ? 0.4791 0.4478 0.5030 0.1019  0.0697  0.0115  324 GLN A CB    
2508 C  CG    . GLN A 348 ? 0.4890 0.5477 0.4542 -0.0055 0.0363  0.0415  324 GLN A CG    
2509 C  CD    . GLN A 348 ? 0.3559 0.2967 0.4293 -0.1351 0.1478  0.0180  324 GLN A CD    
2510 O  OE1   . GLN A 348 ? 0.3760 0.4835 0.4104 -0.2403 0.1349  0.0549  324 GLN A OE1   
2511 N  NE2   . GLN A 348 ? 0.4437 0.5220 0.4753 -0.1065 0.0762  -0.0351 324 GLN A NE2   
2512 N  N     . ALA A 349 ? 0.4849 0.4050 0.4649 0.1235  0.0960  -0.0050 325 ALA A N     
2513 C  CA    . ALA A 349 ? 0.4837 0.4304 0.4327 0.0871  0.0743  -0.0026 325 ALA A CA    
2514 C  C     . ALA A 349 ? 0.5019 0.4443 0.4301 0.1153  0.1133  -0.0267 325 ALA A C     
2515 O  O     . ALA A 349 ? 0.5094 0.5142 0.4396 0.1348  0.1312  0.0148  325 ALA A O     
2516 C  CB    . ALA A 349 ? 0.4381 0.4254 0.3869 0.0751  0.0618  0.0242  325 ALA A CB    
2517 N  N     . GLY A 350 ? 0.5049 0.4197 0.4751 0.1679  0.1057  -0.0486 326 GLY A N     
2518 C  CA    . GLY A 350 ? 0.5108 0.4212 0.4504 0.1785  0.1442  -0.0280 326 GLY A CA    
2519 C  C     . GLY A 350 ? 0.5298 0.4923 0.4710 0.1670  0.1152  0.0105  326 GLY A C     
2520 O  O     . GLY A 350 ? 0.6272 0.5034 0.4641 0.1624  0.1513  -0.0186 326 GLY A O     
2521 N  N     . LEU A 351 ? 0.5104 0.4566 0.4664 0.1652  0.0960  -0.0083 327 LEU A N     
2522 C  CA    . LEU A 351 ? 0.5094 0.4617 0.2923 0.1249  0.0912  -0.0290 327 LEU A CA    
2523 C  C     . LEU A 351 ? 0.5235 0.5592 0.4357 0.0658  0.0380  -0.0937 327 LEU A C     
2524 O  O     . LEU A 351 ? 0.4980 0.5934 0.5096 0.0958  0.0408  -0.0692 327 LEU A O     
2525 C  CB    . LEU A 351 ? 0.4900 0.3664 0.3662 0.1207  0.0807  0.0075  327 LEU A CB    
2526 C  CG    . LEU A 351 ? 0.4901 0.3661 0.3668 0.1164  0.1114  -0.0384 327 LEU A CG    
2527 C  CD1   . LEU A 351 ? 0.4863 0.2763 0.4625 0.1051  0.1311  -0.0321 327 LEU A CD1   
2528 C  CD2   . LEU A 351 ? 0.4996 0.4305 0.3674 0.1102  0.1629  -0.0406 327 LEU A CD2   
2529 N  N     . ILE A 352 ? 0.6306 0.5328 0.6278 0.0999  0.0126  -0.0403 328 ILE A N     
2530 C  CA    . ILE A 352 ? 0.5960 0.5568 0.6219 0.0808  0.0222  -0.1010 328 ILE A CA    
2531 C  C     . ILE A 352 ? 0.6014 0.5473 0.6147 0.1243  0.0299  -0.0514 328 ILE A C     
2532 O  O     . ILE A 352 ? 0.6921 0.5636 0.7150 0.1034  0.1057  -0.0166 328 ILE A O     
2533 C  CB    . ILE A 352 ? 0.5335 0.4753 0.5519 0.2072  0.0051  0.0113  328 ILE A CB    
2534 C  CG1   . ILE A 352 ? 0.5386 0.4246 0.3968 0.2425  -0.0169 0.0486  328 ILE A CG1   
2535 C  CG2   . ILE A 352 ? 0.5438 0.5080 0.4816 0.1594  0.0470  -0.0601 328 ILE A CG2   
2536 C  CD1   . ILE A 352 ? 0.5167 0.4389 0.3849 0.1993  0.0036  0.0966  328 ILE A CD1   
2537 N  N     . MSE B 23  ? 0.5763 0.4952 0.4839 -0.1247 -0.0650 -0.0308 -1  MSE B N     
2538 C  CA    . MSE B 23  ? 0.5760 0.5804 0.4731 -0.0498 -0.0432 -0.0408 -1  MSE B CA    
2539 C  C     . MSE B 23  ? 0.6293 0.4693 0.4830 -0.0288 0.0170  -0.0732 -1  MSE B C     
2540 O  O     . MSE B 23  ? 0.5767 0.7001 0.4638 -0.0562 -0.0117 0.0070  -1  MSE B O     
2541 C  CB    . MSE B 23  ? 0.6312 0.6312 0.5219 -0.0525 -0.0129 0.0235  -1  MSE B CB    
2542 C  CG    . MSE B 23  ? 0.6987 0.6467 0.6078 -0.0913 -0.0414 0.0182  -1  MSE B CG    
2543 SE SE    . MSE B 23  ? 0.7397 0.6951 0.7932 -0.0091 -0.1174 -0.0556 -1  MSE B SE    
2544 C  CE    . MSE B 23  ? 0.4554 0.2937 0.8296 -0.1179 -0.1190 -0.0713 -1  MSE B CE    
2545 N  N     . THR B 24  ? 0.6357 0.4356 0.5237 -0.0147 0.0402  -0.0759 0   THR B N     
2546 C  CA    . THR B 24  ? 0.5325 0.5023 0.4817 0.0080  0.0421  -0.1097 0   THR B CA    
2547 C  C     . THR B 24  ? 0.3787 0.4707 0.5475 -0.0294 0.0667  -0.0212 0   THR B C     
2548 O  O     . THR B 24  ? 0.5372 0.4545 0.6175 -0.0566 0.0399  0.0527  0   THR B O     
2549 C  CB    . THR B 24  ? 0.6591 0.4636 0.4731 0.0031  -0.0220 -0.1389 0   THR B CB    
2550 O  OG1   . THR B 24  ? 0.7474 0.5814 0.5511 -0.0468 0.0356  -0.0908 0   THR B OG1   
2551 C  CG2   . THR B 24  ? 0.4815 0.3977 0.5369 0.0428  0.0551  -0.0441 0   THR B CG2   
2552 N  N     . ARG B 25  ? 0.3344 0.3731 0.3137 0.0390  0.0744  -0.0806 1   ARG B N     
2553 C  CA    . ARG B 25  ? 0.3419 0.3383 0.3311 0.0076  0.0677  -0.0276 1   ARG B CA    
2554 C  C     . ARG B 25  ? 0.2944 0.2795 0.2583 -0.0117 0.0259  0.0138  1   ARG B C     
2555 O  O     . ARG B 25  ? 0.3930 0.2628 0.2626 -0.0058 0.0286  0.0239  1   ARG B O     
2556 C  CB    . ARG B 25  ? 0.3359 0.2862 0.3623 0.0548  0.0720  0.0127  1   ARG B CB    
2557 C  CG    . ARG B 25  ? 0.4077 0.2977 0.4131 -0.0104 0.1125  -0.0377 1   ARG B CG    
2558 C  CD    . ARG B 25  ? 0.4197 0.4076 0.4973 0.0012  0.1438  0.0127  1   ARG B CD    
2559 N  NE    . ARG B 25  ? 0.3309 0.4029 0.5143 0.0057  0.1791  -0.0125 1   ARG B NE    
2560 C  CZ    . ARG B 25  ? 0.3935 0.4592 0.4716 0.0239  0.0214  0.0335  1   ARG B CZ    
2561 N  NH1   . ARG B 25  ? 0.4472 0.4441 0.3950 0.0448  0.0197  0.0227  1   ARG B NH1   
2562 N  NH2   . ARG B 25  ? 0.4795 0.4701 0.5453 0.1628  0.0529  0.0688  1   ARG B NH2   
2563 N  N     . PHE B 26  ? 0.2435 0.2735 0.2482 -0.0266 0.0181  -0.0096 2   PHE B N     
2564 C  CA    . PHE B 26  ? 0.2263 0.2857 0.2666 -0.0258 0.0229  -0.0152 2   PHE B CA    
2565 C  C     . PHE B 26  ? 0.2285 0.2885 0.2051 -0.0168 0.0173  -0.0026 2   PHE B C     
2566 O  O     . PHE B 26  ? 0.2139 0.2778 0.2170 -0.0131 0.0274  0.0181  2   PHE B O     
2567 C  CB    . PHE B 26  ? 0.2135 0.2680 0.2447 -0.0148 0.0403  -0.0264 2   PHE B CB    
2568 C  CG    . PHE B 26  ? 0.2335 0.2219 0.2273 -0.0118 0.0003  -0.0188 2   PHE B CG    
2569 C  CD1   . PHE B 26  ? 0.2170 0.2127 0.2381 -0.0313 -0.0134 -0.0230 2   PHE B CD1   
2570 C  CD2   . PHE B 26  ? 0.2316 0.2760 0.2103 -0.0122 -0.0042 0.0009  2   PHE B CD2   
2571 C  CE1   . PHE B 26  ? 0.2372 0.2282 0.2827 -0.0056 0.0285  -0.0070 2   PHE B CE1   
2572 C  CE2   . PHE B 26  ? 0.2173 0.3121 0.2810 -0.0027 0.0117  -0.0218 2   PHE B CE2   
2573 C  CZ    . PHE B 26  ? 0.2565 0.2542 0.2716 -0.0014 0.0336  -0.0056 2   PHE B CZ    
2574 N  N     . ASP B 27  ? 0.2447 0.2678 0.2104 0.0074  0.0314  0.0201  3   ASP B N     
2575 C  CA    . ASP B 27  ? 0.2332 0.2439 0.2404 -0.0081 0.0340  -0.0183 3   ASP B CA    
2576 C  C     . ASP B 27  ? 0.2323 0.2539 0.2495 -0.0169 -0.0023 0.0260  3   ASP B C     
2577 O  O     . ASP B 27  ? 0.1956 0.2428 0.1848 -0.0468 0.0171  0.0205  3   ASP B O     
2578 C  CB    . ASP B 27  ? 0.2217 0.2735 0.2708 -0.0179 0.0458  0.0030  3   ASP B CB    
2579 C  CG    . ASP B 27  ? 0.2048 0.2639 0.2481 -0.0103 0.0318  0.0050  3   ASP B CG    
2580 O  OD1   . ASP B 27  ? 0.2909 0.3071 0.2832 -0.0624 -0.0031 0.0010  3   ASP B OD1   
2581 O  OD2   . ASP B 27  ? 0.2114 0.2493 0.2956 0.0033  0.0501  0.0381  3   ASP B OD2   
2582 N  N     . VAL B 28  ? 0.1960 0.2211 0.1863 -0.0063 0.0515  -0.0110 4   VAL B N     
2583 C  CA    . VAL B 28  ? 0.1705 0.2310 0.1896 -0.0072 0.0234  -0.0113 4   VAL B CA    
2584 C  C     . VAL B 28  ? 0.1658 0.1937 0.2003 0.0123  0.0271  0.0038  4   VAL B C     
2585 O  O     . VAL B 28  ? 0.1479 0.2410 0.1878 0.0020  0.0532  0.0340  4   VAL B O     
2586 C  CB    . VAL B 28  ? 0.2078 0.2319 0.2094 -0.0046 0.0569  -0.0083 4   VAL B CB    
2587 C  CG1   . VAL B 28  ? 0.2045 0.2324 0.2380 -0.0115 0.0353  0.0195  4   VAL B CG1   
2588 C  CG2   . VAL B 28  ? 0.2087 0.2508 0.2064 -0.0345 0.0623  0.0133  4   VAL B CG2   
2589 N  N     . LEU B 29  ? 0.1806 0.2448 0.1963 -0.0291 0.0263  0.0028  5   LEU B N     
2590 C  CA    . LEU B 29  ? 0.1747 0.2282 0.1738 -0.0105 0.0418  -0.0126 5   LEU B CA    
2591 C  C     . LEU B 29  ? 0.1748 0.2145 0.1739 -0.0089 0.0377  0.0069  5   LEU B C     
2592 O  O     . LEU B 29  ? 0.1678 0.2071 0.1773 -0.0168 0.0321  0.0095  5   LEU B O     
2593 C  CB    . LEU B 29  ? 0.1898 0.2275 0.1670 -0.0224 0.0424  -0.0115 5   LEU B CB    
2594 C  CG    . LEU B 29  ? 0.1940 0.2167 0.1814 -0.0222 0.0497  -0.0078 5   LEU B CG    
2595 C  CD1   . LEU B 29  ? 0.1610 0.2533 0.1638 -0.0252 0.0675  -0.0135 5   LEU B CD1   
2596 C  CD2   . LEU B 29  ? 0.1983 0.2681 0.1899 -0.0098 0.0715  -0.0172 5   LEU B CD2   
2597 N  N     . THR B 30  ? 0.1779 0.1914 0.1582 -0.0056 0.0590  -0.0359 6   THR B N     
2598 C  CA    . THR B 30  ? 0.1510 0.1810 0.1598 -0.0236 0.0497  -0.0179 6   THR B CA    
2599 C  C     . THR B 30  ? 0.1436 0.1709 0.1466 -0.0096 0.0586  -0.0171 6   THR B C     
2600 O  O     . THR B 30  ? 0.1581 0.2082 0.1900 0.0078  0.0627  -0.0187 6   THR B O     
2601 C  CB    . THR B 30  ? 0.1339 0.2372 0.1481 -0.0215 0.0478  0.0138  6   THR B CB    
2602 O  OG1   . THR B 30  ? 0.1482 0.2026 0.1731 -0.0121 0.0429  0.0117  6   THR B OG1   
2603 C  CG2   . THR B 30  ? 0.1307 0.2660 0.1730 -0.0281 0.0433  0.0274  6   THR B CG2   
2604 N  N     . VAL B 31  ? 0.1170 0.1798 0.1596 -0.0281 0.0598  -0.0140 7   VAL B N     
2605 C  CA    . VAL B 31  ? 0.1243 0.1927 0.1685 -0.0371 0.0549  0.0069  7   VAL B CA    
2606 C  C     . VAL B 31  ? 0.1539 0.2091 0.1688 -0.0188 0.0286  -0.0017 7   VAL B C     
2607 O  O     . VAL B 31  ? 0.1633 0.2312 0.1782 -0.0030 0.0463  0.0023  7   VAL B O     
2608 C  CB    . VAL B 31  ? 0.1290 0.1957 0.1606 -0.0380 0.0473  -0.0026 7   VAL B CB    
2609 C  CG1   . VAL B 31  ? 0.1339 0.2127 0.2114 -0.0422 0.0603  0.0117  7   VAL B CG1   
2610 C  CG2   . VAL B 31  ? 0.1486 0.2111 0.1711 -0.0528 0.0715  -0.0187 7   VAL B CG2   
2611 N  N     . GLY B 32  ? 0.1578 0.2263 0.1651 -0.0310 0.0374  -0.0228 8   GLY B N     
2612 C  CA    . GLY B 32  ? 0.1489 0.1892 0.1997 -0.0261 0.0192  -0.0094 8   GLY B CA    
2613 C  C     . GLY B 32  ? 0.1507 0.2023 0.2060 -0.0085 0.0138  -0.0020 8   GLY B C     
2614 O  O     . GLY B 32  ? 0.1976 0.2293 0.1939 0.0120  0.0715  -0.0015 8   GLY B O     
2615 N  N     . ASN B 33  ? 0.1535 0.2200 0.1936 -0.0339 0.0427  -0.0048 9   ASN B N     
2616 C  CA    . ASN B 33  ? 0.1342 0.1973 0.1737 -0.0101 0.0574  0.0190  9   ASN B CA    
2617 C  C     . ASN B 33  ? 0.1447 0.1971 0.1806 0.0134  0.0359  0.0203  9   ASN B C     
2618 O  O     . ASN B 33  ? 0.1744 0.2488 0.1806 0.0143  0.0530  0.0102  9   ASN B O     
2619 C  CB    . ASN B 33  ? 0.1765 0.2081 0.1804 -0.0068 0.0531  0.0090  9   ASN B CB    
2620 C  CG    . ASN B 33  ? 0.2037 0.2238 0.1842 0.0102  0.0536  0.0205  9   ASN B CG    
2621 O  OD1   . ASN B 33  ? 0.1637 0.2397 0.2188 -0.0042 0.0567  -0.0015 9   ASN B OD1   
2622 N  ND2   . ASN B 33  ? 0.1462 0.2194 0.1852 -0.0172 0.0670  0.0304  9   ASN B ND2   
2623 N  N     . ALA B 34  ? 0.1374 0.1619 0.1601 -0.0002 0.0417  0.0135  10  ALA B N     
2624 C  CA    . ALA B 34  ? 0.1439 0.1827 0.1653 0.0135  0.0335  0.0178  10  ALA B CA    
2625 C  C     . ALA B 34  ? 0.1727 0.2239 0.1580 -0.0219 0.0509  0.0049  10  ALA B C     
2626 O  O     . ALA B 34  ? 0.1757 0.2536 0.1987 -0.0303 0.0377  -0.0141 10  ALA B O     
2627 C  CB    . ALA B 34  ? 0.1934 0.2099 0.1953 0.0285  0.0684  0.0060  10  ALA B CB    
2628 N  N     . ILE B 35  ? 0.1555 0.1793 0.1746 -0.0111 0.0592  -0.0062 11  ILE B N     
2629 C  CA    . ILE B 35  ? 0.1660 0.1751 0.1560 -0.0043 0.0551  0.0116  11  ILE B CA    
2630 C  C     . ILE B 35  ? 0.1887 0.2002 0.1408 -0.0114 0.0444  0.0107  11  ILE B C     
2631 O  O     . ILE B 35  ? 0.1755 0.2250 0.1606 -0.0125 0.0474  -0.0073 11  ILE B O     
2632 C  CB    . ILE B 35  ? 0.1816 0.1954 0.1594 0.0204  0.0382  0.0131  11  ILE B CB    
2633 C  CG1   . ILE B 35  ? 0.1718 0.2082 0.1903 0.0152  0.0457  0.0325  11  ILE B CG1   
2634 C  CG2   . ILE B 35  ? 0.2114 0.2357 0.1864 0.0034  0.0337  -0.0229 11  ILE B CG2   
2635 C  CD1   . ILE B 35  ? 0.1612 0.2068 0.1874 0.0046  0.0445  0.0225  11  ILE B CD1   
2636 N  N     . VAL B 36  ? 0.1812 0.2056 0.1591 -0.0104 0.0392  0.0240  12  VAL B N     
2637 C  CA    . VAL B 36  ? 0.1616 0.2106 0.1503 0.0107  0.0465  0.0145  12  VAL B CA    
2638 C  C     . VAL B 36  ? 0.1614 0.1900 0.1642 -0.0248 0.0396  0.0007  12  VAL B C     
2639 O  O     . VAL B 36  ? 0.1961 0.1827 0.1919 -0.0231 0.0581  0.0122  12  VAL B O     
2640 C  CB    . VAL B 36  ? 0.1974 0.2260 0.1672 0.0453  0.0462  0.0088  12  VAL B CB    
2641 C  CG1   . VAL B 36  ? 0.2389 0.2782 0.1943 -0.0108 0.0494  0.0556  12  VAL B CG1   
2642 C  CG2   . VAL B 36  ? 0.2294 0.2039 0.2379 0.0531  0.0597  0.0034  12  VAL B CG2   
2643 N  N     . ASP B 37  ? 0.1552 0.1859 0.1974 -0.0220 0.0455  0.0167  13  ASP B N     
2644 C  CA    . ASP B 37  ? 0.1255 0.1977 0.1801 -0.0097 0.0371  0.0236  13  ASP B CA    
2645 C  C     . ASP B 37  ? 0.1413 0.1819 0.1571 0.0076  0.0572  0.0140  13  ASP B C     
2646 O  O     . ASP B 37  ? 0.1979 0.1972 0.1718 -0.0175 0.0709  0.0407  13  ASP B O     
2647 C  CB    . ASP B 37  ? 0.1278 0.2216 0.2002 -0.0396 0.0306  0.0323  13  ASP B CB    
2648 C  CG    . ASP B 37  ? 0.2122 0.2681 0.1916 -0.0258 0.0207  0.0332  13  ASP B CG    
2649 O  OD1   . ASP B 37  ? 0.2079 0.2764 0.2243 0.0083  0.0844  0.0301  13  ASP B OD1   
2650 O  OD2   . ASP B 37  ? 0.2124 0.2659 0.2206 -0.0306 0.0594  0.0200  13  ASP B OD2   
2651 N  N     . ILE B 38  ? 0.1767 0.2347 0.1767 -0.0014 0.0342  -0.0284 14  ILE B N     
2652 C  CA    . ILE B 38  ? 0.1779 0.1967 0.1829 0.0038  0.0186  -0.0216 14  ILE B CA    
2653 C  C     . ILE B 38  ? 0.1886 0.1904 0.2003 0.0075  0.0414  -0.0017 14  ILE B C     
2654 O  O     . ILE B 38  ? 0.2122 0.2064 0.1962 0.0280  0.0538  0.0213  14  ILE B O     
2655 C  CB    . ILE B 38  ? 0.1811 0.2208 0.1789 -0.0010 0.0133  0.0017  14  ILE B CB    
2656 C  CG1   . ILE B 38  ? 0.1838 0.2645 0.2029 -0.0009 0.0472  0.0141  14  ILE B CG1   
2657 C  CG2   . ILE B 38  ? 0.1816 0.2194 0.1761 -0.0224 0.0293  -0.0260 14  ILE B CG2   
2658 C  CD1   . ILE B 38  ? 0.2055 0.2849 0.2612 -0.0292 0.0562  -0.0006 14  ILE B CD1   
2659 N  N     . ILE B 39  ? 0.1967 0.2012 0.1824 0.0182  0.0456  -0.0028 15  ILE B N     
2660 C  CA    . ILE B 39  ? 0.1726 0.2168 0.1849 0.0050  0.0273  -0.0168 15  ILE B CA    
2661 C  C     . ILE B 39  ? 0.1793 0.2046 0.1791 -0.0073 0.0277  -0.0082 15  ILE B C     
2662 O  O     . ILE B 39  ? 0.2236 0.2196 0.1958 0.0024  0.0555  0.0128  15  ILE B O     
2663 C  CB    . ILE B 39  ? 0.1765 0.2561 0.1805 -0.0133 0.0350  -0.0322 15  ILE B CB    
2664 C  CG1   . ILE B 39  ? 0.1613 0.2733 0.1858 -0.0202 0.0267  -0.0395 15  ILE B CG1   
2665 C  CG2   . ILE B 39  ? 0.1992 0.2888 0.2044 0.0028  0.0672  -0.0267 15  ILE B CG2   
2666 C  CD1   . ILE B 39  ? 0.2812 0.2907 0.3154 -0.0593 0.0251  -0.0600 15  ILE B CD1   
2667 N  N     . SER B 40  ? 0.2288 0.2206 0.1800 0.0049  0.0467  -0.0241 16  SER B N     
2668 C  CA    . SER B 40  ? 0.2231 0.2290 0.1752 0.0217  0.0245  -0.0121 16  SER B CA    
2669 C  C     . SER B 40  ? 0.2783 0.2346 0.2046 0.0592  0.0394  0.0148  16  SER B C     
2670 O  O     . SER B 40  ? 0.2889 0.3119 0.1668 0.0757  0.0600  0.0155  16  SER B O     
2671 C  CB    . SER B 40  ? 0.2221 0.3107 0.2381 -0.0086 0.0454  -0.0501 16  SER B CB    
2672 O  OG    . SER B 40  ? 0.2942 0.4406 0.2470 0.0034  0.0321  -0.0391 16  SER B OG    
2673 N  N     . ARG B 41  ? 0.3010 0.2794 0.2121 0.0428  0.0750  0.0364  17  ARG B N     
2674 C  CA    . ARG B 41  ? 0.3155 0.2529 0.2284 0.0359  0.0518  0.0126  17  ARG B CA    
2675 C  C     . ARG B 41  ? 0.3268 0.2665 0.2215 0.0364  0.0520  -0.0084 17  ARG B C     
2676 O  O     . ARG B 41  ? 0.3540 0.3372 0.3363 0.0485  0.0006  -0.0206 17  ARG B O     
2677 C  CB    . ARG B 41  ? 0.3790 0.3679 0.2750 -0.0166 0.1285  -0.0379 17  ARG B CB    
2678 C  CG    . ARG B 41  ? 0.5697 0.3852 0.7099 0.0772  0.0180  0.0200  17  ARG B CG    
2679 C  CD    . ARG B 41  ? 0.5903 0.4660 0.9108 -0.0088 0.0360  -0.1014 17  ARG B CD    
2680 N  NE    . ARG B 41  ? 0.5526 0.6634 0.7513 0.0262  0.0104  -0.0495 17  ARG B NE    
2681 C  CZ    . ARG B 41  ? 0.5905 0.6204 0.6587 -0.0352 0.1686  0.0142  17  ARG B CZ    
2682 N  NH1   . ARG B 41  ? 0.6426 0.7147 0.8327 -0.1183 0.0986  0.0452  17  ARG B NH1   
2683 N  NH2   . ARG B 41  ? 0.6396 0.5602 0.5694 -0.0082 0.2108  0.0517  17  ARG B NH2   
2684 N  N     . CYS B 42  ? 0.3191 0.2579 0.1929 0.0213  0.0457  0.0088  18  CYS B N     
2685 C  CA    . CYS B 42  ? 0.3124 0.2689 0.2435 0.0331  0.0427  -0.0285 18  CYS B CA    
2686 C  C     . CYS B 42  ? 0.2907 0.3025 0.2550 0.0336  0.0410  -0.0295 18  CYS B C     
2687 O  O     . CYS B 42  ? 0.2835 0.2889 0.2118 0.0171  0.0632  -0.0071 18  CYS B O     
2688 C  CB    . CYS B 42  ? 0.3448 0.3013 0.2399 0.0385  0.0525  -0.0027 18  CYS B CB    
2689 S  SG    . CYS B 42  ? 0.3427 0.2784 0.2273 0.0191  0.0622  0.0009  18  CYS B SG    
2690 N  N     . ASN B 43  ? 0.3970 0.3348 0.2687 0.0252  0.0561  -0.0668 19  ASN B N     
2691 C  CA    . ASN B 43  ? 0.3727 0.3895 0.3432 0.0414  0.0542  -0.0398 19  ASN B CA    
2692 C  C     . ASN B 43  ? 0.3303 0.3563 0.3581 0.0490  0.0529  -0.0405 19  ASN B C     
2693 O  O     . ASN B 43  ? 0.3640 0.2927 0.3433 0.0403  0.0622  -0.1180 19  ASN B O     
2694 C  CB    . ASN B 43  ? 0.4229 0.4491 0.3736 -0.0052 0.1107  -0.0908 19  ASN B CB    
2695 C  CG    . ASN B 43  ? 0.4586 0.4428 0.3428 -0.0427 0.1222  -0.0814 19  ASN B CG    
2696 O  OD1   . ASN B 43  ? 0.4518 0.3721 0.3493 -0.0404 0.0858  -0.0398 19  ASN B OD1   
2697 N  ND2   . ASN B 43  ? 0.4546 0.5295 0.3686 -0.1184 0.0889  0.0139  19  ASN B ND2   
2698 N  N     . ASP B 44  ? 0.3420 0.3143 0.4458 0.0343  0.0781  -0.0651 20  ASP B N     
2699 C  CA    . ASP B 44  ? 0.3519 0.3644 0.4598 0.0126  0.0470  -0.0432 20  ASP B CA    
2700 C  C     . ASP B 44  ? 0.2722 0.3617 0.3085 0.0553  0.0491  -0.0491 20  ASP B C     
2701 O  O     . ASP B 44  ? 0.2892 0.3635 0.2699 0.1105  0.1048  -0.1124 20  ASP B O     
2702 C  CB    . ASP B 44  ? 0.3903 0.4206 0.6013 0.0694  0.0510  -0.0369 20  ASP B CB    
2703 C  CG    . ASP B 44  ? 0.4721 0.4355 0.5935 0.0246  0.0547  -0.0239 20  ASP B CG    
2704 O  OD1   . ASP B 44  ? 0.4304 0.4563 0.5311 0.0189  0.0495  -0.0200 20  ASP B OD1   
2705 O  OD2   . ASP B 44  ? 0.5359 0.4176 0.5570 -0.0112 0.0760  -0.0530 20  ASP B OD2   
2706 N  N     . GLN B 45  ? 0.3025 0.3366 0.2688 0.0506  0.0919  -0.0665 21  GLN B N     
2707 C  CA    . GLN B 45  ? 0.3505 0.3528 0.3322 0.0220  0.0540  -0.0574 21  GLN B CA    
2708 C  C     . GLN B 45  ? 0.3519 0.2497 0.2413 0.0200  0.0341  -0.0378 21  GLN B C     
2709 O  O     . GLN B 45  ? 0.3623 0.2870 0.2759 0.0116  0.0743  -0.0482 21  GLN B O     
2710 C  CB    . GLN B 45  ? 0.4101 0.3950 0.3133 0.0239  0.0783  -0.0540 21  GLN B CB    
2711 C  CG    . GLN B 45  ? 0.5091 0.3899 0.3732 0.0051  0.0569  -0.0617 21  GLN B CG    
2712 C  CD    . GLN B 45  ? 0.4850 0.3668 0.4763 0.0060  0.0484  -0.0580 21  GLN B CD    
2713 O  OE1   . GLN B 45  ? 0.7367 0.3683 0.5793 -0.0283 0.0469  0.0523  21  GLN B OE1   
2714 N  NE2   . GLN B 45  ? 0.4928 0.4180 0.3962 0.0342  0.0846  -0.1362 21  GLN B NE2   
2715 N  N     . PHE B 46  ? 0.3166 0.2543 0.2289 0.0226  0.0170  -0.0494 22  PHE B N     
2716 C  CA    . PHE B 46  ? 0.3188 0.2511 0.2469 0.0360  0.0207  -0.0312 22  PHE B CA    
2717 C  C     . PHE B 46  ? 0.2608 0.2224 0.2564 0.0056  0.0025  -0.0050 22  PHE B C     
2718 O  O     . PHE B 46  ? 0.2890 0.2610 0.2445 0.0139  0.0353  0.0147  22  PHE B O     
2719 C  CB    . PHE B 46  ? 0.2651 0.2629 0.2911 0.0210  0.0321  0.0111  22  PHE B CB    
2720 C  CG    . PHE B 46  ? 0.2882 0.2541 0.2471 0.0296  0.0159  -0.0261 22  PHE B CG    
2721 C  CD1   . PHE B 46  ? 0.2634 0.3068 0.2899 0.0196  0.0310  0.0077  22  PHE B CD1   
2722 C  CD2   . PHE B 46  ? 0.2984 0.2267 0.2563 0.0316  -0.0043 -0.0321 22  PHE B CD2   
2723 C  CE1   . PHE B 46  ? 0.2835 0.3211 0.2720 0.0227  0.0268  -0.0257 22  PHE B CE1   
2724 C  CE2   . PHE B 46  ? 0.2979 0.2790 0.2779 0.0324  0.0224  -0.0140 22  PHE B CE2   
2725 C  CZ    . PHE B 46  ? 0.2882 0.3009 0.2814 0.0074  0.0281  -0.0278 22  PHE B CZ    
2726 N  N     . LEU B 47  ? 0.2458 0.2184 0.2445 0.0201  0.0194  -0.0135 23  LEU B N     
2727 C  CA    . LEU B 47  ? 0.2198 0.2355 0.2384 0.0111  0.0139  -0.0231 23  LEU B CA    
2728 C  C     . LEU B 47  ? 0.2629 0.2312 0.2533 0.0093  0.0278  -0.0190 23  LEU B C     
2729 O  O     . LEU B 47  ? 0.3450 0.2823 0.2560 -0.0133 0.0357  0.0274  23  LEU B O     
2730 C  CB    . LEU B 47  ? 0.2460 0.2471 0.2628 -0.0115 0.0029  -0.0534 23  LEU B CB    
2731 C  CG    . LEU B 47  ? 0.2417 0.2334 0.2319 0.0115  0.0470  -0.0436 23  LEU B CG    
2732 C  CD1   . LEU B 47  ? 0.2499 0.2452 0.2602 -0.0460 0.0445  0.0222  23  LEU B CD1   
2733 C  CD2   . LEU B 47  ? 0.2674 0.2315 0.1730 0.0053  0.0689  -0.0393 23  LEU B CD2   
2734 N  N     . ILE B 48  ? 0.2877 0.2614 0.2607 0.0003  0.0333  -0.0438 24  ILE B N     
2735 C  CA    . ILE B 48  ? 0.3008 0.2693 0.2817 0.0018  0.0435  -0.0483 24  ILE B CA    
2736 C  C     . ILE B 48  ? 0.3137 0.2425 0.2665 -0.0063 -0.0079 -0.0237 24  ILE B C     
2737 O  O     . ILE B 48  ? 0.3355 0.2884 0.2629 0.0065  0.0282  -0.0233 24  ILE B O     
2738 C  CB    . ILE B 48  ? 0.3273 0.2830 0.2998 0.0245  0.0508  -0.0507 24  ILE B CB    
2739 C  CG1   . ILE B 48  ? 0.3214 0.2861 0.2834 0.0120  0.0609  -0.0252 24  ILE B CG1   
2740 C  CG2   . ILE B 48  ? 0.3382 0.2831 0.2748 0.0393  0.1102  -0.0277 24  ILE B CG2   
2741 C  CD1   . ILE B 48  ? 0.4026 0.3890 0.3030 0.0335  0.0970  -0.0486 24  ILE B CD1   
2742 N  N     . ASP B 49  ? 0.3209 0.2611 0.2305 -0.0091 0.0111  -0.0324 25  ASP B N     
2743 C  CA    . ASP B 49  ? 0.3250 0.2379 0.2683 0.0116  -0.0206 -0.0209 25  ASP B CA    
2744 C  C     . ASP B 49  ? 0.3501 0.2576 0.2398 -0.0157 -0.0236 -0.0414 25  ASP B C     
2745 O  O     . ASP B 49  ? 0.4040 0.2846 0.2612 -0.0461 -0.0039 -0.0337 25  ASP B O     
2746 C  CB    . ASP B 49  ? 0.4006 0.2829 0.2508 -0.0012 -0.0290 -0.0255 25  ASP B CB    
2747 C  CG    . ASP B 49  ? 0.4344 0.3327 0.2875 0.0057  -0.0006 -0.0400 25  ASP B CG    
2748 O  OD1   . ASP B 49  ? 0.4554 0.3108 0.3328 -0.0052 0.0087  -0.0857 25  ASP B OD1   
2749 O  OD2   . ASP B 49  ? 0.5272 0.3787 0.3161 -0.0470 -0.0474 -0.0124 25  ASP B OD2   
2750 N  N     . ASN B 50  ? 0.3501 0.2267 0.2271 -0.0147 0.0222  -0.0315 26  ASN B N     
2751 C  CA    . ASN B 50  ? 0.3300 0.2615 0.2211 -0.0022 0.0377  0.0125  26  ASN B CA    
2752 C  C     . ASN B 50  ? 0.2706 0.2780 0.2447 -0.0411 -0.0123 -0.0141 26  ASN B C     
2753 O  O     . ASN B 50  ? 0.3167 0.3062 0.2788 -0.0142 0.0297  -0.0105 26  ASN B O     
2754 C  CB    . ASN B 50  ? 0.2849 0.2756 0.2204 0.0089  0.0108  0.0086  26  ASN B CB    
2755 C  CG    . ASN B 50  ? 0.2970 0.2937 0.2160 -0.0300 -0.0067 0.0099  26  ASN B CG    
2756 O  OD1   . ASN B 50  ? 0.2935 0.3505 0.2555 -0.0150 -0.0124 -0.0357 26  ASN B OD1   
2757 N  ND2   . ASN B 50  ? 0.3092 0.2870 0.2410 -0.0175 0.0344  -0.0165 26  ASN B ND2   
2758 N  N     . GLN B 51  ? 0.3250 0.2881 0.2809 -0.0167 -0.0522 -0.0312 27  GLN B N     
2759 C  CA    . GLN B 51  ? 0.3604 0.2658 0.2469 -0.0495 -0.0206 -0.0327 27  GLN B CA    
2760 C  C     . GLN B 51  ? 0.3324 0.2556 0.2439 -0.0520 0.0263  -0.0352 27  GLN B C     
2761 O  O     . GLN B 51  ? 0.3816 0.3275 0.2691 -0.0684 0.0824  0.0204  27  GLN B O     
2762 C  CB    . GLN B 51  ? 0.4239 0.2910 0.3111 -0.0695 0.0287  -0.0412 27  GLN B CB    
2763 C  CG    . GLN B 51  ? 0.4718 0.3372 0.2992 -0.0980 -0.0130 -0.0667 27  GLN B CG    
2764 C  CD    . GLN B 51  ? 0.5544 0.4468 0.5104 -0.1724 0.0476  -0.0393 27  GLN B CD    
2765 O  OE1   . GLN B 51  ? 0.5985 0.5919 0.6506 -0.1063 0.1096  -0.0680 27  GLN B OE1   
2766 N  NE2   . GLN B 51  ? 0.6736 0.4500 0.6353 -0.1279 0.0209  -0.0489 27  GLN B NE2   
2767 N  N     . ILE B 52  ? 0.2616 0.2213 0.2065 0.0108  0.0147  -0.0152 28  ILE B N     
2768 C  CA    . ILE B 52  ? 0.2538 0.2051 0.2327 0.0132  0.0186  -0.0019 28  ILE B CA    
2769 C  C     . ILE B 52  ? 0.2572 0.2564 0.1933 0.0056  0.0061  -0.0061 28  ILE B C     
2770 O  O     . ILE B 52  ? 0.2869 0.3029 0.2334 0.0086  0.0298  -0.0425 28  ILE B O     
2771 C  CB    . ILE B 52  ? 0.2271 0.2113 0.2091 0.0185  0.0163  -0.0008 28  ILE B CB    
2772 C  CG1   . ILE B 52  ? 0.2324 0.2553 0.2095 0.0243  0.0143  0.0204  28  ILE B CG1   
2773 C  CG2   . ILE B 52  ? 0.2324 0.2205 0.2487 -0.0136 0.0283  0.0020  28  ILE B CG2   
2774 C  CD1   . ILE B 52  ? 0.2193 0.2043 0.2265 0.0049  0.0265  0.0130  28  ILE B CD1   
2775 N  N     . THR B 53  ? 0.2631 0.2469 0.2119 0.0344  -0.0223 -0.0269 29  THR B N     
2776 C  CA    . THR B 53  ? 0.2335 0.2458 0.2209 0.0019  0.0021  -0.0196 29  THR B CA    
2777 C  C     . THR B 53  ? 0.2295 0.2639 0.2334 0.0032  0.0322  -0.0158 29  THR B C     
2778 O  O     . THR B 53  ? 0.2311 0.2657 0.2484 -0.0120 0.0373  0.0064  29  THR B O     
2779 C  CB    . THR B 53  ? 0.2409 0.2463 0.2274 0.0019  0.0197  0.0185  29  THR B CB    
2780 O  OG1   . THR B 53  ? 0.3255 0.2650 0.2829 -0.0295 0.0456  0.0291  29  THR B OG1   
2781 C  CG2   . THR B 53  ? 0.2462 0.2667 0.2600 0.0142  0.0092  0.0068  29  THR B CG2   
2782 N  N     . LYS B 54  ? 0.2219 0.3079 0.2586 -0.0028 0.0427  -0.0233 30  LYS B N     
2783 C  CA    . LYS B 54  ? 0.2448 0.2681 0.2196 0.0082  0.0360  -0.0397 30  LYS B CA    
2784 C  C     . LYS B 54  ? 0.2370 0.2132 0.2527 -0.0036 0.0246  -0.0234 30  LYS B C     
2785 O  O     . LYS B 54  ? 0.2441 0.2813 0.2457 0.0090  0.0317  -0.0041 30  LYS B O     
2786 C  CB    . LYS B 54  ? 0.2627 0.2725 0.2559 0.0256  0.0613  -0.0336 30  LYS B CB    
2787 C  CG    . LYS B 54  ? 0.3052 0.2392 0.2056 0.0382  0.0689  -0.0470 30  LYS B CG    
2788 C  CD    . LYS B 54  ? 0.3003 0.2982 0.2490 0.0374  0.1080  -0.0540 30  LYS B CD    
2789 C  CE    . LYS B 54  ? 0.3332 0.3049 0.2474 0.0200  0.0534  -0.0088 30  LYS B CE    
2790 N  NZ    . LYS B 54  ? 0.2851 0.3300 0.2715 0.0177  0.0692  0.0022  30  LYS B NZ    
2791 N  N     . ALA B 55  ? 0.2082 0.2224 0.2441 0.0053  0.0618  0.0037  31  ALA B N     
2792 C  CA    . ALA B 55  ? 0.1706 0.2708 0.2203 0.0065  0.0521  0.0049  31  ALA B CA    
2793 C  C     . ALA B 55  ? 0.1688 0.2426 0.1957 0.0007  0.0175  -0.0051 31  ALA B C     
2794 O  O     . ALA B 55  ? 0.2326 0.2734 0.1848 -0.0192 0.0267  -0.0146 31  ALA B O     
2795 C  CB    . ALA B 55  ? 0.1643 0.2692 0.2518 -0.0067 0.0379  -0.0053 31  ALA B CB    
2796 N  N     . ALA B 56  ? 0.1819 0.2592 0.1784 0.0042  0.0634  -0.0134 32  ALA B N     
2797 C  CA    . ALA B 56  ? 0.1839 0.2467 0.1668 0.0120  0.0484  -0.0068 32  ALA B CA    
2798 C  C     . ALA B 56  ? 0.1781 0.2481 0.1679 0.0150  0.0314  0.0091  32  ALA B C     
2799 O  O     . ALA B 56  ? 0.2175 0.2317 0.1692 0.0159  0.0326  -0.0037 32  ALA B O     
2800 C  CB    . ALA B 56  ? 0.2502 0.2255 0.2292 0.0166  0.0257  -0.0161 32  ALA B CB    
2801 N  N     . MSE B 57  ? 0.1862 0.2245 0.1802 0.0068  0.0487  -0.0015 33  MSE B N     
2802 C  CA    . MSE B 57  ? 0.1782 0.2042 0.2038 0.0029  0.0226  0.0020  33  MSE B CA    
2803 C  C     . MSE B 57  ? 0.1991 0.2017 0.2128 -0.0053 0.0077  0.0248  33  MSE B C     
2804 O  O     . MSE B 57  ? 0.2124 0.2311 0.2056 -0.0100 0.0268  0.0321  33  MSE B O     
2805 C  CB    . MSE B 57  ? 0.2600 0.2415 0.1665 0.0132  0.0621  0.0063  33  MSE B CB    
2806 C  CG    . MSE B 57  ? 0.2738 0.2891 0.2165 0.0430  0.0088  0.0241  33  MSE B CG    
2807 SE SE    . MSE B 57  ? 0.3822 0.4050 0.3634 -0.0422 0.0230  0.0336  33  MSE B SE    
2808 C  CE    . MSE B 57  ? 0.1531 0.3014 0.2655 -0.0509 0.0968  0.0099  33  MSE B CE    
2809 N  N     . ASN B 58  ? 0.1989 0.2062 0.1845 -0.0327 0.0273  0.0271  34  ASN B N     
2810 C  CA    . ASN B 58  ? 0.1620 0.1936 0.1959 -0.0058 0.0117  0.0090  34  ASN B CA    
2811 C  C     . ASN B 58  ? 0.1822 0.2083 0.2130 0.0042  0.0364  0.0145  34  ASN B C     
2812 O  O     . ASN B 58  ? 0.2155 0.2135 0.2376 -0.0083 0.0356  0.0205  34  ASN B O     
2813 C  CB    . ASN B 58  ? 0.1728 0.2230 0.1907 -0.0044 0.0156  0.0033  34  ASN B CB    
2814 C  CG    . ASN B 58  ? 0.2075 0.2265 0.2280 0.0176  0.0356  0.0207  34  ASN B CG    
2815 O  OD1   . ASN B 58  ? 0.2742 0.2309 0.2668 0.0322  0.0373  -0.0093 34  ASN B OD1   
2816 N  ND2   . ASN B 58  ? 0.2304 0.2219 0.1871 0.0096  0.0512  0.0012  34  ASN B ND2   
2817 N  N     . LEU B 59  ? 0.1707 0.2142 0.2213 -0.0121 0.0680  -0.0208 35  LEU B N     
2818 C  CA    . LEU B 59  ? 0.1666 0.2095 0.1868 0.0101  0.0405  0.0215  35  LEU B CA    
2819 C  C     . LEU B 59  ? 0.2102 0.2372 0.2131 -0.0103 0.0306  0.0038  35  LEU B C     
2820 O  O     . LEU B 59  ? 0.2109 0.2363 0.2767 -0.0435 0.0333  -0.0148 35  LEU B O     
2821 C  CB    . LEU B 59  ? 0.2024 0.2671 0.1931 -0.0270 0.0724  0.0361  35  LEU B CB    
2822 C  CG    . LEU B 59  ? 0.2630 0.2674 0.2052 -0.0371 0.0730  0.0134  35  LEU B CG    
2823 C  CD1   . LEU B 59  ? 0.3355 0.2935 0.2366 -0.0465 0.0679  0.0574  35  LEU B CD1   
2824 C  CD2   . LEU B 59  ? 0.2597 0.2645 0.2255 -0.0374 0.0116  -0.0010 35  LEU B CD2   
2825 N  N     . ILE B 60  ? 0.2108 0.2273 0.2193 -0.0227 0.0254  0.0151  36  ILE B N     
2826 C  CA    . ILE B 60  ? 0.2097 0.2861 0.2319 -0.0209 0.0155  0.0087  36  ILE B CA    
2827 C  C     . ILE B 60  ? 0.2252 0.2402 0.2625 -0.0296 0.0338  0.0017  36  ILE B C     
2828 O  O     . ILE B 60  ? 0.2443 0.2582 0.2347 -0.0213 0.0659  0.0056  36  ILE B O     
2829 C  CB    . ILE B 60  ? 0.2462 0.2381 0.2338 0.0024  0.0399  0.0060  36  ILE B CB    
2830 C  CG1   . ILE B 60  ? 0.2726 0.2479 0.2218 -0.0087 0.0396  0.0455  36  ILE B CG1   
2831 C  CG2   . ILE B 60  ? 0.2415 0.2921 0.2993 0.0130  0.0377  -0.0231 36  ILE B CG2   
2832 C  CD1   . ILE B 60  ? 0.2636 0.2950 0.1994 -0.0224 0.0555  0.0182  36  ILE B CD1   
2833 N  N     . ASP B 61  ? 0.2209 0.2850 0.2355 -0.0418 0.0315  0.0212  37  ASP B N     
2834 C  CA    . ASP B 61  ? 0.2340 0.2570 0.2449 -0.0251 0.0440  0.0210  37  ASP B CA    
2835 C  C     . ASP B 61  ? 0.2240 0.3035 0.2592 0.0177  0.0417  0.0167  37  ASP B C     
2836 O  O     . ASP B 61  ? 0.2532 0.3172 0.2518 -0.0345 0.0364  0.0085  37  ASP B O     
2837 C  CB    . ASP B 61  ? 0.2462 0.2773 0.2467 -0.0193 0.0682  0.0540  37  ASP B CB    
2838 C  CG    . ASP B 61  ? 0.2857 0.2628 0.2907 -0.0576 0.0644  0.0596  37  ASP B CG    
2839 O  OD1   . ASP B 61  ? 0.2484 0.3355 0.2874 -0.0539 0.0598  0.0367  37  ASP B OD1   
2840 O  OD2   . ASP B 61  ? 0.3297 0.2725 0.3439 -0.1017 0.0779  0.0474  37  ASP B OD2   
2841 N  N     . ALA B 62  ? 0.1994 0.2950 0.2667 0.0076  0.0298  0.0156  38  ALA B N     
2842 C  CA    . ALA B 62  ? 0.1937 0.3161 0.2580 -0.0063 0.0356  0.0287  38  ALA B CA    
2843 C  C     . ALA B 62  ? 0.2490 0.3059 0.2675 -0.0022 0.0217  0.0264  38  ALA B C     
2844 O  O     . ALA B 62  ? 0.2468 0.3213 0.3032 -0.0343 0.0601  0.0465  38  ALA B O     
2845 C  CB    . ALA B 62  ? 0.2291 0.4098 0.3481 0.0382  0.0612  0.0130  38  ALA B CB    
2846 N  N     . GLU B 63  ? 0.2610 0.3018 0.3358 -0.0036 0.0322  -0.0037 39  GLU B N     
2847 C  CA    . GLU B 63  ? 0.3152 0.3236 0.3312 -0.0500 0.0564  -0.0027 39  GLU B CA    
2848 C  C     . GLU B 63  ? 0.2757 0.3586 0.2997 -0.0055 0.0099  0.0269  39  GLU B C     
2849 O  O     . GLU B 63  ? 0.2941 0.2930 0.2991 -0.0514 0.0125  0.0468  39  GLU B O     
2850 C  CB    . GLU B 63  ? 0.3838 0.2919 0.4081 -0.0687 0.0383  -0.0168 39  GLU B CB    
2851 C  CG    . GLU B 63  ? 0.4024 0.4197 0.4620 -0.0668 -0.0093 -0.0768 39  GLU B CG    
2852 C  CD    . GLU B 63  ? 0.6185 0.4450 0.5411 -0.0922 0.0400  -0.0198 39  GLU B CD    
2853 O  OE1   . GLU B 63  ? 0.7073 0.4502 0.5978 -0.1600 0.0943  0.0478  39  GLU B OE1   
2854 O  OE2   . GLU B 63  ? 0.7125 0.4966 0.5378 -0.1221 0.0404  -0.0346 39  GLU B OE2   
2855 N  N     . ARG B 64  ? 0.2238 0.2681 0.3316 -0.0210 0.0276  0.0114  40  ARG B N     
2856 C  CA    . ARG B 64  ? 0.2528 0.2610 0.2834 -0.0158 0.0375  -0.0003 40  ARG B CA    
2857 C  C     . ARG B 64  ? 0.2640 0.2627 0.2651 -0.0174 0.0330  -0.0076 40  ARG B C     
2858 O  O     . ARG B 64  ? 0.2720 0.2519 0.2462 -0.0146 0.0251  -0.0150 40  ARG B O     
2859 C  CB    . ARG B 64  ? 0.2561 0.2398 0.2789 -0.0206 0.0564  0.0424  40  ARG B CB    
2860 C  CG    . ARG B 64  ? 0.2061 0.3214 0.3824 -0.0002 0.0365  0.0477  40  ARG B CG    
2861 C  CD    . ARG B 64  ? 0.3172 0.2966 0.4477 0.0256  0.0648  0.0484  40  ARG B CD    
2862 N  NE    . ARG B 64  ? 0.3013 0.3473 0.4757 -0.0421 0.0573  0.0014  40  ARG B NE    
2863 C  CZ    . ARG B 64  ? 0.3482 0.4075 0.4497 -0.0475 0.0120  -0.0305 40  ARG B CZ    
2864 N  NH1   . ARG B 64  ? 0.3739 0.3744 0.5771 -0.0260 0.0055  -0.0802 40  ARG B NH1   
2865 N  NH2   . ARG B 64  ? 0.4018 0.3414 0.3472 0.0071  0.0692  -0.0198 40  ARG B NH2   
2866 N  N     . ALA B 65  ? 0.2298 0.2257 0.2562 -0.0098 -0.0013 0.0141  41  ALA B N     
2867 C  CA    . ALA B 65  ? 0.2322 0.2346 0.2218 -0.0231 0.0186  -0.0001 41  ALA B CA    
2868 C  C     . ALA B 65  ? 0.2183 0.2747 0.2390 -0.0093 0.0083  -0.0078 41  ALA B C     
2869 O  O     . ALA B 65  ? 0.2548 0.2691 0.2480 -0.0156 0.0340  -0.0190 41  ALA B O     
2870 C  CB    . ALA B 65  ? 0.2099 0.2531 0.2300 -0.0200 0.0463  -0.0028 41  ALA B CB    
2871 N  N     . GLU B 66  ? 0.2109 0.2955 0.2379 0.0029  0.0022  0.0117  42  GLU B N     
2872 C  CA    . GLU B 66  ? 0.2495 0.2881 0.2304 -0.0355 -0.0083 0.0173  42  GLU B CA    
2873 C  C     . GLU B 66  ? 0.2475 0.2786 0.2429 -0.0215 -0.0090 0.0189  42  GLU B C     
2874 O  O     . GLU B 66  ? 0.2646 0.3251 0.2580 -0.0311 0.0259  0.0371  42  GLU B O     
2875 C  CB    . GLU B 66  ? 0.2383 0.4223 0.2838 -0.0052 -0.0135 0.0179  42  GLU B CB    
2876 C  CG    . GLU B 66  ? 0.4039 0.4515 0.3652 0.0045  -0.0157 -0.0641 42  GLU B CG    
2877 C  CD    . GLU B 66  ? 0.5749 0.5093 0.5472 0.0208  -0.0874 0.0027  42  GLU B CD    
2878 O  OE1   . GLU B 66  ? 0.7059 0.7713 0.4838 -0.0114 -0.0592 -0.0185 42  GLU B OE1   
2879 O  OE2   . GLU B 66  ? 0.6096 0.4734 0.7513 -0.1062 -0.0341 0.0218  42  GLU B OE2   
2880 N  N     . LEU B 67  ? 0.2600 0.2728 0.2913 0.0013  0.0089  -0.0064 43  LEU B N     
2881 C  CA    . LEU B 67  ? 0.2967 0.2669 0.2672 -0.0215 0.0234  -0.0034 43  LEU B CA    
2882 C  C     . LEU B 67  ? 0.2746 0.2326 0.2197 -0.0023 -0.0055 0.0044  43  LEU B C     
2883 O  O     . LEU B 67  ? 0.2866 0.2396 0.2093 -0.0104 -0.0030 -0.0229 43  LEU B O     
2884 C  CB    . LEU B 67  ? 0.3488 0.2807 0.3038 -0.0349 0.0117  0.0152  43  LEU B CB    
2885 C  CG    . LEU B 67  ? 0.3660 0.3209 0.3515 0.0160  -0.0048 -0.0166 43  LEU B CG    
2886 C  CD1   . LEU B 67  ? 0.3958 0.2902 0.3291 -0.0374 0.0494  -0.0052 43  LEU B CD1   
2887 C  CD2   . LEU B 67  ? 0.4060 0.4698 0.3438 0.0361  -0.0123 -0.0343 43  LEU B CD2   
2888 N  N     . LEU B 68  ? 0.2745 0.2108 0.2769 -0.0368 -0.0095 0.0121  44  LEU B N     
2889 C  CA    . LEU B 68  ? 0.2386 0.2443 0.2327 -0.0121 -0.0314 -0.0081 44  LEU B CA    
2890 C  C     . LEU B 68  ? 0.2808 0.2587 0.2300 0.0065  0.0219  0.0016  44  LEU B C     
2891 O  O     . LEU B 68  ? 0.2817 0.2815 0.2336 0.0224  0.0305  0.0096  44  LEU B O     
2892 C  CB    . LEU B 68  ? 0.3127 0.2833 0.1565 -0.0022 -0.0246 -0.0278 44  LEU B CB    
2893 C  CG    . LEU B 68  ? 0.3139 0.3403 0.2646 0.0452  -0.0337 -0.0227 44  LEU B CG    
2894 C  CD1   . LEU B 68  ? 0.3236 0.3519 0.3134 0.0346  -0.0406 -0.0603 44  LEU B CD1   
2895 C  CD2   . LEU B 68  ? 0.3637 0.3951 0.3223 0.0767  -0.0147 -0.0581 44  LEU B CD2   
2896 N  N     . TYR B 69  ? 0.2869 0.1917 0.2317 -0.0251 -0.0150 -0.0097 45  TYR B N     
2897 C  CA    . TYR B 69  ? 0.2277 0.2058 0.2198 -0.0008 0.0074  -0.0012 45  TYR B CA    
2898 C  C     . TYR B 69  ? 0.2399 0.2234 0.2059 -0.0200 0.0148  0.0067  45  TYR B C     
2899 O  O     . TYR B 69  ? 0.2685 0.2199 0.1950 0.0119  0.0426  0.0017  45  TYR B O     
2900 C  CB    . TYR B 69  ? 0.2622 0.2245 0.2388 0.0026  0.0254  -0.0076 45  TYR B CB    
2901 C  CG    . TYR B 69  ? 0.2242 0.2249 0.1929 -0.0066 0.0361  -0.0069 45  TYR B CG    
2902 C  CD1   . TYR B 69  ? 0.2276 0.2370 0.2263 -0.0079 0.0485  0.0035  45  TYR B CD1   
2903 C  CD2   . TYR B 69  ? 0.2148 0.2502 0.1941 0.0039  0.0380  -0.0035 45  TYR B CD2   
2904 C  CE1   . TYR B 69  ? 0.2551 0.2428 0.1568 0.0236  0.0353  0.0094  45  TYR B CE1   
2905 C  CE2   . TYR B 69  ? 0.2265 0.2467 0.2458 -0.0234 0.0405  -0.0154 45  TYR B CE2   
2906 C  CZ    . TYR B 69  ? 0.2133 0.2378 0.1975 -0.0024 0.0434  -0.0038 45  TYR B CZ    
2907 O  OH    . TYR B 69  ? 0.2480 0.2483 0.2517 0.0239  0.0475  -0.0072 45  TYR B OH    
2908 N  N     . SER B 70  ? 0.2203 0.2680 0.2347 -0.0269 0.0029  -0.0291 46  SER B N     
2909 C  CA    . SER B 70  ? 0.2929 0.2923 0.2321 -0.0199 -0.0147 -0.0093 46  SER B CA    
2910 C  C     . SER B 70  ? 0.2699 0.2707 0.2270 -0.0099 -0.0292 -0.0064 46  SER B C     
2911 O  O     . SER B 70  ? 0.3207 0.3304 0.2328 0.0332  -0.0095 0.0216  46  SER B O     
2912 C  CB    . SER B 70  ? 0.2488 0.2947 0.2709 -0.0014 -0.0183 -0.0278 46  SER B CB    
2913 O  OG    . SER B 70  ? 0.3349 0.3140 0.2425 0.0148  0.0168  0.0186  46  SER B OG    
2914 N  N     . ARG B 71  ? 0.2684 0.2635 0.2306 0.0119  0.0152  0.0011  47  ARG B N     
2915 C  CA    . ARG B 71  ? 0.2723 0.2510 0.2484 0.0210  0.0228  0.0119  47  ARG B CA    
2916 C  C     . ARG B 71  ? 0.2835 0.2592 0.2511 0.0126  0.0309  -0.0178 47  ARG B C     
2917 O  O     . ARG B 71  ? 0.3106 0.3194 0.2365 0.0179  0.0471  -0.0013 47  ARG B O     
2918 C  CB    . ARG B 71  ? 0.2589 0.2364 0.2285 0.0124  0.0574  0.0024  47  ARG B CB    
2919 C  CG    . ARG B 71  ? 0.2587 0.2617 0.2489 -0.0092 0.0413  0.0079  47  ARG B CG    
2920 C  CD    . ARG B 71  ? 0.2687 0.2671 0.2506 -0.0244 0.0304  0.0215  47  ARG B CD    
2921 N  NE    . ARG B 71  ? 0.3101 0.2747 0.2828 -0.0424 0.0510  -0.0207 47  ARG B NE    
2922 C  CZ    . ARG B 71  ? 0.3321 0.2814 0.2973 -0.0023 0.0268  -0.0265 47  ARG B CZ    
2923 N  NH1   . ARG B 71  ? 0.3409 0.3181 0.3444 -0.0020 -0.0267 -0.0520 47  ARG B NH1   
2924 N  NH2   . ARG B 71  ? 0.2950 0.3659 0.2571 -0.0265 0.0735  -0.0314 47  ARG B NH2   
2925 N  N     . MSE B 72  ? 0.2503 0.2559 0.2094 -0.0046 0.0234  -0.0025 48  MSE B N     
2926 C  CA    . MSE B 72  ? 0.2481 0.2316 0.2168 0.0116  0.0065  0.0166  48  MSE B CA    
2927 C  C     . MSE B 72  ? 0.2428 0.2185 0.2356 -0.0043 0.0205  0.0298  48  MSE B C     
2928 O  O     . MSE B 72  ? 0.2584 0.2658 0.2062 0.0067  0.0262  0.0272  48  MSE B O     
2929 C  CB    . MSE B 72  ? 0.2747 0.2579 0.2220 0.0000  0.0076  0.0090  48  MSE B CB    
2930 C  CG    . MSE B 72  ? 0.3062 0.3256 0.3416 -0.0376 -0.0164 -0.0026 48  MSE B CG    
2931 SE SE    . MSE B 72  ? 0.4739 0.6004 0.4446 0.0548  0.0030  -0.0893 48  MSE B SE    
2932 C  CE    . MSE B 72  ? 0.4075 0.3607 0.2587 -0.0076 0.0681  -0.0421 48  MSE B CE    
2933 N  N     . GLY B 73  ? 0.2507 0.2520 0.2202 0.0084  0.0370  0.0114  49  GLY B N     
2934 C  CA    . GLY B 73  ? 0.2859 0.1984 0.2425 0.0209  0.0354  0.0043  49  GLY B CA    
2935 C  C     . GLY B 73  ? 0.2599 0.2024 0.2250 0.0155  0.0467  -0.0009 49  GLY B C     
2936 O  O     . GLY B 73  ? 0.2559 0.2610 0.2152 -0.0058 0.0472  0.0017  49  GLY B O     
2937 N  N     . PRO B 74  ? 0.2565 0.2194 0.1868 0.0016  0.0329  -0.0135 50  PRO B N     
2938 C  CA    . PRO B 74  ? 0.3050 0.2200 0.1915 -0.0030 0.0385  -0.0083 50  PRO B CA    
2939 C  C     . PRO B 74  ? 0.2692 0.2392 0.2186 0.0154  0.0373  -0.0075 50  PRO B C     
2940 O  O     . PRO B 74  ? 0.2774 0.2822 0.2010 0.0189  0.0652  -0.0195 50  PRO B O     
2941 C  CB    . PRO B 74  ? 0.3271 0.2383 0.1992 -0.0145 0.0284  0.0128  50  PRO B CB    
2942 C  CG    . PRO B 74  ? 0.3228 0.2184 0.2395 -0.0319 0.0295  0.0183  50  PRO B CG    
2943 C  CD    . PRO B 74  ? 0.3330 0.2406 0.1719 -0.0099 0.0353  0.0226  50  PRO B CD    
2944 N  N     . ALA B 75  ? 0.2662 0.2637 0.1719 0.0279  0.0203  0.0028  51  ALA B N     
2945 C  CA    . ALA B 75  ? 0.2430 0.2260 0.1827 -0.0118 0.0339  0.0102  51  ALA B CA    
2946 C  C     . ALA B 75  ? 0.2322 0.2335 0.2134 0.0079  0.0214  -0.0080 51  ALA B C     
2947 O  O     . ALA B 75  ? 0.2671 0.2549 0.2291 0.0032  0.0011  0.0129  51  ALA B O     
2948 C  CB    . ALA B 75  ? 0.2785 0.2166 0.1908 0.0012  0.0666  0.0011  51  ALA B CB    
2949 N  N     . LEU B 76  ? 0.1591 0.1944 0.1918 0.0038  0.0695  0.0039  52  LEU B N     
2950 C  CA    . LEU B 76  ? 0.1807 0.2422 0.1787 -0.0073 0.0279  -0.0354 52  LEU B CA    
2951 C  C     . LEU B 76  ? 0.1968 0.1783 0.1830 -0.0034 0.0393  0.0057  52  LEU B C     
2952 O  O     . LEU B 76  ? 0.2288 0.2079 0.1932 0.0347  0.0579  0.0131  52  LEU B O     
2953 C  CB    . LEU B 76  ? 0.2366 0.3110 0.3026 -0.0612 0.0873  -0.0001 52  LEU B CB    
2954 C  CG    . LEU B 76  ? 0.2909 0.4175 0.3073 -0.0111 0.0929  -0.0098 52  LEU B CG    
2955 C  CD1   . LEU B 76  ? 0.2895 0.4927 0.5134 -0.0179 0.0871  -0.0035 52  LEU B CD1   
2956 C  CD2   . LEU B 76  ? 0.3426 0.5053 0.4482 0.0199  0.0499  0.0536  52  LEU B CD2   
2957 N  N     . GLU B 77  ? 0.2055 0.1945 0.1794 0.0049  0.0383  -0.0024 53  GLU B N     
2958 C  CA    . GLU B 77  ? 0.1828 0.2265 0.1719 0.0204  0.0267  0.0078  53  GLU B CA    
2959 C  C     . GLU B 77  ? 0.1731 0.2042 0.1655 0.0234  0.0571  0.0058  53  GLU B C     
2960 O  O     . GLU B 77  ? 0.2028 0.2072 0.1988 -0.0049 0.0601  0.0056  53  GLU B O     
2961 C  CB    . GLU B 77  ? 0.1775 0.2243 0.2000 -0.0153 0.0527  0.0032  53  GLU B CB    
2962 C  CG    . GLU B 77  ? 0.1937 0.2198 0.1990 -0.0134 0.0383  0.0016  53  GLU B CG    
2963 C  CD    . GLU B 77  ? 0.1745 0.2078 0.2006 -0.0023 0.0459  0.0028  53  GLU B CD    
2964 O  OE1   . GLU B 77  ? 0.2130 0.2274 0.2704 -0.0216 0.0815  -0.0198 53  GLU B OE1   
2965 O  OE2   . GLU B 77  ? 0.2053 0.2237 0.2301 -0.0091 0.0748  0.0391  53  GLU B OE2   
2966 N  N     . ALA B 78  ? 0.1470 0.2246 0.1395 0.0055  0.0752  -0.0019 54  ALA B N     
2967 C  CA    . ALA B 78  ? 0.1547 0.2274 0.1299 0.0031  0.0462  0.0179  54  ALA B CA    
2968 C  C     . ALA B 78  ? 0.1693 0.1915 0.1333 -0.0150 0.0579  0.0100  54  ALA B C     
2969 O  O     . ALA B 78  ? 0.2016 0.1938 0.1539 0.0043  0.0672  0.0125  54  ALA B O     
2970 C  CB    . ALA B 78  ? 0.1675 0.2548 0.2118 0.0064  0.0801  0.0339  54  ALA B CB    
2971 N  N     . SER B 79  ? 0.1425 0.1993 0.1452 0.0088  0.0531  0.0067  55  SER B N     
2972 C  CA    . SER B 79  ? 0.1755 0.1966 0.1446 -0.0015 0.0451  0.0132  55  SER B CA    
2973 C  C     . SER B 79  ? 0.1693 0.2336 0.1849 -0.0071 0.0221  0.0234  55  SER B C     
2974 O  O     . SER B 79  ? 0.1885 0.2583 0.1894 0.0014  0.0573  0.0225  55  SER B O     
2975 C  CB    . SER B 79  ? 0.2253 0.1966 0.2033 -0.0102 0.0265  0.0017  55  SER B CB    
2976 O  OG    . SER B 79  ? 0.2247 0.2515 0.2450 0.0088  0.1106  -0.0193 55  SER B OG    
2977 N  N     . GLY B 80  ? 0.2196 0.1904 0.1638 0.0177  0.0442  -0.0042 56  GLY B N     
2978 C  CA    . GLY B 80  ? 0.2004 0.2431 0.1626 0.0063  0.0193  0.0158  56  GLY B CA    
2979 C  C     . GLY B 80  ? 0.1237 0.1769 0.1656 -0.0179 0.0405  0.0101  56  GLY B C     
2980 O  O     . GLY B 80  ? 0.1511 0.1850 0.2019 -0.0198 0.0593  -0.0019 56  GLY B O     
2981 N  N     . GLY B 81  ? 0.1124 0.1966 0.1609 -0.0090 0.0319  0.0331  57  GLY B N     
2982 C  CA    . GLY B 81  ? 0.1374 0.2250 0.1591 0.0130  0.0238  0.0325  57  GLY B CA    
2983 C  C     . GLY B 81  ? 0.1411 0.1880 0.1591 0.0029  0.0249  0.0121  57  GLY B C     
2984 O  O     . GLY B 81  ? 0.1658 0.1972 0.1897 -0.0152 0.0277  -0.0034 57  GLY B O     
2985 N  N     . SER B 82  ? 0.1310 0.2115 0.1591 0.0307  0.0243  0.0028  58  SER B N     
2986 C  CA    A SER B 82  ? 0.1200 0.1862 0.1859 0.0228  0.0434  0.0019  58  SER B CA    
2987 C  CA    B SER B 82  ? 0.1218 0.1960 0.1894 0.0248  0.0428  -0.0061 58  SER B CA    
2988 C  C     . SER B 82  ? 0.1431 0.2116 0.1662 -0.0205 0.0329  0.0119  58  SER B C     
2989 O  O     . SER B 82  ? 0.1541 0.1855 0.1639 -0.0089 0.0690  0.0018  58  SER B O     
2990 C  CB    A SER B 82  ? 0.1316 0.1994 0.2073 0.0129  0.0439  0.0276  58  SER B CB    
2991 C  CB    B SER B 82  ? 0.2055 0.2069 0.2171 0.0317  0.0538  0.0141  58  SER B CB    
2992 O  OG    A SER B 82  ? 0.1284 0.1948 0.1937 -0.0297 0.0395  0.0439  58  SER B OG    
2993 O  OG    B SER B 82  ? 0.3184 0.2540 0.2040 0.0082  0.0467  -0.0240 58  SER B OG    
2994 N  N     . ALA B 83  ? 0.1447 0.2348 0.1755 -0.0099 0.0417  0.0026  59  ALA B N     
2995 C  CA    . ALA B 83  ? 0.1711 0.2059 0.1385 -0.0061 0.0620  0.0226  59  ALA B CA    
2996 C  C     . ALA B 83  ? 0.1592 0.1869 0.1664 0.0003  0.0588  -0.0003 59  ALA B C     
2997 O  O     . ALA B 83  ? 0.1422 0.2217 0.2029 -0.0174 0.0504  -0.0087 59  ALA B O     
2998 C  CB    . ALA B 83  ? 0.1763 0.2448 0.1477 -0.0259 0.0752  0.0164  59  ALA B CB    
2999 N  N     . GLY B 84  ? 0.1571 0.2057 0.1646 -0.0062 0.0541  0.0161  60  GLY B N     
3000 C  CA    . GLY B 84  ? 0.1086 0.1987 0.2209 -0.0097 0.0663  0.0348  60  GLY B CA    
3001 C  C     . GLY B 84  ? 0.1473 0.1957 0.1692 -0.0250 0.0658  0.0232  60  GLY B C     
3002 O  O     . GLY B 84  ? 0.1644 0.1997 0.1882 -0.0195 0.0853  0.0342  60  GLY B O     
3003 N  N     . ASN B 85  ? 0.1475 0.2040 0.1809 -0.0220 0.0508  0.0171  61  ASN B N     
3004 C  CA    . ASN B 85  ? 0.1526 0.2018 0.1722 -0.0144 0.0582  -0.0033 61  ASN B CA    
3005 C  C     . ASN B 85  ? 0.1700 0.1780 0.1558 0.0024  0.0358  0.0139  61  ASN B C     
3006 O  O     . ASN B 85  ? 0.1655 0.2011 0.1899 -0.0125 0.0640  0.0095  61  ASN B O     
3007 C  CB    . ASN B 85  ? 0.1603 0.1786 0.1576 -0.0233 0.0419  0.0034  61  ASN B CB    
3008 C  CG    . ASN B 85  ? 0.1644 0.1963 0.1832 -0.0239 0.0330  0.0137  61  ASN B CG    
3009 O  OD1   . ASN B 85  ? 0.1506 0.2317 0.1724 -0.0007 0.0692  0.0315  61  ASN B OD1   
3010 N  ND2   . ASN B 85  ? 0.1633 0.1996 0.1615 -0.0193 0.0886  -0.0029 61  ASN B ND2   
3011 N  N     . THR B 86  ? 0.1743 0.1821 0.1690 0.0108  0.0156  0.0202  62  THR B N     
3012 C  CA    . THR B 86  ? 0.1477 0.1837 0.1557 -0.0038 0.0504  0.0185  62  THR B CA    
3013 C  C     . THR B 86  ? 0.1533 0.1849 0.1763 -0.0155 0.0381  0.0015  62  THR B C     
3014 O  O     . THR B 86  ? 0.1450 0.2127 0.1599 -0.0219 0.0695  0.0234  62  THR B O     
3015 C  CB    . THR B 86  ? 0.1666 0.1864 0.1712 0.0068  0.0438  0.0246  62  THR B CB    
3016 O  OG1   . THR B 86  ? 0.1900 0.1778 0.1878 0.0003  0.0605  0.0280  62  THR B OG1   
3017 C  CG2   . THR B 86  ? 0.1899 0.2383 0.1663 0.0021  0.0400  0.0219  62  THR B CG2   
3018 N  N     . ALA B 87  ? 0.1664 0.1937 0.1862 0.0013  0.0465  0.0132  63  ALA B N     
3019 C  CA    . ALA B 87  ? 0.1203 0.1910 0.1692 0.0132  0.0526  0.0237  63  ALA B CA    
3020 C  C     . ALA B 87  ? 0.1120 0.1872 0.1608 -0.0032 0.0500  0.0142  63  ALA B C     
3021 O  O     . ALA B 87  ? 0.1508 0.1941 0.1703 -0.0053 0.0725  -0.0122 63  ALA B O     
3022 C  CB    . ALA B 87  ? 0.1227 0.2011 0.2102 0.0126  0.0637  -0.0196 63  ALA B CB    
3023 N  N     . ALA B 88  ? 0.1568 0.2305 0.1488 0.0111  0.0553  0.0116  64  ALA B N     
3024 C  CA    . ALA B 88  ? 0.1356 0.1995 0.1752 -0.0104 0.0456  0.0200  64  ALA B CA    
3025 C  C     . ALA B 88  ? 0.1397 0.2125 0.2074 -0.0135 0.0495  0.0153  64  ALA B C     
3026 O  O     . ALA B 88  ? 0.1597 0.2045 0.2332 -0.0063 0.0736  0.0105  64  ALA B O     
3027 C  CB    . ALA B 88  ? 0.1862 0.2288 0.1629 -0.0113 0.0445  0.0141  64  ALA B CB    
3028 N  N     . GLY B 89  ? 0.1397 0.2201 0.1730 -0.0134 0.0442  -0.0007 65  GLY B N     
3029 C  CA    . GLY B 89  ? 0.1357 0.2634 0.1748 -0.0006 0.0394  0.0096  65  GLY B CA    
3030 C  C     . GLY B 89  ? 0.1855 0.2146 0.1925 -0.0214 0.0585  0.0036  65  GLY B C     
3031 O  O     . GLY B 89  ? 0.2160 0.2157 0.2317 -0.0225 0.0837  0.0202  65  GLY B O     
3032 N  N     . VAL B 90  ? 0.1238 0.2198 0.1918 -0.0063 0.0676  -0.0076 66  VAL B N     
3033 C  CA    . VAL B 90  ? 0.1543 0.2038 0.1837 0.0078  0.0484  0.0059  66  VAL B CA    
3034 C  C     . VAL B 90  ? 0.1532 0.2026 0.2148 0.0057  0.0431  0.0050  66  VAL B C     
3035 O  O     . VAL B 90  ? 0.1695 0.2275 0.2513 -0.0160 0.0575  -0.0046 66  VAL B O     
3036 C  CB    . VAL B 90  ? 0.1821 0.2091 0.1868 -0.0050 0.0601  0.0057  66  VAL B CB    
3037 C  CG1   . VAL B 90  ? 0.1618 0.2316 0.2352 -0.0435 0.0466  -0.0095 66  VAL B CG1   
3038 C  CG2   . VAL B 90  ? 0.1636 0.2234 0.2327 0.0009  0.0457  0.0185  66  VAL B CG2   
3039 N  N     . ALA B 91  ? 0.1283 0.1955 0.1975 -0.0031 0.0794  0.0111  67  ALA B N     
3040 C  CA    . ALA B 91  ? 0.1706 0.1871 0.2105 -0.0061 0.0587  0.0053  67  ALA B CA    
3041 C  C     . ALA B 91  ? 0.2170 0.2114 0.1792 0.0085  0.0422  0.0183  67  ALA B C     
3042 O  O     . ALA B 91  ? 0.2157 0.2550 0.2432 -0.0354 0.0680  0.0412  67  ALA B O     
3043 C  CB    . ALA B 91  ? 0.1654 0.2294 0.2859 -0.0181 0.0622  -0.0036 67  ALA B CB    
3044 N  N     . ASN B 92  ? 0.2193 0.2065 0.2117 -0.0240 0.0380  -0.0036 68  ASN B N     
3045 C  CA    . ASN B 92  ? 0.2013 0.2505 0.2344 -0.0284 0.0575  -0.0068 68  ASN B CA    
3046 C  C     . ASN B 92  ? 0.2009 0.2158 0.2252 -0.0150 0.0432  0.0083  68  ASN B C     
3047 O  O     . ASN B 92  ? 0.2305 0.2313 0.2450 -0.0109 0.0871  0.0211  68  ASN B O     
3048 C  CB    . ASN B 92  ? 0.1929 0.2408 0.2396 0.0000  0.0493  -0.0083 68  ASN B CB    
3049 C  CG    . ASN B 92  ? 0.2365 0.3209 0.2468 -0.0271 0.0562  -0.0009 68  ASN B CG    
3050 O  OD1   . ASN B 92  ? 0.2825 0.3071 0.2846 -0.0509 0.0791  0.0192  68  ASN B OD1   
3051 N  ND2   . ASN B 92  ? 0.2652 0.3130 0.2287 -0.0062 0.0561  -0.0046 68  ASN B ND2   
3052 N  N     . LEU B 93  ? 0.1860 0.2392 0.2297 0.0015  0.0399  -0.0030 69  LEU B N     
3053 C  CA    . LEU B 93  ? 0.1923 0.2203 0.2769 0.0023  0.0265  -0.0081 69  LEU B CA    
3054 C  C     . LEU B 93  ? 0.1959 0.2186 0.2641 -0.0063 0.0269  0.0000  69  LEU B C     
3055 O  O     . LEU B 93  ? 0.2124 0.2602 0.2986 -0.0545 0.1065  0.0302  69  LEU B O     
3056 C  CB    . LEU B 93  ? 0.2268 0.2521 0.2452 0.0195  0.0566  0.0101  69  LEU B CB    
3057 C  CG    . LEU B 93  ? 0.2264 0.2283 0.2448 -0.0059 0.0663  0.0157  69  LEU B CG    
3058 C  CD1   . LEU B 93  ? 0.2435 0.2263 0.2902 0.0045  0.0648  0.0318  69  LEU B CD1   
3059 C  CD2   . LEU B 93  ? 0.2211 0.3201 0.2508 -0.0481 0.0484  0.0262  69  LEU B CD2   
3060 N  N     . GLY B 94  ? 0.2201 0.2100 0.2538 0.0107  0.0497  0.0315  70  GLY B N     
3061 C  CA    . GLY B 94  ? 0.1979 0.2196 0.2792 -0.0318 0.0914  0.0227  70  GLY B CA    
3062 C  C     . GLY B 94  ? 0.2354 0.2304 0.2563 -0.0108 0.0306  0.0044  70  GLY B C     
3063 O  O     . GLY B 94  ? 0.2879 0.2915 0.2709 -0.0413 0.0502  -0.0378 70  GLY B O     
3064 N  N     . GLY B 95  ? 0.2073 0.2324 0.2220 0.0055  0.0615  0.0189  71  GLY B N     
3065 C  CA    . GLY B 95  ? 0.1672 0.2347 0.2155 -0.0183 0.0607  -0.0080 71  GLY B CA    
3066 C  C     . GLY B 95  ? 0.1703 0.2316 0.2111 0.0047  0.0441  -0.0275 71  GLY B C     
3067 O  O     . GLY B 95  ? 0.1889 0.2628 0.2076 -0.0117 0.0602  0.0210  71  GLY B O     
3068 N  N     . LYS B 96  ? 0.1610 0.2650 0.2289 0.0182  0.0773  -0.0049 72  LYS B N     
3069 C  CA    . LYS B 96  ? 0.1375 0.2329 0.2554 0.0090  0.0430  0.0043  72  LYS B CA    
3070 C  C     . LYS B 96  ? 0.1736 0.2360 0.2393 0.0067  0.0295  0.0245  72  LYS B C     
3071 O  O     . LYS B 96  ? 0.1930 0.2712 0.2097 -0.0134 0.0476  0.0320  72  LYS B O     
3072 C  CB    . LYS B 96  ? 0.2173 0.2394 0.2571 -0.0303 0.0613  0.0007  72  LYS B CB    
3073 C  CG    . LYS B 96  ? 0.2347 0.2575 0.3509 -0.0404 0.1257  0.0123  72  LYS B CG    
3074 C  CD    . LYS B 96  ? 0.3446 0.4055 0.4033 0.0130  0.1100  0.0736  72  LYS B CD    
3075 C  CE    . LYS B 96  ? 0.4522 0.4160 0.4317 0.0194  0.1263  -0.0267 72  LYS B CE    
3076 N  NZ    . LYS B 96  ? 0.6298 0.4547 0.6326 0.0328  0.0638  0.0423  72  LYS B NZ    
3077 N  N     . ALA B 97  ? 0.2077 0.2030 0.2283 -0.0135 0.0277  0.0126  73  ALA B N     
3078 C  CA    . ALA B 97  ? 0.1530 0.2102 0.2193 -0.0163 0.0327  -0.0152 73  ALA B CA    
3079 C  C     . ALA B 97  ? 0.1604 0.2006 0.1882 -0.0020 0.0499  -0.0063 73  ALA B C     
3080 O  O     . ALA B 97  ? 0.1979 0.2351 0.1888 0.0274  0.0646  -0.0044 73  ALA B O     
3081 C  CB    . ALA B 97  ? 0.2050 0.2077 0.2230 0.0132  0.0454  -0.0111 73  ALA B CB    
3082 N  N     . ALA B 98  ? 0.1602 0.2207 0.2111 -0.0107 0.0476  0.0034  74  ALA B N     
3083 C  CA    . ALA B 98  ? 0.1722 0.2061 0.1483 -0.0372 0.0617  -0.0024 74  ALA B CA    
3084 C  C     . ALA B 98  ? 0.1819 0.1959 0.1791 -0.0136 0.0529  -0.0099 74  ALA B C     
3085 O  O     . ALA B 98  ? 0.1973 0.2165 0.2064 -0.0030 0.0445  0.0021  74  ALA B O     
3086 C  CB    . ALA B 98  ? 0.1902 0.2368 0.1579 -0.0087 0.0636  -0.0263 74  ALA B CB    
3087 N  N     . TYR B 99  ? 0.1975 0.2078 0.1901 -0.0315 0.0611  -0.0274 75  TYR B N     
3088 C  CA    . TYR B 99  ? 0.1527 0.2041 0.1637 -0.0235 0.0540  -0.0158 75  TYR B CA    
3089 C  C     . TYR B 99  ? 0.1517 0.1955 0.1872 -0.0156 0.0585  -0.0060 75  TYR B C     
3090 O  O     . TYR B 99  ? 0.1843 0.2164 0.1911 0.0025  0.0615  0.0080  75  TYR B O     
3091 C  CB    . TYR B 99  ? 0.1784 0.1962 0.1679 -0.0084 0.0510  -0.0196 75  TYR B CB    
3092 C  CG    . TYR B 99  ? 0.1934 0.1916 0.1739 -0.0017 0.0580  -0.0213 75  TYR B CG    
3093 C  CD1   . TYR B 99  ? 0.1783 0.1810 0.1581 -0.0028 0.0788  -0.0058 75  TYR B CD1   
3094 C  CD2   . TYR B 99  ? 0.1858 0.2132 0.1757 -0.0282 0.0700  -0.0117 75  TYR B CD2   
3095 C  CE1   . TYR B 99  ? 0.1661 0.1925 0.1795 -0.0104 0.0440  -0.0076 75  TYR B CE1   
3096 C  CE2   . TYR B 99  ? 0.1701 0.1762 0.1274 -0.0063 0.0849  0.0158  75  TYR B CE2   
3097 C  CZ    . TYR B 99  ? 0.1544 0.1871 0.1424 -0.0070 0.0622  -0.0188 75  TYR B CZ    
3098 O  OH    . TYR B 99  ? 0.2169 0.1934 0.1975 -0.0462 0.0630  0.0019  75  TYR B OH    
3099 N  N     . PHE B 100 ? 0.1507 0.2039 0.1884 -0.0430 0.0506  -0.0131 76  PHE B N     
3100 C  CA    . PHE B 100 ? 0.1423 0.2121 0.1431 -0.0210 0.0574  -0.0022 76  PHE B CA    
3101 C  C     . PHE B 100 ? 0.1583 0.1900 0.1935 -0.0212 0.0342  0.0054  76  PHE B C     
3102 O  O     . PHE B 100 ? 0.1627 0.2296 0.1880 0.0004  0.0598  0.0011  76  PHE B O     
3103 C  CB    . PHE B 100 ? 0.1472 0.2266 0.1335 0.0039  0.0656  -0.0070 76  PHE B CB    
3104 C  CG    . PHE B 100 ? 0.1479 0.2077 0.1801 -0.0002 0.0562  -0.0152 76  PHE B CG    
3105 C  CD1   . PHE B 100 ? 0.1861 0.2061 0.1674 -0.0051 0.0716  -0.0172 76  PHE B CD1   
3106 C  CD2   . PHE B 100 ? 0.1622 0.2437 0.1758 -0.0012 0.0646  -0.0062 76  PHE B CD2   
3107 C  CE1   . PHE B 100 ? 0.1868 0.2365 0.1756 -0.0154 0.0549  -0.0155 76  PHE B CE1   
3108 C  CE2   . PHE B 100 ? 0.1574 0.2116 0.1791 0.0074  0.1048  -0.0187 76  PHE B CE2   
3109 C  CZ    . PHE B 100 ? 0.1698 0.2127 0.1882 0.0058  0.0921  -0.0036 76  PHE B CZ    
3110 N  N     . GLY B 101 ? 0.1514 0.2448 0.1932 -0.0236 0.0360  -0.0094 77  GLY B N     
3111 C  CA    . GLY B 101 ? 0.1402 0.2394 0.1894 -0.0166 0.0685  -0.0179 77  GLY B CA    
3112 C  C     . GLY B 101 ? 0.1578 0.2122 0.1693 -0.0008 0.0641  0.0070  77  GLY B C     
3113 O  O     . GLY B 101 ? 0.1350 0.2132 0.2145 -0.0057 0.0662  0.0121  77  GLY B O     
3114 N  N     . ASN B 102 ? 0.1399 0.2340 0.1944 -0.0031 0.0488  0.0066  78  ASN B N     
3115 C  CA    . ASN B 102 ? 0.1413 0.2290 0.1929 -0.0088 0.0436  0.0102  78  ASN B CA    
3116 C  C     . ASN B 102 ? 0.0892 0.2229 0.1804 -0.0229 0.0614  0.0237  78  ASN B C     
3117 O  O     . ASN B 102 ? 0.1425 0.2338 0.2141 -0.0197 0.0578  0.0126  78  ASN B O     
3118 C  CB    . ASN B 102 ? 0.1535 0.2437 0.2088 0.0036  0.0689  0.0170  78  ASN B CB    
3119 C  CG    . ASN B 102 ? 0.1542 0.2204 0.2156 0.0047  0.0702  0.0121  78  ASN B CG    
3120 O  OD1   . ASN B 102 ? 0.1865 0.2474 0.1952 0.0267  0.0876  0.0015  78  ASN B OD1   
3121 N  ND2   . ASN B 102 ? 0.1859 0.2610 0.2291 -0.0183 0.0683  0.0006  78  ASN B ND2   
3122 N  N     . VAL B 103 ? 0.1662 0.2296 0.1599 -0.0057 0.0774  0.0318  79  VAL B N     
3123 C  CA    . VAL B 103 ? 0.1210 0.2269 0.2022 0.0295  0.0418  0.0280  79  VAL B CA    
3124 C  C     . VAL B 103 ? 0.1215 0.2581 0.2008 0.0137  0.0447  -0.0112 79  VAL B C     
3125 O  O     . VAL B 103 ? 0.1537 0.2887 0.2127 -0.0043 0.0873  -0.0004 79  VAL B O     
3126 C  CB    . VAL B 103 ? 0.1327 0.2269 0.2114 0.0262  0.0634  0.0245  79  VAL B CB    
3127 C  CG1   . VAL B 103 ? 0.1258 0.2766 0.2208 0.0114  0.0565  0.0056  79  VAL B CG1   
3128 C  CG2   . VAL B 103 ? 0.1647 0.2316 0.2371 0.0316  0.0860  0.0297  79  VAL B CG2   
3129 N  N     . ALA B 104 ? 0.1420 0.2608 0.2184 0.0178  0.0222  0.0042  80  ALA B N     
3130 C  CA    . ALA B 104 ? 0.1373 0.2521 0.1847 0.0131  0.0625  0.0018  80  ALA B CA    
3131 C  C     . ALA B 104 ? 0.1333 0.2704 0.2308 0.0241  0.0782  0.0252  80  ALA B C     
3132 O  O     . ALA B 104 ? 0.1382 0.2675 0.2312 0.0168  0.0889  0.0165  80  ALA B O     
3133 C  CB    . ALA B 104 ? 0.1476 0.2739 0.2292 -0.0341 0.1102  -0.0079 80  ALA B CB    
3134 N  N     . ALA B 105 ? 0.1388 0.2687 0.2138 0.0421  0.0734  0.0210  81  ALA B N     
3135 C  CA    . ALA B 105 ? 0.2018 0.2886 0.2218 0.0379  0.0473  0.0241  81  ALA B CA    
3136 C  C     . ALA B 105 ? 0.2051 0.3276 0.2292 0.0124  0.0380  0.0203  81  ALA B C     
3137 O  O     . ALA B 105 ? 0.1984 0.4222 0.2641 -0.0093 0.0573  0.0235  81  ALA B O     
3138 C  CB    . ALA B 105 ? 0.2288 0.3958 0.2774 0.0568  0.0878  0.0216  81  ALA B CB    
3139 N  N     . ASP B 106 ? 0.2060 0.2837 0.2306 -0.0079 0.0378  -0.0156 82  ASP B N     
3140 C  CA    . ASP B 106 ? 0.1571 0.2752 0.2194 -0.0032 0.0543  0.0027  82  ASP B CA    
3141 C  C     . ASP B 106 ? 0.1964 0.2350 0.2074 -0.0220 0.0397  0.0136  82  ASP B C     
3142 O  O     . ASP B 106 ? 0.1968 0.2569 0.1932 -0.0213 0.0592  -0.0131 82  ASP B O     
3143 C  CB    . ASP B 106 ? 0.1519 0.2716 0.2522 -0.0103 0.0702  0.0274  82  ASP B CB    
3144 C  CG    . ASP B 106 ? 0.2045 0.2390 0.2290 0.0075  0.0481  0.0220  82  ASP B CG    
3145 O  OD1   . ASP B 106 ? 0.1967 0.2646 0.2362 0.0062  0.0535  0.0024  82  ASP B OD1   
3146 O  OD2   . ASP B 106 ? 0.2075 0.2483 0.2409 0.0144  0.0764  0.0191  82  ASP B OD2   
3147 N  N     . GLN B 107 ? 0.2032 0.2576 0.2043 -0.0024 0.0518  0.0058  83  GLN B N     
3148 C  CA    . GLN B 107 ? 0.1741 0.2791 0.1910 0.0065  0.0409  0.0049  83  GLN B CA    
3149 C  C     . GLN B 107 ? 0.1740 0.2100 0.1962 -0.0081 0.0038  0.0034  83  GLN B C     
3150 O  O     . GLN B 107 ? 0.1736 0.2350 0.2226 -0.0200 0.0617  0.0044  83  GLN B O     
3151 C  CB    . GLN B 107 ? 0.1755 0.2580 0.2035 -0.0004 0.0089  0.0070  83  GLN B CB    
3152 C  CG    . GLN B 107 ? 0.1912 0.2672 0.2100 0.0203  0.0223  0.0235  83  GLN B CG    
3153 C  CD    . GLN B 107 ? 0.1998 0.2517 0.2086 0.0102  0.0387  -0.0038 83  GLN B CD    
3154 O  OE1   . GLN B 107 ? 0.1677 0.2446 0.2449 -0.0056 0.0253  -0.0052 83  GLN B OE1   
3155 N  NE2   . GLN B 107 ? 0.1942 0.2959 0.2618 0.0001  -0.0018 0.0127  83  GLN B NE2   
3156 N  N     . LEU B 108 ? 0.1867 0.2209 0.1776 0.0117  0.0446  0.0023  84  LEU B N     
3157 C  CA    . LEU B 108 ? 0.1734 0.2143 0.2025 0.0162  0.0646  -0.0037 84  LEU B CA    
3158 C  C     . LEU B 108 ? 0.1807 0.2598 0.2076 0.0053  0.0424  0.0124  84  LEU B C     
3159 O  O     . LEU B 108 ? 0.1814 0.2439 0.2051 -0.0054 0.0548  0.0307  84  LEU B O     
3160 C  CB    . LEU B 108 ? 0.2128 0.2134 0.1707 -0.0039 0.0808  -0.0058 84  LEU B CB    
3161 C  CG    . LEU B 108 ? 0.2493 0.2427 0.2130 -0.0230 0.0600  -0.0441 84  LEU B CG    
3162 C  CD1   . LEU B 108 ? 0.3426 0.2478 0.3070 0.0221  0.0729  -0.0411 84  LEU B CD1   
3163 C  CD2   . LEU B 108 ? 0.2812 0.3208 0.2884 -0.0754 0.0895  -0.0207 84  LEU B CD2   
3164 N  N     . GLY B 109 ? 0.1745 0.2162 0.1875 -0.0062 0.0312  -0.0114 85  GLY B N     
3165 C  CA    . GLY B 109 ? 0.1531 0.2273 0.1638 -0.0274 0.0745  -0.0111 85  GLY B CA    
3166 C  C     . GLY B 109 ? 0.1966 0.2159 0.1964 -0.0077 0.0368  0.0067  85  GLY B C     
3167 O  O     . GLY B 109 ? 0.1583 0.2548 0.2156 -0.0065 0.0502  0.0194  85  GLY B O     
3168 N  N     . ASP B 110 ? 0.1463 0.2537 0.2409 0.0073  0.0499  0.0188  86  ASP B N     
3169 C  CA    . ASP B 110 ? 0.1628 0.2475 0.2312 0.0076  0.0651  0.0156  86  ASP B CA    
3170 C  C     . ASP B 110 ? 0.1730 0.2357 0.1972 -0.0065 0.0644  0.0061  86  ASP B C     
3171 O  O     . ASP B 110 ? 0.1756 0.2625 0.1974 -0.0100 0.0685  -0.0069 86  ASP B O     
3172 C  CB    . ASP B 110 ? 0.1916 0.2925 0.3065 0.0155  0.0351  0.0298  86  ASP B CB    
3173 C  CG    . ASP B 110 ? 0.2407 0.3387 0.3124 0.0064  0.0786  0.0182  86  ASP B CG    
3174 O  OD1   . ASP B 110 ? 0.2832 0.3170 0.3151 0.0193  0.1221  -0.0249 86  ASP B OD1   
3175 O  OD2   . ASP B 110 ? 0.1649 0.4391 0.4287 0.0555  0.1335  0.0523  86  ASP B OD2   
3176 N  N     . ILE B 111 ? 0.1478 0.2466 0.1867 -0.0034 0.0599  0.0081  87  ILE B N     
3177 C  CA    . ILE B 111 ? 0.1490 0.2127 0.1955 -0.0114 0.0633  0.0070  87  ILE B CA    
3178 C  C     . ILE B 111 ? 0.2094 0.2171 0.1941 -0.0130 0.0356  0.0059  87  ILE B C     
3179 O  O     . ILE B 111 ? 0.1938 0.2285 0.1931 -0.0068 0.0338  -0.0065 87  ILE B O     
3180 C  CB    . ILE B 111 ? 0.1839 0.2246 0.1984 -0.0165 0.0495  -0.0011 87  ILE B CB    
3181 C  CG1   . ILE B 111 ? 0.2036 0.2632 0.2095 -0.0306 0.0243  -0.0189 87  ILE B CG1   
3182 C  CG2   . ILE B 111 ? 0.1892 0.2941 0.2019 0.0075  0.0438  -0.0254 87  ILE B CG2   
3183 C  CD1   . ILE B 111 ? 0.2832 0.2318 0.2380 -0.0866 0.0260  0.0000  87  ILE B CD1   
3184 N  N     . PHE B 112 ? 0.2177 0.2388 0.1779 -0.0146 0.0374  0.0091  88  PHE B N     
3185 C  CA    . PHE B 112 ? 0.1989 0.1843 0.1804 0.0034  0.0455  -0.0064 88  PHE B CA    
3186 C  C     . PHE B 112 ? 0.1754 0.1879 0.1845 -0.0145 0.0319  -0.0049 88  PHE B C     
3187 O  O     . PHE B 112 ? 0.1586 0.2124 0.1766 -0.0093 0.0705  -0.0003 88  PHE B O     
3188 C  CB    . PHE B 112 ? 0.2117 0.1834 0.1963 0.0201  0.0259  0.0122  88  PHE B CB    
3189 C  CG    . PHE B 112 ? 0.1682 0.2065 0.1872 -0.0096 0.0285  0.0083  88  PHE B CG    
3190 C  CD1   . PHE B 112 ? 0.2071 0.1986 0.2059 0.0015  0.0193  -0.0114 88  PHE B CD1   
3191 C  CD2   . PHE B 112 ? 0.2057 0.1979 0.1570 -0.0121 0.0420  -0.0087 88  PHE B CD2   
3192 C  CE1   . PHE B 112 ? 0.2020 0.1863 0.2031 0.0222  0.0414  0.0189  88  PHE B CE1   
3193 C  CE2   . PHE B 112 ? 0.1827 0.2030 0.1689 -0.0237 0.0480  -0.0072 88  PHE B CE2   
3194 C  CZ    . PHE B 112 ? 0.1509 0.1881 0.1764 -0.0118 0.0539  -0.0094 88  PHE B CZ    
3195 N  N     . THR B 113 ? 0.1794 0.1857 0.1849 -0.0163 0.0488  0.0048  89  THR B N     
3196 C  CA    . THR B 113 ? 0.1789 0.1882 0.1925 0.0165  0.0594  -0.0064 89  THR B CA    
3197 C  C     . THR B 113 ? 0.1828 0.1849 0.1735 0.0046  0.0276  -0.0076 89  THR B C     
3198 O  O     . THR B 113 ? 0.2087 0.2248 0.1688 -0.0257 0.0468  -0.0011 89  THR B O     
3199 C  CB    . THR B 113 ? 0.1602 0.2032 0.2124 0.0039  0.0463  -0.0050 89  THR B CB    
3200 O  OG1   . THR B 113 ? 0.2027 0.2363 0.2299 -0.0009 0.0573  0.0230  89  THR B OG1   
3201 C  CG2   . THR B 113 ? 0.1891 0.2011 0.2117 -0.0206 0.0754  -0.0049 89  THR B CG2   
3202 N  N     . HIS B 114 ? 0.1664 0.2338 0.1623 0.0103  0.0609  0.0083  90  HIS B N     
3203 C  CA    . HIS B 114 ? 0.1785 0.2137 0.2080 0.0093  0.0479  0.0058  90  HIS B CA    
3204 C  C     . HIS B 114 ? 0.1718 0.2063 0.1807 -0.0044 0.0487  -0.0045 90  HIS B C     
3205 O  O     . HIS B 114 ? 0.1501 0.2367 0.1773 -0.0222 0.0729  0.0160  90  HIS B O     
3206 C  CB    . HIS B 114 ? 0.1768 0.2175 0.2038 -0.0006 0.0495  0.0113  90  HIS B CB    
3207 C  CG    . HIS B 114 ? 0.1784 0.2177 0.2100 -0.0106 0.0453  0.0105  90  HIS B CG    
3208 N  ND1   . HIS B 114 ? 0.2098 0.2147 0.2383 -0.0219 0.0423  -0.0107 90  HIS B ND1   
3209 C  CD2   . HIS B 114 ? 0.1920 0.2030 0.2017 0.0209  0.0419  0.0083  90  HIS B CD2   
3210 C  CE1   . HIS B 114 ? 0.2177 0.1950 0.2407 -0.0094 0.0512  -0.0067 90  HIS B CE1   
3211 N  NE2   . HIS B 114 ? 0.2197 0.2034 0.2074 0.0076  0.0244  0.0122  90  HIS B NE2   
3212 N  N     . ASP B 115 ? 0.1643 0.2161 0.1910 0.0145  0.0556  0.0153  91  ASP B N     
3213 C  CA    . ASP B 115 ? 0.1632 0.2421 0.1906 0.0256  0.0534  0.0160  91  ASP B CA    
3214 C  C     . ASP B 115 ? 0.1905 0.2290 0.2043 -0.0225 0.0370  0.0257  91  ASP B C     
3215 O  O     . ASP B 115 ? 0.1912 0.2688 0.2147 -0.0344 0.0601  0.0264  91  ASP B O     
3216 C  CB    . ASP B 115 ? 0.2055 0.2488 0.1744 -0.0023 0.0636  0.0030  91  ASP B CB    
3217 C  CG    . ASP B 115 ? 0.2089 0.2502 0.1996 0.0313  0.0415  0.0009  91  ASP B CG    
3218 O  OD1   . ASP B 115 ? 0.2529 0.2472 0.2348 0.0211  0.0679  0.0100  91  ASP B OD1   
3219 O  OD2   . ASP B 115 ? 0.2724 0.3024 0.2193 -0.0062 0.0748  -0.0359 91  ASP B OD2   
3220 N  N     . ILE B 116 ? 0.1948 0.2318 0.1702 0.0079  0.0446  -0.0007 92  ILE B N     
3221 C  CA    . ILE B 116 ? 0.1905 0.2153 0.1894 0.0125  0.0320  -0.0033 92  ILE B CA    
3222 C  C     . ILE B 116 ? 0.1911 0.2025 0.1761 0.0157  0.0155  0.0183  92  ILE B C     
3223 O  O     . ILE B 116 ? 0.1997 0.2455 0.2197 -0.0054 0.0257  0.0127  92  ILE B O     
3224 C  CB    . ILE B 116 ? 0.1843 0.2424 0.2193 0.0087  0.0462  0.0172  92  ILE B CB    
3225 C  CG1   . ILE B 116 ? 0.2695 0.2657 0.2148 -0.0057 0.0006  0.0430  92  ILE B CG1   
3226 C  CG2   . ILE B 116 ? 0.1794 0.2321 0.2119 -0.0327 0.0581  0.0129  92  ILE B CG2   
3227 C  CD1   . ILE B 116 ? 0.2604 0.2691 0.2483 -0.0205 0.0127  0.0444  92  ILE B CD1   
3228 N  N     . ARG B 117 ? 0.2059 0.1922 0.1969 0.0194  0.0485  0.0096  93  ARG B N     
3229 C  CA    . ARG B 117 ? 0.1813 0.2007 0.2249 0.0076  0.0418  -0.0115 93  ARG B CA    
3230 C  C     . ARG B 117 ? 0.2136 0.1963 0.1960 0.0098  0.0167  0.0015  93  ARG B C     
3231 O  O     . ARG B 117 ? 0.2018 0.2288 0.2451 -0.0053 0.0358  -0.0232 93  ARG B O     
3232 C  CB    . ARG B 117 ? 0.1779 0.2082 0.2346 0.0082  0.0424  0.0123  93  ARG B CB    
3233 C  CG    . ARG B 117 ? 0.1830 0.2434 0.2090 0.0235  0.0539  -0.0028 93  ARG B CG    
3234 C  CD    . ARG B 117 ? 0.1633 0.2390 0.2647 0.0244  0.0117  -0.0374 93  ARG B CD    
3235 N  NE    . ARG B 117 ? 0.2742 0.2716 0.2785 -0.0032 0.0008  -0.0513 93  ARG B NE    
3236 C  CZ    . ARG B 117 ? 0.2781 0.2372 0.2927 -0.0060 0.0287  -0.0028 93  ARG B CZ    
3237 N  NH1   . ARG B 117 ? 0.2716 0.3094 0.3655 0.0088  0.0340  -0.0206 93  ARG B NH1   
3238 N  NH2   . ARG B 117 ? 0.2710 0.3182 0.2954 -0.0583 0.0660  -0.0361 93  ARG B NH2   
3239 N  N     . ALA B 118 ? 0.2197 0.2454 0.1901 0.0127  0.0485  -0.0069 94  ALA B N     
3240 C  CA    . ALA B 118 ? 0.1926 0.2611 0.2015 0.0068  0.0096  0.0235  94  ALA B CA    
3241 C  C     . ALA B 118 ? 0.1921 0.2746 0.2245 -0.0013 0.0005  0.0033  94  ALA B C     
3242 O  O     . ALA B 118 ? 0.2128 0.3378 0.2881 -0.0151 0.0649  0.0326  94  ALA B O     
3243 C  CB    . ALA B 118 ? 0.1922 0.2770 0.1813 -0.0071 0.0350  0.0179  94  ALA B CB    
3244 N  N     . GLN B 119 ? 0.1890 0.2451 0.2166 -0.0206 0.0382  0.0033  95  GLN B N     
3245 C  CA    . GLN B 119 ? 0.1910 0.2374 0.2349 -0.0044 0.0404  0.0017  95  GLN B CA    
3246 C  C     . GLN B 119 ? 0.2092 0.2413 0.2296 -0.0117 0.0229  0.0162  95  GLN B C     
3247 O  O     . GLN B 119 ? 0.2097 0.2839 0.2394 -0.0091 0.0146  0.0101  95  GLN B O     
3248 C  CB    . GLN B 119 ? 0.2080 0.2292 0.2035 -0.0174 0.0655  0.0089  95  GLN B CB    
3249 C  CG    . GLN B 119 ? 0.2204 0.2964 0.2834 -0.0023 0.0475  -0.0004 95  GLN B CG    
3250 C  CD    . GLN B 119 ? 0.3154 0.3603 0.3001 -0.0301 0.0675  0.0249  95  GLN B CD    
3251 O  OE1   . GLN B 119 ? 0.2758 0.4292 0.3709 -0.0526 0.0573  0.0122  95  GLN B OE1   
3252 N  NE2   . GLN B 119 ? 0.2698 0.4308 0.3285 0.0240  0.0476  -0.0163 95  GLN B NE2   
3253 N  N     . GLY B 120 ? 0.2233 0.2697 0.2124 -0.0306 0.0443  0.0151  96  GLY B N     
3254 C  CA    . GLY B 120 ? 0.2121 0.2516 0.1997 -0.0167 0.0497  0.0223  96  GLY B CA    
3255 C  C     . GLY B 120 ? 0.2111 0.2091 0.2106 0.0055  0.0523  0.0071  96  GLY B C     
3256 O  O     . GLY B 120 ? 0.2074 0.2822 0.2503 0.0083  0.0150  0.0246  96  GLY B O     
3257 N  N     . VAL B 121 ? 0.1962 0.1918 0.2208 0.0170  0.0545  0.0340  97  VAL B N     
3258 C  CA    . VAL B 121 ? 0.1791 0.1886 0.1891 0.0048  0.0593  0.0107  97  VAL B CA    
3259 C  C     . VAL B 121 ? 0.1923 0.2312 0.1821 0.0126  0.0550  -0.0184 97  VAL B C     
3260 O  O     . VAL B 121 ? 0.2311 0.2489 0.2044 0.0003  0.0346  0.0074  97  VAL B O     
3261 C  CB    . VAL B 121 ? 0.1763 0.1928 0.2140 0.0202  0.0438  -0.0025 97  VAL B CB    
3262 C  CG1   . VAL B 121 ? 0.2217 0.1992 0.2253 0.0133  0.0574  0.0040  97  VAL B CG1   
3263 C  CG2   . VAL B 121 ? 0.1841 0.2455 0.2182 0.0380  0.0442  -0.0172 97  VAL B CG2   
3264 N  N     . HIS B 122 ? 0.1843 0.2247 0.1867 -0.0019 0.0383  -0.0182 98  HIS B N     
3265 C  CA    . HIS B 122 ? 0.1907 0.2243 0.1992 -0.0020 0.0468  -0.0191 98  HIS B CA    
3266 C  C     . HIS B 122 ? 0.1644 0.2110 0.2211 0.0146  0.0432  0.0008  98  HIS B C     
3267 O  O     . HIS B 122 ? 0.1568 0.2187 0.2407 0.0104  0.0693  0.0220  98  HIS B O     
3268 C  CB    . HIS B 122 ? 0.2129 0.2514 0.1886 -0.0124 0.0394  0.0030  98  HIS B CB    
3269 C  CG    . HIS B 122 ? 0.1989 0.2690 0.2301 0.0048  0.0483  0.0075  98  HIS B CG    
3270 N  ND1   . HIS B 122 ? 0.2001 0.2743 0.2358 0.0084  0.0356  -0.0010 98  HIS B ND1   
3271 C  CD2   . HIS B 122 ? 0.2303 0.2709 0.1906 -0.0037 0.0523  -0.0041 98  HIS B CD2   
3272 C  CE1   . HIS B 122 ? 0.2432 0.2647 0.2496 -0.0422 0.0486  -0.0130 98  HIS B CE1   
3273 N  NE2   . HIS B 122 ? 0.2548 0.2657 0.2136 0.0132  0.0560  -0.0294 98  HIS B NE2   
3274 N  N     . TYR B 123 ? 0.1781 0.2284 0.2221 -0.0021 0.0147  -0.0299 99  TYR B N     
3275 C  CA    . TYR B 123 ? 0.1278 0.2349 0.1904 0.0044  0.0570  -0.0314 99  TYR B CA    
3276 C  C     . TYR B 123 ? 0.1346 0.2401 0.2239 0.0215  0.0571  -0.0087 99  TYR B C     
3277 O  O     . TYR B 123 ? 0.1413 0.2279 0.2239 0.0042  0.0647  -0.0129 99  TYR B O     
3278 C  CB    . TYR B 123 ? 0.1819 0.2361 0.1933 -0.0157 0.0474  -0.0348 99  TYR B CB    
3279 C  CG    . TYR B 123 ? 0.1850 0.2048 0.2095 -0.0047 0.0509  0.0057  99  TYR B CG    
3280 C  CD1   . TYR B 123 ? 0.1717 0.1979 0.2013 -0.0238 0.0506  0.0090  99  TYR B CD1   
3281 C  CD2   . TYR B 123 ? 0.1753 0.2353 0.2141 -0.0140 0.0493  -0.0226 99  TYR B CD2   
3282 C  CE1   . TYR B 123 ? 0.1913 0.2062 0.2181 -0.0370 0.0288  0.0179  99  TYR B CE1   
3283 C  CE2   . TYR B 123 ? 0.2107 0.2216 0.2174 -0.0207 0.0514  -0.0021 99  TYR B CE2   
3284 C  CZ    . TYR B 123 ? 0.1918 0.2235 0.2031 -0.0104 0.0338  -0.0060 99  TYR B CZ    
3285 O  OH    . TYR B 123 ? 0.2328 0.2462 0.2408 -0.0353 0.0426  -0.0045 99  TYR B OH    
3286 N  N     . GLN B 124 ? 0.1699 0.2389 0.2273 0.0205  0.0696  -0.0097 100 GLN B N     
3287 C  CA    . GLN B 124 ? 0.1570 0.2381 0.2096 0.0095  0.0585  -0.0119 100 GLN B CA    
3288 C  C     . GLN B 124 ? 0.2077 0.2176 0.2292 0.0067  0.0576  0.0037  100 GLN B C     
3289 O  O     . GLN B 124 ? 0.2065 0.2604 0.2834 0.0053  0.0780  -0.0139 100 GLN B O     
3290 C  CB    . GLN B 124 ? 0.2107 0.2065 0.2403 -0.0073 0.0668  -0.0147 100 GLN B CB    
3291 C  CG    . GLN B 124 ? 0.2456 0.2172 0.2215 0.0039  0.0702  0.0120  100 GLN B CG    
3292 C  CD    . GLN B 124 ? 0.2432 0.2805 0.2154 0.0181  0.0600  0.0141  100 GLN B CD    
3293 O  OE1   . GLN B 124 ? 0.2806 0.3016 0.2986 0.0173  0.1044  -0.0059 100 GLN B OE1   
3294 N  NE2   . GLN B 124 ? 0.2043 0.2685 0.2098 0.0114  0.0303  -0.0081 100 GLN B NE2   
3295 N  N     . THR B 125 ? 0.1889 0.2257 0.2224 -0.0028 0.0735  0.0024  101 THR B N     
3296 C  CA    . THR B 125 ? 0.2015 0.2333 0.2616 -0.0197 0.0409  0.0082  101 THR B CA    
3297 C  C     . THR B 125 ? 0.1892 0.2864 0.2761 -0.0094 0.0413  -0.0130 101 THR B C     
3298 O  O     . THR B 125 ? 0.1656 0.3931 0.2852 -0.0141 0.0387  0.0314  101 THR B O     
3299 C  CB    . THR B 125 ? 0.1844 0.2306 0.2580 -0.0186 0.0453  0.0185  101 THR B CB    
3300 O  OG1   . THR B 125 ? 0.1686 0.2459 0.2012 0.0279  0.0718  -0.0103 101 THR B OG1   
3301 C  CG2   . THR B 125 ? 0.1700 0.2483 0.2733 -0.0199 0.0778  0.0130  101 THR B CG2   
3302 N  N     . LYS B 126 ? 0.2279 0.3158 0.2613 -0.0277 0.0668  -0.0282 102 LYS B N     
3303 C  CA    . LYS B 126 ? 0.2419 0.3224 0.3004 0.0219  0.0581  -0.0685 102 LYS B CA    
3304 C  C     . LYS B 126 ? 0.1411 0.2841 0.2735 0.0214  0.0721  -0.0009 102 LYS B C     
3305 O  O     . LYS B 126 ? 0.2301 0.3033 0.2398 0.0063  0.0696  0.0053  102 LYS B O     
3306 C  CB    . LYS B 126 ? 0.2077 0.3468 0.3233 0.0480  0.0595  -0.0637 102 LYS B CB    
3307 C  CG    . LYS B 126 ? 0.2609 0.3265 0.4206 0.0434  0.0850  -0.0809 102 LYS B CG    
3308 C  CD    . LYS B 126 ? 0.3297 0.3996 0.4781 0.0333  0.0561  -0.0096 102 LYS B CD    
3309 C  CE    . LYS B 126 ? 0.4458 0.5077 0.6061 -0.0423 -0.0083 -0.0901 102 LYS B CE    
3310 N  NZ    . LYS B 126 ? 0.3245 0.5424 0.5211 -0.0014 0.1317  -0.1041 102 LYS B NZ    
3311 N  N     . PRO B 127 ? 0.2563 0.3249 0.2670 0.0224  0.0700  -0.0044 103 PRO B N     
3312 C  CA    . PRO B 127 ? 0.2042 0.3375 0.2624 0.0261  0.0514  0.0010  103 PRO B CA    
3313 C  C     . PRO B 127 ? 0.2068 0.2911 0.3057 0.0052  0.0623  -0.0120 103 PRO B C     
3314 O  O     . PRO B 127 ? 0.1407 0.3634 0.3065 -0.0142 0.1309  -0.0298 103 PRO B O     
3315 C  CB    . PRO B 127 ? 0.2995 0.3486 0.2963 0.0086  0.0121  0.0271  103 PRO B CB    
3316 C  CG    . PRO B 127 ? 0.3411 0.4106 0.3471 -0.0485 0.0434  -0.0091 103 PRO B CG    
3317 C  CD    . PRO B 127 ? 0.3497 0.3342 0.3090 0.0105  0.0653  0.0189  103 PRO B CD    
3318 N  N     . LYS B 128 ? 0.1832 0.3459 0.2908 -0.0757 0.0749  0.0167  104 LYS B N     
3319 C  CA    . LYS B 128 ? 0.2345 0.3654 0.2735 -0.0552 0.0918  0.0643  104 LYS B CA    
3320 C  C     . LYS B 128 ? 0.2968 0.5113 0.2989 -0.0490 0.0338  0.0550  104 LYS B C     
3321 O  O     . LYS B 128 ? 0.2946 0.6216 0.3584 -0.0509 0.0600  0.0246  104 LYS B O     
3322 C  CB    . LYS B 128 ? 0.2292 0.3980 0.2779 -0.0267 0.0491  0.0582  104 LYS B CB    
3323 C  CG    . LYS B 128 ? 0.3047 0.4624 0.3169 -0.0301 -0.0050 0.0310  104 LYS B CG    
3324 C  CD    . LYS B 128 ? 0.3537 0.4499 0.4524 -0.0304 0.0383  -0.0184 104 LYS B CD    
3325 C  CE    . LYS B 128 ? 0.4230 0.3632 0.3402 -0.0839 0.0634  -0.0178 104 LYS B CE    
3326 N  NZ    . LYS B 128 ? 0.3583 0.3479 0.2562 -0.0621 0.0217  -0.0178 104 LYS B NZ    
3327 N  N     . GLY B 129 ? 0.2184 0.5123 0.2965 -0.0021 0.0739  0.0076  105 GLY B N     
3328 C  CA    . GLY B 129 ? 0.1590 0.5431 0.2668 0.0091  0.1145  0.0159  105 GLY B CA    
3329 C  C     . GLY B 129 ? 0.2019 0.4812 0.2520 -0.0116 0.0850  0.0028  105 GLY B C     
3330 O  O     . GLY B 129 ? 0.1912 0.3793 0.2665 -0.0074 0.0718  0.0504  105 GLY B O     
3331 N  N     . ALA B 130 ? 0.1975 0.4840 0.2669 -0.0032 0.0727  0.0060  106 ALA B N     
3332 C  CA    . ALA B 130 ? 0.1791 0.3977 0.2405 -0.0552 0.0296  0.0270  106 ALA B CA    
3333 C  C     . ALA B 130 ? 0.2331 0.3922 0.2758 -0.0063 0.0823  0.0693  106 ALA B C     
3334 O  O     . ALA B 130 ? 0.3935 0.4455 0.2723 0.0374  0.0876  0.0427  106 ALA B O     
3335 C  CB    . ALA B 130 ? 0.2173 0.4256 0.3305 -0.0013 0.0072  0.0474  106 ALA B CB    
3336 N  N     . PHE B 131 ? 0.1779 0.3684 0.2568 -0.0266 0.0647  0.0505  107 PHE B N     
3337 C  CA    . PHE B 131 ? 0.1995 0.3768 0.2656 -0.0230 0.0425  0.0338  107 PHE B CA    
3338 C  C     . PHE B 131 ? 0.2469 0.3992 0.2623 -0.0229 0.0272  0.0272  107 PHE B C     
3339 O  O     . PHE B 131 ? 0.1926 0.5129 0.3178 -0.0114 0.0713  0.0021  107 PHE B O     
3340 C  CB    . PHE B 131 ? 0.2194 0.4057 0.3263 -0.0420 0.0314  0.0073  107 PHE B CB    
3341 C  CG    . PHE B 131 ? 0.2449 0.3936 0.3516 -0.0739 0.0483  0.0127  107 PHE B CG    
3342 C  CD1   . PHE B 131 ? 0.2059 0.3350 0.4059 -0.0669 0.0513  0.0253  107 PHE B CD1   
3343 C  CD2   . PHE B 131 ? 0.2517 0.3766 0.4191 -0.0986 0.0669  -0.0637 107 PHE B CD2   
3344 C  CE1   . PHE B 131 ? 0.1958 0.3563 0.4258 -0.0535 0.0107  -0.0132 107 PHE B CE1   
3345 C  CE2   . PHE B 131 ? 0.3119 0.3455 0.5157 -0.1125 0.0603  0.0110  107 PHE B CE2   
3346 C  CZ    . PHE B 131 ? 0.3536 0.4218 0.4382 -0.0272 0.0227  -0.0250 107 PHE B CZ    
3347 N  N     . PRO B 132 ? 0.2364 0.3864 0.2686 -0.0350 0.0614  0.0321  108 PRO B N     
3348 C  CA    . PRO B 132 ? 0.2530 0.3175 0.3015 -0.0468 0.0829  0.0288  108 PRO B CA    
3349 C  C     . PRO B 132 ? 0.1821 0.2903 0.2301 -0.0305 0.0576  0.0030  108 PRO B C     
3350 O  O     . PRO B 132 ? 0.1582 0.2808 0.2103 -0.0238 0.0921  0.0151  108 PRO B O     
3351 C  CB    . PRO B 132 ? 0.2499 0.3244 0.3048 -0.0340 0.0811  0.0281  108 PRO B CB    
3352 C  CG    . PRO B 132 ? 0.2621 0.4447 0.3171 0.0049  0.1004  0.0403  108 PRO B CG    
3353 C  CD    . PRO B 132 ? 0.3392 0.3955 0.2816 -0.0008 0.0341  0.0330  108 PRO B CD    
3354 N  N     . PRO B 133 ? 0.1645 0.2515 0.2368 -0.0319 0.0766  0.0120  109 PRO B N     
3355 C  CA    . PRO B 133 ? 0.1493 0.2514 0.2070 -0.0269 0.0611  0.0123  109 PRO B CA    
3356 C  C     . PRO B 133 ? 0.1581 0.2335 0.2273 -0.0101 0.0370  0.0231  109 PRO B C     
3357 O  O     . PRO B 133 ? 0.1668 0.2320 0.2292 -0.0037 0.0579  0.0260  109 PRO B O     
3358 C  CB    . PRO B 133 ? 0.1576 0.2772 0.2205 -0.0154 0.0625  -0.0203 109 PRO B CB    
3359 C  CG    . PRO B 133 ? 0.2554 0.2773 0.2193 -0.0031 0.0604  -0.0085 109 PRO B CG    
3360 C  CD    . PRO B 133 ? 0.2355 0.2883 0.2387 -0.0344 0.0790  -0.0118 109 PRO B CD    
3361 N  N     . THR B 134 ? 0.1557 0.2353 0.2158 -0.0258 0.0645  -0.0074 110 THR B N     
3362 C  CA    . THR B 134 ? 0.1598 0.1957 0.2284 -0.0274 0.0473  0.0121  110 THR B CA    
3363 C  C     . THR B 134 ? 0.1803 0.2337 0.2080 -0.0111 0.0457  0.0034  110 THR B C     
3364 O  O     . THR B 134 ? 0.1474 0.2771 0.2149 -0.0163 0.0201  0.0034  110 THR B O     
3365 C  CB    . THR B 134 ? 0.1262 0.1949 0.2309 -0.0377 0.0674  0.0038  110 THR B CB    
3366 O  OG1   . THR B 134 ? 0.1464 0.2310 0.2070 -0.0291 0.0801  -0.0002 110 THR B OG1   
3367 C  CG2   . THR B 134 ? 0.1269 0.2450 0.2163 -0.0536 0.0774  0.0204  110 THR B CG2   
3368 N  N     . ALA B 135 ? 0.1723 0.2103 0.2224 0.0068  0.0664  0.0213  111 ALA B N     
3369 C  CA    . ALA B 135 ? 0.2186 0.2012 0.1566 0.0220  0.0362  0.0134  111 ALA B CA    
3370 C  C     . ALA B 135 ? 0.1780 0.1923 0.1780 0.0161  0.0549  0.0020  111 ALA B C     
3371 O  O     . ALA B 135 ? 0.1554 0.2168 0.2277 0.0036  0.0553  0.0152  111 ALA B O     
3372 C  CB    . ALA B 135 ? 0.1734 0.2024 0.2284 0.0067  0.0182  0.0030  111 ALA B CB    
3373 N  N     . ARG B 136 ? 0.1964 0.2101 0.2043 0.0018  0.0627  -0.0171 112 ARG B N     
3374 C  CA    . ARG B 136 ? 0.2374 0.2371 0.1797 0.0111  0.0497  0.0056  112 ARG B CA    
3375 C  C     . ARG B 136 ? 0.1802 0.2190 0.2177 -0.0166 0.0487  0.0044  112 ARG B C     
3376 O  O     . ARG B 136 ? 0.2002 0.2237 0.2328 -0.0145 0.0650  0.0084  112 ARG B O     
3377 C  CB    . ARG B 136 ? 0.2226 0.2102 0.2017 -0.0017 0.0303  -0.0014 112 ARG B CB    
3378 C  CG    . ARG B 136 ? 0.2144 0.2381 0.2002 -0.0147 0.0373  -0.0277 112 ARG B CG    
3379 C  CD    . ARG B 136 ? 0.2425 0.2659 0.2242 0.0019  0.0644  -0.0126 112 ARG B CD    
3380 N  NE    . ARG B 136 ? 0.2239 0.2636 0.2808 0.0151  0.0397  -0.0138 112 ARG B NE    
3381 C  CZ    . ARG B 136 ? 0.2352 0.2913 0.2671 -0.0122 -0.0088 -0.0453 112 ARG B CZ    
3382 N  NH1   . ARG B 136 ? 0.1939 0.3311 0.2487 -0.0250 0.0129  -0.0416 112 ARG B NH1   
3383 N  NH2   . ARG B 136 ? 0.1665 0.3469 0.2652 -0.0204 0.0510  -0.0293 112 ARG B NH2   
3384 N  N     . SER B 137 ? 0.1766 0.2090 0.1947 -0.0129 0.0427  0.0047  113 SER B N     
3385 C  CA    . SER B 137 ? 0.1915 0.2188 0.1529 0.0074  0.0290  0.0105  113 SER B CA    
3386 C  C     . SER B 137 ? 0.1920 0.1877 0.1552 0.0140  0.0362  0.0070  113 SER B C     
3387 O  O     . SER B 137 ? 0.1923 0.2223 0.1825 0.0050  0.0548  0.0177  113 SER B O     
3388 C  CB    . SER B 137 ? 0.1890 0.2105 0.1469 -0.0054 0.0460  0.0106  113 SER B CB    
3389 O  OG    . SER B 137 ? 0.2120 0.2479 0.2300 0.0269  0.0453  0.0031  113 SER B OG    
3390 N  N     . MSE B 138 ? 0.1616 0.1919 0.1504 -0.0027 0.0439  0.0174  114 MSE B N     
3391 C  CA    . MSE B 138 ? 0.1773 0.2093 0.1692 0.0016  0.0539  -0.0140 114 MSE B CA    
3392 C  C     . MSE B 138 ? 0.1767 0.1939 0.1860 0.0117  0.0423  0.0087  114 MSE B C     
3393 O  O     . MSE B 138 ? 0.1681 0.2049 0.1697 0.0242  0.0743  0.0120  114 MSE B O     
3394 C  CB    . MSE B 138 ? 0.2191 0.2199 0.1834 -0.0221 0.0252  0.0088  114 MSE B CB    
3395 C  CG    . MSE B 138 ? 0.2950 0.2975 0.2154 0.0296  0.0122  0.0829  114 MSE B CG    
3396 SE SE    . MSE B 138 ? 0.5317 0.4643 0.4463 -0.0673 -0.0307 0.0052  114 MSE B SE    
3397 C  CE    . MSE B 138 ? 0.3635 0.3856 0.4061 -0.0112 -0.0586 0.0570  114 MSE B CE    
3398 N  N     . ILE B 139 ? 0.1899 0.2069 0.1786 0.0084  0.0331  0.0311  115 ILE B N     
3399 C  CA    . ILE B 139 ? 0.1961 0.2072 0.1714 0.0257  0.0517  0.0055  115 ILE B CA    
3400 C  C     . ILE B 139 ? 0.1946 0.2202 0.1679 0.0441  0.0404  0.0092  115 ILE B C     
3401 O  O     . ILE B 139 ? 0.2227 0.2348 0.1837 0.0299  0.0559  0.0189  115 ILE B O     
3402 C  CB    . ILE B 139 ? 0.1941 0.2371 0.1346 0.0088  0.0572  0.0008  115 ILE B CB    
3403 C  CG1   . ILE B 139 ? 0.2239 0.2354 0.1383 0.0029  0.0651  -0.0076 115 ILE B CG1   
3404 C  CG2   . ILE B 139 ? 0.1802 0.2615 0.1764 -0.0134 0.0443  0.0283  115 ILE B CG2   
3405 C  CD1   . ILE B 139 ? 0.1745 0.2537 0.1546 -0.0294 0.0815  0.0320  115 ILE B CD1   
3406 N  N     . PHE B 140 ? 0.2310 0.1949 0.1818 0.0162  0.0612  -0.0123 116 PHE B N     
3407 C  CA    . PHE B 140 ? 0.1947 0.2171 0.1792 0.0200  0.0558  -0.0081 116 PHE B CA    
3408 C  C     . PHE B 140 ? 0.1927 0.2315 0.1986 0.0135  0.0393  -0.0061 116 PHE B C     
3409 O  O     . PHE B 140 ? 0.1949 0.2635 0.1946 0.0104  0.0558  0.0129  116 PHE B O     
3410 C  CB    . PHE B 140 ? 0.1924 0.2101 0.1636 0.0160  0.0275  0.0052  116 PHE B CB    
3411 C  CG    . PHE B 140 ? 0.1921 0.2253 0.1874 0.0202  0.0165  -0.0049 116 PHE B CG    
3412 C  CD1   . PHE B 140 ? 0.2048 0.2245 0.2071 0.0221  0.0050  0.0032  116 PHE B CD1   
3413 C  CD2   . PHE B 140 ? 0.2295 0.2427 0.2090 0.0009  0.0401  0.0049  116 PHE B CD2   
3414 C  CE1   . PHE B 140 ? 0.2090 0.2021 0.2178 0.0040  0.0317  0.0279  116 PHE B CE1   
3415 C  CE2   . PHE B 140 ? 0.2306 0.2622 0.2558 -0.0075 0.0028  -0.0107 116 PHE B CE2   
3416 C  CZ    . PHE B 140 ? 0.2799 0.2305 0.1908 0.0141  0.0465  0.0036  116 PHE B CZ    
3417 N  N     . VAL B 141 ? 0.1785 0.2585 0.1885 0.0234  0.0630  -0.0141 117 VAL B N     
3418 C  CA    . VAL B 141 ? 0.1841 0.2309 0.2142 -0.0054 0.0597  -0.0102 117 VAL B CA    
3419 C  C     . VAL B 141 ? 0.2144 0.2295 0.2177 0.0081  0.0276  -0.0227 117 VAL B C     
3420 O  O     . VAL B 141 ? 0.2408 0.2791 0.2281 0.0205  0.0285  -0.0069 117 VAL B O     
3421 C  CB    . VAL B 141 ? 0.2143 0.2351 0.2057 -0.0109 0.0665  -0.0085 117 VAL B CB    
3422 C  CG1   . VAL B 141 ? 0.2098 0.2725 0.2874 -0.0070 0.0755  0.0106  117 VAL B CG1   
3423 C  CG2   . VAL B 141 ? 0.2281 0.2647 0.2004 -0.0117 0.0512  -0.0245 117 VAL B CG2   
3424 N  N     . THR B 142 ? 0.2167 0.2555 0.2204 0.0282  0.0622  -0.0169 118 THR B N     
3425 C  CA    . THR B 142 ? 0.3018 0.2598 0.2292 0.0248  0.0689  -0.0326 118 THR B CA    
3426 C  C     . THR B 142 ? 0.2943 0.2940 0.2860 -0.0063 0.0547  -0.0181 118 THR B C     
3427 O  O     . THR B 142 ? 0.2957 0.3041 0.2769 0.0044  0.0651  -0.0157 118 THR B O     
3428 C  CB    . THR B 142 ? 0.2843 0.2697 0.2231 0.0446  0.0551  -0.0358 118 THR B CB    
3429 O  OG1   . THR B 142 ? 0.2853 0.2738 0.2236 0.0374  0.0469  -0.0050 118 THR B OG1   
3430 C  CG2   . THR B 142 ? 0.3144 0.3234 0.2672 0.0054  0.0412  -0.0380 118 THR B CG2   
3431 N  N     . GLU B 143 ? 0.3470 0.3448 0.3035 0.0403  0.0609  -0.0249 119 GLU B N     
3432 C  CA    . GLU B 143 ? 0.3335 0.3591 0.3169 0.0659  0.0730  -0.0333 119 GLU B CA    
3433 C  C     . GLU B 143 ? 0.3590 0.3145 0.3215 0.0133  0.0680  -0.0060 119 GLU B C     
3434 O  O     . GLU B 143 ? 0.3386 0.4384 0.3500 -0.0027 0.1281  0.0529  119 GLU B O     
3435 C  CB    . GLU B 143 ? 0.4845 0.4418 0.3127 0.0258  0.0542  -0.0787 119 GLU B CB    
3436 C  CG    . GLU B 143 ? 0.5334 0.6409 0.4684 0.0028  -0.0179 -0.0664 119 GLU B CG    
3437 C  CD    . GLU B 143 ? 0.6458 0.8066 0.6019 0.0244  0.0645  -0.1967 119 GLU B CD    
3438 O  OE1   . GLU B 143 ? 0.6048 0.9341 0.7441 -0.0138 0.1383  -0.2451 119 GLU B OE1   
3439 O  OE2   . GLU B 143 ? 0.7394 0.9821 0.5428 0.0329  0.1726  -0.1779 119 GLU B OE2   
3440 N  N     . ASP B 144 ? 0.3531 0.3499 0.2906 0.0955  0.0744  -0.0366 120 ASP B N     
3441 C  CA    . ASP B 144 ? 0.3482 0.3608 0.3206 0.0332  0.0816  -0.0257 120 ASP B CA    
3442 C  C     . ASP B 144 ? 0.3047 0.3428 0.2778 0.0243  0.0655  -0.0016 120 ASP B C     
3443 O  O     . ASP B 144 ? 0.2919 0.3861 0.2938 0.0303  0.0772  -0.0152 120 ASP B O     
3444 C  CB    . ASP B 144 ? 0.2941 0.3623 0.3663 0.0404  0.0810  -0.0091 120 ASP B CB    
3445 C  CG    . ASP B 144 ? 0.3109 0.3290 0.3076 0.0428  0.0764  -0.0167 120 ASP B CG    
3446 O  OD1   . ASP B 144 ? 0.3148 0.3148 0.2420 0.0322  0.0904  -0.0456 120 ASP B OD1   
3447 O  OD2   . ASP B 144 ? 0.3239 0.3283 0.2968 0.0486  0.0927  -0.0245 120 ASP B OD2   
3448 N  N     . GLY B 145 ? 0.3517 0.2749 0.2763 0.0440  0.0826  -0.0055 121 GLY B N     
3449 C  CA    . GLY B 145 ? 0.3048 0.3060 0.2418 -0.0024 0.0797  -0.0247 121 GLY B CA    
3450 C  C     . GLY B 145 ? 0.2862 0.2650 0.2527 0.0062  0.0546  0.0061  121 GLY B C     
3451 O  O     . GLY B 145 ? 0.2843 0.2998 0.2746 -0.0035 0.0496  -0.0241 121 GLY B O     
3452 N  N     . GLU B 146 ? 0.2864 0.2746 0.2555 -0.0136 0.0761  0.0153  122 GLU B N     
3453 C  CA    . GLU B 146 ? 0.2275 0.2648 0.2452 -0.0172 0.0611  -0.0087 122 GLU B CA    
3454 C  C     . GLU B 146 ? 0.2341 0.2540 0.2166 0.0008  0.0465  -0.0191 122 GLU B C     
3455 O  O     . GLU B 146 ? 0.2072 0.2819 0.2353 0.0082  0.0655  -0.0169 122 GLU B O     
3456 C  CB    . GLU B 146 ? 0.2234 0.2723 0.2658 0.0015  0.0803  0.0028  122 GLU B CB    
3457 C  CG    . GLU B 146 ? 0.2903 0.3493 0.2732 0.0147  0.0805  0.0202  122 GLU B CG    
3458 C  CD    . GLU B 146 ? 0.2859 0.3900 0.3658 0.0569  0.0403  -0.0386 122 GLU B CD    
3459 O  OE1   . GLU B 146 ? 0.1866 0.3964 0.2773 0.0481  0.0527  -0.0093 122 GLU B OE1   
3460 O  OE2   . GLU B 146 ? 0.2808 0.4491 0.4506 0.0713  0.0382  -0.0102 122 GLU B OE2   
3461 N  N     . ARG B 147 ? 0.1838 0.2593 0.2271 0.0110  0.0567  -0.0120 123 ARG B N     
3462 C  CA    A ARG B 147 ? 0.1892 0.2147 0.2247 0.0153  0.0434  -0.0086 123 ARG B CA    
3463 C  CA    B ARG B 147 ? 0.1930 0.2089 0.2278 0.0199  0.0470  -0.0095 123 ARG B CA    
3464 C  C     . ARG B 147 ? 0.2087 0.2143 0.2179 -0.0030 0.0339  -0.0118 123 ARG B C     
3465 O  O     . ARG B 147 ? 0.1968 0.2532 0.2172 -0.0044 0.0457  -0.0033 123 ARG B O     
3466 C  CB    A ARG B 147 ? 0.2145 0.2228 0.2021 -0.0131 0.0166  -0.0289 123 ARG B CB    
3467 C  CB    B ARG B 147 ? 0.2205 0.2229 0.2203 0.0063  0.0212  -0.0294 123 ARG B CB    
3468 C  CG    A ARG B 147 ? 0.2059 0.2484 0.1912 -0.0127 0.0094  0.0076  123 ARG B CG    
3469 C  CG    B ARG B 147 ? 0.2287 0.2322 0.2027 0.0075  0.0290  -0.0177 123 ARG B CG    
3470 C  CD    A ARG B 147 ? 0.2037 0.2567 0.1804 -0.0234 0.0149  -0.0083 123 ARG B CD    
3471 C  CD    B ARG B 147 ? 0.2045 0.2204 0.2089 0.0307  0.0161  -0.0088 123 ARG B CD    
3472 N  NE    A ARG B 147 ? 0.2429 0.2127 0.1818 0.0037  0.0392  0.0252  123 ARG B NE    
3473 N  NE    B ARG B 147 ? 0.1937 0.1979 0.1900 0.0355  0.0526  -0.0105 123 ARG B NE    
3474 C  CZ    A ARG B 147 ? 0.1899 0.1580 0.1563 -0.0038 0.0209  -0.0119 123 ARG B CZ    
3475 C  CZ    B ARG B 147 ? 0.2097 0.1943 0.1936 0.0104  0.0245  -0.0102 123 ARG B CZ    
3476 N  NH1   A ARG B 147 ? 0.2547 0.1582 0.2463 -0.0221 0.0332  -0.0188 123 ARG B NH1   
3477 N  NH1   B ARG B 147 ? 0.2248 0.1883 0.2402 -0.0033 0.0232  0.0087  123 ARG B NH1   
3478 N  NH2   A ARG B 147 ? 0.1440 0.1940 0.1562 0.0069  0.0363  -0.0059 123 ARG B NH2   
3479 N  NH2   B ARG B 147 ? 0.2519 0.2773 0.1865 -0.0130 0.0304  0.0049  123 ARG B NH2   
3480 N  N     . SER B 148 ? 0.2040 0.2340 0.2008 0.0091  0.0301  0.0040  124 SER B N     
3481 C  CA    . SER B 148 ? 0.1882 0.2142 0.2260 0.0201  0.0316  -0.0040 124 SER B CA    
3482 C  C     . SER B 148 ? 0.1899 0.1969 0.1711 0.0162  0.0368  -0.0169 124 SER B C     
3483 O  O     . SER B 148 ? 0.1978 0.2156 0.1738 0.0098  0.0460  -0.0017 124 SER B O     
3484 C  CB    . SER B 148 ? 0.2168 0.2292 0.2143 0.0338  0.0201  -0.0154 124 SER B CB    
3485 O  OG    . SER B 148 ? 0.1935 0.2501 0.2362 0.0033  0.0369  -0.0131 124 SER B OG    
3486 N  N     . MSE B 149 ? 0.1712 0.2363 0.1662 0.0068  0.0480  0.0145  125 MSE B N     
3487 C  CA    . MSE B 149 ? 0.1685 0.2184 0.1897 0.0037  0.0417  0.0080  125 MSE B CA    
3488 C  C     . MSE B 149 ? 0.1777 0.1916 0.1710 -0.0013 0.0297  0.0175  125 MSE B C     
3489 O  O     . MSE B 149 ? 0.1965 0.2000 0.1925 0.0075  0.0359  0.0238  125 MSE B O     
3490 C  CB    . MSE B 149 ? 0.1382 0.2641 0.1707 -0.0005 0.0619  -0.0014 125 MSE B CB    
3491 C  CG    . MSE B 149 ? 0.1797 0.2776 0.2387 -0.0401 0.0524  0.0608  125 MSE B CG    
3492 SE SE    . MSE B 149 ? 0.3999 0.3762 0.3520 -0.0261 0.0204  0.0181  125 MSE B SE    
3493 C  CE    . MSE B 149 ? 0.1289 0.2662 0.2777 -0.0114 0.0779  -0.0070 125 MSE B CE    
3494 N  N     . ASN B 150 ? 0.1777 0.2023 0.1548 -0.0005 0.0403  0.0057  126 ASN B N     
3495 C  CA    . ASN B 150 ? 0.1737 0.2042 0.2105 -0.0088 0.0224  -0.0065 126 ASN B CA    
3496 C  C     . ASN B 150 ? 0.1543 0.2360 0.1799 0.0029  0.0201  0.0083  126 ASN B C     
3497 O  O     . ASN B 150 ? 0.1717 0.2116 0.1527 0.0000  0.0729  0.0214  126 ASN B O     
3498 C  CB    . ASN B 150 ? 0.1965 0.1844 0.1953 -0.0106 0.0481  -0.0172 126 ASN B CB    
3499 C  CG    . ASN B 150 ? 0.2113 0.2004 0.1974 0.0047  0.0482  -0.0157 126 ASN B CG    
3500 O  OD1   . ASN B 150 ? 0.2384 0.2115 0.2173 -0.0008 0.0679  0.0062  126 ASN B OD1   
3501 N  ND2   . ASN B 150 ? 0.2444 0.2145 0.1940 -0.0220 0.0276  0.0130  126 ASN B ND2   
3502 N  N     . THR B 151 ? 0.1502 0.2036 0.1874 -0.0459 0.0571  -0.0155 127 THR B N     
3503 C  CA    . THR B 151 ? 0.1520 0.1866 0.1852 -0.0387 0.0352  -0.0021 127 THR B CA    
3504 C  C     . THR B 151 ? 0.1426 0.1945 0.1775 -0.0099 0.0378  0.0163  127 THR B C     
3505 O  O     . THR B 151 ? 0.1630 0.2251 0.1946 -0.0220 0.0347  0.0339  127 THR B O     
3506 C  CB    . THR B 151 ? 0.1293 0.1868 0.1940 -0.0301 0.0392  -0.0068 127 THR B CB    
3507 O  OG1   . THR B 151 ? 0.1546 0.2281 0.1782 -0.0303 0.0608  0.0164  127 THR B OG1   
3508 C  CG2   . THR B 151 ? 0.1352 0.1902 0.1961 -0.0401 0.0796  -0.0035 127 THR B CG2   
3509 N  N     . TYR B 152 ? 0.1683 0.2020 0.1690 0.0069  0.0563  0.0196  128 TYR B N     
3510 C  CA    . TYR B 152 ? 0.1619 0.2348 0.1947 -0.0227 0.0565  0.0030  128 TYR B CA    
3511 C  C     . TYR B 152 ? 0.1495 0.2092 0.1789 -0.0112 0.0559  0.0197  128 TYR B C     
3512 O  O     . TYR B 152 ? 0.1701 0.2062 0.1919 -0.0150 0.0613  0.0192  128 TYR B O     
3513 C  CB    . TYR B 152 ? 0.1715 0.2780 0.2125 -0.0025 0.0500  0.0028  128 TYR B CB    
3514 C  CG    . TYR B 152 ? 0.1782 0.2591 0.2113 -0.0105 0.0590  0.0135  128 TYR B CG    
3515 C  CD1   . TYR B 152 ? 0.2122 0.2614 0.3264 -0.0005 0.0716  0.0610  128 TYR B CD1   
3516 C  CD2   . TYR B 152 ? 0.1950 0.2967 0.2576 0.0200  0.0720  0.0341  128 TYR B CD2   
3517 C  CE1   . TYR B 152 ? 0.2335 0.3382 0.3255 0.0220  0.0811  0.0238  128 TYR B CE1   
3518 C  CE2   . TYR B 152 ? 0.2298 0.3279 0.2836 0.0233  0.1031  -0.0042 128 TYR B CE2   
3519 C  CZ    . TYR B 152 ? 0.2406 0.3134 0.2844 0.0042  0.0633  -0.0021 128 TYR B CZ    
3520 O  OH    . TYR B 152 ? 0.2683 0.3584 0.3527 -0.0043 0.1203  0.0298  128 TYR B OH    
3521 N  N     . LEU B 153 ? 0.1628 0.2519 0.1711 -0.0242 0.0594  0.0252  129 LEU B N     
3522 C  CA    . LEU B 153 ? 0.1948 0.2101 0.2109 -0.0023 0.0336  0.0219  129 LEU B CA    
3523 C  C     . LEU B 153 ? 0.1597 0.2394 0.1946 -0.0143 0.0420  -0.0127 129 LEU B C     
3524 O  O     . LEU B 153 ? 0.1604 0.2233 0.2125 -0.0318 0.0566  0.0077  129 LEU B O     
3525 C  CB    . LEU B 153 ? 0.1975 0.2401 0.2093 0.0051  0.0358  0.0365  129 LEU B CB    
3526 C  CG    . LEU B 153 ? 0.2084 0.2880 0.2435 0.0237  0.0098  0.0399  129 LEU B CG    
3527 C  CD1   . LEU B 153 ? 0.2948 0.3787 0.2383 0.0877  -0.0026 0.0665  129 LEU B CD1   
3528 C  CD2   . LEU B 153 ? 0.1496 0.3686 0.3324 0.0056  0.0616  -0.0144 129 LEU B CD2   
3529 N  N     . GLY B 154 ? 0.1476 0.2610 0.1854 -0.0142 0.0602  -0.0074 130 GLY B N     
3530 C  CA    . GLY B 154 ? 0.1657 0.2525 0.2329 -0.0059 0.0198  0.0085  130 GLY B CA    
3531 C  C     . GLY B 154 ? 0.1410 0.2192 0.2231 -0.0211 0.0384  0.0193  130 GLY B C     
3532 O  O     . GLY B 154 ? 0.1896 0.2781 0.2198 -0.0215 0.0436  0.0343  130 GLY B O     
3533 N  N     . ALA B 155 ? 0.1395 0.2172 0.2079 -0.0188 0.0495  -0.0043 131 ALA B N     
3534 C  CA    . ALA B 155 ? 0.1534 0.2119 0.2066 -0.0283 0.0567  -0.0021 131 ALA B CA    
3535 C  C     . ALA B 155 ? 0.1887 0.2408 0.1969 -0.0085 0.0390  0.0101  131 ALA B C     
3536 O  O     . ALA B 155 ? 0.1828 0.2702 0.2065 -0.0083 0.0767  0.0087  131 ALA B O     
3537 C  CB    . ALA B 155 ? 0.1516 0.2337 0.2397 -0.0080 0.0917  0.0322  131 ALA B CB    
3538 N  N     . CYS B 156 ? 0.2049 0.2517 0.2025 0.0145  0.0434  0.0279  132 CYS B N     
3539 C  CA    . CYS B 156 ? 0.1889 0.2646 0.2125 0.0164  0.0504  0.0128  132 CYS B CA    
3540 C  C     . CYS B 156 ? 0.1992 0.2459 0.2095 0.0023  0.0404  0.0127  132 CYS B C     
3541 O  O     . CYS B 156 ? 0.2283 0.2816 0.1880 -0.0233 0.0632  0.0163  132 CYS B O     
3542 C  CB    . CYS B 156 ? 0.1984 0.2105 0.2127 -0.0121 0.0678  0.0053  132 CYS B CB    
3543 S  SG    . CYS B 156 ? 0.1976 0.2593 0.2240 -0.0293 0.0644  0.0300  132 CYS B SG    
3544 N  N     . VAL B 157 ? 0.2451 0.2429 0.2234 -0.0108 0.0265  -0.0030 133 VAL B N     
3545 C  CA    . VAL B 157 ? 0.2489 0.2739 0.2620 -0.0406 0.0686  0.0028  133 VAL B CA    
3546 C  C     . VAL B 157 ? 0.2153 0.2647 0.2089 -0.0346 0.0350  0.0241  133 VAL B C     
3547 O  O     . VAL B 157 ? 0.2329 0.3429 0.2153 -0.0160 0.0678  0.0472  133 VAL B O     
3548 C  CB    . VAL B 157 ? 0.2421 0.2929 0.2322 -0.0364 0.0399  0.0106  133 VAL B CB    
3549 C  CG1   . VAL B 157 ? 0.2262 0.3016 0.2657 -0.0489 0.0304  -0.0268 133 VAL B CG1   
3550 C  CG2   . VAL B 157 ? 0.2317 0.3211 0.2227 -0.0513 0.0446  0.0605  133 VAL B CG2   
3551 N  N     . GLU B 158 ? 0.1907 0.2584 0.2275 -0.0450 0.0617  0.0129  134 GLU B N     
3552 C  CA    . GLU B 158 ? 0.2497 0.2829 0.2351 -0.0105 0.0748  0.0139  134 GLU B CA    
3553 C  C     . GLU B 158 ? 0.1937 0.3023 0.2860 0.0080  0.0873  -0.0149 134 GLU B C     
3554 O  O     . GLU B 158 ? 0.2175 0.3859 0.2701 -0.0022 0.1081  -0.0256 134 GLU B O     
3555 C  CB    . GLU B 158 ? 0.2538 0.3711 0.2735 0.0215  0.0592  0.0018  134 GLU B CB    
3556 C  CG    . GLU B 158 ? 0.3351 0.4444 0.3702 -0.0791 0.0519  -0.0105 134 GLU B CG    
3557 C  CD    . GLU B 158 ? 0.3738 0.6084 0.5442 -0.0461 0.1149  -0.0631 134 GLU B CD    
3558 O  OE1   . GLU B 158 ? 0.4323 0.6633 0.4480 -0.1075 0.1650  -0.0398 134 GLU B OE1   
3559 O  OE2   . GLU B 158 ? 0.5871 0.6077 0.7438 -0.0222 0.0610  -0.0240 134 GLU B OE2   
3560 N  N     . LEU B 159 ? 0.1769 0.2874 0.2147 -0.0105 0.0515  0.0356  135 LEU B N     
3561 C  CA    . LEU B 159 ? 0.1522 0.2967 0.1916 0.0017  0.0860  0.0007  135 LEU B CA    
3562 C  C     . LEU B 159 ? 0.1273 0.2707 0.2133 0.0067  0.0742  0.0100  135 LEU B C     
3563 O  O     . LEU B 159 ? 0.2209 0.2805 0.2069 0.0098  0.1022  0.0146  135 LEU B O     
3564 C  CB    . LEU B 159 ? 0.1446 0.2620 0.2049 0.0196  0.0819  0.0039  135 LEU B CB    
3565 C  CG    . LEU B 159 ? 0.1567 0.2442 0.2219 0.0216  0.0800  0.0071  135 LEU B CG    
3566 C  CD1   . LEU B 159 ? 0.1373 0.2494 0.2289 0.0201  0.1148  0.0221  135 LEU B CD1   
3567 C  CD2   . LEU B 159 ? 0.1538 0.2565 0.2145 0.0214  0.0748  -0.0055 135 LEU B CD2   
3568 N  N     . GLY B 160 ? 0.1963 0.3235 0.2244 -0.0214 0.0627  -0.0104 136 GLY B N     
3569 C  CA    . GLY B 160 ? 0.1563 0.3638 0.2120 -0.0094 0.0652  -0.0192 136 GLY B CA    
3570 C  C     . GLY B 160 ? 0.1572 0.2669 0.2213 0.0236  0.0745  -0.0006 136 GLY B C     
3571 O  O     . GLY B 160 ? 0.1759 0.3092 0.2079 -0.0106 0.0993  0.0232  136 GLY B O     
3572 N  N     . PRO B 161 ? 0.1984 0.3044 0.2202 0.0100  0.1048  0.0138  137 PRO B N     
3573 C  CA    . PRO B 161 ? 0.2324 0.3040 0.2285 -0.0149 0.0959  0.0118  137 PRO B CA    
3574 C  C     . PRO B 161 ? 0.2356 0.3106 0.2101 0.0010  0.0877  -0.0053 137 PRO B C     
3575 O  O     . PRO B 161 ? 0.2581 0.3479 0.1978 -0.0247 0.1088  -0.0013 137 PRO B O     
3576 C  CB    . PRO B 161 ? 0.2786 0.2960 0.2300 -0.0168 0.0689  0.0334  137 PRO B CB    
3577 C  CG    . PRO B 161 ? 0.3429 0.3213 0.2191 -0.0320 0.0872  -0.0090 137 PRO B CG    
3578 C  CD    . PRO B 161 ? 0.3164 0.3166 0.2266 -0.0289 0.0656  0.0184  137 PRO B CD    
3579 N  N     . GLU B 162 ? 0.2452 0.3130 0.2577 0.0215  0.0780  0.0073  138 GLU B N     
3580 C  CA    . GLU B 162 ? 0.2558 0.3069 0.2895 0.0097  0.0395  0.0176  138 GLU B CA    
3581 C  C     . GLU B 162 ? 0.2403 0.3217 0.2732 0.0354  0.0702  0.0033  138 GLU B C     
3582 O  O     . GLU B 162 ? 0.2326 0.3210 0.2562 0.0128  0.1505  -0.0122 138 GLU B O     
3583 C  CB    . GLU B 162 ? 0.2376 0.4016 0.3417 0.0433  0.0475  -0.0057 138 GLU B CB    
3584 C  CG    . GLU B 162 ? 0.3049 0.4316 0.3821 0.0124  0.0596  -0.0482 138 GLU B CG    
3585 C  CD    . GLU B 162 ? 0.3324 0.4390 0.3774 -0.0140 0.0045  -0.0064 138 GLU B CD    
3586 O  OE1   . GLU B 162 ? 0.1800 0.3425 0.3758 -0.0095 0.1181  0.0435  138 GLU B OE1   
3587 O  OE2   . GLU B 162 ? 0.5140 0.4941 0.5707 -0.0007 -0.0582 -0.1546 138 GLU B OE2   
3588 N  N     . ASP B 163 ? 0.2594 0.3172 0.2443 0.0142  0.0777  -0.0010 139 ASP B N     
3589 C  CA    . ASP B 163 ? 0.2622 0.2815 0.2553 -0.0196 0.0503  -0.0148 139 ASP B CA    
3590 C  C     . ASP B 163 ? 0.2332 0.2644 0.2384 0.0117  0.0423  0.0188  139 ASP B C     
3591 O  O     . ASP B 163 ? 0.2626 0.3101 0.1910 -0.0187 0.0426  0.0027  139 ASP B O     
3592 C  CB    . ASP B 163 ? 0.2496 0.2527 0.2281 -0.0187 0.0344  0.0059  139 ASP B CB    
3593 C  CG    . ASP B 163 ? 0.2271 0.2632 0.2270 -0.0028 0.0686  -0.0104 139 ASP B CG    
3594 O  OD1   . ASP B 163 ? 0.2639 0.3033 0.2321 0.0218  0.0556  -0.0008 139 ASP B OD1   
3595 O  OD2   . ASP B 163 ? 0.2071 0.2692 0.2528 -0.0065 0.0841  0.0095  139 ASP B OD2   
3596 N  N     . VAL B 164 ? 0.2045 0.2762 0.2208 0.0232  0.0604  -0.0180 140 VAL B N     
3597 C  CA    . VAL B 164 ? 0.2335 0.2560 0.2247 0.0065  0.0373  -0.0043 140 VAL B CA    
3598 C  C     . VAL B 164 ? 0.2742 0.2586 0.2400 -0.0187 0.0747  -0.0174 140 VAL B C     
3599 O  O     . VAL B 164 ? 0.3185 0.3339 0.2506 0.0003  0.0940  -0.0457 140 VAL B O     
3600 C  CB    . VAL B 164 ? 0.2235 0.2552 0.2334 0.0000  0.0496  0.0071  140 VAL B CB    
3601 C  CG1   . VAL B 164 ? 0.2233 0.3032 0.2303 -0.0215 0.0622  0.0054  140 VAL B CG1   
3602 C  CG2   . VAL B 164 ? 0.2177 0.2725 0.2679 -0.0097 0.0505  -0.0253 140 VAL B CG2   
3603 N  N     . GLU B 165 ? 0.2295 0.2775 0.2097 -0.0104 0.0854  -0.0242 141 GLU B N     
3604 C  CA    . GLU B 165 ? 0.2159 0.2637 0.1914 0.0160  0.0780  -0.0054 141 GLU B CA    
3605 C  C     . GLU B 165 ? 0.2396 0.3075 0.2067 -0.0156 0.0634  -0.0098 141 GLU B C     
3606 O  O     . GLU B 165 ? 0.2351 0.2733 0.2230 0.0014  0.0681  -0.0201 141 GLU B O     
3607 C  CB    . GLU B 165 ? 0.2295 0.2892 0.2247 0.0230  0.0466  0.0276  141 GLU B CB    
3608 C  CG    . GLU B 165 ? 0.2418 0.3314 0.2464 0.0392  0.0321  0.0120  141 GLU B CG    
3609 C  CD    . GLU B 165 ? 0.2384 0.2880 0.2381 0.0293  0.0418  -0.0211 141 GLU B CD    
3610 O  OE1   . GLU B 165 ? 0.2410 0.3210 0.2332 0.0029  0.0818  -0.0269 141 GLU B OE1   
3611 O  OE2   . GLU B 165 ? 0.2074 0.3279 0.2262 -0.0065 0.1165  -0.0381 141 GLU B OE2   
3612 N  N     . ALA B 166 ? 0.2563 0.3062 0.2072 0.0048  0.0849  -0.0472 142 ALA B N     
3613 C  CA    . ALA B 166 ? 0.2903 0.3244 0.1905 -0.0144 0.0744  -0.0206 142 ALA B CA    
3614 C  C     . ALA B 166 ? 0.2550 0.2988 0.2129 0.0130  0.0760  -0.0267 142 ALA B C     
3615 O  O     . ALA B 166 ? 0.2764 0.3462 0.2080 0.0463  0.0570  -0.0237 142 ALA B O     
3616 C  CB    . ALA B 166 ? 0.3718 0.3409 0.1692 0.0089  0.0709  0.0024  142 ALA B CB    
3617 N  N     . ASP B 167 ? 0.2338 0.2989 0.2597 0.0076  0.0728  -0.0237 143 ASP B N     
3618 C  CA    A ASP B 167 ? 0.2755 0.2931 0.2705 -0.0047 0.0435  -0.0260 143 ASP B CA    
3619 C  CA    B ASP B 167 ? 0.2803 0.2964 0.2659 -0.0089 0.0417  -0.0261 143 ASP B CA    
3620 C  C     . ASP B 167 ? 0.2579 0.3260 0.2650 -0.0087 0.0280  -0.0426 143 ASP B C     
3621 O  O     . ASP B 167 ? 0.2875 0.3175 0.2964 -0.0412 0.0293  -0.0538 143 ASP B O     
3622 C  CB    A ASP B 167 ? 0.3207 0.2847 0.3189 0.0015  0.0556  -0.0245 143 ASP B CB    
3623 C  CB    B ASP B 167 ? 0.3668 0.2836 0.3268 -0.0008 0.0373  -0.0161 143 ASP B CB    
3624 C  CG    A ASP B 167 ? 0.3419 0.3313 0.3621 0.0290  0.0201  -0.0116 143 ASP B CG    
3625 C  CG    B ASP B 167 ? 0.4227 0.3945 0.3722 0.0166  0.0860  -0.0105 143 ASP B CG    
3626 O  OD1   A ASP B 167 ? 0.3923 0.3314 0.3800 0.0388  -0.0060 -0.0776 143 ASP B OD1   
3627 O  OD1   B ASP B 167 ? 0.4624 0.3564 0.4203 0.0342  0.0582  -0.0087 143 ASP B OD1   
3628 O  OD2   A ASP B 167 ? 0.4196 0.3067 0.4802 0.0347  0.0691  0.0070  143 ASP B OD2   
3629 O  OD2   B ASP B 167 ? 0.4091 0.4031 0.3260 0.0129  0.1311  0.0249  143 ASP B OD2   
3630 N  N     . VAL B 168 ? 0.2434 0.2584 0.2305 0.0321  0.0519  -0.0305 144 VAL B N     
3631 C  CA    . VAL B 168 ? 0.2623 0.2577 0.2212 0.0131  0.0561  -0.0335 144 VAL B CA    
3632 C  C     . VAL B 168 ? 0.2101 0.2462 0.2469 -0.0214 0.0463  -0.0154 144 VAL B C     
3633 O  O     . VAL B 168 ? 0.2027 0.2680 0.2460 -0.0002 0.0572  -0.0161 144 VAL B O     
3634 C  CB    . VAL B 168 ? 0.2245 0.2924 0.1979 0.0203  0.0599  0.0014  144 VAL B CB    
3635 C  CG1   . VAL B 168 ? 0.2315 0.3081 0.2217 0.0289  0.0619  -0.0364 144 VAL B CG1   
3636 C  CG2   . VAL B 168 ? 0.2280 0.2666 0.2301 0.0051  0.0973  0.0248  144 VAL B CG2   
3637 N  N     . VAL B 169 ? 0.2146 0.2674 0.2152 0.0014  0.0724  -0.0019 145 VAL B N     
3638 C  CA    . VAL B 169 ? 0.2290 0.2247 0.1877 -0.0075 0.0739  -0.0161 145 VAL B CA    
3639 C  C     . VAL B 169 ? 0.2122 0.2714 0.2211 0.0201  0.0419  -0.0272 145 VAL B C     
3640 O  O     . VAL B 169 ? 0.2127 0.2896 0.2368 0.0138  0.0628  -0.0467 145 VAL B O     
3641 C  CB    . VAL B 169 ? 0.2305 0.2263 0.1483 -0.0144 0.0545  -0.0177 145 VAL B CB    
3642 C  CG1   . VAL B 169 ? 0.2231 0.2875 0.1808 0.0168  0.0711  -0.0159 145 VAL B CG1   
3643 C  CG2   . VAL B 169 ? 0.1874 0.2761 0.1893 -0.0432 0.0867  -0.0462 145 VAL B CG2   
3644 N  N     . ALA B 170 ? 0.2681 0.2818 0.2147 0.0004  0.0626  -0.0357 146 ALA B N     
3645 C  CA    . ALA B 170 ? 0.2749 0.2976 0.2019 0.0137  0.0620  -0.0484 146 ALA B CA    
3646 C  C     . ALA B 170 ? 0.2969 0.2576 0.2244 -0.0100 0.0213  -0.0392 146 ALA B C     
3647 O  O     . ALA B 170 ? 0.3340 0.3194 0.2345 -0.0445 0.0138  0.0008  146 ALA B O     
3648 C  CB    . ALA B 170 ? 0.2918 0.3077 0.1407 0.0025  0.0558  -0.0414 146 ALA B CB    
3649 N  N     . ASP B 171 ? 0.2641 0.2645 0.2069 -0.0065 0.0398  -0.0415 147 ASP B N     
3650 C  CA    . ASP B 171 ? 0.3017 0.2624 0.2060 -0.0071 0.0493  -0.0427 147 ASP B CA    
3651 C  C     . ASP B 171 ? 0.2991 0.2569 0.1955 0.0205  0.0355  -0.0381 147 ASP B C     
3652 O  O     . ASP B 171 ? 0.3195 0.2856 0.2485 0.0037  0.0871  -0.0488 147 ASP B O     
3653 C  CB    . ASP B 171 ? 0.3300 0.2696 0.2719 -0.0047 0.0631  -0.0107 147 ASP B CB    
3654 C  CG    . ASP B 171 ? 0.3156 0.3110 0.3193 0.0029  0.0456  -0.0661 147 ASP B CG    
3655 O  OD1   . ASP B 171 ? 0.3698 0.3789 0.3145 -0.0035 0.0871  -0.0442 147 ASP B OD1   
3656 O  OD2   . ASP B 171 ? 0.3748 0.3297 0.3387 0.0623  0.0967  -0.0796 147 ASP B OD2   
3657 N  N     . ALA B 172 ? 0.2204 0.2701 0.2128 0.0363  0.0508  -0.0562 148 ALA B N     
3658 C  CA    . ALA B 172 ? 0.2028 0.2328 0.1808 0.0078  0.0546  -0.0220 148 ALA B CA    
3659 C  C     . ALA B 172 ? 0.2036 0.2268 0.2041 -0.0027 0.0448  0.0013  148 ALA B C     
3660 O  O     . ALA B 172 ? 0.2271 0.2409 0.1789 -0.0054 0.0428  -0.0005 148 ALA B O     
3661 C  CB    . ALA B 172 ? 0.2088 0.2563 0.1892 0.0068  0.0397  -0.0205 148 ALA B CB    
3662 N  N     . LYS B 173 ? 0.2044 0.2436 0.2276 -0.0310 0.0448  -0.0162 149 LYS B N     
3663 C  CA    . LYS B 173 ? 0.2166 0.2212 0.2053 -0.0197 0.0576  -0.0213 149 LYS B CA    
3664 C  C     . LYS B 173 ? 0.1794 0.2165 0.1906 -0.0062 0.0382  -0.0066 149 LYS B C     
3665 O  O     . LYS B 173 ? 0.2180 0.2491 0.1816 -0.0292 0.0388  0.0188  149 LYS B O     
3666 C  CB    . LYS B 173 ? 0.2015 0.2174 0.2142 -0.0389 0.0399  -0.0241 149 LYS B CB    
3667 C  CG    . LYS B 173 ? 0.2741 0.2098 0.2544 0.0013  0.0365  -0.0545 149 LYS B CG    
3668 C  CD    . LYS B 173 ? 0.2839 0.3086 0.3182 -0.0204 0.0480  -0.0149 149 LYS B CD    
3669 C  CE    . LYS B 173 ? 0.3381 0.3035 0.3858 -0.0261 0.0392  0.0059  149 LYS B CE    
3670 N  NZ    . LYS B 173 ? 0.3834 0.3863 0.4531 -0.0929 0.0654  0.0290  149 LYS B NZ    
3671 N  N     . VAL B 174 ? 0.1560 0.2347 0.2047 -0.0057 0.0521  -0.0364 150 VAL B N     
3672 C  CA    . VAL B 174 ? 0.1795 0.2336 0.1861 -0.0056 0.0441  -0.0180 150 VAL B CA    
3673 C  C     . VAL B 174 ? 0.1754 0.2408 0.2138 -0.0052 0.0291  0.0081  150 VAL B C     
3674 O  O     . VAL B 174 ? 0.1429 0.3068 0.2081 -0.0184 0.0260  0.0331  150 VAL B O     
3675 C  CB    . VAL B 174 ? 0.2321 0.2567 0.1972 0.0043  0.0699  -0.0190 150 VAL B CB    
3676 C  CG1   . VAL B 174 ? 0.2278 0.2622 0.2031 -0.0042 0.0893  -0.0445 150 VAL B CG1   
3677 C  CG2   . VAL B 174 ? 0.2171 0.2964 0.1945 0.0186  0.0808  0.0045  150 VAL B CG2   
3678 N  N     . THR B 175 ? 0.2304 0.2490 0.2182 -0.0271 0.0242  0.0081  151 THR B N     
3679 C  CA    . THR B 175 ? 0.2019 0.2492 0.1768 -0.0269 0.0637  0.0118  151 THR B CA    
3680 C  C     . THR B 175 ? 0.1657 0.2257 0.1683 -0.0241 0.0341  0.0326  151 THR B C     
3681 O  O     . THR B 175 ? 0.2004 0.2089 0.1868 -0.0067 0.0645  0.0312  151 THR B O     
3682 C  CB    . THR B 175 ? 0.1817 0.2183 0.1921 -0.0175 0.0655  0.0080  151 THR B CB    
3683 O  OG1   . THR B 175 ? 0.1960 0.2342 0.1890 -0.0052 0.0658  -0.0040 151 THR B OG1   
3684 C  CG2   . THR B 175 ? 0.2416 0.2384 0.2243 -0.0408 0.0451  -0.0292 151 THR B CG2   
3685 N  N     . TYR B 176 ? 0.1778 0.2174 0.1721 -0.0311 0.0418  -0.0072 152 TYR B N     
3686 C  CA    . TYR B 176 ? 0.1810 0.2244 0.1780 -0.0370 0.0501  -0.0157 152 TYR B CA    
3687 C  C     . TYR B 176 ? 0.1648 0.2235 0.1913 -0.0058 0.0362  -0.0235 152 TYR B C     
3688 O  O     . TYR B 176 ? 0.1456 0.2517 0.2020 -0.0122 0.0320  -0.0085 152 TYR B O     
3689 C  CB    . TYR B 176 ? 0.2247 0.2603 0.1746 -0.0168 0.0765  -0.0158 152 TYR B CB    
3690 C  CG    . TYR B 176 ? 0.1473 0.2255 0.1896 0.0184  0.0492  -0.0118 152 TYR B CG    
3691 C  CD1   . TYR B 176 ? 0.1342 0.2147 0.2150 0.0093  0.0464  0.0048  152 TYR B CD1   
3692 C  CD2   . TYR B 176 ? 0.1847 0.2374 0.1584 -0.0061 0.0517  -0.0033 152 TYR B CD2   
3693 C  CE1   . TYR B 176 ? 0.1531 0.2398 0.2162 -0.0125 0.0485  -0.0104 152 TYR B CE1   
3694 C  CE2   . TYR B 176 ? 0.2072 0.2014 0.1639 0.0065  0.0654  0.0125  152 TYR B CE2   
3695 C  CZ    . TYR B 176 ? 0.1794 0.1998 0.1817 -0.0135 0.0572  -0.0052 152 TYR B CZ    
3696 O  OH    . TYR B 176 ? 0.1374 0.2081 0.1830 -0.0192 0.0718  -0.0019 152 TYR B OH    
3697 N  N     . PHE B 177 ? 0.1578 0.2294 0.1802 -0.0247 0.0547  0.0083  153 PHE B N     
3698 C  CA    . PHE B 177 ? 0.1711 0.2331 0.1971 -0.0319 0.0563  -0.0070 153 PHE B CA    
3699 C  C     . PHE B 177 ? 0.1929 0.2322 0.1835 -0.0043 0.0144  0.0053  153 PHE B C     
3700 O  O     . PHE B 177 ? 0.1901 0.2379 0.1597 -0.0047 0.0374  0.0151  153 PHE B O     
3701 C  CB    . PHE B 177 ? 0.2009 0.2352 0.1737 0.0119  0.0554  0.0239  153 PHE B CB    
3702 C  CG    . PHE B 177 ? 0.1583 0.1966 0.1904 -0.0098 0.0380  0.0068  153 PHE B CG    
3703 C  CD1   . PHE B 177 ? 0.2000 0.2420 0.2062 -0.0304 0.0163  0.0056  153 PHE B CD1   
3704 C  CD2   . PHE B 177 ? 0.1482 0.1993 0.2072 -0.0082 0.0637  0.0033  153 PHE B CD2   
3705 C  CE1   . PHE B 177 ? 0.1965 0.2290 0.2086 -0.0136 0.0547  0.0009  153 PHE B CE1   
3706 C  CE2   . PHE B 177 ? 0.1549 0.2354 0.1634 0.0016  0.0783  0.0125  153 PHE B CE2   
3707 C  CZ    . PHE B 177 ? 0.1913 0.2264 0.1848 -0.0108 0.0644  -0.0003 153 PHE B CZ    
3708 N  N     . GLU B 178 ? 0.1750 0.2236 0.1570 -0.0096 0.0394  -0.0055 154 GLU B N     
3709 C  CA    . GLU B 178 ? 0.1468 0.2050 0.1544 -0.0159 0.0307  0.0023  154 GLU B CA    
3710 C  C     . GLU B 178 ? 0.1764 0.1914 0.1793 -0.0049 0.0390  -0.0020 154 GLU B C     
3711 O  O     . GLU B 178 ? 0.1874 0.2196 0.1799 -0.0349 0.0479  0.0121  154 GLU B O     
3712 C  CB    . GLU B 178 ? 0.1511 0.2202 0.1271 0.0133  0.0453  0.0149  154 GLU B CB    
3713 C  CG    . GLU B 178 ? 0.1998 0.2088 0.1948 0.0086  0.0337  0.0248  154 GLU B CG    
3714 C  CD    . GLU B 178 ? 0.1879 0.2007 0.1881 -0.0108 0.0376  0.0097  154 GLU B CD    
3715 O  OE1   . GLU B 178 ? 0.1843 0.2167 0.1540 -0.0163 0.0421  0.0099  154 GLU B OE1   
3716 O  OE2   . GLU B 178 ? 0.1624 0.2247 0.1916 -0.0094 0.0441  0.0259  154 GLU B OE2   
3717 N  N     . GLY B 179 ? 0.1739 0.1943 0.1838 -0.0004 0.0229  0.0074  155 GLY B N     
3718 C  CA    . GLY B 179 ? 0.1918 0.2083 0.1812 -0.0136 0.0334  0.0237  155 GLY B CA    
3719 C  C     . GLY B 179 ? 0.1966 0.1823 0.1773 -0.0046 0.0265  0.0016  155 GLY B C     
3720 O  O     . GLY B 179 ? 0.2145 0.2214 0.1956 -0.0133 0.0408  0.0221  155 GLY B O     
3721 N  N     . TYR B 180 ? 0.1848 0.1918 0.1890 0.0117  -0.0061 -0.0088 156 TYR B N     
3722 C  CA    . TYR B 180 ? 0.1748 0.2076 0.1884 0.0071  0.0053  0.0309  156 TYR B CA    
3723 C  C     . TYR B 180 ? 0.1848 0.1884 0.1977 -0.0169 0.0145  -0.0019 156 TYR B C     
3724 O  O     . TYR B 180 ? 0.1612 0.2237 0.2053 -0.0241 0.0594  0.0171  156 TYR B O     
3725 C  CB    . TYR B 180 ? 0.1936 0.2237 0.1641 0.0091  0.0381  0.0179  156 TYR B CB    
3726 C  CG    . TYR B 180 ? 0.2026 0.2080 0.1799 -0.0032 0.0504  0.0021  156 TYR B CG    
3727 C  CD1   . TYR B 180 ? 0.1879 0.2279 0.1891 -0.0118 0.0708  -0.0122 156 TYR B CD1   
3728 C  CD2   . TYR B 180 ? 0.2087 0.2184 0.1789 0.0056  0.0719  0.0055  156 TYR B CD2   
3729 C  CE1   . TYR B 180 ? 0.2044 0.2316 0.1798 0.0118  0.0635  -0.0080 156 TYR B CE1   
3730 C  CE2   . TYR B 180 ? 0.1577 0.2088 0.1709 -0.0037 0.0511  -0.0013 156 TYR B CE2   
3731 C  CZ    . TYR B 180 ? 0.1687 0.2192 0.2072 -0.0041 0.0570  -0.0308 156 TYR B CZ    
3732 O  OH    . TYR B 180 ? 0.1975 0.2503 0.1791 -0.0128 0.0534  -0.0257 156 TYR B OH    
3733 N  N     . LEU B 181 ? 0.1653 0.2050 0.1694 -0.0153 0.0531  0.0038  157 LEU B N     
3734 C  CA    . LEU B 181 ? 0.1542 0.1959 0.2157 0.0139  0.0477  -0.0014 157 LEU B CA    
3735 C  C     . LEU B 181 ? 0.1713 0.2172 0.2315 -0.0135 0.0421  0.0106  157 LEU B C     
3736 O  O     . LEU B 181 ? 0.1933 0.2417 0.2113 -0.0162 0.0586  0.0305  157 LEU B O     
3737 C  CB    . LEU B 181 ? 0.1648 0.2220 0.1846 -0.0039 0.0297  0.0053  157 LEU B CB    
3738 C  CG    . LEU B 181 ? 0.1511 0.2239 0.1948 0.0020  0.0444  0.0099  157 LEU B CG    
3739 C  CD1   . LEU B 181 ? 0.1900 0.2471 0.2063 -0.0047 0.0327  -0.0006 157 LEU B CD1   
3740 C  CD2   . LEU B 181 ? 0.1455 0.2335 0.2214 -0.0011 0.0505  0.0164  157 LEU B CD2   
3741 N  N     . TRP B 182 ? 0.1663 0.2120 0.2118 -0.0261 0.0384  0.0129  158 TRP B N     
3742 C  CA    . TRP B 182 ? 0.2065 0.2073 0.2172 -0.0195 0.0279  0.0170  158 TRP B CA    
3743 C  C     . TRP B 182 ? 0.2131 0.2411 0.1959 -0.0217 0.0203  0.0131  158 TRP B C     
3744 O  O     . TRP B 182 ? 0.2188 0.2673 0.2146 -0.0346 0.0540  0.0110  158 TRP B O     
3745 C  CB    . TRP B 182 ? 0.1792 0.2519 0.1989 -0.0105 0.0454  0.0006  158 TRP B CB    
3746 C  CG    . TRP B 182 ? 0.1480 0.2321 0.2056 0.0143  0.0548  -0.0104 158 TRP B CG    
3747 C  CD1   . TRP B 182 ? 0.2256 0.2870 0.2156 0.0146  0.0375  0.0135  158 TRP B CD1   
3748 C  CD2   . TRP B 182 ? 0.1430 0.2286 0.2031 0.0331  0.0608  -0.0199 158 TRP B CD2   
3749 N  NE1   . TRP B 182 ? 0.2213 0.2592 0.2410 -0.0093 0.0504  -0.0120 158 TRP B NE1   
3750 C  CE2   . TRP B 182 ? 0.2186 0.2408 0.2103 0.0229  0.0390  -0.0097 158 TRP B CE2   
3751 C  CE3   . TRP B 182 ? 0.1632 0.2404 0.2577 0.0168  0.0665  -0.0060 158 TRP B CE3   
3752 C  CZ2   . TRP B 182 ? 0.1962 0.2466 0.2165 0.0164  0.0546  -0.0080 158 TRP B CZ2   
3753 C  CZ3   . TRP B 182 ? 0.1592 0.3082 0.2166 -0.0029 0.0496  -0.0166 158 TRP B CZ3   
3754 C  CH2   . TRP B 182 ? 0.1993 0.2485 0.2163 0.0158  0.0377  -0.0182 158 TRP B CH2   
3755 N  N     . ASP B 183 ? 0.1789 0.2555 0.1837 -0.0100 0.0423  0.0122  159 ASP B N     
3756 C  CA    . ASP B 183 ? 0.1856 0.2558 0.1605 0.0043  0.0303  0.0133  159 ASP B CA    
3757 C  C     . ASP B 183 ? 0.1876 0.2219 0.2270 -0.0049 0.0423  0.0085  159 ASP B C     
3758 O  O     . ASP B 183 ? 0.2333 0.2829 0.2660 -0.0313 0.0898  0.0319  159 ASP B O     
3759 C  CB    . ASP B 183 ? 0.1814 0.3004 0.1656 -0.0132 0.0562  0.0104  159 ASP B CB    
3760 C  CG    . ASP B 183 ? 0.2304 0.2400 0.2132 -0.0071 0.0469  0.0070  159 ASP B CG    
3761 O  OD1   . ASP B 183 ? 0.2123 0.2534 0.2127 -0.0130 0.0658  0.0165  159 ASP B OD1   
3762 O  OD2   . ASP B 183 ? 0.2590 0.2505 0.2112 0.0036  0.0725  0.0089  159 ASP B OD2   
3763 N  N     . PRO B 184 ? 0.1862 0.2178 0.2184 -0.0052 0.0574  0.0200  160 PRO B N     
3764 C  CA    . PRO B 184 ? 0.1580 0.2400 0.2265 -0.0096 0.0482  0.0400  160 PRO B CA    
3765 C  C     . PRO B 184 ? 0.2037 0.2894 0.2166 -0.0113 0.0579  -0.0135 160 PRO B C     
3766 O  O     . PRO B 184 ? 0.2268 0.3788 0.2100 -0.0258 0.0576  0.0149  160 PRO B O     
3767 C  CB    . PRO B 184 ? 0.1743 0.2434 0.2320 -0.0351 0.0704  0.0350  160 PRO B CB    
3768 C  CG    . PRO B 184 ? 0.1575 0.2667 0.2586 -0.0002 0.0697  0.0073  160 PRO B CG    
3769 C  CD    . PRO B 184 ? 0.1740 0.2267 0.2095 -0.0115 0.0559  0.0248  160 PRO B CD    
3770 N  N     . PRO B 185 ? 0.2202 0.3388 0.2530 -0.0228 0.0875  0.0168  161 PRO B N     
3771 C  CA    . PRO B 185 ? 0.2252 0.4034 0.2329 -0.0455 0.0702  0.0054  161 PRO B CA    
3772 C  C     . PRO B 185 ? 0.2162 0.2799 0.2776 -0.0200 0.0622  0.0155  161 PRO B C     
3773 O  O     . PRO B 185 ? 0.3910 0.3438 0.2945 0.0182  0.0152  0.0330  161 PRO B O     
3774 C  CB    . PRO B 185 ? 0.2204 0.3987 0.2893 -0.0329 0.0992  0.0503  161 PRO B CB    
3775 C  CG    . PRO B 185 ? 0.2627 0.4194 0.3105 -0.0135 0.0735  0.0483  161 PRO B CG    
3776 C  CD    . PRO B 185 ? 0.2513 0.4266 0.2898 -0.0262 0.0536  0.0314  161 PRO B CD    
3777 N  N     . ARG B 186 ? 0.1547 0.2695 0.2737 -0.0591 0.1155  0.0234  162 ARG B N     
3778 C  CA    . ARG B 186 ? 0.1830 0.3125 0.2823 -0.0463 0.0855  0.0056  162 ARG B CA    
3779 C  C     . ARG B 186 ? 0.1847 0.2932 0.2335 -0.0432 0.0558  -0.0004 162 ARG B C     
3780 O  O     . ARG B 186 ? 0.2175 0.2987 0.2132 -0.0429 0.0908  0.0010  162 ARG B O     
3781 C  CB    . ARG B 186 ? 0.2440 0.3575 0.3321 0.0116  0.1015  -0.0155 162 ARG B CB    
3782 C  CG    . ARG B 186 ? 0.3503 0.3795 0.4299 -0.0772 0.0718  0.0127  162 ARG B CG    
3783 C  CD    . ARG B 186 ? 0.3404 0.4912 0.5973 -0.0558 0.1505  -0.0057 162 ARG B CD    
3784 N  NE    . ARG B 186 ? 0.4300 0.5400 0.6980 -0.0914 0.2240  -0.0554 162 ARG B NE    
3785 C  CZ    . ARG B 186 ? 0.3682 0.5725 0.5362 -0.0149 0.2095  -0.0352 162 ARG B CZ    
3786 N  NH1   . ARG B 186 ? 0.2576 0.7017 0.4934 -0.0242 0.2591  -0.1044 162 ARG B NH1   
3787 N  NH2   . ARG B 186 ? 0.2605 0.5976 0.4759 -0.0293 0.1474  -0.0278 162 ARG B NH2   
3788 N  N     . ALA B 187 ? 0.1933 0.2951 0.2340 -0.0092 0.0567  0.0136  163 ALA B N     
3789 C  CA    . ALA B 187 ? 0.2104 0.2839 0.1831 -0.0170 0.0839  -0.0145 163 ALA B CA    
3790 C  C     . ALA B 187 ? 0.2198 0.2383 0.1741 -0.0043 0.0875  -0.0014 163 ALA B C     
3791 O  O     . ALA B 187 ? 0.2255 0.2683 0.1784 -0.0280 0.1023  -0.0037 163 ALA B O     
3792 C  CB    . ALA B 187 ? 0.2580 0.2605 0.1640 -0.0079 0.0790  0.0069  163 ALA B CB    
3793 N  N     . LYS B 188 ? 0.1908 0.2595 0.2186 0.0024  0.0669  0.0255  164 LYS B N     
3794 C  CA    . LYS B 188 ? 0.1668 0.2596 0.2242 -0.0001 0.0748  -0.0083 164 LYS B CA    
3795 C  C     . LYS B 188 ? 0.2066 0.2896 0.1952 -0.0193 0.0740  0.0070  164 LYS B C     
3796 O  O     . LYS B 188 ? 0.2673 0.2857 0.1941 -0.0464 0.0691  0.0092  164 LYS B O     
3797 C  CB    . LYS B 188 ? 0.1904 0.2684 0.2408 -0.0141 0.0649  0.0208  164 LYS B CB    
3798 C  CG    . LYS B 188 ? 0.2497 0.2833 0.2718 -0.0471 0.0958  0.0258  164 LYS B CG    
3799 C  CD    . LYS B 188 ? 0.3449 0.3141 0.3582 -0.0032 0.0813  0.0630  164 LYS B CD    
3800 C  CE    . LYS B 188 ? 0.4042 0.4071 0.3585 -0.0088 0.0820  0.0319  164 LYS B CE    
3801 N  NZ    . LYS B 188 ? 0.3576 0.4945 0.5203 0.0904  0.0375  0.0279  164 LYS B NZ    
3802 N  N     . GLU B 189 ? 0.2123 0.2764 0.2593 0.0222  0.0695  -0.0060 165 GLU B N     
3803 C  CA    . GLU B 189 ? 0.2407 0.3013 0.2592 -0.0102 0.1081  -0.0095 165 GLU B CA    
3804 C  C     . GLU B 189 ? 0.1771 0.2985 0.2259 -0.0022 0.1003  -0.0031 165 GLU B C     
3805 O  O     . GLU B 189 ? 0.2642 0.3379 0.2232 -0.0281 0.0995  -0.0142 165 GLU B O     
3806 C  CB    . GLU B 189 ? 0.2458 0.3508 0.2700 -0.0298 0.1212  -0.0053 165 GLU B CB    
3807 C  CG    . GLU B 189 ? 0.3229 0.3406 0.2974 -0.0375 0.1412  0.0441  165 GLU B CG    
3808 C  CD    . GLU B 189 ? 0.3304 0.4619 0.4130 -0.0543 0.1579  0.0258  165 GLU B CD    
3809 O  OE1   . GLU B 189 ? 0.3055 0.5338 0.4299 -0.1061 0.1535  0.0257  165 GLU B OE1   
3810 O  OE2   . GLU B 189 ? 0.3330 0.5464 0.4362 -0.0658 0.2550  -0.0295 165 GLU B OE2   
3811 N  N     . ALA B 190 ? 0.1748 0.2813 0.2417 0.0157  0.1061  0.0065  166 ALA B N     
3812 C  CA    . ALA B 190 ? 0.1846 0.2828 0.2422 0.0023  0.0639  0.0029  166 ALA B CA    
3813 C  C     . ALA B 190 ? 0.1852 0.2642 0.1860 -0.0074 0.0613  0.0023  166 ALA B C     
3814 O  O     . ALA B 190 ? 0.1956 0.2936 0.2139 -0.0125 0.0707  -0.0322 166 ALA B O     
3815 C  CB    . ALA B 190 ? 0.1181 0.2958 0.2304 -0.0236 0.0858  0.0195  166 ALA B CB    
3816 N  N     . ILE B 191 ? 0.2153 0.2475 0.2038 0.0056  0.0420  0.0155  167 ILE B N     
3817 C  CA    . ILE B 191 ? 0.2095 0.2780 0.2042 -0.0091 0.0238  -0.0195 167 ILE B CA    
3818 C  C     . ILE B 191 ? 0.2097 0.2813 0.2004 0.0062  0.0339  0.0152  167 ILE B C     
3819 O  O     . ILE B 191 ? 0.2526 0.3080 0.1862 -0.0223 0.0569  -0.0129 167 ILE B O     
3820 C  CB    . ILE B 191 ? 0.1853 0.2941 0.1928 -0.0140 0.0415  -0.0169 167 ILE B CB    
3821 C  CG1   . ILE B 191 ? 0.1471 0.2524 0.1862 0.0025  0.0626  -0.0129 167 ILE B CG1   
3822 C  CG2   . ILE B 191 ? 0.1856 0.2659 0.2127 -0.0006 0.0592  -0.0162 167 ILE B CG2   
3823 C  CD1   . ILE B 191 ? 0.2007 0.2574 0.2296 0.0000  0.0479  -0.0138 167 ILE B CD1   
3824 N  N     . LEU B 192 ? 0.2392 0.3035 0.2037 -0.0140 0.0347  0.0190  168 LEU B N     
3825 C  CA    . LEU B 192 ? 0.2781 0.2950 0.2224 -0.0057 0.0065  0.0223  168 LEU B CA    
3826 C  C     . LEU B 192 ? 0.2546 0.3195 0.1975 -0.0057 0.0545  0.0134  168 LEU B C     
3827 O  O     . LEU B 192 ? 0.2709 0.3633 0.1815 -0.0446 0.0763  0.0150  168 LEU B O     
3828 C  CB    . LEU B 192 ? 0.3568 0.3010 0.2364 -0.0320 0.0220  0.0214  168 LEU B CB    
3829 C  CG    . LEU B 192 ? 0.3198 0.3110 0.3269 -0.0153 0.0603  0.0263  168 LEU B CG    
3830 C  CD1   . LEU B 192 ? 0.4176 0.3704 0.3484 -0.0383 0.0745  0.0701  168 LEU B CD1   
3831 C  CD2   . LEU B 192 ? 0.3221 0.3836 0.4030 -0.0072 0.0918  0.0176  168 LEU B CD2   
3832 N  N     . ASP B 193 ? 0.2708 0.2871 0.2102 0.0029  0.0677  0.0073  169 ASP B N     
3833 C  CA    . ASP B 193 ? 0.2951 0.2713 0.1723 -0.0342 0.0523  0.0084  169 ASP B CA    
3834 C  C     . ASP B 193 ? 0.2521 0.2783 0.2078 -0.0225 0.0503  -0.0080 169 ASP B C     
3835 O  O     . ASP B 193 ? 0.2875 0.3392 0.1814 -0.0309 0.0434  -0.0132 169 ASP B O     
3836 C  CB    . ASP B 193 ? 0.3148 0.3256 0.2470 0.0243  0.0769  -0.0045 169 ASP B CB    
3837 C  CG    . ASP B 193 ? 0.3230 0.4145 0.3222 -0.0115 0.0627  0.0356  169 ASP B CG    
3838 O  OD1   . ASP B 193 ? 0.4076 0.4634 0.3476 -0.0230 0.0790  0.0797  169 ASP B OD1   
3839 O  OD2   . ASP B 193 ? 0.2626 0.4569 0.3715 0.0451  0.1360  0.0203  169 ASP B OD2   
3840 N  N     . CYS B 194 ? 0.2442 0.3089 0.2124 0.0086  0.0576  -0.0139 170 CYS B N     
3841 C  CA    . CYS B 194 ? 0.2727 0.2851 0.1768 -0.0058 0.0518  -0.0274 170 CYS B CA    
3842 C  C     . CYS B 194 ? 0.2476 0.2782 0.1746 -0.0004 0.0763  -0.0162 170 CYS B C     
3843 O  O     . CYS B 194 ? 0.2750 0.2661 0.1839 -0.0155 0.0657  0.0055  170 CYS B O     
3844 C  CB    . CYS B 194 ? 0.2661 0.2989 0.1773 0.0217  0.0771  -0.0059 170 CYS B CB    
3845 S  SG    . CYS B 194 ? 0.2662 0.2978 0.2114 -0.0044 0.0531  0.0139  170 CYS B SG    
3846 N  N     . ALA B 195 ? 0.2381 0.2849 0.2064 -0.0260 0.0771  0.0309  171 ALA B N     
3847 C  CA    . ALA B 195 ? 0.2372 0.2717 0.2255 0.0114  0.0786  -0.0155 171 ALA B CA    
3848 C  C     . ALA B 195 ? 0.2444 0.3170 0.2017 0.0088  0.0549  0.0053  171 ALA B C     
3849 O  O     . ALA B 195 ? 0.2968 0.3278 0.2446 -0.0052 0.0269  -0.0057 171 ALA B O     
3850 C  CB    . ALA B 195 ? 0.2305 0.2738 0.2344 0.0391  0.0754  -0.0296 171 ALA B CB    
3851 N  N     . ARG B 196 ? 0.2265 0.2884 0.2037 -0.0066 0.0445  -0.0028 172 ARG B N     
3852 C  CA    A ARG B 196 ? 0.2643 0.3224 0.2095 -0.0140 0.0310  -0.0191 172 ARG B CA    
3853 C  CA    B ARG B 196 ? 0.2547 0.3225 0.2047 -0.0169 0.0307  -0.0137 172 ARG B CA    
3854 C  C     . ARG B 196 ? 0.2730 0.3057 0.2147 0.0234  0.0397  -0.0017 172 ARG B C     
3855 O  O     . ARG B 196 ? 0.3327 0.3800 0.2412 -0.0197 0.0059  0.0081  172 ARG B O     
3856 C  CB    A ARG B 196 ? 0.2765 0.3584 0.2197 0.0000  0.0543  -0.0093 172 ARG B CB    
3857 C  CB    B ARG B 196 ? 0.2608 0.3306 0.2038 -0.0091 0.0387  0.0075  172 ARG B CB    
3858 C  CG    A ARG B 196 ? 0.3199 0.3651 0.2202 0.0196  0.0596  -0.0018 172 ARG B CG    
3859 C  CG    B ARG B 196 ? 0.2965 0.3083 0.1978 -0.0188 0.0372  0.0194  172 ARG B CG    
3860 C  CD    A ARG B 196 ? 0.2940 0.3219 0.3005 0.0285  0.0405  0.0154  172 ARG B CD    
3861 C  CD    B ARG B 196 ? 0.2877 0.3226 0.3070 -0.0690 0.0276  0.0062  172 ARG B CD    
3862 N  NE    A ARG B 196 ? 0.3060 0.3027 0.3388 0.0246  0.0305  0.0348  172 ARG B NE    
3863 N  NE    B ARG B 196 ? 0.3155 0.2583 0.3563 -0.0201 0.0336  0.0334  172 ARG B NE    
3864 C  CZ    A ARG B 196 ? 0.3394 0.3011 0.2691 0.0351  0.0709  0.0238  172 ARG B CZ    
3865 C  CZ    B ARG B 196 ? 0.2639 0.2016 0.1653 -0.0728 0.0425  -0.0553 172 ARG B CZ    
3866 N  NH1   A ARG B 196 ? 0.4096 0.3233 0.3126 0.0367  0.1506  0.0066  172 ARG B NH1   
3867 N  NH1   B ARG B 196 ? 0.4056 0.2271 0.2465 -0.0959 0.0291  -0.0998 172 ARG B NH1   
3868 N  NH2   A ARG B 196 ? 0.3064 0.4439 0.2524 0.0196  0.0854  0.0745  172 ARG B NH2   
3869 N  NH2   B ARG B 196 ? 0.2904 0.3818 0.2353 -0.0606 0.0035  -0.0235 172 ARG B NH2   
3870 N  N     . ILE B 197 ? 0.2298 0.2628 0.1646 0.0015  0.0729  -0.0056 173 ILE B N     
3871 C  CA    . ILE B 197 ? 0.1973 0.2623 0.2172 -0.0228 0.0546  -0.0210 173 ILE B CA    
3872 C  C     . ILE B 197 ? 0.1959 0.3093 0.1836 0.0049  0.0715  -0.0224 173 ILE B C     
3873 O  O     . ILE B 197 ? 0.2819 0.3276 0.2045 -0.0241 0.0770  -0.0327 173 ILE B O     
3874 C  CB    . ILE B 197 ? 0.2155 0.2751 0.2416 0.0110  0.0571  -0.0215 173 ILE B CB    
3875 C  CG1   . ILE B 197 ? 0.2346 0.3450 0.2380 0.0133  0.0852  -0.0112 173 ILE B CG1   
3876 C  CG2   . ILE B 197 ? 0.2339 0.2715 0.2026 0.0012  0.0843  -0.0561 173 ILE B CG2   
3877 C  CD1   . ILE B 197 ? 0.2447 0.3384 0.2509 0.0054  0.0759  -0.0114 173 ILE B CD1   
3878 N  N     . ALA B 198 ? 0.2237 0.3005 0.1861 0.0106  0.0573  -0.0386 174 ALA B N     
3879 C  CA    . ALA B 198 ? 0.2323 0.2634 0.2014 -0.0265 0.0466  -0.0387 174 ALA B CA    
3880 C  C     . ALA B 198 ? 0.2528 0.2552 0.1972 0.0086  0.0487  -0.0139 174 ALA B C     
3881 O  O     . ALA B 198 ? 0.2575 0.3599 0.2599 -0.0316 0.0278  -0.0511 174 ALA B O     
3882 C  CB    . ALA B 198 ? 0.2294 0.2332 0.1800 -0.0404 0.0494  -0.0241 174 ALA B CB    
3883 N  N     . HIS B 199 ? 0.3003 0.2751 0.2222 0.0356  0.0049  0.0038  175 HIS B N     
3884 C  CA    . HIS B 199 ? 0.3001 0.3054 0.2581 0.0584  -0.0110 -0.0272 175 HIS B CA    
3885 C  C     . HIS B 199 ? 0.3190 0.3597 0.2236 0.0319  0.0009  -0.0215 175 HIS B C     
3886 O  O     . HIS B 199 ? 0.3658 0.3923 0.2792 -0.0211 -0.0125 -0.0354 175 HIS B O     
3887 C  CB    . HIS B 199 ? 0.3493 0.2987 0.2694 0.0329  0.0216  -0.0217 175 HIS B CB    
3888 C  CG    . HIS B 199 ? 0.2774 0.2999 0.3018 0.0577  0.0278  -0.0039 175 HIS B CG    
3889 N  ND1   . HIS B 199 ? 0.3888 0.3402 0.2395 -0.0036 0.0191  -0.0117 175 HIS B ND1   
3890 C  CD2   . HIS B 199 ? 0.3381 0.3328 0.2394 0.0268  0.0226  0.0055  175 HIS B CD2   
3891 C  CE1   . HIS B 199 ? 0.3252 0.3465 0.2523 -0.0017 0.0243  0.0272  175 HIS B CE1   
3892 N  NE2   . HIS B 199 ? 0.2603 0.3412 0.2519 0.0069  0.0129  -0.0112 175 HIS B NE2   
3893 N  N     . GLN B 200 ? 0.3194 0.3293 0.2201 -0.0105 0.0336  -0.0386 176 GLN B N     
3894 C  CA    . GLN B 200 ? 0.3277 0.3330 0.2455 0.0047  0.0201  -0.0590 176 GLN B CA    
3895 C  C     . GLN B 200 ? 0.3633 0.3520 0.2103 -0.0136 0.0242  -0.0489 176 GLN B C     
3896 O  O     . GLN B 200 ? 0.4318 0.4102 0.2478 -0.0474 0.0158  -0.0867 176 GLN B O     
3897 C  CB    . GLN B 200 ? 0.3256 0.4663 0.2932 -0.0241 0.0418  -0.0387 176 GLN B CB    
3898 C  CG    . GLN B 200 ? 0.4617 0.4587 0.4271 -0.0616 0.0697  -0.0265 176 GLN B CG    
3899 C  CD    . GLN B 200 ? 0.5065 0.5077 0.4927 0.0139  0.1410  -0.0173 176 GLN B CD    
3900 O  OE1   . GLN B 200 ? 0.4373 0.6611 0.5371 0.1332  0.2152  0.0239  176 GLN B OE1   
3901 N  NE2   . GLN B 200 ? 0.6363 0.5211 0.4009 -0.0306 0.1256  -0.0269 176 GLN B NE2   
3902 N  N     . HIS B 201 ? 0.3463 0.3420 0.2361 0.0241  0.0164  -0.0019 177 HIS B N     
3903 C  CA    . HIS B 201 ? 0.2881 0.3186 0.2438 -0.0008 -0.0118 -0.0625 177 HIS B CA    
3904 C  C     . HIS B 201 ? 0.2995 0.3304 0.3035 -0.0039 0.0056  -0.0370 177 HIS B C     
3905 O  O     . HIS B 201 ? 0.3818 0.3963 0.2790 -0.0361 0.0436  -0.0225 177 HIS B O     
3906 C  CB    . HIS B 201 ? 0.3123 0.3592 0.2298 0.0091  0.0051  -0.0211 177 HIS B CB    
3907 C  CG    . HIS B 201 ? 0.3425 0.2849 0.2644 0.0313  0.0004  -0.0505 177 HIS B CG    
3908 N  ND1   . HIS B 201 ? 0.3666 0.3265 0.3205 0.0303  0.0210  -0.0087 177 HIS B ND1   
3909 C  CD2   . HIS B 201 ? 0.3755 0.2958 0.2876 0.0461  0.0183  -0.0596 177 HIS B CD2   
3910 C  CE1   . HIS B 201 ? 0.3679 0.3666 0.3545 0.0398  0.0358  -0.0162 177 HIS B CE1   
3911 N  NE2   . HIS B 201 ? 0.3907 0.3866 0.3516 0.0252  0.0470  -0.0358 177 HIS B NE2   
3912 N  N     . GLY B 202 ? 0.2993 0.3544 0.2660 0.0117  -0.0102 -0.0409 178 GLY B N     
3913 C  CA    . GLY B 202 ? 0.2980 0.4112 0.2434 0.0139  -0.0148 -0.0574 178 GLY B CA    
3914 C  C     . GLY B 202 ? 0.2795 0.4097 0.2536 -0.0081 0.0244  0.0210  178 GLY B C     
3915 O  O     . GLY B 202 ? 0.2796 0.4429 0.2127 -0.0299 0.0177  -0.0179 178 GLY B O     
3916 N  N     . ARG B 203 ? 0.3265 0.3324 0.2006 -0.0048 0.0305  -0.0074 179 ARG B N     
3917 C  CA    . ARG B 203 ? 0.2659 0.2611 0.1949 -0.0025 0.0199  0.0094  179 ARG B CA    
3918 C  C     . ARG B 203 ? 0.1951 0.2604 0.2235 -0.0159 0.0311  0.0094  179 ARG B C     
3919 O  O     . ARG B 203 ? 0.2495 0.3036 0.2594 -0.0067 0.0661  0.0481  179 ARG B O     
3920 C  CB    . ARG B 203 ? 0.2659 0.2597 0.1790 -0.0062 0.0323  0.0036  179 ARG B CB    
3921 C  CG    . ARG B 203 ? 0.3024 0.2631 0.2526 0.0137  0.0038  -0.0074 179 ARG B CG    
3922 C  CD    . ARG B 203 ? 0.3028 0.2786 0.2310 0.0041  0.0109  -0.0024 179 ARG B CD    
3923 N  NE    . ARG B 203 ? 0.3399 0.2581 0.2521 -0.0047 0.0151  -0.0064 179 ARG B NE    
3924 C  CZ    . ARG B 203 ? 0.3250 0.2967 0.4897 -0.0207 0.0128  -0.0996 179 ARG B CZ    
3925 N  NH1   . ARG B 203 ? 0.3101 0.4035 0.5896 0.0539  0.0387  -0.1045 179 ARG B NH1   
3926 N  NH2   . ARG B 203 ? 0.3294 0.4809 0.5398 -0.0685 0.0162  -0.1211 179 ARG B NH2   
3927 N  N     . GLU B 204 ? 0.2298 0.2370 0.2195 -0.0174 0.0193  0.0048  180 GLU B N     
3928 C  CA    . GLU B 204 ? 0.2758 0.2634 0.2483 -0.0125 0.0219  -0.0280 180 GLU B CA    
3929 C  C     . GLU B 204 ? 0.1885 0.2474 0.2073 0.0057  0.0541  0.0173  180 GLU B C     
3930 O  O     . GLU B 204 ? 0.2417 0.2577 0.2108 -0.0206 -0.0058 0.0255  180 GLU B O     
3931 C  CB    . GLU B 204 ? 0.2643 0.3532 0.2619 -0.0055 0.0114  -0.0428 180 GLU B CB    
3932 C  CG    . GLU B 204 ? 0.3272 0.4248 0.2220 -0.0155 -0.0043 -0.0865 180 GLU B CG    
3933 C  CD    . GLU B 204 ? 0.3659 0.5170 0.4297 -0.0533 0.0689  -0.0282 180 GLU B CD    
3934 O  OE1   . GLU B 204 ? 0.3658 0.5658 0.6424 0.0009  0.1286  -0.0478 180 GLU B OE1   
3935 O  OE2   . GLU B 204 ? 0.5255 0.6885 0.2575 -0.0581 0.0316  0.0307  180 GLU B OE2   
3936 N  N     . MSE B 205 ? 0.2659 0.2505 0.1959 -0.0114 0.0202  0.0022  181 MSE B N     
3937 C  CA    . MSE B 205 ? 0.2803 0.2646 0.2230 -0.0313 0.0405  -0.0204 181 MSE B CA    
3938 C  C     . MSE B 205 ? 0.2182 0.2685 0.1795 -0.0065 0.0178  0.0153  181 MSE B C     
3939 O  O     . MSE B 205 ? 0.2315 0.2507 0.1718 0.0050  0.0428  0.0193  181 MSE B O     
3940 C  CB    . MSE B 205 ? 0.3276 0.2683 0.2363 -0.0276 0.0485  0.0052  181 MSE B CB    
3941 C  CG    . MSE B 205 ? 0.3734 0.3258 0.2930 -0.0071 0.0908  0.0003  181 MSE B CG    
3942 SE SE    . MSE B 205 ? 0.4869 0.4324 0.3784 0.0014  0.0245  0.0016  181 MSE B SE    
3943 C  CE    . MSE B 205 ? 0.2599 0.3359 0.2279 0.0440  0.1170  0.0232  181 MSE B CE    
3944 N  N     . SER B 206 ? 0.2046 0.2209 0.2011 -0.0108 0.0148  -0.0001 182 SER B N     
3945 C  CA    . SER B 206 ? 0.2113 0.2197 0.1793 -0.0199 0.0280  0.0147  182 SER B CA    
3946 C  C     . SER B 206 ? 0.1833 0.2275 0.1662 0.0037  0.0163  0.0232  182 SER B C     
3947 O  O     . SER B 206 ? 0.1768 0.2493 0.1773 -0.0045 0.0409  0.0212  182 SER B O     
3948 C  CB    . SER B 206 ? 0.2223 0.2036 0.2127 0.0157  0.0518  0.0370  182 SER B CB    
3949 O  OG    . SER B 206 ? 0.1882 0.2600 0.2182 -0.0118 0.0374  -0.0014 182 SER B OG    
3950 N  N     . MSE B 207 ? 0.1927 0.2230 0.1862 -0.0136 0.0257  0.0218  183 MSE B N     
3951 C  CA    . MSE B 207 ? 0.2023 0.2497 0.1903 0.0017  0.0191  -0.0032 183 MSE B CA    
3952 C  C     . MSE B 207 ? 0.1850 0.2141 0.2255 0.0260  0.0038  -0.0211 183 MSE B C     
3953 O  O     . MSE B 207 ? 0.1764 0.2382 0.2189 -0.0034 0.0259  -0.0143 183 MSE B O     
3954 C  CB    . MSE B 207 ? 0.2912 0.2758 0.2570 -0.0226 0.0776  -0.0027 183 MSE B CB    
3955 C  CG    . MSE B 207 ? 0.3754 0.3138 0.2914 0.0517  0.0134  0.0249  183 MSE B CG    
3956 SE SE    . MSE B 207 ? 0.5673 0.4391 0.4066 -0.0318 0.0261  0.0742  183 MSE B SE    
3957 C  CE    . MSE B 207 ? 0.4554 0.3658 0.4633 -0.0167 0.0439  0.0084  183 MSE B CE    
3958 N  N     . THR B 208 ? 0.1924 0.1702 0.1722 -0.0150 0.0426  -0.0096 184 THR B N     
3959 C  CA    . THR B 208 ? 0.1716 0.1924 0.1708 -0.0050 0.0448  -0.0084 184 THR B CA    
3960 C  C     . THR B 208 ? 0.1398 0.1877 0.1858 0.0081  0.0301  0.0026  184 THR B C     
3961 O  O     . THR B 208 ? 0.1611 0.2287 0.1722 -0.0241 0.0673  0.0032  184 THR B O     
3962 C  CB    . THR B 208 ? 0.1583 0.2049 0.1993 -0.0076 0.0500  0.0205  184 THR B CB    
3963 O  OG1   . THR B 208 ? 0.2280 0.2338 0.1992 -0.0311 0.1016  0.0074  184 THR B OG1   
3964 C  CG2   . THR B 208 ? 0.1467 0.2321 0.1873 -0.0122 0.0795  0.0351  184 THR B CG2   
3965 N  N     . LEU B 209 ? 0.1821 0.1887 0.1581 0.0176  0.0483  -0.0063 185 LEU B N     
3966 C  CA    . LEU B 209 ? 0.1658 0.1948 0.1757 0.0184  0.0399  -0.0145 185 LEU B CA    
3967 C  C     . LEU B 209 ? 0.1859 0.1892 0.1770 -0.0097 0.0291  0.0028  185 LEU B C     
3968 O  O     . LEU B 209 ? 0.1793 0.2157 0.1880 -0.0261 0.0380  0.0143  185 LEU B O     
3969 C  CB    . LEU B 209 ? 0.1607 0.2340 0.1866 0.0337  0.0369  0.0133  185 LEU B CB    
3970 C  CG    . LEU B 209 ? 0.2024 0.2267 0.1962 0.0027  0.0223  0.0252  185 LEU B CG    
3971 C  CD1   . LEU B 209 ? 0.1731 0.2413 0.2523 -0.0012 0.0490  0.0478  185 LEU B CD1   
3972 C  CD2   . LEU B 209 ? 0.2335 0.3128 0.1984 0.0088  0.0475  0.0040  185 LEU B CD2   
3973 N  N     . SER B 210 ? 0.1834 0.2100 0.1733 0.0007  0.0228  0.0113  186 SER B N     
3974 C  CA    . SER B 210 ? 0.1317 0.2386 0.1743 0.0040  0.0417  0.0130  186 SER B CA    
3975 C  C     . SER B 210 ? 0.1668 0.1940 0.1829 -0.0005 0.0287  0.0232  186 SER B C     
3976 O  O     . SER B 210 ? 0.2142 0.2221 0.1769 -0.0106 0.0337  0.0235  186 SER B O     
3977 C  CB    . SER B 210 ? 0.1395 0.2134 0.1886 -0.0198 0.0597  0.0024  186 SER B CB    
3978 O  OG    . SER B 210 ? 0.1589 0.2040 0.2068 -0.0218 0.0686  0.0010  186 SER B OG    
3979 N  N     . ASP B 211 ? 0.1748 0.1841 0.1845 -0.0155 0.0337  0.0030  187 ASP B N     
3980 C  CA    . ASP B 211 ? 0.1673 0.1710 0.1996 -0.0130 0.0318  0.0029  187 ASP B CA    
3981 C  C     . ASP B 211 ? 0.2026 0.1831 0.1834 0.0123  0.0452  0.0113  187 ASP B C     
3982 O  O     . ASP B 211 ? 0.2143 0.2146 0.1843 -0.0260 0.0494  0.0196  187 ASP B O     
3983 C  CB    . ASP B 211 ? 0.1698 0.2061 0.2078 -0.0232 0.0268  -0.0032 187 ASP B CB    
3984 C  CG    . ASP B 211 ? 0.2258 0.2295 0.2048 -0.0118 0.0212  -0.0183 187 ASP B CG    
3985 O  OD1   . ASP B 211 ? 0.2807 0.2601 0.2821 -0.0105 0.0637  0.0164  187 ASP B OD1   
3986 O  OD2   . ASP B 211 ? 0.2682 0.2749 0.2045 -0.0129 0.0106  0.0192  187 ASP B OD2   
3987 N  N     . SER B 212 ? 0.2106 0.2065 0.1738 0.0110  0.0656  0.0108  188 SER B N     
3988 C  CA    . SER B 212 ? 0.2144 0.1998 0.2196 0.0003  0.0641  0.0271  188 SER B CA    
3989 C  C     . SER B 212 ? 0.1703 0.2268 0.2035 0.0025  0.0382  0.0234  188 SER B C     
3990 O  O     . SER B 212 ? 0.1753 0.2259 0.2117 0.0183  0.0524  0.0296  188 SER B O     
3991 C  CB    . SER B 212 ? 0.2236 0.2302 0.2321 0.0405  0.0294  -0.0018 188 SER B CB    
3992 O  OG    . SER B 212 ? 0.2529 0.2859 0.1991 0.0115  0.0520  -0.0114 188 SER B OG    
3993 N  N     . PHE B 213 ? 0.1859 0.2120 0.1899 -0.0087 0.0279  0.0162  189 PHE B N     
3994 C  CA    . PHE B 213 ? 0.2161 0.2364 0.1902 -0.0336 0.0465  -0.0161 189 PHE B CA    
3995 C  C     . PHE B 213 ? 0.1866 0.1919 0.2330 0.0141  0.0410  -0.0118 189 PHE B C     
3996 O  O     . PHE B 213 ? 0.2488 0.2164 0.2446 -0.0125 0.0558  -0.0118 189 PHE B O     
3997 C  CB    . PHE B 213 ? 0.1917 0.2671 0.2373 -0.0005 0.0277  -0.0065 189 PHE B CB    
3998 C  CG    . PHE B 213 ? 0.2313 0.2232 0.2373 -0.0205 0.0323  -0.0068 189 PHE B CG    
3999 C  CD1   . PHE B 213 ? 0.2570 0.2651 0.2005 0.0008  0.0242  0.0161  189 PHE B CD1   
4000 C  CD2   . PHE B 213 ? 0.2301 0.2139 0.2536 -0.0051 0.0181  -0.0001 189 PHE B CD2   
4001 C  CE1   . PHE B 213 ? 0.2634 0.2720 0.2512 0.0175  0.0637  0.0167  189 PHE B CE1   
4002 C  CE2   . PHE B 213 ? 0.3118 0.1873 0.2477 0.0102  0.0310  0.0205  189 PHE B CE2   
4003 C  CZ    . PHE B 213 ? 0.2626 0.2795 0.2523 0.0006  0.0275  0.0174  189 PHE B CZ    
4004 N  N     . CYS B 214 ? 0.1517 0.1963 0.1953 -0.0064 0.0441  0.0124  190 CYS B N     
4005 C  CA    . CYS B 214 ? 0.1925 0.2027 0.2070 0.0104  0.0419  0.0067  190 CYS B CA    
4006 C  C     . CYS B 214 ? 0.1806 0.2411 0.2094 -0.0004 0.0441  0.0258  190 CYS B C     
4007 O  O     . CYS B 214 ? 0.2083 0.2345 0.1908 0.0025  0.0647  -0.0183 190 CYS B O     
4008 C  CB    . CYS B 214 ? 0.2136 0.2131 0.1777 -0.0010 0.0715  0.0369  190 CYS B CB    
4009 S  SG    . CYS B 214 ? 0.2452 0.2388 0.2085 0.0209  0.0732  0.0108  190 CYS B SG    
4010 N  N     . VAL B 215 ? 0.1687 0.2081 0.2110 -0.0031 0.0091  0.0200  191 VAL B N     
4011 C  CA    . VAL B 215 ? 0.1594 0.2075 0.1849 0.0068  0.0293  0.0174  191 VAL B CA    
4012 C  C     . VAL B 215 ? 0.1956 0.2110 0.1869 0.0008  0.0388  0.0212  191 VAL B C     
4013 O  O     . VAL B 215 ? 0.2105 0.2596 0.1821 -0.0062 0.0684  0.0257  191 VAL B O     
4014 C  CB    . VAL B 215 ? 0.1726 0.1956 0.1948 0.0055  0.0511  0.0281  191 VAL B CB    
4015 C  CG1   . VAL B 215 ? 0.2080 0.2422 0.1818 0.0192  0.0437  0.0235  191 VAL B CG1   
4016 C  CG2   . VAL B 215 ? 0.2291 0.2200 0.1708 -0.0433 0.0414  0.0255  191 VAL B CG2   
4017 N  N     . ASP B 216 ? 0.2062 0.2187 0.2383 -0.0102 0.0304  0.0010  192 ASP B N     
4018 C  CA    . ASP B 216 ? 0.2283 0.2365 0.2609 -0.0229 0.0471  0.0226  192 ASP B CA    
4019 C  C     . ASP B 216 ? 0.2451 0.2173 0.2171 0.0048  0.0477  0.0541  192 ASP B C     
4020 O  O     . ASP B 216 ? 0.2233 0.2593 0.2056 -0.0145 0.0861  0.0539  192 ASP B O     
4021 C  CB    . ASP B 216 ? 0.2478 0.2580 0.2798 -0.0456 0.0356  0.0058  192 ASP B CB    
4022 C  CG    . ASP B 216 ? 0.3510 0.2630 0.3319 -0.0268 0.0215  0.0459  192 ASP B CG    
4023 O  OD1   . ASP B 216 ? 0.2274 0.3549 0.3330 -0.0468 0.0359  0.0371  192 ASP B OD1   
4024 O  OD2   . ASP B 216 ? 0.4349 0.2971 0.4311 -0.1061 -0.0103 0.0746  192 ASP B OD2   
4025 N  N     . ARG B 217 ? 0.2273 0.2425 0.1676 0.0038  0.0351  0.0080  193 ARG B N     
4026 C  CA    . ARG B 217 ? 0.1966 0.2220 0.2224 -0.0148 0.0198  0.0007  193 ARG B CA    
4027 C  C     . ARG B 217 ? 0.2577 0.2436 0.2147 -0.0552 0.0386  0.0068  193 ARG B C     
4028 O  O     . ARG B 217 ? 0.2798 0.2910 0.2132 -0.0009 0.0711  0.0410  193 ARG B O     
4029 C  CB    . ARG B 217 ? 0.2269 0.2420 0.2033 -0.0165 0.0098  0.0196  193 ARG B CB    
4030 C  CG    . ARG B 217 ? 0.2163 0.2567 0.1976 -0.0321 -0.0010 0.0406  193 ARG B CG    
4031 C  CD    . ARG B 217 ? 0.2093 0.2363 0.2420 -0.0303 0.0255  0.0796  193 ARG B CD    
4032 N  NE    . ARG B 217 ? 0.2775 0.2072 0.2383 -0.0322 0.0210  0.0319  193 ARG B NE    
4033 C  CZ    . ARG B 217 ? 0.2442 0.2096 0.2439 -0.0166 0.0433  -0.0115 193 ARG B CZ    
4034 N  NH1   . ARG B 217 ? 0.2379 0.2247 0.2119 -0.0012 0.0650  0.0143  193 ARG B NH1   
4035 N  NH2   . ARG B 217 ? 0.2209 0.2236 0.2307 0.0090  0.0595  0.0126  193 ARG B NH2   
4036 N  N     . TYR B 218 ? 0.2246 0.2290 0.2261 -0.0384 0.0337  0.0085  194 TYR B N     
4037 C  CA    . TYR B 218 ? 0.1752 0.2080 0.2171 -0.0572 0.0277  0.0252  194 TYR B CA    
4038 C  C     . TYR B 218 ? 0.1761 0.2389 0.1826 -0.0181 0.0406  0.0349  194 TYR B C     
4039 O  O     . TYR B 218 ? 0.1761 0.2622 0.2281 -0.0287 0.0309  0.0213  194 TYR B O     
4040 C  CB    . TYR B 218 ? 0.2094 0.2453 0.2059 0.0093  0.0175  0.0403  194 TYR B CB    
4041 C  CG    . TYR B 218 ? 0.2035 0.2503 0.2004 -0.0103 0.0251  0.0197  194 TYR B CG    
4042 C  CD1   . TYR B 218 ? 0.2416 0.2272 0.1991 -0.0202 0.0361  0.0374  194 TYR B CD1   
4043 C  CD2   . TYR B 218 ? 0.2400 0.2463 0.2062 -0.0053 -0.0008 0.0202  194 TYR B CD2   
4044 C  CE1   . TYR B 218 ? 0.2442 0.2519 0.2405 -0.0098 0.0240  0.0267  194 TYR B CE1   
4045 C  CE2   . TYR B 218 ? 0.2306 0.2725 0.2436 -0.0245 0.0059  0.0275  194 TYR B CE2   
4046 C  CZ    . TYR B 218 ? 0.2340 0.2938 0.2422 -0.0083 0.0181  0.0395  194 TYR B CZ    
4047 O  OH    . TYR B 218 ? 0.2155 0.3097 0.2776 0.0081  0.0455  0.0432  194 TYR B OH    
4048 N  N     . ARG B 219 ? 0.2109 0.2342 0.2041 -0.0074 0.0430  0.0393  195 ARG B N     
4049 C  CA    . ARG B 219 ? 0.2140 0.2382 0.2102 0.0227  0.0275  0.0077  195 ARG B CA    
4050 C  C     . ARG B 219 ? 0.2383 0.2574 0.2134 -0.0188 0.0274  0.0193  195 ARG B C     
4051 O  O     . ARG B 219 ? 0.2434 0.2517 0.2276 -0.0345 0.0402  0.0323  195 ARG B O     
4052 C  CB    . ARG B 219 ? 0.2507 0.2325 0.2299 0.0072  0.0538  -0.0002 195 ARG B CB    
4053 C  CG    . ARG B 219 ? 0.2346 0.2887 0.2715 0.0133  0.0842  -0.0098 195 ARG B CG    
4054 C  CD    . ARG B 219 ? 0.2240 0.2319 0.2558 -0.0332 0.0834  0.0187  195 ARG B CD    
4055 N  NE    . ARG B 219 ? 0.2710 0.2456 0.2547 0.0193  0.0421  0.0330  195 ARG B NE    
4056 C  CZ    . ARG B 219 ? 0.2745 0.2486 0.2420 -0.0016 0.0532  0.0180  195 ARG B CZ    
4057 N  NH1   . ARG B 219 ? 0.2854 0.3121 0.2531 -0.0469 0.0943  -0.0094 195 ARG B NH1   
4058 N  NH2   . ARG B 219 ? 0.2718 0.2188 0.2973 0.0145  0.0653  0.0199  195 ARG B NH2   
4059 N  N     . GLY B 220 ? 0.2167 0.2671 0.2318 -0.0125 0.0481  0.0129  196 GLY B N     
4060 C  CA    . GLY B 220 ? 0.2231 0.2490 0.2329 -0.0234 0.0274  0.0222  196 GLY B CA    
4061 C  C     . GLY B 220 ? 0.2268 0.2645 0.2487 -0.0191 0.0240  0.0138  196 GLY B C     
4062 O  O     . GLY B 220 ? 0.2626 0.2812 0.2256 -0.0170 0.0177  0.0171  196 GLY B O     
4063 N  N     . GLU B 221 ? 0.2641 0.2705 0.2280 0.0031  0.0412  0.0392  197 GLU B N     
4064 C  CA    . GLU B 221 ? 0.2661 0.2515 0.2190 -0.0102 0.0661  0.0396  197 GLU B CA    
4065 C  C     . GLU B 221 ? 0.2239 0.2848 0.2382 -0.0187 0.0611  0.0063  197 GLU B C     
4066 O  O     . GLU B 221 ? 0.1686 0.2725 0.2562 -0.0235 0.0421  0.0224  197 GLU B O     
4067 C  CB    . GLU B 221 ? 0.2731 0.2458 0.2358 -0.0164 0.0653  0.0122  197 GLU B CB    
4068 C  CG    . GLU B 221 ? 0.3647 0.3033 0.3081 -0.0473 0.1147  0.0630  197 GLU B CG    
4069 C  CD    . GLU B 221 ? 0.4613 0.4801 0.3874 -0.0667 0.0520  0.0934  197 GLU B CD    
4070 O  OE1   . GLU B 221 ? 0.6782 0.5426 0.5182 -0.0996 0.0591  -0.0085 197 GLU B OE1   
4071 O  OE2   . GLU B 221 ? 0.5581 0.5112 0.4865 -0.0048 0.1250  0.1539  197 GLU B OE2   
4072 N  N     . PHE B 222 ? 0.2324 0.2691 0.1954 -0.0214 0.0300  0.0401  198 PHE B N     
4073 C  CA    . PHE B 222 ? 0.2080 0.2728 0.2106 -0.0214 0.0276  0.0237  198 PHE B CA    
4074 C  C     . PHE B 222 ? 0.2164 0.2137 0.2069 0.0102  0.0281  0.0317  198 PHE B C     
4075 O  O     . PHE B 222 ? 0.1863 0.2514 0.2478 -0.0167 0.0365  0.0352  198 PHE B O     
4076 C  CB    . PHE B 222 ? 0.2342 0.2224 0.2077 0.0040  0.0390  0.0468  198 PHE B CB    
4077 C  CG    . PHE B 222 ? 0.2091 0.2369 0.2159 -0.0168 0.0277  0.0281  198 PHE B CG    
4078 C  CD1   . PHE B 222 ? 0.2111 0.2424 0.2044 -0.0012 0.0220  0.0530  198 PHE B CD1   
4079 C  CD2   . PHE B 222 ? 0.2135 0.2323 0.2174 -0.0419 0.0160  0.0196  198 PHE B CD2   
4080 C  CE1   . PHE B 222 ? 0.1822 0.2535 0.2009 -0.0260 0.0289  0.0314  198 PHE B CE1   
4081 C  CE2   . PHE B 222 ? 0.2392 0.2081 0.2301 0.0211  0.0230  0.0345  198 PHE B CE2   
4082 C  CZ    . PHE B 222 ? 0.2047 0.2417 0.2100 -0.0164 0.0311  0.0175  198 PHE B CZ    
4083 N  N     . LEU B 223 ? 0.1826 0.2340 0.2103 0.0355  0.0592  0.0322  199 LEU B N     
4084 C  CA    . LEU B 223 ? 0.2268 0.2131 0.2101 0.0312  0.0359  0.0183  199 LEU B CA    
4085 C  C     . LEU B 223 ? 0.2052 0.2781 0.1896 -0.0016 0.0310  0.0180  199 LEU B C     
4086 O  O     . LEU B 223 ? 0.2079 0.2874 0.2552 -0.0109 0.0507  -0.0207 199 LEU B O     
4087 C  CB    . LEU B 223 ? 0.2745 0.2107 0.2291 0.0350  0.0167  -0.0033 199 LEU B CB    
4088 C  CG    . LEU B 223 ? 0.2622 0.2900 0.2433 -0.0146 0.0593  -0.0003 199 LEU B CG    
4089 C  CD1   . LEU B 223 ? 0.3821 0.2867 0.3105 0.0061  0.0590  -0.0150 199 LEU B CD1   
4090 C  CD2   . LEU B 223 ? 0.2425 0.3907 0.3276 -0.0409 0.0213  0.0172  199 LEU B CD2   
4091 N  N     . ASP B 224 ? 0.2178 0.2636 0.2387 0.0024  0.0591  0.0174  200 ASP B N     
4092 C  CA    . ASP B 224 ? 0.2518 0.2988 0.2423 -0.0113 0.0448  -0.0130 200 ASP B CA    
4093 C  C     . ASP B 224 ? 0.2043 0.2912 0.2299 -0.0246 0.0340  0.0286  200 ASP B C     
4094 O  O     . ASP B 224 ? 0.2675 0.2795 0.2616 -0.0289 0.0339  -0.0005 200 ASP B O     
4095 C  CB    . ASP B 224 ? 0.2764 0.3286 0.1979 -0.0742 0.0087  0.0012  200 ASP B CB    
4096 C  CG    . ASP B 224 ? 0.3627 0.4225 0.2809 -0.0242 0.0538  -0.0552 200 ASP B CG    
4097 O  OD1   . ASP B 224 ? 0.4746 0.5303 0.2498 -0.0536 0.0671  0.0504  200 ASP B OD1   
4098 O  OD2   . ASP B 224 ? 0.4966 0.5407 0.4569 0.1113  0.1006  -0.0764 200 ASP B OD2   
4099 N  N     . LEU B 225 ? 0.2366 0.2409 0.2313 -0.0133 0.0378  0.0246  201 LEU B N     
4100 C  CA    . LEU B 225 ? 0.1895 0.2352 0.1988 -0.0066 0.0264  0.0413  201 LEU B CA    
4101 C  C     . LEU B 225 ? 0.2076 0.2199 0.2542 -0.0217 0.0260  0.0189  201 LEU B C     
4102 O  O     . LEU B 225 ? 0.2234 0.2748 0.2080 -0.0204 0.0693  -0.0159 201 LEU B O     
4103 C  CB    . LEU B 225 ? 0.1691 0.2772 0.2092 0.0146  0.0057  0.0257  201 LEU B CB    
4104 C  CG    . LEU B 225 ? 0.1726 0.2797 0.2048 0.0141  -0.0096 0.0214  201 LEU B CG    
4105 C  CD1   . LEU B 225 ? 0.2039 0.3342 0.2040 -0.0166 0.0130  0.0801  201 LEU B CD1   
4106 C  CD2   . LEU B 225 ? 0.3010 0.3205 0.2954 0.0048  0.0623  -0.0308 201 LEU B CD2   
4107 N  N     . MSE B 226 ? 0.2120 0.2758 0.2234 0.0043  0.0059  0.0157  202 MSE B N     
4108 C  CA    . MSE B 226 ? 0.2273 0.3062 0.2335 -0.0256 0.0248  0.0468  202 MSE B CA    
4109 C  C     . MSE B 226 ? 0.2544 0.2462 0.2382 0.0097  0.0186  0.0244  202 MSE B C     
4110 O  O     . MSE B 226 ? 0.2763 0.2887 0.2548 -0.0018 -0.0018 0.0010  202 MSE B O     
4111 C  CB    . MSE B 226 ? 0.2984 0.2946 0.2399 0.0256  -0.0093 0.0457  202 MSE B CB    
4112 C  CG    . MSE B 226 ? 0.3276 0.4063 0.3062 0.0105  -0.0457 0.1376  202 MSE B CG    
4113 SE SE    . MSE B 226 ? 0.7757 0.8752 0.4726 0.2349  0.0824  0.0117  202 MSE B SE    
4114 C  CE    . MSE B 226 ? 0.7277 0.6137 0.3381 0.0097  0.1047  0.0006  202 MSE B CE    
4115 N  N     . ARG B 227 ? 0.2493 0.2489 0.2340 0.0069  0.0238  0.0344  203 ARG B N     
4116 C  CA    . ARG B 227 ? 0.3092 0.2608 0.2255 0.0120  0.0109  0.0271  203 ARG B CA    
4117 C  C     . ARG B 227 ? 0.2893 0.2623 0.2750 0.0056  0.0231  0.0019  203 ARG B C     
4118 O  O     . ARG B 227 ? 0.3908 0.3168 0.3269 0.0024  -0.0282 0.0007  203 ARG B O     
4119 C  CB    . ARG B 227 ? 0.2700 0.2570 0.2050 0.0050  0.0669  -0.0070 203 ARG B CB    
4120 C  CG    . ARG B 227 ? 0.2452 0.2506 0.2197 0.0388  0.0603  0.0115  203 ARG B CG    
4121 C  CD    . ARG B 227 ? 0.2564 0.2631 0.2709 0.0222  0.0480  0.0314  203 ARG B CD    
4122 N  NE    . ARG B 227 ? 0.2618 0.2705 0.2338 0.0116  0.0290  0.0277  203 ARG B NE    
4123 C  CZ    . ARG B 227 ? 0.2909 0.2690 0.2982 0.0014  0.0389  0.0312  203 ARG B CZ    
4124 N  NH1   . ARG B 227 ? 0.3081 0.3090 0.3002 -0.0251 0.0310  0.0572  203 ARG B NH1   
4125 N  NH2   . ARG B 227 ? 0.3024 0.3513 0.3057 0.0394  0.0597  0.0687  203 ARG B NH2   
4126 N  N     . SER B 228 ? 0.2992 0.2875 0.2748 0.0212  0.0319  0.0263  204 SER B N     
4127 C  CA    . SER B 228 ? 0.3427 0.2930 0.2518 0.0188  0.0201  0.0258  204 SER B CA    
4128 C  C     . SER B 228 ? 0.3814 0.3026 0.2507 -0.0034 0.0193  0.0413  204 SER B C     
4129 O  O     . SER B 228 ? 0.5033 0.3291 0.2633 0.0082  0.0300  0.0316  204 SER B O     
4130 C  CB    . SER B 228 ? 0.3282 0.3224 0.2874 0.0464  0.0313  0.0311  204 SER B CB    
4131 O  OG    . SER B 228 ? 0.3514 0.3439 0.2893 0.0504  0.0308  0.0451  204 SER B OG    
4132 N  N     . GLY B 229 ? 0.3907 0.3033 0.2300 -0.0115 -0.0062 0.0527  205 GLY B N     
4133 C  CA    . GLY B 229 ? 0.4017 0.2989 0.2317 -0.0007 0.0052  0.0505  205 GLY B CA    
4134 C  C     . GLY B 229 ? 0.3437 0.2926 0.2801 -0.0054 0.0113  0.0219  205 GLY B C     
4135 O  O     . GLY B 229 ? 0.3568 0.2924 0.2739 -0.0219 0.0858  0.0546  205 GLY B O     
4136 N  N     . LYS B 230 ? 0.3021 0.2867 0.2338 0.0134  0.0515  0.0504  206 LYS B N     
4137 C  CA    . LYS B 230 ? 0.2869 0.3339 0.2463 0.0291  0.0412  0.0174  206 LYS B CA    
4138 C  C     . LYS B 230 ? 0.3166 0.3036 0.2597 0.0121  0.0480  0.0130  206 LYS B C     
4139 O  O     . LYS B 230 ? 0.2992 0.3308 0.2666 0.0088  0.0713  0.0584  206 LYS B O     
4140 C  CB    . LYS B 230 ? 0.3050 0.3841 0.2899 0.0092  0.0618  0.0353  206 LYS B CB    
4141 C  CG    . LYS B 230 ? 0.3749 0.4127 0.2895 0.0216  0.0634  0.0844  206 LYS B CG    
4142 C  CD    . LYS B 230 ? 0.4141 0.3981 0.2763 -0.0024 0.0470  0.1135  206 LYS B CD    
4143 C  CE    . LYS B 230 ? 0.4705 0.4491 0.3150 0.0090  0.1352  0.0805  206 LYS B CE    
4144 N  NZ    . LYS B 230 ? 0.4933 0.4087 0.4196 0.0160  0.1469  0.0919  206 LYS B NZ    
4145 N  N     . VAL B 231 ? 0.2821 0.3006 0.2232 0.0043  0.0432  0.0387  207 VAL B N     
4146 C  CA    A VAL B 231 ? 0.2314 0.2646 0.1835 0.0018  0.0095  0.0116  207 VAL B CA    
4147 C  CA    B VAL B 231 ? 0.2323 0.2940 0.1987 -0.0044 0.0209  0.0198  207 VAL B CA    
4148 C  C     . VAL B 231 ? 0.2311 0.2606 0.2147 -0.0093 0.0249  0.0099  207 VAL B C     
4149 O  O     . VAL B 231 ? 0.2564 0.3030 0.2893 0.0224  0.0248  0.0079  207 VAL B O     
4150 C  CB    A VAL B 231 ? 0.2091 0.2469 0.1985 0.0036  0.0095  0.0093  207 VAL B CB    
4151 C  CB    B VAL B 231 ? 0.2784 0.2954 0.2145 -0.0202 0.0397  -0.0008 207 VAL B CB    
4152 C  CG1   A VAL B 231 ? 0.2049 0.2522 0.2134 0.0177  0.0131  0.0385  207 VAL B CG1   
4153 C  CG1   B VAL B 231 ? 0.2736 0.3042 0.2317 -0.0043 0.0424  0.0415  207 VAL B CG1   
4154 C  CG2   A VAL B 231 ? 0.2022 0.2099 0.1053 -0.0114 0.0223  -0.0124 207 VAL B CG2   
4155 C  CG2   B VAL B 231 ? 0.2126 0.2967 0.2600 -0.0239 0.0465  0.0123  207 VAL B CG2   
4156 N  N     . ASP B 232 ? 0.1920 0.2487 0.2158 0.0050  0.0297  0.0179  208 ASP B N     
4157 C  CA    . ASP B 232 ? 0.2023 0.2733 0.2338 -0.0090 0.0452  0.0076  208 ASP B CA    
4158 C  C     . ASP B 232 ? 0.2243 0.2671 0.2127 0.0323  0.0329  0.0287  208 ASP B C     
4159 O  O     . ASP B 232 ? 0.2219 0.4069 0.2563 0.0370  0.0207  0.0134  208 ASP B O     
4160 C  CB    . ASP B 232 ? 0.2853 0.2854 0.2499 -0.0028 0.0036  -0.0086 208 ASP B CB    
4161 C  CG    . ASP B 232 ? 0.2908 0.3003 0.2149 0.0089  -0.0086 0.0229  208 ASP B CG    
4162 O  OD1   . ASP B 232 ? 0.3224 0.4187 0.2404 0.0651  0.0147  0.0699  208 ASP B OD1   
4163 O  OD2   . ASP B 232 ? 0.3101 0.3216 0.2270 0.0163  -0.0110 0.0247  208 ASP B OD2   
4164 N  N     . ILE B 233 ? 0.2114 0.2681 0.1932 -0.0014 0.0469  0.0131  209 ILE B N     
4165 C  CA    . ILE B 233 ? 0.1905 0.2558 0.2011 0.0101  0.0449  -0.0013 209 ILE B CA    
4166 C  C     . ILE B 233 ? 0.2123 0.2528 0.2197 0.0032  0.0355  0.0005  209 ILE B C     
4167 O  O     . ILE B 233 ? 0.2088 0.2523 0.2121 0.0095  0.0279  0.0034  209 ILE B O     
4168 C  CB    . ILE B 233 ? 0.2478 0.2491 0.1814 -0.0121 0.0402  -0.0092 209 ILE B CB    
4169 C  CG1   . ILE B 233 ? 0.2314 0.2383 0.2162 -0.0271 0.0359  -0.0020 209 ILE B CG1   
4170 C  CG2   . ILE B 233 ? 0.2414 0.2245 0.2081 0.0032  0.0647  0.0035  209 ILE B CG2   
4171 C  CD1   . ILE B 233 ? 0.2983 0.2346 0.2733 0.0008  0.0553  -0.0169 209 ILE B CD1   
4172 N  N     . VAL B 234 ? 0.2156 0.2346 0.1941 -0.0153 0.0274  0.0024  210 VAL B N     
4173 C  CA    A VAL B 234 ? 0.2063 0.2546 0.1996 -0.0246 0.0348  -0.0042 210 VAL B CA    
4174 C  CA    B VAL B 234 ? 0.1908 0.2191 0.1977 -0.0149 0.0294  0.0125  210 VAL B CA    
4175 C  C     . VAL B 234 ? 0.1784 0.2435 0.2080 -0.0112 0.0376  0.0094  210 VAL B C     
4176 O  O     . VAL B 234 ? 0.1676 0.2536 0.2282 0.0002  0.0293  0.0212  210 VAL B O     
4177 C  CB    A VAL B 234 ? 0.2190 0.2607 0.2284 -0.0048 0.0361  0.0085  210 VAL B CB    
4178 C  CB    B VAL B 234 ? 0.1410 0.2175 0.1873 0.0126  0.0149  0.0210  210 VAL B CB    
4179 C  CG1   A VAL B 234 ? 0.2371 0.2312 0.2059 0.0010  0.0572  0.0114  210 VAL B CG1   
4180 C  CG1   B VAL B 234 ? 0.1370 0.1739 0.1579 -0.0017 0.0048  0.0461  210 VAL B CG1   
4181 C  CG2   A VAL B 234 ? 0.2179 0.3412 0.2472 0.0003  0.0639  -0.0019 210 VAL B CG2   
4182 C  CG2   B VAL B 234 ? 0.1748 0.2391 0.1843 -0.0116 0.0339  0.0067  210 VAL B CG2   
4183 N  N     . PHE B 235 ? 0.1776 0.2458 0.1736 -0.0175 0.0554  0.0074  211 PHE B N     
4184 C  CA    . PHE B 235 ? 0.1707 0.2270 0.1626 0.0056  0.0271  0.0169  211 PHE B CA    
4185 C  C     . PHE B 235 ? 0.1726 0.2331 0.2137 -0.0134 0.0483  0.0075  211 PHE B C     
4186 O  O     . PHE B 235 ? 0.1659 0.2325 0.2127 -0.0210 0.0311  0.0057  211 PHE B O     
4187 C  CB    . PHE B 235 ? 0.1476 0.1911 0.1973 -0.0023 0.0469  0.0246  211 PHE B CB    
4188 C  CG    . PHE B 235 ? 0.1894 0.1933 0.2028 -0.0067 0.0274  0.0042  211 PHE B CG    
4189 C  CD1   . PHE B 235 ? 0.1865 0.2116 0.1989 0.0045  0.0180  -0.0037 211 PHE B CD1   
4190 C  CD2   . PHE B 235 ? 0.2011 0.2169 0.2358 -0.0092 0.0527  -0.0032 211 PHE B CD2   
4191 C  CE1   . PHE B 235 ? 0.2040 0.2106 0.2259 -0.0316 0.0405  0.0427  211 PHE B CE1   
4192 C  CE2   . PHE B 235 ? 0.2132 0.2114 0.2294 -0.0003 0.0351  -0.0096 211 PHE B CE2   
4193 C  CZ    . PHE B 235 ? 0.1784 0.2332 0.2064 -0.0255 0.0492  0.0010  211 PHE B CZ    
4194 N  N     . ALA B 236 ? 0.1646 0.2132 0.2748 0.0019  0.0549  0.0089  212 ALA B N     
4195 C  CA    . ALA B 236 ? 0.1756 0.2203 0.2644 -0.0048 0.0646  0.0059  212 ALA B CA    
4196 C  C     . ALA B 236 ? 0.2439 0.2477 0.2446 -0.0213 0.0594  -0.0217 212 ALA B C     
4197 O  O     . ALA B 236 ? 0.2390 0.3164 0.2674 -0.0493 0.0674  -0.0331 212 ALA B O     
4198 C  CB    . ALA B 236 ? 0.2220 0.2865 0.2289 0.0061  0.0875  0.0432  212 ALA B CB    
4199 N  N     . ASN B 237 ? 0.2458 0.2174 0.2442 -0.0095 0.0563  -0.0085 213 ASN B N     
4200 C  CA    . ASN B 237 ? 0.2242 0.2427 0.2387 -0.0026 0.0594  0.0166  213 ASN B CA    
4201 C  C     . ASN B 237 ? 0.2530 0.2418 0.2447 0.0065  0.0682  0.0216  213 ASN B C     
4202 O  O     . ASN B 237 ? 0.1917 0.2243 0.2490 -0.0187 0.0735  0.0047  213 ASN B O     
4203 C  CB    . ASN B 237 ? 0.1885 0.2601 0.2385 -0.0058 0.0676  0.0196  213 ASN B CB    
4204 C  CG    . ASN B 237 ? 0.2286 0.2555 0.2528 -0.0313 0.0429  0.0338  213 ASN B CG    
4205 O  OD1   . ASN B 237 ? 0.1880 0.2455 0.2803 -0.0136 0.0605  0.0445  213 ASN B OD1   
4206 N  ND2   . ASN B 237 ? 0.2329 0.3444 0.2965 0.0047  0.0180  0.0061  213 ASN B ND2   
4207 N  N     . ARG B 238 ? 0.2412 0.2313 0.2678 -0.0058 0.0821  0.0153  214 ARG B N     
4208 C  CA    . ARG B 238 ? 0.2632 0.2368 0.2647 0.0108  0.0780  -0.0141 214 ARG B CA    
4209 C  C     . ARG B 238 ? 0.2592 0.2525 0.2262 0.0063  0.0674  0.0039  214 ARG B C     
4210 O  O     . ARG B 238 ? 0.2485 0.2410 0.2844 0.0174  0.0652  0.0292  214 ARG B O     
4211 C  CB    . ARG B 238 ? 0.3217 0.2703 0.2566 0.0425  0.0878  -0.0087 214 ARG B CB    
4212 C  CG    . ARG B 238 ? 0.3727 0.2589 0.3585 0.0305  0.0814  0.0289  214 ARG B CG    
4213 C  CD    . ARG B 238 ? 0.4835 0.4002 0.3875 0.0313  0.1502  0.0515  214 ARG B CD    
4214 N  NE    . ARG B 238 ? 0.4951 0.6465 0.5519 0.0181  0.1526  -0.0008 214 ARG B NE    
4215 C  CZ    . ARG B 238 ? 0.5821 0.6802 0.5366 0.0072  0.0547  0.0526  214 ARG B CZ    
4216 N  NH1   . ARG B 238 ? 0.7101 0.6881 0.4361 -0.0550 0.0936  -0.0360 214 ARG B NH1   
4217 N  NH2   . ARG B 238 ? 0.5883 0.7870 0.5283 -0.0561 0.0870  0.0732  214 ARG B NH2   
4218 N  N     . GLN B 239 ? 0.2590 0.2412 0.2366 -0.0053 0.0720  -0.0211 215 GLN B N     
4219 C  CA    . GLN B 239 ? 0.2472 0.2683 0.2254 -0.0117 0.0656  -0.0347 215 GLN B CA    
4220 C  C     . GLN B 239 ? 0.2399 0.2350 0.2176 0.0150  0.0538  -0.0011 215 GLN B C     
4221 O  O     . GLN B 239 ? 0.2484 0.2545 0.2598 0.0010  0.0917  0.0061  215 GLN B O     
4222 C  CB    . GLN B 239 ? 0.2656 0.3865 0.2519 -0.0199 0.0463  -0.0399 215 GLN B CB    
4223 C  CG    . GLN B 239 ? 0.3684 0.4124 0.2841 -0.0284 0.0957  -0.0714 215 GLN B CG    
4224 C  CD    . GLN B 239 ? 0.3963 0.4554 0.3601 -0.0634 0.0550  -0.0250 215 GLN B CD    
4225 O  OE1   . GLN B 239 ? 0.3453 0.3495 0.2650 -0.0217 0.1034  0.0307  215 GLN B OE1   
4226 N  NE2   . GLN B 239 ? 0.5105 0.5991 0.3634 0.0020  0.0946  0.0001  215 GLN B NE2   
4227 N  N     . GLU B 240 ? 0.2632 0.2376 0.1815 -0.0002 0.0441  -0.0019 216 GLU B N     
4228 C  CA    . GLU B 240 ? 0.2172 0.2240 0.1955 0.0049  0.0500  0.0146  216 GLU B CA    
4229 C  C     . GLU B 240 ? 0.1973 0.2176 0.2029 -0.0188 0.0249  -0.0064 216 GLU B C     
4230 O  O     . GLU B 240 ? 0.2125 0.2464 0.2510 -0.0103 0.0728  0.0093  216 GLU B O     
4231 C  CB    . GLU B 240 ? 0.1949 0.2292 0.2479 0.0163  0.0525  0.0259  216 GLU B CB    
4232 C  CG    . GLU B 240 ? 0.2571 0.2659 0.2561 0.0434  0.0237  0.0271  216 GLU B CG    
4233 C  CD    . GLU B 240 ? 0.2357 0.2738 0.2841 0.0271  0.0453  0.0291  216 GLU B CD    
4234 O  OE1   . GLU B 240 ? 0.2477 0.3087 0.2781 0.0206  0.0643  0.0039  216 GLU B OE1   
4235 O  OE2   . GLU B 240 ? 0.3116 0.3269 0.2710 0.0311  0.0184  0.0301  216 GLU B OE2   
4236 N  N     . ALA B 241 ? 0.1791 0.2377 0.2172 0.0193  0.0441  -0.0242 217 ALA B N     
4237 C  CA    . ALA B 241 ? 0.2296 0.2501 0.2281 -0.0009 0.0337  0.0274  217 ALA B CA    
4238 C  C     . ALA B 241 ? 0.1959 0.2516 0.2277 0.0104  0.0387  0.0119  217 ALA B C     
4239 O  O     . ALA B 241 ? 0.2292 0.2653 0.2507 0.0181  0.0786  0.0410  217 ALA B O     
4240 C  CB    . ALA B 241 ? 0.2338 0.2452 0.2879 -0.0031 0.0629  0.0323  217 ALA B CB    
4241 N  N     . LEU B 242 ? 0.1691 0.2193 0.2617 -0.0065 0.0676  -0.0098 218 LEU B N     
4242 C  CA    . LEU B 242 ? 0.2364 0.2159 0.2528 -0.0240 0.0545  -0.0110 218 LEU B CA    
4243 C  C     . LEU B 242 ? 0.2209 0.2373 0.2836 0.0034  0.0531  0.0309  218 LEU B C     
4244 O  O     . LEU B 242 ? 0.2406 0.2666 0.3332 0.0170  0.0912  0.0727  218 LEU B O     
4245 C  CB    . LEU B 242 ? 0.2293 0.2778 0.2608 -0.0087 0.0831  0.0011  218 LEU B CB    
4246 C  CG    . LEU B 242 ? 0.2183 0.3169 0.2836 -0.0056 0.0741  0.0260  218 LEU B CG    
4247 C  CD1   . LEU B 242 ? 0.2657 0.3662 0.2909 -0.0162 0.1052  0.0286  218 LEU B CD1   
4248 C  CD2   . LEU B 242 ? 0.2274 0.3030 0.2885 0.0100  0.0937  0.0413  218 LEU B CD2   
4249 N  N     A SER B 243 ? 0.1995 0.2347 0.2611 -0.0090 0.0587  -0.0040 219 SER B N     
4250 N  N     B SER B 243 ? 0.2065 0.2437 0.2705 -0.0025 0.0571  -0.0076 219 SER B N     
4251 C  CA    A SER B 243 ? 0.1900 0.2509 0.2359 -0.0065 0.0391  0.0167  219 SER B CA    
4252 C  CA    B SER B 243 ? 0.2145 0.2795 0.2590 -0.0151 0.0533  0.0043  219 SER B CA    
4253 C  C     A SER B 243 ? 0.1981 0.2492 0.2381 0.0114  0.0471  0.0030  219 SER B C     
4254 C  C     B SER B 243 ? 0.2103 0.2501 0.2583 0.0097  0.0562  -0.0028 219 SER B C     
4255 O  O     A SER B 243 ? 0.2079 0.2463 0.2461 0.0062  0.0236  0.0159  219 SER B O     
4256 O  O     B SER B 243 ? 0.2455 0.2564 0.2657 0.0043  0.0467  0.0182  219 SER B O     
4257 C  CB    A SER B 243 ? 0.1779 0.2183 0.2177 -0.0287 0.0473  0.0251  219 SER B CB    
4258 C  CB    B SER B 243 ? 0.2677 0.2883 0.2874 -0.0066 0.0301  0.0184  219 SER B CB    
4259 O  OG    A SER B 243 ? 0.1533 0.1233 0.2540 -0.0140 0.0102  0.0471  219 SER B OG    
4260 O  OG    B SER B 243 ? 0.3323 0.2688 0.3156 -0.0055 0.0791  -0.0087 219 SER B OG    
4261 N  N     . LEU B 244 ? 0.2235 0.2529 0.2018 0.0110  0.0540  -0.0003 220 LEU B N     
4262 C  CA    . LEU B 244 ? 0.1949 0.2075 0.1973 0.0065  0.0616  0.0055  220 LEU B CA    
4263 C  C     . LEU B 244 ? 0.1796 0.2690 0.2262 0.0285  0.0491  0.0270  220 LEU B C     
4264 O  O     . LEU B 244 ? 0.2120 0.3154 0.2356 -0.0123 0.0565  0.0315  220 LEU B O     
4265 C  CB    . LEU B 244 ? 0.1874 0.2005 0.2123 0.0183  0.0935  -0.0110 220 LEU B CB    
4266 C  CG    . LEU B 244 ? 0.2059 0.2417 0.2060 -0.0044 0.0609  -0.0201 220 LEU B CG    
4267 C  CD1   . LEU B 244 ? 0.2020 0.2397 0.2744 0.0155  0.0711  -0.0111 220 LEU B CD1   
4268 C  CD2   . LEU B 244 ? 0.2522 0.2179 0.2025 -0.0088 0.0928  0.0196  220 LEU B CD2   
4269 N  N     . TYR B 245 ? 0.1666 0.2472 0.2559 0.0160  0.0345  0.0020  221 TYR B N     
4270 C  CA    . TYR B 245 ? 0.1884 0.2154 0.2644 -0.0212 0.0380  0.0343  221 TYR B CA    
4271 C  C     . TYR B 245 ? 0.2236 0.2293 0.3080 -0.0299 0.0289  0.0124  221 TYR B C     
4272 O  O     . TYR B 245 ? 0.2815 0.2455 0.3543 0.0209  0.0183  -0.0025 221 TYR B O     
4273 C  CB    . TYR B 245 ? 0.1854 0.2647 0.3301 -0.0059 0.0221  0.0117  221 TYR B CB    
4274 C  CG    . TYR B 245 ? 0.1607 0.2448 0.2825 0.0016  0.0176  0.0267  221 TYR B CG    
4275 C  CD1   . TYR B 245 ? 0.2424 0.2825 0.2958 -0.0125 0.0580  0.0051  221 TYR B CD1   
4276 C  CD2   . TYR B 245 ? 0.1872 0.2441 0.2925 -0.0081 0.0457  0.0204  221 TYR B CD2   
4277 C  CE1   . TYR B 245 ? 0.2290 0.2725 0.3253 -0.0040 0.0463  0.0080  221 TYR B CE1   
4278 C  CE2   . TYR B 245 ? 0.2055 0.2739 0.2215 -0.0022 0.0497  0.0145  221 TYR B CE2   
4279 C  CZ    . TYR B 245 ? 0.1893 0.3035 0.2207 0.0113  0.0356  0.0118  221 TYR B CZ    
4280 O  OH    . TYR B 245 ? 0.2095 0.2584 0.3349 -0.0335 0.0575  0.0221  221 TYR B OH    
4281 N  N     . GLN B 246 ? 0.2445 0.2383 0.2678 -0.0236 0.0579  -0.0056 222 GLN B N     
4282 C  CA    . GLN B 246 ? 0.2237 0.2213 0.2929 0.0222  0.0672  -0.0098 222 GLN B CA    
4283 C  C     . GLN B 246 ? 0.2399 0.2179 0.3195 0.0428  0.0692  0.0080  222 GLN B C     
4284 O  O     . GLN B 246 ? 0.2788 0.2180 0.3351 0.0105  0.0898  0.0328  222 GLN B O     
4285 C  CB    . GLN B 246 ? 0.2321 0.1890 0.3064 -0.0181 0.0154  0.0002  222 GLN B CB    
4286 C  CG    . GLN B 246 ? 0.2377 0.2403 0.3106 0.0009  0.0324  0.0344  222 GLN B CG    
4287 C  CD    . GLN B 246 ? 0.3317 0.2329 0.3252 -0.0161 0.0095  0.0889  222 GLN B CD    
4288 O  OE1   . GLN B 246 ? 0.4103 0.3080 0.3269 0.0028  0.0246  0.0886  222 GLN B OE1   
4289 N  NE2   . GLN B 246 ? 0.2244 0.2687 0.4375 -0.0420 0.0442  0.1222  222 GLN B NE2   
4290 N  N     . THR B 247 ? 0.2497 0.2376 0.3408 0.0359  0.0701  0.0209  223 THR B N     
4291 C  CA    . THR B 247 ? 0.2553 0.3102 0.2886 0.0285  0.1203  0.0245  223 THR B CA    
4292 C  C     . THR B 247 ? 0.3127 0.3148 0.2626 0.0296  0.0693  0.0254  223 THR B C     
4293 O  O     . THR B 247 ? 0.3145 0.3324 0.2405 0.0072  0.1141  0.0668  223 THR B O     
4294 C  CB    . THR B 247 ? 0.2663 0.2858 0.2972 0.0661  0.0995  0.0079  223 THR B CB    
4295 O  OG1   . THR B 247 ? 0.2343 0.3643 0.3285 0.0333  0.1298  0.0492  223 THR B OG1   
4296 C  CG2   . THR B 247 ? 0.3068 0.2940 0.3133 0.0084  0.0485  0.0622  223 THR B CG2   
4297 N  N     . ASP B 248 ? 0.3523 0.2777 0.3688 0.0059  0.0869  -0.0331 224 ASP B N     
4298 C  CA    . ASP B 248 ? 0.3448 0.3257 0.3812 -0.0179 0.0822  -0.0100 224 ASP B CA    
4299 C  C     . ASP B 248 ? 0.3273 0.3100 0.3258 0.0028  0.0432  0.0067  224 ASP B C     
4300 O  O     . ASP B 248 ? 0.3483 0.3833 0.3949 -0.0387 0.1143  -0.0147 224 ASP B O     
4301 C  CB    . ASP B 248 ? 0.4751 0.4169 0.4629 -0.0109 0.0821  -0.0921 224 ASP B CB    
4302 C  CG    . ASP B 248 ? 0.6219 0.5219 0.6170 0.0401  -0.0086 -0.0348 224 ASP B CG    
4303 O  OD1   . ASP B 248 ? 0.5900 0.6051 0.5839 -0.0054 0.0247  -0.0389 224 ASP B OD1   
4304 O  OD2   . ASP B 248 ? 0.9551 0.5522 0.7860 -0.0389 -0.0119 -0.1638 224 ASP B OD2   
4305 N  N     . ASP B 249 ? 0.3039 0.2936 0.3172 0.0062  0.0696  0.0009  225 ASP B N     
4306 C  CA    . ASP B 249 ? 0.3418 0.3061 0.3372 -0.0114 0.0354  -0.0092 225 ASP B CA    
4307 C  C     . ASP B 249 ? 0.3378 0.2871 0.3354 -0.0080 0.0440  0.0401  225 ASP B C     
4308 O  O     . ASP B 249 ? 0.3568 0.2821 0.3598 0.0331  0.0412  0.0244  225 ASP B O     
4309 C  CB    . ASP B 249 ? 0.3389 0.3165 0.4028 0.0655  0.0327  0.0145  225 ASP B CB    
4310 C  CG    . ASP B 249 ? 0.3729 0.4124 0.4955 0.0157  -0.0033 0.0440  225 ASP B CG    
4311 O  OD1   . ASP B 249 ? 0.3788 0.4272 0.5106 -0.0034 0.0157  0.0294  225 ASP B OD1   
4312 O  OD2   . ASP B 249 ? 0.4790 0.4347 0.5626 0.0302  -0.0488 0.0771  225 ASP B OD2   
4313 N  N     . PHE B 250 ? 0.2377 0.2355 0.3221 0.0133  0.0667  0.0118  226 PHE B N     
4314 C  CA    . PHE B 250 ? 0.2124 0.2285 0.3035 0.0217  0.0630  0.0401  226 PHE B CA    
4315 C  C     . PHE B 250 ? 0.2444 0.2944 0.3055 0.0119  0.0638  0.0275  226 PHE B C     
4316 O  O     . PHE B 250 ? 0.2551 0.3253 0.2818 0.0202  0.0981  0.0413  226 PHE B O     
4317 C  CB    . PHE B 250 ? 0.2745 0.3015 0.2682 -0.0094 0.0849  0.0153  226 PHE B CB    
4318 C  CG    . PHE B 250 ? 0.2915 0.3127 0.3289 0.0074  0.0776  0.0023  226 PHE B CG    
4319 C  CD1   . PHE B 250 ? 0.2933 0.2775 0.2577 0.0258  0.0620  0.0096  226 PHE B CD1   
4320 C  CD2   . PHE B 250 ? 0.3108 0.2817 0.3824 0.0216  0.1242  0.0104  226 PHE B CD2   
4321 C  CE1   . PHE B 250 ? 0.3271 0.2760 0.3217 0.0014  0.0469  -0.0136 226 PHE B CE1   
4322 C  CE2   . PHE B 250 ? 0.3076 0.2875 0.4077 0.0344  0.1080  0.0266  226 PHE B CE2   
4323 C  CZ    . PHE B 250 ? 0.2990 0.2966 0.3382 0.0312  0.0886  0.0408  226 PHE B CZ    
4324 N  N     . GLU B 251 ? 0.2263 0.3586 0.3595 0.0164  0.0714  0.0151  227 GLU B N     
4325 C  CA    . GLU B 251 ? 0.2501 0.3523 0.3491 0.0137  0.0715  -0.0061 227 GLU B CA    
4326 C  C     . GLU B 251 ? 0.2081 0.3158 0.3296 0.0178  0.0382  0.0088  227 GLU B C     
4327 O  O     . GLU B 251 ? 0.2340 0.3775 0.3830 0.0194  0.0763  -0.0370 227 GLU B O     
4328 C  CB    . GLU B 251 ? 0.2416 0.4438 0.4279 0.0167  0.0735  -0.0208 227 GLU B CB    
4329 C  CG    . GLU B 251 ? 0.4005 0.4992 0.4305 0.0279  0.1398  -0.0190 227 GLU B CG    
4330 C  CD    . GLU B 251 ? 0.5447 0.5129 0.4807 -0.0296 0.1082  -0.0205 227 GLU B CD    
4331 O  OE1   . GLU B 251 ? 0.4112 0.5450 0.5368 -0.0503 0.0913  -0.0717 227 GLU B OE1   
4332 O  OE2   . GLU B 251 ? 0.5907 0.5741 0.5270 0.0148  0.1664  0.0437  227 GLU B OE2   
4333 N  N     . GLU B 252 ? 0.2584 0.3152 0.3573 0.0193  0.0595  0.0039  228 GLU B N     
4334 C  CA    . GLU B 252 ? 0.3036 0.2828 0.3406 0.0245  0.0461  0.0225  228 GLU B CA    
4335 C  C     . GLU B 252 ? 0.2532 0.2660 0.2911 0.0035  0.0345  0.0470  228 GLU B C     
4336 O  O     . GLU B 252 ? 0.2426 0.3077 0.3006 0.0111  0.0558  0.0565  228 GLU B O     
4337 C  CB    . GLU B 252 ? 0.3018 0.2984 0.3822 0.0100  0.0192  0.0570  228 GLU B CB    
4338 C  CG    . GLU B 252 ? 0.3874 0.3320 0.3906 -0.0166 0.0536  0.0514  228 GLU B CG    
4339 C  CD    . GLU B 252 ? 0.4036 0.3841 0.4550 -0.0549 0.0597  0.0180  228 GLU B CD    
4340 O  OE1   . GLU B 252 ? 0.4179 0.3539 0.6276 -0.0714 0.0987  -0.0304 228 GLU B OE1   
4341 O  OE2   . GLU B 252 ? 0.4177 0.4265 0.4377 -0.1360 0.0551  0.0754  228 GLU B OE2   
4342 N  N     . ALA B 253 ? 0.2362 0.2989 0.3238 0.0287  0.0309  0.0302  229 ALA B N     
4343 C  CA    . ALA B 253 ? 0.2339 0.2870 0.2901 0.0228  0.0264  0.0236  229 ALA B CA    
4344 C  C     . ALA B 253 ? 0.2319 0.2750 0.2705 -0.0010 0.0596  0.0345  229 ALA B C     
4345 O  O     . ALA B 253 ? 0.2139 0.2863 0.2971 0.0237  0.0674  0.0391  229 ALA B O     
4346 C  CB    . ALA B 253 ? 0.1451 0.2958 0.2904 0.0184  0.0578  0.0586  229 ALA B CB    
4347 N  N     . LEU B 254 ? 0.2082 0.2801 0.2598 -0.0061 0.0322  0.0319  230 LEU B N     
4348 C  CA    . LEU B 254 ? 0.2138 0.2938 0.2479 -0.0202 0.0542  0.0232  230 LEU B CA    
4349 C  C     . LEU B 254 ? 0.2115 0.2538 0.2537 -0.0252 0.0419  0.0472  230 LEU B C     
4350 O  O     . LEU B 254 ? 0.2618 0.3139 0.2946 -0.0059 0.0543  0.0118  230 LEU B O     
4351 C  CB    . LEU B 254 ? 0.2153 0.2495 0.2781 -0.0125 0.0475  0.0742  230 LEU B CB    
4352 C  CG    . LEU B 254 ? 0.2291 0.2668 0.2632 -0.0074 0.0795  0.0661  230 LEU B CG    
4353 C  CD1   . LEU B 254 ? 0.2108 0.3176 0.3615 -0.0138 0.1039  0.0309  230 LEU B CD1   
4354 C  CD2   . LEU B 254 ? 0.2207 0.2572 0.2789 -0.0043 0.1141  0.0337  230 LEU B CD2   
4355 N  N     . ASN B 255 ? 0.2135 0.2764 0.2750 -0.0138 0.0293  0.0557  231 ASN B N     
4356 C  CA    . ASN B 255 ? 0.2412 0.3103 0.2798 0.0100  0.0195  0.0636  231 ASN B CA    
4357 C  C     . ASN B 255 ? 0.2317 0.3050 0.2902 0.0154  0.0187  0.0287  231 ASN B C     
4358 O  O     . ASN B 255 ? 0.2451 0.3234 0.2717 0.0140  0.0498  0.0367  231 ASN B O     
4359 C  CB    . ASN B 255 ? 0.2631 0.3434 0.3869 0.0384  0.0378  0.0576  231 ASN B CB    
4360 C  CG    . ASN B 255 ? 0.2548 0.4125 0.4374 0.0281  0.0376  0.0634  231 ASN B CG    
4361 O  OD1   . ASN B 255 ? 0.2804 0.4626 0.4616 -0.0038 0.0324  0.0607  231 ASN B OD1   
4362 N  ND2   . ASN B 255 ? 0.2383 0.4945 0.4977 0.0201  0.1066  0.0092  231 ASN B ND2   
4363 N  N     . ARG B 256 ? 0.1975 0.2982 0.3060 0.0382  0.0352  0.0320  232 ARG B N     
4364 C  CA    . ARG B 256 ? 0.2211 0.2797 0.3122 -0.0037 0.0510  0.0336  232 ARG B CA    
4365 C  C     . ARG B 256 ? 0.2162 0.2707 0.2171 -0.0056 0.0317  0.0221  232 ARG B C     
4366 O  O     . ARG B 256 ? 0.2258 0.2846 0.2631 -0.0004 0.0761  -0.0067 232 ARG B O     
4367 C  CB    . ARG B 256 ? 0.2945 0.2452 0.3238 0.0000  0.0433  0.0271  232 ARG B CB    
4368 C  CG    . ARG B 256 ? 0.2771 0.2892 0.3317 0.0213  0.0219  0.0635  232 ARG B CG    
4369 C  CD    . ARG B 256 ? 0.3419 0.3426 0.3228 -0.0315 0.0185  0.0590  232 ARG B CD    
4370 N  NE    . ARG B 256 ? 0.3374 0.4314 0.4374 -0.0299 0.0568  0.0643  232 ARG B NE    
4371 C  CZ    . ARG B 256 ? 0.4691 0.4303 0.5364 -0.0920 0.0815  0.0275  232 ARG B CZ    
4372 N  NH1   . ARG B 256 ? 0.5385 0.3373 0.6709 -0.0587 0.0906  0.0131  232 ARG B NH1   
4373 N  NH2   . ARG B 256 ? 0.5165 0.5923 0.6452 -0.1349 0.1568  0.0514  232 ARG B NH2   
4374 N  N     . ILE B 257 ? 0.2182 0.2573 0.2719 -0.0123 0.0256  0.0569  233 ILE B N     
4375 C  CA    . ILE B 257 ? 0.2020 0.2691 0.2273 -0.0064 0.0178  0.0353  233 ILE B CA    
4376 C  C     . ILE B 257 ? 0.1764 0.2537 0.2396 -0.0059 0.0291  0.0335  233 ILE B C     
4377 O  O     . ILE B 257 ? 0.2405 0.2773 0.2598 -0.0052 0.0647  0.0194  233 ILE B O     
4378 C  CB    . ILE B 257 ? 0.2029 0.2611 0.2348 -0.0075 0.0333  0.0597  233 ILE B CB    
4379 C  CG1   . ILE B 257 ? 0.2251 0.2911 0.2016 0.0232  0.0420  0.0109  233 ILE B CG1   
4380 C  CG2   . ILE B 257 ? 0.2496 0.2979 0.1881 -0.0421 0.0466  0.0480  233 ILE B CG2   
4381 C  CD1   . ILE B 257 ? 0.2290 0.2983 0.2091 0.0327  0.0320  0.0263  233 ILE B CD1   
4382 N  N     . ALA B 258 ? 0.1747 0.2926 0.2458 -0.0123 0.0402  0.0477  234 ALA B N     
4383 C  CA    . ALA B 258 ? 0.1700 0.3066 0.2497 -0.0132 0.0319  0.0391  234 ALA B CA    
4384 C  C     . ALA B 258 ? 0.2181 0.2515 0.2456 0.0026  0.0354  0.0206  234 ALA B C     
4385 O  O     . ALA B 258 ? 0.2579 0.2858 0.2735 -0.0028 0.0656  -0.0083 234 ALA B O     
4386 C  CB    . ALA B 258 ? 0.1647 0.2783 0.2901 -0.0143 0.0272  0.0479  234 ALA B CB    
4387 N  N     . ALA B 259 ? 0.1794 0.2775 0.2513 -0.0087 0.0456  0.0519  235 ALA B N     
4388 C  CA    . ALA B 259 ? 0.2110 0.2475 0.2410 0.0030  0.0397  0.0459  235 ALA B CA    
4389 C  C     . ALA B 259 ? 0.1984 0.2929 0.2472 -0.0061 0.0264  0.0318  235 ALA B C     
4390 O  O     . ALA B 259 ? 0.2612 0.3279 0.2526 -0.0067 0.0737  0.0471  235 ALA B O     
4391 C  CB    . ALA B 259 ? 0.2858 0.2427 0.2457 0.0017  0.0622  0.0199  235 ALA B CB    
4392 N  N     . ASP B 260 ? 0.2299 0.2354 0.2090 -0.0022 0.0269  0.0529  236 ASP B N     
4393 C  CA    . ASP B 260 ? 0.2333 0.2685 0.2284 0.0063  0.0244  0.0191  236 ASP B CA    
4394 C  C     . ASP B 260 ? 0.2743 0.2475 0.2557 -0.0136 0.0276  0.0191  236 ASP B C     
4395 O  O     . ASP B 260 ? 0.2538 0.2831 0.3259 -0.0079 0.0351  0.0440  236 ASP B O     
4396 C  CB    . ASP B 260 ? 0.2751 0.2719 0.2250 -0.0190 0.0438  0.0117  236 ASP B CB    
4397 C  CG    . ASP B 260 ? 0.2535 0.2646 0.2399 -0.0247 0.0495  0.0082  236 ASP B CG    
4398 O  OD1   . ASP B 260 ? 0.2957 0.3360 0.2647 -0.0051 0.0732  0.0854  236 ASP B OD1   
4399 O  OD2   . ASP B 260 ? 0.2719 0.2753 0.2667 -0.0627 0.0615  0.0087  236 ASP B OD2   
4400 N  N     . CYS B 261 ? 0.2519 0.2670 0.2448 0.0001  0.0293  0.0351  237 CYS B N     
4401 C  CA    A CYS B 261 ? 0.2440 0.2671 0.2392 -0.0015 0.0326  0.0408  237 CYS B CA    
4402 C  CA    B CYS B 261 ? 0.2304 0.2691 0.1910 0.0056  0.0181  0.0417  237 CYS B CA    
4403 C  C     . CYS B 261 ? 0.2418 0.2493 0.2479 0.0045  0.0188  0.0507  237 CYS B C     
4404 O  O     . CYS B 261 ? 0.2576 0.2762 0.3737 0.0162  0.0486  0.0241  237 CYS B O     
4405 C  CB    A CYS B 261 ? 0.2734 0.3431 0.2610 -0.0240 0.0104  0.0415  237 CYS B CB    
4406 C  CB    B CYS B 261 ? 0.2285 0.2528 0.1776 -0.0037 0.0287  0.0274  237 CYS B CB    
4407 S  SG    A CYS B 261 ? 0.3174 0.3939 0.3193 0.0246  0.0635  0.0169  237 CYS B SG    
4408 S  SG    B CYS B 261 ? 0.2058 0.2471 0.1523 -0.0106 0.0337  0.0301  237 CYS B SG    
4409 N  N     . LYS B 262 ? 0.2261 0.2589 0.2251 -0.0293 0.0462  0.0344  238 LYS B N     
4410 C  CA    . LYS B 262 ? 0.2553 0.2652 0.2476 -0.0429 0.0237  0.0377  238 LYS B CA    
4411 C  C     . LYS B 262 ? 0.2129 0.2873 0.2422 -0.0157 0.0286  0.0116  238 LYS B C     
4412 O  O     . LYS B 262 ? 0.2100 0.2852 0.2804 -0.0283 0.0350  0.0196  238 LYS B O     
4413 C  CB    . LYS B 262 ? 0.3374 0.2951 0.2957 -0.0085 0.0177  0.0155  238 LYS B CB    
4414 C  CG    . LYS B 262 ? 0.4196 0.4121 0.3304 -0.0159 0.1027  -0.0095 238 LYS B CG    
4415 C  CD    . LYS B 262 ? 0.5736 0.4446 0.2367 -0.0527 0.0944  -0.0773 238 LYS B CD    
4416 C  CE    . LYS B 262 ? 0.4734 0.4743 0.4036 -0.0358 0.0918  0.0138  238 LYS B CE    
4417 N  NZ    . LYS B 262 ? 0.5070 0.5165 0.3225 0.0411  -0.0335 0.0441  238 LYS B NZ    
4418 N  N     . ILE B 263 ? 0.2074 0.2798 0.2071 -0.0395 0.0460  0.0125  239 ILE B N     
4419 C  CA    . ILE B 263 ? 0.1961 0.2649 0.2153 -0.0277 0.0520  0.0152  239 ILE B CA    
4420 C  C     . ILE B 263 ? 0.1983 0.2597 0.2034 0.0134  0.0243  0.0115  239 ILE B C     
4421 O  O     . ILE B 263 ? 0.1958 0.2618 0.2374 -0.0017 0.0190  0.0048  239 ILE B O     
4422 C  CB    . ILE B 263 ? 0.2368 0.2495 0.2193 -0.0333 0.0554  -0.0009 239 ILE B CB    
4423 C  CG1   . ILE B 263 ? 0.2670 0.2522 0.2648 -0.0090 0.0179  -0.0234 239 ILE B CG1   
4424 C  CG2   . ILE B 263 ? 0.2267 0.2802 0.2101 -0.0119 0.0436  0.0029  239 ILE B CG2   
4425 C  CD1   . ILE B 263 ? 0.2883 0.2489 0.3067 -0.0152 0.0524  0.0105  239 ILE B CD1   
4426 N  N     . ALA B 264 ? 0.1610 0.2412 0.2133 0.0039  0.0340  0.0218  240 ALA B N     
4427 C  CA    . ALA B 264 ? 0.1522 0.2345 0.2243 -0.0006 0.0432  0.0136  240 ALA B CA    
4428 C  C     . ALA B 264 ? 0.1818 0.2829 0.2230 -0.0164 0.0337  0.0283  240 ALA B C     
4429 O  O     . ALA B 264 ? 0.1723 0.2977 0.2582 0.0077  0.0464  0.0254  240 ALA B O     
4430 C  CB    . ALA B 264 ? 0.1184 0.2346 0.2908 -0.0153 0.0658  0.0104  240 ALA B CB    
4431 N  N     . ALA B 265 ? 0.2025 0.2516 0.1859 -0.0098 0.0560  0.0500  241 ALA B N     
4432 C  CA    . ALA B 265 ? 0.1779 0.2457 0.1941 -0.0130 0.0725  0.0409  241 ALA B CA    
4433 C  C     . ALA B 265 ? 0.1706 0.2514 0.2268 -0.0109 0.0411  0.0307  241 ALA B C     
4434 O  O     . ALA B 265 ? 0.1784 0.3206 0.2897 -0.0380 0.0453  0.0003  241 ALA B O     
4435 C  CB    . ALA B 265 ? 0.1792 0.2281 0.2390 -0.0041 0.0902  0.0124  241 ALA B CB    
4436 N  N     . VAL B 266 ? 0.1974 0.2442 0.2440 -0.0350 0.0868  0.0317  242 VAL B N     
4437 C  CA    . VAL B 266 ? 0.1996 0.2342 0.2179 -0.0021 0.0783  0.0363  242 VAL B CA    
4438 C  C     . VAL B 266 ? 0.1968 0.2768 0.1904 0.0050  0.0443  0.0124  242 VAL B C     
4439 O  O     . VAL B 266 ? 0.2147 0.3304 0.2830 -0.0269 0.0662  0.0290  242 VAL B O     
4440 C  CB    . VAL B 266 ? 0.2354 0.2470 0.2137 0.0146  0.0762  0.0367  242 VAL B CB    
4441 C  CG1   . VAL B 266 ? 0.2536 0.2769 0.2584 -0.0179 0.0718  0.0134  242 VAL B CG1   
4442 C  CG2   . VAL B 266 ? 0.2639 0.2835 0.2210 0.0230  0.0876  0.0578  242 VAL B CG2   
4443 N  N     . THR B 267 ? 0.2003 0.2939 0.1860 -0.0130 0.0470  0.0466  243 THR B N     
4444 C  CA    . THR B 267 ? 0.2162 0.2645 0.1840 -0.0112 0.0740  0.0262  243 THR B CA    
4445 C  C     . THR B 267 ? 0.2515 0.2708 0.2645 -0.0292 0.0730  -0.0051 243 THR B C     
4446 O  O     . THR B 267 ? 0.1848 0.2599 0.3145 0.0072  0.0866  0.0050  243 THR B O     
4447 C  CB    . THR B 267 ? 0.1979 0.2541 0.2427 -0.0210 0.0597  0.0162  243 THR B CB    
4448 O  OG1   . THR B 267 ? 0.1921 0.2756 0.2912 -0.0253 0.0250  0.0309  243 THR B OG1   
4449 C  CG2   . THR B 267 ? 0.2442 0.2550 0.2964 0.0105  0.0409  0.0110  243 THR B CG2   
4450 N  N     . MSE B 268 ? 0.2225 0.3075 0.2877 -0.0220 0.0768  0.0267  244 MSE B N     
4451 C  CA    . MSE B 268 ? 0.2284 0.3433 0.3363 0.0229  0.0698  0.0101  244 MSE B CA    
4452 C  C     . MSE B 268 ? 0.2812 0.3486 0.3302 0.0090  0.0531  0.0047  244 MSE B C     
4453 O  O     . MSE B 268 ? 0.3729 0.3625 0.3242 0.0508  0.0926  0.0207  244 MSE B O     
4454 C  CB    . MSE B 268 ? 0.2276 0.3623 0.3350 0.0699  0.1200  0.0141  244 MSE B CB    
4455 C  CG    . MSE B 268 ? 0.3407 0.3980 0.3663 0.0686  0.1601  0.1085  244 MSE B CG    
4456 SE SE    . MSE B 268 ? 0.4430 0.7717 0.8109 0.0952  0.0545  0.1480  244 MSE B SE    
4457 C  CE    . MSE B 268 ? 0.3811 0.6831 0.5106 0.0667  0.0645  0.0386  244 MSE B CE    
4458 N  N     . SER B 269 ? 0.2965 0.3513 0.2787 0.0040  0.0622  0.0212  245 SER B N     
4459 C  CA    . SER B 269 ? 0.2933 0.3309 0.2956 0.0119  0.0636  0.0242  245 SER B CA    
4460 C  C     . SER B 269 ? 0.3166 0.3122 0.3516 -0.0159 0.0768  0.0228  245 SER B C     
4461 O  O     . SER B 269 ? 0.3267 0.3279 0.3245 -0.0019 0.0866  0.0055  245 SER B O     
4462 C  CB    . SER B 269 ? 0.3405 0.3824 0.3553 -0.0113 0.0696  -0.0310 245 SER B CB    
4463 O  OG    . SER B 269 ? 0.4153 0.5063 0.4399 -0.0938 0.0963  -0.0248 245 SER B OG    
4464 N  N     . GLU B 270 ? 0.3375 0.4114 0.3485 -0.0505 0.0932  0.0006  246 GLU B N     
4465 C  CA    . GLU B 270 ? 0.3449 0.4099 0.3700 -0.0564 0.0896  0.0164  246 GLU B CA    
4466 C  C     . GLU B 270 ? 0.3395 0.4171 0.3264 -0.0039 0.1073  0.0047  246 GLU B C     
4467 O  O     . GLU B 270 ? 0.3627 0.4734 0.2892 -0.0264 0.1544  -0.0452 246 GLU B O     
4468 C  CB    . GLU B 270 ? 0.4089 0.4217 0.3610 -0.0182 0.0929  0.0321  246 GLU B CB    
4469 C  CG    . GLU B 270 ? 0.4655 0.4184 0.4369 -0.0023 0.1161  -0.0302 246 GLU B CG    
4470 C  CD    . GLU B 270 ? 0.4771 0.4546 0.5901 -0.0241 0.1212  -0.0354 246 GLU B CD    
4471 O  OE1   . GLU B 270 ? 0.4937 0.4704 0.5402 -0.0048 0.1134  -0.0429 246 GLU B OE1   
4472 O  OE2   . GLU B 270 ? 0.5671 0.5201 0.7391 0.0362  0.1519  -0.1146 246 GLU B OE2   
4473 N  N     . ASN B 271 ? 0.2927 0.4476 0.3206 -0.0322 0.1287  0.0154  247 ASN B N     
4474 C  CA    . ASN B 271 ? 0.3048 0.4429 0.3467 -0.0690 0.1097  0.0408  247 ASN B CA    
4475 C  C     . ASN B 271 ? 0.3192 0.4165 0.3805 -0.0038 0.0813  0.0364  247 ASN B C     
4476 O  O     . ASN B 271 ? 0.3768 0.5144 0.3550 -0.0552 0.0650  0.0474  247 ASN B O     
4477 C  CB    . ASN B 271 ? 0.3376 0.4299 0.4236 -0.0614 0.1228  0.0445  247 ASN B CB    
4478 C  CG    . ASN B 271 ? 0.4715 0.5016 0.4598 -0.0116 0.1295  0.0018  247 ASN B CG    
4479 O  OD1   . ASN B 271 ? 0.5568 0.6389 0.4227 0.0526  0.1734  -0.0811 247 ASN B OD1   
4480 N  ND2   . ASN B 271 ? 0.5845 0.4671 0.6259 -0.0539 0.1496  -0.0548 247 ASN B ND2   
4481 N  N     . GLY B 272 ? 0.2188 0.3688 0.3183 -0.0751 0.1031  -0.0116 248 GLY B N     
4482 C  CA    . GLY B 272 ? 0.3093 0.3675 0.2691 -0.0841 0.0872  0.0115  248 GLY B CA    
4483 C  C     . GLY B 272 ? 0.2519 0.3086 0.2468 -0.0372 0.0568  0.0106  248 GLY B C     
4484 O  O     . GLY B 272 ? 0.2850 0.3559 0.3171 -0.0754 0.0731  -0.0008 248 GLY B O     
4485 N  N     . ALA B 273 ? 0.2275 0.2804 0.2390 -0.0305 0.0544  0.0468  249 ALA B N     
4486 C  CA    . ALA B 273 ? 0.2442 0.2882 0.2330 0.0176  0.0597  0.0266  249 ALA B CA    
4487 C  C     . ALA B 273 ? 0.2152 0.3172 0.2708 -0.0109 0.0545  0.0413  249 ALA B C     
4488 O  O     . ALA B 273 ? 0.2204 0.3395 0.2689 -0.0170 0.0822  0.0390  249 ALA B O     
4489 C  CB    . ALA B 273 ? 0.2266 0.3121 0.2837 0.0273  0.0741  0.0274  249 ALA B CB    
4490 N  N     . VAL B 274 ? 0.2127 0.2927 0.2733 0.0325  0.0678  0.0454  250 VAL B N     
4491 C  CA    . VAL B 274 ? 0.2261 0.3069 0.2500 -0.0295 0.0760  0.0426  250 VAL B CA    
4492 C  C     . VAL B 274 ? 0.2369 0.2996 0.2485 -0.0020 0.0319  -0.0063 250 VAL B C     
4493 O  O     . VAL B 274 ? 0.2375 0.3204 0.2840 -0.0244 0.0179  -0.0055 250 VAL B O     
4494 C  CB    . VAL B 274 ? 0.2350 0.3438 0.2771 0.0101  0.0334  0.0419  250 VAL B CB    
4495 C  CG1   . VAL B 274 ? 0.3084 0.3384 0.3165 -0.0172 0.0627  0.0533  250 VAL B CG1   
4496 C  CG2   . VAL B 274 ? 0.2570 0.3805 0.3177 0.0353  -0.0023 0.0822  250 VAL B CG2   
4497 N  N     . ILE B 275 ? 0.1891 0.2798 0.2619 -0.0122 0.0398  0.0201  251 ILE B N     
4498 C  CA    . ILE B 275 ? 0.2340 0.2733 0.2336 0.0081  0.0257  0.0353  251 ILE B CA    
4499 C  C     . ILE B 275 ? 0.1831 0.3348 0.2659 0.0124  0.0108  0.0437  251 ILE B C     
4500 O  O     . ILE B 275 ? 0.1802 0.3275 0.3093 -0.0148 0.0203  0.0294  251 ILE B O     
4501 C  CB    . ILE B 275 ? 0.2271 0.2858 0.2480 -0.0071 0.0170  0.0076  251 ILE B CB    
4502 C  CG1   . ILE B 275 ? 0.1933 0.3526 0.2722 0.0074  0.0268  0.0433  251 ILE B CG1   
4503 C  CG2   . ILE B 275 ? 0.1811 0.3177 0.3118 -0.0010 0.0383  0.0142  251 ILE B CG2   
4504 C  CD1   . ILE B 275 ? 0.2383 0.2912 0.2659 -0.0201 0.0100  0.0176  251 ILE B CD1   
4505 N  N     . LEU B 276 ? 0.2030 0.2900 0.2775 -0.0214 0.0171  0.0270  252 LEU B N     
4506 C  CA    . LEU B 276 ? 0.2253 0.2619 0.2760 -0.0143 0.0282  0.0268  252 LEU B CA    
4507 C  C     . LEU B 276 ? 0.2355 0.2792 0.2658 -0.0029 -0.0010 0.0150  252 LEU B C     
4508 O  O     . LEU B 276 ? 0.2332 0.3179 0.2849 0.0017  0.0012  0.0009  252 LEU B O     
4509 C  CB    . LEU B 276 ? 0.2582 0.2724 0.3185 -0.0332 0.0297  0.0411  252 LEU B CB    
4510 C  CG    . LEU B 276 ? 0.3776 0.2940 0.2987 -0.0333 0.0272  0.0459  252 LEU B CG    
4511 C  CD1   . LEU B 276 ? 0.3292 0.4677 0.3882 -0.0071 0.0422  -0.0127 252 LEU B CD1   
4512 C  CD2   . LEU B 276 ? 0.4076 0.3321 0.4335 0.0480  0.0567  0.0181  252 LEU B CD2   
4513 N  N     . LYS B 277 ? 0.2246 0.3321 0.2676 -0.0160 0.0152  -0.0051 253 LYS B N     
4514 C  CA    . LYS B 277 ? 0.2734 0.2700 0.2552 -0.0192 0.0157  0.0270  253 LYS B CA    
4515 C  C     . LYS B 277 ? 0.2631 0.3443 0.3006 -0.0361 -0.0050 0.0626  253 LYS B C     
4516 O  O     . LYS B 277 ? 0.2542 0.3843 0.3594 -0.0314 -0.0233 0.0655  253 LYS B O     
4517 C  CB    . LYS B 277 ? 0.2196 0.2780 0.2658 -0.0465 0.0346  0.0062  253 LYS B CB    
4518 C  CG    . LYS B 277 ? 0.2916 0.3277 0.2615 -0.0253 0.0154  -0.0149 253 LYS B CG    
4519 C  CD    . LYS B 277 ? 0.3524 0.3251 0.3536 -0.0107 0.0222  -0.0034 253 LYS B CD    
4520 C  CE    . LYS B 277 ? 0.3799 0.3491 0.3610 -0.0062 0.0377  -0.0073 253 LYS B CE    
4521 N  NZ    . LYS B 277 ? 0.4640 0.3548 0.4715 -0.0003 0.0486  -0.0590 253 LYS B NZ    
4522 N  N     . GLY B 278 ? 0.2589 0.3741 0.3079 -0.0016 0.0115  0.0948  254 GLY B N     
4523 C  CA    . GLY B 278 ? 0.3385 0.3129 0.3352 0.0309  0.0087  0.0915  254 GLY B CA    
4524 C  C     . GLY B 278 ? 0.2934 0.3593 0.3464 0.0202  -0.0186 0.0456  254 GLY B C     
4525 O  O     . GLY B 278 ? 0.2594 0.3317 0.3696 0.0201  0.0058  0.0442  254 GLY B O     
4526 N  N     . ARG B 279 ? 0.2923 0.3749 0.3730 0.0171  0.0070  0.0317  255 ARG B N     
4527 C  CA    . ARG B 279 ? 0.3071 0.4187 0.3788 0.0446  0.0058  0.0370  255 ARG B CA    
4528 C  C     . ARG B 279 ? 0.3348 0.4087 0.3576 0.0284  0.0284  0.0100  255 ARG B C     
4529 O  O     . ARG B 279 ? 0.3336 0.5417 0.4005 0.0322  0.0701  0.0061  255 ARG B O     
4530 C  CB    . ARG B 279 ? 0.3118 0.5523 0.4770 0.1282  -0.0226 0.0016  255 ARG B CB    
4531 C  CG    . ARG B 279 ? 0.3311 0.7104 0.4802 0.1843  -0.0645 0.0775  255 ARG B CG    
4532 C  CD    . ARG B 279 ? 0.4210 0.8492 0.5533 0.2357  -0.1576 0.0723  255 ARG B CD    
4533 N  NE    . ARG B 279 ? 0.6611 0.8396 0.5753 0.2165  -0.1336 0.0664  255 ARG B NE    
4534 C  CZ    . ARG B 279 ? 0.8407 0.6464 0.6634 0.2426  -0.0147 0.0395  255 ARG B CZ    
4535 N  NH1   . ARG B 279 ? 0.9062 0.6587 0.7922 0.2485  0.0760  0.0077  255 ARG B NH1   
4536 N  NH2   . ARG B 279 ? 0.9668 0.5351 0.8117 0.3241  -0.0340 0.0681  255 ARG B NH2   
4537 N  N     . GLU B 280 ? 0.2662 0.3835 0.3328 -0.0266 -0.0143 0.0716  256 GLU B N     
4538 C  CA    . GLU B 280 ? 0.2666 0.4227 0.3275 -0.0484 0.0330  0.0600  256 GLU B CA    
4539 C  C     . GLU B 280 ? 0.2525 0.4027 0.3181 -0.0176 0.0405  0.0341  256 GLU B C     
4540 O  O     . GLU B 280 ? 0.2462 0.3808 0.3714 -0.0092 0.0298  0.0439  256 GLU B O     
4541 C  CB    . GLU B 280 ? 0.2939 0.4143 0.3728 -0.0839 0.0000  0.0069  256 GLU B CB    
4542 C  CG    . GLU B 280 ? 0.4467 0.4844 0.3428 -0.0529 -0.0473 0.0055  256 GLU B CG    
4543 C  CD    . GLU B 280 ? 0.4654 0.5103 0.4380 -0.0398 -0.0084 0.0258  256 GLU B CD    
4544 O  OE1   . GLU B 280 ? 0.3994 0.5178 0.4328 -0.0763 0.0571  0.0566  256 GLU B OE1   
4545 O  OE2   . GLU B 280 ? 0.6071 0.7288 0.4406 -0.0617 0.0305  0.0432  256 GLU B OE2   
4546 N  N     . ARG B 281 ? 0.1641 0.4187 0.3527 -0.0103 0.0445  0.0123  257 ARG B N     
4547 C  CA    . ARG B 281 ? 0.1982 0.3198 0.3265 -0.0278 0.0748  0.0067  257 ARG B CA    
4548 C  C     . ARG B 281 ? 0.1909 0.3775 0.3347 -0.0392 0.0283  0.0568  257 ARG B C     
4549 O  O     . ARG B 281 ? 0.1806 0.4464 0.3561 -0.0136 0.0670  0.0269  257 ARG B O     
4550 C  CB    . ARG B 281 ? 0.0967 0.3452 0.3608 0.0065  0.1378  0.0033  257 ARG B CB    
4551 C  CG    . ARG B 281 ? 0.3210 0.3384 0.4449 -0.0656 0.0811  0.0464  257 ARG B CG    
4552 C  CD    . ARG B 281 ? 0.3343 0.4013 0.5008 0.0501  0.0100  -0.0038 257 ARG B CD    
4553 N  NE    . ARG B 281 ? 0.3543 0.4781 0.6025 0.0395  -0.0092 0.0672  257 ARG B NE    
4554 C  CZ    . ARG B 281 ? 0.3748 0.5283 0.4931 0.0220  0.0113  0.0251  257 ARG B CZ    
4555 N  NH1   . ARG B 281 ? 0.4696 0.5982 0.4746 0.0246  0.0072  0.0622  257 ARG B NH1   
4556 N  NH2   . ARG B 281 ? 0.3530 0.5791 0.5415 0.0263  0.0421  0.0628  257 ARG B NH2   
4557 N  N     . TYR B 282 ? 0.2187 0.3465 0.2931 -0.0115 0.0446  0.0492  258 TYR B N     
4558 C  CA    . TYR B 282 ? 0.2192 0.3225 0.3162 -0.0164 0.0334  0.0455  258 TYR B CA    
4559 C  C     . TYR B 282 ? 0.2334 0.4058 0.2904 -0.0003 0.0565  0.0226  258 TYR B C     
4560 O  O     . TYR B 282 ? 0.2363 0.3964 0.3118 -0.0055 0.0373  0.0475  258 TYR B O     
4561 C  CB    . TYR B 282 ? 0.1723 0.3292 0.3518 -0.0371 0.0187  0.0118  258 TYR B CB    
4562 C  CG    . TYR B 282 ? 0.2195 0.3656 0.3104 -0.0501 0.0108  0.0686  258 TYR B CG    
4563 C  CD1   . TYR B 282 ? 0.2306 0.4004 0.3852 -0.0507 -0.0250 0.0389  258 TYR B CD1   
4564 C  CD2   . TYR B 282 ? 0.2811 0.4157 0.2977 -0.0279 0.0350  0.0316  258 TYR B CD2   
4565 C  CE1   . TYR B 282 ? 0.3218 0.3508 0.3771 -0.0365 0.0013  -0.0001 258 TYR B CE1   
4566 C  CE2   . TYR B 282 ? 0.2519 0.4410 0.3397 -0.0224 0.0006  0.0073  258 TYR B CE2   
4567 C  CZ    . TYR B 282 ? 0.3049 0.4121 0.3872 -0.0746 0.0025  -0.0106 258 TYR B CZ    
4568 O  OH    . TYR B 282 ? 0.3081 0.5414 0.4295 -0.0936 -0.0294 -0.0414 258 TYR B OH    
4569 N  N     . TYR B 283 ? 0.2047 0.3648 0.3084 -0.0231 0.0622  0.0259  259 TYR B N     
4570 C  CA    . TYR B 283 ? 0.2351 0.3045 0.3206 0.0056  0.0477  0.0189  259 TYR B CA    
4571 C  C     . TYR B 283 ? 0.2264 0.3116 0.3152 -0.0405 0.0510  0.0218  259 TYR B C     
4572 O  O     . TYR B 283 ? 0.2213 0.3480 0.3612 -0.0577 0.0383  0.0142  259 TYR B O     
4573 C  CB    . TYR B 283 ? 0.1982 0.3123 0.3464 0.0052  0.0672  0.0337  259 TYR B CB    
4574 C  CG    . TYR B 283 ? 0.2633 0.3137 0.3591 0.0226  0.0595  0.0299  259 TYR B CG    
4575 C  CD1   . TYR B 283 ? 0.2971 0.3888 0.3547 0.0100  0.0604  0.0507  259 TYR B CD1   
4576 C  CD2   . TYR B 283 ? 0.1960 0.3310 0.3657 0.0454  0.0790  0.0057  259 TYR B CD2   
4577 C  CE1   . TYR B 283 ? 0.2849 0.3574 0.3689 0.0250  0.0314  0.0335  259 TYR B CE1   
4578 C  CE2   . TYR B 283 ? 0.3248 0.3867 0.3382 0.0193  0.0705  0.0506  259 TYR B CE2   
4579 C  CZ    . TYR B 283 ? 0.3385 0.3826 0.4191 0.0148  -0.0078 0.0295  259 TYR B CZ    
4580 O  OH    . TYR B 283 ? 0.4149 0.4156 0.5359 0.0523  0.1088  0.0828  259 TYR B OH    
4581 N  N     . VAL B 284 ? 0.2003 0.3220 0.2971 0.0057  0.0722  0.0260  260 VAL B N     
4582 C  CA    . VAL B 284 ? 0.2503 0.3250 0.3227 -0.0097 0.0252  0.0335  260 VAL B CA    
4583 C  C     . VAL B 284 ? 0.2999 0.3250 0.3270 -0.0107 0.0644  0.0098  260 VAL B C     
4584 O  O     . VAL B 284 ? 0.2859 0.3265 0.3016 -0.0043 0.0572  0.0139  260 VAL B O     
4585 C  CB    . VAL B 284 ? 0.3167 0.3558 0.3672 0.0153  0.0457  -0.0095 260 VAL B CB    
4586 C  CG1   . VAL B 284 ? 0.3745 0.3646 0.4244 -0.0428 0.0574  0.0459  260 VAL B CG1   
4587 C  CG2   . VAL B 284 ? 0.3238 0.4245 0.3843 0.0036  0.0494  -0.0420 260 VAL B CG2   
4588 N  N     . ASN B 285 ? 0.2974 0.3684 0.3645 -0.0330 0.0929  0.0190  261 ASN B N     
4589 C  CA    . ASN B 285 ? 0.3494 0.3789 0.3654 -0.0575 0.0810  0.0207  261 ASN B CA    
4590 C  C     . ASN B 285 ? 0.3572 0.4037 0.3896 -0.0296 0.1028  0.0172  261 ASN B C     
4591 O  O     . ASN B 285 ? 0.2862 0.3922 0.4283 -0.0650 0.1518  0.0260  261 ASN B O     
4592 C  CB    . ASN B 285 ? 0.3780 0.4871 0.4656 -0.0607 0.1417  0.0241  261 ASN B CB    
4593 C  CG    . ASN B 285 ? 0.4493 0.4975 0.7048 0.0013  0.1361  0.0504  261 ASN B CG    
4594 O  OD1   . ASN B 285 ? 0.4304 0.4779 0.6951 0.0051  0.2235  -0.0236 261 ASN B OD1   
4595 N  ND2   . ASN B 285 ? 0.5447 0.6798 0.9681 -0.1155 0.1117  0.0017  261 ASN B ND2   
4596 N  N     . ALA B 286 ? 0.3543 0.3966 0.4089 -0.0697 0.0943  0.0516  262 ALA B N     
4597 C  CA    . ALA B 286 ? 0.4048 0.4510 0.4362 -0.0203 0.0587  0.0201  262 ALA B CA    
4598 C  C     . ALA B 286 ? 0.3746 0.4806 0.4598 -0.0153 0.0908  0.0288  262 ALA B C     
4599 O  O     . ALA B 286 ? 0.4089 0.5192 0.4217 -0.0561 0.1477  0.0704  262 ALA B O     
4600 C  CB    . ALA B 286 ? 0.3201 0.5337 0.4428 0.0000  0.0142  -0.0333 262 ALA B CB    
4601 N  N     . ILE B 287 ? 0.4373 0.5614 0.5078 0.0171  0.0440  0.0509  263 ILE B N     
4602 C  CA    . ILE B 287 ? 0.5322 0.5591 0.5130 0.0205  0.0705  0.0395  263 ILE B CA    
4603 C  C     . ILE B 287 ? 0.4545 0.6552 0.4629 -0.0023 0.0703  0.0276  263 ILE B C     
4604 O  O     . ILE B 287 ? 0.4523 0.7086 0.4424 -0.0295 0.1604  -0.0110 263 ILE B O     
4605 C  CB    . ILE B 287 ? 0.5500 0.5432 0.5527 0.0091  0.0469  0.0607  263 ILE B CB    
4606 C  CG1   . ILE B 287 ? 0.3814 0.5850 0.5447 0.0175  0.1522  -0.0049 263 ILE B CG1   
4607 C  CG2   . ILE B 287 ? 0.5945 0.6065 0.5710 0.0779  0.0286  0.0771  263 ILE B CG2   
4608 C  CD1   . ILE B 287 ? 0.2282 0.5476 0.5190 0.0066  0.2412  -0.0853 263 ILE B CD1   
4609 N  N     . ARG B 288 ? 0.4833 0.6976 0.5102 0.0277  0.1110  0.0581  264 ARG B N     
4610 C  CA    . ARG B 288 ? 0.4714 0.7077 0.5900 0.0172  0.1437  -0.0133 264 ARG B CA    
4611 C  C     . ARG B 288 ? 0.5303 0.6942 0.5843 -0.0159 0.1004  0.0219  264 ARG B C     
4612 O  O     . ARG B 288 ? 0.6264 0.7053 0.6292 -0.0436 0.1513  0.0634  264 ARG B O     
4613 C  CB    . ARG B 288 ? 0.3931 0.6278 0.7459 -0.0445 0.1137  -0.0211 264 ARG B CB    
4614 C  CG    . ARG B 288 ? 0.4192 0.5909 0.7782 -0.0779 0.1332  -0.0301 264 ARG B CG    
4615 C  CD    . ARG B 288 ? 0.3937 0.4112 0.7493 -0.1054 0.1044  -0.1196 264 ARG B CD    
4616 N  NE    . ARG B 288 ? 0.4694 0.3844 0.8562 -0.1448 0.0532  -0.0846 264 ARG B NE    
4617 C  CZ    . ARG B 288 ? 0.4445 0.4716 0.6204 -0.1109 0.0800  -0.0368 264 ARG B CZ    
4618 N  NH1   . ARG B 288 ? 0.4619 0.4537 0.6486 -0.2162 0.1253  -0.0179 264 ARG B NH1   
4619 N  NH2   . ARG B 288 ? 0.4751 0.4671 0.7194 -0.0614 0.0222  -0.0929 264 ARG B NH2   
4620 N  N     . ILE B 289 ? 0.6092 0.7870 0.6102 -0.0323 0.0376  -0.0876 265 ILE B N     
4621 C  CA    . ILE B 289 ? 0.6233 0.8263 0.7002 -0.0437 0.0169  -0.0209 265 ILE B CA    
4622 C  C     . ILE B 289 ? 0.7120 0.9351 0.7151 0.0170  0.0730  -0.0263 265 ILE B C     
4623 O  O     . ILE B 289 ? 0.7406 0.9831 0.8654 0.0822  0.1192  -0.0073 265 ILE B O     
4624 C  CB    . ILE B 289 ? 0.5935 0.7857 0.5955 0.0015  0.0321  -0.0189 265 ILE B CB    
4625 C  CG1   . ILE B 289 ? 0.5307 0.7062 0.5969 -0.0572 0.0670  0.0018  265 ILE B CG1   
4626 C  CG2   . ILE B 289 ? 0.6126 0.7817 0.5713 0.0076  0.0384  0.0442  265 ILE B CG2   
4627 C  CD1   . ILE B 289 ? 0.4768 0.6268 0.6164 -0.1198 0.0991  0.0706  265 ILE B CD1   
4628 N  N     . ARG B 290 ? 0.7817 0.9160 0.7789 -0.0225 0.0941  0.0282  266 ARG B N     
4629 C  CA    . ARG B 290 ? 0.8411 0.8642 0.7968 -0.0619 0.0898  -0.0078 266 ARG B CA    
4630 C  C     . ARG B 290 ? 0.6989 0.9368 0.6826 -0.0218 0.0457  -0.0405 266 ARG B C     
4631 O  O     . ARG B 290 ? 0.7106 0.8820 0.7695 0.0019  0.0137  -0.0283 266 ARG B O     
4632 C  CB    . ARG B 290 ? 0.8971 0.8680 1.0352 -0.0488 0.0752  0.0454  266 ARG B CB    
4633 C  CG    . ARG B 290 ? 0.8549 0.8758 1.3001 0.0059  0.0003  -0.0300 266 ARG B CG    
4634 C  CD    . ARG B 290 ? 0.7276 0.9101 1.3792 0.0126  -0.0102 0.0066  266 ARG B CD    
4635 N  NE    . ARG B 290 ? 0.4873 0.9578 1.3180 -0.0108 0.0007  -0.0047 266 ARG B NE    
4636 C  CZ    . ARG B 290 ? 0.5013 0.9706 1.0721 0.0789  -0.0041 -0.0808 266 ARG B CZ    
4637 N  NH1   . ARG B 290 ? 0.4024 1.0116 1.0393 0.2044  0.0513  -0.1012 266 ARG B NH1   
4638 N  NH2   . ARG B 290 ? 0.3863 0.9973 1.1211 0.0359  -0.0274 -0.1229 266 ARG B NH2   
4639 N  N     . GLU B 291 ? 0.7188 0.8695 0.6113 -0.1006 0.0750  -0.0433 267 GLU B N     
4640 C  CA    . GLU B 291 ? 0.6244 0.8362 0.5489 -0.0524 0.0863  0.0119  267 GLU B CA    
4641 C  C     . GLU B 291 ? 0.5660 0.6551 0.5614 -0.0090 0.0778  0.0368  267 GLU B C     
4642 O  O     . GLU B 291 ? 0.5621 0.7124 0.4751 -0.0276 0.1917  0.0099  267 GLU B O     
4643 C  CB    . GLU B 291 ? 0.7070 0.8097 0.5800 -0.0463 0.0231  -0.0404 267 GLU B CB    
4644 C  CG    . GLU B 291 ? 0.7449 0.7532 0.6786 -0.0191 0.0125  -0.0500 267 GLU B CG    
4645 C  CD    . GLU B 291 ? 0.8178 0.8689 0.7457 0.1373  -0.0247 -0.1059 267 GLU B CD    
4646 O  OE1   . GLU B 291 ? 1.0741 1.0612 0.7180 0.1728  0.0020  -0.1094 267 GLU B OE1   
4647 O  OE2   . GLU B 291 ? 0.8768 0.9253 0.5831 0.1053  0.0898  -0.2349 267 GLU B OE2   
4648 N  N     . VAL B 292 ? 0.5051 0.6345 0.4763 0.0387  0.0720  0.0274  268 VAL B N     
4649 C  CA    . VAL B 292 ? 0.4400 0.5141 0.4560 0.0407  0.0423  -0.0133 268 VAL B CA    
4650 C  C     . VAL B 292 ? 0.4323 0.4606 0.4334 0.0287  0.0554  -0.0602 268 VAL B C     
4651 O  O     . VAL B 292 ? 0.5007 0.4420 0.4224 0.0302  0.0633  -0.0668 268 VAL B O     
4652 C  CB    . VAL B 292 ? 0.4275 0.5741 0.3658 0.0244  0.0160  0.0027  268 VAL B CB    
4653 C  CG1   . VAL B 292 ? 0.3448 0.6303 0.4476 0.0809  0.0254  -0.0311 268 VAL B CG1   
4654 C  CG2   . VAL B 292 ? 0.3825 0.4786 0.4165 0.1076  0.0318  -0.0041 268 VAL B CG2   
4655 N  N     . VAL B 293 ? 0.3615 0.4144 0.2184 -0.0232 0.0634  -0.0481 269 VAL B N     
4656 C  CA    . VAL B 293 ? 0.3593 0.3871 0.2351 -0.0121 0.0744  0.0067  269 VAL B CA    
4657 C  C     . VAL B 293 ? 0.3108 0.3479 0.2189 -0.0188 0.0233  0.0010  269 VAL B C     
4658 O  O     . VAL B 293 ? 0.2856 0.3403 0.2065 -0.0474 0.0737  0.0290  269 VAL B O     
4659 C  CB    . VAL B 293 ? 0.3397 0.3732 0.3091 -0.0408 0.0816  0.0365  269 VAL B CB    
4660 C  CG1   . VAL B 293 ? 0.3747 0.4187 0.3365 -0.0268 0.0213  0.0342  269 VAL B CG1   
4661 C  CG2   . VAL B 293 ? 0.3858 0.4243 0.3015 -0.0703 0.0933  0.0281  269 VAL B CG2   
4662 N  N     . ASP B 294 ? 0.2833 0.3720 0.2179 -0.0039 0.0569  -0.0066 270 ASP B N     
4663 C  CA    . ASP B 294 ? 0.2984 0.3353 0.2197 -0.0226 0.0603  -0.0231 270 ASP B CA    
4664 C  C     . ASP B 294 ? 0.1880 0.2387 0.2235 -0.0035 0.0668  -0.0059 270 ASP B C     
4665 O  O     . ASP B 294 ? 0.2458 0.2656 0.2334 -0.0364 0.0852  -0.0301 270 ASP B O     
4666 C  CB    . ASP B 294 ? 0.2766 0.3262 0.1780 -0.0371 0.0678  -0.0132 270 ASP B CB    
4667 C  CG    . ASP B 294 ? 0.2479 0.3112 0.2248 0.0000  0.0798  -0.0200 270 ASP B CG    
4668 O  OD1   . ASP B 294 ? 0.2893 0.3094 0.2154 0.0186  0.0675  -0.0203 270 ASP B OD1   
4669 O  OD2   . ASP B 294 ? 0.3464 0.3312 0.2911 0.0573  0.1368  0.0385  270 ASP B OD2   
4670 N  N     . THR B 295 ? 0.2197 0.2493 0.2198 -0.0032 0.0747  0.0052  271 THR B N     
4671 C  CA    . THR B 295 ? 0.2442 0.2748 0.2108 0.0072  0.0859  -0.0010 271 THR B CA    
4672 C  C     . THR B 295 ? 0.1828 0.2223 0.2064 -0.0167 0.0564  -0.0086 271 THR B C     
4673 O  O     . THR B 295 ? 0.1883 0.2527 0.2084 0.0091  0.0633  0.0052  271 THR B O     
4674 C  CB    . THR B 295 ? 0.2622 0.2969 0.2222 0.0291  0.0792  -0.0046 271 THR B CB    
4675 O  OG1   . THR B 295 ? 0.3134 0.2916 0.2495 0.0043  0.0251  -0.0136 271 THR B OG1   
4676 C  CG2   . THR B 295 ? 0.2201 0.3807 0.2765 0.0576  0.0524  -0.0460 271 THR B CG2   
4677 N  N     . THR B 296 ? 0.1920 0.2612 0.2030 0.0005  0.0659  -0.0229 272 THR B N     
4678 C  CA    . THR B 296 ? 0.1891 0.2207 0.1962 -0.0082 0.0622  -0.0265 272 THR B CA    
4679 C  C     . THR B 296 ? 0.1394 0.2048 0.1851 0.0043  0.0618  -0.0099 272 THR B C     
4680 O  O     . THR B 296 ? 0.1996 0.2221 0.2111 -0.0088 0.0752  0.0016  272 THR B O     
4681 C  CB    . THR B 296 ? 0.1831 0.2508 0.2181 -0.0273 0.0485  -0.0237 272 THR B CB    
4682 O  OG1   . THR B 296 ? 0.2483 0.2359 0.2191 -0.0158 0.0333  -0.0243 272 THR B OG1   
4683 C  CG2   . THR B 296 ? 0.2428 0.2916 0.1754 -0.0273 0.0720  0.0157  272 THR B CG2   
4684 N  N     . GLY B 297 ? 0.1702 0.2548 0.1849 -0.0085 0.0383  -0.0076 273 GLY B N     
4685 C  CA    . GLY B 297 ? 0.1428 0.2232 0.1794 -0.0414 0.0692  0.0148  273 GLY B CA    
4686 C  C     . GLY B 297 ? 0.1605 0.2231 0.1894 -0.0272 0.0357  -0.0082 273 GLY B C     
4687 O  O     . GLY B 297 ? 0.1497 0.2059 0.1803 0.0020  0.0616  -0.0134 273 GLY B O     
4688 N  N     . ALA B 298 ? 0.1832 0.2571 0.1749 0.0058  0.0564  0.0181  274 ALA B N     
4689 C  CA    . ALA B 298 ? 0.1838 0.2370 0.1890 0.0241  0.0473  -0.0099 274 ALA B CA    
4690 C  C     . ALA B 298 ? 0.1817 0.2151 0.1887 0.0213  0.0375  0.0109  274 ALA B C     
4691 O  O     . ALA B 298 ? 0.2446 0.2126 0.1686 -0.0040 0.0599  0.0216  274 ALA B O     
4692 C  CB    . ALA B 298 ? 0.1989 0.2670 0.2307 0.0564  0.0663  -0.0116 274 ALA B CB    
4693 N  N     . GLY B 299 ? 0.1902 0.1959 0.2043 0.0161  0.0641  -0.0122 275 GLY B N     
4694 C  CA    . GLY B 299 ? 0.2039 0.2244 0.2178 0.0105  0.0301  0.0107  275 GLY B CA    
4695 C  C     . GLY B 299 ? 0.1668 0.1948 0.1963 -0.0264 0.0349  0.0109  275 GLY B C     
4696 O  O     . GLY B 299 ? 0.1325 0.2369 0.1969 -0.0191 0.0441  0.0130  275 GLY B O     
4697 N  N     . ASP B 300 ? 0.1860 0.1750 0.2363 0.0030  0.0588  0.0242  276 ASP B N     
4698 C  CA    . ASP B 300 ? 0.1896 0.1818 0.1867 0.0172  0.0440  0.0331  276 ASP B CA    
4699 C  C     . ASP B 300 ? 0.1650 0.2221 0.1785 -0.0031 0.0442  0.0150  276 ASP B C     
4700 O  O     . ASP B 300 ? 0.1272 0.2194 0.1976 -0.0329 0.0511  0.0157  276 ASP B O     
4701 C  CB    . ASP B 300 ? 0.1483 0.2075 0.2246 -0.0056 0.0477  -0.0066 276 ASP B CB    
4702 C  CG    . ASP B 300 ? 0.1752 0.1908 0.1928 -0.0050 0.0380  -0.0076 276 ASP B CG    
4703 O  OD1   . ASP B 300 ? 0.1746 0.2373 0.2256 -0.0138 0.0510  0.0368  276 ASP B OD1   
4704 O  OD2   . ASP B 300 ? 0.1542 0.2071 0.1736 -0.0160 0.0628  0.0192  276 ASP B OD2   
4705 N  N     . LEU B 301 ? 0.1826 0.1866 0.1696 -0.0120 0.0443  0.0188  277 LEU B N     
4706 C  CA    . LEU B 301 ? 0.1520 0.2189 0.1643 -0.0223 0.0229  0.0233  277 LEU B CA    
4707 C  C     . LEU B 301 ? 0.1417 0.1714 0.1638 -0.0083 0.0375  0.0148  277 LEU B C     
4708 O  O     . LEU B 301 ? 0.1334 0.1849 0.1966 -0.0188 0.0585  -0.0010 277 LEU B O     
4709 C  CB    . LEU B 301 ? 0.1175 0.2206 0.1645 -0.0148 0.0490  0.0276  277 LEU B CB    
4710 C  CG    . LEU B 301 ? 0.1183 0.1812 0.1940 -0.0207 0.0448  0.0096  277 LEU B CG    
4711 C  CD1   . LEU B 301 ? 0.1474 0.1661 0.2213 -0.0203 0.0631  0.0122  277 LEU B CD1   
4712 C  CD2   . LEU B 301 ? 0.1318 0.2210 0.1983 -0.0297 0.0724  0.0355  277 LEU B CD2   
4713 N  N     . PHE B 302 ? 0.1417 0.1948 0.1916 0.0137  0.0515  0.0158  278 PHE B N     
4714 C  CA    . PHE B 302 ? 0.1547 0.1936 0.1826 0.0064  0.0481  0.0312  278 PHE B CA    
4715 C  C     . PHE B 302 ? 0.1299 0.2061 0.1902 -0.0111 0.0527  0.0226  278 PHE B C     
4716 O  O     . PHE B 302 ? 0.1466 0.2256 0.2099 0.0017  0.0526  -0.0009 278 PHE B O     
4717 C  CB    . PHE B 302 ? 0.1540 0.1987 0.1973 0.0063  0.0622  0.0342  278 PHE B CB    
4718 C  CG    . PHE B 302 ? 0.1838 0.2655 0.2055 0.0030  0.0373  0.0135  278 PHE B CG    
4719 C  CD1   . PHE B 302 ? 0.1995 0.2380 0.2117 0.0054  0.0634  0.0223  278 PHE B CD1   
4720 C  CD2   . PHE B 302 ? 0.2122 0.2088 0.1993 0.0111  0.0383  0.0069  278 PHE B CD2   
4721 C  CE1   . PHE B 302 ? 0.1970 0.2390 0.2264 0.0291  0.0589  0.0144  278 PHE B CE1   
4722 C  CE2   . PHE B 302 ? 0.1793 0.2170 0.2879 0.0201  0.0301  0.0127  278 PHE B CE2   
4723 C  CZ    . PHE B 302 ? 0.1936 0.2543 0.2175 0.0209  0.0483  0.0032  278 PHE B CZ    
4724 N  N     . ALA B 303 ? 0.1399 0.2127 0.2095 -0.0172 0.0695  0.0154  279 ALA B N     
4725 C  CA    . ALA B 303 ? 0.1380 0.2071 0.2111 -0.0315 0.0685  0.0097  279 ALA B CA    
4726 C  C     . ALA B 303 ? 0.1361 0.2024 0.1818 -0.0159 0.0351  0.0254  279 ALA B C     
4727 O  O     . ALA B 303 ? 0.1631 0.2037 0.1861 -0.0449 0.0533  0.0140  279 ALA B O     
4728 C  CB    . ALA B 303 ? 0.1169 0.2529 0.1834 -0.0373 0.0515  0.0104  279 ALA B CB    
4729 N  N     . SER B 304 ? 0.1401 0.1847 0.1788 -0.0011 0.0665  0.0360  280 SER B N     
4730 C  CA    . SER B 304 ? 0.0968 0.1808 0.1853 -0.0165 0.0477  0.0258  280 SER B CA    
4731 C  C     . SER B 304 ? 0.1230 0.2077 0.1982 -0.0401 0.0262  0.0140  280 SER B C     
4732 O  O     . SER B 304 ? 0.1362 0.2386 0.2281 -0.0405 0.0453  -0.0159 280 SER B O     
4733 C  CB    . SER B 304 ? 0.1212 0.2031 0.2040 -0.0194 0.0380  0.0484  280 SER B CB    
4734 O  OG    . SER B 304 ? 0.1276 0.2007 0.1931 -0.0291 0.0434  0.0204  280 SER B OG    
4735 N  N     . GLY B 305 ? 0.1595 0.2235 0.1992 0.0002  0.0257  0.0205  281 GLY B N     
4736 C  CA    . GLY B 305 ? 0.1761 0.2398 0.1714 -0.0260 0.0685  0.0159  281 GLY B CA    
4737 C  C     . GLY B 305 ? 0.1731 0.2138 0.2194 -0.0106 0.0372  0.0129  281 GLY B C     
4738 O  O     . GLY B 305 ? 0.2059 0.2440 0.2116 -0.0273 0.0395  0.0096  281 GLY B O     
4739 N  N     . PHE B 306 ? 0.0864 0.2109 0.1999 -0.0147 0.0598  0.0102  282 PHE B N     
4740 C  CA    . PHE B 306 ? 0.1475 0.2243 0.2094 0.0054  0.0586  0.0374  282 PHE B CA    
4741 C  C     . PHE B 306 ? 0.1521 0.2211 0.2237 -0.0029 0.0555  0.0248  282 PHE B C     
4742 O  O     . PHE B 306 ? 0.1781 0.2868 0.2447 -0.0254 0.0670  0.0180  282 PHE B O     
4743 C  CB    . PHE B 306 ? 0.1506 0.2179 0.2083 -0.0173 0.0514  0.0095  282 PHE B CB    
4744 C  CG    . PHE B 306 ? 0.1801 0.2120 0.2277 -0.0081 0.0263  0.0099  282 PHE B CG    
4745 C  CD1   . PHE B 306 ? 0.1763 0.2442 0.2184 -0.0322 0.0321  0.0310  282 PHE B CD1   
4746 C  CD2   . PHE B 306 ? 0.1591 0.2212 0.2596 -0.0263 0.0262  0.0457  282 PHE B CD2   
4747 C  CE1   . PHE B 306 ? 0.1953 0.2715 0.2282 -0.0242 0.0259  0.0466  282 PHE B CE1   
4748 C  CE2   . PHE B 306 ? 0.2212 0.2999 0.2520 -0.0331 0.0119  0.0544  282 PHE B CE2   
4749 C  CZ    . PHE B 306 ? 0.2121 0.2819 0.2544 -0.0042 -0.0001 0.0387  282 PHE B CZ    
4750 N  N     . LEU B 307 ? 0.1451 0.2080 0.2328 -0.0265 0.0517  0.0158  283 LEU B N     
4751 C  CA    . LEU B 307 ? 0.1711 0.2015 0.2154 -0.0189 0.0438  0.0109  283 LEU B CA    
4752 C  C     . LEU B 307 ? 0.1288 0.2092 0.2067 -0.0362 0.0519  0.0030  283 LEU B C     
4753 O  O     . LEU B 307 ? 0.1374 0.2574 0.2303 -0.0251 0.0475  -0.0231 283 LEU B O     
4754 C  CB    . LEU B 307 ? 0.1645 0.1963 0.2071 -0.0089 0.0648  0.0125  283 LEU B CB    
4755 C  CG    . LEU B 307 ? 0.1691 0.2063 0.2477 -0.0349 0.0367  0.0218  283 LEU B CG    
4756 C  CD1   . LEU B 307 ? 0.1611 0.2707 0.2816 -0.0435 0.0881  -0.0037 283 LEU B CD1   
4757 C  CD2   . LEU B 307 ? 0.2956 0.2635 0.2233 -0.0479 0.0623  0.0525  283 LEU B CD2   
4758 N  N     . TYR B 308 ? 0.1472 0.2219 0.2069 -0.0015 0.0380  0.0135  284 TYR B N     
4759 C  CA    . TYR B 308 ? 0.1554 0.2287 0.2461 -0.0098 0.0464  0.0143  284 TYR B CA    
4760 C  C     . TYR B 308 ? 0.1601 0.2337 0.2300 -0.0325 0.0527  0.0181  284 TYR B C     
4761 O  O     . TYR B 308 ? 0.1640 0.2838 0.2681 -0.0551 0.0680  -0.0226 284 TYR B O     
4762 C  CB    . TYR B 308 ? 0.1327 0.2416 0.2364 -0.0214 0.0530  0.0046  284 TYR B CB    
4763 C  CG    . TYR B 308 ? 0.1918 0.2189 0.2663 -0.0170 0.0266  0.0030  284 TYR B CG    
4764 C  CD1   . TYR B 308 ? 0.2483 0.2308 0.3304 -0.0032 0.0213  -0.0189 284 TYR B CD1   
4765 C  CD2   . TYR B 308 ? 0.2039 0.2793 0.3276 -0.0074 0.0570  0.0280  284 TYR B CD2   
4766 C  CE1   . TYR B 308 ? 0.2790 0.2687 0.3164 -0.0388 0.0445  0.0069  284 TYR B CE1   
4767 C  CE2   . TYR B 308 ? 0.2600 0.2711 0.4092 -0.0223 0.0379  0.0188  284 TYR B CE2   
4768 C  CZ    . TYR B 308 ? 0.2792 0.2747 0.4068 -0.0373 0.0577  -0.0177 284 TYR B CZ    
4769 O  OH    . TYR B 308 ? 0.3443 0.3025 0.5138 -0.0890 0.0495  -0.0141 284 TYR B OH    
4770 N  N     . GLY B 309 ? 0.1907 0.2571 0.2397 -0.0058 0.0409  0.0132  285 GLY B N     
4771 C  CA    . GLY B 309 ? 0.1640 0.2853 0.2502 -0.0104 0.0738  0.0101  285 GLY B CA    
4772 C  C     . GLY B 309 ? 0.1979 0.2813 0.2634 -0.0145 0.0274  0.0179  285 GLY B C     
4773 O  O     . GLY B 309 ? 0.2319 0.3067 0.3000 -0.0195 0.0316  -0.0095 285 GLY B O     
4774 N  N     . TYR B 310 ? 0.1731 0.2410 0.2300 -0.0109 0.0025  0.0020  286 TYR B N     
4775 C  CA    . TYR B 310 ? 0.2032 0.2713 0.2415 -0.0249 0.0414  0.0309  286 TYR B CA    
4776 C  C     . TYR B 310 ? 0.2212 0.2714 0.2491 -0.0178 0.0035  0.0204  286 TYR B C     
4777 O  O     . TYR B 310 ? 0.1919 0.3345 0.3036 -0.0360 0.0044  -0.0079 286 TYR B O     
4778 C  CB    . TYR B 310 ? 0.2186 0.2793 0.2113 -0.0401 0.0321  0.0138  286 TYR B CB    
4779 C  CG    . TYR B 310 ? 0.2135 0.2538 0.2217 -0.0329 -0.0187 0.0041  286 TYR B CG    
4780 C  CD1   . TYR B 310 ? 0.2389 0.2700 0.2879 -0.0152 -0.0315 0.0091  286 TYR B CD1   
4781 C  CD2   . TYR B 310 ? 0.2155 0.3325 0.2548 -0.0415 0.0115  0.0216  286 TYR B CD2   
4782 C  CE1   . TYR B 310 ? 0.2975 0.3114 0.2906 -0.0167 -0.0139 0.0211  286 TYR B CE1   
4783 C  CE2   . TYR B 310 ? 0.2410 0.3925 0.2572 -0.0286 -0.0008 0.0360  286 TYR B CE2   
4784 C  CZ    . TYR B 310 ? 0.2998 0.3365 0.2855 -0.0176 0.0042  0.0754  286 TYR B CZ    
4785 O  OH    . TYR B 310 ? 0.2961 0.4387 0.2755 -0.0274 0.0184  0.0840  286 TYR B OH    
4786 N  N     . THR B 311 ? 0.1992 0.2722 0.2781 -0.0146 0.0084  -0.0116 287 THR B N     
4787 C  CA    . THR B 311 ? 0.2213 0.2566 0.3052 -0.0067 0.0107  -0.0182 287 THR B CA    
4788 C  C     . THR B 311 ? 0.2312 0.2836 0.3268 -0.0355 0.0309  -0.0314 287 THR B C     
4789 O  O     . THR B 311 ? 0.3064 0.2985 0.3958 -0.0546 0.0837  -0.0644 287 THR B O     
4790 C  CB    . THR B 311 ? 0.2255 0.2662 0.2508 -0.0236 -0.0054 -0.0175 287 THR B CB    
4791 O  OG1   . THR B 311 ? 0.2053 0.3311 0.2470 -0.0063 0.0181  0.0154  287 THR B OG1   
4792 C  CG2   . THR B 311 ? 0.2045 0.2692 0.2665 -0.0128 0.0199  -0.0204 287 THR B CG2   
4793 N  N     . GLN B 312 ? 0.2452 0.2866 0.3094 -0.0633 0.0333  -0.0040 288 GLN B N     
4794 C  CA    . GLN B 312 ? 0.2992 0.2838 0.3427 -0.0737 0.0194  0.0091  288 GLN B CA    
4795 C  C     . GLN B 312 ? 0.2792 0.3231 0.3407 -0.0529 0.0355  0.0005  288 GLN B C     
4796 O  O     . GLN B 312 ? 0.3167 0.3815 0.4271 -0.0978 0.0258  0.0155  288 GLN B O     
4797 C  CB    . GLN B 312 ? 0.2595 0.2817 0.3466 -0.0639 0.0407  0.0109  288 GLN B CB    
4798 C  CG    . GLN B 312 ? 0.3041 0.2721 0.4154 -0.0447 -0.0138 -0.0296 288 GLN B CG    
4799 C  CD    . GLN B 312 ? 0.3571 0.3308 0.5534 0.0572  0.0115  0.0182  288 GLN B CD    
4800 O  OE1   . GLN B 312 ? 0.3675 0.4023 0.5914 0.0492  0.0589  0.0483  288 GLN B OE1   
4801 N  NE2   . GLN B 312 ? 0.3075 0.4028 0.6400 0.0363  0.0370  -0.0228 288 GLN B NE2   
4802 N  N     . GLY B 313 ? 0.2474 0.3321 0.3416 -0.0316 0.0191  -0.0082 289 GLY B N     
4803 C  CA    . GLY B 313 ? 0.2814 0.3925 0.3568 -0.0128 0.0020  0.0133  289 GLY B CA    
4804 C  C     . GLY B 313 ? 0.2514 0.3673 0.3115 -0.0635 -0.0180 -0.0134 289 GLY B C     
4805 O  O     . GLY B 313 ? 0.2236 0.4620 0.3996 -0.0570 0.0056  -0.0064 289 GLY B O     
4806 N  N     . ARG B 314 ? 0.1922 0.3250 0.3143 -0.0538 0.0297  -0.0224 290 ARG B N     
4807 C  CA    . ARG B 314 ? 0.1820 0.3031 0.3369 -0.0397 0.0288  -0.0101 290 ARG B CA    
4808 C  C     . ARG B 314 ? 0.1933 0.3053 0.3047 -0.0263 0.0289  -0.0127 290 ARG B C     
4809 O  O     . ARG B 314 ? 0.2237 0.3734 0.2908 -0.0490 0.0527  -0.0170 290 ARG B O     
4810 C  CB    . ARG B 314 ? 0.2214 0.2845 0.3311 -0.0416 0.0384  -0.0078 290 ARG B CB    
4811 C  CG    . ARG B 314 ? 0.2586 0.3129 0.4147 -0.0575 0.0305  0.0544  290 ARG B CG    
4812 C  CD    . ARG B 314 ? 0.3126 0.2914 0.4171 -0.0800 0.0418  -0.0164 290 ARG B CD    
4813 N  NE    . ARG B 314 ? 0.3084 0.4026 0.4111 -0.0432 0.0559  0.0512  290 ARG B NE    
4814 C  CZ    . ARG B 314 ? 0.3492 0.4531 0.4108 -0.0617 0.0396  0.0321  290 ARG B CZ    
4815 N  NH1   . ARG B 314 ? 0.3872 0.5420 0.4266 -0.0737 0.1174  0.1017  290 ARG B NH1   
4816 N  NH2   . ARG B 314 ? 0.3582 0.4616 0.4163 -0.0289 0.0575  0.0496  290 ARG B NH2   
4817 N  N     . SER B 315 ? 0.1760 0.3301 0.3152 -0.0262 0.0160  -0.0073 291 SER B N     
4818 C  CA    . SER B 315 ? 0.2113 0.3234 0.2806 -0.0237 0.0290  -0.0110 291 SER B CA    
4819 C  C     . SER B 315 ? 0.2051 0.2791 0.2582 -0.0126 0.0393  0.0088  291 SER B C     
4820 O  O     . SER B 315 ? 0.1999 0.2872 0.2540 -0.0199 0.0326  -0.0072 291 SER B O     
4821 C  CB    . SER B 315 ? 0.2041 0.3088 0.2706 -0.0366 0.0192  0.0057  291 SER B CB    
4822 O  OG    . SER B 315 ? 0.2203 0.3614 0.2806 -0.0189 0.0417  -0.0299 291 SER B OG    
4823 N  N     . LEU B 316 ? 0.2357 0.2822 0.2762 -0.0171 0.0465  0.0161  292 LEU B N     
4824 C  CA    . LEU B 316 ? 0.1959 0.2793 0.2766 0.0092  0.0517  0.0094  292 LEU B CA    
4825 C  C     . LEU B 316 ? 0.1660 0.2869 0.2771 -0.0127 0.0412  0.0002  292 LEU B C     
4826 O  O     . LEU B 316 ? 0.2089 0.3076 0.2555 -0.0187 0.0293  0.0267  292 LEU B O     
4827 C  CB    . LEU B 316 ? 0.2072 0.3170 0.2709 -0.0026 0.0647  0.0378  292 LEU B CB    
4828 C  CG    . LEU B 316 ? 0.2593 0.4413 0.2732 0.0054  0.0718  0.0219  292 LEU B CG    
4829 C  CD1   . LEU B 316 ? 0.2452 0.4443 0.3210 -0.0241 0.0378  0.0475  292 LEU B CD1   
4830 C  CD2   . LEU B 316 ? 0.2311 0.4508 0.3455 -0.1141 0.0429  0.0570  292 LEU B CD2   
4831 N  N     . GLU B 317 ? 0.1598 0.3089 0.2547 0.0062  0.0386  0.0091  293 GLU B N     
4832 C  CA    . GLU B 317 ? 0.1451 0.3120 0.2515 -0.0115 0.0489  0.0313  293 GLU B CA    
4833 C  C     . GLU B 317 ? 0.1576 0.2532 0.2544 -0.0123 0.0498  0.0101  293 GLU B C     
4834 O  O     . GLU B 317 ? 0.1823 0.3002 0.2546 -0.0169 0.0466  0.0110  293 GLU B O     
4835 C  CB    . GLU B 317 ? 0.1360 0.3748 0.3425 -0.0292 0.0223  0.0054  293 GLU B CB    
4836 C  CG    . GLU B 317 ? 0.1524 0.4093 0.3614 -0.0546 0.0716  0.0085  293 GLU B CG    
4837 C  CD    . GLU B 317 ? 0.1393 0.4257 0.4930 -0.0861 0.0297  0.0064  293 GLU B CD    
4838 O  OE1   . GLU B 317 ? 0.2022 0.4109 0.5904 -0.0474 0.0473  0.1236  293 GLU B OE1   
4839 O  OE2   . GLU B 317 ? 0.2941 0.4776 0.4335 -0.0548 0.1493  -0.0227 293 GLU B OE2   
4840 N  N     . ASP B 318 ? 0.1788 0.2621 0.2653 -0.0142 0.0714  0.0134  294 ASP B N     
4841 C  CA    . ASP B 318 ? 0.1647 0.2665 0.2730 -0.0066 0.0741  0.0215  294 ASP B CA    
4842 C  C     . ASP B 318 ? 0.1638 0.2283 0.2347 -0.0045 0.0526  0.0138  294 ASP B C     
4843 O  O     . ASP B 318 ? 0.1516 0.2827 0.2387 0.0072  0.0649  0.0076  294 ASP B O     
4844 C  CB    . ASP B 318 ? 0.1871 0.2819 0.3296 -0.0343 0.0517  0.0040  294 ASP B CB    
4845 C  CG    . ASP B 318 ? 0.1928 0.3332 0.3521 -0.0295 0.0762  0.0055  294 ASP B CG    
4846 O  OD1   . ASP B 318 ? 0.1751 0.3496 0.4022 -0.0564 0.1219  -0.0068 294 ASP B OD1   
4847 O  OD2   . ASP B 318 ? 0.2401 0.3697 0.4680 -0.0582 0.0704  -0.0156 294 ASP B OD2   
4848 N  N     . CYS B 319 ? 0.1541 0.2635 0.2003 -0.0325 0.0404  -0.0156 295 CYS B N     
4849 C  CA    . CYS B 319 ? 0.1582 0.2467 0.2272 -0.0465 0.0483  0.0061  295 CYS B CA    
4850 C  C     . CYS B 319 ? 0.1662 0.2227 0.2163 -0.0172 0.0483  0.0192  295 CYS B C     
4851 O  O     . CYS B 319 ? 0.1956 0.2635 0.2009 0.0105  0.0472  0.0230  295 CYS B O     
4852 C  CB    . CYS B 319 ? 0.1252 0.3169 0.2378 -0.0297 0.0609  0.0211  295 CYS B CB    
4853 S  SG    . CYS B 319 ? 0.1879 0.2991 0.2899 -0.0229 0.0511  0.0089  295 CYS B SG    
4854 N  N     . GLY B 320 ? 0.1650 0.2313 0.2200 -0.0187 0.0515  0.0334  296 GLY B N     
4855 C  CA    . GLY B 320 ? 0.1431 0.2431 0.2262 0.0078  0.0710  0.0217  296 GLY B CA    
4856 C  C     . GLY B 320 ? 0.1489 0.2450 0.2347 -0.0385 0.0397  0.0371  296 GLY B C     
4857 O  O     . GLY B 320 ? 0.1416 0.2682 0.2275 -0.0266 0.0636  0.0261  296 GLY B O     
4858 N  N     . LYS B 321 ? 0.1068 0.2490 0.2679 -0.0185 0.0493  0.0257  297 LYS B N     
4859 C  CA    . LYS B 321 ? 0.1505 0.2642 0.2659 0.0009  0.0527  0.0382  297 LYS B CA    
4860 C  C     . LYS B 321 ? 0.1716 0.2094 0.2438 -0.0024 0.0427  0.0094  297 LYS B C     
4861 O  O     . LYS B 321 ? 0.1479 0.2777 0.2538 -0.0187 0.0436  0.0352  297 LYS B O     
4862 C  CB    . LYS B 321 ? 0.1848 0.2445 0.3076 -0.0143 0.0791  0.0353  297 LYS B CB    
4863 C  CG    . LYS B 321 ? 0.2169 0.2798 0.3230 0.0092  0.0354  0.0174  297 LYS B CG    
4864 C  CD    . LYS B 321 ? 0.2459 0.2623 0.4940 0.0090  0.0812  0.0187  297 LYS B CD    
4865 C  CE    . LYS B 321 ? 0.2049 0.2432 0.7278 -0.0231 0.1525  0.1365  297 LYS B CE    
4866 N  NZ    . LYS B 321 ? 0.1724 0.3192 1.0277 -0.0985 0.1443  0.0693  297 LYS B NZ    
4867 N  N     . LEU B 322 ? 0.1580 0.2351 0.2212 -0.0327 0.0623  0.0031  298 LEU B N     
4868 C  CA    . LEU B 322 ? 0.1727 0.2425 0.2292 -0.0156 0.0644  0.0047  298 LEU B CA    
4869 C  C     . LEU B 322 ? 0.1857 0.2004 0.1895 -0.0060 0.0575  0.0083  298 LEU B C     
4870 O  O     . LEU B 322 ? 0.1287 0.2705 0.2072 -0.0138 0.0685  0.0110  298 LEU B O     
4871 C  CB    . LEU B 322 ? 0.2405 0.1869 0.2414 -0.0303 0.0548  0.0037  298 LEU B CB    
4872 C  CG    . LEU B 322 ? 0.2009 0.2156 0.2473 -0.0445 0.0787  0.0082  298 LEU B CG    
4873 C  CD1   . LEU B 322 ? 0.2087 0.2399 0.2547 -0.0429 0.0636  -0.0083 298 LEU B CD1   
4874 C  CD2   . LEU B 322 ? 0.1678 0.2538 0.2628 -0.0139 0.1043  0.0242  298 LEU B CD2   
4875 N  N     . GLY B 323 ? 0.1788 0.1917 0.2227 -0.0054 0.0932  0.0047  299 GLY B N     
4876 C  CA    . GLY B 323 ? 0.1598 0.2307 0.1971 -0.0147 0.0984  0.0020  299 GLY B CA    
4877 C  C     . GLY B 323 ? 0.1395 0.2116 0.1944 -0.0040 0.0597  0.0030  299 GLY B C     
4878 O  O     . GLY B 323 ? 0.1594 0.2403 0.1926 -0.0139 0.0634  0.0226  299 GLY B O     
4879 N  N     . CYS B 324 ? 0.1278 0.2424 0.2115 -0.0223 0.0680  0.0132  300 CYS B N     
4880 C  CA    . CYS B 324 ? 0.1203 0.2498 0.2141 0.0006  0.0887  0.0176  300 CYS B CA    
4881 C  C     . CYS B 324 ? 0.1095 0.2215 0.2205 -0.0039 0.0558  -0.0044 300 CYS B C     
4882 O  O     . CYS B 324 ? 0.1350 0.2845 0.1881 -0.0278 0.0682  0.0189  300 CYS B O     
4883 C  CB    . CYS B 324 ? 0.1199 0.2724 0.2523 0.0091  0.0745  0.0273  300 CYS B CB    
4884 S  SG    . CYS B 324 ? 0.2261 0.3078 0.2988 0.0360  0.0914  0.0579  300 CYS B SG    
4885 N  N     . LEU B 325 ? 0.1199 0.2036 0.2257 0.0062  0.0860  0.0193  301 LEU B N     
4886 C  CA    . LEU B 325 ? 0.1549 0.2233 0.2478 -0.0014 0.0598  0.0343  301 LEU B CA    
4887 C  C     . LEU B 325 ? 0.1555 0.2485 0.2263 -0.0010 0.0528  0.0215  301 LEU B C     
4888 O  O     . LEU B 325 ? 0.1423 0.3030 0.2316 -0.0158 0.0692  0.0107  301 LEU B O     
4889 C  CB    . LEU B 325 ? 0.1674 0.2558 0.2360 -0.0346 0.0824  0.0187  301 LEU B CB    
4890 C  CG    . LEU B 325 ? 0.2630 0.2903 0.2409 -0.0043 0.0451  0.0241  301 LEU B CG    
4891 C  CD1   . LEU B 325 ? 0.2641 0.4005 0.2935 -0.0045 0.0906  0.0096  301 LEU B CD1   
4892 C  CD2   . LEU B 325 ? 0.3284 0.2904 0.3314 -0.0493 -0.0107 0.0426  301 LEU B CD2   
4893 N  N     . ALA B 326 ? 0.1831 0.2167 0.2183 -0.0167 0.0607  0.0171  302 ALA B N     
4894 C  CA    . ALA B 326 ? 0.1812 0.2391 0.2216 -0.0186 0.0608  0.0091  302 ALA B CA    
4895 C  C     . ALA B 326 ? 0.1730 0.2155 0.2147 -0.0047 0.0631  0.0199  302 ALA B C     
4896 O  O     . ALA B 326 ? 0.1861 0.2344 0.1866 -0.0116 0.0793  0.0192  302 ALA B O     
4897 C  CB    . ALA B 326 ? 0.1566 0.2390 0.2315 -0.0325 0.0895  0.0298  302 ALA B CB    
4898 N  N     . ALA B 327 ? 0.1270 0.2052 0.2243 -0.0119 0.0825  0.0184  303 ALA B N     
4899 C  CA    . ALA B 327 ? 0.1776 0.2135 0.2032 -0.0255 0.0946  0.0196  303 ALA B CA    
4900 C  C     . ALA B 327 ? 0.1630 0.2470 0.1983 -0.0273 0.0739  0.0067  303 ALA B C     
4901 O  O     . ALA B 327 ? 0.1799 0.2714 0.2136 0.0059  0.0674  0.0056  303 ALA B O     
4902 C  CB    . ALA B 327 ? 0.2053 0.2412 0.2764 0.0014  0.0619  0.0363  303 ALA B CB    
4903 N  N     . GLY B 328 ? 0.1457 0.2470 0.1906 -0.0037 0.0675  0.0069  304 GLY B N     
4904 C  CA    . GLY B 328 ? 0.2070 0.2882 0.1930 -0.0019 0.0890  0.0162  304 GLY B CA    
4905 C  C     . GLY B 328 ? 0.1611 0.2316 0.2253 -0.0163 0.0660  -0.0134 304 GLY B C     
4906 O  O     . GLY B 328 ? 0.2130 0.3023 0.2043 0.0286  0.0736  -0.0040 304 GLY B O     
4907 N  N     . ILE B 329 ? 0.1946 0.2054 0.2128 -0.0169 0.0651  0.0199  305 ILE B N     
4908 C  CA    . ILE B 329 ? 0.1779 0.2326 0.2150 -0.0026 0.0746  0.0229  305 ILE B CA    
4909 C  C     . ILE B 329 ? 0.1987 0.2333 0.2151 -0.0104 0.0566  0.0096  305 ILE B C     
4910 O  O     . ILE B 329 ? 0.2342 0.2658 0.2232 -0.0141 0.0475  -0.0104 305 ILE B O     
4911 C  CB    . ILE B 329 ? 0.1976 0.2387 0.2410 -0.0362 0.0608  0.0169  305 ILE B CB    
4912 C  CG1   . ILE B 329 ? 0.2201 0.2422 0.2482 -0.0536 0.0868  -0.0041 305 ILE B CG1   
4913 C  CG2   . ILE B 329 ? 0.1976 0.2628 0.2549 -0.0220 0.0576  0.0189  305 ILE B CG2   
4914 C  CD1   . ILE B 329 ? 0.2057 0.2842 0.2409 -0.0220 0.0671  -0.0343 305 ILE B CD1   
4915 N  N     . VAL B 330 ? 0.1941 0.2729 0.1803 0.0037  0.0664  -0.0163 306 VAL B N     
4916 C  CA    . VAL B 330 ? 0.1940 0.2800 0.1991 0.0017  0.0742  -0.0035 306 VAL B CA    
4917 C  C     . VAL B 330 ? 0.2174 0.2446 0.2311 -0.0056 0.0567  0.0152  306 VAL B C     
4918 O  O     . VAL B 330 ? 0.2505 0.3026 0.2454 0.0049  0.0376  0.0129  306 VAL B O     
4919 C  CB    . VAL B 330 ? 0.1720 0.2604 0.2148 0.0350  0.0851  0.0061  306 VAL B CB    
4920 C  CG1   . VAL B 330 ? 0.2015 0.2714 0.2236 0.0204  0.0598  0.0225  306 VAL B CG1   
4921 C  CG2   . VAL B 330 ? 0.1593 0.2666 0.2141 0.0302  0.1113  -0.0028 306 VAL B CG2   
4922 N  N     . ILE B 331 ? 0.2450 0.2300 0.2105 0.0055  0.0743  0.0180  307 ILE B N     
4923 C  CA    . ILE B 331 ? 0.2409 0.2631 0.2027 -0.0092 0.0681  0.0028  307 ILE B CA    
4924 C  C     . ILE B 331 ? 0.2132 0.2574 0.2125 -0.0156 0.0694  0.0226  307 ILE B C     
4925 O  O     . ILE B 331 ? 0.2882 0.3095 0.2039 -0.0256 0.0838  0.0057  307 ILE B O     
4926 C  CB    . ILE B 331 ? 0.2440 0.2929 0.2346 0.0083  0.0721  0.0080  307 ILE B CB    
4927 C  CG1   . ILE B 331 ? 0.2346 0.2925 0.2197 0.0400  0.0867  0.0349  307 ILE B CG1   
4928 C  CG2   . ILE B 331 ? 0.2670 0.2993 0.2315 0.0313  0.0635  0.0240  307 ILE B CG2   
4929 C  CD1   . ILE B 331 ? 0.2899 0.2978 0.3247 0.0657  0.0656  0.0424  307 ILE B CD1   
4930 N  N     . GLN B 332 ? 0.2551 0.2468 0.2331 -0.0043 0.0810  0.0197  308 GLN B N     
4931 C  CA    . GLN B 332 ? 0.2794 0.2776 0.2319 -0.0310 0.0720  0.0297  308 GLN B CA    
4932 C  C     . GLN B 332 ? 0.2738 0.3360 0.2170 -0.0310 0.0809  0.0631  308 GLN B C     
4933 O  O     . GLN B 332 ? 0.3338 0.3441 0.2237 -0.0455 0.0909  0.0682  308 GLN B O     
4934 C  CB    . GLN B 332 ? 0.2821 0.3568 0.2622 -0.0553 0.1074  0.0133  308 GLN B CB    
4935 C  CG    . GLN B 332 ? 0.2694 0.4501 0.2891 -0.0499 0.0991  0.0183  308 GLN B CG    
4936 C  CD    . GLN B 332 ? 0.2969 0.5524 0.3042 -0.1018 0.0993  0.0266  308 GLN B CD    
4937 O  OE1   . GLN B 332 ? 0.4085 0.6693 0.3108 -0.0778 0.1367  0.0422  308 GLN B OE1   
4938 N  NE2   . GLN B 332 ? 0.3340 0.5534 0.2655 -0.0944 0.1464  0.0214  308 GLN B NE2   
4939 N  N     . GLN B 333 ? 0.2570 0.3262 0.2032 0.0273  0.0743  0.0193  309 GLN B N     
4940 C  CA    . GLN B 333 ? 0.2620 0.3138 0.1560 -0.0120 0.0548  0.0254  309 GLN B CA    
4941 C  C     . GLN B 333 ? 0.2655 0.3217 0.2504 -0.0268 0.0302  0.0222  309 GLN B C     
4942 O  O     . GLN B 333 ? 0.2944 0.3086 0.2233 -0.0235 0.0621  0.0080  309 GLN B O     
4943 C  CB    . GLN B 333 ? 0.2692 0.3123 0.1923 -0.0138 0.0685  0.0345  309 GLN B CB    
4944 C  CG    . GLN B 333 ? 0.2562 0.3493 0.1928 -0.0048 0.1123  0.0368  309 GLN B CG    
4945 C  CD    . GLN B 333 ? 0.2933 0.3143 0.2697 0.0119  0.0751  0.0303  309 GLN B CD    
4946 O  OE1   . GLN B 333 ? 0.3443 0.3395 0.2392 -0.0160 0.0933  0.0099  309 GLN B OE1   
4947 N  NE2   . GLN B 333 ? 0.2872 0.3269 0.3180 -0.0279 0.0656  0.0537  309 GLN B NE2   
4948 N  N     . ILE B 334 ? 0.2714 0.3931 0.2292 -0.0284 0.0341  0.0351  310 ILE B N     
4949 C  CA    . ILE B 334 ? 0.2647 0.3391 0.2605 -0.0324 0.0065  -0.0030 310 ILE B CA    
4950 C  C     . ILE B 334 ? 0.2989 0.3716 0.2829 -0.0282 0.0432  -0.0017 310 ILE B C     
4951 O  O     . ILE B 334 ? 0.3117 0.3765 0.2714 0.0019  0.1238  -0.0303 310 ILE B O     
4952 C  CB    . ILE B 334 ? 0.3353 0.4201 0.2765 -0.0546 -0.0327 -0.0317 310 ILE B CB    
4953 C  CG1   . ILE B 334 ? 0.4144 0.5107 0.2730 -0.0236 -0.0040 -0.0270 310 ILE B CG1   
4954 C  CG2   . ILE B 334 ? 0.3100 0.5401 0.2779 -0.0621 -0.0578 -0.0129 310 ILE B CG2   
4955 C  CD1   . ILE B 334 ? 0.3842 0.5837 0.3525 -0.0337 -0.0711 0.0023  310 ILE B CD1   
4956 N  N     . GLY B 335 ? 0.3052 0.3694 0.2970 -0.0066 0.0207  0.0259  311 GLY B N     
4957 C  CA    . GLY B 335 ? 0.2948 0.3825 0.2750 -0.0128 0.0310  0.0545  311 GLY B CA    
4958 C  C     . GLY B 335 ? 0.2374 0.3700 0.2409 -0.0331 0.0600  0.0793  311 GLY B C     
4959 O  O     . GLY B 335 ? 0.2260 0.3742 0.1828 -0.0162 0.0667  0.0372  311 GLY B O     
4960 N  N     . PRO B 336 ? 0.2216 0.3224 0.2389 -0.0158 0.0519  0.0208  312 PRO B N     
4961 C  CA    . PRO B 336 ? 0.1921 0.2839 0.2413 -0.0221 0.0550  0.0176  312 PRO B CA    
4962 C  C     . PRO B 336 ? 0.1857 0.2441 0.2434 -0.0071 0.0563  0.0497  312 PRO B C     
4963 O  O     . PRO B 336 ? 0.2007 0.2976 0.2606 -0.0013 0.0319  0.0334  312 PRO B O     
4964 C  CB    . PRO B 336 ? 0.2825 0.2713 0.2129 -0.0423 0.0837  0.0182  312 PRO B CB    
4965 C  CG    . PRO B 336 ? 0.2655 0.2793 0.2573 -0.0443 0.1170  0.0390  312 PRO B CG    
4966 C  CD    . PRO B 336 ? 0.2219 0.3084 0.2494 -0.0309 0.0513  0.0444  312 PRO B CD    
4967 N  N     . ARG B 337 ? 0.2086 0.2288 0.1940 0.0076  0.0874  0.0277  313 ARG B N     
4968 C  CA    . ARG B 337 ? 0.2134 0.2614 0.2326 -0.0072 0.0419  0.0271  313 ARG B CA    
4969 C  C     . ARG B 337 ? 0.1758 0.3061 0.2492 -0.0199 0.0185  0.0525  313 ARG B C     
4970 O  O     . ARG B 337 ? 0.2033 0.3345 0.2230 -0.0068 0.0500  0.0528  313 ARG B O     
4971 C  CB    . ARG B 337 ? 0.1961 0.2530 0.2596 -0.0151 0.0472  0.0353  313 ARG B CB    
4972 C  CG    . ARG B 337 ? 0.1815 0.2228 0.2376 -0.0044 0.0500  0.0106  313 ARG B CG    
4973 C  CD    . ARG B 337 ? 0.1900 0.1953 0.2270 -0.0121 0.0478  0.0083  313 ARG B CD    
4974 N  NE    . ARG B 337 ? 0.1506 0.2268 0.2103 -0.0129 0.0513  -0.0129 313 ARG B NE    
4975 C  CZ    . ARG B 337 ? 0.1772 0.2059 0.2030 0.0187  0.0452  -0.0042 313 ARG B CZ    
4976 N  NH1   . ARG B 337 ? 0.2024 0.1958 0.2065 0.0157  0.0588  -0.0243 313 ARG B NH1   
4977 N  NH2   . ARG B 337 ? 0.1847 0.2227 0.2741 -0.0215 0.0582  -0.0013 313 ARG B NH2   
4978 N  N     . PRO B 338 ? 0.2000 0.3115 0.2131 -0.0466 0.0193  0.0485  314 PRO B N     
4979 C  CA    . PRO B 338 ? 0.2399 0.2829 0.2381 -0.0323 0.0448  0.0555  314 PRO B CA    
4980 C  C     . PRO B 338 ? 0.2320 0.2600 0.2345 -0.0168 0.0706  0.0291  314 PRO B C     
4981 O  O     . PRO B 338 ? 0.2780 0.2654 0.2848 0.0261  0.1007  0.0341  314 PRO B O     
4982 C  CB    . PRO B 338 ? 0.1921 0.3047 0.2626 -0.0095 0.0654  0.0361  314 PRO B CB    
4983 C  CG    . PRO B 338 ? 0.1653 0.2909 0.2708 -0.0275 0.0557  0.0390  314 PRO B CG    
4984 C  CD    . PRO B 338 ? 0.1542 0.3238 0.2301 -0.0495 0.0179  0.0236  314 PRO B CD    
4985 N  N     . MSE B 339 ? 0.2380 0.3253 0.2376 -0.0168 0.0683  0.0644  315 MSE B N     
4986 C  CA    . MSE B 339 ? 0.2900 0.3009 0.2978 -0.0256 0.0353  0.0724  315 MSE B CA    
4987 C  C     . MSE B 339 ? 0.3005 0.3192 0.3164 -0.0386 0.0034  0.0783  315 MSE B C     
4988 O  O     . MSE B 339 ? 0.3302 0.3579 0.4522 -0.0315 0.0129  0.1381  315 MSE B O     
4989 C  CB    . MSE B 339 ? 0.4055 0.3607 0.3570 -0.0054 -0.0497 0.0875  315 MSE B CB    
4990 C  CG    . MSE B 339 ? 0.4230 0.3625 0.5521 0.0052  0.0008  0.1361  315 MSE B CG    
4991 SE SE    . MSE B 339 ? 0.7727 0.7390 0.6948 0.0188  -0.1381 0.0618  315 MSE B SE    
4992 C  CE    . MSE B 339 ? 0.5856 0.6373 0.3103 -0.0748 -0.0212 0.1333  315 MSE B CE    
4993 N  N     . THR B 340 ? 0.2789 0.3284 0.2673 -0.0348 0.0538  0.0653  316 THR B N     
4994 C  CA    . THR B 340 ? 0.2762 0.2720 0.2760 -0.0067 0.0262  0.0466  316 THR B CA    
4995 C  C     . THR B 340 ? 0.2949 0.3059 0.2945 -0.0370 0.0221  0.0344  316 THR B C     
4996 O  O     . THR B 340 ? 0.2296 0.3762 0.3313 -0.0191 0.0872  0.0435  316 THR B O     
4997 C  CB    . THR B 340 ? 0.3044 0.3086 0.3080 0.0191  0.0342  0.0088  316 THR B CB    
4998 O  OG1   . THR B 340 ? 0.3303 0.3550 0.3391 0.0304  0.0535  0.0520  316 THR B OG1   
4999 C  CG2   . THR B 340 ? 0.3579 0.4049 0.3064 0.0428  0.0550  -0.0118 316 THR B CG2   
5000 N  N     . SER B 341 ? 0.2705 0.2809 0.3098 -0.0132 0.0566  0.0211  317 SER B N     
5001 C  CA    . SER B 341 ? 0.2034 0.2596 0.2981 -0.0189 0.0867  0.0248  317 SER B CA    
5002 C  C     . SER B 341 ? 0.2452 0.2994 0.2572 -0.0208 0.0551  0.0635  317 SER B C     
5003 O  O     . SER B 341 ? 0.2498 0.2781 0.2658 -0.0393 0.0735  0.0482  317 SER B O     
5004 C  CB    . SER B 341 ? 0.2777 0.2563 0.3076 -0.0215 0.0308  0.0480  317 SER B CB    
5005 O  OG    . SER B 341 ? 0.2527 0.2833 0.3161 0.0188  0.0546  0.0039  317 SER B OG    
5006 N  N     . LEU B 342 ? 0.2243 0.2924 0.2484 -0.0444 0.0716  0.0392  318 LEU B N     
5007 C  CA    . LEU B 342 ? 0.2438 0.2698 0.2744 -0.0500 0.0617  0.0526  318 LEU B CA    
5008 C  C     . LEU B 342 ? 0.2373 0.2380 0.2595 -0.0147 0.0433  0.0429  318 LEU B C     
5009 O  O     . LEU B 342 ? 0.2277 0.2498 0.2565 -0.0191 0.1042  0.0395  318 LEU B O     
5010 C  CB    . LEU B 342 ? 0.2611 0.2348 0.2452 -0.0292 0.0708  0.0279  318 LEU B CB    
5011 C  CG    . LEU B 342 ? 0.2502 0.2369 0.2023 -0.0208 0.0895  0.0171  318 LEU B CG    
5012 C  CD1   . LEU B 342 ? 0.2362 0.2478 0.2238 -0.0041 0.0908  0.0486  318 LEU B CD1   
5013 C  CD2   . LEU B 342 ? 0.2164 0.2417 0.2120 -0.0169 0.0836  0.0139  318 LEU B CD2   
5014 N  N     . SER B 343 ? 0.2144 0.2592 0.2845 -0.0324 0.0554  0.0119  319 SER B N     
5015 C  CA    . SER B 343 ? 0.2964 0.2466 0.2759 -0.0459 0.0569  -0.0020 319 SER B CA    
5016 C  C     . SER B 343 ? 0.2595 0.2669 0.2882 -0.0275 0.0446  0.0124  319 SER B C     
5017 O  O     . SER B 343 ? 0.2484 0.2824 0.3341 -0.0559 0.0699  0.0340  319 SER B O     
5018 C  CB    . SER B 343 ? 0.3083 0.2723 0.2791 -0.0211 0.1367  0.0523  319 SER B CB    
5019 O  OG    . SER B 343 ? 0.3141 0.3680 0.3354 -0.0253 0.0754  0.0298  319 SER B OG    
5020 N  N     . GLU B 344 ? 0.2473 0.2550 0.2772 0.0016  0.0738  0.0203  320 GLU B N     
5021 C  CA    . GLU B 344 ? 0.2685 0.2876 0.3193 -0.0199 0.0918  0.0485  320 GLU B CA    
5022 C  C     . GLU B 344 ? 0.2533 0.2797 0.2871 -0.0264 0.0604  0.0421  320 GLU B C     
5023 O  O     . GLU B 344 ? 0.2610 0.2748 0.3295 -0.0454 0.0699  0.0441  320 GLU B O     
5024 C  CB    . GLU B 344 ? 0.1798 0.3257 0.3022 0.0065  0.1111  0.0176  320 GLU B CB    
5025 C  CG    . GLU B 344 ? 0.2894 0.3461 0.3966 0.0478  0.1306  0.0365  320 GLU B CG    
5026 C  CD    . GLU B 344 ? 0.4582 0.3957 0.5736 -0.0258 0.1068  0.0119  320 GLU B CD    
5027 O  OE1   . GLU B 344 ? 0.4453 0.5102 0.6096 -0.0239 0.1014  0.0951  320 GLU B OE1   
5028 O  OE2   . GLU B 344 ? 0.7105 0.5106 0.5774 -0.0133 0.1072  -0.0607 320 GLU B OE2   
5029 N  N     . ALA B 345 ? 0.2589 0.2494 0.2416 0.0105  0.0428  0.0181  321 ALA B N     
5030 C  CA    . ALA B 345 ? 0.2291 0.2418 0.3142 -0.0109 0.0438  0.0049  321 ALA B CA    
5031 C  C     . ALA B 345 ? 0.2226 0.2756 0.2716 0.0026  0.0648  0.0145  321 ALA B C     
5032 O  O     . ALA B 345 ? 0.2269 0.2588 0.2723 0.0053  0.0900  0.0250  321 ALA B O     
5033 C  CB    . ALA B 345 ? 0.2127 0.2764 0.3262 -0.0342 0.0709  -0.0102 321 ALA B CB    
5034 N  N     . ALA B 346 ? 0.2282 0.2288 0.2567 -0.0207 0.0532  0.0282  322 ALA B N     
5035 C  CA    . ALA B 346 ? 0.2415 0.2579 0.2550 -0.0171 0.0481  0.0250  322 ALA B CA    
5036 C  C     . ALA B 346 ? 0.2482 0.2679 0.2602 -0.0282 0.0447  0.0305  322 ALA B C     
5037 O  O     . ALA B 346 ? 0.2723 0.3237 0.3594 -0.0048 0.0313  0.0187  322 ALA B O     
5038 C  CB    . ALA B 346 ? 0.2705 0.3024 0.2435 -0.0481 0.0497  0.0359  322 ALA B CB    
5039 N  N     . LYS B 347 ? 0.2323 0.2832 0.2953 -0.0276 0.0798  0.0501  323 LYS B N     
5040 C  CA    . LYS B 347 ? 0.2643 0.2617 0.3456 -0.0227 0.0811  0.0341  323 LYS B CA    
5041 C  C     . LYS B 347 ? 0.2433 0.2823 0.2938 -0.0260 0.0475  0.0261  323 LYS B C     
5042 O  O     . LYS B 347 ? 0.2462 0.3226 0.3580 -0.0642 0.0818  0.0115  323 LYS B O     
5043 C  CB    . LYS B 347 ? 0.2527 0.2724 0.3596 -0.0267 0.0423  0.0453  323 LYS B CB    
5044 C  CG    . LYS B 347 ? 0.3035 0.3158 0.4091 0.0032  0.0586  -0.0012 323 LYS B CG    
5045 C  CD    . LYS B 347 ? 0.3998 0.3682 0.4837 0.1328  0.1359  -0.0523 323 LYS B CD    
5046 C  CE    . LYS B 347 ? 0.4365 0.4417 0.6131 0.2267  0.2087  -0.0006 323 LYS B CE    
5047 N  NZ    . LYS B 347 ? 0.7518 0.5387 0.8068 0.3358  0.0672  0.0799  323 LYS B NZ    
5048 N  N     . GLN B 348 ? 0.2497 0.2426 0.2961 -0.0313 0.0798  0.0221  324 GLN B N     
5049 C  CA    . GLN B 348 ? 0.2736 0.2894 0.3065 -0.0097 0.0912  0.0170  324 GLN B CA    
5050 C  C     . GLN B 348 ? 0.2486 0.2991 0.3107 -0.0254 0.0817  0.0351  324 GLN B C     
5051 O  O     . GLN B 348 ? 0.2539 0.3193 0.3344 -0.0275 0.1044  0.0599  324 GLN B O     
5052 C  CB    . GLN B 348 ? 0.2701 0.3065 0.3032 -0.0171 0.0756  0.0461  324 GLN B CB    
5053 C  CG    . GLN B 348 ? 0.3197 0.3469 0.2947 0.0090  0.0803  0.0583  324 GLN B CG    
5054 C  CD    . GLN B 348 ? 0.3417 0.3769 0.3442 0.0146  0.0204  0.0781  324 GLN B CD    
5055 O  OE1   . GLN B 348 ? 0.4644 0.5083 0.3846 0.0120  0.0847  0.1475  324 GLN B OE1   
5056 N  NE2   . GLN B 348 ? 0.3400 0.4387 0.4710 -0.0343 0.0242  0.0678  324 GLN B NE2   
5057 N  N     . ALA B 349 ? 0.2940 0.2597 0.3074 -0.0107 0.0762  0.0390  325 ALA B N     
5058 C  CA    . ALA B 349 ? 0.2761 0.2781 0.3786 -0.0059 0.0575  0.0365  325 ALA B CA    
5059 C  C     . ALA B 349 ? 0.2576 0.3090 0.3450 -0.0151 0.0891  0.0359  325 ALA B C     
5060 O  O     . ALA B 349 ? 0.2734 0.3876 0.3863 0.0114  0.0543  0.0444  325 ALA B O     
5061 C  CB    . ALA B 349 ? 0.2543 0.3052 0.3683 -0.0281 0.0358  0.0146  325 ALA B CB    
5062 N  N     . GLY B 350 ? 0.2800 0.3267 0.3405 -0.0723 0.0956  0.0117  326 GLY B N     
5063 C  CA    . GLY B 350 ? 0.3011 0.3301 0.4070 -0.0609 0.0594  -0.0327 326 GLY B CA    
5064 C  C     . GLY B 350 ? 0.3149 0.3885 0.4059 -0.0558 0.0319  -0.0063 326 GLY B C     
5065 O  O     . GLY B 350 ? 0.4218 0.4955 0.3697 -0.0278 0.0253  -0.0152 326 GLY B O     
5066 N  N     . LEU B 351 ? 0.2975 0.3799 0.4470 -0.0260 0.0406  -0.0061 327 LEU B N     
5067 C  CA    . LEU B 351 ? 0.3494 0.3653 0.4394 -0.0275 0.0395  -0.0094 327 LEU B CA    
5068 C  C     . LEU B 351 ? 0.4249 0.4639 0.4590 -0.0013 0.0432  -0.0837 327 LEU B C     
5069 O  O     . LEU B 351 ? 0.4183 0.5907 0.4891 -0.0088 0.1388  -0.1014 327 LEU B O     
5070 C  CB    . LEU B 351 ? 0.3500 0.3173 0.3652 0.0025  0.0047  0.0307  327 LEU B CB    
5071 C  CG    . LEU B 351 ? 0.3543 0.2943 0.3751 -0.0301 0.0069  0.0153  327 LEU B CG    
5072 C  CD1   . LEU B 351 ? 0.3139 0.2640 0.3401 -0.0210 0.0760  0.0369  327 LEU B CD1   
5073 C  CD2   . LEU B 351 ? 0.3339 0.3695 0.4089 -0.0555 -0.0156 0.0162  327 LEU B CD2   
5074 N  N     . ILE B 352 ? 0.4936 0.3979 0.5815 -0.0028 0.0729  -0.0312 328 ILE B N     
5075 C  CA    . ILE B 352 ? 0.5200 0.4687 0.6668 0.0171  0.0761  -0.1225 328 ILE B CA    
5076 C  C     . ILE B 352 ? 0.5113 0.5713 0.6391 0.0644  0.0726  -0.1341 328 ILE B C     
5077 O  O     . ILE B 352 ? 0.5711 0.8399 0.7080 0.0641  -0.0110 -0.1969 328 ILE B O     
5078 C  CB    . ILE B 352 ? 0.4427 0.5068 0.6878 0.0160  0.0452  -0.0699 328 ILE B CB    
5079 C  CG1   . ILE B 352 ? 0.5760 0.5327 0.6082 0.0516  0.1227  -0.0408 328 ILE B CG1   
5080 C  CG2   . ILE B 352 ? 0.4949 0.5112 0.5728 0.0323  0.0125  -0.0576 328 ILE B CG2   
5081 C  CD1   . ILE B 352 ? 0.7140 0.5769 0.6630 0.1381  -0.0219 0.0032  328 ILE B CD1   
5082 O  "O5'" . ADN C .   ? 0.2247 0.2587 0.2327 0.0106  0.0169  0.0105  401 ADN A "O5'" 
5083 C  "C5'" . ADN C .   ? 0.1754 0.2205 0.2142 -0.0362 0.0366  0.0063  401 ADN A "C5'" 
5084 C  "C4'" . ADN C .   ? 0.1714 0.2131 0.1634 -0.0132 0.0287  0.0178  401 ADN A "C4'" 
5085 O  "O4'" . ADN C .   ? 0.2130 0.2202 0.1936 -0.0048 0.0341  0.0100  401 ADN A "O4'" 
5086 C  "C3'" . ADN C .   ? 0.1800 0.1832 0.1680 0.0272  0.0366  0.0224  401 ADN A "C3'" 
5087 O  "O3'" . ADN C .   ? 0.2222 0.1898 0.2198 0.0331  0.0507  0.0037  401 ADN A "O3'" 
5088 C  "C2'" . ADN C .   ? 0.1649 0.2159 0.2116 0.0103  0.0425  0.0054  401 ADN A "C2'" 
5089 O  "O2'" . ADN C .   ? 0.2358 0.2367 0.1784 -0.0053 0.0666  0.0079  401 ADN A "O2'" 
5090 C  "C1'" . ADN C .   ? 0.2086 0.2192 0.1943 0.0190  0.0438  0.0056  401 ADN A "C1'" 
5091 N  N9    . ADN C .   ? 0.1517 0.2116 0.2175 -0.0087 0.0104  -0.0094 401 ADN A N9    
5092 C  C8    . ADN C .   ? 0.1740 0.2218 0.2181 -0.0195 0.0235  -0.0125 401 ADN A C8    
5093 N  N7    . ADN C .   ? 0.2265 0.2509 0.1891 0.0194  -0.0090 0.0183  401 ADN A N7    
5094 C  C5    . ADN C .   ? 0.1896 0.2574 0.2092 0.0098  0.0183  -0.0039 401 ADN A C5    
5095 C  C6    . ADN C .   ? 0.1827 0.2419 0.2077 0.0091  0.0250  -0.0156 401 ADN A C6    
5096 N  N6    . ADN C .   ? 0.2291 0.1859 0.2243 -0.0138 0.0405  -0.0057 401 ADN A N6    
5097 N  N1    . ADN C .   ? 0.2226 0.2152 0.1849 0.0208  0.0211  -0.0156 401 ADN A N1    
5098 C  C2    . ADN C .   ? 0.1849 0.1818 0.1970 0.0040  0.0136  0.0095  401 ADN A C2    
5099 N  N3    . ADN C .   ? 0.2071 0.2167 0.1830 0.0210  -0.0014 -0.0025 401 ADN A N3    
5100 C  C4    . ADN C .   ? 0.1869 0.2314 0.2053 0.0047  -0.0168 0.0029  401 ADN A C4    
5101 O  O13   . Q3C D .   ? 0.2791 0.2793 0.2734 0.0245  0.0372  0.0149  402 Q3C A O13   
5102 C  C11   . Q3C D .   ? 0.2593 0.2372 0.2425 0.0022  0.0439  0.0525  402 Q3C A C11   
5103 O  O12   . Q3C D .   ? 0.3073 0.2606 0.2484 -0.0424 0.0737  0.0277  402 Q3C A O12   
5104 C  C7    . Q3C D .   ? 0.2505 0.2377 0.2161 0.0044  0.0469  0.0447  402 Q3C A C7    
5105 C  C3    . Q3C D .   ? 0.3042 0.2715 0.2088 -0.0007 0.0655  0.0338  402 Q3C A C3    
5106 C  C9    . Q3C D .   ? 0.2688 0.2536 0.2490 0.0230  0.0341  0.0432  402 Q3C A C9    
5107 N  N5    . Q3C D .   ? 0.2978 0.2456 0.2161 -0.0043 0.0691  0.0341  402 Q3C A N5    
5108 C  C2    . Q3C D .   ? 0.2718 0.2454 0.2259 0.0125  0.0635  0.0294  402 Q3C A C2    
5109 C  C6    . Q3C D .   ? 0.2679 0.2519 0.1850 -0.0100 0.0515  0.0067  402 Q3C A C6    
5110 C  C10   . Q3C D .   ? 0.2314 0.2481 0.1981 0.0186  0.0439  0.0336  402 Q3C A C10   
5111 C  C8    . Q3C D .   ? 0.2474 0.2397 0.2177 0.0211  0.0307  0.0078  402 Q3C A C8    
5112 C  C4    . Q3C D .   ? 0.2736 0.2494 0.2204 0.0072  0.0481  0.0076  402 Q3C A C4    
5113 C  C1    . Q3C D .   ? 0.2522 0.2598 0.2331 0.0092  0.0452  0.0349  402 Q3C A C1    
5114 S  S     . DMS E .   ? 0.3789 0.3305 0.3608 -0.0069 0.0041  -0.0261 403 DMS A S     
5115 O  O     . DMS E .   ? 0.3814 0.3240 0.2503 0.0234  0.0070  -0.0590 403 DMS A O     
5116 C  C1    . DMS E .   ? 0.3954 0.3544 0.3257 0.0200  -0.0191 -0.0255 403 DMS A C1    
5117 C  C2    . DMS E .   ? 0.4456 0.4220 0.3746 -0.0012 0.0617  -0.0407 403 DMS A C2    
5118 S  S     . DMS F .   ? 0.6532 0.4704 0.6201 0.0193  0.0655  -0.0262 404 DMS A S     
5119 O  O     . DMS F .   ? 0.6677 0.6014 0.7972 0.0508  0.0541  0.1353  404 DMS A O     
5120 C  C1    . DMS F .   ? 0.5180 0.5691 0.3254 0.0449  0.0931  0.0296  404 DMS A C1    
5121 C  C2    . DMS F .   ? 0.6174 0.5530 0.5303 -0.0298 0.1088  -0.0695 404 DMS A C2    
5122 K  K     . K   G .   ? 0.4582 0.4852 0.4935 0.0158  0.0182  0.0025  405 K   A K     
5123 O  "O5'" . ADN H .   ? 0.1629 0.2355 0.2099 0.0065  0.0420  0.0008  401 ADN B "O5'" 
5124 C  "C5'" . ADN H .   ? 0.1244 0.2236 0.1969 0.0212  0.0449  -0.0318 401 ADN B "C5'" 
5125 C  "C4'" . ADN H .   ? 0.1467 0.2018 0.1835 0.0330  0.0668  0.0030  401 ADN B "C4'" 
5126 O  "O4'" . ADN H .   ? 0.1875 0.2073 0.1784 0.0068  0.0542  -0.0052 401 ADN B "O4'" 
5127 C  "C3'" . ADN H .   ? 0.1711 0.1795 0.1753 -0.0338 0.0428  -0.0055 401 ADN B "C3'" 
5128 O  "O3'" . ADN H .   ? 0.1731 0.1944 0.1948 -0.0082 0.0641  0.0206  401 ADN B "O3'" 
5129 C  "C2'" . ADN H .   ? 0.1557 0.2030 0.1812 -0.0153 0.0335  0.0190  401 ADN B "C2'" 
5130 O  "O2'" . ADN H .   ? 0.2102 0.2194 0.2018 0.0080  0.0518  0.0104  401 ADN B "O2'" 
5131 C  "C1'" . ADN H .   ? 0.1682 0.2021 0.1822 -0.0119 0.0216  0.0102  401 ADN B "C1'" 
5132 N  N9    . ADN H .   ? 0.1871 0.1912 0.1429 -0.0125 0.0514  -0.0122 401 ADN B N9    
5133 C  C8    . ADN H .   ? 0.2259 0.1741 0.2183 -0.0248 0.0573  -0.0139 401 ADN B C8    
5134 N  N7    . ADN H .   ? 0.1883 0.2212 0.1876 -0.0333 0.0325  -0.0049 401 ADN B N7    
5135 C  C5    . ADN H .   ? 0.1364 0.2105 0.1714 -0.0179 0.0457  0.0032  401 ADN B C5    
5136 C  C6    . ADN H .   ? 0.1628 0.2094 0.1746 -0.0361 0.0443  0.0054  401 ADN B C6    
5137 N  N6    . ADN H .   ? 0.1296 0.2176 0.2175 -0.0288 0.0757  0.0160  401 ADN B N6    
5138 N  N1    . ADN H .   ? 0.1505 0.1999 0.1927 -0.0417 0.0483  -0.0088 401 ADN B N1    
5139 C  C2    . ADN H .   ? 0.2017 0.1838 0.1567 -0.0309 0.0536  0.0138  401 ADN B C2    
5140 N  N3    . ADN H .   ? 0.1420 0.1884 0.1477 -0.0129 0.0519  -0.0055 401 ADN B N3    
5141 C  C4    . ADN H .   ? 0.1507 0.2132 0.1424 -0.0237 0.0334  -0.0126 401 ADN B C4    
5142 O  O13   . Q3C I .   ? 0.2938 0.2750 0.2378 -0.0141 0.0624  0.0421  402 Q3C B O13   
5143 C  C11   . Q3C I .   ? 0.2151 0.2745 0.2447 0.0114  0.0569  0.0329  402 Q3C B C11   
5144 O  O12   . Q3C I .   ? 0.2290 0.2452 0.2580 0.0380  0.0571  0.0019  402 Q3C B O12   
5145 C  C7    . Q3C I .   ? 0.2241 0.2318 0.2582 0.0119  0.0408  0.0125  402 Q3C B C7    
5146 C  C3    . Q3C I .   ? 0.2298 0.2629 0.2552 0.0355  0.0288  0.0045  402 Q3C B C3    
5147 C  C9    . Q3C I .   ? 0.2317 0.2337 0.2416 0.0113  0.0478  0.0120  402 Q3C B C9    
5148 N  N5    . Q3C I .   ? 0.2124 0.2449 0.2618 0.0359  0.0504  0.0101  402 Q3C B N5    
5149 C  C2    . Q3C I .   ? 0.2042 0.2346 0.2533 0.0033  0.0245  0.0094  402 Q3C B C2    
5150 C  C6    . Q3C I .   ? 0.2162 0.2413 0.2221 0.0263  0.0376  -0.0172 402 Q3C B C6    
5151 C  C10   . Q3C I .   ? 0.2122 0.2204 0.2243 -0.0155 0.0400  -0.0100 402 Q3C B C10   
5152 C  C8    . Q3C I .   ? 0.2388 0.2389 0.2055 0.0123  0.0554  0.0100  402 Q3C B C8    
5153 C  C4    . Q3C I .   ? 0.2192 0.2459 0.2288 0.0164  0.0502  0.0055  402 Q3C B C4    
5154 C  C1    . Q3C I .   ? 0.2221 0.2493 0.2253 0.0145  0.0418  0.0176  402 Q3C B C1    
5155 S  S     . DMS J .   ? 0.4510 0.3716 0.3669 -0.0315 0.0064  -0.0480 403 DMS B S     
5156 O  O     . DMS J .   ? 0.4045 0.3188 0.3275 -0.0094 0.0187  -0.0161 403 DMS B O     
5157 C  C1    . DMS J .   ? 0.3657 0.3957 0.2601 -0.0216 0.0404  -0.0630 403 DMS B C1    
5158 C  C2    . DMS J .   ? 0.4502 0.5560 0.4628 -0.0908 -0.0377 -0.0521 403 DMS B C2    
5159 S  S     . DMS K .   ? 0.5382 0.6620 0.7838 0.0740  0.0108  0.1095  404 DMS B S     
5160 O  O     . DMS K .   ? 0.6220 0.6865 0.8330 0.0750  -0.0990 0.0784  404 DMS B O     
5161 C  C1    . DMS K .   ? 0.3967 0.6928 0.6343 0.0927  -0.1206 0.1637  404 DMS B C1    
5162 C  C2    . DMS K .   ? 0.4976 0.5819 0.8899 0.0359  -0.0241 0.1015  404 DMS B C2    
5163 K  K     . K   L .   ? 0.4617 0.4677 0.4443 -0.0142 0.0661  -0.0017 405 K   B K     
5164 O  O     . HOH M .   ? 0.2473 0.3051 0.2969 -0.0428 -0.0306 0.0079  501 HOH A O     
5165 O  O     . HOH M .   ? 0.3149 0.2870 0.2522 -0.0259 0.0137  0.0319  502 HOH A O     
5166 O  O     . HOH M .   ? 0.2431 0.2800 0.2189 0.0580  0.0405  -0.0107 503 HOH A O     
5167 O  O     . HOH M .   ? 0.2692 0.3749 0.3302 0.0200  0.0249  -0.0155 504 HOH A O     
5168 O  O     . HOH M .   ? 0.2936 0.4660 0.1852 0.0248  0.1048  0.0377  505 HOH A O     
5169 O  O     . HOH M .   ? 0.3141 0.2088 0.3042 -0.0221 0.0085  -0.0096 506 HOH A O     
5170 O  O     . HOH M .   ? 0.3429 0.2598 0.3679 0.0182  0.0162  -0.0716 507 HOH A O     
5171 O  O     . HOH M .   ? 0.2342 0.2787 0.2408 -0.0183 0.0188  -0.0238 508 HOH A O     
5172 O  O     . HOH M .   ? 0.3556 0.4372 0.3993 0.1287  0.1418  0.1215  509 HOH A O     
5173 O  O     . HOH M .   ? 0.4764 0.2810 0.3054 -0.0074 -0.0872 -0.0518 510 HOH A O     
5174 O  O     . HOH M .   ? 0.3874 0.3680 0.3326 -0.0126 -0.0189 0.0095  511 HOH A O     
5175 O  O     . HOH M .   ? 0.2496 0.2951 0.2228 0.0182  0.0138  0.0422  512 HOH A O     
5176 O  O     . HOH M .   ? 0.4444 0.4016 0.3783 -0.1141 0.3830  -0.0729 513 HOH A O     
5177 O  O     . HOH M .   ? 0.3711 0.3739 0.2377 0.0010  0.0223  -0.0469 514 HOH A O     
5178 O  O     . HOH M .   ? 0.2996 0.2852 0.2139 0.0074  0.0293  0.0048  515 HOH A O     
5179 O  O     . HOH M .   ? 0.2991 0.4768 0.3845 0.0044  0.0574  -0.0543 516 HOH A O     
5180 O  O     . HOH M .   ? 0.2213 0.3231 0.2967 0.0285  0.1322  -0.0177 517 HOH A O     
5181 O  O     . HOH M .   ? 0.5317 0.2578 0.2802 0.0184  0.0354  0.0568  518 HOH A O     
5182 O  O     . HOH M .   ? 0.2722 0.2796 0.3021 0.0236  0.0002  0.0341  519 HOH A O     
5183 O  O     . HOH M .   ? 0.2786 0.2861 0.2254 0.0815  0.0633  -0.0027 520 HOH A O     
5184 O  O     . HOH M .   ? 0.4961 0.4809 1.2080 0.1232  0.1462  0.0292  521 HOH A O     
5185 O  O     . HOH M .   ? 0.2901 0.2700 0.3394 -0.0341 -0.0094 0.0059  522 HOH A O     
5186 O  O     . HOH M .   ? 0.3063 0.2597 0.5145 0.0128  0.0919  -0.0563 523 HOH A O     
5187 O  O     . HOH M .   ? 0.1838 0.2754 0.3168 0.0246  0.0550  -0.0068 524 HOH A O     
5188 O  O     . HOH M .   ? 0.2936 0.3753 0.3117 -0.0099 0.0058  -0.0388 525 HOH A O     
5189 O  O     . HOH M .   ? 0.2316 0.3034 0.2667 -0.0114 0.0540  0.0141  526 HOH A O     
5190 O  O     . HOH M .   ? 0.3196 0.2711 0.2592 0.0627  0.0317  -0.0336 527 HOH A O     
5191 O  O     . HOH M .   ? 0.3812 0.3267 0.4074 0.0316  0.0276  -0.0418 528 HOH A O     
5192 O  O     . HOH M .   ? 0.3152 0.2834 0.2801 0.0764  0.0103  0.0086  529 HOH A O     
5193 O  O     . HOH M .   ? 0.1903 0.4013 0.3988 -0.0661 0.0599  0.0000  530 HOH A O     
5194 O  O     . HOH M .   ? 0.1513 0.5673 0.3438 0.0041  0.1594  -0.0513 531 HOH A O     
5195 O  O     . HOH M .   ? 0.4517 0.3469 0.2645 0.0331  0.1052  -0.0158 532 HOH A O     
5196 O  O     . HOH M .   ? 0.3605 0.5088 0.5524 0.0083  -0.0527 0.0410  533 HOH A O     
5197 O  O     . HOH M .   ? 0.3286 0.4543 0.3833 0.0562  0.2470  0.0745  534 HOH A O     
5198 O  O     . HOH M .   ? 0.1604 0.8859 0.4520 0.0241  0.1542  0.1024  535 HOH A O     
5199 O  O     . HOH M .   ? 0.4266 0.4080 0.4788 0.1044  0.0592  -0.1315 536 HOH A O     
5200 O  O     . HOH M .   ? 0.4309 0.3658 0.3655 0.0899  0.0922  0.0204  537 HOH A O     
5201 O  O     . HOH M .   ? 0.3860 0.5570 0.2855 -0.0393 0.0652  0.0131  538 HOH A O     
5202 O  O     . HOH M .   ? 0.6202 0.6523 0.2292 0.0672  0.1249  -0.1373 539 HOH A O     
5203 O  O     . HOH M .   ? 0.4590 0.4522 0.2702 0.0403  0.0031  0.0498  540 HOH A O     
5204 O  O     . HOH M .   ? 0.3813 0.3408 0.5138 -0.0301 0.0630  -0.0239 541 HOH A O     
5205 O  O     . HOH M .   ? 0.3779 0.4531 0.3699 0.1003  0.1338  -0.0244 542 HOH A O     
5206 O  O     . HOH M .   ? 0.5762 0.3274 0.4893 0.0722  0.0260  0.0553  543 HOH A O     
5207 O  O     . HOH M .   ? 0.4771 0.4915 0.4724 -0.0027 -0.1045 0.0196  544 HOH A O     
5208 O  O     . HOH M .   ? 0.4287 0.2573 0.4839 -0.0400 0.1448  0.0217  545 HOH A O     
5209 O  O     . HOH M .   ? 0.4732 0.4478 0.3425 0.0424  0.1691  -0.0804 546 HOH A O     
5210 O  O     . HOH M .   ? 0.4548 0.4055 0.2621 0.0006  0.0552  -0.0226 547 HOH A O     
5211 O  O     . HOH M .   ? 0.4260 0.5643 0.5398 -0.0414 0.0622  -0.0344 548 HOH A O     
5212 O  O     . HOH M .   ? 0.6326 0.2756 0.3121 -0.0194 0.0187  0.0064  549 HOH A O     
5213 O  O     . HOH M .   ? 0.4533 0.3687 0.2397 0.1359  -0.0025 -0.0104 550 HOH A O     
5214 O  O     . HOH M .   ? 0.2746 0.5009 0.4860 0.0576  0.1056  0.0417  551 HOH A O     
5215 O  O     . HOH M .   ? 0.3214 0.4544 0.3850 0.0337  0.0351  0.0014  552 HOH A O     
5216 O  O     . HOH M .   ? 0.1610 0.3502 0.4792 -0.0194 0.1038  0.0930  553 HOH A O     
5217 O  O     . HOH M .   ? 0.3894 0.3551 0.2683 0.0388  0.0585  0.0871  554 HOH A O     
5218 O  O     . HOH M .   ? 0.3183 0.3522 0.3508 0.0205  -0.0070 -0.0557 555 HOH A O     
5219 O  O     . HOH M .   ? 0.5077 0.3705 0.4278 0.0933  0.0430  -0.0648 556 HOH A O     
5220 O  O     . HOH M .   ? 0.4166 0.6307 0.3724 0.1306  0.1693  -0.0856 557 HOH A O     
5221 O  O     . HOH M .   ? 0.6659 0.5416 0.2991 0.0762  -0.0093 0.0071  558 HOH A O     
5222 O  O     . HOH M .   ? 0.4748 0.5491 0.4406 0.0012  0.1518  -0.1573 559 HOH A O     
5223 O  O     . HOH M .   ? 0.5753 0.3880 0.4721 0.1108  0.0559  -0.0426 560 HOH A O     
5224 O  O     . HOH M .   ? 0.2202 0.4770 0.3814 -0.0674 0.0748  -0.1043 561 HOH A O     
5225 O  O     . HOH M .   ? 0.3971 0.3675 0.5131 0.0490  -0.0192 -0.0374 562 HOH A O     
5226 O  O     . HOH M .   ? 0.3641 0.4077 0.4002 -0.0230 -0.0272 0.0734  563 HOH A O     
5227 O  O     . HOH M .   ? 0.3268 0.3617 0.4640 0.0522  0.0955  0.0484  564 HOH A O     
5228 O  O     . HOH M .   ? 0.5285 0.4227 0.2641 0.0392  0.0123  0.0818  565 HOH A O     
5229 O  O     . HOH M .   ? 0.4965 0.5050 0.4787 0.0282  -0.0814 0.0778  566 HOH A O     
5230 O  O     . HOH M .   ? 0.3001 0.3175 0.2733 0.0786  0.0176  -0.0266 567 HOH A O     
5231 O  O     . HOH M .   ? 0.5340 0.6132 0.3269 0.0191  0.0362  0.1222  568 HOH A O     
5232 O  O     . HOH M .   ? 0.2312 0.4518 0.3943 0.0405  0.1133  -0.0789 569 HOH A O     
5233 O  O     . HOH M .   ? 0.3324 0.6121 0.7709 0.0700  -0.0087 -0.1193 570 HOH A O     
5234 O  O     . HOH M .   ? 0.3794 0.4120 0.4991 -0.0267 -0.0479 -0.0082 571 HOH A O     
5235 O  O     . HOH M .   ? 0.5343 0.3597 0.4993 0.0212  -0.0742 -0.0828 572 HOH A O     
5236 O  O     . HOH M .   ? 0.2758 0.2701 0.2714 0.0030  -0.0101 -0.0283 573 HOH A O     
5237 O  O     . HOH M .   ? 0.2300 0.2643 0.3339 -0.0547 0.0003  0.0215  574 HOH A O     
5238 O  O     . HOH M .   ? 0.4778 0.4610 0.3734 0.0957  0.1385  0.0585  575 HOH A O     
5239 O  O     . HOH M .   ? 0.3348 0.2576 0.3860 -0.0099 0.1612  0.0356  576 HOH A O     
5240 O  O     . HOH M .   ? 0.7630 0.3720 0.4891 -0.0103 0.0582  0.0801  577 HOH A O     
5241 O  O     . HOH M .   ? 0.3552 0.4241 0.4454 -0.1043 0.1008  -0.0418 578 HOH A O     
5242 O  O     . HOH M .   ? 0.7281 0.6582 0.4975 0.0801  -0.0868 -0.0140 579 HOH A O     
5243 O  O     . HOH M .   ? 0.5895 0.7358 0.3005 0.0448  0.1710  -0.0099 580 HOH A O     
5244 O  O     . HOH M .   ? 0.5086 0.3074 0.4362 -0.0052 -0.0431 -0.0547 581 HOH A O     
5245 O  O     . HOH M .   ? 0.5574 0.4728 0.3528 0.1041  0.1693  -0.0679 582 HOH A O     
5246 O  O     . HOH M .   ? 0.7435 0.5708 0.2768 0.0066  -0.0939 -0.0381 583 HOH A O     
5247 O  O     . HOH M .   ? 0.6379 0.5217 0.3899 0.1395  -0.0918 0.0719  584 HOH A O     
5248 O  O     . HOH M .   ? 0.5324 0.3589 0.3900 0.0531  0.1094  -0.0441 585 HOH A O     
5249 O  O     . HOH M .   ? 0.6554 0.4869 0.4776 -0.0233 -0.1646 0.0919  586 HOH A O     
5250 O  O     . HOH M .   ? 0.3689 0.5676 0.5079 -0.0304 -0.0319 0.1080  587 HOH A O     
5251 O  O     . HOH M .   ? 0.5318 0.4979 0.3569 -0.0429 -0.1045 0.1032  588 HOH A O     
5252 O  O     . HOH M .   ? 0.7924 0.2858 0.6836 -0.0915 -0.1169 0.0293  589 HOH A O     
5253 O  O     . HOH M .   ? 0.3828 0.3269 0.2819 0.0372  -0.0107 0.0792  590 HOH A O     
5254 O  O     . HOH M .   ? 0.2097 0.7331 0.4843 -0.0369 0.1580  -0.0260 591 HOH A O     
5255 O  O     . HOH M .   ? 0.3613 0.4837 0.3784 0.0263  0.1561  -0.0093 592 HOH A O     
5256 O  O     . HOH M .   ? 0.3603 0.3969 0.2925 0.0828  0.1042  0.0640  593 HOH A O     
5257 O  O     . HOH M .   ? 0.4488 0.3415 0.3790 -0.1717 0.0583  0.0039  594 HOH A O     
5258 O  O     . HOH M .   ? 0.5287 0.3114 0.2988 0.0832  0.0995  -0.0375 595 HOH A O     
5259 O  O     . HOH M .   ? 0.6918 0.4196 0.3442 0.1796  0.0539  -0.1029 596 HOH A O     
5260 O  O     . HOH M .   ? 0.4304 0.5784 0.2800 0.1318  0.0083  -0.1410 597 HOH A O     
5261 O  O     . HOH M .   ? 0.4628 0.8906 0.4718 0.2419  -0.0039 -0.0400 598 HOH A O     
5262 O  O     . HOH M .   ? 0.4488 0.3706 0.4298 0.0143  -0.0676 -0.0527 599 HOH A O     
5263 O  O     . HOH M .   ? 0.6296 0.6073 0.4518 -0.2545 -0.0883 0.1898  600 HOH A O     
5264 O  O     . HOH M .   ? 0.4682 0.5412 0.35