data_4KET
# 
_entry.id   4KET 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4KET         
RCSB  RCSB079248   
WWPDB D_1000079248 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2VC5 'Wild type SsoPox'                               unspecified 
PDB 2VC7 'Wild type SsoPox in complex with lactone mimic' unspecified 
PDB 3UF9 'Wild type SsoPox in complex with fensulfothion' unspecified 
PDB 4KER 'SsoPox W263V mutant'                            unspecified 
PDB 4KES 'SsoPox W263T mutant'                            unspecified 
PDB 4KEU 'SsoPox W263M mutant'                            unspecified 
PDB 4KEV 'SsoPox W263L mutant'                            unspecified 
PDB 4KEZ 'SsoPox W263F mutant'                            unspecified 
PDB 4KF1 'SsoPox W263I in complex with C10HTL'            unspecified 
# 
_pdbx_database_status.entry_id                        4KET 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-04-26 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gotthard, G.'  1 
'Hiblot, J.'    2 
'Chabriere, E.' 3 
'Elias, M.'     4 
# 
_citation.id                        primary 
_citation.title                     
'Differential Active Site Loop Conformations Mediate Promiscuous Activities in the Lactonase SsoPox.' 
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            8 
_citation.page_first                e75272 
_citation.page_last                 e75272 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24086491 
_citation.pdbx_database_id_DOI      10.1371/journal.pone.0075272 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hiblot, J.'    1 
primary 'Gotthard, G.'  2 
primary 'Elias, M.'     3 
primary 'Chabriere, E.' 4 
# 
_cell.length_a           87.400 
_cell.length_b           103.900 
_cell.length_c           150.500 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4KET 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         4KET 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Aryldialkylphosphatase  35584.852 4   3.1.8.1 W263I ? ? 
2 non-polymer syn 'FE (II) ION'           55.845    4   ?       ?     ? ? 
3 non-polymer syn 'COBALT (II) ION'       58.933    4   ?       ?     ? ? 
4 non-polymer syn 1,2-ETHANEDIOL          62.068    7   ?       ?     ? ? 
5 non-polymer syn GLYCEROL                92.094    11  ?       ?     ? ? 
6 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120   1   ?       ?     ? ? 
7 non-polymer syn 'TETRAETHYLENE GLYCOL'  194.226   2   ?       ?     ? ? 
8 water       nat water                   18.015    900 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Paraoxonase, SsoPox, Phosphotriesterase-like lactonase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MRIPLVGKDSIESKDIGFTLIHEHLRVFSEAVRQQWPHLYNEDEEFRNAVNEVKRAMQFGVKTIVDPTVMGLGRDIRFME
KVVKATGINLVAGTGIYIYIDLPFYFLNRSIDEIADLFIHDIKEGIQGTLNKAGFV(KCX)IAADEPGITKDVEKVIRAA
AIANKETKVPIITHSNAHNNTGLEQQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLDRYGLDLFLPVDKRN
ETTLRLIKDGYSDKIMISHDYCCTIDIGTAKPEYKPKLAPRWSITLIFEDTIPFLKRNGVNEEVIATIFKENPKKFFS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MRIPLVGKDSIESKDIGFTLIHEHLRVFSEAVRQQWPHLYNEDEEFRNAVNEVKRAMQFGVKTIVDPTVMGLGRDIRFME
KVVKATGINLVAGTGIYIYIDLPFYFLNRSIDEIADLFIHDIKEGIQGTLNKAGFVKIAADEPGITKDVEKVIRAAAIAN
KETKVPIITHSNAHNNTGLEQQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLDRYGLDLFLPVDKRNETTL
RLIKDGYSDKIMISHDYCCTIDIGTAKPEYKPKLAPRWSITLIFEDTIPFLKRNGVNEEVIATIFKENPKKFFS
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   ILE n 
1 4   PRO n 
1 5   LEU n 
1 6   VAL n 
1 7   GLY n 
1 8   LYS n 
1 9   ASP n 
1 10  SER n 
1 11  ILE n 
1 12  GLU n 
1 13  SER n 
1 14  LYS n 
1 15  ASP n 
1 16  ILE n 
1 17  GLY n 
1 18  PHE n 
1 19  THR n 
1 20  LEU n 
1 21  ILE n 
1 22  HIS n 
1 23  GLU n 
1 24  HIS n 
1 25  LEU n 
1 26  ARG n 
1 27  VAL n 
1 28  PHE n 
1 29  SER n 
1 30  GLU n 
1 31  ALA n 
1 32  VAL n 
1 33  ARG n 
1 34  GLN n 
1 35  GLN n 
1 36  TRP n 
1 37  PRO n 
1 38  HIS n 
1 39  LEU n 
1 40  TYR n 
1 41  ASN n 
1 42  GLU n 
1 43  ASP n 
1 44  GLU n 
1 45  GLU n 
1 46  PHE n 
1 47  ARG n 
1 48  ASN n 
1 49  ALA n 
1 50  VAL n 
1 51  ASN n 
1 52  GLU n 
1 53  VAL n 
1 54  LYS n 
1 55  ARG n 
1 56  ALA n 
1 57  MET n 
1 58  GLN n 
1 59  PHE n 
1 60  GLY n 
1 61  VAL n 
1 62  LYS n 
1 63  THR n 
1 64  ILE n 
1 65  VAL n 
1 66  ASP n 
1 67  PRO n 
1 68  THR n 
1 69  VAL n 
1 70  MET n 
1 71  GLY n 
1 72  LEU n 
1 73  GLY n 
1 74  ARG n 
1 75  ASP n 
1 76  ILE n 
1 77  ARG n 
1 78  PHE n 
1 79  MET n 
1 80  GLU n 
1 81  LYS n 
1 82  VAL n 
1 83  VAL n 
1 84  LYS n 
1 85  ALA n 
1 86  THR n 
1 87  GLY n 
1 88  ILE n 
1 89  ASN n 
1 90  LEU n 
1 91  VAL n 
1 92  ALA n 
1 93  GLY n 
1 94  THR n 
1 95  GLY n 
1 96  ILE n 
1 97  TYR n 
1 98  ILE n 
1 99  TYR n 
1 100 ILE n 
1 101 ASP n 
1 102 LEU n 
1 103 PRO n 
1 104 PHE n 
1 105 TYR n 
1 106 PHE n 
1 107 LEU n 
1 108 ASN n 
1 109 ARG n 
1 110 SER n 
1 111 ILE n 
1 112 ASP n 
1 113 GLU n 
1 114 ILE n 
1 115 ALA n 
1 116 ASP n 
1 117 LEU n 
1 118 PHE n 
1 119 ILE n 
1 120 HIS n 
1 121 ASP n 
1 122 ILE n 
1 123 LYS n 
1 124 GLU n 
1 125 GLY n 
1 126 ILE n 
1 127 GLN n 
1 128 GLY n 
1 129 THR n 
1 130 LEU n 
1 131 ASN n 
1 132 LYS n 
1 133 ALA n 
1 134 GLY n 
1 135 PHE n 
1 136 VAL n 
1 137 KCX n 
1 138 ILE n 
1 139 ALA n 
1 140 ALA n 
1 141 ASP n 
1 142 GLU n 
1 143 PRO n 
1 144 GLY n 
1 145 ILE n 
1 146 THR n 
1 147 LYS n 
1 148 ASP n 
1 149 VAL n 
1 150 GLU n 
1 151 LYS n 
1 152 VAL n 
1 153 ILE n 
1 154 ARG n 
1 155 ALA n 
1 156 ALA n 
1 157 ALA n 
1 158 ILE n 
1 159 ALA n 
1 160 ASN n 
1 161 LYS n 
1 162 GLU n 
1 163 THR n 
1 164 LYS n 
1 165 VAL n 
1 166 PRO n 
1 167 ILE n 
1 168 ILE n 
1 169 THR n 
1 170 HIS n 
1 171 SER n 
1 172 ASN n 
1 173 ALA n 
1 174 HIS n 
1 175 ASN n 
1 176 ASN n 
1 177 THR n 
1 178 GLY n 
1 179 LEU n 
1 180 GLU n 
1 181 GLN n 
1 182 GLN n 
1 183 ARG n 
1 184 ILE n 
1 185 LEU n 
1 186 THR n 
1 187 GLU n 
1 188 GLU n 
1 189 GLY n 
1 190 VAL n 
1 191 ASP n 
1 192 PRO n 
1 193 GLY n 
1 194 LYS n 
1 195 ILE n 
1 196 LEU n 
1 197 ILE n 
1 198 GLY n 
1 199 HIS n 
1 200 LEU n 
1 201 GLY n 
1 202 ASP n 
1 203 THR n 
1 204 ASP n 
1 205 ASN n 
1 206 ILE n 
1 207 ASP n 
1 208 TYR n 
1 209 ILE n 
1 210 LYS n 
1 211 LYS n 
1 212 ILE n 
1 213 ALA n 
1 214 ASP n 
1 215 LYS n 
1 216 GLY n 
1 217 SER n 
1 218 PHE n 
1 219 ILE n 
1 220 GLY n 
1 221 LEU n 
1 222 ASP n 
1 223 ARG n 
1 224 TYR n 
1 225 GLY n 
1 226 LEU n 
1 227 ASP n 
1 228 LEU n 
1 229 PHE n 
1 230 LEU n 
1 231 PRO n 
1 232 VAL n 
1 233 ASP n 
1 234 LYS n 
1 235 ARG n 
1 236 ASN n 
1 237 GLU n 
1 238 THR n 
1 239 THR n 
1 240 LEU n 
1 241 ARG n 
1 242 LEU n 
1 243 ILE n 
1 244 LYS n 
1 245 ASP n 
1 246 GLY n 
1 247 TYR n 
1 248 SER n 
1 249 ASP n 
1 250 LYS n 
1 251 ILE n 
1 252 MET n 
1 253 ILE n 
1 254 SER n 
1 255 HIS n 
1 256 ASP n 
1 257 TYR n 
1 258 CYS n 
1 259 CYS n 
1 260 THR n 
1 261 ILE n 
1 262 ASP n 
1 263 ILE n 
1 264 GLY n 
1 265 THR n 
1 266 ALA n 
1 267 LYS n 
1 268 PRO n 
1 269 GLU n 
1 270 TYR n 
1 271 LYS n 
1 272 PRO n 
1 273 LYS n 
1 274 LEU n 
1 275 ALA n 
1 276 PRO n 
1 277 ARG n 
1 278 TRP n 
1 279 SER n 
1 280 ILE n 
1 281 THR n 
1 282 LEU n 
1 283 ILE n 
1 284 PHE n 
1 285 GLU n 
1 286 ASP n 
1 287 THR n 
1 288 ILE n 
1 289 PRO n 
1 290 PHE n 
1 291 LEU n 
1 292 LYS n 
1 293 ARG n 
1 294 ASN n 
1 295 GLY n 
1 296 VAL n 
1 297 ASN n 
1 298 GLU n 
1 299 GLU n 
1 300 VAL n 
1 301 ILE n 
1 302 ALA n 
1 303 THR n 
1 304 ILE n 
1 305 PHE n 
1 306 LYS n 
1 307 GLU n 
1 308 ASN n 
1 309 PRO n 
1 310 LYS n 
1 311 LYS n 
1 312 PHE n 
1 313 PHE n 
1 314 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'php, php SSO2522, SSO2522' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sulfolobus solfataricus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2287 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PHP_SULSO 
_struct_ref.pdbx_db_accession          Q97VT7 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MRIPLVGKDSIESKDIGFTLIHEHLRVFSEAVRQQWPHLYNEDEEFRNAVNEVKRAMQFGVKTIVDPTVMGLGRDIRFME
KVVKATGINLVAGTGIYIYIDLPFYFLNRSIDEIADLFIHDIKEGIQGTLNKAGFVKIAADEPGITKDVEKVIRAAAIAN
KETKVPIITHSNAHNNTGLEQQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLDRYGLDLFLPVDKRNETTL
RLIKDGYSDKIMISHDYCCTIDWGTAKPEYKPKLAPRWSITLIFEDTIPFLKRNGVNEEVIATIFKENPKKFFS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4KET A 1 ? 314 ? Q97VT7 1 ? 314 ? 1 314 
2 1 4KET B 1 ? 314 ? Q97VT7 1 ? 314 ? 1 314 
3 1 4KET C 1 ? 314 ? Q97VT7 1 ? 314 ? 1 314 
4 1 4KET D 1 ? 314 ? Q97VT7 1 ? 314 ? 1 314 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4KET ILE A 263 ? UNP Q97VT7 TRP 263 'ENGINEERED MUTATION' 263 1 
2 4KET ILE B 263 ? UNP Q97VT7 TRP 263 'ENGINEERED MUTATION' 263 2 
3 4KET ILE C 263 ? UNP Q97VT7 TRP 263 'ENGINEERED MUTATION' 263 3 
4 4KET ILE D 263 ? UNP Q97VT7 TRP 263 'ENGINEERED MUTATION' 263 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                    ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ?                               'C4 H7 N O4'     133.103 
CO  non-polymer         . 'COBALT (II) ION'           ?                               'Co 2'           58.933  
CYS 'L-peptide linking' y CYSTEINE                    ?                               'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL              'ETHYLENE GLYCOL'               'C2 H6 O2'       62.068  
FE2 non-polymer         . 'FE (II) ION'               ?                               'Fe 2'           55.845  
GLN 'L-peptide linking' y GLUTAMINE                   ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                     ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                    'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE                   ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                       ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                  ?                               'C6 H13 N O2'    131.173 
KCX 'L-peptide linking' n 'LYSINE NZ-CARBOXYLIC ACID' ?                               'C7 H14 N2 O4'   190.197 
LEU 'L-peptide linking' y LEUCINE                     ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                      ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                  ?                               'C5 H11 N O2 S'  149.211 
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER'     ?                               'C4 H10 O3'      106.120 
PG4 non-polymer         . 'TETRAETHYLENE GLYCOL'      ?                               'C8 H18 O5'      194.226 
PHE 'L-peptide linking' y PHENYLALANINE               ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                     ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                      ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                   ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                    ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                      ?                               'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4KET 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.40 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   48.76 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    '50 mM Tris-HCl, 23-25% PEG8000, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2011-10-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.99987 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_wavelength_list        0.99987 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
# 
_reflns.entry_id                     4KET 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.0 
_reflns.d_resolution_low             44.66 
_reflns.number_all                   ? 
_reflns.number_obs                   92731 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 4KET 
_refine.ls_d_res_high                            2.000 
_refine.ls_d_res_low                             44.66 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.57 
_refine.ls_number_reflns_obs                     92730 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1469 
_refine.ls_R_factor_R_work                       0.1447 
_refine.ls_wR_factor_R_work                      0.1396 
_refine.ls_R_factor_R_free                       0.1895 
_refine.ls_wR_factor_R_free                      0.1817 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  4637 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               24.1689 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            1.3900 
_refine.aniso_B[2][2]                            0.1000 
_refine.aniso_B[3][3]                            -1.4900 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9670 
_refine.correlation_coeff_Fo_to_Fc_free          0.9450 
_refine.overall_SU_R_Cruickshank_DPI             0.1495 
_refine.overall_SU_R_free                        0.1375 
_refine.pdbx_overall_ESU_R                       0.1490 
_refine.pdbx_overall_ESU_R_Free                  0.1370 
_refine.overall_SU_ML                            0.0850 
_refine.overall_SU_B                             6.0820 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.9037 
_refine.B_iso_max                                84.990 
_refine.B_iso_min                                9.540 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10028 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         135 
_refine_hist.number_atoms_solvent             900 
_refine_hist.number_atoms_total               11063 
_refine_hist.d_res_high                       2.000 
_refine_hist.d_res_low                        44.66 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       10474 0.005  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    14083 0.953  1.977  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 1284  5.258  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 473   32.301 24.376 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 1904  12.708 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 63    15.750 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         1592  0.064  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   7723  0.004  0.021  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.052 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.92 
_refine_ls_shell.number_reflns_R_work             6113 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.1680 
_refine_ls_shell.R_factor_R_free                  0.2290 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             322 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                6435 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4KET 
_struct.title                     'Crystal structure of SsoPox W263I' 
_struct.pdbx_descriptor           'Aryldialkylphosphatase (E.C.3.1.8.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4KET 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            '(beta/alpha)8-hydrolase, lactonase, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 3 ? 
G  N N 4 ? 
H  N N 5 ? 
I  N N 5 ? 
J  N N 5 ? 
K  N N 4 ? 
L  N N 4 ? 
M  N N 2 ? 
N  N N 3 ? 
O  N N 5 ? 
P  N N 5 ? 
Q  N N 5 ? 
R  N N 6 ? 
S  N N 2 ? 
T  N N 3 ? 
U  N N 5 ? 
V  N N 7 ? 
W  N N 5 ? 
X  N N 4 ? 
Y  N N 5 ? 
Z  N N 2 ? 
AA N N 3 ? 
BA N N 4 ? 
CA N N 7 ? 
DA N N 5 ? 
EA N N 4 ? 
FA N N 5 ? 
GA N N 4 ? 
HA N N 8 ? 
IA N N 8 ? 
JA N N 8 ? 
KA N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 12  ? ILE A 16  ? GLU A 12  ILE A 16  5 ? 5  
HELX_P HELX_P2  2  SER A 29  ? TRP A 36  ? SER A 29  TRP A 36  1 ? 8  
HELX_P HELX_P3  3  PRO A 37  ? TYR A 40  ? PRO A 37  TYR A 40  5 ? 4  
HELX_P HELX_P4  4  ASN A 41  ? PHE A 59  ? ASN A 41  PHE A 59  1 ? 19 
HELX_P HELX_P5  5  ASP A 75  ? GLY A 87  ? ASP A 75  GLY A 87  1 ? 13 
HELX_P HELX_P6  6  PRO A 103 ? LEU A 107 ? PRO A 103 LEU A 107 5 ? 5  
HELX_P HELX_P7  7  SER A 110 ? GLU A 124 ? SER A 110 GLU A 124 1 ? 15 
HELX_P HELX_P8  8  THR A 146 ? LYS A 164 ? THR A 146 LYS A 164 1 ? 19 
HELX_P HELX_P9  9  ASN A 176 ? GLU A 188 ? ASN A 176 GLU A 188 1 ? 13 
HELX_P HELX_P10 10 ASP A 191 ? GLY A 193 ? ASP A 191 GLY A 193 5 ? 3  
HELX_P HELX_P11 11 HIS A 199 ? THR A 203 ? HIS A 199 THR A 203 5 ? 5  
HELX_P HELX_P12 12 ASN A 205 ? LYS A 215 ? ASN A 205 LYS A 215 1 ? 11 
HELX_P HELX_P13 13 PRO A 231 ? ASP A 245 ? PRO A 231 ASP A 245 1 ? 15 
HELX_P HELX_P14 14 GLY A 246 ? ASP A 249 ? GLY A 246 ASP A 249 5 ? 4  
HELX_P HELX_P15 15 ILE A 263 ? GLU A 269 ? ILE A 263 GLU A 269 5 ? 7  
HELX_P HELX_P16 16 TYR A 270 ? ALA A 275 ? TYR A 270 ALA A 275 1 ? 6  
HELX_P HELX_P17 17 THR A 281 ? ASP A 286 ? THR A 281 ASP A 286 1 ? 6  
HELX_P HELX_P18 18 ASP A 286 ? ARG A 293 ? ASP A 286 ARG A 293 1 ? 8  
HELX_P HELX_P19 19 ASN A 297 ? LYS A 306 ? ASN A 297 LYS A 306 1 ? 10 
HELX_P HELX_P20 20 LYS A 306 ? PHE A 313 ? LYS A 306 PHE A 313 1 ? 8  
HELX_P HELX_P21 21 GLU B 12  ? ILE B 16  ? GLU B 12  ILE B 16  5 ? 5  
HELX_P HELX_P22 22 SER B 29  ? TRP B 36  ? SER B 29  TRP B 36  1 ? 8  
HELX_P HELX_P23 23 PRO B 37  ? TYR B 40  ? PRO B 37  TYR B 40  5 ? 4  
HELX_P HELX_P24 24 ASN B 41  ? PHE B 59  ? ASN B 41  PHE B 59  1 ? 19 
HELX_P HELX_P25 25 ASP B 75  ? GLY B 87  ? ASP B 75  GLY B 87  1 ? 13 
HELX_P HELX_P26 26 PRO B 103 ? LEU B 107 ? PRO B 103 LEU B 107 5 ? 5  
HELX_P HELX_P27 27 SER B 110 ? GLU B 124 ? SER B 110 GLU B 124 1 ? 15 
HELX_P HELX_P28 28 THR B 146 ? LYS B 164 ? THR B 146 LYS B 164 1 ? 19 
HELX_P HELX_P29 29 ASN B 176 ? GLU B 188 ? ASN B 176 GLU B 188 1 ? 13 
HELX_P HELX_P30 30 ASP B 191 ? GLY B 193 ? ASP B 191 GLY B 193 5 ? 3  
HELX_P HELX_P31 31 HIS B 199 ? THR B 203 ? HIS B 199 THR B 203 5 ? 5  
HELX_P HELX_P32 32 ASN B 205 ? LYS B 215 ? ASN B 205 LYS B 215 1 ? 11 
HELX_P HELX_P33 33 PRO B 231 ? ASP B 245 ? PRO B 231 ASP B 245 1 ? 15 
HELX_P HELX_P34 34 ILE B 263 ? GLU B 269 ? ILE B 263 GLU B 269 5 ? 7  
HELX_P HELX_P35 35 TYR B 270 ? ALA B 275 ? TYR B 270 ALA B 275 1 ? 6  
HELX_P HELX_P36 36 THR B 281 ? ASP B 286 ? THR B 281 ASP B 286 1 ? 6  
HELX_P HELX_P37 37 ASP B 286 ? ASN B 294 ? ASP B 286 ASN B 294 1 ? 9  
HELX_P HELX_P38 38 ASN B 297 ? LYS B 306 ? ASN B 297 LYS B 306 1 ? 10 
HELX_P HELX_P39 39 LYS B 306 ? PHE B 313 ? LYS B 306 PHE B 313 1 ? 8  
HELX_P HELX_P40 40 GLU C 12  ? ILE C 16  ? GLU C 12  ILE C 16  5 ? 5  
HELX_P HELX_P41 41 SER C 29  ? TRP C 36  ? SER C 29  TRP C 36  1 ? 8  
HELX_P HELX_P42 42 PRO C 37  ? TYR C 40  ? PRO C 37  TYR C 40  5 ? 4  
HELX_P HELX_P43 43 ASN C 41  ? PHE C 59  ? ASN C 41  PHE C 59  1 ? 19 
HELX_P HELX_P44 44 ASP C 75  ? GLY C 87  ? ASP C 75  GLY C 87  1 ? 13 
HELX_P HELX_P45 45 PRO C 103 ? LEU C 107 ? PRO C 103 LEU C 107 5 ? 5  
HELX_P HELX_P46 46 SER C 110 ? GLU C 124 ? SER C 110 GLU C 124 1 ? 15 
HELX_P HELX_P47 47 THR C 146 ? LYS C 164 ? THR C 146 LYS C 164 1 ? 19 
HELX_P HELX_P48 48 ASN C 176 ? GLU C 188 ? ASN C 176 GLU C 188 1 ? 13 
HELX_P HELX_P49 49 ASP C 191 ? GLY C 193 ? ASP C 191 GLY C 193 5 ? 3  
HELX_P HELX_P50 50 HIS C 199 ? THR C 203 ? HIS C 199 THR C 203 5 ? 5  
HELX_P HELX_P51 51 ASN C 205 ? LYS C 215 ? ASN C 205 LYS C 215 1 ? 11 
HELX_P HELX_P52 52 PRO C 231 ? ASP C 245 ? PRO C 231 ASP C 245 1 ? 15 
HELX_P HELX_P53 53 TYR C 247 ? ASP C 249 ? TYR C 247 ASP C 249 5 ? 3  
HELX_P HELX_P54 54 ILE C 263 ? GLU C 269 ? ILE C 263 GLU C 269 5 ? 7  
HELX_P HELX_P55 55 TYR C 270 ? ALA C 275 ? TYR C 270 ALA C 275 1 ? 6  
HELX_P HELX_P56 56 THR C 281 ? ASP C 286 ? THR C 281 ASP C 286 1 ? 6  
HELX_P HELX_P57 57 ASP C 286 ? ARG C 293 ? ASP C 286 ARG C 293 1 ? 8  
HELX_P HELX_P58 58 ASN C 297 ? LYS C 306 ? ASN C 297 LYS C 306 1 ? 10 
HELX_P HELX_P59 59 LYS C 306 ? PHE C 313 ? LYS C 306 PHE C 313 1 ? 8  
HELX_P HELX_P60 60 GLU D 12  ? ILE D 16  ? GLU D 12  ILE D 16  5 ? 5  
HELX_P HELX_P61 61 SER D 29  ? TRP D 36  ? SER D 29  TRP D 36  1 ? 8  
HELX_P HELX_P62 62 PRO D 37  ? TYR D 40  ? PRO D 37  TYR D 40  5 ? 4  
HELX_P HELX_P63 63 ASN D 41  ? PHE D 59  ? ASN D 41  PHE D 59  1 ? 19 
HELX_P HELX_P64 64 ASP D 75  ? GLY D 87  ? ASP D 75  GLY D 87  1 ? 13 
HELX_P HELX_P65 65 PRO D 103 ? LEU D 107 ? PRO D 103 LEU D 107 5 ? 5  
HELX_P HELX_P66 66 SER D 110 ? GLU D 124 ? SER D 110 GLU D 124 1 ? 15 
HELX_P HELX_P67 67 THR D 146 ? LYS D 164 ? THR D 146 LYS D 164 1 ? 19 
HELX_P HELX_P68 68 ASN D 176 ? GLU D 188 ? ASN D 176 GLU D 188 1 ? 13 
HELX_P HELX_P69 69 ASP D 191 ? GLY D 193 ? ASP D 191 GLY D 193 5 ? 3  
HELX_P HELX_P70 70 HIS D 199 ? THR D 203 ? HIS D 199 THR D 203 5 ? 5  
HELX_P HELX_P71 71 ASN D 205 ? LYS D 215 ? ASN D 205 LYS D 215 1 ? 11 
HELX_P HELX_P72 72 PRO D 231 ? ASP D 245 ? PRO D 231 ASP D 245 1 ? 15 
HELX_P HELX_P73 73 TYR D 247 ? ASP D 249 ? TYR D 247 ASP D 249 5 ? 3  
HELX_P HELX_P74 74 ILE D 263 ? GLU D 269 ? ILE D 263 GLU D 269 5 ? 7  
HELX_P HELX_P75 75 TYR D 270 ? ALA D 275 ? TYR D 270 ALA D 275 1 ? 6  
HELX_P HELX_P76 76 THR D 281 ? ASP D 286 ? THR D 281 ASP D 286 1 ? 6  
HELX_P HELX_P77 77 ASP D 286 ? ARG D 293 ? ASP D 286 ARG D 293 1 ? 8  
HELX_P HELX_P78 78 ASN D 297 ? LYS D 306 ? ASN D 297 LYS D 306 1 ? 10 
HELX_P HELX_P79 79 LYS D 306 ? PHE D 313 ? LYS D 306 PHE D 313 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A  VAL 136 C   ? ? ? 1_555 A  KCX 137 N  ? ? A VAL 136 A KCX 137 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale2  covale ? ? A  KCX 137 C   ? ? ? 1_555 A  ILE 138 N  ? ? A KCX 137 A ILE 138 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale3  covale ? ? B  VAL 136 C   ? ? ? 1_555 B  KCX 137 N  ? ? B VAL 136 B KCX 137 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale4  covale ? ? B  KCX 137 C   ? ? ? 1_555 B  ILE 138 N  ? ? B KCX 137 B ILE 138 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale5  covale ? ? C  VAL 136 C   ? ? ? 1_555 C  KCX 137 N  ? ? C VAL 136 C KCX 137 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale6  covale ? ? C  KCX 137 C   ? ? ? 1_555 C  ILE 138 N  ? ? C KCX 137 C ILE 138 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale7  covale ? ? D  VAL 136 C   ? ? ? 1_555 D  KCX 137 N  ? ? D VAL 136 D KCX 137 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale8  covale ? ? D  KCX 137 C   ? ? ? 1_555 D  ILE 138 N  ? ? D KCX 137 D ILE 138 1_555 ? ? ? ? ? ? ? 1.332 ? 
metalc1  metalc ? ? C  KCX 137 OQ1 ? ? ? 1_555 T  CO  .   CO ? ? C KCX 137 C CO  402 1_555 ? ? ? ? ? ? ? 1.761 ? 
metalc2  metalc ? ? D  KCX 137 OQ1 ? ? ? 1_555 AA CO  .   CO ? ? D KCX 137 D CO  402 1_555 ? ? ? ? ? ? ? 3.259 ? 
metalc3  metalc ? ? B  KCX 137 OQ2 ? ? ? 1_555 N  CO  .   CO ? ? B KCX 137 B CO  403 1_555 ? ? ? ? ? ? ? 1.772 ? 
metalc4  metalc ? ? A  KCX 137 OQ1 ? ? ? 1_555 F  CO  .   CO ? ? A KCX 137 A CO  402 1_555 ? ? ? ? ? ? ? 3.237 ? 
metalc5  metalc ? ? AA CO  .   CO  ? ? ? 1_555 KA HOH .   O  ? ? D CO  402 D HOH 701 1_555 ? ? ? ? ? ? ? 1.892 ? 
metalc6  metalc ? ? D  HIS 170 ND1 ? ? ? 1_555 AA CO  .   CO ? ? D HIS 170 D CO  402 1_555 ? ? ? ? ? ? ? 1.915 ? 
metalc7  metalc ? ? C  HIS 170 ND1 ? ? ? 1_555 T  CO  .   CO ? ? C HIS 170 C CO  402 1_555 ? ? ? ? ? ? ? 1.915 ? 
metalc8  metalc ? ? C  HIS 199 NE2 ? ? ? 1_555 T  CO  .   CO ? ? C HIS 199 C CO  402 1_555 ? ? ? ? ? ? ? 1.916 ? 
metalc9  metalc ? ? D  HIS 199 NE2 ? ? ? 1_555 AA CO  .   CO ? ? D HIS 199 D CO  402 1_555 ? ? ? ? ? ? ? 1.918 ? 
metalc10 metalc ? ? B  HIS 199 NE2 ? ? ? 1_555 N  CO  .   CO ? ? B HIS 199 B CO  403 1_555 ? ? ? ? ? ? ? 1.919 ? 
metalc11 metalc ? ? B  HIS 170 ND1 ? ? ? 1_555 N  CO  .   CO ? ? B HIS 170 B CO  403 1_555 ? ? ? ? ? ? ? 1.920 ? 
metalc12 metalc ? ? A  HIS 199 NE2 ? ? ? 1_555 F  CO  .   CO ? ? A HIS 199 A CO  402 1_555 ? ? ? ? ? ? ? 1.921 ? 
metalc13 metalc ? ? A  HIS 170 ND1 ? ? ? 1_555 F  CO  .   CO ? ? A HIS 170 A CO  402 1_555 ? ? ? ? ? ? ? 1.922 ? 
metalc14 metalc ? ? N  CO  .   CO  ? ? ? 1_555 IA HOH .   O  ? ? B CO  403 B HOH 718 1_555 ? ? ? ? ? ? ? 1.934 ? 
metalc15 metalc ? ? T  CO  .   CO  ? ? ? 1_555 JA HOH .   O  ? ? C CO  402 C HOH 688 1_555 ? ? ? ? ? ? ? 1.950 ? 
metalc16 metalc ? ? F  CO  .   CO  ? ? ? 1_555 HA HOH .   O  ? ? A CO  402 A HOH 699 1_555 ? ? ? ? ? ? ? 1.992 ? 
metalc17 metalc ? ? N  CO  .   CO  ? ? ? 1_555 O  GOL .   O3 ? ? B CO  403 B GOL 404 1_555 ? ? ? ? ? ? ? 2.433 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
C ? 6 ? 
D ? 2 ? 
E ? 3 ? 
F ? 6 ? 
G ? 2 ? 
H ? 3 ? 
I ? 6 ? 
J ? 2 ? 
K ? 3 ? 
L ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? parallel      
G 1 2 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? parallel      
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
I 5 6 ? parallel      
J 1 2 ? anti-parallel 
K 1 2 ? parallel      
K 2 3 ? parallel      
L 1 2 ? parallel      
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
L 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 3   ? LEU A 5   ? ILE A 3   LEU A 5   
A 2 LYS A 8   ? ILE A 11  ? LYS A 8   ILE A 11  
B 1 THR A 19  ? LEU A 20  ? THR A 19  LEU A 20  
B 2 THR A 63  ? ASP A 66  ? THR A 63  ASP A 66  
B 3 ASN A 89  ? ALA A 92  ? ASN A 89  ALA A 92  
C 1 THR A 94  ? ILE A 96  ? THR A 94  ILE A 96  
C 2 VAL A 136 ? ALA A 139 ? VAL A 136 ALA A 139 
C 3 ILE A 167 ? HIS A 170 ? ILE A 167 HIS A 170 
C 4 ILE A 195 ? ILE A 197 ? ILE A 195 ILE A 197 
C 5 PHE A 218 ? LEU A 221 ? PHE A 218 LEU A 221 
C 6 ILE A 251 ? ILE A 253 ? ILE A 251 ILE A 253 
D 1 ILE B 3   ? LEU B 5   ? ILE B 3   LEU B 5   
D 2 LYS B 8   ? ILE B 11  ? LYS B 8   ILE B 11  
E 1 THR B 19  ? LEU B 20  ? THR B 19  LEU B 20  
E 2 THR B 63  ? ASP B 66  ? THR B 63  ASP B 66  
E 3 ASN B 89  ? ALA B 92  ? ASN B 89  ALA B 92  
F 1 THR B 94  ? ILE B 96  ? THR B 94  ILE B 96  
F 2 VAL B 136 ? ALA B 139 ? VAL B 136 ALA B 139 
F 3 ILE B 167 ? HIS B 170 ? ILE B 167 HIS B 170 
F 4 ILE B 195 ? ILE B 197 ? ILE B 195 ILE B 197 
F 5 PHE B 218 ? LEU B 221 ? PHE B 218 LEU B 221 
F 6 ILE B 251 ? ILE B 253 ? ILE B 251 ILE B 253 
G 1 ILE C 3   ? LEU C 5   ? ILE C 3   LEU C 5   
G 2 LYS C 8   ? ILE C 11  ? LYS C 8   ILE C 11  
H 1 THR C 19  ? LEU C 20  ? THR C 19  LEU C 20  
H 2 THR C 63  ? ASP C 66  ? THR C 63  ASP C 66  
H 3 ASN C 89  ? ALA C 92  ? ASN C 89  ALA C 92  
I 1 THR C 94  ? ILE C 96  ? THR C 94  ILE C 96  
I 2 VAL C 136 ? ALA C 139 ? VAL C 136 ALA C 139 
I 3 ILE C 167 ? HIS C 170 ? ILE C 167 HIS C 170 
I 4 ILE C 195 ? ILE C 197 ? ILE C 195 ILE C 197 
I 5 PHE C 218 ? LEU C 221 ? PHE C 218 LEU C 221 
I 6 ILE C 251 ? ILE C 253 ? ILE C 251 ILE C 253 
J 1 ILE D 3   ? LEU D 5   ? ILE D 3   LEU D 5   
J 2 LYS D 8   ? ILE D 11  ? LYS D 8   ILE D 11  
K 1 THR D 19  ? LEU D 20  ? THR D 19  LEU D 20  
K 2 THR D 63  ? ASP D 66  ? THR D 63  ASP D 66  
K 3 ASN D 89  ? ALA D 92  ? ASN D 89  ALA D 92  
L 1 THR D 94  ? GLY D 95  ? THR D 94  GLY D 95  
L 2 VAL D 136 ? ALA D 139 ? VAL D 136 ALA D 139 
L 3 ILE D 167 ? HIS D 170 ? ILE D 167 HIS D 170 
L 4 ILE D 195 ? ILE D 197 ? ILE D 195 ILE D 197 
L 5 PHE D 218 ? LEU D 221 ? PHE D 218 LEU D 221 
L 6 ILE D 251 ? ILE D 253 ? ILE D 251 ILE D 253 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 3   ? N ILE A 3   O ILE A 11  ? O ILE A 11  
B 1 2 N LEU A 20  ? N LEU A 20  O VAL A 65  ? O VAL A 65  
B 2 3 N ILE A 64  ? N ILE A 64  O ASN A 89  ? O ASN A 89  
C 1 2 N THR A 94  ? N THR A 94  O KCX A 137 ? O KCX A 137 
C 2 3 N VAL A 136 ? N VAL A 136 O ILE A 168 ? O ILE A 168 
C 3 4 N ILE A 167 ? N ILE A 167 O LEU A 196 ? O LEU A 196 
C 4 5 N ILE A 197 ? N ILE A 197 O GLY A 220 ? O GLY A 220 
C 5 6 N LEU A 221 ? N LEU A 221 O MET A 252 ? O MET A 252 
D 1 2 N ILE B 3   ? N ILE B 3   O ILE B 11  ? O ILE B 11  
E 1 2 N LEU B 20  ? N LEU B 20  O VAL B 65  ? O VAL B 65  
E 2 3 N ILE B 64  ? N ILE B 64  O ASN B 89  ? O ASN B 89  
F 1 2 N THR B 94  ? N THR B 94  O KCX B 137 ? O KCX B 137 
F 2 3 N VAL B 136 ? N VAL B 136 O ILE B 168 ? O ILE B 168 
F 3 4 N THR B 169 ? N THR B 169 O LEU B 196 ? O LEU B 196 
F 4 5 N ILE B 197 ? N ILE B 197 O GLY B 220 ? O GLY B 220 
F 5 6 N LEU B 221 ? N LEU B 221 O MET B 252 ? O MET B 252 
G 1 2 N ILE C 3   ? N ILE C 3   O ILE C 11  ? O ILE C 11  
H 1 2 N LEU C 20  ? N LEU C 20  O VAL C 65  ? O VAL C 65  
H 2 3 N ILE C 64  ? N ILE C 64  O ASN C 89  ? O ASN C 89  
I 1 2 N THR C 94  ? N THR C 94  O KCX C 137 ? O KCX C 137 
I 2 3 N VAL C 136 ? N VAL C 136 O ILE C 168 ? O ILE C 168 
I 3 4 N ILE C 167 ? N ILE C 167 O LEU C 196 ? O LEU C 196 
I 4 5 N ILE C 197 ? N ILE C 197 O GLY C 220 ? O GLY C 220 
I 5 6 N LEU C 221 ? N LEU C 221 O MET C 252 ? O MET C 252 
J 1 2 N ILE D 3   ? N ILE D 3   O ILE D 11  ? O ILE D 11  
K 1 2 N LEU D 20  ? N LEU D 20  O VAL D 65  ? O VAL D 65  
K 2 3 N ILE D 64  ? N ILE D 64  O ASN D 89  ? O ASN D 89  
L 1 2 N THR D 94  ? N THR D 94  O KCX D 137 ? O KCX D 137 
L 2 3 N VAL D 136 ? N VAL D 136 O ILE D 168 ? O ILE D 168 
L 3 4 N ILE D 167 ? N ILE D 167 O LEU D 196 ? O LEU D 196 
L 4 5 N ILE D 197 ? N ILE D 197 O GLY D 220 ? O GLY D 220 
L 5 6 N LEU D 221 ? N LEU D 221 O MET D 252 ? O MET D 252 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE FE2 A 401' 
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CO A 402'  
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE EDO A 403' 
AC4 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE GOL A 404' 
AC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL A 405' 
AC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 406' 
AC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE EDO A 407' 
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO B 401' 
AC9 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE FE2 B 402' 
BC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CO B 403'  
BC2 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL B 404' 
BC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE GOL B 405' 
BC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL B 406' 
BC5 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE PEG B 407' 
BC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FE2 C 401' 
BC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CO C 402'  
BC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL C 403' 
BC9 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE PG4 C 404' 
CC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL C 405' 
CC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE EDO C 406' 
CC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL C 407' 
CC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FE2 D 401' 
CC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CO D 402'  
CC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE EDO D 403' 
CC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE PG4 D 404' 
CC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL D 405' 
CC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE EDO D 406' 
DC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL D 407' 
DC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO D 408' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 7  HIS A  22  ? HIS A 22  . ? 1_555 ? 
2   AC1 7  HIS A  24  ? HIS A 24  . ? 1_555 ? 
3   AC1 7  KCX A  137 ? KCX A 137 . ? 1_555 ? 
4   AC1 7  ASP A  256 ? ASP A 256 . ? 1_555 ? 
5   AC1 7  CO  F  .   ? CO  A 402 . ? 1_555 ? 
6   AC1 7  EDO G  .   ? EDO A 403 . ? 1_555 ? 
7   AC1 7  HOH HA .   ? HOH A 699 . ? 1_555 ? 
8   AC2 7  KCX A  137 ? KCX A 137 . ? 1_555 ? 
9   AC2 7  HIS A  170 ? HIS A 170 . ? 1_555 ? 
10  AC2 7  HIS A  199 ? HIS A 199 . ? 1_555 ? 
11  AC2 7  ARG A  223 ? ARG A 223 . ? 1_555 ? 
12  AC2 7  FE2 E  .   ? FE2 A 401 . ? 1_555 ? 
13  AC2 7  EDO G  .   ? EDO A 403 . ? 1_555 ? 
14  AC2 7  HOH HA .   ? HOH A 699 . ? 1_555 ? 
15  AC3 10 HIS A  24  ? HIS A 24  . ? 1_555 ? 
16  AC3 10 TYR A  97  ? TYR A 97  . ? 1_555 ? 
17  AC3 10 KCX A  137 ? KCX A 137 . ? 1_555 ? 
18  AC3 10 HIS A  170 ? HIS A 170 . ? 1_555 ? 
19  AC3 10 ARG A  223 ? ARG A 223 . ? 1_555 ? 
20  AC3 10 ASP A  256 ? ASP A 256 . ? 1_555 ? 
21  AC3 10 FE2 E  .   ? FE2 A 401 . ? 1_555 ? 
22  AC3 10 CO  F  .   ? CO  A 402 . ? 1_555 ? 
23  AC3 10 HOH HA .   ? HOH A 699 . ? 1_555 ? 
24  AC3 10 HOH HA .   ? HOH A 706 . ? 1_555 ? 
25  AC4 11 PRO A  4   ? PRO A 4   . ? 1_555 ? 
26  AC4 11 LEU A  5   ? LEU A 5   . ? 1_555 ? 
27  AC4 11 LYS A  8   ? LYS A 8   . ? 1_555 ? 
28  AC4 11 ASP A  9   ? ASP A 9   . ? 1_555 ? 
29  AC4 11 SER A  10  ? SER A 10  . ? 1_555 ? 
30  AC4 11 LEU A  130 ? LEU A 130 . ? 1_555 ? 
31  AC4 11 ASN A  131 ? ASN A 131 . ? 1_555 ? 
32  AC4 11 LYS A  132 ? LYS A 132 . ? 1_555 ? 
33  AC4 11 HOH HA .   ? HOH A 552 . ? 1_555 ? 
34  AC4 11 HOH HA .   ? HOH A 681 . ? 1_555 ? 
35  AC4 11 HOH HA .   ? HOH A 694 . ? 1_555 ? 
36  AC5 7  ASN A  160 ? ASN A 160 . ? 1_555 ? 
37  AC5 7  LYS A  164 ? LYS A 164 . ? 1_555 ? 
38  AC5 7  GLY A  189 ? GLY A 189 . ? 1_555 ? 
39  AC5 7  VAL A  190 ? VAL A 190 . ? 1_555 ? 
40  AC5 7  ASP A  191 ? ASP A 191 . ? 1_555 ? 
41  AC5 7  HOH HA .   ? HOH A 663 . ? 1_555 ? 
42  AC5 7  HOH HA .   ? HOH A 676 . ? 1_555 ? 
43  AC6 8  HIS A  120 ? HIS A 120 . ? 1_555 ? 
44  AC6 8  GLU A  124 ? GLU A 124 . ? 1_555 ? 
45  AC6 8  GLY A  128 ? GLY A 128 . ? 1_555 ? 
46  AC6 8  THR A  129 ? THR A 129 . ? 1_555 ? 
47  AC6 8  HOH HA .   ? HOH A 557 . ? 1_555 ? 
48  AC6 8  HOH HA .   ? HOH A 581 . ? 1_555 ? 
49  AC6 8  HOH HA .   ? HOH A 700 . ? 1_555 ? 
50  AC6 8  HOH HA .   ? HOH A 711 . ? 1_555 ? 
51  AC7 3  PHE A  104 ? PHE A 104 . ? 1_555 ? 
52  AC7 3  TYR C  99  ? TYR C 99  . ? 1_555 ? 
53  AC7 3  PG4 V  .   ? PG4 C 404 . ? 1_555 ? 
54  AC8 5  GLU A  298 ? GLU A 298 . ? 4_445 ? 
55  AC8 5  HOH HA .   ? HOH A 609 . ? 4_445 ? 
56  AC8 5  HOH HA .   ? HOH A 683 . ? 4_445 ? 
57  AC8 5  GLN B  58  ? GLN B 58  . ? 1_555 ? 
58  AC8 5  HOH IA .   ? HOH B 576 . ? 1_555 ? 
59  AC9 7  HIS B  22  ? HIS B 22  . ? 1_555 ? 
60  AC9 7  HIS B  24  ? HIS B 24  . ? 1_555 ? 
61  AC9 7  KCX B  137 ? KCX B 137 . ? 1_555 ? 
62  AC9 7  ASP B  256 ? ASP B 256 . ? 1_555 ? 
63  AC9 7  CO  N  .   ? CO  B 403 . ? 1_555 ? 
64  AC9 7  GOL O  .   ? GOL B 404 . ? 1_555 ? 
65  AC9 7  HOH IA .   ? HOH B 718 . ? 1_555 ? 
66  BC1 7  KCX B  137 ? KCX B 137 . ? 1_555 ? 
67  BC1 7  HIS B  170 ? HIS B 170 . ? 1_555 ? 
68  BC1 7  HIS B  199 ? HIS B 199 . ? 1_555 ? 
69  BC1 7  ARG B  223 ? ARG B 223 . ? 1_555 ? 
70  BC1 7  FE2 M  .   ? FE2 B 402 . ? 1_555 ? 
71  BC1 7  GOL O  .   ? GOL B 404 . ? 1_555 ? 
72  BC1 7  HOH IA .   ? HOH B 718 . ? 1_555 ? 
73  BC2 9  HIS B  24  ? HIS B 24  . ? 1_555 ? 
74  BC2 9  TYR B  97  ? TYR B 97  . ? 1_555 ? 
75  BC2 9  KCX B  137 ? KCX B 137 . ? 1_555 ? 
76  BC2 9  HIS B  170 ? HIS B 170 . ? 1_555 ? 
77  BC2 9  ARG B  223 ? ARG B 223 . ? 1_555 ? 
78  BC2 9  ASP B  256 ? ASP B 256 . ? 1_555 ? 
79  BC2 9  FE2 M  .   ? FE2 B 402 . ? 1_555 ? 
80  BC2 9  CO  N  .   ? CO  B 403 . ? 1_555 ? 
81  BC2 9  HOH IA .   ? HOH B 718 . ? 1_555 ? 
82  BC3 13 PRO B  4   ? PRO B 4   . ? 1_555 ? 
83  BC3 13 LEU B  5   ? LEU B 5   . ? 1_555 ? 
84  BC3 13 LYS B  8   ? LYS B 8   . ? 1_555 ? 
85  BC3 13 ASP B  9   ? ASP B 9   . ? 1_555 ? 
86  BC3 13 SER B  10  ? SER B 10  . ? 1_555 ? 
87  BC3 13 LEU B  130 ? LEU B 130 . ? 1_555 ? 
88  BC3 13 ASN B  131 ? ASN B 131 . ? 1_555 ? 
89  BC3 13 LYS B  132 ? LYS B 132 . ? 1_555 ? 
90  BC3 13 HOH IA .   ? HOH B 542 . ? 1_555 ? 
91  BC3 13 HOH IA .   ? HOH B 685 . ? 1_555 ? 
92  BC3 13 HOH IA .   ? HOH B 686 . ? 1_555 ? 
93  BC3 13 HOH IA .   ? HOH B 722 . ? 1_555 ? 
94  BC3 13 HOH IA .   ? HOH B 729 . ? 1_555 ? 
95  BC4 7  ASN B  160 ? ASN B 160 . ? 1_555 ? 
96  BC4 7  LYS B  164 ? LYS B 164 . ? 1_555 ? 
97  BC4 7  GLY B  189 ? GLY B 189 . ? 1_555 ? 
98  BC4 7  VAL B  190 ? VAL B 190 . ? 1_555 ? 
99  BC4 7  ASP B  191 ? ASP B 191 . ? 1_555 ? 
100 BC4 7  LYS B  194 ? LYS B 194 . ? 1_555 ? 
101 BC4 7  HOH IA .   ? HOH B 636 . ? 1_555 ? 
102 BC5 13 HIS B  120 ? HIS B 120 . ? 1_555 ? 
103 BC5 13 GLU B  124 ? GLU B 124 . ? 1_555 ? 
104 BC5 13 GLY B  125 ? GLY B 125 . ? 1_555 ? 
105 BC5 13 ILE B  126 ? ILE B 126 . ? 1_555 ? 
106 BC5 13 GLN B  127 ? GLN B 127 . ? 1_555 ? 
107 BC5 13 GLY B  128 ? GLY B 128 . ? 1_555 ? 
108 BC5 13 THR B  129 ? THR B 129 . ? 1_555 ? 
109 BC5 13 LEU B  130 ? LEU B 130 . ? 1_555 ? 
110 BC5 13 HOH IA .   ? HOH B 589 . ? 1_555 ? 
111 BC5 13 HOH IA .   ? HOH B 656 . ? 1_555 ? 
112 BC5 13 LYS D  164 ? LYS D 164 . ? 4_544 ? 
113 BC5 13 HOH KA .   ? HOH D 507 . ? 1_555 ? 
114 BC5 13 HOH KA .   ? HOH D 703 . ? 4_544 ? 
115 BC6 6  HIS C  22  ? HIS C 22  . ? 1_555 ? 
116 BC6 6  HIS C  24  ? HIS C 24  . ? 1_555 ? 
117 BC6 6  KCX C  137 ? KCX C 137 . ? 1_555 ? 
118 BC6 6  ASP C  256 ? ASP C 256 . ? 1_555 ? 
119 BC6 6  CO  T  .   ? CO  C 402 . ? 1_555 ? 
120 BC6 6  HOH JA .   ? HOH C 688 . ? 1_555 ? 
121 BC7 6  KCX C  137 ? KCX C 137 . ? 1_555 ? 
122 BC7 6  HIS C  170 ? HIS C 170 . ? 1_555 ? 
123 BC7 6  HIS C  199 ? HIS C 199 . ? 1_555 ? 
124 BC7 6  FE2 S  .   ? FE2 C 401 . ? 1_555 ? 
125 BC7 6  PG4 V  .   ? PG4 C 404 . ? 1_555 ? 
126 BC7 6  HOH JA .   ? HOH C 688 . ? 1_555 ? 
127 BC8 4  ASP C  214 ? ASP C 214 . ? 1_555 ? 
128 BC8 4  GLY C  246 ? GLY C 246 . ? 1_555 ? 
129 BC8 4  TYR C  247 ? TYR C 247 . ? 1_555 ? 
130 BC8 4  ASP C  249 ? ASP C 249 . ? 1_555 ? 
131 BC9 11 EDO K  .   ? EDO A 407 . ? 1_555 ? 
132 BC9 11 TYR C  97  ? TYR C 97  . ? 1_555 ? 
133 BC9 11 HIS C  170 ? HIS C 170 . ? 1_555 ? 
134 BC9 11 ARG C  223 ? ARG C 223 . ? 1_555 ? 
135 BC9 11 LEU C  226 ? LEU C 226 . ? 1_555 ? 
136 BC9 11 ASP C  256 ? ASP C 256 . ? 1_555 ? 
137 BC9 11 TRP C  278 ? TRP C 278 . ? 1_555 ? 
138 BC9 11 CO  T  .   ? CO  C 402 . ? 1_555 ? 
139 BC9 11 HOH JA .   ? HOH C 688 . ? 1_555 ? 
140 BC9 11 HOH JA .   ? HOH C 707 . ? 1_555 ? 
141 BC9 11 HOH JA .   ? HOH C 712 . ? 1_555 ? 
142 CC1 6  HIS C  120 ? HIS C 120 . ? 1_555 ? 
143 CC1 6  GLU C  124 ? GLU C 124 . ? 1_555 ? 
144 CC1 6  GLY C  128 ? GLY C 128 . ? 1_555 ? 
145 CC1 6  THR C  129 ? THR C 129 . ? 1_555 ? 
146 CC1 6  HOH JA .   ? HOH C 540 . ? 1_555 ? 
147 CC1 6  HOH JA .   ? HOH C 550 . ? 1_555 ? 
148 CC2 7  LEU C  102 ? LEU C 102 . ? 1_555 ? 
149 CC2 7  PRO C  103 ? PRO C 103 . ? 1_555 ? 
150 CC2 7  PHE C  104 ? PHE C 104 . ? 1_555 ? 
151 CC2 7  LEU C  107 ? LEU C 107 . ? 1_555 ? 
152 CC2 7  ASP C  148 ? ASP C 148 . ? 1_555 ? 
153 CC2 7  HOH JA .   ? HOH C 704 . ? 1_555 ? 
154 CC2 7  HOH JA .   ? HOH C 706 . ? 1_555 ? 
155 CC3 5  ASN C  160 ? ASN C 160 . ? 1_555 ? 
156 CC3 5  LYS C  164 ? LYS C 164 . ? 1_555 ? 
157 CC3 5  GLY C  189 ? GLY C 189 . ? 1_555 ? 
158 CC3 5  ASP C  191 ? ASP C 191 . ? 1_555 ? 
159 CC3 5  HOH JA .   ? HOH C 599 . ? 1_555 ? 
160 CC4 6  HIS D  22  ? HIS D 22  . ? 1_555 ? 
161 CC4 6  HIS D  24  ? HIS D 24  . ? 1_555 ? 
162 CC4 6  KCX D  137 ? KCX D 137 . ? 1_555 ? 
163 CC4 6  ASP D  256 ? ASP D 256 . ? 1_555 ? 
164 CC4 6  CO  AA .   ? CO  D 402 . ? 1_555 ? 
165 CC4 6  HOH KA .   ? HOH D 701 . ? 1_555 ? 
166 CC5 7  KCX D  137 ? KCX D 137 . ? 1_555 ? 
167 CC5 7  HIS D  170 ? HIS D 170 . ? 1_555 ? 
168 CC5 7  HIS D  199 ? HIS D 199 . ? 1_555 ? 
169 CC5 7  ARG D  223 ? ARG D 223 . ? 1_555 ? 
170 CC5 7  FE2 Z  .   ? FE2 D 401 . ? 1_555 ? 
171 CC5 7  PG4 CA .   ? PG4 D 404 . ? 1_555 ? 
172 CC5 7  HOH KA .   ? HOH D 701 . ? 1_555 ? 
173 CC6 10 ILE C  243 ? ILE C 243 . ? 4_444 ? 
174 CC6 10 GLY C  295 ? GLY C 295 . ? 4_444 ? 
175 CC6 10 VAL C  296 ? VAL C 296 . ? 4_444 ? 
176 CC6 10 ASN C  297 ? ASN C 297 . ? 4_444 ? 
177 CC6 10 VAL C  300 ? VAL C 300 . ? 4_444 ? 
178 CC6 10 GLU D  12  ? GLU D 12  . ? 1_555 ? 
179 CC6 10 LYS D  14  ? LYS D 14  . ? 1_555 ? 
180 CC6 10 ASP D  15  ? ASP D 15  . ? 1_555 ? 
181 CC6 10 HOH KA .   ? HOH D 696 . ? 1_555 ? 
182 CC6 10 HOH KA .   ? HOH D 719 . ? 1_555 ? 
183 CC7 9  TYR D  97  ? TYR D 97  . ? 1_555 ? 
184 CC7 9  ARG D  223 ? ARG D 223 . ? 1_555 ? 
185 CC7 9  ASP D  256 ? ASP D 256 . ? 1_555 ? 
186 CC7 9  THR D  265 ? THR D 265 . ? 1_555 ? 
187 CC7 9  ALA D  266 ? ALA D 266 . ? 1_555 ? 
188 CC7 9  ALA D  275 ? ALA D 275 . ? 1_555 ? 
189 CC7 9  CO  AA .   ? CO  D 402 . ? 1_555 ? 
190 CC7 9  HOH KA .   ? HOH D 701 . ? 1_555 ? 
191 CC7 9  HOH KA .   ? HOH D 704 . ? 1_555 ? 
192 CC8 5  ASP D  112 ? ASP D 112 . ? 1_555 ? 
193 CC8 5  ASP D  116 ? ASP D 116 . ? 1_555 ? 
194 CC8 5  ILE D  119 ? ILE D 119 . ? 1_555 ? 
195 CC8 5  HOH KA .   ? HOH D 710 . ? 4_444 ? 
196 CC8 5  HOH KA .   ? HOH D 722 . ? 1_555 ? 
197 CC9 3  GLN D  58  ? GLN D 58  . ? 1_555 ? 
198 CC9 3  PHE D  59  ? PHE D 59  . ? 1_555 ? 
199 CC9 3  HOH KA .   ? HOH D 718 . ? 1_555 ? 
200 DC1 8  ASN D  160 ? ASN D 160 . ? 1_555 ? 
201 DC1 8  LYS D  164 ? LYS D 164 . ? 1_555 ? 
202 DC1 8  GLY D  189 ? GLY D 189 . ? 1_555 ? 
203 DC1 8  VAL D  190 ? VAL D 190 . ? 1_555 ? 
204 DC1 8  ASP D  191 ? ASP D 191 . ? 1_555 ? 
205 DC1 8  LYS D  194 ? LYS D 194 . ? 1_555 ? 
206 DC1 8  HOH KA .   ? HOH D 589 . ? 1_555 ? 
207 DC1 8  HOH KA .   ? HOH D 706 . ? 1_555 ? 
208 DC2 5  ASP D  249 ? ASP D 249 . ? 1_555 ? 
209 DC2 5  LYS D  250 ? LYS D 250 . ? 1_555 ? 
210 DC2 5  LYS D  311 ? LYS D 311 . ? 1_555 ? 
211 DC2 5  HOH KA .   ? HOH D 678 . ? 1_555 ? 
212 DC2 5  HOH KA .   ? HOH D 702 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4KET 
_atom_sites.fract_transf_matrix[1][1]   0.011442 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009625 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006645 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CO 
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . MET A  1 1   ? 88.745 -49.083 22.791   1.00 74.04 ? 1   MET A N   1 
ATOM   2     C  CA  . MET A  1 1   ? 88.084 -48.308 21.699   1.00 46.85 ? 1   MET A CA  1 
ATOM   3     C  C   . MET A  1 1   ? 87.106 -49.157 20.902   1.00 52.05 ? 1   MET A C   1 
ATOM   4     O  O   . MET A  1 1   ? 87.424 -50.273 20.501   1.00 68.48 ? 1   MET A O   1 
ATOM   5     C  CB  . MET A  1 1   ? 89.127 -47.678 20.788   1.00 45.29 ? 1   MET A CB  1 
ATOM   6     C  CG  . MET A  1 1   ? 89.738 -46.435 21.399   1.00 59.73 ? 1   MET A CG  1 
ATOM   7     S  SD  . MET A  1 1   ? 89.618 -46.497 23.199   1.00 64.75 ? 1   MET A SD  1 
ATOM   8     C  CE  . MET A  1 1   ? 90.458 -44.977 23.650   1.00 67.80 ? 1   MET A CE  1 
ATOM   9     N  N   . ARG A  1 2   ? 85.917 -48.611 20.668   1.00 39.81 ? 2   ARG A N   1 
ATOM   10    C  CA  . ARG A  1 2   ? 84.821 -49.387 20.133   1.00 35.61 ? 2   ARG A CA  1 
ATOM   11    C  C   . ARG A  1 2   ? 83.844 -48.492 19.361   1.00 32.68 ? 2   ARG A C   1 
ATOM   12    O  O   . ARG A  1 2   ? 83.464 -48.829 18.245   1.00 31.47 ? 2   ARG A O   1 
ATOM   13    C  CB  . ARG A  1 2   ? 84.096 -50.115 21.267   1.00 38.39 ? 2   ARG A CB  1 
ATOM   14    C  CG  . ARG A  1 2   ? 83.676 -51.542 20.956   1.00 47.25 ? 2   ARG A CG  1 
ATOM   15    C  CD  . ARG A  1 2   ? 82.742 -51.620 19.756   1.00 68.27 ? 2   ARG A CD  1 
ATOM   16    N  NE  . ARG A  1 2   ? 81.951 -52.850 19.764   1.00 59.50 ? 2   ARG A NE  1 
ATOM   17    C  CZ  . ARG A  1 2   ? 81.209 -53.277 18.746   1.00 53.20 ? 2   ARG A CZ  1 
ATOM   18    N  NH1 . ARG A  1 2   ? 81.150 -52.581 17.616   1.00 60.04 ? 2   ARG A NH1 1 
ATOM   19    N  NH2 . ARG A  1 2   ? 80.525 -54.407 18.858   1.00 60.23 ? 2   ARG A NH2 1 
ATOM   20    N  N   . ILE A  1 3   ? 83.445 -47.360 19.943   1.00 21.35 ? 3   ILE A N   1 
ATOM   21    C  CA  . ILE A  1 3   ? 82.524 -46.442 19.245   1.00 19.87 ? 3   ILE A CA  1 
ATOM   22    C  C   . ILE A  1 3   ? 83.268 -45.290 18.588   1.00 17.62 ? 3   ILE A C   1 
ATOM   23    O  O   . ILE A  1 3   ? 83.888 -44.477 19.275   1.00 19.12 ? 3   ILE A O   1 
ATOM   24    C  CB  . ILE A  1 3   ? 81.462 -45.836 20.178   1.00 19.69 ? 3   ILE A CB  1 
ATOM   25    C  CG1 . ILE A  1 3   ? 80.804 -46.916 21.039   1.00 22.69 ? 3   ILE A CG1 1 
ATOM   26    C  CG2 . ILE A  1 3   ? 80.417 -45.068 19.364   1.00 20.37 ? 3   ILE A CG2 1 
ATOM   27    C  CD1 . ILE A  1 3   ? 79.906 -46.348 22.122   1.00 23.93 ? 3   ILE A CD1 1 
ATOM   28    N  N   . PRO A  1 4   ? 83.209 -45.212 17.254   1.00 15.88 ? 4   PRO A N   1 
ATOM   29    C  CA  . PRO A  1 4   ? 83.848 -44.096 16.575   1.00 17.11 ? 4   PRO A CA  1 
ATOM   30    C  C   . PRO A  1 4   ? 83.102 -42.791 16.862   1.00 18.20 ? 4   PRO A C   1 
ATOM   31    O  O   . PRO A  1 4   ? 81.874 -42.795 17.017   1.00 17.05 ? 4   PRO A O   1 
ATOM   32    C  CB  . PRO A  1 4   ? 83.723 -44.467 15.098   1.00 16.58 ? 4   PRO A CB  1 
ATOM   33    C  CG  . PRO A  1 4   ? 82.491 -45.306 15.030   1.00 17.56 ? 4   PRO A CG  1 
ATOM   34    C  CD  . PRO A  1 4   ? 82.393 -46.036 16.341   1.00 17.51 ? 4   PRO A CD  1 
ATOM   35    N  N   . LEU A  1 5   ? 83.851 -41.696 16.940   1.00 16.93 ? 5   LEU A N   1 
ATOM   36    C  CA  . LEU A  1 5   ? 83.298 -40.374 17.216   1.00 16.00 ? 5   LEU A CA  1 
ATOM   37    C  C   . LEU A  1 5   ? 83.748 -39.424 16.123   1.00 17.57 ? 5   LEU A C   1 
ATOM   38    O  O   . LEU A  1 5   ? 84.852 -39.570 15.588   1.00 17.62 ? 5   LEU A O   1 
ATOM   39    C  CB  . LEU A  1 5   ? 83.815 -39.849 18.559   1.00 15.98 ? 5   LEU A CB  1 
ATOM   40    C  CG  . LEU A  1 5   ? 83.399 -40.539 19.862   1.00 16.33 ? 5   LEU A CG  1 
ATOM   41    C  CD1 . LEU A  1 5   ? 83.896 -39.709 21.047   1.00 16.30 ? 5   LEU A CD1 1 
ATOM   42    C  CD2 . LEU A  1 5   ? 81.884 -40.709 19.918   1.00 17.13 ? 5   LEU A CD2 1 
ATOM   43    N  N   . VAL A  1 6   ? 82.917 -38.438 15.799   1.00 14.29 ? 6   VAL A N   1 
ATOM   44    C  CA  . VAL A  1 6   ? 83.308 -37.444 14.804   1.00 16.24 ? 6   VAL A CA  1 
ATOM   45    C  C   . VAL A  1 6   ? 84.416 -36.528 15.335   1.00 17.43 ? 6   VAL A C   1 
ATOM   46    O  O   . VAL A  1 6   ? 84.261 -35.890 16.375   1.00 16.09 ? 6   VAL A O   1 
ATOM   47    C  CB  . VAL A  1 6   ? 82.116 -36.578 14.362   1.00 16.96 ? 6   VAL A CB  1 
ATOM   48    C  CG1 . VAL A  1 6   ? 82.561 -35.575 13.305   1.00 17.23 ? 6   VAL A CG1 1 
ATOM   49    C  CG2 . VAL A  1 6   ? 80.987 -37.446 13.820   1.00 16.01 ? 6   VAL A CG2 1 
ATOM   50    N  N   . GLY A  1 7   ? 85.535 -36.473 14.620   1.00 17.41 ? 7   GLY A N   1 
ATOM   51    C  CA  . GLY A  1 7   ? 86.641 -35.586 14.989   1.00 18.44 ? 7   GLY A CA  1 
ATOM   52    C  C   . GLY A  1 7   ? 87.320 -35.893 16.313   1.00 19.26 ? 7   GLY A C   1 
ATOM   53    O  O   . GLY A  1 7   ? 87.955 -35.022 16.900   1.00 21.14 ? 7   GLY A O   1 
ATOM   54    N  N   . LYS A  1 8   ? 87.182 -37.123 16.793   1.00 20.07 ? 8   LYS A N   1 
ATOM   55    C  CA  . LYS A  1 8   ? 87.819 -37.548 18.041   1.00 21.24 ? 8   LYS A CA  1 
ATOM   56    C  C   . LYS A  1 8   ? 88.248 -39.001 17.907   1.00 22.03 ? 8   LYS A C   1 
ATOM   57    O  O   . LYS A  1 8   ? 87.805 -39.694 17.000   1.00 20.71 ? 8   LYS A O   1 
ATOM   58    C  CB  . LYS A  1 8   ? 86.846 -37.449 19.221   1.00 20.45 ? 8   LYS A CB  1 
ATOM   59    C  CG  . LYS A  1 8   ? 86.521 -36.050 19.716   1.00 18.44 ? 8   LYS A CG  1 
ATOM   60    C  CD  . LYS A  1 8   ? 85.685 -36.167 20.980   1.00 20.95 ? 8   LYS A CD  1 
ATOM   61    C  CE  . LYS A  1 8   ? 85.337 -34.825 21.603   1.00 18.23 ? 8   LYS A CE  1 
ATOM   62    N  NZ  . LYS A  1 8   ? 84.554 -35.057 22.857   1.00 15.59 ? 8   LYS A NZ  1 
ATOM   63    N  N   . ASP A  1 9   ? 89.101 -39.462 18.816   1.00 22.33 ? 9   ASP A N   1 
ATOM   64    C  CA  . ASP A  1 9   ? 89.432 -40.881 18.895   1.00 24.66 ? 9   ASP A CA  1 
ATOM   65    C  C   . ASP A  1 9   ? 88.204 -41.640 19.382   1.00 23.86 ? 9   ASP A C   1 
ATOM   66    O  O   . ASP A  1 9   ? 87.376 -41.086 20.100   1.00 20.71 ? 9   ASP A O   1 
ATOM   67    C  CB  . ASP A  1 9   ? 90.595 -41.113 19.869   1.00 30.09 ? 9   ASP A CB  1 
ATOM   68    C  CG  . ASP A  1 9   ? 91.911 -40.558 19.357   1.00 32.22 ? 9   ASP A CG  1 
ATOM   69    O  OD1 . ASP A  1 9   ? 92.810 -40.313 20.185   1.00 44.68 ? 9   ASP A OD1 1 
ATOM   70    O  OD2 . ASP A  1 9   ? 92.052 -40.368 18.132   1.00 33.98 ? 9   ASP A OD2 1 
ATOM   71    N  N   . SER A  1 10  ? 88.090 -42.908 19.000   1.00 18.97 ? 10  SER A N   1 
ATOM   72    C  CA  . SER A  1 10  ? 86.957 -43.725 19.417   1.00 21.59 ? 10  SER A CA  1 
ATOM   73    C  C   . SER A  1 10  ? 86.962 -43.935 20.935   1.00 23.62 ? 10  SER A C   1 
ATOM   74    O  O   . SER A  1 10  ? 88.000 -43.821 21.582   1.00 23.96 ? 10  SER A O   1 
ATOM   75    C  CB  . SER A  1 10  ? 86.991 -45.073 18.697   1.00 20.27 ? 10  SER A CB  1 
ATOM   76    O  OG  . SER A  1 10  ? 88.158 -45.791 19.069   1.00 24.66 ? 10  SER A OG  1 
ATOM   77    N  N   . ILE A  1 11  ? 85.800 -44.233 21.504   1.00 23.49 ? 11  ILE A N   1 
ATOM   78    C  CA  . ILE A  1 11  ? 85.712 -44.466 22.938   1.00 23.34 ? 11  ILE A CA  1 
ATOM   79    C  C   . ILE A  1 11  ? 85.137 -45.840 23.228   1.00 23.34 ? 11  ILE A C   1 
ATOM   80    O  O   . ILE A  1 11  ? 84.458 -46.429 22.384   1.00 20.74 ? 11  ILE A O   1 
ATOM   81    C  CB  . ILE A  1 11  ? 84.831 -43.416 23.641   1.00 24.07 ? 11  ILE A CB  1 
ATOM   82    C  CG1 . ILE A  1 11  ? 83.447 -43.356 22.988   1.00 24.50 ? 11  ILE A CG1 1 
ATOM   83    C  CG2 . ILE A  1 11  ? 85.505 -42.053 23.628   1.00 29.87 ? 11  ILE A CG2 1 
ATOM   84    C  CD1 . ILE A  1 11  ? 82.430 -42.603 23.821   1.00 25.58 ? 11  ILE A CD1 1 
ATOM   85    N  N   . GLU A  1 12  ? 85.417 -46.354 24.420   1.00 23.66 ? 12  GLU A N   1 
ATOM   86    C  CA  . GLU A  1 12  ? 84.757 -47.565 24.879   1.00 24.67 ? 12  GLU A CA  1 
ATOM   87    C  C   . GLU A  1 12  ? 83.325 -47.203 25.247   1.00 25.56 ? 12  GLU A C   1 
ATOM   88    O  O   . GLU A  1 12  ? 83.049 -46.075 25.670   1.00 21.25 ? 12  GLU A O   1 
ATOM   89    C  CB  . GLU A  1 12  ? 85.493 -48.173 26.072   1.00 27.17 ? 12  GLU A CB  1 
ATOM   90    C  CG  . GLU A  1 12  ? 86.883 -48.703 25.743   1.00 28.87 ? 12  GLU A CG  1 
ATOM   91    C  CD  . GLU A  1 12  ? 87.588 -49.258 26.966   1.00 33.17 ? 12  GLU A CD  1 
ATOM   92    O  OE1 . GLU A  1 12  ? 87.095 -50.250 27.545   1.00 35.10 ? 12  GLU A OE1 1 
ATOM   93    O  OE2 . GLU A  1 12  ? 88.630 -48.697 27.355   1.00 33.25 ? 12  GLU A OE2 1 
ATOM   94    N  N   . SER A  1 13  ? 82.413 -48.151 25.068   1.00 24.97 ? 13  SER A N   1 
ATOM   95    C  CA  . SER A  1 13  ? 80.995 -47.895 25.304   1.00 22.55 ? 13  SER A CA  1 
ATOM   96    C  C   . SER A  1 13  ? 80.720 -47.518 26.757   1.00 25.40 ? 13  SER A C   1 
ATOM   97    O  O   . SER A  1 13  ? 79.766 -46.802 27.052   1.00 22.62 ? 13  SER A O   1 
ATOM   98    C  CB  . SER A  1 13  ? 80.159 -49.113 24.907   1.00 29.06 ? 13  SER A CB  1 
ATOM   99    O  OG  . SER A  1 13  ? 80.477 -50.232 25.718   1.00 32.04 ? 13  SER A OG  1 
ATOM   100   N  N   . LYS A  1 14  ? 81.560 -47.991 27.670   1.00 22.54 ? 14  LYS A N   1 
ATOM   101   C  CA  . LYS A  1 14  ? 81.356 -47.694 29.081   1.00 25.96 ? 14  LYS A CA  1 
ATOM   102   C  C   . LYS A  1 14  ? 81.564 -46.208 29.364   1.00 24.10 ? 14  LYS A C   1 
ATOM   103   O  O   . LYS A  1 14  ? 81.137 -45.706 30.396   1.00 24.78 ? 14  LYS A O   1 
ATOM   104   C  CB  . LYS A  1 14  ? 82.287 -48.539 29.960   1.00 23.52 ? 14  LYS A CB  1 
ATOM   105   C  CG  . LYS A  1 14  ? 83.756 -48.150 29.868   1.00 26.33 ? 14  LYS A CG  1 
ATOM   106   C  CD  . LYS A  1 14  ? 84.627 -49.138 30.633   1.00 30.07 ? 14  LYS A CD  1 
ATOM   107   C  CE  . LYS A  1 14  ? 85.938 -48.503 31.064   1.00 38.37 ? 14  LYS A CE  1 
ATOM   108   N  NZ  . LYS A  1 14  ? 86.655 -47.891 29.912   1.00 39.03 ? 14  LYS A NZ  1 
ATOM   109   N  N   . ASP A  1 15  ? 82.220 -45.505 28.447   1.00 20.42 ? 15  ASP A N   1 
ATOM   110   C  CA  . ASP A  1 15  ? 82.515 -44.085 28.650   1.00 22.55 ? 15  ASP A CA  1 
ATOM   111   C  C   . ASP A  1 15  ? 81.576 -43.153 27.890   1.00 21.09 ? 15  ASP A C   1 
ATOM   112   O  O   . ASP A  1 15  ? 81.814 -41.948 27.819   1.00 23.72 ? 15  ASP A O   1 
ATOM   113   C  CB  . ASP A  1 15  ? 83.951 -43.787 28.239   1.00 20.85 ? 15  ASP A CB  1 
ATOM   114   C  CG  . ASP A  1 15  ? 84.956 -44.419 29.172   1.00 27.75 ? 15  ASP A CG  1 
ATOM   115   O  OD1 . ASP A  1 15  ? 84.691 -44.440 30.390   1.00 26.58 ? 15  ASP A OD1 1 
ATOM   116   O  OD2 . ASP A  1 15  ? 85.997 -44.900 28.688   1.00 25.12 ? 15  ASP A OD2 1 
ATOM   117   N  N   . ILE A  1 16  ? 80.515 -43.706 27.322   1.00 20.56 ? 16  ILE A N   1 
ATOM   118   C  CA  A ILE A  1 16  ? 79.573 -42.917 26.531   0.50 19.32 ? 16  ILE A CA  1 
ATOM   119   C  CA  B ILE A  1 16  ? 79.582 -42.908 26.532   0.50 21.06 ? 16  ILE A CA  1 
ATOM   120   C  C   . ILE A  1 16  ? 78.848 -41.875 27.384   1.00 17.97 ? 16  ILE A C   1 
ATOM   121   O  O   . ILE A  1 16  ? 78.508 -40.792 26.902   1.00 18.30 ? 16  ILE A O   1 
ATOM   122   C  CB  A ILE A  1 16  ? 78.546 -43.822 25.818   0.50 19.28 ? 16  ILE A CB  1 
ATOM   123   C  CB  B ILE A  1 16  ? 78.578 -43.792 25.760   0.50 23.46 ? 16  ILE A CB  1 
ATOM   124   C  CG1 A ILE A  1 16  ? 77.884 -43.088 24.653   0.50 17.24 ? 16  ILE A CG1 1 
ATOM   125   C  CG1 B ILE A  1 16  ? 77.831 -44.743 26.704   0.50 27.15 ? 16  ILE A CG1 1 
ATOM   126   C  CG2 A ILE A  1 16  ? 77.485 -44.319 26.789   0.50 22.84 ? 16  ILE A CG2 1 
ATOM   127   C  CG2 B ILE A  1 16  ? 79.301 -44.593 24.688   0.50 26.80 ? 16  ILE A CG2 1 
ATOM   128   C  CD1 A ILE A  1 16  ? 77.010 -43.988 23.809   0.50 14.89 ? 16  ILE A CD1 1 
ATOM   129   C  CD1 B ILE A  1 16  ? 76.731 -44.096 27.521   0.50 25.27 ? 16  ILE A CD1 1 
ATOM   130   N  N   . GLY A  1 17  ? 78.613 -42.203 28.652   1.00 17.24 ? 17  GLY A N   1 
ATOM   131   C  CA  . GLY A  1 17  ? 77.954 -41.277 29.581   1.00 15.50 ? 17  GLY A CA  1 
ATOM   132   C  C   . GLY A  1 17  ? 76.532 -40.908 29.177   1.00 17.02 ? 17  GLY A C   1 
ATOM   133   O  O   . GLY A  1 17  ? 75.897 -41.602 28.383   1.00 15.28 ? 17  GLY A O   1 
ATOM   134   N  N   . PHE A  1 18  ? 76.017 -39.817 29.738   1.00 14.66 ? 18  PHE A N   1 
ATOM   135   C  CA  . PHE A  1 18  ? 74.659 -39.390 29.432   1.00 13.87 ? 18  PHE A CA  1 
ATOM   136   C  C   . PHE A  1 18  ? 74.512 -39.076 27.942   1.00 14.07 ? 18  PHE A C   1 
ATOM   137   O  O   . PHE A  1 18  ? 75.179 -38.185 27.401   1.00 14.12 ? 18  PHE A O   1 
ATOM   138   C  CB  . PHE A  1 18  ? 74.267 -38.180 30.285   1.00 14.70 ? 18  PHE A CB  1 
ATOM   139   C  CG  . PHE A  1 18  ? 72.791 -37.894 30.281   1.00 15.57 ? 18  PHE A CG  1 
ATOM   140   C  CD1 . PHE A  1 18  ? 72.031 -38.094 31.426   1.00 16.78 ? 18  PHE A CD1 1 
ATOM   141   C  CD2 . PHE A  1 18  ? 72.163 -37.443 29.135   1.00 15.51 ? 18  PHE A CD2 1 
ATOM   142   C  CE1 . PHE A  1 18  ? 70.671 -37.834 31.428   1.00 13.58 ? 18  PHE A CE1 1 
ATOM   143   C  CE2 . PHE A  1 18  ? 70.802 -37.179 29.130   1.00 14.78 ? 18  PHE A CE2 1 
ATOM   144   C  CZ  . PHE A  1 18  ? 70.059 -37.380 30.279   1.00 13.35 ? 18  PHE A CZ  1 
ATOM   145   N  N   . THR A  1 19  ? 73.609 -39.798 27.289   1.00 14.67 ? 19  THR A N   1 
ATOM   146   C  CA  . THR A  1 19  ? 73.507 -39.767 25.839   1.00 14.39 ? 19  THR A CA  1 
ATOM   147   C  C   . THR A  1 19  ? 72.121 -39.380 25.352   1.00 15.67 ? 19  THR A C   1 
ATOM   148   O  O   . THR A  1 19  ? 71.106 -39.843 25.890   1.00 17.45 ? 19  THR A O   1 
ATOM   149   C  CB  . THR A  1 19  ? 73.845 -41.156 25.261   1.00 16.70 ? 19  THR A CB  1 
ATOM   150   O  OG1 . THR A  1 19  ? 75.182 -41.503 25.631   1.00 16.76 ? 19  THR A OG1 1 
ATOM   151   C  CG2 . THR A  1 19  ? 73.715 -41.177 23.736   1.00 15.56 ? 19  THR A CG2 1 
ATOM   152   N  N   . LEU A  1 20  ? 72.082 -38.525 24.331   1.00 14.48 ? 20  LEU A N   1 
ATOM   153   C  CA  . LEU A  1 20  ? 70.857 -38.330 23.558   1.00 12.98 ? 20  LEU A CA  1 
ATOM   154   C  C   . LEU A  1 20  ? 70.959 -39.178 22.291   1.00 12.65 ? 20  LEU A C   1 
ATOM   155   O  O   . LEU A  1 20  ? 71.773 -38.900 21.416   1.00 13.73 ? 20  LEU A O   1 
ATOM   156   C  CB  . LEU A  1 20  ? 70.634 -36.849 23.229   1.00 13.99 ? 20  LEU A CB  1 
ATOM   157   C  CG  . LEU A  1 20  ? 70.270 -35.942 24.411   1.00 17.29 ? 20  LEU A CG  1 
ATOM   158   C  CD1 . LEU A  1 20  ? 70.130 -34.483 23.976   1.00 16.52 ? 20  LEU A CD1 1 
ATOM   159   C  CD2 . LEU A  1 20  ? 68.976 -36.415 25.058   1.00 18.55 ? 20  LEU A CD2 1 
ATOM   160   N  N   . ILE A  1 21  ? 70.115 -40.204 22.197   1.00 12.91 ? 21  ILE A N   1 
ATOM   161   C  CA  . ILE A  1 21  ? 70.269 -41.272 21.206   1.00 12.02 ? 21  ILE A CA  1 
ATOM   162   C  C   . ILE A  1 21  ? 69.778 -40.923 19.797   1.00 14.09 ? 21  ILE A C   1 
ATOM   163   O  O   . ILE A  1 21  ? 70.080 -41.634 18.845   1.00 13.02 ? 21  ILE A O   1 
ATOM   164   C  CB  . ILE A  1 21  ? 69.548 -42.558 21.680   1.00 15.86 ? 21  ILE A CB  1 
ATOM   165   C  CG1 . ILE A  1 21  ? 70.008 -43.791 20.881   1.00 16.97 ? 21  ILE A CG1 1 
ATOM   166   C  CG2 . ILE A  1 21  ? 68.043 -42.399 21.582   1.00 13.64 ? 21  ILE A CG2 1 
ATOM   167   C  CD1 . ILE A  1 21  ? 71.410 -44.251 21.221   1.00 18.95 ? 21  ILE A CD1 1 
ATOM   168   N  N   . HIS A  1 22  ? 69.017 -39.839 19.656   1.00 13.42 ? 22  HIS A N   1 
ATOM   169   C  CA  . HIS A  1 22  ? 68.457 -39.486 18.352   1.00 12.77 ? 22  HIS A CA  1 
ATOM   170   C  C   . HIS A  1 22  ? 68.219 -38.001 18.265   1.00 14.78 ? 22  HIS A C   1 
ATOM   171   O  O   . HIS A  1 22  ? 67.143 -37.507 18.635   1.00 14.25 ? 22  HIS A O   1 
ATOM   172   C  CB  . HIS A  1 22  ? 67.156 -40.260 18.099   1.00 14.54 ? 22  HIS A CB  1 
ATOM   173   C  CG  . HIS A  1 22  ? 66.621 -40.137 16.675   1.00 15.25 ? 22  HIS A CG  1 
ATOM   174   N  ND1 . HIS A  1 22  ? 66.116 -41.192 15.995   1.00 15.77 ? 22  HIS A ND1 1 
ATOM   175   C  CD2 . HIS A  1 22  ? 66.515 -39.029 15.819   1.00 15.82 ? 22  HIS A CD2 1 
ATOM   176   C  CE1 . HIS A  1 22  ? 65.717 -40.793 14.765   1.00 16.30 ? 22  HIS A CE1 1 
ATOM   177   N  NE2 . HIS A  1 22  ? 65.957 -39.465 14.655   1.00 16.13 ? 22  HIS A NE2 1 
ATOM   178   N  N   . GLU A  1 23  ? 69.233 -37.268 17.799   1.00 15.39 ? 23  GLU A N   1 
ATOM   179   C  CA  . GLU A  1 23  ? 69.113 -35.823 17.564   1.00 14.26 ? 23  GLU A CA  1 
ATOM   180   C  C   . GLU A  1 23  ? 69.803 -35.464 16.251   1.00 14.56 ? 23  GLU A C   1 
ATOM   181   O  O   . GLU A  1 23  ? 70.767 -36.116 15.854   1.00 15.92 ? 23  GLU A O   1 
ATOM   182   C  CB  . GLU A  1 23  ? 69.763 -35.024 18.695   1.00 15.25 ? 23  GLU A CB  1 
ATOM   183   C  CG  . GLU A  1 23  ? 69.348 -35.428 20.105   1.00 15.11 ? 23  GLU A CG  1 
ATOM   184   C  CD  . GLU A  1 23  ? 67.911 -35.087 20.432   1.00 15.70 ? 23  GLU A CD  1 
ATOM   185   O  OE1 . GLU A  1 23  ? 67.365 -35.701 21.381   1.00 17.23 ? 23  GLU A OE1 1 
ATOM   186   O  OE2 . GLU A  1 23  ? 67.320 -34.220 19.743   1.00 15.33 ? 23  GLU A OE2 1 
ATOM   187   N  N   . HIS A  1 24  ? 69.331 -34.414 15.589   1.00 13.81 ? 24  HIS A N   1 
ATOM   188   C  CA  . HIS A  1 24  ? 69.917 -34.004 14.311   1.00 12.92 ? 24  HIS A CA  1 
ATOM   189   C  C   . HIS A  1 24  ? 70.523 -32.627 14.403   1.00 15.71 ? 24  HIS A C   1 
ATOM   190   O  O   . HIS A  1 24  ? 69.848 -31.657 14.770   1.00 15.93 ? 24  HIS A O   1 
ATOM   191   C  CB  . HIS A  1 24  ? 68.854 -34.007 13.212   1.00 12.82 ? 24  HIS A CB  1 
ATOM   192   C  CG  . HIS A  1 24  ? 68.214 -35.356 12.956   1.00 11.96 ? 24  HIS A CG  1 
ATOM   193   N  ND1 . HIS A  1 24  ? 68.746 -36.261 12.108   1.00 11.50 ? 24  HIS A ND1 1 
ATOM   194   C  CD2 . HIS A  1 24  ? 67.024 -35.917 13.432   1.00 12.26 ? 24  HIS A CD2 1 
ATOM   195   C  CE1 . HIS A  1 24  ? 67.944 -37.348 12.052   1.00 11.76 ? 24  HIS A CE1 1 
ATOM   196   N  NE2 . HIS A  1 24  ? 66.895 -37.140 12.866   1.00 11.37 ? 24  HIS A NE2 1 
ATOM   197   N  N   . LEU A  1 25  ? 71.802 -32.514 14.066   1.00 15.40 ? 25  LEU A N   1 
ATOM   198   C  CA  . LEU A  1 25  ? 72.441 -31.200 14.000   1.00 16.79 ? 25  LEU A CA  1 
ATOM   199   C  C   . LEU A  1 25  ? 71.872 -30.377 12.843   1.00 16.21 ? 25  LEU A C   1 
ATOM   200   O  O   . LEU A  1 25  ? 71.678 -29.168 12.954   1.00 16.23 ? 25  LEU A O   1 
ATOM   201   C  CB  . LEU A  1 25  ? 73.954 -31.350 13.844   1.00 16.19 ? 25  LEU A CB  1 
ATOM   202   C  CG  . LEU A  1 25  ? 74.668 -32.028 15.018   1.00 17.60 ? 25  LEU A CG  1 
ATOM   203   C  CD1 . LEU A  1 25  ? 76.173 -32.053 14.786   1.00 18.63 ? 25  LEU A CD1 1 
ATOM   204   C  CD2 . LEU A  1 25  ? 74.328 -31.323 16.324   1.00 15.71 ? 25  LEU A CD2 1 
ATOM   205   N  N   . ARG A  1 26  ? 71.602 -31.038 11.726   1.00 14.69 ? 26  ARG A N   1 
ATOM   206   C  CA  . ARG A  1 26  ? 71.076 -30.349 10.557   1.00 16.42 ? 26  ARG A CA  1 
ATOM   207   C  C   . ARG A  1 26  ? 70.490 -31.367 9.599    1.00 16.33 ? 26  ARG A C   1 
ATOM   208   O  O   . ARG A  1 26  ? 71.102 -32.397 9.340    1.00 17.27 ? 26  ARG A O   1 
ATOM   209   C  CB  . ARG A  1 26  ? 72.178 -29.556 9.844    1.00 16.77 ? 26  ARG A CB  1 
ATOM   210   C  CG  . ARG A  1 26  ? 71.678 -28.789 8.622    1.00 17.27 ? 26  ARG A CG  1 
ATOM   211   C  CD  . ARG A  1 26  ? 72.787 -27.996 7.949    1.00 18.38 ? 26  ARG A CD  1 
ATOM   212   N  NE  . ARG A  1 26  ? 73.854 -28.860 7.445    1.00 15.20 ? 26  ARG A NE  1 
ATOM   213   C  CZ  . ARG A  1 26  ? 74.926 -28.417 6.791    1.00 19.43 ? 26  ARG A CZ  1 
ATOM   214   N  NH1 . ARG A  1 26  ? 75.855 -29.267 6.370    1.00 14.96 ? 26  ARG A NH1 1 
ATOM   215   N  NH2 . ARG A  1 26  ? 75.068 -27.119 6.557    1.00 16.41 ? 26  ARG A NH2 1 
ATOM   216   N  N   . VAL A  1 27  ? 69.306 -31.073 9.079    1.00 14.80 ? 27  VAL A N   1 
ATOM   217   C  CA  . VAL A  1 27  ? 68.661 -31.934 8.091    1.00 13.88 ? 27  VAL A CA  1 
ATOM   218   C  C   . VAL A  1 27  ? 68.335 -31.114 6.838    1.00 17.83 ? 27  VAL A C   1 
ATOM   219   O  O   . VAL A  1 27  ? 67.873 -29.970 6.938    1.00 16.51 ? 27  VAL A O   1 
ATOM   220   C  CB  . VAL A  1 27  ? 67.375 -32.574 8.668    1.00 16.47 ? 27  VAL A CB  1 
ATOM   221   C  CG1 . VAL A  1 27  ? 66.547 -33.211 7.564    1.00 15.65 ? 27  VAL A CG1 1 
ATOM   222   C  CG2 . VAL A  1 27  ? 67.726 -33.613 9.733    1.00 14.97 ? 27  VAL A CG2 1 
ATOM   223   N  N   . PHE A  1 28  ? 68.620 -31.677 5.663    1.00 15.07 ? 28  PHE A N   1 
ATOM   224   C  CA  . PHE A  1 28  ? 68.218 -31.055 4.400    1.00 13.83 ? 28  PHE A CA  1 
ATOM   225   C  C   . PHE A  1 28  ? 68.108 -32.099 3.292    1.00 15.16 ? 28  PHE A C   1 
ATOM   226   O  O   . PHE A  1 28  ? 68.651 -33.203 3.409    1.00 12.24 ? 28  PHE A O   1 
ATOM   227   C  CB  . PHE A  1 28  ? 69.172 -29.912 3.989    1.00 12.90 ? 28  PHE A CB  1 
ATOM   228   C  CG  . PHE A  1 28  ? 70.581 -30.354 3.704    1.00 13.43 ? 28  PHE A CG  1 
ATOM   229   C  CD1 . PHE A  1 28  ? 70.926 -30.881 2.476    1.00 14.55 ? 28  PHE A CD1 1 
ATOM   230   C  CD2 . PHE A  1 28  ? 71.571 -30.224 4.671    1.00 16.81 ? 28  PHE A CD2 1 
ATOM   231   C  CE1 . PHE A  1 28  ? 72.228 -31.287 2.212    1.00 15.94 ? 28  PHE A CE1 1 
ATOM   232   C  CE2 . PHE A  1 28  ? 72.873 -30.621 4.417    1.00 14.76 ? 28  PHE A CE2 1 
ATOM   233   C  CZ  . PHE A  1 28  ? 73.203 -31.153 3.184    1.00 17.15 ? 28  PHE A CZ  1 
ATOM   234   N  N   . SER A  1 29  ? 67.386 -31.752 2.230    1.00 14.52 ? 29  SER A N   1 
ATOM   235   C  CA  . SER A  1 29  ? 67.282 -32.608 1.056    1.00 15.68 ? 29  SER A CA  1 
ATOM   236   C  C   . SER A  1 29  ? 68.488 -32.357 0.161    1.00 14.80 ? 29  SER A C   1 
ATOM   237   O  O   . SER A  1 29  ? 68.668 -31.247 -0.344   1.00 13.94 ? 29  SER A O   1 
ATOM   238   C  CB  . SER A  1 29  ? 66.009 -32.287 0.267    1.00 17.73 ? 29  SER A CB  1 
ATOM   239   O  OG  . SER A  1 29  ? 64.838 -32.624 0.989    1.00 19.70 ? 29  SER A OG  1 
ATOM   240   N  N   . GLU A  1 30  ? 69.298 -33.392 -0.045   1.00 15.24 ? 30  GLU A N   1 
ATOM   241   C  CA  . GLU A  1 30  ? 70.560 -33.259 -0.775   1.00 15.64 ? 30  GLU A CA  1 
ATOM   242   C  C   . GLU A  1 30  ? 70.389 -32.594 -2.137   1.00 16.30 ? 30  GLU A C   1 
ATOM   243   O  O   . GLU A  1 30  ? 71.151 -31.698 -2.498   1.00 15.18 ? 30  GLU A O   1 
ATOM   244   C  CB  . GLU A  1 30  ? 71.228 -34.627 -0.968   1.00 16.02 ? 30  GLU A CB  1 
ATOM   245   C  CG  . GLU A  1 30  ? 71.922 -35.188 0.265    1.00 18.31 ? 30  GLU A CG  1 
ATOM   246   C  CD  . GLU A  1 30  ? 71.043 -36.130 1.072    1.00 18.69 ? 30  GLU A CD  1 
ATOM   247   O  OE1 . GLU A  1 30  ? 69.804 -36.022 0.987    1.00 18.58 ? 30  GLU A OE1 1 
ATOM   248   O  OE2 . GLU A  1 30  ? 71.598 -36.976 1.803    1.00 18.85 ? 30  GLU A OE2 1 
ATOM   249   N  N   . ALA A  1 31  ? 69.403 -33.047 -2.903   1.00 14.13 ? 31  ALA A N   1 
ATOM   250   C  CA  . ALA A  1 31  ? 69.237 -32.553 -4.267   1.00 16.24 ? 31  ALA A CA  1 
ATOM   251   C  C   . ALA A  1 31  ? 68.813 -31.100 -4.280   1.00 15.23 ? 31  ALA A C   1 
ATOM   252   O  O   . ALA A  1 31  ? 69.227 -30.333 -5.155   1.00 14.98 ? 31  ALA A O   1 
ATOM   253   C  CB  . ALA A  1 31  ? 68.233 -33.402 -5.042   1.00 16.63 ? 31  ALA A CB  1 
ATOM   254   N  N   . VAL A  1 32  ? 67.984 -30.716 -3.316   1.00 13.99 ? 32  VAL A N   1 
ATOM   255   C  CA  . VAL A  1 32  ? 67.519 -29.331 -3.254   1.00 14.90 ? 32  VAL A CA  1 
ATOM   256   C  C   . VAL A  1 32  ? 68.672 -28.379 -2.926   1.00 15.15 ? 32  VAL A C   1 
ATOM   257   O  O   . VAL A  1 32  ? 68.824 -27.325 -3.551   1.00 14.68 ? 32  VAL A O   1 
ATOM   258   C  CB  . VAL A  1 32  ? 66.383 -29.147 -2.227   1.00 13.89 ? 32  VAL A CB  1 
ATOM   259   C  CG1 . VAL A  1 32  ? 65.930 -27.685 -2.199   1.00 13.96 ? 32  VAL A CG1 1 
ATOM   260   C  CG2 . VAL A  1 32  ? 65.220 -30.074 -2.555   1.00 14.39 ? 32  VAL A CG2 1 
ATOM   261   N  N   . ARG A  1 33  ? 69.487 -28.747 -1.942   1.00 16.60 ? 33  ARG A N   1 
ATOM   262   C  CA  . ARG A  1 33  ? 70.588 -27.878 -1.538   1.00 16.72 ? 33  ARG A CA  1 
ATOM   263   C  C   . ARG A  1 33  ? 71.625 -27.767 -2.647   1.00 17.28 ? 33  ARG A C   1 
ATOM   264   O  O   . ARG A  1 33  ? 72.188 -26.697 -2.882   1.00 16.57 ? 33  ARG A O   1 
ATOM   265   C  CB  . ARG A  1 33  ? 71.252 -28.377 -0.257   1.00 16.25 ? 33  ARG A CB  1 
ATOM   266   C  CG  . ARG A  1 33  ? 72.316 -27.422 0.254    1.00 19.40 ? 33  ARG A CG  1 
ATOM   267   C  CD  . ARG A  1 33  ? 72.787 -27.805 1.646    1.00 26.46 ? 33  ARG A CD  1 
ATOM   268   N  NE  . ARG A  1 33  ? 73.555 -26.726 2.257    1.00 24.13 ? 33  ARG A NE  1 
ATOM   269   C  CZ  . ARG A  1 33  ? 73.288 -26.206 3.448    1.00 22.57 ? 33  ARG A CZ  1 
ATOM   270   N  NH1 . ARG A  1 33  ? 72.278 -26.679 4.173    1.00 18.55 ? 33  ARG A NH1 1 
ATOM   271   N  NH2 . ARG A  1 33  ? 74.043 -25.226 3.921    1.00 20.68 ? 33  ARG A NH2 1 
ATOM   272   N  N   . GLN A  1 34  ? 71.879 -28.880 -3.328   1.00 17.86 ? 34  GLN A N   1 
ATOM   273   C  CA  . GLN A  1 34  ? 72.831 -28.882 -4.435   1.00 18.98 ? 34  GLN A CA  1 
ATOM   274   C  C   . GLN A  1 34  ? 72.362 -27.981 -5.584   1.00 17.98 ? 34  GLN A C   1 
ATOM   275   O  O   . GLN A  1 34  ? 73.167 -27.274 -6.198   1.00 17.42 ? 34  GLN A O   1 
ATOM   276   C  CB  . GLN A  1 34  ? 73.056 -30.315 -4.925   1.00 22.01 ? 34  GLN A CB  1 
ATOM   277   C  CG  . GLN A  1 34  ? 74.152 -30.454 -5.964   1.00 33.23 ? 34  GLN A CG  1 
ATOM   278   C  CD  . GLN A  1 34  ? 74.599 -31.894 -6.132   1.00 29.93 ? 34  GLN A CD  1 
ATOM   279   O  OE1 . GLN A  1 34  ? 74.398 -32.728 -5.245   1.00 27.87 ? 34  GLN A OE1 1 
ATOM   280   N  NE2 . GLN A  1 34  ? 75.204 -32.192 -7.269   1.00 36.98 ? 34  GLN A NE2 1 
ATOM   281   N  N   . GLN A  1 35  ? 71.061 -27.995 -5.863   1.00 15.81 ? 35  GLN A N   1 
ATOM   282   C  CA  . GLN A  1 35  ? 70.518 -27.274 -7.020   1.00 16.35 ? 35  GLN A CA  1 
ATOM   283   C  C   . GLN A  1 35  ? 70.167 -25.818 -6.740   1.00 16.32 ? 35  GLN A C   1 
ATOM   284   O  O   . GLN A  1 35  ? 70.230 -24.972 -7.643   1.00 17.72 ? 35  GLN A O   1 
ATOM   285   C  CB  . GLN A  1 35  ? 69.295 -28.004 -7.594   1.00 16.81 ? 35  GLN A CB  1 
ATOM   286   C  CG  . GLN A  1 35  ? 69.597 -29.396 -8.135   1.00 17.86 ? 35  GLN A CG  1 
ATOM   287   C  CD  . GLN A  1 35  ? 70.719 -29.397 -9.157   1.00 18.94 ? 35  GLN A CD  1 
ATOM   288   O  OE1 . GLN A  1 35  ? 70.981 -28.386 -9.813   1.00 16.61 ? 35  GLN A OE1 1 
ATOM   289   N  NE2 . GLN A  1 35  ? 71.390 -30.541 -9.298   1.00 17.86 ? 35  GLN A NE2 1 
ATOM   290   N  N   . TRP A  1 36  ? 69.785 -25.528 -5.499   1.00 15.64 ? 36  TRP A N   1 
ATOM   291   C  CA  . TRP A  1 36  ? 69.403 -24.174 -5.104   1.00 16.87 ? 36  TRP A CA  1 
ATOM   292   C  C   . TRP A  1 36  ? 70.045 -23.758 -3.806   1.00 17.95 ? 36  TRP A C   1 
ATOM   293   O  O   . TRP A  1 36  ? 69.370 -23.645 -2.785   1.00 15.00 ? 36  TRP A O   1 
ATOM   294   C  CB  . TRP A  1 36  ? 67.882 -24.037 -5.032   1.00 16.38 ? 36  TRP A CB  1 
ATOM   295   C  CG  . TRP A  1 36  ? 67.237 -24.275 -6.374   1.00 16.89 ? 36  TRP A CG  1 
ATOM   296   C  CD1 . TRP A  1 36  ? 67.237 -23.421 -7.473   1.00 15.39 ? 36  TRP A CD1 1 
ATOM   297   C  CD2 . TRP A  1 36  ? 66.514 -25.481 -6.823   1.00 16.29 ? 36  TRP A CD2 1 
ATOM   298   N  NE1 . TRP A  1 36  ? 66.568 -23.986 -8.526   1.00 17.20 ? 36  TRP A NE1 1 
ATOM   299   C  CE2 . TRP A  1 36  ? 66.112 -25.225 -8.201   1.00 16.31 ? 36  TRP A CE2 1 
ATOM   300   C  CE3 . TRP A  1 36  ? 66.159 -26.689 -6.229   1.00 17.43 ? 36  TRP A CE3 1 
ATOM   301   C  CZ2 . TRP A  1 36  ? 65.392 -26.150 -8.939   1.00 16.96 ? 36  TRP A CZ2 1 
ATOM   302   C  CZ3 . TRP A  1 36  ? 65.437 -27.619 -6.988   1.00 16.34 ? 36  TRP A CZ3 1 
ATOM   303   C  CH2 . TRP A  1 36  ? 65.067 -27.353 -8.311   1.00 15.31 ? 36  TRP A CH2 1 
ATOM   304   N  N   . PRO A  1 37  ? 71.369 -23.519 -3.836   1.00 17.92 ? 37  PRO A N   1 
ATOM   305   C  CA  . PRO A  1 37  ? 72.114 -23.107 -2.648   1.00 19.23 ? 37  PRO A CA  1 
ATOM   306   C  C   . PRO A  1 37  ? 71.584 -21.823 -2.024   1.00 19.90 ? 37  PRO A C   1 
ATOM   307   O  O   . PRO A  1 37  ? 71.785 -21.611 -0.830   1.00 18.67 ? 37  PRO A O   1 
ATOM   308   C  CB  . PRO A  1 37  ? 73.541 -22.887 -3.173   1.00 18.32 ? 37  PRO A CB  1 
ATOM   309   C  CG  . PRO A  1 37  ? 73.422 -22.858 -4.667   1.00 18.38 ? 37  PRO A CG  1 
ATOM   310   C  CD  . PRO A  1 37  ? 72.257 -23.746 -4.984   1.00 16.64 ? 37  PRO A CD  1 
ATOM   311   N  N   . HIS A  1 38  ? 70.918 -20.983 -2.817   1.00 18.50 ? 38  HIS A N   1 
ATOM   312   C  CA  . HIS A  1 38  ? 70.413 -19.698 -2.314   1.00 21.19 ? 38  HIS A CA  1 
ATOM   313   C  C   . HIS A  1 38  ? 69.407 -19.858 -1.213   1.00 19.27 ? 38  HIS A C   1 
ATOM   314   O  O   . HIS A  1 38  ? 69.162 -18.926 -0.460   1.00 20.80 ? 38  HIS A O   1 
ATOM   315   C  CB  . HIS A  1 38  ? 69.850 -18.820 -3.441   1.00 22.07 ? 38  HIS A CB  1 
ATOM   316   C  CG  . HIS A  1 38  ? 68.469 -19.224 -3.912   1.00 21.71 ? 38  HIS A CG  1 
ATOM   317   N  ND1 . HIS A  1 38  ? 68.272 -20.150 -4.872   1.00 20.39 ? 38  HIS A ND1 1 
ATOM   318   C  CD2 . HIS A  1 38  ? 67.205 -18.773 -3.535   1.00 23.21 ? 38  HIS A CD2 1 
ATOM   319   C  CE1 . HIS A  1 38  ? 66.950 -20.296 -5.089   1.00 20.55 ? 38  HIS A CE1 1 
ATOM   320   N  NE2 . HIS A  1 38  ? 66.297 -19.454 -4.269   1.00 23.13 ? 38  HIS A NE2 1 
ATOM   321   N  N   . LEU A  1 39  ? 68.814 -21.039 -1.099   1.00 17.39 ? 39  LEU A N   1 
ATOM   322   C  CA  . LEU A  1 39  ? 67.809 -21.284 -0.068   1.00 18.68 ? 39  LEU A CA  1 
ATOM   323   C  C   . LEU A  1 39  ? 68.404 -21.530 1.322    1.00 21.26 ? 39  LEU A C   1 
ATOM   324   O  O   . LEU A  1 39  ? 67.674 -21.569 2.314    1.00 22.90 ? 39  LEU A O   1 
ATOM   325   C  CB  . LEU A  1 39  ? 66.948 -22.490 -0.443   1.00 17.39 ? 39  LEU A CB  1 
ATOM   326   C  CG  . LEU A  1 39  ? 66.155 -22.428 -1.748   1.00 18.14 ? 39  LEU A CG  1 
ATOM   327   C  CD1 . LEU A  1 39  ? 65.634 -23.825 -2.085   1.00 18.38 ? 39  LEU A CD1 1 
ATOM   328   C  CD2 . LEU A  1 39  ? 65.022 -21.413 -1.637   1.00 18.63 ? 39  LEU A CD2 1 
ATOM   329   N  N   . TYR A  1 40  ? 69.716 -21.721 1.394    1.00 20.02 ? 40  TYR A N   1 
ATOM   330   C  CA  . TYR A  1 40  ? 70.342 -22.168 2.641    1.00 20.71 ? 40  TYR A CA  1 
ATOM   331   C  C   . TYR A  1 40  ? 71.323 -21.146 3.189    1.00 24.11 ? 40  TYR A C   1 
ATOM   332   O  O   . TYR A  1 40  ? 71.857 -20.335 2.443    1.00 21.85 ? 40  TYR A O   1 
ATOM   333   C  CB  . TYR A  1 40  ? 71.036 -23.512 2.425    1.00 17.79 ? 40  TYR A CB  1 
ATOM   334   C  CG  . TYR A  1 40  ? 70.069 -24.605 2.023    1.00 17.63 ? 40  TYR A CG  1 
ATOM   335   C  CD1 . TYR A  1 40  ? 69.738 -24.817 0.687    1.00 18.06 ? 40  TYR A CD1 1 
ATOM   336   C  CD2 . TYR A  1 40  ? 69.474 -25.414 2.983    1.00 18.53 ? 40  TYR A CD2 1 
ATOM   337   C  CE1 . TYR A  1 40  ? 68.842 -25.812 0.319    1.00 16.08 ? 40  TYR A CE1 1 
ATOM   338   C  CE2 . TYR A  1 40  ? 68.583 -26.410 2.628    1.00 18.52 ? 40  TYR A CE2 1 
ATOM   339   C  CZ  . TYR A  1 40  ? 68.271 -26.606 1.295    1.00 19.77 ? 40  TYR A CZ  1 
ATOM   340   O  OH  . TYR A  1 40  ? 67.377 -27.598 0.949    1.00 18.98 ? 40  TYR A OH  1 
ATOM   341   N  N   . ASN A  1 41  ? 71.548 -21.190 4.500    1.00 23.43 ? 41  ASN A N   1 
ATOM   342   C  CA  . ASN A  1 41  ? 72.491 -20.287 5.165    1.00 24.42 ? 41  ASN A CA  1 
ATOM   343   C  C   . ASN A  1 41  ? 73.329 -21.078 6.162    1.00 24.27 ? 41  ASN A C   1 
ATOM   344   O  O   . ASN A  1 41  ? 72.885 -21.327 7.284    1.00 22.28 ? 41  ASN A O   1 
ATOM   345   C  CB  . ASN A  1 41  ? 71.723 -19.181 5.892    1.00 28.71 ? 41  ASN A CB  1 
ATOM   346   C  CG  . ASN A  1 41  ? 72.634 -18.174 6.572    1.00 28.97 ? 41  ASN A CG  1 
ATOM   347   O  OD1 . ASN A  1 41  ? 73.765 -18.483 6.958    1.00 28.78 ? 41  ASN A OD1 1 
ATOM   348   N  ND2 . ASN A  1 41  ? 72.136 -16.960 6.729    1.00 35.79 ? 41  ASN A ND2 1 
ATOM   349   N  N   . GLU A  1 42  ? 74.526 -21.488 5.753    1.00 22.89 ? 42  GLU A N   1 
ATOM   350   C  CA  . GLU A  1 42  ? 75.334 -22.370 6.587    1.00 26.14 ? 42  GLU A CA  1 
ATOM   351   C  C   . GLU A  1 42  ? 75.797 -21.721 7.887    1.00 27.72 ? 42  GLU A C   1 
ATOM   352   O  O   . GLU A  1 42  ? 75.951 -22.410 8.892    1.00 23.85 ? 42  GLU A O   1 
ATOM   353   C  CB  . GLU A  1 42  ? 76.529 -22.946 5.818    1.00 33.30 ? 42  GLU A CB  1 
ATOM   354   C  CG  . GLU A  1 42  ? 77.532 -23.643 6.730    1.00 48.43 ? 42  GLU A CG  1 
ATOM   355   C  CD  . GLU A  1 42  ? 78.154 -24.882 6.114    1.00 59.04 ? 42  GLU A CD  1 
ATOM   356   O  OE1 . GLU A  1 42  ? 77.618 -25.386 5.104    1.00 75.67 ? 42  GLU A OE1 1 
ATOM   357   O  OE2 . GLU A  1 42  ? 79.178 -25.362 6.652    1.00 61.08 ? 42  GLU A OE2 1 
ATOM   358   N  N   . ASP A  1 43  ? 76.019 -20.406 7.866    1.00 28.46 ? 43  ASP A N   1 
ATOM   359   C  CA  . ASP A  1 43  ? 76.391 -19.676 9.083    1.00 27.19 ? 43  ASP A CA  1 
ATOM   360   C  C   . ASP A  1 43  ? 75.299 -19.791 10.134   1.00 26.58 ? 43  ASP A C   1 
ATOM   361   O  O   . ASP A  1 43  ? 75.566 -20.091 11.300   1.00 23.16 ? 43  ASP A O   1 
ATOM   362   C  CB  . ASP A  1 43  ? 76.647 -18.194 8.789    1.00 30.23 ? 43  ASP A CB  1 
ATOM   363   C  CG  . ASP A  1 43  ? 77.914 -17.968 7.992    1.00 38.96 ? 43  ASP A CG  1 
ATOM   364   O  OD1 . ASP A  1 43  ? 78.776 -18.872 7.966    1.00 36.88 ? 43  ASP A OD1 1 
ATOM   365   O  OD2 . ASP A  1 43  ? 78.048 -16.882 7.391    1.00 48.16 ? 43  ASP A OD2 1 
ATOM   366   N  N   . GLU A  1 44  ? 74.062 -19.545 9.719    1.00 24.21 ? 44  GLU A N   1 
ATOM   367   C  CA  . GLU A  1 44  ? 72.939 -19.651 10.629   1.00 25.19 ? 44  GLU A CA  1 
ATOM   368   C  C   . GLU A  1 44  ? 72.762 -21.092 11.108   1.00 21.11 ? 44  GLU A C   1 
ATOM   369   O  O   . GLU A  1 44  ? 72.478 -21.324 12.280   1.00 18.22 ? 44  GLU A O   1 
ATOM   370   C  CB  . GLU A  1 44  ? 71.654 -19.150 9.974    1.00 31.04 ? 44  GLU A CB  1 
ATOM   371   C  CG  . GLU A  1 44  ? 70.501 -19.024 10.956   1.00 46.04 ? 44  GLU A CG  1 
ATOM   372   C  CD  . GLU A  1 44  ? 69.192 -18.658 10.286   1.00 65.22 ? 44  GLU A CD  1 
ATOM   373   O  OE1 . GLU A  1 44  ? 68.128 -18.947 10.875   1.00 78.04 ? 44  GLU A OE1 1 
ATOM   374   O  OE2 . GLU A  1 44  ? 69.229 -18.087 9.174    1.00 76.65 ? 44  GLU A OE2 1 
ATOM   375   N  N   . GLU A  1 45  ? 72.935 -22.052 10.203   1.00 18.57 ? 45  GLU A N   1 
ATOM   376   C  CA  . GLU A  1 45  ? 72.814 -23.469 10.553   1.00 17.66 ? 45  GLU A CA  1 
ATOM   377   C  C   . GLU A  1 45  ? 73.854 -23.867 11.595   1.00 18.19 ? 45  GLU A C   1 
ATOM   378   O  O   . GLU A  1 45  ? 73.563 -24.598 12.549   1.00 17.45 ? 45  GLU A O   1 
ATOM   379   C  CB  . GLU A  1 45  ? 72.980 -24.345 9.306    1.00 19.74 ? 45  GLU A CB  1 
ATOM   380   C  CG  . GLU A  1 45  ? 71.807 -24.275 8.334    1.00 21.36 ? 45  GLU A CG  1 
ATOM   381   C  CD  . GLU A  1 45  ? 72.142 -24.821 6.952    1.00 22.78 ? 45  GLU A CD  1 
ATOM   382   O  OE1 . GLU A  1 45  ? 73.342 -24.979 6.623    1.00 18.30 ? 45  GLU A OE1 1 
ATOM   383   O  OE2 . GLU A  1 45  ? 71.194 -25.087 6.184    1.00 30.10 ? 45  GLU A OE2 1 
ATOM   384   N  N   . PHE A  1 46  ? 75.075 -23.394 11.386   1.00 19.27 ? 46  PHE A N   1 
ATOM   385   C  CA  . PHE A  1 46  ? 76.167 -23.660 12.301   1.00 21.39 ? 46  PHE A CA  1 
ATOM   386   C  C   . PHE A  1 46  ? 75.886 -23.089 13.690   1.00 19.42 ? 46  PHE A C   1 
ATOM   387   O  O   . PHE A  1 46  ? 76.020 -23.791 14.695   1.00 18.76 ? 46  PHE A O   1 
ATOM   388   C  CB  . PHE A  1 46  ? 77.468 -23.085 11.739   1.00 19.92 ? 46  PHE A CB  1 
ATOM   389   C  CG  . PHE A  1 46  ? 78.656 -23.290 12.632   1.00 22.30 ? 46  PHE A CG  1 
ATOM   390   C  CD1 . PHE A  1 46  ? 79.265 -22.210 13.253   1.00 21.95 ? 46  PHE A CD1 1 
ATOM   391   C  CD2 . PHE A  1 46  ? 79.159 -24.563 12.854   1.00 22.35 ? 46  PHE A CD2 1 
ATOM   392   C  CE1 . PHE A  1 46  ? 80.360 -22.392 14.082   1.00 24.41 ? 46  PHE A CE1 1 
ATOM   393   C  CE2 . PHE A  1 46  ? 80.255 -24.753 13.682   1.00 23.76 ? 46  PHE A CE2 1 
ATOM   394   C  CZ  . PHE A  1 46  ? 80.853 -23.667 14.298   1.00 19.82 ? 46  PHE A CZ  1 
ATOM   395   N  N   . ARG A  1 47  ? 75.506 -21.813 13.739   1.00 21.43 ? 47  ARG A N   1 
ATOM   396   C  CA  . ARG A  1 47  ? 75.186 -21.143 14.999   1.00 22.23 ? 47  ARG A CA  1 
ATOM   397   C  C   . ARG A  1 47  ? 74.068 -21.848 15.761   1.00 20.97 ? 47  ARG A C   1 
ATOM   398   O  O   . ARG A  1 47  ? 74.158 -22.047 16.976   1.00 21.79 ? 47  ARG A O   1 
ATOM   399   C  CB  . ARG A  1 47  ? 74.788 -19.685 14.750   1.00 27.55 ? 47  ARG A CB  1 
ATOM   400   C  CG  . ARG A  1 47  ? 75.897 -18.802 14.203   1.00 38.65 ? 47  ARG A CG  1 
ATOM   401   C  CD  . ARG A  1 47  ? 75.551 -17.331 14.398   1.00 51.77 ? 47  ARG A CD  1 
ATOM   402   N  NE  . ARG A  1 47  ? 74.129 -17.082 14.166   1.00 56.55 ? 47  ARG A NE  1 
ATOM   403   C  CZ  . ARG A  1 47  ? 73.615 -16.709 12.997   1.00 74.69 ? 47  ARG A CZ  1 
ATOM   404   N  NH1 . ARG A  1 47  ? 74.408 -16.531 11.947   1.00 64.87 ? 47  ARG A NH1 1 
ATOM   405   N  NH2 . ARG A  1 47  ? 72.308 -16.512 12.880   1.00 80.00 ? 47  ARG A NH2 1 
ATOM   406   N  N   . ASN A  1 48  ? 73.003 -22.215 15.057   1.00 18.32 ? 48  ASN A N   1 
ATOM   407   C  CA  . ASN A  1 48  ? 71.904 -22.935 15.699   1.00 19.66 ? 48  ASN A CA  1 
ATOM   408   C  C   . ASN A  1 48  ? 72.362 -24.253 16.329   1.00 19.37 ? 48  ASN A C   1 
ATOM   409   O  O   . ASN A  1 48  ? 72.004 -24.565 17.471   1.00 16.92 ? 48  ASN A O   1 
ATOM   410   C  CB  . ASN A  1 48  ? 70.785 -23.212 14.701   1.00 23.85 ? 48  ASN A CB  1 
ATOM   411   C  CG  . ASN A  1 48  ? 70.030 -21.960 14.314   1.00 28.41 ? 48  ASN A CG  1 
ATOM   412   O  OD1 . ASN A  1 48  ? 70.210 -20.909 14.918   1.00 29.44 ? 48  ASN A OD1 1 
ATOM   413   N  ND2 . ASN A  1 48  ? 69.175 -22.069 13.302   1.00 37.61 ? 48  ASN A ND2 1 
ATOM   414   N  N   . ALA A  1 49  ? 73.150 -25.021 15.581   1.00 16.90 ? 49  ALA A N   1 
ATOM   415   C  CA  . ALA A  1 49  ? 73.609 -26.325 16.047   1.00 15.44 ? 49  ALA A CA  1 
ATOM   416   C  C   . ALA A  1 49  ? 74.564 -26.182 17.231   1.00 15.88 ? 49  ALA A C   1 
ATOM   417   O  O   . ALA A  1 49  ? 74.470 -26.923 18.207   1.00 15.91 ? 49  ALA A O   1 
ATOM   418   C  CB  . ALA A  1 49  ? 74.265 -27.097 14.915   1.00 14.18 ? 49  ALA A CB  1 
ATOM   419   N  N   . VAL A  1 50  ? 75.481 -25.225 17.145   1.00 15.95 ? 50  VAL A N   1 
ATOM   420   C  CA  . VAL A  1 50  ? 76.394 -24.967 18.250   1.00 15.79 ? 50  VAL A CA  1 
ATOM   421   C  C   . VAL A  1 50  ? 75.645 -24.541 19.519   1.00 17.62 ? 50  VAL A C   1 
ATOM   422   O  O   . VAL A  1 50  ? 75.887 -25.076 20.602   1.00 18.31 ? 50  VAL A O   1 
ATOM   423   C  CB  . VAL A  1 50  ? 77.475 -23.937 17.867   1.00 17.65 ? 50  VAL A CB  1 
ATOM   424   C  CG1 . VAL A  1 50  ? 78.268 -23.505 19.099   1.00 18.05 ? 50  VAL A CG1 1 
ATOM   425   C  CG2 . VAL A  1 50  ? 78.410 -24.532 16.818   1.00 15.73 ? 50  VAL A CG2 1 
ATOM   426   N  N   . ASN A  1 51  ? 74.722 -23.594 19.385   1.00 17.69 ? 51  ASN A N   1 
ATOM   427   C  CA  . ASN A  1 51  ? 73.963 -23.119 20.544   1.00 20.24 ? 51  ASN A CA  1 
ATOM   428   C  C   . ASN A  1 51  ? 73.172 -24.219 21.250   1.00 20.01 ? 51  ASN A C   1 
ATOM   429   O  O   . ASN A  1 51  ? 73.174 -24.301 22.481   1.00 18.18 ? 51  ASN A O   1 
ATOM   430   C  CB  . ASN A  1 51  ? 73.044 -21.960 20.158   1.00 23.15 ? 51  ASN A CB  1 
ATOM   431   C  CG  . ASN A  1 51  ? 73.816 -20.702 19.801   1.00 30.45 ? 51  ASN A CG  1 
ATOM   432   O  OD1 . ASN A  1 51  ? 74.956 -20.518 20.229   1.00 33.28 ? 51  ASN A OD1 1 
ATOM   433   N  ND2 . ASN A  1 51  ? 73.199 -19.833 19.007   1.00 34.95 ? 51  ASN A ND2 1 
ATOM   434   N  N   . GLU A  1 52  ? 72.498 -25.060 20.472   1.00 17.64 ? 52  GLU A N   1 
ATOM   435   C  CA  . GLU A  1 52  ? 71.714 -26.157 21.031   1.00 17.14 ? 52  GLU A CA  1 
ATOM   436   C  C   . GLU A  1 52  ? 72.604 -27.178 21.731   1.00 16.28 ? 52  GLU A C   1 
ATOM   437   O  O   . GLU A  1 52  ? 72.314 -27.603 22.849   1.00 14.48 ? 52  GLU A O   1 
ATOM   438   C  CB  . GLU A  1 52  ? 70.905 -26.857 19.934   1.00 17.00 ? 52  GLU A CB  1 
ATOM   439   C  CG  . GLU A  1 52  ? 69.680 -26.080 19.489   1.00 20.84 ? 52  GLU A CG  1 
ATOM   440   C  CD  . GLU A  1 52  ? 68.702 -25.843 20.624   1.00 23.52 ? 52  GLU A CD  1 
ATOM   441   O  OE1 . GLU A  1 52  ? 68.515 -24.671 21.006   1.00 27.91 ? 52  GLU A OE1 1 
ATOM   442   O  OE2 . GLU A  1 52  ? 68.124 -26.826 21.141   1.00 23.21 ? 52  GLU A OE2 1 
ATOM   443   N  N   . VAL A  1 53  ? 73.681 -27.581 21.063   1.00 14.47 ? 53  VAL A N   1 
ATOM   444   C  CA  . VAL A  1 53  ? 74.573 -28.584 21.628   1.00 14.00 ? 53  VAL A CA  1 
ATOM   445   C  C   . VAL A  1 53  ? 75.201 -28.075 22.923   1.00 14.59 ? 53  VAL A C   1 
ATOM   446   O  O   . VAL A  1 53  ? 75.356 -28.834 23.876   1.00 13.60 ? 53  VAL A O   1 
ATOM   447   C  CB  . VAL A  1 53  ? 75.665 -29.030 20.631   1.00 13.45 ? 53  VAL A CB  1 
ATOM   448   C  CG1 . VAL A  1 53  ? 76.749 -29.837 21.342   1.00 13.57 ? 53  VAL A CG1 1 
ATOM   449   C  CG2 . VAL A  1 53  ? 75.048 -29.846 19.491   1.00 11.75 ? 53  VAL A CG2 1 
ATOM   450   N  N   . LYS A  1 54  ? 75.561 -26.795 22.952   1.00 14.91 ? 54  LYS A N   1 
ATOM   451   C  CA  . LYS A  1 54  ? 76.120 -26.205 24.167   1.00 17.24 ? 54  LYS A CA  1 
ATOM   452   C  C   . LYS A  1 54  ? 75.125 -26.254 25.320   1.00 18.12 ? 54  LYS A C   1 
ATOM   453   O  O   . LYS A  1 54  ? 75.510 -26.512 26.452   1.00 16.85 ? 54  LYS A O   1 
ATOM   454   C  CB  . LYS A  1 54  ? 76.582 -24.763 23.929   1.00 17.79 ? 54  LYS A CB  1 
ATOM   455   C  CG  . LYS A  1 54  ? 77.895 -24.661 23.162   1.00 17.63 ? 54  LYS A CG  1 
ATOM   456   C  CD  . LYS A  1 54  ? 78.365 -23.220 23.079   1.00 22.38 ? 54  LYS A CD  1 
ATOM   457   C  CE  . LYS A  1 54  ? 79.673 -23.114 22.317   1.00 26.16 ? 54  LYS A CE  1 
ATOM   458   N  NZ  . LYS A  1 54  ? 80.185 -21.716 22.333   1.00 32.37 ? 54  LYS A NZ  1 
ATOM   459   N  N   . ARG A  1 55  ? 73.848 -25.999 25.042   1.00 18.29 ? 55  ARG A N   1 
ATOM   460   C  CA  . ARG A  1 55  ? 72.858 -26.066 26.114   1.00 20.48 ? 55  ARG A CA  1 
ATOM   461   C  C   . ARG A  1 55  ? 72.664 -27.498 26.596   1.00 18.22 ? 55  ARG A C   1 
ATOM   462   O  O   . ARG A  1 55  ? 72.533 -27.735 27.796   1.00 20.04 ? 55  ARG A O   1 
ATOM   463   C  CB  . ARG A  1 55  ? 71.516 -25.436 25.721   1.00 20.01 ? 55  ARG A CB  1 
ATOM   464   C  CG  . ARG A  1 55  ? 70.697 -25.019 26.945   1.00 25.81 ? 55  ARG A CG  1 
ATOM   465   C  CD  . ARG A  1 55  ? 69.405 -24.297 26.578   1.00 24.35 ? 55  ARG A CD  1 
ATOM   466   N  NE  . ARG A  1 55  ? 68.516 -25.145 25.790   1.00 20.99 ? 55  ARG A NE  1 
ATOM   467   C  CZ  . ARG A  1 55  ? 68.412 -25.100 24.464   1.00 20.05 ? 55  ARG A CZ  1 
ATOM   468   N  NH1 . ARG A  1 55  ? 67.576 -25.919 23.834   1.00 19.60 ? 55  ARG A NH1 1 
ATOM   469   N  NH2 . ARG A  1 55  ? 69.137 -24.237 23.766   1.00 22.98 ? 55  ARG A NH2 1 
ATOM   470   N  N   . ALA A  1 56  ? 72.653 -28.451 25.665   1.00 15.92 ? 56  ALA A N   1 
ATOM   471   C  CA  . ALA A  1 56  ? 72.571 -29.864 26.034   1.00 14.74 ? 56  ALA A CA  1 
ATOM   472   C  C   . ALA A  1 56  ? 73.734 -30.255 26.937   1.00 15.00 ? 56  ALA A C   1 
ATOM   473   O  O   . ALA A  1 56  ? 73.548 -30.941 27.952   1.00 13.83 ? 56  ALA A O   1 
ATOM   474   C  CB  . ALA A  1 56  ? 72.539 -30.745 24.793   1.00 15.43 ? 56  ALA A CB  1 
ATOM   475   N  N   . MET A  1 57  ? 74.934 -29.807 26.580   1.00 15.32 ? 57  MET A N   1 
ATOM   476   C  CA  . MET A  1 57  ? 76.114 -30.097 27.388   1.00 16.60 ? 57  MET A CA  1 
ATOM   477   C  C   . MET A  1 57  ? 76.031 -29.457 28.772   1.00 17.72 ? 57  MET A C   1 
ATOM   478   O  O   . MET A  1 57  ? 76.408 -30.071 29.772   1.00 16.80 ? 57  MET A O   1 
ATOM   479   C  CB  . MET A  1 57  ? 77.390 -29.661 26.665   1.00 17.33 ? 57  MET A CB  1 
ATOM   480   C  CG  . MET A  1 57  ? 77.650 -30.463 25.402   1.00 15.64 ? 57  MET A CG  1 
ATOM   481   S  SD  . MET A  1 57  ? 79.133 -29.928 24.535   1.00 18.64 ? 57  MET A SD  1 
ATOM   482   C  CE  . MET A  1 57  ? 80.425 -30.500 25.651   1.00 18.86 ? 57  MET A CE  1 
ATOM   483   N  N   . GLN A  1 58  ? 75.527 -28.229 28.835   1.00 16.23 ? 58  GLN A N   1 
ATOM   484   C  CA  . GLN A  1 58  ? 75.346 -27.575 30.126   1.00 18.10 ? 58  GLN A CA  1 
ATOM   485   C  C   . GLN A  1 58  ? 74.451 -28.388 31.065   1.00 17.11 ? 58  GLN A C   1 
ATOM   486   O  O   . GLN A  1 58  ? 74.661 -28.383 32.275   1.00 17.80 ? 58  GLN A O   1 
ATOM   487   C  CB  . GLN A  1 58  ? 74.765 -26.174 29.962   1.00 20.70 ? 58  GLN A CB  1 
ATOM   488   C  CG  . GLN A  1 58  ? 74.527 -25.474 31.289   1.00 23.70 ? 58  GLN A CG  1 
ATOM   489   C  CD  . GLN A  1 58  ? 74.109 -24.030 31.120   1.00 28.71 ? 58  GLN A CD  1 
ATOM   490   O  OE1 . GLN A  1 58  ? 74.594 -23.338 30.225   1.00 25.60 ? 58  GLN A OE1 1 
ATOM   491   N  NE2 . GLN A  1 58  ? 73.217 -23.562 31.990   1.00 25.92 ? 58  GLN A NE2 1 
ATOM   492   N  N   . PHE A  1 59  ? 73.456 -29.067 30.499   1.00 14.75 ? 59  PHE A N   1 
ATOM   493   C  CA  . PHE A  1 59  ? 72.508 -29.876 31.276   1.00 16.04 ? 59  PHE A CA  1 
ATOM   494   C  C   . PHE A  1 59  ? 73.004 -31.310 31.481   1.00 16.97 ? 59  PHE A C   1 
ATOM   495   O  O   . PHE A  1 59  ? 72.293 -32.143 32.036   1.00 19.52 ? 59  PHE A O   1 
ATOM   496   C  CB  . PHE A  1 59  ? 71.122 -29.890 30.614   1.00 16.35 ? 59  PHE A CB  1 
ATOM   497   C  CG  . PHE A  1 59  ? 70.424 -28.547 30.623   1.00 17.12 ? 59  PHE A CG  1 
ATOM   498   C  CD1 . PHE A  1 59  ? 71.003 -27.447 31.242   1.00 19.97 ? 59  PHE A CD1 1 
ATOM   499   C  CD2 . PHE A  1 59  ? 69.178 -28.397 30.036   1.00 18.26 ? 59  PHE A CD2 1 
ATOM   500   C  CE1 . PHE A  1 59  ? 70.362 -26.219 31.260   1.00 21.83 ? 59  PHE A CE1 1 
ATOM   501   C  CE2 . PHE A  1 59  ? 68.528 -27.172 30.051   1.00 19.13 ? 59  PHE A CE2 1 
ATOM   502   C  CZ  . PHE A  1 59  ? 69.121 -26.083 30.664   1.00 21.68 ? 59  PHE A CZ  1 
ATOM   503   N  N   . GLY A  1 60  ? 74.221 -31.595 31.036   1.00 15.27 ? 60  GLY A N   1 
ATOM   504   C  CA  . GLY A  1 60  ? 74.868 -32.864 31.375   1.00 16.59 ? 60  GLY A CA  1 
ATOM   505   C  C   . GLY A  1 60  ? 74.953 -33.899 30.262   1.00 15.64 ? 60  GLY A C   1 
ATOM   506   O  O   . GLY A  1 60  ? 75.335 -35.049 30.508   1.00 15.59 ? 60  GLY A O   1 
ATOM   507   N  N   . VAL A  1 61  ? 74.601 -33.512 29.043   1.00 12.59 ? 61  VAL A N   1 
ATOM   508   C  CA  . VAL A  1 61  ? 74.699 -34.449 27.919   1.00 13.23 ? 61  VAL A CA  1 
ATOM   509   C  C   . VAL A  1 61  ? 76.172 -34.619 27.547   1.00 15.20 ? 61  VAL A C   1 
ATOM   510   O  O   . VAL A  1 61  ? 76.890 -33.640 27.380   1.00 14.12 ? 61  VAL A O   1 
ATOM   511   C  CB  . VAL A  1 61  ? 73.903 -33.973 26.693   1.00 13.52 ? 61  VAL A CB  1 
ATOM   512   C  CG1 . VAL A  1 61  ? 74.177 -34.874 25.486   1.00 12.56 ? 61  VAL A CG1 1 
ATOM   513   C  CG2 . VAL A  1 61  ? 72.416 -33.943 27.011   1.00 13.23 ? 61  VAL A CG2 1 
ATOM   514   N  N   . LYS A  1 62  ? 76.621 -35.864 27.442   1.00 14.46 ? 62  LYS A N   1 
ATOM   515   C  CA  . LYS A  1 62  ? 78.011 -36.138 27.099   1.00 15.68 ? 62  LYS A CA  1 
ATOM   516   C  C   . LYS A  1 62  ? 78.146 -36.522 25.629   1.00 15.63 ? 62  LYS A C   1 
ATOM   517   O  O   . LYS A  1 62  ? 79.092 -36.125 24.947   1.00 14.27 ? 62  LYS A O   1 
ATOM   518   C  CB  . LYS A  1 62  ? 78.559 -37.264 27.982   1.00 16.77 ? 62  LYS A CB  1 
ATOM   519   C  CG  . LYS A  1 62  ? 80.055 -37.475 27.834   1.00 26.10 ? 62  LYS A CG  1 
ATOM   520   C  CD  . LYS A  1 62  ? 80.585 -38.543 28.783   1.00 34.97 ? 62  LYS A CD  1 
ATOM   521   C  CE  . LYS A  1 62  ? 82.101 -38.656 28.689   1.00 30.30 ? 62  LYS A CE  1 
ATOM   522   N  NZ  . LYS A  1 62  ? 82.640 -39.780 29.510   1.00 34.98 ? 62  LYS A NZ  1 
ATOM   523   N  N   . THR A  1 63  ? 77.183 -37.295 25.147   1.00 12.87 ? 63  THR A N   1 
ATOM   524   C  CA  . THR A  1 63  ? 77.242 -37.850 23.809   1.00 12.55 ? 63  THR A CA  1 
ATOM   525   C  C   . THR A  1 63  ? 75.913 -37.661 23.087   1.00 13.47 ? 63  THR A C   1 
ATOM   526   O  O   . THR A  1 63  ? 74.846 -37.867 23.666   1.00 13.47 ? 63  THR A O   1 
ATOM   527   C  CB  . THR A  1 63  ? 77.559 -39.354 23.868   1.00 12.84 ? 63  THR A CB  1 
ATOM   528   O  OG1 . THR A  1 63  ? 78.816 -39.545 24.537   1.00 11.68 ? 63  THR A OG1 1 
ATOM   529   C  CG2 . THR A  1 63  ? 77.598 -39.969 22.459   1.00 13.87 ? 63  THR A CG2 1 
ATOM   530   N  N   . ILE A  1 64  ? 75.990 -37.263 21.823   1.00 11.38 ? 64  ILE A N   1 
ATOM   531   C  CA  . ILE A  1 64  ? 74.812 -37.191 20.971   1.00 12.40 ? 64  ILE A CA  1 
ATOM   532   C  C   . ILE A  1 64  ? 75.001 -38.126 19.790   1.00 13.44 ? 64  ILE A C   1 
ATOM   533   O  O   . ILE A  1 64  ? 76.061 -38.127 19.142   1.00 14.16 ? 64  ILE A O   1 
ATOM   534   C  CB  . ILE A  1 64  ? 74.571 -35.763 20.458   1.00 12.66 ? 64  ILE A CB  1 
ATOM   535   C  CG1 . ILE A  1 64  ? 74.212 -34.836 21.626   1.00 13.81 ? 64  ILE A CG1 1 
ATOM   536   C  CG2 . ILE A  1 64  ? 73.483 -35.753 19.395   1.00 12.03 ? 64  ILE A CG2 1 
ATOM   537   C  CD1 . ILE A  1 64  ? 74.254 -33.361 21.274   1.00 17.84 ? 64  ILE A CD1 1 
ATOM   538   N  N   . VAL A  1 65  ? 73.980 -38.939 19.538   1.00 12.21 ? 65  VAL A N   1 
ATOM   539   C  CA  . VAL A  1 65  ? 73.959 -39.838 18.390   1.00 12.41 ? 65  VAL A CA  1 
ATOM   540   C  C   . VAL A  1 65  ? 73.082 -39.187 17.315   1.00 14.20 ? 65  VAL A C   1 
ATOM   541   O  O   . VAL A  1 65  ? 71.903 -38.910 17.548   1.00 13.50 ? 65  VAL A O   1 
ATOM   542   C  CB  . VAL A  1 65  ? 73.385 -41.213 18.795   1.00 13.83 ? 65  VAL A CB  1 
ATOM   543   C  CG1 . VAL A  1 65  ? 73.283 -42.137 17.594   1.00 13.08 ? 65  VAL A CG1 1 
ATOM   544   C  CG2 . VAL A  1 65  ? 74.233 -41.839 19.903   1.00 12.82 ? 65  VAL A CG2 1 
ATOM   545   N  N   . ASP A  1 66  ? 73.663 -38.932 16.147   1.00 13.35 ? 66  ASP A N   1 
ATOM   546   C  CA  . ASP A  1 66  ? 72.985 -38.165 15.108   1.00 15.85 ? 66  ASP A CA  1 
ATOM   547   C  C   . ASP A  1 66  ? 72.747 -39.049 13.893   1.00 15.39 ? 66  ASP A C   1 
ATOM   548   O  O   . ASP A  1 66  ? 73.677 -39.315 13.136   1.00 16.14 ? 66  ASP A O   1 
ATOM   549   C  CB  . ASP A  1 66  ? 73.840 -36.953 14.719   1.00 15.68 ? 66  ASP A CB  1 
ATOM   550   C  CG  . ASP A  1 66  ? 73.167 -36.064 13.691   1.00 18.95 ? 66  ASP A CG  1 
ATOM   551   O  OD1 . ASP A  1 66  ? 72.237 -36.537 12.991   1.00 18.00 ? 66  ASP A OD1 1 
ATOM   552   O  OD2 . ASP A  1 66  ? 73.571 -34.885 13.584   1.00 19.31 ? 66  ASP A OD2 1 
ATOM   553   N  N   . PRO A  1 67  ? 71.501 -39.517 13.714   1.00 15.69 ? 67  PRO A N   1 
ATOM   554   C  CA  . PRO A  1 67  ? 71.174 -40.459 12.634   1.00 14.18 ? 67  PRO A CA  1 
ATOM   555   C  C   . PRO A  1 67  ? 70.804 -39.775 11.316   1.00 14.13 ? 67  PRO A C   1 
ATOM   556   O  O   . PRO A  1 67  ? 69.965 -40.277 10.569   1.00 12.68 ? 67  PRO A O   1 
ATOM   557   C  CB  . PRO A  1 67  ? 69.980 -41.229 13.203   1.00 14.84 ? 67  PRO A CB  1 
ATOM   558   C  CG  . PRO A  1 67  ? 69.299 -40.242 14.102   1.00 15.69 ? 67  PRO A CG  1 
ATOM   559   C  CD  . PRO A  1 67  ? 70.352 -39.278 14.608   1.00 13.70 ? 67  PRO A CD  1 
ATOM   560   N  N   . THR A  1 68  ? 71.430 -38.636 11.039   1.00 11.86 ? 68  THR A N   1 
ATOM   561   C  CA  . THR A  1 68  ? 71.303 -37.991 9.741    1.00 12.03 ? 68  THR A CA  1 
ATOM   562   C  C   . THR A  1 68  ? 72.142 -38.802 8.757    1.00 15.99 ? 68  THR A C   1 
ATOM   563   O  O   . THR A  1 68  ? 73.366 -38.874 8.914    1.00 12.53 ? 68  THR A O   1 
ATOM   564   C  CB  . THR A  1 68  ? 71.860 -36.554 9.778    1.00 12.92 ? 68  THR A CB  1 
ATOM   565   O  OG1 . THR A  1 68  ? 71.249 -35.819 10.845   1.00 13.33 ? 68  THR A OG1 1 
ATOM   566   C  CG2 . THR A  1 68  ? 71.600 -35.840 8.446    1.00 11.31 ? 68  THR A CG2 1 
ATOM   567   N  N   . VAL A  1 69  ? 71.496 -39.396 7.750    1.00 13.29 ? 69  VAL A N   1 
ATOM   568   C  CA  . VAL A  1 69  ? 72.196 -40.217 6.755    1.00 13.51 ? 69  VAL A CA  1 
ATOM   569   C  C   . VAL A  1 69  ? 71.744 -39.813 5.344    1.00 14.57 ? 69  VAL A C   1 
ATOM   570   O  O   . VAL A  1 69  ? 71.108 -38.775 5.180    1.00 12.92 ? 69  VAL A O   1 
ATOM   571   C  CB  . VAL A  1 69  ? 71.970 -41.735 6.995    1.00 15.34 ? 69  VAL A CB  1 
ATOM   572   C  CG1 . VAL A  1 69  ? 72.515 -42.158 8.359    1.00 13.85 ? 69  VAL A CG1 1 
ATOM   573   C  CG2 . VAL A  1 69  ? 70.493 -42.099 6.888    1.00 11.39 ? 69  VAL A CG2 1 
ATOM   574   N  N   . MET A  1 70  ? 72.066 -40.621 4.333    1.00 13.45 ? 70  MET A N   1 
ATOM   575   C  CA  . MET A  1 70  ? 71.601 -40.342 2.968    1.00 14.50 ? 70  MET A CA  1 
ATOM   576   C  C   . MET A  1 70  ? 70.093 -40.161 2.952    1.00 14.20 ? 70  MET A C   1 
ATOM   577   O  O   . MET A  1 70  ? 69.356 -41.029 3.420    1.00 16.65 ? 70  MET A O   1 
ATOM   578   C  CB  . MET A  1 70  ? 71.975 -41.472 1.992    1.00 14.01 ? 70  MET A CB  1 
ATOM   579   C  CG  . MET A  1 70  ? 71.822 -41.080 0.523    1.00 15.63 ? 70  MET A CG  1 
ATOM   580   S  SD  . MET A  1 70  ? 70.856 -42.237 -0.483   1.00 18.62 ? 70  MET A SD  1 
ATOM   581   C  CE  . MET A  1 70  ? 69.185 -41.786 0.009    1.00 15.96 ? 70  MET A CE  1 
ATOM   582   N  N   . GLY A  1 71  ? 69.634 -39.053 2.381    1.00 16.03 ? 71  GLY A N   1 
ATOM   583   C  CA  . GLY A  1 71  ? 68.211 -38.739 2.367    1.00 16.23 ? 71  GLY A CA  1 
ATOM   584   C  C   . GLY A  1 71  ? 67.882 -37.633 3.355    1.00 17.14 ? 71  GLY A C   1 
ATOM   585   O  O   . GLY A  1 71  ? 66.834 -36.991 3.258    1.00 14.58 ? 71  GLY A O   1 
ATOM   586   N  N   . LEU A  1 72  ? 68.788 -37.400 4.304    1.00 14.97 ? 72  LEU A N   1 
ATOM   587   C  CA  . LEU A  1 72  ? 68.600 -36.342 5.307    1.00 13.28 ? 72  LEU A CA  1 
ATOM   588   C  C   . LEU A  1 72  ? 69.722 -35.308 5.293    1.00 13.42 ? 72  LEU A C   1 
ATOM   589   O  O   . LEU A  1 72  ? 69.747 -34.414 6.140    1.00 15.02 ? 72  LEU A O   1 
ATOM   590   C  CB  . LEU A  1 72  ? 68.486 -36.945 6.710    1.00 14.54 ? 72  LEU A CB  1 
ATOM   591   C  CG  . LEU A  1 72  ? 67.305 -37.894 6.940    1.00 15.63 ? 72  LEU A CG  1 
ATOM   592   C  CD1 . LEU A  1 72  ? 67.409 -38.564 8.306    1.00 15.45 ? 72  LEU A CD1 1 
ATOM   593   C  CD2 . LEU A  1 72  ? 65.986 -37.148 6.796    1.00 14.32 ? 72  LEU A CD2 1 
ATOM   594   N  N   . GLY A  1 73  ? 70.648 -35.430 4.346    1.00 13.66 ? 73  GLY A N   1 
ATOM   595   C  CA  . GLY A  1 73  ? 71.729 -34.446 4.188    1.00 13.93 ? 73  GLY A CA  1 
ATOM   596   C  C   . GLY A  1 73  ? 72.914 -34.612 5.132    1.00 15.91 ? 73  GLY A C   1 
ATOM   597   O  O   . GLY A  1 73  ? 73.511 -33.627 5.579    1.00 14.51 ? 73  GLY A O   1 
ATOM   598   N  N   . ARG A  1 74  ? 73.275 -35.852 5.444    1.00 13.22 ? 74  ARG A N   1 
ATOM   599   C  CA  . ARG A  1 74  ? 74.467 -36.072 6.256    1.00 12.28 ? 74  ARG A CA  1 
ATOM   600   C  C   . ARG A  1 74  ? 75.629 -35.271 5.674    1.00 14.69 ? 74  ARG A C   1 
ATOM   601   O  O   . ARG A  1 74  ? 75.861 -35.301 4.469    1.00 14.24 ? 74  ARG A O   1 
ATOM   602   C  CB  . ARG A  1 74  ? 74.847 -37.550 6.284    1.00 11.82 ? 74  ARG A CB  1 
ATOM   603   C  CG  . ARG A  1 74  ? 76.049 -37.851 7.165    1.00 14.53 ? 74  ARG A CG  1 
ATOM   604   C  CD  . ARG A  1 74  ? 76.399 -39.334 7.138    1.00 15.44 ? 74  ARG A CD  1 
ATOM   605   N  NE  . ARG A  1 74  ? 76.691 -39.789 5.781    1.00 14.45 ? 74  ARG A NE  1 
ATOM   606   C  CZ  . ARG A  1 74  ? 77.213 -40.974 5.480    1.00 15.42 ? 74  ARG A CZ  1 
ATOM   607   N  NH1 . ARG A  1 74  ? 77.509 -41.834 6.443    1.00 11.87 ? 74  ARG A NH1 1 
ATOM   608   N  NH2 . ARG A  1 74  ? 77.435 -41.298 4.210    1.00 14.02 ? 74  ARG A NH2 1 
ATOM   609   N  N   . ASP A  1 75  ? 76.356 -34.559 6.532    1.00 13.54 ? 75  ASP A N   1 
ATOM   610   C  CA  . ASP A  1 75  ? 77.525 -33.802 6.099    1.00 15.41 ? 75  ASP A CA  1 
ATOM   611   C  C   . ASP A  1 75  ? 78.555 -33.882 7.218    1.00 15.74 ? 75  ASP A C   1 
ATOM   612   O  O   . ASP A  1 75  ? 78.450 -33.172 8.224    1.00 15.97 ? 75  ASP A O   1 
ATOM   613   C  CB  . ASP A  1 75  ? 77.142 -32.349 5.818    1.00 16.45 ? 75  ASP A CB  1 
ATOM   614   C  CG  . ASP A  1 75  ? 78.324 -31.503 5.362    1.00 21.92 ? 75  ASP A CG  1 
ATOM   615   O  OD1 . ASP A  1 75  ? 78.093 -30.453 4.736    1.00 33.60 ? 75  ASP A OD1 1 
ATOM   616   O  OD2 . ASP A  1 75  ? 79.475 -31.877 5.639    1.00 23.27 ? 75  ASP A OD2 1 
ATOM   617   N  N   . ILE A  1 76  ? 79.530 -34.770 7.048    1.00 15.35 ? 76  ILE A N   1 
ATOM   618   C  CA  . ILE A  1 76  ? 80.478 -35.083 8.107    1.00 15.54 ? 76  ILE A CA  1 
ATOM   619   C  C   . ILE A  1 76  ? 81.371 -33.891 8.441    1.00 15.88 ? 76  ILE A C   1 
ATOM   620   O  O   . ILE A  1 76  ? 81.788 -33.724 9.583    1.00 16.94 ? 76  ILE A O   1 
ATOM   621   C  CB  . ILE A  1 76  ? 81.343 -36.312 7.745    1.00 16.80 ? 76  ILE A CB  1 
ATOM   622   C  CG1 . ILE A  1 76  ? 81.937 -36.940 9.008    1.00 16.43 ? 76  ILE A CG1 1 
ATOM   623   C  CG2 . ILE A  1 76  ? 82.418 -35.936 6.738    1.00 17.46 ? 76  ILE A CG2 1 
ATOM   624   C  CD1 . ILE A  1 76  ? 80.894 -37.492 9.963    1.00 17.43 ? 76  ILE A CD1 1 
ATOM   625   N  N   . ARG A  1 77  ? 81.654 -33.055 7.450    1.00 16.23 ? 77  ARG A N   1 
ATOM   626   C  CA  . ARG A  1 77  ? 82.492 -31.883 7.687    1.00 16.99 ? 77  ARG A CA  1 
ATOM   627   C  C   . ARG A  1 77  ? 81.761 -30.804 8.505    1.00 18.18 ? 77  ARG A C   1 
ATOM   628   O  O   . ARG A  1 77  ? 82.366 -30.123 9.334    1.00 18.58 ? 77  ARG A O   1 
ATOM   629   C  CB  . ARG A  1 77  ? 83.037 -31.343 6.360    1.00 18.50 ? 77  ARG A CB  1 
ATOM   630   C  CG  . ARG A  1 77  ? 84.009 -32.318 5.702    1.00 19.27 ? 77  ARG A CG  1 
ATOM   631   C  CD  . ARG A  1 77  ? 84.390 -31.909 4.285    1.00 22.01 ? 77  ARG A CD  1 
ATOM   632   N  NE  . ARG A  1 77  ? 85.340 -32.854 3.698    1.00 21.54 ? 77  ARG A NE  1 
ATOM   633   C  CZ  . ARG A  1 77  ? 85.005 -34.053 3.229    1.00 24.98 ? 77  ARG A CZ  1 
ATOM   634   N  NH1 . ARG A  1 77  ? 83.742 -34.460 3.280    1.00 21.08 ? 77  ARG A NH1 1 
ATOM   635   N  NH2 . ARG A  1 77  ? 85.931 -34.849 2.710    1.00 26.03 ? 77  ARG A NH2 1 
ATOM   636   N  N   . PHE A  1 78  ? 80.457 -30.666 8.285    1.00 16.48 ? 78  PHE A N   1 
ATOM   637   C  CA  . PHE A  1 78  ? 79.657 -29.780 9.111    1.00 17.21 ? 78  PHE A CA  1 
ATOM   638   C  C   . PHE A  1 78  ? 79.655 -30.315 10.542   1.00 16.72 ? 78  PHE A C   1 
ATOM   639   O  O   . PHE A  1 78  ? 79.795 -29.558 11.494   1.00 16.39 ? 78  PHE A O   1 
ATOM   640   C  CB  . PHE A  1 78  ? 78.228 -29.685 8.576    1.00 18.96 ? 78  PHE A CB  1 
ATOM   641   C  CG  . PHE A  1 78  ? 77.330 -28.813 9.401    1.00 18.49 ? 78  PHE A CG  1 
ATOM   642   C  CD1 . PHE A  1 78  ? 76.467 -29.371 10.330   1.00 17.23 ? 78  PHE A CD1 1 
ATOM   643   C  CD2 . PHE A  1 78  ? 77.338 -27.436 9.240    1.00 19.04 ? 78  PHE A CD2 1 
ATOM   644   C  CE1 . PHE A  1 78  ? 75.635 -28.575 11.097   1.00 16.80 ? 78  PHE A CE1 1 
ATOM   645   C  CE2 . PHE A  1 78  ? 76.507 -26.632 10.004   1.00 18.08 ? 78  PHE A CE2 1 
ATOM   646   C  CZ  . PHE A  1 78  ? 75.653 -27.203 10.929   1.00 19.40 ? 78  PHE A CZ  1 
ATOM   647   N  N   . MET A  1 79  ? 79.495 -31.628 10.682   1.00 17.58 ? 79  MET A N   1 
ATOM   648   C  CA  . MET A  1 79  ? 79.507 -32.273 11.999   1.00 18.17 ? 79  MET A CA  1 
ATOM   649   C  C   . MET A  1 79  ? 80.851 -32.044 12.708   1.00 17.20 ? 79  MET A C   1 
ATOM   650   O  O   . MET A  1 79  ? 80.890 -31.724 13.905   1.00 15.57 ? 79  MET A O   1 
ATOM   651   C  CB  . MET A  1 79  ? 79.187 -33.778 11.872   1.00 17.08 ? 79  MET A CB  1 
ATOM   652   C  CG  . MET A  1 79  ? 77.801 -34.076 11.298   1.00 18.87 ? 79  MET A CG  1 
ATOM   653   S  SD  . MET A  1 79  ? 77.470 -35.834 10.988   1.00 21.32 ? 79  MET A SD  1 
ATOM   654   C  CE  . MET A  1 79  ? 76.766 -36.343 12.548   1.00 23.79 ? 79  MET A CE  1 
ATOM   655   N  N   . GLU A  1 80  ? 81.950 -32.190 11.971   1.00 16.80 ? 80  GLU A N   1 
ATOM   656   C  CA  . GLU A  1 80  ? 83.276 -31.925 12.532   1.00 18.81 ? 80  GLU A CA  1 
ATOM   657   C  C   . GLU A  1 80  ? 83.358 -30.510 13.075   1.00 16.63 ? 80  GLU A C   1 
ATOM   658   O  O   . GLU A  1 80  ? 83.881 -30.289 14.170   1.00 18.61 ? 80  GLU A O   1 
ATOM   659   C  CB  . GLU A  1 80  ? 84.372 -32.095 11.481   1.00 21.60 ? 80  GLU A CB  1 
ATOM   660   C  CG  . GLU A  1 80  ? 84.776 -33.523 11.183   1.00 27.19 ? 80  GLU A CG  1 
ATOM   661   C  CD  . GLU A  1 80  ? 85.865 -33.588 10.128   1.00 31.83 ? 80  GLU A CD  1 
ATOM   662   O  OE1 . GLU A  1 80  ? 85.912 -32.690 9.264    1.00 36.24 ? 80  GLU A OE1 1 
ATOM   663   O  OE2 . GLU A  1 80  ? 86.673 -34.533 10.159   1.00 31.57 ? 80  GLU A OE2 1 
ATOM   664   N  N   . LYS A  1 81  ? 82.859 -29.553 12.295   1.00 15.99 ? 81  LYS A N   1 
ATOM   665   C  CA  . LYS A  1 81  ? 82.887 -28.140 12.687   1.00 17.04 ? 81  LYS A CA  1 
ATOM   666   C  C   . LYS A  1 81  ? 82.154 -27.905 14.004   1.00 16.70 ? 81  LYS A C   1 
ATOM   667   O  O   . LYS A  1 81  ? 82.596 -27.123 14.843   1.00 16.55 ? 81  LYS A O   1 
ATOM   668   C  CB  . LYS A  1 81  ? 82.276 -27.255 11.597   1.00 22.26 ? 81  LYS A CB  1 
ATOM   669   C  CG  . LYS A  1 81  ? 83.210 -26.907 10.448   1.00 28.70 ? 81  LYS A CG  1 
ATOM   670   C  CD  . LYS A  1 81  ? 82.644 -25.760 9.616    1.00 33.39 ? 81  LYS A CD  1 
ATOM   671   C  CE  . LYS A  1 81  ? 82.521 -24.484 10.440   1.00 51.75 ? 81  LYS A CE  1 
ATOM   672   N  NZ  . LYS A  1 81  ? 82.084 -23.288 9.654    1.00 46.83 ? 81  LYS A NZ  1 
ATOM   673   N  N   . VAL A  1 82  ? 81.032 -28.592 14.186   1.00 17.04 ? 82  VAL A N   1 
ATOM   674   C  CA  . VAL A  1 82  ? 80.243 -28.455 15.411   1.00 16.57 ? 82  VAL A CA  1 
ATOM   675   C  C   . VAL A  1 82  ? 80.955 -29.090 16.609   1.00 16.14 ? 82  VAL A C   1 
ATOM   676   O  O   . VAL A  1 82  ? 80.956 -28.538 17.714   1.00 17.10 ? 82  VAL A O   1 
ATOM   677   C  CB  . VAL A  1 82  ? 78.816 -29.030 15.226   1.00 18.55 ? 82  VAL A CB  1 
ATOM   678   C  CG1 . VAL A  1 82  ? 78.046 -29.018 16.542   1.00 16.09 ? 82  VAL A CG1 1 
ATOM   679   C  CG2 . VAL A  1 82  ? 78.066 -28.228 14.164   1.00 16.92 ? 82  VAL A CG2 1 
ATOM   680   N  N   . VAL A  1 83  ? 81.563 -30.252 16.394   1.00 16.32 ? 83  VAL A N   1 
ATOM   681   C  CA  . VAL A  1 83  ? 82.347 -30.896 17.441   1.00 14.90 ? 83  VAL A CA  1 
ATOM   682   C  C   . VAL A  1 83  ? 83.486 -29.973 17.911   1.00 16.39 ? 83  VAL A C   1 
ATOM   683   O  O   . VAL A  1 83  ? 83.723 -29.801 19.114   1.00 16.56 ? 83  VAL A O   1 
ATOM   684   C  CB  . VAL A  1 83  ? 82.923 -32.245 16.958   1.00 14.64 ? 83  VAL A CB  1 
ATOM   685   C  CG1 . VAL A  1 83  ? 83.953 -32.778 17.945   1.00 14.17 ? 83  VAL A CG1 1 
ATOM   686   C  CG2 . VAL A  1 83  ? 81.799 -33.259 16.752   1.00 13.12 ? 83  VAL A CG2 1 
ATOM   687   N  N   . LYS A  1 84  ? 84.192 -29.375 16.962   1.00 15.55 ? 84  LYS A N   1 
ATOM   688   C  CA  . LYS A  1 84  ? 85.289 -28.481 17.312   1.00 17.47 ? 84  LYS A CA  1 
ATOM   689   C  C   . LYS A  1 84  ? 84.797 -27.302 18.147   1.00 18.17 ? 84  LYS A C   1 
ATOM   690   O  O   . LYS A  1 84  ? 85.464 -26.879 19.101   1.00 19.45 ? 84  LYS A O   1 
ATOM   691   C  CB  . LYS A  1 84  ? 85.998 -27.979 16.057   1.00 16.84 ? 84  LYS A CB  1 
ATOM   692   C  CG  . LYS A  1 84  ? 86.847 -29.026 15.356   1.00 17.94 ? 84  LYS A CG  1 
ATOM   693   C  CD  . LYS A  1 84  ? 87.593 -28.380 14.202   1.00 22.69 ? 84  LYS A CD  1 
ATOM   694   C  CE  . LYS A  1 84  ? 88.181 -29.412 13.254   1.00 23.24 ? 84  LYS A CE  1 
ATOM   695   N  NZ  . LYS A  1 84  ? 88.904 -28.732 12.144   1.00 26.28 ? 84  LYS A NZ  1 
ATOM   696   N  N   . ALA A  1 85  ? 83.631 -26.775 17.785   1.00 16.17 ? 85  ALA A N   1 
ATOM   697   C  CA  . ALA A  1 85  ? 83.067 -25.613 18.474   1.00 19.40 ? 85  ALA A CA  1 
ATOM   698   C  C   . ALA A  1 85  ? 82.481 -25.922 19.855   1.00 18.65 ? 85  ALA A C   1 
ATOM   699   O  O   . ALA A  1 85  ? 82.300 -25.014 20.661   1.00 20.36 ? 85  ALA A O   1 
ATOM   700   C  CB  . ALA A  1 85  ? 82.018 -24.940 17.596   1.00 17.99 ? 85  ALA A CB  1 
ATOM   701   N  N   . THR A  1 86  ? 82.194 -27.191 20.134   1.00 17.32 ? 86  THR A N   1 
ATOM   702   C  CA  . THR A  1 86  ? 81.460 -27.539 21.355   1.00 17.04 ? 86  THR A CA  1 
ATOM   703   C  C   . THR A  1 86  ? 82.168 -28.545 22.258   1.00 18.43 ? 86  THR A C   1 
ATOM   704   O  O   . THR A  1 86  ? 81.971 -28.526 23.472   1.00 17.24 ? 86  THR A O   1 
ATOM   705   C  CB  . THR A  1 86  ? 80.075 -28.135 21.026   1.00 17.18 ? 86  THR A CB  1 
ATOM   706   O  OG1 . THR A  1 86  ? 80.253 -29.371 20.334   1.00 15.95 ? 86  THR A OG1 1 
ATOM   707   C  CG2 . THR A  1 86  ? 79.260 -27.195 20.156   1.00 15.01 ? 86  THR A CG2 1 
ATOM   708   N  N   . GLY A  1 87  ? 82.955 -29.448 21.673   1.00 16.22 ? 87  GLY A N   1 
ATOM   709   C  CA  . GLY A  1 87  ? 83.576 -30.523 22.453   1.00 15.75 ? 87  GLY A CA  1 
ATOM   710   C  C   . GLY A  1 87  ? 82.705 -31.759 22.677   1.00 15.11 ? 87  GLY A C   1 
ATOM   711   O  O   . GLY A  1 87  ? 83.101 -32.676 23.391   1.00 17.02 ? 87  GLY A O   1 
ATOM   712   N  N   . ILE A  1 88  ? 81.525 -31.796 22.065   1.00 14.58 ? 88  ILE A N   1 
ATOM   713   C  CA  . ILE A  1 88  ? 80.588 -32.918 22.232   1.00 15.21 ? 88  ILE A CA  1 
ATOM   714   C  C   . ILE A  1 88  ? 81.144 -34.230 21.659   1.00 16.91 ? 88  ILE A C   1 
ATOM   715   O  O   . ILE A  1 88  ? 81.868 -34.213 20.660   1.00 17.10 ? 88  ILE A O   1 
ATOM   716   C  CB  . ILE A  1 88  ? 79.240 -32.609 21.534   1.00 14.85 ? 88  ILE A CB  1 
ATOM   717   C  CG1 . ILE A  1 88  ? 78.148 -33.590 21.965   1.00 15.32 ? 88  ILE A CG1 1 
ATOM   718   C  CG2 . ILE A  1 88  ? 79.388 -32.638 20.014   1.00 14.16 ? 88  ILE A CG2 1 
ATOM   719   C  CD1 . ILE A  1 88  ? 77.714 -33.433 23.409   1.00 14.38 ? 88  ILE A CD1 1 
ATOM   720   N  N   . ASN A  1 89  ? 80.811 -35.358 22.293   1.00 16.01 ? 89  ASN A N   1 
ATOM   721   C  CA  . ASN A  1 89  ? 81.006 -36.667 21.674   1.00 16.16 ? 89  ASN A CA  1 
ATOM   722   C  C   . ASN A  1 89  ? 79.867 -36.835 20.689   1.00 15.36 ? 89  ASN A C   1 
ATOM   723   O  O   . ASN A  1 89  ? 78.705 -36.797 21.083   1.00 17.31 ? 89  ASN A O   1 
ATOM   724   C  CB  . ASN A  1 89  ? 80.936 -37.806 22.701   1.00 15.30 ? 89  ASN A CB  1 
ATOM   725   C  CG  . ASN A  1 89  ? 82.146 -37.860 23.618   1.00 17.06 ? 89  ASN A CG  1 
ATOM   726   O  OD1 . ASN A  1 89  ? 83.177 -37.243 23.355   1.00 18.20 ? 89  ASN A OD1 1 
ATOM   727   N  ND2 . ASN A  1 89  ? 82.018 -38.608 24.709   1.00 17.64 ? 89  ASN A ND2 1 
ATOM   728   N  N   . LEU A  1 90  ? 80.186 -37.001 19.412   1.00 15.27 ? 90  LEU A N   1 
ATOM   729   C  CA  . LEU A  1 90  ? 79.143 -37.115 18.391   1.00 14.56 ? 90  LEU A CA  1 
ATOM   730   C  C   . LEU A  1 90  ? 79.304 -38.423 17.641   1.00 14.58 ? 90  LEU A C   1 
ATOM   731   O  O   . LEU A  1 90  ? 80.361 -38.683 17.059   1.00 14.35 ? 90  LEU A O   1 
ATOM   732   C  CB  . LEU A  1 90  ? 79.209 -35.936 17.413   1.00 13.64 ? 90  LEU A CB  1 
ATOM   733   C  CG  . LEU A  1 90  ? 78.121 -35.835 16.330   1.00 15.46 ? 90  LEU A CG  1 
ATOM   734   C  CD1 . LEU A  1 90  ? 76.773 -35.507 16.953   1.00 15.90 ? 90  LEU A CD1 1 
ATOM   735   C  CD2 . LEU A  1 90  ? 78.496 -34.770 15.302   1.00 13.90 ? 90  LEU A CD2 1 
ATOM   736   N  N   . VAL A  1 91  ? 78.265 -39.257 17.661   1.00 14.88 ? 91  VAL A N   1 
ATOM   737   C  CA  . VAL A  1 91  ? 78.300 -40.502 16.894   1.00 13.05 ? 91  VAL A CA  1 
ATOM   738   C  C   . VAL A  1 91  ? 77.552 -40.301 15.582   1.00 15.76 ? 91  VAL A C   1 
ATOM   739   O  O   . VAL A  1 91  ? 76.355 -39.987 15.582   1.00 13.94 ? 91  VAL A O   1 
ATOM   740   C  CB  . VAL A  1 91  ? 77.683 -41.694 17.662   1.00 14.84 ? 91  VAL A CB  1 
ATOM   741   C  CG1 . VAL A  1 91  ? 77.991 -43.004 16.935   1.00 15.13 ? 91  VAL A CG1 1 
ATOM   742   C  CG2 . VAL A  1 91  ? 78.209 -41.748 19.097   1.00 13.55 ? 91  VAL A CG2 1 
ATOM   743   N  N   . ALA A  1 92  ? 78.266 -40.468 14.473   1.00 14.07 ? 92  ALA A N   1 
ATOM   744   C  CA  . ALA A  1 92  ? 77.677 -40.377 13.144   1.00 14.57 ? 92  ALA A CA  1 
ATOM   745   C  C   . ALA A  1 92  ? 77.353 -41.773 12.658   1.00 17.06 ? 92  ALA A C   1 
ATOM   746   O  O   . ALA A  1 92  ? 77.954 -42.750 13.112   1.00 15.93 ? 92  ALA A O   1 
ATOM   747   C  CB  . ALA A  1 92  ? 78.633 -39.695 12.172   1.00 13.55 ? 92  ALA A CB  1 
ATOM   748   N  N   . GLY A  1 93  ? 76.416 -41.863 11.719   1.00 15.60 ? 93  GLY A N   1 
ATOM   749   C  CA  . GLY A  1 93  ? 75.998 -43.156 11.207   1.00 17.22 ? 93  GLY A CA  1 
ATOM   750   C  C   . GLY A  1 93  ? 76.071 -43.243 9.700    1.00 14.79 ? 93  GLY A C   1 
ATOM   751   O  O   . GLY A  1 93  ? 76.452 -42.285 9.022    1.00 16.64 ? 93  GLY A O   1 
ATOM   752   N  N   . THR A  1 94  ? 75.732 -44.413 9.180    1.00 13.36 ? 94  THR A N   1 
ATOM   753   C  CA  . THR A  1 94  ? 75.583 -44.604 7.750    1.00 12.15 ? 94  THR A CA  1 
ATOM   754   C  C   . THR A  1 94  ? 74.191 -45.180 7.577    1.00 13.64 ? 94  THR A C   1 
ATOM   755   O  O   . THR A  1 94  ? 73.489 -45.409 8.557    1.00 12.74 ? 94  THR A O   1 
ATOM   756   C  CB  . THR A  1 94  ? 76.654 -45.563 7.169    1.00 12.72 ? 94  THR A CB  1 
ATOM   757   O  OG1 . THR A  1 94  ? 76.485 -45.670 5.749    1.00 12.88 ? 94  THR A OG1 1 
ATOM   758   C  CG2 . THR A  1 94  ? 76.539 -46.959 7.788    1.00 12.15 ? 94  THR A CG2 1 
ATOM   759   N  N   . GLY A  1 95  ? 73.791 -45.409 6.336    1.00 15.13 ? 95  GLY A N   1 
ATOM   760   C  CA  . GLY A  1 95  ? 72.468 -45.936 6.068    1.00 14.52 ? 95  GLY A CA  1 
ATOM   761   C  C   . GLY A  1 95  ? 71.773 -45.132 4.991    1.00 14.58 ? 95  GLY A C   1 
ATOM   762   O  O   . GLY A  1 95  ? 72.368 -44.243 4.365    1.00 15.25 ? 95  GLY A O   1 
ATOM   763   N  N   . ILE A  1 96  ? 70.508 -45.458 4.778    1.00 14.77 ? 96  ILE A N   1 
ATOM   764   C  CA  . ILE A  1 96  ? 69.692 -44.815 3.771    1.00 14.25 ? 96  ILE A CA  1 
ATOM   765   C  C   . ILE A  1 96  ? 68.323 -44.545 4.359    1.00 15.09 ? 96  ILE A C   1 
ATOM   766   O  O   . ILE A  1 96  ? 67.699 -45.429 4.960    1.00 19.26 ? 96  ILE A O   1 
ATOM   767   C  CB  . ILE A  1 96  ? 69.547 -45.697 2.521    1.00 15.40 ? 96  ILE A CB  1 
ATOM   768   C  CG1 . ILE A  1 96  ? 70.847 -45.684 1.707    1.00 15.67 ? 96  ILE A CG1 1 
ATOM   769   C  CG2 . ILE A  1 96  ? 68.365 -45.239 1.670    1.00 14.22 ? 96  ILE A CG2 1 
ATOM   770   C  CD1 . ILE A  1 96  ? 70.882 -46.719 0.593    1.00 14.45 ? 96  ILE A CD1 1 
ATOM   771   N  N   . TYR A  1 97  ? 67.855 -43.317 4.183    1.00 16.40 ? 97  TYR A N   1 
ATOM   772   C  CA  . TYR A  1 97  ? 66.551 -42.915 4.676    1.00 15.52 ? 97  TYR A CA  1 
ATOM   773   C  C   . TYR A  1 97  ? 65.621 -42.716 3.477    1.00 15.80 ? 97  TYR A C   1 
ATOM   774   O  O   . TYR A  1 97  ? 65.719 -41.708 2.770    1.00 14.31 ? 97  TYR A O   1 
ATOM   775   C  CB  . TYR A  1 97  ? 66.711 -41.620 5.477    1.00 16.71 ? 97  TYR A CB  1 
ATOM   776   C  CG  . TYR A  1 97  ? 65.470 -41.084 6.164    1.00 16.77 ? 97  TYR A CG  1 
ATOM   777   C  CD1 . TYR A  1 97  ? 64.530 -40.341 5.462    1.00 20.92 ? 97  TYR A CD1 1 
ATOM   778   C  CD2 . TYR A  1 97  ? 65.270 -41.273 7.527    1.00 19.91 ? 97  TYR A CD2 1 
ATOM   779   C  CE1 . TYR A  1 97  ? 63.411 -39.828 6.087    1.00 23.25 ? 97  TYR A CE1 1 
ATOM   780   C  CE2 . TYR A  1 97  ? 64.149 -40.771 8.165    1.00 19.90 ? 97  TYR A CE2 1 
ATOM   781   C  CZ  . TYR A  1 97  ? 63.225 -40.045 7.443    1.00 26.07 ? 97  TYR A CZ  1 
ATOM   782   O  OH  . TYR A  1 97  ? 62.110 -39.528 8.070    1.00 25.40 ? 97  TYR A OH  1 
ATOM   783   N  N   . ILE A  1 98  ? 64.751 -43.698 3.230    1.00 15.11 ? 98  ILE A N   1 
ATOM   784   C  CA  . ILE A  1 98  ? 63.729 -43.589 2.188    1.00 17.50 ? 98  ILE A CA  1 
ATOM   785   C  C   . ILE A  1 98  ? 62.370 -44.052 2.710    1.00 18.38 ? 98  ILE A C   1 
ATOM   786   O  O   . ILE A  1 98  ? 62.299 -44.803 3.687    1.00 17.66 ? 98  ILE A O   1 
ATOM   787   C  CB  . ILE A  1 98  ? 64.082 -44.404 0.918    1.00 16.20 ? 98  ILE A CB  1 
ATOM   788   C  CG1 . ILE A  1 98  ? 64.350 -45.871 1.271    1.00 14.84 ? 98  ILE A CG1 1 
ATOM   789   C  CG2 . ILE A  1 98  ? 65.283 -43.797 0.200    1.00 14.88 ? 98  ILE A CG2 1 
ATOM   790   C  CD1 . ILE A  1 98  ? 64.115 -46.832 0.121    1.00 16.87 ? 98  ILE A CD1 1 
ATOM   791   N  N   . TYR A  1 99  ? 61.296 -43.598 2.064    1.00 18.22 ? 99  TYR A N   1 
ATOM   792   C  CA  . TYR A  1 99  ? 59.939 -44.058 2.403    1.00 17.97 ? 99  TYR A CA  1 
ATOM   793   C  C   . TYR A  1 99  ? 59.327 -44.935 1.317    1.00 18.70 ? 99  TYR A C   1 
ATOM   794   O  O   . TYR A  1 99  ? 58.438 -45.741 1.591    1.00 17.93 ? 99  TYR A O   1 
ATOM   795   C  CB  . TYR A  1 99  ? 58.990 -42.879 2.626    1.00 20.01 ? 99  TYR A CB  1 
ATOM   796   C  CG  . TYR A  1 99  ? 59.238 -42.023 3.844    1.00 25.68 ? 99  TYR A CG  1 
ATOM   797   C  CD1 . TYR A  1 99  ? 60.213 -42.345 4.787    1.00 23.77 ? 99  TYR A CD1 1 
ATOM   798   C  CD2 . TYR A  1 99  ? 58.458 -40.893 4.068    1.00 27.62 ? 99  TYR A CD2 1 
ATOM   799   C  CE1 . TYR A  1 99  ? 60.418 -41.542 5.903    1.00 22.70 ? 99  TYR A CE1 1 
ATOM   800   C  CE2 . TYR A  1 99  ? 58.650 -40.095 5.174    1.00 26.06 ? 99  TYR A CE2 1 
ATOM   801   C  CZ  . TYR A  1 99  ? 59.625 -40.415 6.086    1.00 28.67 ? 99  TYR A CZ  1 
ATOM   802   O  OH  . TYR A  1 99  ? 59.782 -39.589 7.176    1.00 23.45 ? 99  TYR A OH  1 
ATOM   803   N  N   . ILE A  1 100 ? 59.763 -44.753 0.074    1.00 18.12 ? 100 ILE A N   1 
ATOM   804   C  CA  . ILE A  1 100 ? 59.161 -45.494 -1.034   1.00 18.76 ? 100 ILE A CA  1 
ATOM   805   C  C   . ILE A  1 100 ? 60.205 -46.202 -1.892   1.00 21.42 ? 100 ILE A C   1 
ATOM   806   O  O   . ILE A  1 100 ? 60.401 -47.407 -1.754   1.00 21.70 ? 100 ILE A O   1 
ATOM   807   C  CB  . ILE A  1 100 ? 58.275 -44.597 -1.923   1.00 22.67 ? 100 ILE A CB  1 
ATOM   808   C  CG1 . ILE A  1 100 ? 57.234 -43.862 -1.067   1.00 20.62 ? 100 ILE A CG1 1 
ATOM   809   C  CG2 . ILE A  1 100 ? 57.604 -45.444 -3.002   1.00 20.05 ? 100 ILE A CG2 1 
ATOM   810   C  CD1 . ILE A  1 100 ? 56.394 -42.862 -1.831   1.00 27.12 ? 100 ILE A CD1 1 
ATOM   811   N  N   . ASP A  1 101 ? 60.872 -45.453 -2.770   1.00 18.00 ? 101 ASP A N   1 
ATOM   812   C  CA  . ASP A  1 101 ? 61.877 -46.037 -3.655   1.00 18.47 ? 101 ASP A CA  1 
ATOM   813   C  C   . ASP A  1 101 ? 63.269 -45.491 -3.382   1.00 17.08 ? 101 ASP A C   1 
ATOM   814   O  O   . ASP A  1 101 ? 63.434 -44.382 -2.860   1.00 16.75 ? 101 ASP A O   1 
ATOM   815   C  CB  . ASP A  1 101 ? 61.518 -45.807 -5.133   1.00 23.59 ? 101 ASP A CB  1 
ATOM   816   C  CG  . ASP A  1 101 ? 60.324 -46.648 -5.594   1.00 31.36 ? 101 ASP A CG  1 
ATOM   817   O  OD1 . ASP A  1 101 ? 59.877 -47.538 -4.838   1.00 30.73 ? 101 ASP A OD1 1 
ATOM   818   O  OD2 . ASP A  1 101 ? 59.832 -46.417 -6.718   1.00 35.15 ? 101 ASP A OD2 1 
ATOM   819   N  N   . LEU A  1 102 ? 64.269 -46.285 -3.741   1.00 15.16 ? 102 LEU A N   1 
ATOM   820   C  CA  . LEU A  1 102 ? 65.664 -45.855 -3.693   1.00 15.51 ? 102 LEU A CA  1 
ATOM   821   C  C   . LEU A  1 102 ? 65.944 -44.864 -4.813   1.00 15.72 ? 102 LEU A C   1 
ATOM   822   O  O   . LEU A  1 102 ? 65.209 -44.812 -5.797   1.00 15.12 ? 102 LEU A O   1 
ATOM   823   C  CB  . LEU A  1 102 ? 66.588 -47.068 -3.860   1.00 14.55 ? 102 LEU A CB  1 
ATOM   824   C  CG  . LEU A  1 102 ? 66.789 -47.954 -2.627   1.00 16.72 ? 102 LEU A CG  1 
ATOM   825   C  CD1 . LEU A  1 102 ? 67.249 -49.347 -3.047   1.00 17.56 ? 102 LEU A CD1 1 
ATOM   826   C  CD2 . LEU A  1 102 ? 67.798 -47.316 -1.683   1.00 13.47 ? 102 LEU A CD2 1 
ATOM   827   N  N   . PRO A  1 103 ? 67.004 -44.061 -4.662   1.00 15.98 ? 103 PRO A N   1 
ATOM   828   C  CA  . PRO A  1 103 ? 67.486 -43.244 -5.767   1.00 15.49 ? 103 PRO A CA  1 
ATOM   829   C  C   . PRO A  1 103 ? 67.741 -44.115 -7.001   1.00 18.02 ? 103 PRO A C   1 
ATOM   830   O  O   . PRO A  1 103 ? 68.058 -45.305 -6.876   1.00 15.70 ? 103 PRO A O   1 
ATOM   831   C  CB  . PRO A  1 103 ? 68.821 -42.702 -5.238   1.00 14.48 ? 103 PRO A CB  1 
ATOM   832   C  CG  . PRO A  1 103 ? 68.638 -42.650 -3.753   1.00 14.31 ? 103 PRO A CG  1 
ATOM   833   C  CD  . PRO A  1 103 ? 67.738 -43.805 -3.406   1.00 14.28 ? 103 PRO A CD  1 
ATOM   834   N  N   . PHE A  1 104 ? 67.620 -43.519 -8.182   1.00 17.21 ? 104 PHE A N   1 
ATOM   835   C  CA  . PHE A  1 104 ? 67.833 -44.226 -9.440   1.00 19.54 ? 104 PHE A CA  1 
ATOM   836   C  C   . PHE A  1 104 ? 69.171 -44.963 -9.519   1.00 17.79 ? 104 PHE A C   1 
ATOM   837   O  O   . PHE A  1 104 ? 69.280 -45.988 -10.195  1.00 17.30 ? 104 PHE A O   1 
ATOM   838   C  CB  . PHE A  1 104 ? 67.689 -43.257 -10.620  1.00 23.18 ? 104 PHE A CB  1 
ATOM   839   C  CG  . PHE A  1 104 ? 66.360 -42.555 -10.658  1.00 29.02 ? 104 PHE A CG  1 
ATOM   840   C  CD1 . PHE A  1 104 ? 65.174 -43.278 -10.583  1.00 29.10 ? 104 PHE A CD1 1 
ATOM   841   C  CD2 . PHE A  1 104 ? 66.290 -41.177 -10.778  1.00 29.33 ? 104 PHE A CD2 1 
ATOM   842   C  CE1 . PHE A  1 104 ? 63.945 -42.638 -10.622  1.00 32.94 ? 104 PHE A CE1 1 
ATOM   843   C  CE2 . PHE A  1 104 ? 65.064 -40.531 -10.819  1.00 34.02 ? 104 PHE A CE2 1 
ATOM   844   C  CZ  . PHE A  1 104 ? 63.891 -41.264 -10.737  1.00 27.01 ? 104 PHE A CZ  1 
ATOM   845   N  N   . TYR A  1 105 ? 70.187 -44.445 -8.833   1.00 19.49 ? 105 TYR A N   1 
ATOM   846   C  CA  . TYR A  1 105 ? 71.490 -45.112 -8.780   1.00 17.43 ? 105 TYR A CA  1 
ATOM   847   C  C   . TYR A  1 105 ? 71.331 -46.615 -8.526   1.00 18.01 ? 105 TYR A C   1 
ATOM   848   O  O   . TYR A  1 105 ? 72.063 -47.441 -9.082   1.00 16.50 ? 105 TYR A O   1 
ATOM   849   C  CB  . TYR A  1 105 ? 72.385 -44.486 -7.690   1.00 17.38 ? 105 TYR A CB  1 
ATOM   850   C  CG  . TYR A  1 105 ? 73.645 -45.290 -7.435   1.00 20.47 ? 105 TYR A CG  1 
ATOM   851   C  CD1 . TYR A  1 105 ? 74.756 -45.157 -8.263   1.00 20.22 ? 105 TYR A CD1 1 
ATOM   852   C  CD2 . TYR A  1 105 ? 73.716 -46.209 -6.386   1.00 18.13 ? 105 TYR A CD2 1 
ATOM   853   C  CE1 . TYR A  1 105 ? 75.903 -45.898 -8.046   1.00 19.46 ? 105 TYR A CE1 1 
ATOM   854   C  CE2 . TYR A  1 105 ? 74.863 -46.962 -6.169   1.00 17.65 ? 105 TYR A CE2 1 
ATOM   855   C  CZ  . TYR A  1 105 ? 75.952 -46.798 -7.004   1.00 22.75 ? 105 TYR A CZ  1 
ATOM   856   O  OH  . TYR A  1 105 ? 77.099 -47.538 -6.810   1.00 24.69 ? 105 TYR A OH  1 
ATOM   857   N  N   . PHE A  1 106 ? 70.367 -46.967 -7.685   1.00 18.26 ? 106 PHE A N   1 
ATOM   858   C  CA  . PHE A  1 106 ? 70.248 -48.343 -7.204   1.00 18.49 ? 106 PHE A CA  1 
ATOM   859   C  C   . PHE A  1 106 ? 69.465 -49.275 -8.129   1.00 21.26 ? 106 PHE A C   1 
ATOM   860   O  O   . PHE A  1 106 ? 69.313 -50.464 -7.835   1.00 23.41 ? 106 PHE A O   1 
ATOM   861   C  CB  . PHE A  1 106 ? 69.654 -48.356 -5.795   1.00 17.75 ? 106 PHE A CB  1 
ATOM   862   C  CG  . PHE A  1 106 ? 70.538 -47.704 -4.770   1.00 18.62 ? 106 PHE A CG  1 
ATOM   863   C  CD1 . PHE A  1 106 ? 70.336 -46.383 -4.401   1.00 17.43 ? 106 PHE A CD1 1 
ATOM   864   C  CD2 . PHE A  1 106 ? 71.584 -48.407 -4.192   1.00 18.81 ? 106 PHE A CD2 1 
ATOM   865   C  CE1 . PHE A  1 106 ? 71.155 -45.775 -3.459   1.00 17.97 ? 106 PHE A CE1 1 
ATOM   866   C  CE2 . PHE A  1 106 ? 72.406 -47.807 -3.249   1.00 18.98 ? 106 PHE A CE2 1 
ATOM   867   C  CZ  . PHE A  1 106 ? 72.192 -46.490 -2.884   1.00 16.58 ? 106 PHE A CZ  1 
ATOM   868   N  N   . LEU A  1 107 ? 68.975 -48.740 -9.242   1.00 20.70 ? 107 LEU A N   1 
ATOM   869   C  CA  . LEU A  1 107 ? 68.357 -49.576 -10.268  1.00 22.94 ? 107 LEU A CA  1 
ATOM   870   C  C   . LEU A  1 107 ? 69.292 -50.708 -10.666  1.00 24.35 ? 107 LEU A C   1 
ATOM   871   O  O   . LEU A  1 107 ? 70.433 -50.467 -11.074  1.00 22.30 ? 107 LEU A O   1 
ATOM   872   C  CB  . LEU A  1 107 ? 68.009 -48.745 -11.501  1.00 26.81 ? 107 LEU A CB  1 
ATOM   873   C  CG  . LEU A  1 107 ? 66.541 -48.403 -11.746  1.00 34.13 ? 107 LEU A CG  1 
ATOM   874   C  CD1 . LEU A  1 107 ? 65.727 -48.441 -10.462  1.00 38.02 ? 107 LEU A CD1 1 
ATOM   875   C  CD2 . LEU A  1 107 ? 66.428 -47.052 -12.437  1.00 32.42 ? 107 LEU A CD2 1 
ATOM   876   N  N   . ASN A  1 108 ? 68.802 -51.940 -10.547  1.00 22.65 ? 108 ASN A N   1 
ATOM   877   C  CA  . ASN A  1 108 ? 69.576 -53.128 -10.903  1.00 26.06 ? 108 ASN A CA  1 
ATOM   878   C  C   . ASN A  1 108 ? 70.848 -53.313 -10.079  1.00 28.54 ? 108 ASN A C   1 
ATOM   879   O  O   . ASN A  1 108 ? 71.832 -53.858 -10.577  1.00 29.46 ? 108 ASN A O   1 
ATOM   880   C  CB  . ASN A  1 108 ? 69.926 -53.124 -12.396  1.00 28.56 ? 108 ASN A CB  1 
ATOM   881   C  CG  . ASN A  1 108 ? 68.712 -53.318 -13.277  1.00 33.87 ? 108 ASN A CG  1 
ATOM   882   O  OD1 . ASN A  1 108 ? 68.364 -52.448 -14.074  1.00 36.04 ? 108 ASN A OD1 1 
ATOM   883   N  ND2 . ASN A  1 108 ? 68.049 -54.456 -13.126  1.00 31.66 ? 108 ASN A ND2 1 
ATOM   884   N  N   . ARG A  1 109 ? 70.837 -52.849 -8.832   1.00 22.26 ? 109 ARG A N   1 
ATOM   885   C  CA  . ARG A  1 109 ? 71.936 -53.135 -7.913   1.00 24.11 ? 109 ARG A CA  1 
ATOM   886   C  C   . ARG A  1 109 ? 71.456 -54.044 -6.782   1.00 24.52 ? 109 ARG A C   1 
ATOM   887   O  O   . ARG A  1 109 ? 70.313 -53.949 -6.341   1.00 24.18 ? 109 ARG A O   1 
ATOM   888   C  CB  . ARG A  1 109 ? 72.551 -51.846 -7.355   1.00 21.13 ? 109 ARG A CB  1 
ATOM   889   C  CG  . ARG A  1 109 ? 73.176 -50.960 -8.423   1.00 22.74 ? 109 ARG A CG  1 
ATOM   890   C  CD  . ARG A  1 109 ? 74.035 -49.860 -7.819   1.00 21.09 ? 109 ARG A CD  1 
ATOM   891   N  NE  . ARG A  1 109 ? 74.519 -48.936 -8.845   1.00 24.22 ? 109 ARG A NE  1 
ATOM   892   C  CZ  . ARG A  1 109 ? 75.618 -49.134 -9.567   1.00 25.76 ? 109 ARG A CZ  1 
ATOM   893   N  NH1 . ARG A  1 109 ? 75.989 -48.242 -10.478  1.00 27.66 ? 109 ARG A NH1 1 
ATOM   894   N  NH2 . ARG A  1 109 ? 76.348 -50.226 -9.380   1.00 24.44 ? 109 ARG A NH2 1 
ATOM   895   N  N   . SER A  1 110 ? 72.338 -54.920 -6.317   1.00 22.53 ? 110 SER A N   1 
ATOM   896   C  CA  . SER A  1 110 ? 71.970 -55.915 -5.319   1.00 23.45 ? 110 SER A CA  1 
ATOM   897   C  C   . SER A  1 110 ? 71.899 -55.339 -3.908   1.00 24.05 ? 110 SER A C   1 
ATOM   898   O  O   . SER A  1 110 ? 72.400 -54.246 -3.633   1.00 21.54 ? 110 SER A O   1 
ATOM   899   C  CB  . SER A  1 110 ? 72.977 -57.062 -5.329   1.00 24.25 ? 110 SER A CB  1 
ATOM   900   O  OG  . SER A  1 110 ? 74.242 -56.601 -4.885   1.00 25.76 ? 110 SER A OG  1 
ATOM   901   N  N   . ILE A  1 111 ? 71.277 -56.093 -3.013   1.00 21.75 ? 111 ILE A N   1 
ATOM   902   C  CA  . ILE A  1 111 ? 71.298 -55.762 -1.597   1.00 23.05 ? 111 ILE A CA  1 
ATOM   903   C  C   . ILE A  1 111 ? 72.737 -55.717 -1.083   1.00 21.92 ? 111 ILE A C   1 
ATOM   904   O  O   . ILE A  1 111 ? 73.070 -54.897 -0.231   1.00 20.39 ? 111 ILE A O   1 
ATOM   905   C  CB  . ILE A  1 111 ? 70.451 -56.761 -0.783   1.00 25.50 ? 111 ILE A CB  1 
ATOM   906   C  CG1 . ILE A  1 111 ? 68.968 -56.605 -1.157   1.00 22.26 ? 111 ILE A CG1 1 
ATOM   907   C  CG2 . ILE A  1 111 ? 70.668 -56.555 0.710    1.00 25.27 ? 111 ILE A CG2 1 
ATOM   908   C  CD1 . ILE A  1 111 ? 68.064 -57.699 -0.629   1.00 24.95 ? 111 ILE A CD1 1 
ATOM   909   N  N   . ASP A  1 112 ? 73.595 -56.587 -1.616   1.00 24.95 ? 112 ASP A N   1 
ATOM   910   C  CA  . ASP A  1 112 ? 75.008 -56.603 -1.223   1.00 23.47 ? 112 ASP A CA  1 
ATOM   911   C  C   . ASP A  1 112 ? 75.717 -55.290 -1.549   1.00 23.41 ? 112 ASP A C   1 
ATOM   912   O  O   . ASP A  1 112 ? 76.515 -54.797 -0.755   1.00 20.65 ? 112 ASP A O   1 
ATOM   913   C  CB  . ASP A  1 112 ? 75.758 -57.761 -1.891   1.00 26.60 ? 112 ASP A CB  1 
ATOM   914   C  CG  . ASP A  1 112 ? 75.430 -59.106 -1.273   1.00 34.91 ? 112 ASP A CG  1 
ATOM   915   O  OD1 . ASP A  1 112 ? 75.765 -60.137 -1.888   1.00 48.70 ? 112 ASP A OD1 1 
ATOM   916   O  OD2 . ASP A  1 112 ? 74.841 -59.137 -0.173   1.00 37.77 ? 112 ASP A OD2 1 
ATOM   917   N  N   . GLU A  1 113 ? 75.449 -54.732 -2.726   1.00 21.51 ? 113 GLU A N   1 
ATOM   918   C  CA  . GLU A  1 113 ? 76.066 -53.462 -3.098   1.00 20.44 ? 113 GLU A CA  1 
ATOM   919   C  C   . GLU A  1 113 ? 75.652 -52.361 -2.136   1.00 19.12 ? 113 GLU A C   1 
ATOM   920   O  O   . GLU A  1 113 ? 76.448 -51.478 -1.815   1.00 19.40 ? 113 GLU A O   1 
ATOM   921   C  CB  . GLU A  1 113 ? 75.684 -53.056 -4.518   1.00 21.87 ? 113 GLU A CB  1 
ATOM   922   C  CG  . GLU A  1 113 ? 76.252 -53.942 -5.606   1.00 24.50 ? 113 GLU A CG  1 
ATOM   923   C  CD  . GLU A  1 113 ? 75.874 -53.432 -6.980   1.00 26.21 ? 113 GLU A CD  1 
ATOM   924   O  OE1 . GLU A  1 113 ? 75.100 -54.112 -7.671   1.00 28.79 ? 113 GLU A OE1 1 
ATOM   925   O  OE2 . GLU A  1 113 ? 76.324 -52.328 -7.351   1.00 32.61 ? 113 GLU A OE2 1 
ATOM   926   N  N   . ILE A  1 114 ? 74.398 -52.402 -1.697   1.00 19.30 ? 114 ILE A N   1 
ATOM   927   C  CA  . ILE A  1 114 ? 73.908 -51.420 -0.732   1.00 18.39 ? 114 ILE A CA  1 
ATOM   928   C  C   . ILE A  1 114 ? 74.665 -51.581 0.578    1.00 17.65 ? 114 ILE A C   1 
ATOM   929   O  O   . ILE A  1 114 ? 75.185 -50.614 1.132    1.00 17.60 ? 114 ILE A O   1 
ATOM   930   C  CB  . ILE A  1 114 ? 72.390 -51.549 -0.504   1.00 16.99 ? 114 ILE A CB  1 
ATOM   931   C  CG1 . ILE A  1 114 ? 71.636 -51.326 -1.821   1.00 16.28 ? 114 ILE A CG1 1 
ATOM   932   C  CG2 . ILE A  1 114 ? 71.912 -50.555 0.549    1.00 14.05 ? 114 ILE A CG2 1 
ATOM   933   C  CD1 . ILE A  1 114 ? 70.146 -51.594 -1.720   1.00 17.59 ? 114 ILE A CD1 1 
ATOM   934   N  N   . ALA A  1 115 ? 74.754 -52.817 1.057    1.00 19.67 ? 115 ALA A N   1 
ATOM   935   C  CA  . ALA A  1 115 ? 75.470 -53.091 2.297    1.00 20.59 ? 115 ALA A CA  1 
ATOM   936   C  C   . ALA A  1 115 ? 76.926 -52.629 2.220    1.00 17.81 ? 115 ALA A C   1 
ATOM   937   O  O   . ALA A  1 115 ? 77.477 -52.127 3.198    1.00 18.74 ? 115 ALA A O   1 
ATOM   938   C  CB  . ALA A  1 115 ? 75.393 -54.571 2.634    1.00 14.54 ? 115 ALA A CB  1 
ATOM   939   N  N   . ASP A  1 116 ? 77.550 -52.818 1.061    1.00 17.24 ? 116 ASP A N   1 
ATOM   940   C  CA  . ASP A  1 116 ? 78.931 -52.385 0.854    1.00 19.14 ? 116 ASP A CA  1 
ATOM   941   C  C   . ASP A  1 116 ? 79.137 -50.896 1.122    1.00 17.16 ? 116 ASP A C   1 
ATOM   942   O  O   . ASP A  1 116 ? 80.191 -50.489 1.605    1.00 16.45 ? 116 ASP A O   1 
ATOM   943   C  CB  . ASP A  1 116 ? 79.393 -52.707 -0.567   1.00 20.74 ? 116 ASP A CB  1 
ATOM   944   C  CG  . ASP A  1 116 ? 79.627 -54.189 -0.781   1.00 27.43 ? 116 ASP A CG  1 
ATOM   945   O  OD1 . ASP A  1 116 ? 79.716 -54.614 -1.953   1.00 27.42 ? 116 ASP A OD1 1 
ATOM   946   O  OD2 . ASP A  1 116 ? 79.718 -54.925 0.224    1.00 27.61 ? 116 ASP A OD2 1 
ATOM   947   N  N   . LEU A  1 117 ? 78.142 -50.082 0.781    1.00 16.96 ? 117 LEU A N   1 
ATOM   948   C  CA  . LEU A  1 117 ? 78.212 -48.655 1.060    1.00 15.46 ? 117 LEU A CA  1 
ATOM   949   C  C   . LEU A  1 117 ? 78.267 -48.426 2.558    1.00 15.70 ? 117 LEU A C   1 
ATOM   950   O  O   . LEU A  1 117 ? 79.041 -47.587 3.051    1.00 14.84 ? 117 LEU A O   1 
ATOM   951   C  CB  . LEU A  1 117 ? 76.993 -47.925 0.472    1.00 13.78 ? 117 LEU A CB  1 
ATOM   952   C  CG  . LEU A  1 117 ? 76.845 -48.001 -1.050   1.00 16.14 ? 117 LEU A CG  1 
ATOM   953   C  CD1 . LEU A  1 117 ? 75.589 -47.273 -1.529   1.00 13.52 ? 117 LEU A CD1 1 
ATOM   954   C  CD2 . LEU A  1 117 ? 78.094 -47.439 -1.718   1.00 17.01 ? 117 LEU A CD2 1 
ATOM   955   N  N   . PHE A  1 118 ? 77.433 -49.164 3.287    1.00 15.60 ? 118 PHE A N   1 
ATOM   956   C  CA  . PHE A  1 118 ? 77.365 -49.002 4.737    1.00 16.20 ? 118 PHE A CA  1 
ATOM   957   C  C   . PHE A  1 118 ? 78.683 -49.462 5.352    1.00 16.40 ? 118 PHE A C   1 
ATOM   958   O  O   . PHE A  1 118 ? 79.267 -48.784 6.196    1.00 17.65 ? 118 PHE A O   1 
ATOM   959   C  CB  . PHE A  1 118 ? 76.194 -49.797 5.330    1.00 14.48 ? 118 PHE A CB  1 
ATOM   960   C  CG  . PHE A  1 118 ? 74.845 -49.422 4.762    1.00 16.43 ? 118 PHE A CG  1 
ATOM   961   C  CD1 . PHE A  1 118 ? 74.661 -48.220 4.097    1.00 14.11 ? 118 PHE A CD1 1 
ATOM   962   C  CD2 . PHE A  1 118 ? 73.754 -50.272 4.915    1.00 14.86 ? 118 PHE A CD2 1 
ATOM   963   C  CE1 . PHE A  1 118 ? 73.418 -47.879 3.574    1.00 13.60 ? 118 PHE A CE1 1 
ATOM   964   C  CE2 . PHE A  1 118 ? 72.510 -49.931 4.410    1.00 14.93 ? 118 PHE A CE2 1 
ATOM   965   C  CZ  . PHE A  1 118 ? 72.340 -48.730 3.737    1.00 13.92 ? 118 PHE A CZ  1 
ATOM   966   N  N   . ILE A  1 119 ? 79.158 -50.613 4.901    1.00 18.42 ? 119 ILE A N   1 
ATOM   967   C  CA  . ILE A  1 119 ? 80.413 -51.162 5.403    1.00 18.95 ? 119 ILE A CA  1 
ATOM   968   C  C   . ILE A  1 119 ? 81.583 -50.215 5.112    1.00 18.23 ? 119 ILE A C   1 
ATOM   969   O  O   . ILE A  1 119 ? 82.465 -50.029 5.947    1.00 17.82 ? 119 ILE A O   1 
ATOM   970   C  CB  . ILE A  1 119 ? 80.637 -52.578 4.843    1.00 18.16 ? 119 ILE A CB  1 
ATOM   971   C  CG1 . ILE A  1 119 ? 79.532 -53.506 5.380    1.00 19.10 ? 119 ILE A CG1 1 
ATOM   972   C  CG2 . ILE A  1 119 ? 82.025 -53.094 5.202    1.00 19.90 ? 119 ILE A CG2 1 
ATOM   973   C  CD1 . ILE A  1 119 ? 79.486 -54.883 4.750    1.00 21.26 ? 119 ILE A CD1 1 
ATOM   974   N  N   . HIS A  1 120 ? 81.572 -49.593 3.938    1.00 17.49 ? 120 HIS A N   1 
ATOM   975   C  CA  . HIS A  1 120 ? 82.569 -48.571 3.607    1.00 16.59 ? 120 HIS A CA  1 
ATOM   976   C  C   . HIS A  1 120 ? 82.616 -47.469 4.642    1.00 17.43 ? 120 HIS A C   1 
ATOM   977   O  O   . HIS A  1 120 ? 83.687 -47.105 5.151    1.00 15.79 ? 120 HIS A O   1 
ATOM   978   C  CB  . HIS A  1 120 ? 82.266 -47.968 2.238    1.00 18.02 ? 120 HIS A CB  1 
ATOM   979   C  CG  . HIS A  1 120 ? 83.218 -46.866 1.837    1.00 18.36 ? 120 HIS A CG  1 
ATOM   980   N  ND1 . HIS A  1 120 ? 84.265 -47.079 1.021    1.00 19.31 ? 120 HIS A ND1 1 
ATOM   981   C  CD2 . HIS A  1 120 ? 83.258 -45.520 2.186    1.00 18.47 ? 120 HIS A CD2 1 
ATOM   982   C  CE1 . HIS A  1 120 ? 84.940 -45.925 0.847    1.00 22.18 ? 120 HIS A CE1 1 
ATOM   983   N  NE2 . HIS A  1 120 ? 84.325 -44.973 1.560    1.00 18.35 ? 120 HIS A NE2 1 
ATOM   984   N  N   . ASP A  1 121 ? 81.455 -46.906 4.957    1.00 15.49 ? 121 ASP A N   1 
ATOM   985   C  CA  . ASP A  1 121 ? 81.381 -45.824 5.947    1.00 16.35 ? 121 ASP A CA  1 
ATOM   986   C  C   . ASP A  1 121 ? 81.828 -46.272 7.333    1.00 15.70 ? 121 ASP A C   1 
ATOM   987   O  O   . ASP A  1 121 ? 82.433 -45.505 8.080    1.00 14.46 ? 121 ASP A O   1 
ATOM   988   C  CB  . ASP A  1 121 ? 79.961 -45.263 6.029    1.00 14.55 ? 121 ASP A CB  1 
ATOM   989   C  CG  . ASP A  1 121 ? 79.608 -44.401 4.837    1.00 15.51 ? 121 ASP A CG  1 
ATOM   990   O  OD1 . ASP A  1 121 ? 80.474 -44.205 3.960    1.00 17.15 ? 121 ASP A OD1 1 
ATOM   991   O  OD2 . ASP A  1 121 ? 78.465 -43.913 4.776    1.00 16.38 ? 121 ASP A OD2 1 
ATOM   992   N  N   . ILE A  1 122 ? 81.510 -47.513 7.680    1.00 17.03 ? 122 ILE A N   1 
ATOM   993   C  CA  . ILE A  1 122 ? 81.849 -48.040 9.000    1.00 15.91 ? 122 ILE A CA  1 
ATOM   994   C  C   . ILE A  1 122 ? 83.342 -48.350 9.108    1.00 18.03 ? 122 ILE A C   1 
ATOM   995   O  O   . ILE A  1 122 ? 83.966 -48.060 10.129   1.00 18.32 ? 122 ILE A O   1 
ATOM   996   C  CB  . ILE A  1 122 ? 81.039 -49.312 9.316    1.00 15.20 ? 122 ILE A CB  1 
ATOM   997   C  CG1 . ILE A  1 122 ? 79.541 -48.987 9.423    1.00 14.64 ? 122 ILE A CG1 1 
ATOM   998   C  CG2 . ILE A  1 122 ? 81.534 -49.975 10.598   1.00 14.45 ? 122 ILE A CG2 1 
ATOM   999   C  CD1 . ILE A  1 122 ? 78.664 -50.204 9.179    1.00 14.94 ? 122 ILE A CD1 1 
ATOM   1000  N  N   . LYS A  1 123 ? 83.912 -48.937 8.057    1.00 17.52 ? 123 LYS A N   1 
ATOM   1001  C  CA  . LYS A  1 123 ? 85.291 -49.423 8.118    1.00 21.72 ? 123 LYS A CA  1 
ATOM   1002  C  C   . LYS A  1 123 ? 86.338 -48.484 7.521    1.00 23.10 ? 123 LYS A C   1 
ATOM   1003  O  O   . LYS A  1 123 ? 87.479 -48.466 7.976    1.00 23.38 ? 123 LYS A O   1 
ATOM   1004  C  CB  . LYS A  1 123 ? 85.401 -50.813 7.481    1.00 25.38 ? 123 LYS A CB  1 
ATOM   1005  C  CG  . LYS A  1 123 ? 84.603 -51.870 8.224    1.00 32.01 ? 123 LYS A CG  1 
ATOM   1006  C  CD  . LYS A  1 123 ? 84.477 -53.156 7.428    1.00 39.12 ? 123 LYS A CD  1 
ATOM   1007  C  CE  . LYS A  1 123 ? 85.723 -54.013 7.543    1.00 46.00 ? 123 LYS A CE  1 
ATOM   1008  N  NZ  . LYS A  1 123 ? 85.480 -55.372 6.988    1.00 52.86 ? 123 LYS A NZ  1 
ATOM   1009  N  N   . GLU A  1 124 ? 85.968 -47.715 6.502    1.00 21.82 ? 124 GLU A N   1 
ATOM   1010  C  CA  . GLU A  1 124 ? 86.937 -46.837 5.848    1.00 20.51 ? 124 GLU A CA  1 
ATOM   1011  C  C   . GLU A  1 124 ? 86.739 -45.394 6.285    1.00 21.55 ? 124 GLU A C   1 
ATOM   1012  O  O   . GLU A  1 124 ? 87.699 -44.688 6.583    1.00 22.98 ? 124 GLU A O   1 
ATOM   1013  C  CB  . GLU A  1 124 ? 86.826 -46.932 4.325    1.00 23.37 ? 124 GLU A CB  1 
ATOM   1014  C  CG  . GLU A  1 124 ? 86.958 -48.337 3.774    1.00 29.68 ? 124 GLU A CG  1 
ATOM   1015  C  CD  . GLU A  1 124 ? 88.303 -48.951 4.099    1.00 39.93 ? 124 GLU A CD  1 
ATOM   1016  O  OE1 . GLU A  1 124 ? 89.282 -48.187 4.248    1.00 39.62 ? 124 GLU A OE1 1 
ATOM   1017  O  OE2 . GLU A  1 124 ? 88.378 -50.194 4.210    1.00 44.23 ? 124 GLU A OE2 1 
ATOM   1018  N  N   . GLY A  1 125 ? 85.490 -44.945 6.305    1.00 19.34 ? 125 GLY A N   1 
ATOM   1019  C  CA  . GLY A  1 125 ? 85.210 -43.575 6.703    1.00 17.77 ? 125 GLY A CA  1 
ATOM   1020  C  C   . GLY A  1 125 ? 84.111 -42.951 5.874    1.00 16.27 ? 125 GLY A C   1 
ATOM   1021  O  O   . GLY A  1 125 ? 83.703 -43.506 4.861    1.00 16.33 ? 125 GLY A O   1 
ATOM   1022  N  N   . ILE A  1 126 ? 83.644 -41.786 6.313    1.00 14.62 ? 126 ILE A N   1 
ATOM   1023  C  CA  . ILE A  1 126 ? 82.486 -41.127 5.726    1.00 15.87 ? 126 ILE A CA  1 
ATOM   1024  C  C   . ILE A  1 126 ? 82.891 -39.967 4.830    1.00 17.08 ? 126 ILE A C   1 
ATOM   1025  O  O   . ILE A  1 126 ? 83.650 -39.086 5.239    1.00 16.60 ? 126 ILE A O   1 
ATOM   1026  C  CB  . ILE A  1 126 ? 81.542 -40.608 6.835    1.00 15.04 ? 126 ILE A CB  1 
ATOM   1027  C  CG1 . ILE A  1 126 ? 81.012 -41.791 7.658    1.00 15.71 ? 126 ILE A CG1 1 
ATOM   1028  C  CG2 . ILE A  1 126 ? 80.420 -39.759 6.239    1.00 14.87 ? 126 ILE A CG2 1 
ATOM   1029  C  CD1 . ILE A  1 126 ? 80.326 -41.410 8.959    1.00 14.84 ? 126 ILE A CD1 1 
ATOM   1030  N  N   . GLN A  1 127 ? 82.375 -39.972 3.604    1.00 17.41 ? 127 GLN A N   1 
ATOM   1031  C  CA  . GLN A  1 127 ? 82.572 -38.858 2.684    1.00 17.95 ? 127 GLN A CA  1 
ATOM   1032  C  C   . GLN A  1 127 ? 84.036 -38.449 2.529    1.00 18.71 ? 127 GLN A C   1 
ATOM   1033  O  O   . GLN A  1 127 ? 84.365 -37.261 2.482    1.00 19.09 ? 127 GLN A O   1 
ATOM   1034  C  CB  . GLN A  1 127 ? 81.709 -37.667 3.103    1.00 15.90 ? 127 GLN A CB  1 
ATOM   1035  C  CG  . GLN A  1 127 ? 80.216 -37.950 2.973    1.00 17.02 ? 127 GLN A CG  1 
ATOM   1036  C  CD  . GLN A  1 127 ? 79.361 -36.857 3.581    1.00 21.23 ? 127 GLN A CD  1 
ATOM   1037  O  OE1 . GLN A  1 127 ? 79.553 -36.477 4.732    1.00 22.29 ? 127 GLN A OE1 1 
ATOM   1038  N  NE2 . GLN A  1 127 ? 78.412 -36.340 2.804    1.00 21.58 ? 127 GLN A NE2 1 
ATOM   1039  N  N   . GLY A  1 128 ? 84.910 -39.444 2.430    1.00 19.33 ? 128 GLY A N   1 
ATOM   1040  C  CA  . GLY A  1 128 ? 86.314 -39.193 2.142    1.00 20.78 ? 128 GLY A CA  1 
ATOM   1041  C  C   . GLY A  1 128 ? 87.119 -38.735 3.341    1.00 21.62 ? 128 GLY A C   1 
ATOM   1042  O  O   . GLY A  1 128 ? 88.254 -38.298 3.190    1.00 24.31 ? 128 GLY A O   1 
ATOM   1043  N  N   . THR A  1 129 ? 86.543 -38.828 4.536    1.00 20.04 ? 129 THR A N   1 
ATOM   1044  C  CA  . THR A  1 129 ? 87.282 -38.488 5.748    1.00 19.52 ? 129 THR A CA  1 
ATOM   1045  C  C   . THR A  1 129 ? 87.572 -39.758 6.520    1.00 21.88 ? 129 THR A C   1 
ATOM   1046  O  O   . THR A  1 129 ? 87.159 -40.848 6.112    1.00 21.03 ? 129 THR A O   1 
ATOM   1047  C  CB  . THR A  1 129 ? 86.492 -37.529 6.667    1.00 17.22 ? 129 THR A CB  1 
ATOM   1048  O  OG1 . THR A  1 129 ? 85.386 -38.227 7.268    1.00 16.98 ? 129 THR A OG1 1 
ATOM   1049  C  CG2 . THR A  1 129 ? 85.978 -36.329 5.874    1.00 15.57 ? 129 THR A CG2 1 
ATOM   1050  N  N   . LEU A  1 130 ? 88.247 -39.613 7.654    1.00 20.46 ? 130 LEU A N   1 
ATOM   1051  C  CA  . LEU A  1 130 ? 88.540 -40.762 8.508    1.00 24.25 ? 130 LEU A CA  1 
ATOM   1052  C  C   . LEU A  1 130 ? 87.515 -40.943 9.627    1.00 23.47 ? 130 LEU A C   1 
ATOM   1053  O  O   . LEU A  1 130 ? 87.653 -41.842 10.458   1.00 19.48 ? 130 LEU A O   1 
ATOM   1054  C  CB  . LEU A  1 130 ? 89.957 -40.653 9.085    1.00 26.31 ? 130 LEU A CB  1 
ATOM   1055  C  CG  . LEU A  1 130 ? 91.062 -40.612 8.027    1.00 29.39 ? 130 LEU A CG  1 
ATOM   1056  C  CD1 . LEU A  1 130 ? 92.430 -40.449 8.675    1.00 29.05 ? 130 LEU A CD1 1 
ATOM   1057  C  CD2 . LEU A  1 130 ? 91.012 -41.874 7.180    1.00 33.67 ? 130 LEU A CD2 1 
ATOM   1058  N  N   . ASN A  1 131 ? 86.488 -40.092 9.651    1.00 19.18 ? 131 ASN A N   1 
ATOM   1059  C  CA  . ASN A  1 131 ? 85.406 -40.252 10.614   1.00 16.77 ? 131 ASN A CA  1 
ATOM   1060  C  C   . ASN A  1 131 ? 84.562 -41.456 10.230   1.00 19.55 ? 131 ASN A C   1 
ATOM   1061  O  O   . ASN A  1 131 ? 84.064 -41.534 9.108    1.00 18.82 ? 131 ASN A O   1 
ATOM   1062  C  CB  . ASN A  1 131 ? 84.524 -39.001 10.657   1.00 17.03 ? 131 ASN A CB  1 
ATOM   1063  C  CG  . ASN A  1 131 ? 85.309 -37.750 10.969   1.00 19.77 ? 131 ASN A CG  1 
ATOM   1064  O  OD1 . ASN A  1 131 ? 85.408 -36.843 10.138   1.00 23.12 ? 131 ASN A OD1 1 
ATOM   1065  N  ND2 . ASN A  1 131 ? 85.892 -37.700 12.161   1.00 16.95 ? 131 ASN A ND2 1 
ATOM   1066  N  N   . LYS A  1 132 ? 84.404 -42.399 11.149   1.00 16.87 ? 132 LYS A N   1 
ATOM   1067  C  CA  . LYS A  1 132 ? 83.710 -43.630 10.819   1.00 17.69 ? 132 LYS A CA  1 
ATOM   1068  C  C   . LYS A  1 132 ? 82.295 -43.679 11.399   1.00 15.95 ? 132 LYS A C   1 
ATOM   1069  O  O   . LYS A  1 132 ? 82.007 -43.042 12.411   1.00 15.79 ? 132 LYS A O   1 
ATOM   1070  C  CB  . LYS A  1 132 ? 84.546 -44.835 11.260   1.00 21.10 ? 132 LYS A CB  1 
ATOM   1071  C  CG  . LYS A  1 132 ? 85.875 -44.925 10.511   1.00 23.06 ? 132 LYS A CG  1 
ATOM   1072  C  CD  . LYS A  1 132 ? 86.756 -46.034 11.045   1.00 28.64 ? 132 LYS A CD  1 
ATOM   1073  C  CE  . LYS A  1 132 ? 88.086 -46.067 10.300   1.00 31.18 ? 132 LYS A CE  1 
ATOM   1074  N  NZ  . LYS A  1 132 ? 88.959 -47.174 10.780   1.00 41.45 ? 132 LYS A NZ  1 
ATOM   1075  N  N   . ALA A  1 133 ? 81.419 -44.429 10.735   1.00 14.49 ? 133 ALA A N   1 
ATOM   1076  C  CA  . ALA A  1 133 ? 80.033 -44.595 11.166   1.00 13.86 ? 133 ALA A CA  1 
ATOM   1077  C  C   . ALA A  1 133 ? 79.964 -45.585 12.323   1.00 16.48 ? 133 ALA A C   1 
ATOM   1078  O  O   . ALA A  1 133 ? 80.650 -46.612 12.303   1.00 15.64 ? 133 ALA A O   1 
ATOM   1079  C  CB  . ALA A  1 133 ? 79.190 -45.101 10.001   1.00 13.91 ? 133 ALA A CB  1 
ATOM   1080  N  N   . GLY A  1 134 ? 79.131 -45.287 13.316   1.00 16.22 ? 134 GLY A N   1 
ATOM   1081  C  CA  . GLY A  1 134 ? 79.020 -46.132 14.509   1.00 15.43 ? 134 GLY A CA  1 
ATOM   1082  C  C   . GLY A  1 134 ? 77.736 -46.941 14.578   1.00 15.56 ? 134 GLY A C   1 
ATOM   1083  O  O   . GLY A  1 134 ? 77.493 -47.667 15.549   1.00 14.38 ? 134 GLY A O   1 
ATOM   1084  N  N   . PHE A  1 135 ? 76.909 -46.805 13.548   1.00 13.39 ? 135 PHE A N   1 
ATOM   1085  C  CA  . PHE A  1 135 ? 75.618 -47.469 13.493   1.00 13.56 ? 135 PHE A CA  1 
ATOM   1086  C  C   . PHE A  1 135 ? 75.045 -47.322 12.090   1.00 12.75 ? 135 PHE A C   1 
ATOM   1087  O  O   . PHE A  1 135 ? 75.527 -46.503 11.304   1.00 13.37 ? 135 PHE A O   1 
ATOM   1088  C  CB  . PHE A  1 135 ? 74.640 -46.856 14.516   1.00 13.26 ? 135 PHE A CB  1 
ATOM   1089  C  CG  . PHE A  1 135 ? 74.334 -45.397 14.272   1.00 13.61 ? 135 PHE A CG  1 
ATOM   1090  C  CD1 . PHE A  1 135 ? 75.135 -44.401 14.814   1.00 12.60 ? 135 PHE A CD1 1 
ATOM   1091  C  CD2 . PHE A  1 135 ? 73.246 -45.025 13.498   1.00 13.88 ? 135 PHE A CD2 1 
ATOM   1092  C  CE1 . PHE A  1 135 ? 74.853 -43.062 14.589   1.00 13.87 ? 135 PHE A CE1 1 
ATOM   1093  C  CE2 . PHE A  1 135 ? 72.952 -43.684 13.279   1.00 14.93 ? 135 PHE A CE2 1 
ATOM   1094  C  CZ  . PHE A  1 135 ? 73.760 -42.703 13.820   1.00 12.76 ? 135 PHE A CZ  1 
ATOM   1095  N  N   . VAL A  1 136 ? 74.007 -48.099 11.792   1.00 13.17 ? 136 VAL A N   1 
ATOM   1096  C  CA  . VAL A  1 136 ? 73.277 -47.984 10.525   1.00 11.95 ? 136 VAL A CA  1 
ATOM   1097  C  C   . VAL A  1 136 ? 71.861 -47.480 10.798   1.00 13.00 ? 136 VAL A C   1 
ATOM   1098  O  O   . VAL A  1 136 ? 71.217 -47.939 11.744   1.00 12.10 ? 136 VAL A O   1 
ATOM   1099  C  CB  . VAL A  1 136 ? 73.174 -49.339 9.801    1.00 12.15 ? 136 VAL A CB  1 
ATOM   1100  C  CG1 . VAL A  1 136 ? 72.495 -49.165 8.440    1.00 12.27 ? 136 VAL A CG1 1 
ATOM   1101  C  CG2 . VAL A  1 136 ? 74.552 -49.983 9.658    1.00 12.68 ? 136 VAL A CG2 1 
HETATM 1102  N  N   . KCX A  1 137 ? 71.386 -46.545 9.974    1.00 12.04 ? 137 KCX A N   1 
HETATM 1103  C  CA  . KCX A  1 137 ? 70.040 -45.962 10.116   1.00 11.70 ? 137 KCX A CA  1 
HETATM 1104  C  CB  . KCX A  1 137 ? 70.159 -44.435 10.209   1.00 12.72 ? 137 KCX A CB  1 
HETATM 1105  C  CG  . KCX A  1 137 ? 68.829 -43.697 9.993    1.00 13.12 ? 137 KCX A CG  1 
HETATM 1106  C  CD  . KCX A  1 137 ? 67.876 -43.831 11.183   1.00 12.83 ? 137 KCX A CD  1 
HETATM 1107  C  CE  . KCX A  1 137 ? 66.567 -43.075 10.920   1.00 13.34 ? 137 KCX A CE  1 
HETATM 1108  N  NZ  . KCX A  1 137 ? 66.694 -41.643 11.164   1.00 15.04 ? 137 KCX A NZ  1 
HETATM 1109  C  C   . KCX A  1 137 ? 69.202 -46.336 8.919    1.00 12.23 ? 137 KCX A C   1 
HETATM 1110  O  O   . KCX A  1 137 ? 69.618 -46.146 7.768    1.00 11.65 ? 137 KCX A O   1 
HETATM 1111  C  CX  . KCX A  1 137 ? 65.694 -40.843 11.567   1.00 13.20 ? 137 KCX A CX  1 
HETATM 1112  O  OQ1 . KCX A  1 137 ? 66.038 -39.563 11.742   1.00 12.75 ? 137 KCX A OQ1 1 
HETATM 1113  O  OQ2 . KCX A  1 137 ? 64.514 -41.190 11.788   1.00 15.14 ? 137 KCX A OQ2 1 
ATOM   1114  N  N   . ILE A  1 138 ? 68.018 -46.887 9.178    1.00 13.12 ? 138 ILE A N   1 
ATOM   1115  C  CA  . ILE A  1 138 ? 67.062 -47.216 8.126    1.00 13.06 ? 138 ILE A CA  1 
ATOM   1116  C  C   . ILE A  1 138 ? 65.688 -46.632 8.475    1.00 15.20 ? 138 ILE A C   1 
ATOM   1117  O  O   . ILE A  1 138 ? 65.436 -46.245 9.626    1.00 12.26 ? 138 ILE A O   1 
ATOM   1118  C  CB  . ILE A  1 138 ? 66.941 -48.742 7.937    1.00 14.73 ? 138 ILE A CB  1 
ATOM   1119  C  CG1 . ILE A  1 138 ? 66.398 -49.391 9.217    1.00 19.94 ? 138 ILE A CG1 1 
ATOM   1120  C  CG2 . ILE A  1 138 ? 68.288 -49.333 7.549    1.00 13.98 ? 138 ILE A CG2 1 
ATOM   1121  C  CD1 . ILE A  1 138 ? 66.399 -50.908 9.204    1.00 23.51 ? 138 ILE A CD1 1 
ATOM   1122  N  N   . ALA A  1 139 ? 64.793 -46.593 7.492    1.00 12.76 ? 139 ALA A N   1 
ATOM   1123  C  CA  . ALA A  1 139 ? 63.485 -45.981 7.694    1.00 13.92 ? 139 ALA A CA  1 
ATOM   1124  C  C   . ALA A  1 139 ? 62.348 -46.719 7.000    1.00 15.32 ? 139 ALA A C   1 
ATOM   1125  O  O   . ALA A  1 139 ? 62.548 -47.453 6.031    1.00 17.26 ? 139 ALA A O   1 
ATOM   1126  C  CB  . ALA A  1 139 ? 63.506 -44.525 7.244    1.00 12.68 ? 139 ALA A CB  1 
ATOM   1127  N  N   . ALA A  1 140 ? 61.145 -46.508 7.521    1.00 14.76 ? 140 ALA A N   1 
ATOM   1128  C  CA  . ALA A  1 140 ? 59.915 -46.878 6.842    1.00 15.92 ? 140 ALA A CA  1 
ATOM   1129  C  C   . ALA A  1 140 ? 58.831 -45.978 7.414    1.00 16.03 ? 140 ALA A C   1 
ATOM   1130  O  O   . ALA A  1 140 ? 58.882 -45.600 8.585    1.00 15.24 ? 140 ALA A O   1 
ATOM   1131  C  CB  . ALA A  1 140 ? 59.580 -48.345 7.070    1.00 14.17 ? 140 ALA A CB  1 
ATOM   1132  N  N   . ASP A  1 141 ? 57.855 -45.606 6.602    1.00 18.18 ? 141 ASP A N   1 
ATOM   1133  C  CA  . ASP A  1 141 ? 56.831 -44.717 7.115    1.00 18.44 ? 141 ASP A CA  1 
ATOM   1134  C  C   . ASP A  1 141 ? 55.461 -45.125 6.594    1.00 20.82 ? 141 ASP A C   1 
ATOM   1135  O  O   . ASP A  1 141 ? 55.177 -46.315 6.439    1.00 16.38 ? 141 ASP A O   1 
ATOM   1136  C  CB  . ASP A  1 141 ? 57.186 -43.257 6.790    1.00 20.73 ? 141 ASP A CB  1 
ATOM   1137  C  CG  . ASP A  1 141 ? 56.583 -42.266 7.785    1.00 25.89 ? 141 ASP A CG  1 
ATOM   1138  O  OD1 . ASP A  1 141 ? 55.387 -41.930 7.652    1.00 26.09 ? 141 ASP A OD1 1 
ATOM   1139  O  OD2 . ASP A  1 141 ? 57.304 -41.813 8.695    1.00 22.22 ? 141 ASP A OD2 1 
ATOM   1140  N  N   . GLU A  1 142 ? 54.612 -44.140 6.335    1.00 19.78 ? 142 GLU A N   1 
ATOM   1141  C  CA  . GLU A  1 142 ? 53.243 -44.399 5.900    1.00 24.22 ? 142 GLU A CA  1 
ATOM   1142  C  C   . GLU A  1 142 ? 53.115 -45.416 4.760    1.00 21.85 ? 142 GLU A C   1 
ATOM   1143  O  O   . GLU A  1 142 ? 52.197 -46.238 4.763    1.00 20.23 ? 142 GLU A O   1 
ATOM   1144  C  CB  . GLU A  1 142 ? 52.552 -43.079 5.530    1.00 28.40 ? 142 GLU A CB  1 
ATOM   1145  C  CG  . GLU A  1 142 ? 51.044 -43.184 5.375    1.00 43.41 ? 142 GLU A CG  1 
ATOM   1146  C  CD  . GLU A  1 142 ? 50.394 -41.836 5.132    1.00 65.97 ? 142 GLU A CD  1 
ATOM   1147  O  OE1 . GLU A  1 142 ? 49.247 -41.809 4.636    1.00 77.33 ? 142 GLU A OE1 1 
ATOM   1148  O  OE2 . GLU A  1 142 ? 51.032 -40.803 5.434    1.00 65.77 ? 142 GLU A OE2 1 
ATOM   1149  N  N   . PRO A  1 143 ? 54.026 -45.368 3.773    1.00 20.88 ? 143 PRO A N   1 
ATOM   1150  C  CA  . PRO A  1 143 ? 53.876 -46.276 2.635    1.00 23.36 ? 143 PRO A CA  1 
ATOM   1151  C  C   . PRO A  1 143 ? 54.176 -47.738 2.971    1.00 24.69 ? 143 PRO A C   1 
ATOM   1152  O  O   . PRO A  1 143 ? 53.958 -48.612 2.139    1.00 21.92 ? 143 PRO A O   1 
ATOM   1153  C  CB  . PRO A  1 143 ? 54.891 -45.735 1.615    1.00 22.23 ? 143 PRO A CB  1 
ATOM   1154  C  CG  . PRO A  1 143 ? 55.132 -44.316 2.034    1.00 21.67 ? 143 PRO A CG  1 
ATOM   1155  C  CD  . PRO A  1 143 ? 55.082 -44.372 3.533    1.00 21.89 ? 143 PRO A CD  1 
ATOM   1156  N  N   . GLY A  1 144 ? 54.676 -48.003 4.175    1.00 21.32 ? 144 GLY A N   1 
ATOM   1157  C  CA  . GLY A  1 144 ? 54.895 -49.387 4.612    1.00 19.46 ? 144 GLY A CA  1 
ATOM   1158  C  C   . GLY A  1 144 ? 56.215 -49.959 4.140    1.00 18.79 ? 144 GLY A C   1 
ATOM   1159  O  O   . GLY A  1 144 ? 57.110 -49.225 3.703    1.00 17.08 ? 144 GLY A O   1 
ATOM   1160  N  N   . ILE A  1 145 ? 56.356 -51.276 4.238    1.00 17.50 ? 145 ILE A N   1 
ATOM   1161  C  CA  . ILE A  1 145 ? 57.593 -51.924 3.802    1.00 16.77 ? 145 ILE A CA  1 
ATOM   1162  C  C   . ILE A  1 145 ? 57.572 -52.175 2.289    1.00 19.03 ? 145 ILE A C   1 
ATOM   1163  O  O   . ILE A  1 145 ? 57.246 -53.274 1.846    1.00 18.31 ? 145 ILE A O   1 
ATOM   1164  C  CB  . ILE A  1 145 ? 57.833 -53.261 4.544    1.00 18.23 ? 145 ILE A CB  1 
ATOM   1165  C  CG1 . ILE A  1 145 ? 57.705 -53.083 6.065    1.00 17.75 ? 145 ILE A CG1 1 
ATOM   1166  C  CG2 . ILE A  1 145 ? 59.183 -53.850 4.161    1.00 17.59 ? 145 ILE A CG2 1 
ATOM   1167  C  CD1 . ILE A  1 145 ? 58.622 -52.021 6.647    1.00 17.37 ? 145 ILE A CD1 1 
ATOM   1168  N  N   . THR A  1 146 ? 57.903 -51.151 1.504    1.00 18.83 ? 146 THR A N   1 
ATOM   1169  C  CA  . THR A  1 146 ? 57.996 -51.284 0.047    1.00 17.69 ? 146 THR A CA  1 
ATOM   1170  C  C   . THR A  1 146 ? 59.170 -52.185 -0.326   1.00 20.68 ? 146 THR A C   1 
ATOM   1171  O  O   . THR A  1 146 ? 60.029 -52.488 0.509    1.00 19.49 ? 146 THR A O   1 
ATOM   1172  C  CB  . THR A  1 146 ? 58.227 -49.922 -0.645   1.00 18.34 ? 146 THR A CB  1 
ATOM   1173  O  OG1 . THR A  1 146 ? 59.476 -49.371 -0.204   1.00 17.66 ? 146 THR A OG1 1 
ATOM   1174  C  CG2 . THR A  1 146 ? 57.102 -48.929 -0.324   1.00 19.82 ? 146 THR A CG2 1 
ATOM   1175  N  N   . LYS A  1 147 ? 59.230 -52.585 -1.592   1.00 19.57 ? 147 LYS A N   1 
ATOM   1176  C  CA  . LYS A  1 147 ? 60.335 -53.413 -2.061   1.00 21.24 ? 147 LYS A CA  1 
ATOM   1177  C  C   . LYS A  1 147 ? 61.702 -52.788 -1.756   1.00 18.00 ? 147 LYS A C   1 
ATOM   1178  O  O   . LYS A  1 147 ? 62.594 -53.461 -1.261   1.00 15.81 ? 147 LYS A O   1 
ATOM   1179  C  CB  . LYS A  1 147 ? 60.207 -53.687 -3.562   1.00 25.54 ? 147 LYS A CB  1 
ATOM   1180  C  CG  . LYS A  1 147 ? 61.345 -54.529 -4.115   1.00 38.16 ? 147 LYS A CG  1 
ATOM   1181  C  CD  . LYS A  1 147 ? 61.302 -54.632 -5.635   1.00 46.36 ? 147 LYS A CD  1 
ATOM   1182  C  CE  . LYS A  1 147 ? 62.586 -55.249 -6.167   1.00 38.34 ? 147 LYS A CE  1 
ATOM   1183  N  NZ  . LYS A  1 147 ? 62.589 -55.373 -7.649   1.00 56.79 ? 147 LYS A NZ  1 
ATOM   1184  N  N   . ASP A  1 148 ? 61.865 -51.504 -2.062   1.00 17.81 ? 148 ASP A N   1 
ATOM   1185  C  CA  . ASP A  1 148 ? 63.145 -50.821 -1.820   1.00 18.27 ? 148 ASP A CA  1 
ATOM   1186  C  C   . ASP A  1 148 ? 63.431 -50.596 -0.333   1.00 16.85 ? 148 ASP A C   1 
ATOM   1187  O  O   . ASP A  1 148 ? 64.572 -50.716 0.102    1.00 18.09 ? 148 ASP A O   1 
ATOM   1188  C  CB  . ASP A  1 148 ? 63.223 -49.501 -2.589   1.00 18.11 ? 148 ASP A CB  1 
ATOM   1189  C  CG  . ASP A  1 148 ? 63.516 -49.705 -4.064   1.00 22.33 ? 148 ASP A CG  1 
ATOM   1190  O  OD1 . ASP A  1 148 ? 63.616 -48.698 -4.799   1.00 19.07 ? 148 ASP A OD1 1 
ATOM   1191  O  OD2 . ASP A  1 148 ? 63.656 -50.876 -4.489   1.00 23.59 ? 148 ASP A OD2 1 
ATOM   1192  N  N   . VAL A  1 149 ? 62.404 -50.268 0.446    1.00 15.28 ? 149 VAL A N   1 
ATOM   1193  C  CA  . VAL A  1 149 ? 62.574 -50.162 1.894    1.00 14.90 ? 149 VAL A CA  1 
ATOM   1194  C  C   . VAL A  1 149 ? 63.089 -51.482 2.480    1.00 16.03 ? 149 VAL A C   1 
ATOM   1195  O  O   . VAL A  1 149 ? 64.018 -51.507 3.302    1.00 14.60 ? 149 VAL A O   1 
ATOM   1196  C  CB  . VAL A  1 149 ? 61.268 -49.730 2.586    1.00 16.55 ? 149 VAL A CB  1 
ATOM   1197  C  CG1 . VAL A  1 149 ? 61.349 -49.974 4.089    1.00 15.11 ? 149 VAL A CG1 1 
ATOM   1198  C  CG2 . VAL A  1 149 ? 60.975 -48.264 2.283    1.00 14.45 ? 149 VAL A CG2 1 
ATOM   1199  N  N   . GLU A  1 150 ? 62.487 -52.580 2.042    1.00 16.72 ? 150 GLU A N   1 
ATOM   1200  C  CA  . GLU A  1 150 ? 62.904 -53.905 2.477    1.00 15.89 ? 150 GLU A CA  1 
ATOM   1201  C  C   . GLU A  1 150 ? 64.353 -54.219 2.072    1.00 15.84 ? 150 GLU A C   1 
ATOM   1202  O  O   . GLU A  1 150 ? 65.085 -54.845 2.830    1.00 15.20 ? 150 GLU A O   1 
ATOM   1203  C  CB  . GLU A  1 150 ? 61.954 -54.969 1.924    1.00 19.47 ? 150 GLU A CB  1 
ATOM   1204  C  CG  . GLU A  1 150 ? 62.303 -56.385 2.359    1.00 24.87 ? 150 GLU A CG  1 
ATOM   1205  C  CD  . GLU A  1 150 ? 61.350 -57.423 1.788    1.00 34.89 ? 150 GLU A CD  1 
ATOM   1206  O  OE1 . GLU A  1 150 ? 61.554 -58.628 2.049    1.00 32.42 ? 150 GLU A OE1 1 
ATOM   1207  O  OE2 . GLU A  1 150 ? 60.398 -57.031 1.078    1.00 36.24 ? 150 GLU A OE2 1 
ATOM   1208  N  N   . LYS A  1 151 ? 64.774 -53.785 0.888    1.00 15.95 ? 151 LYS A N   1 
ATOM   1209  C  CA  . LYS A  1 151 ? 66.168 -54.004 0.480    1.00 18.91 ? 151 LYS A CA  1 
ATOM   1210  C  C   . LYS A  1 151 ? 67.143 -53.319 1.431    1.00 17.40 ? 151 LYS A C   1 
ATOM   1211  O  O   . LYS A  1 151 ? 68.176 -53.884 1.802    1.00 18.31 ? 151 LYS A O   1 
ATOM   1212  C  CB  . LYS A  1 151 ? 66.414 -53.527 -0.950   1.00 21.77 ? 151 LYS A CB  1 
ATOM   1213  C  CG  . LYS A  1 151 ? 65.852 -54.471 -1.996   1.00 28.32 ? 151 LYS A CG  1 
ATOM   1214  C  CD  . LYS A  1 151 ? 66.386 -54.149 -3.378   1.00 34.34 ? 151 LYS A CD  1 
ATOM   1215  C  CE  . LYS A  1 151 ? 65.678 -52.953 -3.977   1.00 40.73 ? 151 LYS A CE  1 
ATOM   1216  N  NZ  . LYS A  1 151 ? 65.807 -52.947 -5.462   1.00 45.28 ? 151 LYS A NZ  1 
ATOM   1217  N  N   . VAL A  1 152 ? 66.807 -52.098 1.816    1.00 14.28 ? 152 VAL A N   1 
ATOM   1218  C  CA  . VAL A  1 152 ? 67.648 -51.319 2.716    1.00 14.33 ? 152 VAL A CA  1 
ATOM   1219  C  C   . VAL A  1 152 ? 67.721 -51.978 4.089    1.00 16.08 ? 152 VAL A C   1 
ATOM   1220  O  O   . VAL A  1 152 ? 68.785 -52.033 4.706    1.00 14.64 ? 152 VAL A O   1 
ATOM   1221  C  CB  . VAL A  1 152 ? 67.125 -49.877 2.830    1.00 13.40 ? 152 VAL A CB  1 
ATOM   1222  C  CG1 . VAL A  1 152 ? 67.890 -49.106 3.904    1.00 13.99 ? 152 VAL A CG1 1 
ATOM   1223  C  CG2 . VAL A  1 152 ? 67.257 -49.178 1.477    1.00 14.70 ? 152 VAL A CG2 1 
ATOM   1224  N  N   . ILE A  1 153 ? 66.591 -52.498 4.560    1.00 14.87 ? 153 ILE A N   1 
ATOM   1225  C  CA  . ILE A  1 153 ? 66.570 -53.178 5.850    1.00 14.65 ? 153 ILE A CA  1 
ATOM   1226  C  C   . ILE A  1 153 ? 67.517 -54.372 5.830    1.00 16.74 ? 153 ILE A C   1 
ATOM   1227  O  O   . ILE A  1 153 ? 68.320 -54.557 6.751    1.00 14.60 ? 153 ILE A O   1 
ATOM   1228  C  CB  . ILE A  1 153 ? 65.157 -53.661 6.224    1.00 15.48 ? 153 ILE A CB  1 
ATOM   1229  C  CG1 . ILE A  1 153 ? 64.213 -52.469 6.375    1.00 15.63 ? 153 ILE A CG1 1 
ATOM   1230  C  CG2 . ILE A  1 153 ? 65.195 -54.473 7.516    1.00 15.23 ? 153 ILE A CG2 1 
ATOM   1231  C  CD1 . ILE A  1 153 ? 62.769 -52.876 6.590    1.00 18.61 ? 153 ILE A CD1 1 
ATOM   1232  N  N   . ARG A  1 154 ? 67.424 -55.178 4.775    1.00 15.23 ? 154 ARG A N   1 
ATOM   1233  C  CA  . ARG A  1 154 ? 68.272 -56.354 4.650    1.00 19.24 ? 154 ARG A CA  1 
ATOM   1234  C  C   . ARG A  1 154 ? 69.743 -55.967 4.493    1.00 16.14 ? 154 ARG A C   1 
ATOM   1235  O  O   . ARG A  1 154 ? 70.626 -56.665 4.989    1.00 18.36 ? 154 ARG A O   1 
ATOM   1236  C  CB  . ARG A  1 154 ? 67.800 -57.268 3.506    1.00 17.89 ? 154 ARG A CB  1 
ATOM   1237  C  CG  . ARG A  1 154 ? 66.420 -57.862 3.753    1.00 21.36 ? 154 ARG A CG  1 
ATOM   1238  C  CD  . ARG A  1 154 ? 66.000 -58.921 2.735    1.00 20.88 ? 154 ARG A CD  1 
ATOM   1239  N  NE  . ARG A  1 154 ? 64.588 -59.254 2.930    1.00 22.55 ? 154 ARG A NE  1 
ATOM   1240  C  CZ  . ARG A  1 154 ? 64.131 -60.080 3.871    1.00 25.24 ? 154 ARG A CZ  1 
ATOM   1241  N  NH1 . ARG A  1 154 ? 62.830 -60.298 3.990    1.00 21.17 ? 154 ARG A NH1 1 
ATOM   1242  N  NH2 . ARG A  1 154 ? 64.971 -60.695 4.694    1.00 20.07 ? 154 ARG A NH2 1 
ATOM   1243  N  N   . ALA A  1 155 ? 70.007 -54.853 3.815    1.00 15.40 ? 155 ALA A N   1 
ATOM   1244  C  CA  . ALA A  1 155 ? 71.378 -54.354 3.693    1.00 16.36 ? 155 ALA A CA  1 
ATOM   1245  C  C   . ALA A  1 155 ? 71.932 -53.985 5.071    1.00 15.62 ? 155 ALA A C   1 
ATOM   1246  O  O   . ALA A  1 155 ? 73.095 -54.251 5.385    1.00 17.61 ? 155 ALA A O   1 
ATOM   1247  C  CB  . ALA A  1 155 ? 71.436 -53.150 2.762    1.00 13.80 ? 155 ALA A CB  1 
ATOM   1248  N  N   . ALA A  1 156 ? 71.097 -53.356 5.888    1.00 14.92 ? 156 ALA A N   1 
ATOM   1249  C  CA  . ALA A  1 156 ? 71.499 -53.013 7.255    1.00 15.50 ? 156 ALA A CA  1 
ATOM   1250  C  C   . ALA A  1 156 ? 71.864 -54.269 8.059    1.00 15.46 ? 156 ALA A C   1 
ATOM   1251  O  O   . ALA A  1 156 ? 72.806 -54.256 8.851    1.00 17.05 ? 156 ALA A O   1 
ATOM   1252  C  CB  . ALA A  1 156 ? 70.396 -52.232 7.954    1.00 12.23 ? 156 ALA A CB  1 
ATOM   1253  N  N   . ALA A  1 157 ? 71.108 -55.344 7.864    1.00 15.52 ? 157 ALA A N   1 
ATOM   1254  C  CA  . ALA A  1 157 ? 71.414 -56.609 8.533    1.00 17.16 ? 157 ALA A CA  1 
ATOM   1255  C  C   . ALA A  1 157 ? 72.811 -57.113 8.171    1.00 18.82 ? 157 ALA A C   1 
ATOM   1256  O  O   . ALA A  1 157 ? 73.581 -57.521 9.051    1.00 22.10 ? 157 ALA A O   1 
ATOM   1257  C  CB  . ALA A  1 157 ? 70.362 -57.659 8.201    1.00 18.02 ? 157 ALA A CB  1 
ATOM   1258  N  N   . ILE A  1 158 ? 73.135 -57.096 6.878    1.00 17.47 ? 158 ILE A N   1 
ATOM   1259  C  CA  . ILE A  1 158 ? 74.457 -57.526 6.423    1.00 17.60 ? 158 ILE A CA  1 
ATOM   1260  C  C   . ILE A  1 158 ? 75.543 -56.685 7.094    1.00 18.23 ? 158 ILE A C   1 
ATOM   1261  O  O   . ILE A  1 158 ? 76.550 -57.209 7.566    1.00 16.61 ? 158 ILE A O   1 
ATOM   1262  C  CB  . ILE A  1 158 ? 74.600 -57.413 4.894    1.00 19.74 ? 158 ILE A CB  1 
ATOM   1263  C  CG1 . ILE A  1 158 ? 73.590 -58.326 4.191    1.00 21.20 ? 158 ILE A CG1 1 
ATOM   1264  C  CG2 . ILE A  1 158 ? 76.018 -57.773 4.457    1.00 17.34 ? 158 ILE A CG2 1 
ATOM   1265  C  CD1 . ILE A  1 158 ? 73.617 -58.206 2.683    1.00 19.63 ? 158 ILE A CD1 1 
ATOM   1266  N  N   . ALA A  1 159 ? 75.329 -55.375 7.131    1.00 15.96 ? 159 ALA A N   1 
ATOM   1267  C  CA  . ALA A  1 159 ? 76.276 -54.455 7.751    1.00 15.83 ? 159 ALA A CA  1 
ATOM   1268  C  C   . ALA A  1 159 ? 76.448 -54.733 9.249    1.00 17.36 ? 159 ALA A C   1 
ATOM   1269  O  O   . ALA A  1 159 ? 77.571 -54.744 9.762    1.00 18.71 ? 159 ALA A O   1 
ATOM   1270  C  CB  . ALA A  1 159 ? 75.832 -53.009 7.520    1.00 17.72 ? 159 ALA A CB  1 
ATOM   1271  N  N   . ASN A  1 160 ? 75.341 -54.963 9.954    1.00 16.09 ? 160 ASN A N   1 
ATOM   1272  C  CA  . ASN A  1 160 ? 75.425 -55.304 11.375   1.00 17.25 ? 160 ASN A CA  1 
ATOM   1273  C  C   . ASN A  1 160 ? 76.160 -56.630 11.601   1.00 18.29 ? 160 ASN A C   1 
ATOM   1274  O  O   . ASN A  1 160 ? 77.052 -56.722 12.442   1.00 18.51 ? 160 ASN A O   1 
ATOM   1275  C  CB  . ASN A  1 160 ? 74.037 -55.383 12.017   1.00 17.24 ? 160 ASN A CB  1 
ATOM   1276  C  CG  . ASN A  1 160 ? 74.045 -56.178 13.313   1.00 19.11 ? 160 ASN A CG  1 
ATOM   1277  O  OD1 . ASN A  1 160 ? 73.743 -57.371 13.318   1.00 20.84 ? 160 ASN A OD1 1 
ATOM   1278  N  ND2 . ASN A  1 160 ? 74.419 -55.526 14.416   1.00 19.83 ? 160 ASN A ND2 1 
ATOM   1279  N  N   . LYS A  1 161 ? 75.785 -57.655 10.849   1.00 18.59 ? 161 LYS A N   1 
ATOM   1280  C  CA  . LYS A  1 161 ? 76.410 -58.962 11.025   1.00 25.31 ? 161 LYS A CA  1 
ATOM   1281  C  C   . LYS A  1 161 ? 77.910 -58.889 10.740   1.00 24.31 ? 161 LYS A C   1 
ATOM   1282  O  O   . LYS A  1 161 ? 78.706 -59.539 11.410   1.00 28.41 ? 161 LYS A O   1 
ATOM   1283  C  CB  . LYS A  1 161 ? 75.729 -60.015 10.151   1.00 24.90 ? 161 LYS A CB  1 
ATOM   1284  C  CG  . LYS A  1 161 ? 74.315 -60.348 10.598   1.00 28.18 ? 161 LYS A CG  1 
ATOM   1285  C  CD  . LYS A  1 161 ? 73.470 -60.891 9.453    1.00 31.28 ? 161 LYS A CD  1 
ATOM   1286  C  CE  . LYS A  1 161 ? 73.829 -62.329 9.121    1.00 36.20 ? 161 LYS A CE  1 
ATOM   1287  N  NZ  . LYS A  1 161 ? 72.901 -62.894 8.099    1.00 29.87 ? 161 LYS A NZ  1 
ATOM   1288  N  N   . GLU A  1 162 ? 78.288 -58.073 9.766    1.00 24.68 ? 162 GLU A N   1 
ATOM   1289  C  CA  . GLU A  1 162 ? 79.689 -57.930 9.377    1.00 27.28 ? 162 GLU A CA  1 
ATOM   1290  C  C   . GLU A  1 162 ? 80.508 -57.071 10.350   1.00 28.39 ? 162 GLU A C   1 
ATOM   1291  O  O   . GLU A  1 162 ? 81.664 -57.378 10.631   1.00 26.20 ? 162 GLU A O   1 
ATOM   1292  C  CB  . GLU A  1 162 ? 79.778 -57.351 7.962    1.00 30.19 ? 162 GLU A CB  1 
ATOM   1293  C  CG  . GLU A  1 162 ? 81.179 -56.966 7.519    1.00 40.09 ? 162 GLU A CG  1 
ATOM   1294  C  CD  . GLU A  1 162 ? 82.025 -58.165 7.141    1.00 52.72 ? 162 GLU A CD  1 
ATOM   1295  O  OE1 . GLU A  1 162 ? 81.463 -59.274 7.009    1.00 52.14 ? 162 GLU A OE1 1 
ATOM   1296  O  OE2 . GLU A  1 162 ? 83.252 -58.000 6.980    1.00 61.58 ? 162 GLU A OE2 1 
ATOM   1297  N  N   . THR A  1 163 ? 79.915 -55.998 10.867   1.00 20.81 ? 163 THR A N   1 
ATOM   1298  C  CA  . THR A  1 163 ? 80.681 -55.031 11.655   1.00 21.69 ? 163 THR A CA  1 
ATOM   1299  C  C   . THR A  1 163 ? 80.234 -54.914 13.110   1.00 21.04 ? 163 THR A C   1 
ATOM   1300  O  O   . THR A  1 163 ? 80.902 -54.268 13.917   1.00 20.14 ? 163 THR A O   1 
ATOM   1301  C  CB  . THR A  1 163 ? 80.603 -53.627 11.033   1.00 22.49 ? 163 THR A CB  1 
ATOM   1302  O  OG1 . THR A  1 163 ? 79.251 -53.159 11.099   1.00 18.17 ? 163 THR A OG1 1 
ATOM   1303  C  CG2 . THR A  1 163 ? 81.073 -53.657 9.581    1.00 20.28 ? 163 THR A CG2 1 
ATOM   1304  N  N   . LYS A  1 164 ? 79.090 -55.509 13.434   1.00 18.55 ? 164 LYS A N   1 
ATOM   1305  C  CA  . LYS A  1 164 ? 78.559 -55.481 14.802   1.00 20.67 ? 164 LYS A CA  1 
ATOM   1306  C  C   . LYS A  1 164 ? 78.011 -54.124 15.264   1.00 19.02 ? 164 LYS A C   1 
ATOM   1307  O  O   . LYS A  1 164 ? 77.559 -53.998 16.400   1.00 18.92 ? 164 LYS A O   1 
ATOM   1308  C  CB  . LYS A  1 164 ? 79.601 -55.980 15.809   1.00 24.48 ? 164 LYS A CB  1 
ATOM   1309  C  CG  . LYS A  1 164 ? 80.380 -57.206 15.348   1.00 29.85 ? 164 LYS A CG  1 
ATOM   1310  C  CD  . LYS A  1 164 ? 79.453 -58.341 14.954   1.00 33.84 ? 164 LYS A CD  1 
ATOM   1311  C  CE  . LYS A  1 164 ? 80.236 -59.568 14.514   1.00 43.10 ? 164 LYS A CE  1 
ATOM   1312  N  NZ  . LYS A  1 164 ? 79.323 -60.645 14.042   1.00 50.14 ? 164 LYS A NZ  1 
ATOM   1313  N  N   . VAL A  1 165 ? 78.046 -53.107 14.408   1.00 18.43 ? 165 VAL A N   1 
ATOM   1314  C  CA  . VAL A  1 165 ? 77.432 -51.833 14.792   1.00 15.96 ? 165 VAL A CA  1 
ATOM   1315  C  C   . VAL A  1 165 ? 75.914 -52.013 14.913   1.00 16.30 ? 165 VAL A C   1 
ATOM   1316  O  O   . VAL A  1 165 ? 75.324 -52.838 14.217   1.00 15.26 ? 165 VAL A O   1 
ATOM   1317  C  CB  . VAL A  1 165 ? 77.748 -50.701 13.794   1.00 17.10 ? 165 VAL A CB  1 
ATOM   1318  C  CG1 . VAL A  1 165 ? 79.255 -50.547 13.616   1.00 17.05 ? 165 VAL A CG1 1 
ATOM   1319  C  CG2 . VAL A  1 165 ? 77.039 -50.939 12.465   1.00 15.71 ? 165 VAL A CG2 1 
ATOM   1320  N  N   . PRO A  1 166 ? 75.278 -51.245 15.804   1.00 15.20 ? 166 PRO A N   1 
ATOM   1321  C  CA  . PRO A  1 166 ? 73.847 -51.410 15.979   1.00 15.69 ? 166 PRO A CA  1 
ATOM   1322  C  C   . PRO A  1 166 ? 73.046 -50.698 14.897   1.00 16.99 ? 166 PRO A C   1 
ATOM   1323  O  O   . PRO A  1 166 ? 73.607 -49.969 14.070   1.00 16.02 ? 166 PRO A O   1 
ATOM   1324  C  CB  . PRO A  1 166 ? 73.583 -50.770 17.347   1.00 16.84 ? 166 PRO A CB  1 
ATOM   1325  C  CG  . PRO A  1 166 ? 74.673 -49.754 17.506   1.00 16.75 ? 166 PRO A CG  1 
ATOM   1326  C  CD  . PRO A  1 166 ? 75.870 -50.314 16.785   1.00 15.95 ? 166 PRO A CD  1 
ATOM   1327  N  N   . ILE A  1 167 ? 71.738 -50.918 14.912   1.00 15.32 ? 167 ILE A N   1 
ATOM   1328  C  CA  . ILE A  1 167 ? 70.849 -50.328 13.923   1.00 13.57 ? 167 ILE A CA  1 
ATOM   1329  C  C   . ILE A  1 167 ? 69.787 -49.471 14.596   1.00 15.17 ? 167 ILE A C   1 
ATOM   1330  O  O   . ILE A  1 167 ? 69.152 -49.896 15.560   1.00 15.45 ? 167 ILE A O   1 
ATOM   1331  C  CB  . ILE A  1 167 ? 70.172 -51.415 13.082   1.00 12.71 ? 167 ILE A CB  1 
ATOM   1332  C  CG1 . ILE A  1 167 ? 71.231 -52.195 12.292   1.00 12.68 ? 167 ILE A CG1 1 
ATOM   1333  C  CG2 . ILE A  1 167 ? 69.134 -50.803 12.135   1.00 14.91 ? 167 ILE A CG2 1 
ATOM   1334  C  CD1 . ILE A  1 167 ? 70.712 -53.509 11.730   1.00 12.09 ? 167 ILE A CD1 1 
ATOM   1335  N  N   . ILE A  1 168 ? 69.604 -48.265 14.075   1.00 13.76 ? 168 ILE A N   1 
ATOM   1336  C  CA  . ILE A  1 168 ? 68.570 -47.349 14.546   1.00 12.58 ? 168 ILE A CA  1 
ATOM   1337  C  C   . ILE A  1 168 ? 67.570 -47.213 13.421   1.00 14.93 ? 168 ILE A C   1 
ATOM   1338  O  O   . ILE A  1 168 ? 67.962 -47.037 12.270   1.00 15.38 ? 168 ILE A O   1 
ATOM   1339  C  CB  . ILE A  1 168 ? 69.166 -45.963 14.857   1.00 13.84 ? 168 ILE A CB  1 
ATOM   1340  C  CG1 . ILE A  1 168 ? 70.143 -46.056 16.032   1.00 13.10 ? 168 ILE A CG1 1 
ATOM   1341  C  CG2 . ILE A  1 168 ? 68.072 -44.930 15.126   1.00 14.37 ? 168 ILE A CG2 1 
ATOM   1342  C  CD1 . ILE A  1 168 ? 70.836 -44.739 16.344   1.00 15.68 ? 168 ILE A CD1 1 
ATOM   1343  N  N   . THR A  1 169 ? 66.281 -47.314 13.733   1.00 13.73 ? 169 THR A N   1 
ATOM   1344  C  CA  . THR A  1 169 ? 65.271 -47.177 12.698   1.00 13.74 ? 169 THR A CA  1 
ATOM   1345  C  C   . THR A  1 169 ? 64.367 -45.975 12.911   1.00 13.92 ? 169 THR A C   1 
ATOM   1346  O  O   . THR A  1 169 ? 64.197 -45.476 14.020   1.00 13.42 ? 169 THR A O   1 
ATOM   1347  C  CB  . THR A  1 169 ? 64.370 -48.423 12.563   1.00 14.73 ? 169 THR A CB  1 
ATOM   1348  O  OG1 . THR A  1 169 ? 63.283 -48.335 13.497   1.00 14.64 ? 169 THR A OG1 1 
ATOM   1349  C  CG2 . THR A  1 169 ? 65.183 -49.721 12.789   1.00 11.80 ? 169 THR A CG2 1 
ATOM   1350  N  N   . HIS A  1 170 ? 63.824 -45.514 11.796   1.00 13.32 ? 170 HIS A N   1 
ATOM   1351  C  CA  . HIS A  1 170 ? 62.712 -44.600 11.753   1.00 13.22 ? 170 HIS A CA  1 
ATOM   1352  C  C   . HIS A  1 170 ? 61.532 -45.456 11.372   1.00 13.33 ? 170 HIS A C   1 
ATOM   1353  O  O   . HIS A  1 170 ? 61.592 -46.200 10.391   1.00 12.28 ? 170 HIS A O   1 
ATOM   1354  C  CB  . HIS A  1 170 ? 62.995 -43.568 10.669   1.00 12.59 ? 170 HIS A CB  1 
ATOM   1355  C  CG  . HIS A  1 170 ? 61.834 -42.645 10.364   1.00 16.00 ? 170 HIS A CG  1 
ATOM   1356  N  ND1 . HIS A  1 170 ? 61.816 -41.345 10.750   1.00 14.43 ? 170 HIS A ND1 1 
ATOM   1357  C  CD2 . HIS A  1 170 ? 60.648 -42.870 9.662    1.00 16.41 ? 170 HIS A CD2 1 
ATOM   1358  C  CE1 . HIS A  1 170 ? 60.668 -40.775 10.315   1.00 16.57 ? 170 HIS A CE1 1 
ATOM   1359  N  NE2 . HIS A  1 170 ? 59.955 -41.710 9.655    1.00 16.50 ? 170 HIS A NE2 1 
ATOM   1360  N  N   . SER A  1 171 ? 60.455 -45.389 12.145   1.00 13.95 ? 171 SER A N   1 
ATOM   1361  C  CA  . SER A  1 171 ? 59.227 -46.070 11.758   1.00 13.81 ? 171 SER A CA  1 
ATOM   1362  C  C   . SER A  1 171 ? 58.009 -45.173 11.966   1.00 17.22 ? 171 SER A C   1 
ATOM   1363  O  O   . SER A  1 171 ? 58.109 -44.097 12.558   1.00 18.29 ? 171 SER A O   1 
ATOM   1364  C  CB  . SER A  1 171 ? 59.060 -47.386 12.530   1.00 15.56 ? 171 SER A CB  1 
ATOM   1365  O  OG  . SER A  1 171 ? 58.466 -47.166 13.799   1.00 16.95 ? 171 SER A OG  1 
ATOM   1366  N  N   . ASN A  1 172 ? 56.869 -45.616 11.451   1.00 14.59 ? 172 ASN A N   1 
ATOM   1367  C  CA  . ASN A  1 172 ? 55.587 -44.948 11.672   1.00 16.57 ? 172 ASN A CA  1 
ATOM   1368  C  C   . ASN A  1 172 ? 54.867 -45.733 12.745   1.00 17.44 ? 172 ASN A C   1 
ATOM   1369  O  O   . ASN A  1 172 ? 54.659 -46.937 12.595   1.00 15.97 ? 172 ASN A O   1 
ATOM   1370  C  CB  . ASN A  1 172 ? 54.750 -44.930 10.384   1.00 15.58 ? 172 ASN A CB  1 
ATOM   1371  C  CG  . ASN A  1 172 ? 53.414 -44.223 10.561   1.00 21.36 ? 172 ASN A CG  1 
ATOM   1372  O  OD1 . ASN A  1 172 ? 52.533 -44.701 11.274   1.00 20.77 ? 172 ASN A OD1 1 
ATOM   1373  N  ND2 . ASN A  1 172 ? 53.257 -43.084 9.899    1.00 18.87 ? 172 ASN A ND2 1 
ATOM   1374  N  N   . ALA A  1 173 ? 54.499 -45.055 13.827   1.00 18.19 ? 173 ALA A N   1 
ATOM   1375  C  CA  . ALA A  1 173 ? 53.990 -45.722 15.020   1.00 19.76 ? 173 ALA A CA  1 
ATOM   1376  C  C   . ALA A  1 173 ? 52.622 -46.359 14.822   1.00 22.77 ? 173 ALA A C   1 
ATOM   1377  O  O   . ALA A  1 173 ? 52.183 -47.149 15.657   1.00 24.12 ? 173 ALA A O   1 
ATOM   1378  C  CB  . ALA A  1 173 ? 53.941 -44.748 16.187   1.00 19.28 ? 173 ALA A CB  1 
ATOM   1379  N  N   . HIS A  1 174 ? 51.952 -46.023 13.723   1.00 23.24 ? 174 HIS A N   1 
ATOM   1380  C  CA  . HIS A  1 174 ? 50.556 -46.434 13.544   1.00 25.07 ? 174 HIS A CA  1 
ATOM   1381  C  C   . HIS A  1 174 ? 50.311 -47.525 12.534   1.00 24.38 ? 174 HIS A C   1 
ATOM   1382  O  O   . HIS A  1 174 ? 49.191 -48.015 12.423   1.00 23.52 ? 174 HIS A O   1 
ATOM   1383  C  CB  . HIS A  1 174 ? 49.686 -45.217 13.238   1.00 23.30 ? 174 HIS A CB  1 
ATOM   1384  C  CG  . HIS A  1 174 ? 49.904 -44.068 14.195   1.00 30.18 ? 174 HIS A CG  1 
ATOM   1385  N  ND1 . HIS A  1 174 ? 49.541 -44.126 15.489   1.00 29.01 ? 174 HIS A ND1 1 
ATOM   1386  C  CD2 . HIS A  1 174 ? 50.488 -42.816 14.006   1.00 29.00 ? 174 HIS A CD2 1 
ATOM   1387  C  CE1 . HIS A  1 174 ? 49.869 -42.970 16.099   1.00 26.73 ? 174 HIS A CE1 1 
ATOM   1388  N  NE2 . HIS A  1 174 ? 50.449 -42.172 15.191   1.00 30.05 ? 174 HIS A NE2 1 
ATOM   1389  N  N   . ASN A  1 175 ? 51.337 -47.936 11.796   1.00 22.41 ? 175 ASN A N   1 
ATOM   1390  C  CA  . ASN A  1 175 ? 51.133 -48.958 10.767   1.00 22.02 ? 175 ASN A CA  1 
ATOM   1391  C  C   . ASN A  1 175 ? 52.016 -50.206 10.851   1.00 24.43 ? 175 ASN A C   1 
ATOM   1392  O  O   . ASN A  1 175 ? 52.242 -50.867 9.838    1.00 26.99 ? 175 ASN A O   1 
ATOM   1393  C  CB  . ASN A  1 175 ? 51.266 -48.349 9.376    1.00 22.46 ? 175 ASN A CB  1 
ATOM   1394  C  CG  . ASN A  1 175 ? 52.694 -47.990 9.043    1.00 21.68 ? 175 ASN A CG  1 
ATOM   1395  O  OD1 . ASN A  1 175 ? 53.597 -48.191 9.855    1.00 20.17 ? 175 ASN A OD1 1 
ATOM   1396  N  ND2 . ASN A  1 175 ? 52.912 -47.465 7.843    1.00 22.78 ? 175 ASN A ND2 1 
ATOM   1397  N  N   . ASN A  1 176 ? 52.529 -50.529 12.032   1.00 20.87 ? 176 ASN A N   1 
ATOM   1398  C  CA  A ASN A  1 176 ? 53.269 -51.781 12.224   0.50 19.89 ? 176 ASN A CA  1 
ATOM   1399  C  CA  B ASN A  1 176 ? 53.254 -51.786 12.205   0.50 21.02 ? 176 ASN A CA  1 
ATOM   1400  C  C   . ASN A  1 176 ? 54.636 -51.855 11.528   1.00 19.42 ? 176 ASN A C   1 
ATOM   1401  O  O   . ASN A  1 176 ? 55.285 -52.897 11.545   1.00 18.60 ? 176 ASN A O   1 
ATOM   1402  C  CB  A ASN A  1 176 ? 52.409 -52.986 11.813   0.50 21.20 ? 176 ASN A CB  1 
ATOM   1403  C  CB  B ASN A  1 176 ? 52.346 -52.954 11.773   0.50 25.02 ? 176 ASN A CB  1 
ATOM   1404  C  CG  A ASN A  1 176 ? 51.282 -53.266 12.793   0.50 22.69 ? 176 ASN A CG  1 
ATOM   1405  C  CG  B ASN A  1 176 ? 53.104 -54.087 11.113   0.50 27.99 ? 176 ASN A CG  1 
ATOM   1406  O  OD1 A ASN A  1 176 ? 51.327 -52.854 13.952   0.50 21.11 ? 176 ASN A OD1 1 
ATOM   1407  O  OD1 B ASN A  1 176 ? 53.883 -53.873 10.185   0.50 41.32 ? 176 ASN A OD1 1 
ATOM   1408  N  ND2 A ASN A  1 176 ? 50.263 -53.979 12.328   0.50 26.38 ? 176 ASN A ND2 1 
ATOM   1409  N  ND2 B ASN A  1 176 ? 52.854 -55.308 11.569   0.50 31.24 ? 176 ASN A ND2 1 
ATOM   1410  N  N   . THR A  1 177 ? 55.096 -50.750 10.936   1.00 19.27 ? 177 THR A N   1 
ATOM   1411  C  CA  . THR A  1 177 ? 56.415 -50.759 10.283   1.00 17.13 ? 177 THR A CA  1 
ATOM   1412  C  C   . THR A  1 177 ? 57.560 -51.100 11.246   1.00 18.04 ? 177 THR A C   1 
ATOM   1413  O  O   . THR A  1 177 ? 58.483 -51.829 10.880   1.00 19.32 ? 177 THR A O   1 
ATOM   1414  C  CB  . THR A  1 177 ? 56.743 -49.444 9.541    1.00 18.05 ? 177 THR A CB  1 
ATOM   1415  O  OG1 . THR A  1 177 ? 56.280 -48.321 10.300   1.00 16.66 ? 177 THR A OG1 1 
ATOM   1416  C  CG2 . THR A  1 177 ? 56.094 -49.435 8.145    1.00 17.04 ? 177 THR A CG2 1 
ATOM   1417  N  N   . GLY A  1 178 ? 57.492 -50.586 12.472   1.00 17.00 ? 178 GLY A N   1 
ATOM   1418  C  CA  . GLY A  1 178 ? 58.513 -50.877 13.477   1.00 16.41 ? 178 GLY A CA  1 
ATOM   1419  C  C   . GLY A  1 178 ? 58.618 -52.364 13.752   1.00 17.88 ? 178 GLY A C   1 
ATOM   1420  O  O   . GLY A  1 178 ? 59.710 -52.929 13.777   1.00 17.78 ? 178 GLY A O   1 
ATOM   1421  N  N   . LEU A  1 179 ? 57.471 -53.002 13.954   1.00 18.22 ? 179 LEU A N   1 
ATOM   1422  C  CA  . LEU A  1 179 ? 57.421 -54.430 14.229   1.00 19.93 ? 179 LEU A CA  1 
ATOM   1423  C  C   . LEU A  1 179 ? 57.966 -55.227 13.040   1.00 19.26 ? 179 LEU A C   1 
ATOM   1424  O  O   . LEU A  1 179 ? 58.678 -56.213 13.219   1.00 20.34 ? 179 LEU A O   1 
ATOM   1425  C  CB  . LEU A  1 179 ? 55.984 -54.854 14.543   1.00 19.61 ? 179 LEU A CB  1 
ATOM   1426  C  CG  . LEU A  1 179 ? 55.782 -56.237 15.167   1.00 25.13 ? 179 LEU A CG  1 
ATOM   1427  C  CD1 . LEU A  1 179 ? 56.406 -56.283 16.550   1.00 21.27 ? 179 LEU A CD1 1 
ATOM   1428  C  CD2 . LEU A  1 179 ? 54.302 -56.582 15.245   1.00 24.36 ? 179 LEU A CD2 1 
ATOM   1429  N  N   . GLU A  1 180 ? 57.624 -54.795 11.828   1.00 17.96 ? 180 GLU A N   1 
ATOM   1430  C  CA  . GLU A  1 180 ? 58.122 -55.440 10.602   1.00 19.67 ? 180 GLU A CA  1 
ATOM   1431  C  C   . GLU A  1 180 ? 59.624 -55.273 10.431   1.00 17.04 ? 180 GLU A C   1 
ATOM   1432  O  O   . GLU A  1 180 ? 60.318 -56.202 10.018   1.00 17.18 ? 180 GLU A O   1 
ATOM   1433  C  CB  . GLU A  1 180 ? 57.421 -54.876 9.362    1.00 24.39 ? 180 GLU A CB  1 
ATOM   1434  C  CG  . GLU A  1 180 ? 56.025 -55.418 9.126    1.00 27.47 ? 180 GLU A CG  1 
ATOM   1435  C  CD  . GLU A  1 180 ? 56.045 -56.873 8.706    1.00 38.27 ? 180 GLU A CD  1 
ATOM   1436  O  OE1 . GLU A  1 180 ? 55.982 -57.136 7.488    1.00 42.27 ? 180 GLU A OE1 1 
ATOM   1437  O  OE2 . GLU A  1 180 ? 56.148 -57.751 9.589    1.00 34.83 ? 180 GLU A OE2 1 
ATOM   1438  N  N   . GLN A  1 181 ? 60.130 -54.084 10.728   1.00 17.01 ? 181 GLN A N   1 
ATOM   1439  C  CA  . GLN A  1 181 ? 61.569 -53.864 10.670   1.00 17.38 ? 181 GLN A CA  1 
ATOM   1440  C  C   . GLN A  1 181 ? 62.262 -54.851 11.600   1.00 15.07 ? 181 GLN A C   1 
ATOM   1441  O  O   . GLN A  1 181 ? 63.217 -55.517 11.219   1.00 16.96 ? 181 GLN A O   1 
ATOM   1442  C  CB  . GLN A  1 181 ? 61.919 -52.431 11.078   1.00 16.15 ? 181 GLN A CB  1 
ATOM   1443  C  CG  . GLN A  1 181 ? 61.510 -51.376 10.062   1.00 15.75 ? 181 GLN A CG  1 
ATOM   1444  C  CD  . GLN A  1 181 ? 61.578 -49.981 10.640   1.00 16.25 ? 181 GLN A CD  1 
ATOM   1445  O  OE1 . GLN A  1 181 ? 61.500 -49.805 11.853   1.00 15.06 ? 181 GLN A OE1 1 
ATOM   1446  N  NE2 . GLN A  1 181 ? 61.713 -48.976 9.775    1.00 16.69 ? 181 GLN A NE2 1 
ATOM   1447  N  N   . GLN A  1 182 ? 61.769 -54.942 12.828   1.00 17.17 ? 182 GLN A N   1 
ATOM   1448  C  CA  . GLN A  1 182 ? 62.352 -55.846 13.810   1.00 16.73 ? 182 GLN A CA  1 
ATOM   1449  C  C   . GLN A  1 182 ? 62.303 -57.292 13.336   1.00 17.92 ? 182 GLN A C   1 
ATOM   1450  O  O   . GLN A  1 182 ? 63.285 -58.024 13.462   1.00 18.90 ? 182 GLN A O   1 
ATOM   1451  C  CB  . GLN A  1 182 ? 61.632 -55.702 15.147   1.00 18.90 ? 182 GLN A CB  1 
ATOM   1452  C  CG  . GLN A  1 182 ? 62.161 -56.613 16.241   1.00 17.55 ? 182 GLN A CG  1 
ATOM   1453  C  CD  . GLN A  1 182 ? 61.336 -56.494 17.505   1.00 20.61 ? 182 GLN A CD  1 
ATOM   1454  O  OE1 . GLN A  1 182 ? 60.119 -56.654 17.475   1.00 19.90 ? 182 GLN A OE1 1 
ATOM   1455  N  NE2 . GLN A  1 182 ? 61.996 -56.215 18.624   1.00 17.16 ? 182 GLN A NE2 1 
ATOM   1456  N  N   . ARG A  1 183 ? 61.158 -57.705 12.795   1.00 18.31 ? 183 ARG A N   1 
ATOM   1457  C  CA  . ARG A  1 183 ? 61.009 -59.072 12.299   1.00 20.67 ? 183 ARG A CA  1 
ATOM   1458  C  C   . ARG A  1 183 ? 62.004 -59.393 11.184   1.00 21.54 ? 183 ARG A C   1 
ATOM   1459  O  O   . ARG A  1 183 ? 62.654 -60.437 11.199   1.00 21.29 ? 183 ARG A O   1 
ATOM   1460  C  CB  . ARG A  1 183 ? 59.581 -59.337 11.810   1.00 24.24 ? 183 ARG A CB  1 
ATOM   1461  C  CG  . ARG A  1 183 ? 59.377 -60.761 11.300   1.00 25.32 ? 183 ARG A CG  1 
ATOM   1462  C  CD  . ARG A  1 183 ? 58.008 -60.977 10.671   1.00 29.25 ? 183 ARG A CD  1 
ATOM   1463  N  NE  . ARG A  1 183 ? 57.740 -60.026 9.597    1.00 31.03 ? 183 ARG A NE  1 
ATOM   1464  C  CZ  . ARG A  1 183 ? 58.213 -60.137 8.360    1.00 37.01 ? 183 ARG A CZ  1 
ATOM   1465  N  NH1 . ARG A  1 183 ? 57.916 -59.212 7.454    1.00 32.36 ? 183 ARG A NH1 1 
ATOM   1466  N  NH2 . ARG A  1 183 ? 58.983 -61.168 8.028    1.00 32.82 ? 183 ARG A NH2 1 
ATOM   1467  N  N   . ILE A  1 184 ? 62.114 -58.500 10.209   1.00 21.51 ? 184 ILE A N   1 
ATOM   1468  C  CA  . ILE A  1 184 ? 62.999 -58.746 9.073    1.00 19.44 ? 184 ILE A CA  1 
ATOM   1469  C  C   . ILE A  1 184 ? 64.463 -58.829 9.511    1.00 18.38 ? 184 ILE A C   1 
ATOM   1470  O  O   . ILE A  1 184 ? 65.189 -59.753 9.124    1.00 18.07 ? 184 ILE A O   1 
ATOM   1471  C  CB  . ILE A  1 184 ? 62.817 -57.676 7.984    1.00 18.98 ? 184 ILE A CB  1 
ATOM   1472  C  CG1 . ILE A  1 184 ? 61.419 -57.806 7.370    1.00 18.73 ? 184 ILE A CG1 1 
ATOM   1473  C  CG2 . ILE A  1 184 ? 63.892 -57.818 6.913    1.00 18.64 ? 184 ILE A CG2 1 
ATOM   1474  C  CD1 . ILE A  1 184 ? 60.996 -56.621 6.527    1.00 20.95 ? 184 ILE A CD1 1 
ATOM   1475  N  N   . LEU A  1 185 ? 64.879 -57.877 10.342   1.00 17.75 ? 185 LEU A N   1 
ATOM   1476  C  CA  . LEU A  1 185 ? 66.246 -57.849 10.863   1.00 18.21 ? 185 LEU A CA  1 
ATOM   1477  C  C   . LEU A  1 185 ? 66.560 -59.088 11.698   1.00 18.00 ? 185 LEU A C   1 
ATOM   1478  O  O   . LEU A  1 185 ? 67.614 -59.692 11.527   1.00 18.14 ? 185 LEU A O   1 
ATOM   1479  C  CB  . LEU A  1 185 ? 66.491 -56.585 11.695   1.00 14.56 ? 185 LEU A CB  1 
ATOM   1480  C  CG  . LEU A  1 185 ? 66.511 -55.248 10.944   1.00 15.50 ? 185 LEU A CG  1 
ATOM   1481  C  CD1 . LEU A  1 185 ? 66.537 -54.102 11.943   1.00 12.63 ? 185 LEU A CD1 1 
ATOM   1482  C  CD2 . LEU A  1 185 ? 67.691 -55.164 9.981    1.00 15.05 ? 185 LEU A CD2 1 
ATOM   1483  N  N   . THR A  1 186 ? 65.655 -59.470 12.601   1.00 18.03 ? 186 THR A N   1 
ATOM   1484  C  CA  . THR A  1 186 ? 65.904 -60.656 13.427   1.00 18.11 ? 186 THR A CA  1 
ATOM   1485  C  C   . THR A  1 186 ? 65.898 -61.925 12.572   1.00 20.63 ? 186 THR A C   1 
ATOM   1486  O  O   . THR A  1 186 ? 66.718 -62.807 12.778   1.00 18.69 ? 186 THR A O   1 
ATOM   1487  C  CB  . THR A  1 186 ? 64.933 -60.790 14.623   1.00 18.44 ? 186 THR A CB  1 
ATOM   1488  O  OG1 . THR A  1 186 ? 63.577 -60.754 14.160   1.00 20.57 ? 186 THR A OG1 1 
ATOM   1489  C  CG2 . THR A  1 186 ? 65.149 -59.662 15.622   1.00 15.91 ? 186 THR A CG2 1 
ATOM   1490  N  N   . GLU A  1 187 ? 64.993 -62.011 11.602   1.00 22.82 ? 187 GLU A N   1 
ATOM   1491  C  CA  . GLU A  1 187 ? 64.971 -63.166 10.697   1.00 24.62 ? 187 GLU A CA  1 
ATOM   1492  C  C   . GLU A  1 187 ? 66.258 -63.281 9.892    1.00 23.90 ? 187 GLU A C   1 
ATOM   1493  O  O   . GLU A  1 187 ? 66.649 -64.377 9.508    1.00 26.97 ? 187 GLU A O   1 
ATOM   1494  C  CB  . GLU A  1 187 ? 63.786 -63.103 9.737    1.00 28.07 ? 187 GLU A CB  1 
ATOM   1495  C  CG  . GLU A  1 187 ? 62.476 -63.612 10.309   1.00 33.94 ? 187 GLU A CG  1 
ATOM   1496  C  CD  . GLU A  1 187 ? 61.330 -63.438 9.333    1.00 41.94 ? 187 GLU A CD  1 
ATOM   1497  O  OE1 . GLU A  1 187 ? 60.158 -63.519 9.762    1.00 45.37 ? 187 GLU A OE1 1 
ATOM   1498  O  OE2 . GLU A  1 187 ? 61.605 -63.212 8.134    1.00 38.24 ? 187 GLU A OE2 1 
ATOM   1499  N  N   . GLU A  1 188 ? 66.901 -62.146 9.620    1.00 22.75 ? 188 GLU A N   1 
ATOM   1500  C  CA  . GLU A  1 188 ? 68.194 -62.137 8.939    1.00 23.15 ? 188 GLU A CA  1 
ATOM   1501  C  C   . GLU A  1 188 ? 69.327 -62.486 9.901    1.00 23.57 ? 188 GLU A C   1 
ATOM   1502  O  O   . GLU A  1 188 ? 70.468 -62.669 9.481    1.00 29.12 ? 188 GLU A O   1 
ATOM   1503  C  CB  . GLU A  1 188 ? 68.471 -60.771 8.300    1.00 21.57 ? 188 GLU A CB  1 
ATOM   1504  C  CG  . GLU A  1 188 ? 67.657 -60.466 7.051    1.00 20.90 ? 188 GLU A CG  1 
ATOM   1505  C  CD  . GLU A  1 188 ? 68.177 -61.182 5.819    1.00 23.51 ? 188 GLU A CD  1 
ATOM   1506  O  OE1 . GLU A  1 188 ? 69.221 -61.864 5.913    1.00 24.33 ? 188 GLU A OE1 1 
ATOM   1507  O  OE2 . GLU A  1 188 ? 67.544 -61.060 4.750    1.00 22.20 ? 188 GLU A OE2 1 
ATOM   1508  N  N   . GLY A  1 189 ? 69.019 -62.559 11.191   1.00 21.13 ? 189 GLY A N   1 
ATOM   1509  C  CA  . GLY A  1 189 ? 70.021 -62.950 12.178   1.00 23.26 ? 189 GLY A CA  1 
ATOM   1510  C  C   . GLY A  1 189 ? 70.643 -61.808 12.961   1.00 21.95 ? 189 GLY A C   1 
ATOM   1511  O  O   . GLY A  1 189 ? 71.685 -61.978 13.599   1.00 21.69 ? 189 GLY A O   1 
ATOM   1512  N  N   . VAL A  1 190 ? 70.022 -60.634 12.911   1.00 18.49 ? 190 VAL A N   1 
ATOM   1513  C  CA  . VAL A  1 190 ? 70.458 -59.528 13.764   1.00 18.41 ? 190 VAL A CA  1 
ATOM   1514  C  C   . VAL A  1 190 ? 69.990 -59.772 15.204   1.00 18.69 ? 190 VAL A C   1 
ATOM   1515  O  O   . VAL A  1 190 ? 68.845 -60.148 15.438   1.00 17.82 ? 190 VAL A O   1 
ATOM   1516  C  CB  . VAL A  1 190 ? 69.927 -58.174 13.250   1.00 17.90 ? 190 VAL A CB  1 
ATOM   1517  C  CG1 . VAL A  1 190 ? 70.232 -57.050 14.239   1.00 15.83 ? 190 VAL A CG1 1 
ATOM   1518  C  CG2 . VAL A  1 190 ? 70.523 -57.861 11.884   1.00 17.17 ? 190 VAL A CG2 1 
ATOM   1519  N  N   . ASP A  1 191 ? 70.890 -59.577 16.163   1.00 19.75 ? 191 ASP A N   1 
ATOM   1520  C  CA  . ASP A  1 191 ? 70.537 -59.619 17.584   1.00 22.16 ? 191 ASP A CA  1 
ATOM   1521  C  C   . ASP A  1 191 ? 69.536 -58.495 17.902   1.00 19.92 ? 191 ASP A C   1 
ATOM   1522  O  O   . ASP A  1 191 ? 69.834 -57.322 17.705   1.00 17.57 ? 191 ASP A O   1 
ATOM   1523  C  CB  . ASP A  1 191 ? 71.815 -59.473 18.419   1.00 23.16 ? 191 ASP A CB  1 
ATOM   1524  C  CG  . ASP A  1 191 ? 71.548 -59.256 19.901   1.00 29.12 ? 191 ASP A CG  1 
ATOM   1525  O  OD1 . ASP A  1 191 ? 70.379 -59.249 20.334   1.00 27.58 ? 191 ASP A OD1 1 
ATOM   1526  O  OD2 . ASP A  1 191 ? 72.536 -59.085 20.641   1.00 36.40 ? 191 ASP A OD2 1 
ATOM   1527  N  N   . PRO A  1 192 ? 68.340 -58.860 18.398   1.00 21.25 ? 192 PRO A N   1 
ATOM   1528  C  CA  . PRO A  1 192 ? 67.294 -57.881 18.692   1.00 21.45 ? 192 PRO A CA  1 
ATOM   1529  C  C   . PRO A  1 192 ? 67.789 -56.738 19.575   1.00 21.52 ? 192 PRO A C   1 
ATOM   1530  O  O   . PRO A  1 192 ? 67.311 -55.607 19.446   1.00 19.54 ? 192 PRO A O   1 
ATOM   1531  C  CB  . PRO A  1 192 ? 66.219 -58.701 19.431   1.00 21.35 ? 192 PRO A CB  1 
ATOM   1532  C  CG  . PRO A  1 192 ? 66.815 -60.053 19.679   1.00 23.86 ? 192 PRO A CG  1 
ATOM   1533  C  CD  . PRO A  1 192 ? 67.911 -60.240 18.682   1.00 20.35 ? 192 PRO A CD  1 
ATOM   1534  N  N   . GLY A  1 193 ? 68.729 -57.041 20.469   1.00 20.21 ? 193 GLY A N   1 
ATOM   1535  C  CA  . GLY A  1 193 ? 69.288 -56.047 21.380   1.00 19.05 ? 193 GLY A CA  1 
ATOM   1536  C  C   . GLY A  1 193 ? 70.189 -55.028 20.705   1.00 18.42 ? 193 GLY A C   1 
ATOM   1537  O  O   . GLY A  1 193 ? 70.632 -54.073 21.342   1.00 20.06 ? 193 GLY A O   1 
ATOM   1538  N  N   . LYS A  1 194 ? 70.466 -55.230 19.419   1.00 18.12 ? 194 LYS A N   1 
ATOM   1539  C  CA  . LYS A  1 194 ? 71.250 -54.265 18.632   1.00 17.81 ? 194 LYS A CA  1 
ATOM   1540  C  C   . LYS A  1 194 ? 70.350 -53.421 17.728   1.00 17.14 ? 194 LYS A C   1 
ATOM   1541  O  O   . LYS A  1 194 ? 70.822 -52.783 16.780   1.00 16.06 ? 194 LYS A O   1 
ATOM   1542  C  CB  . LYS A  1 194 ? 72.309 -54.975 17.776   1.00 17.38 ? 194 LYS A CB  1 
ATOM   1543  C  CG  . LYS A  1 194 ? 73.369 -55.733 18.571   1.00 24.96 ? 194 LYS A CG  1 
ATOM   1544  C  CD  . LYS A  1 194 ? 74.243 -54.806 19.406   1.00 27.49 ? 194 LYS A CD  1 
ATOM   1545  C  CE  . LYS A  1 194 ? 75.318 -54.128 18.567   1.00 37.64 ? 194 LYS A CE  1 
ATOM   1546  N  NZ  . LYS A  1 194 ? 76.245 -53.291 19.390   1.00 30.42 ? 194 LYS A NZ  1 
ATOM   1547  N  N   . ILE A  1 195 ? 69.054 -53.421 18.019   1.00 14.73 ? 195 ILE A N   1 
ATOM   1548  C  CA  . ILE A  1 195 ? 68.106 -52.640 17.231   1.00 14.44 ? 195 ILE A CA  1 
ATOM   1549  C  C   . ILE A  1 195 ? 67.362 -51.639 18.109   1.00 15.24 ? 195 ILE A C   1 
ATOM   1550  O  O   . ILE A  1 195 ? 66.848 -51.996 19.170   1.00 14.16 ? 195 ILE A O   1 
ATOM   1551  C  CB  . ILE A  1 195 ? 67.057 -53.548 16.550   1.00 15.11 ? 195 ILE A CB  1 
ATOM   1552  C  CG1 . ILE A  1 195 ? 67.734 -54.737 15.862   1.00 13.90 ? 195 ILE A CG1 1 
ATOM   1553  C  CG2 . ILE A  1 195 ? 66.213 -52.748 15.562   1.00 14.15 ? 195 ILE A CG2 1 
ATOM   1554  C  CD1 . ILE A  1 195 ? 66.761 -55.765 15.327   1.00 14.61 ? 195 ILE A CD1 1 
ATOM   1555  N  N   . LEU A  1 196 ? 67.312 -50.387 17.664   1.00 13.99 ? 196 LEU A N   1 
ATOM   1556  C  CA  . LEU A  1 196 ? 66.410 -49.400 18.244   1.00 14.27 ? 196 LEU A CA  1 
ATOM   1557  C  C   . LEU A  1 196 ? 65.279 -49.143 17.252   1.00 14.66 ? 196 LEU A C   1 
ATOM   1558  O  O   . LEU A  1 196 ? 65.523 -48.648 16.153   1.00 13.37 ? 196 LEU A O   1 
ATOM   1559  C  CB  . LEU A  1 196 ? 67.160 -48.094 18.546   1.00 15.26 ? 196 LEU A CB  1 
ATOM   1560  C  CG  . LEU A  1 196 ? 66.331 -46.840 18.871   1.00 15.06 ? 196 LEU A CG  1 
ATOM   1561  C  CD1 . LEU A  1 196 ? 65.462 -47.061 20.101   1.00 16.83 ? 196 LEU A CD1 1 
ATOM   1562  C  CD2 . LEU A  1 196 ? 67.250 -45.644 19.089   1.00 14.78 ? 196 LEU A CD2 1 
ATOM   1563  N  N   . ILE A  1 197 ? 64.050 -49.499 17.621   1.00 13.82 ? 197 ILE A N   1 
ATOM   1564  C  CA  . ILE A  1 197 ? 62.908 -49.255 16.750   1.00 13.21 ? 197 ILE A CA  1 
ATOM   1565  C  C   . ILE A  1 197 ? 62.364 -47.864 17.074   1.00 13.06 ? 197 ILE A C   1 
ATOM   1566  O  O   . ILE A  1 197 ? 61.897 -47.617 18.181   1.00 14.63 ? 197 ILE A O   1 
ATOM   1567  C  CB  . ILE A  1 197 ? 61.788 -50.299 16.923   1.00 13.59 ? 197 ILE A CB  1 
ATOM   1568  C  CG1 . ILE A  1 197 ? 62.286 -51.697 16.544   1.00 14.17 ? 197 ILE A CG1 1 
ATOM   1569  C  CG2 . ILE A  1 197 ? 60.597 -49.911 16.058   1.00 15.09 ? 197 ILE A CG2 1 
ATOM   1570  C  CD1 . ILE A  1 197 ? 62.743 -51.815 15.096   1.00 13.80 ? 197 ILE A CD1 1 
ATOM   1571  N  N   . GLY A  1 198 ? 62.437 -46.960 16.104   1.00 12.30 ? 198 GLY A N   1 
ATOM   1572  C  CA  . GLY A  1 198 ? 62.256 -45.543 16.385   1.00 13.78 ? 198 GLY A CA  1 
ATOM   1573  C  C   . GLY A  1 198 ? 60.833 -45.056 16.289   1.00 15.12 ? 198 GLY A C   1 
ATOM   1574  O  O   . GLY A  1 198 ? 59.987 -45.685 15.634   1.00 15.05 ? 198 GLY A O   1 
ATOM   1575  N  N   . HIS A  1 199 ? 60.574 -43.946 16.976   1.00 13.53 ? 199 HIS A N   1 
ATOM   1576  C  CA  . HIS A  1 199 ? 59.328 -43.181 16.846   1.00 15.86 ? 199 HIS A CA  1 
ATOM   1577  C  C   . HIS A  1 199 ? 58.114 -43.875 17.430   1.00 17.10 ? 199 HIS A C   1 
ATOM   1578  O  O   . HIS A  1 199 ? 56.961 -43.534 17.125   1.00 14.60 ? 199 HIS A O   1 
ATOM   1579  C  CB  . HIS A  1 199 ? 59.117 -42.737 15.390   1.00 14.83 ? 199 HIS A CB  1 
ATOM   1580  C  CG  . HIS A  1 199 ? 60.325 -42.023 14.785   1.00 16.61 ? 199 HIS A CG  1 
ATOM   1581  N  ND1 . HIS A  1 199 ? 61.217 -41.350 15.535   1.00 18.01 ? 199 HIS A ND1 1 
ATOM   1582  C  CD2 . HIS A  1 199 ? 60.756 -41.896 13.457   1.00 15.75 ? 199 HIS A CD2 1 
ATOM   1583  C  CE1 . HIS A  1 199 ? 62.179 -40.819 14.739   1.00 15.20 ? 199 HIS A CE1 1 
ATOM   1584  N  NE2 . HIS A  1 199 ? 61.901 -41.152 13.467   1.00 16.13 ? 199 HIS A NE2 1 
ATOM   1585  N  N   . LEU A  1 200 ? 58.364 -44.843 18.302   1.00 14.47 ? 200 LEU A N   1 
ATOM   1586  C  CA  . LEU A  1 200 ? 57.287 -45.546 18.984   1.00 17.32 ? 200 LEU A CA  1 
ATOM   1587  C  C   . LEU A  1 200 ? 56.584 -44.632 19.996   1.00 17.62 ? 200 LEU A C   1 
ATOM   1588  O  O   . LEU A  1 200 ? 55.453 -44.887 20.389   1.00 18.53 ? 200 LEU A O   1 
ATOM   1589  C  CB  . LEU A  1 200 ? 57.828 -46.807 19.665   1.00 17.48 ? 200 LEU A CB  1 
ATOM   1590  C  CG  . LEU A  1 200 ? 58.335 -47.863 18.672   1.00 18.99 ? 200 LEU A CG  1 
ATOM   1591  C  CD1 . LEU A  1 200 ? 58.900 -49.082 19.393   1.00 17.11 ? 200 LEU A CD1 1 
ATOM   1592  C  CD2 . LEU A  1 200 ? 57.228 -48.271 17.704   1.00 17.94 ? 200 LEU A CD2 1 
ATOM   1593  N  N   . GLY A  1 201 ? 57.261 -43.560 20.401   1.00 17.99 ? 201 GLY A N   1 
ATOM   1594  C  CA  . GLY A  1 201 ? 56.677 -42.588 21.316   1.00 16.07 ? 201 GLY A CA  1 
ATOM   1595  C  C   . GLY A  1 201 ? 55.608 -41.752 20.635   1.00 18.82 ? 201 GLY A C   1 
ATOM   1596  O  O   . GLY A  1 201 ? 54.930 -40.953 21.281   1.00 18.42 ? 201 GLY A O   1 
ATOM   1597  N  N   . ASP A  1 202 ? 55.454 -41.932 19.325   1.00 18.33 ? 202 ASP A N   1 
ATOM   1598  C  CA  . ASP A  1 202 ? 54.405 -41.237 18.581   1.00 19.27 ? 202 ASP A CA  1 
ATOM   1599  C  C   . ASP A  1 202 ? 53.013 -41.811 18.863   1.00 21.38 ? 202 ASP A C   1 
ATOM   1600  O  O   . ASP A  1 202 ? 52.004 -41.225 18.475   1.00 19.43 ? 202 ASP A O   1 
ATOM   1601  C  CB  . ASP A  1 202 ? 54.687 -41.265 17.075   1.00 19.35 ? 202 ASP A CB  1 
ATOM   1602  C  CG  . ASP A  1 202 ? 55.910 -40.447 16.694   1.00 22.24 ? 202 ASP A CG  1 
ATOM   1603  O  OD1 . ASP A  1 202 ? 56.503 -39.802 17.591   1.00 18.62 ? 202 ASP A OD1 1 
ATOM   1604  O  OD2 . ASP A  1 202 ? 56.274 -40.458 15.499   1.00 22.51 ? 202 ASP A OD2 1 
ATOM   1605  N  N   . THR A  1 203 ? 52.953 -42.957 19.531   1.00 20.96 ? 203 THR A N   1 
ATOM   1606  C  CA  . THR A  1 203 ? 51.655 -43.539 19.870   1.00 21.61 ? 203 THR A CA  1 
ATOM   1607  C  C   . THR A  1 203 ? 51.525 -43.772 21.369   1.00 23.73 ? 203 THR A C   1 
ATOM   1608  O  O   . THR A  1 203 ? 52.529 -43.863 22.075   1.00 20.24 ? 203 THR A O   1 
ATOM   1609  C  CB  . THR A  1 203 ? 51.400 -44.858 19.107   1.00 20.66 ? 203 THR A CB  1 
ATOM   1610  O  OG1 . THR A  1 203 ? 50.061 -45.296 19.355   1.00 23.12 ? 203 THR A OG1 1 
ATOM   1611  C  CG2 . THR A  1 203 ? 52.369 -45.939 19.558   1.00 20.84 ? 203 THR A CG2 1 
ATOM   1612  N  N   . ASP A  1 204 ? 50.287 -43.846 21.857   1.00 24.26 ? 204 ASP A N   1 
ATOM   1613  C  CA  . ASP A  1 204 ? 50.047 -44.207 23.258   1.00 26.60 ? 204 ASP A CA  1 
ATOM   1614  C  C   . ASP A  1 204 ? 49.531 -45.643 23.363   1.00 29.92 ? 204 ASP A C   1 
ATOM   1615  O  O   . ASP A  1 204 ? 49.060 -46.070 24.416   1.00 24.62 ? 204 ASP A O   1 
ATOM   1616  C  CB  . ASP A  1 204 ? 49.086 -43.225 23.939   1.00 34.03 ? 204 ASP A CB  1 
ATOM   1617  C  CG  . ASP A  1 204 ? 47.726 -43.171 23.266   1.00 40.72 ? 204 ASP A CG  1 
ATOM   1618  O  OD1 . ASP A  1 204 ? 47.479 -43.967 22.337   1.00 37.23 ? 204 ASP A OD1 1 
ATOM   1619  O  OD2 . ASP A  1 204 ? 46.900 -42.329 23.669   1.00 52.82 ? 204 ASP A OD2 1 
ATOM   1620  N  N   . ASN A  1 205 ? 49.636 -46.384 22.261   1.00 25.57 ? 205 ASN A N   1 
ATOM   1621  C  CA  . ASN A  1 205 ? 49.289 -47.800 22.246   1.00 25.50 ? 205 ASN A CA  1 
ATOM   1622  C  C   . ASN A  1 205 ? 50.386 -48.649 22.885   1.00 24.05 ? 205 ASN A C   1 
ATOM   1623  O  O   . ASN A  1 205 ? 51.254 -49.169 22.189   1.00 21.99 ? 205 ASN A O   1 
ATOM   1624  C  CB  . ASN A  1 205 ? 49.049 -48.254 20.803   1.00 26.61 ? 205 ASN A CB  1 
ATOM   1625  C  CG  . ASN A  1 205 ? 48.591 -49.697 20.712   1.00 30.49 ? 205 ASN A CG  1 
ATOM   1626  O  OD1 . ASN A  1 205 ? 48.588 -50.424 21.700   1.00 30.23 ? 205 ASN A OD1 1 
ATOM   1627  N  ND2 . ASN A  1 205 ? 48.206 -50.117 19.515   1.00 32.36 ? 205 ASN A ND2 1 
ATOM   1628  N  N   . ILE A  1 206 ? 50.353 -48.796 24.207   1.00 25.81 ? 206 ILE A N   1 
ATOM   1629  C  CA  . ILE A  1 206 ? 51.434 -49.495 24.912   1.00 26.33 ? 206 ILE A CA  1 
ATOM   1630  C  C   . ILE A  1 206 ? 51.548 -50.979 24.559   1.00 24.61 ? 206 ILE A C   1 
ATOM   1631  O  O   . ILE A  1 206 ? 52.628 -51.564 24.654   1.00 24.40 ? 206 ILE A O   1 
ATOM   1632  C  CB  . ILE A  1 206 ? 51.332 -49.328 26.441   1.00 29.62 ? 206 ILE A CB  1 
ATOM   1633  C  CG1 . ILE A  1 206 ? 49.945 -49.728 26.932   1.00 31.47 ? 206 ILE A CG1 1 
ATOM   1634  C  CG2 . ILE A  1 206 ? 51.635 -47.893 26.839   1.00 32.22 ? 206 ILE A CG2 1 
ATOM   1635  C  CD1 . ILE A  1 206 ? 49.670 -49.304 28.357   1.00 38.67 ? 206 ILE A CD1 1 
ATOM   1636  N  N   . ASP A  1 207 ? 50.442 -51.588 24.147   1.00 23.76 ? 207 ASP A N   1 
ATOM   1637  C  CA  . ASP A  1 207 ? 50.468 -52.997 23.766   1.00 27.19 ? 207 ASP A CA  1 
ATOM   1638  C  C   . ASP A  1 207 ? 51.350 -53.218 22.547   1.00 24.35 ? 207 ASP A C   1 
ATOM   1639  O  O   . ASP A  1 207 ? 52.078 -54.208 22.471   1.00 24.67 ? 207 ASP A O   1 
ATOM   1640  C  CB  . ASP A  1 207 ? 49.057 -53.520 23.493   1.00 32.10 ? 207 ASP A CB  1 
ATOM   1641  C  CG  . ASP A  1 207 ? 48.274 -53.755 24.764   1.00 43.57 ? 207 ASP A CG  1 
ATOM   1642  O  OD1 . ASP A  1 207 ? 47.028 -53.720 24.711   1.00 50.89 ? 207 ASP A OD1 1 
ATOM   1643  O  OD2 . ASP A  1 207 ? 48.909 -53.969 25.818   1.00 47.50 ? 207 ASP A OD2 1 
ATOM   1644  N  N   . TYR A  1 208 ? 51.274 -52.300 21.589   1.00 21.84 ? 208 TYR A N   1 
ATOM   1645  C  CA  . TYR A  1 208 ? 52.126 -52.372 20.413   1.00 22.57 ? 208 TYR A CA  1 
ATOM   1646  C  C   . TYR A  1 208 ? 53.577 -52.151 20.827   1.00 20.90 ? 208 TYR A C   1 
ATOM   1647  O  O   . TYR A  1 208 ? 54.457 -52.931 20.478   1.00 21.74 ? 208 TYR A O   1 
ATOM   1648  C  CB  . TYR A  1 208 ? 51.705 -51.335 19.367   1.00 23.54 ? 208 TYR A CB  1 
ATOM   1649  C  CG  . TYR A  1 208 ? 52.620 -51.278 18.156   1.00 20.67 ? 208 TYR A CG  1 
ATOM   1650  C  CD1 . TYR A  1 208 ? 52.794 -52.388 17.329   1.00 21.46 ? 208 TYR A CD1 1 
ATOM   1651  C  CD2 . TYR A  1 208 ? 53.293 -50.110 17.832   1.00 18.93 ? 208 TYR A CD2 1 
ATOM   1652  C  CE1 . TYR A  1 208 ? 53.629 -52.332 16.219   1.00 21.27 ? 208 TYR A CE1 1 
ATOM   1653  C  CE2 . TYR A  1 208 ? 54.124 -50.042 16.729   1.00 18.02 ? 208 TYR A CE2 1 
ATOM   1654  C  CZ  . TYR A  1 208 ? 54.296 -51.150 15.929   1.00 19.11 ? 208 TYR A CZ  1 
ATOM   1655  O  OH  . TYR A  1 208 ? 55.128 -51.053 14.837   1.00 18.54 ? 208 TYR A OH  1 
ATOM   1656  N  N   . ILE A  1 209 ? 53.815 -51.091 21.590   1.00 21.12 ? 209 ILE A N   1 
ATOM   1657  C  CA  . ILE A  1 209 ? 55.166 -50.769 22.043   1.00 21.23 ? 209 ILE A CA  1 
ATOM   1658  C  C   . ILE A  1 209 ? 55.784 -51.940 22.810   1.00 20.39 ? 209 ILE A C   1 
ATOM   1659  O  O   . ILE A  1 209 ? 56.931 -52.315 22.562   1.00 23.24 ? 209 ILE A O   1 
ATOM   1660  C  CB  . ILE A  1 209 ? 55.180 -49.487 22.901   1.00 18.92 ? 209 ILE A CB  1 
ATOM   1661  C  CG1 . ILE A  1 209 ? 54.709 -48.289 22.065   1.00 19.13 ? 209 ILE A CG1 1 
ATOM   1662  C  CG2 . ILE A  1 209 ? 56.572 -49.232 23.473   1.00 19.05 ? 209 ILE A CG2 1 
ATOM   1663  C  CD1 . ILE A  1 209 ? 54.463 -47.030 22.876   1.00 19.35 ? 209 ILE A CD1 1 
ATOM   1664  N  N   . LYS A  1 210 ? 55.020 -52.529 23.727   1.00 22.34 ? 210 LYS A N   1 
ATOM   1665  C  CA  . LYS A  1 210 ? 55.521 -53.653 24.522   1.00 24.46 ? 210 LYS A CA  1 
ATOM   1666  C  C   . LYS A  1 210 ? 55.851 -54.858 23.655   1.00 23.72 ? 210 LYS A C   1 
ATOM   1667  O  O   . LYS A  1 210 ? 56.766 -55.617 23.962   1.00 21.58 ? 210 LYS A O   1 
ATOM   1668  C  CB  . LYS A  1 210 ? 54.523 -54.061 25.599   1.00 22.63 ? 210 LYS A CB  1 
ATOM   1669  C  CG  . LYS A  1 210 ? 54.451 -53.100 26.772   1.00 23.82 ? 210 LYS A CG  1 
ATOM   1670  C  CD  . LYS A  1 210 ? 53.407 -53.577 27.768   1.00 27.38 ? 210 LYS A CD  1 
ATOM   1671  C  CE  . LYS A  1 210 ? 53.224 -52.573 28.894   1.00 29.52 ? 210 LYS A CE  1 
ATOM   1672  N  NZ  . LYS A  1 210 ? 52.383 -53.143 29.982   1.00 27.79 ? 210 LYS A NZ  1 
ATOM   1673  N  N   . LYS A  1 211 ? 55.095 -55.037 22.578   1.00 23.15 ? 211 LYS A N   1 
ATOM   1674  C  CA  . LYS A  1 211 ? 55.326 -56.158 21.674   1.00 26.58 ? 211 LYS A CA  1 
ATOM   1675  C  C   . LYS A  1 211 ? 56.760 -56.124 21.148   1.00 24.05 ? 211 LYS A C   1 
ATOM   1676  O  O   . LYS A  1 211 ? 57.442 -57.149 21.072   1.00 23.80 ? 211 LYS A O   1 
ATOM   1677  C  CB  . LYS A  1 211 ? 54.334 -56.098 20.515   1.00 30.95 ? 211 LYS A CB  1 
ATOM   1678  C  CG  . LYS A  1 211 ? 54.096 -57.426 19.824   1.00 44.28 ? 211 LYS A CG  1 
ATOM   1679  C  CD  . LYS A  1 211 ? 52.898 -57.333 18.894   1.00 50.49 ? 211 LYS A CD  1 
ATOM   1680  C  CE  . LYS A  1 211 ? 51.649 -56.918 19.654   1.00 54.74 ? 211 LYS A CE  1 
ATOM   1681  N  NZ  . LYS A  1 211 ? 50.514 -56.618 18.739   1.00 65.64 ? 211 LYS A NZ  1 
ATOM   1682  N  N   . ILE A  1 212 ? 57.220 -54.933 20.795   1.00 19.28 ? 212 ILE A N   1 
ATOM   1683  C  CA  . ILE A  1 212 ? 58.561 -54.770 20.263   1.00 19.06 ? 212 ILE A CA  1 
ATOM   1684  C  C   . ILE A  1 212 ? 59.613 -54.960 21.358   1.00 20.39 ? 212 ILE A C   1 
ATOM   1685  O  O   . ILE A  1 212 ? 60.631 -55.634 21.153   1.00 17.13 ? 212 ILE A O   1 
ATOM   1686  C  CB  . ILE A  1 212 ? 58.704 -53.406 19.572   1.00 19.79 ? 212 ILE A CB  1 
ATOM   1687  C  CG1 . ILE A  1 212 ? 57.872 -53.415 18.275   1.00 22.96 ? 212 ILE A CG1 1 
ATOM   1688  C  CG2 . ILE A  1 212 ? 60.166 -53.096 19.294   1.00 18.42 ? 212 ILE A CG2 1 
ATOM   1689  C  CD1 . ILE A  1 212 ? 57.361 -52.055 17.855   1.00 21.09 ? 212 ILE A CD1 1 
ATOM   1690  N  N   . ALA A  1 213 ? 59.358 -54.378 22.526   1.00 17.13 ? 213 ALA A N   1 
ATOM   1691  C  CA  . ALA A  1 213 ? 60.245 -54.562 23.662   1.00 16.96 ? 213 ALA A CA  1 
ATOM   1692  C  C   . ALA A  1 213 ? 60.361 -56.037 24.056   1.00 18.05 ? 213 ALA A C   1 
ATOM   1693  O  O   . ALA A  1 213 ? 61.454 -56.517 24.345   1.00 17.64 ? 213 ALA A O   1 
ATOM   1694  C  CB  . ALA A  1 213 ? 59.781 -53.722 24.844   1.00 15.59 ? 213 ALA A CB  1 
ATOM   1695  N  N   . ASP A  1 214 ? 59.235 -56.750 24.069   1.00 18.25 ? 214 ASP A N   1 
ATOM   1696  C  CA  . ASP A  1 214 ? 59.220 -58.162 24.441   1.00 19.44 ? 214 ASP A CA  1 
ATOM   1697  C  C   . ASP A  1 214 ? 60.080 -58.991 23.490   1.00 21.11 ? 214 ASP A C   1 
ATOM   1698  O  O   . ASP A  1 214 ? 60.601 -60.041 23.863   1.00 18.95 ? 214 ASP A O   1 
ATOM   1699  C  CB  . ASP A  1 214 ? 57.790 -58.722 24.443   1.00 21.14 ? 214 ASP A CB  1 
ATOM   1700  C  CG  . ASP A  1 214 ? 56.947 -58.185 25.583   1.00 27.10 ? 214 ASP A CG  1 
ATOM   1701  O  OD1 . ASP A  1 214 ? 57.523 -57.719 26.588   1.00 24.84 ? 214 ASP A OD1 1 
ATOM   1702  O  OD2 . ASP A  1 214 ? 55.700 -58.235 25.472   1.00 30.75 ? 214 ASP A OD2 1 
ATOM   1703  N  N   . LYS A  1 215 ? 60.203 -58.522 22.254   1.00 19.53 ? 215 LYS A N   1 
ATOM   1704  C  CA  . LYS A  1 215 ? 60.974 -59.236 21.252   1.00 22.05 ? 215 LYS A CA  1 
ATOM   1705  C  C   . LYS A  1 215 ? 62.457 -58.891 21.335   1.00 19.74 ? 215 LYS A C   1 
ATOM   1706  O  O   . LYS A  1 215 ? 63.241 -59.375 20.538   1.00 19.12 ? 215 LYS A O   1 
ATOM   1707  C  CB  . LYS A  1 215 ? 60.429 -58.967 19.846   1.00 26.63 ? 215 LYS A CB  1 
ATOM   1708  C  CG  . LYS A  1 215 ? 59.161 -59.737 19.515   1.00 30.26 ? 215 LYS A CG  1 
ATOM   1709  C  CD  . LYS A  1 215 ? 59.444 -61.220 19.347   1.00 48.70 ? 215 LYS A CD  1 
ATOM   1710  C  CE  . LYS A  1 215 ? 58.176 -61.979 18.990   1.00 52.90 ? 215 LYS A CE  1 
ATOM   1711  N  NZ  . LYS A  1 215 ? 57.401 -61.245 17.954   1.00 51.64 ? 215 LYS A NZ  1 
ATOM   1712  N  N   . GLY A  1 216 ? 62.834 -58.049 22.295   1.00 16.84 ? 216 GLY A N   1 
ATOM   1713  C  CA  . GLY A  1 216 ? 64.246 -57.861 22.615   1.00 16.04 ? 216 GLY A CA  1 
ATOM   1714  C  C   . GLY A  1 216 ? 64.890 -56.554 22.173   1.00 18.14 ? 216 GLY A C   1 
ATOM   1715  O  O   . GLY A  1 216 ? 66.080 -56.335 22.422   1.00 17.36 ? 216 GLY A O   1 
ATOM   1716  N  N   . SER A  1 217 ? 64.121 -55.676 21.531   1.00 15.38 ? 217 SER A N   1 
ATOM   1717  C  CA  . SER A  1 217 ? 64.686 -54.432 20.989   1.00 14.84 ? 217 SER A CA  1 
ATOM   1718  C  C   . SER A  1 217 ? 64.387 -53.203 21.840   1.00 14.87 ? 217 SER A C   1 
ATOM   1719  O  O   . SER A  1 217 ? 63.412 -53.169 22.597   1.00 14.44 ? 217 SER A O   1 
ATOM   1720  C  CB  . SER A  1 217 ? 64.191 -54.191 19.560   1.00 13.29 ? 217 SER A CB  1 
ATOM   1721  O  OG  . SER A  1 217 ? 64.645 -55.213 18.695   1.00 15.70 ? 217 SER A OG  1 
ATOM   1722  N  N   . PHE A  1 218 ? 65.232 -52.185 21.704   1.00 13.64 ? 218 PHE A N   1 
ATOM   1723  C  CA  . PHE A  1 218 ? 64.996 -50.918 22.371   1.00 15.15 ? 218 PHE A CA  1 
ATOM   1724  C  C   . PHE A  1 218 ? 63.828 -50.208 21.696   1.00 14.41 ? 218 PHE A C   1 
ATOM   1725  O  O   . PHE A  1 218 ? 63.613 -50.353 20.491   1.00 13.94 ? 218 PHE A O   1 
ATOM   1726  C  CB  . PHE A  1 218 ? 66.260 -50.050 22.356   1.00 13.91 ? 218 PHE A CB  1 
ATOM   1727  C  CG  . PHE A  1 218 ? 67.381 -50.616 23.183   1.00 15.32 ? 218 PHE A CG  1 
ATOM   1728  C  CD1 . PHE A  1 218 ? 68.427 -51.298 22.586   1.00 13.94 ? 218 PHE A CD1 1 
ATOM   1729  C  CD2 . PHE A  1 218 ? 67.367 -50.496 24.567   1.00 15.59 ? 218 PHE A CD2 1 
ATOM   1730  C  CE1 . PHE A  1 218 ? 69.451 -51.836 23.349   1.00 15.31 ? 218 PHE A CE1 1 
ATOM   1731  C  CE2 . PHE A  1 218 ? 68.383 -51.031 25.339   1.00 17.00 ? 218 PHE A CE2 1 
ATOM   1732  C  CZ  . PHE A  1 218 ? 69.429 -51.702 24.728   1.00 18.81 ? 218 PHE A CZ  1 
ATOM   1733  N  N   . ILE A  1 219 ? 63.065 -49.462 22.486   1.00 15.19 ? 219 ILE A N   1 
ATOM   1734  C  CA  . ILE A  1 219 ? 61.906 -48.746 21.979   1.00 15.16 ? 219 ILE A CA  1 
ATOM   1735  C  C   . ILE A  1 219 ? 62.167 -47.243 22.025   1.00 16.67 ? 219 ILE A C   1 
ATOM   1736  O  O   . ILE A  1 219 ? 62.542 -46.687 23.068   1.00 15.35 ? 219 ILE A O   1 
ATOM   1737  C  CB  . ILE A  1 219 ? 60.629 -49.121 22.759   1.00 16.86 ? 219 ILE A CB  1 
ATOM   1738  C  CG1 . ILE A  1 219 ? 60.864 -49.003 24.269   1.00 18.85 ? 219 ILE A CG1 1 
ATOM   1739  C  CG2 . ILE A  1 219 ? 60.197 -50.544 22.409   1.00 15.84 ? 219 ILE A CG2 1 
ATOM   1740  C  CD1 . ILE A  1 219 ? 59.666 -49.401 25.105   1.00 18.96 ? 219 ILE A CD1 1 
ATOM   1741  N  N   . GLY A  1 220 ? 61.990 -46.593 20.882   1.00 16.31 ? 220 GLY A N   1 
ATOM   1742  C  CA  . GLY A  1 220 ? 62.323 -45.180 20.748   1.00 17.38 ? 220 GLY A CA  1 
ATOM   1743  C  C   . GLY A  1 220 ? 61.204 -44.237 21.138   1.00 15.12 ? 220 GLY A C   1 
ATOM   1744  O  O   . GLY A  1 220 ? 60.308 -43.965 20.340   1.00 15.99 ? 220 GLY A O   1 
ATOM   1745  N  N   . LEU A  1 221 ? 61.256 -43.734 22.369   1.00 17.12 ? 221 LEU A N   1 
ATOM   1746  C  CA  . LEU A  1 221 ? 60.330 -42.691 22.822   1.00 14.70 ? 221 LEU A CA  1 
ATOM   1747  C  C   . LEU A  1 221 ? 61.061 -41.392 22.553   1.00 18.36 ? 221 LEU A C   1 
ATOM   1748  O  O   . LEU A  1 221 ? 61.510 -40.692 23.469   1.00 16.48 ? 221 LEU A O   1 
ATOM   1749  C  CB  . LEU A  1 221 ? 60.012 -42.855 24.306   1.00 16.15 ? 221 LEU A CB  1 
ATOM   1750  C  CG  . LEU A  1 221 ? 59.602 -44.273 24.729   1.00 17.05 ? 221 LEU A CG  1 
ATOM   1751  C  CD1 . LEU A  1 221 ? 59.156 -44.313 26.190   1.00 17.62 ? 221 LEU A CD1 1 
ATOM   1752  C  CD2 . LEU A  1 221 ? 58.511 -44.813 23.809   1.00 16.86 ? 221 LEU A CD2 1 
ATOM   1753  N  N   . ASP A  1 222 ? 61.176 -41.077 21.270   1.00 17.86 ? 222 ASP A N   1 
ATOM   1754  C  CA  . ASP A  1 222 ? 62.310 -40.289 20.800   1.00 17.12 ? 222 ASP A CA  1 
ATOM   1755  C  C   . ASP A  1 222 ? 61.951 -38.994 20.078   1.00 15.88 ? 222 ASP A C   1 
ATOM   1756  O  O   . ASP A  1 222 ? 62.808 -38.390 19.426   1.00 15.65 ? 222 ASP A O   1 
ATOM   1757  C  CB  . ASP A  1 222 ? 63.185 -41.179 19.900   1.00 16.67 ? 222 ASP A CB  1 
ATOM   1758  C  CG  . ASP A  1 222 ? 62.394 -41.822 18.756   1.00 16.96 ? 222 ASP A CG  1 
ATOM   1759  O  OD1 . ASP A  1 222 ? 62.862 -42.840 18.203   1.00 16.32 ? 222 ASP A OD1 1 
ATOM   1760  O  OD2 . ASP A  1 222 ? 61.313 -41.302 18.400   1.00 14.84 ? 222 ASP A OD2 1 
ATOM   1761  N  N   . ARG A  1 223 ? 60.697 -38.559 20.192   1.00 15.46 ? 223 ARG A N   1 
ATOM   1762  C  CA  . ARG A  1 223 ? 60.273 -37.330 19.512   1.00 15.09 ? 223 ARG A CA  1 
ATOM   1763  C  C   . ARG A  1 223 ? 59.605 -36.337 20.454   1.00 16.12 ? 223 ARG A C   1 
ATOM   1764  O  O   . ARG A  1 223 ? 58.680 -35.618 20.068   1.00 17.66 ? 223 ARG A O   1 
ATOM   1765  C  CB  . ARG A  1 223 ? 59.355 -37.650 18.333   1.00 15.22 ? 223 ARG A CB  1 
ATOM   1766  C  CG  . ARG A  1 223 ? 60.107 -38.068 17.079   1.00 16.04 ? 223 ARG A CG  1 
ATOM   1767  C  CD  . ARG A  1 223 ? 59.142 -38.476 15.975   1.00 18.88 ? 223 ARG A CD  1 
ATOM   1768  N  NE  . ARG A  1 223 ? 59.731 -38.306 14.645   1.00 15.28 ? 223 ARG A NE  1 
ATOM   1769  C  CZ  . ARG A  1 223 ? 59.174 -38.745 13.521   1.00 18.10 ? 223 ARG A CZ  1 
ATOM   1770  N  NH1 . ARG A  1 223 ? 58.013 -39.393 13.557   1.00 17.08 ? 223 ARG A NH1 1 
ATOM   1771  N  NH2 . ARG A  1 223 ? 59.780 -38.535 12.360   1.00 20.90 ? 223 ARG A NH2 1 
ATOM   1772  N  N   . TYR A  1 224 ? 60.078 -36.305 21.691   1.00 14.43 ? 224 TYR A N   1 
ATOM   1773  C  CA  . TYR A  1 224 ? 59.580 -35.344 22.662   1.00 17.24 ? 224 TYR A CA  1 
ATOM   1774  C  C   . TYR A  1 224 ? 59.653 -33.923 22.134   1.00 16.29 ? 224 TYR A C   1 
ATOM   1775  O  O   . TYR A  1 224 ? 60.713 -33.468 21.714   1.00 17.47 ? 224 TYR A O   1 
ATOM   1776  C  CB  . TYR A  1 224 ? 60.372 -35.457 23.959   1.00 16.18 ? 224 TYR A CB  1 
ATOM   1777  C  CG  . TYR A  1 224 ? 59.742 -36.397 24.950   1.00 16.46 ? 224 TYR A CG  1 
ATOM   1778  C  CD1 . TYR A  1 224 ? 60.241 -37.684 25.153   1.00 16.33 ? 224 TYR A CD1 1 
ATOM   1779  C  CD2 . TYR A  1 224 ? 58.624 -36.003 25.674   1.00 17.98 ? 224 TYR A CD2 1 
ATOM   1780  C  CE1 . TYR A  1 224 ? 59.651 -38.536 26.076   1.00 17.81 ? 224 TYR A CE1 1 
ATOM   1781  C  CE2 . TYR A  1 224 ? 58.030 -36.843 26.586   1.00 18.89 ? 224 TYR A CE2 1 
ATOM   1782  C  CZ  . TYR A  1 224 ? 58.542 -38.104 26.787   1.00 18.98 ? 224 TYR A CZ  1 
ATOM   1783  O  OH  . TYR A  1 224 ? 57.922 -38.911 27.710   1.00 19.49 ? 224 TYR A OH  1 
ATOM   1784  N  N   . GLY A  1 225 ? 58.520 -33.228 22.171   1.00 17.56 ? 225 GLY A N   1 
ATOM   1785  C  CA  . GLY A  1 225 ? 58.420 -31.870 21.646   1.00 19.45 ? 225 GLY A CA  1 
ATOM   1786  C  C   . GLY A  1 225 ? 57.597 -31.788 20.368   1.00 21.78 ? 225 GLY A C   1 
ATOM   1787  O  O   . GLY A  1 225 ? 56.948 -30.773 20.101   1.00 20.12 ? 225 GLY A O   1 
ATOM   1788  N  N   . LEU A  1 226 ? 57.614 -32.860 19.579   1.00 19.13 ? 226 LEU A N   1 
ATOM   1789  C  CA  . LEU A  1 226 ? 56.860 -32.902 18.328   1.00 19.49 ? 226 LEU A CA  1 
ATOM   1790  C  C   . LEU A  1 226 ? 55.392 -33.249 18.590   1.00 24.94 ? 226 LEU A C   1 
ATOM   1791  O  O   . LEU A  1 226 ? 54.944 -34.390 18.378   1.00 21.48 ? 226 LEU A O   1 
ATOM   1792  C  CB  . LEU A  1 226 ? 57.510 -33.877 17.341   1.00 20.77 ? 226 LEU A CB  1 
ATOM   1793  C  CG  . LEU A  1 226 ? 58.867 -33.385 16.810   1.00 20.05 ? 226 LEU A CG  1 
ATOM   1794  C  CD1 . LEU A  1 226 ? 59.729 -34.524 16.280   1.00 19.31 ? 226 LEU A CD1 1 
ATOM   1795  C  CD2 . LEU A  1 226 ? 58.667 -32.320 15.739   1.00 20.60 ? 226 LEU A CD2 1 
ATOM   1796  N  N   . ASP A  1 227 ? 54.656 -32.244 19.052   1.00 21.44 ? 227 ASP A N   1 
ATOM   1797  C  CA  . ASP A  1 227 ? 53.271 -32.404 19.487   1.00 24.33 ? 227 ASP A CA  1 
ATOM   1798  C  C   . ASP A  1 227 ? 52.359 -32.895 18.369   1.00 24.40 ? 227 ASP A C   1 
ATOM   1799  O  O   . ASP A  1 227 ? 51.435 -33.671 18.617   1.00 22.15 ? 227 ASP A O   1 
ATOM   1800  C  CB  . ASP A  1 227 ? 52.732 -31.092 20.074   1.00 23.50 ? 227 ASP A CB  1 
ATOM   1801  C  CG  . ASP A  1 227 ? 53.388 -30.733 21.397   1.00 26.01 ? 227 ASP A CG  1 
ATOM   1802  O  OD1 . ASP A  1 227 ? 54.078 -31.596 21.980   1.00 24.96 ? 227 ASP A OD1 1 
ATOM   1803  O  OD2 . ASP A  1 227 ? 53.217 -29.583 21.859   1.00 27.32 ? 227 ASP A OD2 1 
ATOM   1804  N  N   . LEU A  1 228 ? 52.624 -32.452 17.142   1.00 26.73 ? 228 LEU A N   1 
ATOM   1805  C  CA  . LEU A  1 228 ? 51.834 -32.888 15.994   1.00 27.27 ? 228 LEU A CA  1 
ATOM   1806  C  C   . LEU A  1 228 ? 51.800 -34.418 15.875   1.00 28.58 ? 228 LEU A C   1 
ATOM   1807  O  O   . LEU A  1 228 ? 50.842 -34.970 15.347   1.00 26.95 ? 228 LEU A O   1 
ATOM   1808  C  CB  . LEU A  1 228 ? 52.339 -32.248 14.692   1.00 27.98 ? 228 LEU A CB  1 
ATOM   1809  C  CG  . LEU A  1 228 ? 53.552 -32.878 13.993   1.00 27.56 ? 228 LEU A CG  1 
ATOM   1810  C  CD1 . LEU A  1 228 ? 53.611 -32.460 12.532   1.00 27.82 ? 228 LEU A CD1 1 
ATOM   1811  C  CD2 . LEU A  1 228 ? 54.851 -32.535 14.710   1.00 22.98 ? 228 LEU A CD2 1 
ATOM   1812  N  N   . PHE A  1 229 ? 52.835 -35.101 16.364   1.00 27.64 ? 229 PHE A N   1 
ATOM   1813  C  CA  . PHE A  1 229 ? 52.830 -36.570 16.380   1.00 24.46 ? 229 PHE A CA  1 
ATOM   1814  C  C   . PHE A  1 229 ? 52.170 -37.105 17.652   1.00 27.56 ? 229 PHE A C   1 
ATOM   1815  O  O   . PHE A  1 229 ? 51.326 -37.990 17.594   1.00 27.68 ? 229 PHE A O   1 
ATOM   1816  C  CB  . PHE A  1 229 ? 54.241 -37.138 16.235   1.00 24.80 ? 229 PHE A CB  1 
ATOM   1817  C  CG  . PHE A  1 229 ? 54.888 -36.823 14.919   1.00 28.72 ? 229 PHE A CG  1 
ATOM   1818  C  CD1 . PHE A  1 229 ? 54.218 -37.065 13.729   1.00 30.08 ? 229 PHE A CD1 1 
ATOM   1819  C  CD2 . PHE A  1 229 ? 56.160 -36.281 14.869   1.00 20.99 ? 229 PHE A CD2 1 
ATOM   1820  C  CE1 . PHE A  1 229 ? 54.809 -36.774 12.513   1.00 32.47 ? 229 PHE A CE1 1 
ATOM   1821  C  CE2 . PHE A  1 229 ? 56.755 -35.990 13.655   1.00 28.88 ? 229 PHE A CE2 1 
ATOM   1822  C  CZ  . PHE A  1 229 ? 56.080 -36.237 12.476   1.00 25.70 ? 229 PHE A CZ  1 
ATOM   1823  N  N   . LEU A  1 230 ? 52.580 -36.569 18.797   1.00 23.01 ? 230 LEU A N   1 
ATOM   1824  C  CA  . LEU A  1 230 ? 51.903 -36.811 20.069   1.00 20.98 ? 230 LEU A CA  1 
ATOM   1825  C  C   . LEU A  1 230 ? 52.368 -35.751 21.053   1.00 24.28 ? 230 LEU A C   1 
ATOM   1826  O  O   . LEU A  1 230 ? 53.573 -35.530 21.199   1.00 25.49 ? 230 LEU A O   1 
ATOM   1827  C  CB  . LEU A  1 230 ? 52.220 -38.206 20.617   1.00 20.31 ? 230 LEU A CB  1 
ATOM   1828  C  CG  . LEU A  1 230 ? 51.363 -38.676 21.801   1.00 22.09 ? 230 LEU A CG  1 
ATOM   1829  C  CD1 . LEU A  1 230 ? 49.917 -38.911 21.375   1.00 22.54 ? 230 LEU A CD1 1 
ATOM   1830  C  CD2 . LEU A  1 230 ? 51.942 -39.938 22.436   1.00 21.46 ? 230 LEU A CD2 1 
ATOM   1831  N  N   . PRO A  1 231 ? 51.415 -35.087 21.729   1.00 24.34 ? 231 PRO A N   1 
ATOM   1832  C  CA  . PRO A  1 231 ? 51.735 -34.019 22.670   1.00 23.16 ? 231 PRO A CA  1 
ATOM   1833  C  C   . PRO A  1 231 ? 52.563 -34.525 23.845   1.00 21.78 ? 231 PRO A C   1 
ATOM   1834  O  O   . PRO A  1 231 ? 52.436 -35.681 24.240   1.00 21.84 ? 231 PRO A O   1 
ATOM   1835  C  CB  . PRO A  1 231 ? 50.355 -33.557 23.164   1.00 26.40 ? 231 PRO A CB  1 
ATOM   1836  C  CG  . PRO A  1 231 ? 49.395 -34.022 22.120   1.00 25.79 ? 231 PRO A CG  1 
ATOM   1837  C  CD  . PRO A  1 231 ? 49.962 -35.321 21.632   1.00 24.59 ? 231 PRO A CD  1 
ATOM   1838  N  N   . VAL A  1 232 ? 53.394 -33.647 24.396   1.00 20.89 ? 232 VAL A N   1 
ATOM   1839  C  CA  . VAL A  1 232 ? 54.268 -33.972 25.522   1.00 20.21 ? 232 VAL A CA  1 
ATOM   1840  C  C   . VAL A  1 232 ? 53.583 -34.719 26.670   1.00 20.56 ? 232 VAL A C   1 
ATOM   1841  O  O   . VAL A  1 232 ? 54.123 -35.702 27.178   1.00 21.85 ? 232 VAL A O   1 
ATOM   1842  C  CB  . VAL A  1 232 ? 54.944 -32.704 26.089   1.00 24.04 ? 232 VAL A CB  1 
ATOM   1843  C  CG1 . VAL A  1 232 ? 55.824 -33.053 27.280   1.00 24.62 ? 232 VAL A CG1 1 
ATOM   1844  C  CG2 . VAL A  1 232 ? 55.750 -32.001 25.007   1.00 21.45 ? 232 VAL A CG2 1 
ATOM   1845  N  N   . ASP A  1 233 ? 52.411 -34.257 27.101   1.00 22.13 ? 233 ASP A N   1 
ATOM   1846  C  CA  . ASP A  1 233 ? 51.778 -34.876 28.272   1.00 23.77 ? 233 ASP A CA  1 
ATOM   1847  C  C   . ASP A  1 233 ? 51.378 -36.333 28.022   1.00 24.04 ? 233 ASP A C   1 
ATOM   1848  O  O   . ASP A  1 233 ? 51.511 -37.178 28.908   1.00 24.15 ? 233 ASP A O   1 
ATOM   1849  C  CB  . ASP A  1 233 ? 50.602 -34.041 28.814   1.00 30.03 ? 233 ASP A CB  1 
ATOM   1850  C  CG  . ASP A  1 233 ? 49.529 -33.773 27.769   1.00 39.22 ? 233 ASP A CG  1 
ATOM   1851  O  OD1 . ASP A  1 233 ? 49.659 -34.246 26.618   1.00 43.50 ? 233 ASP A OD1 1 
ATOM   1852  O  OD2 . ASP A  1 233 ? 48.544 -33.081 28.106   1.00 54.61 ? 233 ASP A OD2 1 
ATOM   1853  N  N   . LYS A  1 234 ? 50.908 -36.640 26.816   1.00 21.88 ? 234 LYS A N   1 
ATOM   1854  C  CA  . LYS A  1 234 ? 50.547 -38.026 26.511   1.00 25.23 ? 234 LYS A CA  1 
ATOM   1855  C  C   . LYS A  1 234 ? 51.787 -38.907 26.356   1.00 22.54 ? 234 LYS A C   1 
ATOM   1856  O  O   . LYS A  1 234 ? 51.768 -40.082 26.719   1.00 23.10 ? 234 LYS A O   1 
ATOM   1857  C  CB  . LYS A  1 234 ? 49.655 -38.112 25.272   1.00 26.15 ? 234 LYS A CB  1 
ATOM   1858  C  CG  . LYS A  1 234 ? 48.286 -37.484 25.474   1.00 31.52 ? 234 LYS A CG  1 
ATOM   1859  C  CD  . LYS A  1 234 ? 47.359 -37.765 24.300   1.00 44.47 ? 234 LYS A CD  1 
ATOM   1860  C  CE  . LYS A  1 234 ? 47.209 -39.258 24.050   1.00 53.64 ? 234 LYS A CE  1 
ATOM   1861  N  NZ  . LYS A  1 234 ? 46.803 -39.998 25.277   1.00 60.58 ? 234 LYS A NZ  1 
ATOM   1862  N  N   . ARG A  1 235 ? 52.866 -38.337 25.825   1.00 21.15 ? 235 ARG A N   1 
ATOM   1863  C  CA  . ARG A  1 235 ? 54.139 -39.052 25.773   1.00 21.30 ? 235 ARG A CA  1 
ATOM   1864  C  C   . ARG A  1 235 ? 54.594 -39.377 27.186   1.00 21.20 ? 235 ARG A C   1 
ATOM   1865  O  O   . ARG A  1 235 ? 55.026 -40.499 27.472   1.00 23.49 ? 235 ARG A O   1 
ATOM   1866  C  CB  . ARG A  1 235 ? 55.216 -38.222 25.069   1.00 18.18 ? 235 ARG A CB  1 
ATOM   1867  C  CG  . ARG A  1 235 ? 54.972 -38.010 23.590   1.00 18.41 ? 235 ARG A CG  1 
ATOM   1868  C  CD  . ARG A  1 235 ? 56.095 -37.207 22.954   1.00 17.41 ? 235 ARG A CD  1 
ATOM   1869  N  NE  . ARG A  1 235 ? 55.834 -37.042 21.528   1.00 17.79 ? 235 ARG A NE  1 
ATOM   1870  C  CZ  . ARG A  1 235 ? 56.320 -37.837 20.582   1.00 19.80 ? 235 ARG A CZ  1 
ATOM   1871  N  NH1 . ARG A  1 235 ? 56.004 -37.612 19.307   1.00 20.30 ? 235 ARG A NH1 1 
ATOM   1872  N  NH2 . ARG A  1 235 ? 57.126 -38.847 20.905   1.00 17.81 ? 235 ARG A NH2 1 
ATOM   1873  N  N   . ASN A  1 236 ? 54.504 -38.385 28.066   1.00 19.28 ? 236 ASN A N   1 
ATOM   1874  C  CA  . ASN A  1 236 ? 54.898 -38.565 29.456   1.00 21.19 ? 236 ASN A CA  1 
ATOM   1875  C  C   . ASN A  1 236 ? 54.104 -39.684 30.121   1.00 20.99 ? 236 ASN A C   1 
ATOM   1876  O  O   . ASN A  1 236 ? 54.671 -40.529 30.814   1.00 20.13 ? 236 ASN A O   1 
ATOM   1877  C  CB  . ASN A  1 236 ? 54.749 -37.260 30.248   1.00 21.68 ? 236 ASN A CB  1 
ATOM   1878  C  CG  . ASN A  1 236 ? 55.907 -36.297 30.022   1.00 19.70 ? 236 ASN A CG  1 
ATOM   1879  O  OD1 . ASN A  1 236 ? 56.968 -36.687 29.543   1.00 22.14 ? 236 ASN A OD1 1 
ATOM   1880  N  ND2 . ASN A  1 236 ? 55.707 -35.033 30.383   1.00 18.11 ? 236 ASN A ND2 1 
ATOM   1881  N  N   . GLU A  1 237 ? 52.791 -39.685 29.914   1.00 21.19 ? 237 GLU A N   1 
ATOM   1882  C  CA  . GLU A  1 237 ? 51.943 -40.716 30.508   1.00 23.60 ? 237 GLU A CA  1 
ATOM   1883  C  C   . GLU A  1 237 ? 52.340 -42.100 29.998   1.00 21.76 ? 237 GLU A C   1 
ATOM   1884  O  O   . GLU A  1 237 ? 52.397 -43.059 30.764   1.00 21.34 ? 237 GLU A O   1 
ATOM   1885  C  CB  . GLU A  1 237 ? 50.464 -40.445 30.224   1.00 28.35 ? 237 GLU A CB  1 
ATOM   1886  C  CG  . GLU A  1 237 ? 49.914 -39.223 30.946   1.00 36.38 ? 237 GLU A CG  1 
ATOM   1887  C  CD  . GLU A  1 237 ? 49.907 -39.390 32.458   1.00 52.63 ? 237 GLU A CD  1 
ATOM   1888  O  OE1 . GLU A  1 237 ? 49.964 -38.368 33.177   1.00 57.62 ? 237 GLU A OE1 1 
ATOM   1889  O  OE2 . GLU A  1 237 ? 49.847 -40.545 32.933   1.00 56.48 ? 237 GLU A OE2 1 
ATOM   1890  N  N   . THR A  1 238 ? 52.621 -42.191 28.703   1.00 19.77 ? 238 THR A N   1 
ATOM   1891  C  CA  . THR A  1 238 ? 53.025 -43.451 28.082   1.00 20.94 ? 238 THR A CA  1 
ATOM   1892  C  C   . THR A  1 238 ? 54.367 -43.933 28.636   1.00 22.26 ? 238 THR A C   1 
ATOM   1893  O  O   . THR A  1 238 ? 54.512 -45.094 29.023   1.00 21.21 ? 238 THR A O   1 
ATOM   1894  C  CB  . THR A  1 238 ? 53.129 -43.293 26.554   1.00 20.89 ? 238 THR A CB  1 
ATOM   1895  O  OG1 . THR A  1 238 ? 51.835 -42.975 26.022   1.00 24.59 ? 238 THR A OG1 1 
ATOM   1896  C  CG2 . THR A  1 238 ? 53.635 -44.581 25.909   1.00 21.06 ? 238 THR A CG2 1 
ATOM   1897  N  N   . THR A  1 239 ? 55.341 -43.026 28.665   1.00 21.12 ? 239 THR A N   1 
ATOM   1898  C  CA  . THR A  1 239 ? 56.660 -43.301 29.217   1.00 19.24 ? 239 THR A CA  1 
ATOM   1899  C  C   . THR A  1 239 ? 56.572 -43.781 30.667   1.00 20.48 ? 239 THR A C   1 
ATOM   1900  O  O   . THR A  1 239 ? 57.177 -44.791 31.041   1.00 19.03 ? 239 THR A O   1 
ATOM   1901  C  CB  . THR A  1 239 ? 57.550 -42.039 29.174   1.00 19.49 ? 239 THR A CB  1 
ATOM   1902  O  OG1 . THR A  1 239 ? 57.742 -41.626 27.815   1.00 18.83 ? 239 THR A OG1 1 
ATOM   1903  C  CG2 . THR A  1 239 ? 58.904 -42.316 29.809   1.00 18.99 ? 239 THR A CG2 1 
ATOM   1904  N  N   . LEU A  1 240 ? 55.829 -43.043 31.485   1.00 20.85 ? 240 LEU A N   1 
ATOM   1905  C  CA  . LEU A  1 240 ? 55.662 -43.397 32.890   1.00 22.76 ? 240 LEU A CA  1 
ATOM   1906  C  C   . LEU A  1 240 ? 55.020 -44.779 33.048   1.00 21.59 ? 240 LEU A C   1 
ATOM   1907  O  O   . LEU A  1 240 ? 55.434 -45.576 33.889   1.00 25.85 ? 240 LEU A O   1 
ATOM   1908  C  CB  . LEU A  1 240 ? 54.821 -42.343 33.607   1.00 23.30 ? 240 LEU A CB  1 
ATOM   1909  C  CG  . LEU A  1 240 ? 54.546 -42.608 35.085   1.00 24.79 ? 240 LEU A CG  1 
ATOM   1910  C  CD1 . LEU A  1 240 ? 55.860 -42.627 35.853   1.00 20.39 ? 240 LEU A CD1 1 
ATOM   1911  C  CD2 . LEU A  1 240 ? 53.604 -41.545 35.633   1.00 21.92 ? 240 LEU A CD2 1 
ATOM   1912  N  N   . ARG A  1 241 ? 54.013 -45.058 32.233   1.00 21.93 ? 241 ARG A N   1 
ATOM   1913  C  CA  . ARG A  1 241 ? 53.348 -46.360 32.259   1.00 22.35 ? 241 ARG A CA  1 
ATOM   1914  C  C   . ARG A  1 241 ? 54.322 -47.500 31.936   1.00 22.68 ? 241 ARG A C   1 
ATOM   1915  O  O   . ARG A  1 241 ? 54.337 -48.536 32.605   1.00 21.20 ? 241 ARG A O   1 
ATOM   1916  C  CB  . ARG A  1 241 ? 52.181 -46.372 31.272   1.00 24.04 ? 241 ARG A CB  1 
ATOM   1917  C  CG  . ARG A  1 241 ? 51.551 -47.740 31.074   1.00 32.22 ? 241 ARG A CG  1 
ATOM   1918  C  CD  . ARG A  1 241 ? 51.017 -48.306 32.381   1.00 39.86 ? 241 ARG A CD  1 
ATOM   1919  N  NE  . ARG A  1 241 ? 50.505 -49.663 32.215   1.00 43.58 ? 241 ARG A NE  1 
ATOM   1920  C  CZ  . ARG A  1 241 ? 49.312 -49.953 31.706   1.00 53.42 ? 241 ARG A CZ  1 
ATOM   1921  N  NH1 . ARG A  1 241 ? 48.503 -48.979 31.305   1.00 50.48 ? 241 ARG A NH1 1 
ATOM   1922  N  NH2 . ARG A  1 241 ? 48.929 -51.217 31.593   1.00 50.52 ? 241 ARG A NH2 1 
ATOM   1923  N  N   . LEU A  1 242 ? 55.126 -47.313 30.894   1.00 21.71 ? 242 LEU A N   1 
ATOM   1924  C  CA  . LEU A  1 242 ? 56.078 -48.339 30.487   1.00 20.57 ? 242 LEU A CA  1 
ATOM   1925  C  C   . LEU A  1 242 ? 57.107 -48.572 31.589   1.00 19.46 ? 242 LEU A C   1 
ATOM   1926  O  O   . LEU A  1 242 ? 57.519 -49.706 31.840   1.00 20.40 ? 242 LEU A O   1 
ATOM   1927  C  CB  . LEU A  1 242 ? 56.759 -47.949 29.174   1.00 21.79 ? 242 LEU A CB  1 
ATOM   1928  C  CG  . LEU A  1 242 ? 55.862 -47.969 27.934   1.00 19.65 ? 242 LEU A CG  1 
ATOM   1929  C  CD1 . LEU A  1 242 ? 56.480 -47.174 26.787   1.00 18.30 ? 242 LEU A CD1 1 
ATOM   1930  C  CD2 . LEU A  1 242 ? 55.572 -49.406 27.521   1.00 21.63 ? 242 LEU A CD2 1 
ATOM   1931  N  N   . ILE A  1 243 ? 57.512 -47.498 32.253   1.00 17.76 ? 243 ILE A N   1 
ATOM   1932  C  CA  . ILE A  1 243 ? 58.454 -47.610 33.360   1.00 19.36 ? 243 ILE A CA  1 
ATOM   1933  C  C   . ILE A  1 243 ? 57.835 -48.368 34.532   1.00 20.34 ? 243 ILE A C   1 
ATOM   1934  O  O   . ILE A  1 243 ? 58.469 -49.240 35.117   1.00 21.59 ? 243 ILE A O   1 
ATOM   1935  C  CB  . ILE A  1 243 ? 58.961 -46.233 33.817   1.00 17.86 ? 243 ILE A CB  1 
ATOM   1936  C  CG1 . ILE A  1 243 ? 59.862 -45.627 32.732   1.00 18.38 ? 243 ILE A CG1 1 
ATOM   1937  C  CG2 . ILE A  1 243 ? 59.693 -46.346 35.150   1.00 17.82 ? 243 ILE A CG2 1 
ATOM   1938  C  CD1 . ILE A  1 243 ? 60.322 -44.211 33.011   1.00 16.40 ? 243 ILE A CD1 1 
ATOM   1939  N  N   . LYS A  1 244 ? 56.589 -48.044 34.869   1.00 22.66 ? 244 LYS A N   1 
ATOM   1940  C  CA  . LYS A  1 244 ? 55.908 -48.734 35.962   1.00 24.90 ? 244 LYS A CA  1 
ATOM   1941  C  C   . LYS A  1 244 ? 55.684 -50.208 35.644   1.00 25.28 ? 244 LYS A C   1 
ATOM   1942  O  O   . LYS A  1 244 ? 55.630 -51.037 36.549   1.00 24.42 ? 244 LYS A O   1 
ATOM   1943  C  CB  . LYS A  1 244 ? 54.580 -48.053 36.303   1.00 26.82 ? 244 LYS A CB  1 
ATOM   1944  C  CG  . LYS A  1 244 ? 54.744 -46.714 37.009   1.00 31.34 ? 244 LYS A CG  1 
ATOM   1945  C  CD  . LYS A  1 244 ? 53.391 -46.076 37.283   1.00 38.86 ? 244 LYS A CD  1 
ATOM   1946  C  CE  . LYS A  1 244 ? 53.514 -44.857 38.181   1.00 41.81 ? 244 LYS A CE  1 
ATOM   1947  N  NZ  . LYS A  1 244 ? 52.186 -44.207 38.372   1.00 49.24 ? 244 LYS A NZ  1 
ATOM   1948  N  N   . ASP A  1 245 ? 55.561 -50.531 34.361   1.00 24.89 ? 245 ASP A N   1 
ATOM   1949  C  CA  . ASP A  1 245 ? 55.338 -51.911 33.941   1.00 23.99 ? 245 ASP A CA  1 
ATOM   1950  C  C   . ASP A  1 245 ? 56.640 -52.705 33.816   1.00 25.76 ? 245 ASP A C   1 
ATOM   1951  O  O   . ASP A  1 245 ? 56.616 -53.884 33.464   1.00 24.51 ? 245 ASP A O   1 
ATOM   1952  C  CB  . ASP A  1 245 ? 54.548 -51.969 32.628   1.00 23.70 ? 245 ASP A CB  1 
ATOM   1953  C  CG  . ASP A  1 245 ? 53.081 -51.616 32.811   1.00 25.83 ? 245 ASP A CG  1 
ATOM   1954  O  OD1 . ASP A  1 245 ? 52.342 -51.580 31.807   1.00 30.26 ? 245 ASP A OD1 1 
ATOM   1955  O  OD2 . ASP A  1 245 ? 52.663 -51.367 33.960   1.00 28.06 ? 245 ASP A OD2 1 
ATOM   1956  N  N   . GLY A  1 246 ? 57.767 -52.050 34.088   1.00 23.16 ? 246 GLY A N   1 
ATOM   1957  C  CA  . GLY A  1 246 ? 59.055 -52.733 34.201   1.00 20.63 ? 246 GLY A CA  1 
ATOM   1958  C  C   . GLY A  1 246 ? 59.975 -52.653 32.994   1.00 21.53 ? 246 GLY A C   1 
ATOM   1959  O  O   . GLY A  1 246 ? 61.010 -53.328 32.957   1.00 19.31 ? 246 GLY A O   1 
ATOM   1960  N  N   . TYR A  1 247 ? 59.623 -51.811 32.023   1.00 18.70 ? 247 TYR A N   1 
ATOM   1961  C  CA  . TYR A  1 247 ? 60.298 -51.802 30.718   1.00 20.02 ? 247 TYR A CA  1 
ATOM   1962  C  C   . TYR A  1 247 ? 61.467 -50.816 30.578   1.00 22.21 ? 247 TYR A C   1 
ATOM   1963  O  O   . TYR A  1 247 ? 61.921 -50.548 29.468   1.00 21.04 ? 247 TYR A O   1 
ATOM   1964  C  CB  . TYR A  1 247 ? 59.280 -51.570 29.589   1.00 19.80 ? 247 TYR A CB  1 
ATOM   1965  C  CG  . TYR A  1 247 ? 58.460 -52.794 29.271   1.00 21.66 ? 247 TYR A CG  1 
ATOM   1966  C  CD1 . TYR A  1 247 ? 57.296 -53.083 29.977   1.00 21.73 ? 247 TYR A CD1 1 
ATOM   1967  C  CD2 . TYR A  1 247 ? 58.868 -53.685 28.284   1.00 20.15 ? 247 TYR A CD2 1 
ATOM   1968  C  CE1 . TYR A  1 247 ? 56.552 -54.221 29.697   1.00 22.82 ? 247 TYR A CE1 1 
ATOM   1969  C  CE2 . TYR A  1 247 ? 58.133 -54.819 27.992   1.00 20.34 ? 247 TYR A CE2 1 
ATOM   1970  C  CZ  . TYR A  1 247 ? 56.978 -55.085 28.704   1.00 25.17 ? 247 TYR A CZ  1 
ATOM   1971  O  OH  . TYR A  1 247 ? 56.252 -56.218 28.413   1.00 21.44 ? 247 TYR A OH  1 
ATOM   1972  N  N   . SER A  1 248 ? 61.974 -50.294 31.689   1.00 18.36 ? 248 SER A N   1 
ATOM   1973  C  CA  . SER A  1 248 ? 63.034 -49.290 31.608   1.00 18.75 ? 248 SER A CA  1 
ATOM   1974  C  C   . SER A  1 248 ? 64.299 -49.844 30.936   1.00 19.63 ? 248 SER A C   1 
ATOM   1975  O  O   . SER A  1 248 ? 65.112 -49.078 30.425   1.00 17.69 ? 248 SER A O   1 
ATOM   1976  C  CB  . SER A  1 248 ? 63.357 -48.709 32.991   1.00 21.05 ? 248 SER A CB  1 
ATOM   1977  O  OG  . SER A  1 248 ? 64.194 -49.589 33.723   1.00 28.80 ? 248 SER A OG  1 
ATOM   1978  N  N   . ASP A  1 249 ? 64.458 -51.168 30.930   1.00 16.90 ? 249 ASP A N   1 
ATOM   1979  C  CA  . ASP A  1 249 ? 65.605 -51.799 30.267   1.00 17.06 ? 249 ASP A CA  1 
ATOM   1980  C  C   . ASP A  1 249 ? 65.569 -51.705 28.728   1.00 16.59 ? 249 ASP A C   1 
ATOM   1981  O  O   . ASP A  1 249 ? 66.565 -52.004 28.072   1.00 14.25 ? 249 ASP A O   1 
ATOM   1982  C  CB  . ASP A  1 249 ? 65.736 -53.277 30.682   1.00 18.47 ? 249 ASP A CB  1 
ATOM   1983  C  CG  . ASP A  1 249 ? 64.494 -54.098 30.332   1.00 20.65 ? 249 ASP A CG  1 
ATOM   1984  O  OD1 . ASP A  1 249 ? 63.398 -53.762 30.845   1.00 20.60 ? 249 ASP A OD1 1 
ATOM   1985  O  OD2 . ASP A  1 249 ? 64.611 -55.076 29.554   1.00 17.51 ? 249 ASP A OD2 1 
ATOM   1986  N  N   . LYS A  1 250 ? 64.429 -51.314 28.159   1.00 14.34 ? 250 LYS A N   1 
ATOM   1987  C  CA  . LYS A  1 250 ? 64.292 -51.203 26.701   1.00 14.68 ? 250 LYS A CA  1 
ATOM   1988  C  C   . LYS A  1 250 ? 64.040 -49.772 26.242   1.00 15.53 ? 250 LYS A C   1 
ATOM   1989  O  O   . LYS A  1 250 ? 64.126 -49.474 25.049   1.00 14.99 ? 250 LYS A O   1 
ATOM   1990  C  CB  . LYS A  1 250 ? 63.153 -52.090 26.179   1.00 15.05 ? 250 LYS A CB  1 
ATOM   1991  C  CG  . LYS A  1 250 ? 63.365 -53.584 26.385   1.00 16.04 ? 250 LYS A CG  1 
ATOM   1992  C  CD  . LYS A  1 250 ? 64.604 -54.078 25.655   1.00 17.10 ? 250 LYS A CD  1 
ATOM   1993  C  CE  . LYS A  1 250 ? 64.846 -55.551 25.953   1.00 19.13 ? 250 LYS A CE  1 
ATOM   1994  N  NZ  . LYS A  1 250 ? 66.198 -56.001 25.526   1.00 21.02 ? 250 LYS A NZ  1 
ATOM   1995  N  N   . ILE A  1 251 ? 63.712 -48.895 27.185   1.00 15.95 ? 251 ILE A N   1 
ATOM   1996  C  CA  . ILE A  1 251 ? 63.343 -47.517 26.857   1.00 16.59 ? 251 ILE A CA  1 
ATOM   1997  C  C   . ILE A  1 251 ? 64.539 -46.650 26.481   1.00 15.90 ? 251 ILE A C   1 
ATOM   1998  O  O   . ILE A  1 251 ? 65.558 -46.637 27.167   1.00 12.97 ? 251 ILE A O   1 
ATOM   1999  C  CB  . ILE A  1 251 ? 62.587 -46.837 28.016   1.00 18.11 ? 251 ILE A CB  1 
ATOM   2000  C  CG1 . ILE A  1 251 ? 61.198 -47.455 28.186   1.00 16.37 ? 251 ILE A CG1 1 
ATOM   2001  C  CG2 . ILE A  1 251 ? 62.482 -45.326 27.782   1.00 15.39 ? 251 ILE A CG2 1 
ATOM   2002  C  CD1 . ILE A  1 251 ? 60.499 -47.021 29.463   1.00 17.17 ? 251 ILE A CD1 1 
ATOM   2003  N  N   . MET A  1 252 ? 64.401 -45.932 25.372   1.00 15.09 ? 252 MET A N   1 
ATOM   2004  C  CA  . MET A  1 252 ? 65.336 -44.882 25.025   1.00 15.35 ? 252 MET A CA  1 
ATOM   2005  C  C   . MET A  1 252 ? 64.540 -43.625 24.723   1.00 15.84 ? 252 MET A C   1 
ATOM   2006  O  O   . MET A  1 252 ? 63.477 -43.678 24.095   1.00 17.00 ? 252 MET A O   1 
ATOM   2007  C  CB  . MET A  1 252 ? 66.198 -45.279 23.831   1.00 16.49 ? 252 MET A CB  1 
ATOM   2008  C  CG  . MET A  1 252 ? 67.360 -46.183 24.208   1.00 20.45 ? 252 MET A CG  1 
ATOM   2009  S  SD  . MET A  1 252 ? 68.224 -46.748 22.734   1.00 28.90 ? 252 MET A SD  1 
ATOM   2010  C  CE  . MET A  1 252 ? 69.680 -47.509 23.454   1.00 21.96 ? 252 MET A CE  1 
ATOM   2011  N  N   . ILE A  1 253 ? 65.049 -42.494 25.191   1.00 15.97 ? 253 ILE A N   1 
ATOM   2012  C  CA  . ILE A  1 253 ? 64.316 -41.244 25.093   1.00 14.18 ? 253 ILE A CA  1 
ATOM   2013  C  C   . ILE A  1 253 ? 65.160 -40.197 24.369   1.00 13.87 ? 253 ILE A C   1 
ATOM   2014  O  O   . ILE A  1 253 ? 66.363 -40.099 24.598   1.00 13.20 ? 253 ILE A O   1 
ATOM   2015  C  CB  . ILE A  1 253 ? 63.925 -40.728 26.498   1.00 13.64 ? 253 ILE A CB  1 
ATOM   2016  C  CG1 . ILE A  1 253 ? 62.885 -41.666 27.130   1.00 13.91 ? 253 ILE A CG1 1 
ATOM   2017  C  CG2 . ILE A  1 253 ? 63.425 -39.285 26.418   1.00 15.85 ? 253 ILE A CG2 1 
ATOM   2018  C  CD1 . ILE A  1 253 ? 62.618 -41.409 28.595   1.00 13.65 ? 253 ILE A CD1 1 
ATOM   2019  N  N   . SER A  1 254 ? 64.525 -39.421 23.494   1.00 13.22 ? 254 SER A N   1 
ATOM   2020  C  CA  . SER A  1 254 ? 65.217 -38.337 22.783   1.00 15.57 ? 254 SER A CA  1 
ATOM   2021  C  C   . SER A  1 254 ? 64.194 -37.361 22.193   1.00 15.68 ? 254 SER A C   1 
ATOM   2022  O  O   . SER A  1 254 ? 62.992 -37.524 22.407   1.00 13.32 ? 254 SER A O   1 
ATOM   2023  C  CB  . SER A  1 254 ? 66.139 -38.904 21.690   1.00 15.40 ? 254 SER A CB  1 
ATOM   2024  O  OG  . SER A  1 254 ? 67.445 -38.324 21.763   1.00 17.06 ? 254 SER A OG  1 
ATOM   2025  N  N   . HIS A  1 255 ? 64.668 -36.354 21.457   1.00 15.52 ? 255 HIS A N   1 
ATOM   2026  C  CA  . HIS A  1 255 ? 63.777 -35.349 20.876   1.00 15.83 ? 255 HIS A CA  1 
ATOM   2027  C  C   . HIS A  1 255 ? 63.641 -35.428 19.373   1.00 14.72 ? 255 HIS A C   1 
ATOM   2028  O  O   . HIS A  1 255 ? 62.692 -34.870 18.824   1.00 15.89 ? 255 HIS A O   1 
ATOM   2029  C  CB  . HIS A  1 255 ? 64.240 -33.933 21.215   1.00 15.44 ? 255 HIS A CB  1 
ATOM   2030  C  CG  . HIS A  1 255 ? 64.646 -33.736 22.654   1.00 16.45 ? 255 HIS A CG  1 
ATOM   2031  N  ND1 . HIS A  1 255 ? 65.903 -33.955 23.089   1.00 16.40 ? 255 HIS A ND1 1 
ATOM   2032  C  CD2 . HIS A  1 255 ? 63.921 -33.284 23.754   1.00 17.72 ? 255 HIS A CD2 1 
ATOM   2033  C  CE1 . HIS A  1 255 ? 65.974 -33.677 24.404   1.00 19.01 ? 255 HIS A CE1 1 
ATOM   2034  N  NE2 . HIS A  1 255 ? 64.762 -33.258 24.807   1.00 18.85 ? 255 HIS A NE2 1 
ATOM   2035  N  N   . ASP A  1 256 ? 64.577 -36.100 18.694   1.00 12.77 ? 256 ASP A N   1 
ATOM   2036  C  CA  . ASP A  1 256 ? 64.669 -36.017 17.229   1.00 14.67 ? 256 ASP A CA  1 
ATOM   2037  C  C   . ASP A  1 256 ? 64.684 -34.534 16.857   1.00 17.16 ? 256 ASP A C   1 
ATOM   2038  O  O   . ASP A  1 256 ? 64.135 -34.132 15.837   1.00 16.27 ? 256 ASP A O   1 
ATOM   2039  C  CB  . ASP A  1 256 ? 63.477 -36.738 16.582   1.00 16.41 ? 256 ASP A CB  1 
ATOM   2040  C  CG  . ASP A  1 256 ? 63.656 -37.031 15.072   1.00 14.67 ? 256 ASP A CG  1 
ATOM   2041  O  OD1 . ASP A  1 256 ? 64.785 -37.181 14.504   1.00 13.74 ? 256 ASP A OD1 1 
ATOM   2042  O  OD2 . ASP A  1 256 ? 62.578 -37.187 14.450   1.00 19.12 ? 256 ASP A OD2 1 
ATOM   2043  N  N   . TYR A  1 257 ? 65.303 -33.716 17.704   1.00 19.05 ? 257 TYR A N   1 
ATOM   2044  C  CA  . TYR A  1 257 ? 65.380 -32.291 17.418   1.00 19.24 ? 257 TYR A CA  1 
ATOM   2045  C  C   . TYR A  1 257 ? 66.297 -32.033 16.230   1.00 19.47 ? 257 TYR A C   1 
ATOM   2046  O  O   . TYR A  1 257 ? 67.372 -32.626 16.120   1.00 18.47 ? 257 TYR A O   1 
ATOM   2047  C  CB  . TYR A  1 257 ? 65.854 -31.476 18.630   1.00 18.38 ? 257 TYR A CB  1 
ATOM   2048  C  CG  . TYR A  1 257 ? 65.750 -29.993 18.387   1.00 20.83 ? 257 TYR A CG  1 
ATOM   2049  C  CD1 . TYR A  1 257 ? 66.885 -29.201 18.246   1.00 21.72 ? 257 TYR A CD1 1 
ATOM   2050  C  CD2 . TYR A  1 257 ? 64.509 -29.386 18.251   1.00 20.16 ? 257 TYR A CD2 1 
ATOM   2051  C  CE1 . TYR A  1 257 ? 66.779 -27.841 18.007   1.00 19.15 ? 257 TYR A CE1 1 
ATOM   2052  C  CE2 . TYR A  1 257 ? 64.394 -28.035 18.006   1.00 19.58 ? 257 TYR A CE2 1 
ATOM   2053  C  CZ  . TYR A  1 257 ? 65.531 -27.267 17.884   1.00 24.65 ? 257 TYR A CZ  1 
ATOM   2054  O  OH  . TYR A  1 257 ? 65.405 -25.919 17.642   1.00 22.53 ? 257 TYR A OH  1 
ATOM   2055  N  N   . CYS A  1 258 ? 65.850 -31.150 15.341   1.00 18.20 ? 258 CYS A N   1 
ATOM   2056  C  CA  . CYS A  1 258 ? 66.663 -30.688 14.228   1.00 16.88 ? 258 CYS A CA  1 
ATOM   2057  C  C   . CYS A  1 258 ? 67.066 -29.235 14.459   1.00 20.05 ? 258 CYS A C   1 
ATOM   2058  O  O   . CYS A  1 258 ? 66.233 -28.326 14.383   1.00 18.55 ? 258 CYS A O   1 
ATOM   2059  C  CB  . CYS A  1 258 ? 65.879 -30.812 12.922   1.00 18.63 ? 258 CYS A CB  1 
ATOM   2060  S  SG  . CYS A  1 258 ? 65.330 -32.499 12.591   1.00 23.88 ? 258 CYS A SG  1 
ATOM   2061  N  N   . CYS A  1 259 ? 68.342 -29.011 14.740   1.00 18.74 ? 259 CYS A N   1 
ATOM   2062  C  CA  . CYS A  1 259 ? 68.800 -27.655 15.013   1.00 24.61 ? 259 CYS A CA  1 
ATOM   2063  C  C   . CYS A  1 259 ? 68.476 -26.743 13.826   1.00 24.67 ? 259 CYS A C   1 
ATOM   2064  O  O   . CYS A  1 259 ? 68.177 -25.557 14.003   1.00 21.60 ? 259 CYS A O   1 
ATOM   2065  C  CB  . CYS A  1 259 ? 70.281 -27.666 15.367   1.00 23.52 ? 259 CYS A CB  1 
ATOM   2066  S  SG  . CYS A  1 259 ? 70.578 -28.705 16.817   1.00 24.52 ? 259 CYS A SG  1 
ATOM   2067  N  N   . THR A  1 260 ? 68.519 -27.319 12.626   1.00 21.52 ? 260 THR A N   1 
ATOM   2068  C  CA  . THR A  1 260 ? 67.943 -26.705 11.434   1.00 23.47 ? 260 THR A CA  1 
ATOM   2069  C  C   . THR A  1 260 ? 67.351 -27.799 10.560   1.00 23.03 ? 260 THR A C   1 
ATOM   2070  O  O   . THR A  1 260 ? 67.943 -28.866 10.408   1.00 20.51 ? 260 THR A O   1 
ATOM   2071  C  CB  . THR A  1 260 ? 68.995 -25.937 10.612   1.00 25.67 ? 260 THR A CB  1 
ATOM   2072  O  OG1 . THR A  1 260 ? 69.595 -24.929 11.437   1.00 30.41 ? 260 THR A OG1 1 
ATOM   2073  C  CG2 . THR A  1 260 ? 68.337 -25.271 9.398    1.00 33.49 ? 260 THR A CG2 1 
ATOM   2074  N  N   . ILE A  1 261 ? 66.173 -27.543 10.001   1.00 19.96 ? 261 ILE A N   1 
ATOM   2075  C  CA  . ILE A  1 261 ? 65.591 -28.455 9.023    1.00 22.94 ? 261 ILE A CA  1 
ATOM   2076  C  C   . ILE A  1 261 ? 64.947 -27.634 7.908    1.00 24.98 ? 261 ILE A C   1 
ATOM   2077  O  O   . ILE A  1 261 ? 64.349 -26.592 8.174    1.00 26.01 ? 261 ILE A O   1 
ATOM   2078  C  CB  . ILE A  1 261 ? 64.609 -29.459 9.669    1.00 20.39 ? 261 ILE A CB  1 
ATOM   2079  C  CG1 . ILE A  1 261 ? 63.974 -30.360 8.606    1.00 22.51 ? 261 ILE A CG1 1 
ATOM   2080  C  CG2 . ILE A  1 261 ? 63.548 -28.749 10.497   1.00 21.88 ? 261 ILE A CG2 1 
ATOM   2081  C  CD1 . ILE A  1 261 ? 63.252 -31.558 9.186    1.00 23.17 ? 261 ILE A CD1 1 
ATOM   2082  N  N   . ASP A  1 262 ? 65.085 -28.089 6.665    1.00 22.26 ? 262 ASP A N   1 
ATOM   2083  C  CA  . ASP A  1 262 ? 64.700 -27.261 5.513    1.00 24.46 ? 262 ASP A CA  1 
ATOM   2084  C  C   . ASP A  1 262 ? 63.258 -27.433 5.012    1.00 27.59 ? 262 ASP A C   1 
ATOM   2085  O  O   . ASP A  1 262 ? 62.821 -26.698 4.126    1.00 30.81 ? 262 ASP A O   1 
ATOM   2086  C  CB  . ASP A  1 262 ? 65.671 -27.484 4.352    1.00 23.74 ? 262 ASP A CB  1 
ATOM   2087  C  CG  . ASP A  1 262 ? 65.578 -28.886 3.782    1.00 21.22 ? 262 ASP A CG  1 
ATOM   2088  O  OD1 . ASP A  1 262 ? 64.916 -29.739 4.416    1.00 23.76 ? 262 ASP A OD1 1 
ATOM   2089  O  OD2 . ASP A  1 262 ? 66.161 -29.133 2.704    1.00 19.55 ? 262 ASP A OD2 1 
ATOM   2090  N  N   . ILE A  1 263 ? 62.517 -28.387 5.568    1.00 24.33 ? 263 ILE A N   1 
ATOM   2091  C  CA  . ILE A  1 263 ? 61.166 -28.655 5.069    1.00 25.31 ? 263 ILE A CA  1 
ATOM   2092  C  C   . ILE A  1 263 ? 60.201 -27.504 5.361    1.00 28.11 ? 263 ILE A C   1 
ATOM   2093  O  O   . ILE A  1 263 ? 60.371 -26.770 6.338    1.00 25.88 ? 263 ILE A O   1 
ATOM   2094  C  CB  . ILE A  1 263 ? 60.598 -29.981 5.613    1.00 25.20 ? 263 ILE A CB  1 
ATOM   2095  C  CG1 . ILE A  1 263 ? 60.211 -29.844 7.092    1.00 28.46 ? 263 ILE A CG1 1 
ATOM   2096  C  CG2 . ILE A  1 263 ? 61.605 -31.109 5.409    1.00 26.19 ? 263 ILE A CG2 1 
ATOM   2097  C  CD1 . ILE A  1 263 ? 59.663 -31.120 7.695    1.00 22.95 ? 263 ILE A CD1 1 
ATOM   2098  N  N   . GLY A  1 264 ? 59.192 -27.350 4.505    1.00 31.96 ? 264 GLY A N   1 
ATOM   2099  C  CA  . GLY A  1 264 ? 58.227 -26.259 4.636    1.00 29.75 ? 264 GLY A CA  1 
ATOM   2100  C  C   . GLY A  1 264 ? 57.419 -26.350 5.917    1.00 30.07 ? 264 GLY A C   1 
ATOM   2101  O  O   . GLY A  1 264 ? 57.017 -25.336 6.486    1.00 34.28 ? 264 GLY A O   1 
ATOM   2102  N  N   . THR A  1 265 ? 57.190 -27.576 6.373    1.00 31.02 ? 265 THR A N   1 
ATOM   2103  C  CA  . THR A  1 265 ? 56.451 -27.823 7.605    1.00 30.82 ? 265 THR A CA  1 
ATOM   2104  C  C   . THR A  1 265 ? 57.101 -27.140 8.814    1.00 29.34 ? 265 THR A C   1 
ATOM   2105  O  O   . THR A  1 265 ? 56.426 -26.804 9.790    1.00 25.78 ? 265 THR A O   1 
ATOM   2106  C  CB  . THR A  1 265 ? 56.347 -29.332 7.884    1.00 33.93 ? 265 THR A CB  1 
ATOM   2107  O  OG1 . THR A  1 265 ? 56.094 -30.028 6.656    1.00 30.37 ? 265 THR A OG1 1 
ATOM   2108  C  CG2 . THR A  1 265 ? 55.228 -29.618 8.878    1.00 31.39 ? 265 THR A CG2 1 
ATOM   2109  N  N   . ALA A  1 266 ? 58.411 -26.927 8.737    1.00 31.68 ? 266 ALA A N   1 
ATOM   2110  C  CA  . ALA A  1 266 ? 59.168 -26.386 9.862    1.00 32.15 ? 266 ALA A CA  1 
ATOM   2111  C  C   . ALA A  1 266 ? 59.363 -24.874 9.780    1.00 34.37 ? 266 ALA A C   1 
ATOM   2112  O  O   . ALA A  1 266 ? 60.154 -24.306 10.534   1.00 35.98 ? 266 ALA A O   1 
ATOM   2113  C  CB  . ALA A  1 266 ? 60.511 -27.094 9.989    1.00 27.49 ? 266 ALA A CB  1 
ATOM   2114  N  N   . LYS A  1 267 ? 58.655 -24.219 8.865    1.00 33.72 ? 267 LYS A N   1 
ATOM   2115  C  CA  . LYS A  1 267 ? 58.672 -22.758 8.829    1.00 35.51 ? 267 LYS A CA  1 
ATOM   2116  C  C   . LYS A  1 267 ? 58.312 -22.234 10.220   1.00 39.61 ? 267 LYS A C   1 
ATOM   2117  O  O   . LYS A  1 267 ? 57.392 -22.748 10.858   1.00 34.34 ? 267 LYS A O   1 
ATOM   2118  C  CB  . LYS A  1 267 ? 57.686 -22.221 7.792    1.00 35.71 ? 267 LYS A CB  1 
ATOM   2119  C  CG  . LYS A  1 267 ? 58.087 -22.473 6.348    1.00 40.04 ? 267 LYS A CG  1 
ATOM   2120  C  CD  . LYS A  1 267 ? 56.998 -21.996 5.397    1.00 43.58 ? 267 LYS A CD  1 
ATOM   2121  C  CE  . LYS A  1 267 ? 57.350 -22.314 3.953    1.00 46.40 ? 267 LYS A CE  1 
ATOM   2122  N  NZ  . LYS A  1 267 ? 56.211 -22.093 3.016    1.00 39.03 ? 267 LYS A NZ  1 
ATOM   2123  N  N   . PRO A  1 268 ? 59.038 -21.209 10.694   1.00 47.80 ? 268 PRO A N   1 
ATOM   2124  C  CA  . PRO A  1 268 ? 58.861 -20.686 12.053   1.00 46.20 ? 268 PRO A CA  1 
ATOM   2125  C  C   . PRO A  1 268 ? 57.398 -20.409 12.417   1.00 50.67 ? 268 PRO A C   1 
ATOM   2126  O  O   . PRO A  1 268 ? 57.005 -20.597 13.571   1.00 46.29 ? 268 PRO A O   1 
ATOM   2127  C  CB  . PRO A  1 268 ? 59.685 -19.385 12.055   1.00 45.99 ? 268 PRO A CB  1 
ATOM   2128  C  CG  . PRO A  1 268 ? 60.161 -19.181 10.650   1.00 51.41 ? 268 PRO A CG  1 
ATOM   2129  C  CD  . PRO A  1 268 ? 60.115 -20.515 9.971    1.00 46.88 ? 268 PRO A CD  1 
ATOM   2130  N  N   . GLU A  1 269 ? 56.600 -19.972 11.447   1.00 50.12 ? 269 GLU A N   1 
ATOM   2131  C  CA  . GLU A  1 269 ? 55.201 -19.637 11.715   1.00 49.53 ? 269 GLU A CA  1 
ATOM   2132  C  C   . GLU A  1 269 ? 54.402 -20.848 12.194   1.00 45.88 ? 269 GLU A C   1 
ATOM   2133  O  O   . GLU A  1 269 ? 53.359 -20.695 12.826   1.00 43.52 ? 269 GLU A O   1 
ATOM   2134  C  CB  . GLU A  1 269 ? 54.527 -19.026 10.481   1.00 51.51 ? 269 GLU A CB  1 
ATOM   2135  C  CG  . GLU A  1 269 ? 55.397 -18.041 9.718    1.00 66.38 ? 269 GLU A CG  1 
ATOM   2136  C  CD  . GLU A  1 269 ? 56.240 -18.719 8.657    1.00 66.72 ? 269 GLU A CD  1 
ATOM   2137  O  OE1 . GLU A  1 269 ? 57.483 -18.729 8.788    1.00 60.12 ? 269 GLU A OE1 1 
ATOM   2138  O  OE2 . GLU A  1 269 ? 55.654 -19.253 7.693    1.00 80.75 ? 269 GLU A OE2 1 
ATOM   2139  N  N   . TYR A  1 270 ? 54.889 -22.049 11.893   1.00 41.06 ? 270 TYR A N   1 
ATOM   2140  C  CA  . TYR A  1 270 ? 54.170 -23.267 12.266   1.00 41.25 ? 270 TYR A CA  1 
ATOM   2141  C  C   . TYR A  1 270 ? 54.621 -23.841 13.608   1.00 37.95 ? 270 TYR A C   1 
ATOM   2142  O  O   . TYR A  1 270 ? 53.962 -24.721 14.166   1.00 37.07 ? 270 TYR A O   1 
ATOM   2143  C  CB  . TYR A  1 270 ? 54.294 -24.338 11.175   1.00 39.63 ? 270 TYR A CB  1 
ATOM   2144  C  CG  . TYR A  1 270 ? 53.774 -23.913 9.816    1.00 40.02 ? 270 TYR A CG  1 
ATOM   2145  C  CD1 . TYR A  1 270 ? 52.624 -23.135 9.697    1.00 47.84 ? 270 TYR A CD1 1 
ATOM   2146  C  CD2 . TYR A  1 270 ? 54.423 -24.304 8.653    1.00 39.15 ? 270 TYR A CD2 1 
ATOM   2147  C  CE1 . TYR A  1 270 ? 52.148 -22.749 8.456    1.00 43.40 ? 270 TYR A CE1 1 
ATOM   2148  C  CE2 . TYR A  1 270 ? 53.956 -23.925 7.409    1.00 40.29 ? 270 TYR A CE2 1 
ATOM   2149  C  CZ  . TYR A  1 270 ? 52.819 -23.150 7.315    1.00 52.80 ? 270 TYR A CZ  1 
ATOM   2150  O  OH  . TYR A  1 270 ? 52.356 -22.779 6.073    1.00 51.51 ? 270 TYR A OH  1 
ATOM   2151  N  N   . LYS A  1 271 ? 55.742 -23.349 14.123   1.00 38.09 ? 271 LYS A N   1 
ATOM   2152  C  CA  . LYS A  1 271 ? 56.315 -23.902 15.348   1.00 38.60 ? 271 LYS A CA  1 
ATOM   2153  C  C   . LYS A  1 271 ? 55.346 -23.856 16.532   1.00 35.42 ? 271 LYS A C   1 
ATOM   2154  O  O   . LYS A  1 271 ? 55.118 -24.872 17.190   1.00 33.79 ? 271 LYS A O   1 
ATOM   2155  C  CB  . LYS A  1 271 ? 57.633 -23.210 15.707   1.00 40.62 ? 271 LYS A CB  1 
ATOM   2156  C  CG  . LYS A  1 271 ? 58.398 -23.900 16.831   1.00 41.84 ? 271 LYS A CG  1 
ATOM   2157  C  CD  . LYS A  1 271 ? 59.738 -23.227 17.083   1.00 48.85 ? 271 LYS A CD  1 
ATOM   2158  C  CE  . LYS A  1 271 ? 60.374 -23.701 18.380   1.00 50.81 ? 271 LYS A CE  1 
ATOM   2159  N  NZ  . LYS A  1 271 ? 60.698 -25.153 18.350   1.00 37.37 ? 271 LYS A NZ  1 
ATOM   2160  N  N   . PRO A  1 272 ? 54.779 -22.673 16.817   1.00 36.32 ? 272 PRO A N   1 
ATOM   2161  C  CA  . PRO A  1 272 ? 53.853 -22.572 17.939   1.00 38.09 ? 272 PRO A CA  1 
ATOM   2162  C  C   . PRO A  1 272 ? 52.739 -23.619 17.867   1.00 34.75 ? 272 PRO A C   1 
ATOM   2163  O  O   . PRO A  1 272 ? 52.312 -24.130 18.898   1.00 32.74 ? 272 PRO A O   1 
ATOM   2164  C  CB  . PRO A  1 272 ? 53.283 -21.158 17.790   1.00 34.40 ? 272 PRO A CB  1 
ATOM   2165  C  CG  . PRO A  1 272 ? 54.395 -20.395 17.155   1.00 35.78 ? 272 PRO A CG  1 
ATOM   2166  C  CD  . PRO A  1 272 ? 55.043 -21.359 16.200   1.00 36.85 ? 272 PRO A CD  1 
ATOM   2167  N  N   . LYS A  1 273 ? 52.294 -23.947 16.657   1.00 37.55 ? 273 LYS A N   1 
ATOM   2168  C  CA  . LYS A  1 273 ? 51.181 -24.882 16.469   1.00 36.98 ? 273 LYS A CA  1 
ATOM   2169  C  C   . LYS A  1 273 ? 51.603 -26.350 16.514   1.00 35.58 ? 273 LYS A C   1 
ATOM   2170  O  O   . LYS A  1 273 ? 50.912 -27.184 17.099   1.00 36.65 ? 273 LYS A O   1 
ATOM   2171  C  CB  . LYS A  1 273 ? 50.468 -24.608 15.141   1.00 41.41 ? 273 LYS A CB  1 
ATOM   2172  C  CG  . LYS A  1 273 ? 49.768 -23.260 15.072   1.00 57.04 ? 273 LYS A CG  1 
ATOM   2173  C  CD  . LYS A  1 273 ? 49.164 -23.015 13.697   1.00 55.34 ? 273 LYS A CD  1 
ATOM   2174  C  CE  . LYS A  1 273 ? 48.495 -21.651 13.632   1.00 54.58 ? 273 LYS A CE  1 
ATOM   2175  N  NZ  . LYS A  1 273 ? 47.863 -21.388 12.310   1.00 53.04 ? 273 LYS A NZ  1 
ATOM   2176  N  N   . LEU A  1 274 ? 52.733 -26.662 15.889   1.00 29.00 ? 274 LEU A N   1 
ATOM   2177  C  CA  . LEU A  1 274 ? 53.141 -28.055 15.702   1.00 29.30 ? 274 LEU A CA  1 
ATOM   2178  C  C   . LEU A  1 274 ? 54.107 -28.574 16.766   1.00 31.96 ? 274 LEU A C   1 
ATOM   2179  O  O   . LEU A  1 274 ? 54.037 -29.743 17.162   1.00 27.96 ? 274 LEU A O   1 
ATOM   2180  C  CB  . LEU A  1 274 ? 53.771 -28.228 14.317   1.00 28.43 ? 274 LEU A CB  1 
ATOM   2181  C  CG  . LEU A  1 274 ? 52.867 -27.839 13.146   1.00 25.67 ? 274 LEU A CG  1 
ATOM   2182  C  CD1 . LEU A  1 274 ? 53.601 -28.030 11.829   1.00 25.81 ? 274 LEU A CD1 1 
ATOM   2183  C  CD2 . LEU A  1 274 ? 51.591 -28.663 13.178   1.00 24.44 ? 274 LEU A CD2 1 
ATOM   2184  N  N   . ALA A  1 275 ? 55.019 -27.716 17.217   1.00 26.19 ? 275 ALA A N   1 
ATOM   2185  C  CA  . ALA A  1 275 ? 56.058 -28.151 18.143   1.00 22.99 ? 275 ALA A CA  1 
ATOM   2186  C  C   . ALA A  1 275 ? 56.556 -27.003 19.013   1.00 23.65 ? 275 ALA A C   1 
ATOM   2187  O  O   . ALA A  1 275 ? 57.745 -26.676 18.983   1.00 23.54 ? 275 ALA A O   1 
ATOM   2188  C  CB  . ALA A  1 275 ? 57.212 -28.781 17.369   1.00 19.73 ? 275 ALA A CB  1 
ATOM   2189  N  N   . PRO A  1 276 ? 55.649 -26.399 19.806   1.00 23.97 ? 276 PRO A N   1 
ATOM   2190  C  CA  . PRO A  1 276 ? 55.945 -25.169 20.551   1.00 26.33 ? 276 PRO A CA  1 
ATOM   2191  C  C   . PRO A  1 276 ? 57.160 -25.251 21.487   1.00 25.47 ? 276 PRO A C   1 
ATOM   2192  O  O   . PRO A  1 276 ? 57.917 -24.282 21.598   1.00 24.82 ? 276 PRO A O   1 
ATOM   2193  C  CB  . PRO A  1 276 ? 54.655 -24.918 21.353   1.00 27.30 ? 276 PRO A CB  1 
ATOM   2194  C  CG  . PRO A  1 276 ? 53.927 -26.226 21.350   1.00 26.16 ? 276 PRO A CG  1 
ATOM   2195  C  CD  . PRO A  1 276 ? 54.267 -26.854 20.031   1.00 23.91 ? 276 PRO A CD  1 
ATOM   2196  N  N   . ARG A  1 277 ? 57.354 -26.388 22.147   1.00 20.91 ? 277 ARG A N   1 
ATOM   2197  C  CA  . ARG A  1 277 ? 58.426 -26.500 23.149   1.00 21.73 ? 277 ARG A CA  1 
ATOM   2198  C  C   . ARG A  1 277 ? 59.564 -27.420 22.713   1.00 25.10 ? 277 ARG A C   1 
ATOM   2199  O  O   . ARG A  1 277 ? 60.429 -27.806 23.512   1.00 21.72 ? 277 ARG A O   1 
ATOM   2200  C  CB  . ARG A  1 277 ? 57.846 -26.940 24.487   1.00 25.11 ? 277 ARG A CB  1 
ATOM   2201  C  CG  . ARG A  1 277 ? 56.804 -25.970 25.023   1.00 29.84 ? 277 ARG A CG  1 
ATOM   2202  C  CD  . ARG A  1 277 ? 56.516 -26.247 26.483   1.00 34.09 ? 277 ARG A CD  1 
ATOM   2203  N  NE  . ARG A  1 277 ? 55.812 -27.511 26.648   1.00 42.04 ? 277 ARG A NE  1 
ATOM   2204  C  CZ  . ARG A  1 277 ? 55.922 -28.292 27.717   1.00 40.29 ? 277 ARG A CZ  1 
ATOM   2205  N  NH1 . ARG A  1 277 ? 55.242 -29.428 27.778   1.00 38.76 ? 277 ARG A NH1 1 
ATOM   2206  N  NH2 . ARG A  1 277 ? 56.721 -27.942 28.717   1.00 37.52 ? 277 ARG A NH2 1 
ATOM   2207  N  N   . TRP A  1 278 ? 59.557 -27.756 21.430   1.00 20.25 ? 278 TRP A N   1 
ATOM   2208  C  CA  . TRP A  1 278 ? 60.548 -28.638 20.843   1.00 20.91 ? 278 TRP A CA  1 
ATOM   2209  C  C   . TRP A  1 278 ? 61.920 -28.014 20.876   1.00 18.27 ? 278 TRP A C   1 
ATOM   2210  O  O   . TRP A  1 278 ? 62.124 -26.898 20.398   1.00 16.45 ? 278 TRP A O   1 
ATOM   2211  C  CB  . TRP A  1 278 ? 60.121 -28.939 19.414   1.00 17.71 ? 278 TRP A CB  1 
ATOM   2212  C  CG  . TRP A  1 278 ? 60.858 -30.040 18.692   1.00 19.26 ? 278 TRP A CG  1 
ATOM   2213  C  CD1 . TRP A  1 278 ? 61.311 -31.268 19.200   1.00 16.83 ? 278 TRP A CD1 1 
ATOM   2214  C  CD2 . TRP A  1 278 ? 61.187 -30.071 17.260   1.00 16.62 ? 278 TRP A CD2 1 
ATOM   2215  N  NE1 . TRP A  1 278 ? 61.908 -32.014 18.206   1.00 19.93 ? 278 TRP A NE1 1 
ATOM   2216  C  CE2 . TRP A  1 278 ? 61.860 -31.349 17.016   1.00 18.76 ? 278 TRP A CE2 1 
ATOM   2217  C  CE3 . TRP A  1 278 ? 61.013 -29.185 16.203   1.00 20.54 ? 278 TRP A CE3 1 
ATOM   2218  C  CZ2 . TRP A  1 278 ? 62.331 -31.699 15.758   1.00 23.00 ? 278 TRP A CZ2 1 
ATOM   2219  C  CZ3 . TRP A  1 278 ? 61.480 -29.552 14.939   1.00 19.53 ? 278 TRP A CZ3 1 
ATOM   2220  C  CH2 . TRP A  1 278 ? 62.125 -30.779 14.723   1.00 20.78 ? 278 TRP A CH2 1 
ATOM   2221  N  N   . SER A  1 279 ? 62.874 -28.740 21.447   1.00 20.16 ? 279 SER A N   1 
ATOM   2222  C  CA  . SER A  1 279 ? 64.269 -28.318 21.473   1.00 17.58 ? 279 SER A CA  1 
ATOM   2223  C  C   . SER A  1 279 ? 65.093 -29.487 21.987   1.00 19.53 ? 279 SER A C   1 
ATOM   2224  O  O   . SER A  1 279 ? 64.547 -30.530 22.357   1.00 19.67 ? 279 SER A O   1 
ATOM   2225  C  CB  . SER A  1 279 ? 64.466 -27.105 22.388   1.00 21.87 ? 279 SER A CB  1 
ATOM   2226  O  OG  . SER A  1 279 ? 64.796 -27.523 23.707   1.00 21.31 ? 279 SER A OG  1 
ATOM   2227  N  N   . ILE A  1 280 ? 66.406 -29.322 22.018   1.00 16.16 ? 280 ILE A N   1 
ATOM   2228  C  CA  . ILE A  1 280 ? 67.274 -30.431 22.391   1.00 16.18 ? 280 ILE A CA  1 
ATOM   2229  C  C   . ILE A  1 280 ? 67.350 -30.624 23.916   1.00 15.72 ? 280 ILE A C   1 
ATOM   2230  O  O   . ILE A  1 280 ? 67.978 -31.570 24.399   1.00 14.56 ? 280 ILE A O   1 
ATOM   2231  C  CB  . ILE A  1 280 ? 68.687 -30.261 21.788   1.00 17.01 ? 280 ILE A CB  1 
ATOM   2232  C  CG1 . ILE A  1 280 ? 69.370 -31.626 21.610   1.00 18.38 ? 280 ILE A CG1 1 
ATOM   2233  C  CG2 . ILE A  1 280 ? 69.531 -29.315 22.636   1.00 17.22 ? 280 ILE A CG2 1 
ATOM   2234  C  CD1 . ILE A  1 280 ? 70.630 -31.577 20.767   1.00 16.93 ? 280 ILE A CD1 1 
ATOM   2235  N  N   . THR A  1 281 ? 66.706 -29.736 24.672   1.00 13.64 ? 281 THR A N   1 
ATOM   2236  C  CA  . THR A  1 281 ? 66.721 -29.847 26.133   1.00 16.65 ? 281 THR A CA  1 
ATOM   2237  C  C   . THR A  1 281 ? 65.339 -30.012 26.766   1.00 16.63 ? 281 THR A C   1 
ATOM   2238  O  O   . THR A  1 281 ? 65.195 -29.894 27.979   1.00 17.74 ? 281 THR A O   1 
ATOM   2239  C  CB  . THR A  1 281 ? 67.434 -28.653 26.803   1.00 15.84 ? 281 THR A CB  1 
ATOM   2240  O  OG1 . THR A  1 281 ? 66.752 -27.435 26.472   1.00 17.41 ? 281 THR A OG1 1 
ATOM   2241  C  CG2 . THR A  1 281 ? 68.891 -28.567 26.353   1.00 17.57 ? 281 THR A CG2 1 
ATOM   2242  N  N   . LEU A  1 282 ? 64.320 -30.278 25.956   1.00 18.18 ? 282 LEU A N   1 
ATOM   2243  C  CA  . LEU A  1 282 ? 62.963 -30.404 26.497   1.00 18.21 ? 282 LEU A CA  1 
ATOM   2244  C  C   . LEU A  1 282 ? 62.841 -31.499 27.572   1.00 16.60 ? 282 LEU A C   1 
ATOM   2245  O  O   . LEU A  1 282 ? 62.173 -31.305 28.591   1.00 17.19 ? 282 LEU A O   1 
ATOM   2246  C  CB  . LEU A  1 282 ? 61.942 -30.614 25.371   1.00 16.71 ? 282 LEU A CB  1 
ATOM   2247  C  CG  . LEU A  1 282 ? 60.493 -30.866 25.802   1.00 21.88 ? 282 LEU A CG  1 
ATOM   2248  C  CD1 . LEU A  1 282 ? 59.972 -29.725 26.668   1.00 19.50 ? 282 LEU A CD1 1 
ATOM   2249  C  CD2 . LEU A  1 282 ? 59.603 -31.069 24.585   1.00 20.22 ? 282 LEU A CD2 1 
ATOM   2250  N  N   . ILE A  1 283 ? 63.502 -32.636 27.380   1.00 17.00 ? 283 ILE A N   1 
ATOM   2251  C  CA  . ILE A  1 283 ? 63.367 -33.716 28.368   1.00 16.26 ? 283 ILE A CA  1 
ATOM   2252  C  C   . ILE A  1 283 ? 63.933 -33.325 29.738   1.00 17.88 ? 283 ILE A C   1 
ATOM   2253  O  O   . ILE A  1 283 ? 63.502 -33.843 30.771   1.00 17.04 ? 283 ILE A O   1 
ATOM   2254  C  CB  . ILE A  1 283 ? 63.949 -35.064 27.880   1.00 20.26 ? 283 ILE A CB  1 
ATOM   2255  C  CG1 . ILE A  1 283 ? 65.426 -34.934 27.514   1.00 22.09 ? 283 ILE A CG1 1 
ATOM   2256  C  CG2 . ILE A  1 283 ? 63.147 -35.597 26.702   1.00 18.64 ? 283 ILE A CG2 1 
ATOM   2257  C  CD1 . ILE A  1 283 ? 66.358 -35.269 28.652   1.00 24.57 ? 283 ILE A CD1 1 
ATOM   2258  N  N   . PHE A  1 284 ? 64.887 -32.398 29.751   1.00 17.10 ? 284 PHE A N   1 
ATOM   2259  C  CA  . PHE A  1 284 ? 65.406 -31.874 31.014   1.00 18.03 ? 284 PHE A CA  1 
ATOM   2260  C  C   . PHE A  1 284 ? 64.424 -30.925 31.688   1.00 17.14 ? 284 PHE A C   1 
ATOM   2261  O  O   . PHE A  1 284 ? 64.418 -30.790 32.914   1.00 18.64 ? 284 PHE A O   1 
ATOM   2262  C  CB  . PHE A  1 284 ? 66.724 -31.147 30.780   1.00 17.13 ? 284 PHE A CB  1 
ATOM   2263  C  CG  . PHE A  1 284 ? 67.800 -32.040 30.242   1.00 20.03 ? 284 PHE A CG  1 
ATOM   2264  C  CD1 . PHE A  1 284 ? 68.175 -31.969 28.913   1.00 16.20 ? 284 PHE A CD1 1 
ATOM   2265  C  CD2 . PHE A  1 284 ? 68.409 -32.976 31.066   1.00 17.94 ? 284 PHE A CD2 1 
ATOM   2266  C  CE1 . PHE A  1 284 ? 69.158 -32.806 28.412   1.00 22.31 ? 284 PHE A CE1 1 
ATOM   2267  C  CE2 . PHE A  1 284 ? 69.391 -33.816 30.571   1.00 20.91 ? 284 PHE A CE2 1 
ATOM   2268  C  CZ  . PHE A  1 284 ? 69.765 -33.731 29.246   1.00 20.02 ? 284 PHE A CZ  1 
ATOM   2269  N  N   . GLU A  1 285 ? 63.603 -30.269 30.876   1.00 18.65 ? 285 GLU A N   1 
ATOM   2270  C  CA  . GLU A  1 285 ? 62.720 -29.208 31.348   1.00 18.56 ? 285 GLU A CA  1 
ATOM   2271  C  C   . GLU A  1 285 ? 61.355 -29.729 31.756   1.00 21.54 ? 285 GLU A C   1 
ATOM   2272  O  O   . GLU A  1 285 ? 60.670 -29.133 32.594   1.00 19.38 ? 285 GLU A O   1 
ATOM   2273  C  CB  . GLU A  1 285 ? 62.549 -28.170 30.243   1.00 20.86 ? 285 GLU A CB  1 
ATOM   2274  C  CG  . GLU A  1 285 ? 63.839 -27.451 29.895   1.00 18.63 ? 285 GLU A CG  1 
ATOM   2275  C  CD  . GLU A  1 285 ? 63.847 -26.921 28.477   1.00 21.24 ? 285 GLU A CD  1 
ATOM   2276  O  OE1 . GLU A  1 285 ? 62.780 -26.924 27.830   1.00 21.06 ? 285 GLU A OE1 1 
ATOM   2277  O  OE2 . GLU A  1 285 ? 64.926 -26.510 28.005   1.00 24.23 ? 285 GLU A OE2 1 
ATOM   2278  N  N   . ASP A  1 286 ? 60.961 -30.846 31.160   1.00 20.03 ? 286 ASP A N   1 
ATOM   2279  C  CA  . ASP A  1 286 ? 59.602 -31.333 31.325   1.00 23.49 ? 286 ASP A CA  1 
ATOM   2280  C  C   . ASP A  1 286 ? 59.567 -32.812 31.692   1.00 19.94 ? 286 ASP A C   1 
ATOM   2281  O  O   . ASP A  1 286 ? 59.124 -33.177 32.773   1.00 24.01 ? 286 ASP A O   1 
ATOM   2282  C  CB  . ASP A  1 286 ? 58.813 -31.095 30.041   1.00 24.49 ? 286 ASP A CB  1 
ATOM   2283  C  CG  . ASP A  1 286 ? 57.344 -31.409 30.201   1.00 28.09 ? 286 ASP A CG  1 
ATOM   2284  O  OD1 . ASP A  1 286 ? 57.023 -32.468 30.781   1.00 25.64 ? 286 ASP A OD1 1 
ATOM   2285  O  OD2 . ASP A  1 286 ? 56.514 -30.594 29.751   1.00 31.58 ? 286 ASP A OD2 1 
ATOM   2286  N  N   . THR A  1 287 ? 60.060 -33.654 30.793   1.00 20.11 ? 287 THR A N   1 
ATOM   2287  C  CA  . THR A  1 287 ? 59.954 -35.103 30.954   1.00 20.00 ? 287 THR A CA  1 
ATOM   2288  C  C   . THR A  1 287 ? 60.612 -35.618 32.225   1.00 21.03 ? 287 THR A C   1 
ATOM   2289  O  O   . THR A  1 287 ? 59.970 -36.290 33.032   1.00 23.88 ? 287 THR A O   1 
ATOM   2290  C  CB  . THR A  1 287 ? 60.536 -35.834 29.737   1.00 20.49 ? 287 THR A CB  1 
ATOM   2291  O  OG1 . THR A  1 287 ? 59.845 -35.392 28.565   1.00 25.56 ? 287 THR A OG1 1 
ATOM   2292  C  CG2 . THR A  1 287 ? 60.380 -37.342 29.883   1.00 21.83 ? 287 THR A CG2 1 
ATOM   2293  N  N   . ILE A  1 288 ? 61.887 -35.304 32.414   1.00 18.85 ? 288 ILE A N   1 
ATOM   2294  C  CA  . ILE A  1 288 ? 62.604 -35.864 33.550   1.00 20.21 ? 288 ILE A CA  1 
ATOM   2295  C  C   . ILE A  1 288 ? 62.019 -35.366 34.871   1.00 21.66 ? 288 ILE A C   1 
ATOM   2296  O  O   . ILE A  1 288 ? 61.773 -36.161 35.784   1.00 21.79 ? 288 ILE A O   1 
ATOM   2297  C  CB  . ILE A  1 288 ? 64.129 -35.648 33.455   1.00 20.13 ? 288 ILE A CB  1 
ATOM   2298  C  CG1 . ILE A  1 288 ? 64.685 -36.462 32.280   1.00 21.38 ? 288 ILE A CG1 1 
ATOM   2299  C  CG2 . ILE A  1 288 ? 64.813 -36.093 34.740   1.00 21.47 ? 288 ILE A CG2 1 
ATOM   2300  C  CD1 . ILE A  1 288 ? 66.186 -36.362 32.103   1.00 18.55 ? 288 ILE A CD1 1 
ATOM   2301  N  N   . PRO A  1 289 ? 61.775 -34.048 34.975   1.00 21.53 ? 289 PRO A N   1 
ATOM   2302  C  CA  . PRO A  1 289 ? 61.082 -33.542 36.157   1.00 22.49 ? 289 PRO A CA  1 
ATOM   2303  C  C   . PRO A  1 289 ? 59.733 -34.239 36.379   1.00 23.44 ? 289 PRO A C   1 
ATOM   2304  O  O   . PRO A  1 289 ? 59.404 -34.606 37.514   1.00 23.34 ? 289 PRO A O   1 
ATOM   2305  C  CB  . PRO A  1 289 ? 60.869 -32.062 35.830   1.00 23.05 ? 289 PRO A CB  1 
ATOM   2306  C  CG  . PRO A  1 289 ? 61.975 -31.724 34.895   1.00 22.95 ? 289 PRO A CG  1 
ATOM   2307  C  CD  . PRO A  1 289 ? 62.225 -32.965 34.081   1.00 19.74 ? 289 PRO A CD  1 
ATOM   2308  N  N   . PHE A  1 290 ? 58.952 -34.413 35.315   1.00 21.03 ? 290 PHE A N   1 
ATOM   2309  C  CA  . PHE A  1 290 ? 57.663 -35.114 35.430   1.00 21.05 ? 290 PHE A CA  1 
ATOM   2310  C  C   . PHE A  1 290 ? 57.804 -36.536 35.976   1.00 20.17 ? 290 PHE A C   1 
ATOM   2311  O  O   . PHE A  1 290 ? 57.022 -36.963 36.829   1.00 20.49 ? 290 PHE A O   1 
ATOM   2312  C  CB  . PHE A  1 290 ? 56.938 -35.151 34.080   1.00 22.18 ? 290 PHE A CB  1 
ATOM   2313  C  CG  . PHE A  1 290 ? 55.788 -36.126 34.031   1.00 24.02 ? 290 PHE A CG  1 
ATOM   2314  C  CD1 . PHE A  1 290 ? 54.505 -35.724 34.374   1.00 26.08 ? 290 PHE A CD1 1 
ATOM   2315  C  CD2 . PHE A  1 290 ? 55.991 -37.444 33.641   1.00 24.46 ? 290 PHE A CD2 1 
ATOM   2316  C  CE1 . PHE A  1 290 ? 53.443 -36.618 34.326   1.00 27.17 ? 290 PHE A CE1 1 
ATOM   2317  C  CE2 . PHE A  1 290 ? 54.938 -38.343 33.595   1.00 22.74 ? 290 PHE A CE2 1 
ATOM   2318  C  CZ  . PHE A  1 290 ? 53.660 -37.928 33.934   1.00 26.01 ? 290 PHE A CZ  1 
ATOM   2319  N  N   . LEU A  1 291 ? 58.789 -37.282 35.483   1.00 19.80 ? 291 LEU A N   1 
ATOM   2320  C  CA  . LEU A  1 291 ? 58.970 -38.653 35.949   1.00 20.19 ? 291 LEU A CA  1 
ATOM   2321  C  C   . LEU A  1 291 ? 59.356 -38.646 37.422   1.00 22.79 ? 291 LEU A C   1 
ATOM   2322  O  O   . LEU A  1 291 ? 58.821 -39.416 38.217   1.00 24.41 ? 291 LEU A O   1 
ATOM   2323  C  CB  . LEU A  1 291 ? 60.020 -39.403 35.107   1.00 18.94 ? 291 LEU A CB  1 
ATOM   2324  C  CG  . LEU A  1 291 ? 59.676 -39.693 33.636   1.00 19.90 ? 291 LEU A CG  1 
ATOM   2325  C  CD1 . LEU A  1 291 ? 60.898 -40.143 32.846   1.00 17.97 ? 291 LEU A CD1 1 
ATOM   2326  C  CD2 . LEU A  1 291 ? 58.559 -40.726 33.527   1.00 21.26 ? 291 LEU A CD2 1 
ATOM   2327  N  N   . LYS A  1 292 ? 60.270 -37.753 37.786   1.00 24.44 ? 292 LYS A N   1 
ATOM   2328  C  CA  . LYS A  1 292 ? 60.764 -37.678 39.162   1.00 31.29 ? 292 LYS A CA  1 
ATOM   2329  C  C   . LYS A  1 292 ? 59.673 -37.415 40.199   1.00 31.68 ? 292 LYS A C   1 
ATOM   2330  O  O   . LYS A  1 292 ? 59.661 -38.032 41.264   1.00 30.82 ? 292 LYS A O   1 
ATOM   2331  C  CB  . LYS A  1 292 ? 61.908 -36.664 39.281   1.00 30.59 ? 292 LYS A CB  1 
ATOM   2332  C  CG  . LYS A  1 292 ? 63.221 -37.206 38.732   1.00 38.03 ? 292 LYS A CG  1 
ATOM   2333  C  CD  . LYS A  1 292 ? 64.434 -36.446 39.244   1.00 48.88 ? 292 LYS A CD  1 
ATOM   2334  C  CE  . LYS A  1 292 ? 64.774 -35.269 38.346   1.00 58.33 ? 292 LYS A CE  1 
ATOM   2335  N  NZ  . LYS A  1 292 ? 66.194 -34.839 38.506   1.00 55.04 ? 292 LYS A NZ  1 
ATOM   2336  N  N   . ARG A  1 293 ? 58.752 -36.507 39.900   1.00 30.57 ? 293 ARG A N   1 
ATOM   2337  C  CA  . ARG A  1 293 ? 57.704 -36.215 40.871   1.00 36.26 ? 293 ARG A CA  1 
ATOM   2338  C  C   . ARG A  1 293 ? 56.591 -37.258 40.803   1.00 35.21 ? 293 ARG A C   1 
ATOM   2339  O  O   . ARG A  1 293 ? 55.632 -37.211 41.571   1.00 29.74 ? 293 ARG A O   1 
ATOM   2340  C  CB  . ARG A  1 293 ? 57.170 -34.787 40.725   1.00 38.89 ? 293 ARG A CB  1 
ATOM   2341  C  CG  . ARG A  1 293 ? 56.460 -34.493 39.424   1.00 38.39 ? 293 ARG A CG  1 
ATOM   2342  C  CD  . ARG A  1 293 ? 56.081 -33.021 39.344   1.00 46.60 ? 293 ARG A CD  1 
ATOM   2343  N  NE  . ARG A  1 293 ? 55.515 -32.689 38.042   1.00 45.14 ? 293 ARG A NE  1 
ATOM   2344  C  CZ  . ARG A  1 293 ? 56.190 -32.101 37.061   1.00 43.68 ? 293 ARG A CZ  1 
ATOM   2345  N  NH1 . ARG A  1 293 ? 55.594 -31.845 35.905   1.00 47.60 ? 293 ARG A NH1 1 
ATOM   2346  N  NH2 . ARG A  1 293 ? 57.459 -31.761 37.238   1.00 40.39 ? 293 ARG A NH2 1 
ATOM   2347  N  N   . ASN A  1 294 ? 56.736 -38.211 39.891   1.00 30.35 ? 294 ASN A N   1 
ATOM   2348  C  CA  . ASN A  1 294 ? 55.837 -39.352 39.846   1.00 28.91 ? 294 ASN A CA  1 
ATOM   2349  C  C   . ASN A  1 294 ? 56.494 -40.608 40.391   1.00 27.64 ? 294 ASN A C   1 
ATOM   2350  O  O   . ASN A  1 294 ? 56.057 -41.720 40.108   1.00 28.39 ? 294 ASN A O   1 
ATOM   2351  C  CB  . ASN A  1 294 ? 55.306 -39.577 38.434   1.00 27.89 ? 294 ASN A CB  1 
ATOM   2352  C  CG  . ASN A  1 294 ? 54.186 -38.622 38.087   1.00 33.68 ? 294 ASN A CG  1 
ATOM   2353  O  OD1 . ASN A  1 294 ? 54.400 -37.600 37.432   1.00 35.44 ? 294 ASN A OD1 1 
ATOM   2354  N  ND2 . ASN A  1 294 ? 52.987 -38.931 38.555   1.00 31.61 ? 294 ASN A ND2 1 
ATOM   2355  N  N   . GLY A  1 295 ? 57.550 -40.419 41.175   1.00 27.58 ? 295 GLY A N   1 
ATOM   2356  C  CA  . GLY A  1 295 ? 58.186 -41.524 41.883   1.00 28.96 ? 295 GLY A CA  1 
ATOM   2357  C  C   . GLY A  1 295 ? 59.254 -42.291 41.125   1.00 32.52 ? 295 GLY A C   1 
ATOM   2358  O  O   . GLY A  1 295 ? 59.721 -43.326 41.593   1.00 32.23 ? 295 GLY A O   1 
ATOM   2359  N  N   . VAL A  1 296 ? 59.648 -41.807 39.952   1.00 31.86 ? 296 VAL A N   1 
ATOM   2360  C  CA  . VAL A  1 296 ? 60.725 -42.460 39.220   1.00 28.10 ? 296 VAL A CA  1 
ATOM   2361  C  C   . VAL A  1 296 ? 62.063 -41.971 39.763   1.00 30.64 ? 296 VAL A C   1 
ATOM   2362  O  O   . VAL A  1 296 ? 62.307 -40.766 39.831   1.00 32.00 ? 296 VAL A O   1 
ATOM   2363  C  CB  . VAL A  1 296 ? 60.644 -42.187 37.706   1.00 27.34 ? 296 VAL A CB  1 
ATOM   2364  C  CG1 . VAL A  1 296 ? 61.776 -42.901 36.989   1.00 24.16 ? 296 VAL A CG1 1 
ATOM   2365  C  CG2 . VAL A  1 296 ? 59.305 -42.641 37.155   1.00 26.75 ? 296 VAL A CG2 1 
ATOM   2366  N  N   . ASN A  1 297 ? 62.933 -42.899 40.147   1.00 29.38 ? 297 ASN A N   1 
ATOM   2367  C  CA  . ASN A  1 297 ? 64.183 -42.521 40.804   1.00 32.15 ? 297 ASN A CA  1 
ATOM   2368  C  C   . ASN A  1 297 ? 65.335 -42.259 39.837   1.00 35.11 ? 297 ASN A C   1 
ATOM   2369  O  O   . ASN A  1 297 ? 65.239 -42.551 38.646   1.00 27.50 ? 297 ASN A O   1 
ATOM   2370  C  CB  . ASN A  1 297 ? 64.588 -43.568 41.845   1.00 35.72 ? 297 ASN A CB  1 
ATOM   2371  C  CG  . ASN A  1 297 ? 64.885 -44.915 41.227   1.00 38.82 ? 297 ASN A CG  1 
ATOM   2372  O  OD1 . ASN A  1 297 ? 65.435 -45.000 40.129   1.00 47.70 ? 297 ASN A OD1 1 
ATOM   2373  N  ND2 . ASN A  1 297 ? 64.523 -45.980 41.931   1.00 42.87 ? 297 ASN A ND2 1 
ATOM   2374  N  N   . GLU A  1 298 ? 66.424 -41.705 40.364   1.00 29.05 ? 298 GLU A N   1 
ATOM   2375  C  CA  . GLU A  1 298 ? 67.592 -41.370 39.555   1.00 30.47 ? 298 GLU A CA  1 
ATOM   2376  C  C   . GLU A  1 298 ? 68.195 -42.582 38.855   1.00 24.91 ? 298 GLU A C   1 
ATOM   2377  O  O   . GLU A  1 298 ? 68.770 -42.453 37.775   1.00 27.81 ? 298 GLU A O   1 
ATOM   2378  C  CB  . GLU A  1 298 ? 68.663 -40.677 40.405   1.00 36.58 ? 298 GLU A CB  1 
ATOM   2379  C  CG  . GLU A  1 298 ? 68.368 -39.217 40.707   1.00 48.82 ? 298 GLU A CG  1 
ATOM   2380  C  CD  . GLU A  1 298 ? 68.155 -38.393 39.450   1.00 58.90 ? 298 GLU A CD  1 
ATOM   2381  O  OE1 . GLU A  1 298 ? 67.401 -37.397 39.511   1.00 69.80 ? 298 GLU A OE1 1 
ATOM   2382  O  OE2 . GLU A  1 298 ? 68.733 -38.744 38.399   1.00 56.30 ? 298 GLU A OE2 1 
ATOM   2383  N  N   . GLU A  1 299 ? 68.071 -43.754 39.468   1.00 22.27 ? 299 GLU A N   1 
ATOM   2384  C  CA  . GLU A  1 299 ? 68.598 -44.983 38.869   1.00 27.84 ? 299 GLU A CA  1 
ATOM   2385  C  C   . GLU A  1 299 ? 67.904 -45.327 37.553   1.00 23.38 ? 299 GLU A C   1 
ATOM   2386  O  O   . GLU A  1 299 ? 68.544 -45.771 36.603   1.00 22.71 ? 299 GLU A O   1 
ATOM   2387  C  CB  . GLU A  1 299 ? 68.490 -46.164 39.839   1.00 29.89 ? 299 GLU A CB  1 
ATOM   2388  C  CG  . GLU A  1 299 ? 69.362 -46.029 41.075   1.00 38.20 ? 299 GLU A CG  1 
ATOM   2389  C  CD  . GLU A  1 299 ? 68.849 -44.975 42.041   1.00 52.79 ? 299 GLU A CD  1 
ATOM   2390  O  OE1 . GLU A  1 299 ? 67.613 -44.846 42.196   1.00 50.87 ? 299 GLU A OE1 1 
ATOM   2391  O  OE2 . GLU A  1 299 ? 69.685 -44.276 42.651   1.00 69.37 ? 299 GLU A OE2 1 
ATOM   2392  N  N   . VAL A  1 300 ? 66.590 -45.132 37.501   1.00 22.24 ? 300 VAL A N   1 
ATOM   2393  C  CA  . VAL A  1 300 ? 65.845 -45.388 36.274   1.00 22.69 ? 300 VAL A CA  1 
ATOM   2394  C  C   . VAL A  1 300 ? 66.266 -44.397 35.186   1.00 20.53 ? 300 VAL A C   1 
ATOM   2395  O  O   . VAL A  1 300 ? 66.420 -44.766 34.027   1.00 19.52 ? 300 VAL A O   1 
ATOM   2396  C  CB  . VAL A  1 300 ? 64.323 -45.324 36.508   1.00 22.31 ? 300 VAL A CB  1 
ATOM   2397  C  CG1 . VAL A  1 300 ? 63.569 -45.508 35.199   1.00 19.16 ? 300 VAL A CG1 1 
ATOM   2398  C  CG2 . VAL A  1 300 ? 63.898 -46.387 37.509   1.00 21.88 ? 300 VAL A CG2 1 
ATOM   2399  N  N   . ILE A  1 301 ? 66.461 -43.139 35.563   1.00 22.15 ? 301 ILE A N   1 
ATOM   2400  C  CA  . ILE A  1 301 ? 66.921 -42.132 34.604   1.00 22.02 ? 301 ILE A CA  1 
ATOM   2401  C  C   . ILE A  1 301 ? 68.307 -42.520 34.072   1.00 20.60 ? 301 ILE A C   1 
ATOM   2402  O  O   . ILE A  1 301 ? 68.592 -42.384 32.878   1.00 18.71 ? 301 ILE A O   1 
ATOM   2403  C  CB  . ILE A  1 301 ? 66.960 -40.725 35.230   1.00 22.10 ? 301 ILE A CB  1 
ATOM   2404  C  CG1 . ILE A  1 301 ? 65.617 -40.396 35.889   1.00 20.99 ? 301 ILE A CG1 1 
ATOM   2405  C  CG2 . ILE A  1 301 ? 67.332 -39.679 34.186   1.00 19.88 ? 301 ILE A CG2 1 
ATOM   2406  C  CD1 . ILE A  1 301 ? 64.443 -40.419 34.933   1.00 25.11 ? 301 ILE A CD1 1 
ATOM   2407  N  N   . ALA A  1 302 ? 69.155 -43.024 34.964   1.00 20.13 ? 302 ALA A N   1 
ATOM   2408  C  CA  . ALA A  1 302 ? 70.491 -43.505 34.589   1.00 22.16 ? 302 ALA A CA  1 
ATOM   2409  C  C   . ALA A  1 302 ? 70.435 -44.701 33.634   1.00 19.49 ? 302 ALA A C   1 
ATOM   2410  O  O   . ALA A  1 302 ? 71.225 -44.798 32.697   1.00 19.41 ? 302 ALA A O   1 
ATOM   2411  C  CB  . ALA A  1 302 ? 71.293 -43.862 35.834   1.00 24.59 ? 302 ALA A CB  1 
ATOM   2412  N  N   . THR A  1 303 ? 69.502 -45.614 33.883   1.00 19.46 ? 303 THR A N   1 
ATOM   2413  C  CA  . THR A  1 303 ? 69.311 -46.767 33.015   1.00 19.41 ? 303 THR A CA  1 
ATOM   2414  C  C   . THR A  1 303 ? 68.954 -46.323 31.610   1.00 17.57 ? 303 THR A C   1 
ATOM   2415  O  O   . THR A  1 303 ? 69.507 -46.816 30.632   1.00 17.32 ? 303 THR A O   1 
ATOM   2416  C  CB  . THR A  1 303 ? 68.178 -47.669 33.531   1.00 18.74 ? 303 THR A CB  1 
ATOM   2417  O  OG1 . THR A  1 303 ? 68.556 -48.217 34.793   1.00 20.37 ? 303 THR A OG1 1 
ATOM   2418  C  CG2 . THR A  1 303 ? 67.903 -48.808 32.550   1.00 16.72 ? 303 THR A CG2 1 
ATOM   2419  N  N   . ILE A  1 304 ? 68.018 -45.388 31.512   1.00 17.29 ? 304 ILE A N   1 
ATOM   2420  C  CA  . ILE A  1 304 ? 67.533 -44.960 30.211   1.00 16.38 ? 304 ILE A CA  1 
ATOM   2421  C  C   . ILE A  1 304 ? 68.583 -44.189 29.408   1.00 16.03 ? 304 ILE A C   1 
ATOM   2422  O  O   . ILE A  1 304 ? 68.763 -44.434 28.218   1.00 13.74 ? 304 ILE A O   1 
ATOM   2423  C  CB  . ILE A  1 304 ? 66.262 -44.102 30.344   1.00 16.66 ? 304 ILE A CB  1 
ATOM   2424  C  CG1 . ILE A  1 304 ? 65.103 -44.962 30.847   1.00 17.45 ? 304 ILE A CG1 1 
ATOM   2425  C  CG2 . ILE A  1 304 ? 65.911 -43.458 29.003   1.00 15.89 ? 304 ILE A CG2 1 
ATOM   2426  C  CD1 . ILE A  1 304 ? 63.855 -44.173 31.204   1.00 17.76 ? 304 ILE A CD1 1 
ATOM   2427  N  N   . PHE A  1 305 ? 69.268 -43.253 30.057   1.00 15.22 ? 305 PHE A N   1 
ATOM   2428  C  CA  . PHE A  1 305 ? 70.141 -42.323 29.330   1.00 15.59 ? 305 PHE A CA  1 
ATOM   2429  C  C   . PHE A  1 305 ? 71.621 -42.690 29.307   1.00 16.37 ? 305 PHE A C   1 
ATOM   2430  O  O   . PHE A  1 305 ? 72.382 -42.129 28.516   1.00 17.90 ? 305 PHE A O   1 
ATOM   2431  C  CB  . PHE A  1 305 ? 69.966 -40.902 29.866   1.00 13.75 ? 305 PHE A CB  1 
ATOM   2432  C  CG  . PHE A  1 305 ? 68.602 -40.337 29.606   1.00 15.66 ? 305 PHE A CG  1 
ATOM   2433  C  CD1 . PHE A  1 305 ? 67.640 -40.315 30.611   1.00 15.55 ? 305 PHE A CD1 1 
ATOM   2434  C  CD2 . PHE A  1 305 ? 68.273 -39.846 28.351   1.00 15.28 ? 305 PHE A CD2 1 
ATOM   2435  C  CE1 . PHE A  1 305 ? 66.381 -39.802 30.369   1.00 14.80 ? 305 PHE A CE1 1 
ATOM   2436  C  CE2 . PHE A  1 305 ? 67.012 -39.333 28.102   1.00 14.77 ? 305 PHE A CE2 1 
ATOM   2437  C  CZ  . PHE A  1 305 ? 66.069 -39.312 29.114   1.00 15.63 ? 305 PHE A CZ  1 
ATOM   2438  N  N   . LYS A  1 306 ? 72.029 -43.624 30.162   1.00 16.04 ? 306 LYS A N   1 
ATOM   2439  C  CA  . LYS A  1 306 ? 73.438 -44.041 30.219   1.00 15.86 ? 306 LYS A CA  1 
ATOM   2440  C  C   . LYS A  1 306 ? 73.596 -45.532 29.933   1.00 17.74 ? 306 LYS A C   1 
ATOM   2441  O  O   . LYS A  1 306 ? 74.316 -45.929 29.009   1.00 16.79 ? 306 LYS A O   1 
ATOM   2442  C  CB  . LYS A  1 306 ? 74.050 -43.731 31.589   1.00 15.50 ? 306 LYS A CB  1 
ATOM   2443  C  CG  . LYS A  1 306 ? 74.168 -42.250 31.904   1.00 19.06 ? 306 LYS A CG  1 
ATOM   2444  C  CD  . LYS A  1 306 ? 74.737 -42.022 33.299   1.00 24.97 ? 306 LYS A CD  1 
ATOM   2445  C  CE  . LYS A  1 306 ? 74.744 -40.541 33.650   1.00 30.49 ? 306 LYS A CE  1 
ATOM   2446  N  NZ  . LYS A  1 306 ? 75.189 -40.292 35.054   1.00 37.11 ? 306 LYS A NZ  1 
ATOM   2447  N  N   . GLU A  1 307 ? 72.920 -46.356 30.728   1.00 17.36 ? 307 GLU A N   1 
ATOM   2448  C  CA  . GLU A  1 307 ? 73.072 -47.805 30.612   1.00 20.54 ? 307 GLU A CA  1 
ATOM   2449  C  C   . GLU A  1 307 ? 72.540 -48.370 29.290   1.00 18.05 ? 307 GLU A C   1 
ATOM   2450  O  O   . GLU A  1 307 ? 73.172 -49.238 28.679   1.00 17.55 ? 307 GLU A O   1 
ATOM   2451  C  CB  . GLU A  1 307 ? 72.417 -48.512 31.804   1.00 23.37 ? 307 GLU A CB  1 
ATOM   2452  C  CG  . GLU A  1 307 ? 73.100 -48.208 33.127   1.00 28.80 ? 307 GLU A CG  1 
ATOM   2453  C  CD  . GLU A  1 307 ? 74.572 -48.576 33.104   1.00 38.79 ? 307 GLU A CD  1 
ATOM   2454  O  OE1 . GLU A  1 307 ? 75.407 -47.724 33.479   1.00 48.80 ? 307 GLU A OE1 1 
ATOM   2455  O  OE2 . GLU A  1 307 ? 74.895 -49.710 32.686   1.00 31.98 ? 307 GLU A OE2 1 
ATOM   2456  N  N   . ASN A  1 308 ? 71.385 -47.890 28.842   1.00 14.95 ? 308 ASN A N   1 
ATOM   2457  C  CA  . ASN A  1 308 ? 70.801 -48.453 27.626   1.00 15.67 ? 308 ASN A CA  1 
ATOM   2458  C  C   . ASN A  1 308 ? 71.633 -48.144 26.376   1.00 15.94 ? 308 ASN A C   1 
ATOM   2459  O  O   . ASN A  1 308 ? 71.935 -49.045 25.594   1.00 16.70 ? 308 ASN A O   1 
ATOM   2460  C  CB  . ASN A  1 308 ? 69.322 -48.076 27.474   1.00 14.25 ? 308 ASN A CB  1 
ATOM   2461  C  CG  . ASN A  1 308 ? 68.436 -48.810 28.465   1.00 17.54 ? 308 ASN A CG  1 
ATOM   2462  O  OD1 . ASN A  1 308 ? 68.874 -49.763 29.105   1.00 16.63 ? 308 ASN A OD1 1 
ATOM   2463  N  ND2 . ASN A  1 308 ? 67.186 -48.383 28.589   1.00 14.74 ? 308 ASN A ND2 1 
ATOM   2464  N  N   . PRO A  1 309 ? 72.035 -46.876 26.201   1.00 15.43 ? 309 PRO A N   1 
ATOM   2465  C  CA  . PRO A  1 309 ? 72.943 -46.547 25.098   1.00 16.83 ? 309 PRO A CA  1 
ATOM   2466  C  C   . PRO A  1 309 ? 74.261 -47.318 25.191   1.00 17.44 ? 309 PRO A C   1 
ATOM   2467  O  O   . PRO A  1 309 ? 74.777 -47.775 24.173   1.00 17.44 ? 309 PRO A O   1 
ATOM   2468  C  CB  . PRO A  1 309 ? 73.172 -45.046 25.276   1.00 17.18 ? 309 PRO A CB  1 
ATOM   2469  C  CG  . PRO A  1 309 ? 71.914 -44.571 25.937   1.00 15.26 ? 309 PRO A CG  1 
ATOM   2470  C  CD  . PRO A  1 309 ? 71.588 -45.668 26.916   1.00 14.69 ? 309 PRO A CD  1 
ATOM   2471  N  N   . LYS A  1 310 ? 74.792 -47.477 26.401   1.00 16.72 ? 310 LYS A N   1 
ATOM   2472  C  CA  . LYS A  1 310 ? 75.967 -48.323 26.599   1.00 17.78 ? 310 LYS A CA  1 
ATOM   2473  C  C   . LYS A  1 310 ? 75.748 -49.737 26.045   1.00 18.93 ? 310 LYS A C   1 
ATOM   2474  O  O   . LYS A  1 310 ? 76.541 -50.242 25.233   1.00 20.31 ? 310 LYS A O   1 
ATOM   2475  C  CB  . LYS A  1 310 ? 76.335 -48.388 28.084   1.00 22.49 ? 310 LYS A CB  1 
ATOM   2476  C  CG  . LYS A  1 310 ? 77.505 -49.316 28.383   1.00 25.26 ? 310 LYS A CG  1 
ATOM   2477  C  CD  . LYS A  1 310 ? 77.824 -49.314 29.871   1.00 29.81 ? 310 LYS A CD  1 
ATOM   2478  C  CE  . LYS A  1 310 ? 78.865 -50.363 30.237   1.00 34.66 ? 310 LYS A CE  1 
ATOM   2479  N  NZ  . LYS A  1 310 ? 79.293 -50.176 31.653   1.00 37.39 ? 310 LYS A NZ  1 
ATOM   2480  N  N   . LYS A  1 311 ? 74.666 -50.378 26.473   1.00 18.34 ? 311 LYS A N   1 
ATOM   2481  C  CA  . LYS A  1 311 ? 74.361 -51.731 26.012   1.00 17.67 ? 311 LYS A CA  1 
ATOM   2482  C  C   . LYS A  1 311 ? 74.217 -51.756 24.493   1.00 19.61 ? 311 LYS A C   1 
ATOM   2483  O  O   . LYS A  1 311 ? 74.767 -52.624 23.817   1.00 18.45 ? 311 LYS A O   1 
ATOM   2484  C  CB  . LYS A  1 311 ? 73.071 -52.237 26.666   1.00 22.81 ? 311 LYS A CB  1 
ATOM   2485  C  CG  . LYS A  1 311 ? 73.202 -52.555 28.149   1.00 26.66 ? 311 LYS A CG  1 
ATOM   2486  C  CD  . LYS A  1 311 ? 71.893 -53.081 28.722   1.00 31.58 ? 311 LYS A CD  1 
ATOM   2487  C  CE  . LYS A  1 311 ? 70.836 -51.986 28.790   1.00 44.39 ? 311 LYS A CE  1 
ATOM   2488  N  NZ  . LYS A  1 311 ? 69.599 -52.388 29.526   1.00 45.65 ? 311 LYS A NZ  1 
ATOM   2489  N  N   . PHE A  1 312 ? 73.469 -50.788 23.969   1.00 16.18 ? 312 PHE A N   1 
ATOM   2490  C  CA  . PHE A  1 312 ? 73.183 -50.690 22.544   1.00 15.49 ? 312 PHE A CA  1 
ATOM   2491  C  C   . PHE A  1 312 ? 74.458 -50.700 21.709   1.00 15.54 ? 312 PHE A C   1 
ATOM   2492  O  O   . PHE A  1 312 ? 74.496 -51.298 20.631   1.00 15.44 ? 312 PHE A O   1 
ATOM   2493  C  CB  . PHE A  1 312 ? 72.380 -49.408 22.297   1.00 14.01 ? 312 PHE A CB  1 
ATOM   2494  C  CG  . PHE A  1 312 ? 71.873 -49.239 20.887   1.00 16.07 ? 312 PHE A CG  1 
ATOM   2495  C  CD1 . PHE A  1 312 ? 72.240 -48.126 20.139   1.00 15.46 ? 312 PHE A CD1 1 
ATOM   2496  C  CD2 . PHE A  1 312 ? 71.003 -50.163 20.321   1.00 14.56 ? 312 PHE A CD2 1 
ATOM   2497  C  CE1 . PHE A  1 312 ? 71.765 -47.945 18.850   1.00 14.11 ? 312 PHE A CE1 1 
ATOM   2498  C  CE2 . PHE A  1 312 ? 70.520 -49.981 19.038   1.00 15.70 ? 312 PHE A CE2 1 
ATOM   2499  C  CZ  . PHE A  1 312 ? 70.902 -48.873 18.299   1.00 15.81 ? 312 PHE A CZ  1 
ATOM   2500  N  N   . PHE A  1 313 ? 75.497 -50.036 22.213   1.00 15.36 ? 313 PHE A N   1 
ATOM   2501  C  CA  . PHE A  1 313 ? 76.763 -49.906 21.496   1.00 16.32 ? 313 PHE A CA  1 
ATOM   2502  C  C   . PHE A  1 313 ? 77.833 -50.886 21.958   1.00 19.09 ? 313 PHE A C   1 
ATOM   2503  O  O   . PHE A  1 313 ? 78.997 -50.761 21.573   1.00 20.81 ? 313 PHE A O   1 
ATOM   2504  C  CB  . PHE A  1 313 ? 77.312 -48.485 21.624   1.00 15.49 ? 313 PHE A CB  1 
ATOM   2505  C  CG  . PHE A  1 313 ? 76.611 -47.486 20.751   1.00 15.27 ? 313 PHE A CG  1 
ATOM   2506  C  CD1 . PHE A  1 313 ? 75.737 -46.565 21.297   1.00 16.98 ? 313 PHE A CD1 1 
ATOM   2507  C  CD2 . PHE A  1 313 ? 76.835 -47.469 19.381   1.00 16.47 ? 313 PHE A CD2 1 
ATOM   2508  C  CE1 . PHE A  1 313 ? 75.091 -45.644 20.492   1.00 17.02 ? 313 PHE A CE1 1 
ATOM   2509  C  CE2 . PHE A  1 313 ? 76.189 -46.556 18.564   1.00 15.70 ? 313 PHE A CE2 1 
ATOM   2510  C  CZ  . PHE A  1 313 ? 75.316 -45.640 19.124   1.00 17.74 ? 313 PHE A CZ  1 
ATOM   2511  N  N   . SER A  1 314 ? 77.451 -51.861 22.772   1.00 20.67 ? 314 SER A N   1 
ATOM   2512  C  CA  . SER A  1 314 ? 78.431 -52.827 23.259   1.00 27.23 ? 314 SER A CA  1 
ATOM   2513  C  C   . SER A  1 314 ? 78.470 -54.095 22.412   1.00 40.29 ? 314 SER A C   1 
ATOM   2514  O  O   . SER A  1 314 ? 77.585 -54.362 21.591   1.00 38.81 ? 314 SER A O   1 
ATOM   2515  C  CB  . SER A  1 314 ? 78.174 -53.164 24.726   1.00 27.51 ? 314 SER A CB  1 
ATOM   2516  O  OG  . SER A  1 314 ? 78.419 -52.032 25.540   1.00 33.99 ? 314 SER A OG  1 
ATOM   2517  O  OXT . SER A  1 314 ? 79.406 -54.886 22.531   1.00 49.03 ? 314 SER A OXT 1 
ATOM   2518  N  N   . MET B  1 1   ? 45.587 -37.874 -45.758  1.00 64.39 ? 1   MET B N   1 
ATOM   2519  C  CA  . MET B  1 1   ? 46.373 -39.141 -45.765  1.00 43.66 ? 1   MET B CA  1 
ATOM   2520  C  C   . MET B  1 1   ? 45.539 -40.346 -46.185  1.00 47.54 ? 1   MET B C   1 
ATOM   2521  O  O   . MET B  1 1   ? 46.095 -41.396 -46.496  1.00 59.44 ? 1   MET B O   1 
ATOM   2522  C  CB  . MET B  1 1   ? 47.001 -39.392 -44.392  1.00 55.39 ? 1   MET B CB  1 
ATOM   2523  C  CG  . MET B  1 1   ? 48.165 -38.473 -44.091  1.00 46.20 ? 1   MET B CG  1 
ATOM   2524  S  SD  . MET B  1 1   ? 47.785 -36.807 -44.658  1.00 65.96 ? 1   MET B SD  1 
ATOM   2525  C  CE  . MET B  1 1   ? 49.440 -36.152 -44.907  1.00 47.60 ? 1   MET B CE  1 
ATOM   2526  N  N   . ARG B  1 2   ? 44.213 -40.212 -46.197  1.00 39.79 ? 2   ARG B N   1 
ATOM   2527  C  CA  A ARG B  1 2   ? 43.337 -41.334 -46.550  0.50 35.03 ? 2   ARG B CA  1 
ATOM   2528  C  CA  B ARG B  1 2   ? 43.384 -41.311 -46.662  0.50 34.45 ? 2   ARG B CA  1 
ATOM   2529  C  C   . ARG B  1 2   ? 42.010 -40.886 -47.186  1.00 29.31 ? 2   ARG B C   1 
ATOM   2530  O  O   . ARG B  1 2   ? 41.581 -41.420 -48.202  1.00 28.33 ? 2   ARG B O   1 
ATOM   2531  C  CB  A ARG B  1 2   ? 43.068 -42.194 -45.312  0.50 38.22 ? 2   ARG B CB  1 
ATOM   2532  C  CB  B ARG B  1 2   ? 43.306 -42.454 -45.640  0.50 33.34 ? 2   ARG B CB  1 
ATOM   2533  C  CG  A ARG B  1 2   ? 43.000 -43.691 -45.570  0.50 41.53 ? 2   ARG B CG  1 
ATOM   2534  C  CG  B ARG B  1 2   ? 43.346 -43.827 -46.300  0.50 38.86 ? 2   ARG B CG  1 
ATOM   2535  C  CD  A ARG B  1 2   ? 41.886 -44.073 -46.535  0.50 43.55 ? 2   ARG B CD  1 
ATOM   2536  C  CD  B ARG B  1 2   ? 43.700 -44.949 -45.332  0.50 38.61 ? 2   ARG B CD  1 
ATOM   2537  N  NE  A ARG B  1 2   ? 41.391 -45.418 -46.258  0.50 41.07 ? 2   ARG B NE  1 
ATOM   2538  N  NE  B ARG B  1 2   ? 42.610 -45.242 -44.407  0.50 42.99 ? 2   ARG B NE  1 
ATOM   2539  C  CZ  A ARG B  1 2   ? 40.674 -46.152 -47.102  0.50 35.36 ? 2   ARG B CZ  1 
ATOM   2540  C  CZ  B ARG B  1 2   ? 41.673 -44.365 -44.061  0.50 42.71 ? 2   ARG B CZ  1 
ATOM   2541  N  NH1 A ARG B  1 2   ? 40.276 -47.361 -46.740  0.50 34.70 ? 2   ARG B NH1 1 
ATOM   2542  N  NH1 B ARG B  1 2   ? 41.703 -43.131 -44.549  0.50 43.67 ? 2   ARG B NH1 1 
ATOM   2543  N  NH2 A ARG B  1 2   ? 40.359 -45.687 -48.306  0.50 35.09 ? 2   ARG B NH2 1 
ATOM   2544  N  NH2 B ARG B  1 2   ? 40.714 -44.716 -43.215  0.50 44.90 ? 2   ARG B NH2 1 
ATOM   2545  N  N   . ILE B  1 3   ? 41.345 -39.916 -46.552  1.00 21.21 ? 3   ILE B N   1 
ATOM   2546  C  CA  . ILE B  1 3   ? 40.099 -39.360 -47.116  1.00 20.40 ? 3   ILE B CA  1 
ATOM   2547  C  C   . ILE B  1 3   ? 40.375 -38.107 -47.961  1.00 21.69 ? 3   ILE B C   1 
ATOM   2548  O  O   . ILE B  1 3   ? 40.823 -37.085 -47.434  1.00 20.19 ? 3   ILE B O   1 
ATOM   2549  C  CB  . ILE B  1 3   ? 39.078 -38.940 -46.037  1.00 21.70 ? 3   ILE B CB  1 
ATOM   2550  C  CG1 . ILE B  1 3   ? 38.784 -40.080 -45.061  1.00 24.18 ? 3   ILE B CG1 1 
ATOM   2551  C  CG2 . ILE B  1 3   ? 37.791 -38.446 -46.685  1.00 18.94 ? 3   ILE B CG2 1 
ATOM   2552  C  CD1 . ILE B  1 3   ? 37.873 -39.651 -43.931  1.00 25.99 ? 3   ILE B CD1 1 
ATOM   2553  N  N   . PRO B  1 4   ? 40.089 -38.171 -49.271  1.00 18.13 ? 4   PRO B N   1 
ATOM   2554  C  CA  . PRO B  1 4   ? 40.332 -37.010 -50.123  1.00 18.04 ? 4   PRO B CA  1 
ATOM   2555  C  C   . PRO B  1 4   ? 39.326 -35.893 -49.860  1.00 18.07 ? 4   PRO B C   1 
ATOM   2556  O  O   . PRO B  1 4   ? 38.149 -36.158 -49.582  1.00 16.66 ? 4   PRO B O   1 
ATOM   2557  C  CB  . PRO B  1 4   ? 40.151 -37.569 -51.538  1.00 19.11 ? 4   PRO B CB  1 
ATOM   2558  C  CG  . PRO B  1 4   ? 39.191 -38.706 -51.361  1.00 17.51 ? 4   PRO B CG  1 
ATOM   2559  C  CD  . PRO B  1 4   ? 39.473 -39.292 -50.007  1.00 19.25 ? 4   PRO B CD  1 
ATOM   2560  N  N   . LEU B  1 5   ? 39.801 -34.655 -49.937  1.00 17.48 ? 5   LEU B N   1 
ATOM   2561  C  CA  . LEU B  1 5   ? 38.954 -33.484 -49.736  1.00 17.86 ? 5   LEU B CA  1 
ATOM   2562  C  C   . LEU B  1 5   ? 39.003 -32.607 -50.971  1.00 17.43 ? 5   LEU B C   1 
ATOM   2563  O  O   . LEU B  1 5   ? 40.020 -32.552 -51.659  1.00 22.49 ? 5   LEU B O   1 
ATOM   2564  C  CB  . LEU B  1 5   ? 39.427 -32.678 -48.529  1.00 17.39 ? 5   LEU B CB  1 
ATOM   2565  C  CG  . LEU B  1 5   ? 39.348 -33.380 -47.171  1.00 17.43 ? 5   LEU B CG  1 
ATOM   2566  C  CD1 . LEU B  1 5   ? 39.858 -32.460 -46.073  1.00 16.80 ? 5   LEU B CD1 1 
ATOM   2567  C  CD2 . LEU B  1 5   ? 37.917 -33.826 -46.882  1.00 14.97 ? 5   LEU B CD2 1 
ATOM   2568  N  N   . VAL B  1 6   ? 37.907 -31.917 -51.254  1.00 15.46 ? 6   VAL B N   1 
ATOM   2569  C  CA  . VAL B  1 6   ? 37.883 -30.986 -52.374  1.00 14.70 ? 6   VAL B CA  1 
ATOM   2570  C  C   . VAL B  1 6   ? 38.740 -29.768 -52.053  1.00 15.93 ? 6   VAL B C   1 
ATOM   2571  O  O   . VAL B  1 6   ? 38.526 -29.114 -51.035  1.00 15.27 ? 6   VAL B O   1 
ATOM   2572  C  CB  . VAL B  1 6   ? 36.450 -30.538 -52.692  1.00 12.86 ? 6   VAL B CB  1 
ATOM   2573  C  CG1 . VAL B  1 6   ? 36.443 -29.550 -53.858  1.00 13.03 ? 6   VAL B CG1 1 
ATOM   2574  C  CG2 . VAL B  1 6   ? 35.594 -31.756 -53.011  1.00 11.99 ? 6   VAL B CG2 1 
ATOM   2575  N  N   . GLY B  1 7   ? 39.722 -29.488 -52.909  1.00 15.99 ? 7   GLY B N   1 
ATOM   2576  C  CA  . GLY B  1 7   ? 40.572 -28.302 -52.759  1.00 16.51 ? 7   GLY B CA  1 
ATOM   2577  C  C   . GLY B  1 7   ? 41.502 -28.285 -51.557  1.00 20.11 ? 7   GLY B C   1 
ATOM   2578  O  O   . GLY B  1 7   ? 42.029 -27.234 -51.191  1.00 18.67 ? 7   GLY B O   1 
ATOM   2579  N  N   . LYS B  1 8   ? 41.720 -29.448 -50.951  1.00 18.80 ? 8   LYS B N   1 
ATOM   2580  C  CA  . LYS B  1 8   ? 42.621 -29.572 -49.806  1.00 21.39 ? 8   LYS B CA  1 
ATOM   2581  C  C   . LYS B  1 8   ? 43.410 -30.881 -49.875  1.00 21.56 ? 8   LYS B C   1 
ATOM   2582  O  O   . LYS B  1 8   ? 43.060 -31.787 -50.621  1.00 19.95 ? 8   LYS B O   1 
ATOM   2583  C  CB  . LYS B  1 8   ? 41.837 -29.567 -48.487  1.00 21.41 ? 8   LYS B CB  1 
ATOM   2584  C  CG  . LYS B  1 8   ? 41.144 -28.269 -48.115  1.00 21.20 ? 8   LYS B CG  1 
ATOM   2585  C  CD  . LYS B  1 8   ? 40.659 -28.355 -46.675  1.00 23.06 ? 8   LYS B CD  1 
ATOM   2586  C  CE  . LYS B  1 8   ? 39.729 -27.217 -46.286  1.00 20.48 ? 8   LYS B CE  1 
ATOM   2587  N  NZ  . LYS B  1 8   ? 39.457 -27.263 -44.818  1.00 18.40 ? 8   LYS B NZ  1 
ATOM   2588  N  N   . ASP B  1 9   ? 44.462 -30.982 -49.069  1.00 24.86 ? 9   ASP B N   1 
ATOM   2589  C  CA  . ASP B  1 9   ? 45.169 -32.249 -48.891  1.00 24.87 ? 9   ASP B CA  1 
ATOM   2590  C  C   . ASP B  1 9   ? 44.263 -33.260 -48.212  1.00 22.23 ? 9   ASP B C   1 
ATOM   2591  O  O   . ASP B  1 9   ? 43.451 -32.897 -47.360  1.00 19.81 ? 9   ASP B O   1 
ATOM   2592  C  CB  . ASP B  1 9   ? 46.404 -32.050 -48.022  1.00 26.18 ? 9   ASP B CB  1 
ATOM   2593  C  CG  . ASP B  1 9   ? 47.481 -31.269 -48.725  1.00 33.23 ? 9   ASP B CG  1 
ATOM   2594  O  OD1 . ASP B  1 9   ? 48.392 -30.765 -48.036  1.00 39.61 ? 9   ASP B OD1 1 
ATOM   2595  O  OD2 . ASP B  1 9   ? 47.408 -31.159 -49.966  1.00 33.05 ? 9   ASP B OD2 1 
ATOM   2596  N  N   . SER B  1 10  ? 44.415 -34.531 -48.571  1.00 21.55 ? 10  SER B N   1 
ATOM   2597  C  CA  . SER B  1 10  ? 43.624 -35.584 -47.945  1.00 21.36 ? 10  SER B CA  1 
ATOM   2598  C  C   . SER B  1 10  ? 43.903 -35.621 -46.446  1.00 25.34 ? 10  SER B C   1 
ATOM   2599  O  O   . SER B  1 10  ? 44.957 -35.169 -45.992  1.00 24.67 ? 10  SER B O   1 
ATOM   2600  C  CB  . SER B  1 10  ? 43.947 -36.940 -48.571  1.00 23.63 ? 10  SER B CB  1 
ATOM   2601  O  OG  . SER B  1 10  ? 45.300 -37.290 -48.338  1.00 22.94 ? 10  SER B OG  1 
ATOM   2602  N  N   . ILE B  1 11  ? 42.964 -36.165 -45.677  1.00 21.59 ? 11  ILE B N   1 
ATOM   2603  C  CA  . ILE B  1 11  ? 43.120 -36.222 -44.228  1.00 22.43 ? 11  ILE B CA  1 
ATOM   2604  C  C   . ILE B  1 11  ? 42.937 -37.635 -43.696  1.00 23.32 ? 11  ILE B C   1 
ATOM   2605  O  O   . ILE B  1 11  ? 42.284 -38.474 -44.325  1.00 19.33 ? 11  ILE B O   1 
ATOM   2606  C  CB  . ILE B  1 11  ? 42.114 -35.295 -43.510  1.00 21.90 ? 11  ILE B CB  1 
ATOM   2607  C  CG1 . ILE B  1 11  ? 40.679 -35.652 -43.900  1.00 18.56 ? 11  ILE B CG1 1 
ATOM   2608  C  CG2 . ILE B  1 11  ? 42.395 -33.839 -43.841  1.00 22.43 ? 11  ILE B CG2 1 
ATOM   2609  C  CD1 . ILE B  1 11  ? 39.635 -35.044 -42.981  1.00 20.27 ? 11  ILE B CD1 1 
ATOM   2610  N  N   . GLU B  1 12  ? 43.524 -37.899 -42.534  1.00 20.17 ? 12  GLU B N   1 
ATOM   2611  C  CA  . GLU B  1 12  ? 43.269 -39.145 -41.839  1.00 20.37 ? 12  GLU B CA  1 
ATOM   2612  C  C   . GLU B  1 12  ? 41.863 -39.097 -41.246  1.00 19.48 ? 12  GLU B C   1 
ATOM   2613  O  O   . GLU B  1 12  ? 41.366 -38.029 -40.901  1.00 17.23 ? 12  GLU B O   1 
ATOM   2614  C  CB  . GLU B  1 12  ? 44.331 -39.384 -40.758  1.00 22.63 ? 12  GLU B CB  1 
ATOM   2615  C  CG  . GLU B  1 12  ? 45.755 -39.332 -41.305  1.00 24.29 ? 12  GLU B CG  1 
ATOM   2616  C  CD  . GLU B  1 12  ? 46.798 -39.767 -40.290  1.00 32.25 ? 12  GLU B CD  1 
ATOM   2617  O  OE1 . GLU B  1 12  ? 47.838 -39.086 -40.177  1.00 31.67 ? 12  GLU B OE1 1 
ATOM   2618  O  OE2 . GLU B  1 12  ? 46.575 -40.784 -39.601  1.00 32.13 ? 12  GLU B OE2 1 
ATOM   2619  N  N   . SER B  1 13  ? 41.223 -40.254 -41.133  1.00 19.05 ? 13  SER B N   1 
ATOM   2620  C  CA  . SER B  1 13  ? 39.840 -40.307 -40.676  1.00 19.99 ? 13  SER B CA  1 
ATOM   2621  C  C   . SER B  1 13  ? 39.669 -39.677 -39.298  1.00 20.83 ? 13  SER B C   1 
ATOM   2622  O  O   . SER B  1 13  ? 38.602 -39.162 -38.975  1.00 18.10 ? 13  SER B O   1 
ATOM   2623  C  CB  . SER B  1 13  ? 39.339 -41.751 -40.661  1.00 22.76 ? 13  SER B CB  1 
ATOM   2624  O  OG  . SER B  1 13  ? 40.087 -42.532 -39.748  1.00 22.09 ? 13  SER B OG  1 
ATOM   2625  N  N   . LYS B  1 14  ? 40.723 -39.708 -38.489  1.00 21.05 ? 14  LYS B N   1 
ATOM   2626  C  CA  . LYS B  1 14  ? 40.660 -39.148 -37.143  1.00 22.03 ? 14  LYS B CA  1 
ATOM   2627  C  C   . LYS B  1 14  ? 40.432 -37.641 -37.174  1.00 21.29 ? 14  LYS B C   1 
ATOM   2628  O  O   . LYS B  1 14  ? 40.041 -37.050 -36.176  1.00 24.15 ? 14  LYS B O   1 
ATOM   2629  C  CB  . LYS B  1 14  ? 41.950 -39.447 -36.376  1.00 21.13 ? 14  LYS B CB  1 
ATOM   2630  C  CG  . LYS B  1 14  ? 43.183 -38.782 -36.977  1.00 21.72 ? 14  LYS B CG  1 
ATOM   2631  C  CD  . LYS B  1 14  ? 44.416 -38.989 -36.109  1.00 23.75 ? 14  LYS B CD  1 
ATOM   2632  C  CE  . LYS B  1 14  ? 45.692 -38.577 -36.831  1.00 22.90 ? 14  LYS B CE  1 
ATOM   2633  N  NZ  . LYS B  1 14  ? 45.777 -37.126 -37.161  1.00 21.95 ? 14  LYS B NZ  1 
ATOM   2634  N  N   . ASP B  1 15  ? 40.692 -37.021 -38.317  1.00 20.82 ? 15  ASP B N   1 
ATOM   2635  C  CA  . ASP B  1 15  ? 40.615 -35.567 -38.422  1.00 22.31 ? 15  ASP B CA  1 
ATOM   2636  C  C   . ASP B  1 15  ? 39.314 -35.065 -39.053  1.00 21.74 ? 15  ASP B C   1 
ATOM   2637  O  O   . ASP B  1 15  ? 39.150 -33.871 -39.273  1.00 20.04 ? 15  ASP B O   1 
ATOM   2638  C  CB  . ASP B  1 15  ? 41.828 -35.030 -39.185  1.00 27.68 ? 15  ASP B CB  1 
ATOM   2639  C  CG  . ASP B  1 15  ? 43.132 -35.213 -38.409  1.00 29.74 ? 15  ASP B CG  1 
ATOM   2640  O  OD1 . ASP B  1 15  ? 43.172 -34.863 -37.213  1.00 33.13 ? 15  ASP B OD1 1 
ATOM   2641  O  OD2 . ASP B  1 15  ? 44.111 -35.714 -38.993  1.00 32.94 ? 15  ASP B OD2 1 
ATOM   2642  N  N   . ILE B  1 16  ? 38.389 -35.977 -39.334  1.00 19.07 ? 16  ILE B N   1 
ATOM   2643  C  CA  A ILE B  1 16  ? 37.121 -35.601 -39.954  0.50 19.63 ? 16  ILE B CA  1 
ATOM   2644  C  CA  C ILE B  1 16  ? 37.110 -35.607 -39.948  0.50 20.97 ? 16  ILE B CA  1 
ATOM   2645  C  C   . ILE B  1 16  ? 36.294 -34.691 -39.035  1.00 19.16 ? 16  ILE B C   1 
ATOM   2646  O  O   . ILE B  1 16  ? 35.636 -33.767 -39.498  1.00 18.58 ? 16  ILE B O   1 
ATOM   2647  C  CB  A ILE B  1 16  ? 36.308 -36.849 -40.357  0.50 17.83 ? 16  ILE B CB  1 
ATOM   2648  C  CB  C ILE B  1 16  ? 36.273 -36.851 -40.309  0.50 20.52 ? 16  ILE B CB  1 
ATOM   2649  C  CG1 A ILE B  1 16  ? 35.140 -36.469 -41.267  0.50 16.99 ? 16  ILE B CG1 1 
ATOM   2650  C  CG1 C ILE B  1 16  ? 36.973 -37.668 -41.394  0.50 22.23 ? 16  ILE B CG1 1 
ATOM   2651  C  CG2 A ILE B  1 16  ? 35.830 -37.598 -39.126  0.50 18.28 ? 16  ILE B CG2 1 
ATOM   2652  C  CG2 C ILE B  1 16  ? 34.886 -36.450 -40.786  0.50 20.66 ? 16  ILE B CG2 1 
ATOM   2653  C  CD1 A ILE B  1 16  ? 34.381 -37.661 -41.800  0.50 15.27 ? 16  ILE B CD1 1 
ATOM   2654  C  CD1 C ILE B  1 16  ? 36.217 -38.918 -41.783  0.50 26.02 ? 16  ILE B CD1 1 
ATOM   2655  N  N   . GLY B  1 17  ? 36.350 -34.948 -37.734  1.00 17.62 ? 17  GLY B N   1 
ATOM   2656  C  CA  . GLY B  1 17  ? 35.626 -34.135 -36.756  1.00 17.37 ? 17  GLY B CA  1 
ATOM   2657  C  C   . GLY B  1 17  ? 34.121 -34.195 -36.954  1.00 17.45 ? 17  GLY B C   1 
ATOM   2658  O  O   . GLY B  1 17  ? 33.594 -35.151 -37.535  1.00 16.72 ? 17  GLY B O   1 
ATOM   2659  N  N   . PHE B  1 18  ? 33.422 -33.171 -36.473  1.00 16.55 ? 18  PHE B N   1 
ATOM   2660  C  CA  . PHE B  1 18  ? 31.961 -33.156 -36.551  1.00 17.95 ? 18  PHE B CA  1 
ATOM   2661  C  C   . PHE B  1 18  ? 31.523 -33.085 -38.015  1.00 15.15 ? 18  PHE B C   1 
ATOM   2662  O  O   . PHE B  1 18  ? 31.862 -32.141 -38.734  1.00 15.61 ? 18  PHE B O   1 
ATOM   2663  C  CB  . PHE B  1 18  ? 31.387 -31.987 -35.747  1.00 15.76 ? 18  PHE B CB  1 
ATOM   2664  C  CG  . PHE B  1 18  ? 29.904 -32.086 -35.506  1.00 17.73 ? 18  PHE B CG  1 
ATOM   2665  C  CD1 . PHE B  1 18  ? 29.409 -32.275 -34.222  1.00 19.98 ? 18  PHE B CD1 1 
ATOM   2666  C  CD2 . PHE B  1 18  ? 29.002 -31.982 -36.560  1.00 16.97 ? 18  PHE B CD2 1 
ATOM   2667  C  CE1 . PHE B  1 18  ? 28.045 -32.369 -33.996  1.00 21.21 ? 18  PHE B CE1 1 
ATOM   2668  C  CE2 . PHE B  1 18  ? 27.636 -32.069 -36.339  1.00 18.85 ? 18  PHE B CE2 1 
ATOM   2669  C  CZ  . PHE B  1 18  ? 27.156 -32.260 -35.052  1.00 19.48 ? 18  PHE B CZ  1 
ATOM   2670  N  N   . THR B  1 19  ? 30.772 -34.092 -38.444  1.00 15.29 ? 19  THR B N   1 
ATOM   2671  C  CA  . THR B  1 19  ? 30.428 -34.262 -39.853  1.00 15.67 ? 19  THR B CA  1 
ATOM   2672  C  C   . THR B  1 19  ? 28.924 -34.259 -40.119  1.00 16.22 ? 19  THR B C   1 
ATOM   2673  O  O   . THR B  1 19  ? 28.137 -34.816 -39.346  1.00 15.27 ? 19  THR B O   1 
ATOM   2674  C  CB  . THR B  1 19  ? 31.001 -35.593 -40.385  1.00 16.35 ? 19  THR B CB  1 
ATOM   2675  O  OG1 . THR B  1 19  ? 32.422 -35.601 -40.207  1.00 18.96 ? 19  THR B OG1 1 
ATOM   2676  C  CG2 . THR B  1 19  ? 30.680 -35.776 -41.869  1.00 14.68 ? 19  THR B CG2 1 
ATOM   2677  N  N   . LEU B  1 20  ? 28.537 -33.616 -41.217  1.00 13.77 ? 20  LEU B N   1 
ATOM   2678  C  CA  . LEU B  1 20  ? 27.222 -33.803 -41.795  1.00 12.68 ? 20  LEU B CA  1 
ATOM   2679  C  C   . LEU B  1 20  ? 27.418 -34.741 -42.979  1.00 15.38 ? 20  LEU B C   1 
ATOM   2680  O  O   . LEU B  1 20  ? 28.042 -34.372 -43.977  1.00 15.04 ? 20  LEU B O   1 
ATOM   2681  C  CB  . LEU B  1 20  ? 26.622 -32.467 -42.232  1.00 13.69 ? 20  LEU B CB  1 
ATOM   2682  C  CG  . LEU B  1 20  ? 26.292 -31.474 -41.106  1.00 15.86 ? 20  LEU B CG  1 
ATOM   2683  C  CD1 . LEU B  1 20  ? 25.603 -30.231 -41.659  1.00 14.95 ? 20  LEU B CD1 1 
ATOM   2684  C  CD2 . LEU B  1 20  ? 25.413 -32.130 -40.044  1.00 15.29 ? 20  LEU B CD2 1 
ATOM   2685  N  N   . ILE B  1 21  ? 26.910 -35.964 -42.849  1.00 13.00 ? 21  ILE B N   1 
ATOM   2686  C  CA  . ILE B  1 21  ? 27.253 -37.046 -43.777  1.00 14.46 ? 21  ILE B CA  1 
ATOM   2687  C  C   . ILE B  1 21  ? 26.492 -36.991 -45.108  1.00 12.39 ? 21  ILE B C   1 
ATOM   2688  O  O   . ILE B  1 21  ? 26.871 -37.660 -46.060  1.00 12.46 ? 21  ILE B O   1 
ATOM   2689  C  CB  . ILE B  1 21  ? 27.028 -38.428 -43.115  1.00 14.94 ? 21  ILE B CB  1 
ATOM   2690  C  CG1 . ILE B  1 21  ? 27.732 -39.539 -43.902  1.00 16.01 ? 21  ILE B CG1 1 
ATOM   2691  C  CG2 . ILE B  1 21  ? 25.542 -38.712 -42.969  1.00 15.10 ? 21  ILE B CG2 1 
ATOM   2692  C  CD1 . ILE B  1 21  ? 29.192 -39.719 -43.529  1.00 16.87 ? 21  ILE B CD1 1 
ATOM   2693  N  N   . HIS B  1 22  ? 25.422 -36.200 -45.184  1.00 12.26 ? 22  HIS B N   1 
ATOM   2694  C  CA  . HIS B  1 22  ? 24.639 -36.141 -46.423  1.00 11.64 ? 22  HIS B CA  1 
ATOM   2695  C  C   . HIS B  1 22  ? 24.025 -34.785 -46.623  1.00 12.32 ? 22  HIS B C   1 
ATOM   2696  O  O   . HIS B  1 22  ? 22.941 -34.510 -46.120  1.00 14.05 ? 22  HIS B O   1 
ATOM   2697  C  CB  . HIS B  1 22  ? 23.568 -37.240 -46.424  1.00 12.43 ? 22  HIS B CB  1 
ATOM   2698  C  CG  . HIS B  1 22  ? 22.866 -37.429 -47.760  1.00 11.54 ? 22  HIS B CG  1 
ATOM   2699  N  ND1 . HIS B  1 22  ? 22.655 -38.649 -48.298  1.00 12.58 ? 22  HIS B ND1 1 
ATOM   2700  C  CD2 . HIS B  1 22  ? 22.317 -36.498 -48.659  1.00 13.49 ? 22  HIS B CD2 1 
ATOM   2701  C  CE1 . HIS B  1 22  ? 22.002 -38.519 -49.476  1.00 12.95 ? 22  HIS B CE1 1 
ATOM   2702  N  NE2 . HIS B  1 22  ? 21.785 -37.200 -49.695  1.00 16.56 ? 22  HIS B NE2 1 
ATOM   2703  N  N   . GLU B  1 23  ? 24.737 -33.908 -47.334  1.00 11.68 ? 23  GLU B N   1 
ATOM   2704  C  CA  . GLU B  1 23  ? 24.219 -32.583 -47.683  1.00 12.87 ? 23  GLU B CA  1 
ATOM   2705  C  C   . GLU B  1 23  ? 24.651 -32.261 -49.117  1.00 14.60 ? 23  GLU B C   1 
ATOM   2706  O  O   . GLU B  1 23  ? 25.679 -32.760 -49.577  1.00 14.83 ? 23  GLU B O   1 
ATOM   2707  C  CB  . GLU B  1 23  ? 24.757 -31.501 -46.727  1.00 12.10 ? 23  GLU B CB  1 
ATOM   2708  C  CG  . GLU B  1 23  ? 24.645 -31.811 -45.239  1.00 12.54 ? 23  GLU B CG  1 
ATOM   2709  C  CD  . GLU B  1 23  ? 23.216 -31.784 -44.708  1.00 15.79 ? 23  GLU B CD  1 
ATOM   2710  O  OE1 . GLU B  1 23  ? 22.984 -32.320 -43.595  1.00 16.67 ? 23  GLU B OE1 1 
ATOM   2711  O  OE2 . GLU B  1 23  ? 22.320 -31.242 -45.397  1.00 18.75 ? 23  GLU B OE2 1 
ATOM   2712  N  N   . HIS B  1 24  ? 23.879 -31.428 -49.814  1.00 12.94 ? 24  HIS B N   1 
ATOM   2713  C  CA  . HIS B  1 24  ? 24.184 -31.070 -51.198  1.00 13.38 ? 24  HIS B CA  1 
ATOM   2714  C  C   . HIS B  1 24  ? 24.406 -29.590 -51.328  1.00 14.42 ? 24  HIS B C   1 
ATOM   2715  O  O   . HIS B  1 24  ? 23.529 -28.795 -50.990  1.00 14.07 ? 24  HIS B O   1 
ATOM   2716  C  CB  . HIS B  1 24  ? 23.033 -31.461 -52.135  1.00 11.60 ? 24  HIS B CB  1 
ATOM   2717  C  CG  . HIS B  1 24  ? 22.701 -32.936 -52.137  1.00 11.55 ? 24  HIS B CG  1 
ATOM   2718  N  ND1 . HIS B  1 24  ? 23.335 -33.822 -52.932  1.00 11.07 ? 24  HIS B ND1 1 
ATOM   2719  C  CD2 . HIS B  1 24  ? 21.747 -33.663 -51.415  1.00 9.54  ? 24  HIS B CD2 1 
ATOM   2720  C  CE1 . HIS B  1 24  ? 22.821 -35.057 -52.728  1.00 10.80 ? 24  HIS B CE1 1 
ATOM   2721  N  NE2 . HIS B  1 24  ? 21.848 -34.958 -51.800  1.00 10.41 ? 24  HIS B NE2 1 
ATOM   2722  N  N   . LEU B  1 25  ? 25.562 -29.180 -51.843  1.00 13.47 ? 25  LEU B N   1 
ATOM   2723  C  CA  . LEU B  1 25  ? 25.760 -27.752 -52.075  1.00 14.56 ? 25  LEU B CA  1 
ATOM   2724  C  C   . LEU B  1 25  ? 24.845 -27.265 -53.204  1.00 16.81 ? 25  LEU B C   1 
ATOM   2725  O  O   . LEU B  1 25  ? 24.328 -26.141 -53.165  1.00 15.36 ? 25  LEU B O   1 
ATOM   2726  C  CB  . LEU B  1 25  ? 27.214 -27.441 -52.402  1.00 15.23 ? 25  LEU B CB  1 
ATOM   2727  C  CG  . LEU B  1 25  ? 28.243 -27.809 -51.337  1.00 18.89 ? 25  LEU B CG  1 
ATOM   2728  C  CD1 . LEU B  1 25  ? 29.634 -27.443 -51.823  1.00 17.46 ? 25  LEU B CD1 1 
ATOM   2729  C  CD2 . LEU B  1 25  ? 27.936 -27.120 -50.011  1.00 16.26 ? 25  LEU B CD2 1 
ATOM   2730  N  N   . ARG B  1 26  ? 24.644 -28.116 -54.206  1.00 14.89 ? 26  ARG B N   1 
ATOM   2731  C  CA  . ARG B  1 26  ? 23.796 -27.762 -55.338  1.00 16.88 ? 26  ARG B CA  1 
ATOM   2732  C  C   . ARG B  1 26  ? 23.366 -28.999 -56.118  1.00 16.49 ? 26  ARG B C   1 
ATOM   2733  O  O   . ARG B  1 26  ? 24.175 -29.886 -56.387  1.00 17.24 ? 26  ARG B O   1 
ATOM   2734  C  CB  . ARG B  1 26  ? 24.526 -26.787 -56.270  1.00 16.90 ? 26  ARG B CB  1 
ATOM   2735  C  CG  . ARG B  1 26  ? 23.692 -26.320 -57.459  1.00 18.24 ? 26  ARG B CG  1 
ATOM   2736  C  CD  . ARG B  1 26  ? 24.491 -25.402 -58.364  1.00 20.26 ? 26  ARG B CD  1 
ATOM   2737  N  NE  . ARG B  1 26  ? 25.641 -26.066 -58.977  1.00 15.18 ? 26  ARG B NE  1 
ATOM   2738  C  CZ  . ARG B  1 26  ? 26.485 -25.462 -59.810  1.00 19.22 ? 26  ARG B CZ  1 
ATOM   2739  N  NH1 . ARG B  1 26  ? 26.303 -24.181 -60.128  1.00 17.31 ? 26  ARG B NH1 1 
ATOM   2740  N  NH2 . ARG B  1 26  ? 27.508 -26.132 -60.327  1.00 16.70 ? 26  ARG B NH2 1 
ATOM   2741  N  N   . VAL B  1 27  ? 22.093 -29.049 -56.487  1.00 13.73 ? 27  VAL B N   1 
ATOM   2742  C  CA  . VAL B  1 27  ? 21.577 -30.153 -57.291  1.00 15.42 ? 27  VAL B CA  1 
ATOM   2743  C  C   . VAL B  1 27  ? 20.887 -29.602 -58.536  1.00 14.51 ? 27  VAL B C   1 
ATOM   2744  O  O   . VAL B  1 27  ? 20.113 -28.653 -58.447  1.00 14.91 ? 27  VAL B O   1 
ATOM   2745  C  CB  . VAL B  1 27  ? 20.600 -31.037 -56.477  1.00 14.93 ? 27  VAL B CB  1 
ATOM   2746  C  CG1 . VAL B  1 27  ? 19.835 -31.983 -57.389  1.00 16.99 ? 27  VAL B CG1 1 
ATOM   2747  C  CG2 . VAL B  1 27  ? 21.371 -31.833 -55.426  1.00 15.72 ? 27  VAL B CG2 1 
ATOM   2748  N  N   . PHE B  1 28  ? 21.194 -30.180 -59.696  1.00 14.87 ? 28  PHE B N   1 
ATOM   2749  C  CA  . PHE B  1 28  ? 20.475 -29.858 -60.928  1.00 14.78 ? 28  PHE B CA  1 
ATOM   2750  C  C   . PHE B  1 28  ? 20.498 -31.043 -61.890  1.00 16.18 ? 28  PHE B C   1 
ATOM   2751  O  O   . PHE B  1 28  ? 21.304 -31.962 -61.733  1.00 12.32 ? 28  PHE B O   1 
ATOM   2752  C  CB  . PHE B  1 28  ? 21.047 -28.605 -61.608  1.00 14.02 ? 28  PHE B CB  1 
ATOM   2753  C  CG  . PHE B  1 28  ? 22.480 -28.743 -62.060  1.00 15.76 ? 28  PHE B CG  1 
ATOM   2754  C  CD1 . PHE B  1 28  ? 22.788 -29.371 -63.263  1.00 15.04 ? 28  PHE B CD1 1 
ATOM   2755  C  CD2 . PHE B  1 28  ? 23.518 -28.212 -61.302  1.00 13.92 ? 28  PHE B CD2 1 
ATOM   2756  C  CE1 . PHE B  1 28  ? 24.101 -29.498 -63.683  1.00 15.12 ? 28  PHE B CE1 1 
ATOM   2757  C  CE2 . PHE B  1 28  ? 24.833 -28.324 -61.721  1.00 14.01 ? 28  PHE B CE2 1 
ATOM   2758  C  CZ  . PHE B  1 28  ? 25.127 -28.965 -62.918  1.00 15.86 ? 28  PHE B CZ  1 
ATOM   2759  N  N   . SER B  1 29  ? 19.595 -31.031 -62.866  1.00 13.64 ? 29  SER B N   1 
ATOM   2760  C  CA  . SER B  1 29  ? 19.600 -32.050 -63.913  1.00 15.74 ? 29  SER B CA  1 
ATOM   2761  C  C   . SER B  1 29  ? 20.585 -31.628 -64.989  1.00 14.24 ? 29  SER B C   1 
ATOM   2762  O  O   . SER B  1 29  ? 20.402 -30.596 -65.637  1.00 11.93 ? 29  SER B O   1 
ATOM   2763  C  CB  . SER B  1 29  ? 18.204 -32.210 -64.528  1.00 17.20 ? 29  SER B CB  1 
ATOM   2764  O  OG  . SER B  1 29  ? 17.267 -32.649 -63.558  1.00 20.82 ? 29  SER B OG  1 
ATOM   2765  N  N   . GLU B  1 30  ? 21.625 -32.432 -65.185  1.00 13.50 ? 30  GLU B N   1 
ATOM   2766  C  CA  . GLU B  1 30  ? 22.672 -32.083 -66.137  1.00 13.95 ? 30  GLU B CA  1 
ATOM   2767  C  C   . GLU B  1 30  ? 22.135 -31.670 -67.507  1.00 14.61 ? 30  GLU B C   1 
ATOM   2768  O  O   . GLU B  1 30  ? 22.595 -30.687 -68.077  1.00 15.06 ? 30  GLU B O   1 
ATOM   2769  C  CB  . GLU B  1 30  ? 23.671 -33.234 -66.293  1.00 15.27 ? 30  GLU B CB  1 
ATOM   2770  C  CG  . GLU B  1 30  ? 24.557 -33.457 -65.081  1.00 13.76 ? 30  GLU B CG  1 
ATOM   2771  C  CD  . GLU B  1 30  ? 23.990 -34.493 -64.130  1.00 17.00 ? 30  GLU B CD  1 
ATOM   2772  O  OE1 . GLU B  1 30  ? 22.757 -34.707 -64.127  1.00 18.34 ? 30  GLU B OE1 1 
ATOM   2773  O  OE2 . GLU B  1 30  ? 24.778 -35.092 -63.376  1.00 19.02 ? 30  GLU B OE2 1 
ATOM   2774  N  N   . ALA B  1 31  ? 21.187 -32.435 -68.051  1.00 13.09 ? 31  ALA B N   1 
ATOM   2775  C  CA  . ALA B  1 31  ? 20.723 -32.187 -69.423  1.00 13.02 ? 31  ALA B CA  1 
ATOM   2776  C  C   . ALA B  1 31  ? 19.959 -30.876 -69.505  1.00 12.65 ? 31  ALA B C   1 
ATOM   2777  O  O   . ALA B  1 31  ? 20.070 -30.142 -70.491  1.00 13.17 ? 31  ALA B O   1 
ATOM   2778  C  CB  . ALA B  1 31  ? 19.869 -33.350 -69.943  1.00 11.94 ? 31  ALA B CB  1 
ATOM   2779  N  N   . VAL B  1 32  ? 19.199 -30.563 -68.458  1.00 13.65 ? 32  VAL B N   1 
ATOM   2780  C  CA  . VAL B  1 32  ? 18.395 -29.341 -68.453  1.00 12.13 ? 32  VAL B CA  1 
ATOM   2781  C  C   . VAL B  1 32  ? 19.285 -28.106 -68.383  1.00 14.77 ? 32  VAL B C   1 
ATOM   2782  O  O   . VAL B  1 32  ? 19.079 -27.143 -69.120  1.00 13.67 ? 32  VAL B O   1 
ATOM   2783  C  CB  . VAL B  1 32  ? 17.406 -29.327 -67.272  1.00 13.47 ? 32  VAL B CB  1 
ATOM   2784  C  CG1 . VAL B  1 32  ? 16.631 -28.010 -67.229  1.00 12.84 ? 32  VAL B CG1 1 
ATOM   2785  C  CG2 . VAL B  1 32  ? 16.454 -30.509 -67.386  1.00 13.31 ? 32  VAL B CG2 1 
ATOM   2786  N  N   . ARG B  1 33  ? 20.272 -28.135 -67.494  1.00 13.33 ? 33  ARG B N   1 
ATOM   2787  C  CA  . ARG B  1 33  ? 21.174 -27.002 -67.337  1.00 14.64 ? 33  ARG B CA  1 
ATOM   2788  C  C   . ARG B  1 33  ? 22.001 -26.768 -68.590  1.00 15.08 ? 33  ARG B C   1 
ATOM   2789  O  O   . ARG B  1 33  ? 22.221 -25.631 -68.995  1.00 15.02 ? 33  ARG B O   1 
ATOM   2790  C  CB  . ARG B  1 33  ? 22.107 -27.200 -66.142  1.00 15.70 ? 33  ARG B CB  1 
ATOM   2791  C  CG  . ARG B  1 33  ? 22.827 -25.911 -65.788  1.00 18.93 ? 33  ARG B CG  1 
ATOM   2792  C  CD  . ARG B  1 33  ? 23.662 -26.007 -64.525  1.00 20.26 ? 33  ARG B CD  1 
ATOM   2793  N  NE  . ARG B  1 33  ? 24.157 -24.688 -64.144  1.00 24.77 ? 33  ARG B NE  1 
ATOM   2794  C  CZ  . ARG B  1 33  ? 23.882 -24.073 -62.997  1.00 23.57 ? 33  ARG B CZ  1 
ATOM   2795  N  NH1 . ARG B  1 33  ? 23.128 -24.666 -62.074  1.00 19.20 ? 33  ARG B NH1 1 
ATOM   2796  N  NH2 . ARG B  1 33  ? 24.384 -22.868 -62.764  1.00 19.86 ? 33  ARG B NH2 1 
ATOM   2797  N  N   . GLN B  1 34  ? 22.465 -27.853 -69.200  1.00 14.84 ? 34  GLN B N   1 
ATOM   2798  C  CA  . GLN B  1 34  ? 23.207 -27.752 -70.450  1.00 15.13 ? 34  GLN B CA  1 
ATOM   2799  C  C   . GLN B  1 34  ? 22.354 -27.172 -71.580  1.00 14.21 ? 34  GLN B C   1 
ATOM   2800  O  O   . GLN B  1 34  ? 22.833 -26.354 -72.373  1.00 13.57 ? 34  GLN B O   1 
ATOM   2801  C  CB  . GLN B  1 34  ? 23.784 -29.119 -70.845  1.00 17.48 ? 34  GLN B CB  1 
ATOM   2802  C  CG  . GLN B  1 34  ? 24.412 -29.135 -72.227  1.00 23.90 ? 34  GLN B CG  1 
ATOM   2803  C  CD  . GLN B  1 34  ? 25.302 -30.352 -72.455  1.00 28.60 ? 34  GLN B CD  1 
ATOM   2804  O  OE1 . GLN B  1 34  ? 25.631 -31.077 -71.523  1.00 23.58 ? 34  GLN B OE1 1 
ATOM   2805  N  NE2 . GLN B  1 34  ? 25.690 -30.574 -73.705  1.00 39.27 ? 34  GLN B NE2 1 
ATOM   2806  N  N   . GLN B  1 35  ? 21.091 -27.582 -71.662  1.00 13.41 ? 35  GLN B N   1 
ATOM   2807  C  CA  . GLN B  1 35  ? 20.235 -27.127 -72.766  1.00 14.06 ? 35  GLN B CA  1 
ATOM   2808  C  C   . GLN B  1 35  ? 19.586 -25.764 -72.542  1.00 14.25 ? 35  GLN B C   1 
ATOM   2809  O  O   . GLN B  1 35  ? 19.354 -25.032 -73.502  1.00 13.82 ? 35  GLN B O   1 
ATOM   2810  C  CB  . GLN B  1 35  ? 19.165 -28.177 -73.110  1.00 13.34 ? 35  GLN B CB  1 
ATOM   2811  C  CG  . GLN B  1 35  ? 19.756 -29.506 -73.562  1.00 14.51 ? 35  GLN B CG  1 
ATOM   2812  C  CD  . GLN B  1 35  ? 20.754 -29.338 -74.690  1.00 14.78 ? 35  GLN B CD  1 
ATOM   2813  O  OE1 . GLN B  1 35  ? 20.679 -28.381 -75.458  1.00 15.10 ? 35  GLN B OE1 1 
ATOM   2814  N  NE2 . GLN B  1 35  ? 21.697 -30.271 -74.795  1.00 14.27 ? 35  GLN B NE2 1 
ATOM   2815  N  N   . TRP B  1 36  ? 19.289 -25.432 -71.284  1.00 13.30 ? 36  TRP B N   1 
ATOM   2816  C  CA  . TRP B  1 36  ? 18.588 -24.184 -70.959  1.00 14.05 ? 36  TRP B CA  1 
ATOM   2817  C  C   . TRP B  1 36  ? 19.225 -23.456 -69.815  1.00 15.38 ? 36  TRP B C   1 
ATOM   2818  O  O   . TRP B  1 36  ? 18.676 -23.418 -68.718  1.00 16.52 ? 36  TRP B O   1 
ATOM   2819  C  CB  . TRP B  1 36  ? 17.111 -24.465 -70.656  1.00 14.11 ? 36  TRP B CB  1 
ATOM   2820  C  CG  . TRP B  1 36  ? 16.392 -24.985 -71.877  1.00 14.52 ? 36  TRP B CG  1 
ATOM   2821  C  CD1 . TRP B  1 36  ? 16.053 -24.275 -73.025  1.00 14.26 ? 36  TRP B CD1 1 
ATOM   2822  C  CD2 . TRP B  1 36  ? 15.953 -26.368 -72.136  1.00 14.55 ? 36  TRP B CD2 1 
ATOM   2823  N  NE1 . TRP B  1 36  ? 15.439 -25.095 -73.939  1.00 15.46 ? 36  TRP B NE1 1 
ATOM   2824  C  CE2 . TRP B  1 36  ? 15.349 -26.362 -73.468  1.00 15.06 ? 36  TRP B CE2 1 
ATOM   2825  C  CE3 . TRP B  1 36  ? 15.998 -27.561 -71.421  1.00 14.78 ? 36  TRP B CE3 1 
ATOM   2826  C  CZ2 . TRP B  1 36  ? 14.810 -27.508 -74.036  1.00 15.36 ? 36  TRP B CZ2 1 
ATOM   2827  C  CZ3 . TRP B  1 36  ? 15.450 -28.706 -72.003  1.00 14.92 ? 36  TRP B CZ3 1 
ATOM   2828  C  CH2 . TRP B  1 36  ? 14.875 -28.680 -73.278  1.00 14.48 ? 36  TRP B CH2 1 
ATOM   2829  N  N   . PRO B  1 37  ? 20.408 -22.867 -70.052  1.00 18.66 ? 37  PRO B N   1 
ATOM   2830  C  CA  . PRO B  1 37  ? 21.138 -22.165 -68.999  1.00 18.35 ? 37  PRO B CA  1 
ATOM   2831  C  C   . PRO B  1 37  ? 20.402 -20.935 -68.456  1.00 19.13 ? 37  PRO B C   1 
ATOM   2832  O  O   . PRO B  1 37  ? 20.702 -20.490 -67.346  1.00 18.73 ? 37  PRO B O   1 
ATOM   2833  C  CB  . PRO B  1 37  ? 22.452 -21.761 -69.687  1.00 19.18 ? 37  PRO B CB  1 
ATOM   2834  C  CG  . PRO B  1 37  ? 22.159 -21.828 -71.156  1.00 18.75 ? 37  PRO B CG  1 
ATOM   2835  C  CD  . PRO B  1 37  ? 21.200 -22.973 -71.287  1.00 17.24 ? 37  PRO B CD  1 
ATOM   2836  N  N   . HIS B  1 38  ? 19.449 -20.395 -69.215  1.00 17.62 ? 38  HIS B N   1 
ATOM   2837  C  CA  . HIS B  1 38  ? 18.701 -19.215 -68.760  1.00 19.09 ? 38  HIS B CA  1 
ATOM   2838  C  C   . HIS B  1 38  ? 17.908 -19.494 -67.512  1.00 19.46 ? 38  HIS B C   1 
ATOM   2839  O  O   . HIS B  1 38  ? 17.484 -18.577 -66.823  1.00 20.99 ? 38  HIS B O   1 
ATOM   2840  C  CB  . HIS B  1 38  ? 17.778 -18.678 -69.859  1.00 18.30 ? 38  HIS B CB  1 
ATOM   2841  C  CG  . HIS B  1 38  ? 16.530 -19.512 -70.082  1.00 17.70 ? 38  HIS B CG  1 
ATOM   2842  N  ND1 . HIS B  1 38  ? 16.520 -20.614 -70.857  1.00 17.58 ? 38  HIS B ND1 1 
ATOM   2843  C  CD2 . HIS B  1 38  ? 15.222 -19.346 -69.620  1.00 18.56 ? 38  HIS B CD2 1 
ATOM   2844  C  CE1 . HIS B  1 38  ? 15.277 -21.140 -70.877  1.00 18.23 ? 38  HIS B CE1 1 
ATOM   2845  N  NE2 . HIS B  1 38  ? 14.484 -20.363 -70.120  1.00 17.89 ? 38  HIS B NE2 1 
ATOM   2846  N  N   . LEU B  1 39  ? 17.702 -20.768 -67.207  1.00 19.10 ? 39  LEU B N   1 
ATOM   2847  C  CA  . LEU B  1 39  ? 16.907 -21.157 -66.046  1.00 20.31 ? 39  LEU B CA  1 
ATOM   2848  C  C   . LEU B  1 39  ? 17.689 -21.064 -64.732  1.00 22.59 ? 39  LEU B C   1 
ATOM   2849  O  O   . LEU B  1 39  ? 17.104 -21.147 -63.654  1.00 19.90 ? 39  LEU B O   1 
ATOM   2850  C  CB  . LEU B  1 39  ? 16.400 -22.591 -66.212  1.00 18.98 ? 39  LEU B CB  1 
ATOM   2851  C  CG  . LEU B  1 39  ? 15.465 -22.899 -67.383  1.00 17.21 ? 39  LEU B CG  1 
ATOM   2852  C  CD1 . LEU B  1 39  ? 15.309 -24.413 -67.511  1.00 16.77 ? 39  LEU B CD1 1 
ATOM   2853  C  CD2 . LEU B  1 39  ? 14.114 -22.223 -67.182  1.00 17.44 ? 39  LEU B CD2 1 
ATOM   2854  N  N   . TYR B  1 40  ? 19.005 -20.915 -64.824  1.00 19.60 ? 40  TYR B N   1 
ATOM   2855  C  CA  . TYR B  1 40  ? 19.859 -21.032 -63.647  1.00 19.50 ? 40  TYR B CA  1 
ATOM   2856  C  C   . TYR B  1 40  ? 20.615 -19.746 -63.364  1.00 20.51 ? 40  TYR B C   1 
ATOM   2857  O  O   . TYR B  1 40  ? 20.858 -18.945 -64.264  1.00 20.16 ? 40  TYR B O   1 
ATOM   2858  C  CB  . TYR B  1 40  ? 20.849 -22.193 -63.824  1.00 17.58 ? 40  TYR B CB  1 
ATOM   2859  C  CG  . TYR B  1 40  ? 20.165 -23.528 -64.007  1.00 17.80 ? 40  TYR B CG  1 
ATOM   2860  C  CD1 . TYR B  1 40  ? 19.705 -23.929 -65.258  1.00 16.83 ? 40  TYR B CD1 1 
ATOM   2861  C  CD2 . TYR B  1 40  ? 19.955 -24.377 -62.924  1.00 19.69 ? 40  TYR B CD2 1 
ATOM   2862  C  CE1 . TYR B  1 40  ? 19.059 -25.142 -65.427  1.00 16.73 ? 40  TYR B CE1 1 
ATOM   2863  C  CE2 . TYR B  1 40  ? 19.312 -25.594 -63.081  1.00 18.99 ? 40  TYR B CE2 1 
ATOM   2864  C  CZ  . TYR B  1 40  ? 18.875 -25.973 -64.334  1.00 17.65 ? 40  TYR B CZ  1 
ATOM   2865  O  OH  . TYR B  1 40  ? 18.243 -27.180 -64.491  1.00 16.08 ? 40  TYR B OH  1 
ATOM   2866  N  N   . ASN B  1 41  ? 20.995 -19.551 -62.109  1.00 21.19 ? 41  ASN B N   1 
ATOM   2867  C  CA  . ASN B  1 41  ? 21.743 -18.354 -61.725  1.00 22.04 ? 41  ASN B CA  1 
ATOM   2868  C  C   . ASN B  1 41  ? 22.880 -18.772 -60.811  1.00 22.02 ? 41  ASN B C   1 
ATOM   2869  O  O   . ASN B  1 41  ? 22.678 -18.989 -59.617  1.00 20.44 ? 41  ASN B O   1 
ATOM   2870  C  CB  . ASN B  1 41  ? 20.824 -17.346 -61.028  1.00 23.59 ? 41  ASN B CB  1 
ATOM   2871  C  CG  . ASN B  1 41  ? 21.533 -16.044 -60.675  1.00 27.31 ? 41  ASN B CG  1 
ATOM   2872  O  OD1 . ASN B  1 41  ? 22.723 -16.024 -60.352  1.00 28.86 ? 41  ASN B OD1 1 
ATOM   2873  N  ND2 . ASN B  1 41  ? 20.796 -14.950 -60.731  1.00 34.73 ? 41  ASN B ND2 1 
ATOM   2874  N  N   . GLU B  1 42  ? 24.076 -18.896 -61.374  1.00 22.83 ? 42  GLU B N   1 
ATOM   2875  C  CA  . GLU B  1 42  ? 25.193 -19.448 -60.615  1.00 28.14 ? 42  GLU B CA  1 
ATOM   2876  C  C   . GLU B  1 42  ? 25.672 -18.542 -59.480  1.00 25.45 ? 42  GLU B C   1 
ATOM   2877  O  O   . GLU B  1 42  ? 26.248 -19.024 -58.501  1.00 24.05 ? 42  GLU B O   1 
ATOM   2878  C  CB  . GLU B  1 42  ? 26.357 -19.835 -61.525  1.00 30.44 ? 42  GLU B CB  1 
ATOM   2879  C  CG  . GLU B  1 42  ? 27.499 -20.478 -60.753  1.00 49.76 ? 42  GLU B CG  1 
ATOM   2880  C  CD  . GLU B  1 42  ? 28.344 -21.414 -61.594  1.00 55.87 ? 42  GLU B CD  1 
ATOM   2881  O  OE1 . GLU B  1 42  ? 29.345 -21.943 -61.064  1.00 59.62 ? 42  GLU B OE1 1 
ATOM   2882  O  OE2 . GLU B  1 42  ? 28.006 -21.623 -62.780  1.00 84.99 ? 42  GLU B OE2 1 
ATOM   2883  N  N   . ASP B  1 43  ? 25.432 -17.241 -59.609  1.00 23.20 ? 43  ASP B N   1 
ATOM   2884  C  CA  . ASP B  1 43  ? 25.791 -16.290 -58.556  1.00 25.79 ? 43  ASP B CA  1 
ATOM   2885  C  C   . ASP B  1 43  ? 24.975 -16.548 -57.295  1.00 26.47 ? 43  ASP B C   1 
ATOM   2886  O  O   . ASP B  1 43  ? 25.533 -16.613 -56.192  1.00 25.22 ? 43  ASP B O   1 
ATOM   2887  C  CB  . ASP B  1 43  ? 25.590 -14.844 -59.019  1.00 30.17 ? 43  ASP B CB  1 
ATOM   2888  C  CG  . ASP B  1 43  ? 26.657 -14.388 -60.001  1.00 35.96 ? 43  ASP B CG  1 
ATOM   2889  O  OD1 . ASP B  1 43  ? 27.694 -15.071 -60.131  1.00 32.44 ? 43  ASP B OD1 1 
ATOM   2890  O  OD2 . ASP B  1 43  ? 26.456 -13.340 -60.647  1.00 48.06 ? 43  ASP B OD2 1 
ATOM   2891  N  N   . GLU B  1 44  ? 23.658 -16.688 -57.461  1.00 23.97 ? 44  GLU B N   1 
ATOM   2892  C  CA  . GLU B  1 44  ? 22.765 -17.040 -56.356  1.00 23.65 ? 44  GLU B CA  1 
ATOM   2893  C  C   . GLU B  1 44  ? 23.100 -18.400 -55.760  1.00 22.17 ? 44  GLU B C   1 
ATOM   2894  O  O   . GLU B  1 44  ? 23.050 -18.590 -54.542  1.00 20.21 ? 44  GLU B O   1 
ATOM   2895  C  CB  . GLU B  1 44  ? 21.312 -17.084 -56.822  1.00 27.44 ? 44  GLU B CB  1 
ATOM   2896  C  CG  . GLU B  1 44  ? 20.696 -15.742 -57.160  1.00 42.68 ? 44  GLU B CG  1 
ATOM   2897  C  CD  . GLU B  1 44  ? 19.219 -15.865 -57.496  1.00 63.57 ? 44  GLU B CD  1 
ATOM   2898  O  OE1 . GLU B  1 44  ? 18.599 -14.841 -57.860  1.00 80.49 ? 44  GLU B OE1 1 
ATOM   2899  O  OE2 . GLU B  1 44  ? 18.678 -16.989 -57.394  1.00 61.77 ? 44  GLU B OE2 1 
ATOM   2900  N  N   . GLU B  1 45  ? 23.398 -19.364 -56.623  1.00 19.10 ? 45  GLU B N   1 
ATOM   2901  C  CA  . GLU B  1 45  ? 23.679 -20.714 -56.155  1.00 17.83 ? 45  GLU B CA  1 
ATOM   2902  C  C   . GLU B  1 45  ? 24.906 -20.683 -55.262  1.00 18.70 ? 45  GLU B C   1 
ATOM   2903  O  O   . GLU B  1 45  ? 24.933 -21.307 -54.203  1.00 17.94 ? 45  GLU B O   1 
ATOM   2904  C  CB  . GLU B  1 45  ? 23.889 -21.665 -57.335  1.00 17.71 ? 45  GLU B CB  1 
ATOM   2905  C  CG  . GLU B  1 45  ? 22.612 -21.984 -58.108  1.00 18.65 ? 45  GLU B CG  1 
ATOM   2906  C  CD  . GLU B  1 45  ? 22.890 -22.567 -59.492  1.00 21.39 ? 45  GLU B CD  1 
ATOM   2907  O  OE1 . GLU B  1 45  ? 24.032 -22.448 -59.988  1.00 18.67 ? 45  GLU B OE1 1 
ATOM   2908  O  OE2 . GLU B  1 45  ? 21.964 -23.148 -60.091  1.00 25.21 ? 45  GLU B OE2 1 
ATOM   2909  N  N   . PHE B  1 46  ? 25.919 -19.943 -55.702  1.00 17.00 ? 46  PHE B N   1 
ATOM   2910  C  CA  . PHE B  1 46  ? 27.158 -19.828 -54.964  1.00 18.01 ? 46  PHE B CA  1 
ATOM   2911  C  C   . PHE B  1 46  ? 26.940 -19.117 -53.623  1.00 19.21 ? 46  PHE B C   1 
ATOM   2912  O  O   . PHE B  1 46  ? 27.420 -19.569 -52.579  1.00 17.68 ? 46  PHE B O   1 
ATOM   2913  C  CB  . PHE B  1 46  ? 28.200 -19.098 -55.810  1.00 20.02 ? 46  PHE B CB  1 
ATOM   2914  C  CG  . PHE B  1 46  ? 29.500 -18.877 -55.100  1.00 21.92 ? 46  PHE B CG  1 
ATOM   2915  C  CD1 . PHE B  1 46  ? 29.838 -17.620 -54.632  1.00 24.08 ? 46  PHE B CD1 1 
ATOM   2916  C  CD2 . PHE B  1 46  ? 30.375 -19.930 -54.884  1.00 21.12 ? 46  PHE B CD2 1 
ATOM   2917  C  CE1 . PHE B  1 46  ? 31.036 -17.413 -53.974  1.00 26.71 ? 46  PHE B CE1 1 
ATOM   2918  C  CE2 . PHE B  1 46  ? 31.571 -19.730 -54.221  1.00 20.64 ? 46  PHE B CE2 1 
ATOM   2919  C  CZ  . PHE B  1 46  ? 31.901 -18.469 -53.768  1.00 23.09 ? 46  PHE B CZ  1 
ATOM   2920  N  N   . ARG B  1 47  ? 26.203 -18.014 -53.658  1.00 20.83 ? 47  ARG B N   1 
ATOM   2921  C  CA  . ARG B  1 47  ? 25.877 -17.260 -52.446  1.00 24.24 ? 47  ARG B CA  1 
ATOM   2922  C  C   . ARG B  1 47  ? 25.107 -18.119 -51.431  1.00 22.05 ? 47  ARG B C   1 
ATOM   2923  O  O   . ARG B  1 47  ? 25.438 -18.130 -50.250  1.00 22.30 ? 47  ARG B O   1 
ATOM   2924  C  CB  . ARG B  1 47  ? 25.090 -15.997 -52.810  1.00 27.83 ? 47  ARG B CB  1 
ATOM   2925  C  CG  . ARG B  1 47  ? 24.922 -15.000 -51.676  1.00 45.07 ? 47  ARG B CG  1 
ATOM   2926  C  CD  . ARG B  1 47  ? 24.416 -13.654 -52.187  1.00 55.58 ? 47  ARG B CD  1 
ATOM   2927  N  NE  . ARG B  1 47  ? 23.204 -13.782 -52.996  1.00 63.95 ? 47  ARG B NE  1 
ATOM   2928  C  CZ  . ARG B  1 47  ? 23.150 -13.585 -54.311  1.00 68.02 ? 47  ARG B CZ  1 
ATOM   2929  N  NH1 . ARG B  1 47  ? 24.240 -13.237 -54.985  1.00 65.78 ? 47  ARG B NH1 1 
ATOM   2930  N  NH2 . ARG B  1 47  ? 21.999 -13.730 -54.955  1.00 55.00 ? 47  ARG B NH2 1 
ATOM   2931  N  N   . ASN B  1 48  ? 24.096 -18.848 -51.894  1.00 19.05 ? 48  ASN B N   1 
ATOM   2932  C  CA  . ASN B  1 48  ? 23.318 -19.721 -51.017  1.00 19.89 ? 48  ASN B CA  1 
ATOM   2933  C  C   . ASN B  1 48  ? 24.164 -20.822 -50.388  1.00 21.18 ? 48  ASN B C   1 
ATOM   2934  O  O   . ASN B  1 48  ? 24.052 -21.102 -49.190  1.00 21.53 ? 48  ASN B O   1 
ATOM   2935  C  CB  . ASN B  1 48  ? 22.154 -20.359 -51.778  1.00 21.88 ? 48  ASN B CB  1 
ATOM   2936  C  CG  . ASN B  1 48  ? 21.058 -19.368 -52.109  1.00 27.26 ? 48  ASN B CG  1 
ATOM   2937  O  OD1 . ASN B  1 48  ? 20.992 -18.294 -51.532  1.00 31.29 ? 48  ASN B OD1 1 
ATOM   2938  N  ND2 . ASN B  1 48  ? 20.186 -19.735 -53.034  1.00 37.74 ? 48  ASN B ND2 1 
ATOM   2939  N  N   . ALA B  1 49  ? 25.006 -21.453 -51.200  1.00 15.65 ? 49  ALA B N   1 
ATOM   2940  C  CA  . ALA B  1 49  ? 25.845 -22.538 -50.715  1.00 16.45 ? 49  ALA B CA  1 
ATOM   2941  C  C   . ALA B  1 49  ? 26.857 -22.025 -49.687  1.00 16.90 ? 49  ALA B C   1 
ATOM   2942  O  O   . ALA B  1 49  ? 27.053 -22.634 -48.634  1.00 17.49 ? 49  ALA B O   1 
ATOM   2943  C  CB  . ALA B  1 49  ? 26.555 -23.212 -51.881  1.00 15.17 ? 49  ALA B CB  1 
ATOM   2944  N  N   . VAL B  1 50  ? 27.505 -20.905 -49.997  1.00 16.40 ? 50  VAL B N   1 
ATOM   2945  C  CA  . VAL B  1 50  ? 28.477 -20.319 -49.081  1.00 15.26 ? 50  VAL B CA  1 
ATOM   2946  C  C   . VAL B  1 50  ? 27.832 -19.909 -47.758  1.00 17.96 ? 50  VAL B C   1 
ATOM   2947  O  O   . VAL B  1 50  ? 28.362 -20.212 -46.678  1.00 18.72 ? 50  VAL B O   1 
ATOM   2948  C  CB  . VAL B  1 50  ? 29.212 -19.123 -49.722  1.00 18.02 ? 50  VAL B CB  1 
ATOM   2949  C  CG1 . VAL B  1 50  ? 30.005 -18.354 -48.670  1.00 17.52 ? 50  VAL B CG1 1 
ATOM   2950  C  CG2 . VAL B  1 50  ? 30.128 -19.615 -50.838  1.00 16.28 ? 50  VAL B CG2 1 
ATOM   2951  N  N   . ASN B  1 51  ? 26.688 -19.229 -47.833  1.00 18.26 ? 51  ASN B N   1 
ATOM   2952  C  CA  . ASN B  1 51  ? 25.962 -18.837 -46.621  1.00 20.83 ? 51  ASN B CA  1 
ATOM   2953  C  C   . ASN B  1 51  ? 25.539 -20.019 -45.744  1.00 19.08 ? 51  ASN B C   1 
ATOM   2954  O  O   . ASN B  1 51  ? 25.669 -19.963 -44.520  1.00 18.96 ? 51  ASN B O   1 
ATOM   2955  C  CB  . ASN B  1 51  ? 24.735 -17.986 -46.955  1.00 23.74 ? 51  ASN B CB  1 
ATOM   2956  C  CG  . ASN B  1 51  ? 25.102 -16.624 -47.508  1.00 33.14 ? 51  ASN B CG  1 
ATOM   2957  O  OD1 . ASN B  1 51  ? 24.299 -15.981 -48.183  1.00 41.16 ? 51  ASN B OD1 1 
ATOM   2958  N  ND2 . ASN B  1 51  ? 26.323 -16.180 -47.232  1.00 32.78 ? 51  ASN B ND2 1 
ATOM   2959  N  N   . GLU B  1 52  ? 25.018 -21.077 -46.361  1.00 16.85 ? 52  GLU B N   1 
ATOM   2960  C  CA  . GLU B  1 52  ? 24.615 -22.260 -45.604  1.00 17.96 ? 52  GLU B CA  1 
ATOM   2961  C  C   . GLU B  1 52  ? 25.820 -22.916 -44.940  1.00 17.38 ? 52  GLU B C   1 
ATOM   2962  O  O   . GLU B  1 52  ? 25.791 -23.219 -43.756  1.00 16.34 ? 52  GLU B O   1 
ATOM   2963  C  CB  . GLU B  1 52  ? 23.894 -23.277 -46.498  1.00 21.35 ? 52  GLU B CB  1 
ATOM   2964  C  CG  . GLU B  1 52  ? 22.485 -22.857 -46.885  1.00 26.48 ? 52  GLU B CG  1 
ATOM   2965  C  CD  . GLU B  1 52  ? 21.556 -22.763 -45.688  1.00 25.25 ? 52  GLU B CD  1 
ATOM   2966  O  OE1 . GLU B  1 52  ? 20.969 -21.681 -45.478  1.00 26.64 ? 52  GLU B OE1 1 
ATOM   2967  O  OE2 . GLU B  1 52  ? 21.412 -23.767 -44.956  1.00 28.13 ? 52  GLU B OE2 1 
ATOM   2968  N  N   . VAL B  1 53  ? 26.880 -23.130 -45.711  1.00 17.73 ? 53  VAL B N   1 
ATOM   2969  C  CA  . VAL B  1 53  ? 28.081 -23.773 -45.189  1.00 16.45 ? 53  VAL B CA  1 
ATOM   2970  C  C   . VAL B  1 53  ? 28.694 -22.962 -44.045  1.00 16.38 ? 53  VAL B C   1 
ATOM   2971  O  O   . VAL B  1 53  ? 29.150 -23.524 -43.049  1.00 16.59 ? 53  VAL B O   1 
ATOM   2972  C  CB  . VAL B  1 53  ? 29.130 -23.995 -46.299  1.00 17.33 ? 53  VAL B CB  1 
ATOM   2973  C  CG1 . VAL B  1 53  ? 30.445 -24.475 -45.699  1.00 15.26 ? 53  VAL B CG1 1 
ATOM   2974  C  CG2 . VAL B  1 53  ? 28.609 -25.005 -47.319  1.00 15.91 ? 53  VAL B CG2 1 
ATOM   2975  N  N   . LYS B  1 54  ? 28.713 -21.642 -44.190  1.00 16.84 ? 54  LYS B N   1 
ATOM   2976  C  CA  . LYS B  1 54  ? 29.245 -20.794 -43.131  1.00 19.33 ? 54  LYS B CA  1 
ATOM   2977  C  C   . LYS B  1 54  ? 28.426 -20.944 -41.860  1.00 18.19 ? 54  LYS B C   1 
ATOM   2978  O  O   . LYS B  1 54  ? 28.977 -20.959 -40.762  1.00 19.70 ? 54  LYS B O   1 
ATOM   2979  C  CB  . LYS B  1 54  ? 29.296 -19.326 -43.556  1.00 17.62 ? 54  LYS B CB  1 
ATOM   2980  C  CG  . LYS B  1 54  ? 30.442 -19.019 -44.507  1.00 20.01 ? 54  LYS B CG  1 
ATOM   2981  C  CD  . LYS B  1 54  ? 30.634 -17.522 -44.685  1.00 24.29 ? 54  LYS B CD  1 
ATOM   2982  C  CE  . LYS B  1 54  ? 31.910 -17.234 -45.464  1.00 26.88 ? 54  LYS B CE  1 
ATOM   2983  N  NZ  . LYS B  1 54  ? 32.075 -15.778 -45.731  1.00 30.85 ? 54  LYS B NZ  1 
ATOM   2984  N  N   . ARG B  1 55  ? 27.111 -21.056 -42.003  1.00 18.48 ? 55  ARG B N   1 
ATOM   2985  C  CA  . ARG B  1 55  ? 26.264 -21.201 -40.823  1.00 19.52 ? 55  ARG B CA  1 
ATOM   2986  C  C   . ARG B  1 55  ? 26.500 -22.543 -40.146  1.00 18.22 ? 55  ARG B C   1 
ATOM   2987  O  O   . ARG B  1 55  ? 26.567 -22.614 -38.921  1.00 17.75 ? 55  ARG B O   1 
ATOM   2988  C  CB  . ARG B  1 55  ? 24.777 -21.007 -41.136  1.00 19.98 ? 55  ARG B CB  1 
ATOM   2989  C  CG  . ARG B  1 55  ? 23.971 -20.679 -39.877  1.00 25.12 ? 55  ARG B CG  1 
ATOM   2990  C  CD  . ARG B  1 55  ? 22.522 -20.324 -40.173  1.00 27.92 ? 55  ARG B CD  1 
ATOM   2991  N  NE  . ARG B  1 55  ? 21.741 -21.494 -40.569  1.00 24.85 ? 55  ARG B NE  1 
ATOM   2992  C  CZ  . ARG B  1 55  ? 21.458 -21.807 -41.830  1.00 25.26 ? 55  ARG B CZ  1 
ATOM   2993  N  NH1 . ARG B  1 55  ? 20.741 -22.892 -42.104  1.00 20.97 ? 55  ARG B NH1 1 
ATOM   2994  N  NH2 . ARG B  1 55  ? 21.887 -21.030 -42.818  1.00 21.68 ? 55  ARG B NH2 1 
ATOM   2995  N  N   . ALA B  1 56  ? 26.626 -23.602 -40.945  1.00 16.00 ? 56  ALA B N   1 
ATOM   2996  C  CA  . ALA B  1 56  ? 26.970 -24.919 -40.414  1.00 16.53 ? 56  ALA B CA  1 
ATOM   2997  C  C   . ALA B  1 56  ? 28.273 -24.856 -39.620  1.00 15.44 ? 56  ALA B C   1 
ATOM   2998  O  O   . ALA B  1 56  ? 28.365 -25.390 -38.518  1.00 15.16 ? 56  ALA B O   1 
ATOM   2999  C  CB  . ALA B  1 56  ? 27.087 -25.936 -41.541  1.00 15.44 ? 56  ALA B CB  1 
ATOM   3000  N  N   . MET B  1 57  ? 29.280 -24.200 -40.183  1.00 14.83 ? 57  MET B N   1 
ATOM   3001  C  CA  . MET B  1 57  ? 30.571 -24.113 -39.514  1.00 15.77 ? 57  MET B CA  1 
ATOM   3002  C  C   . MET B  1 57  ? 30.486 -23.329 -38.195  1.00 16.50 ? 57  MET B C   1 
ATOM   3003  O  O   . MET B  1 57  ? 31.218 -23.612 -37.254  1.00 16.25 ? 57  MET B O   1 
ATOM   3004  C  CB  . MET B  1 57  ? 31.619 -23.502 -40.444  1.00 17.18 ? 57  MET B CB  1 
ATOM   3005  C  CG  . MET B  1 57  ? 31.941 -24.378 -41.645  1.00 16.28 ? 57  MET B CG  1 
ATOM   3006  S  SD  . MET B  1 57  ? 33.165 -23.647 -42.748  1.00 19.69 ? 57  MET B SD  1 
ATOM   3007  C  CE  . MET B  1 57  ? 34.677 -23.928 -41.818  1.00 18.90 ? 57  MET B CE  1 
ATOM   3008  N  N   . GLN B  1 58  ? 29.586 -22.356 -38.124  1.00 17.77 ? 58  GLN B N   1 
ATOM   3009  C  CA  . GLN B  1 58  ? 29.417 -21.580 -36.895  1.00 21.43 ? 58  GLN B CA  1 
ATOM   3010  C  C   . GLN B  1 58  ? 28.836 -22.413 -35.758  1.00 19.97 ? 58  GLN B C   1 
ATOM   3011  O  O   . GLN B  1 58  ? 28.957 -22.035 -34.597  1.00 20.62 ? 58  GLN B O   1 
ATOM   3012  C  CB  . GLN B  1 58  ? 28.538 -20.350 -37.139  1.00 23.31 ? 58  GLN B CB  1 
ATOM   3013  C  CG  . GLN B  1 58  ? 29.244 -19.257 -37.915  1.00 27.73 ? 58  GLN B CG  1 
ATOM   3014  C  CD  . GLN B  1 58  ? 28.294 -18.188 -38.414  1.00 36.77 ? 58  GLN B CD  1 
ATOM   3015  O  OE1 . GLN B  1 58  ? 28.720 -17.107 -38.812  1.00 51.31 ? 58  GLN B OE1 1 
ATOM   3016  N  NE2 . GLN B  1 58  ? 26.999 -18.485 -38.392  1.00 33.18 ? 58  GLN B NE2 1 
ATOM   3017  N  N   . PHE B  1 59  ? 28.193 -23.529 -36.095  1.00 16.78 ? 59  PHE B N   1 
ATOM   3018  C  CA  . PHE B  1 59  ? 27.723 -24.485 -35.090  1.00 17.83 ? 59  PHE B CA  1 
ATOM   3019  C  C   . PHE B  1 59  ? 28.770 -25.565 -34.793  1.00 20.16 ? 59  PHE B C   1 
ATOM   3020  O  O   . PHE B  1 59  ? 28.559 -26.424 -33.935  1.00 21.18 ? 59  PHE B O   1 
ATOM   3021  C  CB  . PHE B  1 59  ? 26.423 -25.165 -35.539  1.00 17.93 ? 59  PHE B CB  1 
ATOM   3022  C  CG  . PHE B  1 59  ? 25.185 -24.337 -35.319  1.00 18.95 ? 59  PHE B CG  1 
ATOM   3023  C  CD1 . PHE B  1 59  ? 24.639 -24.201 -34.050  1.00 18.33 ? 59  PHE B CD1 1 
ATOM   3024  C  CD2 . PHE B  1 59  ? 24.550 -23.720 -36.386  1.00 18.92 ? 59  PHE B CD2 1 
ATOM   3025  C  CE1 . PHE B  1 59  ? 23.496 -23.446 -33.847  1.00 19.12 ? 59  PHE B CE1 1 
ATOM   3026  C  CE2 . PHE B  1 59  ? 23.405 -22.963 -36.189  1.00 21.14 ? 59  PHE B CE2 1 
ATOM   3027  C  CZ  . PHE B  1 59  ? 22.875 -22.830 -34.917  1.00 18.46 ? 59  PHE B CZ  1 
ATOM   3028  N  N   . GLY B  1 60  ? 29.886 -25.538 -35.513  1.00 18.61 ? 60  GLY B N   1 
ATOM   3029  C  CA  . GLY B  1 60  ? 30.979 -26.463 -35.242  1.00 17.58 ? 60  GLY B CA  1 
ATOM   3030  C  C   . GLY B  1 60  ? 31.160 -27.589 -36.247  1.00 18.66 ? 60  GLY B C   1 
ATOM   3031  O  O   . GLY B  1 60  ? 31.991 -28.478 -36.037  1.00 16.64 ? 60  GLY B O   1 
ATOM   3032  N  N   . VAL B  1 61  ? 30.399 -27.564 -37.340  1.00 16.01 ? 61  VAL B N   1 
ATOM   3033  C  CA  . VAL B  1 61  ? 30.571 -28.566 -38.391  1.00 13.82 ? 61  VAL B CA  1 
ATOM   3034  C  C   . VAL B  1 61  ? 31.960 -28.412 -39.027  1.00 15.34 ? 61  VAL B C   1 
ATOM   3035  O  O   . VAL B  1 61  ? 32.346 -27.318 -39.436  1.00 13.50 ? 61  VAL B O   1 
ATOM   3036  C  CB  . VAL B  1 61  ? 29.470 -28.467 -39.471  1.00 14.24 ? 61  VAL B CB  1 
ATOM   3037  C  CG1 . VAL B  1 61  ? 29.759 -29.422 -40.627  1.00 12.49 ? 61  VAL B CG1 1 
ATOM   3038  C  CG2 . VAL B  1 61  ? 28.101 -28.762 -38.863  1.00 12.50 ? 61  VAL B CG2 1 
ATOM   3039  N  N   . LYS B  1 62  ? 32.716 -29.505 -39.098  1.00 15.53 ? 62  LYS B N   1 
ATOM   3040  C  CA  A LYS B  1 62  ? 34.067 -29.462 -39.654  0.50 16.48 ? 62  LYS B CA  1 
ATOM   3041  C  CA  B LYS B  1 62  ? 34.064 -29.453 -39.657  0.50 16.43 ? 62  LYS B CA  1 
ATOM   3042  C  C   . LYS B  1 62  ? 34.095 -30.014 -41.073  1.00 15.94 ? 62  LYS B C   1 
ATOM   3043  O  O   . LYS B  1 62  ? 34.869 -29.553 -41.916  1.00 16.70 ? 62  LYS B O   1 
ATOM   3044  C  CB  A LYS B  1 62  ? 35.036 -30.254 -38.772  0.50 16.79 ? 62  LYS B CB  1 
ATOM   3045  C  CB  B LYS B  1 62  ? 35.052 -30.220 -38.772  0.50 16.72 ? 62  LYS B CB  1 
ATOM   3046  C  CG  A LYS B  1 62  ? 36.479 -30.228 -39.248  0.50 17.69 ? 62  LYS B CG  1 
ATOM   3047  C  CG  B LYS B  1 62  ? 35.194 -29.669 -37.361  0.50 17.55 ? 62  LYS B CG  1 
ATOM   3048  C  CD  A LYS B  1 62  ? 37.387 -31.008 -38.307  0.50 18.51 ? 62  LYS B CD  1 
ATOM   3049  C  CD  B LYS B  1 62  ? 35.510 -28.181 -37.371  0.50 18.53 ? 62  LYS B CD  1 
ATOM   3050  C  CE  A LYS B  1 62  ? 38.856 -30.743 -38.601  0.50 20.25 ? 62  LYS B CE  1 
ATOM   3051  C  CE  B LYS B  1 62  ? 35.981 -27.713 -36.004  0.50 20.84 ? 62  LYS B CE  1 
ATOM   3052  N  NZ  A LYS B  1 62  ? 39.736 -31.390 -37.587  0.50 22.50 ? 62  LYS B NZ  1 
ATOM   3053  N  NZ  B LYS B  1 62  ? 36.079 -26.231 -35.942  0.50 22.34 ? 62  LYS B NZ  1 
ATOM   3054  N  N   . THR B  1 63  ? 33.242 -30.999 -41.327  1.00 15.45 ? 63  THR B N   1 
ATOM   3055  C  CA  . THR B  1 63  ? 33.244 -31.717 -42.589  1.00 14.70 ? 63  THR B CA  1 
ATOM   3056  C  C   . THR B  1 63  ? 31.842 -31.952 -43.101  1.00 15.85 ? 63  THR B C   1 
ATOM   3057  O  O   . THR B  1 63  ? 30.937 -32.317 -42.346  1.00 13.55 ? 63  THR B O   1 
ATOM   3058  C  CB  . THR B  1 63  ? 33.929 -33.089 -42.424  1.00 14.96 ? 63  THR B CB  1 
ATOM   3059  O  OG1 . THR B  1 63  ? 35.259 -32.888 -41.948  1.00 15.54 ? 63  THR B OG1 1 
ATOM   3060  C  CG2 . THR B  1 63  ? 33.979 -33.861 -43.758  1.00 15.41 ? 63  THR B CG2 1 
ATOM   3061  N  N   . ILE B  1 64  ? 31.667 -31.733 -44.398  1.00 15.18 ? 64  ILE B N   1 
ATOM   3062  C  CA  . ILE B  1 64  ? 30.418 -32.049 -45.053  1.00 13.39 ? 64  ILE B CA  1 
ATOM   3063  C  C   . ILE B  1 64  ? 30.687 -33.072 -46.146  1.00 12.83 ? 64  ILE B C   1 
ATOM   3064  O  O   . ILE B  1 64  ? 31.619 -32.926 -46.935  1.00 13.13 ? 64  ILE B O   1 
ATOM   3065  C  CB  . ILE B  1 64  ? 29.761 -30.785 -45.646  1.00 14.57 ? 64  ILE B CB  1 
ATOM   3066  C  CG1 . ILE B  1 64  ? 29.299 -29.849 -44.515  1.00 13.38 ? 64  ILE B CG1 1 
ATOM   3067  C  CG2 . ILE B  1 64  ? 28.590 -31.165 -46.539  1.00 11.57 ? 64  ILE B CG2 1 
ATOM   3068  C  CD1 . ILE B  1 64  ? 28.987 -28.439 -44.988  1.00 15.20 ? 64  ILE B CD1 1 
ATOM   3069  N  N   . VAL B  1 65  ? 29.872 -34.120 -46.174  1.00 13.42 ? 65  VAL B N   1 
ATOM   3070  C  CA  . VAL B  1 65  ? 29.956 -35.123 -47.224  1.00 13.35 ? 65  VAL B CA  1 
ATOM   3071  C  C   . VAL B  1 65  ? 28.832 -34.861 -48.226  1.00 14.93 ? 65  VAL B C   1 
ATOM   3072  O  O   . VAL B  1 65  ? 27.660 -34.848 -47.866  1.00 11.40 ? 65  VAL B O   1 
ATOM   3073  C  CB  . VAL B  1 65  ? 29.839 -36.543 -46.639  1.00 12.56 ? 65  VAL B CB  1 
ATOM   3074  C  CG1 . VAL B  1 65  ? 29.845 -37.589 -47.747  1.00 13.32 ? 65  VAL B CG1 1 
ATOM   3075  C  CG2 . VAL B  1 65  ? 30.979 -36.789 -45.651  1.00 12.48 ? 65  VAL B CG2 1 
ATOM   3076  N  N   . ASP B  1 66  ? 29.196 -34.633 -49.481  1.00 12.34 ? 66  ASP B N   1 
ATOM   3077  C  CA  . ASP B  1 66  ? 28.221 -34.194 -50.466  1.00 14.19 ? 66  ASP B CA  1 
ATOM   3078  C  C   . ASP B  1 66  ? 28.047 -35.257 -51.540  1.00 13.85 ? 66  ASP B C   1 
ATOM   3079  O  O   . ASP B  1 66  ? 28.895 -35.395 -52.412  1.00 13.30 ? 66  ASP B O   1 
ATOM   3080  C  CB  . ASP B  1 66  ? 28.669 -32.861 -51.076  1.00 15.13 ? 66  ASP B CB  1 
ATOM   3081  C  CG  . ASP B  1 66  ? 27.680 -32.318 -52.091  1.00 20.32 ? 66  ASP B CG  1 
ATOM   3082  O  OD1 . ASP B  1 66  ? 26.948 -33.124 -52.716  1.00 18.83 ? 66  ASP B OD1 1 
ATOM   3083  O  OD2 . ASP B  1 66  ? 27.648 -31.084 -52.274  1.00 18.57 ? 66  ASP B OD2 1 
ATOM   3084  N  N   . PRO B  1 67  ? 26.949 -36.025 -51.465  1.00 13.49 ? 67  PRO B N   1 
ATOM   3085  C  CA  . PRO B  1 67  ? 26.743 -37.133 -52.403  1.00 13.34 ? 67  PRO B CA  1 
ATOM   3086  C  C   . PRO B  1 67  ? 26.073 -36.724 -53.718  1.00 13.30 ? 67  PRO B C   1 
ATOM   3087  O  O   . PRO B  1 67  ? 25.289 -37.494 -54.291  1.00 14.00 ? 67  PRO B O   1 
ATOM   3088  C  CB  . PRO B  1 67  ? 25.848 -38.090 -51.614  1.00 13.15 ? 67  PRO B CB  1 
ATOM   3089  C  CG  . PRO B  1 67  ? 25.068 -37.198 -50.705  1.00 16.49 ? 67  PRO B CG  1 
ATOM   3090  C  CD  . PRO B  1 67  ? 25.981 -36.047 -50.351  1.00 12.92 ? 67  PRO B CD  1 
ATOM   3091  N  N   . THR B  1 68  ? 26.380 -35.526 -54.193  1.00 11.38 ? 68  THR B N   1 
ATOM   3092  C  CA  . THR B  1 68  ? 25.939 -35.098 -55.517  1.00 11.11 ? 68  THR B CA  1 
ATOM   3093  C  C   . THR B  1 68  ? 26.827 -35.803 -56.541  1.00 11.54 ? 68  THR B C   1 
ATOM   3094  O  O   . THR B  1 68  ? 28.050 -35.608 -56.547  1.00 12.25 ? 68  THR B O   1 
ATOM   3095  C  CB  . THR B  1 68  ? 26.079 -33.570 -55.680  1.00 11.94 ? 68  THR B CB  1 
ATOM   3096  O  OG1 . THR B  1 68  ? 25.435 -32.910 -54.581  1.00 14.80 ? 68  THR B OG1 1 
ATOM   3097  C  CG2 . THR B  1 68  ? 25.436 -33.096 -56.983  1.00 12.25 ? 68  THR B CG2 1 
ATOM   3098  N  N   . VAL B  1 69  ? 26.222 -36.640 -57.381  1.00 10.59 ? 69  VAL B N   1 
ATOM   3099  C  CA  . VAL B  1 69  ? 26.964 -37.385 -58.398  1.00 12.29 ? 69  VAL B CA  1 
ATOM   3100  C  C   . VAL B  1 69  ? 26.241 -37.315 -59.740  1.00 12.76 ? 69  VAL B C   1 
ATOM   3101  O  O   . VAL B  1 69  ? 25.333 -36.499 -59.913  1.00 14.13 ? 69  VAL B O   1 
ATOM   3102  C  CB  . VAL B  1 69  ? 27.179 -38.856 -57.978  1.00 16.03 ? 69  VAL B CB  1 
ATOM   3103  C  CG1 . VAL B  1 69  ? 28.047 -38.927 -56.729  1.00 15.74 ? 69  VAL B CG1 1 
ATOM   3104  C  CG2 . VAL B  1 69  ? 25.842 -39.544 -57.731  1.00 14.48 ? 69  VAL B CG2 1 
ATOM   3105  N  N   . MET B  1 70  ? 26.641 -38.150 -60.696  1.00 10.78 ? 70  MET B N   1 
ATOM   3106  C  CA  . MET B  1 70  ? 25.979 -38.143 -61.999  1.00 12.15 ? 70  MET B CA  1 
ATOM   3107  C  C   . MET B  1 70  ? 24.485 -38.327 -61.819  1.00 13.59 ? 70  MET B C   1 
ATOM   3108  O  O   . MET B  1 70  ? 24.050 -39.280 -61.171  1.00 13.99 ? 70  MET B O   1 
ATOM   3109  C  CB  . MET B  1 70  ? 26.506 -39.251 -62.923  1.00 12.90 ? 70  MET B CB  1 
ATOM   3110  C  CG  . MET B  1 70  ? 26.082 -39.071 -64.385  1.00 14.78 ? 70  MET B CG  1 
ATOM   3111  S  SD  . MET B  1 70  ? 25.332 -40.543 -65.125  1.00 16.51 ? 70  MET B SD  1 
ATOM   3112  C  CE  . MET B  1 70  ? 23.668 -40.442 -64.458  1.00 17.94 ? 70  MET B CE  1 
ATOM   3113  N  N   . GLY B  1 71  ? 23.701 -37.430 -62.413  1.00 11.35 ? 71  GLY B N   1 
ATOM   3114  C  CA  . GLY B  1 71  ? 22.254 -37.480 -62.256  1.00 13.10 ? 71  GLY B CA  1 
ATOM   3115  C  C   . GLY B  1 71  ? 21.754 -36.390 -61.318  1.00 13.50 ? 71  GLY B C   1 
ATOM   3116  O  O   . GLY B  1 71  ? 20.567 -36.061 -61.319  1.00 14.57 ? 71  GLY B O   1 
ATOM   3117  N  N   . LEU B  1 72  ? 22.661 -35.831 -60.516  1.00 12.31 ? 72  LEU B N   1 
ATOM   3118  C  CA  . LEU B  1 72  ? 22.305 -34.757 -59.582  1.00 12.62 ? 72  LEU B CA  1 
ATOM   3119  C  C   . LEU B  1 72  ? 23.097 -33.484 -59.857  1.00 12.51 ? 72  LEU B C   1 
ATOM   3120  O  O   . LEU B  1 72  ? 22.989 -32.503 -59.112  1.00 12.89 ? 72  LEU B O   1 
ATOM   3121  C  CB  . LEU B  1 72  ? 22.532 -35.192 -58.128  1.00 12.74 ? 72  LEU B CB  1 
ATOM   3122  C  CG  . LEU B  1 72  ? 21.685 -36.347 -57.571  1.00 13.09 ? 72  LEU B CG  1 
ATOM   3123  C  CD1 . LEU B  1 72  ? 22.153 -36.706 -56.163  1.00 12.84 ? 72  LEU B CD1 1 
ATOM   3124  C  CD2 . LEU B  1 72  ? 20.209 -35.981 -57.566  1.00 14.47 ? 72  LEU B CD2 1 
ATOM   3125  N  N   . GLY B  1 73  ? 23.899 -33.505 -60.918  1.00 12.32 ? 73  GLY B N   1 
ATOM   3126  C  CA  . GLY B  1 73  ? 24.635 -32.318 -61.335  1.00 13.21 ? 73  GLY B CA  1 
ATOM   3127  C  C   . GLY B  1 73  ? 25.911 -32.023 -60.569  1.00 15.29 ? 73  GLY B C   1 
ATOM   3128  O  O   . GLY B  1 73  ? 26.219 -30.865 -60.302  1.00 16.16 ? 73  GLY B O   1 
ATOM   3129  N  N   . ARG B  1 74  ? 26.668 -33.064 -60.229  1.00 14.25 ? 74  ARG B N   1 
ATOM   3130  C  CA  . ARG B  1 74  ? 27.965 -32.884 -59.584  1.00 12.10 ? 74  ARG B CA  1 
ATOM   3131  C  C   . ARG B  1 74  ? 28.831 -31.921 -60.388  1.00 13.40 ? 74  ARG B C   1 
ATOM   3132  O  O   . ARG B  1 74  ? 28.952 -32.047 -61.608  1.00 12.44 ? 74  ARG B O   1 
ATOM   3133  C  CB  . ARG B  1 74  ? 28.701 -34.224 -59.443  1.00 12.31 ? 74  ARG B CB  1 
ATOM   3134  C  CG  . ARG B  1 74  ? 30.060 -34.109 -58.758  1.00 11.68 ? 74  ARG B CG  1 
ATOM   3135  C  CD  . ARG B  1 74  ? 30.800 -35.447 -58.733  1.00 13.75 ? 74  ARG B CD  1 
ATOM   3136  N  NE  . ARG B  1 74  ? 31.060 -35.975 -60.073  1.00 13.55 ? 74  ARG B NE  1 
ATOM   3137  C  CZ  . ARG B  1 74  ? 31.798 -37.055 -60.318  1.00 15.51 ? 74  ARG B CZ  1 
ATOM   3138  N  NH1 . ARG B  1 74  ? 32.356 -37.717 -59.311  1.00 11.65 ? 74  ARG B NH1 1 
ATOM   3139  N  NH2 . ARG B  1 74  ? 31.983 -37.469 -61.570  1.00 13.44 ? 74  ARG B NH2 1 
ATOM   3140  N  N   . ASP B  1 75  ? 29.440 -30.967 -59.696  1.00 13.42 ? 75  ASP B N   1 
ATOM   3141  C  CA  . ASP B  1 75  ? 30.306 -29.986 -60.346  1.00 16.04 ? 75  ASP B CA  1 
ATOM   3142  C  C   . ASP B  1 75  ? 31.471 -29.697 -59.404  1.00 17.35 ? 75  ASP B C   1 
ATOM   3143  O  O   . ASP B  1 75  ? 31.349 -28.899 -58.468  1.00 14.03 ? 75  ASP B O   1 
ATOM   3144  C  CB  . ASP B  1 75  ? 29.514 -28.711 -60.641  1.00 16.68 ? 75  ASP B CB  1 
ATOM   3145  C  CG  . ASP B  1 75  ? 30.308 -27.683 -61.440  1.00 20.33 ? 75  ASP B CG  1 
ATOM   3146  O  OD1 . ASP B  1 75  ? 29.679 -26.803 -62.054  1.00 32.48 ? 75  ASP B OD1 1 
ATOM   3147  O  OD2 . ASP B  1 75  ? 31.544 -27.726 -61.444  1.00 18.97 ? 75  ASP B OD2 1 
ATOM   3148  N  N   . ILE B  1 76  ? 32.592 -30.368 -59.642  1.00 14.85 ? 76  ILE B N   1 
ATOM   3149  C  CA  . ILE B  1 76  ? 33.728 -30.311 -58.715  1.00 15.34 ? 76  ILE B CA  1 
ATOM   3150  C  C   . ILE B  1 76  ? 34.318 -28.900 -58.631  1.00 15.52 ? 76  ILE B C   1 
ATOM   3151  O  O   . ILE B  1 76  ? 34.856 -28.500 -57.596  1.00 14.72 ? 76  ILE B O   1 
ATOM   3152  C  CB  . ILE B  1 76  ? 34.827 -31.336 -59.099  1.00 15.25 ? 76  ILE B CB  1 
ATOM   3153  C  CG1 . ILE B  1 76  ? 35.737 -31.629 -57.901  1.00 14.86 ? 76  ILE B CG1 1 
ATOM   3154  C  CG2 . ILE B  1 76  ? 35.640 -30.845 -60.297  1.00 13.62 ? 76  ILE B CG2 1 
ATOM   3155  C  CD1 . ILE B  1 76  ? 35.015 -32.274 -56.731  1.00 14.88 ? 76  ILE B CD1 1 
ATOM   3156  N  N   . ARG B  1 77  ? 34.182 -28.139 -59.714  1.00 17.25 ? 77  ARG B N   1 
ATOM   3157  C  CA  . ARG B  1 77  ? 34.714 -26.775 -59.758  1.00 18.73 ? 77  ARG B CA  1 
ATOM   3158  C  C   . ARG B  1 77  ? 33.898 -25.804 -58.908  1.00 17.53 ? 77  ARG B C   1 
ATOM   3159  O  O   . ARG B  1 77  ? 34.462 -24.942 -58.225  1.00 17.08 ? 77  ARG B O   1 
ATOM   3160  C  CB  . ARG B  1 77  ? 34.846 -26.294 -61.211  1.00 18.80 ? 77  ARG B CB  1 
ATOM   3161  C  CG  . ARG B  1 77  ? 36.033 -26.942 -61.914  1.00 20.84 ? 77  ARG B CG  1 
ATOM   3162  C  CD  . ARG B  1 77  ? 36.028 -26.719 -63.420  1.00 21.07 ? 77  ARG B CD  1 
ATOM   3163  N  NE  . ARG B  1 77  ? 37.138 -27.430 -64.061  1.00 19.74 ? 77  ARG B NE  1 
ATOM   3164  C  CZ  . ARG B  1 77  ? 37.163 -28.739 -64.312  1.00 20.28 ? 77  ARG B CZ  1 
ATOM   3165  N  NH1 . ARG B  1 77  ? 36.128 -29.514 -63.994  1.00 16.89 ? 77  ARG B NH1 1 
ATOM   3166  N  NH2 . ARG B  1 77  ? 38.225 -29.278 -64.899  1.00 19.42 ? 77  ARG B NH2 1 
ATOM   3167  N  N   . PHE B  1 78  ? 32.576 -25.952 -58.948  1.00 14.72 ? 78  PHE B N   1 
ATOM   3168  C  CA  . PHE B  1 78  ? 31.678 -25.219 -58.046  1.00 15.77 ? 78  PHE B CA  1 
ATOM   3169  C  C   . PHE B  1 78  ? 31.978 -25.553 -56.583  1.00 16.25 ? 78  PHE B C   1 
ATOM   3170  O  O   . PHE B  1 78  ? 32.067 -24.663 -55.741  1.00 16.04 ? 78  PHE B O   1 
ATOM   3171  C  CB  . PHE B  1 78  ? 30.222 -25.549 -58.370  1.00 16.22 ? 78  PHE B CB  1 
ATOM   3172  C  CG  . PHE B  1 78  ? 29.220 -24.841 -57.493  1.00 17.41 ? 78  PHE B CG  1 
ATOM   3173  C  CD1 . PHE B  1 78  ? 28.656 -25.489 -56.397  1.00 17.29 ? 78  PHE B CD1 1 
ATOM   3174  C  CD2 . PHE B  1 78  ? 28.824 -23.545 -57.774  1.00 17.19 ? 78  PHE B CD2 1 
ATOM   3175  C  CE1 . PHE B  1 78  ? 27.734 -24.847 -55.592  1.00 16.02 ? 78  PHE B CE1 1 
ATOM   3176  C  CE2 . PHE B  1 78  ? 27.896 -22.897 -56.973  1.00 18.61 ? 78  PHE B CE2 1 
ATOM   3177  C  CZ  . PHE B  1 78  ? 27.353 -23.550 -55.881  1.00 17.73 ? 78  PHE B CZ  1 
ATOM   3178  N  N   . MET B  1 79  ? 32.129 -26.844 -56.288  1.00 15.28 ? 79  MET B N   1 
ATOM   3179  C  CA  . MET B  1 79  ? 32.509 -27.290 -54.951  1.00 15.30 ? 79  MET B CA  1 
ATOM   3180  C  C   . MET B  1 79  ? 33.816 -26.632 -54.496  1.00 15.84 ? 79  MET B C   1 
ATOM   3181  O  O   . MET B  1 79  ? 33.911 -26.122 -53.379  1.00 17.92 ? 79  MET B O   1 
ATOM   3182  C  CB  . MET B  1 79  ? 32.621 -28.820 -54.923  1.00 15.51 ? 79  MET B CB  1 
ATOM   3183  C  CG  . MET B  1 79  ? 31.278 -29.531 -55.064  1.00 19.60 ? 79  MET B CG  1 
ATOM   3184  S  SD  . MET B  1 79  ? 31.454 -31.308 -55.359  1.00 22.30 ? 79  MET B SD  1 
ATOM   3185  C  CE  . MET B  1 79  ? 30.020 -31.958 -54.514  1.00 30.96 ? 79  MET B CE  1 
ATOM   3186  N  N   . GLU B  1 80  ? 34.812 -26.613 -55.376  1.00 16.62 ? 80  GLU B N   1 
ATOM   3187  C  CA  . GLU B  1 80  ? 36.089 -25.970 -55.068  1.00 19.01 ? 80  GLU B CA  1 
ATOM   3188  C  C   . GLU B  1 80  ? 35.922 -24.514 -54.678  1.00 17.06 ? 80  GLU B C   1 
ATOM   3189  O  O   . GLU B  1 80  ? 36.548 -24.051 -53.724  1.00 17.94 ? 80  GLU B O   1 
ATOM   3190  C  CB  . GLU B  1 80  ? 37.040 -26.032 -56.260  1.00 23.29 ? 80  GLU B CB  1 
ATOM   3191  C  CG  . GLU B  1 80  ? 37.742 -27.355 -56.448  1.00 29.75 ? 80  GLU B CG  1 
ATOM   3192  C  CD  . GLU B  1 80  ? 38.640 -27.347 -57.672  1.00 42.10 ? 80  GLU B CD  1 
ATOM   3193  O  OE1 . GLU B  1 80  ? 38.255 -26.738 -58.695  1.00 38.69 ? 80  GLU B OE1 1 
ATOM   3194  O  OE2 . GLU B  1 80  ? 39.729 -27.948 -57.611  1.00 40.12 ? 80  GLU B OE2 1 
ATOM   3195  N  N   . LYS B  1 81  ? 35.104 -23.787 -55.433  1.00 17.39 ? 81  LYS B N   1 
ATOM   3196  C  CA  . LYS B  1 81  ? 34.845 -22.378 -55.139  1.00 20.08 ? 81  LYS B CA  1 
ATOM   3197  C  C   . LYS B  1 81  ? 34.263 -22.216 -53.738  1.00 16.43 ? 81  LYS B C   1 
ATOM   3198  O  O   . LYS B  1 81  ? 34.646 -21.321 -52.988  1.00 16.51 ? 81  LYS B O   1 
ATOM   3199  C  CB  . LYS B  1 81  ? 33.887 -21.776 -56.168  1.00 22.37 ? 81  LYS B CB  1 
ATOM   3200  C  CG  . LYS B  1 81  ? 34.509 -21.536 -57.532  1.00 32.88 ? 81  LYS B CG  1 
ATOM   3201  C  CD  . LYS B  1 81  ? 33.480 -20.966 -58.493  1.00 36.45 ? 81  LYS B CD  1 
ATOM   3202  C  CE  . LYS B  1 81  ? 34.072 -20.739 -59.875  1.00 47.15 ? 81  LYS B CE  1 
ATOM   3203  N  NZ  . LYS B  1 81  ? 33.015 -20.326 -60.840  1.00 49.11 ? 81  LYS B NZ  1 
ATOM   3204  N  N   . VAL B  1 82  ? 33.330 -23.086 -53.388  1.00 16.41 ? 82  VAL B N   1 
ATOM   3205  C  CA  . VAL B  1 82  ? 32.699 -23.013 -52.075  1.00 16.38 ? 82  VAL B CA  1 
ATOM   3206  C  C   . VAL B  1 82  ? 33.713 -23.312 -50.968  1.00 16.55 ? 82  VAL B C   1 
ATOM   3207  O  O   . VAL B  1 82  ? 33.742 -22.639 -49.933  1.00 18.66 ? 82  VAL B O   1 
ATOM   3208  C  CB  . VAL B  1 82  ? 31.470 -23.933 -51.998  1.00 15.63 ? 82  VAL B CB  1 
ATOM   3209  C  CG1 . VAL B  1 82  ? 30.917 -23.978 -50.577  1.00 15.46 ? 82  VAL B CG1 1 
ATOM   3210  C  CG2 . VAL B  1 82  ? 30.403 -23.440 -52.971  1.00 14.93 ? 82  VAL B CG2 1 
ATOM   3211  N  N   . VAL B  1 83  ? 34.563 -24.309 -51.191  1.00 16.20 ? 83  VAL B N   1 
ATOM   3212  C  CA  . VAL B  1 83  ? 35.610 -24.614 -50.227  1.00 16.50 ? 83  VAL B CA  1 
ATOM   3213  C  C   . VAL B  1 83  ? 36.540 -23.418 -50.042  1.00 19.02 ? 83  VAL B C   1 
ATOM   3214  O  O   . VAL B  1 83  ? 36.888 -23.060 -48.913  1.00 18.43 ? 83  VAL B O   1 
ATOM   3215  C  CB  . VAL B  1 83  ? 36.427 -25.859 -50.629  1.00 16.65 ? 83  VAL B CB  1 
ATOM   3216  C  CG1 . VAL B  1 83  ? 37.662 -25.991 -49.744  1.00 16.36 ? 83  VAL B CG1 1 
ATOM   3217  C  CG2 . VAL B  1 83  ? 35.561 -27.113 -50.537  1.00 14.55 ? 83  VAL B CG2 1 
ATOM   3218  N  N   . LYS B  1 84  ? 36.933 -22.793 -51.149  1.00 18.10 ? 84  LYS B N   1 
ATOM   3219  C  CA  . LYS B  1 84  ? 37.827 -21.643 -51.088  1.00 21.14 ? 84  LYS B CA  1 
ATOM   3220  C  C   . LYS B  1 84  ? 37.203 -20.494 -50.306  1.00 21.65 ? 84  LYS B C   1 
ATOM   3221  O  O   . LYS B  1 84  ? 37.904 -19.722 -49.656  1.00 22.41 ? 84  LYS B O   1 
ATOM   3222  C  CB  . LYS B  1 84  ? 38.198 -21.163 -52.491  1.00 23.41 ? 84  LYS B CB  1 
ATOM   3223  C  CG  . LYS B  1 84  ? 39.281 -21.989 -53.159  1.00 32.43 ? 84  LYS B CG  1 
ATOM   3224  C  CD  . LYS B  1 84  ? 39.886 -21.239 -54.333  1.00 36.66 ? 84  LYS B CD  1 
ATOM   3225  C  CE  . LYS B  1 84  ? 40.694 -22.162 -55.229  1.00 40.75 ? 84  LYS B CE  1 
ATOM   3226  N  NZ  . LYS B  1 84  ? 41.137 -21.453 -56.464  1.00 44.18 ? 84  LYS B NZ  1 
ATOM   3227  N  N   . ALA B  1 85  ? 35.882 -20.382 -50.376  1.00 19.91 ? 85  ALA B N   1 
ATOM   3228  C  CA  . ALA B  1 85  ? 35.185 -19.279 -49.732  1.00 22.31 ? 85  ALA B CA  1 
ATOM   3229  C  C   . ALA B  1 85  ? 34.849 -19.557 -48.266  1.00 22.58 ? 85  ALA B C   1 
ATOM   3230  O  O   . ALA B  1 85  ? 34.495 -18.638 -47.528  1.00 23.82 ? 85  ALA B O   1 
ATOM   3231  C  CB  . ALA B  1 85  ? 33.924 -18.930 -50.504  1.00 19.88 ? 85  ALA B CB  1 
ATOM   3232  N  N   . THR B  1 86  ? 34.953 -20.815 -47.839  1.00 20.11 ? 86  THR B N   1 
ATOM   3233  C  CA  . THR B  1 86  ? 34.483 -21.178 -46.503  1.00 18.21 ? 86  THR B CA  1 
ATOM   3234  C  C   . THR B  1 86  ? 35.517 -21.876 -45.626  1.00 19.67 ? 86  THR B C   1 
ATOM   3235  O  O   . THR B  1 86  ? 35.468 -21.758 -44.404  1.00 20.10 ? 86  THR B O   1 
ATOM   3236  C  CB  . THR B  1 86  ? 33.240 -22.086 -46.557  1.00 17.08 ? 86  THR B CB  1 
ATOM   3237  O  OG1 . THR B  1 86  ? 33.574 -23.312 -47.226  1.00 17.48 ? 86  THR B OG1 1 
ATOM   3238  C  CG2 . THR B  1 86  ? 32.086 -21.393 -47.282  1.00 16.82 ? 86  THR B CG2 1 
ATOM   3239  N  N   . GLY B  1 87  ? 36.430 -22.625 -46.237  1.00 19.75 ? 87  GLY B N   1 
ATOM   3240  C  CA  . GLY B  1 87  ? 37.381 -23.432 -45.463  1.00 18.58 ? 87  GLY B CA  1 
ATOM   3241  C  C   . GLY B  1 87  ? 36.814 -24.753 -44.944  1.00 18.92 ? 87  GLY B C   1 
ATOM   3242  O  O   . GLY B  1 87  ? 37.463 -25.447 -44.161  1.00 18.21 ? 87  GLY B O   1 
ATOM   3243  N  N   . ILE B  1 88  ? 35.612 -25.117 -45.386  1.00 17.00 ? 88  ILE B N   1 
ATOM   3244  C  CA  . ILE B  1 88  ? 34.996 -26.392 -44.985  1.00 15.55 ? 88  ILE B CA  1 
ATOM   3245  C  C   . ILE B  1 88  ? 35.793 -27.578 -45.521  1.00 16.71 ? 88  ILE B C   1 
ATOM   3246  O  O   . ILE B  1 88  ? 36.373 -27.498 -46.605  1.00 17.00 ? 88  ILE B O   1 
ATOM   3247  C  CB  . ILE B  1 88  ? 33.552 -26.508 -45.518  1.00 13.93 ? 88  ILE B CB  1 
ATOM   3248  C  CG1 . ILE B  1 88  ? 32.799 -27.664 -44.844  1.00 15.62 ? 88  ILE B CG1 1 
ATOM   3249  C  CG2 . ILE B  1 88  ? 33.547 -26.696 -47.035  1.00 12.53 ? 88  ILE B CG2 1 
ATOM   3250  C  CD1 . ILE B  1 88  ? 32.479 -27.424 -43.378  1.00 13.63 ? 88  ILE B CD1 1 
ATOM   3251  N  N   . ASN B  1 89  ? 35.840 -28.669 -44.759  1.00 16.53 ? 89  ASN B N   1 
ATOM   3252  C  CA  . ASN B  1 89  ? 36.289 -29.946 -45.313  1.00 16.94 ? 89  ASN B CA  1 
ATOM   3253  C  C   . ASN B  1 89  ? 35.123 -30.530 -46.111  1.00 14.64 ? 89  ASN B C   1 
ATOM   3254  O  O   . ASN B  1 89  ? 34.059 -30.794 -45.552  1.00 15.76 ? 89  ASN B O   1 
ATOM   3255  C  CB  . ASN B  1 89  ? 36.660 -30.946 -44.214  1.00 15.26 ? 89  ASN B CB  1 
ATOM   3256  C  CG  . ASN B  1 89  ? 37.953 -30.609 -43.503  1.00 16.77 ? 89  ASN B CG  1 
ATOM   3257  O  OD1 . ASN B  1 89  ? 38.786 -29.837 -43.996  1.00 15.84 ? 89  ASN B OD1 1 
ATOM   3258  N  ND2 . ASN B  1 89  ? 38.135 -31.209 -42.324  1.00 15.45 ? 89  ASN B ND2 1 
ATOM   3259  N  N   . LEU B  1 90  ? 35.314 -30.729 -47.409  1.00 14.89 ? 90  LEU B N   1 
ATOM   3260  C  CA  . LEU B  1 90  ? 34.245 -31.247 -48.263  1.00 13.57 ? 90  LEU B CA  1 
ATOM   3261  C  C   . LEU B  1 90  ? 34.667 -32.547 -48.932  1.00 14.63 ? 90  LEU B C   1 
ATOM   3262  O  O   . LEU B  1 90  ? 35.680 -32.591 -49.640  1.00 14.89 ? 90  LEU B O   1 
ATOM   3263  C  CB  . LEU B  1 90  ? 33.892 -30.215 -49.334  1.00 12.98 ? 90  LEU B CB  1 
ATOM   3264  C  CG  . LEU B  1 90  ? 32.711 -30.499 -50.270  1.00 15.11 ? 90  LEU B CG  1 
ATOM   3265  C  CD1 . LEU B  1 90  ? 31.388 -30.463 -49.519  1.00 14.52 ? 90  LEU B CD1 1 
ATOM   3266  C  CD2 . LEU B  1 90  ? 32.713 -29.493 -51.415  1.00 14.49 ? 90  LEU B CD2 1 
ATOM   3267  N  N   . VAL B  1 91  ? 33.888 -33.604 -48.711  1.00 14.46 ? 91  VAL B N   1 
ATOM   3268  C  CA  . VAL B  1 91  ? 34.162 -34.891 -49.338  1.00 13.96 ? 91  VAL B CA  1 
ATOM   3269  C  C   . VAL B  1 91  ? 33.215 -35.066 -50.508  1.00 13.12 ? 91  VAL B C   1 
ATOM   3270  O  O   . VAL B  1 91  ? 31.995 -35.113 -50.325  1.00 11.84 ? 91  VAL B O   1 
ATOM   3271  C  CB  . VAL B  1 91  ? 33.957 -36.076 -48.373  1.00 14.31 ? 91  VAL B CB  1 
ATOM   3272  C  CG1 . VAL B  1 91  ? 34.462 -37.361 -49.014  1.00 13.85 ? 91  VAL B CG1 1 
ATOM   3273  C  CG2 . VAL B  1 91  ? 34.667 -35.822 -47.044  1.00 14.67 ? 91  VAL B CG2 1 
ATOM   3274  N  N   . ALA B  1 92  ? 33.786 -35.130 -51.708  1.00 13.85 ? 92  ALA B N   1 
ATOM   3275  C  CA  . ALA B  1 92  ? 33.013 -35.354 -52.921  1.00 14.61 ? 92  ALA B CA  1 
ATOM   3276  C  C   . ALA B  1 92  ? 33.022 -36.841 -53.227  1.00 14.38 ? 92  ALA B C   1 
ATOM   3277  O  O   . ALA B  1 92  ? 33.900 -37.576 -52.772  1.00 13.78 ? 92  ALA B O   1 
ATOM   3278  C  CB  . ALA B  1 92  ? 33.598 -34.560 -54.083  1.00 13.63 ? 92  ALA B CB  1 
ATOM   3279  N  N   . GLY B  1 93  ? 32.038 -37.285 -53.994  1.00 13.63 ? 93  GLY B N   1 
ATOM   3280  C  CA  . GLY B  1 93  ? 31.932 -38.690 -54.322  1.00 13.50 ? 93  GLY B CA  1 
ATOM   3281  C  C   . GLY B  1 93  ? 31.820 -38.928 -55.811  1.00 14.43 ? 93  GLY B C   1 
ATOM   3282  O  O   . GLY B  1 93  ? 31.830 -37.989 -56.614  1.00 12.97 ? 93  GLY B O   1 
ATOM   3283  N  N   . THR B  1 94  ? 31.726 -40.199 -56.170  1.00 11.92 ? 94  THR B N   1 
ATOM   3284  C  CA  . THR B  1 94  ? 31.438 -40.601 -57.528  1.00 12.68 ? 94  THR B CA  1 
ATOM   3285  C  C   . THR B  1 94  ? 30.252 -41.542 -57.424  1.00 13.44 ? 94  THR B C   1 
ATOM   3286  O  O   . THR B  1 94  ? 29.785 -41.837 -56.322  1.00 13.14 ? 94  THR B O   1 
ATOM   3287  C  CB  . THR B  1 94  ? 32.635 -41.317 -58.181  1.00 12.66 ? 94  THR B CB  1 
ATOM   3288  O  OG1 . THR B  1 94  ? 32.342 -41.586 -59.558  1.00 13.61 ? 94  THR B OG1 1 
ATOM   3289  C  CG2 . THR B  1 94  ? 32.960 -42.640 -57.457  1.00 12.18 ? 94  THR B CG2 1 
ATOM   3290  N  N   . GLY B  1 95  ? 29.750 -41.985 -58.568  1.00 16.55 ? 95  GLY B N   1 
ATOM   3291  C  CA  . GLY B  1 95  ? 28.600 -42.873 -58.597  1.00 15.60 ? 95  GLY B CA  1 
ATOM   3292  C  C   . GLY B  1 95  ? 27.593 -42.428 -59.633  1.00 13.84 ? 95  GLY B C   1 
ATOM   3293  O  O   . GLY B  1 95  ? 27.868 -41.541 -60.447  1.00 13.71 ? 95  GLY B O   1 
ATOM   3294  N  N   . ILE B  1 96  ? 26.426 -43.058 -59.597  1.00 12.15 ? 96  ILE B N   1 
ATOM   3295  C  CA  . ILE B  1 96  ? 25.359 -42.760 -60.532  1.00 15.27 ? 96  ILE B CA  1 
ATOM   3296  C  C   . ILE B  1 96  ? 24.041 -42.790 -59.786  1.00 14.49 ? 96  ILE B C   1 
ATOM   3297  O  O   . ILE B  1 96  ? 23.762 -43.718 -59.028  1.00 17.42 ? 96  ILE B O   1 
ATOM   3298  C  CB  . ILE B  1 96  ? 25.312 -43.783 -61.675  1.00 15.67 ? 96  ILE B CB  1 
ATOM   3299  C  CG1 . ILE B  1 96  ? 26.489 -43.568 -62.628  1.00 14.51 ? 96  ILE B CG1 1 
ATOM   3300  C  CG2 . ILE B  1 96  ? 23.992 -43.680 -62.438  1.00 16.42 ? 96  ILE B CG2 1 
ATOM   3301  C  CD1 . ILE B  1 96  ? 26.642 -44.686 -63.644  1.00 17.14 ? 96  ILE B CD1 1 
ATOM   3302  N  N   . TYR B  1 97  ? 23.236 -41.764 -60.012  1.00 15.63 ? 97  TYR B N   1 
ATOM   3303  C  CA  . TYR B  1 97  ? 21.932 -41.648 -59.386  1.00 14.22 ? 97  TYR B CA  1 
ATOM   3304  C  C   . TYR B  1 97  ? 20.864 -41.803 -60.465  1.00 17.07 ? 97  TYR B C   1 
ATOM   3305  O  O   . TYR B  1 97  ? 20.661 -40.894 -61.277  1.00 15.05 ? 97  TYR B O   1 
ATOM   3306  C  CB  . TYR B  1 97  ? 21.838 -40.266 -58.754  1.00 14.43 ? 97  TYR B CB  1 
ATOM   3307  C  CG  . TYR B  1 97  ? 20.624 -39.988 -57.914  1.00 15.22 ? 97  TYR B CG  1 
ATOM   3308  C  CD1 . TYR B  1 97  ? 19.420 -39.631 -58.497  1.00 18.44 ? 97  TYR B CD1 1 
ATOM   3309  C  CD2 . TYR B  1 97  ? 20.702 -40.005 -56.523  1.00 19.11 ? 97  TYR B CD2 1 
ATOM   3310  C  CE1 . TYR B  1 97  ? 18.313 -39.333 -57.725  1.00 20.46 ? 97  TYR B CE1 1 
ATOM   3311  C  CE2 . TYR B  1 97  ? 19.603 -39.705 -55.743  1.00 19.89 ? 97  TYR B CE2 1 
ATOM   3312  C  CZ  . TYR B  1 97  ? 18.409 -39.374 -56.348  1.00 20.71 ? 97  TYR B CZ  1 
ATOM   3313  O  OH  . TYR B  1 97  ? 17.310 -39.068 -55.573  1.00 24.58 ? 97  TYR B OH  1 
ATOM   3314  N  N   . ILE B  1 98  ? 20.195 -42.954 -60.476  1.00 15.01 ? 98  ILE B N   1 
ATOM   3315  C  CA  . ILE B  1 98  ? 19.085 -43.205 -61.392  1.00 15.44 ? 98  ILE B CA  1 
ATOM   3316  C  C   . ILE B  1 98  ? 17.990 -43.970 -60.653  1.00 18.17 ? 98  ILE B C   1 
ATOM   3317  O  O   . ILE B  1 98  ? 18.264 -44.624 -59.641  1.00 17.75 ? 98  ILE B O   1 
ATOM   3318  C  CB  . ILE B  1 98  ? 19.522 -44.056 -62.603  1.00 15.13 ? 98  ILE B CB  1 
ATOM   3319  C  CG1 . ILE B  1 98  ? 20.171 -45.365 -62.118  1.00 17.10 ? 98  ILE B CG1 1 
ATOM   3320  C  CG2 . ILE B  1 98  ? 20.452 -43.268 -63.513  1.00 13.78 ? 98  ILE B CG2 1 
ATOM   3321  C  CD1 . ILE B  1 98  ? 20.150 -46.492 -63.144  1.00 18.03 ? 98  ILE B CD1 1 
ATOM   3322  N  N   . TYR B  1 99  ? 16.757 -43.885 -61.147  1.00 18.34 ? 99  TYR B N   1 
ATOM   3323  C  CA  . TYR B  1 99  ? 15.643 -44.625 -60.538  1.00 17.79 ? 99  TYR B CA  1 
ATOM   3324  C  C   . TYR B  1 99  ? 15.182 -45.790 -61.412  1.00 19.98 ? 99  TYR B C   1 
ATOM   3325  O  O   . TYR B  1 99  ? 14.650 -46.777 -60.907  1.00 20.31 ? 99  TYR B O   1 
ATOM   3326  C  CB  . TYR B  1 99  ? 14.442 -43.715 -60.260  1.00 20.70 ? 99  TYR B CB  1 
ATOM   3327  C  CG  . TYR B  1 99  ? 14.619 -42.677 -59.167  1.00 23.02 ? 99  TYR B CG  1 
ATOM   3328  C  CD1 . TYR B  1 99  ? 15.772 -42.628 -58.385  1.00 22.10 ? 99  TYR B CD1 1 
ATOM   3329  C  CD2 . TYR B  1 99  ? 13.604 -41.766 -58.893  1.00 29.91 ? 99  TYR B CD2 1 
ATOM   3330  C  CE1 . TYR B  1 99  ? 15.916 -41.676 -57.387  1.00 23.41 ? 99  TYR B CE1 1 
ATOM   3331  C  CE2 . TYR B  1 99  ? 13.739 -40.816 -57.897  1.00 28.69 ? 99  TYR B CE2 1 
ATOM   3332  C  CZ  . TYR B  1 99  ? 14.894 -40.773 -57.147  1.00 27.05 ? 99  TYR B CZ  1 
ATOM   3333  O  OH  . TYR B  1 99  ? 15.018 -39.817 -56.156  1.00 28.03 ? 99  TYR B OH  1 
ATOM   3334  N  N   . ILE B  1 100 ? 15.369 -45.667 -62.723  1.00 19.22 ? 100 ILE B N   1 
ATOM   3335  C  CA  . ILE B  1 100 ? 14.891 -46.690 -63.654  1.00 20.16 ? 100 ILE B CA  1 
ATOM   3336  C  C   . ILE B  1 100 ? 16.010 -47.194 -64.562  1.00 19.68 ? 100 ILE B C   1 
ATOM   3337  O  O   . ILE B  1 100 ? 16.565 -48.268 -64.333  1.00 21.35 ? 100 ILE B O   1 
ATOM   3338  C  CB  . ILE B  1 100 ? 13.713 -46.177 -64.513  1.00 22.85 ? 100 ILE B CB  1 
ATOM   3339  C  CG1 . ILE B  1 100 ? 12.608 -45.615 -63.620  1.00 26.64 ? 100 ILE B CG1 1 
ATOM   3340  C  CG2 . ILE B  1 100 ? 13.165 -47.290 -65.405  1.00 21.62 ? 100 ILE B CG2 1 
ATOM   3341  C  CD1 . ILE B  1 100 ? 11.504 -44.913 -64.386  1.00 26.11 ? 100 ILE B CD1 1 
ATOM   3342  N  N   . ASP B  1 101 ? 16.343 -46.419 -65.587  1.00 18.33 ? 101 ASP B N   1 
ATOM   3343  C  CA  . ASP B  1 101 ? 17.350 -46.841 -66.559  1.00 19.30 ? 101 ASP B CA  1 
ATOM   3344  C  C   . ASP B  1 101 ? 18.572 -45.923 -66.558  1.00 16.71 ? 101 ASP B C   1 
ATOM   3345  O  O   . ASP B  1 101 ? 18.488 -44.752 -66.185  1.00 16.25 ? 101 ASP B O   1 
ATOM   3346  C  CB  . ASP B  1 101 ? 16.758 -46.880 -67.969  1.00 22.06 ? 101 ASP B CB  1 
ATOM   3347  C  CG  . ASP B  1 101 ? 15.760 -48.007 -68.161  1.00 32.88 ? 101 ASP B CG  1 
ATOM   3348  O  OD1 . ASP B  1 101 ? 15.668 -48.904 -67.293  1.00 38.21 ? 101 ASP B OD1 1 
ATOM   3349  O  OD2 . ASP B  1 101 ? 15.067 -47.996 -69.198  1.00 41.75 ? 101 ASP B OD2 1 
ATOM   3350  N  N   . LEU B  1 102 ? 19.702 -46.471 -66.987  1.00 15.78 ? 102 LEU B N   1 
ATOM   3351  C  CA  . LEU B  1 102 ? 20.925 -45.702 -67.185  1.00 16.01 ? 102 LEU B CA  1 
ATOM   3352  C  C   . LEU B  1 102 ? 20.794 -44.841 -68.432  1.00 15.99 ? 102 LEU B C   1 
ATOM   3353  O  O   . LEU B  1 102 ? 19.991 -45.148 -69.315  1.00 14.23 ? 102 LEU B O   1 
ATOM   3354  C  CB  . LEU B  1 102 ? 22.105 -46.660 -67.362  1.00 14.87 ? 102 LEU B CB  1 
ATOM   3355  C  CG  . LEU B  1 102 ? 22.658 -47.236 -66.055  1.00 15.10 ? 102 LEU B CG  1 
ATOM   3356  C  CD1 . LEU B  1 102 ? 23.328 -48.574 -66.313  1.00 17.25 ? 102 LEU B CD1 1 
ATOM   3357  C  CD2 . LEU B  1 102 ? 23.629 -46.246 -65.411  1.00 13.66 ? 102 LEU B CD2 1 
ATOM   3358  N  N   . PRO B  1 103 ? 21.589 -43.767 -68.516  1.00 14.64 ? 103 PRO B N   1 
ATOM   3359  C  CA  . PRO B  1 103 ? 21.665 -43.025 -69.769  1.00 14.73 ? 103 PRO B CA  1 
ATOM   3360  C  C   . PRO B  1 103 ? 22.011 -43.965 -70.937  1.00 18.55 ? 103 PRO B C   1 
ATOM   3361  O  O   . PRO B  1 103 ? 22.614 -45.027 -70.730  1.00 18.55 ? 103 PRO B O   1 
ATOM   3362  C  CB  . PRO B  1 103 ? 22.810 -42.036 -69.522  1.00 14.66 ? 103 PRO B CB  1 
ATOM   3363  C  CG  . PRO B  1 103 ? 22.849 -41.853 -68.037  1.00 14.31 ? 103 PRO B CG  1 
ATOM   3364  C  CD  . PRO B  1 103 ? 22.433 -43.180 -67.453  1.00 13.29 ? 103 PRO B CD  1 
ATOM   3365  N  N   . PHE B  1 104 ? 21.637 -43.575 -72.152  1.00 18.14 ? 104 PHE B N   1 
ATOM   3366  C  CA  . PHE B  1 104 ? 21.879 -44.400 -73.345  1.00 21.70 ? 104 PHE B CA  1 
ATOM   3367  C  C   . PHE B  1 104 ? 23.356 -44.743 -73.567  1.00 19.97 ? 104 PHE B C   1 
ATOM   3368  O  O   . PHE B  1 104 ? 23.670 -45.743 -74.205  1.00 19.01 ? 104 PHE B O   1 
ATOM   3369  C  CB  . PHE B  1 104 ? 21.309 -43.723 -74.599  1.00 23.74 ? 104 PHE B CB  1 
ATOM   3370  C  CG  . PHE B  1 104 ? 19.856 -43.360 -74.481  1.00 32.37 ? 104 PHE B CG  1 
ATOM   3371  C  CD1 . PHE B  1 104 ? 19.453 -42.031 -74.486  1.00 38.25 ? 104 PHE B CD1 1 
ATOM   3372  C  CD2 . PHE B  1 104 ? 18.887 -44.349 -74.354  1.00 37.54 ? 104 PHE B CD2 1 
ATOM   3373  C  CE1 . PHE B  1 104 ? 18.112 -41.695 -74.377  1.00 39.76 ? 104 PHE B CE1 1 
ATOM   3374  C  CE2 . PHE B  1 104 ? 17.546 -44.019 -74.243  1.00 36.89 ? 104 PHE B CE2 1 
ATOM   3375  C  CZ  . PHE B  1 104 ? 17.157 -42.691 -74.255  1.00 34.66 ? 104 PHE B CZ  1 
ATOM   3376  N  N   . TYR B  1 105 ? 24.256 -43.905 -73.057  1.00 17.70 ? 105 TYR B N   1 
ATOM   3377  C  CA  . TYR B  1 105 ? 25.687 -44.197 -73.124  1.00 18.00 ? 105 TYR B CA  1 
ATOM   3378  C  C   . TYR B  1 105 ? 25.981 -45.655 -72.754  1.00 19.11 ? 105 TYR B C   1 
ATOM   3379  O  O   . TYR B  1 105 ? 26.810 -46.319 -73.379  1.00 17.94 ? 105 TYR B O   1 
ATOM   3380  C  CB  . TYR B  1 105 ? 26.472 -43.272 -72.186  1.00 17.59 ? 105 TYR B CB  1 
ATOM   3381  C  CG  . TYR B  1 105 ? 27.924 -43.673 -72.071  1.00 19.28 ? 105 TYR B CG  1 
ATOM   3382  C  CD1 . TYR B  1 105 ? 28.847 -43.287 -73.039  1.00 18.19 ? 105 TYR B CD1 1 
ATOM   3383  C  CD2 . TYR B  1 105 ? 28.368 -44.471 -71.019  1.00 19.48 ? 105 TYR B CD2 1 
ATOM   3384  C  CE1 . TYR B  1 105 ? 30.170 -43.673 -72.960  1.00 18.31 ? 105 TYR B CE1 1 
ATOM   3385  C  CE2 . TYR B  1 105 ? 29.694 -44.861 -70.930  1.00 18.42 ? 105 TYR B CE2 1 
ATOM   3386  C  CZ  . TYR B  1 105 ? 30.591 -44.458 -71.903  1.00 21.10 ? 105 TYR B CZ  1 
ATOM   3387  O  OH  . TYR B  1 105 ? 31.917 -44.835 -71.829  1.00 23.31 ? 105 TYR B OH  1 
ATOM   3388  N  N   . PHE B  1 106 ? 25.299 -46.144 -71.725  1.00 17.46 ? 106 PHE B N   1 
ATOM   3389  C  CA  . PHE B  1 106 ? 25.610 -47.442 -71.139  1.00 17.94 ? 106 PHE B CA  1 
ATOM   3390  C  C   . PHE B  1 106 ? 24.979 -48.627 -71.857  1.00 18.92 ? 106 PHE B C   1 
ATOM   3391  O  O   . PHE B  1 106 ? 25.136 -49.766 -71.425  1.00 19.43 ? 106 PHE B O   1 
ATOM   3392  C  CB  . PHE B  1 106 ? 25.223 -47.454 -69.660  1.00 16.19 ? 106 PHE B CB  1 
ATOM   3393  C  CG  . PHE B  1 106 ? 25.965 -46.438 -68.849  1.00 17.37 ? 106 PHE B CG  1 
ATOM   3394  C  CD1 . PHE B  1 106 ? 25.424 -45.175 -68.622  1.00 15.46 ? 106 PHE B CD1 1 
ATOM   3395  C  CD2 . PHE B  1 106 ? 27.221 -46.733 -68.336  1.00 17.76 ? 106 PHE B CD2 1 
ATOM   3396  C  CE1 . PHE B  1 106 ? 26.120 -44.232 -67.889  1.00 15.31 ? 106 PHE B CE1 1 
ATOM   3397  C  CE2 . PHE B  1 106 ? 27.918 -45.793 -67.598  1.00 17.37 ? 106 PHE B CE2 1 
ATOM   3398  C  CZ  . PHE B  1 106 ? 27.371 -44.543 -67.376  1.00 15.16 ? 106 PHE B CZ  1 
ATOM   3399  N  N   . LEU B  1 107 ? 24.275 -48.373 -72.955  1.00 22.43 ? 107 LEU B N   1 
ATOM   3400  C  CA  . LEU B  1 107 ? 23.726 -49.472 -73.741  1.00 24.95 ? 107 LEU B CA  1 
ATOM   3401  C  C   . LEU B  1 107 ? 24.872 -50.365 -74.206  1.00 26.67 ? 107 LEU B C   1 
ATOM   3402  O  O   . LEU B  1 107 ? 25.825 -49.887 -74.817  1.00 26.47 ? 107 LEU B O   1 
ATOM   3403  C  CB  . LEU B  1 107 ? 22.944 -48.944 -74.943  1.00 28.38 ? 107 LEU B CB  1 
ATOM   3404  C  CG  . LEU B  1 107 ? 21.495 -48.515 -74.709  1.00 32.96 ? 107 LEU B CG  1 
ATOM   3405  C  CD1 . LEU B  1 107 ? 21.361 -47.680 -73.447  1.00 43.32 ? 107 LEU B CD1 1 
ATOM   3406  C  CD2 . LEU B  1 107 ? 20.972 -47.749 -75.918  1.00 35.43 ? 107 LEU B CD2 1 
ATOM   3407  N  N   . ASN B  1 108 ? 24.788 -51.655 -73.896  1.00 24.00 ? 108 ASN B N   1 
ATOM   3408  C  CA  . ASN B  1 108 ? 25.816 -52.610 -74.306  1.00 28.37 ? 108 ASN B CA  1 
ATOM   3409  C  C   . ASN B  1 108 ? 27.176 -52.340 -73.667  1.00 28.88 ? 108 ASN B C   1 
ATOM   3410  O  O   . ASN B  1 108 ? 28.220 -52.608 -74.263  1.00 34.45 ? 108 ASN B O   1 
ATOM   3411  C  CB  . ASN B  1 108 ? 25.944 -52.642 -75.831  1.00 33.35 ? 108 ASN B CB  1 
ATOM   3412  C  CG  . ASN B  1 108 ? 24.673 -53.117 -76.508  1.00 36.88 ? 108 ASN B CG  1 
ATOM   3413  O  OD1 . ASN B  1 108 ? 24.036 -52.371 -77.250  1.00 32.27 ? 108 ASN B OD1 1 
ATOM   3414  N  ND2 . ASN B  1 108 ? 24.286 -54.356 -76.233  1.00 36.57 ? 108 ASN B ND2 1 
ATOM   3415  N  N   . ARG B  1 109 ? 27.157 -51.788 -72.461  1.00 23.18 ? 109 ARG B N   1 
ATOM   3416  C  CA  . ARG B  1 109 ? 28.375 -51.623 -71.684  1.00 23.96 ? 109 ARG B CA  1 
ATOM   3417  C  C   . ARG B  1 109 ? 28.271 -52.460 -70.410  1.00 21.90 ? 109 ARG B C   1 
ATOM   3418  O  O   . ARG B  1 109 ? 27.194 -52.602 -69.841  1.00 27.33 ? 109 ARG B O   1 
ATOM   3419  C  CB  . ARG B  1 109 ? 28.624 -50.145 -71.362  1.00 22.04 ? 109 ARG B CB  1 
ATOM   3420  C  CG  . ARG B  1 109 ? 28.805 -49.278 -72.602  1.00 23.20 ? 109 ARG B CG  1 
ATOM   3421  C  CD  . ARG B  1 109 ? 29.359 -47.907 -72.256  1.00 20.90 ? 109 ARG B CD  1 
ATOM   3422  N  NE  . ARG B  1 109 ? 29.564 -47.094 -73.452  1.00 22.00 ? 109 ARG B NE  1 
ATOM   3423  C  CZ  . ARG B  1 109 ? 30.668 -47.115 -74.191  1.00 21.19 ? 109 ARG B CZ  1 
ATOM   3424  N  NH1 . ARG B  1 109 ? 30.769 -46.340 -75.263  1.00 20.62 ? 109 ARG B NH1 1 
ATOM   3425  N  NH2 . ARG B  1 109 ? 31.670 -47.920 -73.866  1.00 19.96 ? 109 ARG B NH2 1 
ATOM   3426  N  N   . SER B  1 110 ? 29.391 -53.018 -69.975  1.00 23.65 ? 110 SER B N   1 
ATOM   3427  C  CA  . SER B  1 110 ? 29.401 -53.951 -68.854  1.00 23.30 ? 110 SER B CA  1 
ATOM   3428  C  C   . SER B  1 110 ? 29.384 -53.267 -67.488  1.00 24.41 ? 110 SER B C   1 
ATOM   3429  O  O   . SER B  1 110 ? 29.614 -52.063 -67.365  1.00 21.71 ? 110 SER B O   1 
ATOM   3430  C  CB  . SER B  1 110 ? 30.641 -54.835 -68.940  1.00 26.55 ? 110 SER B CB  1 
ATOM   3431  O  OG  . SER B  1 110 ? 31.806 -54.046 -68.766  1.00 25.60 ? 110 SER B OG  1 
ATOM   3432  N  N   . ILE B  1 111 ? 29.115 -54.057 -66.456  1.00 24.02 ? 111 ILE B N   1 
ATOM   3433  C  CA  . ILE B  1 111 ? 29.217 -53.577 -65.096  1.00 24.79 ? 111 ILE B CA  1 
ATOM   3434  C  C   . ILE B  1 111 ? 30.637 -53.080 -64.816  1.00 24.63 ? 111 ILE B C   1 
ATOM   3435  O  O   . ILE B  1 111 ? 30.828 -52.083 -64.127  1.00 20.78 ? 111 ILE B O   1 
ATOM   3436  C  CB  . ILE B  1 111 ? 28.815 -54.672 -64.094  1.00 23.65 ? 111 ILE B CB  1 
ATOM   3437  C  CG1 . ILE B  1 111 ? 27.322 -54.979 -64.241  1.00 24.18 ? 111 ILE B CG1 1 
ATOM   3438  C  CG2 . ILE B  1 111 ? 29.127 -54.220 -62.679  1.00 23.03 ? 111 ILE B CG2 1 
ATOM   3439  C  CD1 . ILE B  1 111 ? 26.853 -56.201 -63.474  1.00 23.75 ? 111 ILE B CD1 1 
ATOM   3440  N  N   . ASP B  1 112 ? 31.628 -53.765 -65.377  1.00 22.88 ? 112 ASP B N   1 
ATOM   3441  C  CA  . ASP B  1 112 ? 33.025 -53.369 -65.205  1.00 25.01 ? 112 ASP B CA  1 
ATOM   3442  C  C   . ASP B  1 112 ? 33.341 -51.999 -65.785  1.00 23.70 ? 112 ASP B C   1 
ATOM   3443  O  O   . ASP B  1 112 ? 34.112 -51.248 -65.200  1.00 22.42 ? 112 ASP B O   1 
ATOM   3444  C  CB  . ASP B  1 112 ? 33.961 -54.416 -65.805  1.00 29.70 ? 112 ASP B CB  1 
ATOM   3445  C  CG  . ASP B  1 112 ? 34.110 -55.625 -64.914  1.00 35.10 ? 112 ASP B CG  1 
ATOM   3446  O  OD1 . ASP B  1 112 ? 33.725 -56.728 -65.345  1.00 49.02 ? 112 ASP B OD1 1 
ATOM   3447  O  OD2 . ASP B  1 112 ? 34.587 -55.464 -63.771  1.00 41.83 ? 112 ASP B OD2 1 
ATOM   3448  N  N   . GLU B  1 113 ? 32.760 -51.675 -66.936  1.00 20.83 ? 113 GLU B N   1 
ATOM   3449  C  CA  . GLU B  1 113 ? 32.951 -50.350 -67.519  1.00 21.00 ? 113 GLU B CA  1 
ATOM   3450  C  C   . GLU B  1 113 ? 32.403 -49.271 -66.607  1.00 17.91 ? 113 GLU B C   1 
ATOM   3451  O  O   . GLU B  1 113 ? 33.007 -48.210 -66.457  1.00 17.64 ? 113 GLU B O   1 
ATOM   3452  C  CB  . GLU B  1 113 ? 32.274 -50.239 -68.884  1.00 21.31 ? 113 GLU B CB  1 
ATOM   3453  C  CG  . GLU B  1 113 ? 32.998 -50.957 -70.006  1.00 26.97 ? 113 GLU B CG  1 
ATOM   3454  C  CD  . GLU B  1 113 ? 32.390 -50.612 -71.347  1.00 29.46 ? 113 GLU B CD  1 
ATOM   3455  O  OE1 . GLU B  1 113 ? 31.853 -51.518 -72.003  1.00 28.57 ? 113 GLU B OE1 1 
ATOM   3456  O  OE2 . GLU B  1 113 ? 32.417 -49.421 -71.718  1.00 31.18 ? 113 GLU B OE2 1 
ATOM   3457  N  N   . ILE B  1 114 ? 31.247 -49.541 -66.010  1.00 16.71 ? 114 ILE B N   1 
ATOM   3458  C  CA  . ILE B  1 114 ? 30.651 -48.605 -65.067  1.00 18.26 ? 114 ILE B CA  1 
ATOM   3459  C  C   . ILE B  1 114 ? 31.576 -48.440 -63.860  1.00 18.77 ? 114 ILE B C   1 
ATOM   3460  O  O   . ILE B  1 114 ? 31.897 -47.324 -63.461  1.00 18.02 ? 114 ILE B O   1 
ATOM   3461  C  CB  . ILE B  1 114 ? 29.260 -49.085 -64.602  1.00 19.56 ? 114 ILE B CB  1 
ATOM   3462  C  CG1 . ILE B  1 114 ? 28.327 -49.276 -65.806  1.00 18.31 ? 114 ILE B CG1 1 
ATOM   3463  C  CG2 . ILE B  1 114 ? 28.681 -48.121 -63.579  1.00 17.49 ? 114 ILE B CG2 1 
ATOM   3464  C  CD1 . ILE B  1 114 ? 26.940 -49.766 -65.444  1.00 20.15 ? 114 ILE B CD1 1 
ATOM   3465  N  N   . ALA B  1 115 ? 32.027 -49.559 -63.299  1.00 17.17 ? 115 ALA B N   1 
ATOM   3466  C  CA  . ALA B  1 115 ? 32.929 -49.523 -62.152  1.00 17.44 ? 115 ALA B CA  1 
ATOM   3467  C  C   . ALA B  1 115 ? 34.208 -48.744 -62.465  1.00 15.71 ? 115 ALA B C   1 
ATOM   3468  O  O   . ALA B  1 115 ? 34.739 -48.045 -61.605  1.00 16.53 ? 115 ALA B O   1 
ATOM   3469  C  CB  . ALA B  1 115 ? 33.260 -50.939 -61.693  1.00 15.81 ? 115 ALA B CB  1 
ATOM   3470  N  N   . ASP B  1 116 ? 34.703 -48.885 -63.695  1.00 16.93 ? 116 ASP B N   1 
ATOM   3471  C  CA  . ASP B  1 116 ? 35.873 -48.146 -64.154  1.00 16.83 ? 116 ASP B CA  1 
ATOM   3472  C  C   . ASP B  1 116 ? 35.705 -46.626 -64.063  1.00 15.81 ? 116 ASP B C   1 
ATOM   3473  O  O   . ASP B  1 116 ? 36.659 -45.916 -63.769  1.00 17.93 ? 116 ASP B O   1 
ATOM   3474  C  CB  . ASP B  1 116 ? 36.240 -48.541 -65.591  1.00 19.58 ? 116 ASP B CB  1 
ATOM   3475  C  CG  . ASP B  1 116 ? 36.919 -49.910 -65.670  1.00 24.56 ? 116 ASP B CG  1 
ATOM   3476  O  OD1 . ASP B  1 116 ? 37.048 -50.443 -66.789  1.00 24.18 ? 116 ASP B OD1 1 
ATOM   3477  O  OD2 . ASP B  1 116 ? 37.316 -50.450 -64.619  1.00 23.93 ? 116 ASP B OD2 1 
ATOM   3478  N  N   . LEU B  1 117 ? 34.504 -46.124 -64.337  1.00 16.18 ? 117 LEU B N   1 
ATOM   3479  C  CA  . LEU B  1 117 ? 34.243 -44.693 -64.164  1.00 16.08 ? 117 LEU B CA  1 
ATOM   3480  C  C   . LEU B  1 117 ? 34.429 -44.300 -62.707  1.00 16.07 ? 117 LEU B C   1 
ATOM   3481  O  O   . LEU B  1 117 ? 35.066 -43.287 -62.401  1.00 14.26 ? 117 LEU B O   1 
ATOM   3482  C  CB  . LEU B  1 117 ? 32.824 -44.337 -64.598  1.00 15.38 ? 117 LEU B CB  1 
ATOM   3483  C  CG  . LEU B  1 117 ? 32.477 -44.684 -66.043  1.00 18.03 ? 117 LEU B CG  1 
ATOM   3484  C  CD1 . LEU B  1 117 ? 31.039 -44.278 -66.335  1.00 16.82 ? 117 LEU B CD1 1 
ATOM   3485  C  CD2 . LEU B  1 117 ? 33.437 -43.977 -66.990  1.00 19.58 ? 117 LEU B CD2 1 
ATOM   3486  N  N   . PHE B  1 118 ? 33.861 -45.097 -61.804  1.00 15.65 ? 118 PHE B N   1 
ATOM   3487  C  CA  . PHE B  1 118 ? 33.954 -44.788 -60.379  1.00 14.50 ? 118 PHE B CA  1 
ATOM   3488  C  C   . PHE B  1 118 ? 35.413 -44.820 -59.934  1.00 14.57 ? 118 PHE B C   1 
ATOM   3489  O  O   . PHE B  1 118 ? 35.890 -43.917 -59.241  1.00 15.19 ? 118 PHE B O   1 
ATOM   3490  C  CB  . PHE B  1 118 ? 33.115 -45.769 -59.545  1.00 14.79 ? 118 PHE B CB  1 
ATOM   3491  C  CG  . PHE B  1 118 ? 31.666 -45.822 -59.944  1.00 14.52 ? 118 PHE B CG  1 
ATOM   3492  C  CD1 . PHE B  1 118 ? 31.104 -44.818 -60.725  1.00 15.22 ? 118 PHE B CD1 1 
ATOM   3493  C  CD2 . PHE B  1 118 ? 30.856 -46.869 -59.520  1.00 16.79 ? 118 PHE B CD2 1 
ATOM   3494  C  CE1 . PHE B  1 118 ? 29.766 -44.867 -61.093  1.00 14.47 ? 118 PHE B CE1 1 
ATOM   3495  C  CE2 . PHE B  1 118 ? 29.515 -46.921 -59.873  1.00 15.44 ? 118 PHE B CE2 1 
ATOM   3496  C  CZ  . PHE B  1 118 ? 28.968 -45.922 -60.663  1.00 15.12 ? 118 PHE B CZ  1 
ATOM   3497  N  N   . ILE B  1 119 ? 36.118 -45.871 -60.341  1.00 14.81 ? 119 ILE B N   1 
ATOM   3498  C  CA  . ILE B  1 119 ? 37.508 -46.048 -59.970  1.00 15.89 ? 119 ILE B CA  1 
ATOM   3499  C  C   . ILE B  1 119 ? 38.366 -44.911 -60.533  1.00 16.37 ? 119 ILE B C   1 
ATOM   3500  O  O   . ILE B  1 119 ? 39.276 -44.419 -59.862  1.00 17.54 ? 119 ILE B O   1 
ATOM   3501  C  CB  . ILE B  1 119 ? 38.030 -47.443 -60.402  1.00 17.68 ? 119 ILE B CB  1 
ATOM   3502  C  CG1 . ILE B  1 119 ? 37.371 -48.532 -59.542  1.00 17.48 ? 119 ILE B CG1 1 
ATOM   3503  C  CG2 . ILE B  1 119 ? 39.546 -47.531 -60.264  1.00 17.54 ? 119 ILE B CG2 1 
ATOM   3504  C  CD1 . ILE B  1 119 ? 37.547 -49.943 -60.068  1.00 19.87 ? 119 ILE B CD1 1 
ATOM   3505  N  N   . HIS B  1 120 ? 38.062 -44.481 -61.755  1.00 16.77 ? 120 HIS B N   1 
ATOM   3506  C  CA  . HIS B  1 120 ? 38.737 -43.320 -62.332  1.00 16.01 ? 120 HIS B CA  1 
ATOM   3507  C  C   . HIS B  1 120 ? 38.622 -42.110 -61.435  1.00 16.86 ? 120 HIS B C   1 
ATOM   3508  O  O   . HIS B  1 120 ? 39.619 -41.440 -61.160  1.00 16.68 ? 120 HIS B O   1 
ATOM   3509  C  CB  . HIS B  1 120 ? 38.187 -43.015 -63.720  1.00 18.89 ? 120 HIS B CB  1 
ATOM   3510  C  CG  . HIS B  1 120 ? 38.672 -41.701 -64.293  1.00 17.80 ? 120 HIS B CG  1 
ATOM   3511  N  ND1 . HIS B  1 120 ? 39.699 -41.627 -65.161  1.00 18.05 ? 120 HIS B ND1 1 
ATOM   3512  C  CD2 . HIS B  1 120 ? 38.236 -40.393 -64.086  1.00 16.18 ? 120 HIS B CD2 1 
ATOM   3513  C  CE1 . HIS B  1 120 ? 39.913 -40.338 -65.499  1.00 17.28 ? 120 HIS B CE1 1 
ATOM   3514  N  NE2 . HIS B  1 120 ? 39.014 -39.583 -64.843  1.00 16.73 ? 120 HIS B NE2 1 
ATOM   3515  N  N   . ASP B  1 121 ? 37.408 -41.812 -60.970  1.00 14.56 ? 121 ASP B N   1 
ATOM   3516  C  CA  . ASP B  1 121 ? 37.177 -40.656 -60.092  1.00 14.27 ? 121 ASP B CA  1 
ATOM   3517  C  C   . ASP B  1 121 ? 37.898 -40.791 -58.751  1.00 15.58 ? 121 ASP B C   1 
ATOM   3518  O  O   . ASP B  1 121 ? 38.309 -39.790 -58.157  1.00 14.29 ? 121 ASP B O   1 
ATOM   3519  C  CB  . ASP B  1 121 ? 35.681 -40.456 -59.826  1.00 13.33 ? 121 ASP B CB  1 
ATOM   3520  C  CG  . ASP B  1 121 ? 34.944 -39.897 -61.023  1.00 13.25 ? 121 ASP B CG  1 
ATOM   3521  O  OD1 . ASP B  1 121 ? 35.601 -39.578 -62.033  1.00 16.10 ? 121 ASP B OD1 1 
ATOM   3522  O  OD2 . ASP B  1 121 ? 33.706 -39.773 -60.955  1.00 12.69 ? 121 ASP B OD2 1 
ATOM   3523  N  N   . ILE B  1 122 ? 38.027 -42.025 -58.274  1.00 14.88 ? 122 ILE B N   1 
ATOM   3524  C  CA  . ILE B  1 122 ? 38.667 -42.290 -56.982  1.00 15.63 ? 122 ILE B CA  1 
ATOM   3525  C  C   . ILE B  1 122 ? 40.196 -42.237 -57.083  1.00 17.32 ? 122 ILE B C   1 
ATOM   3526  O  O   . ILE B  1 122 ? 40.852 -41.637 -56.236  1.00 17.93 ? 122 ILE B O   1 
ATOM   3527  C  CB  . ILE B  1 122 ? 38.231 -43.656 -56.403  1.00 16.92 ? 122 ILE B CB  1 
ATOM   3528  C  CG1 . ILE B  1 122 ? 36.720 -43.666 -56.121  1.00 15.18 ? 122 ILE B CG1 1 
ATOM   3529  C  CG2 . ILE B  1 122 ? 38.994 -43.976 -55.123  1.00 16.84 ? 122 ILE B CG2 1 
ATOM   3530  C  CD1 . ILE B  1 122 ? 36.133 -45.060 -56.086  1.00 15.28 ? 122 ILE B CD1 1 
ATOM   3531  N  N   . LYS B  1 123 ? 40.753 -42.850 -58.122  1.00 16.83 ? 123 LYS B N   1 
ATOM   3532  C  CA  . LYS B  1 123 ? 42.204 -42.954 -58.247  1.00 21.70 ? 123 LYS B CA  1 
ATOM   3533  C  C   . LYS B  1 123 ? 42.825 -41.807 -59.043  1.00 23.98 ? 123 LYS B C   1 
ATOM   3534  O  O   . LYS B  1 123 ? 43.936 -41.376 -58.738  1.00 22.13 ? 123 LYS B O   1 
ATOM   3535  C  CB  . LYS B  1 123 ? 42.605 -44.295 -58.870  1.00 21.42 ? 123 LYS B CB  1 
ATOM   3536  C  CG  . LYS B  1 123 ? 42.276 -45.510 -58.016  1.00 25.16 ? 123 LYS B CG  1 
ATOM   3537  C  CD  . LYS B  1 123 ? 42.918 -46.759 -58.601  1.00 31.94 ? 123 LYS B CD  1 
ATOM   3538  C  CE  . LYS B  1 123 ? 42.523 -48.018 -57.843  1.00 37.66 ? 123 LYS B CE  1 
ATOM   3539  N  NZ  . LYS B  1 123 ? 43.280 -49.208 -58.328  1.00 33.97 ? 123 LYS B NZ  1 
ATOM   3540  N  N   . GLU B  1 124 ? 42.115 -41.317 -60.057  1.00 22.39 ? 124 GLU B N   1 
ATOM   3541  C  CA  . GLU B  1 124 ? 42.660 -40.278 -60.936  1.00 24.91 ? 124 GLU B CA  1 
ATOM   3542  C  C   . GLU B  1 124 ? 42.167 -38.888 -60.558  1.00 25.18 ? 124 GLU B C   1 
ATOM   3543  O  O   . GLU B  1 124 ? 42.963 -37.959 -60.406  1.00 23.07 ? 124 GLU B O   1 
ATOM   3544  C  CB  . GLU B  1 124 ? 42.311 -40.561 -62.400  1.00 28.18 ? 124 GLU B CB  1 
ATOM   3545  C  CG  . GLU B  1 124 ? 42.650 -41.967 -62.852  1.00 31.26 ? 124 GLU B CG  1 
ATOM   3546  C  CD  . GLU B  1 124 ? 44.127 -42.254 -62.744  1.00 43.81 ? 124 GLU B CD  1 
ATOM   3547  O  OE1 . GLU B  1 124 ? 44.930 -41.358 -63.088  1.00 45.31 ? 124 GLU B OE1 1 
ATOM   3548  O  OE2 . GLU B  1 124 ? 44.480 -43.370 -62.309  1.00 44.03 ? 124 GLU B OE2 1 
ATOM   3549  N  N   . GLY B  1 125 ? 40.853 -38.740 -60.416  1.00 18.36 ? 125 GLY B N   1 
ATOM   3550  C  CA  . GLY B  1 125 ? 40.291 -37.443 -60.071  1.00 17.04 ? 125 GLY B CA  1 
ATOM   3551  C  C   . GLY B  1 125 ? 38.977 -37.181 -60.786  1.00 18.90 ? 125 GLY B C   1 
ATOM   3552  O  O   . GLY B  1 125 ? 38.600 -37.904 -61.705  1.00 16.70 ? 125 GLY B O   1 
ATOM   3553  N  N   . ILE B  1 126 ? 38.302 -36.116 -60.375  1.00 14.81 ? 126 ILE B N   1 
ATOM   3554  C  CA  . ILE B  1 126 ? 36.945 -35.838 -60.818  1.00 15.77 ? 126 ILE B CA  1 
ATOM   3555  C  C   . ILE B  1 126 ? 36.915 -34.740 -61.872  1.00 15.28 ? 126 ILE B C   1 
ATOM   3556  O  O   . ILE B  1 126 ? 37.478 -33.663 -61.673  1.00 15.45 ? 126 ILE B O   1 
ATOM   3557  C  CB  . ILE B  1 126 ? 36.067 -35.428 -59.618  1.00 13.65 ? 126 ILE B CB  1 
ATOM   3558  C  CG1 . ILE B  1 126 ? 35.959 -36.597 -58.628  1.00 12.95 ? 126 ILE B CG1 1 
ATOM   3559  C  CG2 . ILE B  1 126 ? 34.690 -34.956 -60.084  1.00 14.26 ? 126 ILE B CG2 1 
ATOM   3560  C  CD1 . ILE B  1 126 ? 35.363 -36.219 -57.279  1.00 11.59 ? 126 ILE B CD1 1 
ATOM   3561  N  N   . GLN B  1 127 ? 36.270 -35.034 -62.995  1.00 15.84 ? 127 GLN B N   1 
ATOM   3562  C  CA  . GLN B  1 127 ? 35.988 -34.031 -64.025  1.00 18.06 ? 127 GLN B CA  1 
ATOM   3563  C  C   . GLN B  1 127 ? 37.227 -33.272 -64.494  1.00 20.76 ? 127 GLN B C   1 
ATOM   3564  O  O   . GLN B  1 127 ? 37.186 -32.054 -64.695  1.00 18.55 ? 127 GLN B O   1 
ATOM   3565  C  CB  . GLN B  1 127 ? 34.907 -33.065 -63.532  1.00 15.96 ? 127 GLN B CB  1 
ATOM   3566  C  CG  . GLN B  1 127 ? 33.536 -33.721 -63.413  1.00 15.32 ? 127 GLN B CG  1 
ATOM   3567  C  CD  . GLN B  1 127 ? 32.477 -32.758 -62.915  1.00 21.72 ? 127 GLN B CD  1 
ATOM   3568  O  OE1 . GLN B  1 127 ? 31.435 -32.575 -63.551  1.00 23.56 ? 127 GLN B OE1 1 
ATOM   3569  N  NE2 . GLN B  1 127 ? 32.741 -32.128 -61.780  1.00 18.46 ? 127 GLN B NE2 1 
ATOM   3570  N  N   . GLY B  1 128 ? 38.327 -33.996 -64.674  1.00 20.33 ? 128 GLY B N   1 
ATOM   3571  C  CA  . GLY B  1 128 ? 39.567 -33.386 -65.144  1.00 23.96 ? 128 GLY B CA  1 
ATOM   3572  C  C   . GLY B  1 128 ? 40.348 -32.616 -64.092  1.00 22.66 ? 128 GLY B C   1 
ATOM   3573  O  O   . GLY B  1 128 ? 41.273 -31.873 -64.419  1.00 23.70 ? 128 GLY B O   1 
ATOM   3574  N  N   . THR B  1 129 ? 39.986 -32.777 -62.824  1.00 18.64 ? 129 THR B N   1 
ATOM   3575  C  CA  . THR B  1 129 ? 40.774 -32.172 -61.756  1.00 18.44 ? 129 THR B CA  1 
ATOM   3576  C  C   . THR B  1 129 ? 41.468 -33.267 -60.958  1.00 17.78 ? 129 THR B C   1 
ATOM   3577  O  O   . THR B  1 129 ? 41.219 -34.453 -61.174  1.00 19.40 ? 129 THR B O   1 
ATOM   3578  C  CB  . THR B  1 129 ? 39.909 -31.337 -60.791  1.00 19.17 ? 129 THR B CB  1 
ATOM   3579  O  OG1 . THR B  1 129 ? 39.128 -32.214 -59.969  1.00 17.16 ? 129 THR B OG1 1 
ATOM   3580  C  CG2 . THR B  1 129 ? 38.986 -30.395 -61.565  1.00 17.02 ? 129 THR B CG2 1 
ATOM   3581  N  N   . LEU B  1 130 ? 42.324 -32.867 -60.023  1.00 16.98 ? 130 LEU B N   1 
ATOM   3582  C  CA  . LEU B  1 130 ? 42.976 -33.828 -59.145  1.00 18.40 ? 130 LEU B CA  1 
ATOM   3583  C  C   . LEU B  1 130 ? 42.196 -34.046 -57.852  1.00 17.85 ? 130 LEU B C   1 
ATOM   3584  O  O   . LEU B  1 130 ? 42.660 -34.752 -56.962  1.00 17.79 ? 130 LEU B O   1 
ATOM   3585  C  CB  . LEU B  1 130 ? 44.418 -33.408 -58.842  1.00 19.58 ? 130 LEU B CB  1 
ATOM   3586  C  CG  . LEU B  1 130 ? 45.344 -33.387 -60.061  1.00 21.24 ? 130 LEU B CG  1 
ATOM   3587  C  CD1 . LEU B  1 130 ? 46.775 -33.049 -59.654  1.00 23.85 ? 130 LEU B CD1 1 
ATOM   3588  C  CD2 . LEU B  1 130 ? 45.295 -34.713 -60.802  1.00 20.89 ? 130 LEU B CD2 1 
ATOM   3589  N  N   . ASN B  1 131 ? 41.020 -33.432 -57.745  1.00 15.31 ? 131 ASN B N   1 
ATOM   3590  C  CA  . ASN B  1 131 ? 40.123 -33.716 -56.621  1.00 17.04 ? 131 ASN B CA  1 
ATOM   3591  C  C   . ASN B  1 131 ? 39.576 -35.133 -56.764  1.00 16.71 ? 131 ASN B C   1 
ATOM   3592  O  O   . ASN B  1 131 ? 38.962 -35.464 -57.774  1.00 15.92 ? 131 ASN B O   1 
ATOM   3593  C  CB  . ASN B  1 131 ? 38.964 -32.725 -56.590  1.00 16.80 ? 131 ASN B CB  1 
ATOM   3594  C  CG  . ASN B  1 131 ? 39.428 -31.295 -56.462  1.00 19.23 ? 131 ASN B CG  1 
ATOM   3595  O  OD1 . ASN B  1 131 ? 39.278 -30.492 -57.387  1.00 23.20 ? 131 ASN B OD1 1 
ATOM   3596  N  ND2 . ASN B  1 131 ? 40.005 -30.970 -55.323  1.00 16.06 ? 131 ASN B ND2 1 
ATOM   3597  N  N   . LYS B  1 132 ? 39.796 -35.966 -55.756  1.00 15.60 ? 132 LYS B N   1 
ATOM   3598  C  CA  . LYS B  1 132 ? 39.414 -37.370 -55.844  1.00 17.33 ? 132 LYS B CA  1 
ATOM   3599  C  C   . LYS B  1 132 ? 38.136 -37.693 -55.080  1.00 14.67 ? 132 LYS B C   1 
ATOM   3600  O  O   . LYS B  1 132 ? 37.816 -37.047 -54.085  1.00 15.35 ? 132 LYS B O   1 
ATOM   3601  C  CB  . LYS B  1 132 ? 40.572 -38.256 -55.373  1.00 18.47 ? 132 LYS B CB  1 
ATOM   3602  C  CG  . LYS B  1 132 ? 41.772 -38.195 -56.313  1.00 22.57 ? 132 LYS B CG  1 
ATOM   3603  C  CD  . LYS B  1 132 ? 42.968 -38.938 -55.751  1.00 29.07 ? 132 LYS B CD  1 
ATOM   3604  C  CE  . LYS B  1 132 ? 44.142 -38.864 -56.715  1.00 34.19 ? 132 LYS B CE  1 
ATOM   3605  N  NZ  . LYS B  1 132 ? 44.314 -37.468 -57.208  1.00 41.57 ? 132 LYS B NZ  1 
ATOM   3606  N  N   . ALA B  1 133 ? 37.399 -38.690 -55.563  1.00 15.38 ? 133 ALA B N   1 
ATOM   3607  C  CA  . ALA B  1 133 ? 36.162 -39.135 -54.920  1.00 13.04 ? 133 ALA B CA  1 
ATOM   3608  C  C   . ALA B  1 133 ? 36.498 -39.938 -53.676  1.00 16.37 ? 133 ALA B C   1 
ATOM   3609  O  O   . ALA B  1 133 ? 37.432 -40.756 -53.693  1.00 15.04 ? 133 ALA B O   1 
ATOM   3610  C  CB  . ALA B  1 133 ? 35.338 -39.985 -55.885  1.00 13.43 ? 133 ALA B CB  1 
ATOM   3611  N  N   . GLY B  1 134 ? 35.742 -39.715 -52.601  1.00 12.01 ? 134 GLY B N   1 
ATOM   3612  C  CA  . GLY B  1 134 ? 36.013 -40.392 -51.329  1.00 13.60 ? 134 GLY B CA  1 
ATOM   3613  C  C   . GLY B  1 134 ? 35.006 -41.483 -50.989  1.00 14.05 ? 134 GLY B C   1 
ATOM   3614  O  O   . GLY B  1 134 ? 35.120 -42.141 -49.958  1.00 14.52 ? 134 GLY B O   1 
ATOM   3615  N  N   . PHE B  1 135 ? 34.009 -41.668 -51.850  1.00 11.60 ? 135 PHE B N   1 
ATOM   3616  C  CA  . PHE B  1 135 ? 32.986 -42.698 -51.655  1.00 12.16 ? 135 PHE B CA  1 
ATOM   3617  C  C   . PHE B  1 135 ? 32.228 -42.854 -52.970  1.00 11.79 ? 135 PHE B C   1 
ATOM   3618  O  O   . PHE B  1 135 ? 32.407 -42.049 -53.882  1.00 11.65 ? 135 PHE B O   1 
ATOM   3619  C  CB  . PHE B  1 135 ? 32.003 -42.289 -50.551  1.00 11.44 ? 135 PHE B CB  1 
ATOM   3620  C  CG  . PHE B  1 135 ? 31.291 -40.998 -50.833  1.00 13.47 ? 135 PHE B CG  1 
ATOM   3621  C  CD1 . PHE B  1 135 ? 31.874 -39.779 -50.499  1.00 12.18 ? 135 PHE B CD1 1 
ATOM   3622  C  CD2 . PHE B  1 135 ? 30.052 -40.995 -51.458  1.00 12.08 ? 135 PHE B CD2 1 
ATOM   3623  C  CE1 . PHE B  1 135 ? 31.232 -38.582 -50.777  1.00 12.23 ? 135 PHE B CE1 1 
ATOM   3624  C  CE2 . PHE B  1 135 ? 29.402 -39.801 -51.741  1.00 13.18 ? 135 PHE B CE2 1 
ATOM   3625  C  CZ  . PHE B  1 135 ? 29.991 -38.593 -51.398  1.00 11.66 ? 135 PHE B CZ  1 
ATOM   3626  N  N   . VAL B  1 136 ? 31.390 -43.883 -53.062  1.00 12.07 ? 136 VAL B N   1 
ATOM   3627  C  CA  . VAL B  1 136 ? 30.512 -44.084 -54.216  1.00 13.59 ? 136 VAL B CA  1 
ATOM   3628  C  C   . VAL B  1 136 ? 29.069 -43.950 -53.746  1.00 13.89 ? 136 VAL B C   1 
ATOM   3629  O  O   . VAL B  1 136 ? 28.715 -44.475 -52.685  1.00 16.35 ? 136 VAL B O   1 
ATOM   3630  C  CB  . VAL B  1 136 ? 30.677 -45.495 -54.828  1.00 17.38 ? 136 VAL B CB  1 
ATOM   3631  C  CG1 . VAL B  1 136 ? 29.800 -45.637 -56.066  1.00 15.97 ? 136 VAL B CG1 1 
ATOM   3632  C  CG2 . VAL B  1 136 ? 32.140 -45.774 -55.159  1.00 16.11 ? 136 VAL B CG2 1 
HETATM 3633  N  N   . KCX B  1 137 ? 28.250 -43.244 -54.528  1.00 12.11 ? 137 KCX B N   1 
HETATM 3634  C  CA  . KCX B  1 137 ? 26.835 -43.023 -54.209  1.00 10.73 ? 137 KCX B CA  1 
HETATM 3635  C  CB  . KCX B  1 137 ? 26.527 -41.521 -54.248  1.00 10.27 ? 137 KCX B CB  1 
HETATM 3636  C  CG  . KCX B  1 137 ? 25.027 -41.212 -54.370  1.00 12.54 ? 137 KCX B CG  1 
HETATM 3637  C  CD  . KCX B  1 137 ? 24.322 -41.380 -53.018  1.00 11.83 ? 137 KCX B CD  1 
HETATM 3638  C  CE  . KCX B  1 137 ? 22.854 -40.954 -53.089  1.00 14.63 ? 137 KCX B CE  1 
HETATM 3639  N  NZ  . KCX B  1 137 ? 22.657 -39.507 -53.043  1.00 10.98 ? 137 KCX B NZ  1 
HETATM 3640  C  C   . KCX B  1 137 ? 25.984 -43.746 -55.229  1.00 12.50 ? 137 KCX B C   1 
HETATM 3641  O  O   . KCX B  1 137 ? 26.241 -43.657 -56.429  1.00 12.35 ? 137 KCX B O   1 
HETATM 3642  C  CX  . KCX B  1 137 ? 21.535 -38.928 -52.584  1.00 11.81 ? 137 KCX B CX  1 
HETATM 3643  O  OQ1 . KCX B  1 137 ? 21.545 -37.599 -52.610  1.00 11.75 ? 137 KCX B OQ1 1 
HETATM 3644  O  OQ2 . KCX B  1 137 ? 20.514 -39.515 -52.146  1.00 11.90 ? 137 KCX B OQ2 1 
ATOM   3645  N  N   . ILE B  1 138 ? 24.974 -44.478 -54.759  1.00 14.00 ? 138 ILE B N   1 
ATOM   3646  C  CA  . ILE B  1 138 ? 24.036 -45.186 -55.635  1.00 14.62 ? 138 ILE B CA  1 
ATOM   3647  C  C   . ILE B  1 138 ? 22.607 -44.962 -55.145  1.00 14.98 ? 138 ILE B C   1 
ATOM   3648  O  O   . ILE B  1 138 ? 22.395 -44.527 -54.010  1.00 13.43 ? 138 ILE B O   1 
ATOM   3649  C  CB  . ILE B  1 138 ? 24.297 -46.706 -55.640  1.00 19.34 ? 138 ILE B CB  1 
ATOM   3650  C  CG1 . ILE B  1 138 ? 24.031 -47.279 -54.239  1.00 20.08 ? 138 ILE B CG1 1 
ATOM   3651  C  CG2 . ILE B  1 138 ? 25.706 -47.009 -56.156  1.00 13.55 ? 138 ILE B CG2 1 
ATOM   3652  C  CD1 . ILE B  1 138 ? 24.379 -48.745 -54.076  1.00 26.43 ? 138 ILE B CD1 1 
ATOM   3653  N  N   . ALA B  1 139 ? 21.632 -45.277 -55.990  1.00 14.32 ? 139 ALA B N   1 
ATOM   3654  C  CA  . ALA B  1 139 ? 20.234 -44.995 -55.668  1.00 15.44 ? 139 ALA B CA  1 
ATOM   3655  C  C   . ALA B  1 139 ? 19.257 -46.067 -56.138  1.00 16.22 ? 139 ALA B C   1 
ATOM   3656  O  O   . ALA B  1 139 ? 19.507 -46.788 -57.098  1.00 16.04 ? 139 ALA B O   1 
ATOM   3657  C  CB  . ALA B  1 139 ? 19.819 -43.651 -56.247  1.00 13.47 ? 139 ALA B CB  1 
ATOM   3658  N  N   . ALA B  1 140 ? 18.135 -46.144 -55.434  1.00 13.44 ? 140 ALA B N   1 
ATOM   3659  C  CA  . ALA B  1 140 ? 16.958 -46.843 -55.905  1.00 16.45 ? 140 ALA B CA  1 
ATOM   3660  C  C   . ALA B  1 140 ? 15.776 -46.141 -55.250  1.00 14.85 ? 140 ALA B C   1 
ATOM   3661  O  O   . ALA B  1 140 ? 15.921 -45.535 -54.192  1.00 13.78 ? 140 ALA B O   1 
ATOM   3662  C  CB  . ALA B  1 140 ? 17.004 -48.317 -55.515  1.00 13.58 ? 140 ALA B CB  1 
ATOM   3663  N  N   . ASP B  1 141 ? 14.610 -46.199 -55.875  1.00 18.53 ? 141 ASP B N   1 
ATOM   3664  C  CA  . ASP B  1 141 ? 13.456 -45.529 -55.298  1.00 18.13 ? 141 ASP B CA  1 
ATOM   3665  C  C   . ASP B  1 141 ? 12.181 -46.311 -55.588  1.00 19.34 ? 141 ASP B C   1 
ATOM   3666  O  O   . ASP B  1 141 ? 12.198 -47.545 -55.571  1.00 20.46 ? 141 ASP B O   1 
ATOM   3667  C  CB  . ASP B  1 141 ? 13.386 -44.073 -55.775  1.00 17.37 ? 141 ASP B CB  1 
ATOM   3668  C  CG  . ASP B  1 141 ? 12.665 -43.167 -54.785  1.00 22.21 ? 141 ASP B CG  1 
ATOM   3669  O  OD1 . ASP B  1 141 ? 11.428 -43.279 -54.661  1.00 24.94 ? 141 ASP B OD1 1 
ATOM   3670  O  OD2 . ASP B  1 141 ? 13.331 -42.331 -54.134  1.00 24.72 ? 141 ASP B OD2 1 
ATOM   3671  N  N   . GLU B  1 142 ? 11.079 -45.611 -55.841  1.00 20.12 ? 142 GLU B N   1 
ATOM   3672  C  CA  . GLU B  1 142 ? 9.787  -46.277 -56.063  1.00 24.63 ? 142 GLU B CA  1 
ATOM   3673  C  C   . GLU B  1 142 ? 9.846  -47.430 -57.067  1.00 22.35 ? 142 GLU B C   1 
ATOM   3674  O  O   . GLU B  1 142 ? 9.242  -48.474 -56.841  1.00 23.99 ? 142 GLU B O   1 
ATOM   3675  C  CB  . GLU B  1 142 ? 8.712  -45.274 -56.496  1.00 28.64 ? 142 GLU B CB  1 
ATOM   3676  C  CG  . GLU B  1 142 ? 8.446  -44.172 -55.489  1.00 37.19 ? 142 GLU B CG  1 
ATOM   3677  C  CD  . GLU B  1 142 ? 7.200  -43.374 -55.826  1.00 61.08 ? 142 GLU B CD  1 
ATOM   3678  O  OE1 . GLU B  1 142 ? 6.454  -43.793 -56.737  1.00 70.27 ? 142 GLU B OE1 1 
ATOM   3679  O  OE2 . GLU B  1 142 ? 6.963  -42.330 -55.179  1.00 57.87 ? 142 GLU B OE2 1 
ATOM   3680  N  N   . PRO B  1 143 ? 10.566 -47.245 -58.185  1.00 22.24 ? 143 PRO B N   1 
ATOM   3681  C  CA  . PRO B  1 143 ? 10.603 -48.306 -59.198  1.00 21.45 ? 143 PRO B CA  1 
ATOM   3682  C  C   . PRO B  1 143 ? 11.259 -49.610 -58.724  1.00 22.42 ? 143 PRO B C   1 
ATOM   3683  O  O   . PRO B  1 143 ? 11.159 -50.626 -59.407  1.00 21.32 ? 143 PRO B O   1 
ATOM   3684  C  CB  . PRO B  1 143 ? 11.434 -47.681 -60.324  1.00 21.55 ? 143 PRO B CB  1 
ATOM   3685  C  CG  . PRO B  1 143 ? 11.231 -46.214 -60.166  1.00 18.82 ? 143 PRO B CG  1 
ATOM   3686  C  CD  . PRO B  1 143 ? 11.184 -45.999 -58.677  1.00 18.80 ? 143 PRO B CD  1 
ATOM   3687  N  N   . GLY B  1 144 ? 11.935 -49.576 -57.580  1.00 21.45 ? 144 GLY B N   1 
ATOM   3688  C  CA  . GLY B  1 144 ? 12.590 -50.768 -57.042  1.00 22.19 ? 144 GLY B CA  1 
ATOM   3689  C  C   . GLY B  1 144 ? 13.943 -51.056 -57.670  1.00 20.89 ? 144 GLY B C   1 
ATOM   3690  O  O   . GLY B  1 144 ? 14.545 -50.190 -58.309  1.00 21.31 ? 144 GLY B O   1 
ATOM   3691  N  N   . ILE B  1 145 ? 14.430 -52.276 -57.484  1.00 20.53 ? 145 ILE B N   1 
ATOM   3692  C  CA  . ILE B  1 145 ? 15.719 -52.661 -58.045  1.00 21.36 ? 145 ILE B CA  1 
ATOM   3693  C  C   . ILE B  1 145 ? 15.566 -53.090 -59.506  1.00 22.66 ? 145 ILE B C   1 
ATOM   3694  O  O   . ILE B  1 145 ? 15.426 -54.277 -59.810  1.00 22.21 ? 145 ILE B O   1 
ATOM   3695  C  CB  . ILE B  1 145 ? 16.398 -53.778 -57.221  1.00 23.18 ? 145 ILE B CB  1 
ATOM   3696  C  CG1 . ILE B  1 145 ? 16.393 -53.429 -55.725  1.00 21.82 ? 145 ILE B CG1 1 
ATOM   3697  C  CG2 . ILE B  1 145 ? 17.826 -54.005 -57.702  1.00 21.09 ? 145 ILE B CG2 1 
ATOM   3698  C  CD1 . ILE B  1 145 ? 17.019 -52.078 -55.401  1.00 19.76 ? 145 ILE B CD1 1 
ATOM   3699  N  N   . THR B  1 146 ? 15.580 -52.115 -60.410  1.00 18.99 ? 146 THR B N   1 
ATOM   3700  C  CA  . THR B  1 146 ? 15.507 -52.408 -61.836  1.00 19.87 ? 146 THR B CA  1 
ATOM   3701  C  C   . THR B  1 146 ? 16.825 -53.029 -62.301  1.00 20.21 ? 146 THR B C   1 
ATOM   3702  O  O   . THR B  1 146 ? 17.812 -53.027 -61.572  1.00 21.21 ? 146 THR B O   1 
ATOM   3703  C  CB  . THR B  1 146 ? 15.223 -51.138 -62.651  1.00 20.30 ? 146 THR B CB  1 
ATOM   3704  O  OG1 . THR B  1 146 ? 16.319 -50.229 -62.506  1.00 20.42 ? 146 THR B OG1 1 
ATOM   3705  C  CG2 . THR B  1 146 ? 13.941 -50.462 -62.157  1.00 18.06 ? 146 THR B CG2 1 
ATOM   3706  N  N   . LYS B  1 147 ? 16.843 -53.574 -63.507  1.00 20.88 ? 147 LYS B N   1 
ATOM   3707  C  CA  . LYS B  1 147 ? 18.066 -54.175 -64.029  1.00 23.16 ? 147 LYS B CA  1 
ATOM   3708  C  C   . LYS B  1 147 ? 19.234 -53.182 -64.019  1.00 22.12 ? 147 LYS B C   1 
ATOM   3709  O  O   . LYS B  1 147 ? 20.347 -53.534 -63.620  1.00 19.99 ? 147 LYS B O   1 
ATOM   3710  C  CB  . LYS B  1 147 ? 17.840 -54.742 -65.433  1.00 25.41 ? 147 LYS B CB  1 
ATOM   3711  C  CG  . LYS B  1 147 ? 17.028 -56.028 -65.451  1.00 36.01 ? 147 LYS B CG  1 
ATOM   3712  C  CD  . LYS B  1 147 ? 16.660 -56.431 -66.871  1.00 49.39 ? 147 LYS B CD  1 
ATOM   3713  C  CE  . LYS B  1 147 ? 15.791 -55.374 -67.538  1.00 61.15 ? 147 LYS B CE  1 
ATOM   3714  N  NZ  . LYS B  1 147 ? 15.501 -55.696 -68.962  1.00 75.00 ? 147 LYS B NZ  1 
ATOM   3715  N  N   . ASP B  1 148 ? 18.976 -51.947 -64.443  1.00 17.63 ? 148 ASP B N   1 
ATOM   3716  C  CA  . ASP B  1 148 ? 20.022 -50.922 -64.496  1.00 18.08 ? 148 ASP B CA  1 
ATOM   3717  C  C   . ASP B  1 148 ? 20.448 -50.424 -63.115  1.00 18.31 ? 148 ASP B C   1 
ATOM   3718  O  O   . ASP B  1 148 ? 21.622 -50.165 -62.881  1.00 18.83 ? 148 ASP B O   1 
ATOM   3719  C  CB  . ASP B  1 148 ? 19.594 -49.742 -65.374  1.00 17.27 ? 148 ASP B CB  1 
ATOM   3720  C  CG  . ASP B  1 148 ? 19.760 -50.035 -66.865  1.00 21.43 ? 148 ASP B CG  1 
ATOM   3721  O  OD1 . ASP B  1 148 ? 19.450 -49.164 -67.698  1.00 21.10 ? 148 ASP B OD1 1 
ATOM   3722  O  OD2 . ASP B  1 148 ? 20.213 -51.141 -67.200  1.00 21.94 ? 148 ASP B OD2 1 
ATOM   3723  N  N   . VAL B  1 149 ? 19.488 -50.257 -62.214  1.00 19.49 ? 149 VAL B N   1 
ATOM   3724  C  CA  . VAL B  1 149 ? 19.808 -49.925 -60.831  1.00 16.68 ? 149 VAL B CA  1 
ATOM   3725  C  C   . VAL B  1 149 ? 20.722 -51.008 -60.261  1.00 17.16 ? 149 VAL B C   1 
ATOM   3726  O  O   . VAL B  1 149 ? 21.716 -50.720 -59.591  1.00 17.10 ? 149 VAL B O   1 
ATOM   3727  C  CB  . VAL B  1 149 ? 18.525 -49.791 -59.986  1.00 18.18 ? 149 VAL B CB  1 
ATOM   3728  C  CG1 . VAL B  1 149 ? 18.824 -49.960 -58.497  1.00 16.01 ? 149 VAL B CG1 1 
ATOM   3729  C  CG2 . VAL B  1 149 ? 17.848 -48.453 -60.265  1.00 17.89 ? 149 VAL B CG2 1 
ATOM   3730  N  N   . GLU B  1 150 ? 20.401 -52.261 -60.549  1.00 16.39 ? 150 GLU B N   1 
ATOM   3731  C  CA  . GLU B  1 150 ? 21.216 -53.365 -60.062  1.00 17.47 ? 150 GLU B CA  1 
ATOM   3732  C  C   . GLU B  1 150 ? 22.640 -53.348 -60.626  1.00 17.72 ? 150 GLU B C   1 
ATOM   3733  O  O   . GLU B  1 150 ? 23.597 -53.654 -59.912  1.00 18.19 ? 150 GLU B O   1 
ATOM   3734  C  CB  . GLU B  1 150 ? 20.548 -54.715 -60.355  1.00 19.33 ? 150 GLU B CB  1 
ATOM   3735  C  CG  . GLU B  1 150 ? 21.347 -55.890 -59.815  1.00 26.49 ? 150 GLU B CG  1 
ATOM   3736  C  CD  . GLU B  1 150 ? 20.600 -57.206 -59.906  1.00 36.57 ? 150 GLU B CD  1 
ATOM   3737  O  OE1 . GLU B  1 150 ? 21.222 -58.252 -59.632  1.00 41.09 ? 150 GLU B OE1 1 
ATOM   3738  O  OE2 . GLU B  1 150 ? 19.398 -57.196 -60.251  1.00 42.67 ? 150 GLU B OE2 1 
ATOM   3739  N  N   . LYS B  1 151 ? 22.788 -53.001 -61.901  1.00 17.67 ? 151 LYS B N   1 
ATOM   3740  C  CA  . LYS B  1 151 ? 24.125 -52.911 -62.490  1.00 18.26 ? 151 LYS B CA  1 
ATOM   3741  C  C   . LYS B  1 151 ? 24.983 -51.883 -61.762  1.00 17.54 ? 151 LYS B C   1 
ATOM   3742  O  O   . LYS B  1 151 ? 26.163 -52.115 -61.511  1.00 15.82 ? 151 LYS B O   1 
ATOM   3743  C  CB  . LYS B  1 151 ? 24.059 -52.585 -63.982  1.00 22.83 ? 151 LYS B CB  1 
ATOM   3744  C  CG  . LYS B  1 151 ? 23.381 -53.679 -64.793  1.00 28.73 ? 151 LYS B CG  1 
ATOM   3745  C  CD  . LYS B  1 151 ? 23.812 -53.672 -66.251  1.00 36.17 ? 151 LYS B CD  1 
ATOM   3746  C  CE  . LYS B  1 151 ? 23.264 -52.465 -66.981  1.00 37.40 ? 151 LYS B CE  1 
ATOM   3747  N  NZ  . LYS B  1 151 ? 23.042 -52.782 -68.418  1.00 38.39 ? 151 LYS B NZ  1 
ATOM   3748  N  N   . VAL B  1 152 ? 24.377 -50.753 -61.418  1.00 15.31 ? 152 VAL B N   1 
ATOM   3749  C  CA  . VAL B  1 152 ? 25.082 -49.684 -60.719  1.00 14.55 ? 152 VAL B CA  1 
ATOM   3750  C  C   . VAL B  1 152 ? 25.488 -50.143 -59.322  1.00 14.74 ? 152 VAL B C   1 
ATOM   3751  O  O   . VAL B  1 152 ? 26.601 -49.870 -58.871  1.00 15.86 ? 152 VAL B O   1 
ATOM   3752  C  CB  . VAL B  1 152 ? 24.215 -48.407 -60.624  1.00 15.23 ? 152 VAL B CB  1 
ATOM   3753  C  CG1 . VAL B  1 152 ? 24.862 -47.388 -59.700  1.00 14.20 ? 152 VAL B CG1 1 
ATOM   3754  C  CG2 . VAL B  1 152 ? 24.013 -47.803 -62.011  1.00 16.80 ? 152 VAL B CG2 1 
ATOM   3755  N  N   . ILE B  1 153 ? 24.588 -50.851 -58.642  1.00 13.81 ? 153 ILE B N   1 
ATOM   3756  C  CA  . ILE B  1 153 ? 24.895 -51.374 -57.320  1.00 15.57 ? 153 ILE B CA  1 
ATOM   3757  C  C   . ILE B  1 153 ? 26.097 -52.308 -57.383  1.00 17.71 ? 153 ILE B C   1 
ATOM   3758  O  O   . ILE B  1 153 ? 27.014 -52.209 -56.565  1.00 16.25 ? 153 ILE B O   1 
ATOM   3759  C  CB  . ILE B  1 153 ? 23.696 -52.124 -56.707  1.00 16.31 ? 153 ILE B CB  1 
ATOM   3760  C  CG1 . ILE B  1 153 ? 22.550 -51.148 -56.427  1.00 17.41 ? 153 ILE B CG1 1 
ATOM   3761  C  CG2 . ILE B  1 153 ? 24.103 -52.825 -55.420  1.00 15.16 ? 153 ILE B CG2 1 
ATOM   3762  C  CD1 . ILE B  1 153 ? 21.237 -51.833 -56.116  1.00 17.00 ? 153 ILE B CD1 1 
ATOM   3763  N  N   . ARG B  1 154 ? 26.101 -53.205 -58.367  1.00 18.14 ? 154 ARG B N   1 
ATOM   3764  C  CA  . ARG B  1 154 ? 27.203 -54.156 -58.507  1.00 18.88 ? 154 ARG B CA  1 
ATOM   3765  C  C   . ARG B  1 154 ? 28.508 -53.460 -58.892  1.00 18.23 ? 154 ARG B C   1 
ATOM   3766  O  O   . ARG B  1 154 ? 29.595 -53.874 -58.470  1.00 18.20 ? 154 ARG B O   1 
ATOM   3767  C  CB  . ARG B  1 154 ? 26.842 -55.274 -59.492  1.00 20.40 ? 154 ARG B CB  1 
ATOM   3768  C  CG  . ARG B  1 154 ? 25.679 -56.131 -59.010  1.00 23.68 ? 154 ARG B CG  1 
ATOM   3769  C  CD  . ARG B  1 154 ? 25.417 -57.330 -59.917  1.00 28.50 ? 154 ARG B CD  1 
ATOM   3770  N  NE  . ARG B  1 154 ? 24.230 -58.050 -59.463  1.00 33.14 ? 154 ARG B NE  1 
ATOM   3771  C  CZ  . ARG B  1 154 ? 24.228 -58.933 -58.470  1.00 36.93 ? 154 ARG B CZ  1 
ATOM   3772  N  NH1 . ARG B  1 154 ? 23.101 -59.533 -58.111  1.00 40.84 ? 154 ARG B NH1 1 
ATOM   3773  N  NH2 . ARG B  1 154 ? 25.354 -59.218 -57.834  1.00 33.42 ? 154 ARG B NH2 1 
ATOM   3774  N  N   . ALA B  1 155 ? 28.397 -52.389 -59.670  1.00 17.86 ? 155 ALA B N   1 
ATOM   3775  C  CA  . ALA B  1 155 ? 29.569 -51.602 -60.054  1.00 15.78 ? 155 ALA B CA  1 
ATOM   3776  C  C   . ALA B  1 155 ? 30.165 -50.882 -58.840  1.00 16.80 ? 155 ALA B C   1 
ATOM   3777  O  O   . ALA B  1 155 ? 31.388 -50.753 -58.719  1.00 15.82 ? 155 ALA B O   1 
ATOM   3778  C  CB  . ALA B  1 155 ? 29.203 -50.602 -61.147  1.00 14.60 ? 155 ALA B CB  1 
ATOM   3779  N  N   . ALA B  1 156 ? 29.294 -50.402 -57.953  1.00 14.40 ? 156 ALA B N   1 
ATOM   3780  C  CA  . ALA B  1 156 ? 29.727 -49.795 -56.699  1.00 15.72 ? 156 ALA B CA  1 
ATOM   3781  C  C   . ALA B  1 156 ? 30.496 -50.804 -55.842  1.00 17.18 ? 156 ALA B C   1 
ATOM   3782  O  O   . ALA B  1 156 ? 31.495 -50.457 -55.222  1.00 18.09 ? 156 ALA B O   1 
ATOM   3783  C  CB  . ALA B  1 156 ? 28.531 -49.249 -55.922  1.00 13.54 ? 156 ALA B CB  1 
ATOM   3784  N  N   . ALA B  1 157 ? 30.006 -52.040 -55.794  1.00 16.70 ? 157 ALA B N   1 
ATOM   3785  C  CA  . ALA B  1 157 ? 30.684 -53.106 -55.060  1.00 19.41 ? 157 ALA B CA  1 
ATOM   3786  C  C   . ALA B  1 157 ? 32.090 -53.353 -55.598  1.00 19.09 ? 157 ALA B C   1 
ATOM   3787  O  O   . ALA B  1 157 ? 33.037 -53.530 -54.827  1.00 22.77 ? 157 ALA B O   1 
ATOM   3788  C  CB  . ALA B  1 157 ? 29.868 -54.396 -55.103  1.00 18.31 ? 157 ALA B CB  1 
ATOM   3789  N  N   . ILE B  1 158 ? 32.221 -53.373 -56.921  1.00 19.28 ? 158 ILE B N   1 
ATOM   3790  C  CA  . ILE B  1 158 ? 33.520 -53.524 -57.556  1.00 20.40 ? 158 ILE B CA  1 
ATOM   3791  C  C   . ILE B  1 158 ? 34.448 -52.378 -57.160  1.00 20.75 ? 158 ILE B C   1 
ATOM   3792  O  O   . ILE B  1 158 ? 35.594 -52.608 -56.775  1.00 18.43 ? 158 ILE B O   1 
ATOM   3793  C  CB  . ILE B  1 158 ? 33.398 -53.610 -59.090  1.00 20.00 ? 158 ILE B CB  1 
ATOM   3794  C  CG1 . ILE B  1 158 ? 32.661 -54.892 -59.489  1.00 23.45 ? 158 ILE B CG1 1 
ATOM   3795  C  CG2 . ILE B  1 158 ? 34.774 -53.569 -59.737  1.00 21.16 ? 158 ILE B CG2 1 
ATOM   3796  C  CD1 . ILE B  1 158 ? 32.253 -54.936 -60.945  1.00 21.04 ? 158 ILE B CD1 1 
ATOM   3797  N  N   . ALA B  1 159 ? 33.942 -51.147 -57.222  1.00 16.84 ? 159 ALA B N   1 
ATOM   3798  C  CA  . ALA B  1 159 ? 34.746 -49.969 -56.880  1.00 18.72 ? 159 ALA B CA  1 
ATOM   3799  C  C   . ALA B  1 159 ? 35.214 -49.990 -55.424  1.00 19.13 ? 159 ALA B C   1 
ATOM   3800  O  O   . ALA B  1 159 ? 36.361 -49.648 -55.125  1.00 21.20 ? 159 ALA B O   1 
ATOM   3801  C  CB  . ALA B  1 159 ? 33.978 -48.677 -57.180  1.00 15.19 ? 159 ALA B CB  1 
ATOM   3802  N  N   . ASN B  1 160 ? 34.327 -50.394 -54.519  1.00 18.79 ? 160 ASN B N   1 
ATOM   3803  C  CA  . ASN B  1 160 ? 34.687 -50.505 -53.106  1.00 18.76 ? 160 ASN B CA  1 
ATOM   3804  C  C   . ASN B  1 160 ? 35.767 -51.557 -52.834  1.00 20.79 ? 160 ASN B C   1 
ATOM   3805  O  O   . ASN B  1 160 ? 36.667 -51.346 -52.023  1.00 23.09 ? 160 ASN B O   1 
ATOM   3806  C  CB  . ASN B  1 160 ? 33.454 -50.803 -52.250  1.00 16.41 ? 160 ASN B CB  1 
ATOM   3807  C  CG  . ASN B  1 160 ? 33.819 -51.401 -50.903  1.00 19.66 ? 160 ASN B CG  1 
ATOM   3808  O  OD1 . ASN B  1 160 ? 33.856 -52.622 -50.749  1.00 17.43 ? 160 ASN B OD1 1 
ATOM   3809  N  ND2 . ASN B  1 160 ? 34.129 -50.545 -49.933  1.00 15.73 ? 160 ASN B ND2 1 
ATOM   3810  N  N   . LYS B  1 161 ? 35.678 -52.692 -53.510  1.00 21.57 ? 161 LYS B N   1 
ATOM   3811  C  CA  . LYS B  1 161 ? 36.608 -53.779 -53.252  1.00 23.02 ? 161 LYS B CA  1 
ATOM   3812  C  C   . LYS B  1 161 ? 38.004 -53.446 -53.770  1.00 23.39 ? 161 LYS B C   1 
ATOM   3813  O  O   . LYS B  1 161 ? 39.000 -53.869 -53.194  1.00 24.58 ? 161 LYS B O   1 
ATOM   3814  C  CB  . LYS B  1 161 ? 36.083 -55.092 -53.838  1.00 26.45 ? 161 LYS B CB  1 
ATOM   3815  C  CG  . LYS B  1 161 ? 34.835 -55.596 -53.121  1.00 30.16 ? 161 LYS B CG  1 
ATOM   3816  C  CD  . LYS B  1 161 ? 34.430 -56.985 -53.587  1.00 34.79 ? 161 LYS B CD  1 
ATOM   3817  C  CE  . LYS B  1 161 ? 33.974 -56.971 -55.036  1.00 39.02 ? 161 LYS B CE  1 
ATOM   3818  N  NZ  . LYS B  1 161 ? 33.614 -58.339 -55.505  1.00 38.17 ? 161 LYS B NZ  1 
ATOM   3819  N  N   . GLU B  1 162 ? 38.067 -52.654 -54.834  1.00 22.74 ? 162 GLU B N   1 
ATOM   3820  C  CA  . GLU B  1 162 ? 39.343 -52.225 -55.388  1.00 27.27 ? 162 GLU B CA  1 
ATOM   3821  C  C   . GLU B  1 162 ? 39.974 -51.060 -54.634  1.00 24.54 ? 162 GLU B C   1 
ATOM   3822  O  O   . GLU B  1 162 ? 41.194 -50.981 -54.543  1.00 25.71 ? 162 GLU B O   1 
ATOM   3823  C  CB  . GLU B  1 162 ? 39.193 -51.858 -56.867  1.00 27.07 ? 162 GLU B CB  1 
ATOM   3824  C  CG  . GLU B  1 162 ? 39.066 -53.070 -57.768  1.00 40.11 ? 162 GLU B CG  1 
ATOM   3825  C  CD  . GLU B  1 162 ? 40.287 -53.969 -57.675  1.00 40.85 ? 162 GLU B CD  1 
ATOM   3826  O  OE1 . GLU B  1 162 ? 41.387 -53.513 -58.054  1.00 38.61 ? 162 GLU B OE1 1 
ATOM   3827  O  OE2 . GLU B  1 162 ? 40.146 -55.122 -57.211  1.00 45.60 ? 162 GLU B OE2 1 
ATOM   3828  N  N   . THR B  1 163 ? 39.151 -50.155 -54.109  1.00 20.28 ? 163 THR B N   1 
ATOM   3829  C  CA  . THR B  1 163 ? 39.662 -48.910 -53.520  1.00 19.51 ? 163 THR B CA  1 
ATOM   3830  C  C   . THR B  1 163 ? 39.341 -48.747 -52.036  1.00 18.91 ? 163 THR B C   1 
ATOM   3831  O  O   . THR B  1 163 ? 39.905 -47.883 -51.369  1.00 18.11 ? 163 THR B O   1 
ATOM   3832  C  CB  . THR B  1 163 ? 39.092 -47.670 -54.239  1.00 20.92 ? 163 THR B CB  1 
ATOM   3833  O  OG1 . THR B  1 163 ? 37.687 -47.584 -53.980  1.00 21.25 ? 163 THR B OG1 1 
ATOM   3834  C  CG2 . THR B  1 163 ? 39.341 -47.738 -55.757  1.00 19.10 ? 163 THR B CG2 1 
ATOM   3835  N  N   . LYS B  1 164 ? 38.411 -49.555 -51.535  1.00 19.10 ? 164 LYS B N   1 
ATOM   3836  C  CA  A LYS B  1 164 ? 38.004 -49.501 -50.130  0.50 20.24 ? 164 LYS B CA  1 
ATOM   3837  C  CA  B LYS B  1 164 ? 38.004 -49.504 -50.130  0.50 19.87 ? 164 LYS B CA  1 
ATOM   3838  C  C   . LYS B  1 164 ? 37.210 -48.254 -49.736  1.00 19.48 ? 164 LYS B C   1 
ATOM   3839  O  O   . LYS B  1 164 ? 36.929 -48.050 -48.561  1.00 18.19 ? 164 LYS B O   1 
ATOM   3840  C  CB  A LYS B  1 164 ? 39.210 -49.663 -49.194  0.50 23.14 ? 164 LYS B CB  1 
ATOM   3841  C  CB  B LYS B  1 164 ? 39.217 -49.678 -49.204  0.50 22.21 ? 164 LYS B CB  1 
ATOM   3842  C  CG  A LYS B  1 164 ? 39.714 -51.093 -49.051  0.50 27.93 ? 164 LYS B CG  1 
ATOM   3843  C  CG  B LYS B  1 164 ? 39.991 -50.967 -49.446  0.50 25.68 ? 164 LYS B CG  1 
ATOM   3844  C  CD  A LYS B  1 164 ? 40.963 -51.352 -49.881  0.50 32.81 ? 164 LYS B CD  1 
ATOM   3845  C  CD  B LYS B  1 164 ? 41.174 -51.108 -48.496  0.50 28.52 ? 164 LYS B CD  1 
ATOM   3846  C  CE  A LYS B  1 164 ? 40.643 -51.927 -51.252  0.50 34.49 ? 164 LYS B CE  1 
ATOM   3847  C  CE  B LYS B  1 164 ? 40.716 -51.370 -47.071  0.50 33.99 ? 164 LYS B CE  1 
ATOM   3848  N  NZ  A LYS B  1 164 ? 41.837 -52.591 -51.848  0.50 27.99 ? 164 LYS B NZ  1 
ATOM   3849  N  NZ  B LYS B  1 164 ? 41.873 -51.525 -46.144  0.50 37.09 ? 164 LYS B NZ  1 
ATOM   3850  N  N   . VAL B  1 165 ? 36.840 -47.410 -50.702  1.00 16.83 ? 165 VAL B N   1 
ATOM   3851  C  CA  . VAL B  1 165 ? 35.993 -46.257 -50.345  1.00 15.50 ? 165 VAL B CA  1 
ATOM   3852  C  C   . VAL B  1 165 ? 34.594 -46.765 -49.966  1.00 15.83 ? 165 VAL B C   1 
ATOM   3853  O  O   . VAL B  1 165 ? 34.115 -47.748 -50.532  1.00 15.28 ? 165 VAL B O   1 
ATOM   3854  C  CB  . VAL B  1 165 ? 35.894 -45.173 -51.452  1.00 13.89 ? 165 VAL B CB  1 
ATOM   3855  C  CG1 . VAL B  1 165 ? 37.286 -44.688 -51.878  1.00 13.66 ? 165 VAL B CG1 1 
ATOM   3856  C  CG2 . VAL B  1 165 ? 35.092 -45.668 -52.650  1.00 13.29 ? 165 VAL B CG2 1 
ATOM   3857  N  N   . PRO B  1 166 ? 33.936 -46.103 -49.001  1.00 15.68 ? 166 PRO B N   1 
ATOM   3858  C  CA  . PRO B  1 166 ? 32.614 -46.561 -48.586  1.00 16.23 ? 166 PRO B CA  1 
ATOM   3859  C  C   . PRO B  1 166 ? 31.530 -46.234 -49.611  1.00 15.26 ? 166 PRO B C   1 
ATOM   3860  O  O   . PRO B  1 166 ? 31.780 -45.517 -50.585  1.00 11.88 ? 166 PRO B O   1 
ATOM   3861  C  CB  . PRO B  1 166 ? 32.370 -45.775 -47.295  1.00 14.78 ? 166 PRO B CB  1 
ATOM   3862  C  CG  . PRO B  1 166 ? 33.144 -44.509 -47.494  1.00 15.57 ? 166 PRO B CG  1 
ATOM   3863  C  CD  . PRO B  1 166 ? 34.388 -44.936 -48.222  1.00 15.48 ? 166 PRO B CD  1 
ATOM   3864  N  N   . ILE B  1 167 ? 30.331 -46.760 -49.380  1.00 14.22 ? 167 ILE B N   1 
ATOM   3865  C  CA  . ILE B  1 167 ? 29.219 -46.579 -50.298  1.00 12.86 ? 167 ILE B CA  1 
ATOM   3866  C  C   . ILE B  1 167 ? 28.062 -45.911 -49.561  1.00 14.40 ? 167 ILE B C   1 
ATOM   3867  O  O   . ILE B  1 167 ? 27.668 -46.339 -48.473  1.00 14.46 ? 167 ILE B O   1 
ATOM   3868  C  CB  . ILE B  1 167 ? 28.760 -47.931 -50.889  1.00 13.61 ? 167 ILE B CB  1 
ATOM   3869  C  CG1 . ILE B  1 167 ? 29.867 -48.547 -51.752  1.00 14.09 ? 167 ILE B CG1 1 
ATOM   3870  C  CG2 . ILE B  1 167 ? 27.475 -47.777 -51.700  1.00 13.28 ? 167 ILE B CG2 1 
ATOM   3871  C  CD1 . ILE B  1 167 ? 29.597 -49.983 -52.171  1.00 15.09 ? 167 ILE B CD1 1 
ATOM   3872  N  N   . ILE B  1 168 ? 27.539 -44.839 -50.140  1.00 13.12 ? 168 ILE B N   1 
ATOM   3873  C  CA  . ILE B  1 168 ? 26.363 -44.181 -49.588  1.00 13.58 ? 168 ILE B CA  1 
ATOM   3874  C  C   . ILE B  1 168 ? 25.201 -44.477 -50.528  1.00 14.70 ? 168 ILE B C   1 
ATOM   3875  O  O   . ILE B  1 168 ? 25.359 -44.409 -51.749  1.00 15.72 ? 168 ILE B O   1 
ATOM   3876  C  CB  . ILE B  1 168 ? 26.563 -42.652 -49.493  1.00 13.69 ? 168 ILE B CB  1 
ATOM   3877  C  CG1 . ILE B  1 168 ? 27.671 -42.310 -48.494  1.00 14.54 ? 168 ILE B CG1 1 
ATOM   3878  C  CG2 . ILE B  1 168 ? 25.253 -41.950 -49.131  1.00 12.49 ? 168 ILE B CG2 1 
ATOM   3879  C  CD1 . ILE B  1 168 ? 27.937 -40.820 -48.355  1.00 14.91 ? 168 ILE B CD1 1 
ATOM   3880  N  N   . THR B  1 169 ? 24.036 -44.817 -49.986  1.00 15.66 ? 169 THR B N   1 
ATOM   3881  C  CA  . THR B  1 169 ? 22.888 -45.033 -50.866  1.00 14.47 ? 169 THR B CA  1 
ATOM   3882  C  C   . THR B  1 169 ? 21.745 -44.037 -50.653  1.00 14.33 ? 169 THR B C   1 
ATOM   3883  O  O   . THR B  1 169 ? 21.610 -43.413 -49.602  1.00 14.93 ? 169 THR B O   1 
ATOM   3884  C  CB  . THR B  1 169 ? 22.323 -46.469 -50.807  1.00 14.24 ? 169 THR B CB  1 
ATOM   3885  O  OG1 . THR B  1 169 ? 21.382 -46.574 -49.730  1.00 13.52 ? 169 THR B OG1 1 
ATOM   3886  C  CG2 . THR B  1 169 ? 23.441 -47.510 -50.620  1.00 14.65 ? 169 THR B CG2 1 
ATOM   3887  N  N   . HIS B  1 170 ? 20.955 -43.890 -51.708  1.00 13.70 ? 170 HIS B N   1 
ATOM   3888  C  CA  . HIS B  1 170 ? 19.645 -43.290 -51.666  1.00 13.76 ? 170 HIS B CA  1 
ATOM   3889  C  C   . HIS B  1 170 ? 18.697 -44.457 -51.755  1.00 13.92 ? 170 HIS B C   1 
ATOM   3890  O  O   . HIS B  1 170 ? 18.862 -45.323 -52.611  1.00 12.67 ? 170 HIS B O   1 
ATOM   3891  C  CB  . HIS B  1 170 ? 19.491 -42.399 -52.891  1.00 13.04 ? 170 HIS B CB  1 
ATOM   3892  C  CG  . HIS B  1 170 ? 18.113 -41.810 -53.061  1.00 14.85 ? 170 HIS B CG  1 
ATOM   3893  N  ND1 . HIS B  1 170 ? 17.840 -40.515 -52.793  1.00 14.05 ? 170 HIS B ND1 1 
ATOM   3894  C  CD2 . HIS B  1 170 ? 16.920 -42.383 -53.516  1.00 16.40 ? 170 HIS B CD2 1 
ATOM   3895  C  CE1 . HIS B  1 170 ? 16.535 -40.274 -53.067  1.00 14.31 ? 170 HIS B CE1 1 
ATOM   3896  N  NE2 . HIS B  1 170 ? 15.977 -41.414 -53.503  1.00 15.28 ? 170 HIS B NE2 1 
ATOM   3897  N  N   . SER B  1 171 ? 17.719 -44.529 -50.860  1.00 14.02 ? 171 SER B N   1 
ATOM   3898  C  CA  . SER B  1 171 ? 16.675 -45.543 -50.993  1.00 14.91 ? 171 SER B CA  1 
ATOM   3899  C  C   . SER B  1 171 ? 15.301 -44.960 -50.682  1.00 17.01 ? 171 SER B C   1 
ATOM   3900  O  O   . SER B  1 171 ? 15.188 -43.832 -50.215  1.00 16.24 ? 171 SER B O   1 
ATOM   3901  C  CB  . SER B  1 171 ? 16.961 -46.762 -50.102  1.00 14.26 ? 171 SER B CB  1 
ATOM   3902  O  OG  . SER B  1 171 ? 16.537 -46.548 -48.763  1.00 16.16 ? 171 SER B OG  1 
ATOM   3903  N  N   . ASN B  1 172 ? 14.257 -45.736 -50.963  1.00 18.44 ? 172 ASN B N   1 
ATOM   3904  C  CA  . ASN B  1 172 ? 12.912 -45.353 -50.593  1.00 16.65 ? 172 ASN B CA  1 
ATOM   3905  C  C   . ASN B  1 172 ? 12.566 -46.162 -49.356  1.00 17.68 ? 172 ASN B C   1 
ATOM   3906  O  O   . ASN B  1 172 ? 12.662 -47.394 -49.361  1.00 16.60 ? 172 ASN B O   1 
ATOM   3907  C  CB  . ASN B  1 172 ? 11.944 -45.637 -51.742  1.00 18.80 ? 172 ASN B CB  1 
ATOM   3908  C  CG  . ASN B  1 172 ? 10.517 -45.262 -51.409  1.00 23.78 ? 172 ASN B CG  1 
ATOM   3909  O  OD1 . ASN B  1 172 ? 9.929  -45.785 -50.462  1.00 22.79 ? 172 ASN B OD1 1 
ATOM   3910  N  ND2 . ASN B  1 172 ? 9.946  -44.357 -52.194  1.00 20.89 ? 172 ASN B ND2 1 
ATOM   3911  N  N   . ALA B  1 173 ? 12.193 -45.471 -48.286  1.00 16.01 ? 173 ALA B N   1 
ATOM   3912  C  CA  . ALA B  1 173 ? 12.078 -46.109 -46.981  1.00 18.05 ? 173 ALA B CA  1 
ATOM   3913  C  C   . ALA B  1 173 ? 10.904 -47.072 -46.895  1.00 22.16 ? 173 ALA B C   1 
ATOM   3914  O  O   . ALA B  1 173 ? 10.817 -47.862 -45.951  1.00 24.84 ? 173 ALA B O   1 
ATOM   3915  C  CB  . ALA B  1 173 ? 11.991 -45.056 -45.875  1.00 17.39 ? 173 ALA B CB  1 
ATOM   3916  N  N   . HIS B  1 174 ? 10.019 -47.031 -47.890  1.00 21.90 ? 174 HIS B N   1 
ATOM   3917  C  CA  . HIS B  1 174 ? 8.761  -47.782 -47.819  1.00 23.07 ? 174 HIS B CA  1 
ATOM   3918  C  C   . HIS B  1 174 ? 8.664  -48.992 -48.714  1.00 24.53 ? 174 HIS B C   1 
ATOM   3919  O  O   . HIS B  1 174 ? 7.637  -49.661 -48.720  1.00 26.15 ? 174 HIS B O   1 
ATOM   3920  C  CB  . HIS B  1 174 ? 7.578  -46.847 -48.087  1.00 23.23 ? 174 HIS B CB  1 
ATOM   3921  C  CG  . HIS B  1 174 ? 7.585  -45.600 -47.228  1.00 24.68 ? 174 HIS B CG  1 
ATOM   3922  N  ND1 . HIS B  1 174 ? 7.410  -45.640 -45.895  1.00 27.29 ? 174 HIS B ND1 1 
ATOM   3923  C  CD2 . HIS B  1 174 ? 7.764  -44.260 -47.560  1.00 28.30 ? 174 HIS B CD2 1 
ATOM   3924  C  CE1 . HIS B  1 174 ? 7.465  -44.393 -45.395  1.00 28.77 ? 174 HIS B CE1 1 
ATOM   3925  N  NE2 . HIS B  1 174 ? 7.684  -43.547 -46.416  1.00 34.57 ? 174 HIS B NE2 1 
ATOM   3926  N  N   . ASN B  1 175 ? 9.707  -49.312 -49.473  1.00 22.27 ? 175 ASN B N   1 
ATOM   3927  C  CA  . ASN B  1 175 ? 9.603  -50.457 -50.391  1.00 24.29 ? 175 ASN B CA  1 
ATOM   3928  C  C   . ASN B  1 175 ? 10.766 -51.450 -50.391  1.00 25.18 ? 175 ASN B C   1 
ATOM   3929  O  O   . ASN B  1 175 ? 10.985 -52.146 -51.381  1.00 28.41 ? 175 ASN B O   1 
ATOM   3930  C  CB  . ASN B  1 175 ? 9.357  -49.979 -51.821  1.00 22.66 ? 175 ASN B CB  1 
ATOM   3931  C  CG  . ASN B  1 175 ? 10.583 -49.338 -52.435  1.00 21.01 ? 175 ASN B CG  1 
ATOM   3932  O  OD1 . ASN B  1 175 ? 11.618 -49.197 -51.781  1.00 21.26 ? 175 ASN B OD1 1 
ATOM   3933  N  ND2 . ASN B  1 175 ? 10.477 -48.955 -53.699  1.00 21.49 ? 175 ASN B ND2 1 
ATOM   3934  N  N   . ASN B  1 176 ? 11.519 -51.512 -49.303  1.00 23.08 ? 176 ASN B N   1 
ATOM   3935  C  CA  . ASN B  1 176 ? 12.598 -52.495 -49.206  1.00 22.96 ? 176 ASN B CA  1 
ATOM   3936  C  C   . ASN B  1 176 ? 13.829 -52.276 -50.091  1.00 19.83 ? 176 ASN B C   1 
ATOM   3937  O  O   . ASN B  1 176 ? 14.740 -53.098 -50.085  1.00 18.52 ? 176 ASN B O   1 
ATOM   3938  C  CB  . ASN B  1 176 ? 12.049 -53.899 -49.460  1.00 27.66 ? 176 ASN B CB  1 
ATOM   3939  C  CG  . ASN B  1 176 ? 11.454 -54.520 -48.215  1.00 39.15 ? 176 ASN B CG  1 
ATOM   3940  O  OD1 . ASN B  1 176 ? 10.343 -55.047 -48.240  1.00 61.99 ? 176 ASN B OD1 1 
ATOM   3941  N  ND2 . ASN B  1 176 ? 12.191 -54.455 -47.112  1.00 36.16 ? 176 ASN B ND2 1 
ATOM   3942  N  N   . THR B  1 177 ? 13.866 -51.197 -50.864  1.00 17.62 ? 177 THR B N   1 
ATOM   3943  C  CA  . THR B  1 177 ? 15.041 -50.953 -51.696  1.00 17.30 ? 177 THR B CA  1 
ATOM   3944  C  C   . THR B  1 177 ? 16.341 -50.883 -50.883  1.00 17.89 ? 177 THR B C   1 
ATOM   3945  O  O   . THR B  1 177 ? 17.393 -51.340 -51.338  1.00 18.38 ? 177 THR B O   1 
ATOM   3946  C  CB  . THR B  1 177 ? 14.901 -49.682 -52.546  1.00 18.65 ? 177 THR B CB  1 
ATOM   3947  O  OG1 . THR B  1 177 ? 14.365 -48.623 -51.744  1.00 16.89 ? 177 THR B OG1 1 
ATOM   3948  C  CG2 . THR B  1 177 ? 13.986 -49.946 -53.742  1.00 17.10 ? 177 THR B CG2 1 
ATOM   3949  N  N   . GLY B  1 178 ? 16.271 -50.310 -49.686  1.00 17.52 ? 178 GLY B N   1 
ATOM   3950  C  CA  . GLY B  1 178 ? 17.455 -50.204 -48.831  1.00 15.44 ? 178 GLY B CA  1 
ATOM   3951  C  C   . GLY B  1 178 ? 17.991 -51.572 -48.444  1.00 17.24 ? 178 GLY B C   1 
ATOM   3952  O  O   . GLY B  1 178 ? 19.196 -51.845 -48.564  1.00 14.72 ? 178 GLY B O   1 
ATOM   3953  N  N   . LEU B  1 179 ? 17.090 -52.436 -47.982  1.00 16.72 ? 179 LEU B N   1 
ATOM   3954  C  CA  . LEU B  1 179 ? 17.449 -53.793 -47.601  1.00 18.81 ? 179 LEU B CA  1 
ATOM   3955  C  C   . LEU B  1 179 ? 18.041 -54.541 -48.798  1.00 19.45 ? 179 LEU B C   1 
ATOM   3956  O  O   . LEU B  1 179 ? 19.013 -55.278 -48.658  1.00 18.56 ? 179 LEU B O   1 
ATOM   3957  C  CB  . LEU B  1 179 ? 16.215 -54.533 -47.063  1.00 22.64 ? 179 LEU B CB  1 
ATOM   3958  C  CG  . LEU B  1 179 ? 16.465 -55.890 -46.412  1.00 26.20 ? 179 LEU B CG  1 
ATOM   3959  C  CD1 . LEU B  1 179 ? 17.115 -55.703 -45.049  1.00 25.82 ? 179 LEU B CD1 1 
ATOM   3960  C  CD2 . LEU B  1 179 ? 15.166 -56.677 -46.293  1.00 28.27 ? 179 LEU B CD2 1 
ATOM   3961  N  N   . GLU B  1 180 ? 17.454 -54.341 -49.974  1.00 18.69 ? 180 GLU B N   1 
ATOM   3962  C  CA  . GLU B  1 180 ? 17.947 -54.966 -51.201  1.00 21.00 ? 180 GLU B CA  1 
ATOM   3963  C  C   . GLU B  1 180 ? 19.330 -54.471 -51.609  1.00 17.60 ? 180 GLU B C   1 
ATOM   3964  O  O   . GLU B  1 180 ? 20.172 -55.258 -52.033  1.00 19.20 ? 180 GLU B O   1 
ATOM   3965  C  CB  . GLU B  1 180 ? 16.959 -54.764 -52.352  1.00 21.40 ? 180 GLU B CB  1 
ATOM   3966  C  CG  . GLU B  1 180 ? 15.738 -55.657 -52.261  1.00 28.20 ? 180 GLU B CG  1 
ATOM   3967  C  CD  . GLU B  1 180 ? 16.100 -57.124 -52.406  1.00 35.07 ? 180 GLU B CD  1 
ATOM   3968  O  OE1 . GLU B  1 180 ? 16.373 -57.563 -53.543  1.00 40.64 ? 180 GLU B OE1 1 
ATOM   3969  O  OE2 . GLU B  1 180 ? 16.117 -57.833 -51.382  1.00 35.36 ? 180 GLU B OE2 1 
ATOM   3970  N  N   . GLN B  1 181 ? 19.559 -53.167 -51.489  1.00 18.80 ? 181 GLN B N   1 
ATOM   3971  C  CA  . GLN B  1 181 ? 20.875 -52.599 -51.776  1.00 18.00 ? 181 GLN B CA  1 
ATOM   3972  C  C   . GLN B  1 181 ? 21.928 -53.257 -50.890  1.00 17.71 ? 181 GLN B C   1 
ATOM   3973  O  O   . GLN B  1 181 ? 22.954 -53.731 -51.369  1.00 19.76 ? 181 GLN B O   1 
ATOM   3974  C  CB  . GLN B  1 181 ? 20.872 -51.084 -51.537  1.00 16.63 ? 181 GLN B CB  1 
ATOM   3975  C  CG  . GLN B  1 181 ? 20.096 -50.282 -52.579  1.00 16.58 ? 181 GLN B CG  1 
ATOM   3976  C  CD  . GLN B  1 181 ? 19.869 -48.843 -52.146  1.00 17.04 ? 181 GLN B CD  1 
ATOM   3977  O  OE1 . GLN B  1 181 ? 19.919 -48.526 -50.955  1.00 14.83 ? 181 GLN B OE1 1 
ATOM   3978  N  NE2 . GLN B  1 181 ? 19.605 -47.966 -53.111  1.00 15.69 ? 181 GLN B NE2 1 
ATOM   3979  N  N   . GLN B  1 182 ? 21.659 -53.285 -49.592  1.00 18.84 ? 182 GLN B N   1 
ATOM   3980  C  CA  . GLN B  1 182 ? 22.553 -53.921 -48.631  1.00 21.09 ? 182 GLN B CA  1 
ATOM   3981  C  C   . GLN B  1 182 ? 22.817 -55.388 -48.986  1.00 20.32 ? 182 GLN B C   1 
ATOM   3982  O  O   . GLN B  1 182 ? 23.957 -55.858 -48.934  1.00 19.51 ? 182 GLN B O   1 
ATOM   3983  C  CB  . GLN B  1 182 ? 21.963 -53.817 -47.229  1.00 19.60 ? 182 GLN B CB  1 
ATOM   3984  C  CG  . GLN B  1 182 ? 22.852 -54.372 -46.131  1.00 21.42 ? 182 GLN B CG  1 
ATOM   3985  C  CD  . GLN B  1 182 ? 22.130 -54.403 -44.802  1.00 22.25 ? 182 GLN B CD  1 
ATOM   3986  O  OE1 . GLN B  1 182 ? 21.025 -54.942 -44.699  1.00 22.59 ? 182 GLN B OE1 1 
ATOM   3987  N  NE2 . GLN B  1 182 ? 22.743 -53.823 -43.779  1.00 17.55 ? 182 GLN B NE2 1 
ATOM   3988  N  N   . ARG B  1 183 ? 21.762 -56.110 -49.349  1.00 19.47 ? 183 ARG B N   1 
ATOM   3989  C  CA  . ARG B  1 183 ? 21.904 -57.518 -49.684  1.00 21.89 ? 183 ARG B CA  1 
ATOM   3990  C  C   . ARG B  1 183 ? 22.834 -57.718 -50.880  1.00 20.68 ? 183 ARG B C   1 
ATOM   3991  O  O   . ARG B  1 183 ? 23.773 -58.509 -50.819  1.00 20.81 ? 183 ARG B O   1 
ATOM   3992  C  CB  . ARG B  1 183 ? 20.540 -58.161 -49.965  1.00 23.30 ? 183 ARG B CB  1 
ATOM   3993  C  CG  . ARG B  1 183 ? 20.645 -59.631 -50.353  1.00 30.19 ? 183 ARG B CG  1 
ATOM   3994  C  CD  . ARG B  1 183 ? 19.307 -60.223 -50.787  1.00 32.41 ? 183 ARG B CD  1 
ATOM   3995  N  NE  . ARG B  1 183 ? 18.769 -59.567 -51.978  1.00 33.82 ? 183 ARG B NE  1 
ATOM   3996  C  CZ  . ARG B  1 183 ? 19.195 -59.792 -53.218  1.00 34.93 ? 183 ARG B CZ  1 
ATOM   3997  N  NH1 . ARG B  1 183 ? 18.643 -59.148 -54.236  1.00 35.44 ? 183 ARG B NH1 1 
ATOM   3998  N  NH2 . ARG B  1 183 ? 20.177 -60.657 -53.442  1.00 32.73 ? 183 ARG B NH2 1 
ATOM   3999  N  N   . ILE B  1 184 ? 22.568 -57.006 -51.969  1.00 19.90 ? 184 ILE B N   1 
ATOM   4000  C  CA  . ILE B  1 184 ? 23.359 -57.168 -53.184  1.00 20.26 ? 184 ILE B CA  1 
ATOM   4001  C  C   . ILE B  1 184 ? 24.826 -56.807 -52.921  1.00 19.94 ? 184 ILE B C   1 
ATOM   4002  O  O   . ILE B  1 184 ? 25.734 -57.573 -53.243  1.00 19.36 ? 184 ILE B O   1 
ATOM   4003  C  CB  . ILE B  1 184 ? 22.773 -56.351 -54.355  1.00 21.71 ? 184 ILE B CB  1 
ATOM   4004  C  CG1 . ILE B  1 184 ? 21.360 -56.848 -54.691  1.00 21.85 ? 184 ILE B CG1 1 
ATOM   4005  C  CG2 . ILE B  1 184 ? 23.675 -56.436 -55.587  1.00 19.49 ? 184 ILE B CG2 1 
ATOM   4006  C  CD1 . ILE B  1 184 ? 20.619 -55.950 -55.665  1.00 21.65 ? 184 ILE B CD1 1 
ATOM   4007  N  N   . LEU B  1 185 ? 25.051 -55.660 -52.292  1.00 17.10 ? 185 LEU B N   1 
ATOM   4008  C  CA  . LEU B  1 185 ? 26.407 -55.231 -51.956  1.00 17.85 ? 185 LEU B CA  1 
ATOM   4009  C  C   . LEU B  1 185 ? 27.151 -56.246 -51.085  1.00 22.09 ? 185 LEU B C   1 
ATOM   4010  O  O   . LEU B  1 185 ? 28.297 -56.597 -51.370  1.00 22.43 ? 185 LEU B O   1 
ATOM   4011  C  CB  . LEU B  1 185 ? 26.388 -53.861 -51.274  1.00 16.45 ? 185 LEU B CB  1 
ATOM   4012  C  CG  . LEU B  1 185 ? 25.972 -52.685 -52.163  1.00 16.26 ? 185 LEU B CG  1 
ATOM   4013  C  CD1 . LEU B  1 185 ? 25.758 -51.438 -51.321  1.00 12.00 ? 185 LEU B CD1 1 
ATOM   4014  C  CD2 . LEU B  1 185 ? 27.013 -52.437 -53.256  1.00 15.59 ? 185 LEU B CD2 1 
ATOM   4015  N  N   . THR B  1 186 ? 26.509 -56.721 -50.024  1.00 20.17 ? 186 THR B N   1 
ATOM   4016  C  CA  . THR B  1 186 ? 27.183 -57.656 -49.136  1.00 22.55 ? 186 THR B CA  1 
ATOM   4017  C  C   . THR B  1 186 ? 27.407 -59.015 -49.822  1.00 26.66 ? 186 THR B C   1 
ATOM   4018  O  O   . THR B  1 186 ? 28.434 -59.661 -49.616  1.00 24.64 ? 186 THR B O   1 
ATOM   4019  C  CB  . THR B  1 186 ? 26.448 -57.819 -47.785  1.00 25.36 ? 186 THR B CB  1 
ATOM   4020  O  OG1 . THR B  1 186 ? 25.098 -58.233 -48.014  1.00 27.45 ? 186 THR B OG1 1 
ATOM   4021  C  CG2 . THR B  1 186 ? 26.443 -56.501 -47.019  1.00 18.56 ? 186 THR B CG2 1 
ATOM   4022  N  N   . GLU B  1 187 ? 26.458 -59.440 -50.647  1.00 22.36 ? 187 GLU B N   1 
ATOM   4023  C  CA  . GLU B  1 187 ? 26.651 -60.661 -51.422  1.00 28.94 ? 187 GLU B CA  1 
ATOM   4024  C  C   . GLU B  1 187 ? 27.854 -60.531 -52.356  1.00 28.26 ? 187 GLU B C   1 
ATOM   4025  O  O   . GLU B  1 187 ? 28.543 -61.507 -52.621  1.00 31.69 ? 187 GLU B O   1 
ATOM   4026  C  CB  . GLU B  1 187 ? 25.389 -61.018 -52.209  1.00 30.04 ? 187 GLU B CB  1 
ATOM   4027  C  CG  . GLU B  1 187 ? 24.267 -61.541 -51.326  1.00 37.36 ? 187 GLU B CG  1 
ATOM   4028  C  CD  . GLU B  1 187 ? 22.991 -61.840 -52.093  1.00 38.27 ? 187 GLU B CD  1 
ATOM   4029  O  OE1 . GLU B  1 187 ? 22.001 -62.253 -51.454  1.00 42.68 ? 187 GLU B OE1 1 
ATOM   4030  O  OE2 . GLU B  1 187 ? 22.977 -61.661 -53.329  1.00 41.00 ? 187 GLU B OE2 1 
ATOM   4031  N  N   . GLU B  1 188 ? 28.103 -59.316 -52.839  1.00 26.28 ? 188 GLU B N   1 
ATOM   4032  C  CA  . GLU B  1 188 ? 29.235 -59.038 -53.718  1.00 27.91 ? 188 GLU B CA  1 
ATOM   4033  C  C   . GLU B  1 188 ? 30.535 -58.807 -52.950  1.00 27.26 ? 188 GLU B C   1 
ATOM   4034  O  O   . GLU B  1 188 ? 31.546 -58.438 -53.538  1.00 29.69 ? 188 GLU B O   1 
ATOM   4035  C  CB  . GLU B  1 188 ? 28.944 -57.816 -54.600  1.00 27.09 ? 188 GLU B CB  1 
ATOM   4036  C  CG  . GLU B  1 188 ? 27.928 -58.066 -55.699  1.00 34.30 ? 188 GLU B CG  1 
ATOM   4037  C  CD  . GLU B  1 188 ? 28.455 -58.992 -56.783  1.00 51.06 ? 188 GLU B CD  1 
ATOM   4038  O  OE1 . GLU B  1 188 ? 29.674 -59.283 -56.791  1.00 52.24 ? 188 GLU B OE1 1 
ATOM   4039  O  OE2 . GLU B  1 188 ? 27.646 -59.430 -57.631  1.00 57.12 ? 188 GLU B OE2 1 
ATOM   4040  N  N   . GLY B  1 189 ? 30.507 -58.998 -51.638  1.00 23.27 ? 189 GLY B N   1 
ATOM   4041  C  CA  . GLY B  1 189 ? 31.733 -58.922 -50.844  1.00 22.47 ? 189 GLY B CA  1 
ATOM   4042  C  C   . GLY B  1 189 ? 32.050 -57.581 -50.203  1.00 23.23 ? 189 GLY B C   1 
ATOM   4043  O  O   . GLY B  1 189 ? 33.151 -57.384 -49.693  1.00 23.65 ? 189 GLY B O   1 
ATOM   4044  N  N   . VAL B  1 190 ? 31.099 -56.649 -50.222  1.00 20.51 ? 190 VAL B N   1 
ATOM   4045  C  CA  . VAL B  1 190 ? 31.297 -55.379 -49.525  1.00 18.31 ? 190 VAL B CA  1 
ATOM   4046  C  C   . VAL B  1 190 ? 31.069 -55.600 -48.032  1.00 19.89 ? 190 VAL B C   1 
ATOM   4047  O  O   . VAL B  1 190 ? 30.108 -56.258 -47.628  1.00 18.57 ? 190 VAL B O   1 
ATOM   4048  C  CB  . VAL B  1 190 ? 30.338 -54.272 -50.034  1.00 18.03 ? 190 VAL B CB  1 
ATOM   4049  C  CG1 . VAL B  1 190 ? 30.549 -52.969 -49.263  1.00 17.04 ? 190 VAL B CG1 1 
ATOM   4050  C  CG2 . VAL B  1 190 ? 30.540 -54.042 -51.523  1.00 18.84 ? 190 VAL B CG2 1 
ATOM   4051  N  N   . ASP B  1 191 ? 31.977 -55.075 -47.221  1.00 18.64 ? 191 ASP B N   1 
ATOM   4052  C  CA  . ASP B  1 191 ? 31.812 -55.062 -45.775  1.00 21.01 ? 191 ASP B CA  1 
ATOM   4053  C  C   . ASP B  1 191 ? 30.577 -54.206 -45.477  1.00 20.95 ? 191 ASP B C   1 
ATOM   4054  O  O   . ASP B  1 191 ? 30.508 -53.057 -45.905  1.00 19.50 ? 191 ASP B O   1 
ATOM   4055  C  CB  . ASP B  1 191 ? 33.065 -54.445 -45.149  1.00 22.24 ? 191 ASP B CB  1 
ATOM   4056  C  CG  . ASP B  1 191 ? 32.962 -54.272 -43.641  1.00 27.93 ? 191 ASP B CG  1 
ATOM   4057  O  OD1 . ASP B  1 191 ? 31.857 -54.385 -43.071  1.00 30.08 ? 191 ASP B OD1 1 
ATOM   4058  O  OD2 . ASP B  1 191 ? 34.012 -54.007 -43.022  1.00 37.87 ? 191 ASP B OD2 1 
ATOM   4059  N  N   . PRO B  1 192 ? 29.586 -54.772 -44.770  1.00 19.36 ? 192 PRO B N   1 
ATOM   4060  C  CA  . PRO B  1 192 ? 28.344 -54.032 -44.524  1.00 20.46 ? 192 PRO B CA  1 
ATOM   4061  C  C   . PRO B  1 192 ? 28.595 -52.720 -43.784  1.00 19.90 ? 192 PRO B C   1 
ATOM   4062  O  O   . PRO B  1 192 ? 27.820 -51.773 -43.936  1.00 20.82 ? 192 PRO B O   1 
ATOM   4063  C  CB  . PRO B  1 192 ? 27.518 -54.990 -43.646  1.00 20.65 ? 192 PRO B CB  1 
ATOM   4064  C  CG  . PRO B  1 192 ? 28.502 -55.982 -43.107  1.00 24.71 ? 192 PRO B CG  1 
ATOM   4065  C  CD  . PRO B  1 192 ? 29.560 -56.116 -44.167  1.00 21.30 ? 192 PRO B CD  1 
ATOM   4066  N  N   . GLY B  1 193 ? 29.659 -52.681 -42.982  1.00 17.65 ? 193 GLY B N   1 
ATOM   4067  C  CA  . GLY B  1 193 ? 30.049 -51.472 -42.254  1.00 17.28 ? 193 GLY B CA  1 
ATOM   4068  C  C   . GLY B  1 193 ? 30.635 -50.382 -43.135  1.00 17.72 ? 193 GLY B C   1 
ATOM   4069  O  O   . GLY B  1 193 ? 30.959 -49.290 -42.657  1.00 16.60 ? 193 GLY B O   1 
ATOM   4070  N  N   . LYS B  1 194 ? 30.783 -50.673 -44.425  1.00 16.43 ? 194 LYS B N   1 
ATOM   4071  C  CA  . LYS B  1 194 ? 31.229 -49.663 -45.380  1.00 17.75 ? 194 LYS B CA  1 
ATOM   4072  C  C   . LYS B  1 194 ? 30.043 -49.126 -46.183  1.00 17.47 ? 194 LYS B C   1 
ATOM   4073  O  O   . LYS B  1 194 ? 30.223 -48.444 -47.185  1.00 17.55 ? 194 LYS B O   1 
ATOM   4074  C  CB  . LYS B  1 194 ? 32.303 -50.225 -46.318  1.00 18.95 ? 194 LYS B CB  1 
ATOM   4075  C  CG  . LYS B  1 194 ? 33.603 -50.610 -45.619  1.00 22.51 ? 194 LYS B CG  1 
ATOM   4076  C  CD  . LYS B  1 194 ? 34.269 -49.415 -44.948  1.00 25.25 ? 194 LYS B CD  1 
ATOM   4077  C  CE  . LYS B  1 194 ? 34.945 -48.510 -45.960  1.00 26.60 ? 194 LYS B CE  1 
ATOM   4078  N  NZ  . LYS B  1 194 ? 35.811 -47.486 -45.304  1.00 27.05 ? 194 LYS B NZ  1 
ATOM   4079  N  N   . ILE B  1 195 ? 28.831 -49.438 -45.730  1.00 16.04 ? 195 ILE B N   1 
ATOM   4080  C  CA  . ILE B  1 195 ? 27.626 -49.018 -46.424  1.00 14.35 ? 195 ILE B CA  1 
ATOM   4081  C  C   . ILE B  1 195 ? 26.769 -48.140 -45.531  1.00 16.44 ? 195 ILE B C   1 
ATOM   4082  O  O   . ILE B  1 195 ? 26.569 -48.449 -44.354  1.00 15.62 ? 195 ILE B O   1 
ATOM   4083  C  CB  . ILE B  1 195 ? 26.763 -50.220 -46.859  1.00 14.78 ? 195 ILE B CB  1 
ATOM   4084  C  CG1 . ILE B  1 195 ? 27.607 -51.264 -47.590  1.00 15.41 ? 195 ILE B CG1 1 
ATOM   4085  C  CG2 . ILE B  1 195 ? 25.617 -49.753 -47.746  1.00 16.70 ? 195 ILE B CG2 1 
ATOM   4086  C  CD1 . ILE B  1 195 ? 26.861 -52.560 -47.853  1.00 15.42 ? 195 ILE B CD1 1 
ATOM   4087  N  N   . LEU B  1 196 ? 26.275 -47.037 -46.091  1.00 15.15 ? 196 LEU B N   1 
ATOM   4088  C  CA  . LEU B  1 196 ? 25.279 -46.218 -45.412  1.00 14.08 ? 196 LEU B CA  1 
ATOM   4089  C  C   . LEU B  1 196 ? 23.991 -46.326 -46.213  1.00 12.49 ? 196 LEU B C   1 
ATOM   4090  O  O   . LEU B  1 196 ? 23.918 -45.850 -47.348  1.00 12.65 ? 196 LEU B O   1 
ATOM   4091  C  CB  . LEU B  1 196 ? 25.731 -44.751 -45.301  1.00 14.11 ? 196 LEU B CB  1 
ATOM   4092  C  CG  . LEU B  1 196 ? 24.639 -43.703 -45.003  1.00 13.26 ? 196 LEU B CG  1 
ATOM   4093  C  CD1 . LEU B  1 196 ? 23.980 -43.966 -43.659  1.00 11.78 ? 196 LEU B CD1 1 
ATOM   4094  C  CD2 . LEU B  1 196 ? 25.235 -42.297 -45.030  1.00 13.50 ? 196 LEU B CD2 1 
ATOM   4095  N  N   . ILE B  1 197 ? 22.985 -46.975 -45.638  1.00 13.40 ? 197 ILE B N   1 
ATOM   4096  C  CA  . ILE B  1 197 ? 21.706 -47.107 -46.322  1.00 14.22 ? 197 ILE B CA  1 
ATOM   4097  C  C   . ILE B  1 197 ? 20.887 -45.853 -46.037  1.00 16.71 ? 197 ILE B C   1 
ATOM   4098  O  O   . ILE B  1 197 ? 20.544 -45.565 -44.886  1.00 14.97 ? 197 ILE B O   1 
ATOM   4099  C  CB  . ILE B  1 197 ? 20.949 -48.371 -45.883  1.00 16.52 ? 197 ILE B CB  1 
ATOM   4100  C  CG1 . ILE B  1 197 ? 21.790 -49.622 -46.188  1.00 15.83 ? 197 ILE B CG1 1 
ATOM   4101  C  CG2 . ILE B  1 197 ? 19.598 -48.451 -46.584  1.00 15.18 ? 197 ILE B CG2 1 
ATOM   4102  C  CD1 . ILE B  1 197 ? 22.020 -49.846 -47.672  1.00 13.84 ? 197 ILE B CD1 1 
ATOM   4103  N  N   . GLY B  1 198 ? 20.577 -45.105 -47.091  1.00 14.93 ? 198 GLY B N   1 
ATOM   4104  C  CA  . GLY B  1 198 ? 20.041 -43.761 -46.924  1.00 14.47 ? 198 GLY B CA  1 
ATOM   4105  C  C   . GLY B  1 198 ? 18.532 -43.648 -46.838  1.00 17.61 ? 198 GLY B C   1 
ATOM   4106  O  O   . GLY B  1 198 ? 17.801 -44.525 -47.305  1.00 16.97 ? 198 GLY B O   1 
ATOM   4107  N  N   . HIS B  1 199 ? 18.087 -42.560 -46.212  1.00 14.34 ? 199 HIS B N   1 
ATOM   4108  C  CA  . HIS B  1 199 ? 16.689 -42.131 -46.198  1.00 15.81 ? 199 HIS B CA  1 
ATOM   4109  C  C   . HIS B  1 199 ? 15.775 -43.039 -45.397  1.00 16.91 ? 199 HIS B C   1 
ATOM   4110  O  O   . HIS B  1 199 ? 14.557 -43.038 -45.575  1.00 13.85 ? 199 HIS B O   1 
ATOM   4111  C  CB  . HIS B  1 199 ? 16.176 -41.863 -47.625  1.00 14.21 ? 199 HIS B CB  1 
ATOM   4112  C  CG  . HIS B  1 199 ? 17.095 -40.965 -48.456  1.00 13.33 ? 199 HIS B CG  1 
ATOM   4113  N  ND1 . HIS B  1 199 ? 17.895 -40.023 -47.902  1.00 15.25 ? 199 HIS B ND1 1 
ATOM   4114  C  CD2 . HIS B  1 199 ? 17.296 -40.881 -49.840  1.00 13.89 ? 199 HIS B CD2 1 
ATOM   4115  C  CE1 . HIS B  1 199 ? 18.588 -39.384 -48.874  1.00 11.74 ? 199 HIS B CE1 1 
ATOM   4116  N  NE2 . HIS B  1 199 ? 18.224 -39.905 -50.063  1.00 14.55 ? 199 HIS B NE2 1 
ATOM   4117  N  N   . LEU B  1 200 ? 16.358 -43.792 -44.468  1.00 16.99 ? 200 LEU B N   1 
ATOM   4118  C  CA  . LEU B  1 200 ? 15.573 -44.645 -43.576  1.00 17.02 ? 200 LEU B CA  1 
ATOM   4119  C  C   . LEU B  1 200 ? 14.789 -43.818 -42.561  1.00 18.89 ? 200 LEU B C   1 
ATOM   4120  O  O   . LEU B  1 200 ? 13.791 -44.278 -42.007  1.00 18.28 ? 200 LEU B O   1 
ATOM   4121  C  CB  . LEU B  1 200 ? 16.491 -45.640 -42.851  1.00 16.40 ? 200 LEU B CB  1 
ATOM   4122  C  CG  . LEU B  1 200 ? 17.162 -46.623 -43.817  1.00 16.01 ? 200 LEU B CG  1 
ATOM   4123  C  CD1 . LEU B  1 200 ? 18.054 -47.621 -43.088  1.00 16.99 ? 200 LEU B CD1 1 
ATOM   4124  C  CD2 . LEU B  1 200 ? 16.093 -47.354 -44.617  1.00 14.66 ? 200 LEU B CD2 1 
ATOM   4125  N  N   . GLY B  1 201 ? 15.252 -42.597 -42.312  1.00 16.78 ? 201 GLY B N   1 
ATOM   4126  C  CA  . GLY B  1 201 ? 14.533 -41.687 -41.429  1.00 18.87 ? 201 GLY B CA  1 
ATOM   4127  C  C   . GLY B  1 201 ? 13.213 -41.214 -42.013  1.00 17.65 ? 201 GLY B C   1 
ATOM   4128  O  O   . GLY B  1 201 ? 12.437 -40.542 -41.330  1.00 18.13 ? 201 GLY B O   1 
ATOM   4129  N  N   . ASP B  1 202 ? 12.960 -41.548 -43.278  1.00 16.50 ? 202 ASP B N   1 
ATOM   4130  C  CA  . ASP B  1 202 ? 11.668 -41.226 -43.912  1.00 19.81 ? 202 ASP B CA  1 
ATOM   4131  C  C   . ASP B  1 202 ? 10.528 -42.106 -43.374  1.00 21.04 ? 202 ASP B C   1 
ATOM   4132  O  O   . ASP B  1 202 ? 9.352  -41.891 -43.692  1.00 19.34 ? 202 ASP B O   1 
ATOM   4133  C  CB  . ASP B  1 202 ? 11.744 -41.388 -45.435  1.00 19.06 ? 202 ASP B CB  1 
ATOM   4134  C  CG  . ASP B  1 202 ? 12.710 -40.413 -46.085  1.00 19.36 ? 202 ASP B CG  1 
ATOM   4135  O  OD1 . ASP B  1 202 ? 13.295 -39.561 -45.377  1.00 21.39 ? 202 ASP B OD1 1 
ATOM   4136  O  OD2 . ASP B  1 202 ? 12.872 -40.498 -47.319  1.00 20.62 ? 202 ASP B OD2 1 
ATOM   4137  N  N   . THR B  1 203 ? 10.873 -43.101 -42.567  1.00 22.09 ? 203 THR B N   1 
ATOM   4138  C  CA  . THR B  1 203 ? 9.855  -43.975 -41.989  1.00 21.63 ? 203 THR B CA  1 
ATOM   4139  C  C   . THR B  1 203 ? 9.996  -44.066 -40.472  1.00 24.69 ? 203 THR B C   1 
ATOM   4140  O  O   . THR B  1 203 ? 11.076 -43.819 -39.910  1.00 22.32 ? 203 THR B O   1 
ATOM   4141  C  CB  . THR B  1 203 ? 9.906  -45.400 -42.583  1.00 22.63 ? 203 THR B CB  1 
ATOM   4142  O  OG1 . THR B  1 203 ? 8.848  -46.185 -42.021  1.00 23.55 ? 203 THR B OG1 1 
ATOM   4143  C  CG2 . THR B  1 203 ? 11.233 -46.080 -42.261  1.00 21.27 ? 203 THR B CG2 1 
ATOM   4144  N  N   . ASP B  1 204 ? 8.896  -44.408 -39.813  1.00 23.57 ? 204 ASP B N   1 
ATOM   4145  C  CA  . ASP B  1 204 ? 8.920  -44.646 -38.381  1.00 29.76 ? 204 ASP B CA  1 
ATOM   4146  C  C   . ASP B  1 204 ? 8.798  -46.143 -38.122  1.00 27.54 ? 204 ASP B C   1 
ATOM   4147  O  O   . ASP B  1 204 ? 8.596  -46.574 -36.987  1.00 25.98 ? 204 ASP B O   1 
ATOM   4148  C  CB  . ASP B  1 204 ? 7.809  -43.867 -37.667  1.00 30.22 ? 204 ASP B CB  1 
ATOM   4149  C  CG  . ASP B  1 204 ? 6.430  -44.230 -38.170  1.00 41.13 ? 204 ASP B CG  1 
ATOM   4150  O  OD1 . ASP B  1 204 ? 5.468  -43.501 -37.844  1.00 50.69 ? 204 ASP B OD1 1 
ATOM   4151  O  OD2 . ASP B  1 204 ? 6.307  -45.242 -38.894  1.00 38.84 ? 204 ASP B OD2 1 
ATOM   4152  N  N   . ASN B  1 205 ? 8.928  -46.933 -39.183  1.00 24.91 ? 205 ASN B N   1 
ATOM   4153  C  CA  . ASN B  1 205 ? 8.946  -48.388 -39.047  1.00 28.48 ? 205 ASN B CA  1 
ATOM   4154  C  C   . ASN B  1 205 ? 10.281 -48.842 -38.461  1.00 28.07 ? 205 ASN B C   1 
ATOM   4155  O  O   . ASN B  1 205 ? 11.224 -49.151 -39.192  1.00 25.96 ? 205 ASN B O   1 
ATOM   4156  C  CB  . ASN B  1 205 ? 8.699  -49.064 -40.396  1.00 27.05 ? 205 ASN B CB  1 
ATOM   4157  C  CG  . ASN B  1 205 ? 8.669  -50.577 -40.292  1.00 28.42 ? 205 ASN B CG  1 
ATOM   4158  O  OD1 . ASN B  1 205 ? 9.039  -51.151 -39.269  1.00 26.11 ? 205 ASN B OD1 1 
ATOM   4159  N  ND2 . ASN B  1 205 ? 8.232  -51.231 -41.355  1.00 30.52 ? 205 ASN B ND2 1 
ATOM   4160  N  N   . ILE B  1 206 ? 10.351 -48.875 -37.136  1.00 25.93 ? 206 ILE B N   1 
ATOM   4161  C  CA  . ILE B  1 206 ? 11.595 -49.170 -36.433  1.00 28.57 ? 206 ILE B CA  1 
ATOM   4162  C  C   . ILE B  1 206 ? 12.158 -50.566 -36.710  1.00 24.57 ? 206 ILE B C   1 
ATOM   4163  O  O   . ILE B  1 206 ? 13.369 -50.758 -36.677  1.00 25.83 ? 206 ILE B O   1 
ATOM   4164  C  CB  . ILE B  1 206 ? 11.438 -48.972 -34.909  1.00 34.46 ? 206 ILE B CB  1 
ATOM   4165  C  CG1 . ILE B  1 206 ? 11.719 -47.516 -34.532  1.00 38.62 ? 206 ILE B CG1 1 
ATOM   4166  C  CG2 . ILE B  1 206 ? 12.389 -49.876 -34.144  1.00 41.96 ? 206 ILE B CG2 1 
ATOM   4167  C  CD1 . ILE B  1 206 ? 10.546 -46.584 -34.749  1.00 43.56 ? 206 ILE B CD1 1 
ATOM   4168  N  N   . ASP B  1 207 ? 11.289 -51.538 -36.975  1.00 24.62 ? 207 ASP B N   1 
ATOM   4169  C  CA  . ASP B  1 207 ? 11.751 -52.912 -37.178  1.00 27.82 ? 207 ASP B CA  1 
ATOM   4170  C  C   . ASP B  1 207 ? 12.499 -53.067 -38.498  1.00 25.63 ? 207 ASP B C   1 
ATOM   4171  O  O   . ASP B  1 207 ? 13.448 -53.843 -38.598  1.00 25.96 ? 207 ASP B O   1 
ATOM   4172  C  CB  . ASP B  1 207 ? 10.587 -53.897 -37.109  1.00 30.11 ? 207 ASP B CB  1 
ATOM   4173  C  CG  . ASP B  1 207 ? 10.101 -54.121 -35.687  1.00 36.62 ? 207 ASP B CG  1 
ATOM   4174  O  OD1 . ASP B  1 207 ? 8.975  -54.627 -35.521  1.00 40.38 ? 207 ASP B OD1 1 
ATOM   4175  O  OD2 . ASP B  1 207 ? 10.844 -53.787 -34.738  1.00 36.67 ? 207 ASP B OD2 1 
ATOM   4176  N  N   . TYR B  1 208 ? 12.049 -52.338 -39.511  1.00 21.71 ? 208 TYR B N   1 
ATOM   4177  C  CA  . TYR B  1 208 ? 12.731 -52.323 -40.796  1.00 21.11 ? 208 TYR B CA  1 
ATOM   4178  C  C   . TYR B  1 208 ? 14.097 -51.650 -40.638  1.00 19.56 ? 208 TYR B C   1 
ATOM   4179  O  O   . TYR B  1 208 ? 15.120 -52.172 -41.093  1.00 19.46 ? 208 TYR B O   1 
ATOM   4180  C  CB  . TYR B  1 208 ? 11.886 -51.588 -41.842  1.00 19.58 ? 208 TYR B CB  1 
ATOM   4181  C  CG  . TYR B  1 208 ? 12.576 -51.430 -43.180  1.00 20.64 ? 208 TYR B CG  1 
ATOM   4182  C  CD1 . TYR B  1 208 ? 12.913 -52.543 -43.942  1.00 19.57 ? 208 TYR B CD1 1 
ATOM   4183  C  CD2 . TYR B  1 208 ? 12.884 -50.171 -43.681  1.00 18.83 ? 208 TYR B CD2 1 
ATOM   4184  C  CE1 . TYR B  1 208 ? 13.544 -52.407 -45.163  1.00 19.59 ? 208 TYR B CE1 1 
ATOM   4185  C  CE2 . TYR B  1 208 ? 13.517 -50.024 -44.904  1.00 17.97 ? 208 TYR B CE2 1 
ATOM   4186  C  CZ  . TYR B  1 208 ? 13.843 -51.147 -45.638  1.00 18.36 ? 208 TYR B CZ  1 
ATOM   4187  O  OH  . TYR B  1 208 ? 14.475 -51.016 -46.853  1.00 19.39 ? 208 TYR B OH  1 
ATOM   4188  N  N   . ILE B  1 209 ? 14.112 -50.492 -39.987  1.00 18.98 ? 209 ILE B N   1 
ATOM   4189  C  CA  . ILE B  1 209 ? 15.362 -49.779 -39.746  1.00 18.13 ? 209 ILE B CA  1 
ATOM   4190  C  C   . ILE B  1 209 ? 16.375 -50.659 -38.995  1.00 19.94 ? 209 ILE B C   1 
ATOM   4191  O  O   . ILE B  1 209 ? 17.536 -50.771 -39.401  1.00 19.23 ? 209 ILE B O   1 
ATOM   4192  C  CB  . ILE B  1 209 ? 15.112 -48.452 -38.996  1.00 19.37 ? 209 ILE B CB  1 
ATOM   4193  C  CG1 . ILE B  1 209 ? 14.228 -47.528 -39.844  1.00 17.00 ? 209 ILE B CG1 1 
ATOM   4194  C  CG2 . ILE B  1 209 ? 16.429 -47.767 -38.656  1.00 17.15 ? 209 ILE B CG2 1 
ATOM   4195  C  CD1 . ILE B  1 209 ? 13.644 -46.353 -39.082  1.00 17.66 ? 209 ILE B CD1 1 
ATOM   4196  N  N   . LYS B  1 210 ? 15.930 -51.298 -37.914  1.00 19.99 ? 210 LYS B N   1 
ATOM   4197  C  CA  . LYS B  1 210 ? 16.807 -52.165 -37.115  1.00 22.51 ? 210 LYS B CA  1 
ATOM   4198  C  C   . LYS B  1 210 ? 17.348 -53.350 -37.906  1.00 22.00 ? 210 LYS B C   1 
ATOM   4199  O  O   . LYS B  1 210 ? 18.463 -53.811 -37.664  1.00 22.81 ? 210 LYS B O   1 
ATOM   4200  C  CB  . LYS B  1 210 ? 16.073 -52.695 -35.875  1.00 20.68 ? 210 LYS B CB  1 
ATOM   4201  C  CG  . LYS B  1 210 ? 15.912 -51.683 -34.755  1.00 21.96 ? 210 LYS B CG  1 
ATOM   4202  C  CD  . LYS B  1 210 ? 15.123 -52.288 -33.597  1.00 24.90 ? 210 LYS B CD  1 
ATOM   4203  C  CE  . LYS B  1 210 ? 14.943 -51.285 -32.470  1.00 26.81 ? 210 LYS B CE  1 
ATOM   4204  N  NZ  . LYS B  1 210 ? 14.534 -51.937 -31.192  1.00 25.47 ? 210 LYS B NZ  1 
ATOM   4205  N  N   . LYS B  1 211 ? 16.541 -53.864 -38.828  1.00 22.92 ? 211 LYS B N   1 
ATOM   4206  C  CA  . LYS B  1 211 ? 16.923 -55.029 -39.616  1.00 24.22 ? 211 LYS B CA  1 
ATOM   4207  C  C   . LYS B  1 211 ? 18.151 -54.717 -40.468  1.00 23.97 ? 211 LYS B C   1 
ATOM   4208  O  O   . LYS B  1 211 ? 19.060 -55.535 -40.603  1.00 21.81 ? 211 LYS B O   1 
ATOM   4209  C  CB  . LYS B  1 211 ? 15.753 -55.460 -40.502  1.00 29.66 ? 211 LYS B CB  1 
ATOM   4210  C  CG  . LYS B  1 211 ? 15.935 -56.790 -41.208  1.00 37.54 ? 211 LYS B CG  1 
ATOM   4211  C  CD  . LYS B  1 211 ? 14.646 -57.201 -41.906  1.00 39.55 ? 211 LYS B CD  1 
ATOM   4212  C  CE  . LYS B  1 211 ? 14.790 -58.550 -42.593  1.00 52.87 ? 211 LYS B CE  1 
ATOM   4213  N  NZ  . LYS B  1 211 ? 13.589 -58.891 -43.407  1.00 56.65 ? 211 LYS B NZ  1 
ATOM   4214  N  N   . ILE B  1 212 ? 18.166 -53.524 -41.051  1.00 21.02 ? 212 ILE B N   1 
ATOM   4215  C  CA  . ILE B  1 212 ? 19.293 -53.090 -41.869  1.00 19.65 ? 212 ILE B CA  1 
ATOM   4216  C  C   . ILE B  1 212 ? 20.532 -52.870 -40.988  1.00 19.24 ? 212 ILE B C   1 
ATOM   4217  O  O   . ILE B  1 212 ? 21.633 -53.339 -41.309  1.00 17.04 ? 212 ILE B O   1 
ATOM   4218  C  CB  . ILE B  1 212 ? 18.922 -51.833 -42.686  1.00 19.87 ? 212 ILE B CB  1 
ATOM   4219  C  CG1 . ILE B  1 212 ? 17.982 -52.232 -43.834  1.00 20.42 ? 212 ILE B CG1 1 
ATOM   4220  C  CG2 . ILE B  1 212 ? 20.169 -51.131 -43.216  1.00 17.12 ? 212 ILE B CG2 1 
ATOM   4221  C  CD1 . ILE B  1 212 ? 17.124 -51.103 -44.362  1.00 22.68 ? 212 ILE B CD1 1 
ATOM   4222  N  N   . ALA B  1 213 ? 20.340 -52.199 -39.856  1.00 15.94 ? 213 ALA B N   1 
ATOM   4223  C  CA  . ALA B  1 213 ? 21.436 -51.964 -38.925  1.00 18.07 ? 213 ALA B CA  1 
ATOM   4224  C  C   . ALA B  1 213 ? 22.019 -53.284 -38.400  1.00 20.23 ? 213 ALA B C   1 
ATOM   4225  O  O   . ALA B  1 213 ? 23.235 -53.434 -38.303  1.00 20.88 ? 213 ALA B O   1 
ATOM   4226  C  CB  . ALA B  1 213 ? 20.981 -51.072 -37.773  1.00 16.20 ? 213 ALA B CB  1 
ATOM   4227  N  N   . ASP B  1 214 ? 21.153 -54.242 -38.072  1.00 20.99 ? 214 ASP B N   1 
ATOM   4228  C  CA  . ASP B  1 214 ? 21.614 -55.512 -37.516  1.00 22.13 ? 214 ASP B CA  1 
ATOM   4229  C  C   . ASP B  1 214 ? 22.434 -56.310 -38.526  1.00 22.67 ? 214 ASP B C   1 
ATOM   4230  O  O   . ASP B  1 214 ? 23.232 -57.170 -38.147  1.00 21.77 ? 214 ASP B O   1 
ATOM   4231  C  CB  . ASP B  1 214 ? 20.440 -56.348 -36.989  1.00 25.61 ? 214 ASP B CB  1 
ATOM   4232  C  CG  . ASP B  1 214 ? 19.914 -55.843 -35.648  1.00 26.26 ? 214 ASP B CG  1 
ATOM   4233  O  OD1 . ASP B  1 214 ? 20.688 -55.237 -34.880  1.00 25.75 ? 214 ASP B OD1 1 
ATOM   4234  O  OD2 . ASP B  1 214 ? 18.722 -56.059 -35.361  1.00 31.30 ? 214 ASP B OD2 1 
ATOM   4235  N  N   . LYS B  1 215 ? 22.238 -56.023 -39.809  1.00 22.47 ? 215 LYS B N   1 
ATOM   4236  C  CA  . LYS B  1 215 ? 23.034 -56.662 -40.857  1.00 23.25 ? 215 LYS B CA  1 
ATOM   4237  C  C   . LYS B  1 215 ? 24.364 -55.950 -41.088  1.00 22.63 ? 215 LYS B C   1 
ATOM   4238  O  O   . LYS B  1 215 ? 25.150 -56.341 -41.952  1.00 19.80 ? 215 LYS B O   1 
ATOM   4239  C  CB  . LYS B  1 215 ? 22.226 -56.808 -42.148  1.00 25.99 ? 215 LYS B CB  1 
ATOM   4240  C  CG  . LYS B  1 215 ? 21.340 -58.049 -42.124  1.00 32.28 ? 215 LYS B CG  1 
ATOM   4241  C  CD  . LYS B  1 215 ? 20.256 -58.007 -43.185  1.00 35.27 ? 215 LYS B CD  1 
ATOM   4242  C  CE  . LYS B  1 215 ? 19.319 -59.197 -43.028  1.00 44.54 ? 215 LYS B CE  1 
ATOM   4243  N  NZ  . LYS B  1 215 ? 18.217 -59.162 -44.030  1.00 52.87 ? 215 LYS B NZ  1 
ATOM   4244  N  N   . GLY B  1 216 ? 24.617 -54.910 -40.299  1.00 17.08 ? 216 GLY B N   1 
ATOM   4245  C  CA  . GLY B  1 216 ? 25.956 -54.338 -40.217  1.00 17.34 ? 216 GLY B CA  1 
ATOM   4246  C  C   . GLY B  1 216 ? 26.188 -52.986 -40.875  1.00 16.00 ? 216 GLY B C   1 
ATOM   4247  O  O   . GLY B  1 216 ? 27.314 -52.490 -40.866  1.00 15.76 ? 216 GLY B O   1 
ATOM   4248  N  N   . SER B  1 217 ? 25.137 -52.385 -41.433  1.00 16.03 ? 217 SER B N   1 
ATOM   4249  C  CA  . SER B  1 217 ? 25.267 -51.116 -42.160  1.00 14.72 ? 217 SER B CA  1 
ATOM   4250  C  C   . SER B  1 217 ? 24.776 -49.915 -41.360  1.00 15.62 ? 217 SER B C   1 
ATOM   4251  O  O   . SER B  1 217 ? 23.883 -50.036 -40.515  1.00 14.72 ? 217 SER B O   1 
ATOM   4252  C  CB  . SER B  1 217 ? 24.513 -51.175 -43.493  1.00 14.45 ? 217 SER B CB  1 
ATOM   4253  O  OG  . SER B  1 217 ? 25.076 -52.158 -44.350  1.00 17.74 ? 217 SER B OG  1 
ATOM   4254  N  N   . PHE B  1 218 ? 25.360 -48.752 -41.635  1.00 13.45 ? 218 PHE B N   1 
ATOM   4255  C  CA  . PHE B  1 218 ? 24.889 -47.516 -41.036  1.00 13.74 ? 218 PHE B CA  1 
ATOM   4256  C  C   . PHE B  1 218 ? 23.505 -47.194 -41.582  1.00 13.50 ? 218 PHE B C   1 
ATOM   4257  O  O   . PHE B  1 218 ? 23.173 -47.552 -42.721  1.00 13.17 ? 218 PHE B O   1 
ATOM   4258  C  CB  . PHE B  1 218 ? 25.875 -46.359 -41.305  1.00 13.33 ? 218 PHE B CB  1 
ATOM   4259  C  CG  . PHE B  1 218 ? 27.195 -46.523 -40.596  1.00 15.39 ? 218 PHE B CG  1 
ATOM   4260  C  CD1 . PHE B  1 218 ? 28.312 -47.008 -41.271  1.00 16.08 ? 218 PHE B CD1 1 
ATOM   4261  C  CD2 . PHE B  1 218 ? 27.312 -46.221 -39.239  1.00 15.68 ? 218 PHE B CD2 1 
ATOM   4262  C  CE1 . PHE B  1 218 ? 29.523 -47.168 -40.614  1.00 17.12 ? 218 PHE B CE1 1 
ATOM   4263  C  CE2 . PHE B  1 218 ? 28.515 -46.388 -38.575  1.00 15.56 ? 218 PHE B CE2 1 
ATOM   4264  C  CZ  . PHE B  1 218 ? 29.623 -46.862 -39.262  1.00 17.53 ? 218 PHE B CZ  1 
ATOM   4265  N  N   . ILE B  1 219 ? 22.698 -46.526 -40.765  1.00 13.50 ? 219 ILE B N   1 
ATOM   4266  C  CA  . ILE B  1 219 ? 21.328 -46.207 -41.144  1.00 15.18 ? 219 ILE B CA  1 
ATOM   4267  C  C   . ILE B  1 219 ? 21.138 -44.698 -41.238  1.00 15.69 ? 219 ILE B C   1 
ATOM   4268  O  O   . ILE B  1 219 ? 21.461 -43.960 -40.306  1.00 15.24 ? 219 ILE B O   1 
ATOM   4269  C  CB  . ILE B  1 219 ? 20.316 -46.809 -40.155  1.00 15.97 ? 219 ILE B CB  1 
ATOM   4270  C  CG1 . ILE B  1 219 ? 20.772 -46.562 -38.713  1.00 17.36 ? 219 ILE B CG1 1 
ATOM   4271  C  CG2 . ILE B  1 219 ? 20.149 -48.301 -40.421  1.00 15.78 ? 219 ILE B CG2 1 
ATOM   4272  C  CD1 . ILE B  1 219 ? 19.749 -46.972 -37.669  1.00 20.63 ? 219 ILE B CD1 1 
ATOM   4273  N  N   . GLY B  1 220 ? 20.626 -44.246 -42.375  1.00 15.75 ? 220 GLY B N   1 
ATOM   4274  C  CA  . GLY B  1 220 ? 20.547 -42.815 -42.657  1.00 14.32 ? 220 GLY B CA  1 
ATOM   4275  C  C   . GLY B  1 220 ? 19.276 -42.159 -42.167  1.00 13.49 ? 220 GLY B C   1 
ATOM   4276  O  O   . GLY B  1 220 ? 18.252 -42.202 -42.839  1.00 14.14 ? 220 GLY B O   1 
ATOM   4277  N  N   . LEU B  1 221 ? 19.337 -41.550 -40.990  1.00 14.01 ? 221 LEU B N   1 
ATOM   4278  C  CA  . LEU B  1 221 ? 18.241 -40.708 -40.510  1.00 15.32 ? 221 LEU B CA  1 
ATOM   4279  C  C   . LEU B  1 221 ? 18.577 -39.302 -40.999  1.00 17.91 ? 221 LEU B C   1 
ATOM   4280  O  O   . LEU B  1 221 ? 18.933 -38.415 -40.222  1.00 16.72 ? 221 LEU B O   1 
ATOM   4281  C  CB  . LEU B  1 221 ? 18.152 -40.783 -38.986  1.00 15.34 ? 221 LEU B CB  1 
ATOM   4282  C  CG  . LEU B  1 221 ? 18.141 -42.217 -38.425  1.00 16.24 ? 221 LEU B CG  1 
ATOM   4283  C  CD1 . LEU B  1 221 ? 18.048 -42.208 -36.905  1.00 17.99 ? 221 LEU B CD1 1 
ATOM   4284  C  CD2 . LEU B  1 221 ? 17.016 -43.058 -39.022  1.00 16.26 ? 221 LEU B CD2 1 
ATOM   4285  N  N   . ASP B  1 222 ? 18.459 -39.118 -42.312  1.00 16.75 ? 222 ASP B N   1 
ATOM   4286  C  CA  . ASP B  1 222 ? 19.271 -38.144 -43.022  1.00 16.92 ? 222 ASP B CA  1 
ATOM   4287  C  C   . ASP B  1 222 ? 18.487 -37.090 -43.801  1.00 16.87 ? 222 ASP B C   1 
ATOM   4288  O  O   . ASP B  1 222 ? 19.061 -36.381 -44.627  1.00 17.54 ? 222 ASP B O   1 
ATOM   4289  C  CB  . ASP B  1 222 ? 20.222 -38.881 -43.976  1.00 18.10 ? 222 ASP B CB  1 
ATOM   4290  C  CG  . ASP B  1 222 ? 19.482 -39.806 -44.938  1.00 17.54 ? 222 ASP B CG  1 
ATOM   4291  O  OD1 . ASP B  1 222 ? 20.100 -40.762 -45.456  1.00 16.03 ? 222 ASP B OD1 1 
ATOM   4292  O  OD2 . ASP B  1 222 ? 18.274 -39.574 -45.173  1.00 17.47 ? 222 ASP B OD2 1 
ATOM   4293  N  N   . ARG B  1 223 ? 17.192 -36.969 -43.529  1.00 15.95 ? 223 ARG B N   1 
ATOM   4294  C  CA  . ARG B  1 223 ? 16.380 -35.967 -44.225  1.00 17.00 ? 223 ARG B CA  1 
ATOM   4295  C  C   . ARG B  1 223 ? 15.617 -35.046 -43.275  1.00 17.68 ? 223 ARG B C   1 
ATOM   4296  O  O   . ARG B  1 223 ? 14.511 -34.582 -43.580  1.00 19.22 ? 223 ARG B O   1 
ATOM   4297  C  CB  . ARG B  1 223 ? 15.438 -36.642 -45.224  1.00 16.21 ? 223 ARG B CB  1 
ATOM   4298  C  CG  . ARG B  1 223 ? 16.151 -37.094 -46.494  1.00 16.46 ? 223 ARG B CG  1 
ATOM   4299  C  CD  . ARG B  1 223 ? 15.238 -37.871 -47.430  1.00 17.31 ? 223 ARG B CD  1 
ATOM   4300  N  NE  . ARG B  1 223 ? 15.600 -37.640 -48.824  1.00 16.32 ? 223 ARG B NE  1 
ATOM   4301  C  CZ  . ARG B  1 223 ? 15.008 -38.225 -49.855  1.00 18.65 ? 223 ARG B CZ  1 
ATOM   4302  N  NH1 . ARG B  1 223 ? 14.035 -39.104 -49.651  1.00 16.63 ? 223 ARG B NH1 1 
ATOM   4303  N  NH2 . ARG B  1 223 ? 15.408 -37.949 -51.092  1.00 18.63 ? 223 ARG B NH2 1 
ATOM   4304  N  N   . TYR B  1 224 ? 16.222 -34.776 -42.126  1.00 18.03 ? 224 TYR B N   1 
ATOM   4305  C  CA  . TYR B  1 224 ? 15.632 -33.869 -41.154  1.00 20.58 ? 224 TYR B CA  1 
ATOM   4306  C  C   . TYR B  1 224 ? 15.214 -32.564 -41.806  1.00 21.51 ? 224 TYR B C   1 
ATOM   4307  O  O   . TYR B  1 224 ? 16.022 -31.907 -42.467  1.00 17.57 ? 224 TYR B O   1 
ATOM   4308  C  CB  . TYR B  1 224 ? 16.605 -33.600 -40.004  1.00 19.86 ? 224 TYR B CB  1 
ATOM   4309  C  CG  . TYR B  1 224 ? 16.356 -34.496 -38.814  1.00 21.87 ? 224 TYR B CG  1 
ATOM   4310  C  CD1 . TYR B  1 224 ? 17.166 -35.603 -38.554  1.00 19.56 ? 224 TYR B CD1 1 
ATOM   4311  C  CD2 . TYR B  1 224 ? 15.286 -34.250 -37.960  1.00 19.52 ? 224 TYR B CD2 1 
ATOM   4312  C  CE1 . TYR B  1 224 ? 16.917 -36.423 -37.460  1.00 17.58 ? 224 TYR B CE1 1 
ATOM   4313  C  CE2 . TYR B  1 224 ? 15.036 -35.061 -36.874  1.00 18.27 ? 224 TYR B CE2 1 
ATOM   4314  C  CZ  . TYR B  1 224 ? 15.847 -36.141 -36.626  1.00 18.62 ? 224 TYR B CZ  1 
ATOM   4315  O  OH  . TYR B  1 224 ? 15.573 -36.928 -35.530  1.00 19.44 ? 224 TYR B OH  1 
ATOM   4316  N  N   . GLY B  1 225 ? 13.948 -32.196 -41.620  1.00 21.06 ? 225 GLY B N   1 
ATOM   4317  C  CA  . GLY B  1 225 ? 13.405 -30.963 -42.201  1.00 20.72 ? 225 GLY B CA  1 
ATOM   4318  C  C   . GLY B  1 225 ? 12.519 -31.220 -43.411  1.00 26.18 ? 225 GLY B C   1 
ATOM   4319  O  O   . GLY B  1 225 ? 11.689 -30.391 -43.775  1.00 21.59 ? 225 GLY B O   1 
ATOM   4320  N  N   . LEU B  1 226 ? 12.694 -32.369 -44.051  1.00 22.55 ? 226 LEU B N   1 
ATOM   4321  C  CA  . LEU B  1 226 ? 11.844 -32.719 -45.186  1.00 23.05 ? 226 LEU B CA  1 
ATOM   4322  C  C   . LEU B  1 226 ? 10.555 -33.352 -44.679  1.00 24.11 ? 226 LEU B C   1 
ATOM   4323  O  O   . LEU B  1 226 ? 10.406 -34.574 -44.646  1.00 23.84 ? 226 LEU B O   1 
ATOM   4324  C  CB  . LEU B  1 226 ? 12.575 -33.627 -46.174  1.00 20.57 ? 226 LEU B CB  1 
ATOM   4325  C  CG  . LEU B  1 226 ? 13.642 -32.875 -46.983  1.00 23.58 ? 226 LEU B CG  1 
ATOM   4326  C  CD1 . LEU B  1 226 ? 14.648 -33.818 -47.628  1.00 22.72 ? 226 LEU B CD1 1 
ATOM   4327  C  CD2 . LEU B  1 226 ? 12.989 -31.981 -48.027  1.00 21.86 ? 226 LEU B CD2 1 
ATOM   4328  N  N   . ASP B  1 227 ? 9.625  -32.495 -44.276  1.00 25.41 ? 227 ASP B N   1 
ATOM   4329  C  CA  . ASP B  1 227 ? 8.403  -32.945 -43.622  1.00 27.43 ? 227 ASP B CA  1 
ATOM   4330  C  C   . ASP B  1 227 ? 7.512  -33.759 -44.547  1.00 28.17 ? 227 ASP B C   1 
ATOM   4331  O  O   . ASP B  1 227 ? 6.753  -34.609 -44.086  1.00 25.45 ? 227 ASP B O   1 
ATOM   4332  C  CB  . ASP B  1 227 ? 7.640  -31.756 -43.037  1.00 26.94 ? 227 ASP B CB  1 
ATOM   4333  C  CG  . ASP B  1 227 ? 8.332  -31.169 -41.815  1.00 32.42 ? 227 ASP B CG  1 
ATOM   4334  O  OD1 . ASP B  1 227 ? 9.286  -31.795 -41.307  1.00 29.11 ? 227 ASP B OD1 1 
ATOM   4335  O  OD2 . ASP B  1 227 ? 7.925  -30.087 -41.358  1.00 34.46 ? 227 ASP B OD2 1 
ATOM   4336  N  N   . LEU B  1 228 ? 7.615  -33.513 -45.849  1.00 23.70 ? 228 LEU B N   1 
ATOM   4337  C  CA  . LEU B  1 228 ? 6.791  -34.233 -46.808  1.00 25.38 ? 228 LEU B CA  1 
ATOM   4338  C  C   . LEU B  1 228 ? 7.117  -35.727 -46.782  1.00 29.53 ? 228 LEU B C   1 
ATOM   4339  O  O   . LEU B  1 228 ? 6.279  -36.553 -47.130  1.00 27.33 ? 228 LEU B O   1 
ATOM   4340  C  CB  . LEU B  1 228 ? 6.949  -33.661 -48.219  1.00 26.00 ? 228 LEU B CB  1 
ATOM   4341  C  CG  . LEU B  1 228 ? 8.112  -34.150 -49.089  1.00 22.83 ? 228 LEU B CG  1 
ATOM   4342  C  CD1 . LEU B  1 228 ? 7.889  -33.763 -50.547  1.00 21.81 ? 228 LEU B CD1 1 
ATOM   4343  C  CD2 . LEU B  1 228 ? 9.448  -33.621 -48.589  1.00 24.10 ? 228 LEU B CD2 1 
ATOM   4344  N  N   . PHE B  1 229 ? 8.329  -36.074 -46.357  1.00 25.54 ? 229 PHE B N   1 
ATOM   4345  C  CA  . PHE B  1 229 ? 8.683  -37.481 -46.187  1.00 23.22 ? 229 PHE B CA  1 
ATOM   4346  C  C   . PHE B  1 229 ? 8.300  -37.969 -44.782  1.00 26.31 ? 229 PHE B C   1 
ATOM   4347  O  O   . PHE B  1 229 ? 7.679  -39.016 -44.626  1.00 26.92 ? 229 PHE B O   1 
ATOM   4348  C  CB  . PHE B  1 229 ? 10.170 -37.713 -46.486  1.00 23.50 ? 229 PHE B CB  1 
ATOM   4349  C  CG  . PHE B  1 229 ? 10.556 -37.428 -47.918  1.00 25.80 ? 229 PHE B CG  1 
ATOM   4350  C  CD1 . PHE B  1 229 ? 9.813  -37.950 -48.972  1.00 29.42 ? 229 PHE B CD1 1 
ATOM   4351  C  CD2 . PHE B  1 229 ? 11.663 -36.651 -48.213  1.00 22.76 ? 229 PHE B CD2 1 
ATOM   4352  C  CE1 . PHE B  1 229 ? 10.165 -37.694 -50.288  1.00 29.37 ? 229 PHE B CE1 1 
ATOM   4353  C  CE2 . PHE B  1 229 ? 12.016 -36.385 -49.527  1.00 26.87 ? 229 PHE B CE2 1 
ATOM   4354  C  CZ  . PHE B  1 229 ? 11.269 -36.911 -50.567  1.00 25.49 ? 229 PHE B CZ  1 
ATOM   4355  N  N   . LEU B  1 230 ? 8.671  -37.203 -43.760  1.00 24.40 ? 230 LEU B N   1 
ATOM   4356  C  CA  . LEU B  1 230 ? 8.234  -37.468 -42.387  1.00 21.91 ? 230 LEU B CA  1 
ATOM   4357  C  C   . LEU B  1 230 ? 8.540  -36.236 -41.549  1.00 26.08 ? 230 LEU B C   1 
ATOM   4358  O  O   . LEU B  1 230 ? 9.650  -35.705 -41.616  1.00 24.48 ? 230 LEU B O   1 
ATOM   4359  C  CB  . LEU B  1 230 ? 8.930  -38.703 -41.795  1.00 21.11 ? 230 LEU B CB  1 
ATOM   4360  C  CG  . LEU B  1 230 ? 8.418  -39.216 -40.439  1.00 21.18 ? 230 LEU B CG  1 
ATOM   4361  C  CD1 . LEU B  1 230 ? 7.050  -39.874 -40.568  1.00 25.27 ? 230 LEU B CD1 1 
ATOM   4362  C  CD2 . LEU B  1 230 ? 9.406  -40.182 -39.796  1.00 21.21 ? 230 LEU B CD2 1 
ATOM   4363  N  N   . PRO B  1 231 ? 7.550  -35.765 -40.771  1.00 29.70 ? 231 PRO B N   1 
ATOM   4364  C  CA  . PRO B  1 231 ? 7.694  -34.561 -39.947  1.00 30.69 ? 231 PRO B CA  1 
ATOM   4365  C  C   . PRO B  1 231 ? 8.834  -34.669 -38.939  1.00 27.97 ? 231 PRO B C   1 
ATOM   4366  O  O   . PRO B  1 231 ? 9.193  -35.774 -38.521  1.00 24.38 ? 231 PRO B O   1 
ATOM   4367  C  CB  . PRO B  1 231 ? 6.346  -34.470 -39.220  1.00 27.31 ? 231 PRO B CB  1 
ATOM   4368  C  CG  . PRO B  1 231 ? 5.394  -35.175 -40.126  1.00 30.90 ? 231 PRO B CG  1 
ATOM   4369  C  CD  . PRO B  1 231 ? 6.188  -36.321 -40.692  1.00 30.55 ? 231 PRO B CD  1 
ATOM   4370  N  N   . VAL B  1 232 ? 9.391  -33.521 -38.556  1.00 27.84 ? 232 VAL B N   1 
ATOM   4371  C  CA  . VAL B  1 232 ? 10.519 -33.472 -37.625  1.00 24.47 ? 232 VAL B CA  1 
ATOM   4372  C  C   . VAL B  1 232 ? 10.244 -34.216 -36.318  1.00 25.08 ? 232 VAL B C   1 
ATOM   4373  O  O   . VAL B  1 232 ? 11.071 -35.011 -35.866  1.00 22.29 ? 232 VAL B O   1 
ATOM   4374  C  CB  . VAL B  1 232 ? 10.928 -32.014 -37.306  1.00 28.10 ? 232 VAL B CB  1 
ATOM   4375  C  CG1 . VAL B  1 232 ? 12.015 -31.980 -36.239  1.00 23.32 ? 232 VAL B CG1 1 
ATOM   4376  C  CG2 . VAL B  1 232 ? 11.399 -31.303 -38.569  1.00 22.66 ? 232 VAL B CG2 1 
ATOM   4377  N  N   . ASP B  1 233 ? 9.087  -33.968 -35.707  1.00 27.95 ? 233 ASP B N   1 
ATOM   4378  C  CA  . ASP B  1 233 ? 8.786  -34.603 -34.419  1.00 29.14 ? 233 ASP B CA  1 
ATOM   4379  C  C   . ASP B  1 233 ? 8.739  -36.133 -34.498  1.00 26.22 ? 233 ASP B C   1 
ATOM   4380  O  O   . ASP B  1 233 ? 9.173  -36.819 -33.575  1.00 25.62 ? 233 ASP B O   1 
ATOM   4381  C  CB  . ASP B  1 233 ? 7.507  -34.032 -33.794  1.00 35.76 ? 233 ASP B CB  1 
ATOM   4382  C  CG  . ASP B  1 233 ? 6.284  -34.246 -34.659  1.00 48.81 ? 233 ASP B CG  1 
ATOM   4383  O  OD1 . ASP B  1 233 ? 6.440  -34.533 -35.865  1.00 59.40 ? 233 ASP B OD1 1 
ATOM   4384  O  OD2 . ASP B  1 233 ? 5.161  -34.121 -34.129  1.00 64.48 ? 233 ASP B OD2 1 
ATOM   4385  N  N   . LYS B  1 234 ? 8.231  -36.671 -35.602  1.00 24.54 ? 234 LYS B N   1 
ATOM   4386  C  CA  . LYS B  1 234 ? 8.183  -38.126 -35.764  1.00 28.76 ? 234 LYS B CA  1 
ATOM   4387  C  C   . LYS B  1 234 ? 9.579  -38.709 -36.015  1.00 25.98 ? 234 LYS B C   1 
ATOM   4388  O  O   . LYS B  1 234 ? 9.898  -39.803 -35.545  1.00 25.58 ? 234 LYS B O   1 
ATOM   4389  C  CB  . LYS B  1 234 ? 7.213  -38.529 -36.876  1.00 31.16 ? 234 LYS B CB  1 
ATOM   4390  C  CG  . LYS B  1 234 ? 5.752  -38.310 -36.511  1.00 38.94 ? 234 LYS B CG  1 
ATOM   4391  C  CD  . LYS B  1 234 ? 4.823  -38.910 -37.551  1.00 47.05 ? 234 LYS B CD  1 
ATOM   4392  C  CE  . LYS B  1 234 ? 5.046  -40.408 -37.677  1.00 60.01 ? 234 LYS B CE  1 
ATOM   4393  N  NZ  . LYS B  1 234 ? 5.040  -41.084 -36.350  1.00 67.57 ? 234 LYS B NZ  1 
ATOM   4394  N  N   . ARG B  1 235 ? 10.406 -37.974 -36.754  1.00 22.93 ? 235 ARG B N   1 
ATOM   4395  C  CA  . ARG B  1 235 ? 11.803 -38.359 -36.938  1.00 21.52 ? 235 ARG B CA  1 
ATOM   4396  C  C   . ARG B  1 235 ? 12.523 -38.376 -35.589  1.00 22.07 ? 235 ARG B C   1 
ATOM   4397  O  O   . ARG B  1 235 ? 13.264 -39.308 -35.273  1.00 22.88 ? 235 ARG B O   1 
ATOM   4398  C  CB  . ARG B  1 235 ? 12.509 -37.391 -37.884  1.00 19.47 ? 235 ARG B CB  1 
ATOM   4399  C  CG  . ARG B  1 235 ? 12.064 -37.501 -39.328  1.00 18.92 ? 235 ARG B CG  1 
ATOM   4400  C  CD  . ARG B  1 235 ? 12.832 -36.518 -40.204  1.00 19.18 ? 235 ARG B CD  1 
ATOM   4401  N  NE  . ARG B  1 235 ? 12.366 -36.582 -41.582  1.00 18.08 ? 235 ARG B NE  1 
ATOM   4402  C  CZ  . ARG B  1 235 ? 12.948 -37.302 -42.531  1.00 18.21 ? 235 ARG B CZ  1 
ATOM   4403  N  NH1 . ARG B  1 235 ? 12.442 -37.303 -43.757  1.00 18.11 ? 235 ARG B NH1 1 
ATOM   4404  N  NH2 . ARG B  1 235 ? 14.042 -38.010 -42.257  1.00 19.35 ? 235 ARG B NH2 1 
ATOM   4405  N  N   . ASN B  1 236 ? 12.290 -37.338 -34.792  1.00 21.89 ? 236 ASN B N   1 
ATOM   4406  C  CA  . ASN B  1 236 ? 12.903 -37.237 -33.476  1.00 22.15 ? 236 ASN B CA  1 
ATOM   4407  C  C   . ASN B  1 236 ? 12.526 -38.408 -32.568  1.00 21.89 ? 236 ASN B C   1 
ATOM   4408  O  O   . ASN B  1 236 ? 13.376 -38.948 -31.859  1.00 21.73 ? 236 ASN B O   1 
ATOM   4409  C  CB  . ASN B  1 236 ? 12.558 -35.898 -32.816  1.00 21.10 ? 236 ASN B CB  1 
ATOM   4410  C  CG  . ASN B  1 236 ? 13.404 -34.751 -33.348  1.00 26.72 ? 236 ASN B CG  1 
ATOM   4411  O  OD1 . ASN B  1 236 ? 14.417 -34.970 -34.017  1.00 25.10 ? 236 ASN B OD1 1 
ATOM   4412  N  ND2 . ASN B  1 236 ? 12.992 -33.520 -33.052  1.00 23.88 ? 236 ASN B ND2 1 
ATOM   4413  N  N   . GLU B  1 237 ? 11.259 -38.808 -32.598  1.00 23.94 ? 237 GLU B N   1 
ATOM   4414  C  CA  . GLU B  1 237 ? 10.804 -39.931 -31.777  1.00 26.10 ? 237 GLU B CA  1 
ATOM   4415  C  C   . GLU B  1 237 ? 11.449 -41.241 -32.215  1.00 24.03 ? 237 GLU B C   1 
ATOM   4416  O  O   . GLU B  1 237 ? 11.810 -42.074 -31.384  1.00 24.52 ? 237 GLU B O   1 
ATOM   4417  C  CB  . GLU B  1 237 ? 9.285  -40.057 -31.822  1.00 33.78 ? 237 GLU B CB  1 
ATOM   4418  C  CG  . GLU B  1 237 ? 8.553  -38.832 -31.303  1.00 44.63 ? 237 GLU B CG  1 
ATOM   4419  C  CD  . GLU B  1 237 ? 7.049  -38.944 -31.463  1.00 68.62 ? 237 GLU B CD  1 
ATOM   4420  O  OE1 . GLU B  1 237 ? 6.337  -38.011 -31.030  1.00 72.46 ? 237 GLU B OE1 1 
ATOM   4421  O  OE2 . GLU B  1 237 ? 6.580  -39.963 -32.021  1.00 71.39 ? 237 GLU B OE2 1 
ATOM   4422  N  N   . THR B  1 238 ? 11.584 -41.419 -33.525  1.00 24.22 ? 238 THR B N   1 
ATOM   4423  C  CA  . THR B  1 238 ? 12.252 -42.587 -34.093  1.00 20.49 ? 238 THR B CA  1 
ATOM   4424  C  C   . THR B  1 238 ? 13.742 -42.608 -33.743  1.00 21.31 ? 238 THR B C   1 
ATOM   4425  O  O   . THR B  1 238 ? 14.272 -43.622 -33.277  1.00 18.96 ? 238 THR B O   1 
ATOM   4426  C  CB  . THR B  1 238 ? 12.075 -42.627 -35.622  1.00 22.01 ? 238 THR B CB  1 
ATOM   4427  O  OG1 . THR B  1 238 ? 10.677 -42.611 -35.934  1.00 23.97 ? 238 THR B OG1 1 
ATOM   4428  C  CG2 . THR B  1 238 ? 12.702 -43.882 -36.214  1.00 19.84 ? 238 THR B CG2 1 
ATOM   4429  N  N   . THR B  1 239 ? 14.417 -41.482 -33.957  1.00 20.44 ? 239 THR B N   1 
ATOM   4430  C  CA  . THR B  1 239 ? 15.826 -41.376 -33.599  1.00 18.49 ? 239 THR B CA  1 
ATOM   4431  C  C   . THR B  1 239 ? 16.047 -41.711 -32.130  1.00 20.61 ? 239 THR B C   1 
ATOM   4432  O  O   . THR B  1 239 ? 16.900 -42.533 -31.788  1.00 22.06 ? 239 THR B O   1 
ATOM   4433  C  CB  . THR B  1 239 ? 16.367 -39.966 -33.868  1.00 18.10 ? 239 THR B CB  1 
ATOM   4434  O  OG1 . THR B  1 239 ? 16.186 -39.654 -35.254  1.00 18.72 ? 239 THR B OG1 1 
ATOM   4435  C  CG2 . THR B  1 239 ? 17.852 -39.900 -33.516  1.00 18.66 ? 239 THR B CG2 1 
ATOM   4436  N  N   . LEU B  1 240 ? 15.263 -41.079 -31.264  1.00 20.99 ? 240 LEU B N   1 
ATOM   4437  C  CA  . LEU B  1 240 ? 15.368 -41.305 -29.829  1.00 21.03 ? 240 LEU B CA  1 
ATOM   4438  C  C   . LEU B  1 240 ? 15.180 -42.776 -29.459  1.00 21.15 ? 240 LEU B C   1 
ATOM   4439  O  O   . LEU B  1 240 ? 15.941 -43.335 -28.666  1.00 23.18 ? 240 LEU B O   1 
ATOM   4440  C  CB  . LEU B  1 240 ? 14.339 -40.443 -29.095  1.00 24.24 ? 240 LEU B CB  1 
ATOM   4441  C  CG  . LEU B  1 240 ? 14.300 -40.579 -27.573  1.00 25.93 ? 240 LEU B CG  1 
ATOM   4442  C  CD1 . LEU B  1 240 ? 15.648 -40.217 -26.968  1.00 25.94 ? 240 LEU B CD1 1 
ATOM   4443  C  CD2 . LEU B  1 240 ? 13.190 -39.711 -26.996  1.00 24.16 ? 240 LEU B CD2 1 
ATOM   4444  N  N   . ARG B  1 241 ? 14.158 -43.399 -30.028  1.00 20.56 ? 241 ARG B N   1 
ATOM   4445  C  CA  . ARG B  1 241 ? 13.880 -44.805 -29.766  1.00 21.29 ? 241 ARG B CA  1 
ATOM   4446  C  C   . ARG B  1 241 ? 15.068 -45.684 -30.162  1.00 22.09 ? 241 ARG B C   1 
ATOM   4447  O  O   . ARG B  1 241 ? 15.495 -46.561 -29.403  1.00 23.20 ? 241 ARG B O   1 
ATOM   4448  C  CB  . ARG B  1 241 ? 12.616 -45.231 -30.519  1.00 25.23 ? 241 ARG B CB  1 
ATOM   4449  C  CG  . ARG B  1 241 ? 12.308 -46.713 -30.439  1.00 30.43 ? 241 ARG B CG  1 
ATOM   4450  C  CD  . ARG B  1 241 ? 12.089 -47.160 -29.005  1.00 38.06 ? 241 ARG B CD  1 
ATOM   4451  N  NE  . ARG B  1 241 ? 11.859 -48.600 -28.939  1.00 47.04 ? 241 ARG B NE  1 
ATOM   4452  C  CZ  . ARG B  1 241 ? 10.705 -49.181 -29.244  1.00 57.23 ? 241 ARG B CZ  1 
ATOM   4453  N  NH1 . ARG B  1 241 ? 9.673  -48.445 -29.634  1.00 60.93 ? 241 ARG B NH1 1 
ATOM   4454  N  NH2 . ARG B  1 241 ? 10.582 -50.498 -29.161  1.00 70.66 ? 241 ARG B NH2 1 
ATOM   4455  N  N   . LEU B  1 242 ? 15.609 -45.438 -31.352  1.00 21.07 ? 242 LEU B N   1 
ATOM   4456  C  CA  . LEU B  1 242 ? 16.733 -46.220 -31.840  1.00 20.71 ? 242 LEU B CA  1 
ATOM   4457  C  C   . LEU B  1 242 ? 17.917 -46.069 -30.901  1.00 20.02 ? 242 LEU B C   1 
ATOM   4458  O  O   . LEU B  1 242 ? 18.621 -47.042 -30.612  1.00 23.34 ? 242 LEU B O   1 
ATOM   4459  C  CB  . LEU B  1 242 ? 17.107 -45.796 -33.258  1.00 19.63 ? 242 LEU B CB  1 
ATOM   4460  C  CG  . LEU B  1 242 ? 16.129 -46.224 -34.352  1.00 21.45 ? 242 LEU B CG  1 
ATOM   4461  C  CD1 . LEU B  1 242 ? 16.390 -45.440 -35.628  1.00 17.30 ? 242 LEU B CD1 1 
ATOM   4462  C  CD2 . LEU B  1 242 ? 16.226 -47.725 -34.604  1.00 19.91 ? 242 LEU B CD2 1 
ATOM   4463  N  N   . ILE B  1 243 ? 18.128 -44.846 -30.424  1.00 19.22 ? 243 ILE B N   1 
ATOM   4464  C  CA  . ILE B  1 243 ? 19.176 -44.574 -29.452  1.00 20.66 ? 243 ILE B CA  1 
ATOM   4465  C  C   . ILE B  1 243 ? 18.937 -45.331 -28.139  1.00 21.84 ? 243 ILE B C   1 
ATOM   4466  O  O   . ILE B  1 243 ? 19.827 -46.037 -27.653  1.00 22.38 ? 243 ILE B O   1 
ATOM   4467  C  CB  . ILE B  1 243 ? 19.319 -43.059 -29.186  1.00 20.32 ? 243 ILE B CB  1 
ATOM   4468  C  CG1 . ILE B  1 243 ? 19.950 -42.369 -30.396  1.00 19.70 ? 243 ILE B CG1 1 
ATOM   4469  C  CG2 . ILE B  1 243 ? 20.132 -42.814 -27.924  1.00 21.65 ? 243 ILE B CG2 1 
ATOM   4470  C  CD1 . ILE B  1 243 ? 19.954 -40.858 -30.310  1.00 19.22 ? 243 ILE B CD1 1 
ATOM   4471  N  N   . LYS B  1 244 ? 17.743 -45.193 -27.567  1.00 22.02 ? 244 LYS B N   1 
ATOM   4472  C  CA  . LYS B  1 244 ? 17.415 -45.927 -26.342  1.00 26.68 ? 244 LYS B CA  1 
ATOM   4473  C  C   . LYS B  1 244 ? 17.586 -47.443 -26.504  1.00 28.59 ? 244 LYS B C   1 
ATOM   4474  O  O   . LYS B  1 244 ? 17.924 -48.135 -25.551  1.00 29.98 ? 244 LYS B O   1 
ATOM   4475  C  CB  . LYS B  1 244 ? 15.991 -45.627 -25.878  1.00 29.24 ? 244 LYS B CB  1 
ATOM   4476  C  CG  . LYS B  1 244 ? 15.759 -44.209 -25.386  1.00 34.85 ? 244 LYS B CG  1 
ATOM   4477  C  CD  . LYS B  1 244 ? 14.308 -44.047 -24.967  1.00 43.45 ? 244 LYS B CD  1 
ATOM   4478  C  CE  . LYS B  1 244 ? 14.028 -42.666 -24.402  1.00 45.90 ? 244 LYS B CE  1 
ATOM   4479  N  NZ  . LYS B  1 244 ? 12.566 -42.459 -24.210  1.00 50.82 ? 244 LYS B NZ  1 
ATOM   4480  N  N   . ASP B  1 245 ? 17.348 -47.961 -27.704  1.00 26.73 ? 245 ASP B N   1 
ATOM   4481  C  CA  . ASP B  1 245 ? 17.488 -49.399 -27.931  1.00 26.39 ? 245 ASP B CA  1 
ATOM   4482  C  C   . ASP B  1 245 ? 18.916 -49.805 -28.263  1.00 24.26 ? 245 ASP B C   1 
ATOM   4483  O  O   . ASP B  1 245 ? 19.172 -50.953 -28.615  1.00 23.42 ? 245 ASP B O   1 
ATOM   4484  C  CB  . ASP B  1 245 ? 16.529 -49.875 -29.019  1.00 27.87 ? 245 ASP B CB  1 
ATOM   4485  C  CG  . ASP B  1 245 ? 15.080 -49.799 -28.581  1.00 31.80 ? 245 ASP B CG  1 
ATOM   4486  O  OD1 . ASP B  1 245 ? 14.183 -49.884 -29.446  1.00 33.90 ? 245 ASP B OD1 1 
ATOM   4487  O  OD2 . ASP B  1 245 ? 14.844 -49.641 -27.365  1.00 29.05 ? 245 ASP B OD2 1 
ATOM   4488  N  N   . GLY B  1 246 ? 19.836 -48.852 -28.155  1.00 23.10 ? 246 GLY B N   1 
ATOM   4489  C  CA  . GLY B  1 246 ? 21.262 -49.130 -28.296  1.00 25.17 ? 246 GLY B CA  1 
ATOM   4490  C  C   . GLY B  1 246 ? 21.822 -49.112 -29.710  1.00 24.52 ? 246 GLY B C   1 
ATOM   4491  O  O   . GLY B  1 246 ? 22.859 -49.729 -29.975  1.00 23.11 ? 246 GLY B O   1 
ATOM   4492  N  N   . TYR B  1 247 ? 21.173 -48.385 -30.618  1.00 20.86 ? 247 TYR B N   1 
ATOM   4493  C  CA  . TYR B  1 247 ? 21.596 -48.406 -32.029  1.00 20.56 ? 247 TYR B CA  1 
ATOM   4494  C  C   . TYR B  1 247 ? 22.461 -47.231 -32.474  1.00 19.66 ? 247 TYR B C   1 
ATOM   4495  O  O   . TYR B  1 247 ? 22.658 -47.024 -33.674  1.00 18.72 ? 247 TYR B O   1 
ATOM   4496  C  CB  . TYR B  1 247 ? 20.390 -48.579 -32.967  1.00 17.45 ? 247 TYR B CB  1 
ATOM   4497  C  CG  . TYR B  1 247 ? 19.922 -50.016 -33.060  1.00 19.19 ? 247 TYR B CG  1 
ATOM   4498  C  CD1 . TYR B  1 247 ? 19.110 -50.570 -32.073  1.00 19.98 ? 247 TYR B CD1 1 
ATOM   4499  C  CD2 . TYR B  1 247 ? 20.306 -50.826 -34.122  1.00 19.96 ? 247 TYR B CD2 1 
ATOM   4500  C  CE1 . TYR B  1 247 ? 18.692 -51.888 -32.148  1.00 22.54 ? 247 TYR B CE1 1 
ATOM   4501  C  CE2 . TYR B  1 247 ? 19.891 -52.147 -34.205  1.00 19.61 ? 247 TYR B CE2 1 
ATOM   4502  C  CZ  . TYR B  1 247 ? 19.092 -52.671 -33.213  1.00 21.40 ? 247 TYR B CZ  1 
ATOM   4503  O  OH  . TYR B  1 247 ? 18.675 -53.976 -33.291  1.00 22.43 ? 247 TYR B OH  1 
ATOM   4504  N  N   . SER B  1 248 ? 22.994 -46.471 -31.521  1.00 19.53 ? 248 SER B N   1 
ATOM   4505  C  CA  A SER B  1 248 ? 23.834 -45.315 -31.847  0.50 20.11 ? 248 SER B CA  1 
ATOM   4506  C  CA  B SER B  1 248 ? 23.819 -45.311 -31.865  0.50 19.88 ? 248 SER B CA  1 
ATOM   4507  C  C   . SER B  1 248 ? 25.063 -45.704 -32.657  1.00 18.92 ? 248 SER B C   1 
ATOM   4508  O  O   . SER B  1 248 ? 25.630 -44.880 -33.372  1.00 21.55 ? 248 SER B O   1 
ATOM   4509  C  CB  A SER B  1 248 ? 24.266 -44.580 -30.575  0.50 20.98 ? 248 SER B CB  1 
ATOM   4510  C  CB  B SER B  1 248 ? 24.209 -44.514 -30.614  0.50 20.41 ? 248 SER B CB  1 
ATOM   4511  O  OG  A SER B  1 248 ? 23.145 -44.081 -29.875  0.50 20.24 ? 248 SER B OG  1 
ATOM   4512  O  OG  B SER B  1 248 ? 25.159 -45.213 -29.831  0.50 19.38 ? 248 SER B OG  1 
ATOM   4513  N  N   . ASP B  1 249 ? 25.480 -46.962 -32.539  1.00 17.70 ? 249 ASP B N   1 
ATOM   4514  C  CA  . ASP B  1 249 ? 26.649 -47.444 -33.273  1.00 18.43 ? 249 ASP B CA  1 
ATOM   4515  C  C   . ASP B  1 249 ? 26.433 -47.449 -34.786  1.00 18.57 ? 249 ASP B C   1 
ATOM   4516  O  O   . ASP B  1 249 ? 27.390 -47.541 -35.553  1.00 19.49 ? 249 ASP B O   1 
ATOM   4517  C  CB  . ASP B  1 249 ? 27.060 -48.846 -32.807  1.00 21.20 ? 249 ASP B CB  1 
ATOM   4518  C  CG  . ASP B  1 249 ? 25.960 -49.884 -33.013  1.00 21.87 ? 249 ASP B CG  1 
ATOM   4519  O  OD1 . ASP B  1 249 ? 24.868 -49.724 -32.433  1.00 24.80 ? 249 ASP B OD1 1 
ATOM   4520  O  OD2 . ASP B  1 249 ? 26.189 -50.870 -33.751  1.00 21.02 ? 249 ASP B OD2 1 
ATOM   4521  N  N   . LYS B  1 250 ? 25.180 -47.342 -35.220  1.00 18.92 ? 250 LYS B N   1 
ATOM   4522  C  CA  . LYS B  1 250 ? 24.874 -47.391 -36.654  1.00 17.37 ? 250 LYS B CA  1 
ATOM   4523  C  C   . LYS B  1 250 ? 24.146 -46.141 -37.150  1.00 16.78 ? 250 LYS B C   1 
ATOM   4524  O  O   . LYS B  1 250 ? 23.997 -45.931 -38.353  1.00 15.21 ? 250 LYS B O   1 
ATOM   4525  C  CB  . LYS B  1 250 ? 24.058 -48.652 -36.975  1.00 20.74 ? 250 LYS B CB  1 
ATOM   4526  C  CG  . LYS B  1 250 ? 24.863 -49.940 -36.832  1.00 19.26 ? 250 LYS B CG  1 
ATOM   4527  C  CD  . LYS B  1 250 ? 25.988 -49.981 -37.854  1.00 21.10 ? 250 LYS B CD  1 
ATOM   4528  C  CE  . LYS B  1 250 ? 26.853 -51.228 -37.723  1.00 21.57 ? 250 LYS B CE  1 
ATOM   4529  N  NZ  . LYS B  1 250 ? 27.526 -51.289 -36.400  1.00 28.36 ? 250 LYS B NZ  1 
ATOM   4530  N  N   . ILE B  1 251 ? 23.695 -45.309 -36.221  1.00 16.26 ? 251 ILE B N   1 
ATOM   4531  C  CA  . ILE B  1 251 ? 22.934 -44.120 -36.594  1.00 14.55 ? 251 ILE B CA  1 
ATOM   4532  C  C   . ILE B  1 251 ? 23.811 -43.034 -37.223  1.00 14.54 ? 251 ILE B C   1 
ATOM   4533  O  O   . ILE B  1 251 ? 24.857 -42.678 -36.689  1.00 13.35 ? 251 ILE B O   1 
ATOM   4534  C  CB  . ILE B  1 251 ? 22.207 -43.529 -35.382  1.00 14.62 ? 251 ILE B CB  1 
ATOM   4535  C  CG1 . ILE B  1 251 ? 21.068 -44.463 -34.946  1.00 16.57 ? 251 ILE B CG1 1 
ATOM   4536  C  CG2 . ILE B  1 251 ? 21.688 -42.125 -35.694  1.00 14.90 ? 251 ILE B CG2 1 
ATOM   4537  C  CD1 . ILE B  1 251 ? 20.541 -44.148 -33.561  1.00 17.68 ? 251 ILE B CD1 1 
ATOM   4538  N  N   . MET B  1 252 ? 23.367 -42.513 -38.359  1.00 14.65 ? 252 MET B N   1 
ATOM   4539  C  CA  . MET B  1 252 ? 23.945 -41.300 -38.922  1.00 14.44 ? 252 MET B CA  1 
ATOM   4540  C  C   . MET B  1 252 ? 22.805 -40.323 -39.192  1.00 16.11 ? 252 MET B C   1 
ATOM   4541  O  O   . MET B  1 252 ? 21.705 -40.733 -39.573  1.00 14.51 ? 252 MET B O   1 
ATOM   4542  C  CB  . MET B  1 252 ? 24.729 -41.615 -40.200  1.00 17.73 ? 252 MET B CB  1 
ATOM   4543  C  CG  . MET B  1 252 ? 26.145 -42.120 -39.937  1.00 19.58 ? 252 MET B CG  1 
ATOM   4544  S  SD  . MET B  1 252 ? 26.970 -42.679 -41.443  1.00 29.80 ? 252 MET B SD  1 
ATOM   4545  C  CE  . MET B  1 252 ? 28.661 -42.802 -40.871  1.00 19.87 ? 252 MET B CE  1 
ATOM   4546  N  N   . ILE B  1 253 ? 23.067 -39.036 -38.990  1.00 13.33 ? 253 ILE B N   1 
ATOM   4547  C  CA  . ILE B  1 253 ? 22.020 -38.018 -39.045  1.00 14.21 ? 253 ILE B CA  1 
ATOM   4548  C  C   . ILE B  1 253 ? 22.453 -36.863 -39.929  1.00 14.25 ? 253 ILE B C   1 
ATOM   4549  O  O   . ILE B  1 253 ? 23.597 -36.397 -39.846  1.00 16.46 ? 253 ILE B O   1 
ATOM   4550  C  CB  . ILE B  1 253 ? 21.680 -37.481 -37.635  1.00 14.49 ? 253 ILE B CB  1 
ATOM   4551  C  CG1 . ILE B  1 253 ? 21.006 -38.572 -36.792  1.00 13.55 ? 253 ILE B CG1 1 
ATOM   4552  C  CG2 . ILE B  1 253 ? 20.792 -36.253 -37.729  1.00 13.50 ? 253 ILE B CG2 1 
ATOM   4553  C  CD1 . ILE B  1 253 ? 20.754 -38.177 -35.352  1.00 13.75 ? 253 ILE B CD1 1 
ATOM   4554  N  N   . SER B  1 254 ? 21.538 -36.405 -40.778  1.00 13.66 ? 254 SER B N   1 
ATOM   4555  C  CA  . SER B  1 254 ? 21.810 -35.281 -41.661  1.00 15.32 ? 254 SER B CA  1 
ATOM   4556  C  C   . SER B  1 254 ? 20.491 -34.702 -42.169  1.00 15.18 ? 254 SER B C   1 
ATOM   4557  O  O   . SER B  1 254 ? 19.416 -35.138 -41.744  1.00 15.01 ? 254 SER B O   1 
ATOM   4558  C  CB  . SER B  1 254 ? 22.698 -35.720 -42.832  1.00 14.71 ? 254 SER B CB  1 
ATOM   4559  O  OG  . SER B  1 254 ? 23.779 -34.816 -43.002  1.00 16.34 ? 254 SER B OG  1 
ATOM   4560  N  N   . HIS B  1 255 ? 20.579 -33.723 -43.069  1.00 14.59 ? 255 HIS B N   1 
ATOM   4561  C  CA  . HIS B  1 255 ? 19.393 -33.037 -43.585  1.00 15.39 ? 255 HIS B CA  1 
ATOM   4562  C  C   . HIS B  1 255 ? 19.092 -33.329 -45.031  1.00 14.95 ? 255 HIS B C   1 
ATOM   4563  O  O   . HIS B  1 255 ? 17.968 -33.091 -45.465  1.00 16.76 ? 255 HIS B O   1 
ATOM   4564  C  CB  . HIS B  1 255 ? 19.528 -31.517 -43.457  1.00 15.60 ? 255 HIS B CB  1 
ATOM   4565  C  CG  . HIS B  1 255 ? 20.013 -31.038 -42.110  1.00 16.93 ? 255 HIS B CG  1 
ATOM   4566  N  ND1 . HIS B  1 255 ? 21.320 -30.861 -41.831  1.00 16.49 ? 255 HIS B ND1 1 
ATOM   4567  C  CD2 . HIS B  1 255 ? 19.309 -30.653 -40.968  1.00 16.05 ? 255 HIS B CD2 1 
ATOM   4568  C  CE1 . HIS B  1 255 ? 21.447 -30.399 -40.570  1.00 19.06 ? 255 HIS B CE1 1 
ATOM   4569  N  NE2 . HIS B  1 255 ? 20.213 -30.275 -40.046  1.00 18.65 ? 255 HIS B NE2 1 
ATOM   4570  N  N   . ASP B  1 256 ? 20.083 -33.802 -45.797  1.00 12.79 ? 256 ASP B N   1 
ATOM   4571  C  CA  . ASP B  1 256 ? 19.947 -33.907 -47.265  1.00 15.00 ? 256 ASP B CA  1 
ATOM   4572  C  C   . ASP B  1 256 ? 19.578 -32.520 -47.788  1.00 17.14 ? 256 ASP B C   1 
ATOM   4573  O  O   . ASP B  1 256 ? 18.838 -32.376 -48.758  1.00 17.53 ? 256 ASP B O   1 
ATOM   4574  C  CB  . ASP B  1 256 ? 18.866 -34.938 -47.632  1.00 15.79 ? 256 ASP B CB  1 
ATOM   4575  C  CG  . ASP B  1 256 ? 18.937 -35.452 -49.103  1.00 14.99 ? 256 ASP B CG  1 
ATOM   4576  O  OD1 . ASP B  1 256 ? 19.980 -35.417 -49.843  1.00 13.65 ? 256 ASP B OD1 1 
ATOM   4577  O  OD2 . ASP B  1 256 ? 17.869 -35.972 -49.503  1.00 17.31 ? 256 ASP B OD2 1 
ATOM   4578  N  N   . TYR B  1 257 ? 20.086 -31.482 -47.132  1.00 16.38 ? 257 TYR B N   1 
ATOM   4579  C  CA  . TYR B  1 257 ? 19.721 -30.135 -47.550  1.00 18.23 ? 257 TYR B CA  1 
ATOM   4580  C  C   . TYR B  1 257 ? 20.341 -29.777 -48.903  1.00 18.93 ? 257 TYR B C   1 
ATOM   4581  O  O   . TYR B  1 257 ? 21.506 -30.070 -49.164  1.00 19.51 ? 257 TYR B O   1 
ATOM   4582  C  CB  . TYR B  1 257 ? 20.083 -29.085 -46.498  1.00 17.47 ? 257 TYR B CB  1 
ATOM   4583  C  CG  . TYR B  1 257 ? 19.523 -27.727 -46.856  1.00 18.70 ? 257 TYR B CG  1 
ATOM   4584  C  CD1 . TYR B  1 257 ? 20.356 -26.711 -47.308  1.00 20.47 ? 257 TYR B CD1 1 
ATOM   4585  C  CD2 . TYR B  1 257 ? 18.153 -27.474 -46.789  1.00 19.96 ? 257 TYR B CD2 1 
ATOM   4586  C  CE1 . TYR B  1 257 ? 19.851 -25.474 -47.650  1.00 18.40 ? 257 TYR B CE1 1 
ATOM   4587  C  CE2 . TYR B  1 257 ? 17.639 -26.233 -47.135  1.00 23.96 ? 257 TYR B CE2 1 
ATOM   4588  C  CZ  . TYR B  1 257 ? 18.497 -25.242 -47.572  1.00 23.46 ? 257 TYR B CZ  1 
ATOM   4589  O  OH  . TYR B  1 257 ? 18.013 -24.000 -47.929  1.00 26.68 ? 257 TYR B OH  1 
ATOM   4590  N  N   . CYS B  1 258 ? 19.544 -29.162 -49.767  1.00 19.37 ? 258 CYS B N   1 
ATOM   4591  C  CA  . CYS B  1 258 ? 20.047 -28.662 -51.041  1.00 21.73 ? 258 CYS B CA  1 
ATOM   4592  C  C   . CYS B  1 258 ? 20.054 -27.138 -51.005  1.00 21.50 ? 258 CYS B C   1 
ATOM   4593  O  O   . CYS B  1 258 ? 19.003 -26.506 -51.038  1.00 24.86 ? 258 CYS B O   1 
ATOM   4594  C  CB  . CYS B  1 258 ? 19.177 -29.158 -52.198  1.00 21.38 ? 258 CYS B CB  1 
ATOM   4595  S  SG  . CYS B  1 258 ? 19.070 -30.962 -52.302  1.00 25.56 ? 258 CYS B SG  1 
ATOM   4596  N  N   . CYS B  1 259 ? 21.244 -26.560 -50.925  1.00 24.89 ? 259 CYS B N   1 
ATOM   4597  C  CA  . CYS B  1 259 ? 21.386 -25.116 -50.847  1.00 24.06 ? 259 CYS B CA  1 
ATOM   4598  C  C   . CYS B  1 259 ? 20.694 -24.479 -52.047  1.00 24.56 ? 259 CYS B C   1 
ATOM   4599  O  O   . CYS B  1 259 ? 20.085 -23.417 -51.932  1.00 20.47 ? 259 CYS B O   1 
ATOM   4600  C  CB  . CYS B  1 259 ? 22.865 -24.742 -50.754  1.00 20.79 ? 259 CYS B CB  1 
ATOM   4601  S  SG  . CYS B  1 259 ? 23.682 -25.538 -49.340  1.00 24.41 ? 259 CYS B SG  1 
ATOM   4602  N  N   . THR B  1 260 ? 20.786 -25.151 -53.191  1.00 19.43 ? 260 THR B N   1 
ATOM   4603  C  CA  . THR B  1 260 ? 19.917 -24.877 -54.336  1.00 23.85 ? 260 THR B CA  1 
ATOM   4604  C  C   . THR B  1 260 ? 19.512 -26.202 -54.978  1.00 21.75 ? 260 THR B C   1 
ATOM   4605  O  O   . THR B  1 260 ? 20.330 -27.112 -55.109  1.00 20.11 ? 260 THR B O   1 
ATOM   4606  C  CB  . THR B  1 260 ? 20.608 -24.002 -55.403  1.00 27.67 ? 260 THR B CB  1 
ATOM   4607  O  OG1 . THR B  1 260 ? 21.238 -22.880 -54.774  1.00 30.66 ? 260 THR B OG1 1 
ATOM   4608  C  CG2 . THR B  1 260 ? 19.582 -23.492 -56.411  1.00 31.35 ? 260 THR B CG2 1 
ATOM   4609  N  N   . ILE B  1 261 ? 18.245 -26.326 -55.352  1.00 22.00 ? 261 ILE B N   1 
ATOM   4610  C  CA  . ILE B  1 261 ? 17.795 -27.487 -56.121  1.00 23.17 ? 261 ILE B CA  1 
ATOM   4611  C  C   . ILE B  1 261 ? 16.818 -27.007 -57.186  1.00 25.44 ? 261 ILE B C   1 
ATOM   4612  O  O   . ILE B  1 261 ? 16.004 -26.123 -56.924  1.00 21.49 ? 261 ILE B O   1 
ATOM   4613  C  CB  . ILE B  1 261 ? 17.179 -28.597 -55.230  1.00 23.90 ? 261 ILE B CB  1 
ATOM   4614  C  CG1 . ILE B  1 261 ? 16.577 -29.714 -56.095  1.00 24.55 ? 261 ILE B CG1 1 
ATOM   4615  C  CG2 . ILE B  1 261 ? 16.145 -28.016 -54.275  1.00 21.80 ? 261 ILE B CG2 1 
ATOM   4616  C  CD1 . ILE B  1 261 ? 16.503 -31.063 -55.402  1.00 27.80 ? 261 ILE B CD1 1 
ATOM   4617  N  N   . ASP B  1 262 ? 16.912 -27.581 -58.385  1.00 25.39 ? 262 ASP B N   1 
ATOM   4618  C  CA  . ASP B  1 262 ? 16.191 -27.051 -59.543  1.00 23.91 ? 262 ASP B CA  1 
ATOM   4619  C  C   . ASP B  1 262 ? 14.808 -27.667 -59.816  1.00 26.66 ? 262 ASP B C   1 
ATOM   4620  O  O   . ASP B  1 262 ? 14.072 -27.176 -60.674  1.00 30.49 ? 262 ASP B O   1 
ATOM   4621  C  CB  . ASP B  1 262 ? 17.065 -27.137 -60.807  1.00 21.37 ? 262 ASP B CB  1 
ATOM   4622  C  CG  . ASP B  1 262 ? 17.283 -28.571 -61.277  1.00 20.87 ? 262 ASP B CG  1 
ATOM   4623  O  OD1 . ASP B  1 262 ? 16.973 -29.514 -60.508  1.00 22.91 ? 262 ASP B OD1 1 
ATOM   4624  O  OD2 . ASP B  1 262 ? 17.754 -28.757 -62.420  1.00 17.03 ? 262 ASP B OD2 1 
ATOM   4625  N  N   . ILE B  1 263 ? 14.443 -28.728 -59.101  1.00 20.97 ? 263 ILE B N   1 
ATOM   4626  C  CA  . ILE B  1 263 ? 13.157 -29.387 -59.381  1.00 24.58 ? 263 ILE B CA  1 
ATOM   4627  C  C   . ILE B  1 263 ? 11.951 -28.502 -59.057  1.00 24.52 ? 263 ILE B C   1 
ATOM   4628  O  O   . ILE B  1 263 ? 12.017 -27.636 -58.180  1.00 25.06 ? 263 ILE B O   1 
ATOM   4629  C  CB  . ILE B  1 263 ? 13.018 -30.755 -58.678  1.00 21.93 ? 263 ILE B CB  1 
ATOM   4630  C  CG1 . ILE B  1 263 ? 12.719 -30.578 -57.188  1.00 26.10 ? 263 ILE B CG1 1 
ATOM   4631  C  CG2 . ILE B  1 263 ? 14.262 -31.613 -58.905  1.00 20.06 ? 263 ILE B CG2 1 
ATOM   4632  C  CD1 . ILE B  1 263 ? 12.557 -31.899 -56.451  1.00 24.23 ? 263 ILE B CD1 1 
ATOM   4633  N  N   . GLY B  1 264 ? 10.847 -28.736 -59.763  1.00 26.21 ? 264 GLY B N   1 
ATOM   4634  C  CA  . GLY B  1 264 ? 9.643  -27.921 -59.605  1.00 28.87 ? 264 GLY B CA  1 
ATOM   4635  C  C   . GLY B  1 264 ? 9.026  -28.024 -58.222  1.00 35.30 ? 264 GLY B C   1 
ATOM   4636  O  O   . GLY B  1 264 ? 8.314  -27.116 -57.775  1.00 32.98 ? 264 GLY B O   1 
ATOM   4637  N  N   . THR B  1 265 ? 9.304  -29.133 -57.542  1.00 30.97 ? 265 THR B N   1 
ATOM   4638  C  CA  . THR B  1 265 ? 8.759  -29.385 -56.213  1.00 32.36 ? 265 THR B CA  1 
ATOM   4639  C  C   . THR B  1 265 ? 9.361  -28.444 -55.175  1.00 32.85 ? 265 THR B C   1 
ATOM   4640  O  O   . THR B  1 265 ? 8.775  -28.219 -54.113  1.00 31.48 ? 265 THR B O   1 
ATOM   4641  C  CB  . THR B  1 265 ? 9.025  -30.830 -55.764  1.00 34.83 ? 265 THR B CB  1 
ATOM   4642  O  OG1 . THR B  1 265 ? 8.877  -31.714 -56.881  1.00 31.41 ? 265 THR B OG1 1 
ATOM   4643  C  CG2 . THR B  1 265 ? 8.053  -31.227 -54.658  1.00 30.09 ? 265 THR B CG2 1 
ATOM   4644  N  N   . ALA B  1 266 ? 10.533 -27.899 -55.488  1.00 30.02 ? 266 ALA B N   1 
ATOM   4645  C  CA  . ALA B  1 266 ? 11.243 -27.017 -54.567  1.00 31.74 ? 266 ALA B CA  1 
ATOM   4646  C  C   . ALA B  1 266 ? 10.903 -25.543 -54.781  1.00 37.17 ? 266 ALA B C   1 
ATOM   4647  O  O   . ALA B  1 266 ? 11.607 -24.661 -54.291  1.00 37.46 ? 266 ALA B O   1 
ATOM   4648  C  CB  . ALA B  1 266 ? 12.748 -27.239 -54.675  1.00 31.88 ? 266 ALA B CB  1 
ATOM   4649  N  N   . LYS B  1 267 ? 9.828  -25.267 -55.511  1.00 43.38 ? 267 LYS B N   1 
ATOM   4650  C  CA  . LYS B  1 267 ? 9.389  -23.886 -55.677  1.00 48.09 ? 267 LYS B CA  1 
ATOM   4651  C  C   . LYS B  1 267 ? 9.087  -23.295 -54.302  1.00 48.60 ? 267 LYS B C   1 
ATOM   4652  O  O   . LYS B  1 267 ? 8.504  -23.970 -53.451  1.00 41.89 ? 267 LYS B O   1 
ATOM   4653  C  CB  . LYS B  1 267 ? 8.172  -23.795 -56.601  1.00 44.56 ? 267 LYS B CB  1 
ATOM   4654  C  CG  . LYS B  1 267 ? 8.493  -24.092 -58.058  1.00 44.72 ? 267 LYS B CG  1 
ATOM   4655  C  CD  . LYS B  1 267 ? 7.236  -24.124 -58.909  1.00 46.26 ? 267 LYS B CD  1 
ATOM   4656  C  CE  . LYS B  1 267 ? 7.558  -24.540 -60.336  1.00 49.30 ? 267 LYS B CE  1 
ATOM   4657  N  NZ  . LYS B  1 267 ? 6.329  -24.706 -61.157  1.00 44.09 ? 267 LYS B NZ  1 
ATOM   4658  N  N   . PRO B  1 268 ? 9.503  -22.037 -54.079  1.00 45.63 ? 268 PRO B N   1 
ATOM   4659  C  CA  . PRO B  1 268 ? 9.389  -21.369 -52.783  1.00 47.98 ? 268 PRO B CA  1 
ATOM   4660  C  C   . PRO B  1 268 ? 7.999  -21.480 -52.160  1.00 47.93 ? 268 PRO B C   1 
ATOM   4661  O  O   . PRO B  1 268 ? 7.880  -21.561 -50.937  1.00 46.93 ? 268 PRO B O   1 
ATOM   4662  C  CB  . PRO B  1 268 ? 9.697  -19.908 -53.118  1.00 48.68 ? 268 PRO B CB  1 
ATOM   4663  C  CG  . PRO B  1 268 ? 10.600 -19.983 -54.302  1.00 48.79 ? 268 PRO B CG  1 
ATOM   4664  C  CD  . PRO B  1 268 ? 10.131 -21.171 -55.095  1.00 48.29 ? 268 PRO B CD  1 
ATOM   4665  N  N   . GLU B  1 269 ? 6.959  -21.485 -52.989  1.00 50.76 ? 269 GLU B N   1 
ATOM   4666  C  CA  . GLU B  1 269 ? 5.592  -21.519 -52.470  1.00 51.04 ? 269 GLU B CA  1 
ATOM   4667  C  C   . GLU B  1 269 ? 5.224  -22.872 -51.857  1.00 47.24 ? 269 GLU B C   1 
ATOM   4668  O  O   . GLU B  1 269 ? 4.261  -22.970 -51.100  1.00 48.18 ? 269 GLU B O   1 
ATOM   4669  C  CB  . GLU B  1 269 ? 4.571  -21.105 -53.540  1.00 53.84 ? 269 GLU B CB  1 
ATOM   4670  C  CG  . GLU B  1 269 ? 4.533  -21.990 -54.776  1.00 63.72 ? 269 GLU B CG  1 
ATOM   4671  C  CD  . GLU B  1 269 ? 5.517  -21.553 -55.846  1.00 74.96 ? 269 GLU B CD  1 
ATOM   4672  O  OE1 . GLU B  1 269 ? 6.469  -20.808 -55.524  1.00 70.79 ? 269 GLU B OE1 1 
ATOM   4673  O  OE2 . GLU B  1 269 ? 5.337  -21.955 -57.015  1.00 79.82 ? 269 GLU B OE2 1 
ATOM   4674  N  N   . TYR B  1 270 ? 5.992  -23.910 -52.178  1.00 36.80 ? 270 TYR B N   1 
ATOM   4675  C  CA  . TYR B  1 270 ? 5.736  -25.239 -51.626  1.00 41.06 ? 270 TYR B CA  1 
ATOM   4676  C  C   . TYR B  1 270 ? 6.472  -25.466 -50.309  1.00 37.74 ? 270 TYR B C   1 
ATOM   4677  O  O   . TYR B  1 270 ? 6.179  -26.417 -49.585  1.00 46.97 ? 270 TYR B O   1 
ATOM   4678  C  CB  . TYR B  1 270 ? 6.121  -26.335 -52.624  1.00 40.24 ? 270 TYR B CB  1 
ATOM   4679  C  CG  . TYR B  1 270 ? 5.389  -26.251 -53.942  1.00 51.09 ? 270 TYR B CG  1 
ATOM   4680  C  CD1 . TYR B  1 270 ? 4.027  -25.984 -53.987  1.00 50.18 ? 270 TYR B CD1 1 
ATOM   4681  C  CD2 . TYR B  1 270 ? 6.058  -26.450 -55.143  1.00 49.13 ? 270 TYR B CD2 1 
ATOM   4682  C  CE1 . TYR B  1 270 ? 3.353  -25.909 -55.190  1.00 52.15 ? 270 TYR B CE1 1 
ATOM   4683  C  CE2 . TYR B  1 270 ? 5.393  -26.378 -56.350  1.00 47.23 ? 270 TYR B CE2 1 
ATOM   4684  C  CZ  . TYR B  1 270 ? 4.042  -26.108 -56.368  1.00 57.65 ? 270 TYR B CZ  1 
ATOM   4685  O  OH  . TYR B  1 270 ? 3.378  -26.035 -57.569  1.00 69.38 ? 270 TYR B OH  1 
ATOM   4686  N  N   . LYS B  1 271 ? 7.425  -24.590 -50.003  1.00 33.52 ? 271 LYS B N   1 
ATOM   4687  C  CA  . LYS B  1 271 ? 8.277  -24.755 -48.828  1.00 33.13 ? 271 LYS B CA  1 
ATOM   4688  C  C   . LYS B  1 271 ? 7.493  -24.786 -47.513  1.00 37.30 ? 271 LYS B C   1 
ATOM   4689  O  O   . LYS B  1 271 ? 7.667  -25.701 -46.700  1.00 33.54 ? 271 LYS B O   1 
ATOM   4690  C  CB  . LYS B  1 271 ? 9.345  -23.661 -48.787  1.00 34.89 ? 271 LYS B CB  1 
ATOM   4691  C  CG  . LYS B  1 271 ? 10.324 -23.788 -47.630  1.00 45.49 ? 271 LYS B CG  1 
ATOM   4692  C  CD  . LYS B  1 271 ? 11.580 -22.964 -47.878  1.00 43.80 ? 271 LYS B CD  1 
ATOM   4693  C  CE  . LYS B  1 271 ? 12.441 -22.858 -46.628  1.00 56.13 ? 271 LYS B CE  1 
ATOM   4694  N  NZ  . LYS B  1 271 ? 12.972 -24.177 -46.184  1.00 49.68 ? 271 LYS B NZ  1 
ATOM   4695  N  N   . PRO B  1 272 ? 6.631  -23.781 -47.295  1.00 37.53 ? 272 PRO B N   1 
ATOM   4696  C  CA  . PRO B  1 272 ? 5.867  -23.679 -46.052  1.00 40.39 ? 272 PRO B CA  1 
ATOM   4697  C  C   . PRO B  1 272 ? 5.185  -24.987 -45.667  1.00 37.74 ? 272 PRO B C   1 
ATOM   4698  O  O   . PRO B  1 272 ? 5.163  -25.351 -44.490  1.00 40.17 ? 272 PRO B O   1 
ATOM   4699  C  CB  . PRO B  1 272 ? 4.816  -22.615 -46.378  1.00 48.05 ? 272 PRO B CB  1 
ATOM   4700  C  CG  . PRO B  1 272 ? 5.483  -21.746 -47.392  1.00 43.95 ? 272 PRO B CG  1 
ATOM   4701  C  CD  . PRO B  1 272 ? 6.360  -22.656 -48.210  1.00 38.41 ? 272 PRO B CD  1 
ATOM   4702  N  N   . LYS B  1 273 ? 4.637  -25.689 -46.653  1.00 38.03 ? 273 LYS B N   1 
ATOM   4703  C  CA  . LYS B  1 273 ? 3.927  -26.934 -46.387  1.00 39.42 ? 273 LYS B CA  1 
ATOM   4704  C  C   . LYS B  1 273 ? 4.818  -28.180 -46.494  1.00 42.82 ? 273 LYS B C   1 
ATOM   4705  O  O   . LYS B  1 273 ? 4.611  -29.152 -45.773  1.00 38.34 ? 273 LYS B O   1 
ATOM   4706  C  CB  . LYS B  1 273 ? 2.705  -27.061 -47.304  1.00 48.54 ? 273 LYS B CB  1 
ATOM   4707  C  CG  . LYS B  1 273 ? 1.799  -25.835 -47.280  1.00 60.07 ? 273 LYS B CG  1 
ATOM   4708  C  CD  . LYS B  1 273 ? 0.482  -26.076 -48.003  1.00 67.36 ? 273 LYS B CD  1 
ATOM   4709  C  CE  . LYS B  1 273 ? -0.427 -26.999 -47.207  1.00 65.73 ? 273 LYS B CE  1 
ATOM   4710  N  NZ  . LYS B  1 273 ? -1.736 -27.201 -47.884  1.00 69.15 ? 273 LYS B NZ  1 
ATOM   4711  N  N   . LEU B  1 274 ? 5.815  -28.152 -47.375  1.00 32.69 ? 274 LEU B N   1 
ATOM   4712  C  CA  . LEU B  1 274 ? 6.609  -29.357 -47.628  1.00 32.65 ? 274 LEU B CA  1 
ATOM   4713  C  C   . LEU B  1 274 ? 7.855  -29.470 -46.758  1.00 31.37 ? 274 LEU B C   1 
ATOM   4714  O  O   . LEU B  1 274 ? 8.293  -30.575 -46.433  1.00 30.89 ? 274 LEU B O   1 
ATOM   4715  C  CB  . LEU B  1 274 ? 6.999  -29.453 -49.107  1.00 33.83 ? 274 LEU B CB  1 
ATOM   4716  C  CG  . LEU B  1 274 ? 5.837  -29.454 -50.104  1.00 30.23 ? 274 LEU B CG  1 
ATOM   4717  C  CD1 . LEU B  1 274 ? 6.353  -29.616 -51.523  1.00 28.77 ? 274 LEU B CD1 1 
ATOM   4718  C  CD2 . LEU B  1 274 ? 4.823  -30.536 -49.764  1.00 33.12 ? 274 LEU B CD2 1 
ATOM   4719  N  N   . ALA B  1 275 ? 8.440  -28.333 -46.397  1.00 30.46 ? 275 ALA B N   1 
ATOM   4720  C  CA  . ALA B  1 275 ? 9.703  -28.343 -45.665  1.00 27.76 ? 275 ALA B CA  1 
ATOM   4721  C  C   . ALA B  1 275 ? 9.992  -26.983 -45.040  1.00 26.06 ? 275 ALA B C   1 
ATOM   4722  O  O   . ALA B  1 275 ? 10.995 -26.349 -45.358  1.00 24.73 ? 275 ALA B O   1 
ATOM   4723  C  CB  . ALA B  1 275 ? 10.844 -28.763 -46.592  1.00 24.21 ? 275 ALA B CB  1 
ATOM   4724  N  N   . PRO B  1 276 ? 9.115  -26.535 -44.130  1.00 29.83 ? 276 PRO B N   1 
ATOM   4725  C  CA  . PRO B  1 276 ? 9.205  -25.179 -43.580  1.00 31.90 ? 276 PRO B CA  1 
ATOM   4726  C  C   . PRO B  1 276 ? 10.535 -24.856 -42.886  1.00 31.03 ? 276 PRO B C   1 
ATOM   4727  O  O   . PRO B  1 276 ? 11.011 -23.725 -42.972  1.00 33.64 ? 276 PRO B O   1 
ATOM   4728  C  CB  . PRO B  1 276 ? 8.037  -25.121 -42.576  1.00 31.95 ? 276 PRO B CB  1 
ATOM   4729  C  CG  . PRO B  1 276 ? 7.690  -26.546 -42.290  1.00 30.06 ? 276 PRO B CG  1 
ATOM   4730  C  CD  . PRO B  1 276 ? 7.991  -27.296 -43.556  1.00 29.66 ? 276 PRO B CD  1 
ATOM   4731  N  N   . ARG B  1 277 ? 11.132 -25.831 -42.207  1.00 31.47 ? 277 ARG B N   1 
ATOM   4732  C  CA  . ARG B  1 277 ? 12.341 -25.569 -41.416  1.00 30.30 ? 277 ARG B CA  1 
ATOM   4733  C  C   . ARG B  1 277 ? 13.591 -26.250 -41.969  1.00 30.68 ? 277 ARG B C   1 
ATOM   4734  O  O   . ARG B  1 277 ? 14.634 -26.305 -41.314  1.00 23.48 ? 277 ARG B O   1 
ATOM   4735  C  CB  . ARG B  1 277 ? 12.120 -25.986 -39.964  1.00 32.81 ? 277 ARG B CB  1 
ATOM   4736  C  CG  . ARG B  1 277 ? 11.235 -25.031 -39.184  1.00 41.38 ? 277 ARG B CG  1 
ATOM   4737  C  CD  . ARG B  1 277 ? 11.195 -25.426 -37.719  1.00 47.64 ? 277 ARG B CD  1 
ATOM   4738  N  NE  . ARG B  1 277 ? 10.392 -26.625 -37.504  1.00 47.35 ? 277 ARG B NE  1 
ATOM   4739  C  CZ  . ARG B  1 277 ? 10.584 -27.479 -36.504  1.00 51.92 ? 277 ARG B CZ  1 
ATOM   4740  N  NH1 . ARG B  1 277 ? 9.798  -28.541 -36.377  1.00 50.65 ? 277 ARG B NH1 1 
ATOM   4741  N  NH2 . ARG B  1 277 ? 11.569 -27.271 -35.637  1.00 45.58 ? 277 ARG B NH2 1 
ATOM   4742  N  N   . TRP B  1 278 ? 13.473 -26.767 -43.182  1.00 27.38 ? 278 TRP B N   1 
ATOM   4743  C  CA  . TRP B  1 278 ? 14.565 -27.471 -43.832  1.00 25.47 ? 278 TRP B CA  1 
ATOM   4744  C  C   . TRP B  1 278 ? 15.705 -26.526 -44.059  1.00 26.62 ? 278 TRP B C   1 
ATOM   4745  O  O   . TRP B  1 278 ? 15.556 -25.506 -44.725  1.00 23.87 ? 278 TRP B O   1 
ATOM   4746  C  CB  . TRP B  1 278 ? 14.063 -28.025 -45.150  1.00 22.63 ? 278 TRP B CB  1 
ATOM   4747  C  CG  . TRP B  1 278 ? 14.972 -28.985 -45.871  1.00 21.49 ? 278 TRP B CG  1 
ATOM   4748  C  CD1 . TRP B  1 278 ? 15.805 -29.967 -45.324  1.00 19.12 ? 278 TRP B CD1 1 
ATOM   4749  C  CD2 . TRP B  1 278 ? 15.116 -29.125 -47.325  1.00 19.92 ? 278 TRP B CD2 1 
ATOM   4750  N  NE1 . TRP B  1 278 ? 16.448 -30.667 -46.319  1.00 18.99 ? 278 TRP B NE1 1 
ATOM   4751  C  CE2 . TRP B  1 278 ? 16.076 -30.210 -47.543  1.00 21.02 ? 278 TRP B CE2 1 
ATOM   4752  C  CE3 . TRP B  1 278 ? 14.569 -28.477 -48.425  1.00 23.69 ? 278 TRP B CE3 1 
ATOM   4753  C  CZ2 . TRP B  1 278 ? 16.458 -30.604 -48.815  1.00 21.43 ? 278 TRP B CZ2 1 
ATOM   4754  C  CZ3 . TRP B  1 278 ? 14.964 -28.885 -49.704  1.00 22.14 ? 278 TRP B CZ3 1 
ATOM   4755  C  CH2 . TRP B  1 278 ? 15.885 -29.923 -49.890  1.00 22.86 ? 278 TRP B CH2 1 
ATOM   4756  N  N   . SER B  1 279 ? 16.854 -26.855 -43.484  1.00 21.93 ? 279 SER B N   1 
ATOM   4757  C  CA  . SER B  1 279 ? 18.072 -26.096 -43.698  1.00 24.69 ? 279 SER B CA  1 
ATOM   4758  C  C   . SER B  1 279 ? 19.223 -26.980 -43.256  1.00 21.93 ? 279 SER B C   1 
ATOM   4759  O  O   . SER B  1 279 ? 19.004 -28.095 -42.776  1.00 21.68 ? 279 SER B O   1 
ATOM   4760  C  CB  . SER B  1 279 ? 18.065 -24.808 -42.884  1.00 24.53 ? 279 SER B CB  1 
ATOM   4761  O  OG  . SER B  1 279 ? 18.542 -25.043 -41.572  1.00 24.31 ? 279 SER B OG  1 
ATOM   4762  N  N   . ILE B  1 280 ? 20.442 -26.477 -43.394  1.00 20.67 ? 280 ILE B N   1 
ATOM   4763  C  CA  . ILE B  1 280 ? 21.628 -27.279 -43.101  1.00 19.69 ? 280 ILE B CA  1 
ATOM   4764  C  C   . ILE B  1 280 ? 21.979 -27.257 -41.611  1.00 20.65 ? 280 ILE B C   1 
ATOM   4765  O  O   . ILE B  1 280 ? 22.922 -27.929 -41.185  1.00 21.59 ? 280 ILE B O   1 
ATOM   4766  C  CB  . ILE B  1 280 ? 22.840 -26.830 -43.952  1.00 23.24 ? 280 ILE B CB  1 
ATOM   4767  C  CG1 . ILE B  1 280 ? 23.809 -28.000 -44.181  1.00 24.41 ? 280 ILE B CG1 1 
ATOM   4768  C  CG2 . ILE B  1 280 ? 23.548 -25.641 -43.312  1.00 22.97 ? 280 ILE B CG2 1 
ATOM   4769  C  CD1 . ILE B  1 280 ? 24.953 -27.663 -45.114  1.00 26.25 ? 280 ILE B CD1 1 
ATOM   4770  N  N   . THR B  1 281 ? 21.221 -26.495 -40.820  1.00 16.83 ? 281 THR B N   1 
ATOM   4771  C  CA  . THR B  1 281 ? 21.467 -26.414 -39.376  1.00 17.44 ? 281 THR B CA  1 
ATOM   4772  C  C   . THR B  1 281 ? 20.247 -26.771 -38.515  1.00 18.77 ? 281 THR B C   1 
ATOM   4773  O  O   . THR B  1 281 ? 20.237 -26.522 -37.311  1.00 20.83 ? 281 THR B O   1 
ATOM   4774  C  CB  . THR B  1 281 ? 21.993 -25.020 -38.942  1.00 19.41 ? 281 THR B CB  1 
ATOM   4775  O  OG1 . THR B  1 281 ? 21.039 -24.006 -39.286  1.00 20.08 ? 281 THR B OG1 1 
ATOM   4776  C  CG2 . THR B  1 281 ? 23.318 -24.706 -39.616  1.00 18.53 ? 281 THR B CG2 1 
ATOM   4777  N  N   . LEU B  1 282 ? 19.227 -27.373 -39.114  1.00 19.90 ? 282 LEU B N   1 
ATOM   4778  C  CA  . LEU B  1 282 ? 18.045 -27.766 -38.342  1.00 20.23 ? 282 LEU B CA  1 
ATOM   4779  C  C   . LEU B  1 282 ? 18.365 -28.664 -37.137  1.00 20.15 ? 282 LEU B C   1 
ATOM   4780  O  O   . LEU B  1 282 ? 17.772 -28.505 -36.070  1.00 21.16 ? 282 LEU B O   1 
ATOM   4781  C  CB  . LEU B  1 282 ? 16.990 -28.430 -39.232  1.00 21.77 ? 282 LEU B CB  1 
ATOM   4782  C  CG  . LEU B  1 282 ? 15.701 -28.837 -38.495  1.00 21.10 ? 282 LEU B CG  1 
ATOM   4783  C  CD1 . LEU B  1 282 ? 15.109 -27.651 -37.749  1.00 20.98 ? 282 LEU B CD1 1 
ATOM   4784  C  CD2 . LEU B  1 282 ? 14.683 -29.412 -39.470  1.00 19.61 ? 282 LEU B CD2 1 
ATOM   4785  N  N   . ILE B  1 283 ? 19.296 -29.602 -37.290  1.00 17.00 ? 283 ILE B N   1 
ATOM   4786  C  CA  . ILE B  1 283 ? 19.571 -30.527 -36.187  1.00 19.44 ? 283 ILE B CA  1 
ATOM   4787  C  C   . ILE B  1 283 ? 20.181 -29.849 -34.959  1.00 18.23 ? 283 ILE B C   1 
ATOM   4788  O  O   . ILE B  1 283 ? 19.997 -30.313 -33.842  1.00 17.87 ? 283 ILE B O   1 
ATOM   4789  C  CB  . ILE B  1 283 ? 20.449 -31.734 -36.609  1.00 21.22 ? 283 ILE B CB  1 
ATOM   4790  C  CG1 . ILE B  1 283 ? 21.759 -31.256 -37.225  1.00 23.00 ? 283 ILE B CG1 1 
ATOM   4791  C  CG2 . ILE B  1 283 ? 19.690 -32.648 -37.573  1.00 20.88 ? 283 ILE B CG2 1 
ATOM   4792  C  CD1 . ILE B  1 283 ? 22.812 -32.337 -37.321  1.00 25.76 ? 283 ILE B CD1 1 
ATOM   4793  N  N   . PHE B  1 284 ? 20.908 -28.756 -35.162  1.00 18.05 ? 284 PHE B N   1 
ATOM   4794  C  CA  . PHE B  1 284 ? 21.418 -27.979 -34.024  1.00 18.89 ? 284 PHE B CA  1 
ATOM   4795  C  C   . PHE B  1 284 ? 20.298 -27.198 -33.350  1.00 20.16 ? 284 PHE B C   1 
ATOM   4796  O  O   . PHE B  1 284 ? 20.332 -26.947 -32.143  1.00 19.97 ? 284 PHE B O   1 
ATOM   4797  C  CB  . PHE B  1 284 ? 22.521 -27.021 -34.472  1.00 20.37 ? 284 PHE B CB  1 
ATOM   4798  C  CG  . PHE B  1 284 ? 23.745 -27.716 -34.995  1.00 23.17 ? 284 PHE B CG  1 
ATOM   4799  C  CD1 . PHE B  1 284 ? 23.961 -27.837 -36.359  1.00 21.49 ? 284 PHE B CD1 1 
ATOM   4800  C  CD2 . PHE B  1 284 ? 24.676 -28.255 -34.119  1.00 24.77 ? 284 PHE B CD2 1 
ATOM   4801  C  CE1 . PHE B  1 284 ? 25.084 -28.483 -36.844  1.00 23.18 ? 284 PHE B CE1 1 
ATOM   4802  C  CE2 . PHE B  1 284 ? 25.803 -28.900 -34.595  1.00 24.40 ? 284 PHE B CE2 1 
ATOM   4803  C  CZ  . PHE B  1 284 ? 26.006 -29.015 -35.959  1.00 22.06 ? 284 PHE B CZ  1 
ATOM   4804  N  N   . GLU B  1 285 ? 19.305 -26.816 -34.143  1.00 21.03 ? 285 GLU B N   1 
ATOM   4805  C  CA  . GLU B  1 285 ? 18.214 -25.977 -33.664  1.00 22.20 ? 285 GLU B CA  1 
ATOM   4806  C  C   . GLU B  1 285 ? 17.115 -26.777 -32.980  1.00 25.98 ? 285 GLU B C   1 
ATOM   4807  O  O   . GLU B  1 285 ? 16.421 -26.261 -32.103  1.00 23.50 ? 285 GLU B O   1 
ATOM   4808  C  CB  . GLU B  1 285 ? 17.613 -25.187 -34.827  1.00 22.30 ? 285 GLU B CB  1 
ATOM   4809  C  CG  . GLU B  1 285 ? 18.606 -24.257 -35.500  1.00 24.41 ? 285 GLU B CG  1 
ATOM   4810  C  CD  . GLU B  1 285 ? 18.102 -23.728 -36.827  1.00 26.97 ? 285 GLU B CD  1 
ATOM   4811  O  OE1 . GLU B  1 285 ? 16.886 -23.825 -37.095  1.00 32.78 ? 285 GLU B OE1 1 
ATOM   4812  O  OE2 . GLU B  1 285 ? 18.929 -23.215 -37.603  1.00 25.96 ? 285 GLU B OE2 1 
ATOM   4813  N  N   . ASP B  1 286 ? 16.960 -28.037 -33.377  1.00 21.30 ? 286 ASP B N   1 
ATOM   4814  C  CA  . ASP B  1 286 ? 15.818 -28.828 -32.922  1.00 23.20 ? 286 ASP B CA  1 
ATOM   4815  C  C   . ASP B  1 286 ? 16.211 -30.217 -32.403  1.00 26.00 ? 286 ASP B C   1 
ATOM   4816  O  O   . ASP B  1 286 ? 16.034 -30.535 -31.221  1.00 23.49 ? 286 ASP B O   1 
ATOM   4817  C  CB  . ASP B  1 286 ? 14.804 -28.950 -34.064  1.00 24.90 ? 286 ASP B CB  1 
ATOM   4818  C  CG  . ASP B  1 286 ? 13.522 -29.640 -33.641  1.00 27.97 ? 286 ASP B CG  1 
ATOM   4819  O  OD1 . ASP B  1 286 ? 13.594 -30.783 -33.146  1.00 26.18 ? 286 ASP B OD1 1 
ATOM   4820  O  OD2 . ASP B  1 286 ? 12.440 -29.041 -33.815  1.00 33.17 ? 286 ASP B OD2 1 
ATOM   4821  N  N   . THR B  1 287 ? 16.760 -31.034 -33.294  1.00 21.06 ? 287 THR B N   1 
ATOM   4822  C  CA  . THR B  1 287 ? 17.020 -32.446 -33.002  1.00 22.27 ? 287 THR B CA  1 
ATOM   4823  C  C   . THR B  1 287 ? 17.950 -32.703 -31.819  1.00 20.92 ? 287 THR B C   1 
ATOM   4824  O  O   . THR B  1 287 ? 17.586 -33.400 -30.871  1.00 19.67 ? 287 THR B O   1 
ATOM   4825  C  CB  . THR B  1 287 ? 17.586 -33.145 -34.249  1.00 24.04 ? 287 THR B CB  1 
ATOM   4826  O  OG1 . THR B  1 287 ? 16.637 -33.020 -35.309  1.00 23.04 ? 287 THR B OG1 1 
ATOM   4827  C  CG2 . THR B  1 287 ? 17.858 -34.621 -33.975  1.00 21.77 ? 287 THR B CG2 1 
ATOM   4828  N  N   . ILE B  1 288 ? 19.158 -32.154 -31.875  1.00 19.74 ? 288 ILE B N   1 
ATOM   4829  C  CA  . ILE B  1 288 ? 20.113 -32.385 -30.801  1.00 19.31 ? 288 ILE B CA  1 
ATOM   4830  C  C   . ILE B  1 288 ? 19.585 -31.870 -29.450  1.00 19.30 ? 288 ILE B C   1 
ATOM   4831  O  O   . ILE B  1 288 ? 19.648 -32.580 -28.452  1.00 21.66 ? 288 ILE B O   1 
ATOM   4832  C  CB  . ILE B  1 288 ? 21.514 -31.833 -31.147  1.00 20.07 ? 288 ILE B CB  1 
ATOM   4833  C  CG1 . ILE B  1 288 ? 22.086 -32.596 -32.348  1.00 18.30 ? 288 ILE B CG1 1 
ATOM   4834  C  CG2 . ILE B  1 288 ? 22.449 -31.953 -29.954  1.00 20.48 ? 288 ILE B CG2 1 
ATOM   4835  C  CD1 . ILE B  1 288 ? 23.477 -32.152 -32.769  1.00 22.44 ? 288 ILE B CD1 1 
ATOM   4836  N  N   . PRO B  1 289 ? 19.048 -30.638 -29.417  1.00 21.10 ? 289 PRO B N   1 
ATOM   4837  C  CA  . PRO B  1 289 ? 18.467 -30.145 -28.170  1.00 22.28 ? 289 PRO B CA  1 
ATOM   4838  C  C   . PRO B  1 289 ? 17.353 -31.062 -27.659  1.00 22.40 ? 289 PRO B C   1 
ATOM   4839  O  O   . PRO B  1 289 ? 17.268 -31.326 -26.458  1.00 23.39 ? 289 PRO B O   1 
ATOM   4840  C  CB  . PRO B  1 289 ? 17.897 -28.782 -28.570  1.00 22.57 ? 289 PRO B CB  1 
ATOM   4841  C  CG  . PRO B  1 289 ? 18.770 -28.333 -29.694  1.00 21.04 ? 289 PRO B CG  1 
ATOM   4842  C  CD  . PRO B  1 289 ? 19.112 -29.589 -30.453  1.00 19.39 ? 289 PRO B CD  1 
ATOM   4843  N  N   . PHE B  1 290 ? 16.514 -31.544 -28.569  1.00 21.38 ? 290 PHE B N   1 
ATOM   4844  C  CA  . PHE B  1 290 ? 15.469 -32.506 -28.217  1.00 22.32 ? 290 PHE B CA  1 
ATOM   4845  C  C   . PHE B  1 290 ? 16.037 -33.777 -27.595  1.00 21.80 ? 290 PHE B C   1 
ATOM   4846  O  O   . PHE B  1 290 ? 15.546 -34.250 -26.569  1.00 23.28 ? 290 PHE B O   1 
ATOM   4847  C  CB  . PHE B  1 290 ? 14.631 -32.868 -29.445  1.00 23.65 ? 290 PHE B CB  1 
ATOM   4848  C  CG  . PHE B  1 290 ? 13.734 -34.059 -29.234  1.00 25.00 ? 290 PHE B CG  1 
ATOM   4849  C  CD1 . PHE B  1 290 ? 12.462 -33.901 -28.712  1.00 27.53 ? 290 PHE B CD1 1 
ATOM   4850  C  CD2 . PHE B  1 290 ? 14.171 -35.336 -29.543  1.00 25.83 ? 290 PHE B CD2 1 
ATOM   4851  C  CE1 . PHE B  1 290 ? 11.637 -34.996 -28.508  1.00 29.88 ? 290 PHE B CE1 1 
ATOM   4852  C  CE2 . PHE B  1 290 ? 13.352 -36.436 -29.343  1.00 28.16 ? 290 PHE B CE2 1 
ATOM   4853  C  CZ  . PHE B  1 290 ? 12.082 -36.264 -28.830  1.00 25.36 ? 290 PHE B CZ  1 
ATOM   4854  N  N   . LEU B  1 291 ? 17.067 -34.337 -28.220  1.00 20.75 ? 291 LEU B N   1 
ATOM   4855  C  CA  . LEU B  1 291 ? 17.690 -35.551 -27.699  1.00 20.33 ? 291 LEU B CA  1 
ATOM   4856  C  C   . LEU B  1 291 ? 18.281 -35.327 -26.306  1.00 23.11 ? 291 LEU B C   1 
ATOM   4857  O  O   . LEU B  1 291 ? 18.084 -36.142 -25.402  1.00 24.20 ? 291 LEU B O   1 
ATOM   4858  C  CB  . LEU B  1 291 ? 18.765 -36.075 -28.665  1.00 19.77 ? 291 LEU B CB  1 
ATOM   4859  C  CG  . LEU B  1 291 ? 18.298 -36.516 -30.058  1.00 15.88 ? 291 LEU B CG  1 
ATOM   4860  C  CD1 . LEU B  1 291 ? 19.497 -36.929 -30.895  1.00 16.04 ? 291 LEU B CD1 1 
ATOM   4861  C  CD2 . LEU B  1 291 ? 17.291 -37.658 -29.972  1.00 16.66 ? 291 LEU B CD2 1 
ATOM   4862  N  N   . LYS B  1 292 ? 19.002 -34.226 -26.130  1.00 24.83 ? 292 LYS B N   1 
ATOM   4863  C  CA  . LYS B  1 292 ? 19.577 -33.906 -24.819  1.00 28.36 ? 292 LYS B CA  1 
ATOM   4864  C  C   . LYS B  1 292 ? 18.492 -33.746 -23.746  1.00 30.44 ? 292 LYS B C   1 
ATOM   4865  O  O   . LYS B  1 292 ? 18.645 -34.208 -22.614  1.00 31.63 ? 292 LYS B O   1 
ATOM   4866  C  CB  . LYS B  1 292 ? 20.443 -32.650 -24.907  1.00 31.23 ? 292 LYS B CB  1 
ATOM   4867  C  CG  . LYS B  1 292 ? 21.771 -32.876 -25.620  1.00 39.45 ? 292 LYS B CG  1 
ATOM   4868  C  CD  . LYS B  1 292 ? 22.556 -31.584 -25.754  1.00 48.01 ? 292 LYS B CD  1 
ATOM   4869  C  CE  . LYS B  1 292 ? 23.797 -31.781 -26.610  1.00 69.17 ? 292 LYS B CE  1 
ATOM   4870  N  NZ  . LYS B  1 292 ? 24.471 -30.493 -26.945  1.00 74.36 ? 292 LYS B NZ  1 
ATOM   4871  N  N   . ARG B  1 293 ? 17.397 -33.094 -24.120  1.00 27.40 ? 293 ARG B N   1 
ATOM   4872  C  CA  . ARG B  1 293 ? 16.258 -32.891 -23.236  1.00 31.64 ? 293 ARG B CA  1 
ATOM   4873  C  C   . ARG B  1 293 ? 15.671 -34.240 -22.821  1.00 30.67 ? 293 ARG B C   1 
ATOM   4874  O  O   . ARG B  1 293 ? 14.979 -34.346 -21.812  1.00 29.71 ? 293 ARG B O   1 
ATOM   4875  C  CB  . ARG B  1 293 ? 15.198 -32.069 -23.974  1.00 35.64 ? 293 ARG B CB  1 
ATOM   4876  C  CG  . ARG B  1 293 ? 14.245 -31.276 -23.100  1.00 49.44 ? 293 ARG B CG  1 
ATOM   4877  C  CD  . ARG B  1 293 ? 13.262 -30.529 -23.986  1.00 42.67 ? 293 ARG B CD  1 
ATOM   4878  N  NE  . ARG B  1 293 ? 13.966 -29.845 -25.060  1.00 41.13 ? 293 ARG B NE  1 
ATOM   4879  C  CZ  . ARG B  1 293 ? 13.569 -29.827 -26.327  1.00 38.73 ? 293 ARG B CZ  1 
ATOM   4880  N  NH1 . ARG B  1 293 ? 12.467 -30.466 -26.692  1.00 40.42 ? 293 ARG B NH1 1 
ATOM   4881  N  NH2 . ARG B  1 293 ? 14.285 -29.180 -27.232  1.00 39.56 ? 293 ARG B NH2 1 
ATOM   4882  N  N   . ASN B  1 294 ? 15.948 -35.270 -23.612  1.00 29.75 ? 294 ASN B N   1 
ATOM   4883  C  CA  . ASN B  1 294 ? 15.429 -36.601 -23.330  1.00 29.02 ? 294 ASN B CA  1 
ATOM   4884  C  C   . ASN B  1 294 ? 16.458 -37.584 -22.780  1.00 32.23 ? 294 ASN B C   1 
ATOM   4885  O  O   . ASN B  1 294 ? 16.236 -38.789 -22.810  1.00 30.63 ? 294 ASN B O   1 
ATOM   4886  C  CB  . ASN B  1 294 ? 14.744 -37.182 -24.565  1.00 27.39 ? 294 ASN B CB  1 
ATOM   4887  C  CG  . ASN B  1 294 ? 13.418 -36.510 -24.858  1.00 31.92 ? 294 ASN B CG  1 
ATOM   4888  O  OD1 . ASN B  1 294 ? 13.367 -35.443 -25.475  1.00 32.68 ? 294 ASN B OD1 1 
ATOM   4889  N  ND2 . ASN B  1 294 ? 12.334 -37.130 -24.407  1.00 34.78 ? 294 ASN B ND2 1 
ATOM   4890  N  N   . GLY B  1 295 ? 17.580 -37.070 -22.279  1.00 33.65 ? 295 GLY B N   1 
ATOM   4891  C  CA  . GLY B  1 295 ? 18.548 -37.905 -21.562  1.00 31.51 ? 295 GLY B CA  1 
ATOM   4892  C  C   . GLY B  1 295 ? 19.700 -38.454 -22.387  1.00 33.31 ? 295 GLY B C   1 
ATOM   4893  O  O   . GLY B  1 295 ? 20.541 -39.192 -21.878  1.00 36.04 ? 295 GLY B O   1 
ATOM   4894  N  N   . VAL B  1 296 ? 19.742 -38.110 -23.666  1.00 30.76 ? 296 VAL B N   1 
ATOM   4895  C  CA  . VAL B  1 296 ? 20.853 -38.519 -24.509  1.00 26.77 ? 296 VAL B CA  1 
ATOM   4896  C  C   . VAL B  1 296 ? 22.063 -37.661 -24.167  1.00 29.07 ? 296 VAL B C   1 
ATOM   4897  O  O   . VAL B  1 296 ? 21.999 -36.435 -24.240  1.00 30.44 ? 296 VAL B O   1 
ATOM   4898  C  CB  . VAL B  1 296 ? 20.502 -38.360 -25.996  1.00 24.96 ? 296 VAL B CB  1 
ATOM   4899  C  CG1 . VAL B  1 296 ? 21.672 -38.777 -26.877  1.00 21.77 ? 296 VAL B CG1 1 
ATOM   4900  C  CG2 . VAL B  1 296 ? 19.257 -39.167 -26.323  1.00 23.09 ? 296 VAL B CG2 1 
ATOM   4901  N  N   . ASN B  1 297 ? 23.160 -38.301 -23.777  1.00 29.01 ? 297 ASN B N   1 
ATOM   4902  C  CA  . ASN B  1 297 ? 24.354 -37.562 -23.370  1.00 31.87 ? 297 ASN B CA  1 
ATOM   4903  C  C   . ASN B  1 297 ? 25.256 -37.171 -24.545  1.00 33.49 ? 297 ASN B C   1 
ATOM   4904  O  O   . ASN B  1 297 ? 25.070 -37.633 -25.681  1.00 27.99 ? 297 ASN B O   1 
ATOM   4905  C  CB  . ASN B  1 297 ? 25.147 -38.340 -22.312  1.00 33.54 ? 297 ASN B CB  1 
ATOM   4906  C  CG  . ASN B  1 297 ? 25.691 -39.654 -22.834  1.00 43.20 ? 297 ASN B CG  1 
ATOM   4907  O  OD1 . ASN B  1 297 ? 26.072 -39.767 -23.999  1.00 44.22 ? 297 ASN B OD1 1 
ATOM   4908  N  ND2 . ASN B  1 297 ? 25.737 -40.657 -21.968  1.00 50.65 ? 297 ASN B ND2 1 
ATOM   4909  N  N   . GLU B  1 298 ? 26.232 -36.313 -24.266  1.00 31.28 ? 298 GLU B N   1 
ATOM   4910  C  CA  . GLU B  1 298 ? 27.131 -35.808 -25.302  1.00 33.58 ? 298 GLU B CA  1 
ATOM   4911  C  C   . GLU B  1 298 ? 27.948 -36.921 -25.944  1.00 28.43 ? 298 GLU B C   1 
ATOM   4912  O  O   . GLU B  1 298 ? 28.382 -36.792 -27.086  1.00 26.39 ? 298 GLU B O   1 
ATOM   4913  C  CB  . GLU B  1 298 ? 28.060 -34.721 -24.747  1.00 36.64 ? 298 GLU B CB  1 
ATOM   4914  C  CG  . GLU B  1 298 ? 27.368 -33.403 -24.422  1.00 37.80 ? 298 GLU B CG  1 
ATOM   4915  C  CD  . GLU B  1 298 ? 26.783 -32.718 -25.646  1.00 46.72 ? 298 GLU B CD  1 
ATOM   4916  O  OE1 . GLU B  1 298 ? 25.793 -31.972 -25.486  1.00 53.49 ? 298 GLU B OE1 1 
ATOM   4917  O  OE2 . GLU B  1 298 ? 27.303 -32.918 -26.767  1.00 40.94 ? 298 GLU B OE2 1 
ATOM   4918  N  N   . GLU B  1 299 ? 28.154 -38.015 -25.217  1.00 29.32 ? 299 GLU B N   1 
ATOM   4919  C  CA  . GLU B  1 299 ? 28.902 -39.144 -25.772  1.00 32.18 ? 299 GLU B CA  1 
ATOM   4920  C  C   . GLU B  1 299 ? 28.167 -39.756 -26.958  1.00 26.92 ? 299 GLU B C   1 
ATOM   4921  O  O   . GLU B  1 299 ? 28.785 -40.107 -27.961  1.00 27.17 ? 299 GLU B O   1 
ATOM   4922  C  CB  . GLU B  1 299 ? 29.171 -40.221 -24.716  1.00 35.59 ? 299 GLU B CB  1 
ATOM   4923  C  CG  . GLU B  1 299 ? 30.343 -39.925 -23.793  1.00 49.28 ? 299 GLU B CG  1 
ATOM   4924  C  CD  . GLU B  1 299 ? 29.943 -39.150 -22.548  1.00 65.26 ? 299 GLU B CD  1 
ATOM   4925  O  OE1 . GLU B  1 299 ? 30.705 -39.188 -21.558  1.00 69.75 ? 299 GLU B OE1 1 
ATOM   4926  O  OE2 . GLU B  1 299 ? 28.870 -38.507 -22.552  1.00 68.02 ? 299 GLU B OE2 1 
ATOM   4927  N  N   . VAL B  1 300 ? 26.850 -39.891 -26.836  1.00 25.42 ? 300 VAL B N   1 
ATOM   4928  C  CA  . VAL B  1 300 ? 26.042 -40.438 -27.917  1.00 24.10 ? 300 VAL B CA  1 
ATOM   4929  C  C   . VAL B  1 300 ? 26.048 -39.481 -29.105  1.00 22.96 ? 300 VAL B C   1 
ATOM   4930  O  O   . VAL B  1 300 ? 26.197 -39.908 -30.244  1.00 21.71 ? 300 VAL B O   1 
ATOM   4931  C  CB  . VAL B  1 300 ? 24.591 -40.729 -27.480  1.00 26.05 ? 300 VAL B CB  1 
ATOM   4932  C  CG1 . VAL B  1 300 ? 23.741 -41.112 -28.680  1.00 22.87 ? 300 VAL B CG1 1 
ATOM   4933  C  CG2 . VAL B  1 300 ? 24.551 -41.831 -26.427  1.00 25.69 ? 300 VAL B CG2 1 
ATOM   4934  N  N   . ILE B  1 301 ? 25.898 -38.186 -28.837  1.00 23.73 ? 301 ILE B N   1 
ATOM   4935  C  CA  . ILE B  1 301 ? 25.974 -37.185 -29.902  1.00 22.13 ? 301 ILE B CA  1 
ATOM   4936  C  C   . ILE B  1 301 ? 27.312 -37.287 -30.636  1.00 22.49 ? 301 ILE B C   1 
ATOM   4937  O  O   . ILE B  1 301 ? 27.357 -37.275 -31.868  1.00 19.47 ? 301 ILE B O   1 
ATOM   4938  C  CB  . ILE B  1 301 ? 25.772 -35.750 -29.367  1.00 21.43 ? 301 ILE B CB  1 
ATOM   4939  C  CG1 . ILE B  1 301 ? 24.461 -35.646 -28.584  1.00 22.39 ? 301 ILE B CG1 1 
ATOM   4940  C  CG2 . ILE B  1 301 ? 25.772 -34.738 -30.507  1.00 19.20 ? 301 ILE B CG2 1 
ATOM   4941  C  CD1 . ILE B  1 301 ? 23.252 -36.126 -29.360  1.00 28.03 ? 301 ILE B CD1 1 
ATOM   4942  N  N   . ALA B  1 302 ? 28.401 -37.415 -29.882  1.00 19.44 ? 302 ALA B N   1 
ATOM   4943  C  CA  . ALA B  1 302 ? 29.730 -37.514 -30.483  1.00 22.94 ? 302 ALA B CA  1 
ATOM   4944  C  C   . ALA B  1 302 ? 29.866 -38.776 -31.335  1.00 21.79 ? 302 ALA B C   1 
ATOM   4945  O  O   . ALA B  1 302 ? 30.513 -38.769 -32.385  1.00 20.55 ? 302 ALA B O   1 
ATOM   4946  C  CB  . ALA B  1 302 ? 30.813 -37.469 -29.406  1.00 22.91 ? 302 ALA B CB  1 
ATOM   4947  N  N   . THR B  1 303 ? 29.258 -39.864 -30.875  1.00 19.28 ? 303 THR B N   1 
ATOM   4948  C  CA  . THR B  1 303 ? 29.302 -41.116 -31.613  1.00 18.90 ? 303 THR B CA  1 
ATOM   4949  C  C   . THR B  1 303 ? 28.653 -40.956 -32.989  1.00 17.67 ? 303 THR B C   1 
ATOM   4950  O  O   . THR B  1 303 ? 29.202 -41.387 -34.001  1.00 15.17 ? 303 THR B O   1 
ATOM   4951  C  CB  . THR B  1 303 ? 28.590 -42.237 -30.832  1.00 20.66 ? 303 THR B CB  1 
ATOM   4952  O  OG1 . THR B  1 303 ? 29.361 -42.557 -29.669  1.00 22.26 ? 303 THR B OG1 1 
ATOM   4953  C  CG2 . THR B  1 303 ? 28.441 -43.479 -31.683  1.00 18.68 ? 303 THR B CG2 1 
ATOM   4954  N  N   . ILE B  1 304 ? 27.486 -40.321 -33.010  1.00 15.77 ? 304 ILE B N   1 
ATOM   4955  C  CA  . ILE B  1 304 ? 26.710 -40.162 -34.232  1.00 14.53 ? 304 ILE B CA  1 
ATOM   4956  C  C   . ILE B  1 304 ? 27.402 -39.255 -35.245  1.00 15.74 ? 304 ILE B C   1 
ATOM   4957  O  O   . ILE B  1 304 ? 27.543 -39.617 -36.420  1.00 15.57 ? 304 ILE B O   1 
ATOM   4958  C  CB  . ILE B  1 304 ? 25.292 -39.637 -33.916  1.00 16.03 ? 304 ILE B CB  1 
ATOM   4959  C  CG1 . ILE B  1 304 ? 24.513 -40.693 -33.118  1.00 16.82 ? 304 ILE B CG1 1 
ATOM   4960  C  CG2 . ILE B  1 304 ? 24.551 -39.285 -35.197  1.00 13.16 ? 304 ILE B CG2 1 
ATOM   4961  C  CD1 . ILE B  1 304 ? 23.222 -40.190 -32.501  1.00 15.93 ? 304 ILE B CD1 1 
ATOM   4962  N  N   . PHE B  1 305 ? 27.860 -38.092 -34.783  1.00 15.69 ? 305 PHE B N   1 
ATOM   4963  C  CA  . PHE B  1 305 ? 28.402 -37.079 -35.682  1.00 15.49 ? 305 PHE B CA  1 
ATOM   4964  C  C   . PHE B  1 305 ? 29.919 -37.107 -35.868  1.00 15.49 ? 305 PHE B C   1 
ATOM   4965  O  O   . PHE B  1 305 ? 30.441 -36.461 -36.775  1.00 15.93 ? 305 PHE B O   1 
ATOM   4966  C  CB  . PHE B  1 305 ? 27.944 -35.693 -35.235  1.00 16.14 ? 305 PHE B CB  1 
ATOM   4967  C  CG  . PHE B  1 305 ? 26.462 -35.525 -35.283  1.00 16.79 ? 305 PHE B CG  1 
ATOM   4968  C  CD1 . PHE B  1 305 ? 25.696 -35.697 -34.140  1.00 17.16 ? 305 PHE B CD1 1 
ATOM   4969  C  CD2 . PHE B  1 305 ? 25.826 -35.243 -36.483  1.00 16.78 ? 305 PHE B CD2 1 
ATOM   4970  C  CE1 . PHE B  1 305 ? 24.320 -35.561 -34.190  1.00 17.11 ? 305 PHE B CE1 1 
ATOM   4971  C  CE2 . PHE B  1 305 ? 24.449 -35.100 -36.535  1.00 17.56 ? 305 PHE B CE2 1 
ATOM   4972  C  CZ  . PHE B  1 305 ? 23.699 -35.263 -35.389  1.00 15.83 ? 305 PHE B CZ  1 
ATOM   4973  N  N   . LYS B  1 306 ? 30.622 -37.843 -35.017  1.00 14.71 ? 306 LYS B N   1 
ATOM   4974  C  CA  . LYS B  1 306 ? 32.073 -37.917 -35.121  1.00 18.44 ? 306 LYS B CA  1 
ATOM   4975  C  C   . LYS B  1 306 ? 32.594 -39.340 -35.318  1.00 17.18 ? 306 LYS B C   1 
ATOM   4976  O  O   . LYS B  1 306 ? 33.240 -39.618 -36.321  1.00 15.50 ? 306 LYS B O   1 
ATOM   4977  C  CB  . LYS B  1 306 ? 32.744 -37.257 -33.911  1.00 18.74 ? 306 LYS B CB  1 
ATOM   4978  C  CG  . LYS B  1 306 ? 32.493 -35.758 -33.819  1.00 20.67 ? 306 LYS B CG  1 
ATOM   4979  C  CD  . LYS B  1 306 ? 33.184 -35.158 -32.604  1.00 26.30 ? 306 LYS B CD  1 
ATOM   4980  C  CE  . LYS B  1 306 ? 32.803 -33.697 -32.431  1.00 32.77 ? 306 LYS B CE  1 
ATOM   4981  N  NZ  . LYS B  1 306 ? 33.642 -33.014 -31.406  1.00 34.88 ? 306 LYS B NZ  1 
ATOM   4982  N  N   . GLU B  1 307 ? 32.308 -40.230 -34.371  1.00 18.00 ? 307 GLU B N   1 
ATOM   4983  C  CA  . GLU B  1 307 ? 32.830 -41.603 -34.425  1.00 19.59 ? 307 GLU B CA  1 
ATOM   4984  C  C   . GLU B  1 307 ? 32.297 -42.425 -35.599  1.00 17.69 ? 307 GLU B C   1 
ATOM   4985  O  O   . GLU B  1 307 ? 33.051 -43.148 -36.253  1.00 19.07 ? 307 GLU B O   1 
ATOM   4986  C  CB  . GLU B  1 307 ? 32.572 -42.345 -33.105  1.00 22.64 ? 307 GLU B CB  1 
ATOM   4987  C  CG  . GLU B  1 307 ? 33.541 -41.971 -32.001  1.00 34.80 ? 307 GLU B CG  1 
ATOM   4988  C  CD  . GLU B  1 307 ? 34.991 -42.129 -32.424  1.00 37.34 ? 307 GLU B CD  1 
ATOM   4989  O  OE1 . GLU B  1 307 ? 35.763 -41.161 -32.260  1.00 52.77 ? 307 GLU B OE1 1 
ATOM   4990  O  OE2 . GLU B  1 307 ? 35.354 -43.213 -32.934  1.00 38.77 ? 307 GLU B OE2 1 
ATOM   4991  N  N   . ASN B  1 308 ? 30.999 -42.323 -35.872  1.00 15.77 ? 308 ASN B N   1 
ATOM   4992  C  CA  . ASN B  1 308 ? 30.418 -43.083 -36.976  1.00 15.88 ? 308 ASN B CA  1 
ATOM   4993  C  C   . ASN B  1 308 ? 30.962 -42.698 -38.363  1.00 15.42 ? 308 ASN B C   1 
ATOM   4994  O  O   . ASN B  1 308 ? 31.361 -43.560 -39.136  1.00 16.91 ? 308 ASN B O   1 
ATOM   4995  C  CB  . ASN B  1 308 ? 28.886 -43.074 -36.914  1.00 13.92 ? 308 ASN B CB  1 
ATOM   4996  C  CG  . ASN B  1 308 ? 28.358 -43.943 -35.785  1.00 16.57 ? 308 ASN B CG  1 
ATOM   4997  O  OD1 . ASN B  1 308 ? 29.119 -44.684 -35.170  1.00 16.33 ? 308 ASN B OD1 1 
ATOM   4998  N  ND2 . ASN B  1 308 ? 27.060 -43.853 -35.502  1.00 16.04 ? 308 ASN B ND2 1 
ATOM   4999  N  N   . PRO B  1 309 ? 30.978 -41.398 -38.681  1.00 16.02 ? 309 PRO B N   1 
ATOM   5000  C  CA  . PRO B  1 309 ? 31.643 -40.981 -39.917  1.00 15.59 ? 309 PRO B CA  1 
ATOM   5001  C  C   . PRO B  1 309 ? 33.108 -41.432 -39.978  1.00 16.25 ? 309 PRO B C   1 
ATOM   5002  O  O   . PRO B  1 309 ? 33.590 -41.832 -41.041  1.00 15.89 ? 309 PRO B O   1 
ATOM   5003  C  CB  . PRO B  1 309 ? 31.548 -39.456 -39.857  1.00 14.80 ? 309 PRO B CB  1 
ATOM   5004  C  CG  . PRO B  1 309 ? 30.272 -39.215 -39.107  1.00 16.60 ? 309 PRO B CG  1 
ATOM   5005  C  CD  . PRO B  1 309 ? 30.241 -40.289 -38.048  1.00 13.75 ? 309 PRO B CD  1 
ATOM   5006  N  N   . LYS B  1 310 ? 33.811 -41.374 -38.850  1.00 18.09 ? 310 LYS B N   1 
ATOM   5007  C  CA  . LYS B  1 310 ? 35.205 -41.812 -38.822  1.00 18.03 ? 310 LYS B CA  1 
ATOM   5008  C  C   . LYS B  1 310 ? 35.323 -43.296 -39.180  1.00 19.23 ? 310 LYS B C   1 
ATOM   5009  O  O   . LYS B  1 310 ? 36.130 -43.672 -40.028  1.00 18.02 ? 310 LYS B O   1 
ATOM   5010  C  CB  . LYS B  1 310 ? 35.843 -41.538 -37.457  1.00 18.27 ? 310 LYS B CB  1 
ATOM   5011  C  CG  . LYS B  1 310 ? 37.268 -42.057 -37.349  1.00 21.05 ? 310 LYS B CG  1 
ATOM   5012  C  CD  . LYS B  1 310 ? 37.810 -41.879 -35.943  1.00 25.67 ? 310 LYS B CD  1 
ATOM   5013  C  CE  . LYS B  1 310 ? 39.245 -42.357 -35.861  1.00 30.12 ? 310 LYS B CE  1 
ATOM   5014  N  NZ  . LYS B  1 310 ? 39.726 -42.297 -34.457  1.00 30.94 ? 310 LYS B NZ  1 
ATOM   5015  N  N   . LYS B  1 311 ? 34.501 -44.130 -38.547  1.00 17.36 ? 311 LYS B N   1 
ATOM   5016  C  CA  . LYS B  1 311 ? 34.492 -45.565 -38.824  1.00 20.86 ? 311 LYS B CA  1 
ATOM   5017  C  C   . LYS B  1 311 ? 34.169 -45.828 -40.284  1.00 19.75 ? 311 LYS B C   1 
ATOM   5018  O  O   . LYS B  1 311 ? 34.800 -46.651 -40.939  1.00 17.86 ? 311 LYS B O   1 
ATOM   5019  C  CB  . LYS B  1 311 ? 33.464 -46.284 -37.945  1.00 20.76 ? 311 LYS B CB  1 
ATOM   5020  C  CG  . LYS B  1 311 ? 33.824 -46.336 -36.470  1.00 27.54 ? 311 LYS B CG  1 
ATOM   5021  C  CD  . LYS B  1 311 ? 32.858 -47.220 -35.689  1.00 39.98 ? 311 LYS B CD  1 
ATOM   5022  C  CE  . LYS B  1 311 ? 31.458 -46.623 -35.658  1.00 44.79 ? 311 LYS B CE  1 
ATOM   5023  N  NZ  . LYS B  1 311 ? 30.489 -47.426 -34.856  1.00 38.45 ? 311 LYS B NZ  1 
ATOM   5024  N  N   . PHE B  1 312 ? 33.168 -45.114 -40.780  1.00 16.17 ? 312 PHE B N   1 
ATOM   5025  C  CA  . PHE B  1 312 ? 32.692 -45.252 -42.149  1.00 16.55 ? 312 PHE B CA  1 
ATOM   5026  C  C   . PHE B  1 312 ? 33.816 -45.020 -43.150  1.00 16.31 ? 312 PHE B C   1 
ATOM   5027  O  O   . PHE B  1 312 ? 33.894 -45.703 -44.167  1.00 17.86 ? 312 PHE B O   1 
ATOM   5028  C  CB  . PHE B  1 312 ? 31.575 -44.229 -42.360  1.00 15.87 ? 312 PHE B CB  1 
ATOM   5029  C  CG  . PHE B  1 312 ? 30.842 -44.358 -43.665  1.00 15.06 ? 312 PHE B CG  1 
ATOM   5030  C  CD1 . PHE B  1 312 ? 30.775 -43.281 -44.538  1.00 13.70 ? 312 PHE B CD1 1 
ATOM   5031  C  CD2 . PHE B  1 312 ? 30.181 -45.530 -44.003  1.00 16.12 ? 312 PHE B CD2 1 
ATOM   5032  C  CE1 . PHE B  1 312 ? 30.079 -43.371 -45.733  1.00 13.58 ? 312 PHE B CE1 1 
ATOM   5033  C  CE2 . PHE B  1 312 ? 29.481 -45.628 -45.199  1.00 15.19 ? 312 PHE B CE2 1 
ATOM   5034  C  CZ  . PHE B  1 312 ? 29.426 -44.548 -46.062  1.00 13.94 ? 312 PHE B CZ  1 
ATOM   5035  N  N   . PHE B  1 313 ? 34.688 -44.058 -42.858  1.00 16.39 ? 313 PHE B N   1 
ATOM   5036  C  CA  . PHE B  1 313 ? 35.775 -43.718 -43.766  1.00 19.15 ? 313 PHE B CA  1 
ATOM   5037  C  C   . PHE B  1 313 ? 37.116 -44.351 -43.387  1.00 22.05 ? 313 PHE B C   1 
ATOM   5038  O  O   . PHE B  1 313 ? 38.148 -43.975 -43.936  1.00 26.95 ? 313 PHE B O   1 
ATOM   5039  C  CB  . PHE B  1 313 ? 35.952 -42.199 -43.855  1.00 17.83 ? 313 PHE B CB  1 
ATOM   5040  C  CG  . PHE B  1 313 ? 34.922 -41.514 -44.705  1.00 17.62 ? 313 PHE B CG  1 
ATOM   5041  C  CD1 . PHE B  1 313 ? 33.906 -40.767 -44.121  1.00 16.28 ? 313 PHE B CD1 1 
ATOM   5042  C  CD2 . PHE B  1 313 ? 34.972 -41.608 -46.088  1.00 14.94 ? 313 PHE B CD2 1 
ATOM   5043  C  CE1 . PHE B  1 313 ? 32.958 -40.131 -44.899  1.00 16.60 ? 313 PHE B CE1 1 
ATOM   5044  C  CE2 . PHE B  1 313 ? 34.022 -40.973 -46.871  1.00 17.26 ? 313 PHE B CE2 1 
ATOM   5045  C  CZ  . PHE B  1 313 ? 33.015 -40.236 -46.276  1.00 15.63 ? 313 PHE B CZ  1 
ATOM   5046  N  N   . SER B  1 314 ? 37.123 -45.292 -42.450  1.00 22.76 ? 314 SER B N   1 
ATOM   5047  C  CA  A SER B  1 314 ? 38.389 -45.903 -42.046  0.50 28.14 ? 314 SER B CA  1 
ATOM   5048  C  CA  B SER B  1 314 ? 38.368 -45.921 -42.006  0.50 25.73 ? 314 SER B CA  1 
ATOM   5049  C  C   . SER B  1 314 ? 38.497 -47.352 -42.519  1.00 35.95 ? 314 SER B C   1 
ATOM   5050  O  O   . SER B  1 314 ? 37.814 -47.761 -43.459  1.00 34.30 ? 314 SER B O   1 
ATOM   5051  C  CB  A SER B  1 314 ? 38.597 -45.805 -40.531  0.50 26.10 ? 314 SER B CB  1 
ATOM   5052  C  CB  B SER B  1 314 ? 38.470 -45.914 -40.480  0.50 21.86 ? 314 SER B CB  1 
ATOM   5053  O  OG  A SER B  1 314 ? 37.643 -46.576 -39.827  0.50 30.75 ? 314 SER B OG  1 
ATOM   5054  O  OG  B SER B  1 314 ? 38.515 -44.594 -39.980  0.50 18.17 ? 314 SER B OG  1 
ATOM   5055  O  OXT A SER B  1 314 ? 39.269 -48.141 -41.975  0.50 45.29 ? 314 SER B OXT 1 
ATOM   5056  O  OXT B SER B  1 314 ? 39.296 -48.135 -42.005  0.50 44.07 ? 314 SER B OXT 1 
ATOM   5057  N  N   . MET C  1 1   ? 70.883 -12.566 -27.542  1.00 54.82 ? 1   MET C N   1 
ATOM   5058  C  CA  . MET C  1 1   ? 69.944 -11.930 -26.575  1.00 49.92 ? 1   MET C CA  1 
ATOM   5059  C  C   . MET C  1 1   ? 68.574 -12.612 -26.553  1.00 56.41 ? 1   MET C C   1 
ATOM   5060  O  O   . MET C  1 1   ? 67.549 -11.952 -26.714  1.00 55.70 ? 1   MET C O   1 
ATOM   5061  C  CB  . MET C  1 1   ? 69.789 -10.444 -26.895  1.00 69.69 ? 1   MET C CB  1 
ATOM   5062  C  CG  . MET C  1 1   ? 69.615 -10.154 -28.376  1.00 77.36 ? 1   MET C CG  1 
ATOM   5063  S  SD  . MET C  1 1   ? 70.802 -11.078 -29.373  1.00 82.84 ? 1   MET C SD  1 
ATOM   5064  C  CE  . MET C  1 1   ? 70.655 -10.243 -30.953  1.00 68.16 ? 1   MET C CE  1 
ATOM   5065  N  N   . ARG C  1 2   ? 68.563 -13.932 -26.357  1.00 39.74 ? 2   ARG C N   1 
ATOM   5066  C  CA  A ARG C  1 2   ? 67.318 -14.701 -26.277  0.50 37.29 ? 2   ARG C CA  1 
ATOM   5067  C  CA  B ARG C  1 2   ? 67.316 -14.681 -26.241  0.50 37.38 ? 2   ARG C CA  1 
ATOM   5068  C  C   . ARG C  1 2   ? 67.513 -16.030 -25.544  1.00 31.96 ? 2   ARG C C   1 
ATOM   5069  O  O   . ARG C  1 2   ? 66.996 -16.226 -24.446  1.00 31.88 ? 2   ARG C O   1 
ATOM   5070  C  CB  A ARG C  1 2   ? 66.728 -14.943 -27.669  0.50 40.63 ? 2   ARG C CB  1 
ATOM   5071  C  CB  B ARG C  1 2   ? 66.640 -14.859 -27.600  0.50 40.71 ? 2   ARG C CB  1 
ATOM   5072  C  CG  A ARG C  1 2   ? 65.388 -14.263 -27.897  0.50 44.35 ? 2   ARG C CG  1 
ATOM   5073  C  CG  B ARG C  1 2   ? 65.237 -15.432 -27.498  0.50 46.85 ? 2   ARG C CG  1 
ATOM   5074  C  CD  A ARG C  1 2   ? 64.263 -15.072 -27.272  0.50 54.53 ? 2   ARG C CD  1 
ATOM   5075  C  CD  B ARG C  1 2   ? 64.411 -15.079 -28.719  0.50 46.34 ? 2   ARG C CD  1 
ATOM   5076  N  NE  A ARG C  1 2   ? 63.062 -14.275 -27.040  0.50 53.08 ? 2   ARG C NE  1 
ATOM   5077  N  NE  B ARG C  1 2   ? 65.168 -15.262 -29.950  0.50 47.37 ? 2   ARG C NE  1 
ATOM   5078  C  CZ  A ARG C  1 2   ? 62.712 -13.788 -25.855  0.50 50.24 ? 2   ARG C CZ  1 
ATOM   5079  C  CZ  B ARG C  1 2   ? 64.651 -15.121 -31.165  0.50 57.97 ? 2   ARG C CZ  1 
ATOM   5080  N  NH1 A ARG C  1 2   ? 63.471 -14.019 -24.794  0.50 49.70 ? 2   ARG C NH1 1 
ATOM   5081  N  NH1 B ARG C  1 2   ? 65.413 -15.303 -32.234  0.50 62.87 ? 2   ARG C NH1 1 
ATOM   5082  N  NH2 A ARG C  1 2   ? 61.603 -13.074 -25.728  0.50 58.28 ? 2   ARG C NH2 1 
ATOM   5083  N  NH2 B ARG C  1 2   ? 63.372 -14.801 -31.312  0.50 53.99 ? 2   ARG C NH2 1 
ATOM   5084  N  N   . ILE C  1 3   ? 68.256 -16.946 -26.164  1.00 25.25 ? 3   ILE C N   1 
ATOM   5085  C  CA  . ILE C  1 3   ? 68.590 -18.221 -25.511  1.00 19.76 ? 3   ILE C CA  1 
ATOM   5086  C  C   . ILE C  1 3   ? 69.913 -18.116 -24.747  1.00 21.50 ? 3   ILE C C   1 
ATOM   5087  O  O   . ILE C  1 3   ? 70.972 -17.895 -25.346  1.00 22.37 ? 3   ILE C O   1 
ATOM   5088  C  CB  . ILE C  1 3   ? 68.712 -19.390 -26.509  1.00 22.78 ? 3   ILE C CB  1 
ATOM   5089  C  CG1 . ILE C  1 3   ? 67.481 -19.489 -27.403  1.00 21.85 ? 3   ILE C CG1 1 
ATOM   5090  C  CG2 . ILE C  1 3   ? 68.919 -20.705 -25.767  1.00 20.00 ? 3   ILE C CG2 1 
ATOM   5091  C  CD1 . ILE C  1 3   ? 67.686 -20.429 -28.570  1.00 25.82 ? 3   ILE C CD1 1 
ATOM   5092  N  N   . PRO C  1 4   ? 69.863 -18.288 -23.420  1.00 21.16 ? 4   PRO C N   1 
ATOM   5093  C  CA  . PRO C  1 4   ? 71.093 -18.254 -22.641  1.00 22.09 ? 4   PRO C CA  1 
ATOM   5094  C  C   . PRO C  1 4   ? 71.911 -19.514 -22.916  1.00 21.48 ? 4   PRO C C   1 
ATOM   5095  O  O   . PRO C  1 4   ? 71.343 -20.582 -23.148  1.00 18.60 ? 4   PRO C O   1 
ATOM   5096  C  CB  . PRO C  1 4   ? 70.592 -18.252 -21.198  1.00 22.03 ? 4   PRO C CB  1 
ATOM   5097  C  CG  . PRO C  1 4   ? 69.279 -18.967 -21.256  1.00 19.88 ? 4   PRO C CG  1 
ATOM   5098  C  CD  . PRO C  1 4   ? 68.689 -18.653 -22.605  1.00 20.75 ? 4   PRO C CD  1 
ATOM   5099  N  N   . LEU C  1 5   ? 73.233 -19.370 -22.913  1.00 19.47 ? 5   LEU C N   1 
ATOM   5100  C  CA  . LEU C  1 5   ? 74.133 -20.484 -23.141  1.00 19.32 ? 5   LEU C CA  1 
ATOM   5101  C  C   . LEU C  1 5   ? 75.089 -20.599 -21.964  1.00 22.45 ? 5   LEU C C   1 
ATOM   5102  O  O   . LEU C  1 5   ? 75.438 -19.594 -21.340  1.00 27.40 ? 5   LEU C O   1 
ATOM   5103  C  CB  . LEU C  1 5   ? 74.927 -20.278 -24.430  1.00 19.32 ? 5   LEU C CB  1 
ATOM   5104  C  CG  . LEU C  1 5   ? 74.143 -20.271 -25.741  1.00 21.15 ? 5   LEU C CG  1 
ATOM   5105  C  CD1 . LEU C  1 5   ? 75.069 -20.057 -26.929  1.00 19.05 ? 5   LEU C CD1 1 
ATOM   5106  C  CD2 . LEU C  1 5   ? 73.358 -21.567 -25.889  1.00 17.24 ? 5   LEU C CD2 1 
ATOM   5107  N  N   . VAL C  1 6   ? 75.514 -21.819 -21.660  1.00 18.33 ? 6   VAL C N   1 
ATOM   5108  C  CA  . VAL C  1 6   ? 76.481 -22.025 -20.598  1.00 17.78 ? 6   VAL C CA  1 
ATOM   5109  C  C   . VAL C  1 6   ? 77.825 -21.446 -21.033  1.00 20.04 ? 6   VAL C C   1 
ATOM   5110  O  O   . VAL C  1 6   ? 78.331 -21.793 -22.096  1.00 22.10 ? 6   VAL C O   1 
ATOM   5111  C  CB  . VAL C  1 6   ? 76.639 -23.520 -20.265  1.00 17.79 ? 6   VAL C CB  1 
ATOM   5112  C  CG1 . VAL C  1 6   ? 77.610 -23.710 -19.112  1.00 18.51 ? 6   VAL C CG1 1 
ATOM   5113  C  CG2 . VAL C  1 6   ? 75.281 -24.127 -19.924  1.00 16.43 ? 6   VAL C CG2 1 
ATOM   5114  N  N   . GLY C  1 7   ? 78.387 -20.555 -20.219  1.00 18.91 ? 7   GLY C N   1 
ATOM   5115  C  CA  . GLY C  1 7   ? 79.714 -19.995 -20.491  1.00 21.32 ? 7   GLY C CA  1 
ATOM   5116  C  C   . GLY C  1 7   ? 79.843 -19.143 -21.744  1.00 25.28 ? 7   GLY C C   1 
ATOM   5117  O  O   . GLY C  1 7   ? 80.949 -18.918 -22.233  1.00 25.28 ? 7   GLY C O   1 
ATOM   5118  N  N   . LYS C  1 8   ? 78.719 -18.661 -22.268  1.00 24.10 ? 8   LYS C N   1 
ATOM   5119  C  CA  . LYS C  1 8   ? 78.739 -17.819 -23.463  1.00 25.46 ? 8   LYS C CA  1 
ATOM   5120  C  C   . LYS C  1 8   ? 77.668 -16.747 -23.375  1.00 23.81 ? 8   LYS C C   1 
ATOM   5121  O  O   . LYS C  1 8   ? 76.732 -16.863 -22.582  1.00 25.05 ? 8   LYS C O   1 
ATOM   5122  C  CB  . LYS C  1 8   ? 78.473 -18.657 -24.716  1.00 26.51 ? 8   LYS C CB  1 
ATOM   5123  C  CG  . LYS C  1 8   ? 79.543 -19.671 -25.074  1.00 27.16 ? 8   LYS C CG  1 
ATOM   5124  C  CD  . LYS C  1 8   ? 79.231 -20.247 -26.445  1.00 27.71 ? 8   LYS C CD  1 
ATOM   5125  C  CE  . LYS C  1 8   ? 80.256 -21.264 -26.907  1.00 24.94 ? 8   LYS C CE  1 
ATOM   5126  N  NZ  . LYS C  1 8   ? 79.876 -21.796 -28.248  1.00 22.15 ? 8   LYS C NZ  1 
ATOM   5127  N  N   . ASP C  1 9   ? 77.800 -15.711 -24.200  1.00 26.20 ? 9   ASP C N   1 
ATOM   5128  C  CA  . ASP C  1 9   ? 76.725 -14.737 -24.397  1.00 26.54 ? 9   ASP C CA  1 
ATOM   5129  C  C   . ASP C  1 9   ? 75.508 -15.444 -24.976  1.00 26.07 ? 9   ASP C C   1 
ATOM   5130  O  O   . ASP C  1 9   ? 75.653 -16.387 -25.758  1.00 27.56 ? 9   ASP C O   1 
ATOM   5131  C  CB  . ASP C  1 9   ? 77.164 -13.648 -25.379  1.00 30.47 ? 9   ASP C CB  1 
ATOM   5132  C  CG  . ASP C  1 9   ? 78.148 -12.671 -24.770  1.00 35.38 ? 9   ASP C CG  1 
ATOM   5133  O  OD1 . ASP C  1 9   ? 78.866 -11.992 -25.537  1.00 45.03 ? 9   ASP C OD1 1 
ATOM   5134  O  OD2 . ASP C  1 9   ? 78.203 -12.582 -23.527  1.00 38.05 ? 9   ASP C OD2 1 
ATOM   5135  N  N   . SER C  1 10  ? 74.314 -14.985 -24.608  1.00 23.87 ? 10  SER C N   1 
ATOM   5136  C  CA  . SER C  1 10  ? 73.086 -15.578 -25.119  1.00 23.46 ? 10  SER C CA  1 
ATOM   5137  C  C   . SER C  1 10  ? 72.989 -15.354 -26.624  1.00 27.27 ? 10  SER C C   1 
ATOM   5138  O  O   . SER C  1 10  ? 73.641 -14.458 -27.159  1.00 27.76 ? 10  SER C O   1 
ATOM   5139  C  CB  . SER C  1 10  ? 71.863 -15.006 -24.390  1.00 24.05 ? 10  SER C CB  1 
ATOM   5140  O  OG  . SER C  1 10  ? 71.777 -13.600 -24.554  1.00 35.23 ? 10  SER C OG  1 
ATOM   5141  N  N   . ILE C  1 11  ? 72.197 -16.176 -27.308  1.00 24.16 ? 11  ILE C N   1 
ATOM   5142  C  CA  . ILE C  1 11  ? 72.075 -16.080 -28.758  1.00 26.77 ? 11  ILE C CA  1 
ATOM   5143  C  C   . ILE C  1 11  ? 70.631 -15.938 -29.214  1.00 28.70 ? 11  ILE C C   1 
ATOM   5144  O  O   . ILE C  1 11  ? 69.701 -16.315 -28.505  1.00 27.50 ? 11  ILE C O   1 
ATOM   5145  C  CB  . ILE C  1 11  ? 72.680 -17.306 -29.483  1.00 27.93 ? 11  ILE C CB  1 
ATOM   5146  C  CG1 . ILE C  1 11  ? 72.078 -18.606 -28.937  1.00 29.87 ? 11  ILE C CG1 1 
ATOM   5147  C  CG2 . ILE C  1 11  ? 74.199 -17.303 -29.374  1.00 29.76 ? 11  ILE C CG2 1 
ATOM   5148  C  CD1 . ILE C  1 11  ? 72.345 -19.817 -29.810  1.00 31.72 ? 11  ILE C CD1 1 
ATOM   5149  N  N   . GLU C  1 12  ? 70.454 -15.399 -30.413  1.00 27.72 ? 12  GLU C N   1 
ATOM   5150  C  CA  . GLU C  1 12  ? 69.154 -15.403 -31.061  1.00 29.84 ? 12  GLU C CA  1 
ATOM   5151  C  C   . GLU C  1 12  ? 68.804 -16.831 -31.453  1.00 29.13 ? 12  GLU C C   1 
ATOM   5152  O  O   . GLU C  1 12  ? 69.677 -17.616 -31.826  1.00 26.12 ? 12  GLU C O   1 
ATOM   5153  C  CB  . GLU C  1 12  ? 69.187 -14.532 -32.314  1.00 31.52 ? 12  GLU C CB  1 
ATOM   5154  C  CG  . GLU C  1 12  ? 69.689 -13.121 -32.077  1.00 47.35 ? 12  GLU C CG  1 
ATOM   5155  C  CD  . GLU C  1 12  ? 68.572 -12.165 -31.726  1.00 51.76 ? 12  GLU C CD  1 
ATOM   5156  O  OE1 . GLU C  1 12  ? 68.641 -10.994 -32.151  1.00 64.44 ? 12  GLU C OE1 1 
ATOM   5157  O  OE2 . GLU C  1 12  ? 67.620 -12.591 -31.038  1.00 58.29 ? 12  GLU C OE2 1 
ATOM   5158  N  N   . SER C  1 13  ? 67.522 -17.165 -31.382  1.00 27.23 ? 13  SER C N   1 
ATOM   5159  C  CA  . SER C  1 13  ? 67.070 -18.496 -31.750  1.00 27.38 ? 13  SER C CA  1 
ATOM   5160  C  C   . SER C  1 13  ? 67.419 -18.823 -33.203  1.00 27.99 ? 13  SER C C   1 
ATOM   5161  O  O   . SER C  1 13  ? 67.719 -19.967 -33.533  1.00 25.66 ? 13  SER C O   1 
ATOM   5162  C  CB  . SER C  1 13  ? 65.563 -18.624 -31.523  1.00 31.75 ? 13  SER C CB  1 
ATOM   5163  O  OG  . SER C  1 13  ? 64.854 -17.733 -32.367  1.00 36.90 ? 13  SER C OG  1 
ATOM   5164  N  N   . LYS C  1 14  ? 67.391 -17.817 -34.073  1.00 24.54 ? 14  LYS C N   1 
ATOM   5165  C  CA  . LYS C  1 14  ? 67.697 -18.051 -35.479  1.00 29.83 ? 14  LYS C CA  1 
ATOM   5166  C  C   . LYS C  1 14  ? 69.143 -18.514 -35.652  1.00 28.06 ? 14  LYS C C   1 
ATOM   5167  O  O   . LYS C  1 14  ? 69.530 -18.979 -36.720  1.00 29.89 ? 14  LYS C O   1 
ATOM   5168  C  CB  . LYS C  1 14  ? 67.417 -16.799 -36.322  1.00 29.94 ? 14  LYS C CB  1 
ATOM   5169  C  CG  . LYS C  1 14  ? 68.426 -15.677 -36.143  1.00 34.58 ? 14  LYS C CG  1 
ATOM   5170  C  CD  . LYS C  1 14  ? 67.952 -14.401 -36.826  1.00 40.19 ? 14  LYS C CD  1 
ATOM   5171  C  CE  . LYS C  1 14  ? 69.108 -13.452 -37.106  1.00 43.97 ? 14  LYS C CE  1 
ATOM   5172  N  NZ  . LYS C  1 14  ? 69.911 -13.154 -35.888  1.00 41.26 ? 14  LYS C NZ  1 
ATOM   5173  N  N   . ASP C  1 15  ? 69.933 -18.407 -34.588  1.00 26.87 ? 15  ASP C N   1 
ATOM   5174  C  CA  . ASP C  1 15  ? 71.350 -18.766 -34.648  1.00 25.50 ? 15  ASP C CA  1 
ATOM   5175  C  C   . ASP C  1 15  ? 71.698 -20.081 -33.939  1.00 23.42 ? 15  ASP C C   1 
ATOM   5176  O  O   . ASP C  1 15  ? 72.872 -20.391 -33.771  1.00 25.69 ? 15  ASP C O   1 
ATOM   5177  C  CB  . ASP C  1 15  ? 72.201 -17.634 -34.066  1.00 25.90 ? 15  ASP C CB  1 
ATOM   5178  C  CG  . ASP C  1 15  ? 72.279 -16.431 -34.987  1.00 31.56 ? 15  ASP C CG  1 
ATOM   5179  O  OD1 . ASP C  1 15  ? 72.256 -16.620 -36.219  1.00 32.56 ? 15  ASP C OD1 1 
ATOM   5180  O  OD2 . ASP C  1 15  ? 72.367 -15.296 -34.481  1.00 32.29 ? 15  ASP C OD2 1 
ATOM   5181  N  N   . ILE C  1 16  ? 70.687 -20.845 -33.523  1.00 24.19 ? 16  ILE C N   1 
ATOM   5182  C  CA  A ILE C  1 16  ? 70.921 -22.112 -32.820  0.50 23.56 ? 16  ILE C CA  1 
ATOM   5183  C  CA  B ILE C  1 16  ? 70.908 -22.112 -32.820  0.50 22.58 ? 16  ILE C CA  1 
ATOM   5184  C  C   . ILE C  1 16  ? 71.539 -23.179 -33.720  1.00 21.50 ? 16  ILE C C   1 
ATOM   5185  O  O   . ILE C  1 16  ? 72.305 -24.023 -33.258  1.00 22.57 ? 16  ILE C O   1 
ATOM   5186  C  CB  A ILE C  1 16  ? 69.637 -22.664 -32.160  0.50 23.87 ? 16  ILE C CB  1 
ATOM   5187  C  CB  B ILE C  1 16  ? 69.594 -22.647 -32.211  0.50 21.64 ? 16  ILE C CB  1 
ATOM   5188  C  CG1 A ILE C  1 16  ? 68.521 -22.849 -33.191  0.50 27.82 ? 16  ILE C CG1 1 
ATOM   5189  C  CG1 B ILE C  1 16  ? 69.868 -23.805 -31.255  0.50 21.25 ? 16  ILE C CG1 1 
ATOM   5190  C  CG2 A ILE C  1 16  ? 69.179 -21.743 -31.042  0.50 26.36 ? 16  ILE C CG2 1 
ATOM   5191  C  CG2 B ILE C  1 16  ? 68.627 -23.071 -33.303  0.50 25.78 ? 16  ILE C CG2 1 
ATOM   5192  C  CD1 A ILE C  1 16  ? 68.620 -24.123 -34.005  0.50 27.80 ? 16  ILE C CD1 1 
ATOM   5193  C  CD1 B ILE C  1 16  ? 68.645 -24.235 -30.477  0.50 19.41 ? 16  ILE C CD1 1 
ATOM   5194  N  N   . GLY C  1 17  ? 71.213 -23.142 -35.007  1.00 19.81 ? 17  GLY C N   1 
ATOM   5195  C  CA  . GLY C  1 17  ? 71.774 -24.105 -35.957  1.00 21.65 ? 17  GLY C CA  1 
ATOM   5196  C  C   . GLY C  1 17  ? 71.353 -25.543 -35.692  1.00 22.75 ? 17  GLY C C   1 
ATOM   5197  O  O   . GLY C  1 17  ? 70.337 -25.800 -35.035  1.00 20.32 ? 17  GLY C O   1 
ATOM   5198  N  N   . PHE C  1 18  ? 72.136 -26.488 -36.200  1.00 18.38 ? 18  PHE C N   1 
ATOM   5199  C  CA  . PHE C  1 18  ? 71.814 -27.900 -36.043  1.00 19.18 ? 18  PHE C CA  1 
ATOM   5200  C  C   . PHE C  1 18  ? 71.883 -28.264 -34.564  1.00 20.18 ? 18  PHE C C   1 
ATOM   5201  O  O   . PHE C  1 18  ? 72.922 -28.084 -33.916  1.00 17.43 ? 18  PHE C O   1 
ATOM   5202  C  CB  . PHE C  1 18  ? 72.776 -28.763 -36.859  1.00 20.07 ? 18  PHE C CB  1 
ATOM   5203  C  CG  . PHE C  1 18  ? 72.335 -30.189 -37.005  1.00 18.51 ? 18  PHE C CG  1 
ATOM   5204  C  CD1 . PHE C  1 18  ? 71.927 -30.674 -38.234  1.00 19.11 ? 18  PHE C CD1 1 
ATOM   5205  C  CD2 . PHE C  1 18  ? 72.330 -31.045 -35.912  1.00 17.26 ? 18  PHE C CD2 1 
ATOM   5206  C  CE1 . PHE C  1 18  ? 71.528 -31.990 -38.377  1.00 21.24 ? 18  PHE C CE1 1 
ATOM   5207  C  CE2 . PHE C  1 18  ? 71.930 -32.358 -36.045  1.00 16.80 ? 18  PHE C CE2 1 
ATOM   5208  C  CZ  . PHE C  1 18  ? 71.529 -32.832 -37.280  1.00 19.58 ? 18  PHE C CZ  1 
ATOM   5209  N  N   . THR C  1 19  ? 70.774 -28.779 -34.039  1.00 17.61 ? 19  THR C N   1 
ATOM   5210  C  CA  . THR C  1 19  ? 70.624 -28.955 -32.600  1.00 16.20 ? 19  THR C CA  1 
ATOM   5211  C  C   . THR C  1 19  ? 70.299 -30.393 -32.220  1.00 18.24 ? 19  THR C C   1 
ATOM   5212  O  O   . THR C  1 19  ? 69.516 -31.064 -32.899  1.00 17.16 ? 19  THR C O   1 
ATOM   5213  C  CB  . THR C  1 19  ? 69.498 -28.052 -32.052  1.00 16.33 ? 19  THR C CB  1 
ATOM   5214  O  OG1 . THR C  1 19  ? 69.778 -26.683 -32.366  1.00 18.33 ? 19  THR C OG1 1 
ATOM   5215  C  CG2 . THR C  1 19  ? 69.373 -28.196 -30.542  1.00 17.27 ? 19  THR C CG2 1 
ATOM   5216  N  N   . LEU C  1 20  ? 70.914 -30.860 -31.135  1.00 17.45 ? 20  LEU C N   1 
ATOM   5217  C  CA  . LEU C  1 20  ? 70.474 -32.077 -30.471  1.00 14.26 ? 20  LEU C CA  1 
ATOM   5218  C  C   . LEU C  1 20  ? 69.705 -31.627 -29.237  1.00 16.81 ? 20  LEU C C   1 
ATOM   5219  O  O   . LEU C  1 20  ? 70.277 -31.045 -28.317  1.00 14.16 ? 20  LEU C O   1 
ATOM   5220  C  CB  . LEU C  1 20  ? 71.662 -32.956 -30.072  1.00 15.28 ? 20  LEU C CB  1 
ATOM   5221  C  CG  . LEU C  1 20  ? 72.473 -33.600 -31.198  1.00 17.61 ? 20  LEU C CG  1 
ATOM   5222  C  CD1 . LEU C  1 20  ? 73.615 -34.419 -30.607  1.00 16.35 ? 20  LEU C CD1 1 
ATOM   5223  C  CD2 . LEU C  1 20  ? 71.582 -34.473 -32.068  1.00 16.90 ? 20  LEU C CD2 1 
ATOM   5224  N  N   . ILE C  1 21  ? 68.405 -31.899 -29.230  1.00 14.55 ? 21  ILE C N   1 
ATOM   5225  C  CA  . ILE C  1 21  ? 67.497 -31.297 -28.257  1.00 15.63 ? 21  ILE C CA  1 
ATOM   5226  C  C   . ILE C  1 21  ? 67.461 -31.988 -26.884  1.00 14.61 ? 21  ILE C C   1 
ATOM   5227  O  O   . ILE C  1 21  ? 66.882 -31.456 -25.937  1.00 15.49 ? 21  ILE C O   1 
ATOM   5228  C  CB  . ILE C  1 21  ? 66.067 -31.264 -28.825  1.00 16.59 ? 21  ILE C CB  1 
ATOM   5229  C  CG1 . ILE C  1 21  ? 65.196 -30.274 -28.046  1.00 18.17 ? 21  ILE C CG1 1 
ATOM   5230  C  CG2 . ILE C  1 21  ? 65.476 -32.667 -28.846  1.00 15.99 ? 21  ILE C CG2 1 
ATOM   5231  C  CD1 . ILE C  1 21  ? 65.368 -28.842 -28.507  1.00 21.50 ? 21  ILE C CD1 1 
ATOM   5232  N  N   . HIS C  1 22  ? 68.054 -33.172 -26.768  1.00 13.22 ? 22  HIS C N   1 
ATOM   5233  C  CA  . HIS C  1 22  ? 67.954 -33.921 -25.508  1.00 13.58 ? 22  HIS C CA  1 
ATOM   5234  C  C   . HIS C  1 22  ? 69.118 -34.859 -25.370  1.00 15.79 ? 22  HIS C C   1 
ATOM   5235  O  O   . HIS C  1 22  ? 69.061 -36.000 -25.828  1.00 14.20 ? 22  HIS C O   1 
ATOM   5236  C  CB  . HIS C  1 22  ? 66.628 -34.691 -25.427  1.00 12.62 ? 22  HIS C CB  1 
ATOM   5237  C  CG  . HIS C  1 22  ? 66.335 -35.289 -24.058  1.00 13.52 ? 22  HIS C CG  1 
ATOM   5238  N  ND1 . HIS C  1 22  ? 65.128 -35.185 -23.469  1.00 14.32 ? 22  HIS C ND1 1 
ATOM   5239  C  CD2 . HIS C  1 22  ? 67.149 -36.000 -23.166  1.00 12.82 ? 22  HIS C CD2 1 
ATOM   5240  C  CE1 . HIS C  1 22  ? 65.156 -35.807 -22.262  1.00 15.18 ? 22  HIS C CE1 1 
ATOM   5241  N  NE2 . HIS C  1 22  ? 66.393 -36.309 -22.076  1.00 14.08 ? 22  HIS C NE2 1 
ATOM   5242  N  N   . GLU C  1 23  ? 70.195 -34.365 -24.761  1.00 14.24 ? 23  GLU C N   1 
ATOM   5243  C  CA  . GLU C  1 23  ? 71.383 -35.170 -24.468  1.00 14.98 ? 23  GLU C CA  1 
ATOM   5244  C  C   . GLU C  1 23  ? 71.870 -34.790 -23.064  1.00 15.38 ? 23  GLU C C   1 
ATOM   5245  O  O   . GLU C  1 23  ? 71.608 -33.682 -22.602  1.00 16.81 ? 23  GLU C O   1 
ATOM   5246  C  CB  . GLU C  1 23  ? 72.505 -34.885 -25.478  1.00 13.22 ? 23  GLU C CB  1 
ATOM   5247  C  CG  . GLU C  1 23  ? 72.119 -34.964 -26.954  1.00 13.82 ? 23  GLU C CG  1 
ATOM   5248  C  CD  . GLU C  1 23  ? 71.711 -36.363 -27.402  1.00 15.49 ? 23  GLU C CD  1 
ATOM   5249  O  OE1 . GLU C  1 23  ? 71.038 -36.478 -28.448  1.00 17.19 ? 23  GLU C OE1 1 
ATOM   5250  O  OE2 . GLU C  1 23  ? 72.062 -37.355 -26.724  1.00 16.74 ? 23  GLU C OE2 1 
ATOM   5251  N  N   . HIS C  1 24  ? 72.589 -35.689 -22.396  1.00 14.03 ? 24  HIS C N   1 
ATOM   5252  C  CA  . HIS C  1 24  ? 73.074 -35.416 -21.039  1.00 14.23 ? 24  HIS C CA  1 
ATOM   5253  C  C   . HIS C  1 24  ? 74.571 -35.537 -20.995  1.00 14.61 ? 24  HIS C C   1 
ATOM   5254  O  O   . HIS C  1 24  ? 75.121 -36.590 -21.319  1.00 14.91 ? 24  HIS C O   1 
ATOM   5255  C  CB  . HIS C  1 24  ? 72.477 -36.401 -20.020  1.00 13.76 ? 24  HIS C CB  1 
ATOM   5256  C  CG  . HIS C  1 24  ? 70.960 -36.356 -19.904  1.00 14.48 ? 24  HIS C CG  1 
ATOM   5257  N  ND1 . HIS C  1 24  ? 70.321 -35.542 -19.035  1.00 14.23 ? 24  HIS C ND1 1 
ATOM   5258  C  CD2 . HIS C  1 24  ? 69.965 -37.091 -20.558  1.00 13.85 ? 24  HIS C CD2 1 
ATOM   5259  C  CE1 . HIS C  1 24  ? 68.984 -35.729 -19.141  1.00 13.14 ? 24  HIS C CE1 1 
ATOM   5260  N  NE2 . HIS C  1 24  ? 68.765 -36.676 -20.076  1.00 14.46 ? 24  HIS C NE2 1 
ATOM   5261  N  N   . LEU C  1 25  ? 75.258 -34.483 -20.568  1.00 16.02 ? 25  LEU C N   1 
ATOM   5262  C  CA  . LEU C  1 25  ? 76.706 -34.578 -20.376  1.00 15.53 ? 25  LEU C CA  1 
ATOM   5263  C  C   . LEU C  1 25  ? 77.052 -35.552 -19.253  1.00 18.52 ? 25  LEU C C   1 
ATOM   5264  O  O   . LEU C  1 25  ? 78.014 -36.328 -19.352  1.00 16.11 ? 25  LEU C O   1 
ATOM   5265  C  CB  . LEU C  1 25  ? 77.306 -33.208 -20.070  1.00 16.98 ? 25  LEU C CB  1 
ATOM   5266  C  CG  . LEU C  1 25  ? 77.121 -32.145 -21.146  1.00 17.53 ? 25  LEU C CG  1 
ATOM   5267  C  CD1 . LEU C  1 25  ? 77.894 -30.892 -20.763  1.00 19.03 ? 25  LEU C CD1 1 
ATOM   5268  C  CD2 . LEU C  1 25  ? 77.587 -32.684 -22.490  1.00 17.84 ? 25  LEU C CD2 1 
ATOM   5269  N  N   . ARG C  1 26  ? 76.258 -35.514 -18.187  1.00 15.34 ? 26  ARG C N   1 
ATOM   5270  C  CA  . ARG C  1 26  ? 76.471 -36.389 -17.035  1.00 17.85 ? 26  ARG C CA  1 
ATOM   5271  C  C   . ARG C  1 26  ? 75.193 -36.469 -16.197  1.00 18.36 ? 26  ARG C C   1 
ATOM   5272  O  O   . ARG C  1 26  ? 74.522 -35.460 -15.966  1.00 19.12 ? 26  ARG C O   1 
ATOM   5273  C  CB  . ARG C  1 26  ? 77.629 -35.875 -16.167  1.00 15.92 ? 26  ARG C CB  1 
ATOM   5274  C  CG  . ARG C  1 26  ? 77.932 -36.762 -14.960  1.00 19.09 ? 26  ARG C CG  1 
ATOM   5275  C  CD  . ARG C  1 26  ? 79.035 -36.176 -14.088  1.00 19.25 ? 26  ARG C CD  1 
ATOM   5276  N  NE  . ARG C  1 26  ? 78.686 -34.856 -13.575  1.00 17.03 ? 26  ARG C NE  1 
ATOM   5277  C  CZ  . ARG C  1 26  ? 79.482 -34.119 -12.807  1.00 20.62 ? 26  ARG C CZ  1 
ATOM   5278  N  NH1 . ARG C  1 26  ? 80.674 -34.574 -12.449  1.00 18.45 ? 26  ARG C NH1 1 
ATOM   5279  N  NH2 . ARG C  1 26  ? 79.078 -32.930 -12.386  1.00 18.46 ? 26  ARG C NH2 1 
ATOM   5280  N  N   . VAL C  1 27  ? 74.860 -37.674 -15.751  1.00 18.32 ? 27  VAL C N   1 
ATOM   5281  C  CA  . VAL C  1 27  ? 73.700 -37.884 -14.897  1.00 15.41 ? 27  VAL C CA  1 
ATOM   5282  C  C   . VAL C  1 27  ? 74.129 -38.609 -13.620  1.00 18.76 ? 27  VAL C C   1 
ATOM   5283  O  O   . VAL C  1 27  ? 74.874 -39.585 -13.676  1.00 13.57 ? 27  VAL C O   1 
ATOM   5284  C  CB  . VAL C  1 27  ? 72.611 -38.693 -15.633  1.00 18.22 ? 27  VAL C CB  1 
ATOM   5285  C  CG1 . VAL C  1 27  ? 71.589 -39.256 -14.653  1.00 16.33 ? 27  VAL C CG1 1 
ATOM   5286  C  CG2 . VAL C  1 27  ? 71.914 -37.809 -16.668  1.00 16.22 ? 27  VAL C CG2 1 
ATOM   5287  N  N   . PHE C  1 28  ? 73.674 -38.128 -12.468  1.00 16.26 ? 28  PHE C N   1 
ATOM   5288  C  CA  . PHE C  1 28  ? 73.891 -38.870 -11.226  1.00 16.18 ? 28  PHE C CA  1 
ATOM   5289  C  C   . PHE C  1 28  ? 72.807 -38.560 -10.202  1.00 16.63 ? 28  PHE C C   1 
ATOM   5290  O  O   . PHE C  1 28  ? 72.070 -37.585 -10.350  1.00 14.14 ? 28  PHE C O   1 
ATOM   5291  C  CB  . PHE C  1 28  ? 75.297 -38.618 -10.654  1.00 16.39 ? 28  PHE C CB  1 
ATOM   5292  C  CG  . PHE C  1 28  ? 75.556 -37.192 -10.263  1.00 17.39 ? 28  PHE C CG  1 
ATOM   5293  C  CD1 . PHE C  1 28  ? 75.123 -36.702 -9.037   1.00 17.64 ? 28  PHE C CD1 1 
ATOM   5294  C  CD2 . PHE C  1 28  ? 76.251 -36.339 -11.115  1.00 18.67 ? 28  PHE C CD2 1 
ATOM   5295  C  CE1 . PHE C  1 28  ? 75.368 -35.392 -8.664   1.00 16.41 ? 28  PHE C CE1 1 
ATOM   5296  C  CE2 . PHE C  1 28  ? 76.497 -35.027 -10.750  1.00 18.15 ? 28  PHE C CE2 1 
ATOM   5297  C  CZ  . PHE C  1 28  ? 76.050 -34.549 -9.525   1.00 21.48 ? 28  PHE C CZ  1 
ATOM   5298  N  N   . SER C  1 29  ? 72.696 -39.405 -9.182   1.00 15.04 ? 29  SER C N   1 
ATOM   5299  C  CA  . SER C  1 29  ? 71.782 -39.152 -8.079   1.00 17.16 ? 29  SER C CA  1 
ATOM   5300  C  C   . SER C  1 29  ? 72.471 -38.237 -7.074   1.00 16.32 ? 29  SER C C   1 
ATOM   5301  O  O   . SER C  1 29  ? 73.494 -38.609 -6.508   1.00 14.19 ? 29  SER C O   1 
ATOM   5302  C  CB  . SER C  1 29  ? 71.386 -40.466 -7.396   1.00 18.53 ? 29  SER C CB  1 
ATOM   5303  O  OG  . SER C  1 29  ? 70.567 -41.259 -8.247   1.00 24.52 ? 29  SER C OG  1 
ATOM   5304  N  N   . GLU C  1 30  ? 71.914 -37.048 -6.850   1.00 14.40 ? 30  GLU C N   1 
ATOM   5305  C  CA  . GLU C  1 30  ? 72.554 -36.079 -5.966   1.00 14.86 ? 30  GLU C CA  1 
ATOM   5306  C  C   . GLU C  1 30  ? 72.911 -36.672 -4.599   1.00 16.42 ? 30  GLU C C   1 
ATOM   5307  O  O   . GLU C  1 30  ? 74.021 -36.468 -4.105   1.00 14.01 ? 30  GLU C O   1 
ATOM   5308  C  CB  . GLU C  1 30  ? 71.675 -34.837 -5.767   1.00 16.33 ? 30  GLU C CB  1 
ATOM   5309  C  CG  . GLU C  1 30  ? 71.639 -33.868 -6.942   1.00 18.10 ? 30  GLU C CG  1 
ATOM   5310  C  CD  . GLU C  1 30  ? 70.519 -34.155 -7.926   1.00 17.33 ? 30  GLU C CD  1 
ATOM   5311  O  OE1 . GLU C  1 30  ? 69.947 -35.270 -7.909   1.00 19.74 ? 30  GLU C OE1 1 
ATOM   5312  O  OE2 . GLU C  1 30  ? 70.210 -33.253 -8.729   1.00 18.95 ? 30  GLU C OE2 1 
ATOM   5313  N  N   . ALA C  1 31  ? 71.971 -37.398 -3.990   1.00 13.87 ? 31  ALA C N   1 
ATOM   5314  C  CA  . ALA C  1 31  ? 72.149 -37.862 -2.616   1.00 15.17 ? 31  ALA C CA  1 
ATOM   5315  C  C   . ALA C  1 31  ? 73.216 -38.937 -2.530   1.00 14.68 ? 31  ALA C C   1 
ATOM   5316  O  O   . ALA C  1 31  ? 73.968 -38.997 -1.557   1.00 17.61 ? 31  ALA C O   1 
ATOM   5317  C  CB  . ALA C  1 31  ? 70.830 -38.363 -2.035   1.00 16.78 ? 31  ALA C CB  1 
ATOM   5318  N  N   . VAL C  1 32  ? 73.302 -39.772 -3.559   1.00 14.74 ? 32  VAL C N   1 
ATOM   5319  C  CA  . VAL C  1 32  ? 74.283 -40.860 -3.561   1.00 14.17 ? 32  VAL C CA  1 
ATOM   5320  C  C   . VAL C  1 32  ? 75.697 -40.308 -3.719   1.00 14.60 ? 32  VAL C C   1 
ATOM   5321  O  O   . VAL C  1 32  ? 76.624 -40.733 -3.021   1.00 16.05 ? 32  VAL C O   1 
ATOM   5322  C  CB  . VAL C  1 32  ? 73.978 -41.891 -4.666   1.00 13.86 ? 32  VAL C CB  1 
ATOM   5323  C  CG1 . VAL C  1 32  ? 75.065 -42.962 -4.735   1.00 15.43 ? 32  VAL C CG1 1 
ATOM   5324  C  CG2 . VAL C  1 32  ? 72.621 -42.525 -4.416   1.00 14.03 ? 32  VAL C CG2 1 
ATOM   5325  N  N   . ARG C  1 33  ? 75.860 -39.352 -4.629   1.00 13.61 ? 33  ARG C N   1 
ATOM   5326  C  CA  . ARG C  1 33  ? 77.174 -38.773 -4.895   1.00 16.24 ? 33  ARG C CA  1 
ATOM   5327  C  C   . ARG C  1 33  ? 77.662 -37.952 -3.707   1.00 15.94 ? 33  ARG C C   1 
ATOM   5328  O  O   . ARG C  1 33  ? 78.844 -37.954 -3.375   1.00 16.66 ? 33  ARG C O   1 
ATOM   5329  C  CB  . ARG C  1 33  ? 77.143 -37.898 -6.156   1.00 19.64 ? 33  ARG C CB  1 
ATOM   5330  C  CG  . ARG C  1 33  ? 78.500 -37.290 -6.496   1.00 20.10 ? 33  ARG C CG  1 
ATOM   5331  C  CD  . ARG C  1 33  ? 78.598 -36.902 -7.958   1.00 20.93 ? 33  ARG C CD  1 
ATOM   5332  N  NE  . ARG C  1 33  ? 79.987 -36.691 -8.373   1.00 23.80 ? 33  ARG C NE  1 
ATOM   5333  C  CZ  . ARG C  1 33  ? 80.445 -36.960 -9.591   1.00 21.93 ? 33  ARG C CZ  1 
ATOM   5334  N  NH1 . ARG C  1 33  ? 79.619 -37.459 -10.504  1.00 19.44 ? 33  ARG C NH1 1 
ATOM   5335  N  NH2 . ARG C  1 33  ? 81.723 -36.741 -9.890   1.00 19.43 ? 33  ARG C NH2 1 
ATOM   5336  N  N   . GLN C  1 34  ? 76.738 -37.243 -3.073   1.00 17.82 ? 34  GLN C N   1 
ATOM   5337  C  CA  . GLN C  1 34  ? 77.049 -36.485 -1.872   1.00 17.38 ? 34  GLN C CA  1 
ATOM   5338  C  C   . GLN C  1 34  ? 77.479 -37.424 -0.734   1.00 16.66 ? 34  GLN C C   1 
ATOM   5339  O  O   . GLN C  1 34  ? 78.428 -37.130 -0.004   1.00 15.14 ? 34  GLN C O   1 
ATOM   5340  C  CB  . GLN C  1 34  ? 75.814 -35.675 -1.474   1.00 20.93 ? 34  GLN C CB  1 
ATOM   5341  C  CG  . GLN C  1 34  ? 76.060 -34.516 -0.538   1.00 36.27 ? 34  GLN C CG  1 
ATOM   5342  C  CD  . GLN C  1 34  ? 74.911 -33.526 -0.575   1.00 31.43 ? 34  GLN C CD  1 
ATOM   5343  O  OE1 . GLN C  1 34  ? 74.412 -33.173 -1.645   1.00 34.13 ? 34  GLN C OE1 1 
ATOM   5344  N  NE2 . GLN C  1 34  ? 74.483 -33.084 0.590    1.00 37.37 ? 34  GLN C NE2 1 
ATOM   5345  N  N   . GLN C  1 35  ? 76.801 -38.565 -0.592   1.00 14.47 ? 35  GLN C N   1 
ATOM   5346  C  CA  . GLN C  1 35  ? 77.080 -39.465 0.528    1.00 14.21 ? 35  GLN C CA  1 
ATOM   5347  C  C   . GLN C  1 35  ? 78.236 -40.432 0.282    1.00 15.76 ? 35  GLN C C   1 
ATOM   5348  O  O   . GLN C  1 35  ? 78.963 -40.789 1.215    1.00 13.93 ? 35  GLN C O   1 
ATOM   5349  C  CB  . GLN C  1 35  ? 75.820 -40.225 0.948    1.00 15.52 ? 35  GLN C CB  1 
ATOM   5350  C  CG  . GLN C  1 35  ? 74.704 -39.304 1.425    1.00 16.09 ? 35  GLN C CG  1 
ATOM   5351  C  CD  . GLN C  1 35  ? 75.153 -38.370 2.532    1.00 16.27 ? 35  GLN C CD  1 
ATOM   5352  O  OE1 . GLN C  1 35  ? 76.107 -38.661 3.263    1.00 13.78 ? 35  GLN C OE1 1 
ATOM   5353  N  NE2 . GLN C  1 35  ? 74.460 -37.240 2.672    1.00 16.19 ? 35  GLN C NE2 1 
ATOM   5354  N  N   . TRP C  1 36  ? 78.417 -40.833 -0.973   1.00 15.53 ? 36  TRP C N   1 
ATOM   5355  C  CA  . TRP C  1 36  ? 79.464 -41.786 -1.324   1.00 15.39 ? 36  TRP C CA  1 
ATOM   5356  C  C   . TRP C  1 36  ? 80.259 -41.342 -2.525   1.00 16.55 ? 36  TRP C C   1 
ATOM   5357  O  O   . TRP C  1 36  ? 80.130 -41.916 -3.611   1.00 17.25 ? 36  TRP C O   1 
ATOM   5358  C  CB  . TRP C  1 36  ? 78.847 -43.165 -1.538   1.00 15.19 ? 36  TRP C CB  1 
ATOM   5359  C  CG  . TRP C  1 36  ? 78.204 -43.690 -0.272   1.00 15.96 ? 36  TRP C CG  1 
ATOM   5360  C  CD1 . TRP C  1 36  ? 78.844 -44.170 0.867    1.00 15.33 ? 36  TRP C CD1 1 
ATOM   5361  C  CD2 . TRP C  1 36  ? 76.768 -43.782 0.032    1.00 15.94 ? 36  TRP C CD2 1 
ATOM   5362  N  NE1 . TRP C  1 36  ? 77.933 -44.545 1.820    1.00 17.69 ? 36  TRP C NE1 1 
ATOM   5363  C  CE2 . TRP C  1 36  ? 76.671 -44.336 1.385    1.00 17.13 ? 36  TRP C CE2 1 
ATOM   5364  C  CE3 . TRP C  1 36  ? 75.598 -43.461 -0.653   1.00 16.24 ? 36  TRP C CE3 1 
ATOM   5365  C  CZ2 . TRP C  1 36  ? 75.446 -44.558 2.004    1.00 17.94 ? 36  TRP C CZ2 1 
ATOM   5366  C  CZ3 . TRP C  1 36  ? 74.374 -43.694 -0.022   1.00 16.96 ? 36  TRP C CZ3 1 
ATOM   5367  C  CH2 . TRP C  1 36  ? 74.302 -44.223 1.278    1.00 15.58 ? 36  TRP C CH2 1 
ATOM   5368  N  N   . PRO C  1 37  ? 81.097 -40.300 -2.353   1.00 18.66 ? 37  PRO C N   1 
ATOM   5369  C  CA  . PRO C  1 37  ? 81.908 -39.791 -3.463   1.00 18.87 ? 37  PRO C CA  1 
ATOM   5370  C  C   . PRO C  1 37  ? 82.854 -40.836 -4.053   1.00 19.33 ? 37  PRO C C   1 
ATOM   5371  O  O   . PRO C  1 37  ? 83.223 -40.721 -5.217   1.00 21.03 ? 37  PRO C O   1 
ATOM   5372  C  CB  . PRO C  1 37  ? 82.714 -38.640 -2.830   1.00 18.66 ? 37  PRO C CB  1 
ATOM   5373  C  CG  . PRO C  1 37  ? 82.640 -38.869 -1.352   1.00 19.51 ? 37  PRO C CG  1 
ATOM   5374  C  CD  . PRO C  1 37  ? 81.306 -39.522 -1.119   1.00 17.98 ? 37  PRO C CD  1 
ATOM   5375  N  N   . HIS C  1 38  ? 83.244 -41.841 -3.268   1.00 19.10 ? 38  HIS C N   1 
ATOM   5376  C  CA  . HIS C  1 38  ? 84.172 -42.865 -3.759   1.00 19.62 ? 38  HIS C CA  1 
ATOM   5377  C  C   . HIS C  1 38  ? 83.634 -43.612 -4.951   1.00 20.98 ? 38  HIS C C   1 
ATOM   5378  O  O   . HIS C  1 38  ? 84.387 -44.271 -5.676   1.00 18.68 ? 38  HIS C O   1 
ATOM   5379  C  CB  . HIS C  1 38  ? 84.574 -43.843 -2.650   1.00 21.06 ? 38  HIS C CB  1 
ATOM   5380  C  CG  . HIS C  1 38  ? 83.511 -44.864 -2.320   1.00 20.11 ? 38  HIS C CG  1 
ATOM   5381  N  ND1 . HIS C  1 38  ? 82.546 -44.636 -1.411   1.00 22.98 ? 38  HIS C ND1 1 
ATOM   5382  C  CD2 . HIS C  1 38  ? 83.285 -46.146 -2.822   1.00 20.64 ? 38  HIS C CD2 1 
ATOM   5383  C  CE1 . HIS C  1 38  ? 81.736 -45.714 -1.333   1.00 20.73 ? 38  HIS C CE1 1 
ATOM   5384  N  NE2 . HIS C  1 38  ? 82.187 -46.635 -2.200   1.00 22.70 ? 38  HIS C NE2 1 
ATOM   5385  N  N   . LEU C  1 39  ? 82.330 -43.513 -5.185   1.00 18.99 ? 39  LEU C N   1 
ATOM   5386  C  CA  . LEU C  1 39  ? 81.715 -44.245 -6.291   1.00 21.61 ? 39  LEU C CA  1 
ATOM   5387  C  C   . LEU C  1 39  ? 81.922 -43.566 -7.644   1.00 22.28 ? 39  LEU C C   1 
ATOM   5388  O  O   . LEU C  1 39  ? 81.602 -44.139 -8.677   1.00 22.93 ? 39  LEU C O   1 
ATOM   5389  C  CB  . LEU C  1 39  ? 80.213 -44.424 -6.051   1.00 19.40 ? 39  LEU C CB  1 
ATOM   5390  C  CG  . LEU C  1 39  ? 79.763 -45.257 -4.848   1.00 19.12 ? 39  LEU C CG  1 
ATOM   5391  C  CD1 . LEU C  1 39  ? 78.268 -45.059 -4.616   1.00 15.86 ? 39  LEU C CD1 1 
ATOM   5392  C  CD2 . LEU C  1 39  ? 80.107 -46.730 -5.048   1.00 17.38 ? 39  LEU C CD2 1 
ATOM   5393  N  N   . TYR C  1 40  ? 82.448 -42.346 -7.633   1.00 19.95 ? 40  TYR C N   1 
ATOM   5394  C  CA  . TYR C  1 40  ? 82.459 -41.516 -8.833   1.00 20.54 ? 40  TYR C CA  1 
ATOM   5395  C  C   . TYR C  1 40  ? 83.859 -41.080 -9.222   1.00 23.20 ? 40  TYR C C   1 
ATOM   5396  O  O   . TYR C  1 40  ? 84.745 -40.987 -8.379   1.00 20.19 ? 40  TYR C O   1 
ATOM   5397  C  CB  . TYR C  1 40  ? 81.595 -40.273 -8.611   1.00 19.85 ? 40  TYR C CB  1 
ATOM   5398  C  CG  . TYR C  1 40  ? 80.145 -40.603 -8.378   1.00 20.74 ? 40  TYR C CG  1 
ATOM   5399  C  CD1 . TYR C  1 40  ? 79.665 -40.842 -7.097   1.00 19.87 ? 40  TYR C CD1 1 
ATOM   5400  C  CD2 . TYR C  1 40  ? 79.259 -40.686 -9.440   1.00 19.29 ? 40  TYR C CD2 1 
ATOM   5401  C  CE1 . TYR C  1 40  ? 78.334 -41.159 -6.884   1.00 22.27 ? 40  TYR C CE1 1 
ATOM   5402  C  CE2 . TYR C  1 40  ? 77.926 -40.993 -9.237   1.00 19.02 ? 40  TYR C CE2 1 
ATOM   5403  C  CZ  . TYR C  1 40  ? 77.469 -41.226 -7.958   1.00 19.78 ? 40  TYR C CZ  1 
ATOM   5404  O  OH  . TYR C  1 40  ? 76.144 -41.535 -7.754   1.00 19.72 ? 40  TYR C OH  1 
ATOM   5405  N  N   . ASN C  1 41  ? 84.039 -40.795 -10.505  1.00 22.09 ? 41  ASN C N   1 
ATOM   5406  C  CA  . ASN C  1 41  ? 85.337 -40.398 -11.025  1.00 23.87 ? 41  ASN C CA  1 
ATOM   5407  C  C   . ASN C  1 41  ? 85.176 -39.213 -11.960  1.00 25.22 ? 41  ASN C C   1 
ATOM   5408  O  O   . ASN C  1 41  ? 84.823 -39.378 -13.131  1.00 23.14 ? 41  ASN C O   1 
ATOM   5409  C  CB  . ASN C  1 41  ? 85.974 -41.577 -11.758  1.00 24.33 ? 41  ASN C CB  1 
ATOM   5410  C  CG  . ASN C  1 41  ? 87.353 -41.258 -12.288  1.00 28.44 ? 41  ASN C CG  1 
ATOM   5411  O  OD1 . ASN C  1 41  ? 87.646 -40.118 -12.649  1.00 30.99 ? 41  ASN C OD1 1 
ATOM   5412  N  ND2 . ASN C  1 41  ? 88.212 -42.270 -12.339  1.00 29.74 ? 41  ASN C ND2 1 
ATOM   5413  N  N   . GLU C  1 42  ? 85.431 -38.014 -11.453  1.00 25.33 ? 42  GLU C N   1 
ATOM   5414  C  CA  . GLU C  1 42  ? 85.126 -36.821 -12.237  1.00 31.52 ? 42  GLU C CA  1 
ATOM   5415  C  C   . GLU C  1 42  ? 86.043 -36.654 -13.451  1.00 30.50 ? 42  GLU C C   1 
ATOM   5416  O  O   . GLU C  1 42  ? 85.660 -36.027 -14.439  1.00 26.15 ? 42  GLU C O   1 
ATOM   5417  C  CB  . GLU C  1 42  ? 85.124 -35.563 -11.370  1.00 32.85 ? 42  GLU C CB  1 
ATOM   5418  C  CG  . GLU C  1 42  ? 84.459 -34.383 -12.060  1.00 40.25 ? 42  GLU C CG  1 
ATOM   5419  C  CD  . GLU C  1 42  ? 83.960 -33.334 -11.088  1.00 49.68 ? 42  GLU C CD  1 
ATOM   5420  O  OE1 . GLU C  1 42  ? 82.906 -32.723 -11.369  1.00 55.87 ? 42  GLU C OE1 1 
ATOM   5421  O  OE2 . GLU C  1 42  ? 84.613 -33.128 -10.040  1.00 61.20 ? 42  GLU C OE2 1 
ATOM   5422  N  N   . ASP C  1 43  ? 87.245 -37.217 -13.384  1.00 27.12 ? 43  ASP C N   1 
ATOM   5423  C  CA  . ASP C  1 43  ? 88.167 -37.122 -14.511  1.00 32.17 ? 43  ASP C CA  1 
ATOM   5424  C  C   . ASP C  1 43  ? 87.626 -37.915 -15.690  1.00 27.30 ? 43  ASP C C   1 
ATOM   5425  O  O   . ASP C  1 43  ? 87.617 -37.437 -16.821  1.00 28.55 ? 43  ASP C O   1 
ATOM   5426  C  CB  . ASP C  1 43  ? 89.565 -37.627 -14.134  1.00 36.88 ? 43  ASP C CB  1 
ATOM   5427  C  CG  . ASP C  1 43  ? 90.279 -36.704 -13.166  1.00 46.96 ? 43  ASP C CG  1 
ATOM   5428  O  OD1 . ASP C  1 43  ? 89.951 -35.499 -13.132  1.00 45.23 ? 43  ASP C OD1 1 
ATOM   5429  O  OD2 . ASP C  1 43  ? 91.176 -37.183 -12.440  1.00 58.20 ? 43  ASP C OD2 1 
ATOM   5430  N  N   . GLU C  1 44  ? 87.176 -39.134 -15.414  1.00 24.62 ? 44  GLU C N   1 
ATOM   5431  C  CA  . GLU C  1 44  ? 86.579 -39.980 -16.435  1.00 26.45 ? 44  GLU C CA  1 
ATOM   5432  C  C   . GLU C  1 44  ? 85.310 -39.343 -17.017  1.00 25.78 ? 44  GLU C C   1 
ATOM   5433  O  O   . GLU C  1 44  ? 85.112 -39.333 -18.230  1.00 22.36 ? 44  GLU C O   1 
ATOM   5434  C  CB  . GLU C  1 44  ? 86.261 -41.358 -15.854  1.00 31.52 ? 44  GLU C CB  1 
ATOM   5435  C  CG  . GLU C  1 44  ? 85.916 -42.405 -16.896  1.00 49.80 ? 44  GLU C CG  1 
ATOM   5436  C  CD  . GLU C  1 44  ? 85.762 -43.786 -16.295  1.00 66.79 ? 44  GLU C CD  1 
ATOM   5437  O  OE1 . GLU C  1 44  ? 85.703 -44.765 -17.070  1.00 79.43 ? 44  GLU C OE1 1 
ATOM   5438  O  OE2 . GLU C  1 44  ? 85.703 -43.892 -15.050  1.00 62.78 ? 44  GLU C OE2 1 
ATOM   5439  N  N   . GLU C  1 45  ? 84.456 -38.810 -16.147  1.00 22.35 ? 45  GLU C N   1 
ATOM   5440  C  CA  . GLU C  1 45  ? 83.225 -38.147 -16.584  1.00 19.73 ? 45  GLU C CA  1 
ATOM   5441  C  C   . GLU C  1 45  ? 83.517 -36.987 -17.529  1.00 20.76 ? 45  GLU C C   1 
ATOM   5442  O  O   . GLU C  1 45  ? 82.882 -36.849 -18.576  1.00 18.41 ? 45  GLU C O   1 
ATOM   5443  C  CB  . GLU C  1 45  ? 82.419 -37.662 -15.375  1.00 18.50 ? 45  GLU C CB  1 
ATOM   5444  C  CG  . GLU C  1 45  ? 81.868 -38.800 -14.523  1.00 22.10 ? 45  GLU C CG  1 
ATOM   5445  C  CD  . GLU C  1 45  ? 81.491 -38.368 -13.114  1.00 21.00 ? 45  GLU C CD  1 
ATOM   5446  O  OE1 . GLU C  1 45  ? 81.894 -37.268 -12.681  1.00 23.40 ? 45  GLU C OE1 1 
ATOM   5447  O  OE2 . GLU C  1 45  ? 80.791 -39.138 -12.434  1.00 23.91 ? 45  GLU C OE2 1 
ATOM   5448  N  N   . PHE C  1 46  ? 84.482 -36.156 -17.155  1.00 20.84 ? 46  PHE C N   1 
ATOM   5449  C  CA  . PHE C  1 46  ? 84.877 -35.029 -17.988  1.00 23.61 ? 46  PHE C CA  1 
ATOM   5450  C  C   . PHE C  1 46  ? 85.409 -35.496 -19.338  1.00 22.89 ? 46  PHE C C   1 
ATOM   5451  O  O   . PHE C  1 46  ? 85.035 -34.957 -20.379  1.00 21.77 ? 46  PHE C O   1 
ATOM   5452  C  CB  . PHE C  1 46  ? 85.932 -34.180 -17.277  1.00 24.74 ? 46  PHE C CB  1 
ATOM   5453  C  CG  . PHE C  1 46  ? 86.359 -32.969 -18.055  1.00 27.25 ? 46  PHE C CG  1 
ATOM   5454  C  CD1 . PHE C  1 46  ? 87.624 -32.897 -18.611  1.00 30.93 ? 46  PHE C CD1 1 
ATOM   5455  C  CD2 . PHE C  1 46  ? 85.490 -31.903 -18.237  1.00 29.03 ? 46  PHE C CD2 1 
ATOM   5456  C  CE1 . PHE C  1 46  ? 88.021 -31.778 -19.325  1.00 33.34 ? 46  PHE C CE1 1 
ATOM   5457  C  CE2 . PHE C  1 46  ? 85.880 -30.785 -18.953  1.00 29.70 ? 46  PHE C CE2 1 
ATOM   5458  C  CZ  . PHE C  1 46  ? 87.146 -30.723 -19.496  1.00 30.75 ? 46  PHE C CZ  1 
ATOM   5459  N  N   . ARG C  1 47  ? 86.288 -36.494 -19.314  1.00 27.18 ? 47  ARG C N   1 
ATOM   5460  C  CA  . ARG C  1 47  ? 86.845 -37.049 -20.548  1.00 29.85 ? 47  ARG C CA  1 
ATOM   5461  C  C   . ARG C  1 47  ? 85.752 -37.560 -21.485  1.00 26.81 ? 47  ARG C C   1 
ATOM   5462  O  O   . ARG C  1 47  ? 85.731 -37.223 -22.672  1.00 24.97 ? 47  ARG C O   1 
ATOM   5463  C  CB  . ARG C  1 47  ? 87.854 -38.159 -20.240  1.00 29.61 ? 47  ARG C CB  1 
ATOM   5464  C  CG  . ARG C  1 47  ? 89.307 -37.717 -20.342  1.00 45.90 ? 47  ARG C CG  1 
ATOM   5465  C  CD  . ARG C  1 47  ? 90.265 -38.739 -19.742  1.00 48.55 ? 47  ARG C CD  1 
ATOM   5466  N  NE  . ARG C  1 47  ? 89.680 -40.077 -19.677  1.00 59.03 ? 47  ARG C NE  1 
ATOM   5467  C  CZ  . ARG C  1 47  ? 89.484 -40.750 -18.546  1.00 65.11 ? 47  ARG C CZ  1 
ATOM   5468  N  NH1 . ARG C  1 47  ? 89.840 -40.219 -17.383  1.00 51.24 ? 47  ARG C NH1 1 
ATOM   5469  N  NH2 . ARG C  1 47  ? 88.939 -41.960 -18.577  1.00 67.78 ? 47  ARG C NH2 1 
ATOM   5470  N  N   . ASN C  1 48  ? 84.850 -38.373 -20.947  1.00 22.74 ? 48  ASN C N   1 
ATOM   5471  C  CA  . ASN C  1 48  ? 83.749 -38.925 -21.723  1.00 25.27 ? 48  ASN C CA  1 
ATOM   5472  C  C   . ASN C  1 48  ? 82.868 -37.844 -22.336  1.00 25.29 ? 48  ASN C C   1 
ATOM   5473  O  O   . ASN C  1 48  ? 82.485 -37.933 -23.502  1.00 24.28 ? 48  ASN C O   1 
ATOM   5474  C  CB  . ASN C  1 48  ? 82.881 -39.846 -20.859  1.00 28.05 ? 48  ASN C CB  1 
ATOM   5475  C  CG  . ASN C  1 48  ? 83.555 -41.169 -20.555  1.00 37.21 ? 48  ASN C CG  1 
ATOM   5476  O  OD1 . ASN C  1 48  ? 84.577 -41.507 -21.146  1.00 32.09 ? 48  ASN C OD1 1 
ATOM   5477  N  ND2 . ASN C  1 48  ? 82.975 -41.931 -19.636  1.00 40.66 ? 48  ASN C ND2 1 
ATOM   5478  N  N   . ALA C  1 49  ? 82.536 -36.829 -21.547  1.00 22.30 ? 49  ALA C N   1 
ATOM   5479  C  CA  . ALA C  1 49  ? 81.668 -35.767 -22.039  1.00 20.30 ? 49  ALA C CA  1 
ATOM   5480  C  C   . ALA C  1 49  ? 82.342 -34.957 -23.155  1.00 21.62 ? 49  ALA C C   1 
ATOM   5481  O  O   . ALA C  1 49  ? 81.735 -34.679 -24.191  1.00 21.79 ? 49  ALA C O   1 
ATOM   5482  C  CB  . ALA C  1 49  ? 81.227 -34.870 -20.898  1.00 19.91 ? 49  ALA C CB  1 
ATOM   5483  N  N   . VAL C  1 50  ? 83.600 -34.592 -22.948  1.00 22.28 ? 50  VAL C N   1 
ATOM   5484  C  CA  . VAL C  1 50  ? 84.344 -33.836 -23.947  1.00 20.71 ? 50  VAL C CA  1 
ATOM   5485  C  C   . VAL C  1 50  ? 84.469 -34.616 -25.258  1.00 21.89 ? 50  VAL C C   1 
ATOM   5486  O  O   . VAL C  1 50  ? 84.225 -34.074 -26.338  1.00 21.79 ? 50  VAL C O   1 
ATOM   5487  C  CB  . VAL C  1 50  ? 85.742 -33.435 -23.424  1.00 22.76 ? 50  VAL C CB  1 
ATOM   5488  C  CG1 . VAL C  1 50  ? 86.579 -32.817 -24.540  1.00 24.33 ? 50  VAL C CG1 1 
ATOM   5489  C  CG2 . VAL C  1 50  ? 85.607 -32.466 -22.256  1.00 21.24 ? 50  VAL C CG2 1 
ATOM   5490  N  N   . ASN C  1 51  ? 84.843 -35.889 -25.165  1.00 23.92 ? 51  ASN C N   1 
ATOM   5491  C  CA  . ASN C  1 51  ? 84.980 -36.722 -26.358  1.00 24.85 ? 51  ASN C CA  1 
ATOM   5492  C  C   . ASN C  1 51  ? 83.684 -36.812 -27.165  1.00 24.64 ? 51  ASN C C   1 
ATOM   5493  O  O   . ASN C  1 51  ? 83.693 -36.679 -28.391  1.00 21.98 ? 51  ASN C O   1 
ATOM   5494  C  CB  . ASN C  1 51  ? 85.474 -38.128 -25.998  1.00 28.38 ? 51  ASN C CB  1 
ATOM   5495  C  CG  . ASN C  1 51  ? 86.935 -38.149 -25.586  1.00 30.90 ? 51  ASN C CG  1 
ATOM   5496  O  OD1 . ASN C  1 51  ? 87.380 -39.065 -24.897  1.00 43.13 ? 51  ASN C OD1 1 
ATOM   5497  N  ND2 . ASN C  1 51  ? 87.688 -37.141 -26.006  1.00 34.68 ? 51  ASN C ND2 1 
ATOM   5498  N  N   . GLU C  1 52  ? 82.570 -37.047 -26.482  1.00 22.85 ? 52  GLU C N   1 
ATOM   5499  C  CA  . GLU C  1 52  ? 81.287 -37.171 -27.169  1.00 21.99 ? 52  GLU C CA  1 
ATOM   5500  C  C   . GLU C  1 52  ? 80.854 -35.859 -27.824  1.00 20.60 ? 52  GLU C C   1 
ATOM   5501  O  O   . GLU C  1 52  ? 80.409 -35.848 -28.979  1.00 21.48 ? 52  GLU C O   1 
ATOM   5502  C  CB  . GLU C  1 52  ? 80.198 -37.676 -26.212  1.00 22.51 ? 52  GLU C CB  1 
ATOM   5503  C  CG  . GLU C  1 52  ? 80.377 -39.120 -25.772  1.00 23.17 ? 52  GLU C CG  1 
ATOM   5504  C  CD  . GLU C  1 52  ? 80.169 -40.121 -26.900  1.00 26.51 ? 52  GLU C CD  1 
ATOM   5505  O  OE1 . GLU C  1 52  ? 81.112 -40.884 -27.185  1.00 31.61 ? 52  GLU C OE1 1 
ATOM   5506  O  OE2 . GLU C  1 52  ? 79.072 -40.151 -27.509  1.00 23.27 ? 52  GLU C OE2 1 
ATOM   5507  N  N   . VAL C  1 53  ? 80.971 -34.756 -27.090  1.00 19.96 ? 53  VAL C N   1 
ATOM   5508  C  CA  . VAL C  1 53  ? 80.601 -33.453 -27.643  1.00 22.39 ? 53  VAL C CA  1 
ATOM   5509  C  C   . VAL C  1 53  ? 81.449 -33.128 -28.868  1.00 22.24 ? 53  VAL C C   1 
ATOM   5510  O  O   . VAL C  1 53  ? 80.949 -32.588 -29.856  1.00 21.23 ? 53  VAL C O   1 
ATOM   5511  C  CB  . VAL C  1 53  ? 80.693 -32.323 -26.592  1.00 21.64 ? 53  VAL C CB  1 
ATOM   5512  C  CG1 . VAL C  1 53  ? 80.536 -30.958 -27.250  1.00 19.55 ? 53  VAL C CG1 1 
ATOM   5513  C  CG2 . VAL C  1 53  ? 79.619 -32.517 -25.530  1.00 21.16 ? 53  VAL C CG2 1 
ATOM   5514  N  N   . LYS C  1 54  ? 82.732 -33.470 -28.810  1.00 22.11 ? 54  LYS C N   1 
ATOM   5515  C  CA  . LYS C  1 54  ? 83.630 -33.206 -29.934  1.00 23.51 ? 54  LYS C CA  1 
ATOM   5516  C  C   . LYS C  1 54  ? 83.217 -33.977 -31.184  1.00 21.41 ? 54  LYS C C   1 
ATOM   5517  O  O   . LYS C  1 54  ? 83.286 -33.455 -32.289  1.00 23.59 ? 54  LYS C O   1 
ATOM   5518  C  CB  . LYS C  1 54  ? 85.076 -33.543 -29.576  1.00 24.17 ? 54  LYS C CB  1 
ATOM   5519  C  CG  . LYS C  1 54  ? 85.824 -32.442 -28.838  1.00 27.81 ? 54  LYS C CG  1 
ATOM   5520  C  CD  . LYS C  1 54  ? 87.255 -32.880 -28.565  1.00 28.44 ? 54  LYS C CD  1 
ATOM   5521  C  CE  . LYS C  1 54  ? 88.198 -31.697 -28.435  1.00 36.39 ? 54  LYS C CE  1 
ATOM   5522  N  NZ  . LYS C  1 54  ? 87.967 -30.918 -27.191  1.00 38.72 ? 54  LYS C NZ  1 
ATOM   5523  N  N   . ARG C  1 55  ? 82.797 -35.225 -31.013  1.00 22.59 ? 55  ARG C N   1 
ATOM   5524  C  CA  . ARG C  1 55  ? 82.380 -36.014 -32.166  1.00 23.01 ? 55  ARG C CA  1 
ATOM   5525  C  C   . ARG C  1 55  ? 81.068 -35.477 -32.747  1.00 22.36 ? 55  ARG C C   1 
ATOM   5526  O  O   . ARG C  1 55  ? 80.898 -35.417 -33.960  1.00 24.65 ? 55  ARG C O   1 
ATOM   5527  C  CB  . ARG C  1 55  ? 82.270 -37.500 -31.815  1.00 23.21 ? 55  ARG C CB  1 
ATOM   5528  C  CG  . ARG C  1 55  ? 82.239 -38.403 -33.043  1.00 26.59 ? 55  ARG C CG  1 
ATOM   5529  C  CD  . ARG C  1 55  ? 82.288 -39.875 -32.660  1.00 30.04 ? 55  ARG C CD  1 
ATOM   5530  N  NE  . ARG C  1 55  ? 81.060 -40.303 -31.994  1.00 28.00 ? 55  ARG C NE  1 
ATOM   5531  C  CZ  . ARG C  1 55  ? 80.953 -40.545 -30.691  1.00 29.48 ? 55  ARG C CZ  1 
ATOM   5532  N  NH1 . ARG C  1 55  ? 82.009 -40.401 -29.899  1.00 30.51 ? 55  ARG C NH1 1 
ATOM   5533  N  NH2 . ARG C  1 55  ? 79.786 -40.927 -30.179  1.00 25.72 ? 55  ARG C NH2 1 
ATOM   5534  N  N   . ALA C  1 56  ? 80.145 -35.076 -31.877  1.00 21.93 ? 56  ALA C N   1 
ATOM   5535  C  CA  . ALA C  1 56  ? 78.903 -34.444 -32.324  1.00 20.32 ? 56  ALA C CA  1 
ATOM   5536  C  C   . ALA C  1 56  ? 79.212 -33.214 -33.181  1.00 21.21 ? 56  ALA C C   1 
ATOM   5537  O  O   . ALA C  1 56  ? 78.630 -33.011 -34.251  1.00 20.90 ? 56  ALA C O   1 
ATOM   5538  C  CB  . ALA C  1 56  ? 78.047 -34.062 -31.120  1.00 16.51 ? 56  ALA C CB  1 
ATOM   5539  N  N   . MET C  1 57  ? 80.148 -32.397 -32.712  1.00 20.87 ? 57  MET C N   1 
ATOM   5540  C  CA  . MET C  1 57  ? 80.529 -31.192 -33.438  1.00 23.67 ? 57  MET C CA  1 
ATOM   5541  C  C   . MET C  1 57  ? 81.153 -31.516 -34.794  1.00 21.55 ? 57  MET C C   1 
ATOM   5542  O  O   . MET C  1 57  ? 80.970 -30.778 -35.761  1.00 26.58 ? 57  MET C O   1 
ATOM   5543  C  CB  . MET C  1 57  ? 81.474 -30.340 -32.589  1.00 23.19 ? 57  MET C CB  1 
ATOM   5544  C  CG  . MET C  1 57  ? 80.783 -29.775 -31.360  1.00 23.08 ? 57  MET C CG  1 
ATOM   5545  S  SD  . MET C  1 57  ? 81.867 -28.776 -30.331  1.00 25.91 ? 57  MET C SD  1 
ATOM   5546  C  CE  . MET C  1 57  ? 81.960 -27.270 -31.302  1.00 26.16 ? 57  MET C CE  1 
ATOM   5547  N  N   . GLN C  1 58  ? 81.884 -32.622 -34.863  1.00 23.75 ? 58  GLN C N   1 
ATOM   5548  C  CA  . GLN C  1 58  ? 82.472 -33.062 -36.127  1.00 26.47 ? 58  GLN C CA  1 
ATOM   5549  C  C   . GLN C  1 58  ? 81.402 -33.430 -37.152  1.00 25.09 ? 58  GLN C C   1 
ATOM   5550  O  O   . GLN C  1 58  ? 81.621 -33.309 -38.360  1.00 22.36 ? 58  GLN C O   1 
ATOM   5551  C  CB  . GLN C  1 58  ? 83.421 -34.238 -35.897  1.00 27.88 ? 58  GLN C CB  1 
ATOM   5552  C  CG  . GLN C  1 58  ? 84.688 -33.850 -35.156  1.00 34.00 ? 58  GLN C CG  1 
ATOM   5553  C  CD  . GLN C  1 58  ? 85.465 -35.049 -34.647  1.00 44.70 ? 58  GLN C CD  1 
ATOM   5554  O  OE1 . GLN C  1 58  ? 86.484 -34.901 -33.973  1.00 64.95 ? 58  GLN C OE1 1 
ATOM   5555  N  NE2 . GLN C  1 58  ? 84.986 -36.245 -34.965  1.00 44.92 ? 58  GLN C NE2 1 
ATOM   5556  N  N   . PHE C  1 59  ? 80.252 -33.885 -36.666  1.00 21.94 ? 59  PHE C N   1 
ATOM   5557  C  CA  . PHE C  1 59  ? 79.122 -34.213 -37.533  1.00 23.64 ? 59  PHE C CA  1 
ATOM   5558  C  C   . PHE C  1 59  ? 78.262 -32.994 -37.840  1.00 24.60 ? 59  PHE C C   1 
ATOM   5559  O  O   . PHE C  1 59  ? 77.283 -33.095 -38.573  1.00 29.83 ? 59  PHE C O   1 
ATOM   5560  C  CB  . PHE C  1 59  ? 78.256 -35.309 -36.909  1.00 22.52 ? 59  PHE C CB  1 
ATOM   5561  C  CG  . PHE C  1 59  ? 78.773 -36.700 -37.145  1.00 24.32 ? 59  PHE C CG  1 
ATOM   5562  C  CD1 . PHE C  1 59  ? 78.647 -37.298 -38.390  1.00 24.88 ? 59  PHE C CD1 1 
ATOM   5563  C  CD2 . PHE C  1 59  ? 79.383 -37.410 -36.126  1.00 24.92 ? 59  PHE C CD2 1 
ATOM   5564  C  CE1 . PHE C  1 59  ? 79.125 -38.580 -38.613  1.00 25.48 ? 59  PHE C CE1 1 
ATOM   5565  C  CE2 . PHE C  1 59  ? 79.860 -38.695 -36.341  1.00 32.43 ? 59  PHE C CE2 1 
ATOM   5566  C  CZ  . PHE C  1 59  ? 79.730 -39.281 -37.588  1.00 25.23 ? 59  PHE C CZ  1 
ATOM   5567  N  N   . GLY C  1 60  ? 78.616 -31.848 -37.265  1.00 24.14 ? 60  GLY C N   1 
ATOM   5568  C  CA  . GLY C  1 60  ? 77.949 -30.595 -37.604  1.00 21.23 ? 60  GLY C CA  1 
ATOM   5569  C  C   . GLY C  1 60  ? 76.985 -30.078 -36.550  1.00 21.23 ? 60  GLY C C   1 
ATOM   5570  O  O   . GLY C  1 60  ? 76.281 -29.097 -36.782  1.00 21.58 ? 60  GLY C O   1 
ATOM   5571  N  N   . VAL C  1 61  ? 76.952 -30.718 -35.385  1.00 21.13 ? 61  VAL C N   1 
ATOM   5572  C  CA  . VAL C  1 61  ? 76.084 -30.247 -34.296  1.00 19.79 ? 61  VAL C CA  1 
ATOM   5573  C  C   . VAL C  1 61  ? 76.610 -28.926 -33.737  1.00 21.30 ? 61  VAL C C   1 
ATOM   5574  O  O   . VAL C  1 61  ? 77.771 -28.832 -33.335  1.00 20.10 ? 61  VAL C O   1 
ATOM   5575  C  CB  . VAL C  1 61  ? 75.972 -31.281 -33.156  1.00 18.98 ? 61  VAL C CB  1 
ATOM   5576  C  CG1 . VAL C  1 61  ? 75.193 -30.701 -31.975  1.00 20.26 ? 61  VAL C CG1 1 
ATOM   5577  C  CG2 . VAL C  1 61  ? 75.307 -32.554 -33.659  1.00 16.64 ? 61  VAL C CG2 1 
ATOM   5578  N  N   . LYS C  1 62  ? 75.754 -27.908 -33.719  1.00 20.66 ? 62  LYS C N   1 
ATOM   5579  C  CA  . LYS C  1 62  ? 76.146 -26.579 -33.257  1.00 21.37 ? 62  LYS C CA  1 
ATOM   5580  C  C   . LYS C  1 62  ? 75.699 -26.344 -31.823  1.00 20.65 ? 62  LYS C C   1 
ATOM   5581  O  O   . LYS C  1 62  ? 76.411 -25.718 -31.032  1.00 19.51 ? 62  LYS C O   1 
ATOM   5582  C  CB  . LYS C  1 62  ? 75.542 -25.499 -34.157  1.00 25.06 ? 62  LYS C CB  1 
ATOM   5583  C  CG  . LYS C  1 62  ? 75.879 -24.081 -33.713  1.00 32.25 ? 62  LYS C CG  1 
ATOM   5584  C  CD  . LYS C  1 62  ? 75.455 -23.039 -34.738  1.00 33.32 ? 62  LYS C CD  1 
ATOM   5585  C  CE  . LYS C  1 62  ? 75.982 -21.666 -34.351  1.00 39.26 ? 62  LYS C CE  1 
ATOM   5586  N  NZ  . LYS C  1 62  ? 75.508 -20.601 -35.279  1.00 38.76 ? 62  LYS C NZ  1 
ATOM   5587  N  N   . THR C  1 63  ? 74.514 -26.855 -31.498  1.00 18.53 ? 63  THR C N   1 
ATOM   5588  C  CA  . THR C  1 63  ? 73.923 -26.658 -30.183  1.00 18.08 ? 63  THR C CA  1 
ATOM   5589  C  C   . THR C  1 63  ? 73.422 -27.965 -29.578  1.00 18.28 ? 63  THR C C   1 
ATOM   5590  O  O   . THR C  1 63  ? 72.807 -28.786 -30.263  1.00 15.76 ? 63  THR C O   1 
ATOM   5591  C  CB  . THR C  1 63  ? 72.751 -25.665 -30.260  1.00 15.93 ? 63  THR C CB  1 
ATOM   5592  O  OG1 . THR C  1 63  ? 73.219 -24.433 -30.827  1.00 16.97 ? 63  THR C OG1 1 
ATOM   5593  C  CG2 . THR C  1 63  ? 72.167 -25.407 -28.880  1.00 15.81 ? 63  THR C CG2 1 
ATOM   5594  N  N   . ILE C  1 64  ? 73.691 -28.146 -28.289  1.00 14.74 ? 64  ILE C N   1 
ATOM   5595  C  CA  . ILE C  1 64  ? 73.169 -29.284 -27.543  1.00 16.76 ? 64  ILE C CA  1 
ATOM   5596  C  C   . ILE C  1 64  ? 72.333 -28.763 -26.386  1.00 17.56 ? 64  ILE C C   1 
ATOM   5597  O  O   . ILE C  1 64  ? 72.755 -27.858 -25.663  1.00 17.15 ? 64  ILE C O   1 
ATOM   5598  C  CB  . ILE C  1 64  ? 74.297 -30.181 -26.996  1.00 16.38 ? 64  ILE C CB  1 
ATOM   5599  C  CG1 . ILE C  1 64  ? 75.048 -30.845 -28.156  1.00 16.57 ? 64  ILE C CG1 1 
ATOM   5600  C  CG2 . ILE C  1 64  ? 73.729 -31.228 -26.045  1.00 18.20 ? 64  ILE C CG2 1 
ATOM   5601  C  CD1 . ILE C  1 64  ? 76.247 -31.679 -27.735  1.00 19.37 ? 64  ILE C CD1 1 
ATOM   5602  N  N   . VAL C  1 65  ? 71.134 -29.312 -26.235  1.00 15.39 ? 65  VAL C N   1 
ATOM   5603  C  CA  . VAL C  1 65  ? 70.262 -28.945 -25.129  1.00 15.24 ? 65  VAL C CA  1 
ATOM   5604  C  C   . VAL C  1 65  ? 70.325 -30.084 -24.120  1.00 15.98 ? 65  VAL C C   1 
ATOM   5605  O  O   . VAL C  1 65  ? 70.074 -31.244 -24.459  1.00 16.27 ? 65  VAL C O   1 
ATOM   5606  C  CB  . VAL C  1 65  ? 68.817 -28.699 -25.613  1.00 13.89 ? 65  VAL C CB  1 
ATOM   5607  C  CG1 . VAL C  1 65  ? 67.891 -28.361 -24.449  1.00 13.78 ? 65  VAL C CG1 1 
ATOM   5608  C  CG2 . VAL C  1 65  ? 68.795 -27.580 -26.647  1.00 12.23 ? 65  VAL C CG2 1 
ATOM   5609  N  N   . ASP C  1 66  ? 70.673 -29.752 -22.881  1.00 15.06 ? 66  ASP C N   1 
ATOM   5610  C  CA  . ASP C  1 66  ? 70.935 -30.763 -21.862  1.00 15.25 ? 66  ASP C CA  1 
ATOM   5611  C  C   . ASP C  1 66  ? 69.938 -30.618 -20.717  1.00 14.44 ? 66  ASP C C   1 
ATOM   5612  O  O   . ASP C  1 66  ? 70.084 -29.730 -19.884  1.00 16.66 ? 66  ASP C O   1 
ATOM   5613  C  CB  . ASP C  1 66  ? 72.364 -30.598 -21.342  1.00 15.89 ? 66  ASP C CB  1 
ATOM   5614  C  CG  . ASP C  1 66  ? 72.723 -31.615 -20.264  1.00 18.43 ? 66  ASP C CG  1 
ATOM   5615  O  OD1 . ASP C  1 66  ? 71.808 -32.143 -19.591  1.00 19.19 ? 66  ASP C OD1 1 
ATOM   5616  O  OD2 . ASP C  1 66  ? 73.927 -31.884 -20.097  1.00 18.11 ? 66  ASP C OD2 1 
ATOM   5617  N  N   . PRO C  1 67  ? 68.916 -31.487 -20.679  1.00 12.92 ? 67  PRO C N   1 
ATOM   5618  C  CA  . PRO C  1 67  ? 67.868 -31.385 -19.671  1.00 15.67 ? 67  PRO C CA  1 
ATOM   5619  C  C   . PRO C  1 67  ? 68.195 -32.072 -18.336  1.00 16.93 ? 67  PRO C C   1 
ATOM   5620  O  O   . PRO C  1 67  ? 67.290 -32.590 -17.668  1.00 15.36 ? 67  PRO C O   1 
ATOM   5621  C  CB  . PRO C  1 67  ? 66.668 -32.053 -20.350  1.00 12.77 ? 67  PRO C CB  1 
ATOM   5622  C  CG  . PRO C  1 67  ? 67.268 -33.042 -21.285  1.00 16.92 ? 67  PRO C CG  1 
ATOM   5623  C  CD  . PRO C  1 67  ? 68.629 -32.530 -21.681  1.00 14.63 ? 67  PRO C CD  1 
ATOM   5624  N  N   . THR C  1 68  ? 69.467 -32.077 -17.951  1.00 14.17 ? 68  THR C N   1 
ATOM   5625  C  CA  . THR C  1 68  ? 69.838 -32.531 -16.619  1.00 12.39 ? 68  THR C CA  1 
ATOM   5626  C  C   . THR C  1 68  ? 69.426 -31.467 -15.594  1.00 12.20 ? 68  THR C C   1 
ATOM   5627  O  O   . THR C  1 68  ? 69.904 -30.334 -15.637  1.00 12.82 ? 68  THR C O   1 
ATOM   5628  C  CB  . THR C  1 68  ? 71.349 -32.801 -16.503  1.00 15.00 ? 68  THR C CB  1 
ATOM   5629  O  OG1 . THR C  1 68  ? 71.773 -33.667 -17.565  1.00 14.95 ? 68  THR C OG1 1 
ATOM   5630  C  CG2 . THR C  1 68  ? 71.676 -33.454 -15.157  1.00 13.16 ? 68  THR C CG2 1 
ATOM   5631  N  N   . VAL C  1 69  ? 68.530 -31.833 -14.683  1.00 11.63 ? 69  VAL C N   1 
ATOM   5632  C  CA  . VAL C  1 69  ? 68.013 -30.893 -13.686  1.00 11.11 ? 69  VAL C CA  1 
ATOM   5633  C  C   . VAL C  1 69  ? 68.016 -31.548 -12.310  1.00 13.20 ? 69  VAL C C   1 
ATOM   5634  O  O   . VAL C  1 69  ? 68.617 -32.609 -12.135  1.00 12.88 ? 69  VAL C O   1 
ATOM   5635  C  CB  . VAL C  1 69  ? 66.598 -30.388 -14.058  1.00 12.71 ? 69  VAL C CB  1 
ATOM   5636  C  CG1 . VAL C  1 69  ? 66.642 -29.621 -15.377  1.00 12.93 ? 69  VAL C CG1 1 
ATOM   5637  C  CG2 . VAL C  1 69  ? 65.612 -31.544 -14.159  1.00 13.21 ? 69  VAL C CG2 1 
ATOM   5638  N  N   . MET C  1 70  ? 67.363 -30.927 -11.328  1.00 12.76 ? 70  MET C N   1 
ATOM   5639  C  CA  . MET C  1 70  ? 67.318 -31.511 -9.986   1.00 13.20 ? 70  MET C CA  1 
ATOM   5640  C  C   . MET C  1 70  ? 66.811 -32.946 -10.064  1.00 15.29 ? 70  MET C C   1 
ATOM   5641  O  O   . MET C  1 70  ? 65.764 -33.201 -10.654  1.00 13.75 ? 70  MET C O   1 
ATOM   5642  C  CB  . MET C  1 70  ? 66.395 -30.715 -9.052   1.00 15.91 ? 70  MET C CB  1 
ATOM   5643  C  CG  . MET C  1 70  ? 66.560 -31.089 -7.582   1.00 14.42 ? 70  MET C CG  1 
ATOM   5644  S  SD  . MET C  1 70  ? 65.000 -31.373 -6.722   1.00 17.42 ? 70  MET C SD  1 
ATOM   5645  C  CE  . MET C  1 70  ? 64.597 -33.024 -7.309   1.00 16.90 ? 70  MET C CE  1 
ATOM   5646  N  N   . GLY C  1 71  ? 67.546 -33.878 -9.462   1.00 12.58 ? 71  GLY C N   1 
ATOM   5647  C  CA  . GLY C  1 71  ? 67.163 -35.277 -9.503   1.00 13.40 ? 71  GLY C CA  1 
ATOM   5648  C  C   . GLY C  1 71  ? 67.989 -36.064 -10.502  1.00 16.49 ? 71  GLY C C   1 
ATOM   5649  O  O   . GLY C  1 71  ? 68.000 -37.293 -10.466  1.00 16.12 ? 71  GLY C O   1 
ATOM   5650  N  N   . LEU C  1 72  ? 68.688 -35.351 -11.386  1.00 15.25 ? 72  LEU C N   1 
ATOM   5651  C  CA  . LEU C  1 72  ? 69.580 -35.976 -12.373  1.00 15.96 ? 72  LEU C CA  1 
ATOM   5652  C  C   . LEU C  1 72  ? 71.027 -35.498 -12.228  1.00 14.58 ? 72  LEU C C   1 
ATOM   5653  O  O   . LEU C  1 72  ? 71.900 -35.861 -13.025  1.00 14.05 ? 72  LEU C O   1 
ATOM   5654  C  CB  . LEU C  1 72  ? 69.090 -35.698 -13.802  1.00 13.63 ? 72  LEU C CB  1 
ATOM   5655  C  CG  . LEU C  1 72  ? 67.716 -36.253 -14.179  1.00 13.24 ? 72  LEU C CG  1 
ATOM   5656  C  CD1 . LEU C  1 72  ? 67.346 -35.820 -15.595  1.00 13.77 ? 72  LEU C CD1 1 
ATOM   5657  C  CD2 . LEU C  1 72  ? 67.704 -37.766 -14.064  1.00 12.71 ? 72  LEU C CD2 1 
ATOM   5658  N  N   . GLY C  1 73  ? 71.277 -34.662 -11.228  1.00 13.22 ? 73  GLY C N   1 
ATOM   5659  C  CA  . GLY C  1 73  ? 72.641 -34.235 -10.926  1.00 14.16 ? 73  GLY C CA  1 
ATOM   5660  C  C   . GLY C  1 73  ? 73.159 -33.052 -11.729  1.00 16.31 ? 73  GLY C C   1 
ATOM   5661  O  O   . GLY C  1 73  ? 74.349 -32.975 -12.023  1.00 15.58 ? 73  GLY C O   1 
ATOM   5662  N  N   . ARG C  1 74  ? 72.280 -32.114 -12.073  1.00 13.29 ? 74  ARG C N   1 
ATOM   5663  C  CA  . ARG C  1 74  ? 72.723 -30.910 -12.769  1.00 13.27 ? 74  ARG C CA  1 
ATOM   5664  C  C   . ARG C  1 74  ? 73.893 -30.266 -12.025  1.00 16.40 ? 74  ARG C C   1 
ATOM   5665  O  O   . ARG C  1 74  ? 73.838 -30.087 -10.801  1.00 15.51 ? 74  ARG C O   1 
ATOM   5666  C  CB  . ARG C  1 74  ? 71.581 -29.902 -12.891  1.00 13.36 ? 74  ARG C CB  1 
ATOM   5667  C  CG  . ARG C  1 74  ? 71.954 -28.635 -13.644  1.00 17.86 ? 74  ARG C CG  1 
ATOM   5668  C  CD  . ARG C  1 74  ? 70.804 -27.633 -13.634  1.00 18.03 ? 74  ARG C CD  1 
ATOM   5669  N  NE  . ARG C  1 74  ? 70.505 -27.173 -12.281  1.00 15.11 ? 74  ARG C NE  1 
ATOM   5670  C  CZ  . ARG C  1 74  ? 69.661 -26.186 -11.990  1.00 16.36 ? 74  ARG C CZ  1 
ATOM   5671  N  NH1 . ARG C  1 74  ? 69.019 -25.555 -12.961  1.00 13.13 ? 74  ARG C NH1 1 
ATOM   5672  N  NH2 . ARG C  1 74  ? 69.451 -25.837 -10.722  1.00 13.73 ? 74  ARG C NH2 1 
ATOM   5673  N  N   . ASP C  1 75  ? 74.937 -29.916 -12.777  1.00 15.79 ? 75  ASP C N   1 
ATOM   5674  C  CA  . ASP C  1 75  ? 76.116 -29.247 -12.240  1.00 17.00 ? 75  ASP C CA  1 
ATOM   5675  C  C   . ASP C  1 75  ? 76.605 -28.228 -13.274  1.00 18.28 ? 75  ASP C C   1 
ATOM   5676  O  O   . ASP C  1 75  ? 77.247 -28.593 -14.263  1.00 17.46 ? 75  ASP C O   1 
ATOM   5677  C  CB  . ASP C  1 75  ? 77.209 -30.267 -11.944  1.00 16.70 ? 75  ASP C CB  1 
ATOM   5678  C  CG  . ASP C  1 75  ? 78.401 -29.659 -11.217  1.00 23.19 ? 75  ASP C CG  1 
ATOM   5679  O  OD1 . ASP C  1 75  ? 78.821 -30.233 -10.195  1.00 33.45 ? 75  ASP C OD1 1 
ATOM   5680  O  OD2 . ASP C  1 75  ? 78.914 -28.614 -11.660  1.00 24.84 ? 75  ASP C OD2 1 
ATOM   5681  N  N   . ILE C  1 76  ? 76.280 -26.960 -13.050  1.00 16.78 ? 76  ILE C N   1 
ATOM   5682  C  CA  . ILE C  1 76  ? 76.554 -25.906 -14.024  1.00 16.53 ? 76  ILE C CA  1 
ATOM   5683  C  C   . ILE C  1 76  ? 78.055 -25.712 -14.233  1.00 17.75 ? 76  ILE C C   1 
ATOM   5684  O  O   . ILE C  1 76  ? 78.500 -25.391 -15.341  1.00 17.93 ? 76  ILE C O   1 
ATOM   5685  C  CB  . ILE C  1 76  ? 75.860 -24.574 -13.637  1.00 17.88 ? 76  ILE C CB  1 
ATOM   5686  C  CG1 . ILE C  1 76  ? 75.699 -23.664 -14.859  1.00 18.42 ? 76  ILE C CG1 1 
ATOM   5687  C  CG2 . ILE C  1 76  ? 76.633 -23.849 -12.545  1.00 18.23 ? 76  ILE C CG2 1 
ATOM   5688  C  CD1 . ILE C  1 76  ? 75.009 -24.323 -16.037  1.00 18.99 ? 76  ILE C CD1 1 
ATOM   5689  N  N   . ARG C  1 77  ? 78.837 -25.935 -13.180  1.00 18.42 ? 77  ARG C N   1 
ATOM   5690  C  CA  . ARG C  1 77  ? 80.286 -25.763 -13.268  1.00 20.80 ? 77  ARG C CA  1 
ATOM   5691  C  C   . ARG C  1 77  ? 80.933 -26.888 -14.083  1.00 20.17 ? 77  ARG C C   1 
ATOM   5692  O  O   . ARG C  1 77  ? 81.865 -26.646 -14.846  1.00 21.28 ? 77  ARG C O   1 
ATOM   5693  C  CB  . ARG C  1 77  ? 80.906 -25.628 -11.873  1.00 21.85 ? 77  ARG C CB  1 
ATOM   5694  C  CG  . ARG C  1 77  ? 80.604 -24.281 -11.230  1.00 22.69 ? 77  ARG C CG  1 
ATOM   5695  C  CD  . ARG C  1 77  ? 80.915 -24.265 -9.741   1.00 27.79 ? 77  ARG C CD  1 
ATOM   5696  N  NE  . ARG C  1 77  ? 80.520 -22.996 -9.136   1.00 28.64 ? 77  ARG C NE  1 
ATOM   5697  C  CZ  . ARG C  1 77  ? 79.287 -22.705 -8.735   1.00 28.77 ? 77  ARG C CZ  1 
ATOM   5698  N  NH1 . ARG C  1 77  ? 78.312 -23.595 -8.872   1.00 24.76 ? 77  ARG C NH1 1 
ATOM   5699  N  NH2 . ARG C  1 77  ? 79.025 -21.522 -8.194   1.00 31.22 ? 77  ARG C NH2 1 
ATOM   5700  N  N   . PHE C  1 78  ? 80.426 -28.109 -13.945  1.00 17.74 ? 78  PHE C N   1 
ATOM   5701  C  CA  . PHE C  1 78  ? 80.871 -29.197 -14.818  1.00 18.97 ? 78  PHE C CA  1 
ATOM   5702  C  C   . PHE C  1 78  ? 80.552 -28.851 -16.277  1.00 20.41 ? 78  PHE C C   1 
ATOM   5703  O  O   . PHE C  1 78  ? 81.402 -28.992 -17.163  1.00 20.87 ? 78  PHE C O   1 
ATOM   5704  C  CB  . PHE C  1 78  ? 80.218 -30.525 -14.408  1.00 19.60 ? 78  PHE C CB  1 
ATOM   5705  C  CG  . PHE C  1 78  ? 80.621 -31.697 -15.263  1.00 18.20 ? 78  PHE C CG  1 
ATOM   5706  C  CD1 . PHE C  1 78  ? 79.795 -32.145 -16.286  1.00 19.64 ? 78  PHE C CD1 1 
ATOM   5707  C  CD2 . PHE C  1 78  ? 81.816 -32.360 -15.035  1.00 20.08 ? 78  PHE C CD2 1 
ATOM   5708  C  CE1 . PHE C  1 78  ? 80.157 -33.221 -17.075  1.00 17.10 ? 78  PHE C CE1 1 
ATOM   5709  C  CE2 . PHE C  1 78  ? 82.184 -33.442 -15.816  1.00 19.54 ? 78  PHE C CE2 1 
ATOM   5710  C  CZ  . PHE C  1 78  ? 81.355 -33.870 -16.839  1.00 20.77 ? 78  PHE C CZ  1 
ATOM   5711  N  N   . MET C  1 79  ? 79.338 -28.364 -16.520  1.00 18.07 ? 79  MET C N   1 
ATOM   5712  C  CA  . MET C  1 79  ? 78.939 -27.960 -17.867  1.00 20.54 ? 79  MET C CA  1 
ATOM   5713  C  C   . MET C  1 79  ? 79.848 -26.852 -18.425  1.00 21.71 ? 79  MET C C   1 
ATOM   5714  O  O   . MET C  1 79  ? 80.280 -26.913 -19.577  1.00 20.35 ? 79  MET C O   1 
ATOM   5715  C  CB  . MET C  1 79  ? 77.467 -27.536 -17.883  1.00 21.69 ? 79  MET C CB  1 
ATOM   5716  C  CG  . MET C  1 79  ? 76.498 -28.649 -17.489  1.00 24.29 ? 79  MET C CG  1 
ATOM   5717  S  SD  . MET C  1 79  ? 74.793 -28.064 -17.322  1.00 26.86 ? 79  MET C SD  1 
ATOM   5718  C  CE  . MET C  1 79  ? 73.890 -29.604 -17.454  1.00 41.36 ? 79  MET C CE  1 
ATOM   5719  N  N   . GLU C  1 80  ? 80.151 -25.855 -17.600  1.00 19.77 ? 80  GLU C N   1 
ATOM   5720  C  CA  . GLU C  1 80  ? 81.076 -24.788 -17.982  1.00 22.09 ? 80  GLU C CA  1 
ATOM   5721  C  C   . GLU C  1 80  ? 82.401 -25.329 -18.510  1.00 22.71 ? 80  GLU C C   1 
ATOM   5722  O  O   . GLU C  1 80  ? 82.897 -24.872 -19.539  1.00 24.66 ? 80  GLU C O   1 
ATOM   5723  C  CB  . GLU C  1 80  ? 81.356 -23.868 -16.791  1.00 26.76 ? 80  GLU C CB  1 
ATOM   5724  C  CG  . GLU C  1 80  ? 80.392 -22.705 -16.631  1.00 34.16 ? 80  GLU C CG  1 
ATOM   5725  C  CD  . GLU C  1 80  ? 80.678 -21.876 -15.386  1.00 42.27 ? 80  GLU C CD  1 
ATOM   5726  O  OE1 . GLU C  1 80  ? 81.284 -22.409 -14.429  1.00 40.17 ? 80  GLU C OE1 1 
ATOM   5727  O  OE2 . GLU C  1 80  ? 80.288 -20.690 -15.358  1.00 37.55 ? 80  GLU C OE2 1 
ATOM   5728  N  N   . LYS C  1 81  ? 82.976 -26.295 -17.801  1.00 22.28 ? 81  LYS C N   1 
ATOM   5729  C  CA  . LYS C  1 81  ? 84.262 -26.875 -18.196  1.00 23.04 ? 81  LYS C CA  1 
ATOM   5730  C  C   . LYS C  1 81  ? 84.175 -27.596 -19.533  1.00 23.32 ? 81  LYS C C   1 
ATOM   5731  O  O   . LYS C  1 81  ? 85.089 -27.506 -20.354  1.00 22.94 ? 81  LYS C O   1 
ATOM   5732  C  CB  . LYS C  1 81  ? 84.775 -27.840 -17.126  1.00 26.90 ? 81  LYS C CB  1 
ATOM   5733  C  CG  . LYS C  1 81  ? 85.009 -27.196 -15.774  1.00 26.52 ? 81  LYS C CG  1 
ATOM   5734  C  CD  . LYS C  1 81  ? 85.330 -28.246 -14.720  1.00 30.72 ? 81  LYS C CD  1 
ATOM   5735  C  CE  . LYS C  1 81  ? 85.664 -27.599 -13.384  1.00 34.32 ? 81  LYS C CE  1 
ATOM   5736  N  NZ  . LYS C  1 81  ? 86.106 -28.607 -12.382  1.00 44.21 ? 81  LYS C NZ  1 
ATOM   5737  N  N   . VAL C  1 82  ? 83.085 -28.324 -19.751  1.00 19.48 ? 82  VAL C N   1 
ATOM   5738  C  CA  . VAL C  1 82  ? 82.889 -28.985 -21.032  1.00 19.26 ? 82  VAL C CA  1 
ATOM   5739  C  C   . VAL C  1 82  ? 82.798 -27.968 -22.169  1.00 20.23 ? 82  VAL C C   1 
ATOM   5740  O  O   . VAL C  1 82  ? 83.429 -28.145 -23.214  1.00 20.19 ? 82  VAL C O   1 
ATOM   5741  C  CB  . VAL C  1 82  ? 81.641 -29.887 -21.041  1.00 19.82 ? 82  VAL C CB  1 
ATOM   5742  C  CG1 . VAL C  1 82  ? 81.415 -30.438 -22.443  1.00 20.07 ? 82  VAL C CG1 1 
ATOM   5743  C  CG2 . VAL C  1 82  ? 81.804 -31.022 -20.041  1.00 19.17 ? 82  VAL C CG2 1 
ATOM   5744  N  N   . VAL C  1 83  ? 82.022 -26.901 -21.973  1.00 18.47 ? 83  VAL C N   1 
ATOM   5745  C  CA  . VAL C  1 83  ? 81.950 -25.847 -22.984  1.00 20.53 ? 83  VAL C CA  1 
ATOM   5746  C  C   . VAL C  1 83  ? 83.336 -25.266 -23.265  1.00 23.40 ? 83  VAL C C   1 
ATOM   5747  O  O   . VAL C  1 83  ? 83.738 -25.133 -24.417  1.00 27.61 ? 83  VAL C O   1 
ATOM   5748  C  CB  . VAL C  1 83  ? 80.989 -24.710 -22.589  1.00 18.73 ? 83  VAL C CB  1 
ATOM   5749  C  CG1 . VAL C  1 83  ? 81.114 -23.550 -23.572  1.00 20.71 ? 83  VAL C CG1 1 
ATOM   5750  C  CG2 . VAL C  1 83  ? 79.556 -25.228 -22.537  1.00 17.55 ? 83  VAL C CG2 1 
ATOM   5751  N  N   . LYS C  1 84  ? 84.061 -24.921 -22.206  1.00 25.44 ? 84  LYS C N   1 
ATOM   5752  C  CA  . LYS C  1 84  ? 85.412 -24.390 -22.348  1.00 28.89 ? 84  LYS C CA  1 
ATOM   5753  C  C   . LYS C  1 84  ? 86.273 -25.288 -23.230  1.00 29.42 ? 84  LYS C C   1 
ATOM   5754  O  O   . LYS C  1 84  ? 87.020 -24.808 -24.079  1.00 29.38 ? 84  LYS C O   1 
ATOM   5755  C  CB  . LYS C  1 84  ? 86.074 -24.258 -20.975  1.00 34.28 ? 84  LYS C CB  1 
ATOM   5756  C  CG  . LYS C  1 84  ? 85.821 -22.943 -20.265  1.00 40.83 ? 84  LYS C CG  1 
ATOM   5757  C  CD  . LYS C  1 84  ? 87.034 -22.038 -20.362  1.00 50.62 ? 84  LYS C CD  1 
ATOM   5758  C  CE  . LYS C  1 84  ? 87.073 -21.066 -19.194  1.00 58.53 ? 84  LYS C CE  1 
ATOM   5759  N  NZ  . LYS C  1 84  ? 88.345 -20.295 -19.164  1.00 71.12 ? 84  LYS C NZ  1 
ATOM   5760  N  N   . ALA C  1 85  ? 86.168 -26.595 -23.018  1.00 25.91 ? 85  ALA C N   1 
ATOM   5761  C  CA  . ALA C  1 85  ? 87.037 -27.547 -23.695  1.00 26.88 ? 85  ALA C CA  1 
ATOM   5762  C  C   . ALA C  1 85  ? 86.570 -27.918 -25.108  1.00 30.02 ? 85  ALA C C   1 
ATOM   5763  O  O   . ALA C  1 85  ? 87.291 -28.597 -25.843  1.00 28.79 ? 85  ALA C O   1 
ATOM   5764  C  CB  . ALA C  1 85  ? 87.210 -28.793 -22.838  1.00 25.43 ? 85  ALA C CB  1 
ATOM   5765  N  N   . THR C  1 86  ? 85.374 -27.476 -25.495  1.00 23.72 ? 86  THR C N   1 
ATOM   5766  C  CA  . THR C  1 86  ? 84.814 -27.870 -26.791  1.00 25.10 ? 86  THR C CA  1 
ATOM   5767  C  C   . THR C  1 86  ? 84.315 -26.708 -27.652  1.00 23.41 ? 86  THR C C   1 
ATOM   5768  O  O   . THR C  1 86  ? 84.339 -26.789 -28.875  1.00 23.20 ? 86  THR C O   1 
ATOM   5769  C  CB  . THR C  1 86  ? 83.635 -28.854 -26.625  1.00 26.65 ? 86  THR C CB  1 
ATOM   5770  O  OG1 . THR C  1 86  ? 82.583 -28.219 -25.887  1.00 21.84 ? 86  THR C OG1 1 
ATOM   5771  C  CG2 . THR C  1 86  ? 84.076 -30.122 -25.903  1.00 23.81 ? 86  THR C CG2 1 
ATOM   5772  N  N   . GLY C  1 87  ? 83.829 -25.646 -27.015  1.00 24.25 ? 87  GLY C N   1 
ATOM   5773  C  CA  . GLY C  1 87  ? 83.225 -24.534 -27.744  1.00 24.44 ? 87  GLY C CA  1 
ATOM   5774  C  C   . GLY C  1 87  ? 81.787 -24.788 -28.187  1.00 23.34 ? 87  GLY C C   1 
ATOM   5775  O  O   . GLY C  1 87  ? 81.226 -24.021 -28.968  1.00 23.37 ? 87  GLY C O   1 
ATOM   5776  N  N   . ILE C  1 88  ? 81.182 -25.859 -27.691  1.00 22.07 ? 88  ILE C N   1 
ATOM   5777  C  CA  . ILE C  1 88  ? 79.788 -26.164 -28.018  1.00 20.88 ? 88  ILE C CA  1 
ATOM   5778  C  C   . ILE C  1 88  ? 78.842 -25.081 -27.486  1.00 19.93 ? 88  ILE C C   1 
ATOM   5779  O  O   . ILE C  1 88  ? 79.130 -24.453 -26.465  1.00 19.86 ? 88  ILE C O   1 
ATOM   5780  C  CB  . ILE C  1 88  ? 79.380 -27.533 -27.433  1.00 19.86 ? 88  ILE C CB  1 
ATOM   5781  C  CG1 . ILE C  1 88  ? 78.064 -28.025 -28.036  1.00 17.58 ? 88  ILE C CG1 1 
ATOM   5782  C  CG2 . ILE C  1 88  ? 79.280 -27.466 -25.911  1.00 19.80 ? 88  ILE C CG2 1 
ATOM   5783  C  CD1 . ILE C  1 88  ? 78.163 -28.415 -29.493  1.00 17.70 ? 88  ILE C CD1 1 
ATOM   5784  N  N   . ASN C  1 89  ? 77.741 -24.835 -28.201  1.00 19.09 ? 89  ASN C N   1 
ATOM   5785  C  CA  . ASN C  1 89  ? 76.605 -24.101 -27.636  1.00 17.73 ? 89  ASN C CA  1 
ATOM   5786  C  C   . ASN C  1 89  ? 75.829 -25.063 -26.743  1.00 18.17 ? 89  ASN C C   1 
ATOM   5787  O  O   . ASN C  1 89  ? 75.291 -26.070 -27.213  1.00 17.73 ? 89  ASN C O   1 
ATOM   5788  C  CB  . ASN C  1 89  ? 75.654 -23.591 -28.721  1.00 17.72 ? 89  ASN C CB  1 
ATOM   5789  C  CG  . ASN C  1 89  ? 76.189 -22.391 -29.481  1.00 21.94 ? 89  ASN C CG  1 
ATOM   5790  O  OD1 . ASN C  1 89  ? 77.185 -21.773 -29.105  1.00 19.26 ? 89  ASN C OD1 1 
ATOM   5791  N  ND2 . ASN C  1 89  ? 75.509 -22.054 -30.574  1.00 20.87 ? 89  ASN C ND2 1 
ATOM   5792  N  N   . LEU C  1 90  ? 75.778 -24.769 -25.455  1.00 17.82 ? 90  LEU C N   1 
ATOM   5793  C  CA  . LEU C  1 90  ? 75.100 -25.655 -24.514  1.00 17.13 ? 90  LEU C CA  1 
ATOM   5794  C  C   . LEU C  1 90  ? 73.977 -24.908 -23.809  1.00 18.09 ? 90  LEU C C   1 
ATOM   5795  O  O   . LEU C  1 90  ? 74.208 -23.889 -23.153  1.00 17.45 ? 90  LEU C O   1 
ATOM   5796  C  CB  . LEU C  1 90  ? 76.101 -26.205 -23.489  1.00 17.19 ? 90  LEU C CB  1 
ATOM   5797  C  CG  . LEU C  1 90  ? 75.586 -27.240 -22.486  1.00 18.07 ? 90  LEU C CG  1 
ATOM   5798  C  CD1 . LEU C  1 90  ? 75.200 -28.543 -23.181  1.00 17.15 ? 90  LEU C CD1 1 
ATOM   5799  C  CD2 . LEU C  1 90  ? 76.645 -27.481 -21.421  1.00 18.89 ? 90  LEU C CD2 1 
ATOM   5800  N  N   . VAL C  1 91  ? 72.756 -25.410 -23.962  1.00 19.07 ? 91  VAL C N   1 
ATOM   5801  C  CA  . VAL C  1 91  ? 71.610 -24.846 -23.263  1.00 15.44 ? 91  VAL C CA  1 
ATOM   5802  C  C   . VAL C  1 91  ? 71.327 -25.667 -22.013  1.00 17.00 ? 91  VAL C C   1 
ATOM   5803  O  O   . VAL C  1 91  ? 71.052 -26.875 -22.090  1.00 15.82 ? 91  VAL C O   1 
ATOM   5804  C  CB  . VAL C  1 91  ? 70.349 -24.824 -24.149  1.00 16.22 ? 91  VAL C CB  1 
ATOM   5805  C  CG1 . VAL C  1 91  ? 69.240 -24.035 -23.463  1.00 17.74 ? 91  VAL C CG1 1 
ATOM   5806  C  CG2 . VAL C  1 91  ? 70.671 -24.217 -25.509  1.00 13.71 ? 91  VAL C CG2 1 
ATOM   5807  N  N   . ALA C  1 92  ? 71.413 -25.010 -20.861  1.00 15.53 ? 92  ALA C N   1 
ATOM   5808  C  CA  . ALA C  1 92  ? 71.108 -25.648 -19.594  1.00 16.43 ? 92  ALA C CA  1 
ATOM   5809  C  C   . ALA C  1 92  ? 69.689 -25.306 -19.204  1.00 16.73 ? 92  ALA C C   1 
ATOM   5810  O  O   . ALA C  1 92  ? 69.132 -24.298 -19.648  1.00 18.02 ? 92  ALA C O   1 
ATOM   5811  C  CB  . ALA C  1 92  ? 72.076 -25.179 -18.513  1.00 17.17 ? 92  ALA C CB  1 
ATOM   5812  N  N   . GLY C  1 93  ? 69.109 -26.136 -18.351  1.00 16.18 ? 93  GLY C N   1 
ATOM   5813  C  CA  . GLY C  1 93  ? 67.730 -25.952 -17.957  1.00 17.51 ? 93  GLY C CA  1 
ATOM   5814  C  C   . GLY C  1 93  ? 67.562 -25.902 -16.460  1.00 16.64 ? 93  GLY C C   1 
ATOM   5815  O  O   . GLY C  1 93  ? 68.517 -26.064 -15.698  1.00 17.13 ? 93  GLY C O   1 
ATOM   5816  N  N   . THR C  1 94  ? 66.330 -25.668 -16.047  1.00 14.35 ? 94  THR C N   1 
ATOM   5817  C  CA  . THR C  1 94  ? 65.962 -25.787 -14.663  1.00 17.00 ? 94  THR C CA  1 
ATOM   5818  C  C   . THR C  1 94  ? 64.746 -26.694 -14.621  1.00 15.25 ? 94  THR C C   1 
ATOM   5819  O  O   . THR C  1 94  ? 64.243 -27.116 -15.668  1.00 14.79 ? 94  THR C O   1 
ATOM   5820  C  CB  . THR C  1 94  ? 65.630 -24.416 -14.041  1.00 17.72 ? 94  THR C CB  1 
ATOM   5821  O  OG1 . THR C  1 94  ? 65.369 -24.590 -12.647  1.00 15.88 ? 94  THR C OG1 1 
ATOM   5822  C  CG2 . THR C  1 94  ? 64.397 -23.792 -14.710  1.00 13.59 ? 94  THR C CG2 1 
ATOM   5823  N  N   . GLY C  1 95  ? 64.285 -27.016 -13.420  1.00 16.88 ? 95  GLY C N   1 
ATOM   5824  C  CA  . GLY C  1 95  ? 63.174 -27.947 -13.271  1.00 15.20 ? 95  GLY C CA  1 
ATOM   5825  C  C   . GLY C  1 95  ? 63.420 -29.028 -12.230  1.00 19.02 ? 95  GLY C C   1 
ATOM   5826  O  O   . GLY C  1 95  ? 64.396 -28.979 -11.466  1.00 20.25 ? 95  GLY C O   1 
ATOM   5827  N  N   . ILE C  1 96  ? 62.522 -30.007 -12.203  1.00 15.24 ? 96  ILE C N   1 
ATOM   5828  C  CA  . ILE C  1 96  ? 62.578 -31.079 -11.222  1.00 14.07 ? 96  ILE C CA  1 
ATOM   5829  C  C   . ILE C  1 96  ? 62.188 -32.386 -11.890  1.00 14.77 ? 96  ILE C C   1 
ATOM   5830  O  O   . ILE C  1 96  ? 61.154 -32.485 -12.554  1.00 16.95 ? 96  ILE C O   1 
ATOM   5831  C  CB  . ILE C  1 96  ? 61.650 -30.806 -10.020  1.00 15.00 ? 96  ILE C CB  1 
ATOM   5832  C  CG1 . ILE C  1 96  ? 62.180 -29.639 -9.185   1.00 16.78 ? 96  ILE C CG1 1 
ATOM   5833  C  CG2 . ILE C  1 96  ? 61.527 -32.036 -9.131   1.00 15.31 ? 96  ILE C CG2 1 
ATOM   5834  C  CD1 . ILE C  1 96  ? 61.242 -29.211 -8.069   1.00 15.01 ? 96  ILE C CD1 1 
ATOM   5835  N  N   . TYR C  1 97  ? 63.032 -33.387 -11.714  1.00 13.64 ? 97  TYR C N   1 
ATOM   5836  C  CA  . TYR C  1 97  ? 62.789 -34.701 -12.266  1.00 13.58 ? 97  TYR C CA  1 
ATOM   5837  C  C   . TYR C  1 97  ? 62.440 -35.646 -11.115  1.00 19.19 ? 97  TYR C C   1 
ATOM   5838  O  O   . TYR C  1 97  ? 63.316 -36.034 -10.338  1.00 17.01 ? 97  TYR C O   1 
ATOM   5839  C  CB  . TYR C  1 97  ? 64.058 -35.155 -12.980  1.00 15.94 ? 97  TYR C CB  1 
ATOM   5840  C  CG  . TYR C  1 97  ? 64.004 -36.476 -13.714  1.00 17.66 ? 97  TYR C CG  1 
ATOM   5841  C  CD1 . TYR C  1 97  ? 64.124 -37.676 -13.032  1.00 18.68 ? 97  TYR C CD1 1 
ATOM   5842  C  CD2 . TYR C  1 97  ? 63.905 -36.515 -15.101  1.00 18.37 ? 97  TYR C CD2 1 
ATOM   5843  C  CE1 . TYR C  1 97  ? 64.113 -38.889 -13.709  1.00 23.30 ? 97  TYR C CE1 1 
ATOM   5844  C  CE2 . TYR C  1 97  ? 63.893 -37.718 -15.787  1.00 18.59 ? 97  TYR C CE2 1 
ATOM   5845  C  CZ  . TYR C  1 97  ? 63.999 -38.902 -15.088  1.00 18.88 ? 97  TYR C CZ  1 
ATOM   5846  O  OH  . TYR C  1 97  ? 63.997 -40.103 -15.771  1.00 21.06 ? 97  TYR C OH  1 
ATOM   5847  N  N   . ILE C  1 98  ? 61.154 -35.978 -10.994  1.00 14.87 ? 98  ILE C N   1 
ATOM   5848  C  CA  . ILE C  1 98  ? 60.675 -36.942 -10.007  1.00 16.89 ? 98  ILE C CA  1 
ATOM   5849  C  C   . ILE C  1 98  ? 59.649 -37.865 -10.659  1.00 16.94 ? 98  ILE C C   1 
ATOM   5850  O  O   . ILE C  1 98  ? 59.015 -37.491 -11.652  1.00 16.46 ? 98  ILE C O   1 
ATOM   5851  C  CB  . ILE C  1 98  ? 60.004 -36.262 -8.797   1.00 18.13 ? 98  ILE C CB  1 
ATOM   5852  C  CG1 . ILE C  1 98  ? 58.824 -35.401 -9.254   1.00 15.96 ? 98  ILE C CG1 1 
ATOM   5853  C  CG2 . ILE C  1 98  ? 61.007 -35.439 -7.998   1.00 12.82 ? 98  ILE C CG2 1 
ATOM   5854  C  CD1 . ILE C  1 98  ? 57.903 -34.977 -8.126   1.00 16.99 ? 98  ILE C CD1 1 
ATOM   5855  N  N   . TYR C  1 99  ? 59.494 -39.066 -10.104  1.00 17.09 ? 99  TYR C N   1 
ATOM   5856  C  CA  . TYR C  1 99  ? 58.494 -40.028 -10.575  1.00 18.76 ? 99  TYR C CA  1 
ATOM   5857  C  C   . TYR C  1 99  ? 57.315 -40.143 -9.622   1.00 19.90 ? 99  TYR C C   1 
ATOM   5858  O  O   . TYR C  1 99  ? 56.208 -40.484 -10.037  1.00 19.48 ? 99  TYR C O   1 
ATOM   5859  C  CB  . TYR C  1 99  ? 59.113 -41.420 -10.725  1.00 20.69 ? 99  TYR C CB  1 
ATOM   5860  C  CG  . TYR C  1 99  ? 60.021 -41.587 -11.918  1.00 23.68 ? 99  TYR C CG  1 
ATOM   5861  C  CD1 . TYR C  1 99  ? 60.372 -40.504 -12.708  1.00 22.37 ? 99  TYR C CD1 1 
ATOM   5862  C  CD2 . TYR C  1 99  ? 60.551 -42.834 -12.236  1.00 24.06 ? 99  TYR C CD2 1 
ATOM   5863  C  CE1 . TYR C  1 99  ? 61.215 -40.652 -13.792  1.00 24.57 ? 99  TYR C CE1 1 
ATOM   5864  C  CE2 . TYR C  1 99  ? 61.397 -42.993 -13.314  1.00 21.75 ? 99  TYR C CE2 1 
ATOM   5865  C  CZ  . TYR C  1 99  ? 61.725 -41.901 -14.089  1.00 25.61 ? 99  TYR C CZ  1 
ATOM   5866  O  OH  . TYR C  1 99  ? 62.565 -42.061 -15.165  1.00 25.13 ? 99  TYR C OH  1 
ATOM   5867  N  N   . ILE C  1 100 ? 57.551 -39.892 -8.339   1.00 18.16 ? 100 ILE C N   1 
ATOM   5868  C  CA  . ILE C  1 100 ? 56.515 -40.111 -7.334   1.00 18.70 ? 100 ILE C CA  1 
ATOM   5869  C  C   . ILE C  1 100 ? 56.281 -38.884 -6.451   1.00 19.46 ? 100 ILE C C   1 
ATOM   5870  O  O   . ILE C  1 100 ? 55.294 -38.150 -6.629   1.00 21.09 ? 100 ILE C O   1 
ATOM   5871  C  CB  . ILE C  1 100 ? 56.830 -41.345 -6.453   1.00 19.71 ? 100 ILE C CB  1 
ATOM   5872  C  CG1 . ILE C  1 100 ? 57.208 -42.544 -7.332   1.00 22.61 ? 100 ILE C CG1 1 
ATOM   5873  C  CG2 . ILE C  1 100 ? 55.636 -41.701 -5.572   1.00 20.32 ? 100 ILE C CG2 1 
ATOM   5874  C  CD1 . ILE C  1 100 ? 57.314 -43.852 -6.576   1.00 22.48 ? 100 ILE C CD1 1 
ATOM   5875  N  N   . ASP C  1 101 ? 57.187 -38.669 -5.502   1.00 18.82 ? 101 ASP C N   1 
ATOM   5876  C  CA  . ASP C  1 101 ? 57.070 -37.567 -4.556   1.00 19.04 ? 101 ASP C CA  1 
ATOM   5877  C  C   . ASP C  1 101 ? 58.238 -36.589 -4.676   1.00 18.05 ? 101 ASP C C   1 
ATOM   5878  O  O   . ASP C  1 101 ? 59.327 -36.946 -5.121   1.00 17.29 ? 101 ASP C O   1 
ATOM   5879  C  CB  . ASP C  1 101 ? 56.992 -38.102 -3.122   1.00 22.92 ? 101 ASP C CB  1 
ATOM   5880  C  CG  . ASP C  1 101 ? 55.660 -38.771 -2.820   1.00 36.36 ? 101 ASP C CG  1 
ATOM   5881  O  OD1 . ASP C  1 101 ? 54.747 -38.705 -3.672   1.00 35.31 ? 101 ASP C OD1 1 
ATOM   5882  O  OD2 . ASP C  1 101 ? 55.519 -39.357 -1.724   1.00 46.37 ? 101 ASP C OD2 1 
ATOM   5883  N  N   . LEU C  1 102 ? 57.989 -35.351 -4.278   1.00 18.22 ? 102 LEU C N   1 
ATOM   5884  C  CA  . LEU C  1 102 ? 59.022 -34.335 -4.175   1.00 16.25 ? 102 LEU C CA  1 
ATOM   5885  C  C   . LEU C  1 102 ? 59.938 -34.649 -2.994   1.00 17.56 ? 102 LEU C C   1 
ATOM   5886  O  O   . LEU C  1 102 ? 59.551 -35.382 -2.084   1.00 16.44 ? 102 LEU C O   1 
ATOM   5887  C  CB  . LEU C  1 102 ? 58.365 -32.966 -3.965   1.00 15.64 ? 102 LEU C CB  1 
ATOM   5888  C  CG  . LEU C  1 102 ? 57.808 -32.291 -5.226   1.00 16.44 ? 102 LEU C CG  1 
ATOM   5889  C  CD1 . LEU C  1 102 ? 56.765 -31.240 -4.869   1.00 18.83 ? 102 LEU C CD1 1 
ATOM   5890  C  CD2 . LEU C  1 102 ? 58.946 -31.663 -6.016   1.00 16.28 ? 102 LEU C CD2 1 
ATOM   5891  N  N   . PRO C  1 103 ? 61.163 -34.102 -3.007   1.00 17.19 ? 103 PRO C N   1 
ATOM   5892  C  CA  . PRO C  1 103 ? 61.979 -34.170 -1.811   1.00 18.09 ? 103 PRO C CA  1 
ATOM   5893  C  C   . PRO C  1 103 ? 61.234 -33.559 -0.624   1.00 19.63 ? 103 PRO C C   1 
ATOM   5894  O  O   . PRO C  1 103 ? 60.348 -32.713 -0.807   1.00 15.96 ? 103 PRO C O   1 
ATOM   5895  C  CB  . PRO C  1 103 ? 63.202 -33.325 -2.183   1.00 20.98 ? 103 PRO C CB  1 
ATOM   5896  C  CG  . PRO C  1 103 ? 63.330 -33.515 -3.667   1.00 17.24 ? 103 PRO C CG  1 
ATOM   5897  C  CD  . PRO C  1 103 ? 61.909 -33.564 -4.162   1.00 16.76 ? 103 PRO C CD  1 
ATOM   5898  N  N   . PHE C  1 104 ? 61.591 -33.997 0.581    1.00 18.82 ? 104 PHE C N   1 
ATOM   5899  C  CA  . PHE C  1 104 ? 60.920 -33.568 1.805    1.00 21.01 ? 104 PHE C CA  1 
ATOM   5900  C  C   . PHE C  1 104 ? 60.946 -32.052 1.979    1.00 18.78 ? 104 PHE C C   1 
ATOM   5901  O  O   . PHE C  1 104 ? 60.086 -31.473 2.649    1.00 18.56 ? 104 PHE C O   1 
ATOM   5902  C  CB  . PHE C  1 104 ? 61.553 -34.258 3.021    1.00 23.24 ? 104 PHE C CB  1 
ATOM   5903  C  CG  . PHE C  1 104 ? 61.461 -35.760 2.978    1.00 30.21 ? 104 PHE C CG  1 
ATOM   5904  C  CD1 . PHE C  1 104 ? 60.226 -36.392 2.908    1.00 29.95 ? 104 PHE C CD1 1 
ATOM   5905  C  CD2 . PHE C  1 104 ? 62.606 -36.542 3.014    1.00 34.78 ? 104 PHE C CD2 1 
ATOM   5906  C  CE1 . PHE C  1 104 ? 60.136 -37.773 2.873    1.00 32.14 ? 104 PHE C CE1 1 
ATOM   5907  C  CE2 . PHE C  1 104 ? 62.522 -37.925 2.977    1.00 33.18 ? 104 PHE C CE2 1 
ATOM   5908  C  CZ  . PHE C  1 104 ? 61.285 -38.541 2.907    1.00 26.76 ? 104 PHE C CZ  1 
ATOM   5909  N  N   . TYR C  1 105 ? 61.936 -31.405 1.377    1.00 18.35 ? 105 TYR C N   1 
ATOM   5910  C  CA  . TYR C  1 105 ? 62.011 -29.950 1.423    1.00 18.98 ? 105 TYR C CA  1 
ATOM   5911  C  C   . TYR C  1 105 ? 60.657 -29.323 1.082    1.00 16.39 ? 105 TYR C C   1 
ATOM   5912  O  O   . TYR C  1 105 ? 60.255 -28.306 1.657    1.00 20.07 ? 105 TYR C O   1 
ATOM   5913  C  CB  . TYR C  1 105 ? 63.067 -29.430 0.447    1.00 17.58 ? 105 TYR C CB  1 
ATOM   5914  C  CG  . TYR C  1 105 ? 62.996 -27.930 0.282    1.00 19.32 ? 105 TYR C CG  1 
ATOM   5915  C  CD1 . TYR C  1 105 ? 63.592 -27.093 1.211    1.00 19.65 ? 105 TYR C CD1 1 
ATOM   5916  C  CD2 . TYR C  1 105 ? 62.307 -27.348 -0.786   1.00 19.61 ? 105 TYR C CD2 1 
ATOM   5917  C  CE1 . TYR C  1 105 ? 63.524 -25.719 1.088    1.00 23.68 ? 105 TYR C CE1 1 
ATOM   5918  C  CE2 . TYR C  1 105 ? 62.232 -25.965 -0.919   1.00 20.79 ? 105 TYR C CE2 1 
ATOM   5919  C  CZ  . TYR C  1 105 ? 62.843 -25.158 0.029    1.00 22.28 ? 105 TYR C CZ  1 
ATOM   5920  O  OH  . TYR C  1 105 ? 62.793 -23.789 -0.058   1.00 21.79 ? 105 TYR C OH  1 
ATOM   5921  N  N   . PHE C  1 106 ? 59.946 -29.946 0.155    1.00 17.04 ? 106 PHE C N   1 
ATOM   5922  C  CA  . PHE C  1 106 ? 58.752 -29.336 -0.417   1.00 18.54 ? 106 PHE C CA  1 
ATOM   5923  C  C   . PHE C  1 106 ? 57.478 -29.603 0.369    1.00 20.50 ? 106 PHE C C   1 
ATOM   5924  O  O   . PHE C  1 106 ? 56.403 -29.158 -0.032   1.00 23.69 ? 106 PHE C O   1 
ATOM   5925  C  CB  . PHE C  1 106 ? 58.575 -29.770 -1.872   1.00 18.19 ? 106 PHE C CB  1 
ATOM   5926  C  CG  . PHE C  1 106 ? 59.666 -29.279 -2.777   1.00 17.34 ? 106 PHE C CG  1 
ATOM   5927  C  CD1 . PHE C  1 106 ? 60.769 -30.071 -3.041   1.00 14.97 ? 106 PHE C CD1 1 
ATOM   5928  C  CD2 . PHE C  1 106 ? 59.594 -28.019 -3.344   1.00 17.99 ? 106 PHE C CD2 1 
ATOM   5929  C  CE1 . PHE C  1 106 ? 61.777 -29.617 -3.868   1.00 17.26 ? 106 PHE C CE1 1 
ATOM   5930  C  CE2 . PHE C  1 106 ? 60.598 -27.555 -4.170   1.00 20.33 ? 106 PHE C CE2 1 
ATOM   5931  C  CZ  . PHE C  1 106 ? 61.694 -28.357 -4.428   1.00 15.96 ? 106 PHE C CZ  1 
ATOM   5932  N  N   . LEU C  1 107 ? 57.593 -30.328 1.477    1.00 20.03 ? 107 LEU C N   1 
ATOM   5933  C  CA  . LEU C  1 107 ? 56.447 -30.524 2.358    1.00 25.83 ? 107 LEU C CA  1 
ATOM   5934  C  C   . LEU C  1 107 ? 55.901 -29.169 2.757    1.00 23.94 ? 107 LEU C C   1 
ATOM   5935  O  O   . LEU C  1 107 ? 56.652 -28.298 3.216    1.00 22.82 ? 107 LEU C O   1 
ATOM   5936  C  CB  . LEU C  1 107 ? 56.840 -31.306 3.613    1.00 26.21 ? 107 LEU C CB  1 
ATOM   5937  C  CG  . LEU C  1 107 ? 56.450 -32.784 3.714    1.00 39.55 ? 107 LEU C CG  1 
ATOM   5938  C  CD1 . LEU C  1 107 ? 55.966 -33.356 2.391    1.00 38.16 ? 107 LEU C CD1 1 
ATOM   5939  C  CD2 . LEU C  1 107 ? 57.599 -33.606 4.285    1.00 31.38 ? 107 LEU C CD2 1 
ATOM   5940  N  N   . ASN C  1 108 ? 54.596 -28.992 2.579    1.00 23.34 ? 108 ASN C N   1 
ATOM   5941  C  CA  . ASN C  1 108 ? 53.935 -27.740 2.937    1.00 26.80 ? 108 ASN C CA  1 
ATOM   5942  C  C   . ASN C  1 108 ? 54.546 -26.520 2.259    1.00 31.51 ? 108 ASN C C   1 
ATOM   5943  O  O   . ASN C  1 108 ? 54.653 -25.453 2.867    1.00 34.03 ? 108 ASN C O   1 
ATOM   5944  C  CB  . ASN C  1 108 ? 53.929 -27.552 4.454    1.00 26.14 ? 108 ASN C CB  1 
ATOM   5945  C  CG  . ASN C  1 108 ? 53.173 -28.655 5.164    1.00 33.15 ? 108 ASN C CG  1 
ATOM   5946  O  OD1 . ASN C  1 108 ? 53.733 -29.394 5.973    1.00 36.15 ? 108 ASN C OD1 1 
ATOM   5947  N  ND2 . ASN C  1 108 ? 51.897 -28.791 4.836    1.00 36.46 ? 108 ASN C ND2 1 
ATOM   5948  N  N   . ARG C  1 109 ? 54.961 -26.687 1.008    1.00 23.94 ? 109 ARG C N   1 
ATOM   5949  C  CA  . ARG C  1 109 ? 55.346 -25.544 0.179    1.00 30.21 ? 109 ARG C CA  1 
ATOM   5950  C  C   . ARG C  1 109 ? 54.446 -25.501 -1.057   1.00 24.49 ? 109 ARG C C   1 
ATOM   5951  O  O   . ARG C  1 109 ? 54.005 -26.531 -1.548   1.00 24.25 ? 109 ARG C O   1 
ATOM   5952  C  CB  . ARG C  1 109 ? 56.831 -25.609 -0.206   1.00 26.00 ? 109 ARG C CB  1 
ATOM   5953  C  CG  . ARG C  1 109 ? 57.765 -25.639 1.000    1.00 23.63 ? 109 ARG C CG  1 
ATOM   5954  C  CD  . ARG C  1 109 ? 59.219 -25.449 0.595    1.00 27.01 ? 109 ARG C CD  1 
ATOM   5955  N  NE  . ARG C  1 109 ? 60.116 -25.440 1.750    1.00 25.59 ? 109 ARG C NE  1 
ATOM   5956  C  CZ  . ARG C  1 109 ? 60.418 -24.349 2.447    1.00 28.36 ? 109 ARG C CZ  1 
ATOM   5957  N  NH1 . ARG C  1 109 ? 61.241 -24.422 3.487    1.00 23.56 ? 109 ARG C NH1 1 
ATOM   5958  N  NH2 . ARG C  1 109 ? 59.897 -23.181 2.103    1.00 23.21 ? 109 ARG C NH2 1 
ATOM   5959  N  N   . SER C  1 110 ? 54.164 -24.304 -1.546   1.00 27.10 ? 110 SER C N   1 
ATOM   5960  C  CA  . SER C  1 110 ? 53.178 -24.135 -2.598   1.00 22.66 ? 110 SER C CA  1 
ATOM   5961  C  C   . SER C  1 110 ? 53.769 -24.350 -3.986   1.00 24.18 ? 110 SER C C   1 
ATOM   5962  O  O   . SER C  1 110 ? 54.985 -24.382 -4.165   1.00 22.50 ? 110 SER C O   1 
ATOM   5963  C  CB  . SER C  1 110 ? 52.609 -22.728 -2.533   1.00 24.09 ? 110 SER C CB  1 
ATOM   5964  O  OG  . SER C  1 110 ? 53.640 -21.787 -2.775   1.00 26.91 ? 110 SER C OG  1 
ATOM   5965  N  N   . ILE C  1 111 ? 52.890 -24.474 -4.973   1.00 21.59 ? 111 ILE C N   1 
ATOM   5966  C  CA  . ILE C  1 111 ? 53.317 -24.531 -6.356   1.00 21.10 ? 111 ILE C CA  1 
ATOM   5967  C  C   . ILE C  1 111 ? 54.099 -23.259 -6.711   1.00 23.11 ? 111 ILE C C   1 
ATOM   5968  O  O   . ILE C  1 111 ? 55.085 -23.316 -7.454   1.00 17.28 ? 111 ILE C O   1 
ATOM   5969  C  CB  . ILE C  1 111 ? 52.115 -24.758 -7.297   1.00 23.22 ? 111 ILE C CB  1 
ATOM   5970  C  CG1 . ILE C  1 111 ? 51.528 -26.160 -7.063   1.00 23.79 ? 111 ILE C CG1 1 
ATOM   5971  C  CG2 . ILE C  1 111 ? 52.532 -24.600 -8.752   1.00 23.98 ? 111 ILE C CG2 1 
ATOM   5972  C  CD1 . ILE C  1 111 ? 50.204 -26.411 -7.759   1.00 25.85 ? 111 ILE C CD1 1 
ATOM   5973  N  N   . ASP C  1 112 ? 53.671 -22.122 -6.156   1.00 20.64 ? 112 ASP C N   1 
ATOM   5974  C  CA  . ASP C  1 112 ? 54.369 -20.842 -6.349   1.00 22.95 ? 112 ASP C CA  1 
ATOM   5975  C  C   . ASP C  1 112 ? 55.828 -20.873 -5.887   1.00 21.45 ? 112 ASP C C   1 
ATOM   5976  O  O   . ASP C  1 112 ? 56.713 -20.371 -6.577   1.00 21.85 ? 112 ASP C O   1 
ATOM   5977  C  CB  . ASP C  1 112 ? 53.633 -19.696 -5.635   1.00 27.61 ? 112 ASP C CB  1 
ATOM   5978  C  CG  . ASP C  1 112 ? 52.488 -19.123 -6.460   1.00 33.92 ? 112 ASP C CG  1 
ATOM   5979  O  OD1 . ASP C  1 112 ? 51.829 -18.180 -5.979   1.00 44.69 ? 112 ASP C OD1 1 
ATOM   5980  O  OD2 . ASP C  1 112 ? 52.246 -19.602 -7.585   1.00 33.39 ? 112 ASP C OD2 1 
ATOM   5981  N  N   . GLU C  1 113 ? 56.082 -21.445 -4.716   1.00 21.63 ? 113 GLU C N   1 
ATOM   5982  C  CA  . GLU C  1 113 ? 57.461 -21.591 -4.237   1.00 20.50 ? 113 GLU C CA  1 
ATOM   5983  C  C   . GLU C  1 113 ? 58.326 -22.425 -5.188   1.00 18.30 ? 113 GLU C C   1 
ATOM   5984  O  O   . GLU C  1 113 ? 59.496 -22.104 -5.420   1.00 19.13 ? 113 GLU C O   1 
ATOM   5985  C  CB  . GLU C  1 113 ? 57.490 -22.222 -2.846   1.00 24.06 ? 113 GLU C CB  1 
ATOM   5986  C  CG  . GLU C  1 113 ? 57.057 -21.295 -1.725   1.00 30.62 ? 113 GLU C CG  1 
ATOM   5987  C  CD  . GLU C  1 113 ? 57.187 -21.958 -0.368   1.00 34.79 ? 113 GLU C CD  1 
ATOM   5988  O  OE1 . GLU C  1 113 ? 56.152 -22.180 0.291    1.00 37.47 ? 113 GLU C OE1 1 
ATOM   5989  O  OE2 . GLU C  1 113 ? 58.328 -22.273 0.027    1.00 36.95 ? 113 GLU C OE2 1 
ATOM   5990  N  N   . ILE C  1 114 ? 57.757 -23.505 -5.721   1.00 17.30 ? 114 ILE C N   1 
ATOM   5991  C  CA  . ILE C  1 114 ? 58.463 -24.334 -6.703   1.00 18.55 ? 114 ILE C CA  1 
ATOM   5992  C  C   . ILE C  1 114 ? 58.780 -23.531 -7.967   1.00 19.55 ? 114 ILE C C   1 
ATOM   5993  O  O   . ILE C  1 114 ? 59.911 -23.529 -8.443   1.00 19.85 ? 114 ILE C O   1 
ATOM   5994  C  CB  . ILE C  1 114 ? 57.643 -25.576 -7.095   1.00 19.23 ? 114 ILE C CB  1 
ATOM   5995  C  CG1 . ILE C  1 114 ? 57.250 -26.381 -5.859   1.00 17.88 ? 114 ILE C CG1 1 
ATOM   5996  C  CG2 . ILE C  1 114 ? 58.418 -26.456 -8.069   1.00 17.28 ? 114 ILE C CG2 1 
ATOM   5997  C  CD1 . ILE C  1 114 ? 56.448 -27.621 -6.186   1.00 18.07 ? 114 ILE C CD1 1 
ATOM   5998  N  N   . ALA C  1 115 ? 57.775 -22.846 -8.512   1.00 18.58 ? 115 ALA C N   1 
ATOM   5999  C  CA  . ALA C  1 115 ? 57.974 -22.044 -9.715   1.00 17.44 ? 115 ALA C CA  1 
ATOM   6000  C  C   . ALA C  1 115 ? 59.047 -20.972 -9.502   1.00 18.39 ? 115 ALA C C   1 
ATOM   6001  O  O   . ALA C  1 115 ? 59.810 -20.655 -10.421  1.00 17.98 ? 115 ALA C O   1 
ATOM   6002  C  CB  . ALA C  1 115 ? 56.656 -21.409 -10.151  1.00 16.38 ? 115 ALA C CB  1 
ATOM   6003  N  N   . ASP C  1 116 ? 59.092 -20.407 -8.296   1.00 20.06 ? 116 ASP C N   1 
ATOM   6004  C  CA  . ASP C  1 116 ? 60.088 -19.390 -7.950   1.00 19.33 ? 116 ASP C CA  1 
ATOM   6005  C  C   . ASP C  1 116 ? 61.510 -19.916 -8.123   1.00 17.28 ? 116 ASP C C   1 
ATOM   6006  O  O   . ASP C  1 116 ? 62.411 -19.183 -8.540   1.00 18.50 ? 116 ASP C O   1 
ATOM   6007  C  CB  . ASP C  1 116 ? 59.903 -18.916 -6.508   1.00 18.87 ? 116 ASP C CB  1 
ATOM   6008  C  CG  . ASP C  1 116 ? 58.771 -17.922 -6.357   1.00 22.78 ? 116 ASP C CG  1 
ATOM   6009  O  OD1 . ASP C  1 116 ? 58.386 -17.662 -5.201   1.00 24.23 ? 116 ASP C OD1 1 
ATOM   6010  O  OD2 . ASP C  1 116 ? 58.266 -17.403 -7.380   1.00 21.31 ? 116 ASP C OD2 1 
ATOM   6011  N  N   . LEU C  1 117 ? 61.716 -21.180 -7.773   1.00 18.42 ? 117 LEU C N   1 
ATOM   6012  C  CA  . LEU C  1 117 ? 63.014 -21.823 -7.974   1.00 17.34 ? 117 LEU C CA  1 
ATOM   6013  C  C   . LEU C  1 117 ? 63.389 -21.828 -9.453   1.00 15.30 ? 117 LEU C C   1 
ATOM   6014  O  O   . LEU C  1 117 ? 64.534 -21.548 -9.812   1.00 15.50 ? 117 LEU C O   1 
ATOM   6015  C  CB  . LEU C  1 117 ? 62.998 -23.265 -7.444   1.00 16.93 ? 117 LEU C CB  1 
ATOM   6016  C  CG  . LEU C  1 117 ? 62.741 -23.415 -5.944   1.00 20.10 ? 117 LEU C CG  1 
ATOM   6017  C  CD1 . LEU C  1 117 ? 62.746 -24.884 -5.550   1.00 17.88 ? 117 LEU C CD1 1 
ATOM   6018  C  CD2 . LEU C  1 117 ? 63.773 -22.635 -5.138   1.00 20.71 ? 117 LEU C CD2 1 
ATOM   6019  N  N   . PHE C  1 118 ? 62.421 -22.146 -10.309  1.00 16.71 ? 118 PHE C N   1 
ATOM   6020  C  CA  . PHE C  1 118 ? 62.677 -22.179 -11.751  1.00 16.56 ? 118 PHE C CA  1 
ATOM   6021  C  C   . PHE C  1 118 ? 62.979 -20.784 -12.278  1.00 16.42 ? 118 PHE C C   1 
ATOM   6022  O  O   . PHE C  1 118 ? 63.926 -20.587 -13.037  1.00 15.23 ? 118 PHE C O   1 
ATOM   6023  C  CB  . PHE C  1 118 ? 61.501 -22.788 -12.519  1.00 15.42 ? 118 PHE C CB  1 
ATOM   6024  C  CG  . PHE C  1 118 ? 61.108 -24.165 -12.048  1.00 16.82 ? 118 PHE C CG  1 
ATOM   6025  C  CD1 . PHE C  1 118 ? 61.999 -24.957 -11.339  1.00 18.08 ? 118 PHE C CD1 1 
ATOM   6026  C  CD2 . PHE C  1 118 ? 59.848 -24.676 -12.337  1.00 16.00 ? 118 PHE C CD2 1 
ATOM   6027  C  CE1 . PHE C  1 118 ? 61.631 -26.223 -10.906  1.00 16.65 ? 118 PHE C CE1 1 
ATOM   6028  C  CE2 . PHE C  1 118 ? 59.476 -25.936 -11.909  1.00 15.79 ? 118 PHE C CE2 1 
ATOM   6029  C  CZ  . PHE C  1 118 ? 60.373 -26.716 -11.196  1.00 16.49 ? 118 PHE C CZ  1 
ATOM   6030  N  N   . ILE C  1 119 ? 62.162 -19.818 -11.868  1.00 16.97 ? 119 ILE C N   1 
ATOM   6031  C  CA  . ILE C  1 119 ? 62.353 -18.434 -12.263  1.00 16.83 ? 119 ILE C CA  1 
ATOM   6032  C  C   . ILE C  1 119 ? 63.703 -17.894 -11.785  1.00 18.95 ? 119 ILE C C   1 
ATOM   6033  O  O   . ILE C  1 119 ? 64.385 -17.172 -12.513  1.00 17.40 ? 119 ILE C O   1 
ATOM   6034  C  CB  . ILE C  1 119 ? 61.193 -17.558 -11.755  1.00 18.66 ? 119 ILE C CB  1 
ATOM   6035  C  CG1 . ILE C  1 119 ? 59.892 -17.998 -12.447  1.00 20.05 ? 119 ILE C CG1 1 
ATOM   6036  C  CG2 . ILE C  1 119 ? 61.489 -16.082 -11.993  1.00 18.30 ? 119 ILE C CG2 1 
ATOM   6037  C  CD1 . ILE C  1 119 ? 58.633 -17.386 -11.866  1.00 21.97 ? 119 ILE C CD1 1 
ATOM   6038  N  N   . HIS C  1 120 ? 64.105 -18.255 -10.572  1.00 17.96 ? 120 HIS C N   1 
ATOM   6039  C  CA  . HIS C  1 120 ? 65.435 -17.883 -10.107  1.00 19.26 ? 120 HIS C CA  1 
ATOM   6040  C  C   . HIS C  1 120 ? 66.505 -18.351 -11.064  1.00 17.94 ? 120 HIS C C   1 
ATOM   6041  O  O   . HIS C  1 120 ? 67.383 -17.576 -11.457  1.00 17.16 ? 120 HIS C O   1 
ATOM   6042  C  CB  . HIS C  1 120 ? 65.689 -18.428 -8.701   1.00 18.45 ? 120 HIS C CB  1 
ATOM   6043  C  CG  . HIS C  1 120 ? 67.095 -18.197 -8.201   1.00 19.81 ? 120 HIS C CG  1 
ATOM   6044  N  ND1 . HIS C  1 120 ? 67.420 -17.171 -7.385   1.00 21.22 ? 120 HIS C ND1 1 
ATOM   6045  C  CD2 . HIS C  1 120 ? 68.275 -18.908 -8.428   1.00 18.64 ? 120 HIS C CD2 1 
ATOM   6046  C  CE1 . HIS C  1 120 ? 68.739 -17.226 -7.102   1.00 21.93 ? 120 HIS C CE1 1 
ATOM   6047  N  NE2 . HIS C  1 120 ? 69.259 -18.289 -7.747   1.00 19.94 ? 120 HIS C NE2 1 
ATOM   6048  N  N   . ASP C  1 121 ? 66.442 -19.621 -11.461  1.00 15.17 ? 121 ASP C N   1 
ATOM   6049  C  CA  . ASP C  1 121 ? 67.443 -20.177 -12.380  1.00 15.47 ? 121 ASP C CA  1 
ATOM   6050  C  C   . ASP C  1 121 ? 67.406 -19.498 -13.751  1.00 16.00 ? 121 ASP C C   1 
ATOM   6051  O  O   . ASP C  1 121 ? 68.436 -19.336 -14.398  1.00 17.14 ? 121 ASP C O   1 
ATOM   6052  C  CB  . ASP C  1 121 ? 67.252 -21.688 -12.547  1.00 14.95 ? 121 ASP C CB  1 
ATOM   6053  C  CG  . ASP C  1 121 ? 67.725 -22.477 -11.342  1.00 16.52 ? 121 ASP C CG  1 
ATOM   6054  O  OD1 . ASP C  1 121 ? 68.304 -21.867 -10.410  1.00 17.07 ? 121 ASP C OD1 1 
ATOM   6055  O  OD2 . ASP C  1 121 ? 67.514 -23.712 -11.322  1.00 18.32 ? 121 ASP C OD2 1 
ATOM   6056  N  N   . ILE C  1 122 ? 66.213 -19.124 -14.198  1.00 16.64 ? 122 ILE C N   1 
ATOM   6057  C  CA  . ILE C  1 122 ? 66.049 -18.479 -15.497  1.00 16.90 ? 122 ILE C CA  1 
ATOM   6058  C  C   . ILE C  1 122 ? 66.476 -17.007 -15.490  1.00 20.81 ? 122 ILE C C   1 
ATOM   6059  O  O   . ILE C  1 122 ? 67.155 -16.551 -16.413  1.00 20.01 ? 122 ILE C O   1 
ATOM   6060  C  CB  . ILE C  1 122 ? 64.590 -18.584 -15.984  1.00 18.78 ? 122 ILE C CB  1 
ATOM   6061  C  CG1 . ILE C  1 122 ? 64.193 -20.057 -16.147  1.00 16.00 ? 122 ILE C CG1 1 
ATOM   6062  C  CG2 . ILE C  1 122 ? 64.407 -17.833 -17.296  1.00 20.23 ? 122 ILE C CG2 1 
ATOM   6063  C  CD1 . ILE C  1 122 ? 62.700 -20.302 -16.023  1.00 17.31 ? 122 ILE C CD1 1 
ATOM   6064  N  N   . LYS C  1 123 ? 66.090 -16.266 -14.453  1.00 20.14 ? 123 LYS C N   1 
ATOM   6065  C  CA  . LYS C  1 123 ? 66.357 -14.826 -14.407  1.00 23.81 ? 123 LYS C CA  1 
ATOM   6066  C  C   . LYS C  1 123 ? 67.666 -14.455 -13.716  1.00 23.62 ? 123 LYS C C   1 
ATOM   6067  O  O   . LYS C  1 123 ? 68.358 -13.529 -14.142  1.00 24.70 ? 123 LYS C O   1 
ATOM   6068  C  CB  . LYS C  1 123 ? 65.205 -14.085 -13.719  1.00 27.71 ? 123 LYS C CB  1 
ATOM   6069  C  CG  . LYS C  1 123 ? 63.890 -14.135 -14.472  1.00 31.88 ? 123 LYS C CG  1 
ATOM   6070  C  CD  . LYS C  1 123 ? 62.849 -13.267 -13.785  1.00 38.01 ? 123 LYS C CD  1 
ATOM   6071  C  CE  . LYS C  1 123 ? 61.590 -13.149 -14.629  1.00 46.29 ? 123 LYS C CE  1 
ATOM   6072  N  NZ  . LYS C  1 123 ? 60.509 -12.431 -13.901  1.00 43.26 ? 123 LYS C NZ  1 
ATOM   6073  N  N   . GLU C  1 124 ? 67.989 -15.150 -12.630  1.00 23.75 ? 124 GLU C N   1 
ATOM   6074  C  CA  . GLU C  1 124 ? 69.171 -14.804 -11.834  1.00 24.92 ? 124 GLU C CA  1 
ATOM   6075  C  C   . GLU C  1 124 ? 70.382 -15.633 -12.255  1.00 26.33 ? 124 GLU C C   1 
ATOM   6076  O  O   . GLU C  1 124 ? 71.460 -15.099 -12.493  1.00 24.31 ? 124 GLU C O   1 
ATOM   6077  C  CB  . GLU C  1 124 ? 68.894 -14.998 -10.339  1.00 26.42 ? 124 GLU C CB  1 
ATOM   6078  C  CG  . GLU C  1 124 ? 67.788 -14.103 -9.792   1.00 28.94 ? 124 GLU C CG  1 
ATOM   6079  C  CD  . GLU C  1 124 ? 68.079 -12.632 -10.004  1.00 39.30 ? 124 GLU C CD  1 
ATOM   6080  O  OE1 . GLU C  1 124 ? 69.248 -12.226 -9.829   1.00 41.49 ? 124 GLU C OE1 1 
ATOM   6081  O  OE2 . GLU C  1 124 ? 67.141 -11.884 -10.347  1.00 45.79 ? 124 GLU C OE2 1 
ATOM   6082  N  N   . GLY C  1 125 ? 70.199 -16.945 -12.351  1.00 23.67 ? 125 GLY C N   1 
ATOM   6083  C  CA  . GLY C  1 125 ? 71.293 -17.826 -12.744  1.00 22.43 ? 125 GLY C CA  1 
ATOM   6084  C  C   . GLY C  1 125 ? 71.283 -19.139 -11.976  1.00 19.29 ? 125 GLY C C   1 
ATOM   6085  O  O   . GLY C  1 125 ? 70.555 -19.297 -11.001  1.00 20.75 ? 125 GLY C O   1 
ATOM   6086  N  N   . ILE C  1 126 ? 72.101 -20.082 -12.422  1.00 21.30 ? 126 ILE C N   1 
ATOM   6087  C  CA  . ILE C  1 126 ? 72.079 -21.438 -11.888  1.00 19.00 ? 126 ILE C CA  1 
ATOM   6088  C  C   . ILE C  1 126 ? 73.186 -21.674 -10.867  1.00 20.57 ? 126 ILE C C   1 
ATOM   6089  O  O   . ILE C  1 126 ? 74.349 -21.375 -11.130  1.00 22.19 ? 126 ILE C O   1 
ATOM   6090  C  CB  . ILE C  1 126 ? 72.226 -22.467 -13.023  1.00 17.69 ? 126 ILE C CB  1 
ATOM   6091  C  CG1 . ILE C  1 126 ? 71.033 -22.367 -13.983  1.00 17.48 ? 126 ILE C CG1 1 
ATOM   6092  C  CG2 . ILE C  1 126 ? 72.357 -23.873 -12.455  1.00 19.44 ? 126 ILE C CG2 1 
ATOM   6093  C  CD1 . ILE C  1 126 ? 71.252 -23.069 -15.304  1.00 16.29 ? 126 ILE C CD1 1 
ATOM   6094  N  N   . GLN C  1 127 ? 72.808 -22.210 -9.708   1.00 20.77 ? 127 GLN C N   1 
ATOM   6095  C  CA  . GLN C  1 127 ? 73.764 -22.604 -8.672   1.00 21.52 ? 127 GLN C CA  1 
ATOM   6096  C  C   . GLN C  1 127 ? 74.804 -21.539 -8.355   1.00 23.61 ? 127 GLN C C   1 
ATOM   6097  O  O   . GLN C  1 127 ? 75.988 -21.843 -8.222   1.00 21.06 ? 127 GLN C O   1 
ATOM   6098  C  CB  . GLN C  1 127 ? 74.462 -23.911 -9.060   1.00 19.89 ? 127 GLN C CB  1 
ATOM   6099  C  CG  . GLN C  1 127 ? 73.513 -25.093 -9.134   1.00 18.84 ? 127 GLN C CG  1 
ATOM   6100  C  CD  . GLN C  1 127 ? 74.190 -26.361 -9.610   1.00 22.85 ? 127 GLN C CD  1 
ATOM   6101  O  OE1 . GLN C  1 127 ? 74.080 -27.411 -8.974   1.00 28.57 ? 127 GLN C OE1 1 
ATOM   6102  N  NE2 . GLN C  1 127 ? 74.891 -26.276 -10.734  1.00 18.31 ? 127 GLN C NE2 1 
ATOM   6103  N  N   . GLY C  1 128 ? 74.362 -20.291 -8.237   1.00 22.76 ? 128 GLY C N   1 
ATOM   6104  C  CA  . GLY C  1 128 ? 75.244 -19.211 -7.814   1.00 24.28 ? 128 GLY C CA  1 
ATOM   6105  C  C   . GLY C  1 128 ? 76.096 -18.636 -8.928   1.00 27.88 ? 128 GLY C C   1 
ATOM   6106  O  O   . GLY C  1 128 ? 76.940 -17.784 -8.680   1.00 27.68 ? 128 GLY C O   1 
ATOM   6107  N  N   . THR C  1 129 ? 75.885 -19.101 -10.159  1.00 25.15 ? 129 THR C N   1 
ATOM   6108  C  CA  . THR C  1 129 ? 76.603 -18.553 -11.308  1.00 24.91 ? 129 THR C CA  1 
ATOM   6109  C  C   . THR C  1 129 ? 75.682 -17.656 -12.120  1.00 25.61 ? 129 THR C C   1 
ATOM   6110  O  O   . THR C  1 129 ? 74.496 -17.539 -11.812  1.00 24.73 ? 129 THR C O   1 
ATOM   6111  C  CB  . THR C  1 129 ? 77.153 -19.658 -12.233  1.00 24.68 ? 129 THR C CB  1 
ATOM   6112  O  OG1 . THR C  1 129 ? 76.073 -20.266 -12.959  1.00 21.24 ? 129 THR C OG1 1 
ATOM   6113  C  CG2 . THR C  1 129 ? 77.895 -20.720 -11.423  1.00 22.72 ? 129 THR C CG2 1 
ATOM   6114  N  N   . LEU C  1 130 ? 76.226 -17.028 -13.158  1.00 20.76 ? 130 LEU C N   1 
ATOM   6115  C  CA  . LEU C  1 130 ? 75.425 -16.170 -14.022  1.00 23.34 ? 130 LEU C CA  1 
ATOM   6116  C  C   . LEU C  1 130 ? 74.973 -16.909 -15.283  1.00 24.27 ? 130 LEU C C   1 
ATOM   6117  O  O   . LEU C  1 130 ? 74.402 -16.311 -16.197  1.00 24.94 ? 130 LEU C O   1 
ATOM   6118  C  CB  . LEU C  1 130 ? 76.187 -14.888 -14.380  1.00 26.09 ? 130 LEU C CB  1 
ATOM   6119  C  CG  . LEU C  1 130 ? 76.559 -13.992 -13.184  1.00 30.97 ? 130 LEU C CG  1 
ATOM   6120  C  CD1 . LEU C  1 130 ? 77.414 -12.811 -13.620  1.00 32.77 ? 130 LEU C CD1 1 
ATOM   6121  C  CD2 . LEU C  1 130 ? 75.315 -13.509 -12.452  1.00 34.36 ? 130 LEU C CD2 1 
ATOM   6122  N  N   . ASN C  1 131 ? 75.238 -18.211 -15.329  1.00 21.05 ? 131 ASN C N   1 
ATOM   6123  C  CA  . ASN C  1 131 ? 74.682 -19.062 -16.370  1.00 21.32 ? 131 ASN C CA  1 
ATOM   6124  C  C   . ASN C  1 131 ? 73.198 -19.259 -16.118  1.00 19.97 ? 131 ASN C C   1 
ATOM   6125  O  O   . ASN C  1 131 ? 72.799 -19.713 -15.051  1.00 21.08 ? 131 ASN C O   1 
ATOM   6126  C  CB  . ASN C  1 131 ? 75.388 -20.413 -16.378  1.00 19.46 ? 131 ASN C CB  1 
ATOM   6127  C  CG  . ASN C  1 131 ? 76.879 -20.276 -16.565  1.00 22.16 ? 131 ASN C CG  1 
ATOM   6128  O  OD1 . ASN C  1 131 ? 77.342 -19.855 -17.627  1.00 22.81 ? 131 ASN C OD1 1 
ATOM   6129  N  ND2 . ASN C  1 131 ? 77.642 -20.625 -15.533  1.00 21.76 ? 131 ASN C ND2 1 
ATOM   6130  N  N   . LYS C  1 132 ? 72.376 -18.893 -17.088  1.00 20.26 ? 132 LYS C N   1 
ATOM   6131  C  CA  . LYS C  1 132 ? 70.935 -18.919 -16.881  1.00 18.96 ? 132 LYS C CA  1 
ATOM   6132  C  C   . LYS C  1 132 ? 70.275 -20.118 -17.555  1.00 17.38 ? 132 LYS C C   1 
ATOM   6133  O  O   . LYS C  1 132 ? 70.800 -20.650 -18.529  1.00 16.91 ? 132 LYS C O   1 
ATOM   6134  C  CB  . LYS C  1 132 ? 70.319 -17.613 -17.371  1.00 20.26 ? 132 LYS C CB  1 
ATOM   6135  C  CG  . LYS C  1 132 ? 70.703 -16.412 -16.519  1.00 23.84 ? 132 LYS C CG  1 
ATOM   6136  C  CD  . LYS C  1 132 ? 70.224 -15.122 -17.160  1.00 32.53 ? 132 LYS C CD  1 
ATOM   6137  C  CE  . LYS C  1 132 ? 70.498 -13.934 -16.247  1.00 33.64 ? 132 LYS C CE  1 
ATOM   6138  N  NZ  . LYS C  1 132 ? 71.887 -13.995 -15.722  1.00 34.37 ? 132 LYS C NZ  1 
ATOM   6139  N  N   . ALA C  1 133 ? 69.128 -20.538 -17.020  1.00 15.37 ? 133 ALA C N   1 
ATOM   6140  C  CA  . ALA C  1 133 ? 68.351 -21.639 -17.599  1.00 15.92 ? 133 ALA C CA  1 
ATOM   6141  C  C   . ALA C  1 133 ? 67.566 -21.177 -18.819  1.00 17.95 ? 133 ALA C C   1 
ATOM   6142  O  O   . ALA C  1 133 ? 66.954 -20.108 -18.793  1.00 17.15 ? 133 ALA C O   1 
ATOM   6143  C  CB  . ALA C  1 133 ? 67.392 -22.210 -16.561  1.00 15.87 ? 133 ALA C CB  1 
ATOM   6144  N  N   . GLY C  1 134 ? 67.562 -21.997 -19.872  1.00 15.78 ? 134 GLY C N   1 
ATOM   6145  C  CA  . GLY C  1 134 ? 66.890 -21.652 -21.122  1.00 16.23 ? 134 GLY C CA  1 
ATOM   6146  C  C   . GLY C  1 134 ? 65.571 -22.387 -21.323  1.00 15.33 ? 134 GLY C C   1 
ATOM   6147  O  O   . GLY C  1 134 ? 64.905 -22.203 -22.333  1.00 16.73 ? 134 GLY C O   1 
ATOM   6148  N  N   . PHE C  1 135 ? 65.192 -23.217 -20.354  1.00 14.53 ? 135 PHE C N   1 
ATOM   6149  C  CA  . PHE C  1 135 ? 63.987 -24.044 -20.466  1.00 14.23 ? 135 PHE C CA  1 
ATOM   6150  C  C   . PHE C  1 135 ? 63.683 -24.707 -19.126  1.00 13.85 ? 135 PHE C C   1 
ATOM   6151  O  O   . PHE C  1 135 ? 64.510 -24.674 -18.210  1.00 17.31 ? 135 PHE C O   1 
ATOM   6152  C  CB  . PHE C  1 135 ? 64.145 -25.109 -21.564  1.00 14.12 ? 135 PHE C CB  1 
ATOM   6153  C  CG  . PHE C  1 135 ? 65.190 -26.144 -21.260  1.00 14.26 ? 135 PHE C CG  1 
ATOM   6154  C  CD1 . PHE C  1 135 ? 66.497 -25.977 -21.694  1.00 14.64 ? 135 PHE C CD1 1 
ATOM   6155  C  CD2 . PHE C  1 135 ? 64.869 -27.281 -20.535  1.00 13.46 ? 135 PHE C CD2 1 
ATOM   6156  C  CE1 . PHE C  1 135 ? 67.465 -26.920 -21.404  1.00 14.53 ? 135 PHE C CE1 1 
ATOM   6157  C  CE2 . PHE C  1 135 ? 65.836 -28.231 -20.239  1.00 13.87 ? 135 PHE C CE2 1 
ATOM   6158  C  CZ  . PHE C  1 135 ? 67.136 -28.050 -20.675  1.00 14.04 ? 135 PHE C CZ  1 
ATOM   6159  N  N   . VAL C  1 136 ? 62.489 -25.281 -19.000  1.00 12.48 ? 136 VAL C N   1 
ATOM   6160  C  CA  . VAL C  1 136 ? 62.111 -26.023 -17.804  1.00 12.76 ? 136 VAL C CA  1 
ATOM   6161  C  C   . VAL C  1 136 ? 61.884 -27.496 -18.157  1.00 15.13 ? 136 VAL C C   1 
ATOM   6162  O  O   . VAL C  1 136 ? 61.220 -27.809 -19.147  1.00 13.46 ? 136 VAL C O   1 
ATOM   6163  C  CB  . VAL C  1 136 ? 60.825 -25.462 -17.157  1.00 14.55 ? 136 VAL C CB  1 
ATOM   6164  C  CG1 . VAL C  1 136 ? 60.477 -26.232 -15.884  1.00 13.59 ? 136 VAL C CG1 1 
ATOM   6165  C  CG2 . VAL C  1 136 ? 60.987 -23.980 -16.850  1.00 13.98 ? 136 VAL C CG2 1 
HETATM 6166  N  N   . KCX C  1 137 ? 62.449 -28.389 -17.350  1.00 14.72 ? 137 KCX C N   1 
HETATM 6167  C  CA  . KCX C  1 137 ? 62.298 -29.831 -17.552  1.00 14.48 ? 137 KCX C CA  1 
HETATM 6168  C  CB  . KCX C  1 137 ? 63.691 -30.473 -17.548  1.00 13.72 ? 137 KCX C CB  1 
HETATM 6169  C  CG  . KCX C  1 137 ? 63.669 -31.995 -17.381  1.00 13.02 ? 137 KCX C CG  1 
HETATM 6170  C  CD  . KCX C  1 137 ? 63.207 -32.728 -18.646  1.00 13.89 ? 137 KCX C CD  1 
HETATM 6171  C  CE  . KCX C  1 137 ? 63.216 -34.248 -18.430  1.00 16.94 ? 137 KCX C CE  1 
HETATM 6172  N  NZ  . KCX C  1 137 ? 64.541 -34.833 -18.621  1.00 16.36 ? 137 KCX C NZ  1 
HETATM 6173  C  C   . KCX C  1 137 ? 61.486 -30.429 -16.439  1.00 14.60 ? 137 KCX C C   1 
HETATM 6174  O  O   . KCX C  1 137 ? 61.755 -30.186 -15.253  1.00 14.37 ? 137 KCX C O   1 
HETATM 6175  C  CX  . KCX C  1 137 ? 64.815 -36.068 -19.078  1.00 13.62 ? 137 KCX C CX  1 
HETATM 6176  O  OQ1 . KCX C  1 137 ? 63.992 -36.927 -19.421  1.00 16.16 ? 137 KCX C OQ1 1 
HETATM 6177  O  OQ2 . KCX C  1 137 ? 66.101 -36.385 -19.184  1.00 14.02 ? 137 KCX C OQ2 1 
ATOM   6178  N  N   . ILE C  1 138 ? 60.486 -31.221 -16.810  1.00 13.72 ? 138 ILE C N   1 
ATOM   6179  C  CA  A ILE C  1 138 ? 59.657 -31.939 -15.846  0.50 13.53 ? 138 ILE C CA  1 
ATOM   6180  C  CA  B ILE C  1 138 ? 59.691 -31.951 -15.828  0.50 13.60 ? 138 ILE C CA  1 
ATOM   6181  C  C   . ILE C  1 138 ? 59.517 -33.396 -16.276  1.00 13.61 ? 138 ILE C C   1 
ATOM   6182  O  O   . ILE C  1 138 ? 59.812 -33.737 -17.420  1.00 12.79 ? 138 ILE C O   1 
ATOM   6183  C  CB  A ILE C  1 138 ? 58.261 -31.300 -15.698  0.50 13.80 ? 138 ILE C CB  1 
ATOM   6184  C  CB  B ILE C  1 138 ? 58.312 -31.303 -15.552  0.50 14.07 ? 138 ILE C CB  1 
ATOM   6185  C  CG1 A ILE C  1 138 ? 57.509 -31.324 -17.031  0.50 15.81 ? 138 ILE C CG1 1 
ATOM   6186  C  CG1 B ILE C  1 138 ? 57.261 -31.770 -16.563  0.50 15.97 ? 138 ILE C CG1 1 
ATOM   6187  C  CG2 A ILE C  1 138 ? 58.380 -29.876 -15.165  0.50 14.65 ? 138 ILE C CG2 1 
ATOM   6188  C  CG2 B ILE C  1 138 ? 58.427 -29.782 -15.512  0.50 14.94 ? 138 ILE C CG2 1 
ATOM   6189  C  CD1 A ILE C  1 138 ? 56.631 -32.544 -17.228  0.50 16.04 ? 138 ILE C CD1 1 
ATOM   6190  C  CD1 B ILE C  1 138 ? 56.689 -30.669 -17.431  0.50 15.11 ? 138 ILE C CD1 1 
ATOM   6191  N  N   . ALA C  1 139 ? 59.056 -34.241 -15.363  1.00 12.72 ? 139 ALA C N   1 
ATOM   6192  C  CA  . ALA C  1 139 ? 58.965 -35.671 -15.630  1.00 14.59 ? 139 ALA C CA  1 
ATOM   6193  C  C   . ALA C  1 139 ? 57.722 -36.315 -15.055  1.00 16.47 ? 139 ALA C C   1 
ATOM   6194  O  O   . ALA C  1 139 ? 57.120 -35.821 -14.100  1.00 15.48 ? 139 ALA C O   1 
ATOM   6195  C  CB  . ALA C  1 139 ? 60.200 -36.391 -15.092  1.00 13.45 ? 139 ALA C CB  1 
ATOM   6196  N  N   . ALA C  1 140 ? 57.359 -37.434 -15.663  1.00 16.16 ? 140 ALA C N   1 
ATOM   6197  C  CA  . ALA C  1 140 ? 56.420 -38.376 -15.093  1.00 14.73 ? 140 ALA C CA  1 
ATOM   6198  C  C   . ALA C  1 140 ? 56.758 -39.715 -15.735  1.00 14.37 ? 140 ALA C C   1 
ATOM   6199  O  O   . ALA C  1 140 ? 57.289 -39.761 -16.844  1.00 17.65 ? 140 ALA C O   1 
ATOM   6200  C  CB  . ALA C  1 140 ? 54.989 -37.978 -15.415  1.00 16.34 ? 140 ALA C CB  1 
ATOM   6201  N  N   . ASP C  1 141 ? 56.461 -40.810 -15.056  1.00 16.67 ? 141 ASP C N   1 
ATOM   6202  C  CA  . ASP C  1 141 ? 56.804 -42.101 -15.614  1.00 18.12 ? 141 ASP C CA  1 
ATOM   6203  C  C   . ASP C  1 141 ? 55.765 -43.153 -15.232  1.00 18.65 ? 141 ASP C C   1 
ATOM   6204  O  O   . ASP C  1 141 ? 54.569 -42.870 -15.224  1.00 17.57 ? 141 ASP C O   1 
ATOM   6205  C  CB  . ASP C  1 141 ? 58.226 -42.498 -15.199  1.00 14.93 ? 141 ASP C CB  1 
ATOM   6206  C  CG  . ASP C  1 141 ? 58.875 -43.457 -16.191  1.00 23.15 ? 141 ASP C CG  1 
ATOM   6207  O  OD1 . ASP C  1 141 ? 58.490 -44.641 -16.207  1.00 22.73 ? 141 ASP C OD1 1 
ATOM   6208  O  OD2 . ASP C  1 141 ? 59.763 -43.025 -16.957  1.00 22.55 ? 141 ASP C OD2 1 
ATOM   6209  N  N   . GLU C  1 142 ? 56.215 -44.363 -14.918  1.00 19.87 ? 142 GLU C N   1 
ATOM   6210  C  CA  . GLU C  1 142 ? 55.290 -45.470 -14.648  1.00 22.45 ? 142 GLU C CA  1 
ATOM   6211  C  C   . GLU C  1 142 ? 54.234 -45.166 -13.574  1.00 21.56 ? 142 GLU C C   1 
ATOM   6212  O  O   . GLU C  1 142 ? 53.082 -45.584 -13.704  1.00 20.33 ? 142 GLU C O   1 
ATOM   6213  C  CB  . GLU C  1 142 ? 56.062 -46.754 -14.321  1.00 27.76 ? 142 GLU C CB  1 
ATOM   6214  C  CG  . GLU C  1 142 ? 55.200 -48.003 -14.205  1.00 39.41 ? 142 GLU C CG  1 
ATOM   6215  C  CD  . GLU C  1 142 ? 54.566 -48.162 -12.834  1.00 51.20 ? 142 GLU C CD  1 
ATOM   6216  O  OE1 . GLU C  1 142 ? 55.058 -47.535 -11.868  1.00 49.99 ? 142 GLU C OE1 1 
ATOM   6217  O  OE2 . GLU C  1 142 ? 53.578 -48.921 -12.718  1.00 61.49 ? 142 GLU C OE2 1 
ATOM   6218  N  N   . PRO C  1 143 ? 54.618 -44.447 -12.505  1.00 19.79 ? 143 PRO C N   1 
ATOM   6219  C  CA  . PRO C  1 143 ? 53.657 -44.136 -11.442  1.00 20.61 ? 143 PRO C CA  1 
ATOM   6220  C  C   . PRO C  1 143 ? 52.533 -43.177 -11.857  1.00 22.41 ? 143 PRO C C   1 
ATOM   6221  O  O   . PRO C  1 143 ? 51.593 -42.985 -11.098  1.00 23.41 ? 143 PRO C O   1 
ATOM   6222  C  CB  . PRO C  1 143 ? 54.532 -43.494 -10.355  1.00 19.78 ? 143 PRO C CB  1 
ATOM   6223  C  CG  . PRO C  1 143 ? 55.882 -44.082 -10.589  1.00 19.21 ? 143 PRO C CG  1 
ATOM   6224  C  CD  . PRO C  1 143 ? 56.004 -44.183 -12.084  1.00 18.01 ? 143 PRO C CD  1 
ATOM   6225  N  N   . GLY C  1 144 ? 52.636 -42.570 -13.035  1.00 20.90 ? 144 GLY C N   1 
ATOM   6226  C  CA  . GLY C  1 144 ? 51.576 -41.687 -13.529  1.00 22.05 ? 144 GLY C CA  1 
ATOM   6227  C  C   . GLY C  1 144 ? 51.655 -40.263 -13.004  1.00 20.75 ? 144 GLY C C   1 
ATOM   6228  O  O   . GLY C  1 144 ? 52.663 -39.848 -12.435  1.00 18.48 ? 144 GLY C O   1 
ATOM   6229  N  N   . ILE C  1 145 ? 50.589 -39.498 -13.202  1.00 21.40 ? 145 ILE C N   1 
ATOM   6230  C  CA  . ILE C  1 145 ? 50.563 -38.123 -12.724  1.00 18.90 ? 145 ILE C CA  1 
ATOM   6231  C  C   . ILE C  1 145 ? 50.153 -38.089 -11.249  1.00 20.21 ? 145 ILE C C   1 
ATOM   6232  O  O   . ILE C  1 145 ? 48.986 -37.901 -10.929  1.00 20.73 ? 145 ILE C O   1 
ATOM   6233  C  CB  . ILE C  1 145 ? 49.618 -37.248 -13.577  1.00 19.12 ? 145 ILE C CB  1 
ATOM   6234  C  CG1 . ILE C  1 145 ? 49.983 -37.370 -15.059  1.00 18.65 ? 145 ILE C CG1 1 
ATOM   6235  C  CG2 . ILE C  1 145 ? 49.657 -35.794 -13.129  1.00 21.13 ? 145 ILE C CG2 1 
ATOM   6236  C  CD1 . ILE C  1 145 ? 51.379 -36.892 -15.407  1.00 16.94 ? 145 ILE C CD1 1 
ATOM   6237  N  N   . THR C  1 146 ? 51.125 -38.283 -10.360  1.00 19.08 ? 146 THR C N   1 
ATOM   6238  C  CA  . THR C  1 146 ? 50.890 -38.219 -8.918   1.00 19.38 ? 146 THR C CA  1 
ATOM   6239  C  C   . THR C  1 146 ? 50.666 -36.766 -8.497   1.00 18.47 ? 146 THR C C   1 
ATOM   6240  O  O   . THR C  1 146 ? 50.907 -35.843 -9.277   1.00 18.36 ? 146 THR C O   1 
ATOM   6241  C  CB  . THR C  1 146 ? 52.109 -38.747 -8.133   1.00 20.94 ? 146 THR C CB  1 
ATOM   6242  O  OG1 . THR C  1 146 ? 53.218 -37.864 -8.338   1.00 21.05 ? 146 THR C OG1 1 
ATOM   6243  C  CG2 . THR C  1 146 ? 52.500 -40.151 -8.605   1.00 19.65 ? 146 THR C CG2 1 
ATOM   6244  N  N   . LYS C  1 147 ? 50.225 -36.565 -7.259   1.00 20.23 ? 147 LYS C N   1 
ATOM   6245  C  CA  A LYS C  1 147 ? 49.989 -35.222 -6.741   0.50 22.60 ? 147 LYS C CA  1 
ATOM   6246  C  CA  B LYS C  1 147 ? 49.992 -35.222 -6.740   0.50 22.51 ? 147 LYS C CA  1 
ATOM   6247  C  C   . LYS C  1 147 ? 51.214 -34.325 -6.903   1.00 20.42 ? 147 LYS C C   1 
ATOM   6248  O  O   . LYS C  1 147 ? 51.099 -33.193 -7.369   1.00 18.97 ? 147 LYS C O   1 
ATOM   6249  C  CB  A LYS C  1 147 ? 49.586 -35.272 -5.265   0.50 25.28 ? 147 LYS C CB  1 
ATOM   6250  C  CB  B LYS C  1 147 ? 49.579 -35.269 -5.266   0.50 25.09 ? 147 LYS C CB  1 
ATOM   6251  C  CG  A LYS C  1 147 ? 48.360 -36.119 -4.962   0.50 31.19 ? 147 LYS C CG  1 
ATOM   6252  C  CG  B LYS C  1 147 ? 48.089 -35.089 -5.016   0.50 29.90 ? 147 LYS C CG  1 
ATOM   6253  C  CD  A LYS C  1 147 ? 47.145 -35.679 -5.763   0.50 34.87 ? 147 LYS C CD  1 
ATOM   6254  C  CD  B LYS C  1 147 ? 47.265 -36.191 -5.658   0.50 36.78 ? 147 LYS C CD  1 
ATOM   6255  C  CE  A LYS C  1 147 ? 47.160 -36.282 -7.159   0.50 36.81 ? 147 LYS C CE  1 
ATOM   6256  C  CE  B LYS C  1 147 ? 45.806 -36.091 -5.239   0.50 37.12 ? 147 LYS C CE  1 
ATOM   6257  N  NZ  A LYS C  1 147 ? 45.814 -36.235 -7.794   0.50 35.53 ? 147 LYS C NZ  1 
ATOM   6258  N  NZ  B LYS C  1 147 ? 45.668 -36.142 -3.757   0.50 39.01 ? 147 LYS C NZ  1 
ATOM   6259  N  N   . ASP C  1 148 ? 52.382 -34.828 -6.510   1.00 19.48 ? 148 ASP C N   1 
ATOM   6260  C  CA  . ASP C  1 148 ? 53.606 -34.022 -6.572   1.00 20.18 ? 148 ASP C CA  1 
ATOM   6261  C  C   . ASP C  1 148 ? 54.088 -33.815 -8.004   1.00 19.70 ? 148 ASP C C   1 
ATOM   6262  O  O   . ASP C  1 148 ? 54.620 -32.755 -8.335   1.00 20.08 ? 148 ASP C O   1 
ATOM   6263  C  CB  . ASP C  1 148 ? 54.732 -34.634 -5.731   1.00 20.13 ? 148 ASP C CB  1 
ATOM   6264  C  CG  . ASP C  1 148 ? 54.582 -34.339 -4.239   1.00 24.40 ? 148 ASP C CG  1 
ATOM   6265  O  OD1 . ASP C  1 148 ? 55.433 -34.802 -3.452   1.00 23.39 ? 148 ASP C OD1 1 
ATOM   6266  O  OD2 . ASP C  1 148 ? 53.611 -33.655 -3.854   1.00 27.33 ? 148 ASP C OD2 1 
ATOM   6267  N  N   . VAL C  1 149 ? 53.927 -34.834 -8.842   1.00 18.88 ? 149 VAL C N   1 
ATOM   6268  C  CA  . VAL C  1 149 ? 54.273 -34.713 -10.260  1.00 16.51 ? 149 VAL C CA  1 
ATOM   6269  C  C   . VAL C  1 149 ? 53.439 -33.580 -10.859  1.00 17.63 ? 149 VAL C C   1 
ATOM   6270  O  O   . VAL C  1 149 ? 53.947 -32.732 -11.596  1.00 16.59 ? 149 VAL C O   1 
ATOM   6271  C  CB  . VAL C  1 149 ? 54.028 -36.044 -11.021  1.00 17.25 ? 149 VAL C CB  1 
ATOM   6272  C  CG1 . VAL C  1 149 ? 53.931 -35.815 -12.526  1.00 15.61 ? 149 VAL C CG1 1 
ATOM   6273  C  CG2 . VAL C  1 149 ? 55.137 -37.048 -10.713  1.00 16.52 ? 149 VAL C CG2 1 
ATOM   6274  N  N   . GLU C  1 150 ? 52.157 -33.551 -10.509  1.00 16.98 ? 150 GLU C N   1 
ATOM   6275  C  CA  . GLU C  1 150 ? 51.270 -32.502 -11.002  1.00 19.46 ? 150 GLU C CA  1 
ATOM   6276  C  C   . GLU C  1 150 ? 51.669 -31.110 -10.511  1.00 19.50 ? 150 GLU C C   1 
ATOM   6277  O  O   . GLU C  1 150 ? 51.621 -30.145 -11.281  1.00 17.70 ? 150 GLU C O   1 
ATOM   6278  C  CB  . GLU C  1 150 ? 49.820 -32.782 -10.636  1.00 22.66 ? 150 GLU C CB  1 
ATOM   6279  C  CG  . GLU C  1 150 ? 48.864 -31.748 -11.203  1.00 27.40 ? 150 GLU C CG  1 
ATOM   6280  C  CD  . GLU C  1 150 ? 47.425 -32.054 -10.871  1.00 38.03 ? 150 GLU C CD  1 
ATOM   6281  O  OE1 . GLU C  1 150 ? 46.587 -31.132 -10.958  1.00 37.25 ? 150 GLU C OE1 1 
ATOM   6282  O  OE2 . GLU C  1 150 ? 47.137 -33.216 -10.518  1.00 44.19 ? 150 GLU C OE2 1 
ATOM   6283  N  N   . LYS C  1 151 ? 52.059 -31.004 -9.240   1.00 18.50 ? 151 LYS C N   1 
ATOM   6284  C  CA  . LYS C  1 151 ? 52.543 -29.728 -8.704   1.00 18.97 ? 151 LYS C CA  1 
ATOM   6285  C  C   . LYS C  1 151 ? 53.693 -29.187 -9.536   1.00 17.43 ? 151 LYS C C   1 
ATOM   6286  O  O   . LYS C  1 151 ? 53.737 -28.001 -9.857   1.00 18.51 ? 151 LYS C O   1 
ATOM   6287  C  CB  . LYS C  1 151 ? 53.034 -29.880 -7.267   1.00 19.89 ? 151 LYS C CB  1 
ATOM   6288  C  CG  . LYS C  1 151 ? 51.960 -30.163 -6.234   1.00 25.58 ? 151 LYS C CG  1 
ATOM   6289  C  CD  . LYS C  1 151 ? 52.566 -30.083 -4.840   1.00 28.19 ? 151 LYS C CD  1 
ATOM   6290  C  CE  . LYS C  1 151 ? 51.775 -30.894 -3.829   1.00 37.65 ? 151 LYS C CE  1 
ATOM   6291  N  NZ  . LYS C  1 151 ? 52.523 -30.991 -2.540   1.00 41.23 ? 151 LYS C NZ  1 
ATOM   6292  N  N   . VAL C  1 152 ? 54.637 -30.063 -9.863   1.00 17.26 ? 152 VAL C N   1 
ATOM   6293  C  CA  . VAL C  1 152 ? 55.814 -29.671 -10.628  1.00 16.17 ? 152 VAL C CA  1 
ATOM   6294  C  C   . VAL C  1 152 ? 55.412 -29.226 -12.025  1.00 17.21 ? 152 VAL C C   1 
ATOM   6295  O  O   . VAL C  1 152 ? 55.981 -28.279 -12.575  1.00 14.80 ? 152 VAL C O   1 
ATOM   6296  C  CB  . VAL C  1 152 ? 56.836 -30.826 -10.719  1.00 16.47 ? 152 VAL C CB  1 
ATOM   6297  C  CG1 . VAL C  1 152 ? 57.908 -30.505 -11.749  1.00 15.04 ? 152 VAL C CG1 1 
ATOM   6298  C  CG2 . VAL C  1 152 ? 57.468 -31.089 -9.348   1.00 14.21 ? 152 VAL C CG2 1 
ATOM   6299  N  N   . ILE C  1 153 ? 54.429 -29.908 -12.604  1.00 14.12 ? 153 ILE C N   1 
ATOM   6300  C  CA  . ILE C  1 153 ? 53.961 -29.532 -13.944  1.00 17.52 ? 153 ILE C CA  1 
ATOM   6301  C  C   . ILE C  1 153 ? 53.340 -28.136 -13.959  1.00 20.87 ? 153 ILE C C   1 
ATOM   6302  O  O   . ILE C  1 153 ? 53.602 -27.325 -14.866  1.00 18.25 ? 153 ILE C O   1 
ATOM   6303  C  CB  . ILE C  1 153 ? 52.948 -30.537 -14.510  1.00 18.50 ? 153 ILE C CB  1 
ATOM   6304  C  CG1 . ILE C  1 153 ? 53.612 -31.909 -14.697  1.00 16.77 ? 153 ILE C CG1 1 
ATOM   6305  C  CG2 . ILE C  1 153 ? 52.406 -30.020 -15.837  1.00 17.99 ? 153 ILE C CG2 1 
ATOM   6306  C  CD1 . ILE C  1 153 ? 52.644 -33.029 -15.026  1.00 21.00 ? 153 ILE C CD1 1 
ATOM   6307  N  N   . ARG C  1 154 ? 52.516 -27.856 -12.952  1.00 17.58 ? 154 ARG C N   1 
ATOM   6308  C  CA  . ARG C  1 154 ? 51.881 -26.550 -12.847  1.00 17.73 ? 154 ARG C CA  1 
ATOM   6309  C  C   . ARG C  1 154 ? 52.902 -25.462 -12.530  1.00 18.63 ? 154 ARG C C   1 
ATOM   6310  O  O   . ARG C  1 154 ? 52.748 -24.329 -12.971  1.00 18.68 ? 154 ARG C O   1 
ATOM   6311  C  CB  . ARG C  1 154 ? 50.763 -26.569 -11.806  1.00 19.58 ? 154 ARG C CB  1 
ATOM   6312  C  CG  . ARG C  1 154 ? 49.664 -27.569 -12.141  1.00 21.11 ? 154 ARG C CG  1 
ATOM   6313  C  CD  . ARG C  1 154 ? 48.431 -27.404 -11.262  1.00 24.74 ? 154 ARG C CD  1 
ATOM   6314  N  NE  . ARG C  1 154 ? 47.456 -28.452 -11.565  1.00 30.65 ? 154 ARG C NE  1 
ATOM   6315  C  CZ  . ARG C  1 154 ? 46.550 -28.387 -12.542  1.00 36.25 ? 154 ARG C CZ  1 
ATOM   6316  N  NH1 . ARG C  1 154 ? 45.716 -29.400 -12.738  1.00 36.00 ? 154 ARG C NH1 1 
ATOM   6317  N  NH2 . ARG C  1 154 ? 46.472 -27.315 -13.325  1.00 31.47 ? 154 ARG C NH2 1 
ATOM   6318  N  N   . ALA C  1 155 ? 53.947 -25.808 -11.778  1.00 15.84 ? 155 ALA C N   1 
ATOM   6319  C  CA  . ALA C  1 155 ? 55.023 -24.847 -11.499  1.00 16.32 ? 155 ALA C CA  1 
ATOM   6320  C  C   . ALA C  1 155 ? 55.783 -24.503 -12.776  1.00 17.58 ? 155 ALA C C   1 
ATOM   6321  O  O   . ALA C  1 155 ? 56.179 -23.352 -12.986  1.00 16.70 ? 155 ALA C O   1 
ATOM   6322  C  CB  . ALA C  1 155 ? 55.976 -25.388 -10.443  1.00 14.93 ? 155 ALA C CB  1 
ATOM   6323  N  N   . ALA C  1 156 ? 55.992 -25.507 -13.626  1.00 15.73 ? 156 ALA C N   1 
ATOM   6324  C  CA  . ALA C  1 156 ? 56.647 -25.281 -14.910  1.00 16.66 ? 156 ALA C CA  1 
ATOM   6325  C  C   . ALA C  1 156 ? 55.832 -24.335 -15.787  1.00 15.82 ? 156 ALA C C   1 
ATOM   6326  O  O   . ALA C  1 156 ? 56.397 -23.488 -16.479  1.00 15.65 ? 156 ALA C O   1 
ATOM   6327  C  CB  . ALA C  1 156 ? 56.896 -26.599 -15.632  1.00 16.10 ? 156 ALA C CB  1 
ATOM   6328  N  N   . ALA C  1 157 ? 54.509 -24.487 -15.767  1.00 15.49 ? 157 ALA C N   1 
ATOM   6329  C  CA  . ALA C  1 157 ? 53.626 -23.593 -16.525  1.00 17.35 ? 157 ALA C CA  1 
ATOM   6330  C  C   . ALA C  1 157 ? 53.760 -22.147 -16.057  1.00 19.05 ? 157 ALA C C   1 
ATOM   6331  O  O   . ALA C  1 157 ? 53.786 -21.222 -16.874  1.00 21.87 ? 157 ALA C O   1 
ATOM   6332  C  CB  . ALA C  1 157 ? 52.179 -24.046 -16.425  1.00 17.00 ? 157 ALA C CB  1 
ATOM   6333  N  N   . ILE C  1 158 ? 53.846 -21.949 -14.746  1.00 18.12 ? 158 ILE C N   1 
ATOM   6334  C  CA  . ILE C  1 158 ? 54.022 -20.602 -14.204  1.00 20.02 ? 158 ILE C CA  1 
ATOM   6335  C  C   . ILE C  1 158 ? 55.322 -19.980 -14.716  1.00 23.55 ? 158 ILE C C   1 
ATOM   6336  O  O   . ILE C  1 158 ? 55.347 -18.828 -15.164  1.00 21.03 ? 158 ILE C O   1 
ATOM   6337  C  CB  . ILE C  1 158 ? 54.017 -20.618 -12.668  1.00 22.02 ? 158 ILE C CB  1 
ATOM   6338  C  CG1 . ILE C  1 158 ? 52.636 -21.037 -12.161  1.00 20.68 ? 158 ILE C CG1 1 
ATOM   6339  C  CG2 . ILE C  1 158 ? 54.431 -19.258 -12.114  1.00 21.84 ? 158 ILE C CG2 1 
ATOM   6340  C  CD1 . ILE C  1 158 ? 52.593 -21.316 -10.674  1.00 22.56 ? 158 ILE C CD1 1 
ATOM   6341  N  N   . ALA C  1 159 ? 56.396 -20.764 -14.675  1.00 18.60 ? 159 ALA C N   1 
ATOM   6342  C  CA  . ALA C  1 159 ? 57.706 -20.299 -15.116  1.00 19.01 ? 159 ALA C CA  1 
ATOM   6343  C  C   . ALA C  1 159 ? 57.720 -19.929 -16.593  1.00 19.23 ? 159 ALA C C   1 
ATOM   6344  O  O   . ALA C  1 159 ? 58.343 -18.941 -16.979  1.00 17.66 ? 159 ALA C O   1 
ATOM   6345  C  CB  . ALA C  1 159 ? 58.774 -21.353 -14.818  1.00 20.36 ? 159 ALA C CB  1 
ATOM   6346  N  N   . ASN C  1 160 ? 57.052 -20.733 -17.419  1.00 21.74 ? 160 ASN C N   1 
ATOM   6347  C  CA  . ASN C  1 160 ? 56.944 -20.442 -18.848  1.00 18.76 ? 160 ASN C CA  1 
ATOM   6348  C  C   . ASN C  1 160 ? 56.149 -19.174 -19.100  1.00 22.17 ? 160 ASN C C   1 
ATOM   6349  O  O   . ASN C  1 160 ? 56.516 -18.360 -19.952  1.00 19.60 ? 160 ASN C O   1 
ATOM   6350  C  CB  . ASN C  1 160 ? 56.299 -21.605 -19.615  1.00 18.72 ? 160 ASN C CB  1 
ATOM   6351  C  CG  . ASN C  1 160 ? 55.690 -21.157 -20.935  1.00 18.95 ? 160 ASN C CG  1 
ATOM   6352  O  OD1 . ASN C  1 160 ? 54.518 -20.804 -20.992  1.00 19.94 ? 160 ASN C OD1 1 
ATOM   6353  N  ND2 . ASN C  1 160 ? 56.496 -21.136 -21.997  1.00 19.23 ? 160 ASN C ND2 1 
ATOM   6354  N  N   . LYS C  1 161 ? 55.049 -19.009 -18.368  1.00 21.77 ? 161 LYS C N   1 
ATOM   6355  C  CA  . LYS C  1 161 ? 54.205 -17.833 -18.554  1.00 27.02 ? 161 LYS C CA  1 
ATOM   6356  C  C   . LYS C  1 161 ? 54.959 -16.564 -18.166  1.00 24.45 ? 161 LYS C C   1 
ATOM   6357  O  O   . LYS C  1 161 ? 54.799 -15.527 -18.794  1.00 26.61 ? 161 LYS C O   1 
ATOM   6358  C  CB  . LYS C  1 161 ? 52.887 -17.971 -17.782  1.00 25.61 ? 161 LYS C CB  1 
ATOM   6359  C  CG  . LYS C  1 161 ? 51.960 -19.023 -18.383  1.00 31.99 ? 161 LYS C CG  1 
ATOM   6360  C  CD  . LYS C  1 161 ? 50.884 -19.472 -17.409  1.00 35.59 ? 161 LYS C CD  1 
ATOM   6361  C  CE  . LYS C  1 161 ? 49.776 -18.441 -17.292  1.00 42.88 ? 161 LYS C CE  1 
ATOM   6362  N  NZ  . LYS C  1 161 ? 48.796 -18.833 -16.241  1.00 44.53 ? 161 LYS C NZ  1 
ATOM   6363  N  N   . GLU C  1 162 ? 55.804 -16.665 -17.147  1.00 25.48 ? 162 GLU C N   1 
ATOM   6364  C  CA  . GLU C  1 162 ? 56.553 -15.512 -16.656  1.00 27.18 ? 162 GLU C CA  1 
ATOM   6365  C  C   . GLU C  1 162 ? 57.803 -15.201 -17.490  1.00 27.20 ? 162 GLU C C   1 
ATOM   6366  O  O   . GLU C  1 162 ? 58.151 -14.038 -17.674  1.00 29.32 ? 162 GLU C O   1 
ATOM   6367  C  CB  . GLU C  1 162 ? 56.942 -15.721 -15.190  1.00 29.79 ? 162 GLU C CB  1 
ATOM   6368  C  CG  . GLU C  1 162 ? 57.874 -14.657 -14.635  1.00 34.89 ? 162 GLU C CG  1 
ATOM   6369  C  CD  . GLU C  1 162 ? 57.181 -13.323 -14.420  1.00 46.76 ? 162 GLU C CD  1 
ATOM   6370  O  OE1 . GLU C  1 162 ? 57.880 -12.287 -14.394  1.00 47.98 ? 162 GLU C OE1 1 
ATOM   6371  O  OE2 . GLU C  1 162 ? 55.940 -13.307 -14.279  1.00 41.94 ? 162 GLU C OE2 1 
ATOM   6372  N  N   . THR C  1 163 ? 58.471 -16.233 -17.999  1.00 20.85 ? 163 THR C N   1 
ATOM   6373  C  CA  . THR C  1 163 ? 59.765 -16.040 -18.658  1.00 20.72 ? 163 THR C CA  1 
ATOM   6374  C  C   . THR C  1 163 ? 59.771 -16.429 -20.139  1.00 21.12 ? 163 THR C C   1 
ATOM   6375  O  O   . THR C  1 163 ? 60.731 -16.149 -20.859  1.00 20.52 ? 163 THR C O   1 
ATOM   6376  C  CB  . THR C  1 163 ? 60.853 -16.864 -17.959  1.00 21.48 ? 163 THR C CB  1 
ATOM   6377  O  OG1 . THR C  1 163 ? 60.608 -18.256 -18.199  1.00 20.99 ? 163 THR C OG1 1 
ATOM   6378  C  CG2 . THR C  1 163 ? 60.842 -16.602 -16.463  1.00 19.89 ? 163 THR C CG2 1 
ATOM   6379  N  N   . LYS C  1 164 ? 58.720 -17.099 -20.590  1.00 19.76 ? 164 LYS C N   1 
ATOM   6380  C  CA  . LYS C  1 164 ? 58.623 -17.498 -21.996  1.00 21.61 ? 164 LYS C CA  1 
ATOM   6381  C  C   . LYS C  1 164 ? 59.568 -18.632 -22.421  1.00 21.31 ? 164 LYS C C   1 
ATOM   6382  O  O   . LYS C  1 164 ? 59.628 -18.969 -23.596  1.00 23.01 ? 164 LYS C O   1 
ATOM   6383  C  CB  . LYS C  1 164 ? 58.822 -16.290 -22.927  1.00 28.58 ? 164 LYS C CB  1 
ATOM   6384  C  CG  . LYS C  1 164 ? 57.628 -15.349 -23.012  1.00 26.33 ? 164 LYS C CG  1 
ATOM   6385  C  CD  . LYS C  1 164 ? 57.310 -14.748 -21.658  1.00 37.33 ? 164 LYS C CD  1 
ATOM   6386  C  CE  . LYS C  1 164 ? 56.170 -13.744 -21.748  1.00 53.24 ? 164 LYS C CE  1 
ATOM   6387  N  NZ  . LYS C  1 164 ? 55.999 -13.006 -20.464  1.00 50.99 ? 164 LYS C NZ  1 
ATOM   6388  N  N   . VAL C  1 165 ? 60.310 -19.222 -21.489  1.00 20.61 ? 165 VAL C N   1 
ATOM   6389  C  CA  . VAL C  1 165 ? 61.134 -20.377 -21.846  1.00 18.99 ? 165 VAL C CA  1 
ATOM   6390  C  C   . VAL C  1 165 ? 60.244 -21.590 -22.127  1.00 16.72 ? 165 VAL C C   1 
ATOM   6391  O  O   . VAL C  1 165 ? 59.177 -21.740 -21.532  1.00 20.84 ? 165 VAL C O   1 
ATOM   6392  C  CB  . VAL C  1 165 ? 62.183 -20.716 -20.760  1.00 20.04 ? 165 VAL C CB  1 
ATOM   6393  C  CG1 . VAL C  1 165 ? 63.095 -19.519 -20.510  1.00 17.50 ? 165 VAL C CG1 1 
ATOM   6394  C  CG2 . VAL C  1 165 ? 61.504 -21.159 -19.466  1.00 17.50 ? 165 VAL C CG2 1 
ATOM   6395  N  N   . PRO C  1 166 ? 60.673 -22.456 -23.052  1.00 16.51 ? 166 PRO C N   1 
ATOM   6396  C  CA  . PRO C  1 166 ? 59.893 -23.647 -23.375  1.00 15.17 ? 166 PRO C CA  1 
ATOM   6397  C  C   . PRO C  1 166 ? 60.030 -24.739 -22.314  1.00 15.05 ? 166 PRO C C   1 
ATOM   6398  O  O   . PRO C  1 166 ? 60.843 -24.623 -21.394  1.00 14.79 ? 166 PRO C O   1 
ATOM   6399  C  CB  . PRO C  1 166 ? 60.504 -24.110 -24.697  1.00 14.45 ? 166 PRO C CB  1 
ATOM   6400  C  CG  . PRO C  1 166 ? 61.922 -23.639 -24.627  1.00 15.35 ? 166 PRO C CG  1 
ATOM   6401  C  CD  . PRO C  1 166 ? 61.870 -22.324 -23.902  1.00 15.41 ? 166 PRO C CD  1 
ATOM   6402  N  N   . ILE C  1 167 ? 59.223 -25.786 -22.446  1.00 15.66 ? 167 ILE C N   1 
ATOM   6403  C  CA  . ILE C  1 167 ? 59.217 -26.885 -21.498  1.00 14.53 ? 167 ILE C CA  1 
ATOM   6404  C  C   . ILE C  1 167 ? 59.536 -28.206 -22.202  1.00 16.06 ? 167 ILE C C   1 
ATOM   6405  O  O   . ILE C  1 167 ? 58.914 -28.557 -23.199  1.00 13.29 ? 167 ILE C O   1 
ATOM   6406  C  CB  . ILE C  1 167 ? 57.853 -26.978 -20.781  1.00 16.21 ? 167 ILE C CB  1 
ATOM   6407  C  CG1 . ILE C  1 167 ? 57.587 -25.671 -20.016  1.00 15.64 ? 167 ILE C CG1 1 
ATOM   6408  C  CG2 . ILE C  1 167 ? 57.808 -28.190 -19.856  1.00 15.26 ? 167 ILE C CG2 1 
ATOM   6409  C  CD1 . ILE C  1 167 ? 56.168 -25.528 -19.501  1.00 16.84 ? 167 ILE C CD1 1 
ATOM   6410  N  N   . ILE C  1 168 ? 60.533 -28.917 -21.692  1.00 13.72 ? 168 ILE C N   1 
ATOM   6411  C  CA  . ILE C  1 168 ? 60.835 -30.262 -22.168  1.00 12.36 ? 168 ILE C CA  1 
ATOM   6412  C  C   . ILE C  1 168 ? 60.334 -31.266 -21.128  1.00 13.75 ? 168 ILE C C   1 
ATOM   6413  O  O   . ILE C  1 168 ? 60.528 -31.067 -19.930  1.00 13.43 ? 168 ILE C O   1 
ATOM   6414  C  CB  . ILE C  1 168 ? 62.353 -30.451 -22.350  1.00 12.80 ? 168 ILE C CB  1 
ATOM   6415  C  CG1 . ILE C  1 168 ? 62.877 -29.495 -23.434  1.00 12.22 ? 168 ILE C CG1 1 
ATOM   6416  C  CG2 . ILE C  1 168 ? 62.675 -31.912 -22.670  1.00 11.54 ? 168 ILE C CG2 1 
ATOM   6417  C  CD1 . ILE C  1 168 ? 64.384 -29.472 -23.579  1.00 12.62 ? 168 ILE C CD1 1 
ATOM   6418  N  N   . THR C  1 169 ? 59.684 -32.337 -21.568  1.00 14.80 ? 169 THR C N   1 
ATOM   6419  C  CA  . THR C  1 169 ? 59.222 -33.337 -20.612  1.00 13.98 ? 169 THR C CA  1 
ATOM   6420  C  C   . THR C  1 169 ? 59.880 -34.694 -20.802  1.00 15.55 ? 169 THR C C   1 
ATOM   6421  O  O   . THR C  1 169 ? 60.389 -35.022 -21.875  1.00 17.25 ? 169 THR C O   1 
ATOM   6422  C  CB  . THR C  1 169 ? 57.691 -33.528 -20.628  1.00 14.23 ? 169 THR C CB  1 
ATOM   6423  O  OG1 . THR C  1 169 ? 57.330 -34.474 -21.646  1.00 14.67 ? 169 THR C OG1 1 
ATOM   6424  C  CG2 . THR C  1 169 ? 56.957 -32.190 -20.852  1.00 15.69 ? 169 THR C CG2 1 
ATOM   6425  N  N   . HIS C  1 170 ? 59.876 -35.462 -19.720  1.00 14.31 ? 170 HIS C N   1 
ATOM   6426  C  CA  . HIS C  1 170 ? 60.161 -36.877 -19.726  1.00 15.88 ? 170 HIS C CA  1 
ATOM   6427  C  C   . HIS C  1 170 ? 58.827 -37.522 -19.495  1.00 16.11 ? 170 HIS C C   1 
ATOM   6428  O  O   . HIS C  1 170 ? 58.119 -37.150 -18.562  1.00 15.08 ? 170 HIS C O   1 
ATOM   6429  C  CB  . HIS C  1 170 ? 61.084 -37.192 -18.553  1.00 14.81 ? 170 HIS C CB  1 
ATOM   6430  C  CG  . HIS C  1 170 ? 61.313 -38.668 -18.315  1.00 16.31 ? 170 HIS C CG  1 
ATOM   6431  N  ND1 . HIS C  1 170 ? 62.486 -39.283 -18.624  1.00 14.77 ? 170 HIS C ND1 1 
ATOM   6432  C  CD2 . HIS C  1 170 ? 60.490 -39.644 -17.745  1.00 15.68 ? 170 HIS C CD2 1 
ATOM   6433  C  CE1 . HIS C  1 170 ? 62.401 -40.590 -18.282  1.00 16.99 ? 170 HIS C CE1 1 
ATOM   6434  N  NE2 . HIS C  1 170 ? 61.183 -40.808 -17.744  1.00 16.93 ? 170 HIS C NE2 1 
ATOM   6435  N  N   . SER C  1 171 ? 58.446 -38.473 -20.338  1.00 14.78 ? 171 SER C N   1 
ATOM   6436  C  CA  . SER C  1 171 ? 57.220 -39.231 -20.080  1.00 15.36 ? 171 SER C CA  1 
ATOM   6437  C  C   . SER C  1 171 ? 57.469 -40.714 -20.283  1.00 15.52 ? 171 SER C C   1 
ATOM   6438  O  O   . SER C  1 171 ? 58.546 -41.114 -20.729  1.00 17.30 ? 171 SER C O   1 
ATOM   6439  C  CB  . SER C  1 171 ? 56.067 -38.750 -20.965  1.00 15.97 ? 171 SER C CB  1 
ATOM   6440  O  OG  . SER C  1 171 ? 56.110 -39.339 -22.258  1.00 16.99 ? 171 SER C OG  1 
ATOM   6441  N  N   . ASN C  1 172 ? 56.481 -41.526 -19.926  1.00 15.98 ? 172 ASN C N   1 
ATOM   6442  C  CA  . ASN C  1 172 ? 56.501 -42.952 -20.230  1.00 17.12 ? 172 ASN C CA  1 
ATOM   6443  C  C   . ASN C  1 172 ? 55.562 -43.150 -21.400  1.00 17.79 ? 172 ASN C C   1 
ATOM   6444  O  O   . ASN C  1 172 ? 54.380 -42.803 -21.315  1.00 17.96 ? 172 ASN C O   1 
ATOM   6445  C  CB  . ASN C  1 172 ? 56.036 -43.777 -19.025  1.00 17.23 ? 172 ASN C CB  1 
ATOM   6446  C  CG  . ASN C  1 172 ? 56.001 -45.270 -19.314  1.00 21.98 ? 172 ASN C CG  1 
ATOM   6447  O  OD1 . ASN C  1 172 ? 55.260 -45.729 -20.183  1.00 22.35 ? 172 ASN C OD1 1 
ATOM   6448  N  ND2 . ASN C  1 172 ? 56.801 -46.036 -18.575  1.00 21.01 ? 172 ASN C ND2 1 
ATOM   6449  N  N   . ALA C  1 173 ? 56.084 -43.685 -22.498  1.00 18.61 ? 173 ALA C N   1 
ATOM   6450  C  CA  . ALA C  1 173 ? 55.324 -43.735 -23.747  1.00 20.67 ? 173 ALA C CA  1 
ATOM   6451  C  C   . ALA C  1 173 ? 54.113 -44.665 -23.702  1.00 22.06 ? 173 ALA C C   1 
ATOM   6452  O  O   . ALA C  1 173 ? 53.284 -44.645 -24.614  1.00 20.44 ? 173 ALA C O   1 
ATOM   6453  C  CB  . ALA C  1 173 ? 56.228 -44.115 -24.911  1.00 17.92 ? 173 ALA C CB  1 
ATOM   6454  N  N   . HIS C  1 174 ? 54.005 -45.472 -22.651  1.00 21.29 ? 174 HIS C N   1 
ATOM   6455  C  CA  . HIS C  1 174 ? 52.966 -46.509 -22.608  1.00 23.07 ? 174 HIS C CA  1 
ATOM   6456  C  C   . HIS C  1 174 ? 51.806 -46.268 -21.678  1.00 23.10 ? 174 HIS C C   1 
ATOM   6457  O  O   . HIS C  1 174 ? 50.894 -47.086 -21.637  1.00 23.20 ? 174 HIS C O   1 
ATOM   6458  C  CB  . HIS C  1 174 ? 53.585 -47.868 -22.302  1.00 22.67 ? 174 HIS C CB  1 
ATOM   6459  C  CG  . HIS C  1 174 ? 54.795 -48.185 -23.141  1.00 26.94 ? 174 HIS C CG  1 
ATOM   6460  N  ND1 . HIS C  1 174 ? 54.706 -48.525 -24.441  1.00 26.98 ? 174 HIS C ND1 1 
ATOM   6461  C  CD2 . HIS C  1 174 ? 56.150 -48.197 -22.823  1.00 28.77 ? 174 HIS C CD2 1 
ATOM   6462  C  CE1 . HIS C  1 174 ? 55.939 -48.745 -24.932  1.00 32.84 ? 174 HIS C CE1 1 
ATOM   6463  N  NE2 . HIS C  1 174 ? 56.823 -48.544 -23.939  1.00 36.19 ? 174 HIS C NE2 1 
ATOM   6464  N  N   . ASN C  1 175 ? 51.797 -45.161 -20.935  1.00 19.76 ? 175 ASN C N   1 
ATOM   6465  C  CA  . ASN C  1 175 ? 50.722 -44.953 -19.956  1.00 20.98 ? 175 ASN C CA  1 
ATOM   6466  C  C   . ASN C  1 175 ? 50.023 -43.592 -19.988  1.00 26.68 ? 175 ASN C C   1 
ATOM   6467  O  O   . ASN C  1 175 ? 49.434 -43.177 -18.991  1.00 29.73 ? 175 ASN C O   1 
ATOM   6468  C  CB  . ASN C  1 175 ? 51.237 -45.199 -18.538  1.00 19.55 ? 175 ASN C CB  1 
ATOM   6469  C  CG  . ASN C  1 175 ? 52.208 -44.126 -18.085  1.00 20.84 ? 175 ASN C CG  1 
ATOM   6470  O  OD1 . ASN C  1 175 ? 52.538 -43.211 -18.847  1.00 19.69 ? 175 ASN C OD1 1 
ATOM   6471  N  ND2 . ASN C  1 175 ? 52.664 -44.224 -16.844  1.00 17.70 ? 175 ASN C ND2 1 
ATOM   6472  N  N   . ASN C  1 176 ? 50.101 -42.887 -21.106  1.00 21.45 ? 176 ASN C N   1 
ATOM   6473  C  CA  . ASN C  1 176 ? 49.364 -41.628 -21.247  1.00 23.47 ? 176 ASN C CA  1 
ATOM   6474  C  C   . ASN C  1 176 ? 49.932 -40.417 -20.492  1.00 20.72 ? 176 ASN C C   1 
ATOM   6475  O  O   . ASN C  1 176 ? 49.329 -39.341 -20.501  1.00 18.87 ? 176 ASN C O   1 
ATOM   6476  C  CB  . ASN C  1 176 ? 47.906 -41.839 -20.832  1.00 31.85 ? 176 ASN C CB  1 
ATOM   6477  C  CG  . ASN C  1 176 ? 46.935 -41.135 -21.749  1.00 49.08 ? 176 ASN C CG  1 
ATOM   6478  O  OD1 . ASN C  1 176 ? 46.985 -41.306 -22.969  1.00 61.89 ? 176 ASN C OD1 1 
ATOM   6479  N  ND2 . ASN C  1 176 ? 46.035 -40.345 -21.168  1.00 53.76 ? 176 ASN C ND2 1 
ATOM   6480  N  N   . THR C  1 177 ? 51.075 -40.571 -19.829  1.00 17.43 ? 177 THR C N   1 
ATOM   6481  C  CA  . THR C  1 177 ? 51.608 -39.454 -19.048  1.00 16.49 ? 177 THR C CA  1 
ATOM   6482  C  C   . THR C  1 177 ? 51.963 -38.256 -19.932  1.00 16.63 ? 177 THR C C   1 
ATOM   6483  O  O   . THR C  1 177 ? 51.764 -37.103 -19.539  1.00 16.61 ? 177 THR C O   1 
ATOM   6484  C  CB  . THR C  1 177 ? 52.824 -39.855 -18.182  1.00 16.22 ? 177 THR C CB  1 
ATOM   6485  O  OG1 . THR C  1 177 ? 53.712 -40.681 -18.945  1.00 16.94 ? 177 THR C OG1 1 
ATOM   6486  C  CG2 . THR C  1 177 ? 52.360 -40.618 -16.926  1.00 17.33 ? 177 THR C CG2 1 
ATOM   6487  N  N   . GLY C  1 178 ? 52.486 -38.526 -21.124  1.00 13.44 ? 178 GLY C N   1 
ATOM   6488  C  CA  . GLY C  1 178 ? 52.804 -37.453 -22.066  1.00 16.70 ? 178 GLY C CA  1 
ATOM   6489  C  C   . GLY C  1 178 ? 51.581 -36.626 -22.436  1.00 17.38 ? 178 GLY C C   1 
ATOM   6490  O  O   . GLY C  1 178 ? 51.611 -35.393 -22.403  1.00 18.73 ? 178 GLY C O   1 
ATOM   6491  N  N   . LEU C  1 179 ? 50.494 -37.300 -22.784  1.00 17.20 ? 179 LEU C N   1 
ATOM   6492  C  CA  . LEU C  1 179 ? 49.260 -36.598 -23.134  1.00 18.11 ? 179 LEU C CA  1 
ATOM   6493  C  C   . LEU C  1 179 ? 48.717 -35.781 -21.954  1.00 19.80 ? 179 LEU C C   1 
ATOM   6494  O  O   . LEU C  1 179 ? 48.211 -34.677 -22.134  1.00 19.97 ? 179 LEU C O   1 
ATOM   6495  C  CB  . LEU C  1 179 ? 48.209 -37.590 -23.621  1.00 22.60 ? 179 LEU C CB  1 
ATOM   6496  C  CG  . LEU C  1 179 ? 46.965 -36.983 -24.271  1.00 24.32 ? 179 LEU C CG  1 
ATOM   6497  C  CD1 . LEU C  1 179 ? 47.319 -36.353 -25.613  1.00 22.48 ? 179 LEU C CD1 1 
ATOM   6498  C  CD2 . LEU C  1 179 ? 45.916 -38.068 -24.439  1.00 27.35 ? 179 LEU C CD2 1 
ATOM   6499  N  N   . GLU C  1 180 ? 48.825 -36.328 -20.749  1.00 19.93 ? 180 GLU C N   1 
ATOM   6500  C  CA  . GLU C  1 180 ? 48.397 -35.623 -19.538  1.00 20.94 ? 180 GLU C CA  1 
ATOM   6501  C  C   . GLU C  1 180 ? 49.256 -34.398 -19.222  1.00 19.42 ? 180 GLU C C   1 
ATOM   6502  O  O   . GLU C  1 180 ? 48.733 -33.358 -18.823  1.00 18.39 ? 180 GLU C O   1 
ATOM   6503  C  CB  . GLU C  1 180 ? 48.378 -36.579 -18.347  1.00 21.92 ? 180 GLU C CB  1 
ATOM   6504  C  CG  . GLU C  1 180 ? 47.161 -37.488 -18.340  1.00 25.94 ? 180 GLU C CG  1 
ATOM   6505  C  CD  . GLU C  1 180 ? 45.886 -36.706 -18.098  1.00 32.24 ? 180 GLU C CD  1 
ATOM   6506  O  OE1 . GLU C  1 180 ? 45.572 -36.432 -16.921  1.00 35.17 ? 180 GLU C OE1 1 
ATOM   6507  O  OE2 . GLU C  1 180 ? 45.203 -36.357 -19.080  1.00 33.56 ? 180 GLU C OE2 1 
ATOM   6508  N  N   . GLN C  1 181 ? 50.569 -34.526 -19.392  1.00 15.94 ? 181 GLN C N   1 
ATOM   6509  C  CA  . GLN C  1 181 ? 51.480 -33.395 -19.218  1.00 15.59 ? 181 GLN C CA  1 
ATOM   6510  C  C   . GLN C  1 181 ? 51.063 -32.250 -20.139  1.00 16.01 ? 181 GLN C C   1 
ATOM   6511  O  O   . GLN C  1 181 ? 50.975 -31.095 -19.722  1.00 15.22 ? 181 GLN C O   1 
ATOM   6512  C  CB  . GLN C  1 181 ? 52.924 -33.813 -19.528  1.00 16.51 ? 181 GLN C CB  1 
ATOM   6513  C  CG  . GLN C  1 181 ? 53.613 -34.663 -18.460  1.00 13.91 ? 181 GLN C CG  1 
ATOM   6514  C  CD  . GLN C  1 181 ? 54.905 -35.290 -18.969  1.00 17.78 ? 181 GLN C CD  1 
ATOM   6515  O  OE1 . GLN C  1 181 ? 55.114 -35.401 -20.178  1.00 15.18 ? 181 GLN C OE1 1 
ATOM   6516  N  NE2 . GLN C  1 181 ? 55.779 -35.708 -18.048  1.00 14.23 ? 181 GLN C NE2 1 
ATOM   6517  N  N   . GLN C  1 182 ? 50.810 -32.582 -21.400  1.00 16.35 ? 182 GLN C N   1 
ATOM   6518  C  CA  . GLN C  1 182 ? 50.397 -31.591 -22.383  1.00 15.88 ? 182 GLN C CA  1 
ATOM   6519  C  C   . GLN C  1 182 ? 49.069 -30.962 -21.979  1.00 16.82 ? 182 GLN C C   1 
ATOM   6520  O  O   . GLN C  1 182 ? 48.909 -29.751 -22.040  1.00 17.23 ? 182 GLN C O   1 
ATOM   6521  C  CB  . GLN C  1 182 ? 50.267 -32.236 -23.763  1.00 16.63 ? 182 GLN C CB  1 
ATOM   6522  C  CG  . GLN C  1 182 ? 49.772 -31.297 -24.852  1.00 19.51 ? 182 GLN C CG  1 
ATOM   6523  C  CD  . GLN C  1 182 ? 49.586 -32.014 -26.173  1.00 23.13 ? 182 GLN C CD  1 
ATOM   6524  O  OE1 . GLN C  1 182 ? 48.951 -33.070 -26.234  1.00 22.29 ? 182 GLN C OE1 1 
ATOM   6525  N  NE2 . GLN C  1 182 ? 50.148 -31.451 -27.236  1.00 19.48 ? 182 GLN C NE2 1 
ATOM   6526  N  N   . ARG C  1 183 ? 48.117 -31.792 -21.572  1.00 15.94 ? 183 ARG C N   1 
ATOM   6527  C  CA  . ARG C  1 183 ? 46.810 -31.285 -21.188  1.00 19.75 ? 183 ARG C CA  1 
ATOM   6528  C  C   . ARG C  1 183 ? 46.933 -30.287 -20.045  1.00 17.25 ? 183 ARG C C   1 
ATOM   6529  O  O   . ARG C  1 183 ? 46.404 -29.187 -20.126  1.00 20.20 ? 183 ARG C O   1 
ATOM   6530  C  CB  . ARG C  1 183 ? 45.865 -32.422 -20.785  1.00 19.23 ? 183 ARG C CB  1 
ATOM   6531  C  CG  . ARG C  1 183 ? 44.502 -31.910 -20.341  1.00 23.22 ? 183 ARG C CG  1 
ATOM   6532  C  CD  . ARG C  1 183 ? 43.594 -33.016 -19.822  1.00 26.14 ? 183 ARG C CD  1 
ATOM   6533  N  NE  . ARG C  1 183 ? 44.142 -33.694 -18.647  1.00 26.82 ? 183 ARG C NE  1 
ATOM   6534  C  CZ  . ARG C  1 183 ? 44.137 -33.193 -17.413  1.00 28.40 ? 183 ARG C CZ  1 
ATOM   6535  N  NH1 . ARG C  1 183 ? 44.648 -33.895 -16.410  1.00 27.31 ? 183 ARG C NH1 1 
ATOM   6536  N  NH2 . ARG C  1 183 ? 43.630 -31.991 -17.177  1.00 28.54 ? 183 ARG C NH2 1 
ATOM   6537  N  N   . ILE C  1 184 ? 47.650 -30.670 -18.990  1.00 16.81 ? 184 ILE C N   1 
ATOM   6538  C  CA  . ILE C  1 184 ? 47.762 -29.825 -17.802  1.00 16.72 ? 184 ILE C CA  1 
ATOM   6539  C  C   . ILE C  1 184 ? 48.513 -28.526 -18.117  1.00 16.75 ? 184 ILE C C   1 
ATOM   6540  O  O   . ILE C  1 184 ? 48.095 -27.441 -17.702  1.00 16.80 ? 184 ILE C O   1 
ATOM   6541  C  CB  . ILE C  1 184 ? 48.413 -30.581 -16.627  1.00 18.72 ? 184 ILE C CB  1 
ATOM   6542  C  CG1 . ILE C  1 184 ? 47.504 -31.723 -16.163  1.00 21.15 ? 184 ILE C CG1 1 
ATOM   6543  C  CG2 . ILE C  1 184 ? 48.695 -29.643 -15.458  1.00 17.59 ? 184 ILE C CG2 1 
ATOM   6544  C  CD1 . ILE C  1 184 ? 48.235 -32.783 -15.364  1.00 24.35 ? 184 ILE C CD1 1 
ATOM   6545  N  N   . LEU C  1 185 ? 49.606 -28.627 -18.864  1.00 14.97 ? 185 LEU C N   1 
ATOM   6546  C  CA  . LEU C  1 185 ? 50.337 -27.423 -19.269  1.00 16.14 ? 185 LEU C CA  1 
ATOM   6547  C  C   . LEU C  1 185 ? 49.469 -26.463 -20.094  1.00 16.24 ? 185 LEU C C   1 
ATOM   6548  O  O   . LEU C  1 185 ? 49.446 -25.259 -19.838  1.00 17.33 ? 185 LEU C O   1 
ATOM   6549  C  CB  . LEU C  1 185 ? 51.592 -27.790 -20.055  1.00 14.24 ? 185 LEU C CB  1 
ATOM   6550  C  CG  . LEU C  1 185 ? 52.670 -28.504 -19.238  1.00 15.08 ? 185 LEU C CG  1 
ATOM   6551  C  CD1 . LEU C  1 185 ? 53.775 -29.006 -20.158  1.00 13.02 ? 185 LEU C CD1 1 
ATOM   6552  C  CD2 . LEU C  1 185 ? 53.222 -27.587 -18.150  1.00 14.05 ? 185 LEU C CD2 1 
ATOM   6553  N  N   . THR C  1 186 ? 48.767 -26.989 -21.093  1.00 16.12 ? 186 THR C N   1 
ATOM   6554  C  CA  . THR C  1 186 ? 47.957 -26.122 -21.947  1.00 18.73 ? 186 THR C CA  1 
ATOM   6555  C  C   . THR C  1 186 ? 46.784 -25.512 -21.174  1.00 18.92 ? 186 THR C C   1 
ATOM   6556  O  O   . THR C  1 186 ? 46.416 -24.355 -21.397  1.00 21.96 ? 186 THR C O   1 
ATOM   6557  C  CB  . THR C  1 186 ? 47.493 -26.827 -23.241  1.00 22.65 ? 186 THR C CB  1 
ATOM   6558  O  OG1 . THR C  1 186 ? 46.811 -28.044 -22.919  1.00 25.82 ? 186 THR C OG1 1 
ATOM   6559  C  CG2 . THR C  1 186 ? 48.691 -27.152 -24.117  1.00 19.68 ? 186 THR C CG2 1 
ATOM   6560  N  N   . GLU C  1 187 ? 46.205 -26.277 -20.257  1.00 18.59 ? 187 GLU C N   1 
ATOM   6561  C  CA  . GLU C  1 187 ? 45.153 -25.733 -19.403  1.00 20.15 ? 187 GLU C CA  1 
ATOM   6562  C  C   . GLU C  1 187 ? 45.671 -24.586 -18.534  1.00 20.69 ? 187 GLU C C   1 
ATOM   6563  O  O   . GLU C  1 187 ? 44.938 -23.637 -18.249  1.00 20.82 ? 187 GLU C O   1 
ATOM   6564  C  CB  . GLU C  1 187 ? 44.524 -26.826 -18.536  1.00 21.40 ? 187 GLU C CB  1 
ATOM   6565  C  CG  . GLU C  1 187 ? 43.605 -27.748 -19.319  1.00 25.90 ? 187 GLU C CG  1 
ATOM   6566  C  CD  . GLU C  1 187 ? 42.970 -28.829 -18.463  1.00 32.73 ? 187 GLU C CD  1 
ATOM   6567  O  OE1 . GLU C  1 187 ? 42.228 -29.660 -19.029  1.00 35.46 ? 187 GLU C OE1 1 
ATOM   6568  O  OE2 . GLU C  1 187 ? 43.212 -28.853 -17.235  1.00 33.73 ? 187 GLU C OE2 1 
ATOM   6569  N  N   . GLU C  1 188 ? 46.926 -24.675 -18.108  1.00 19.78 ? 188 GLU C N   1 
ATOM   6570  C  CA  . GLU C  1 188 ? 47.534 -23.607 -17.314  1.00 22.08 ? 188 GLU C CA  1 
ATOM   6571  C  C   . GLU C  1 188 ? 47.929 -22.403 -18.169  1.00 22.68 ? 188 GLU C C   1 
ATOM   6572  O  O   . GLU C  1 188 ? 48.396 -21.395 -17.643  1.00 26.51 ? 188 GLU C O   1 
ATOM   6573  C  CB  . GLU C  1 188 ? 48.749 -24.124 -16.536  1.00 24.13 ? 188 GLU C CB  1 
ATOM   6574  C  CG  . GLU C  1 188 ? 48.404 -25.035 -15.362  1.00 25.33 ? 188 GLU C CG  1 
ATOM   6575  C  CD  . GLU C  1 188 ? 47.806 -24.285 -14.185  1.00 27.06 ? 188 GLU C CD  1 
ATOM   6576  O  OE1 . GLU C  1 188 ? 47.776 -23.039 -14.216  1.00 31.89 ? 188 GLU C OE1 1 
ATOM   6577  O  OE2 . GLU C  1 188 ? 47.354 -24.939 -13.226  1.00 28.42 ? 188 GLU C OE2 1 
ATOM   6578  N  N   . GLY C  1 189 ? 47.759 -22.512 -19.486  1.00 21.28 ? 189 GLY C N   1 
ATOM   6579  C  CA  . GLY C  1 189 ? 47.985 -21.378 -20.377  1.00 21.56 ? 189 GLY C CA  1 
ATOM   6580  C  C   . GLY C  1 189 ? 49.295 -21.408 -21.148  1.00 22.64 ? 189 GLY C C   1 
ATOM   6581  O  O   . GLY C  1 189 ? 49.683 -20.413 -21.770  1.00 18.44 ? 189 GLY C O   1 
ATOM   6582  N  N   . VAL C  1 190 ? 49.977 -22.549 -21.114  1.00 17.79 ? 190 VAL C N   1 
ATOM   6583  C  CA  . VAL C  1 190 ? 51.184 -22.730 -21.905  1.00 18.03 ? 190 VAL C CA  1 
ATOM   6584  C  C   . VAL C  1 190 ? 50.814 -22.950 -23.368  1.00 21.32 ? 190 VAL C C   1 
ATOM   6585  O  O   . VAL C  1 190 ? 49.928 -23.755 -23.685  1.00 20.36 ? 190 VAL C O   1 
ATOM   6586  C  CB  . VAL C  1 190 ? 52.006 -23.948 -21.425  1.00 17.09 ? 190 VAL C CB  1 
ATOM   6587  C  CG1 . VAL C  1 190 ? 53.212 -24.172 -22.334  1.00 14.78 ? 190 VAL C CG1 1 
ATOM   6588  C  CG2 . VAL C  1 190 ? 52.443 -23.765 -19.977  1.00 17.23 ? 190 VAL C CG2 1 
ATOM   6589  N  N   . ASP C  1 191 ? 51.500 -22.240 -24.256  1.00 19.02 ? 191 ASP C N   1 
ATOM   6590  C  CA  . ASP C  1 191 ? 51.355 -22.464 -25.692  1.00 19.98 ? 191 ASP C CA  1 
ATOM   6591  C  C   . ASP C  1 191 ? 51.831 -23.881 -26.015  1.00 20.45 ? 191 ASP C C   1 
ATOM   6592  O  O   . ASP C  1 191 ? 52.935 -24.266 -25.628  1.00 20.22 ? 191 ASP C O   1 
ATOM   6593  C  CB  . ASP C  1 191 ? 52.185 -21.422 -26.442  1.00 23.10 ? 191 ASP C CB  1 
ATOM   6594  C  CG  . ASP C  1 191 ? 52.157 -21.600 -27.950  1.00 28.38 ? 191 ASP C CG  1 
ATOM   6595  O  OD1 . ASP C  1 191 ? 51.787 -22.683 -28.452  1.00 27.74 ? 191 ASP C OD1 1 
ATOM   6596  O  OD2 . ASP C  1 191 ? 52.531 -20.632 -28.640  1.00 41.21 ? 191 ASP C OD2 1 
ATOM   6597  N  N   . PRO C  1 192 ? 51.002 -24.664 -26.732  1.00 21.64 ? 192 PRO C N   1 
ATOM   6598  C  CA  . PRO C  1 192 ? 51.343 -26.050 -27.065  1.00 20.03 ? 192 PRO C CA  1 
ATOM   6599  C  C   . PRO C  1 192 ? 52.682 -26.141 -27.796  1.00 18.97 ? 192 PRO C C   1 
ATOM   6600  O  O   . PRO C  1 192 ? 53.414 -27.124 -27.636  1.00 17.17 ? 192 PRO C O   1 
ATOM   6601  C  CB  . PRO C  1 192 ? 50.204 -26.485 -27.999  1.00 22.09 ? 192 PRO C CB  1 
ATOM   6602  C  CG  . PRO C  1 192 ? 49.072 -25.561 -27.691  1.00 28.89 ? 192 PRO C CG  1 
ATOM   6603  C  CD  . PRO C  1 192 ? 49.703 -24.253 -27.299  1.00 22.44 ? 192 PRO C CD  1 
ATOM   6604  N  N   . GLY C  1 193 ? 52.988 -25.115 -28.587  1.00 19.30 ? 193 GLY C N   1 
ATOM   6605  C  CA  . GLY C  1 193 ? 54.215 -25.069 -29.376  1.00 18.35 ? 193 GLY C CA  1 
ATOM   6606  C  C   . GLY C  1 193 ? 55.451 -24.767 -28.550  1.00 19.45 ? 193 GLY C C   1 
ATOM   6607  O  O   . GLY C  1 193 ? 56.566 -24.725 -29.071  1.00 18.85 ? 193 GLY C O   1 
ATOM   6608  N  N   . LYS C  1 194 ? 55.255 -24.548 -27.256  1.00 16.78 ? 194 LYS C N   1 
ATOM   6609  C  CA  . LYS C  1 194 ? 56.375 -24.341 -26.348  1.00 17.94 ? 194 LYS C CA  1 
ATOM   6610  C  C   . LYS C  1 194 ? 56.613 -25.583 -25.488  1.00 15.92 ? 194 LYS C C   1 
ATOM   6611  O  O   . LYS C  1 194 ? 57.294 -25.520 -24.459  1.00 19.16 ? 194 LYS C O   1 
ATOM   6612  C  CB  . LYS C  1 194 ? 56.137 -23.103 -25.481  1.00 15.76 ? 194 LYS C CB  1 
ATOM   6613  C  CG  . LYS C  1 194 ? 56.449 -21.797 -26.202  1.00 19.56 ? 194 LYS C CG  1 
ATOM   6614  C  CD  . LYS C  1 194 ? 57.926 -21.471 -26.010  1.00 22.35 ? 194 LYS C CD  1 
ATOM   6615  C  CE  . LYS C  1 194 ? 58.426 -20.416 -26.971  1.00 26.46 ? 194 LYS C CE  1 
ATOM   6616  N  NZ  . LYS C  1 194 ? 59.885 -20.205 -26.755  1.00 22.21 ? 194 LYS C NZ  1 
ATOM   6617  N  N   . ILE C  1 195 ? 56.054 -26.710 -25.926  1.00 16.35 ? 195 ILE C N   1 
ATOM   6618  C  CA  . ILE C  1 195 ? 56.191 -27.974 -25.208  1.00 14.04 ? 195 ILE C CA  1 
ATOM   6619  C  C   . ILE C  1 195 ? 56.780 -29.075 -26.084  1.00 15.21 ? 195 ILE C C   1 
ATOM   6620  O  O   . ILE C  1 195 ? 56.345 -29.282 -27.225  1.00 14.83 ? 195 ILE C O   1 
ATOM   6621  C  CB  . ILE C  1 195 ? 54.831 -28.473 -24.671  1.00 13.02 ? 195 ILE C CB  1 
ATOM   6622  C  CG1 . ILE C  1 195 ? 54.134 -27.393 -23.839  1.00 13.40 ? 195 ILE C CG1 1 
ATOM   6623  C  CG2 . ILE C  1 195 ? 55.011 -29.735 -23.839  1.00 13.70 ? 195 ILE C CG2 1 
ATOM   6624  C  CD1 . ILE C  1 195 ? 52.654 -27.678 -23.626  1.00 13.44 ? 195 ILE C CD1 1 
ATOM   6625  N  N   . LEU C  1 196 ? 57.770 -29.779 -25.538  1.00 13.99 ? 196 LEU C N   1 
ATOM   6626  C  CA  . LEU C  1 196 ? 58.293 -30.998 -26.144  1.00 12.76 ? 196 LEU C CA  1 
ATOM   6627  C  C   . LEU C  1 196 ? 57.919 -32.148 -25.226  1.00 11.94 ? 196 LEU C C   1 
ATOM   6628  O  O   . LEU C  1 196 ? 58.412 -32.233 -24.101  1.00 12.12 ? 196 LEU C O   1 
ATOM   6629  C  CB  . LEU C  1 196 ? 59.816 -30.940 -26.285  1.00 11.75 ? 196 LEU C CB  1 
ATOM   6630  C  CG  . LEU C  1 196 ? 60.495 -32.282 -26.629  1.00 12.72 ? 196 LEU C CG  1 
ATOM   6631  C  CD1 . LEU C  1 196 ? 59.873 -32.917 -27.872  1.00 10.95 ? 196 LEU C CD1 1 
ATOM   6632  C  CD2 . LEU C  1 196 ? 61.988 -32.090 -26.839  1.00 13.00 ? 196 LEU C CD2 1 
ATOM   6633  N  N   . ILE C  1 197 ? 57.031 -33.018 -25.691  1.00 12.89 ? 197 ILE C N   1 
ATOM   6634  C  CA  . ILE C  1 197 ? 56.648 -34.179 -24.901  1.00 12.82 ? 197 ILE C CA  1 
ATOM   6635  C  C   . ILE C  1 197 ? 57.640 -35.308 -25.190  1.00 14.62 ? 197 ILE C C   1 
ATOM   6636  O  O   . ILE C  1 197 ? 57.695 -35.829 -26.305  1.00 15.14 ? 197 ILE C O   1 
ATOM   6637  C  CB  . ILE C  1 197 ? 55.213 -34.631 -25.217  1.00 13.92 ? 197 ILE C CB  1 
ATOM   6638  C  CG1 . ILE C  1 197 ? 54.219 -33.511 -24.882  1.00 14.03 ? 197 ILE C CG1 1 
ATOM   6639  C  CG2 . ILE C  1 197 ? 54.873 -35.890 -24.435  1.00 15.01 ? 197 ILE C CG2 1 
ATOM   6640  C  CD1 . ILE C  1 197 ? 54.216 -33.145 -23.405  1.00 12.13 ? 197 ILE C CD1 1 
ATOM   6641  N  N   . GLY C  1 198 ? 58.415 -35.681 -24.178  1.00 12.82 ? 198 GLY C N   1 
ATOM   6642  C  CA  . GLY C  1 198 ? 59.560 -36.565 -24.377  1.00 15.10 ? 198 GLY C CA  1 
ATOM   6643  C  C   . GLY C  1 198 ? 59.304 -38.061 -24.358  1.00 14.93 ? 198 GLY C C   1 
ATOM   6644  O  O   . GLY C  1 198 ? 58.325 -38.542 -23.779  1.00 13.77 ? 198 GLY C O   1 
ATOM   6645  N  N   . HIS C  1 199 ? 60.213 -38.791 -25.003  1.00 15.09 ? 199 HIS C N   1 
ATOM   6646  C  CA  . HIS C  1 199 ? 60.264 -40.253 -24.963  1.00 13.82 ? 199 HIS C CA  1 
ATOM   6647  C  C   . HIS C  1 199 ? 59.137 -40.963 -25.662  1.00 15.32 ? 199 HIS C C   1 
ATOM   6648  O  O   . HIS C  1 199 ? 58.902 -42.154 -25.429  1.00 18.47 ? 199 HIS C O   1 
ATOM   6649  C  CB  . HIS C  1 199 ? 60.468 -40.756 -23.534  1.00 13.89 ? 199 HIS C CB  1 
ATOM   6650  C  CG  . HIS C  1 199 ? 61.594 -40.050 -22.794  1.00 14.92 ? 199 HIS C CG  1 
ATOM   6651  N  ND1 . HIS C  1 199 ? 62.668 -39.539 -23.429  1.00 14.49 ? 199 HIS C ND1 1 
ATOM   6652  C  CD2 . HIS C  1 199 ? 61.785 -39.799 -21.433  1.00 13.05 ? 199 HIS C CD2 1 
ATOM   6653  C  CE1 . HIS C  1 199 ? 63.499 -38.969 -22.524  1.00 11.64 ? 199 HIS C CE1 1 
ATOM   6654  N  NE2 . HIS C  1 199 ? 62.961 -39.133 -21.301  1.00 13.77 ? 199 HIS C NE2 1 
ATOM   6655  N  N   . LEU C  1 200 ? 58.451 -40.251 -26.550  1.00 14.52 ? 200 LEU C N   1 
ATOM   6656  C  CA  . LEU C  1 200 ? 57.397 -40.842 -27.381  1.00 15.74 ? 200 LEU C CA  1 
ATOM   6657  C  C   . LEU C  1 200 ? 57.958 -41.832 -28.400  1.00 15.64 ? 200 LEU C C   1 
ATOM   6658  O  O   . LEU C  1 200 ? 57.236 -42.701 -28.901  1.00 16.52 ? 200 LEU C O   1 
ATOM   6659  C  CB  . LEU C  1 200 ? 56.588 -39.746 -28.091  1.00 14.92 ? 200 LEU C CB  1 
ATOM   6660  C  CG  . LEU C  1 200 ? 55.807 -38.840 -27.130  1.00 16.31 ? 200 LEU C CG  1 
ATOM   6661  C  CD1 . LEU C  1 200 ? 55.016 -37.774 -27.881  1.00 13.79 ? 200 LEU C CD1 1 
ATOM   6662  C  CD2 . LEU C  1 200 ? 54.887 -39.672 -26.248  1.00 15.83 ? 200 LEU C CD2 1 
ATOM   6663  N  N   . GLY C  1 201 ? 59.246 -41.699 -28.706  1.00 14.17 ? 201 GLY C N   1 
ATOM   6664  C  CA  . GLY C  1 201 ? 59.919 -42.652 -29.601  1.00 15.59 ? 201 GLY C CA  1 
ATOM   6665  C  C   . GLY C  1 201 ? 60.070 -44.039 -28.991  1.00 17.19 ? 201 GLY C C   1 
ATOM   6666  O  O   . GLY C  1 201 ? 60.434 -44.989 -29.680  1.00 16.82 ? 201 GLY C O   1 
ATOM   6667  N  N   . ASP C  1 202 ? 59.776 -44.161 -27.699  1.00 17.39 ? 202 ASP C N   1 
ATOM   6668  C  CA  . ASP C  1 202 ? 59.846 -45.454 -27.008  1.00 16.92 ? 202 ASP C CA  1 
ATOM   6669  C  C   . ASP C  1 202 ? 58.703 -46.395 -27.404  1.00 19.05 ? 202 ASP C C   1 
ATOM   6670  O  O   . ASP C  1 202 ? 58.698 -47.558 -27.002  1.00 18.76 ? 202 ASP C O   1 
ATOM   6671  C  CB  . ASP C  1 202 ? 59.814 -45.272 -25.486  1.00 16.06 ? 202 ASP C CB  1 
ATOM   6672  C  CG  . ASP C  1 202 ? 61.021 -44.530 -24.960  1.00 18.55 ? 202 ASP C CG  1 
ATOM   6673  O  OD1 . ASP C  1 202 ? 61.924 -44.215 -25.765  1.00 15.87 ? 202 ASP C OD1 1 
ATOM   6674  O  OD2 . ASP C  1 202 ? 61.063 -44.262 -23.736  1.00 18.32 ? 202 ASP C OD2 1 
ATOM   6675  N  N   . THR C  1 203 ? 57.731 -45.896 -28.169  1.00 18.32 ? 203 THR C N   1 
ATOM   6676  C  CA  . THR C  1 203 ? 56.622 -46.745 -28.621  1.00 18.43 ? 203 THR C CA  1 
ATOM   6677  C  C   . THR C  1 203 ? 56.465 -46.734 -30.135  1.00 23.29 ? 203 THR C C   1 
ATOM   6678  O  O   . THR C  1 203 ? 56.893 -45.790 -30.804  1.00 18.55 ? 203 THR C O   1 
ATOM   6679  C  CB  . THR C  1 203 ? 55.277 -46.354 -27.964  1.00 19.72 ? 203 THR C CB  1 
ATOM   6680  O  OG1 . THR C  1 203 ? 54.274 -47.317 -28.317  1.00 20.00 ? 203 THR C OG1 1 
ATOM   6681  C  CG2 . THR C  1 203 ? 54.825 -44.964 -28.412  1.00 17.88 ? 203 THR C CG2 1 
ATOM   6682  N  N   . ASP C  1 204 ? 55.869 -47.793 -30.677  1.00 21.95 ? 204 ASP C N   1 
ATOM   6683  C  CA  . ASP C  1 204 ? 55.502 -47.796 -32.089  1.00 25.18 ? 204 ASP C CA  1 
ATOM   6684  C  C   . ASP C  1 204 ? 54.002 -47.547 -32.265  1.00 25.52 ? 204 ASP C C   1 
ATOM   6685  O  O   . ASP C  1 204 ? 53.462 -47.679 -33.362  1.00 23.10 ? 204 ASP C O   1 
ATOM   6686  C  CB  . ASP C  1 204 ? 55.952 -49.080 -32.800  1.00 25.14 ? 204 ASP C CB  1 
ATOM   6687  C  CG  . ASP C  1 204 ? 55.338 -50.327 -32.212  1.00 31.19 ? 204 ASP C CG  1 
ATOM   6688  O  OD1 . ASP C  1 204 ? 55.700 -51.427 -32.679  1.00 40.58 ? 204 ASP C OD1 1 
ATOM   6689  O  OD2 . ASP C  1 204 ? 54.502 -50.218 -31.288  1.00 32.51 ? 204 ASP C OD2 1 
ATOM   6690  N  N   . ASN C  1 205 ? 53.337 -47.177 -31.176  1.00 24.12 ? 205 ASN C N   1 
ATOM   6691  C  CA  . ASN C  1 205 ? 51.933 -46.785 -31.241  1.00 25.65 ? 205 ASN C CA  1 
ATOM   6692  C  C   . ASN C  1 205 ? 51.792 -45.372 -31.810  1.00 24.46 ? 205 ASN C C   1 
ATOM   6693  O  O   . ASN C  1 205 ? 51.679 -44.395 -31.063  1.00 21.49 ? 205 ASN C O   1 
ATOM   6694  C  CB  . ASN C  1 205 ? 51.291 -46.881 -29.854  1.00 26.09 ? 205 ASN C CB  1 
ATOM   6695  C  CG  . ASN C  1 205 ? 49.824 -46.487 -29.857  1.00 31.22 ? 205 ASN C CG  1 
ATOM   6696  O  OD1 . ASN C  1 205 ? 49.280 -46.071 -30.880  1.00 30.69 ? 205 ASN C OD1 1 
ATOM   6697  N  ND2 . ASN C  1 205 ? 49.178 -46.607 -28.701  1.00 32.53 ? 205 ASN C ND2 1 
ATOM   6698  N  N   . ILE C  1 206 ? 51.801 -45.268 -33.138  1.00 22.61 ? 206 ILE C N   1 
ATOM   6699  C  CA  . ILE C  1 206 ? 51.800 -43.969 -33.798  1.00 22.63 ? 206 ILE C CA  1 
ATOM   6700  C  C   . ILE C  1 206 ? 50.510 -43.197 -33.577  1.00 21.56 ? 206 ILE C C   1 
ATOM   6701  O  O   . ILE C  1 206 ? 50.496 -41.985 -33.714  1.00 18.78 ? 206 ILE C O   1 
ATOM   6702  C  CB  . ILE C  1 206 ? 52.025 -44.081 -35.318  1.00 27.28 ? 206 ILE C CB  1 
ATOM   6703  C  CG1 . ILE C  1 206 ? 51.010 -45.049 -35.931  1.00 28.15 ? 206 ILE C CG1 1 
ATOM   6704  C  CG2 . ILE C  1 206 ? 53.449 -44.511 -35.617  1.00 37.40 ? 206 ILE C CG2 1 
ATOM   6705  C  CD1 . ILE C  1 206 ? 51.017 -45.058 -37.442  1.00 37.77 ? 206 ILE C CD1 1 
ATOM   6706  N  N   . ASP C  1 207 ? 49.425 -43.894 -33.256  1.00 22.27 ? 207 ASP C N   1 
ATOM   6707  C  CA  . ASP C  1 207 ? 48.154 -43.213 -33.018  1.00 23.14 ? 207 ASP C CA  1 
ATOM   6708  C  C   . ASP C  1 207 ? 48.271 -42.332 -31.780  1.00 22.89 ? 207 ASP C C   1 
ATOM   6709  O  O   . ASP C  1 207 ? 47.824 -41.184 -31.772  1.00 21.63 ? 207 ASP C O   1 
ATOM   6710  C  CB  . ASP C  1 207 ? 47.016 -44.219 -32.859  1.00 26.21 ? 207 ASP C CB  1 
ATOM   6711  C  CG  . ASP C  1 207 ? 46.615 -44.861 -34.180  1.00 35.93 ? 207 ASP C CG  1 
ATOM   6712  O  OD1 . ASP C  1 207 ? 45.933 -45.908 -34.154  1.00 45.41 ? 207 ASP C OD1 1 
ATOM   6713  O  OD2 . ASP C  1 207 ? 46.984 -44.320 -35.246  1.00 35.82 ? 207 ASP C OD2 1 
ATOM   6714  N  N   . TYR C  1 208 ? 48.884 -42.868 -30.732  1.00 20.13 ? 208 TYR C N   1 
ATOM   6715  C  CA  . TYR C  1 208 ? 49.109 -42.089 -29.521  1.00 17.43 ? 208 TYR C CA  1 
ATOM   6716  C  C   . TYR C  1 208 ? 50.065 -40.921 -29.798  1.00 17.55 ? 208 TYR C C   1 
ATOM   6717  O  O   . TYR C  1 208 ? 49.817 -39.776 -29.395  1.00 17.46 ? 208 TYR C O   1 
ATOM   6718  C  CB  . TYR C  1 208 ? 49.647 -42.995 -28.409  1.00 17.40 ? 208 TYR C CB  1 
ATOM   6719  C  CG  . TYR C  1 208 ? 50.082 -42.257 -27.168  1.00 18.02 ? 208 TYR C CG  1 
ATOM   6720  C  CD1 . TYR C  1 208 ? 49.158 -41.585 -26.380  1.00 18.92 ? 208 TYR C CD1 1 
ATOM   6721  C  CD2 . TYR C  1 208 ? 51.423 -42.233 -26.781  1.00 16.96 ? 208 TYR C CD2 1 
ATOM   6722  C  CE1 . TYR C  1 208 ? 49.552 -40.907 -25.243  1.00 18.44 ? 208 TYR C CE1 1 
ATOM   6723  C  CE2 . TYR C  1 208 ? 51.826 -41.557 -25.642  1.00 16.83 ? 208 TYR C CE2 1 
ATOM   6724  C  CZ  . TYR C  1 208 ? 50.884 -40.895 -24.881  1.00 18.61 ? 208 TYR C CZ  1 
ATOM   6725  O  OH  . TYR C  1 208 ? 51.267 -40.220 -23.750  1.00 16.75 ? 208 TYR C OH  1 
ATOM   6726  N  N   . ILE C  1 209 ? 51.151 -41.203 -30.507  1.00 16.72 ? 209 ILE C N   1 
ATOM   6727  C  CA  . ILE C  1 209 ? 52.139 -40.170 -30.802  1.00 16.96 ? 209 ILE C CA  1 
ATOM   6728  C  C   . ILE C  1 209 ? 51.512 -39.000 -31.561  1.00 18.49 ? 209 ILE C C   1 
ATOM   6729  O  O   . ILE C  1 209 ? 51.766 -37.827 -31.249  1.00 17.31 ? 209 ILE C O   1 
ATOM   6730  C  CB  . ILE C  1 209 ? 53.321 -40.743 -31.604  1.00 15.25 ? 209 ILE C CB  1 
ATOM   6731  C  CG1 . ILE C  1 209 ? 54.080 -41.780 -30.765  1.00 14.44 ? 209 ILE C CG1 1 
ATOM   6732  C  CG2 . ILE C  1 209 ? 54.251 -39.627 -32.048  1.00 16.62 ? 209 ILE C CG2 1 
ATOM   6733  C  CD1 . ILE C  1 209 ? 55.245 -42.419 -31.501  1.00 17.34 ? 209 ILE C CD1 1 
ATOM   6734  N  N   . LYS C  1 210 ? 50.698 -39.316 -32.564  1.00 16.17 ? 210 LYS C N   1 
ATOM   6735  C  CA  . LYS C  1 210 ? 50.041 -38.275 -33.360  1.00 17.62 ? 210 LYS C CA  1 
ATOM   6736  C  C   . LYS C  1 210 ? 49.047 -37.429 -32.557  1.00 18.69 ? 210 LYS C C   1 
ATOM   6737  O  O   . LYS C  1 210 ? 48.856 -36.252 -32.854  1.00 20.42 ? 210 LYS C O   1 
ATOM   6738  C  CB  . LYS C  1 210 ? 49.342 -38.882 -34.578  1.00 18.52 ? 210 LYS C CB  1 
ATOM   6739  C  CG  . LYS C  1 210 ? 50.286 -39.509 -35.596  1.00 19.12 ? 210 LYS C CG  1 
ATOM   6740  C  CD  . LYS C  1 210 ? 49.498 -40.095 -36.759  1.00 21.00 ? 210 LYS C CD  1 
ATOM   6741  C  CE  . LYS C  1 210 ? 50.409 -40.643 -37.843  1.00 21.50 ? 210 LYS C CE  1 
ATOM   6742  N  NZ  . LYS C  1 210 ? 49.601 -41.310 -38.905  1.00 22.75 ? 210 LYS C NZ  1 
ATOM   6743  N  N   . LYS C  1 211 ? 48.410 -38.021 -31.551  1.00 22.44 ? 211 LYS C N   1 
ATOM   6744  C  CA  . LYS C  1 211 ? 47.485 -37.269 -30.708  1.00 24.16 ? 211 LYS C CA  1 
ATOM   6745  C  C   . LYS C  1 211 ? 48.176 -36.050 -30.122  1.00 22.82 ? 211 LYS C C   1 
ATOM   6746  O  O   . LYS C  1 211 ? 47.631 -34.949 -30.109  1.00 25.71 ? 211 LYS C O   1 
ATOM   6747  C  CB  . LYS C  1 211 ? 46.964 -38.122 -29.555  1.00 28.82 ? 211 LYS C CB  1 
ATOM   6748  C  CG  . LYS C  1 211 ? 46.024 -39.235 -29.953  1.00 30.88 ? 211 LYS C CG  1 
ATOM   6749  C  CD  . LYS C  1 211 ? 45.338 -39.814 -28.727  1.00 39.40 ? 211 LYS C CD  1 
ATOM   6750  C  CE  . LYS C  1 211 ? 44.384 -38.805 -28.105  1.00 49.13 ? 211 LYS C CE  1 
ATOM   6751  N  NZ  . LYS C  1 211 ? 43.599 -39.396 -26.984  1.00 56.28 ? 211 LYS C NZ  1 
ATOM   6752  N  N   . ILE C  1 212 ? 49.383 -36.258 -29.623  1.00 22.08 ? 212 ILE C N   1 
ATOM   6753  C  CA  . ILE C  1 212 ? 50.114 -35.200 -28.960  1.00 19.74 ? 212 ILE C CA  1 
ATOM   6754  C  C   . ILE C  1 212 ? 50.500 -34.132 -29.977  1.00 21.06 ? 212 ILE C C   1 
ATOM   6755  O  O   . ILE C  1 212 ? 50.278 -32.940 -29.751  1.00 19.25 ? 212 ILE C O   1 
ATOM   6756  C  CB  . ILE C  1 212 ? 51.338 -35.777 -28.226  1.00 21.22 ? 212 ILE C CB  1 
ATOM   6757  C  CG1 . ILE C  1 212 ? 50.857 -36.623 -27.039  1.00 24.74 ? 212 ILE C CG1 1 
ATOM   6758  C  CG2 . ILE C  1 212 ? 52.284 -34.665 -27.790  1.00 20.93 ? 212 ILE C CG2 1 
ATOM   6759  C  CD1 . ILE C  1 212 ? 51.618 -37.915 -26.830  1.00 25.34 ? 212 ILE C CD1 1 
ATOM   6760  N  N   . ALA C  1 213 ? 51.040 -34.560 -31.114  1.00 17.78 ? 213 ALA C N   1 
ATOM   6761  C  CA  . ALA C  1 213 ? 51.398 -33.622 -32.172  1.00 18.16 ? 213 ALA C CA  1 
ATOM   6762  C  C   . ALA C  1 213 ? 50.160 -32.877 -32.668  1.00 18.76 ? 213 ALA C C   1 
ATOM   6763  O  O   . ALA C  1 213 ? 50.203 -31.675 -32.926  1.00 17.69 ? 213 ALA C O   1 
ATOM   6764  C  CB  . ALA C  1 213 ? 52.082 -34.348 -33.324  1.00 20.25 ? 213 ALA C CB  1 
ATOM   6765  N  N   . ASP C  1 214 ? 49.053 -33.596 -32.793  1.00 19.07 ? 214 ASP C N   1 
ATOM   6766  C  CA  . ASP C  1 214 ? 47.809 -32.989 -33.251  1.00 23.71 ? 214 ASP C CA  1 
ATOM   6767  C  C   . ASP C  1 214 ? 47.332 -31.875 -32.320  1.00 21.55 ? 214 ASP C C   1 
ATOM   6768  O  O   . ASP C  1 214 ? 46.624 -30.972 -32.743  1.00 23.72 ? 214 ASP C O   1 
ATOM   6769  C  CB  . ASP C  1 214 ? 46.721 -34.054 -33.416  1.00 20.62 ? 214 ASP C CB  1 
ATOM   6770  C  CG  . ASP C  1 214 ? 46.911 -34.883 -34.669  1.00 25.07 ? 214 ASP C CG  1 
ATOM   6771  O  OD1 . ASP C  1 214 ? 47.768 -34.504 -35.499  1.00 20.11 ? 214 ASP C OD1 1 
ATOM   6772  O  OD2 . ASP C  1 214 ? 46.207 -35.907 -34.829  1.00 22.14 ? 214 ASP C OD2 1 
ATOM   6773  N  N   . LYS C  1 215 ? 47.722 -31.932 -31.055  1.00 21.06 ? 215 LYS C N   1 
ATOM   6774  C  CA  . LYS C  1 215 ? 47.329 -30.883 -30.118  1.00 22.15 ? 215 LYS C CA  1 
ATOM   6775  C  C   . LYS C  1 215 ? 48.348 -29.755 -30.072  1.00 22.53 ? 215 LYS C C   1 
ATOM   6776  O  O   . LYS C  1 215 ? 48.231 -28.849 -29.252  1.00 23.26 ? 215 LYS C O   1 
ATOM   6777  C  CB  . LYS C  1 215 ? 47.085 -31.454 -28.721  1.00 24.51 ? 215 LYS C CB  1 
ATOM   6778  C  CG  . LYS C  1 215 ? 45.887 -32.383 -28.667  1.00 29.70 ? 215 LYS C CG  1 
ATOM   6779  C  CD  . LYS C  1 215 ? 45.804 -33.109 -27.338  1.00 36.67 ? 215 LYS C CD  1 
ATOM   6780  C  CE  . LYS C  1 215 ? 44.570 -33.997 -27.288  1.00 47.26 ? 215 LYS C CE  1 
ATOM   6781  N  NZ  . LYS C  1 215 ? 43.338 -33.224 -27.609  1.00 45.72 ? 215 LYS C NZ  1 
ATOM   6782  N  N   . GLY C  1 216 ? 49.353 -29.824 -30.941  1.00 18.24 ? 216 GLY C N   1 
ATOM   6783  C  CA  . GLY C  1 216 ? 50.239 -28.680 -31.169  1.00 21.17 ? 216 GLY C CA  1 
ATOM   6784  C  C   . GLY C  1 216 ? 51.633 -28.731 -30.564  1.00 19.29 ? 216 GLY C C   1 
ATOM   6785  O  O   . GLY C  1 216 ? 52.400 -27.774 -30.694  1.00 18.29 ? 216 GLY C O   1 
ATOM   6786  N  N   . SER C  1 217 ? 51.980 -29.838 -29.914  1.00 18.22 ? 217 SER C N   1 
ATOM   6787  C  CA  . SER C  1 217 ? 53.272 -29.929 -29.228  1.00 15.68 ? 217 SER C CA  1 
ATOM   6788  C  C   . SER C  1 217 ? 54.294 -30.757 -30.006  1.00 14.49 ? 217 SER C C   1 
ATOM   6789  O  O   . SER C  1 217 ? 53.927 -31.649 -30.766  1.00 13.27 ? 217 SER C O   1 
ATOM   6790  C  CB  . SER C  1 217 ? 53.095 -30.512 -27.819  1.00 16.19 ? 217 SER C CB  1 
ATOM   6791  O  OG  . SER C  1 217 ? 52.341 -29.633 -26.993  1.00 15.84 ? 217 SER C OG  1 
ATOM   6792  N  N   . PHE C  1 218 ? 55.579 -30.467 -29.807  1.00 13.75 ? 218 PHE C N   1 
ATOM   6793  C  CA  . PHE C  1 218 ? 56.634 -31.291 -30.386  1.00 15.41 ? 218 PHE C CA  1 
ATOM   6794  C  C   . PHE C  1 218 ? 56.647 -32.682 -29.745  1.00 15.76 ? 218 PHE C C   1 
ATOM   6795  O  O   . PHE C  1 218 ? 56.311 -32.843 -28.570  1.00 14.31 ? 218 PHE C O   1 
ATOM   6796  C  CB  . PHE C  1 218 ? 58.007 -30.607 -30.257  1.00 13.57 ? 218 PHE C CB  1 
ATOM   6797  C  CG  . PHE C  1 218 ? 58.108 -29.322 -31.032  1.00 16.71 ? 218 PHE C CG  1 
ATOM   6798  C  CD1 . PHE C  1 218 ? 57.984 -28.098 -30.394  1.00 16.06 ? 218 PHE C CD1 1 
ATOM   6799  C  CD2 . PHE C  1 218 ? 58.293 -29.342 -32.408  1.00 14.58 ? 218 PHE C CD2 1 
ATOM   6800  C  CE1 . PHE C  1 218 ? 58.067 -26.920 -31.111  1.00 17.80 ? 218 PHE C CE1 1 
ATOM   6801  C  CE2 . PHE C  1 218 ? 58.377 -28.165 -33.131  1.00 16.49 ? 218 PHE C CE2 1 
ATOM   6802  C  CZ  . PHE C  1 218 ? 58.261 -26.952 -32.482  1.00 19.04 ? 218 PHE C CZ  1 
ATOM   6803  N  N   . ILE C  1 219 ? 57.029 -33.682 -30.535  1.00 16.04 ? 219 ILE C N   1 
ATOM   6804  C  CA  . ILE C  1 219 ? 57.044 -35.061 -30.086  1.00 15.34 ? 219 ILE C CA  1 
ATOM   6805  C  C   . ILE C  1 219 ? 58.478 -35.582 -30.077  1.00 15.54 ? 219 ILE C C   1 
ATOM   6806  O  O   . ILE C  1 219 ? 59.207 -35.459 -31.069  1.00 15.99 ? 219 ILE C O   1 
ATOM   6807  C  CB  . ILE C  1 219 ? 56.134 -35.960 -30.950  1.00 16.08 ? 219 ILE C CB  1 
ATOM   6808  C  CG1 . ILE C  1 219 ? 56.508 -35.851 -32.431  1.00 18.64 ? 219 ILE C CG1 1 
ATOM   6809  C  CG2 . ILE C  1 219 ? 54.671 -35.567 -30.754  1.00 18.42 ? 219 ILE C CG2 1 
ATOM   6810  C  CD1 . ILE C  1 219 ? 55.669 -36.725 -33.342  1.00 16.55 ? 219 ILE C CD1 1 
ATOM   6811  N  N   . GLY C  1 220 ? 58.875 -36.154 -28.948  1.00 13.92 ? 220 GLY C N   1 
ATOM   6812  C  CA  . GLY C  1 220 ? 60.273 -36.504 -28.723  1.00 16.49 ? 220 GLY C CA  1 
ATOM   6813  C  C   . GLY C  1 220 ? 60.595 -37.915 -29.165  1.00 13.76 ? 220 GLY C C   1 
ATOM   6814  O  O   . GLY C  1 220 ? 60.347 -38.875 -28.433  1.00 13.78 ? 220 GLY C O   1 
ATOM   6815  N  N   . LEU C  1 221 ? 61.133 -38.041 -30.374  1.00 13.36 ? 221 LEU C N   1 
ATOM   6816  C  CA  . LEU C  1 221 ? 61.628 -39.331 -30.855  1.00 14.79 ? 221 LEU C CA  1 
ATOM   6817  C  C   . LEU C  1 221 ? 63.093 -39.311 -30.464  1.00 14.37 ? 221 LEU C C   1 
ATOM   6818  O  O   . LEU C  1 221 ? 63.989 -39.176 -31.306  1.00 15.99 ? 221 LEU C O   1 
ATOM   6819  C  CB  . LEU C  1 221 ? 61.437 -39.442 -32.370  1.00 13.09 ? 221 LEU C CB  1 
ATOM   6820  C  CG  . LEU C  1 221 ? 60.019 -39.093 -32.824  1.00 14.83 ? 221 LEU C CG  1 
ATOM   6821  C  CD1 . LEU C  1 221 ? 59.829 -39.369 -34.317  1.00 15.85 ? 221 LEU C CD1 1 
ATOM   6822  C  CD2 . LEU C  1 221 ? 58.987 -39.845 -31.994  1.00 13.33 ? 221 LEU C CD2 1 
ATOM   6823  N  N   . ASP C  1 222 ? 63.321 -39.421 -29.160  1.00 14.08 ? 222 ASP C N   1 
ATOM   6824  C  CA  . ASP C  1 222 ? 64.498 -38.810 -28.542  1.00 14.23 ? 222 ASP C CA  1 
ATOM   6825  C  C   . ASP C  1 222 ? 65.386 -39.759 -27.761  1.00 14.80 ? 222 ASP C C   1 
ATOM   6826  O  O   . ASP C  1 222 ? 66.209 -39.313 -26.960  1.00 16.84 ? 222 ASP C O   1 
ATOM   6827  C  CB  . ASP C  1 222 ? 64.056 -37.663 -27.626  1.00 14.49 ? 222 ASP C CB  1 
ATOM   6828  C  CG  . ASP C  1 222 ? 63.057 -38.106 -26.561  1.00 17.87 ? 222 ASP C CG  1 
ATOM   6829  O  OD1 . ASP C  1 222 ? 62.338 -37.226 -26.034  1.00 16.39 ? 222 ASP C OD1 1 
ATOM   6830  O  OD2 . ASP C  1 222 ? 62.982 -39.324 -26.251  1.00 15.37 ? 222 ASP C OD2 1 
ATOM   6831  N  N   . ARG C  1 223 ? 65.231 -41.060 -27.991  1.00 14.81 ? 223 ARG C N   1 
ATOM   6832  C  CA  . ARG C  1 223 ? 66.045 -42.042 -27.274  1.00 15.98 ? 223 ARG C CA  1 
ATOM   6833  C  C   . ARG C  1 223 ? 66.690 -43.050 -28.225  1.00 16.40 ? 223 ARG C C   1 
ATOM   6834  O  O   . ARG C  1 223 ? 66.842 -44.231 -27.908  1.00 18.34 ? 223 ARG C O   1 
ATOM   6835  C  CB  . ARG C  1 223 ? 65.209 -42.757 -26.213  1.00 12.87 ? 223 ARG C CB  1 
ATOM   6836  C  CG  . ARG C  1 223 ? 65.057 -41.956 -24.924  1.00 14.63 ? 223 ARG C CG  1 
ATOM   6837  C  CD  . ARG C  1 223 ? 64.086 -42.609 -23.943  1.00 14.71 ? 223 ARG C CD  1 
ATOM   6838  N  NE  . ARG C  1 223 ? 64.489 -42.329 -22.565  1.00 16.05 ? 223 ARG C NE  1 
ATOM   6839  C  CZ  . ARG C  1 223 ? 63.810 -42.684 -21.481  1.00 19.37 ? 223 ARG C CZ  1 
ATOM   6840  N  NH1 . ARG C  1 223 ? 62.652 -43.327 -21.595  1.00 15.24 ? 223 ARG C NH1 1 
ATOM   6841  N  NH2 . ARG C  1 223 ? 64.298 -42.389 -20.277  1.00 19.03 ? 223 ARG C NH2 1 
ATOM   6842  N  N   . TYR C  1 224 ? 67.059 -42.576 -29.404  1.00 13.92 ? 224 TYR C N   1 
ATOM   6843  C  CA  . TYR C  1 224 ? 67.705 -43.432 -30.385  1.00 15.40 ? 224 TYR C CA  1 
ATOM   6844  C  C   . TYR C  1 224 ? 68.943 -44.109 -29.799  1.00 16.71 ? 224 TYR C C   1 
ATOM   6845  O  O   . TYR C  1 224 ? 69.847 -43.437 -29.300  1.00 17.56 ? 224 TYR C O   1 
ATOM   6846  C  CB  . TYR C  1 224 ? 68.080 -42.614 -31.613  1.00 15.36 ? 224 TYR C CB  1 
ATOM   6847  C  CG  . TYR C  1 224 ? 67.049 -42.693 -32.703  1.00 15.70 ? 224 TYR C CG  1 
ATOM   6848  C  CD1 . TYR C  1 224 ? 66.134 -41.670 -32.904  1.00 16.66 ? 224 TYR C CD1 1 
ATOM   6849  C  CD2 . TYR C  1 224 ? 66.989 -43.811 -33.534  1.00 17.63 ? 224 TYR C CD2 1 
ATOM   6850  C  CE1 . TYR C  1 224 ? 65.185 -41.755 -33.912  1.00 16.47 ? 224 TYR C CE1 1 
ATOM   6851  C  CE2 . TYR C  1 224 ? 66.055 -43.901 -34.543  1.00 19.22 ? 224 TYR C CE2 1 
ATOM   6852  C  CZ  . TYR C  1 224 ? 65.159 -42.872 -34.733  1.00 17.52 ? 224 TYR C CZ  1 
ATOM   6853  O  OH  . TYR C  1 224 ? 64.230 -42.977 -35.747  1.00 16.48 ? 224 TYR C OH  1 
ATOM   6854  N  N   . GLY C  1 225 ? 68.975 -45.438 -29.858  1.00 18.69 ? 225 GLY C N   1 
ATOM   6855  C  CA  . GLY C  1 225 ? 70.095 -46.205 -29.314  1.00 18.08 ? 225 GLY C CA  1 
ATOM   6856  C  C   . GLY C  1 225 ? 69.687 -47.006 -28.094  1.00 22.94 ? 225 GLY C C   1 
ATOM   6857  O  O   . GLY C  1 225 ? 70.271 -48.045 -27.802  1.00 22.50 ? 225 GLY C O   1 
ATOM   6858  N  N   . LEU C  1 226 ? 68.674 -46.526 -27.379  1.00 19.83 ? 226 LEU C N   1 
ATOM   6859  C  CA  . LEU C  1 226 ? 68.207 -47.220 -26.187  1.00 20.85 ? 226 LEU C CA  1 
ATOM   6860  C  C   . LEU C  1 226 ? 67.247 -48.338 -26.566  1.00 22.94 ? 226 LEU C C   1 
ATOM   6861  O  O   . LEU C  1 226 ? 66.024 -48.192 -26.476  1.00 21.69 ? 226 LEU C O   1 
ATOM   6862  C  CB  . LEU C  1 226 ? 67.567 -46.235 -25.218  1.00 17.40 ? 226 LEU C CB  1 
ATOM   6863  C  CG  . LEU C  1 226 ? 68.609 -45.331 -24.555  1.00 24.93 ? 226 LEU C CG  1 
ATOM   6864  C  CD1 . LEU C  1 226 ? 67.976 -44.062 -24.007  1.00 25.10 ? 226 LEU C CD1 1 
ATOM   6865  C  CD2 . LEU C  1 226 ? 69.358 -46.087 -23.465  1.00 24.24 ? 226 LEU C CD2 1 
ATOM   6866  N  N   . ASP C  1 227 ? 67.821 -49.456 -27.000  1.00 21.78 ? 227 ASP C N   1 
ATOM   6867  C  CA  . ASP C  1 227 ? 67.049 -50.559 -27.557  1.00 22.85 ? 227 ASP C CA  1 
ATOM   6868  C  C   . ASP C  1 227 ? 66.102 -51.173 -26.537  1.00 25.91 ? 227 ASP C C   1 
ATOM   6869  O  O   . ASP C  1 227 ? 65.028 -51.656 -26.896  1.00 31.04 ? 227 ASP C O   1 
ATOM   6870  C  CB  . ASP C  1 227 ? 67.976 -51.640 -28.133  1.00 24.89 ? 227 ASP C CB  1 
ATOM   6871  C  CG  . ASP C  1 227 ? 68.655 -51.203 -29.425  1.00 29.02 ? 227 ASP C CG  1 
ATOM   6872  O  OD1 . ASP C  1 227 ? 68.155 -50.268 -30.086  1.00 29.42 ? 227 ASP C OD1 1 
ATOM   6873  O  OD2 . ASP C  1 227 ? 69.689 -51.800 -29.785  1.00 29.32 ? 227 ASP C OD2 1 
ATOM   6874  N  N   . LEU C  1 228 ? 66.502 -51.160 -25.269  1.00 24.13 ? 228 LEU C N   1 
ATOM   6875  C  CA  . LEU C  1 228 ? 65.663 -51.716 -24.216  1.00 27.60 ? 228 LEU C CA  1 
ATOM   6876  C  C   . LEU C  1 228 ? 64.292 -51.040 -24.170  1.00 27.64 ? 228 LEU C C   1 
ATOM   6877  O  O   . LEU C  1 228 ? 63.313 -51.651 -23.758  1.00 24.58 ? 228 LEU C O   1 
ATOM   6878  C  CB  . LEU C  1 228 ? 66.358 -51.635 -22.849  1.00 29.30 ? 228 LEU C CB  1 
ATOM   6879  C  CG  . LEU C  1 228 ? 66.335 -50.299 -22.107  1.00 30.07 ? 228 LEU C CG  1 
ATOM   6880  C  CD1 . LEU C  1 228 ? 66.765 -50.487 -20.656  1.00 32.79 ? 228 LEU C CD1 1 
ATOM   6881  C  CD2 . LEU C  1 228 ? 67.206 -49.262 -22.811  1.00 28.96 ? 228 LEU C CD2 1 
ATOM   6882  N  N   . PHE C  1 229 ? 64.214 -49.783 -24.596  1.00 22.96 ? 229 PHE C N   1 
ATOM   6883  C  CA  . PHE C  1 229 ? 62.908 -49.126 -24.693  1.00 23.12 ? 229 PHE C CA  1 
ATOM   6884  C  C   . PHE C  1 229 ? 62.237 -49.439 -26.031  1.00 26.98 ? 229 PHE C C   1 
ATOM   6885  O  O   . PHE C  1 229 ? 61.084 -49.870 -26.080  1.00 29.99 ? 229 PHE C O   1 
ATOM   6886  C  CB  . PHE C  1 229 ? 63.034 -47.618 -24.467  1.00 22.83 ? 229 PHE C CB  1 
ATOM   6887  C  CG  . PHE C  1 229 ? 63.540 -47.256 -23.093  1.00 29.14 ? 229 PHE C CG  1 
ATOM   6888  C  CD1 . PHE C  1 229 ? 62.935 -47.779 -21.959  1.00 32.93 ? 229 PHE C CD1 1 
ATOM   6889  C  CD2 . PHE C  1 229 ? 64.614 -46.394 -22.934  1.00 24.85 ? 229 PHE C CD2 1 
ATOM   6890  C  CE1 . PHE C  1 229 ? 63.394 -47.451 -20.694  1.00 32.47 ? 229 PHE C CE1 1 
ATOM   6891  C  CE2 . PHE C  1 229 ? 65.076 -46.061 -21.673  1.00 26.78 ? 229 PHE C CE2 1 
ATOM   6892  C  CZ  . PHE C  1 229 ? 64.467 -46.593 -20.551  1.00 28.82 ? 229 PHE C CZ  1 
ATOM   6893  N  N   . LEU C  1 230 ? 62.969 -49.227 -27.118  1.00 24.85 ? 230 LEU C N   1 
ATOM   6894  C  CA  . LEU C  1 230 ? 62.510 -49.627 -28.439  1.00 21.86 ? 230 LEU C CA  1 
ATOM   6895  C  C   . LEU C  1 230 ? 63.730 -49.740 -29.340  1.00 21.79 ? 230 LEU C C   1 
ATOM   6896  O  O   . LEU C  1 230 ? 64.574 -48.848 -29.347  1.00 22.06 ? 230 LEU C O   1 
ATOM   6897  C  CB  . LEU C  1 230 ? 61.524 -48.602 -29.014  1.00 19.40 ? 230 LEU C CB  1 
ATOM   6898  C  CG  . LEU C  1 230 ? 60.786 -49.077 -30.270  1.00 21.31 ? 230 LEU C CG  1 
ATOM   6899  C  CD1 . LEU C  1 230 ? 59.834 -50.214 -29.905  1.00 21.87 ? 230 LEU C CD1 1 
ATOM   6900  C  CD2 . LEU C  1 230 ? 60.043 -47.938 -30.969  1.00 19.46 ? 230 LEU C CD2 1 
ATOM   6901  N  N   . PRO C  1 231 ? 63.834 -50.846 -30.093  1.00 21.52 ? 231 PRO C N   1 
ATOM   6902  C  CA  . PRO C  1 231 ? 64.974 -51.058 -30.980  1.00 25.69 ? 231 PRO C CA  1 
ATOM   6903  C  C   . PRO C  1 231 ? 65.091 -49.963 -32.043  1.00 24.19 ? 231 PRO C C   1 
ATOM   6904  O  O   . PRO C  1 231 ? 64.088 -49.367 -32.428  1.00 19.20 ? 231 PRO C O   1 
ATOM   6905  C  CB  . PRO C  1 231 ? 64.665 -52.413 -31.635  1.00 24.55 ? 231 PRO C CB  1 
ATOM   6906  C  CG  . PRO C  1 231 ? 63.751 -53.102 -30.677  1.00 27.50 ? 231 PRO C CG  1 
ATOM   6907  C  CD  . PRO C  1 231 ? 62.928 -52.010 -30.056  1.00 25.17 ? 231 PRO C CD  1 
ATOM   6908  N  N   . VAL C  1 232 ? 66.313 -49.709 -32.504  1.00 21.16 ? 232 VAL C N   1 
ATOM   6909  C  CA  . VAL C  1 232 ? 66.571 -48.683 -33.504  1.00 23.32 ? 232 VAL C CA  1 
ATOM   6910  C  C   . VAL C  1 232 ? 65.735 -48.864 -34.771  1.00 26.50 ? 232 VAL C C   1 
ATOM   6911  O  O   . VAL C  1 232 ? 65.172 -47.898 -35.292  1.00 23.47 ? 232 VAL C O   1 
ATOM   6912  C  CB  . VAL C  1 232 ? 68.063 -48.627 -33.893  1.00 24.66 ? 232 VAL C CB  1 
ATOM   6913  C  CG1 . VAL C  1 232 ? 68.281 -47.602 -35.000  1.00 24.03 ? 232 VAL C CG1 1 
ATOM   6914  C  CG2 . VAL C  1 232 ? 68.914 -48.282 -32.679  1.00 24.52 ? 232 VAL C CG2 1 
ATOM   6915  N  N   . ASP C  1 233 ? 65.652 -50.094 -35.273  1.00 26.25 ? 233 ASP C N   1 
ATOM   6916  C  CA  . ASP C  1 233 ? 64.918 -50.322 -36.521  1.00 31.93 ? 233 ASP C CA  1 
ATOM   6917  C  C   . ASP C  1 233 ? 63.444 -49.939 -36.399  1.00 29.38 ? 233 ASP C C   1 
ATOM   6918  O  O   . ASP C  1 233 ? 62.887 -49.323 -37.315  1.00 22.83 ? 233 ASP C O   1 
ATOM   6919  C  CB  . ASP C  1 233 ? 65.103 -51.748 -37.065  1.00 33.51 ? 233 ASP C CB  1 
ATOM   6920  C  CG  . ASP C  1 233 ? 64.734 -52.821 -36.059  1.00 47.58 ? 233 ASP C CG  1 
ATOM   6921  O  OD1 . ASP C  1 233 ? 64.627 -52.515 -34.851  1.00 44.08 ? 233 ASP C OD1 1 
ATOM   6922  O  OD2 . ASP C  1 233 ? 64.559 -53.985 -36.485  1.00 63.54 ? 233 ASP C OD2 1 
ATOM   6923  N  N   . LYS C  1 234 ? 62.820 -50.288 -35.273  1.00 22.61 ? 234 LYS C N   1 
ATOM   6924  C  CA  . LYS C  1 234 ? 61.420 -49.919 -35.038  1.00 25.13 ? 234 LYS C CA  1 
ATOM   6925  C  C   . LYS C  1 234 ? 61.243 -48.413 -34.849  1.00 20.09 ? 234 LYS C C   1 
ATOM   6926  O  O   . LYS C  1 234 ? 60.246 -47.844 -35.283  1.00 20.91 ? 234 LYS C O   1 
ATOM   6927  C  CB  . LYS C  1 234 ? 60.829 -50.677 -33.844  1.00 24.52 ? 234 LYS C CB  1 
ATOM   6928  C  CG  . LYS C  1 234 ? 60.524 -52.136 -34.143  1.00 32.25 ? 234 LYS C CG  1 
ATOM   6929  C  CD  . LYS C  1 234 ? 59.916 -52.838 -32.940  1.00 41.51 ? 234 LYS C CD  1 
ATOM   6930  C  CE  . LYS C  1 234 ? 59.596 -54.289 -33.258  1.00 46.50 ? 234 LYS C CE  1 
ATOM   6931  N  NZ  . LYS C  1 234 ? 58.977 -54.971 -32.089  1.00 63.27 ? 234 LYS C NZ  1 
ATOM   6932  N  N   . ARG C  1 235 ? 62.201 -47.772 -34.189  1.00 18.60 ? 235 ARG C N   1 
ATOM   6933  C  CA  . ARG C  1 235 ? 62.178 -46.322 -34.078  1.00 18.25 ? 235 ARG C CA  1 
ATOM   6934  C  C   . ARG C  1 235 ? 62.241 -45.719 -35.469  1.00 17.58 ? 235 ARG C C   1 
ATOM   6935  O  O   . ARG C  1 235 ? 61.459 -44.832 -35.804  1.00 17.46 ? 235 ARG C O   1 
ATOM   6936  C  CB  . ARG C  1 235 ? 63.347 -45.814 -33.238  1.00 18.04 ? 235 ARG C CB  1 
ATOM   6937  C  CG  . ARG C  1 235 ? 63.200 -46.088 -31.753  1.00 16.48 ? 235 ARG C CG  1 
ATOM   6938  C  CD  . ARG C  1 235 ? 64.413 -45.620 -30.970  1.00 15.07 ? 235 ARG C CD  1 
ATOM   6939  N  NE  . ARG C  1 235 ? 64.281 -46.001 -29.568  1.00 15.44 ? 235 ARG C NE  1 
ATOM   6940  C  CZ  . ARG C  1 235 ? 63.784 -45.206 -28.632  1.00 14.56 ? 235 ARG C CZ  1 
ATOM   6941  N  NH1 . ARG C  1 235 ? 63.681 -45.637 -27.382  1.00 15.10 ? 235 ARG C NH1 1 
ATOM   6942  N  NH2 . ARG C  1 235 ? 63.393 -43.979 -28.947  1.00 16.26 ? 235 ARG C NH2 1 
ATOM   6943  N  N   . ASN C  1 236 ? 63.173 -46.209 -36.278  1.00 17.97 ? 236 ASN C N   1 
ATOM   6944  C  CA  . ASN C  1 236 ? 63.330 -45.711 -37.643  1.00 19.37 ? 236 ASN C CA  1 
ATOM   6945  C  C   . ASN C  1 236 ? 62.058 -45.847 -38.464  1.00 18.25 ? 236 ASN C C   1 
ATOM   6946  O  O   . ASN C  1 236 ? 61.681 -44.934 -39.196  1.00 17.29 ? 236 ASN C O   1 
ATOM   6947  C  CB  . ASN C  1 236 ? 64.480 -46.431 -38.349  1.00 19.72 ? 236 ASN C CB  1 
ATOM   6948  C  CG  . ASN C  1 236 ? 65.827 -45.837 -38.013  1.00 22.85 ? 236 ASN C CG  1 
ATOM   6949  O  OD1 . ASN C  1 236 ? 65.911 -44.752 -37.431  1.00 22.47 ? 236 ASN C OD1 1 
ATOM   6950  N  ND2 . ASN C  1 236 ? 66.893 -46.536 -38.388  1.00 20.64 ? 236 ASN C ND2 1 
ATOM   6951  N  N   . GLU C  1 237 ? 61.410 -47.000 -38.349  1.00 18.07 ? 237 GLU C N   1 
ATOM   6952  C  CA  . GLU C  1 237 ? 60.170 -47.250 -39.063  1.00 19.93 ? 237 GLU C CA  1 
ATOM   6953  C  C   . GLU C  1 237 ? 59.096 -46.271 -38.612  1.00 20.01 ? 237 GLU C C   1 
ATOM   6954  O  O   . GLU C  1 237 ? 58.312 -45.782 -39.420  1.00 18.67 ? 237 GLU C O   1 
ATOM   6955  C  CB  . GLU C  1 237 ? 59.711 -48.688 -38.817  1.00 27.97 ? 237 GLU C CB  1 
ATOM   6956  C  CG  . GLU C  1 237 ? 58.295 -48.992 -39.284  1.00 38.42 ? 237 GLU C CG  1 
ATOM   6957  C  CD  . GLU C  1 237 ? 57.783 -50.324 -38.754  1.00 61.99 ? 237 GLU C CD  1 
ATOM   6958  O  OE1 . GLU C  1 237 ? 56.578 -50.610 -38.916  1.00 64.92 ? 237 GLU C OE1 1 
ATOM   6959  O  OE2 . GLU C  1 237 ? 58.583 -51.087 -38.168  1.00 68.90 ? 237 GLU C OE2 1 
ATOM   6960  N  N   . THR C  1 238 ? 59.070 -45.980 -37.314  1.00 19.04 ? 238 THR C N   1 
ATOM   6961  C  CA  . THR C  1 238 ? 58.054 -45.097 -36.758  1.00 17.62 ? 238 THR C CA  1 
ATOM   6962  C  C   . THR C  1 238 ? 58.305 -43.648 -37.181  1.00 15.98 ? 238 THR C C   1 
ATOM   6963  O  O   . THR C  1 238 ? 57.387 -42.958 -37.634  1.00 17.08 ? 238 THR C O   1 
ATOM   6964  C  CB  . THR C  1 238 ? 57.982 -45.230 -35.221  1.00 17.71 ? 238 THR C CB  1 
ATOM   6965  O  OG1 . THR C  1 238 ? 57.633 -46.582 -34.884  1.00 19.50 ? 238 THR C OG1 1 
ATOM   6966  C  CG2 . THR C  1 238 ? 56.924 -44.299 -34.643  1.00 18.66 ? 238 THR C CG2 1 
ATOM   6967  N  N   . THR C  1 239 ? 59.554 -43.209 -37.055  1.00 15.13 ? 239 THR C N   1 
ATOM   6968  C  CA  . THR C  1 239 ? 59.970 -41.887 -37.519  1.00 15.52 ? 239 THR C CA  1 
ATOM   6969  C  C   . THR C  1 239 ? 59.633 -41.693 -38.992  1.00 16.61 ? 239 THR C C   1 
ATOM   6970  O  O   . THR C  1 239 ? 59.098 -40.648 -39.390  1.00 16.35 ? 239 THR C O   1 
ATOM   6971  C  CB  . THR C  1 239 ? 61.490 -41.683 -37.343  1.00 17.54 ? 239 THR C CB  1 
ATOM   6972  O  OG1 . THR C  1 239 ? 61.845 -41.835 -35.965  1.00 15.80 ? 239 THR C OG1 1 
ATOM   6973  C  CG2 . THR C  1 239 ? 61.910 -40.291 -37.825  1.00 14.90 ? 239 THR C CG2 1 
ATOM   6974  N  N   . LEU C  1 240 ? 59.949 -42.693 -39.809  1.00 15.22 ? 240 LEU C N   1 
ATOM   6975  C  CA  . LEU C  1 240 ? 59.702 -42.588 -41.244  1.00 15.68 ? 240 LEU C CA  1 
ATOM   6976  C  C   . LEU C  1 240 ? 58.209 -42.452 -41.546  1.00 18.59 ? 240 LEU C C   1 
ATOM   6977  O  O   . LEU C  1 240 ? 57.800 -41.656 -42.398  1.00 15.80 ? 240 LEU C O   1 
ATOM   6978  C  CB  . LEU C  1 240 ? 60.290 -43.795 -41.983  1.00 16.04 ? 240 LEU C CB  1 
ATOM   6979  C  CG  . LEU C  1 240 ? 60.037 -43.864 -43.488  1.00 15.78 ? 240 LEU C CG  1 
ATOM   6980  C  CD1 . LEU C  1 240 ? 60.597 -42.630 -44.195  1.00 16.57 ? 240 LEU C CD1 1 
ATOM   6981  C  CD2 . LEU C  1 240 ? 60.626 -45.141 -44.066  1.00 14.89 ? 240 LEU C CD2 1 
ATOM   6982  N  N   . ARG C  1 241 ? 57.402 -43.236 -40.839  1.00 18.03 ? 241 ARG C N   1 
ATOM   6983  C  CA  . ARG C  1 241 ? 55.954 -43.215 -41.008  1.00 19.69 ? 241 ARG C CA  1 
ATOM   6984  C  C   . ARG C  1 241 ? 55.374 -41.841 -40.623  1.00 17.70 ? 241 ARG C C   1 
ATOM   6985  O  O   . ARG C  1 241 ? 54.529 -41.291 -41.321  1.00 16.38 ? 241 ARG C O   1 
ATOM   6986  C  CB  . ARG C  1 241 ? 55.329 -44.322 -40.150  1.00 21.46 ? 241 ARG C CB  1 
ATOM   6987  C  CG  . ARG C  1 241 ? 54.215 -45.098 -40.824  1.00 36.67 ? 241 ARG C CG  1 
ATOM   6988  C  CD  . ARG C  1 241 ? 52.899 -44.338 -40.795  1.00 49.98 ? 241 ARG C CD  1 
ATOM   6989  N  NE  . ARG C  1 241 ? 51.815 -45.111 -41.396  1.00 54.93 ? 241 ARG C NE  1 
ATOM   6990  C  CZ  . ARG C  1 241 ? 51.236 -46.161 -40.820  1.00 62.37 ? 241 ARG C CZ  1 
ATOM   6991  N  NH1 . ARG C  1 241 ? 51.639 -46.578 -39.625  1.00 53.89 ? 241 ARG C NH1 1 
ATOM   6992  N  NH2 . ARG C  1 241 ? 50.257 -46.802 -41.443  1.00 55.79 ? 241 ARG C NH2 1 
ATOM   6993  N  N   . LEU C  1 242 ? 55.828 -41.295 -39.502  1.00 16.36 ? 242 LEU C N   1 
ATOM   6994  C  CA  . LEU C  1 242 ? 55.382 -39.964 -39.071  1.00 16.81 ? 242 LEU C CA  1 
ATOM   6995  C  C   . LEU C  1 242 ? 55.723 -38.902 -40.110  1.00 16.58 ? 242 LEU C C   1 
ATOM   6996  O  O   . LEU C  1 242 ? 54.893 -38.066 -40.456  1.00 15.28 ? 242 LEU C O   1 
ATOM   6997  C  CB  . LEU C  1 242 ? 55.993 -39.611 -37.713  1.00 15.23 ? 242 LEU C CB  1 
ATOM   6998  C  CG  . LEU C  1 242 ? 55.453 -40.474 -36.565  1.00 16.77 ? 242 LEU C CG  1 
ATOM   6999  C  CD1 . LEU C  1 242 ? 56.359 -40.386 -35.338  1.00 15.85 ? 242 LEU C CD1 1 
ATOM   7000  C  CD2 . LEU C  1 242 ? 54.017 -40.077 -36.228  1.00 17.66 ? 242 LEU C CD2 1 
ATOM   7001  N  N   . ILE C  1 243 ? 56.946 -38.943 -40.623  1.00 16.12 ? 243 ILE C N   1 
ATOM   7002  C  CA  . ILE C  1 243 ? 57.342 -38.020 -41.686  1.00 16.76 ? 243 ILE C CA  1 
ATOM   7003  C  C   . ILE C  1 243 ? 56.439 -38.162 -42.919  1.00 18.56 ? 243 ILE C C   1 
ATOM   7004  O  O   . ILE C  1 243 ? 55.941 -37.170 -43.467  1.00 15.01 ? 243 ILE C O   1 
ATOM   7005  C  CB  . ILE C  1 243 ? 58.810 -38.238 -42.080  1.00 15.42 ? 243 ILE C CB  1 
ATOM   7006  C  CG1 . ILE C  1 243 ? 59.722 -37.748 -40.953  1.00 15.04 ? 243 ILE C CG1 1 
ATOM   7007  C  CG2 . ILE C  1 243 ? 59.125 -37.525 -43.392  1.00 14.96 ? 243 ILE C CG2 1 
ATOM   7008  C  CD1 . ILE C  1 243 ? 61.145 -38.261 -41.058  1.00 13.62 ? 243 ILE C CD1 1 
ATOM   7009  N  N   . LYS C  1 244 ? 56.222 -39.398 -43.352  1.00 17.42 ? 244 LYS C N   1 
ATOM   7010  C  CA  . LYS C  1 244 ? 55.383 -39.629 -44.526  1.00 21.97 ? 244 LYS C CA  1 
ATOM   7011  C  C   . LYS C  1 244 ? 53.955 -39.139 -44.291  1.00 21.78 ? 244 LYS C C   1 
ATOM   7012  O  O   . LYS C  1 244 ? 53.288 -38.704 -45.223  1.00 21.38 ? 244 LYS C O   1 
ATOM   7013  C  CB  . LYS C  1 244 ? 55.401 -41.107 -44.928  1.00 22.44 ? 244 LYS C CB  1 
ATOM   7014  C  CG  . LYS C  1 244 ? 56.716 -41.537 -45.561  1.00 27.11 ? 244 LYS C CG  1 
ATOM   7015  C  CD  . LYS C  1 244 ? 56.677 -42.994 -45.997  1.00 47.36 ? 244 LYS C CD  1 
ATOM   7016  C  CE  . LYS C  1 244 ? 57.951 -43.373 -46.739  1.00 51.50 ? 244 LYS C CE  1 
ATOM   7017  N  NZ  . LYS C  1 244 ? 57.955 -44.803 -47.148  1.00 60.18 ? 244 LYS C NZ  1 
ATOM   7018  N  N   . ASP C  1 245 ? 53.494 -39.205 -43.043  1.00 20.73 ? 245 ASP C N   1 
ATOM   7019  C  CA  . ASP C  1 245 ? 52.137 -38.774 -42.715  1.00 21.93 ? 245 ASP C CA  1 
ATOM   7020  C  C   . ASP C  1 245 ? 52.036 -37.269 -42.450  1.00 19.98 ? 245 ASP C C   1 
ATOM   7021  O  O   . ASP C  1 245 ? 50.976 -36.769 -42.092  1.00 21.12 ? 245 ASP C O   1 
ATOM   7022  C  CB  . ASP C  1 245 ? 51.580 -39.573 -41.535  1.00 22.11 ? 245 ASP C CB  1 
ATOM   7023  C  CG  . ASP C  1 245 ? 51.311 -41.031 -41.893  1.00 27.87 ? 245 ASP C CG  1 
ATOM   7024  O  OD1 . ASP C  1 245 ? 51.040 -41.833 -40.978  1.00 26.49 ? 245 ASP C OD1 1 
ATOM   7025  O  OD2 . ASP C  1 245 ? 51.380 -41.376 -43.092  1.00 27.61 ? 245 ASP C OD2 1 
ATOM   7026  N  N   . GLY C  1 246 ? 53.142 -36.554 -42.613  1.00 17.76 ? 246 GLY C N   1 
ATOM   7027  C  CA  . GLY C  1 246 ? 53.114 -35.094 -42.566  1.00 18.94 ? 246 GLY C CA  1 
ATOM   7028  C  C   . GLY C  1 246 ? 53.465 -34.466 -41.225  1.00 21.79 ? 246 GLY C C   1 
ATOM   7029  O  O   . GLY C  1 246 ? 53.126 -33.308 -40.977  1.00 20.01 ? 246 GLY C O   1 
ATOM   7030  N  N   . TYR C  1 247 ? 54.157 -35.213 -40.364  1.00 17.85 ? 247 TYR C N   1 
ATOM   7031  C  CA  . TYR C  1 247 ? 54.434 -34.746 -39.003  1.00 16.29 ? 247 TYR C CA  1 
ATOM   7032  C  C   . TYR C  1 247 ? 55.846 -34.193 -38.777  1.00 17.57 ? 247 TYR C C   1 
ATOM   7033  O  O   . TYR C  1 247 ? 56.267 -34.032 -37.634  1.00 17.67 ? 247 TYR C O   1 
ATOM   7034  C  CB  . TYR C  1 247 ? 54.136 -35.865 -37.990  1.00 17.26 ? 247 TYR C CB  1 
ATOM   7035  C  CG  . TYR C  1 247 ? 52.654 -36.051 -37.758  1.00 20.29 ? 247 TYR C CG  1 
ATOM   7036  C  CD1 . TYR C  1 247 ? 51.890 -36.834 -38.616  1.00 18.60 ? 247 TYR C CD1 1 
ATOM   7037  C  CD2 . TYR C  1 247 ? 52.010 -35.401 -36.708  1.00 19.34 ? 247 TYR C CD2 1 
ATOM   7038  C  CE1 . TYR C  1 247 ? 50.530 -36.989 -38.421  1.00 20.12 ? 247 TYR C CE1 1 
ATOM   7039  C  CE2 . TYR C  1 247 ? 50.650 -35.548 -36.503  1.00 19.39 ? 247 TYR C CE2 1 
ATOM   7040  C  CZ  . TYR C  1 247 ? 49.916 -36.341 -37.360  1.00 20.73 ? 247 TYR C CZ  1 
ATOM   7041  O  OH  . TYR C  1 247 ? 48.566 -36.483 -37.162  1.00 24.46 ? 247 TYR C OH  1 
ATOM   7042  N  N   . SER C  1 248 ? 56.568 -33.868 -39.848  1.00 16.26 ? 248 SER C N   1 
ATOM   7043  C  CA  A SER C  1 248 ? 57.952 -33.395 -39.732  0.50 16.84 ? 248 SER C CA  1 
ATOM   7044  C  CA  B SER C  1 248 ? 57.954 -33.423 -39.695  0.50 16.60 ? 248 SER C CA  1 
ATOM   7045  C  C   . SER C  1 248 ? 58.091 -32.123 -38.893  1.00 17.26 ? 248 SER C C   1 
ATOM   7046  O  O   . SER C  1 248 ? 59.074 -31.943 -38.170  1.00 13.31 ? 248 SER C O   1 
ATOM   7047  C  CB  A SER C  1 248 ? 58.560 -33.160 -41.120  0.50 18.16 ? 248 SER C CB  1 
ATOM   7048  C  CB  B SER C  1 248 ? 58.648 -33.290 -41.055  0.50 17.99 ? 248 SER C CB  1 
ATOM   7049  O  OG  A SER C  1 248 ? 58.826 -34.386 -41.778  0.50 16.76 ? 248 SER C OG  1 
ATOM   7050  O  OG  B SER C  1 248 ? 58.145 -32.185 -41.777  0.50 15.65 ? 248 SER C OG  1 
ATOM   7051  N  N   . ASP C  1 249 ? 57.113 -31.223 -39.010  1.00 17.66 ? 249 ASP C N   1 
ATOM   7052  C  CA  . ASP C  1 249 ? 57.173 -29.951 -38.276  1.00 19.72 ? 249 ASP C CA  1 
ATOM   7053  C  C   . ASP C  1 249 ? 56.851 -30.085 -36.780  1.00 20.55 ? 249 ASP C C   1 
ATOM   7054  O  O   . ASP C  1 249 ? 56.838 -29.093 -36.052  1.00 19.80 ? 249 ASP C O   1 
ATOM   7055  C  CB  . ASP C  1 249 ? 56.280 -28.880 -38.932  1.00 23.39 ? 249 ASP C CB  1 
ATOM   7056  C  CG  . ASP C  1 249 ? 54.807 -29.225 -38.868  1.00 27.58 ? 249 ASP C CG  1 
ATOM   7057  O  OD1 . ASP C  1 249 ? 54.459 -30.249 -38.249  1.00 28.18 ? 249 ASP C OD1 1 
ATOM   7058  O  OD2 . ASP C  1 249 ? 53.991 -28.473 -39.441  1.00 35.63 ? 249 ASP C OD2 1 
ATOM   7059  N  N   . LYS C  1 250 ? 56.610 -31.315 -36.337  1.00 15.22 ? 250 LYS C N   1 
ATOM   7060  C  CA  . LYS C  1 250 ? 56.367 -31.634 -34.926  1.00 16.08 ? 250 LYS C CA  1 
ATOM   7061  C  C   . LYS C  1 250 ? 57.476 -32.518 -34.350  1.00 16.09 ? 250 LYS C C   1 
ATOM   7062  O  O   . LYS C  1 250 ? 57.608 -32.663 -33.131  1.00 14.75 ? 250 LYS C O   1 
ATOM   7063  C  CB  . LYS C  1 250 ? 55.058 -32.408 -34.803  1.00 20.56 ? 250 LYS C CB  1 
ATOM   7064  C  CG  . LYS C  1 250 ? 53.880 -31.621 -34.264  1.00 32.88 ? 250 LYS C CG  1 
ATOM   7065  C  CD  . LYS C  1 250 ? 54.009 -30.141 -34.523  1.00 30.48 ? 250 LYS C CD  1 
ATOM   7066  C  CE  . LYS C  1 250 ? 52.781 -29.414 -34.012  1.00 37.43 ? 250 LYS C CE  1 
ATOM   7067  N  NZ  . LYS C  1 250 ? 52.560 -28.167 -34.782  1.00 41.43 ? 250 LYS C NZ  1 
ATOM   7068  N  N   . ILE C  1 251 ? 58.265 -33.123 -35.228  1.00 15.53 ? 251 ILE C N   1 
ATOM   7069  C  CA  . ILE C  1 251 ? 59.250 -34.120 -34.794  1.00 14.71 ? 251 ILE C CA  1 
ATOM   7070  C  C   . ILE C  1 251 ? 60.546 -33.518 -34.268  1.00 14.16 ? 251 ILE C C   1 
ATOM   7071  O  O   . ILE C  1 251 ? 61.129 -32.628 -34.889  1.00 13.51 ? 251 ILE C O   1 
ATOM   7072  C  CB  . ILE C  1 251 ? 59.591 -35.082 -35.945  1.00 14.52 ? 251 ILE C CB  1 
ATOM   7073  C  CG1 . ILE C  1 251 ? 58.432 -36.043 -36.179  1.00 13.50 ? 251 ILE C CG1 1 
ATOM   7074  C  CG2 . ILE C  1 251 ? 60.871 -35.858 -35.651  1.00 11.78 ? 251 ILE C CG2 1 
ATOM   7075  C  CD1 . ILE C  1 251 ? 58.556 -36.798 -37.490  1.00 16.22 ? 251 ILE C CD1 1 
ATOM   7076  N  N   . MET C  1 252 ? 60.988 -34.003 -33.112  1.00 14.56 ? 252 MET C N   1 
ATOM   7077  C  CA  . MET C  1 252 ? 62.339 -33.729 -32.643  1.00 15.75 ? 252 MET C CA  1 
ATOM   7078  C  C   . MET C  1 252 ? 63.048 -35.038 -32.337  1.00 16.83 ? 252 MET C C   1 
ATOM   7079  O  O   . MET C  1 252 ? 62.463 -35.951 -31.752  1.00 16.70 ? 252 MET C O   1 
ATOM   7080  C  CB  . MET C  1 252 ? 62.329 -32.820 -31.422  1.00 17.23 ? 252 MET C CB  1 
ATOM   7081  C  CG  . MET C  1 252 ? 62.009 -31.382 -31.786  1.00 22.58 ? 252 MET C CG  1 
ATOM   7082  S  SD  . MET C  1 252 ? 61.885 -30.344 -30.328  1.00 30.89 ? 252 MET C SD  1 
ATOM   7083  C  CE  . MET C  1 252 ? 61.965 -28.727 -31.098  1.00 22.11 ? 252 MET C CE  1 
ATOM   7084  N  N   . ILE C  1 253 ? 64.307 -35.122 -32.748  1.00 13.70 ? 253 ILE C N   1 
ATOM   7085  C  CA  . ILE C  1 253 ? 65.046 -36.368 -32.672  1.00 12.93 ? 253 ILE C CA  1 
ATOM   7086  C  C   . ILE C  1 253 ? 66.304 -36.182 -31.849  1.00 13.28 ? 253 ILE C C   1 
ATOM   7087  O  O   . ILE C  1 253 ? 67.009 -35.189 -32.002  1.00 14.93 ? 253 ILE C O   1 
ATOM   7088  C  CB  . ILE C  1 253 ? 65.440 -36.861 -34.081  1.00 14.18 ? 253 ILE C CB  1 
ATOM   7089  C  CG1 . ILE C  1 253 ? 64.208 -37.325 -34.857  1.00 14.02 ? 253 ILE C CG1 1 
ATOM   7090  C  CG2 . ILE C  1 253 ? 66.481 -37.971 -33.989  1.00 14.18 ? 253 ILE C CG2 1 
ATOM   7091  C  CD1 . ILE C  1 253 ? 64.497 -37.671 -36.309  1.00 14.22 ? 253 ILE C CD1 1 
ATOM   7092  N  N   . SER C  1 254 ? 66.591 -37.141 -30.980  1.00 13.36 ? 254 SER C N   1 
ATOM   7093  C  CA  . SER C  1 254 ? 67.813 -37.088 -30.193  1.00 14.68 ? 254 SER C CA  1 
ATOM   7094  C  C   . SER C  1 254 ? 68.104 -38.471 -29.635  1.00 14.23 ? 254 SER C C   1 
ATOM   7095  O  O   . SER C  1 254 ? 67.394 -39.438 -29.959  1.00 14.15 ? 254 SER C O   1 
ATOM   7096  C  CB  . SER C  1 254 ? 67.682 -36.045 -29.066  1.00 16.01 ? 254 SER C CB  1 
ATOM   7097  O  OG  . SER C  1 254 ? 68.835 -35.200 -29.026  1.00 17.51 ? 254 SER C OG  1 
ATOM   7098  N  N   . HIS C  1 255 ? 69.127 -38.572 -28.786  1.00 13.80 ? 255 HIS C N   1 
ATOM   7099  C  CA  . HIS C  1 255 ? 69.533 -39.873 -28.243  1.00 14.88 ? 255 HIS C CA  1 
ATOM   7100  C  C   . HIS C  1 255 ? 69.285 -40.057 -26.770  1.00 15.67 ? 255 HIS C C   1 
ATOM   7101  O  O   . HIS C  1 255 ? 69.320 -41.190 -26.288  1.00 16.59 ? 255 HIS C O   1 
ATOM   7102  C  CB  . HIS C  1 255 ? 71.022 -40.128 -28.477  1.00 14.56 ? 255 HIS C CB  1 
ATOM   7103  C  CG  . HIS C  1 255 ? 71.503 -39.809 -29.874  1.00 14.20 ? 255 HIS C CG  1 
ATOM   7104  N  ND1 . HIS C  1 255 ? 71.964 -38.589 -30.221  1.00 16.93 ? 255 HIS C ND1 1 
ATOM   7105  C  CD2 . HIS C  1 255 ? 71.625 -40.615 -31.008  1.00 13.92 ? 255 HIS C CD2 1 
ATOM   7106  C  CE1 . HIS C  1 255 ? 72.354 -38.608 -31.516  1.00 17.66 ? 255 HIS C CE1 1 
ATOM   7107  N  NE2 . HIS C  1 255 ? 72.148 -39.849 -31.994  1.00 18.00 ? 255 HIS C NE2 1 
ATOM   7108  N  N   . ASP C  1 256 ? 69.075 -38.962 -26.034  1.00 15.63 ? 256 ASP C N   1 
ATOM   7109  C  CA  . ASP C  1 256 ? 69.037 -39.004 -24.562  1.00 16.42 ? 256 ASP C CA  1 
ATOM   7110  C  C   . ASP C  1 256 ? 70.322 -39.651 -24.074  1.00 16.44 ? 256 ASP C C   1 
ATOM   7111  O  O   . ASP C  1 256 ? 70.345 -40.330 -23.048  1.00 19.66 ? 256 ASP C O   1 
ATOM   7112  C  CB  . ASP C  1 256 ? 67.813 -39.792 -24.065  1.00 14.77 ? 256 ASP C CB  1 
ATOM   7113  C  CG  . ASP C  1 256 ? 67.444 -39.509 -22.575  1.00 17.05 ? 256 ASP C CG  1 
ATOM   7114  O  OD1 . ASP C  1 256 ? 67.795 -38.450 -21.955  1.00 14.17 ? 256 ASP C OD1 1 
ATOM   7115  O  OD2 . ASP C  1 256 ? 66.730 -40.386 -22.027  1.00 17.63 ? 256 ASP C OD2 1 
ATOM   7116  N  N   . TYR C  1 257 ? 71.406 -39.446 -24.813  1.00 18.27 ? 257 TYR C N   1 
ATOM   7117  C  CA  . TYR C  1 257 ? 72.648 -40.102 -24.443  1.00 18.94 ? 257 TYR C CA  1 
ATOM   7118  C  C   . TYR C  1 257 ? 73.227 -39.520 -23.152  1.00 21.60 ? 257 TYR C C   1 
ATOM   7119  O  O   . TYR C  1 257 ? 73.204 -38.309 -22.935  1.00 21.64 ? 257 TYR C O   1 
ATOM   7120  C  CB  . TYR C  1 257 ? 73.680 -40.064 -25.571  1.00 19.18 ? 257 TYR C CB  1 
ATOM   7121  C  CG  . TYR C  1 257 ? 74.900 -40.897 -25.234  1.00 21.02 ? 257 TYR C CG  1 
ATOM   7122  C  CD1 . TYR C  1 257 ? 76.134 -40.300 -25.010  1.00 20.13 ? 257 TYR C CD1 1 
ATOM   7123  C  CD2 . TYR C  1 257 ? 74.801 -42.282 -25.096  1.00 19.49 ? 257 TYR C CD2 1 
ATOM   7124  C  CE1 . TYR C  1 257 ? 77.243 -41.061 -24.680  1.00 23.01 ? 257 TYR C CE1 1 
ATOM   7125  C  CE2 . TYR C  1 257 ? 75.903 -43.047 -24.758  1.00 22.26 ? 257 TYR C CE2 1 
ATOM   7126  C  CZ  . TYR C  1 257 ? 77.120 -42.430 -24.552  1.00 23.19 ? 257 TYR C CZ  1 
ATOM   7127  O  OH  . TYR C  1 257 ? 78.221 -43.184 -24.223  1.00 28.33 ? 257 TYR C OH  1 
ATOM   7128  N  N   . CYS C  1 258 ? 73.729 -40.404 -22.296  1.00 19.14 ? 258 CYS C N   1 
ATOM   7129  C  CA  . CYS C  1 258 ? 74.397 -40.002 -21.068  1.00 21.35 ? 258 CYS C CA  1 
ATOM   7130  C  C   . CYS C  1 258 ? 75.874 -40.347 -21.186  1.00 26.44 ? 258 CYS C C   1 
ATOM   7131  O  O   . CYS C  1 258 ? 76.254 -41.513 -21.143  1.00 21.96 ? 258 CYS C O   1 
ATOM   7132  C  CB  . CYS C  1 258 ? 73.790 -40.720 -19.861  1.00 22.18 ? 258 CYS C CB  1 
ATOM   7133  S  SG  . CYS C  1 258 ? 72.033 -40.402 -19.608  1.00 25.80 ? 258 CYS C SG  1 
ATOM   7134  N  N   . CYS C  1 259 ? 76.704 -39.326 -21.350  1.00 29.72 ? 259 CYS C N   1 
ATOM   7135  C  CA  . CYS C  1 259 ? 78.131 -39.542 -21.526  1.00 28.08 ? 259 CYS C CA  1 
ATOM   7136  C  C   . CYS C  1 259 ? 78.673 -40.319 -20.335  1.00 31.44 ? 259 CYS C C   1 
ATOM   7137  O  O   . CYS C  1 259 ? 79.612 -41.107 -20.463  1.00 22.75 ? 259 CYS C O   1 
ATOM   7138  C  CB  . CYS C  1 259 ? 78.838 -38.204 -21.722  1.00 27.93 ? 259 CYS C CB  1 
ATOM   7139  S  SG  . CYS C  1 259 ? 78.168 -37.301 -23.146  1.00 27.33 ? 259 CYS C SG  1 
ATOM   7140  N  N   . THR C  1 260 ? 78.049 -40.087 -19.183  1.00 28.27 ? 260 THR C N   1 
ATOM   7141  C  CA  . THR C  1 260 ? 78.228 -40.902 -17.993  1.00 29.48 ? 260 THR C CA  1 
ATOM   7142  C  C   . THR C  1 260 ? 76.900 -40.949 -17.236  1.00 28.46 ? 260 THR C C   1 
ATOM   7143  O  O   . THR C  1 260 ? 76.194 -39.943 -17.148  1.00 23.39 ? 260 THR C O   1 
ATOM   7144  C  CB  . THR C  1 260 ? 79.315 -40.332 -17.064  1.00 29.35 ? 260 THR C CB  1 
ATOM   7145  O  OG1 . THR C  1 260 ? 80.562 -40.273 -17.769  1.00 28.99 ? 260 THR C OG1 1 
ATOM   7146  C  CG2 . THR C  1 260 ? 79.477 -41.220 -15.837  1.00 30.22 ? 260 THR C CG2 1 
ATOM   7147  N  N   . ILE C  1 261 ? 76.549 -42.125 -16.726  1.00 28.17 ? 261 ILE C N   1 
ATOM   7148  C  CA  . ILE C  1 261 ? 75.360 -42.278 -15.883  1.00 27.49 ? 261 ILE C CA  1 
ATOM   7149  C  C   . ILE C  1 261 ? 75.616 -43.349 -14.819  1.00 29.35 ? 261 ILE C C   1 
ATOM   7150  O  O   . ILE C  1 261 ? 76.271 -44.360 -15.089  1.00 26.07 ? 261 ILE C O   1 
ATOM   7151  C  CB  . ILE C  1 261 ? 74.081 -42.577 -16.705  1.00 27.87 ? 261 ILE C CB  1 
ATOM   7152  C  CG1 . ILE C  1 261 ? 72.880 -42.788 -15.772  1.00 27.69 ? 261 ILE C CG1 1 
ATOM   7153  C  CG2 . ILE C  1 261 ? 74.287 -43.770 -17.630  1.00 25.78 ? 261 ILE C CG2 1 
ATOM   7154  C  CD1 . ILE C  1 261 ? 71.551 -42.882 -16.495  1.00 30.84 ? 261 ILE C CD1 1 
ATOM   7155  N  N   . ASP C  1 262 ? 75.106 -43.115 -13.612  1.00 28.98 ? 262 ASP C N   1 
ATOM   7156  C  CA  . ASP C  1 262 ? 75.511 -43.888 -12.439  1.00 28.16 ? 262 ASP C CA  1 
ATOM   7157  C  C   . ASP C  1 262 ? 74.587 -45.052 -12.074  1.00 27.36 ? 262 ASP C C   1 
ATOM   7158  O  O   . ASP C  1 262 ? 74.881 -45.813 -11.148  1.00 29.98 ? 262 ASP C O   1 
ATOM   7159  C  CB  . ASP C  1 262 ? 75.699 -42.958 -11.225  1.00 23.38 ? 262 ASP C CB  1 
ATOM   7160  C  CG  . ASP C  1 262 ? 74.382 -42.370 -10.717  1.00 25.72 ? 262 ASP C CG  1 
ATOM   7161  O  OD1 . ASP C  1 262 ? 73.361 -42.453 -11.434  1.00 26.48 ? 262 ASP C OD1 1 
ATOM   7162  O  OD2 . ASP C  1 262 ? 74.364 -41.830 -9.590   1.00 21.05 ? 262 ASP C OD2 1 
ATOM   7163  N  N   . ILE C  1 263 ? 73.478 -45.206 -12.790  1.00 24.82 ? 263 ILE C N   1 
ATOM   7164  C  CA  . ILE C  1 263 ? 72.534 -46.276 -12.453  1.00 25.20 ? 263 ILE C CA  1 
ATOM   7165  C  C   . ILE C  1 263 ? 73.112 -47.653 -12.777  1.00 29.44 ? 263 ILE C C   1 
ATOM   7166  O  O   . ILE C  1 263 ? 73.914 -47.799 -13.707  1.00 24.96 ? 263 ILE C O   1 
ATOM   7167  C  CB  . ILE C  1 263 ? 71.167 -46.091 -13.145  1.00 29.58 ? 263 ILE C CB  1 
ATOM   7168  C  CG1 . ILE C  1 263 ? 71.270 -46.390 -14.644  1.00 31.77 ? 263 ILE C CG1 1 
ATOM   7169  C  CG2 . ILE C  1 263 ? 70.627 -44.681 -12.905  1.00 28.04 ? 263 ILE C CG2 1 
ATOM   7170  C  CD1 . ILE C  1 263 ? 69.967 -46.170 -15.389  1.00 31.87 ? 263 ILE C CD1 1 
ATOM   7171  N  N   . GLY C  1 264 ? 72.710 -48.655 -11.996  1.00 28.95 ? 264 GLY C N   1 
ATOM   7172  C  CA  . GLY C  1 264 ? 73.213 -50.021 -12.161  1.00 29.82 ? 264 GLY C CA  1 
ATOM   7173  C  C   . GLY C  1 264 ? 72.845 -50.610 -13.511  1.00 29.18 ? 264 GLY C C   1 
ATOM   7174  O  O   . GLY C  1 264 ? 73.550 -51.473 -14.039  1.00 31.01 ? 264 GLY C O   1 
ATOM   7175  N  N   . THR C  1 265 ? 71.738 -50.138 -14.074  1.00 29.95 ? 265 THR C N   1 
ATOM   7176  C  CA  . THR C  1 265 ? 71.291 -50.606 -15.387  1.00 35.74 ? 265 THR C CA  1 
ATOM   7177  C  C   . THR C  1 265 ? 72.318 -50.282 -16.465  1.00 37.01 ? 265 THR C C   1 
ATOM   7178  O  O   . THR C  1 265 ? 72.396 -50.966 -17.487  1.00 34.89 ? 265 THR C O   1 
ATOM   7179  C  CB  . THR C  1 265 ? 69.942 -49.985 -15.779  1.00 36.79 ? 265 THR C CB  1 
ATOM   7180  O  OG1 . THR C  1 265 ? 69.029 -50.112 -14.684  1.00 32.56 ? 265 THR C OG1 1 
ATOM   7181  C  CG2 . THR C  1 265 ? 69.364 -50.680 -17.016  1.00 35.56 ? 265 THR C CG2 1 
ATOM   7182  N  N   . ALA C  1 266 ? 73.120 -49.249 -16.217  1.00 33.74 ? 266 ALA C N   1 
ATOM   7183  C  CA  . ALA C  1 266 ? 74.097 -48.783 -17.193  1.00 35.24 ? 266 ALA C CA  1 
ATOM   7184  C  C   . ALA C  1 266 ? 75.471 -49.446 -17.053  1.00 35.94 ? 266 ALA C C   1 
ATOM   7185  O  O   . ALA C  1 266 ? 76.436 -48.998 -17.668  1.00 34.09 ? 266 ALA C O   1 
ATOM   7186  C  CB  . ALA C  1 266 ? 74.226 -47.267 -17.132  1.00 35.77 ? 266 ALA C CB  1 
ATOM   7187  N  N   . LYS C  1 267 ? 75.567 -50.503 -16.250  1.00 36.56 ? 267 LYS C N   1 
ATOM   7188  C  CA  . LYS C  1 267 ? 76.826 -51.249 -16.137  1.00 40.70 ? 267 LYS C CA  1 
ATOM   7189  C  C   . LYS C  1 267 ? 77.272 -51.770 -17.505  1.00 42.22 ? 267 LYS C C   1 
ATOM   7190  O  O   . LYS C  1 267 ? 76.457 -52.279 -18.271  1.00 39.69 ? 267 LYS C O   1 
ATOM   7191  C  CB  . LYS C  1 267 ? 76.694 -52.409 -15.147  1.00 36.58 ? 267 LYS C CB  1 
ATOM   7192  C  CG  . LYS C  1 267 ? 76.602 -51.975 -13.693  1.00 43.13 ? 267 LYS C CG  1 
ATOM   7193  C  CD  . LYS C  1 267 ? 76.362 -53.167 -12.783  1.00 44.75 ? 267 LYS C CD  1 
ATOM   7194  C  CE  . LYS C  1 267 ? 76.116 -52.719 -11.352  1.00 46.09 ? 267 LYS C CE  1 
ATOM   7195  N  NZ  . LYS C  1 267 ? 75.742 -53.850 -10.459  1.00 46.42 ? 267 LYS C NZ  1 
ATOM   7196  N  N   . PRO C  1 268 ? 78.576 -51.647 -17.808  1.00 48.82 ? 268 PRO C N   1 
ATOM   7197  C  CA  . PRO C  1 268 ? 79.148 -51.999 -19.108  1.00 49.75 ? 268 PRO C CA  1 
ATOM   7198  C  C   . PRO C  1 268 ? 78.719 -53.371 -19.629  1.00 49.58 ? 268 PRO C C   1 
ATOM   7199  O  O   . PRO C  1 268 ? 78.556 -53.545 -20.836  1.00 49.73 ? 268 PRO C O   1 
ATOM   7200  C  CB  . PRO C  1 268 ? 80.666 -51.971 -18.855  1.00 52.85 ? 268 PRO C CB  1 
ATOM   7201  C  CG  . PRO C  1 268 ? 80.839 -51.823 -17.376  1.00 55.84 ? 268 PRO C CG  1 
ATOM   7202  C  CD  . PRO C  1 268 ? 79.600 -51.145 -16.882  1.00 45.98 ? 268 PRO C CD  1 
ATOM   7203  N  N   . GLU C  1 269 ? 78.532 -54.334 -18.734  1.00 42.20 ? 269 GLU C N   1 
ATOM   7204  C  CA  . GLU C  1 269 ? 78.155 -55.679 -19.162  1.00 44.62 ? 269 GLU C CA  1 
ATOM   7205  C  C   . GLU C  1 269 ? 76.697 -55.780 -19.621  1.00 42.15 ? 269 GLU C C   1 
ATOM   7206  O  O   . GLU C  1 269 ? 76.270 -56.823 -20.112  1.00 46.53 ? 269 GLU C O   1 
ATOM   7207  C  CB  . GLU C  1 269 ? 78.445 -56.712 -18.067  1.00 41.77 ? 269 GLU C CB  1 
ATOM   7208  C  CG  . GLU C  1 269 ? 77.596 -56.561 -16.817  1.00 47.35 ? 269 GLU C CG  1 
ATOM   7209  C  CD  . GLU C  1 269 ? 78.296 -55.783 -15.716  1.00 53.80 ? 269 GLU C CD  1 
ATOM   7210  O  OE1 . GLU C  1 269 ? 77.928 -55.977 -14.538  1.00 53.50 ? 269 GLU C OE1 1 
ATOM   7211  O  OE2 . GLU C  1 269 ? 79.215 -54.988 -16.020  1.00 48.08 ? 269 GLU C OE2 1 
ATOM   7212  N  N   . TYR C  1 270 ? 75.935 -54.702 -19.463  1.00 40.99 ? 270 TYR C N   1 
ATOM   7213  C  CA  . TYR C  1 270 ? 74.553 -54.679 -19.940  1.00 43.28 ? 270 TYR C CA  1 
ATOM   7214  C  C   . TYR C  1 270 ? 74.421 -53.958 -21.283  1.00 36.09 ? 270 TYR C C   1 
ATOM   7215  O  O   . TYR C  1 270 ? 73.387 -54.045 -21.941  1.00 38.90 ? 270 TYR C O   1 
ATOM   7216  C  CB  . TYR C  1 270 ? 73.620 -54.032 -18.910  1.00 43.81 ? 270 TYR C CB  1 
ATOM   7217  C  CG  . TYR C  1 270 ? 73.551 -54.763 -17.589  1.00 45.43 ? 270 TYR C CG  1 
ATOM   7218  C  CD1 . TYR C  1 270 ? 73.602 -56.151 -17.537  1.00 46.96 ? 270 TYR C CD1 1 
ATOM   7219  C  CD2 . TYR C  1 270 ? 73.419 -54.065 -16.394  1.00 43.53 ? 270 TYR C CD2 1 
ATOM   7220  C  CE1 . TYR C  1 270 ? 73.538 -56.824 -16.330  1.00 48.93 ? 270 TYR C CE1 1 
ATOM   7221  C  CE2 . TYR C  1 270 ? 73.351 -54.728 -15.182  1.00 46.68 ? 270 TYR C CE2 1 
ATOM   7222  C  CZ  . TYR C  1 270 ? 73.411 -56.107 -15.157  1.00 52.17 ? 270 TYR C CZ  1 
ATOM   7223  O  OH  . TYR C  1 270 ? 73.344 -56.769 -13.957  1.00 52.53 ? 270 TYR C OH  1 
ATOM   7224  N  N   . LYS C  1 271 ? 75.473 -53.250 -21.679  1.00 30.69 ? 271 LYS C N   1 
ATOM   7225  C  CA  . LYS C  1 271 ? 75.454 -52.457 -22.903  1.00 35.01 ? 271 LYS C CA  1 
ATOM   7226  C  C   . LYS C  1 271 ? 75.068 -53.266 -24.144  1.00 34.32 ? 271 LYS C C   1 
ATOM   7227  O  O   . LYS C  1 271 ? 74.171 -52.869 -24.891  1.00 37.75 ? 271 LYS C O   1 
ATOM   7228  C  CB  . LYS C  1 271 ? 76.808 -51.768 -23.118  1.00 39.02 ? 271 LYS C CB  1 
ATOM   7229  C  CG  . LYS C  1 271 ? 76.828 -50.781 -24.276  1.00 47.57 ? 271 LYS C CG  1 
ATOM   7230  C  CD  . LYS C  1 271 ? 78.200 -50.144 -24.451  1.00 45.72 ? 271 LYS C CD  1 
ATOM   7231  C  CE  . LYS C  1 271 ? 78.286 -49.368 -25.756  1.00 45.24 ? 271 LYS C CE  1 
ATOM   7232  N  NZ  . LYS C  1 271 ? 77.161 -48.397 -25.901  1.00 50.19 ? 271 LYS C NZ  1 
ATOM   7233  N  N   . PRO C  1 272 ? 75.747 -54.402 -24.372  1.00 37.90 ? 272 PRO C N   1 
ATOM   7234  C  CA  . PRO C  1 272 ? 75.524 -55.192 -25.584  1.00 40.15 ? 272 PRO C CA  1 
ATOM   7235  C  C   . PRO C  1 272 ? 74.052 -55.517 -25.852  1.00 38.96 ? 272 PRO C C   1 
ATOM   7236  O  O   . PRO C  1 272 ? 73.609 -55.447 -27.000  1.00 40.04 ? 272 PRO C O   1 
ATOM   7237  C  CB  . PRO C  1 272 ? 76.323 -56.472 -25.316  1.00 44.34 ? 272 PRO C CB  1 
ATOM   7238  C  CG  . PRO C  1 272 ? 77.430 -56.023 -24.426  1.00 42.49 ? 272 PRO C CG  1 
ATOM   7239  C  CD  . PRO C  1 272 ? 76.823 -54.968 -23.538  1.00 38.66 ? 272 PRO C CD  1 
ATOM   7240  N  N   . LYS C  1 273 ? 73.296 -55.869 -24.815  1.00 38.41 ? 273 LYS C N   1 
ATOM   7241  C  CA  . LYS C  1 273 ? 71.896 -56.241 -25.024  1.00 40.50 ? 273 LYS C CA  1 
ATOM   7242  C  C   . LYS C  1 273 ? 70.934 -55.050 -24.897  1.00 40.54 ? 273 LYS C C   1 
ATOM   7243  O  O   . LYS C  1 273 ? 69.927 -54.982 -25.601  1.00 35.31 ? 273 LYS C O   1 
ATOM   7244  C  CB  . LYS C  1 273 ? 71.478 -57.385 -24.089  1.00 44.10 ? 273 LYS C CB  1 
ATOM   7245  C  CG  . LYS C  1 273 ? 70.866 -56.937 -22.772  1.00 57.65 ? 273 LYS C CG  1 
ATOM   7246  C  CD  . LYS C  1 273 ? 70.216 -58.099 -22.034  1.00 64.69 ? 273 LYS C CD  1 
ATOM   7247  C  CE  . LYS C  1 273 ? 71.253 -59.016 -21.403  1.00 69.47 ? 273 LYS C CE  1 
ATOM   7248  N  NZ  . LYS C  1 273 ? 72.011 -58.335 -20.315  1.00 58.95 ? 273 LYS C NZ  1 
ATOM   7249  N  N   . LEU C  1 274 ? 71.253 -54.111 -24.011  1.00 34.52 ? 274 LEU C N   1 
ATOM   7250  C  CA  . LEU C  1 274 ? 70.350 -52.991 -23.719  1.00 33.22 ? 274 LEU C CA  1 
ATOM   7251  C  C   . LEU C  1 274 ? 70.477 -51.797 -24.667  1.00 32.17 ? 274 LEU C C   1 
ATOM   7252  O  O   . LEU C  1 274 ? 69.480 -51.151 -24.999  1.00 33.39 ? 274 LEU C O   1 
ATOM   7253  C  CB  . LEU C  1 274 ? 70.551 -52.515 -22.277  1.00 35.84 ? 274 LEU C CB  1 
ATOM   7254  C  CG  . LEU C  1 274 ? 69.634 -53.108 -21.205  1.00 39.95 ? 274 LEU C CG  1 
ATOM   7255  C  CD1 . LEU C  1 274 ? 69.157 -54.498 -21.595  1.00 31.39 ? 274 LEU C CD1 1 
ATOM   7256  C  CD2 . LEU C  1 274 ? 70.358 -53.128 -19.865  1.00 31.16 ? 274 LEU C CD2 1 
ATOM   7257  N  N   . ALA C  1 275 ? 71.702 -51.498 -25.088  1.00 28.33 ? 275 ALA C N   1 
ATOM   7258  C  CA  . ALA C  1 275 ? 71.971 -50.283 -25.853  1.00 29.06 ? 275 ALA C CA  1 
ATOM   7259  C  C   . ALA C  1 275 ? 73.314 -50.369 -26.563  1.00 27.70 ? 275 ALA C C   1 
ATOM   7260  O  O   . ALA C  1 275 ? 74.199 -49.552 -26.317  1.00 28.16 ? 275 ALA C O   1 
ATOM   7261  C  CB  . ALA C  1 275 ? 71.945 -49.073 -24.925  1.00 25.09 ? 275 ALA C CB  1 
ATOM   7262  N  N   . PRO C  1 276 ? 73.472 -51.363 -27.452  1.00 33.56 ? 276 PRO C N   1 
ATOM   7263  C  CA  . PRO C  1 276 ? 74.779 -51.652 -28.048  1.00 33.18 ? 276 PRO C CA  1 
ATOM   7264  C  C   . PRO C  1 276 ? 75.363 -50.509 -28.879  1.00 32.40 ? 276 PRO C C   1 
ATOM   7265  O  O   . PRO C  1 276 ? 76.582 -50.351 -28.926  1.00 34.11 ? 276 PRO C O   1 
ATOM   7266  C  CB  . PRO C  1 276 ? 74.503 -52.878 -28.937  1.00 36.93 ? 276 PRO C CB  1 
ATOM   7267  C  CG  . PRO C  1 276 ? 73.020 -52.887 -29.145  1.00 36.35 ? 276 PRO C CG  1 
ATOM   7268  C  CD  . PRO C  1 276 ? 72.443 -52.327 -27.879  1.00 32.77 ? 276 PRO C CD  1 
ATOM   7269  N  N   . ARG C  1 277 ? 74.515 -49.719 -29.531  1.00 26.30 ? 277 ARG C N   1 
ATOM   7270  C  CA  . ARG C  1 277 ? 75.017 -48.668 -30.420  1.00 27.54 ? 277 ARG C CA  1 
ATOM   7271  C  C   . ARG C  1 277 ? 74.712 -47.255 -29.930  1.00 24.58 ? 277 ARG C C   1 
ATOM   7272  O  O   . ARG C  1 277 ? 74.881 -46.280 -30.662  1.00 29.70 ? 277 ARG C O   1 
ATOM   7273  C  CB  . ARG C  1 277 ? 74.469 -48.865 -31.834  1.00 31.05 ? 277 ARG C CB  1 
ATOM   7274  C  CG  . ARG C  1 277 ? 74.956 -50.137 -32.504  1.00 32.84 ? 277 ARG C CG  1 
ATOM   7275  C  CD  . ARG C  1 277 ? 74.398 -50.229 -33.910  1.00 39.63 ? 277 ARG C CD  1 
ATOM   7276  N  NE  . ARG C  1 277 ? 72.958 -50.462 -33.890  1.00 49.35 ? 277 ARG C NE  1 
ATOM   7277  C  CZ  . ARG C  1 277 ? 72.118 -50.022 -34.819  1.00 52.16 ? 277 ARG C CZ  1 
ATOM   7278  N  NH1 . ARG C  1 277 ? 70.822 -50.286 -34.719  1.00 56.80 ? 277 ARG C NH1 1 
ATOM   7279  N  NH2 . ARG C  1 277 ? 72.572 -49.309 -35.842  1.00 54.38 ? 277 ARG C NH2 1 
ATOM   7280  N  N   . TRP C  1 278 ? 74.271 -47.163 -28.683  1.00 26.27 ? 278 TRP C N   1 
ATOM   7281  C  CA  . TRP C  1 278 ? 73.900 -45.906 -28.046  1.00 22.61 ? 278 TRP C CA  1 
ATOM   7282  C  C   . TRP C  1 278 ? 75.092 -44.993 -27.909  1.00 23.66 ? 278 TRP C C   1 
ATOM   7283  O  O   . TRP C  1 278 ? 76.077 -45.337 -27.256  1.00 24.46 ? 278 TRP C O   1 
ATOM   7284  C  CB  . TRP C  1 278 ? 73.330 -46.241 -26.674  1.00 23.51 ? 278 TRP C CB  1 
ATOM   7285  C  CG  . TRP C  1 278 ? 72.611 -45.137 -25.939  1.00 23.58 ? 278 TRP C CG  1 
ATOM   7286  C  CD1 . TRP C  1 278 ? 71.760 -44.163 -26.464  1.00 22.42 ? 278 TRP C CD1 1 
ATOM   7287  C  CD2 . TRP C  1 278 ? 72.606 -44.906 -24.480  1.00 21.68 ? 278 TRP C CD2 1 
ATOM   7288  N  NE1 . TRP C  1 278 ? 71.263 -43.360 -25.464  1.00 21.91 ? 278 TRP C NE1 1 
ATOM   7289  C  CE2 . TRP C  1 278 ? 71.733 -43.753 -24.249  1.00 22.08 ? 278 TRP C CE2 1 
ATOM   7290  C  CE3 . TRP C  1 278 ? 73.226 -45.514 -23.389  1.00 25.21 ? 278 TRP C CE3 1 
ATOM   7291  C  CZ2 . TRP C  1 278 ? 71.509 -43.243 -22.974  1.00 21.25 ? 278 TRP C CZ2 1 
ATOM   7292  C  CZ3 . TRP C  1 278 ? 72.992 -44.992 -22.109  1.00 22.82 ? 278 TRP C CZ3 1 
ATOM   7293  C  CH2 . TRP C  1 278 ? 72.151 -43.884 -21.909  1.00 24.21 ? 278 TRP C CH2 1 
ATOM   7294  N  N   . SER C  1 279 ? 75.017 -43.826 -28.537  1.00 21.43 ? 279 SER C N   1 
ATOM   7295  C  CA  . SER C  1 279 ? 76.025 -42.778 -28.383  1.00 20.70 ? 279 SER C CA  1 
ATOM   7296  C  C   . SER C  1 279 ? 75.415 -41.476 -28.874  1.00 20.20 ? 279 SER C C   1 
ATOM   7297  O  O   . SER C  1 279 ? 74.301 -41.466 -29.400  1.00 20.07 ? 279 SER C O   1 
ATOM   7298  C  CB  . SER C  1 279 ? 77.295 -43.091 -29.187  1.00 21.43 ? 279 SER C CB  1 
ATOM   7299  O  OG  . SER C  1 279 ? 77.199 -42.594 -30.516  1.00 23.50 ? 279 SER C OG  1 
ATOM   7300  N  N   . ILE C  1 280 ? 76.143 -40.377 -28.725  1.00 22.63 ? 280 ILE C N   1 
ATOM   7301  C  CA  . ILE C  1 280 ? 75.603 -39.073 -29.103  1.00 20.94 ? 280 ILE C CA  1 
ATOM   7302  C  C   . ILE C  1 280 ? 75.647 -38.816 -30.614  1.00 21.04 ? 280 ILE C C   1 
ATOM   7303  O  O   . ILE C  1 280 ? 75.238 -37.749 -31.077  1.00 21.45 ? 280 ILE C O   1 
ATOM   7304  C  CB  . ILE C  1 280 ? 76.317 -37.927 -28.353  1.00 23.30 ? 280 ILE C CB  1 
ATOM   7305  C  CG1 . ILE C  1 280 ? 75.402 -36.705 -28.236  1.00 24.20 ? 280 ILE C CG1 1 
ATOM   7306  C  CG2 . ILE C  1 280 ? 77.623 -37.566 -29.043  1.00 22.28 ? 280 ILE C CG2 1 
ATOM   7307  C  CD1 . ILE C  1 280 ? 75.984 -35.588 -27.393  1.00 25.69 ? 280 ILE C CD1 1 
ATOM   7308  N  N   . THR C  1 281 ? 76.137 -39.784 -31.383  1.00 18.68 ? 281 THR C N   1 
ATOM   7309  C  CA  . THR C  1 281 ? 76.206 -39.608 -32.834  1.00 24.41 ? 281 THR C CA  1 
ATOM   7310  C  C   . THR C  1 281 ? 75.523 -40.712 -33.639  1.00 20.76 ? 281 THR C C   1 
ATOM   7311  O  O   . THR C  1 281 ? 75.671 -40.772 -34.861  1.00 21.03 ? 281 THR C O   1 
ATOM   7312  C  CB  . THR C  1 281 ? 77.658 -39.450 -33.338  1.00 22.39 ? 281 THR C CB  1 
ATOM   7313  O  OG1 . THR C  1 281 ? 78.404 -40.640 -33.053  1.00 25.81 ? 281 THR C OG1 1 
ATOM   7314  C  CG2 . THR C  1 281 ? 78.330 -38.254 -32.675  1.00 24.56 ? 281 THR C CG2 1 
ATOM   7315  N  N   . LEU C  1 282 ? 74.777 -41.576 -32.961  1.00 18.22 ? 282 LEU C N   1 
ATOM   7316  C  CA  . LEU C  1 282 ? 74.100 -42.682 -33.636  1.00 17.78 ? 282 LEU C CA  1 
ATOM   7317  C  C   . LEU C  1 282 ? 73.216 -42.219 -34.805  1.00 17.10 ? 282 LEU C C   1 
ATOM   7318  O  O   . LEU C  1 282 ? 73.197 -42.848 -35.861  1.00 17.39 ? 282 LEU C O   1 
ATOM   7319  C  CB  . LEU C  1 282 ? 73.286 -43.519 -32.639  1.00 19.92 ? 282 LEU C CB  1 
ATOM   7320  C  CG  . LEU C  1 282 ? 72.494 -44.688 -33.249  1.00 21.69 ? 282 LEU C CG  1 
ATOM   7321  C  CD1 . LEU C  1 282 ? 73.414 -45.687 -33.938  1.00 22.10 ? 282 LEU C CD1 1 
ATOM   7322  C  CD2 . LEU C  1 282 ? 71.647 -45.385 -32.193  1.00 20.85 ? 282 LEU C CD2 1 
ATOM   7323  N  N   . ILE C  1 283 ? 72.488 -41.120 -34.639  1.00 16.03 ? 283 ILE C N   1 
ATOM   7324  C  CA  . ILE C  1 283 ? 71.589 -40.689 -35.718  1.00 18.44 ? 283 ILE C CA  1 
ATOM   7325  C  C   . ILE C  1 283 ? 72.323 -40.315 -37.008  1.00 18.83 ? 283 ILE C C   1 
ATOM   7326  O  O   . ILE C  1 283 ? 71.761 -40.430 -38.092  1.00 19.61 ? 283 ILE C O   1 
ATOM   7327  C  CB  . ILE C  1 283 ? 70.677 -39.515 -35.313  1.00 18.92 ? 283 ILE C CB  1 
ATOM   7328  C  CG1 . ILE C  1 283 ? 71.507 -38.256 -35.077  1.00 19.30 ? 283 ILE C CG1 1 
ATOM   7329  C  CG2 . ILE C  1 283 ? 69.813 -39.888 -34.115  1.00 18.54 ? 283 ILE C CG2 1 
ATOM   7330  C  CD1 . ILE C  1 283 ? 70.670 -37.010 -34.904  1.00 25.02 ? 283 ILE C CD1 1 
ATOM   7331  N  N   . PHE C  1 284 ? 73.564 -39.845 -36.896  1.00 18.36 ? 284 PHE C N   1 
ATOM   7332  C  CA  . PHE C  1 284 ? 74.345 -39.535 -38.088  1.00 21.53 ? 284 PHE C CA  1 
ATOM   7333  C  C   . PHE C  1 284 ? 74.817 -40.810 -38.766  1.00 23.28 ? 284 PHE C C   1 
ATOM   7334  O  O   . PHE C  1 284 ? 75.004 -40.837 -39.977  1.00 22.65 ? 284 PHE C O   1 
ATOM   7335  C  CB  . PHE C  1 284 ? 75.545 -38.646 -37.748  1.00 21.81 ? 284 PHE C CB  1 
ATOM   7336  C  CG  . PHE C  1 284 ? 75.161 -37.350 -37.104  1.00 23.95 ? 284 PHE C CG  1 
ATOM   7337  C  CD1 . PHE C  1 284 ? 75.358 -37.147 -35.748  1.00 24.01 ? 284 PHE C CD1 1 
ATOM   7338  C  CD2 . PHE C  1 284 ? 74.574 -36.341 -37.854  1.00 24.28 ? 284 PHE C CD2 1 
ATOM   7339  C  CE1 . PHE C  1 284 ? 74.986 -35.954 -35.151  1.00 23.97 ? 284 PHE C CE1 1 
ATOM   7340  C  CE2 . PHE C  1 284 ? 74.201 -35.146 -37.263  1.00 24.38 ? 284 PHE C CE2 1 
ATOM   7341  C  CZ  . PHE C  1 284 ? 74.406 -34.954 -35.909  1.00 21.39 ? 284 PHE C CZ  1 
ATOM   7342  N  N   . GLU C  1 285 ? 74.990 -41.865 -37.974  1.00 20.20 ? 285 GLU C N   1 
ATOM   7343  C  CA  . GLU C  1 285 ? 75.526 -43.132 -38.468  1.00 25.72 ? 285 GLU C CA  1 
ATOM   7344  C  C   . GLU C  1 285 ? 74.420 -44.035 -38.990  1.00 26.94 ? 285 GLU C C   1 
ATOM   7345  O  O   . GLU C  1 285 ? 74.647 -44.858 -39.873  1.00 26.27 ? 285 GLU C O   1 
ATOM   7346  C  CB  . GLU C  1 285 ? 76.274 -43.863 -37.350  1.00 24.18 ? 285 GLU C CB  1 
ATOM   7347  C  CG  . GLU C  1 285 ? 77.343 -43.024 -36.665  1.00 29.33 ? 285 GLU C CG  1 
ATOM   7348  C  CD  . GLU C  1 285 ? 77.646 -43.483 -35.249  1.00 31.85 ? 285 GLU C CD  1 
ATOM   7349  O  OE1 . GLU C  1 285 ? 76.952 -44.393 -34.744  1.00 36.01 ? 285 GLU C OE1 1 
ATOM   7350  O  OE2 . GLU C  1 285 ? 78.574 -42.922 -34.634  1.00 37.33 ? 285 GLU C OE2 1 
ATOM   7351  N  N   . ASP C  1 286 ? 73.223 -43.889 -38.437  1.00 22.10 ? 286 ASP C N   1 
ATOM   7352  C  CA  . ASP C  1 286 ? 72.140 -44.805 -38.762  1.00 25.12 ? 286 ASP C CA  1 
ATOM   7353  C  C   . ASP C  1 286 ? 70.884 -44.092 -39.263  1.00 23.96 ? 286 ASP C C   1 
ATOM   7354  O  O   . ASP C  1 286 ? 70.503 -44.229 -40.428  1.00 21.95 ? 286 ASP C O   1 
ATOM   7355  C  CB  . ASP C  1 286 ? 71.807 -45.672 -37.546  1.00 25.07 ? 286 ASP C CB  1 
ATOM   7356  C  CG  . ASP C  1 286 ? 70.700 -46.671 -37.825  1.00 31.61 ? 286 ASP C CG  1 
ATOM   7357  O  OD1 . ASP C  1 286 ? 69.661 -46.270 -38.385  1.00 33.29 ? 286 ASP C OD1 1 
ATOM   7358  O  OD2 . ASP C  1 286 ? 70.865 -47.855 -37.472  1.00 35.82 ? 286 ASP C OD2 1 
ATOM   7359  N  N   . THR C  1 287 ? 70.266 -43.320 -38.377  1.00 17.90 ? 287 THR C N   1 
ATOM   7360  C  CA  . THR C  1 287 ? 68.954 -42.730 -38.631  1.00 19.42 ? 287 THR C CA  1 
ATOM   7361  C  C   . THR C  1 287 ? 68.907 -41.835 -39.864  1.00 18.15 ? 287 THR C C   1 
ATOM   7362  O  O   . THR C  1 287 ? 68.101 -42.058 -40.766  1.00 17.94 ? 287 THR C O   1 
ATOM   7363  C  CB  . THR C  1 287 ? 68.451 -41.951 -37.403  1.00 18.38 ? 287 THR C CB  1 
ATOM   7364  O  OG1 . THR C  1 287 ? 68.473 -42.813 -36.261  1.00 21.76 ? 287 THR C OG1 1 
ATOM   7365  C  CG2 . THR C  1 287 ? 67.021 -41.445 -37.625  1.00 15.69 ? 287 THR C CG2 1 
ATOM   7366  N  N   . ILE C  1 288 ? 69.766 -40.824 -39.919  1.00 17.99 ? 288 ILE C N   1 
ATOM   7367  C  CA  . ILE C  1 288 ? 69.682 -39.881 -41.035  1.00 19.47 ? 288 ILE C CA  1 
ATOM   7368  C  C   . ILE C  1 288 ? 70.003 -40.552 -42.372  1.00 17.93 ? 288 ILE C C   1 
ATOM   7369  O  O   . ILE C  1 288 ? 69.301 -40.340 -43.361  1.00 17.74 ? 288 ILE C O   1 
ATOM   7370  C  CB  . ILE C  1 288 ? 70.514 -38.601 -40.798  1.00 19.63 ? 288 ILE C CB  1 
ATOM   7371  C  CG1 . ILE C  1 288 ? 69.929 -37.815 -39.618  1.00 17.96 ? 288 ILE C CG1 1 
ATOM   7372  C  CG2 . ILE C  1 288 ? 70.523 -37.732 -42.048  1.00 18.23 ? 288 ILE C CG2 1 
ATOM   7373  C  CD1 . ILE C  1 288 ? 70.791 -36.653 -39.162  1.00 19.54 ? 288 ILE C CD1 1 
ATOM   7374  N  N   . PRO C  1 289 ? 71.053 -41.377 -42.414  1.00 17.58 ? 289 PRO C N   1 
ATOM   7375  C  CA  . PRO C  1 289 ? 71.266 -42.106 -43.663  1.00 17.48 ? 289 PRO C CA  1 
ATOM   7376  C  C   . PRO C  1 289 ? 70.053 -42.970 -44.025  1.00 17.05 ? 289 PRO C C   1 
ATOM   7377  O  O   . PRO C  1 289 ? 69.665 -43.041 -45.195  1.00 17.14 ? 289 PRO C O   1 
ATOM   7378  C  CB  . PRO C  1 289 ? 72.478 -42.987 -43.347  1.00 20.62 ? 289 PRO C CB  1 
ATOM   7379  C  CG  . PRO C  1 289 ? 73.230 -42.205 -42.319  1.00 20.44 ? 289 PRO C CG  1 
ATOM   7380  C  CD  . PRO C  1 289 ? 72.170 -41.548 -41.470  1.00 20.30 ? 289 PRO C CD  1 
ATOM   7381  N  N   . PHE C  1 290 ? 69.454 -43.616 -43.029  1.00 16.33 ? 290 PHE C N   1 
ATOM   7382  C  CA  . PHE C  1 290 ? 68.278 -44.458 -43.273  1.00 16.31 ? 290 PHE C CA  1 
ATOM   7383  C  C   . PHE C  1 290 ? 67.140 -43.662 -43.908  1.00 15.81 ? 290 PHE C C   1 
ATOM   7384  O  O   . PHE C  1 290 ? 66.550 -44.079 -44.914  1.00 15.32 ? 290 PHE C O   1 
ATOM   7385  C  CB  . PHE C  1 290 ? 67.799 -45.119 -41.970  1.00 15.46 ? 290 PHE C CB  1 
ATOM   7386  C  CG  . PHE C  1 290 ? 66.396 -45.660 -42.049  1.00 17.04 ? 290 PHE C CG  1 
ATOM   7387  C  CD1 . PHE C  1 290 ? 66.159 -46.955 -42.493  1.00 15.91 ? 290 PHE C CD1 1 
ATOM   7388  C  CD2 . PHE C  1 290 ? 65.316 -44.876 -41.678  1.00 15.56 ? 290 PHE C CD2 1 
ATOM   7389  C  CE1 . PHE C  1 290 ? 64.870 -47.457 -42.566  1.00 18.23 ? 290 PHE C CE1 1 
ATOM   7390  C  CE2 . PHE C  1 290 ? 64.022 -45.368 -41.753  1.00 17.18 ? 290 PHE C CE2 1 
ATOM   7391  C  CZ  . PHE C  1 290 ? 63.797 -46.658 -42.200  1.00 17.55 ? 290 PHE C CZ  1 
ATOM   7392  N  N   . LEU C  1 291 ? 66.829 -42.513 -43.318  1.00 15.08 ? 291 LEU C N   1 
ATOM   7393  C  CA  . LEU C  1 291 ? 65.756 -41.666 -43.831  1.00 15.31 ? 291 LEU C CA  1 
ATOM   7394  C  C   . LEU C  1 291 ? 66.043 -41.218 -45.261  1.00 17.22 ? 291 LEU C C   1 
ATOM   7395  O  O   . LEU C  1 291 ? 65.165 -41.271 -46.122  1.00 16.71 ? 291 LEU C O   1 
ATOM   7396  C  CB  . LEU C  1 291 ? 65.541 -40.452 -42.919  1.00 15.63 ? 291 LEU C CB  1 
ATOM   7397  C  CG  . LEU C  1 291 ? 65.073 -40.769 -41.496  1.00 15.11 ? 291 LEU C CG  1 
ATOM   7398  C  CD1 . LEU C  1 291 ? 65.052 -39.511 -40.635  1.00 15.34 ? 291 LEU C CD1 1 
ATOM   7399  C  CD2 . LEU C  1 291 ? 63.694 -41.412 -41.531  1.00 14.50 ? 291 LEU C CD2 1 
ATOM   7400  N  N   . LYS C  1 292 ? 67.274 -40.786 -45.518  1.00 18.16 ? 292 LYS C N   1 
ATOM   7401  C  CA  . LYS C  1 292 ? 67.622 -40.293 -46.848  1.00 20.61 ? 292 LYS C CA  1 
ATOM   7402  C  C   . LYS C  1 292 ? 67.476 -41.350 -47.953  1.00 19.87 ? 292 LYS C C   1 
ATOM   7403  O  O   . LYS C  1 292 ? 67.058 -41.026 -49.065  1.00 20.01 ? 292 LYS C O   1 
ATOM   7404  C  CB  . LYS C  1 292 ? 69.007 -39.640 -46.848  1.00 24.04 ? 292 LYS C CB  1 
ATOM   7405  C  CG  . LYS C  1 292 ? 69.034 -38.331 -46.062  1.00 31.91 ? 292 LYS C CG  1 
ATOM   7406  C  CD  . LYS C  1 292 ? 70.250 -37.465 -46.376  1.00 38.69 ? 292 LYS C CD  1 
ATOM   7407  C  CE  . LYS C  1 292 ? 71.382 -37.676 -45.378  1.00 50.26 ? 292 LYS C CE  1 
ATOM   7408  N  NZ  . LYS C  1 292 ? 72.367 -36.550 -45.367  1.00 34.48 ? 292 LYS C NZ  1 
ATOM   7409  N  N   . ARG C  1 293 ? 67.789 -42.610 -47.651  1.00 17.17 ? 293 ARG C N   1 
ATOM   7410  C  CA  . ARG C  1 293 ? 67.639 -43.678 -48.658  1.00 19.49 ? 293 ARG C CA  1 
ATOM   7411  C  C   . ARG C  1 293 ? 66.234 -44.278 -48.664  1.00 19.71 ? 293 ARG C C   1 
ATOM   7412  O  O   . ARG C  1 293 ? 65.966 -45.257 -49.361  1.00 19.45 ? 293 ARG C O   1 
ATOM   7413  C  CB  . ARG C  1 293 ? 68.702 -44.774 -48.499  1.00 18.85 ? 293 ARG C CB  1 
ATOM   7414  C  CG  . ARG C  1 293 ? 68.572 -45.596 -47.227  1.00 17.82 ? 293 ARG C CG  1 
ATOM   7415  C  CD  . ARG C  1 293 ? 69.385 -46.887 -47.304  1.00 18.76 ? 293 ARG C CD  1 
ATOM   7416  N  NE  . ARG C  1 293 ? 69.229 -47.694 -46.094  1.00 18.81 ? 293 ARG C NE  1 
ATOM   7417  C  CZ  . ARG C  1 293 ? 69.972 -47.548 -45.000  1.00 21.31 ? 293 ARG C CZ  1 
ATOM   7418  N  NH1 . ARG C  1 293 ? 69.757 -48.314 -43.935  1.00 17.76 ? 293 ARG C NH1 1 
ATOM   7419  N  NH2 . ARG C  1 293 ? 70.934 -46.630 -44.967  1.00 20.77 ? 293 ARG C NH2 1 
ATOM   7420  N  N   . ASN C  1 294 ? 65.339 -43.683 -47.885  1.00 18.34 ? 294 ASN C N   1 
ATOM   7421  C  CA  . ASN C  1 294 ? 63.929 -44.050 -47.929  1.00 19.42 ? 294 ASN C CA  1 
ATOM   7422  C  C   . ASN C  1 294 ? 63.051 -42.872 -48.338  1.00 19.66 ? 294 ASN C C   1 
ATOM   7423  O  O   . ASN C  1 294 ? 61.914 -42.742 -47.885  1.00 21.45 ? 294 ASN C O   1 
ATOM   7424  C  CB  . ASN C  1 294 ? 63.481 -44.622 -46.588  1.00 19.69 ? 294 ASN C CB  1 
ATOM   7425  C  CG  . ASN C  1 294 ? 63.998 -46.032 -46.367  1.00 21.81 ? 294 ASN C CG  1 
ATOM   7426  O  OD1 . ASN C  1 294 ? 65.064 -46.232 -45.780  1.00 20.69 ? 294 ASN C OD1 1 
ATOM   7427  N  ND2 . ASN C  1 294 ? 63.263 -47.013 -46.872  1.00 20.31 ? 294 ASN C ND2 1 
ATOM   7428  N  N   . GLY C  1 295 ? 63.604 -42.008 -49.179  1.00 19.49 ? 295 GLY C N   1 
ATOM   7429  C  CA  . GLY C  1 295 ? 62.825 -40.972 -49.843  1.00 22.56 ? 295 GLY C CA  1 
ATOM   7430  C  C   . GLY C  1 295 ? 62.634 -39.696 -49.046  1.00 22.05 ? 295 GLY C C   1 
ATOM   7431  O  O   . GLY C  1 295 ? 61.868 -38.825 -49.450  1.00 22.93 ? 295 GLY C O   1 
ATOM   7432  N  N   . VAL C  1 296 ? 63.329 -39.564 -47.921  1.00 18.69 ? 296 VAL C N   1 
ATOM   7433  C  CA  . VAL C  1 296 ? 63.183 -38.348 -47.111  1.00 16.71 ? 296 VAL C CA  1 
ATOM   7434  C  C   . VAL C  1 296 ? 64.096 -37.239 -47.620  1.00 17.91 ? 296 VAL C C   1 
ATOM   7435  O  O   . VAL C  1 296 ? 65.319 -37.393 -47.657  1.00 18.35 ? 296 VAL C O   1 
ATOM   7436  C  CB  . VAL C  1 296 ? 63.427 -38.613 -45.612  1.00 16.53 ? 296 VAL C CB  1 
ATOM   7437  C  CG1 . VAL C  1 296 ? 63.417 -37.306 -44.824  1.00 15.49 ? 296 VAL C CG1 1 
ATOM   7438  C  CG2 . VAL C  1 296 ? 62.367 -39.563 -45.075  1.00 14.85 ? 296 VAL C CG2 1 
ATOM   7439  N  N   . ASN C  1 297 ? 63.493 -36.119 -48.010  1.00 16.45 ? 297 ASN C N   1 
ATOM   7440  C  CA  . ASN C  1 297 ? 64.244 -35.002 -48.561  1.00 17.33 ? 297 ASN C CA  1 
ATOM   7441  C  C   . ASN C  1 297 ? 65.074 -34.273 -47.507  1.00 18.12 ? 297 ASN C C   1 
ATOM   7442  O  O   . ASN C  1 297 ? 64.715 -34.247 -46.329  1.00 18.86 ? 297 ASN C O   1 
ATOM   7443  C  CB  . ASN C  1 297 ? 63.295 -34.028 -49.279  1.00 18.02 ? 297 ASN C CB  1 
ATOM   7444  C  CG  . ASN C  1 297 ? 64.034 -33.047 -50.167  1.00 18.79 ? 297 ASN C CG  1 
ATOM   7445  O  OD1 . ASN C  1 297 ? 64.231 -33.296 -51.361  1.00 20.42 ? 297 ASN C OD1 1 
ATOM   7446  N  ND2 . ASN C  1 297 ? 64.468 -31.938 -49.589  1.00 15.75 ? 297 ASN C ND2 1 
ATOM   7447  N  N   . GLU C  1 298 ? 66.191 -33.688 -47.929  1.00 19.38 ? 298 GLU C N   1 
ATOM   7448  C  CA  . GLU C  1 298 ? 67.043 -32.918 -47.027  1.00 19.90 ? 298 GLU C CA  1 
ATOM   7449  C  C   . GLU C  1 298 ? 66.276 -31.815 -46.283  1.00 20.20 ? 298 GLU C C   1 
ATOM   7450  O  O   . GLU C  1 298 ? 66.632 -31.456 -45.158  1.00 20.78 ? 298 GLU C O   1 
ATOM   7451  C  CB  . GLU C  1 298 ? 68.234 -32.322 -47.791  1.00 26.04 ? 298 GLU C CB  1 
ATOM   7452  C  CG  . GLU C  1 298 ? 69.179 -31.477 -46.943  1.00 32.86 ? 298 GLU C CG  1 
ATOM   7453  C  CD  . GLU C  1 298 ? 69.830 -32.247 -45.800  1.00 49.11 ? 298 GLU C CD  1 
ATOM   7454  O  OE1 . GLU C  1 298 ? 70.072 -33.470 -45.940  1.00 52.85 ? 298 GLU C OE1 1 
ATOM   7455  O  OE2 . GLU C  1 298 ? 70.112 -31.621 -44.754  1.00 48.28 ? 298 GLU C OE2 1 
ATOM   7456  N  N   . GLU C  1 299 ? 65.233 -31.273 -46.902  1.00 16.57 ? 299 GLU C N   1 
ATOM   7457  C  CA  . GLU C  1 299 ? 64.459 -30.205 -46.268  1.00 19.07 ? 299 GLU C CA  1 
ATOM   7458  C  C   . GLU C  1 299 ? 63.793 -30.694 -44.975  1.00 18.95 ? 299 GLU C C   1 
ATOM   7459  O  O   . GLU C  1 299 ? 63.580 -29.921 -44.041  1.00 19.38 ? 299 GLU C O   1 
ATOM   7460  C  CB  . GLU C  1 299 ? 63.413 -29.644 -47.237  1.00 20.30 ? 299 GLU C CB  1 
ATOM   7461  C  CG  . GLU C  1 299 ? 62.578 -28.491 -46.686  1.00 24.57 ? 299 GLU C CG  1 
ATOM   7462  C  CD  . GLU C  1 299 ? 63.380 -27.226 -46.391  1.00 27.16 ? 299 GLU C CD  1 
ATOM   7463  O  OE1 . GLU C  1 299 ? 62.822 -26.311 -45.750  1.00 28.15 ? 299 GLU C OE1 1 
ATOM   7464  O  OE2 . GLU C  1 299 ? 64.558 -27.132 -46.788  1.00 24.77 ? 299 GLU C OE2 1 
ATOM   7465  N  N   . VAL C  1 300 ? 63.460 -31.980 -44.927  1.00 18.08 ? 300 VAL C N   1 
ATOM   7466  C  CA  . VAL C  1 300 ? 62.879 -32.566 -43.722  1.00 16.90 ? 300 VAL C CA  1 
ATOM   7467  C  C   . VAL C  1 300 ? 63.915 -32.646 -42.609  1.00 16.34 ? 300 VAL C C   1 
ATOM   7468  O  O   . VAL C  1 300 ? 63.612 -32.380 -41.446  1.00 15.30 ? 300 VAL C O   1 
ATOM   7469  C  CB  . VAL C  1 300 ? 62.292 -33.966 -43.987  1.00 16.07 ? 300 VAL C CB  1 
ATOM   7470  C  CG1 . VAL C  1 300 ? 61.895 -34.630 -42.679  1.00 16.54 ? 300 VAL C CG1 1 
ATOM   7471  C  CG2 . VAL C  1 300 ? 61.086 -33.866 -44.908  1.00 19.47 ? 300 VAL C CG2 1 
ATOM   7472  N  N   . ILE C  1 301 ? 65.138 -33.023 -42.965  1.00 15.50 ? 301 ILE C N   1 
ATOM   7473  C  CA  . ILE C  1 301 ? 66.230 -33.049 -42.004  1.00 19.72 ? 301 ILE C CA  1 
ATOM   7474  C  C   . ILE C  1 301 ? 66.483 -31.653 -41.431  1.00 18.95 ? 301 ILE C C   1 
ATOM   7475  O  O   . ILE C  1 301 ? 66.662 -31.494 -40.223  1.00 20.24 ? 301 ILE C O   1 
ATOM   7476  C  CB  . ILE C  1 301 ? 67.526 -33.597 -42.640  1.00 20.48 ? 301 ILE C CB  1 
ATOM   7477  C  CG1 . ILE C  1 301 ? 67.251 -34.940 -43.326  1.00 20.89 ? 301 ILE C CG1 1 
ATOM   7478  C  CG2 . ILE C  1 301 ? 68.631 -33.706 -41.601  1.00 20.04 ? 301 ILE C CG2 1 
ATOM   7479  C  CD1 . ILE C  1 301 ? 66.560 -35.961 -42.443  1.00 25.85 ? 301 ILE C CD1 1 
ATOM   7480  N  N   . ALA C  1 302 ? 66.482 -30.641 -42.296  1.00 18.14 ? 302 ALA C N   1 
ATOM   7481  C  CA  . ALA C  1 302 ? 66.666 -29.263 -41.847  1.00 17.73 ? 302 ALA C CA  1 
ATOM   7482  C  C   . ALA C  1 302 ? 65.548 -28.867 -40.895  1.00 19.45 ? 302 ALA C C   1 
ATOM   7483  O  O   . ALA C  1 302 ? 65.772 -28.167 -39.904  1.00 17.67 ? 302 ALA C O   1 
ATOM   7484  C  CB  . ALA C  1 302 ? 66.713 -28.309 -43.037  1.00 15.82 ? 302 ALA C CB  1 
ATOM   7485  N  N   . THR C  1 303 ? 64.335 -29.312 -41.206  1.00 16.47 ? 303 THR C N   1 
ATOM   7486  C  CA  . THR C  1 303 ? 63.180 -28.983 -40.390  1.00 16.42 ? 303 THR C CA  1 
ATOM   7487  C  C   . THR C  1 303 ? 63.293 -29.595 -38.998  1.00 17.12 ? 303 THR C C   1 
ATOM   7488  O  O   . THR C  1 303 ? 63.106 -28.919 -37.991  1.00 15.77 ? 303 THR C O   1 
ATOM   7489  C  CB  . THR C  1 303 ? 61.889 -29.471 -41.057  1.00 17.86 ? 303 THR C CB  1 
ATOM   7490  O  OG1 . THR C  1 303 ? 61.664 -28.700 -42.241  1.00 21.08 ? 303 THR C OG1 1 
ATOM   7491  C  CG2 . THR C  1 303 ? 60.698 -29.308 -40.113  1.00 17.42 ? 303 THR C CG2 1 
ATOM   7492  N  N   . ILE C  1 304 ? 63.614 -30.880 -38.943  1.00 14.81 ? 304 ILE C N   1 
ATOM   7493  C  CA  . ILE C  1 304 ? 63.692 -31.567 -37.657  1.00 14.61 ? 304 ILE C CA  1 
ATOM   7494  C  C   . ILE C  1 304 ? 64.789 -31.004 -36.749  1.00 15.86 ? 304 ILE C C   1 
ATOM   7495  O  O   . ILE C  1 304 ? 64.561 -30.765 -35.562  1.00 15.57 ? 304 ILE C O   1 
ATOM   7496  C  CB  . ILE C  1 304 ? 63.855 -33.084 -37.856  1.00 13.28 ? 304 ILE C CB  1 
ATOM   7497  C  CG1 . ILE C  1 304 ? 62.545 -33.680 -38.389  1.00 13.11 ? 304 ILE C CG1 1 
ATOM   7498  C  CG2 . ILE C  1 304 ? 64.258 -33.772 -36.552  1.00 14.45 ? 304 ILE C CG2 1 
ATOM   7499  C  CD1 . ILE C  1 304 ? 62.694 -35.099 -38.920  1.00 12.71 ? 304 ILE C CD1 1 
ATOM   7500  N  N   . PHE C  1 305 ? 65.966 -30.754 -37.315  1.00 15.31 ? 305 PHE C N   1 
ATOM   7501  C  CA  . PHE C  1 305 ? 67.135 -30.448 -36.501  1.00 17.26 ? 305 PHE C CA  1 
ATOM   7502  C  C   . PHE C  1 305 ? 67.492 -28.978 -36.438  1.00 17.69 ? 305 PHE C C   1 
ATOM   7503  O  O   . PHE C  1 305 ? 68.308 -28.573 -35.613  1.00 16.39 ? 305 PHE C O   1 
ATOM   7504  C  CB  . PHE C  1 305 ? 68.338 -31.252 -36.985  1.00 14.91 ? 305 PHE C CB  1 
ATOM   7505  C  CG  . PHE C  1 305 ? 68.168 -32.731 -36.824  1.00 16.80 ? 305 PHE C CG  1 
ATOM   7506  C  CD1 . PHE C  1 305 ? 67.831 -33.525 -37.908  1.00 14.93 ? 305 PHE C CD1 1 
ATOM   7507  C  CD2 . PHE C  1 305 ? 68.350 -33.330 -35.584  1.00 15.50 ? 305 PHE C CD2 1 
ATOM   7508  C  CE1 . PHE C  1 305 ? 67.674 -34.888 -37.761  1.00 16.13 ? 305 PHE C CE1 1 
ATOM   7509  C  CE2 . PHE C  1 305 ? 68.198 -34.697 -35.433  1.00 16.73 ? 305 PHE C CE2 1 
ATOM   7510  C  CZ  . PHE C  1 305 ? 67.856 -35.477 -36.525  1.00 15.34 ? 305 PHE C CZ  1 
ATOM   7511  N  N   . LYS C  1 306 ? 66.898 -28.171 -37.307  1.00 17.17 ? 306 LYS C N   1 
ATOM   7512  C  CA  . LYS C  1 306 ? 67.174 -26.737 -37.259  1.00 18.67 ? 306 LYS C CA  1 
ATOM   7513  C  C   . LYS C  1 306 ? 65.912 -25.924 -36.998  1.00 18.57 ? 306 LYS C C   1 
ATOM   7514  O  O   . LYS C  1 306 ? 65.839 -25.174 -36.029  1.00 17.84 ? 306 LYS C O   1 
ATOM   7515  C  CB  . LYS C  1 306 ? 67.860 -26.268 -38.540  1.00 20.36 ? 306 LYS C CB  1 
ATOM   7516  C  CG  . LYS C  1 306 ? 69.255 -26.841 -38.738  1.00 24.33 ? 306 LYS C CG  1 
ATOM   7517  C  CD  . LYS C  1 306 ? 69.876 -26.282 -40.011  1.00 31.73 ? 306 LYS C CD  1 
ATOM   7518  C  CE  . LYS C  1 306 ? 71.161 -27.007 -40.368  1.00 35.63 ? 306 LYS C CE  1 
ATOM   7519  N  NZ  . LYS C  1 306 ? 71.746 -26.480 -41.630  1.00 44.51 ? 306 LYS C NZ  1 
ATOM   7520  N  N   . GLU C  1 307 ? 64.914 -26.090 -37.858  1.00 18.79 ? 307 GLU C N   1 
ATOM   7521  C  CA  . GLU C  1 307 ? 63.728 -25.248 -37.795  1.00 21.49 ? 307 GLU C CA  1 
ATOM   7522  C  C   . GLU C  1 307 ? 62.896 -25.511 -36.546  1.00 18.79 ? 307 GLU C C   1 
ATOM   7523  O  O   . GLU C  1 307 ? 62.410 -24.580 -35.902  1.00 18.02 ? 307 GLU C O   1 
ATOM   7524  C  CB  . GLU C  1 307 ? 62.864 -25.450 -39.036  1.00 22.03 ? 307 GLU C CB  1 
ATOM   7525  C  CG  . GLU C  1 307 ? 61.915 -24.301 -39.284  1.00 38.49 ? 307 GLU C CG  1 
ATOM   7526  C  CD  . GLU C  1 307 ? 62.655 -22.997 -39.515  1.00 38.58 ? 307 GLU C CD  1 
ATOM   7527  O  OE1 . GLU C  1 307 ? 63.787 -23.037 -40.048  1.00 44.71 ? 307 GLU C OE1 1 
ATOM   7528  O  OE2 . GLU C  1 307 ? 62.106 -21.936 -39.158  1.00 54.49 ? 307 GLU C OE2 1 
ATOM   7529  N  N   . ASN C  1 308 ? 62.715 -26.782 -36.208  1.00 18.67 ? 308 ASN C N   1 
ATOM   7530  C  CA  . ASN C  1 308 ? 61.899 -27.124 -35.052  1.00 17.01 ? 308 ASN C CA  1 
ATOM   7531  C  C   . ASN C  1 308 ? 62.492 -26.588 -33.741  1.00 17.33 ? 308 ASN C C   1 
ATOM   7532  O  O   . ASN C  1 308 ? 61.802 -25.915 -32.978  1.00 17.90 ? 308 ASN C O   1 
ATOM   7533  C  CB  . ASN C  1 308 ? 61.590 -28.632 -35.011  1.00 15.97 ? 308 ASN C CB  1 
ATOM   7534  C  CG  . ASN C  1 308 ? 60.566 -29.041 -36.062  1.00 17.18 ? 308 ASN C CG  1 
ATOM   7535  O  OD1 . ASN C  1 308 ? 60.027 -28.191 -36.782  1.00 16.13 ? 308 ASN C OD1 1 
ATOM   7536  N  ND2 . ASN C  1 308 ? 60.295 -30.338 -36.163  1.00 14.43 ? 308 ASN C ND2 1 
ATOM   7537  N  N   . PRO C  1 309 ? 63.779 -26.854 -33.487  1.00 16.82 ? 309 PRO C N   1 
ATOM   7538  C  CA  . PRO C  1 309 ? 64.433 -26.249 -32.322  1.00 16.80 ? 309 PRO C CA  1 
ATOM   7539  C  C   . PRO C  1 309 ? 64.375 -24.716 -32.333  1.00 17.35 ? 309 PRO C C   1 
ATOM   7540  O  O   . PRO C  1 309 ? 64.156 -24.104 -31.293  1.00 16.78 ? 309 PRO C O   1 
ATOM   7541  C  CB  . PRO C  1 309 ? 65.881 -26.725 -32.463  1.00 18.19 ? 309 PRO C CB  1 
ATOM   7542  C  CG  . PRO C  1 309 ? 65.742 -28.060 -33.131  1.00 16.80 ? 309 PRO C CG  1 
ATOM   7543  C  CD  . PRO C  1 309 ? 64.638 -27.862 -34.135  1.00 16.20 ? 309 PRO C CD  1 
ATOM   7544  N  N   . LYS C  1 310 ? 64.567 -24.100 -33.495  1.00 16.51 ? 310 LYS C N   1 
ATOM   7545  C  CA  . LYS C  1 310 ? 64.482 -22.646 -33.583  1.00 19.59 ? 310 LYS C CA  1 
ATOM   7546  C  C   . LYS C  1 310 ? 63.103 -22.161 -33.140  1.00 21.26 ? 310 LYS C C   1 
ATOM   7547  O  O   . LYS C  1 310 ? 62.983 -21.212 -32.364  1.00 19.11 ? 310 LYS C O   1 
ATOM   7548  C  CB  . LYS C  1 310 ? 64.781 -22.160 -35.004  1.00 20.42 ? 310 LYS C CB  1 
ATOM   7549  C  CG  . LYS C  1 310 ? 64.502 -20.674 -35.187  1.00 23.71 ? 310 LYS C CG  1 
ATOM   7550  C  CD  . LYS C  1 310 ? 64.610 -20.238 -36.637  1.00 29.50 ? 310 LYS C CD  1 
ATOM   7551  C  CE  . LYS C  1 310 ? 64.363 -18.741 -36.742  1.00 37.23 ? 310 LYS C CE  1 
ATOM   7552  N  NZ  . LYS C  1 310 ? 64.145 -18.303 -38.146  1.00 47.13 ? 310 LYS C NZ  1 
ATOM   7553  N  N   . LYS C  1 311 ? 62.065 -22.826 -33.640  1.00 19.60 ? 311 LYS C N   1 
ATOM   7554  C  CA  . LYS C  1 311 ? 60.688 -22.493 -33.300  1.00 21.50 ? 311 LYS C CA  1 
ATOM   7555  C  C   . LYS C  1 311 ? 60.423 -22.689 -31.807  1.00 22.25 ? 311 LYS C C   1 
ATOM   7556  O  O   . LYS C  1 311 ? 59.815 -21.836 -31.146  1.00 19.43 ? 311 LYS C O   1 
ATOM   7557  C  CB  . LYS C  1 311 ? 59.731 -23.361 -34.125  1.00 26.42 ? 311 LYS C CB  1 
ATOM   7558  C  CG  . LYS C  1 311 ? 58.256 -23.088 -33.892  1.00 40.48 ? 311 LYS C CG  1 
ATOM   7559  C  CD  . LYS C  1 311 ? 57.820 -21.778 -34.532  1.00 48.15 ? 311 LYS C CD  1 
ATOM   7560  C  CE  . LYS C  1 311 ? 56.347 -21.501 -34.272  1.00 48.94 ? 311 LYS C CE  1 
ATOM   7561  N  NZ  . LYS C  1 311 ? 55.885 -20.261 -34.954  1.00 61.72 ? 311 LYS C NZ  1 
ATOM   7562  N  N   . PHE C  1 312 ? 60.880 -23.824 -31.291  1.00 15.58 ? 312 PHE C N   1 
ATOM   7563  C  CA  . PHE C  1 312 ? 60.729 -24.182 -29.884  1.00 16.51 ? 312 PHE C CA  1 
ATOM   7564  C  C   . PHE C  1 312 ? 61.251 -23.063 -28.983  1.00 15.86 ? 312 PHE C C   1 
ATOM   7565  O  O   . PHE C  1 312 ? 60.664 -22.759 -27.937  1.00 16.44 ? 312 PHE C O   1 
ATOM   7566  C  CB  . PHE C  1 312 ? 61.514 -25.475 -29.630  1.00 13.60 ? 312 PHE C CB  1 
ATOM   7567  C  CG  . PHE C  1 312 ? 61.249 -26.123 -28.291  1.00 14.28 ? 312 PHE C CG  1 
ATOM   7568  C  CD1 . PHE C  1 312 ? 62.302 -26.403 -27.424  1.00 13.00 ? 312 PHE C CD1 1 
ATOM   7569  C  CD2 . PHE C  1 312 ? 59.969 -26.497 -27.919  1.00 14.50 ? 312 PHE C CD2 1 
ATOM   7570  C  CE1 . PHE C  1 312 ? 62.078 -27.029 -26.209  1.00 15.16 ? 312 PHE C CE1 1 
ATOM   7571  C  CE2 . PHE C  1 312 ? 59.735 -27.122 -26.706  1.00 13.88 ? 312 PHE C CE2 1 
ATOM   7572  C  CZ  . PHE C  1 312 ? 60.788 -27.392 -25.848  1.00 13.97 ? 312 PHE C CZ  1 
ATOM   7573  N  N   . PHE C  1 313 ? 62.365 -22.458 -29.384  1.00 14.64 ? 313 PHE C N   1 
ATOM   7574  C  CA  . PHE C  1 313 ? 63.026 -21.456 -28.549  1.00 17.70 ? 313 PHE C CA  1 
ATOM   7575  C  C   . PHE C  1 313 ? 62.690 -20.025 -28.944  1.00 20.87 ? 313 PHE C C   1 
ATOM   7576  O  O   . PHE C  1 313 ? 63.317 -19.089 -28.455  1.00 23.01 ? 313 PHE C O   1 
ATOM   7577  C  CB  . PHE C  1 313 ? 64.544 -21.639 -28.591  1.00 17.82 ? 313 PHE C CB  1 
ATOM   7578  C  CG  . PHE C  1 313 ? 65.040 -22.761 -27.725  1.00 20.23 ? 313 PHE C CG  1 
ATOM   7579  C  CD1 . PHE C  1 313 ? 65.386 -23.982 -28.280  1.00 17.68 ? 313 PHE C CD1 1 
ATOM   7580  C  CD2 . PHE C  1 313 ? 65.144 -22.598 -26.355  1.00 18.95 ? 313 PHE C CD2 1 
ATOM   7581  C  CE1 . PHE C  1 313 ? 65.847 -25.016 -27.485  1.00 19.11 ? 313 PHE C CE1 1 
ATOM   7582  C  CE2 . PHE C  1 313 ? 65.603 -23.632 -25.552  1.00 21.15 ? 313 PHE C CE2 1 
ATOM   7583  C  CZ  . PHE C  1 313 ? 65.959 -24.842 -26.120  1.00 17.90 ? 313 PHE C CZ  1 
ATOM   7584  N  N   . SER C  1 314 ? 61.712 -19.851 -29.825  1.00 23.01 ? 314 SER C N   1 
ATOM   7585  C  CA  A SER C  1 314 ? 61.330 -18.514 -30.277  0.50 28.13 ? 314 SER C CA  1 
ATOM   7586  C  CA  B SER C  1 314 ? 61.331 -18.514 -30.277  0.50 25.96 ? 314 SER C CA  1 
ATOM   7587  C  C   . SER C  1 314 ? 60.052 -18.042 -29.595  1.00 35.05 ? 314 SER C C   1 
ATOM   7588  O  O   . SER C  1 314 ? 59.458 -18.753 -28.778  1.00 34.79 ? 314 SER C O   1 
ATOM   7589  C  CB  A SER C  1 314 ? 61.141 -18.494 -31.791  0.50 28.90 ? 314 SER C CB  1 
ATOM   7590  C  CB  B SER C  1 314 ? 61.166 -18.482 -31.798  0.50 24.14 ? 314 SER C CB  1 
ATOM   7591  O  OG  A SER C  1 314 ? 60.032 -19.292 -32.161  0.50 39.95 ? 314 SER C OG  1 
ATOM   7592  O  OG  B SER C  1 314 ? 62.400 -18.727 -32.453  0.50 24.44 ? 314 SER C OG  1 
ATOM   7593  O  OXT A SER C  1 314 ? 59.582 -16.934 -29.851  0.50 39.86 ? 314 SER C OXT 1 
ATOM   7594  O  OXT B SER C  1 314 ? 59.581 -16.934 -29.851  0.50 39.06 ? 314 SER C OXT 1 
ATOM   7595  N  N   . MET D  1 1   ? 15.022 -15.189 -94.254  1.00 52.31 ? 1   MET D N   1 
ATOM   7596  C  CA  . MET D  1 1   ? 13.847 -14.988 -93.357  1.00 47.42 ? 1   MET D CA  1 
ATOM   7597  C  C   . MET D  1 1   ? 12.775 -16.060 -93.554  1.00 43.32 ? 1   MET D C   1 
ATOM   7598  O  O   . MET D  1 1   ? 11.899 -15.917 -94.400  1.00 54.84 ? 1   MET D O   1 
ATOM   7599  C  CB  . MET D  1 1   ? 13.252 -13.603 -93.587  1.00 58.34 ? 1   MET D CB  1 
ATOM   7600  C  CG  . MET D  1 1   ? 13.143 -13.233 -95.057  1.00 73.41 ? 1   MET D CG  1 
ATOM   7601  S  SD  . MET D  1 1   ? 14.550 -13.846 -96.006  1.00 70.28 ? 1   MET D SD  1 
ATOM   7602  C  CE  . MET D  1 1   ? 14.434 -12.824 -97.474  1.00 77.44 ? 1   MET D CE  1 
ATOM   7603  N  N   . ARG D  1 2   ? 12.851 -17.134 -92.771  1.00 38.16 ? 2   ARG D N   1 
ATOM   7604  C  CA  A ARG D  1 2   ? 11.868 -18.212 -92.841  0.50 33.16 ? 2   ARG D CA  1 
ATOM   7605  C  CA  B ARG D  1 2   ? 11.861 -18.208 -92.835  0.50 34.72 ? 2   ARG D CA  1 
ATOM   7606  C  C   . ARG D  1 2   ? 12.347 -19.428 -92.048  1.00 28.19 ? 2   ARG D C   1 
ATOM   7607  O  O   . ARG D  1 2   ? 11.678 -19.873 -91.126  1.00 30.55 ? 2   ARG D O   1 
ATOM   7608  C  CB  A ARG D  1 2   ? 11.583 -18.600 -94.293  0.50 38.54 ? 2   ARG D CB  1 
ATOM   7609  C  CB  B ARG D  1 2   ? 11.560 -18.590 -94.285  0.50 43.21 ? 2   ARG D CB  1 
ATOM   7610  C  CG  A ARG D  1 2   ? 10.323 -19.428 -94.478  0.50 37.40 ? 2   ARG D CG  1 
ATOM   7611  C  CG  B ARG D  1 2   ? 10.082 -18.759 -94.614  0.50 46.22 ? 2   ARG D CG  1 
ATOM   7612  C  CD  A ARG D  1 2   ? 9.092  -18.638 -94.066  0.50 35.89 ? 2   ARG D CD  1 
ATOM   7613  C  CD  B ARG D  1 2   ? 9.408  -19.831 -93.773  0.50 51.48 ? 2   ARG D CD  1 
ATOM   7614  N  NE  A ARG D  1 2   ? 7.905  -19.481 -93.957  0.50 34.01 ? 2   ARG D NE  1 
ATOM   7615  N  NE  B ARG D  1 2   ? 8.886  -19.307 -92.514  0.50 53.56 ? 2   ARG D NE  1 
ATOM   7616  C  CZ  A ARG D  1 2   ? 7.398  -19.913 -92.805  0.50 38.48 ? 2   ARG D CZ  1 
ATOM   7617  C  CZ  B ARG D  1 2   ? 8.098  -19.995 -91.691  0.50 45.83 ? 2   ARG D CZ  1 
ATOM   7618  N  NH1 A ARG D  1 2   ? 6.310  -20.672 -92.799  0.50 40.24 ? 2   ARG D NH1 1 
ATOM   7619  N  NH1 B ARG D  1 2   ? 7.741  -21.234 -91.997  0.50 49.30 ? 2   ARG D NH1 1 
ATOM   7620  N  NH2 A ARG D  1 2   ? 7.976  -19.584 -91.656  0.50 35.63 ? 2   ARG D NH2 1 
ATOM   7621  N  NH2 B ARG D  1 2   ? 7.664  -19.446 -90.566  0.50 38.21 ? 2   ARG D NH2 1 
ATOM   7622  N  N   . ILE D  1 3   ? 13.508 -19.965 -92.414  1.00 22.04 ? 3   ILE D N   1 
ATOM   7623  C  CA  . ILE D  1 3   ? 14.123 -21.049 -91.634  1.00 19.36 ? 3   ILE D CA  1 
ATOM   7624  C  C   . ILE D  1 3   ? 15.423 -20.544 -91.015  1.00 19.40 ? 3   ILE D C   1 
ATOM   7625  O  O   . ILE D  1 3   ? 16.324 -20.109 -91.741  1.00 19.75 ? 3   ILE D O   1 
ATOM   7626  C  CB  . ILE D  1 3   ? 14.476 -22.278 -92.492  1.00 18.07 ? 3   ILE D CB  1 
ATOM   7627  C  CG1 . ILE D  1 3   ? 13.276 -22.757 -93.313  1.00 19.07 ? 3   ILE D CG1 1 
ATOM   7628  C  CG2 . ILE D  1 3   ? 15.028 -23.393 -91.612  1.00 17.54 ? 3   ILE D CG2 1 
ATOM   7629  C  CD1 . ILE D  1 3   ? 13.646 -23.812 -94.333  1.00 23.81 ? 3   ILE D CD1 1 
ATOM   7630  N  N   . PRO D  1 4   ? 15.528 -20.588 -89.676  1.00 20.77 ? 4   PRO D N   1 
ATOM   7631  C  CA  . PRO D  1 4   ? 16.776 -20.155 -89.046  1.00 17.84 ? 4   PRO D CA  1 
ATOM   7632  C  C   . PRO D  1 4   ? 17.875 -21.174 -89.319  1.00 16.65 ? 4   PRO D C   1 
ATOM   7633  O  O   . PRO D  1 4   ? 17.612 -22.377 -89.333  1.00 14.66 ? 4   PRO D O   1 
ATOM   7634  C  CB  . PRO D  1 4   ? 16.438 -20.135 -87.553  1.00 16.44 ? 4   PRO D CB  1 
ATOM   7635  C  CG  . PRO D  1 4   ? 15.297 -21.083 -87.397  1.00 16.70 ? 4   PRO D CG  1 
ATOM   7636  C  CD  . PRO D  1 4   ? 14.553 -21.121 -88.703  1.00 19.12 ? 4   PRO D CD  1 
ATOM   7637  N  N   . LEU D  1 5   ? 19.089 -20.690 -89.550  1.00 15.17 ? 5   LEU D N   1 
ATOM   7638  C  CA  . LEU D  1 5   ? 20.230 -21.564 -89.801  1.00 15.81 ? 5   LEU D CA  1 
ATOM   7639  C  C   . LEU D  1 5   ? 21.299 -21.289 -88.763  1.00 16.71 ? 5   LEU D C   1 
ATOM   7640  O  O   . LEU D  1 5   ? 21.512 -20.143 -88.384  1.00 19.89 ? 5   LEU D O   1 
ATOM   7641  C  CB  . LEU D  1 5   ? 20.808 -21.298 -91.191  1.00 14.00 ? 5   LEU D CB  1 
ATOM   7642  C  CG  . LEU D  1 5   ? 19.932 -21.622 -92.408  1.00 15.34 ? 5   LEU D CG  1 
ATOM   7643  C  CD1 . LEU D  1 5   ? 20.681 -21.285 -93.695  1.00 13.91 ? 5   LEU D CD1 1 
ATOM   7644  C  CD2 . LEU D  1 5   ? 19.487 -23.084 -92.381  1.00 12.21 ? 5   LEU D CD2 1 
ATOM   7645  N  N   . VAL D  1 6   ? 21.984 -22.330 -88.312  1.00 14.87 ? 6   VAL D N   1 
ATOM   7646  C  CA  . VAL D  1 6   ? 23.093 -22.135 -87.390  1.00 15.54 ? 6   VAL D CA  1 
ATOM   7647  C  C   . VAL D  1 6   ? 24.221 -21.371 -88.068  1.00 17.20 ? 6   VAL D C   1 
ATOM   7648  O  O   . VAL D  1 6   ? 24.685 -21.759 -89.142  1.00 16.44 ? 6   VAL D O   1 
ATOM   7649  C  CB  . VAL D  1 6   ? 23.622 -23.468 -86.846  1.00 17.63 ? 6   VAL D CB  1 
ATOM   7650  C  CG1 . VAL D  1 6   ? 24.746 -23.221 -85.844  1.00 15.93 ? 6   VAL D CG1 1 
ATOM   7651  C  CG2 . VAL D  1 6   ? 22.480 -24.241 -86.195  1.00 15.79 ? 6   VAL D CG2 1 
ATOM   7652  N  N   . GLY D  1 7   ? 24.651 -20.280 -87.437  1.00 17.05 ? 7   GLY D N   1 
ATOM   7653  C  CA  . GLY D  1 7   ? 25.775 -19.475 -87.925  1.00 17.74 ? 7   GLY D CA  1 
ATOM   7654  C  C   . GLY D  1 7   ? 25.549 -18.728 -89.231  1.00 21.49 ? 7   GLY D C   1 
ATOM   7655  O  O   . GLY D  1 7   ? 26.489 -18.223 -89.834  1.00 22.49 ? 7   GLY D O   1 
ATOM   7656  N  N   . LYS D  1 8   ? 24.304 -18.653 -89.683  1.00 20.18 ? 8   LYS D N   1 
ATOM   7657  C  CA  . LYS D  1 8   ? 24.002 -17.944 -90.918  1.00 21.85 ? 8   LYS D CA  1 
ATOM   7658  C  C   . LYS D  1 8   ? 22.726 -17.133 -90.764  1.00 22.44 ? 8   LYS D C   1 
ATOM   7659  O  O   . LYS D  1 8   ? 21.988 -17.306 -89.794  1.00 22.64 ? 8   LYS D O   1 
ATOM   7660  C  CB  . LYS D  1 8   ? 23.808 -18.927 -92.076  1.00 23.97 ? 8   LYS D CB  1 
ATOM   7661  C  CG  . LYS D  1 8   ? 25.059 -19.647 -92.553  1.00 24.64 ? 8   LYS D CG  1 
ATOM   7662  C  CD  . LYS D  1 8   ? 24.754 -20.364 -93.864  1.00 23.83 ? 8   LYS D CD  1 
ATOM   7663  C  CE  . LYS D  1 8   ? 25.884 -21.281 -94.304  1.00 20.46 ? 8   LYS D CE  1 
ATOM   7664  N  NZ  . LYS D  1 8   ? 25.531 -21.934 -95.596  1.00 19.53 ? 8   LYS D NZ  1 
ATOM   7665  N  N   . ASP D  1 9   ? 22.462 -16.265 -91.738  1.00 24.44 ? 9   ASP D N   1 
ATOM   7666  C  CA  . ASP D  1 9   ? 21.179 -15.581 -91.832  1.00 24.00 ? 9   ASP D CA  1 
ATOM   7667  C  C   . ASP D  1 9   ? 20.101 -16.596 -92.180  1.00 22.65 ? 9   ASP D C   1 
ATOM   7668  O  O   . ASP D  1 9   ? 20.369 -17.599 -92.852  1.00 19.78 ? 9   ASP D O   1 
ATOM   7669  C  CB  . ASP D  1 9   ? 21.231 -14.499 -92.907  1.00 29.11 ? 9   ASP D CB  1 
ATOM   7670  C  CG  . ASP D  1 9   ? 22.250 -13.417 -92.596  1.00 38.04 ? 9   ASP D CG  1 
ATOM   7671  O  OD1 . ASP D  1 9   ? 22.687 -12.722 -93.537  1.00 47.92 ? 9   ASP D OD1 1 
ATOM   7672  O  OD2 . ASP D  1 9   ? 22.617 -13.263 -91.411  1.00 44.10 ? 9   ASP D OD2 1 
ATOM   7673  N  N   . SER D  1 10  ? 18.881 -16.352 -91.720  1.00 19.80 ? 10  SER D N   1 
ATOM   7674  C  CA  . SER D  1 10  ? 17.785 -17.264 -92.015  1.00 20.71 ? 10  SER D CA  1 
ATOM   7675  C  C   . SER D  1 10  ? 17.519 -17.282 -93.522  1.00 22.10 ? 10  SER D C   1 
ATOM   7676  O  O   . SER D  1 10  ? 17.804 -16.315 -94.222  1.00 21.50 ? 10  SER D O   1 
ATOM   7677  C  CB  . SER D  1 10  ? 16.537 -16.851 -91.240  1.00 21.86 ? 10  SER D CB  1 
ATOM   7678  O  OG  . SER D  1 10  ? 16.001 -15.653 -91.773  1.00 23.67 ? 10  SER D OG  1 
ATOM   7679  N  N   . ILE D  1 11  ? 16.976 -18.380 -94.029  1.00 21.50 ? 11  ILE D N   1 
ATOM   7680  C  CA  . ILE D  1 11  ? 16.703 -18.486 -95.453  1.00 20.76 ? 11  ILE D CA  1 
ATOM   7681  C  C   . ILE D  1 11  ? 15.234 -18.738 -95.720  1.00 22.13 ? 11  ILE D C   1 
ATOM   7682  O  O   . ILE D  1 11  ? 14.546 -19.373 -94.918  1.00 22.87 ? 11  ILE D O   1 
ATOM   7683  C  CB  . ILE D  1 11  ? 17.477 -19.658 -96.091  1.00 19.64 ? 11  ILE D CB  1 
ATOM   7684  C  CG1 . ILE D  1 11  ? 17.076 -20.978 -95.434  1.00 18.81 ? 11  ILE D CG1 1 
ATOM   7685  C  CG2 . ILE D  1 11  ? 18.974 -19.434 -95.967  1.00 25.68 ? 11  ILE D CG2 1 
ATOM   7686  C  CD1 . ILE D  1 11  ? 17.597 -22.203 -96.164  1.00 23.59 ? 11  ILE D CD1 1 
ATOM   7687  N  N   . GLU D  1 12  ? 14.746 -18.245 -96.852  1.00 19.23 ? 12  GLU D N   1 
ATOM   7688  C  CA  A GLU D  1 12  ? 13.420 -18.614 -97.323  0.50 21.31 ? 12  GLU D CA  1 
ATOM   7689  C  CA  B GLU D  1 12  ? 13.413 -18.614 -97.286  0.50 20.92 ? 12  GLU D CA  1 
ATOM   7690  C  C   . GLU D  1 12  ? 13.385 -20.128 -97.474  1.00 20.69 ? 12  GLU D C   1 
ATOM   7691  O  O   . GLU D  1 12  ? 14.376 -20.734 -97.893  1.00 17.85 ? 12  GLU D O   1 
ATOM   7692  C  CB  A GLU D  1 12  ? 13.132 -17.957 -98.674  0.50 24.91 ? 12  GLU D CB  1 
ATOM   7693  C  CB  B GLU D  1 12  ? 13.033 -17.882 -98.578  0.50 24.08 ? 12  GLU D CB  1 
ATOM   7694  C  CG  A GLU D  1 12  ? 13.098 -16.439 -98.644  0.50 28.55 ? 12  GLU D CG  1 
ATOM   7695  C  CG  B GLU D  1 12  ? 12.885 -16.378 -98.403  0.50 26.08 ? 12  GLU D CG  1 
ATOM   7696  C  CD  A GLU D  1 12  ? 11.746 -15.891 -98.234  0.50 29.01 ? 12  GLU D CD  1 
ATOM   7697  C  CD  B GLU D  1 12  ? 12.545 -15.661 -99.697  0.50 27.77 ? 12  GLU D CD  1 
ATOM   7698  O  OE1 A GLU D  1 12  ? 11.393 -14.783 -98.689  0.50 37.72 ? 12  GLU D OE1 1 
ATOM   7699  O  OE1 B GLU D  1 12  ? 13.205 -14.645 -100.003 0.50 30.59 ? 12  GLU D OE1 1 
ATOM   7700  O  OE2 A GLU D  1 12  ? 11.033 -16.566 -97.466  0.50 30.22 ? 12  GLU D OE2 1 
ATOM   7701  O  OE2 B GLU D  1 12  ? 11.622 -16.109 -100.406 0.50 29.92 ? 12  GLU D OE2 1 
ATOM   7702  N  N   . SER D  1 13  ? 12.259 -20.743 -97.138  1.00 21.95 ? 13  SER D N   1 
ATOM   7703  C  CA  . SER D  1 13  ? 12.144 -22.195 -97.257  1.00 22.78 ? 13  SER D CA  1 
ATOM   7704  C  C   . SER D  1 13  ? 12.335 -22.643 -98.703  1.00 21.91 ? 13  SER D C   1 
ATOM   7705  O  O   . SER D  1 13  ? 12.777 -23.762 -98.960  1.00 19.49 ? 13  SER D O   1 
ATOM   7706  C  CB  . SER D  1 13  ? 10.800 -22.683 -96.708  1.00 25.05 ? 13  SER D CB  1 
ATOM   7707  O  OG  . SER D  1 13  ? 9.723  -22.085 -97.405  1.00 29.73 ? 13  SER D OG  1 
ATOM   7708  N  N   . LYS D  1 14  ? 12.011 -21.763 -99.647  1.00 18.56 ? 14  LYS D N   1 
ATOM   7709  C  CA  . LYS D  1 14  ? 12.182 -22.070 -101.071 1.00 21.06 ? 14  LYS D CA  1 
ATOM   7710  C  C   . LYS D  1 14  ? 13.650 -22.243 -101.480 1.00 20.25 ? 14  LYS D C   1 
ATOM   7711  O  O   . LYS D  1 14  ? 13.947 -22.850 -102.513 1.00 19.70 ? 14  LYS D O   1 
ATOM   7712  C  CB  . LYS D  1 14  ? 11.522 -20.990 -101.938 1.00 25.23 ? 14  LYS D CB  1 
ATOM   7713  C  CG  . LYS D  1 14  ? 12.284 -19.672 -101.941 1.00 31.71 ? 14  LYS D CG  1 
ATOM   7714  C  CD  . LYS D  1 14  ? 11.847 -18.752 -103.074 1.00 36.02 ? 14  LYS D CD  1 
ATOM   7715  C  CE  . LYS D  1 14  ? 12.679 -17.475 -103.102 1.00 44.30 ? 14  LYS D CE  1 
ATOM   7716  N  NZ  . LYS D  1 14  ? 14.073 -17.681 -103.599 1.00 31.11 ? 14  LYS D NZ  1 
ATOM   7717  N  N   . ASP D  1 15  ? 14.567 -21.719 -100.672 1.00 20.10 ? 15  ASP D N   1 
ATOM   7718  C  CA  . ASP D  1 15  ? 16.001 -21.800 -100.974 1.00 20.55 ? 15  ASP D CA  1 
ATOM   7719  C  C   . ASP D  1 15  ? 16.724 -22.954 -100.270 1.00 20.53 ? 15  ASP D C   1 
ATOM   7720  O  O   . ASP D  1 15  ? 17.950 -23.046 -100.336 1.00 18.00 ? 15  ASP D O   1 
ATOM   7721  C  CB  . ASP D  1 15  ? 16.691 -20.480 -100.617 1.00 19.83 ? 15  ASP D CB  1 
ATOM   7722  C  CG  . ASP D  1 15  ? 16.242 -19.335 -101.501 1.00 19.38 ? 15  ASP D CG  1 
ATOM   7723  O  OD1 . ASP D  1 15  ? 16.217 -18.188 -101.019 1.00 21.91 ? 15  ASP D OD1 1 
ATOM   7724  O  OD2 . ASP D  1 15  ? 15.909 -19.587 -102.678 1.00 21.83 ? 15  ASP D OD2 1 
ATOM   7725  N  N   . ILE D  1 16  ? 15.969 -23.832 -99.614  1.00 17.08 ? 16  ILE D N   1 
ATOM   7726  C  CA  . ILE D  1 16  ? 16.557 -24.915 -98.809  1.00 18.99 ? 16  ILE D CA  1 
ATOM   7727  C  C   . ILE D  1 16  ? 17.389 -25.909 -99.639  1.00 19.43 ? 16  ILE D C   1 
ATOM   7728  O  O   . ILE D  1 16  ? 18.384 -26.457 -99.156  1.00 16.34 ? 16  ILE D O   1 
ATOM   7729  C  CB  . ILE D  1 16  ? 15.462 -25.656 -98.003  1.00 20.66 ? 16  ILE D CB  1 
ATOM   7730  C  CG1 . ILE D  1 16  ? 16.068 -26.464 -96.859  1.00 24.47 ? 16  ILE D CG1 1 
ATOM   7731  C  CG2 . ILE D  1 16  ? 14.625 -26.549 -98.913  1.00 19.26 ? 16  ILE D CG2 1 
ATOM   7732  C  CD1 . ILE D  1 16  ? 15.023 -27.157 -96.010  1.00 23.52 ? 16  ILE D CD1 1 
ATOM   7733  N  N   . GLY D  1 17  ? 16.989 -26.130 -100.889 1.00 17.78 ? 17  GLY D N   1 
ATOM   7734  C  CA  . GLY D  1 17  ? 17.714 -27.041 -101.778 1.00 17.39 ? 17  GLY D CA  1 
ATOM   7735  C  C   . GLY D  1 17  ? 17.672 -28.494 -101.314 1.00 17.84 ? 17  GLY D C   1 
ATOM   7736  O  O   . GLY D  1 17  ? 16.825 -28.877 -100.505 1.00 15.55 ? 17  GLY D O   1 
ATOM   7737  N  N   . PHE D  1 18  ? 18.593 -29.304 -101.833 1.00 16.33 ? 18  PHE D N   1 
ATOM   7738  C  CA  . PHE D  1 18  ? 18.652 -30.727 -101.505 1.00 16.37 ? 18  PHE D CA  1 
ATOM   7739  C  C   . PHE D  1 18  ? 18.976 -30.880 -100.020 1.00 14.29 ? 18  PHE D C   1 
ATOM   7740  O  O   . PHE D  1 18  ? 19.996 -30.381 -99.541  1.00 17.15 ? 18  PHE D O   1 
ATOM   7741  C  CB  . PHE D  1 18  ? 19.704 -31.433 -102.369 1.00 16.64 ? 18  PHE D CB  1 
ATOM   7742  C  CG  . PHE D  1 18  ? 19.596 -32.934 -102.359 1.00 20.20 ? 18  PHE D CG  1 
ATOM   7743  C  CD1 . PHE D  1 18  ? 19.140 -33.617 -103.480 1.00 20.17 ? 18  PHE D CD1 1 
ATOM   7744  C  CD2 . PHE D  1 18  ? 19.940 -33.662 -101.230 1.00 19.72 ? 18  PHE D CD2 1 
ATOM   7745  C  CE1 . PHE D  1 18  ? 19.039 -35.000 -103.477 1.00 22.50 ? 18  PHE D CE1 1 
ATOM   7746  C  CE2 . PHE D  1 18  ? 19.834 -35.046 -101.219 1.00 21.68 ? 18  PHE D CE2 1 
ATOM   7747  C  CZ  . PHE D  1 18  ? 19.385 -35.713 -102.345 1.00 20.54 ? 18  PHE D CZ  1 
ATOM   7748  N  N   . THR D  1 19  ? 18.105 -31.574 -99.301  1.00 13.75 ? 19  THR D N   1 
ATOM   7749  C  CA  . THR D  1 19  ? 18.134 -31.591 -97.841  1.00 14.45 ? 19  THR D CA  1 
ATOM   7750  C  C   . THR D  1 19  ? 18.184 -33.009 -97.286  1.00 14.86 ? 19  THR D C   1 
ATOM   7751  O  O   . THR D  1 19  ? 17.491 -33.907 -97.772  1.00 16.25 ? 19  THR D O   1 
ATOM   7752  C  CB  . THR D  1 19  ? 16.875 -30.893 -97.270  1.00 16.35 ? 19  THR D CB  1 
ATOM   7753  O  OG1 . THR D  1 19  ? 16.852 -29.526 -97.693  1.00 17.19 ? 19  THR D OG1 1 
ATOM   7754  C  CG2 . THR D  1 19  ? 16.845 -30.949 -95.745  1.00 14.18 ? 19  THR D CG2 1 
ATOM   7755  N  N   . LEU D  1 20  ? 19.022 -33.212 -96.279  1.00 14.82 ? 20  LEU D N   1 
ATOM   7756  C  CA  . LEU D  1 20  ? 18.964 -34.433 -95.475  1.00 14.05 ? 20  LEU D CA  1 
ATOM   7757  C  C   . LEU D  1 20  ? 18.220 -34.042 -94.208  1.00 12.93 ? 20  LEU D C   1 
ATOM   7758  O  O   . LEU D  1 20  ? 18.727 -33.256 -93.398  1.00 14.51 ? 20  LEU D O   1 
ATOM   7759  C  CB  . LEU D  1 20  ? 20.367 -34.950 -95.145  1.00 13.28 ? 20  LEU D CB  1 
ATOM   7760  C  CG  . LEU D  1 20  ? 21.213 -35.435 -96.328  1.00 15.84 ? 20  LEU D CG  1 
ATOM   7761  C  CD1 . LEU D  1 20  ? 22.573 -35.917 -95.837  1.00 16.29 ? 20  LEU D CD1 1 
ATOM   7762  C  CD2 . LEU D  1 20  ? 20.500 -36.544 -97.100  1.00 16.80 ? 20  LEU D CD2 1 
ATOM   7763  N  N   . ILE D  1 21  ? 17.016 -34.581 -94.051  1.00 12.61 ? 21  ILE D N   1 
ATOM   7764  C  CA  . ILE D  1 21  ? 16.069 -34.118 -93.025  1.00 13.52 ? 21  ILE D CA  1 
ATOM   7765  C  C   . ILE D  1 21  ? 16.352 -34.615 -91.598  1.00 14.50 ? 21  ILE D C   1 
ATOM   7766  O  O   . ILE D  1 21  ? 15.810 -34.067 -90.631  1.00 14.60 ? 21  ILE D O   1 
ATOM   7767  C  CB  . ILE D  1 21  ? 14.613 -34.482 -93.410  1.00 14.38 ? 21  ILE D CB  1 
ATOM   7768  C  CG1 . ILE D  1 21  ? 13.608 -33.643 -92.607  1.00 17.48 ? 21  ILE D CG1 1 
ATOM   7769  C  CG2 . ILE D  1 21  ? 14.353 -35.975 -93.235  1.00 15.15 ? 21  ILE D CG2 1 
ATOM   7770  C  CD1 . ILE D  1 21  ? 13.536 -32.193 -93.055  1.00 15.21 ? 21  ILE D CD1 1 
ATOM   7771  N  N   . HIS D  1 22  ? 17.180 -35.650 -91.460  1.00 12.57 ? 22  HIS D N   1 
ATOM   7772  C  CA  . HIS D  1 22  ? 17.450 -36.225 -90.127  1.00 14.05 ? 22  HIS D CA  1 
ATOM   7773  C  C   . HIS D  1 22  ? 18.828 -36.819 -90.051  1.00 16.96 ? 22  HIS D C   1 
ATOM   7774  O  O   . HIS D  1 22  ? 19.024 -37.984 -90.412  1.00 17.50 ? 22  HIS D O   1 
ATOM   7775  C  CB  . HIS D  1 22  ? 16.396 -37.287 -89.774  1.00 13.84 ? 22  HIS D CB  1 
ATOM   7776  C  CG  . HIS D  1 22  ? 16.437 -37.755 -88.324  1.00 15.20 ? 22  HIS D CG  1 
ATOM   7777  N  ND1 . HIS D  1 22  ? 15.321 -37.961 -87.604  1.00 14.75 ? 22  HIS D ND1 1 
ATOM   7778  C  CD2 . HIS D  1 22  ? 17.506 -38.060 -87.481  1.00 14.41 ? 22  HIS D CD2 1 
ATOM   7779  C  CE1 . HIS D  1 22  ? 15.648 -38.370 -86.361  1.00 12.43 ? 22  HIS D CE1 1 
ATOM   7780  N  NE2 . HIS D  1 22  ? 16.985 -38.442 -86.283  1.00 14.95 ? 22  HIS D NE2 1 
ATOM   7781  N  N   . GLU D  1 23  ? 19.797 -36.019 -89.595  1.00 14.98 ? 23  GLU D N   1 
ATOM   7782  C  CA  . GLU D  1 23  ? 21.172 -36.478 -89.381  1.00 15.92 ? 23  GLU D CA  1 
ATOM   7783  C  C   . GLU D  1 23  ? 21.740 -35.812 -88.124  1.00 16.85 ? 23  GLU D C   1 
ATOM   7784  O  O   . GLU D  1 23  ? 21.329 -34.715 -87.755  1.00 16.11 ? 23  GLU D O   1 
ATOM   7785  C  CB  . GLU D  1 23  ? 22.081 -36.124 -90.572  1.00 15.95 ? 23  GLU D CB  1 
ATOM   7786  C  CG  . GLU D  1 23  ? 21.531 -36.464 -91.953  1.00 16.00 ? 23  GLU D CG  1 
ATOM   7787  C  CD  . GLU D  1 23  ? 21.501 -37.954 -92.250  1.00 18.25 ? 23  GLU D CD  1 
ATOM   7788  O  OE1 . GLU D  1 23  ? 20.814 -38.348 -93.219  1.00 19.91 ? 23  GLU D OE1 1 
ATOM   7789  O  OE2 . GLU D  1 23  ? 22.153 -38.735 -91.525  1.00 18.79 ? 23  GLU D OE2 1 
ATOM   7790  N  N   . HIS D  1 24  ? 22.701 -36.464 -87.482  1.00 16.40 ? 24  HIS D N   1 
ATOM   7791  C  CA  . HIS D  1 24  ? 23.293 -35.928 -86.261  1.00 14.11 ? 24  HIS D CA  1 
ATOM   7792  C  C   . HIS D  1 24  ? 24.768 -35.652 -86.426  1.00 15.54 ? 24  HIS D C   1 
ATOM   7793  O  O   . HIS D  1 24  ? 25.549 -36.554 -86.752  1.00 17.15 ? 24  HIS D O   1 
ATOM   7794  C  CB  . HIS D  1 24  ? 23.070 -36.907 -85.108  1.00 14.10 ? 24  HIS D CB  1 
ATOM   7795  C  CG  . HIS D  1 24  ? 21.610 -37.206 -84.823  1.00 14.70 ? 24  HIS D CG  1 
ATOM   7796  N  ND1 . HIS D  1 24  ? 20.862 -36.452 -83.985  1.00 12.65 ? 24  HIS D ND1 1 
ATOM   7797  C  CD2 . HIS D  1 24  ? 20.769 -38.223 -85.295  1.00 12.82 ? 24  HIS D CD2 1 
ATOM   7798  C  CE1 . HIS D  1 24  ? 19.609 -36.966 -83.915  1.00 12.50 ? 24  HIS D CE1 1 
ATOM   7799  N  NE2 . HIS D  1 24  ? 19.553 -38.049 -84.719  1.00 13.51 ? 24  HIS D NE2 1 
ATOM   7800  N  N   . LEU D  1 25  ? 25.188 -34.411 -86.204  1.00 14.75 ? 25  LEU D N   1 
ATOM   7801  C  CA  . LEU D  1 25  ? 26.624 -34.123 -86.187  1.00 17.12 ? 25  LEU D CA  1 
ATOM   7802  C  C   . LEU D  1 25  ? 27.315 -34.824 -85.019  1.00 17.78 ? 25  LEU D C   1 
ATOM   7803  O  O   . LEU D  1 25  ? 28.426 -35.356 -85.165  1.00 17.59 ? 25  LEU D O   1 
ATOM   7804  C  CB  . LEU D  1 25  ? 26.879 -32.622 -86.118  1.00 16.85 ? 25  LEU D CB  1 
ATOM   7805  C  CG  . LEU D  1 25  ? 26.312 -31.823 -87.292  1.00 19.06 ? 25  LEU D CG  1 
ATOM   7806  C  CD1 . LEU D  1 25  ? 26.638 -30.353 -87.095  1.00 16.42 ? 25  LEU D CD1 1 
ATOM   7807  C  CD2 . LEU D  1 25  ? 26.889 -32.342 -88.604  1.00 17.56 ? 25  LEU D CD2 1 
ATOM   7808  N  N   . ARG D  1 26  ? 26.654 -34.828 -83.863  1.00 14.71 ? 26  ARG D N   1 
ATOM   7809  C  CA  . ARG D  1 26  ? 27.195 -35.496 -82.675  1.00 17.46 ? 26  ARG D CA  1 
ATOM   7810  C  C   . ARG D  1 26  ? 26.099 -35.816 -81.666  1.00 16.43 ? 26  ARG D C   1 
ATOM   7811  O  O   . ARG D  1 26  ? 25.233 -34.984 -81.394  1.00 19.04 ? 26  ARG D O   1 
ATOM   7812  C  CB  . ARG D  1 26  ? 28.273 -34.632 -82.008  1.00 19.36 ? 26  ARG D CB  1 
ATOM   7813  C  CG  . ARG D  1 26  ? 28.907 -35.291 -80.789  1.00 17.98 ? 26  ARG D CG  1 
ATOM   7814  C  CD  . ARG D  1 26  ? 29.936 -34.382 -80.153  1.00 17.67 ? 26  ARG D CD  1 
ATOM   7815  N  NE  . ARG D  1 26  ? 29.353 -33.107 -79.747  1.00 16.84 ? 26  ARG D NE  1 
ATOM   7816  C  CZ  . ARG D  1 26  ? 30.037 -32.142 -79.148  1.00 17.37 ? 26  ARG D CZ  1 
ATOM   7817  N  NH1 . ARG D  1 26  ? 29.434 -31.007 -78.804  1.00 17.10 ? 26  ARG D NH1 1 
ATOM   7818  N  NH2 . ARG D  1 26  ? 31.323 -32.322 -78.885  1.00 16.29 ? 26  ARG D NH2 1 
ATOM   7819  N  N   . VAL D  1 27  ? 26.140 -37.024 -81.113  1.00 14.72 ? 27  VAL D N   1 
ATOM   7820  C  CA  . VAL D  1 27  ? 25.212 -37.412 -80.064  1.00 16.14 ? 27  VAL D CA  1 
ATOM   7821  C  C   . VAL D  1 27  ? 25.973 -37.858 -78.819  1.00 16.61 ? 27  VAL D C   1 
ATOM   7822  O  O   . VAL D  1 27  ? 26.946 -38.600 -78.921  1.00 15.38 ? 27  VAL D O   1 
ATOM   7823  C  CB  . VAL D  1 27  ? 24.276 -38.546 -80.534  1.00 16.42 ? 27  VAL D CB  1 
ATOM   7824  C  CG1 . VAL D  1 27  ? 23.525 -39.140 -79.359  1.00 20.69 ? 27  VAL D CG1 1 
ATOM   7825  C  CG2 . VAL D  1 27  ? 23.286 -38.024 -81.573  1.00 18.05 ? 27  VAL D CG2 1 
ATOM   7826  N  N   . PHE D  1 28  ? 25.534 -37.406 -77.647  1.00 14.50 ? 28  PHE D N   1 
ATOM   7827  C  CA  . PHE D  1 28  ? 26.109 -37.882 -76.382  1.00 14.40 ? 28  PHE D CA  1 
ATOM   7828  C  C   . PHE D  1 28  ? 25.110 -37.711 -75.241  1.00 16.86 ? 28  PHE D C   1 
ATOM   7829  O  O   . PHE D  1 28  ? 24.205 -36.881 -75.330  1.00 12.87 ? 28  PHE D O   1 
ATOM   7830  C  CB  . PHE D  1 28  ? 27.447 -37.185 -76.073  1.00 15.77 ? 28  PHE D CB  1 
ATOM   7831  C  CG  . PHE D  1 28  ? 27.336 -35.694 -75.852  1.00 15.74 ? 28  PHE D CG  1 
ATOM   7832  C  CD1 . PHE D  1 28  ? 26.915 -35.190 -74.630  1.00 16.39 ? 28  PHE D CD1 1 
ATOM   7833  C  CD2 . PHE D  1 28  ? 27.684 -34.797 -76.854  1.00 15.66 ? 28  PHE D CD2 1 
ATOM   7834  C  CE1 . PHE D  1 28  ? 26.817 -33.821 -74.413  1.00 15.74 ? 28  PHE D CE1 1 
ATOM   7835  C  CE2 . PHE D  1 28  ? 27.590 -33.425 -76.644  1.00 14.66 ? 28  PHE D CE2 1 
ATOM   7836  C  CZ  . PHE D  1 28  ? 27.152 -32.936 -75.424  1.00 15.73 ? 28  PHE D CZ  1 
ATOM   7837  N  N   . SER D  1 29  ? 25.257 -38.516 -74.190  1.00 14.98 ? 29  SER D N   1 
ATOM   7838  C  CA  . SER D  1 29  ? 24.459 -38.347 -72.979  1.00 16.50 ? 29  SER D CA  1 
ATOM   7839  C  C   . SER D  1 29  ? 25.015 -37.179 -72.174  1.00 16.87 ? 29  SER D C   1 
ATOM   7840  O  O   . SER D  1 29  ? 26.168 -37.225 -71.734  1.00 13.95 ? 29  SER D O   1 
ATOM   7841  C  CB  . SER D  1 29  ? 24.506 -39.621 -72.123  1.00 18.36 ? 29  SER D CB  1 
ATOM   7842  O  OG  . SER D  1 29  ? 23.897 -40.717 -72.785  1.00 22.07 ? 29  SER D OG  1 
ATOM   7843  N  N   . GLU D  1 30  ? 24.204 -36.143 -71.969  1.00 15.33 ? 30  GLU D N   1 
ATOM   7844  C  CA  . GLU D  1 30  ? 24.671 -34.936 -71.285  1.00 16.00 ? 30  GLU D CA  1 
ATOM   7845  C  C   . GLU D  1 30  ? 25.289 -35.230 -69.925  1.00 15.25 ? 30  GLU D C   1 
ATOM   7846  O  O   . GLU D  1 30  ? 26.344 -34.685 -69.596  1.00 14.62 ? 30  GLU D O   1 
ATOM   7847  C  CB  . GLU D  1 30  ? 23.537 -33.911 -71.101  1.00 16.17 ? 30  GLU D CB  1 
ATOM   7848  C  CG  . GLU D  1 30  ? 23.110 -33.181 -72.368  1.00 18.67 ? 30  GLU D CG  1 
ATOM   7849  C  CD  . GLU D  1 30  ? 21.960 -33.860 -73.088  1.00 20.75 ? 30  GLU D CD  1 
ATOM   7850  O  OE1 . GLU D  1 30  ? 21.769 -35.081 -72.901  1.00 21.11 ? 30  GLU D OE1 1 
ATOM   7851  O  OE2 . GLU D  1 30  ? 21.249 -33.171 -73.854  1.00 19.92 ? 30  GLU D OE2 1 
ATOM   7852  N  N   . ALA D  1 31  ? 24.627 -36.069 -69.127  1.00 12.41 ? 31  ALA D N   1 
ATOM   7853  C  CA  . ALA D  1 31  ? 25.110 -36.322 -67.773  1.00 14.83 ? 31  ALA D CA  1 
ATOM   7854  C  C   . ALA D  1 31  ? 26.433 -37.087 -67.781  1.00 14.32 ? 31  ALA D C   1 
ATOM   7855  O  O   . ALA D  1 31  ? 27.299 -36.851 -66.936  1.00 15.35 ? 31  ALA D O   1 
ATOM   7856  C  CB  . ALA D  1 31  ? 24.058 -37.046 -66.931  1.00 13.43 ? 31  ALA D CB  1 
ATOM   7857  N  N   . VAL D  1 32  ? 26.593 -38.005 -68.731  1.00 13.55 ? 32  VAL D N   1 
ATOM   7858  C  CA  . VAL D  1 32  ? 27.835 -38.784 -68.804  1.00 13.58 ? 32  VAL D CA  1 
ATOM   7859  C  C   . VAL D  1 32  ? 29.021 -37.899 -69.201  1.00 13.85 ? 32  VAL D C   1 
ATOM   7860  O  O   . VAL D  1 32  ? 30.100 -37.974 -68.595  1.00 13.11 ? 32  VAL D O   1 
ATOM   7861  C  CB  . VAL D  1 32  ? 27.717 -39.969 -69.779  1.00 13.47 ? 32  VAL D CB  1 
ATOM   7862  C  CG1 . VAL D  1 32  ? 29.026 -40.755 -69.814  1.00 14.71 ? 32  VAL D CG1 1 
ATOM   7863  C  CG2 . VAL D  1 32  ? 26.562 -40.875 -69.359  1.00 14.06 ? 32  VAL D CG2 1 
ATOM   7864  N  N   . ARG D  1 33  ? 28.819 -37.059 -70.211  1.00 13.42 ? 33  ARG D N   1 
ATOM   7865  C  CA  . ARG D  1 33  ? 29.893 -36.195 -70.703  1.00 15.15 ? 33  ARG D CA  1 
ATOM   7866  C  C   . ARG D  1 33  ? 30.277 -35.153 -69.666  1.00 15.55 ? 33  ARG D C   1 
ATOM   7867  O  O   . ARG D  1 33  ? 31.449 -34.799 -69.535  1.00 13.64 ? 33  ARG D O   1 
ATOM   7868  C  CB  . ARG D  1 33  ? 29.501 -35.494 -72.009  1.00 15.94 ? 33  ARG D CB  1 
ATOM   7869  C  CG  . ARG D  1 33  ? 30.654 -34.698 -72.621  1.00 17.26 ? 33  ARG D CG  1 
ATOM   7870  C  CD  . ARG D  1 33  ? 30.331 -34.128 -73.994  1.00 22.73 ? 33  ARG D CD  1 
ATOM   7871  N  NE  . ARG D  1 33  ? 31.553 -33.718 -74.694  1.00 22.04 ? 33  ARG D NE  1 
ATOM   7872  C  CZ  . ARG D  1 33  ? 31.959 -34.220 -75.857  1.00 28.52 ? 33  ARG D CZ  1 
ATOM   7873  N  NH1 . ARG D  1 33  ? 31.228 -35.141 -76.482  1.00 20.40 ? 33  ARG D NH1 1 
ATOM   7874  N  NH2 . ARG D  1 33  ? 33.089 -33.786 -76.411  1.00 20.47 ? 33  ARG D NH2 1 
ATOM   7875  N  N   . GLN D  1 34  ? 29.285 -34.648 -68.941  1.00 14.69 ? 34  GLN D N   1 
ATOM   7876  C  CA  . GLN D  1 34  ? 29.562 -33.701 -67.876  1.00 16.44 ? 34  GLN D CA  1 
ATOM   7877  C  C   . GLN D  1 34  ? 30.365 -34.358 -66.746  1.00 15.34 ? 34  GLN D C   1 
ATOM   7878  O  O   . GLN D  1 34  ? 31.282 -33.756 -66.189  1.00 13.26 ? 34  GLN D O   1 
ATOM   7879  C  CB  . GLN D  1 34  ? 28.258 -33.098 -67.340  1.00 17.42 ? 34  GLN D CB  1 
ATOM   7880  C  CG  . GLN D  1 34  ? 28.473 -32.172 -66.152  1.00 26.63 ? 34  GLN D CG  1 
ATOM   7881  C  CD  . GLN D  1 34  ? 27.258 -31.311 -65.848  1.00 33.07 ? 34  GLN D CD  1 
ATOM   7882  O  OE1 . GLN D  1 34  ? 27.096 -30.827 -64.728  1.00 50.29 ? 34  GLN D OE1 1 
ATOM   7883  N  NE2 . GLN D  1 34  ? 26.398 -31.128 -66.840  1.00 22.53 ? 34  GLN D NE2 1 
ATOM   7884  N  N   . GLN D  1 35  ? 30.030 -35.598 -66.408  1.00 13.78 ? 35  GLN D N   1 
ATOM   7885  C  CA  . GLN D  1 35  ? 30.665 -36.241 -65.259  1.00 14.54 ? 35  GLN D CA  1 
ATOM   7886  C  C   . GLN D  1 35  ? 31.989 -36.919 -65.596  1.00 13.67 ? 35  GLN D C   1 
ATOM   7887  O  O   . GLN D  1 35  ? 32.870 -37.006 -64.747  1.00 13.57 ? 35  GLN D O   1 
ATOM   7888  C  CB  . GLN D  1 35  ? 29.705 -37.233 -64.588  1.00 13.98 ? 35  GLN D CB  1 
ATOM   7889  C  CG  . GLN D  1 35  ? 28.467 -36.568 -64.014  1.00 13.77 ? 35  GLN D CG  1 
ATOM   7890  C  CD  . GLN D  1 35  ? 28.797 -35.400 -63.100  1.00 15.09 ? 35  GLN D CD  1 
ATOM   7891  O  OE1 . GLN D  1 35  ? 29.864 -35.363 -62.471  1.00 15.34 ? 35  GLN D OE1 1 
ATOM   7892  N  NE2 . GLN D  1 35  ? 27.878 -34.437 -63.017  1.00 13.63 ? 35  GLN D NE2 1 
ATOM   7893  N  N   . TRP D  1 36  ? 32.123 -37.406 -66.827  1.00 13.36 ? 36  TRP D N   1 
ATOM   7894  C  CA  . TRP D  1 36  ? 33.332 -38.129 -67.237  1.00 13.87 ? 36  TRP D CA  1 
ATOM   7895  C  C   . TRP D  1 36  ? 33.843 -37.673 -68.583  1.00 14.41 ? 36  TRP D C   1 
ATOM   7896  O  O   . TRP D  1 36  ? 33.754 -38.403 -69.568  1.00 16.56 ? 36  TRP D O   1 
ATOM   7897  C  CB  . TRP D  1 36  ? 33.088 -39.643 -67.217  1.00 14.13 ? 36  TRP D CB  1 
ATOM   7898  C  CG  . TRP D  1 36  ? 32.769 -40.163 -65.827  1.00 13.53 ? 36  TRP D CG  1 
ATOM   7899  C  CD1 . TRP D  1 36  ? 33.653 -40.345 -64.768  1.00 13.38 ? 36  TRP D CD1 1 
ATOM   7900  C  CD2 . TRP D  1 36  ? 31.454 -40.551 -65.295  1.00 13.24 ? 36  TRP D CD2 1 
ATOM   7901  N  NE1 . TRP D  1 36  ? 32.995 -40.804 -63.653  1.00 13.31 ? 36  TRP D NE1 1 
ATOM   7902  C  CE2 . TRP D  1 36  ? 31.675 -40.950 -63.903  1.00 13.26 ? 36  TRP D CE2 1 
ATOM   7903  C  CE3 . TRP D  1 36  ? 30.165 -40.618 -65.820  1.00 14.09 ? 36  TRP D CE3 1 
ATOM   7904  C  CZ2 . TRP D  1 36  ? 30.640 -41.390 -63.089  1.00 13.94 ? 36  TRP D CZ2 1 
ATOM   7905  C  CZ3 . TRP D  1 36  ? 29.129 -41.060 -64.992  1.00 15.08 ? 36  TRP D CZ3 1 
ATOM   7906  C  CH2 . TRP D  1 36  ? 29.362 -41.441 -63.658  1.00 15.08 ? 36  TRP D CH2 1 
ATOM   7907  N  N   . PRO D  1 37  ? 34.387 -36.446 -68.645  1.00 15.48 ? 37  PRO D N   1 
ATOM   7908  C  CA  . PRO D  1 37  ? 34.910 -35.906 -69.904  1.00 16.26 ? 37  PRO D CA  1 
ATOM   7909  C  C   . PRO D  1 37  ? 36.040 -36.751 -70.502  1.00 18.22 ? 37  PRO D C   1 
ATOM   7910  O  O   . PRO D  1 37  ? 36.279 -36.674 -71.706  1.00 17.52 ? 37  PRO D O   1 
ATOM   7911  C  CB  . PRO D  1 37  ? 35.433 -34.508 -69.513  1.00 17.06 ? 37  PRO D CB  1 
ATOM   7912  C  CG  . PRO D  1 37  ? 35.517 -34.505 -68.020  1.00 18.41 ? 37  PRO D CG  1 
ATOM   7913  C  CD  . PRO D  1 37  ? 34.428 -35.449 -67.563  1.00 17.15 ? 37  PRO D CD  1 
ATOM   7914  N  N   . HIS D  1 38  ? 36.722 -37.549 -69.678  1.00 17.02 ? 38  HIS D N   1 
ATOM   7915  C  CA  . HIS D  1 38  ? 37.828 -38.368 -70.181  1.00 20.27 ? 38  HIS D CA  1 
ATOM   7916  C  C   . HIS D  1 38  ? 37.376 -39.357 -71.223  1.00 20.08 ? 38  HIS D C   1 
ATOM   7917  O  O   . HIS D  1 38  ? 38.189 -39.871 -71.981  1.00 18.56 ? 38  HIS D O   1 
ATOM   7918  C  CB  . HIS D  1 38  ? 38.576 -39.076 -69.048  1.00 19.18 ? 38  HIS D CB  1 
ATOM   7919  C  CG  . HIS D  1 38  ? 37.861 -40.294 -68.499  1.00 21.79 ? 38  HIS D CG  1 
ATOM   7920  N  ND1 . HIS D  1 38  ? 36.928 -40.213 -67.524  1.00 20.04 ? 38  HIS D ND1 1 
ATOM   7921  C  CD2 . HIS D  1 38  ? 37.987 -41.650 -68.811  1.00 22.57 ? 38  HIS D CD2 1 
ATOM   7922  C  CE1 . HIS D  1 38  ? 36.473 -41.450 -67.235  1.00 19.33 ? 38  HIS D CE1 1 
ATOM   7923  N  NE2 . HIS D  1 38  ? 37.121 -42.329 -68.019  1.00 22.11 ? 38  HIS D NE2 1 
ATOM   7924  N  N   . LEU D  1 39  ? 36.072 -39.625 -71.277  1.00 19.54 ? 39  LEU D N   1 
ATOM   7925  C  CA  . LEU D  1 39  ? 35.522 -40.570 -72.249  1.00 19.75 ? 39  LEU D CA  1 
ATOM   7926  C  C   . LEU D  1 39  ? 35.425 -39.991 -73.658  1.00 22.62 ? 39  LEU D C   1 
ATOM   7927  O  O   . LEU D  1 39  ? 35.179 -40.721 -74.616  1.00 24.34 ? 39  LEU D O   1 
ATOM   7928  C  CB  . LEU D  1 39  ? 34.126 -41.028 -71.810  1.00 19.09 ? 39  LEU D CB  1 
ATOM   7929  C  CG  . LEU D  1 39  ? 34.000 -41.777 -70.481  1.00 18.15 ? 39  LEU D CG  1 
ATOM   7930  C  CD1 . LEU D  1 39  ? 32.534 -41.949 -70.112  1.00 16.59 ? 39  LEU D CD1 1 
ATOM   7931  C  CD2 . LEU D  1 39  ? 34.706 -43.125 -70.530  1.00 19.97 ? 39  LEU D CD2 1 
ATOM   7932  N  N   . TYR D  1 40  ? 35.598 -38.681 -73.789  1.00 20.45 ? 40  TYR D N   1 
ATOM   7933  C  CA  . TYR D  1 40  ? 35.245 -38.006 -75.031  1.00 18.32 ? 40  TYR D CA  1 
ATOM   7934  C  C   . TYR D  1 40  ? 36.436 -37.331 -75.681  1.00 22.36 ? 40  TYR D C   1 
ATOM   7935  O  O   . TYR D  1 40  ? 37.352 -36.880 -75.003  1.00 20.46 ? 40  TYR D O   1 
ATOM   7936  C  CB  . TYR D  1 40  ? 34.128 -36.987 -74.774  1.00 17.22 ? 40  TYR D CB  1 
ATOM   7937  C  CG  . TYR D  1 40  ? 32.847 -37.642 -74.309  1.00 17.61 ? 40  TYR D CG  1 
ATOM   7938  C  CD1 . TYR D  1 40  ? 32.620 -37.897 -72.959  1.00 16.62 ? 40  TYR D CD1 1 
ATOM   7939  C  CD2 . TYR D  1 40  ? 31.883 -38.043 -75.222  1.00 15.64 ? 40  TYR D CD2 1 
ATOM   7940  C  CE1 . TYR D  1 40  ? 31.457 -38.520 -72.534  1.00 17.45 ? 40  TYR D CE1 1 
ATOM   7941  C  CE2 . TYR D  1 40  ? 30.713 -38.654 -74.809  1.00 16.33 ? 40  TYR D CE2 1 
ATOM   7942  C  CZ  . TYR D  1 40  ? 30.505 -38.889 -73.466  1.00 18.45 ? 40  TYR D CZ  1 
ATOM   7943  O  OH  . TYR D  1 40  ? 29.344 -39.509 -73.063  1.00 19.21 ? 40  TYR D OH  1 
ATOM   7944  N  N   . ASN D  1 41  ? 36.418 -37.266 -77.005  1.00 22.31 ? 41  ASN D N   1 
ATOM   7945  C  CA  . ASN D  1 41  ? 37.493 -36.616 -77.746  1.00 24.07 ? 41  ASN D CA  1 
ATOM   7946  C  C   . ASN D  1 41  ? 36.895 -35.619 -78.730  1.00 23.37 ? 41  ASN D C   1 
ATOM   7947  O  O   . ASN D  1 41  ? 36.471 -35.986 -79.825  1.00 20.92 ? 41  ASN D O   1 
ATOM   7948  C  CB  . ASN D  1 41  ? 38.343 -37.662 -78.470  1.00 25.66 ? 41  ASN D CB  1 
ATOM   7949  C  CG  . ASN D  1 41  ? 39.517 -37.055 -79.216  1.00 31.35 ? 41  ASN D CG  1 
ATOM   7950  O  OD1 . ASN D  1 41  ? 39.496 -35.886 -79.609  1.00 28.22 ? 41  ASN D OD1 1 
ATOM   7951  N  ND2 . ASN D  1 41  ? 40.550 -37.859 -79.425  1.00 33.71 ? 41  ASN D ND2 1 
ATOM   7952  N  N   . GLU D  1 42  ? 36.838 -34.358 -78.327  1.00 23.62 ? 42  GLU D N   1 
ATOM   7953  C  CA  . GLU D  1 42  ? 36.202 -33.344 -79.153  1.00 31.33 ? 42  GLU D CA  1 
ATOM   7954  C  C   . GLU D  1 42  ? 36.890 -33.113 -80.507  1.00 25.71 ? 42  GLU D C   1 
ATOM   7955  O  O   . GLU D  1 42  ? 36.240 -32.722 -81.475  1.00 24.19 ? 42  GLU D O   1 
ATOM   7956  C  CB  . GLU D  1 42  ? 36.084 -32.023 -78.391  1.00 34.99 ? 42  GLU D CB  1 
ATOM   7957  C  CG  . GLU D  1 42  ? 34.991 -31.131 -78.948  1.00 49.73 ? 42  GLU D CG  1 
ATOM   7958  C  CD  . GLU D  1 42  ? 35.093 -29.706 -78.459  1.00 58.56 ? 42  GLU D CD  1 
ATOM   7959  O  OE1 . GLU D  1 42  ? 34.331 -28.856 -78.965  1.00 60.83 ? 42  GLU D OE1 1 
ATOM   7960  O  OE2 . GLU D  1 42  ? 35.936 -29.441 -77.576  1.00 70.32 ? 42  GLU D OE2 1 
ATOM   7961  N  N   . ASP D  1 43  ? 38.198 -33.347 -80.574  1.00 26.74 ? 43  ASP D N   1 
ATOM   7962  C  CA  . ASP D  1 43  ? 38.939 -33.170 -81.825  1.00 27.98 ? 43  ASP D CA  1 
ATOM   7963  C  C   . ASP D  1 43  ? 38.491 -34.196 -82.847  1.00 24.38 ? 43  ASP D C   1 
ATOM   7964  O  O   . ASP D  1 43  ? 38.311 -33.877 -84.020  1.00 26.88 ? 43  ASP D O   1 
ATOM   7965  C  CB  . ASP D  1 43  ? 40.448 -33.313 -81.598  1.00 30.47 ? 43  ASP D CB  1 
ATOM   7966  C  CG  . ASP D  1 43  ? 41.022 -32.187 -80.769  1.00 41.56 ? 43  ASP D CG  1 
ATOM   7967  O  OD1 . ASP D  1 43  ? 40.374 -31.122 -80.681  1.00 47.52 ? 43  ASP D OD1 1 
ATOM   7968  O  OD2 . ASP D  1 43  ? 42.125 -32.368 -80.206  1.00 46.42 ? 43  ASP D OD2 1 
ATOM   7969  N  N   . GLU D  1 44  ? 38.334 -35.438 -82.404  1.00 23.80 ? 44  GLU D N   1 
ATOM   7970  C  CA  . GLU D  1 44  ? 37.840 -36.495 -83.276  1.00 26.44 ? 44  GLU D CA  1 
ATOM   7971  C  C   . GLU D  1 44  ? 36.400 -36.219 -83.673  1.00 22.32 ? 44  GLU D C   1 
ATOM   7972  O  O   . GLU D  1 44  ? 36.020 -36.419 -84.822  1.00 20.59 ? 44  GLU D O   1 
ATOM   7973  C  CB  . GLU D  1 44  ? 37.916 -37.853 -82.585  1.00 28.49 ? 44  GLU D CB  1 
ATOM   7974  C  CG  . GLU D  1 44  ? 39.324 -38.328 -82.289  1.00 42.57 ? 44  GLU D CG  1 
ATOM   7975  C  CD  . GLU D  1 44  ? 39.333 -39.704 -81.654  1.00 59.18 ? 44  GLU D CD  1 
ATOM   7976  O  OE1 . GLU D  1 44  ? 40.427 -40.294 -81.513  1.00 73.82 ? 44  GLU D OE1 1 
ATOM   7977  O  OE2 . GLU D  1 44  ? 38.237 -40.194 -81.302  1.00 58.16 ? 44  GLU D OE2 1 
ATOM   7978  N  N   . GLU D  1 45  ? 35.595 -35.776 -82.711  1.00 19.09 ? 45  GLU D N   1 
ATOM   7979  C  CA  . GLU D  1 45  ? 34.194 -35.468 -82.987  1.00 17.84 ? 45  GLU D CA  1 
ATOM   7980  C  C   . GLU D  1 45  ? 34.077 -34.406 -84.072  1.00 17.62 ? 45  GLU D C   1 
ATOM   7981  O  O   . GLU D  1 45  ? 33.309 -34.556 -85.019  1.00 16.92 ? 45  GLU D O   1 
ATOM   7982  C  CB  . GLU D  1 45  ? 33.488 -35.009 -81.714  1.00 18.21 ? 45  GLU D CB  1 
ATOM   7983  C  CG  . GLU D  1 45  ? 33.293 -36.136 -80.717  1.00 19.50 ? 45  GLU D CG  1 
ATOM   7984  C  CD  . GLU D  1 45  ? 32.994 -35.637 -79.317  1.00 22.28 ? 45  GLU D CD  1 
ATOM   7985  O  OE1 . GLU D  1 45  ? 33.097 -34.418 -79.069  1.00 23.29 ? 45  GLU D OE1 1 
ATOM   7986  O  OE2 . GLU D  1 45  ? 32.671 -36.474 -78.456  1.00 26.03 ? 45  GLU D OE2 1 
ATOM   7987  N  N   . PHE D  1 46  ? 34.850 -33.336 -83.928  1.00 17.42 ? 46  PHE D N   1 
ATOM   7988  C  CA  . PHE D  1 46  ? 34.833 -32.247 -84.894  1.00 19.73 ? 46  PHE D CA  1 
ATOM   7989  C  C   . PHE D  1 46  ? 35.312 -32.740 -86.261  1.00 23.59 ? 46  PHE D C   1 
ATOM   7990  O  O   . PHE D  1 46  ? 34.701 -32.445 -87.289  1.00 21.04 ? 46  PHE D O   1 
ATOM   7991  C  CB  . PHE D  1 46  ? 35.702 -31.091 -84.389  1.00 21.38 ? 46  PHE D CB  1 
ATOM   7992  C  CG  . PHE D  1 46  ? 35.758 -29.915 -85.325  1.00 24.80 ? 46  PHE D CG  1 
ATOM   7993  C  CD1 . PHE D  1 46  ? 36.917 -29.631 -86.030  1.00 24.22 ? 46  PHE D CD1 1 
ATOM   7994  C  CD2 . PHE D  1 46  ? 34.650 -29.096 -85.501  1.00 25.43 ? 46  PHE D CD2 1 
ATOM   7995  C  CE1 . PHE D  1 46  ? 36.975 -28.550 -86.891  1.00 28.96 ? 46  PHE D CE1 1 
ATOM   7996  C  CE2 . PHE D  1 46  ? 34.699 -28.016 -86.366  1.00 24.76 ? 46  PHE D CE2 1 
ATOM   7997  C  CZ  . PHE D  1 46  ? 35.863 -27.742 -87.062  1.00 24.26 ? 46  PHE D CZ  1 
ATOM   7998  N  N   . ARG D  1 47  ? 36.405 -33.497 -86.269  1.00 22.23 ? 47  ARG D N   1 
ATOM   7999  C  CA  . ARG D  1 47  ? 36.945 -34.060 -87.507  1.00 25.57 ? 47  ARG D CA  1 
ATOM   8000  C  C   . ARG D  1 47  ? 35.934 -34.948 -88.244  1.00 24.70 ? 47  ARG D C   1 
ATOM   8001  O  O   . ARG D  1 47  ? 35.728 -34.801 -89.452  1.00 27.83 ? 47  ARG D O   1 
ATOM   8002  C  CB  . ARG D  1 47  ? 38.228 -34.844 -87.222  1.00 28.06 ? 47  ARG D CB  1 
ATOM   8003  C  CG  . ARG D  1 47  ? 38.774 -35.599 -88.425  1.00 42.31 ? 47  ARG D CG  1 
ATOM   8004  C  CD  . ARG D  1 47  ? 40.159 -36.181 -88.164  1.00 46.10 ? 47  ARG D CD  1 
ATOM   8005  N  NE  . ARG D  1 47  ? 40.156 -37.197 -87.114  1.00 50.79 ? 47  ARG D NE  1 
ATOM   8006  C  CZ  . ARG D  1 47  ? 40.719 -37.046 -85.919  1.00 59.38 ? 47  ARG D CZ  1 
ATOM   8007  N  NH1 . ARG D  1 47  ? 41.345 -35.915 -85.611  1.00 63.72 ? 47  ARG D NH1 1 
ATOM   8008  N  NH2 . ARG D  1 47  ? 40.662 -38.030 -85.029  1.00 50.71 ? 47  ARG D NH2 1 
ATOM   8009  N  N   . ASN D  1 48  ? 35.316 -35.876 -87.523  1.00 21.67 ? 48  ASN D N   1 
ATOM   8010  C  CA  . ASN D  1 48  ? 34.306 -36.745 -88.115  1.00 24.74 ? 48  ASN D CA  1 
ATOM   8011  C  C   . ASN D  1 48  ? 33.146 -35.953 -88.702  1.00 22.44 ? 48  ASN D C   1 
ATOM   8012  O  O   . ASN D  1 48  ? 32.702 -36.223 -89.815  1.00 23.53 ? 48  ASN D O   1 
ATOM   8013  C  CB  . ASN D  1 48  ? 33.766 -37.735 -87.080  1.00 26.27 ? 48  ASN D CB  1 
ATOM   8014  C  CG  . ASN D  1 48  ? 34.764 -38.819 -86.731  1.00 30.29 ? 48  ASN D CG  1 
ATOM   8015  O  OD1 . ASN D  1 48  ? 35.810 -38.947 -87.362  1.00 30.87 ? 48  ASN D OD1 1 
ATOM   8016  N  ND2 . ASN D  1 48  ? 34.436 -39.615 -85.723  1.00 35.73 ? 48  ASN D ND2 1 
ATOM   8017  N  N   . ALA D  1 49  ? 32.651 -34.979 -87.944  1.00 20.18 ? 49  ALA D N   1 
ATOM   8018  C  CA  . ALA D  1 49  ? 31.495 -34.196 -88.373  1.00 21.02 ? 49  ALA D CA  1 
ATOM   8019  C  C   . ALA D  1 49  ? 31.816 -33.417 -89.642  1.00 20.79 ? 49  ALA D C   1 
ATOM   8020  O  O   . ALA D  1 49  ? 31.042 -33.411 -90.596  1.00 19.29 ? 49  ALA D O   1 
ATOM   8021  C  CB  . ALA D  1 49  ? 31.042 -33.249 -87.268  1.00 17.02 ? 49  ALA D CB  1 
ATOM   8022  N  N   . VAL D  1 50  ? 32.965 -32.757 -89.648  1.00 20.51 ? 50  VAL D N   1 
ATOM   8023  C  CA  . VAL D  1 50  ? 33.345 -31.953 -90.793  1.00 21.21 ? 50  VAL D CA  1 
ATOM   8024  C  C   . VAL D  1 50  ? 33.556 -32.814 -92.033  1.00 20.62 ? 50  VAL D C   1 
ATOM   8025  O  O   . VAL D  1 50  ? 33.113 -32.454 -93.124  1.00 20.72 ? 50  VAL D O   1 
ATOM   8026  C  CB  . VAL D  1 50  ? 34.601 -31.121 -90.505  1.00 20.41 ? 50  VAL D CB  1 
ATOM   8027  C  CG1 . VAL D  1 50  ? 35.111 -30.485 -91.787  1.00 23.84 ? 50  VAL D CG1 1 
ATOM   8028  C  CG2 . VAL D  1 50  ? 34.283 -30.060 -89.462  1.00 22.18 ? 50  VAL D CG2 1 
ATOM   8029  N  N   . ASN D  1 51  ? 34.219 -33.956 -91.860  1.00 21.99 ? 51  ASN D N   1 
ATOM   8030  C  CA  . ASN D  1 51  ? 34.471 -34.867 -92.976  1.00 25.34 ? 51  ASN D CA  1 
ATOM   8031  C  C   . ASN D  1 51  ? 33.187 -35.411 -93.584  1.00 24.93 ? 51  ASN D C   1 
ATOM   8032  O  O   . ASN D  1 51  ? 33.050 -35.475 -94.806  1.00 19.74 ? 51  ASN D O   1 
ATOM   8033  C  CB  . ASN D  1 51  ? 35.371 -36.032 -92.555  1.00 27.38 ? 51  ASN D CB  1 
ATOM   8034  C  CG  . ASN D  1 51  ? 36.816 -35.620 -92.391  1.00 34.47 ? 51  ASN D CG  1 
ATOM   8035  O  OD1 . ASN D  1 51  ? 37.241 -34.594 -92.919  1.00 36.64 ? 51  ASN D OD1 1 
ATOM   8036  N  ND2 . ASN D  1 51  ? 37.585 -36.419 -91.654  1.00 41.20 ? 51  ASN D ND2 1 
ATOM   8037  N  N   . GLU D  1 52  ? 32.251 -35.816 -92.734  1.00 20.21 ? 52  GLU D N   1 
ATOM   8038  C  CA  . GLU D  1 52  ? 30.993 -36.354 -93.225  1.00 21.09 ? 52  GLU D CA  1 
ATOM   8039  C  C   . GLU D  1 52  ? 30.190 -35.262 -93.938  1.00 21.85 ? 52  GLU D C   1 
ATOM   8040  O  O   . GLU D  1 52  ? 29.660 -35.486 -95.029  1.00 20.47 ? 52  GLU D O   1 
ATOM   8041  C  CB  . GLU D  1 52  ? 30.178 -36.979 -92.084  1.00 22.26 ? 52  GLU D CB  1 
ATOM   8042  C  CG  . GLU D  1 52  ? 30.772 -38.265 -91.523  1.00 24.52 ? 52  GLU D CG  1 
ATOM   8043  C  CD  . GLU D  1 52  ? 30.722 -39.420 -92.512  1.00 26.86 ? 52  GLU D CD  1 
ATOM   8044  O  OE1 . GLU D  1 52  ? 31.792 -39.969 -92.831  1.00 30.60 ? 52  GLU D OE1 1 
ATOM   8045  O  OE2 . GLU D  1 52  ? 29.620 -39.774 -92.983  1.00 21.81 ? 52  GLU D OE2 1 
ATOM   8046  N  N   . VAL D  1 53  ? 30.107 -34.085 -93.324  1.00 17.30 ? 53  VAL D N   1 
ATOM   8047  C  CA  . VAL D  1 53  ? 29.378 -32.976 -93.925  1.00 17.20 ? 53  VAL D CA  1 
ATOM   8048  C  C   . VAL D  1 53  ? 29.973 -32.596 -95.280  1.00 18.04 ? 53  VAL D C   1 
ATOM   8049  O  O   . VAL D  1 53  ? 29.242 -32.373 -96.245  1.00 16.95 ? 53  VAL D O   1 
ATOM   8050  C  CB  . VAL D  1 53  ? 29.331 -31.740 -93.001  1.00 15.47 ? 53  VAL D CB  1 
ATOM   8051  C  CG1 . VAL D  1 53  ? 28.802 -30.531 -93.762  1.00 15.01 ? 53  VAL D CG1 1 
ATOM   8052  C  CG2 . VAL D  1 53  ? 28.476 -32.021 -91.769  1.00 15.18 ? 53  VAL D CG2 1 
ATOM   8053  N  N   . LYS D  1 54  ? 31.297 -32.534 -95.359  1.00 18.98 ? 54  LYS D N   1 
ATOM   8054  C  CA  . LYS D  1 54  ? 31.953 -32.202 -96.627  1.00 22.23 ? 54  LYS D CA  1 
ATOM   8055  C  C   . LYS D  1 54  ? 31.651 -33.220 -97.725  1.00 22.86 ? 54  LYS D C   1 
ATOM   8056  O  O   . LYS D  1 54  ? 31.441 -32.852 -98.881  1.00 21.28 ? 54  LYS D O   1 
ATOM   8057  C  CB  . LYS D  1 54  ? 33.462 -32.060 -96.448  1.00 21.99 ? 54  LYS D CB  1 
ATOM   8058  C  CG  . LYS D  1 54  ? 33.866 -30.798 -95.702  1.00 26.83 ? 54  LYS D CG  1 
ATOM   8059  C  CD  . LYS D  1 54  ? 35.376 -30.630 -95.715  1.00 27.45 ? 54  LYS D CD  1 
ATOM   8060  C  CE  . LYS D  1 54  ? 35.762 -29.225 -95.296  1.00 32.06 ? 54  LYS D CE  1 
ATOM   8061  N  NZ  . LYS D  1 54  ? 37.237 -29.018 -95.337  1.00 38.92 ? 54  LYS D NZ  1 
ATOM   8062  N  N   . ARG D  1 55  ? 31.638 -34.500 -97.370  1.00 19.94 ? 55  ARG D N   1 
ATOM   8063  C  CA  . ARG D  1 55  ? 31.319 -35.530 -98.357  1.00 23.38 ? 55  ARG D CA  1 
ATOM   8064  C  C   . ARG D  1 55  ? 29.854 -35.429 -98.799  1.00 21.30 ? 55  ARG D C   1 
ATOM   8065  O  O   . ARG D  1 55  ? 29.530 -35.648 -99.969  1.00 21.64 ? 55  ARG D O   1 
ATOM   8066  C  CB  . ARG D  1 55  ? 31.649 -36.934 -97.834  1.00 22.04 ? 55  ARG D CB  1 
ATOM   8067  C  CG  . ARG D  1 55  ? 31.735 -37.982 -98.941  1.00 27.21 ? 55  ARG D CG  1 
ATOM   8068  C  CD  . ARG D  1 55  ? 32.222 -39.331 -98.429  1.00 29.74 ? 55  ARG D CD  1 
ATOM   8069  N  NE  . ARG D  1 55  ? 31.201 -40.009 -97.633  1.00 26.24 ? 55  ARG D NE  1 
ATOM   8070  C  CZ  . ARG D  1 55  ? 31.167 -40.013 -96.305  1.00 30.28 ? 55  ARG D CZ  1 
ATOM   8071  N  NH1 . ARG D  1 55  ? 30.187 -40.651 -95.666  1.00 26.55 ? 55  ARG D NH1 1 
ATOM   8072  N  NH2 . ARG D  1 55  ? 32.110 -39.378 -95.616  1.00 24.84 ? 55  ARG D NH2 1 
ATOM   8073  N  N   . ALA D  1 56  ? 28.970 -35.078 -97.871  1.00 19.52 ? 56  ALA D N   1 
ATOM   8074  C  CA  . ALA D  1 56  ? 27.567 -34.864 -98.224  1.00 19.77 ? 56  ALA D CA  1 
ATOM   8075  C  C   . ALA D  1 56  ? 27.438 -33.719 -99.226  1.00 18.14 ? 56  ALA D C   1 
ATOM   8076  O  O   . ALA D  1 56  ? 26.709 -33.826 -100.215 1.00 16.96 ? 56  ALA D O   1 
ATOM   8077  C  CB  . ALA D  1 56  ? 26.730 -34.589 -96.985  1.00 20.75 ? 56  ALA D CB  1 
ATOM   8078  N  N   . MET D  1 57  ? 28.156 -32.629 -98.972  1.00 17.10 ? 57  MET D N   1 
ATOM   8079  C  CA  . MET D  1 57  ? 28.117 -31.469 -99.863  1.00 18.38 ? 57  MET D CA  1 
ATOM   8080  C  C   . MET D  1 57  ? 28.668 -31.807 -101.253 1.00 18.70 ? 57  MET D C   1 
ATOM   8081  O  O   . MET D  1 57  ? 28.163 -31.319 -102.258 1.00 20.46 ? 57  MET D O   1 
ATOM   8082  C  CB  . MET D  1 57  ? 28.856 -30.273 -99.243  1.00 18.42 ? 57  MET D CB  1 
ATOM   8083  C  CG  . MET D  1 57  ? 28.164 -29.724 -97.996  1.00 18.08 ? 57  MET D CG  1 
ATOM   8084  S  SD  . MET D  1 57  ? 29.087 -28.433 -97.144  1.00 21.29 ? 57  MET D SD  1 
ATOM   8085  C  CE  . MET D  1 57  ? 28.864 -27.062 -98.284  1.00 21.45 ? 57  MET D CE  1 
ATOM   8086  N  N   . GLN D  1 58  ? 29.689 -32.656 -101.304 1.00 19.25 ? 58  GLN D N   1 
ATOM   8087  C  CA  . GLN D  1 58  ? 30.222 -33.124 -102.580 1.00 22.72 ? 58  GLN D CA  1 
ATOM   8088  C  C   . GLN D  1 58  ? 29.156 -33.849 -103.388 1.00 20.93 ? 58  GLN D C   1 
ATOM   8089  O  O   . GLN D  1 58  ? 29.189 -33.841 -104.618 1.00 21.56 ? 58  GLN D O   1 
ATOM   8090  C  CB  . GLN D  1 58  ? 31.420 -34.047 -102.363 1.00 25.82 ? 58  GLN D CB  1 
ATOM   8091  C  CG  . GLN D  1 58  ? 32.707 -33.311 -102.037 1.00 30.03 ? 58  GLN D CG  1 
ATOM   8092  C  CD  . GLN D  1 58  ? 33.861 -34.254 -101.778 1.00 44.12 ? 58  GLN D CD  1 
ATOM   8093  O  OE1 . GLN D  1 58  ? 35.017 -33.919 -102.033 1.00 53.98 ? 58  GLN D OE1 1 
ATOM   8094  N  NE2 . GLN D  1 58  ? 33.554 -35.446 -101.274 1.00 38.13 ? 58  GLN D NE2 1 
ATOM   8095  N  N   . PHE D  1 59  ? 28.216 -34.484 -102.699 1.00 18.92 ? 59  PHE D N   1 
ATOM   8096  C  CA  . PHE D  1 59  ? 27.125 -35.189 -103.372 1.00 20.59 ? 59  PHE D CA  1 
ATOM   8097  C  C   . PHE D  1 59  ? 25.952 -34.263 -103.709 1.00 22.00 ? 59  PHE D C   1 
ATOM   8098  O  O   . PHE D  1 59  ? 24.966 -34.698 -104.295 1.00 19.66 ? 59  PHE D O   1 
ATOM   8099  C  CB  . PHE D  1 59  ? 26.644 -36.396 -102.546 1.00 20.54 ? 59  PHE D CB  1 
ATOM   8100  C  CG  . PHE D  1 59  ? 27.409 -37.667 -102.819 1.00 22.22 ? 59  PHE D CG  1 
ATOM   8101  C  CD1 . PHE D  1 59  ? 27.345 -38.278 -104.065 1.00 23.12 ? 59  PHE D CD1 1 
ATOM   8102  C  CD2 . PHE D  1 59  ? 28.182 -38.257 -101.831 1.00 23.58 ? 59  PHE D CD2 1 
ATOM   8103  C  CE1 . PHE D  1 59  ? 28.048 -39.444 -104.323 1.00 24.34 ? 59  PHE D CE1 1 
ATOM   8104  C  CE2 . PHE D  1 59  ? 28.889 -39.424 -102.084 1.00 27.14 ? 59  PHE D CE2 1 
ATOM   8105  C  CZ  . PHE D  1 59  ? 28.820 -40.019 -103.331 1.00 23.44 ? 59  PHE D CZ  1 
ATOM   8106  N  N   . GLY D  1 60  ? 26.071 -32.980 -103.367 1.00 18.82 ? 60  GLY D N   1 
ATOM   8107  C  CA  . GLY D  1 60  ? 25.018 -32.009 -103.680 1.00 17.54 ? 60  GLY D CA  1 
ATOM   8108  C  C   . GLY D  1 60  ? 24.106 -31.619 -102.520 1.00 16.51 ? 60  GLY D C   1 
ATOM   8109  O  O   . GLY D  1 60  ? 23.137 -30.887 -102.710 1.00 19.33 ? 60  GLY D O   1 
ATOM   8110  N  N   . VAL D  1 61  ? 24.395 -32.091 -101.312 1.00 15.96 ? 61  VAL D N   1 
ATOM   8111  C  CA  . VAL D  1 61  ? 23.560 -31.711 -100.169 1.00 15.75 ? 61  VAL D CA  1 
ATOM   8112  C  C   . VAL D  1 61  ? 23.794 -30.249 -99.792  1.00 16.44 ? 61  VAL D C   1 
ATOM   8113  O  O   . VAL D  1 61  ? 24.935 -29.833 -99.593  1.00 18.42 ? 61  VAL D O   1 
ATOM   8114  C  CB  . VAL D  1 61  ? 23.819 -32.594 -98.936  1.00 15.16 ? 61  VAL D CB  1 
ATOM   8115  C  CG1 . VAL D  1 61  ? 23.051 -32.053 -97.733  1.00 13.63 ? 61  VAL D CG1 1 
ATOM   8116  C  CG2 . VAL D  1 61  ? 23.420 -34.037 -99.220  1.00 13.67 ? 61  VAL D CG2 1 
ATOM   8117  N  N   . LYS D  1 62  ? 22.715 -29.474 -99.698  1.00 15.75 ? 62  LYS D N   1 
ATOM   8118  C  CA  . LYS D  1 62  ? 22.819 -28.051 -99.365  1.00 17.37 ? 62  LYS D CA  1 
ATOM   8119  C  C   . LYS D  1 62  ? 22.471 -27.805 -97.907  1.00 14.82 ? 62  LYS D C   1 
ATOM   8120  O  O   . LYS D  1 62  ? 23.050 -26.928 -97.262  1.00 14.70 ? 62  LYS D O   1 
ATOM   8121  C  CB  . LYS D  1 62  ? 21.891 -27.198 -100.250 1.00 15.91 ? 62  LYS D CB  1 
ATOM   8122  C  CG  . LYS D  1 62  ? 22.077 -27.406 -101.746 1.00 18.18 ? 62  LYS D CG  1 
ATOM   8123  C  CD  . LYS D  1 62  ? 23.529 -27.221 -102.158 1.00 20.19 ? 62  LYS D CD  1 
ATOM   8124  C  CE  . LYS D  1 62  ? 23.706 -27.422 -103.655 1.00 24.20 ? 62  LYS D CE  1 
ATOM   8125  N  NZ  . LYS D  1 62  ? 22.796 -26.526 -104.417 1.00 28.01 ? 62  LYS D NZ  1 
ATOM   8126  N  N   . THR D  1 63  ? 21.513 -28.574 -97.397  1.00 13.03 ? 63  THR D N   1 
ATOM   8127  C  CA  . THR D  1 63  ? 20.971 -28.340 -96.065  1.00 13.84 ? 63  THR D CA  1 
ATOM   8128  C  C   . THR D  1 63  ? 20.893 -29.638 -95.280  1.00 14.52 ? 63  THR D C   1 
ATOM   8129  O  O   . THR D  1 63  ? 20.512 -30.678 -95.821  1.00 15.48 ? 63  THR D O   1 
ATOM   8130  C  CB  . THR D  1 63  ? 19.556 -27.727 -96.132  1.00 13.42 ? 63  THR D CB  1 
ATOM   8131  O  OG1 . THR D  1 63  ? 19.589 -26.500 -96.878  1.00 12.66 ? 63  THR D OG1 1 
ATOM   8132  C  CG2 . THR D  1 63  ? 19.018 -27.452 -94.724  1.00 14.73 ? 63  THR D CG2 1 
ATOM   8133  N  N   . ILE D  1 64  ? 21.276 -29.573 -94.009  1.00 14.93 ? 64  ILE D N   1 
ATOM   8134  C  CA  . ILE D  1 64  ? 21.131 -30.706 -93.105  1.00 14.45 ? 64  ILE D CA  1 
ATOM   8135  C  C   . ILE D  1 64  ? 20.301 -30.280 -91.906  1.00 14.45 ? 64  ILE D C   1 
ATOM   8136  O  O   . ILE D  1 64  ? 20.566 -29.246 -91.291  1.00 14.89 ? 64  ILE D O   1 
ATOM   8137  C  CB  . ILE D  1 64  ? 22.499 -31.235 -92.638  1.00 15.28 ? 64  ILE D CB  1 
ATOM   8138  C  CG1 . ILE D  1 64  ? 23.266 -31.807 -93.834  1.00 14.33 ? 64  ILE D CG1 1 
ATOM   8139  C  CG2 . ILE D  1 64  ? 22.324 -32.295 -91.561  1.00 13.03 ? 64  ILE D CG2 1 
ATOM   8140  C  CD1 . ILE D  1 64  ? 24.670 -32.264 -93.496  1.00 17.39 ? 64  ILE D CD1 1 
ATOM   8141  N  N   . VAL D  1 65  ? 19.277 -31.068 -91.599  1.00 13.29 ? 65  VAL D N   1 
ATOM   8142  C  CA  . VAL D  1 65  ? 18.440 -30.824 -90.431  1.00 14.09 ? 65  VAL D CA  1 
ATOM   8143  C  C   . VAL D  1 65  ? 18.898 -31.792 -89.342  1.00 13.82 ? 65  VAL D C   1 
ATOM   8144  O  O   . VAL D  1 65  ? 18.881 -33.003 -89.530  1.00 13.64 ? 65  VAL D O   1 
ATOM   8145  C  CB  . VAL D  1 65  ? 16.948 -31.025 -90.774  1.00 15.63 ? 65  VAL D CB  1 
ATOM   8146  C  CG1 . VAL D  1 65  ? 16.048 -30.772 -89.568  1.00 16.09 ? 65  VAL D CG1 1 
ATOM   8147  C  CG2 . VAL D  1 65  ? 16.551 -30.117 -91.932  1.00 13.51 ? 65  VAL D CG2 1 
ATOM   8148  N  N   . ASP D  1 66  ? 19.325 -31.245 -88.209  1.00 12.86 ? 66  ASP D N   1 
ATOM   8149  C  CA  . ASP D  1 66  ? 19.933 -32.036 -87.150  1.00 13.94 ? 66  ASP D CA  1 
ATOM   8150  C  C   . ASP D  1 66  ? 19.026 -32.042 -85.922  1.00 13.78 ? 66  ASP D C   1 
ATOM   8151  O  O   . ASP D  1 66  ? 18.980 -31.063 -85.191  1.00 14.71 ? 66  ASP D O   1 
ATOM   8152  C  CB  . ASP D  1 66  ? 21.291 -31.422 -86.800  1.00 13.66 ? 66  ASP D CB  1 
ATOM   8153  C  CG  . ASP D  1 66  ? 22.033 -32.204 -85.732  1.00 19.78 ? 66  ASP D CG  1 
ATOM   8154  O  OD1 . ASP D  1 66  ? 21.382 -32.891 -84.917  1.00 19.44 ? 66  ASP D OD1 1 
ATOM   8155  O  OD2 . ASP D  1 66  ? 23.277 -32.125 -85.710  1.00 21.84 ? 66  ASP D OD2 1 
ATOM   8156  N  N   . PRO D  1 67  ? 18.278 -33.141 -85.705  1.00 14.76 ? 67  PRO D N   1 
ATOM   8157  C  CA  . PRO D  1 67  ? 17.356 -33.199 -84.566  1.00 14.63 ? 67  PRO D CA  1 
ATOM   8158  C  C   . PRO D  1 67  ? 18.005 -33.566 -83.215  1.00 14.63 ? 67  PRO D C   1 
ATOM   8159  O  O   . PRO D  1 67  ? 17.373 -34.208 -82.377  1.00 12.98 ? 67  PRO D O   1 
ATOM   8160  C  CB  . PRO D  1 67  ? 16.330 -34.257 -84.994  1.00 15.40 ? 67  PRO D CB  1 
ATOM   8161  C  CG  . PRO D  1 67  ? 17.046 -35.124 -85.979  1.00 18.06 ? 67  PRO D CG  1 
ATOM   8162  C  CD  . PRO D  1 67  ? 18.163 -34.317 -86.587  1.00 16.15 ? 67  PRO D CD  1 
ATOM   8163  N  N   . THR D  1 68  ? 19.243 -33.142 -82.992  1.00 12.65 ? 68  THR D N   1 
ATOM   8164  C  CA  . THR D  1 68  ? 19.878 -33.375 -81.703  1.00 13.08 ? 68  THR D CA  1 
ATOM   8165  C  C   . THR D  1 68  ? 19.333 -32.353 -80.710  1.00 13.23 ? 68  THR D C   1 
ATOM   8166  O  O   . THR D  1 68  ? 19.563 -31.160 -80.873  1.00 14.66 ? 68  THR D O   1 
ATOM   8167  C  CB  . THR D  1 68  ? 21.406 -33.208 -81.799  1.00 13.09 ? 68  THR D CB  1 
ATOM   8168  O  OG1 . THR D  1 68  ? 21.912 -34.034 -82.851  1.00 15.18 ? 68  THR D OG1 1 
ATOM   8169  C  CG2 . THR D  1 68  ? 22.092 -33.593 -80.482  1.00 12.15 ? 68  THR D CG2 1 
ATOM   8170  N  N   . VAL D  1 69  ? 18.626 -32.824 -79.684  1.00 12.35 ? 69  VAL D N   1 
ATOM   8171  C  CA  . VAL D  1 69  ? 18.018 -31.937 -78.698  1.00 12.58 ? 69  VAL D CA  1 
ATOM   8172  C  C   . VAL D  1 69  ? 18.355 -32.427 -77.290  1.00 15.01 ? 69  VAL D C   1 
ATOM   8173  O  O   . VAL D  1 69  ? 19.226 -33.287 -77.132  1.00 10.95 ? 69  VAL D O   1 
ATOM   8174  C  CB  . VAL D  1 69  ? 16.488 -31.813 -78.904  1.00 12.84 ? 69  VAL D CB  1 
ATOM   8175  C  CG1 . VAL D  1 69  ? 16.189 -31.217 -80.283  1.00 10.97 ? 69  VAL D CG1 1 
ATOM   8176  C  CG2 . VAL D  1 69  ? 15.803 -33.164 -78.729  1.00 13.24 ? 69  VAL D CG2 1 
ATOM   8177  N  N   . MET D  1 70  ? 17.689 -31.881 -76.271  1.00 13.36 ? 70  MET D N   1 
ATOM   8178  C  CA  . MET D  1 70  ? 17.930 -32.328 -74.892  1.00 13.19 ? 70  MET D CA  1 
ATOM   8179  C  C   . MET D  1 70  ? 17.796 -33.838 -74.816  1.00 14.84 ? 70  MET D C   1 
ATOM   8180  O  O   . MET D  1 70  ? 16.789 -34.399 -75.257  1.00 14.22 ? 70  MET D O   1 
ATOM   8181  C  CB  . MET D  1 70  ? 16.944 -31.690 -73.899  1.00 15.72 ? 70  MET D CB  1 
ATOM   8182  C  CG  . MET D  1 70  ? 17.386 -31.777 -72.437  1.00 14.65 ? 70  MET D CG  1 
ATOM   8183  S  SD  . MET D  1 70  ? 16.111 -32.371 -71.297  1.00 16.84 ? 70  MET D SD  1 
ATOM   8184  C  CE  . MET D  1 70  ? 16.144 -34.129 -71.652  1.00 18.85 ? 70  MET D CE  1 
ATOM   8185  N  N   . GLY D  1 71  ? 18.798 -34.495 -74.238  1.00 13.36 ? 71  GLY D N   1 
ATOM   8186  C  CA  . GLY D  1 71  ? 18.784 -35.945 -74.117  1.00 14.14 ? 71  GLY D CA  1 
ATOM   8187  C  C   . GLY D  1 71  ? 19.702 -36.595 -75.133  1.00 16.00 ? 71  GLY D C   1 
ATOM   8188  O  O   . GLY D  1 71  ? 20.059 -37.771 -74.999  1.00 15.98 ? 71  GLY D O   1 
ATOM   8189  N  N   . LEU D  1 72  ? 20.096 -35.819 -76.142  1.00 14.61 ? 72  LEU D N   1 
ATOM   8190  C  CA  . LEU D  1 72  ? 20.993 -36.295 -77.196  1.00 12.95 ? 72  LEU D CA  1 
ATOM   8191  C  C   . LEU D  1 72  ? 22.272 -35.477 -77.283  1.00 11.34 ? 72  LEU D C   1 
ATOM   8192  O  O   . LEU D  1 72  ? 23.134 -35.749 -78.123  1.00 14.28 ? 72  LEU D O   1 
ATOM   8193  C  CB  . LEU D  1 72  ? 20.286 -36.254 -78.560  1.00 14.10 ? 72  LEU D CB  1 
ATOM   8194  C  CG  . LEU D  1 72  ? 19.119 -37.218 -78.749  1.00 14.65 ? 72  LEU D CG  1 
ATOM   8195  C  CD1 . LEU D  1 72  ? 18.479 -37.010 -80.120  1.00 15.03 ? 72  LEU D CD1 1 
ATOM   8196  C  CD2 . LEU D  1 72  ? 19.599 -38.651 -78.565  1.00 14.95 ? 72  LEU D CD2 1 
ATOM   8197  N  N   . GLY D  1 73  ? 22.404 -34.467 -76.432  1.00 13.47 ? 73  GLY D N   1 
ATOM   8198  C  CA  . GLY D  1 73  ? 23.667 -33.734 -76.344  1.00 11.13 ? 73  GLY D CA  1 
ATOM   8199  C  C   . GLY D  1 73  ? 23.776 -32.539 -77.275  1.00 13.52 ? 73  GLY D C   1 
ATOM   8200  O  O   . GLY D  1 73  ? 24.867 -32.181 -77.713  1.00 14.11 ? 73  GLY D O   1 
ATOM   8201  N  N   . ARG D  1 74  ? 22.648 -31.895 -77.565  1.00 12.37 ? 74  ARG D N   1 
ATOM   8202  C  CA  . ARG D  1 74  ? 22.677 -30.718 -78.429  1.00 12.69 ? 74  ARG D CA  1 
ATOM   8203  C  C   . ARG D  1 74  ? 23.746 -29.734 -77.948  1.00 14.79 ? 74  ARG D C   1 
ATOM   8204  O  O   . ARG D  1 74  ? 23.857 -29.464 -76.748  1.00 15.15 ? 74  ARG D O   1 
ATOM   8205  C  CB  . ARG D  1 74  ? 21.299 -30.031 -78.459  1.00 13.76 ? 74  ARG D CB  1 
ATOM   8206  C  CG  . ARG D  1 74  ? 21.260 -28.780 -79.333  1.00 14.79 ? 74  ARG D CG  1 
ATOM   8207  C  CD  . ARG D  1 74  ? 19.905 -28.092 -79.266  1.00 11.84 ? 74  ARG D CD  1 
ATOM   8208  N  NE  . ARG D  1 74  ? 19.646 -27.557 -77.933  1.00 12.96 ? 74  ARG D NE  1 
ATOM   8209  C  CZ  . ARG D  1 74  ? 18.614 -26.776 -77.631  1.00 13.07 ? 74  ARG D CZ  1 
ATOM   8210  N  NH1 . ARG D  1 74  ? 17.751 -26.431 -78.575  1.00 10.79 ? 74  ARG D NH1 1 
ATOM   8211  N  NH2 . ARG D  1 74  ? 18.455 -26.337 -76.382  1.00 12.15 ? 74  ARG D NH2 1 
ATOM   8212  N  N   . ASP D  1 75  ? 24.532 -29.197 -78.879  1.00 14.01 ? 75  ASP D N   1 
ATOM   8213  C  CA  . ASP D  1 75  ? 25.578 -28.222 -78.530  1.00 14.94 ? 75  ASP D CA  1 
ATOM   8214  C  C   . ASP D  1 75  ? 25.686 -27.227 -79.674  1.00 13.69 ? 75  ASP D C   1 
ATOM   8215  O  O   . ASP D  1 75  ? 26.293 -27.520 -80.700  1.00 15.03 ? 75  ASP D O   1 
ATOM   8216  C  CB  . ASP D  1 75  ? 26.910 -28.939 -78.314  1.00 15.22 ? 75  ASP D CB  1 
ATOM   8217  C  CG  . ASP D  1 75  ? 28.030 -28.004 -77.890  1.00 22.88 ? 75  ASP D CG  1 
ATOM   8218  O  OD1 . ASP D  1 75  ? 28.978 -28.494 -77.240  1.00 33.95 ? 75  ASP D OD1 1 
ATOM   8219  O  OD2 . ASP D  1 75  ? 27.994 -26.799 -78.220  1.00 21.57 ? 75  ASP D OD2 1 
ATOM   8220  N  N   . ILE D  1 76  ? 25.069 -26.064 -79.507  1.00 14.64 ? 76  ILE D N   1 
ATOM   8221  C  CA  . ILE D  1 76  ? 24.941 -25.106 -80.605  1.00 14.84 ? 76  ILE D CA  1 
ATOM   8222  C  C   . ILE D  1 76  ? 26.299 -24.541 -81.040  1.00 14.21 ? 76  ILE D C   1 
ATOM   8223  O  O   . ILE D  1 76  ? 26.494 -24.191 -82.210  1.00 14.59 ? 76  ILE D O   1 
ATOM   8224  C  CB  . ILE D  1 76  ? 23.943 -23.965 -80.260  1.00 15.13 ? 76  ILE D CB  1 
ATOM   8225  C  CG1 . ILE D  1 76  ? 23.464 -23.256 -81.534  1.00 16.03 ? 76  ILE D CG1 1 
ATOM   8226  C  CG2 . ILE D  1 76  ? 24.542 -22.977 -79.268  1.00 15.17 ? 76  ILE D CG2 1 
ATOM   8227  C  CD1 . ILE D  1 76  ? 22.566 -24.112 -82.413  1.00 16.34 ? 76  ILE D CD1 1 
ATOM   8228  N  N   . ARG D  1 77  ? 27.242 -24.472 -80.104  1.00 16.19 ? 77  ARG D N   1 
ATOM   8229  C  CA  . ARG D  1 77  ? 28.568 -23.921 -80.399  1.00 17.18 ? 77  ARG D CA  1 
ATOM   8230  C  C   . ARG D  1 77  ? 29.418 -24.911 -81.200  1.00 17.71 ? 77  ARG D C   1 
ATOM   8231  O  O   . ARG D  1 77  ? 30.175 -24.512 -82.079  1.00 20.11 ? 77  ARG D O   1 
ATOM   8232  C  CB  . ARG D  1 77  ? 29.279 -23.482 -79.112  1.00 17.12 ? 77  ARG D CB  1 
ATOM   8233  C  CG  . ARG D  1 77  ? 28.669 -22.235 -78.504  1.00 20.53 ? 77  ARG D CG  1 
ATOM   8234  C  CD  . ARG D  1 77  ? 29.111 -22.020 -77.063  1.00 22.41 ? 77  ARG D CD  1 
ATOM   8235  N  NE  . ARG D  1 77  ? 28.477 -20.830 -76.497  1.00 21.98 ? 77  ARG D NE  1 
ATOM   8236  C  CZ  . ARG D  1 77  ? 27.259 -20.810 -75.959  1.00 27.31 ? 77  ARG D CZ  1 
ATOM   8237  N  NH1 . ARG D  1 77  ? 26.525 -21.918 -75.907  1.00 20.43 ? 77  ARG D NH1 1 
ATOM   8238  N  NH2 . ARG D  1 77  ? 26.770 -19.677 -75.472  1.00 21.78 ? 77  ARG D NH2 1 
ATOM   8239  N  N   . PHE D  1 78  ? 29.279 -26.201 -80.906  1.00 15.87 ? 78  PHE D N   1 
ATOM   8240  C  CA  . PHE D  1 78  ? 29.906 -27.239 -81.731  1.00 16.97 ? 78  PHE D CA  1 
ATOM   8241  C  C   . PHE D  1 78  ? 29.310 -27.177 -83.138  1.00 17.56 ? 78  PHE D C   1 
ATOM   8242  O  O   . PHE D  1 78  ? 30.019 -27.285 -84.130  1.00 17.26 ? 78  PHE D O   1 
ATOM   8243  C  CB  . PHE D  1 78  ? 29.667 -28.621 -81.115  1.00 17.41 ? 78  PHE D CB  1 
ATOM   8244  C  CG  . PHE D  1 78  ? 30.228 -29.764 -81.925  1.00 16.93 ? 78  PHE D CG  1 
ATOM   8245  C  CD1 . PHE D  1 78  ? 29.397 -30.544 -82.718  1.00 16.84 ? 78  PHE D CD1 1 
ATOM   8246  C  CD2 . PHE D  1 78  ? 31.578 -30.070 -81.874  1.00 16.28 ? 78  PHE D CD2 1 
ATOM   8247  C  CE1 . PHE D  1 78  ? 29.905 -31.593 -83.459  1.00 18.58 ? 78  PHE D CE1 1 
ATOM   8248  C  CE2 . PHE D  1 78  ? 32.094 -31.123 -82.610  1.00 19.35 ? 78  PHE D CE2 1 
ATOM   8249  C  CZ  . PHE D  1 78  ? 31.256 -31.889 -83.398  1.00 17.82 ? 78  PHE D CZ  1 
ATOM   8250  N  N   . MET D  1 79  ? 27.993 -26.997 -83.216  1.00 16.86 ? 79  MET D N   1 
ATOM   8251  C  CA  . MET D  1 79  ? 27.312 -26.890 -84.500  1.00 17.51 ? 79  MET D CA  1 
ATOM   8252  C  C   . MET D  1 79  ? 27.813 -25.691 -85.304  1.00 17.41 ? 79  MET D C   1 
ATOM   8253  O  O   . MET D  1 79  ? 28.036 -25.801 -86.506  1.00 19.25 ? 79  MET D O   1 
ATOM   8254  C  CB  . MET D  1 79  ? 25.791 -26.825 -84.307  1.00 15.72 ? 79  MET D CB  1 
ATOM   8255  C  CG  . MET D  1 79  ? 25.193 -28.140 -83.808  1.00 20.20 ? 79  MET D CG  1 
ATOM   8256  S  SD  . MET D  1 79  ? 23.449 -27.973 -83.370  1.00 20.92 ? 79  MET D SD  1 
ATOM   8257  C  CE  . MET D  1 79  ? 23.138 -29.541 -82.561  1.00 31.93 ? 79  MET D CE  1 
ATOM   8258  N  N   . GLU D  1 80  ? 28.002 -24.555 -84.638  1.00 16.26 ? 80  GLU D N   1 
ATOM   8259  C  CA  . GLU D  1 80  ? 28.554 -23.362 -85.293  1.00 19.66 ? 80  GLU D CA  1 
ATOM   8260  C  C   . GLU D  1 80  ? 29.927 -23.619 -85.887  1.00 18.96 ? 80  GLU D C   1 
ATOM   8261  O  O   . GLU D  1 80  ? 30.227 -23.190 -86.997  1.00 18.91 ? 80  GLU D O   1 
ATOM   8262  C  CB  . GLU D  1 80  ? 28.672 -22.200 -84.302  1.00 23.76 ? 80  GLU D CB  1 
ATOM   8263  C  CG  . GLU D  1 80  ? 27.376 -21.464 -84.037  1.00 29.95 ? 80  GLU D CG  1 
ATOM   8264  C  CD  . GLU D  1 80  ? 27.571 -20.271 -83.118  1.00 43.61 ? 80  GLU D CD  1 
ATOM   8265  O  OE1 . GLU D  1 80  ? 28.264 -20.406 -82.079  1.00 36.30 ? 80  GLU D OE1 1 
ATOM   8266  O  OE2 . GLU D  1 80  ? 27.027 -19.196 -83.440  1.00 40.68 ? 80  GLU D OE2 1 
ATOM   8267  N  N   . LYS D  1 81  ? 30.778 -24.289 -85.119  1.00 21.44 ? 81  LYS D N   1 
ATOM   8268  C  CA  . LYS D  1 81  ? 32.124 -24.602 -85.568  1.00 21.29 ? 81  LYS D CA  1 
ATOM   8269  C  C   . LYS D  1 81  ? 32.084 -25.420 -86.852  1.00 19.44 ? 81  LYS D C   1 
ATOM   8270  O  O   . LYS D  1 81  ? 32.810 -25.133 -87.802  1.00 18.76 ? 81  LYS D O   1 
ATOM   8271  C  CB  . LYS D  1 81  ? 32.882 -25.373 -84.490  1.00 24.50 ? 81  LYS D CB  1 
ATOM   8272  C  CG  . LYS D  1 81  ? 33.386 -24.515 -83.345  1.00 33.35 ? 81  LYS D CG  1 
ATOM   8273  C  CD  . LYS D  1 81  ? 34.220 -25.340 -82.379  1.00 35.03 ? 81  LYS D CD  1 
ATOM   8274  C  CE  . LYS D  1 81  ? 34.515 -24.561 -81.107  1.00 42.52 ? 81  LYS D CE  1 
ATOM   8275  N  NZ  . LYS D  1 81  ? 35.246 -25.396 -80.114  1.00 55.95 ? 81  LYS D NZ  1 
ATOM   8276  N  N   . VAL D  1 82  ? 31.239 -26.445 -86.866  1.00 17.21 ? 82  VAL D N   1 
ATOM   8277  C  CA  . VAL D  1 82  ? 31.062 -27.275 -88.052  1.00 17.28 ? 82  VAL D CA  1 
ATOM   8278  C  C   . VAL D  1 82  ? 30.563 -26.470 -89.251  1.00 17.74 ? 82  VAL D C   1 
ATOM   8279  O  O   . VAL D  1 82  ? 31.030 -26.675 -90.364  1.00 17.43 ? 82  VAL D O   1 
ATOM   8280  C  CB  . VAL D  1 82  ? 30.121 -28.467 -87.777  1.00 17.64 ? 82  VAL D CB  1 
ATOM   8281  C  CG1 . VAL D  1 82  ? 29.858 -29.255 -89.055  1.00 14.63 ? 82  VAL D CG1 1 
ATOM   8282  C  CG2 . VAL D  1 82  ? 30.734 -29.373 -86.721  1.00 16.66 ? 82  VAL D CG2 1 
ATOM   8283  N  N   . VAL D  1 83  ? 29.627 -25.549 -89.020  1.00 17.28 ? 83  VAL D N   1 
ATOM   8284  C  CA  . VAL D  1 83  ? 29.111 -24.709 -90.094  1.00 17.24 ? 83  VAL D CA  1 
ATOM   8285  C  C   . VAL D  1 83  ? 30.219 -23.814 -90.654  1.00 20.72 ? 83  VAL D C   1 
ATOM   8286  O  O   . VAL D  1 83  ? 30.319 -23.623 -91.867  1.00 18.18 ? 83  VAL D O   1 
ATOM   8287  C  CB  . VAL D  1 83  ? 27.922 -23.827 -89.636  1.00 17.71 ? 83  VAL D CB  1 
ATOM   8288  C  CG1 . VAL D  1 83  ? 27.676 -22.717 -90.646  1.00 18.64 ? 83  VAL D CG1 1 
ATOM   8289  C  CG2 . VAL D  1 83  ? 26.653 -24.661 -89.433  1.00 15.24 ? 83  VAL D CG2 1 
ATOM   8290  N  N   . LYS D  1 84  ? 31.041 -23.260 -89.767  1.00 18.34 ? 84  LYS D N   1 
ATOM   8291  C  CA  . LYS D  1 84  ? 32.141 -22.398 -90.190  1.00 23.72 ? 84  LYS D CA  1 
ATOM   8292  C  C   . LYS D  1 84  ? 33.180 -23.152 -91.013  1.00 23.86 ? 84  LYS D C   1 
ATOM   8293  O  O   . LYS D  1 84  ? 33.772 -22.592 -91.930  1.00 24.55 ? 84  LYS D O   1 
ATOM   8294  C  CB  . LYS D  1 84  ? 32.809 -21.729 -88.987  1.00 27.64 ? 84  LYS D CB  1 
ATOM   8295  C  CG  . LYS D  1 84  ? 32.035 -20.539 -88.447  1.00 37.88 ? 84  LYS D CG  1 
ATOM   8296  C  CD  . LYS D  1 84  ? 32.666 -19.996 -87.176  1.00 51.34 ? 84  LYS D CD  1 
ATOM   8297  C  CE  . LYS D  1 84  ? 31.748 -18.992 -86.499  1.00 53.99 ? 84  LYS D CE  1 
ATOM   8298  N  NZ  . LYS D  1 84  ? 32.177 -18.722 -85.100  1.00 64.98 ? 84  LYS D NZ  1 
ATOM   8299  N  N   . ALA D  1 85  ? 33.395 -24.422 -90.691  1.00 23.10 ? 85  ALA D N   1 
ATOM   8300  C  CA  . ALA D  1 85  ? 34.373 -25.235 -91.415  1.00 22.27 ? 85  ALA D CA  1 
ATOM   8301  C  C   . ALA D  1 85  ? 33.837 -25.818 -92.722  1.00 23.00 ? 85  ALA D C   1 
ATOM   8302  O  O   . ALA D  1 85  ? 34.611 -26.326 -93.532  1.00 26.88 ? 85  ALA D O   1 
ATOM   8303  C  CB  . ALA D  1 85  ? 34.906 -26.352 -90.524  1.00 21.69 ? 85  ALA D CB  1 
ATOM   8304  N  N   . THR D  1 86  ? 32.525 -25.747 -92.939  1.00 20.06 ? 86  THR D N   1 
ATOM   8305  C  CA  . THR D  1 86  ? 31.930 -26.440 -94.083  1.00 21.01 ? 86  THR D CA  1 
ATOM   8306  C  C   . THR D  1 86  ? 31.082 -25.574 -95.018  1.00 21.81 ? 86  THR D C   1 
ATOM   8307  O  O   . THR D  1 86  ? 31.015 -25.841 -96.218  1.00 21.62 ? 86  THR D O   1 
ATOM   8308  C  CB  . THR D  1 86  ? 31.061 -27.631 -93.627  1.00 21.96 ? 86  THR D CB  1 
ATOM   8309  O  OG1 . THR D  1 86  ? 29.970 -27.149 -92.834  1.00 20.56 ? 86  THR D OG1 1 
ATOM   8310  C  CG2 . THR D  1 86  ? 31.881 -28.630 -92.816  1.00 18.78 ? 86  THR D CG2 1 
ATOM   8311  N  N   . GLY D  1 87  ? 30.426 -24.553 -94.474  1.00 19.69 ? 87  GLY D N   1 
ATOM   8312  C  CA  . GLY D  1 87  ? 29.484 -23.757 -95.261  1.00 20.31 ? 87  GLY D CA  1 
ATOM   8313  C  C   . GLY D  1 87  ? 28.113 -24.405 -95.430  1.00 20.10 ? 87  GLY D C   1 
ATOM   8314  O  O   . GLY D  1 87  ? 27.288 -23.921 -96.194  1.00 21.64 ? 87  GLY D O   1 
ATOM   8315  N  N   . ILE D  1 88  ? 27.857 -25.497 -94.717  1.00 19.48 ? 88  ILE D N   1 
ATOM   8316  C  CA  . ILE D  1 88  ? 26.567 -26.189 -94.826  1.00 19.43 ? 88  ILE D CA  1 
ATOM   8317  C  C   . ILE D  1 88  ? 25.444 -25.325 -94.235  1.00 18.46 ? 88  ILE D C   1 
ATOM   8318  O  O   . ILE D  1 88  ? 25.670 -24.604 -93.261  1.00 17.28 ? 88  ILE D O   1 
ATOM   8319  C  CB  . ILE D  1 88  ? 26.597 -27.553 -94.098  1.00 16.16 ? 88  ILE D CB  1 
ATOM   8320  C  CG1 . ILE D  1 88  ? 25.381 -28.415 -94.469  1.00 17.32 ? 88  ILE D CG1 1 
ATOM   8321  C  CG2 . ILE D  1 88  ? 26.650 -27.371 -92.585  1.00 18.31 ? 88  ILE D CG2 1 
ATOM   8322  C  CD1 . ILE D  1 88  ? 25.462 -29.019 -95.857  1.00 16.20 ? 88  ILE D CD1 1 
ATOM   8323  N  N   . ASN D  1 89  ? 24.252 -25.376 -94.834  1.00 16.06 ? 89  ASN D N   1 
ATOM   8324  C  CA  . ASN D  1 89  ? 23.044 -24.867 -94.172  1.00 14.49 ? 89  ASN D CA  1 
ATOM   8325  C  C   . ASN D  1 89  ? 22.655 -25.882 -93.110  1.00 15.07 ? 89  ASN D C   1 
ATOM   8326  O  O   . ASN D  1 89  ? 22.357 -27.034 -93.430  1.00 15.14 ? 89  ASN D O   1 
ATOM   8327  C  CB  . ASN D  1 89  ? 21.865 -24.732 -95.140  1.00 13.42 ? 89  ASN D CB  1 
ATOM   8328  C  CG  . ASN D  1 89  ? 22.036 -23.609 -96.151  1.00 15.15 ? 89  ASN D CG  1 
ATOM   8329  O  OD1 . ASN D  1 89  ? 22.812 -22.669 -95.950  1.00 16.79 ? 89  ASN D OD1 1 
ATOM   8330  N  ND2 . ASN D  1 89  ? 21.288 -23.701 -97.250  1.00 16.14 ? 89  ASN D ND2 1 
ATOM   8331  N  N   . LEU D  1 90  ? 22.647 -25.467 -91.851  1.00 14.60 ? 90  LEU D N   1 
ATOM   8332  C  CA  . LEU D  1 90  ? 22.328 -26.384 -90.765  1.00 15.47 ? 90  LEU D CA  1 
ATOM   8333  C  C   . LEU D  1 90  ? 21.122 -25.869 -89.984  1.00 13.53 ? 90  LEU D C   1 
ATOM   8334  O  O   . LEU D  1 90  ? 21.138 -24.746 -89.495  1.00 12.47 ? 90  LEU D O   1 
ATOM   8335  C  CB  . LEU D  1 90  ? 23.541 -26.534 -89.841  1.00 14.41 ? 90  LEU D CB  1 
ATOM   8336  C  CG  . LEU D  1 90  ? 23.421 -27.495 -88.658  1.00 17.53 ? 90  LEU D CG  1 
ATOM   8337  C  CD1 . LEU D  1 90  ? 23.392 -28.938 -89.149  1.00 12.74 ? 90  LEU D CD1 1 
ATOM   8338  C  CD2 . LEU D  1 90  ? 24.566 -27.271 -87.672  1.00 15.85 ? 90  LEU D CD2 1 
ATOM   8339  N  N   . VAL D  1 91  ? 20.076 -26.685 -89.879  1.00 12.60 ? 91  VAL D N   1 
ATOM   8340  C  CA  . VAL D  1 91  ? 18.910 -26.318 -89.077  1.00 12.67 ? 91  VAL D CA  1 
ATOM   8341  C  C   . VAL D  1 91  ? 18.937 -27.058 -87.740  1.00 15.15 ? 91  VAL D C   1 
ATOM   8342  O  O   . VAL D  1 91  ? 18.881 -28.290 -87.710  1.00 13.01 ? 91  VAL D O   1 
ATOM   8343  C  CB  . VAL D  1 91  ? 17.586 -26.672 -89.784  1.00 14.50 ? 91  VAL D CB  1 
ATOM   8344  C  CG1 . VAL D  1 91  ? 16.404 -26.049 -89.037  1.00 11.82 ? 91  VAL D CG1 1 
ATOM   8345  C  CG2 . VAL D  1 91  ? 17.616 -26.212 -91.240  1.00 14.84 ? 91  VAL D CG2 1 
ATOM   8346  N  N   . ALA D  1 92  ? 19.031 -26.299 -86.648  1.00 14.45 ? 92  ALA D N   1 
ATOM   8347  C  CA  . ALA D  1 92  ? 19.003 -26.843 -85.295  1.00 14.23 ? 92  ALA D CA  1 
ATOM   8348  C  C   . ALA D  1 92  ? 17.581 -26.786 -84.784  1.00 15.47 ? 92  ALA D C   1 
ATOM   8349  O  O   . ALA D  1 92  ? 16.777 -25.978 -85.245  1.00 15.69 ? 92  ALA D O   1 
ATOM   8350  C  CB  . ALA D  1 92  ? 19.911 -26.030 -84.370  1.00 13.90 ? 92  ALA D CB  1 
ATOM   8351  N  N   . GLY D  1 93  ? 17.274 -27.645 -83.820  1.00 14.39 ? 93  GLY D N   1 
ATOM   8352  C  CA  . GLY D  1 93  ? 15.936 -27.696 -83.268  1.00 15.26 ? 93  GLY D CA  1 
ATOM   8353  C  C   . GLY D  1 93  ? 15.932 -27.565 -81.765  1.00 13.59 ? 93  GLY D C   1 
ATOM   8354  O  O   . GLY D  1 93  ? 16.972 -27.381 -81.132  1.00 12.68 ? 93  GLY D O   1 
ATOM   8355  N  N   . THR D  1 94  ? 14.744 -27.660 -81.191  1.00 12.92 ? 94  THR D N   1 
ATOM   8356  C  CA  . THR D  1 94  ? 14.607 -27.717 -79.754  1.00 13.35 ? 94  THR D CA  1 
ATOM   8357  C  C   . THR D  1 94  ? 13.710 -28.906 -79.471  1.00 13.71 ? 94  THR D C   1 
ATOM   8358  O  O   . THR D  1 94  ? 13.226 -29.558 -80.394  1.00 12.64 ? 94  THR D O   1 
ATOM   8359  C  CB  . THR D  1 94  ? 13.999 -26.406 -79.194  1.00 14.46 ? 94  THR D CB  1 
ATOM   8360  O  OG1 . THR D  1 94  ? 13.964 -26.451 -77.761  1.00 14.16 ? 94  THR D OG1 1 
ATOM   8361  C  CG2 . THR D  1 94  ? 12.587 -26.192 -79.729  1.00 12.24 ? 94  THR D CG2 1 
ATOM   8362  N  N   . GLY D  1 95  ? 13.468 -29.188 -78.203  1.00 15.91 ? 95  GLY D N   1 
ATOM   8363  C  CA  . GLY D  1 95  ? 12.617 -30.305 -77.851  1.00 15.48 ? 95  GLY D CA  1 
ATOM   8364  C  C   . GLY D  1 95  ? 13.253 -31.145 -76.765  1.00 16.76 ? 95  GLY D C   1 
ATOM   8365  O  O   . GLY D  1 95  ? 14.275 -30.771 -76.186  1.00 14.16 ? 95  GLY D O   1 
ATOM   8366  N  N   . ILE D  1 96  ? 12.633 -32.284 -76.484  1.00 14.79 ? 96  ILE D N   1 
ATOM   8367  C  CA  . ILE D  1 96  ? 13.137 -33.185 -75.463  1.00 14.44 ? 96  ILE D CA  1 
ATOM   8368  C  C   . ILE D  1 96  ? 13.064 -34.598 -75.998  1.00 13.41 ? 96  ILE D C   1 
ATOM   8369  O  O   . ILE D  1 96  ? 12.054 -35.006 -76.565  1.00 15.74 ? 96  ILE D O   1 
ATOM   8370  C  CB  . ILE D  1 96  ? 12.321 -33.069 -74.157  1.00 13.41 ? 96  ILE D CB  1 
ATOM   8371  C  CG1 . ILE D  1 96  ? 12.643 -31.743 -73.453  1.00 14.23 ? 96  ILE D CG1 1 
ATOM   8372  C  CG2 . ILE D  1 96  ? 12.599 -34.258 -73.236  1.00 13.31 ? 96  ILE D CG2 1 
ATOM   8373  C  CD1 . ILE D  1 96  ? 11.719 -31.423 -72.291  1.00 15.52 ? 96  ILE D CD1 1 
ATOM   8374  N  N   . TYR D  1 97  ? 14.149 -35.337 -75.823  1.00 14.20 ? 97  TYR D N   1 
ATOM   8375  C  CA  . TYR D  1 97  ? 14.208 -36.719 -76.255  1.00 14.55 ? 97  TYR D CA  1 
ATOM   8376  C  C   . TYR D  1 97  ? 14.276 -37.609 -75.012  1.00 17.31 ? 97  TYR D C   1 
ATOM   8377  O  O   . TYR D  1 97  ? 15.315 -37.671 -74.337  1.00 14.62 ? 97  TYR D O   1 
ATOM   8378  C  CB  . TYR D  1 97  ? 15.436 -36.896 -77.140  1.00 15.58 ? 97  TYR D CB  1 
ATOM   8379  C  CG  . TYR D  1 97  ? 15.643 -38.267 -77.743  1.00 19.87 ? 97  TYR D CG  1 
ATOM   8380  C  CD1 . TYR D  1 97  ? 16.119 -39.317 -76.974  1.00 21.41 ? 97  TYR D CD1 1 
ATOM   8381  C  CD2 . TYR D  1 97  ? 15.416 -38.492 -79.096  1.00 17.82 ? 97  TYR D CD2 1 
ATOM   8382  C  CE1 . TYR D  1 97  ? 16.341 -40.561 -77.531  1.00 25.91 ? 97  TYR D CE1 1 
ATOM   8383  C  CE2 . TYR D  1 97  ? 15.633 -39.732 -79.661  1.00 20.73 ? 97  TYR D CE2 1 
ATOM   8384  C  CZ  . TYR D  1 97  ? 16.098 -40.761 -78.874  1.00 23.85 ? 97  TYR D CZ  1 
ATOM   8385  O  OH  . TYR D  1 97  ? 16.321 -42.001 -79.420  1.00 23.92 ? 97  TYR D OH  1 
ATOM   8386  N  N   . ILE D  1 98  ? 13.153 -38.260 -74.699  1.00 16.16 ? 98  ILE D N   1 
ATOM   8387  C  CA  . ILE D  1 98  ? 13.055 -39.212 -73.589  1.00 16.74 ? 98  ILE D CA  1 
ATOM   8388  C  C   . ILE D  1 98  ? 12.230 -40.433 -74.008  1.00 18.08 ? 98  ILE D C   1 
ATOM   8389  O  O   . ILE D  1 98  ? 11.411 -40.346 -74.926  1.00 14.70 ? 98  ILE D O   1 
ATOM   8390  C  CB  . ILE D  1 98  ? 12.380 -38.599 -72.338  1.00 17.53 ? 98  ILE D CB  1 
ATOM   8391  C  CG1 . ILE D  1 98  ? 11.011 -38.002 -72.694  1.00 18.32 ? 98  ILE D CG1 1 
ATOM   8392  C  CG2 . ILE D  1 98  ? 13.288 -37.578 -71.664  1.00 16.32 ? 98  ILE D CG2 1 
ATOM   8393  C  CD1 . ILE D  1 98  ? 10.080 -37.893 -71.497  1.00 19.86 ? 98  ILE D CD1 1 
ATOM   8394  N  N   . TYR D  1 99  ? 12.454 -41.564 -73.341  1.00 17.67 ? 99  TYR D N   1 
ATOM   8395  C  CA  . TYR D  1 99  ? 11.669 -42.779 -73.599  1.00 20.31 ? 99  TYR D CA  1 
ATOM   8396  C  C   . TYR D  1 99  ? 10.699 -43.075 -72.466  1.00 20.05 ? 99  TYR D C   1 
ATOM   8397  O  O   . TYR D  1 99  ? 9.665  -43.703 -72.687  1.00 21.30 ? 99  TYR D O   1 
ATOM   8398  C  CB  . TYR D  1 99  ? 12.560 -44.012 -73.784  1.00 21.94 ? 99  TYR D CB  1 
ATOM   8399  C  CG  . TYR D  1 99  ? 13.378 -44.054 -75.049  1.00 24.89 ? 99  TYR D CG  1 
ATOM   8400  C  CD1 . TYR D  1 99  ? 13.285 -43.048 -76.007  1.00 28.33 ? 99  TYR D CD1 1 
ATOM   8401  C  CD2 . TYR D  1 99  ? 14.223 -45.132 -75.306  1.00 28.31 ? 99  TYR D CD2 1 
ATOM   8402  C  CE1 . TYR D  1 99  ? 14.036 -43.105 -77.172  1.00 27.57 ? 99  TYR D CE1 1 
ATOM   8403  C  CE2 . TYR D  1 99  ? 14.973 -45.200 -76.464  1.00 24.87 ? 99  TYR D CE2 1 
ATOM   8404  C  CZ  . TYR D  1 99  ? 14.879 -44.185 -77.391  1.00 26.99 ? 99  TYR D CZ  1 
ATOM   8405  O  OH  . TYR D  1 99  ? 15.629 -44.260 -78.543  1.00 28.30 ? 99  TYR D OH  1 
ATOM   8406  N  N   . ILE D  1 100 ? 11.033 -42.638 -71.254  1.00 17.82 ? 100 ILE D N   1 
ATOM   8407  C  CA  . ILE D  1 100 ? 10.213 -42.972 -70.087  1.00 19.76 ? 100 ILE D CA  1 
ATOM   8408  C  C   . ILE D  1 100 ? 9.835  -41.741 -69.259  1.00 22.33 ? 100 ILE D C   1 
ATOM   8409  O  O   . ILE D  1 100 ? 8.729  -41.226 -69.380  1.00 21.59 ? 100 ILE D O   1 
ATOM   8410  C  CB  . ILE D  1 100 ? 10.886 -44.043 -69.197  1.00 21.54 ? 100 ILE D CB  1 
ATOM   8411  C  CG1 . ILE D  1 100 ? 11.281 -45.269 -70.030  1.00 21.51 ? 100 ILE D CG1 1 
ATOM   8412  C  CG2 . ILE D  1 100 ? 9.962  -44.459 -68.061  1.00 22.12 ? 100 ILE D CG2 1 
ATOM   8413  C  CD1 . ILE D  1 100 ? 12.043 -46.324 -69.252  1.00 22.95 ? 100 ILE D CD1 1 
ATOM   8414  N  N   . ASP D  1 101 ? 10.753 -41.269 -68.424  1.00 21.43 ? 101 ASP D N   1 
ATOM   8415  C  CA  . ASP D  1 101 ? 10.476 -40.113 -67.581  1.00 25.74 ? 101 ASP D CA  1 
ATOM   8416  C  C   . ASP D  1 101 ? 11.297 -38.887 -67.984  1.00 20.25 ? 101 ASP D C   1 
ATOM   8417  O  O   . ASP D  1 101 ? 12.354 -39.001 -68.610  1.00 18.57 ? 101 ASP D O   1 
ATOM   8418  C  CB  . ASP D  1 101 ? 10.738 -40.444 -66.105  1.00 24.78 ? 101 ASP D CB  1 
ATOM   8419  C  CG  . ASP D  1 101 ? 9.682  -41.368 -65.509  1.00 38.66 ? 101 ASP D CG  1 
ATOM   8420  O  OD1 . ASP D  1 101 ? 8.765  -41.804 -66.239  1.00 32.29 ? 101 ASP D OD1 1 
ATOM   8421  O  OD2 . ASP D  1 101 ? 9.771  -41.656 -64.296  1.00 40.30 ? 101 ASP D OD2 1 
ATOM   8422  N  N   . LEU D  1 102 ? 10.790 -37.714 -67.623  1.00 18.02 ? 102 LEU D N   1 
ATOM   8423  C  CA  . LEU D  1 102 ? 11.531 -36.464 -67.760  1.00 17.36 ? 102 LEU D CA  1 
ATOM   8424  C  C   . LEU D  1 102 ? 12.605 -36.379 -66.678  1.00 17.68 ? 102 LEU D C   1 
ATOM   8425  O  O   . LEU D  1 102 ? 12.498 -37.031 -65.645  1.00 17.51 ? 102 LEU D O   1 
ATOM   8426  C  CB  . LEU D  1 102 ? 10.576 -35.276 -67.610  1.00 17.33 ? 102 LEU D CB  1 
ATOM   8427  C  CG  . LEU D  1 102 ? 9.684  -34.952 -68.815  1.00 17.94 ? 102 LEU D CG  1 
ATOM   8428  C  CD1 . LEU D  1 102 ? 8.536  -34.028 -68.431  1.00 18.53 ? 102 LEU D CD1 1 
ATOM   8429  C  CD2 . LEU D  1 102 ? 10.522 -34.327 -69.919  1.00 16.72 ? 102 LEU D CD2 1 
ATOM   8430  N  N   . PRO D  1 103 ? 13.649 -35.572 -66.914  1.00 19.76 ? 103 PRO D N   1 
ATOM   8431  C  CA  . PRO D  1 103 ? 14.590 -35.264 -65.848  1.00 18.80 ? 103 PRO D CA  1 
ATOM   8432  C  C   . PRO D  1 103 ? 13.865 -34.762 -64.593  1.00 19.17 ? 103 PRO D C   1 
ATOM   8433  O  O   . PRO D  1 103 ? 12.769 -34.205 -64.684  1.00 20.26 ? 103 PRO D O   1 
ATOM   8434  C  CB  . PRO D  1 103 ? 15.445 -34.142 -66.454  1.00 20.42 ? 103 PRO D CB  1 
ATOM   8435  C  CG  . PRO D  1 103 ? 15.406 -34.399 -67.925  1.00 20.05 ? 103 PRO D CG  1 
ATOM   8436  C  CD  . PRO D  1 103 ? 14.056 -34.998 -68.211  1.00 17.25 ? 103 PRO D CD  1 
ATOM   8437  N  N   . PHE D  1 104 ? 14.480 -34.950 -63.431  1.00 17.55 ? 104 PHE D N   1 
ATOM   8438  C  CA  . PHE D  1 104 ? 13.857 -34.569 -62.163  1.00 18.47 ? 104 PHE D CA  1 
ATOM   8439  C  C   . PHE D  1 104 ? 13.476 -33.092 -62.116  1.00 17.66 ? 104 PHE D C   1 
ATOM   8440  O  O   . PHE D  1 104 ? 12.553 -32.703 -61.391  1.00 17.04 ? 104 PHE D O   1 
ATOM   8441  C  CB  . PHE D  1 104 ? 14.777 -34.909 -60.984  1.00 23.61 ? 104 PHE D CB  1 
ATOM   8442  C  CG  . PHE D  1 104 ? 15.114 -36.371 -60.881  1.00 28.77 ? 104 PHE D CG  1 
ATOM   8443  C  CD1 . PHE D  1 104 ? 14.111 -37.318 -60.745  1.00 33.08 ? 104 PHE D CD1 1 
ATOM   8444  C  CD2 . PHE D  1 104 ? 16.437 -36.798 -60.896  1.00 31.87 ? 104 PHE D CD2 1 
ATOM   8445  C  CE1 . PHE D  1 104 ? 14.418 -38.664 -60.634  1.00 35.15 ? 104 PHE D CE1 1 
ATOM   8446  C  CE2 . PHE D  1 104 ? 16.749 -38.141 -60.785  1.00 27.26 ? 104 PHE D CE2 1 
ATOM   8447  C  CZ  . PHE D  1 104 ? 15.738 -39.075 -60.657  1.00 26.60 ? 104 PHE D CZ  1 
ATOM   8448  N  N   . TYR D  1 105 ? 14.184 -32.273 -62.891  1.00 16.58 ? 105 TYR D N   1 
ATOM   8449  C  CA  . TYR D  1 105 ? 13.854 -30.856 -63.001  1.00 17.48 ? 105 TYR D CA  1 
ATOM   8450  C  C   . TYR D  1 105 ? 12.350 -30.651 -63.201  1.00 17.81 ? 105 TYR D C   1 
ATOM   8451  O  O   . TYR D  1 105 ? 11.752 -29.708 -62.660  1.00 17.59 ? 105 TYR D O   1 
ATOM   8452  C  CB  . TYR D  1 105 ? 14.617 -30.199 -64.163  1.00 17.53 ? 105 TYR D CB  1 
ATOM   8453  C  CG  . TYR D  1 105 ? 14.136 -28.784 -64.433  1.00 18.94 ? 105 TYR D CG  1 
ATOM   8454  C  CD1 . TYR D  1 105 ? 14.584 -27.723 -63.659  1.00 17.05 ? 105 TYR D CD1 1 
ATOM   8455  C  CD2 . TYR D  1 105 ? 13.208 -28.518 -65.439  1.00 18.16 ? 105 TYR D CD2 1 
ATOM   8456  C  CE1 . TYR D  1 105 ? 14.131 -26.435 -63.880  1.00 17.78 ? 105 TYR D CE1 1 
ATOM   8457  C  CE2 . TYR D  1 105 ? 12.756 -27.236 -65.671  1.00 16.85 ? 105 TYR D CE2 1 
ATOM   8458  C  CZ  . TYR D  1 105 ? 13.220 -26.198 -64.886  1.00 20.69 ? 105 TYR D CZ  1 
ATOM   8459  O  OH  . TYR D  1 105 ? 12.773 -24.914 -65.103  1.00 21.91 ? 105 TYR D OH  1 
ATOM   8460  N  N   . PHE D  1 106 ? 11.742 -31.547 -63.971  1.00 17.28 ? 106 PHE D N   1 
ATOM   8461  C  CA  . PHE D  1 106 ? 10.361 -31.366 -64.411  1.00 17.14 ? 106 PHE D CA  1 
ATOM   8462  C  C   . PHE D  1 106 ? 9.301  -31.835 -63.424  1.00 21.11 ? 106 PHE D C   1 
ATOM   8463  O  O   . PHE D  1 106 ? 8.105  -31.701 -63.695  1.00 20.03 ? 106 PHE D O   1 
ATOM   8464  C  CB  . PHE D  1 106 ? 10.147 -32.018 -65.778  1.00 16.29 ? 106 PHE D CB  1 
ATOM   8465  C  CG  . PHE D  1 106 ? 10.924 -31.349 -66.871  1.00 17.29 ? 106 PHE D CG  1 
ATOM   8466  C  CD1 . PHE D  1 106 ? 12.167 -31.827 -67.244  1.00 15.64 ? 106 PHE D CD1 1 
ATOM   8467  C  CD2 . PHE D  1 106 ? 10.432 -30.213 -67.489  1.00 17.83 ? 106 PHE D CD2 1 
ATOM   8468  C  CE1 . PHE D  1 106 ? 12.897 -31.202 -68.239  1.00 16.41 ? 106 PHE D CE1 1 
ATOM   8469  C  CE2 . PHE D  1 106 ? 11.153 -29.586 -68.490  1.00 17.90 ? 106 PHE D CE2 1 
ATOM   8470  C  CZ  . PHE D  1 106 ? 12.390 -30.077 -68.860  1.00 14.90 ? 106 PHE D CZ  1 
ATOM   8471  N  N   . LEU D  1 107 ? 9.733  -32.367 -62.283  1.00 20.50 ? 107 LEU D N   1 
ATOM   8472  C  CA  . LEU D  1 107 ? 8.797  -32.753 -61.224  1.00 22.60 ? 107 LEU D CA  1 
ATOM   8473  C  C   . LEU D  1 107 ? 7.951  -31.553 -60.827  1.00 23.48 ? 107 LEU D C   1 
ATOM   8474  O  O   . LEU D  1 107 ? 8.481  -30.482 -60.532  1.00 23.65 ? 107 LEU D O   1 
ATOM   8475  C  CB  . LEU D  1 107 ? 9.550  -33.271 -59.997  1.00 24.28 ? 107 LEU D CB  1 
ATOM   8476  C  CG  . LEU D  1 107 ? 9.734  -34.778 -59.797  1.00 35.92 ? 107 LEU D CG  1 
ATOM   8477  C  CD1 . LEU D  1 107 ? 9.996  -35.503 -61.104  1.00 39.99 ? 107 LEU D CD1 1 
ATOM   8478  C  CD2 . LEU D  1 107 ? 10.849 -35.042 -58.792  1.00 32.72 ? 107 LEU D CD2 1 
ATOM   8479  N  N   . ASN D  1 108 ? 6.635  -31.733 -60.825  1.00 24.76 ? 108 ASN D N   1 
ATOM   8480  C  CA  . ASN D  1 108 ? 5.717  -30.659 -60.457  1.00 27.51 ? 108 ASN D CA  1 
ATOM   8481  C  C   . ASN D  1 108 ? 5.870  -29.421 -61.334  1.00 27.39 ? 108 ASN D C   1 
ATOM   8482  O  O   . ASN D  1 108 ? 5.696  -28.296 -60.868  1.00 33.14 ? 108 ASN D O   1 
ATOM   8483  C  CB  . ASN D  1 108 ? 5.888  -30.283 -58.982  1.00 29.37 ? 108 ASN D CB  1 
ATOM   8484  C  CG  . ASN D  1 108 ? 5.422  -31.376 -58.048  1.00 38.91 ? 108 ASN D CG  1 
ATOM   8485  O  OD1 . ASN D  1 108 ? 4.255  -31.777 -58.081  1.00 44.19 ? 108 ASN D OD1 1 
ATOM   8486  N  ND2 . ASN D  1 108 ? 6.329  -31.868 -57.205  1.00 33.15 ? 108 ASN D ND2 1 
ATOM   8487  N  N   . ARG D  1 109 ? 6.210  -29.624 -62.600  1.00 25.49 ? 109 ARG D N   1 
ATOM   8488  C  CA  . ARG D  1 109 ? 6.162  -28.535 -63.569  1.00 26.51 ? 109 ARG D CA  1 
ATOM   8489  C  C   . ARG D  1 109 ? 5.150  -28.854 -64.660  1.00 24.21 ? 109 ARG D C   1 
ATOM   8490  O  O   . ARG D  1 109 ? 4.913  -30.017 -64.979  1.00 24.27 ? 109 ARG D O   1 
ATOM   8491  C  CB  . ARG D  1 109 ? 7.546  -28.255 -64.161  1.00 23.58 ? 109 ARG D CB  1 
ATOM   8492  C  CG  . ARG D  1 109 ? 8.571  -27.845 -63.113  1.00 23.08 ? 109 ARG D CG  1 
ATOM   8493  C  CD  . ARG D  1 109 ? 9.853  -27.355 -63.765  1.00 24.93 ? 109 ARG D CD  1 
ATOM   8494  N  NE  . ARG D  1 109 ? 10.876 -27.020 -62.778  1.00 21.24 ? 109 ARG D NE  1 
ATOM   8495  C  CZ  . ARG D  1 109 ? 10.989 -25.836 -62.184  1.00 24.81 ? 109 ARG D CZ  1 
ATOM   8496  N  NH1 . ARG D  1 109 ? 11.963 -25.631 -61.307  1.00 20.74 ? 109 ARG D NH1 1 
ATOM   8497  N  NH2 . ARG D  1 109 ? 10.138 -24.855 -62.468  1.00 19.55 ? 109 ARG D NH2 1 
ATOM   8498  N  N   . SER D  1 110 ? 4.559  -27.817 -65.236  1.00 23.26 ? 110 SER D N   1 
ATOM   8499  C  CA  . SER D  1 110 ? 3.442  -27.998 -66.150  1.00 23.06 ? 110 SER D CA  1 
ATOM   8500  C  C   . SER D  1 110 ? 3.900  -28.186 -67.588  1.00 23.63 ? 110 SER D C   1 
ATOM   8501  O  O   . SER D  1 110 ? 5.054  -27.925 -67.923  1.00 19.13 ? 110 SER D O   1 
ATOM   8502  C  CB  . SER D  1 110 ? 2.519  -26.783 -66.083  1.00 26.51 ? 110 SER D CB  1 
ATOM   8503  O  OG  . SER D  1 110 ? 3.174  -25.638 -66.608  1.00 27.46 ? 110 SER D OG  1 
ATOM   8504  N  N   . ILE D  1 111 ? 2.970  -28.624 -68.432  1.00 22.49 ? 111 ILE D N   1 
ATOM   8505  C  CA  . ILE D  1 111 ? 3.197  -28.731 -69.865  1.00 22.87 ? 111 ILE D CA  1 
ATOM   8506  C  C   . ILE D  1 111 ? 3.568  -27.368 -70.456  1.00 25.81 ? 111 ILE D C   1 
ATOM   8507  O  O   . ILE D  1 111 ? 4.422  -27.283 -71.336  1.00 21.47 ? 111 ILE D O   1 
ATOM   8508  C  CB  . ILE D  1 111 ? 1.953  -29.307 -70.572  1.00 25.84 ? 111 ILE D CB  1 
ATOM   8509  C  CG1 . ILE D  1 111 ? 1.861  -30.820 -70.329  1.00 28.20 ? 111 ILE D CG1 1 
ATOM   8510  C  CG2 . ILE D  1 111 ? 1.989  -29.015 -72.063  1.00 23.38 ? 111 ILE D CG2 1 
ATOM   8511  C  CD1 . ILE D  1 111 ? 0.486  -31.401 -70.597  1.00 32.06 ? 111 ILE D CD1 1 
ATOM   8512  N  N   . ASP D  1 112 ? 2.946  -26.303 -69.953  1.00 23.01 ? 112 ASP D N   1 
ATOM   8513  C  CA  . ASP D  1 112 ? 3.251  -24.943 -70.417  1.00 24.37 ? 112 ASP D CA  1 
ATOM   8514  C  C   . ASP D  1 112 ? 4.692  -24.525 -70.140  1.00 23.06 ? 112 ASP D C   1 
ATOM   8515  O  O   . ASP D  1 112 ? 5.318  -23.851 -70.963  1.00 20.74 ? 112 ASP D O   1 
ATOM   8516  C  CB  . ASP D  1 112 ? 2.302  -23.918 -69.790  1.00 24.09 ? 112 ASP D CB  1 
ATOM   8517  C  CG  . ASP D  1 112 ? 0.955  -23.870 -70.484  1.00 33.38 ? 112 ASP D CG  1 
ATOM   8518  O  OD1 . ASP D  1 112 ? 0.912  -24.022 -71.721  1.00 43.45 ? 112 ASP D OD1 1 
ATOM   8519  O  OD2 . ASP D  1 112 ? -0.062 -23.671 -69.793  1.00 41.81 ? 112 ASP D OD2 1 
ATOM   8520  N  N   . GLU D  1 113 ? 5.207  -24.905 -68.973  1.00 20.14 ? 113 GLU D N   1 
ATOM   8521  C  CA  . GLU D  1 113 ? 6.602  -24.634 -68.634  1.00 23.73 ? 113 GLU D CA  1 
ATOM   8522  C  C   . GLU D  1 113 ? 7.545  -25.320 -69.613  1.00 19.01 ? 113 GLU D C   1 
ATOM   8523  O  O   . GLU D  1 113 ? 8.551  -24.744 -70.017  1.00 18.52 ? 113 GLU D O   1 
ATOM   8524  C  CB  . GLU D  1 113 ? 6.923  -25.090 -67.211  1.00 23.37 ? 113 GLU D CB  1 
ATOM   8525  C  CG  . GLU D  1 113 ? 6.334  -24.198 -66.134  1.00 30.33 ? 113 GLU D CG  1 
ATOM   8526  C  CD  . GLU D  1 113 ? 6.796  -24.598 -64.745  1.00 33.21 ? 113 GLU D CD  1 
ATOM   8527  O  OE1 . GLU D  1 113 ? 5.961  -25.091 -63.962  1.00 33.28 ? 113 GLU D OE1 1 
ATOM   8528  O  OE2 . GLU D  1 113 ? 7.998  -24.433 -64.444  1.00 32.08 ? 113 GLU D OE2 1 
ATOM   8529  N  N   . ILE D  1 114 ? 7.218  -26.553 -69.984  1.00 18.49 ? 114 ILE D N   1 
ATOM   8530  C  CA  . ILE D  1 114 ? 8.009  -27.282 -70.977  1.00 17.23 ? 114 ILE D CA  1 
ATOM   8531  C  C   . ILE D  1 114 ? 7.973  -26.552 -72.323  1.00 21.49 ? 114 ILE D C   1 
ATOM   8532  O  O   . ILE D  1 114 ? 9.018  -26.311 -72.938  1.00 19.24 ? 114 ILE D O   1 
ATOM   8533  C  CB  . ILE D  1 114 ? 7.508  -28.733 -71.150  1.00 19.44 ? 114 ILE D CB  1 
ATOM   8534  C  CG1 . ILE D  1 114 ? 7.531  -29.468 -69.804  1.00 17.19 ? 114 ILE D CG1 1 
ATOM   8535  C  CG2 . ILE D  1 114 ? 8.370  -29.479 -72.164  1.00 19.72 ? 114 ILE D CG2 1 
ATOM   8536  C  CD1 . ILE D  1 114 ? 6.962  -30.871 -69.858  1.00 17.62 ? 114 ILE D CD1 1 
ATOM   8537  N  N   . ALA D  1 115 ? 6.771  -26.189 -72.767  1.00 16.69 ? 115 ALA D N   1 
ATOM   8538  C  CA  . ALA D  1 115 ? 6.601  -25.471 -74.024  1.00 18.14 ? 115 ALA D CA  1 
ATOM   8539  C  C   . ALA D  1 115 ? 7.378  -24.164 -74.031  1.00 18.26 ? 115 ALA D C   1 
ATOM   8540  O  O   . ALA D  1 115 ? 7.944  -23.772 -75.059  1.00 17.79 ? 115 ALA D O   1 
ATOM   8541  C  CB  . ALA D  1 115 ? 5.123  -25.210 -74.298  1.00 16.39 ? 115 ALA D CB  1 
ATOM   8542  N  N   . ASP D  1 116 ? 7.394  -23.477 -72.893  1.00 20.44 ? 116 ASP D N   1 
ATOM   8543  C  CA  . ASP D  1 116 ? 8.138  -22.222 -72.774  1.00 22.51 ? 116 ASP D CA  1 
ATOM   8544  C  C   . ASP D  1 116 ? 9.618  -22.412 -73.095  1.00 20.24 ? 116 ASP D C   1 
ATOM   8545  O  O   . ASP D  1 116 ? 10.259 -21.529 -73.664  1.00 19.04 ? 116 ASP D O   1 
ATOM   8546  C  CB  . ASP D  1 116 ? 7.996  -21.633 -71.370  1.00 23.63 ? 116 ASP D CB  1 
ATOM   8547  C  CG  . ASP D  1 116 ? 6.647  -20.958 -71.145  1.00 30.23 ? 116 ASP D CG  1 
ATOM   8548  O  OD1 . ASP D  1 116 ? 6.354  -20.630 -69.979  1.00 27.90 ? 116 ASP D OD1 1 
ATOM   8549  O  OD2 . ASP D  1 116 ? 5.886  -20.759 -72.116  1.00 24.09 ? 116 ASP D OD2 1 
ATOM   8550  N  N   . LEU D  1 117 ? 10.168 -23.558 -72.709  1.00 16.67 ? 117 LEU D N   1 
ATOM   8551  C  CA  . LEU D  1 117 ? 11.548 -23.867 -73.034  1.00 15.12 ? 117 LEU D CA  1 
ATOM   8552  C  C   . LEU D  1 117 ? 11.724 -23.925 -74.548  1.00 13.34 ? 117 LEU D C   1 
ATOM   8553  O  O   . LEU D  1 117 ? 12.670 -23.347 -75.098  1.00 13.61 ? 117 LEU D O   1 
ATOM   8554  C  CB  . LEU D  1 117 ? 11.975 -25.204 -72.407  1.00 14.02 ? 117 LEU D CB  1 
ATOM   8555  C  CG  . LEU D  1 117 ? 11.899 -25.308 -70.885  1.00 15.89 ? 117 LEU D CG  1 
ATOM   8556  C  CD1 . LEU D  1 117 ? 12.387 -26.669 -70.397  1.00 15.21 ? 117 LEU D CD1 1 
ATOM   8557  C  CD2 . LEU D  1 117 ? 12.692 -24.175 -70.243  1.00 18.49 ? 117 LEU D CD2 1 
ATOM   8558  N  N   . PHE D  1 118 ? 10.815 -24.624 -75.219  1.00 14.47 ? 118 PHE D N   1 
ATOM   8559  C  CA  . PHE D  1 118 ? 10.882 -24.749 -76.677  1.00 14.42 ? 118 PHE D CA  1 
ATOM   8560  C  C   . PHE D  1 118 ? 10.711 -23.379 -77.338  1.00 15.83 ? 118 PHE D C   1 
ATOM   8561  O  O   . PHE D  1 118 ? 11.455 -23.019 -78.248  1.00 14.61 ? 118 PHE D O   1 
ATOM   8562  C  CB  . PHE D  1 118 ? 9.813  -25.721 -77.198  1.00 14.21 ? 118 PHE D CB  1 
ATOM   8563  C  CG  . PHE D  1 118 ? 9.863  -27.092 -76.566  1.00 16.49 ? 118 PHE D CG  1 
ATOM   8564  C  CD1 . PHE D  1 118 ? 11.008 -27.543 -75.924  1.00 14.10 ? 118 PHE D CD1 1 
ATOM   8565  C  CD2 . PHE D  1 118 ? 8.764  -27.942 -76.639  1.00 17.64 ? 118 PHE D CD2 1 
ATOM   8566  C  CE1 . PHE D  1 118 ? 11.046 -28.809 -75.355  1.00 15.62 ? 118 PHE D CE1 1 
ATOM   8567  C  CE2 . PHE D  1 118 ? 8.796  -29.212 -76.081  1.00 14.23 ? 118 PHE D CE2 1 
ATOM   8568  C  CZ  . PHE D  1 118 ? 9.937  -29.644 -75.432  1.00 14.21 ? 118 PHE D CZ  1 
ATOM   8569  N  N   . ILE D  1 119 ? 9.727  -22.616 -76.872  1.00 15.57 ? 119 ILE D N   1 
ATOM   8570  C  CA  . ILE D  1 119 ? 9.474  -21.292 -77.429  1.00 15.86 ? 119 ILE D CA  1 
ATOM   8571  C  C   . ILE D  1 119 ? 10.678 -20.377 -77.211  1.00 19.19 ? 119 ILE D C   1 
ATOM   8572  O  O   . ILE D  1 119 ? 11.054 -19.611 -78.103  1.00 19.69 ? 119 ILE D O   1 
ATOM   8573  C  CB  . ILE D  1 119 ? 8.180  -20.679 -76.860  1.00 18.43 ? 119 ILE D CB  1 
ATOM   8574  C  CG1 . ILE D  1 119 ? 6.980  -21.516 -77.314  1.00 18.61 ? 119 ILE D CG1 1 
ATOM   8575  C  CG2 . ILE D  1 119 ? 8.010  -19.234 -77.324  1.00 18.64 ? 119 ILE D CG2 1 
ATOM   8576  C  CD1 . ILE D  1 119 ? 5.697  -21.203 -76.575  1.00 25.97 ? 119 ILE D CD1 1 
ATOM   8577  N  N   . HIS D  1 120 ? 11.302 -20.474 -76.038  1.00 17.59 ? 120 HIS D N   1 
ATOM   8578  C  CA  . HIS D  1 120 ? 12.541 -19.736 -75.781  1.00 17.03 ? 120 HIS D CA  1 
ATOM   8579  C  C   . HIS D  1 120 ? 13.584 -19.995 -76.845  1.00 15.90 ? 120 HIS D C   1 
ATOM   8580  O  O   . HIS D  1 120 ? 14.205 -19.061 -77.359  1.00 16.23 ? 120 HIS D O   1 
ATOM   8581  C  CB  . HIS D  1 120 ? 13.106 -20.073 -74.396  1.00 17.17 ? 120 HIS D CB  1 
ATOM   8582  C  CG  . HIS D  1 120 ? 14.472 -19.473 -74.136  1.00 16.36 ? 120 HIS D CG  1 
ATOM   8583  N  ND1 . HIS D  1 120 ? 14.644 -18.320 -73.463  1.00 18.67 ? 120 HIS D ND1 1 
ATOM   8584  C  CD2 . HIS D  1 120 ? 15.742 -19.902 -74.509  1.00 14.72 ? 120 HIS D CD2 1 
ATOM   8585  C  CE1 . HIS D  1 120 ? 15.956 -18.023 -73.408  1.00 15.42 ? 120 HIS D CE1 1 
ATOM   8586  N  NE2 . HIS D  1 120 ? 16.628 -18.992 -74.050  1.00 14.99 ? 120 HIS D NE2 1 
ATOM   8587  N  N   . ASP D  1 121 ? 13.799 -21.264 -77.186  1.00 14.17 ? 121 ASP D N   1 
ATOM   8588  C  CA  . ASP D  1 121 ? 14.832 -21.626 -78.158  1.00 14.86 ? 121 ASP D CA  1 
ATOM   8589  C  C   . ASP D  1 121 ? 14.490 -21.135 -79.559  1.00 15.45 ? 121 ASP D C   1 
ATOM   8590  O  O   . ASP D  1 121 ? 15.378 -20.830 -80.357  1.00 14.93 ? 121 ASP D O   1 
ATOM   8591  C  CB  . ASP D  1 121 ? 15.024 -23.147 -78.211  1.00 12.66 ? 121 ASP D CB  1 
ATOM   8592  C  CG  . ASP D  1 121 ? 15.809 -23.685 -77.024  1.00 13.94 ? 121 ASP D CG  1 
ATOM   8593  O  OD1 . ASP D  1 121 ? 16.357 -22.878 -76.250  1.00 16.41 ? 121 ASP D OD1 1 
ATOM   8594  O  OD2 . ASP D  1 121 ? 15.876 -24.918 -76.874  1.00 14.97 ? 121 ASP D OD2 1 
ATOM   8595  N  N   . ILE D  1 122 ? 13.200 -21.106 -79.863  1.00 15.30 ? 122 ILE D N   1 
ATOM   8596  C  CA  . ILE D  1 122 ? 12.722 -20.703 -81.186  1.00 16.63 ? 122 ILE D CA  1 
ATOM   8597  C  C   . ILE D  1 122 ? 12.753 -19.192 -81.374  1.00 18.23 ? 122 ILE D C   1 
ATOM   8598  O  O   . ILE D  1 122 ? 13.172 -18.701 -82.427  1.00 17.99 ? 122 ILE D O   1 
ATOM   8599  C  CB  . ILE D  1 122 ? 11.293 -21.234 -81.448  1.00 17.71 ? 122 ILE D CB  1 
ATOM   8600  C  CG1 . ILE D  1 122 ? 11.297 -22.770 -81.465  1.00 14.20 ? 122 ILE D CG1 1 
ATOM   8601  C  CG2 . ILE D  1 122 ? 10.757 -20.702 -82.768  1.00 18.26 ? 122 ILE D CG2 1 
ATOM   8602  C  CD1 . ILE D  1 122 ? 9.951  -23.407 -81.214  1.00 14.24 ? 122 ILE D CD1 1 
ATOM   8603  N  N   . LYS D  1 123 ? 12.317 -18.464 -80.347  1.00 19.26 ? 123 LYS D N   1 
ATOM   8604  C  CA  . LYS D  1 123 ? 12.189 -17.007 -80.405  1.00 25.12 ? 123 LYS D CA  1 
ATOM   8605  C  C   . LYS D  1 123 ? 13.406 -16.231 -79.885  1.00 23.21 ? 123 LYS D C   1 
ATOM   8606  O  O   . LYS D  1 123 ? 13.722 -15.156 -80.390  1.00 20.91 ? 123 LYS D O   1 
ATOM   8607  C  CB  . LYS D  1 123 ? 10.952 -16.558 -79.619  1.00 25.41 ? 123 LYS D CB  1 
ATOM   8608  C  CG  . LYS D  1 123 ? 9.624  -16.962 -80.239  1.00 30.00 ? 123 LYS D CG  1 
ATOM   8609  C  CD  . LYS D  1 123 ? 8.483  -16.400 -79.403  1.00 35.15 ? 123 LYS D CD  1 
ATOM   8610  C  CE  . LYS D  1 123 ? 7.197  -16.286 -80.204  1.00 49.10 ? 123 LYS D CE  1 
ATOM   8611  N  NZ  . LYS D  1 123 ? 6.162  -15.504 -79.468  1.00 50.84 ? 123 LYS D NZ  1 
ATOM   8612  N  N   . GLU D  1 124 ? 14.070 -16.750 -78.858  1.00 20.45 ? 124 GLU D N   1 
ATOM   8613  C  CA  . GLU D  1 124 ? 15.211 -16.033 -78.272  1.00 22.45 ? 124 GLU D CA  1 
ATOM   8614  C  C   . GLU D  1 124 ? 16.534 -16.578 -78.795  1.00 21.60 ? 124 GLU D C   1 
ATOM   8615  O  O   . GLU D  1 124 ? 17.426 -15.819 -79.172  1.00 23.60 ? 124 GLU D O   1 
ATOM   8616  C  CB  . GLU D  1 124 ? 15.186 -16.110 -76.738  1.00 23.31 ? 124 GLU D CB  1 
ATOM   8617  C  CG  . GLU D  1 124 ? 13.935 -15.537 -76.099  1.00 32.00 ? 124 GLU D CG  1 
ATOM   8618  C  CD  . GLU D  1 124 ? 13.876 -14.021 -76.181  1.00 41.87 ? 124 GLU D CD  1 
ATOM   8619  O  OE1 . GLU D  1 124 ? 14.912 -13.362 -75.934  1.00 44.22 ? 124 GLU D OE1 1 
ATOM   8620  O  OE2 . GLU D  1 124 ? 12.790 -13.488 -76.485  1.00 50.33 ? 124 GLU D OE2 1 
ATOM   8621  N  N   . GLY D  1 125 ? 16.666 -17.899 -78.799  1.00 18.34 ? 125 GLY D N   1 
ATOM   8622  C  CA  . GLY D  1 125 ? 17.886 -18.534 -79.269  1.00 17.26 ? 125 GLY D CA  1 
ATOM   8623  C  C   . GLY D  1 125 ? 18.313 -19.700 -78.397  1.00 16.79 ? 125 GLY D C   1 
ATOM   8624  O  O   . GLY D  1 125 ? 17.764 -19.920 -77.320  1.00 16.47 ? 125 GLY D O   1 
ATOM   8625  N  N   . ILE D  1 126 ? 19.317 -20.435 -78.857  1.00 16.81 ? 126 ILE D N   1 
ATOM   8626  C  CA  . ILE D  1 126 ? 19.719 -21.680 -78.206  1.00 15.27 ? 126 ILE D CA  1 
ATOM   8627  C  C   . ILE D  1 126 ? 20.968 -21.485 -77.348  1.00 17.21 ? 126 ILE D C   1 
ATOM   8628  O  O   . ILE D  1 126 ? 21.992 -20.979 -77.824  1.00 15.33 ? 126 ILE D O   1 
ATOM   8629  C  CB  . ILE D  1 126 ? 19.933 -22.801 -79.248  1.00 14.35 ? 126 ILE D CB  1 
ATOM   8630  C  CG1 . ILE D  1 126 ? 18.600 -23.150 -79.923  1.00 13.98 ? 126 ILE D CG1 1 
ATOM   8631  C  CG2 . ILE D  1 126 ? 20.530 -24.051 -78.600  1.00 14.20 ? 126 ILE D CG2 1 
ATOM   8632  C  CD1 . ILE D  1 126 ? 18.745 -23.888 -81.244  1.00 12.12 ? 126 ILE D CD1 1 
ATOM   8633  N  N   . GLN D  1 127 ? 20.861 -21.869 -76.077  1.00 17.94 ? 127 GLN D N   1 
ATOM   8634  C  CA  . GLN D  1 127 ? 22.014 -21.938 -75.172  1.00 16.72 ? 127 GLN D CA  1 
ATOM   8635  C  C   . GLN D  1 127 ? 22.791 -20.628 -75.061  1.00 19.29 ? 127 GLN D C   1 
ATOM   8636  O  O   . GLN D  1 127 ? 24.028 -20.616 -75.073  1.00 17.97 ? 127 GLN D O   1 
ATOM   8637  C  CB  . GLN D  1 127 ? 22.943 -23.104 -75.563  1.00 16.35 ? 127 GLN D CB  1 
ATOM   8638  C  CG  . GLN D  1 127 ? 22.287 -24.473 -75.406  1.00 15.67 ? 127 GLN D CG  1 
ATOM   8639  C  CD  . GLN D  1 127 ? 23.152 -25.625 -75.902  1.00 21.43 ? 127 GLN D CD  1 
ATOM   8640  O  OE1 . GLN D  1 127 ? 23.411 -26.588 -75.173  1.00 24.71 ? 127 GLN D OE1 1 
ATOM   8641  N  NE2 . GLN D  1 127 ? 23.597 -25.534 -77.136  1.00 16.47 ? 127 GLN D NE2 1 
ATOM   8642  N  N   . GLY D  1 128 ? 22.056 -19.528 -74.933  1.00 16.68 ? 128 GLY D N   1 
ATOM   8643  C  CA  . GLY D  1 128 ? 22.663 -18.219 -74.765  1.00 17.73 ? 128 GLY D CA  1 
ATOM   8644  C  C   . GLY D  1 128 ? 23.164 -17.564 -76.040  1.00 16.79 ? 128 GLY D C   1 
ATOM   8645  O  O   . GLY D  1 128 ? 23.789 -16.515 -75.975  1.00 19.34 ? 128 GLY D O   1 
ATOM   8646  N  N   . THR D  1 129 ? 22.917 -18.177 -77.196  1.00 15.92 ? 129 THR D N   1 
ATOM   8647  C  CA  . THR D  1 129 ? 23.326 -17.580 -78.469  1.00 16.29 ? 129 THR D CA  1 
ATOM   8648  C  C   . THR D  1 129 ? 22.080 -17.101 -79.188  1.00 17.70 ? 129 THR D C   1 
ATOM   8649  O  O   . THR D  1 129 ? 20.962 -17.348 -78.732  1.00 16.63 ? 129 THR D O   1 
ATOM   8650  C  CB  . THR D  1 129 ? 24.048 -18.582 -79.400  1.00 17.59 ? 129 THR D CB  1 
ATOM   8651  O  OG1 . THR D  1 129 ? 23.097 -19.512 -79.928  1.00 17.53 ? 129 THR D OG1 1 
ATOM   8652  C  CG2 . THR D  1 129 ? 25.155 -19.346 -78.667  1.00 17.23 ? 129 THR D CG2 1 
ATOM   8653  N  N   . LEU D  1 130 ? 22.265 -16.438 -80.325  1.00 19.81 ? 130 LEU D N   1 
ATOM   8654  C  CA  . LEU D  1 130 ? 21.129 -15.998 -81.124  1.00 18.90 ? 130 LEU D CA  1 
ATOM   8655  C  C   . LEU D  1 130 ? 20.762 -16.984 -82.238  1.00 21.68 ? 130 LEU D C   1 
ATOM   8656  O  O   . LEU D  1 130 ? 19.892 -16.692 -83.054  1.00 19.60 ? 130 LEU D O   1 
ATOM   8657  C  CB  . LEU D  1 130 ? 21.363 -14.588 -81.690  1.00 20.20 ? 130 LEU D CB  1 
ATOM   8658  C  CG  . LEU D  1 130 ? 21.473 -13.466 -80.650  1.00 21.79 ? 130 LEU D CG  1 
ATOM   8659  C  CD1 . LEU D  1 130 ? 21.798 -12.125 -81.298  1.00 23.82 ? 130 LEU D CD1 1 
ATOM   8660  C  CD2 . LEU D  1 130 ? 20.190 -13.367 -79.843  1.00 24.56 ? 130 LEU D CD2 1 
ATOM   8661  N  N   . ASN D  1 131 ? 21.413 -18.150 -82.275  1.00 19.48 ? 131 ASN D N   1 
ATOM   8662  C  CA  . ASN D  1 131 ? 20.988 -19.208 -83.196  1.00 18.61 ? 131 ASN D CA  1 
ATOM   8663  C  C   . ASN D  1 131 ? 19.647 -19.754 -82.744  1.00 19.58 ? 131 ASN D C   1 
ATOM   8664  O  O   . ASN D  1 131 ? 19.483 -20.153 -81.592  1.00 17.50 ? 131 ASN D O   1 
ATOM   8665  C  CB  . ASN D  1 131 ? 21.998 -20.353 -83.247  1.00 20.28 ? 131 ASN D CB  1 
ATOM   8666  C  CG  . ASN D  1 131 ? 23.377 -19.893 -83.660  1.00 20.88 ? 131 ASN D CG  1 
ATOM   8667  O  OD1 . ASN D  1 131 ? 24.308 -19.889 -82.851  1.00 25.77 ? 131 ASN D OD1 1 
ATOM   8668  N  ND2 . ASN D  1 131 ? 23.515 -19.490 -84.912  1.00 16.77 ? 131 ASN D ND2 1 
ATOM   8669  N  N   . LYS D  1 132 ? 18.685 -19.786 -83.649  1.00 17.40 ? 132 LYS D N   1 
ATOM   8670  C  CA  . LYS D  1 132 ? 17.323 -20.121 -83.255  1.00 17.94 ? 132 LYS D CA  1 
ATOM   8671  C  C   . LYS D  1 132 ? 16.891 -21.503 -83.740  1.00 16.76 ? 132 LYS D C   1 
ATOM   8672  O  O   . LYS D  1 132 ? 17.320 -21.956 -84.799  1.00 17.82 ? 132 LYS D O   1 
ATOM   8673  C  CB  . LYS D  1 132 ? 16.367 -19.026 -83.737  1.00 17.76 ? 132 LYS D CB  1 
ATOM   8674  C  CG  . LYS D  1 132 ? 16.537 -17.718 -82.959  1.00 21.38 ? 132 LYS D CG  1 
ATOM   8675  C  CD  . LYS D  1 132 ? 16.034 -16.527 -83.754  1.00 24.11 ? 132 LYS D CD  1 
ATOM   8676  C  CE  . LYS D  1 132 ? 15.871 -15.294 -82.875  1.00 25.13 ? 132 LYS D CE  1 
ATOM   8677  N  NZ  . LYS D  1 132 ? 17.129 -14.947 -82.167  1.00 29.88 ? 132 LYS D NZ  1 
ATOM   8678  N  N   . ALA D  1 133 ? 16.056 -22.170 -82.944  1.00 15.32 ? 133 ALA D N   1 
ATOM   8679  C  CA  . ALA D  1 133 ? 15.504 -23.482 -83.301  1.00 14.89 ? 133 ALA D CA  1 
ATOM   8680  C  C   . ALA D  1 133 ? 14.501 -23.360 -84.429  1.00 15.92 ? 133 ALA D C   1 
ATOM   8681  O  O   . ALA D  1 133 ? 13.614 -22.495 -84.385  1.00 14.91 ? 133 ALA D O   1 
ATOM   8682  C  CB  . ALA D  1 133 ? 14.831 -24.122 -82.093  1.00 11.91 ? 133 ALA D CB  1 
ATOM   8683  N  N   . GLY D  1 134 ? 14.616 -24.250 -85.412  1.00 13.39 ? 134 GLY D N   1 
ATOM   8684  C  CA  . GLY D  1 134 ? 13.740 -24.235 -86.578  1.00 13.59 ? 134 GLY D CA  1 
ATOM   8685  C  C   . GLY D  1 134 ? 12.613 -25.255 -86.544  1.00 15.60 ? 134 GLY D C   1 
ATOM   8686  O  O   . GLY D  1 134 ? 11.786 -25.290 -87.453  1.00 14.30 ? 134 GLY D O   1 
ATOM   8687  N  N   . PHE D  1 135 ? 12.578 -26.078 -85.493  1.00 13.06 ? 135 PHE D N   1 
ATOM   8688  C  CA  . PHE D  1 135 ? 11.594 -27.152 -85.355  1.00 14.41 ? 135 PHE D CA  1 
ATOM   8689  C  C   . PHE D  1 135 ? 11.626 -27.683 -83.924  1.00 13.32 ? 135 PHE D C   1 
ATOM   8690  O  O   . PHE D  1 135 ? 12.510 -27.328 -83.154  1.00 14.91 ? 135 PHE D O   1 
ATOM   8691  C  CB  . PHE D  1 135 ? 11.898 -28.306 -86.325  1.00 12.04 ? 135 PHE D CB  1 
ATOM   8692  C  CG  . PHE D  1 135 ? 13.247 -28.939 -86.108  1.00 12.79 ? 135 PHE D CG  1 
ATOM   8693  C  CD1 . PHE D  1 135 ? 14.365 -28.463 -86.775  1.00 13.06 ? 135 PHE D CD1 1 
ATOM   8694  C  CD2 . PHE D  1 135 ? 13.399 -30.011 -85.236  1.00 12.04 ? 135 PHE D CD2 1 
ATOM   8695  C  CE1 . PHE D  1 135 ? 15.611 -29.037 -86.574  1.00 13.65 ? 135 PHE D CE1 1 
ATOM   8696  C  CE2 . PHE D  1 135 ? 14.639 -30.597 -85.034  1.00 14.12 ? 135 PHE D CE2 1 
ATOM   8697  C  CZ  . PHE D  1 135 ? 15.749 -30.110 -85.705  1.00 14.50 ? 135 PHE D CZ  1 
ATOM   8698  N  N   . VAL D  1 136 ? 10.662 -28.530 -83.575  1.00 13.27 ? 136 VAL D N   1 
ATOM   8699  C  CA  . VAL D  1 136 ? 10.648 -29.199 -82.270  1.00 13.64 ? 136 VAL D CA  1 
ATOM   8700  C  C   . VAL D  1 136 ? 10.784 -30.708 -82.470  1.00 14.33 ? 136 VAL D C   1 
ATOM   8701  O  O   . VAL D  1 136 ? 10.129 -31.288 -83.336  1.00 14.73 ? 136 VAL D O   1 
ATOM   8702  C  CB  . VAL D  1 136 ? 9.357  -28.909 -81.483  1.00 15.85 ? 136 VAL D CB  1 
ATOM   8703  C  CG1 . VAL D  1 136 ? 9.402  -29.575 -80.104  1.00 16.21 ? 136 VAL D CG1 1 
ATOM   8704  C  CG2 . VAL D  1 136 ? 9.148  -27.405 -81.348  1.00 15.78 ? 136 VAL D CG2 1 
HETATM 8705  N  N   . KCX D  1 137 ? 11.649 -31.333 -81.674  1.00 13.82 ? 137 KCX D N   1 
HETATM 8706  C  CA  . KCX D  1 137 ? 11.880 -32.771 -81.771  1.00 13.12 ? 137 KCX D CA  1 
HETATM 8707  C  CB  . KCX D  1 137 ? 13.388 -33.024 -81.918  1.00 14.04 ? 137 KCX D CB  1 
HETATM 8708  C  CG  . KCX D  1 137 ? 13.785 -34.479 -81.641  1.00 15.59 ? 137 KCX D CG  1 
HETATM 8709  C  CD  . KCX D  1 137 ? 13.397 -35.417 -82.788  1.00 14.92 ? 137 KCX D CD  1 
HETATM 8710  C  CE  . KCX D  1 137 ? 13.816 -36.860 -82.484  1.00 17.15 ? 137 KCX D CE  1 
HETATM 8711  N  NZ  . KCX D  1 137 ? 15.221 -37.103 -82.784  1.00 16.24 ? 137 KCX D NZ  1 
HETATM 8712  C  C   . KCX D  1 137 ? 11.329 -33.417 -80.536  1.00 13.40 ? 137 KCX D C   1 
HETATM 8713  O  O   . KCX D  1 137 ? 11.585 -32.957 -79.418  1.00 14.88 ? 137 KCX D O   1 
HETATM 8714  C  CX  . KCX D  1 137 ? 15.735 -38.284 -83.154  1.00 13.75 ? 137 KCX D CX  1 
HETATM 8715  O  OQ1 . KCX D  1 137 ? 17.044 -38.268 -83.388  1.00 13.77 ? 137 KCX D OQ1 1 
HETATM 8716  O  OQ2 . KCX D  1 137 ? 15.113 -39.363 -83.299  1.00 17.11 ? 137 KCX D OQ2 1 
ATOM   8717  N  N   . ILE D  1 138 ? 10.536 -34.471 -80.720  1.00 13.32 ? 138 ILE D N   1 
ATOM   8718  C  CA  . ILE D  1 138 ? 10.035 -35.258 -79.597  1.00 14.31 ? 138 ILE D CA  1 
ATOM   8719  C  C   . ILE D  1 138 ? 10.230 -36.750 -79.870  1.00 15.03 ? 138 ILE D C   1 
ATOM   8720  O  O   . ILE D  1 138 ? 10.536 -37.143 -80.994  1.00 15.76 ? 138 ILE D O   1 
ATOM   8721  C  CB  . ILE D  1 138 ? 8.545  -34.977 -79.330  1.00 16.62 ? 138 ILE D CB  1 
ATOM   8722  C  CG1 . ILE D  1 138 ? 7.700  -35.414 -80.529  1.00 19.83 ? 138 ILE D CG1 1 
ATOM   8723  C  CG2 . ILE D  1 138 ? 8.324  -33.504 -79.022  1.00 15.51 ? 138 ILE D CG2 1 
ATOM   8724  C  CD1 . ILE D  1 138 ? 6.250  -35.003 -80.415  1.00 26.31 ? 138 ILE D CD1 1 
ATOM   8725  N  N   . ALA D  1 139 ? 10.041 -37.581 -78.851  1.00 14.53 ? 139 ALA D N   1 
ATOM   8726  C  CA  . ALA D  1 139 ? 10.345 -39.001 -78.992  1.00 17.25 ? 139 ALA D CA  1 
ATOM   8727  C  C   . ALA D  1 139 ? 9.406  -39.904 -78.207  1.00 20.67 ? 139 ALA D C   1 
ATOM   8728  O  O   . ALA D  1 139 ? 8.796  -39.495 -77.216  1.00 19.74 ? 139 ALA D O   1 
ATOM   8729  C  CB  . ALA D  1 139 ? 11.789 -39.279 -78.580  1.00 15.48 ? 139 ALA D CB  1 
ATOM   8730  N  N   . ALA D  1 140 ? 9.304  -41.142 -78.674  1.00 19.05 ? 140 ALA D N   1 
ATOM   8731  C  CA  . ALA D  1 140 ? 8.718  -42.230 -77.907  1.00 19.54 ? 140 ALA D CA  1 
ATOM   8732  C  C   . ALA D  1 140 ? 9.310  -43.505 -78.478  1.00 20.46 ? 140 ALA D C   1 
ATOM   8733  O  O   . ALA D  1 140 ? 9.696  -43.538 -79.648  1.00 19.77 ? 140 ALA D O   1 
ATOM   8734  C  CB  . ALA D  1 140 ? 7.204  -42.237 -78.040  1.00 22.48 ? 140 ALA D CB  1 
ATOM   8735  N  N   . ASP D  1 141 ? 9.398  -44.552 -77.669  1.00 21.06 ? 141 ASP D N   1 
ATOM   8736  C  CA  . ASP D  1 141 ? 9.964  -45.789 -78.172  1.00 21.42 ? 141 ASP D CA  1 
ATOM   8737  C  C   . ASP D  1 141 ? 9.281  -47.002 -77.557  1.00 23.25 ? 141 ASP D C   1 
ATOM   8738  O  O   . ASP D  1 141 ? 8.059  -47.008 -77.396  1.00 22.51 ? 141 ASP D O   1 
ATOM   8739  C  CB  . ASP D  1 141 ? 11.484 -45.813 -77.973  1.00 21.76 ? 141 ASP D CB  1 
ATOM   8740  C  CG  . ASP D  1 141 ? 12.185 -46.738 -78.956  1.00 27.51 ? 141 ASP D CG  1 
ATOM   8741  O  OD1 . ASP D  1 141 ? 11.982 -47.972 -78.869  1.00 29.60 ? 141 ASP D OD1 1 
ATOM   8742  O  OD2 . ASP D  1 141 ? 12.930 -46.231 -79.820  1.00 22.73 ? 141 ASP D OD2 1 
ATOM   8743  N  N   . GLU D  1 142 ? 10.058 -48.027 -77.224  1.00 24.33 ? 142 GLU D N   1 
ATOM   8744  C  CA  . GLU D  1 142 ? 9.487  -49.287 -76.737  1.00 27.48 ? 142 GLU D CA  1 
ATOM   8745  C  C   . GLU D  1 142 ? 8.575  -49.125 -75.529  1.00 24.12 ? 142 GLU D C   1 
ATOM   8746  O  O   . GLU D  1 142 ? 7.569  -49.821 -75.413  1.00 26.58 ? 142 GLU D O   1 
ATOM   8747  C  CB  . GLU D  1 142 ? 10.586 -50.308 -76.432  1.00 31.32 ? 142 GLU D CB  1 
ATOM   8748  C  CG  . GLU D  1 142 ? 11.295 -50.827 -77.670  1.00 48.63 ? 142 GLU D CG  1 
ATOM   8749  C  CD  . GLU D  1 142 ? 12.154 -52.041 -77.382  1.00 69.63 ? 142 GLU D CD  1 
ATOM   8750  O  OE1 . GLU D  1 142 ? 11.972 -52.656 -76.309  1.00 73.18 ? 142 GLU D OE1 1 
ATOM   8751  O  OE2 . GLU D  1 142 ? 13.007 -52.383 -78.231  1.00 65.84 ? 142 GLU D OE2 1 
ATOM   8752  N  N   . PRO D  1 143 ? 8.926  -48.223 -74.607  1.00 23.46 ? 143 PRO D N   1 
ATOM   8753  C  CA  . PRO D  1 143 ? 8.055  -48.060 -73.442  1.00 23.50 ? 143 PRO D CA  1 
ATOM   8754  C  C   . PRO D  1 143 ? 6.685  -47.490 -73.799  1.00 25.76 ? 143 PRO D C   1 
ATOM   8755  O  O   . PRO D  1 143 ? 5.773  -47.523 -72.972  1.00 28.48 ? 143 PRO D O   1 
ATOM   8756  C  CB  . PRO D  1 143 ? 8.831  -47.077 -72.556  1.00 24.32 ? 143 PRO D CB  1 
ATOM   8757  C  CG  . PRO D  1 143 ? 10.256 -47.224 -72.988  1.00 21.96 ? 143 PRO D CG  1 
ATOM   8758  C  CD  . PRO D  1 143 ? 10.182 -47.465 -74.470  1.00 22.41 ? 143 PRO D CD  1 
ATOM   8759  N  N   . GLY D  1 144 ? 6.539  -46.971 -75.013  1.00 24.24 ? 144 GLY D N   1 
ATOM   8760  C  CA  . GLY D  1 144 ? 5.246  -46.453 -75.466  1.00 23.74 ? 144 GLY D CA  1 
ATOM   8761  C  C   . GLY D  1 144 ? 4.991  -45.026 -75.007  1.00 25.35 ? 144 GLY D C   1 
ATOM   8762  O  O   . GLY D  1 144 ? 5.902  -44.340 -74.551  1.00 23.46 ? 144 GLY D O   1 
ATOM   8763  N  N   . ILE D  1 145 ? 3.748  -44.572 -75.123  1.00 23.76 ? 145 ILE D N   1 
ATOM   8764  C  CA  . ILE D  1 145 ? 3.415  -43.211 -74.718  1.00 23.99 ? 145 ILE D CA  1 
ATOM   8765  C  C   . ILE D  1 145 ? 3.226  -43.111 -73.208  1.00 25.07 ? 145 ILE D C   1 
ATOM   8766  O  O   . ILE D  1 145 ? 2.102  -43.190 -72.718  1.00 24.07 ? 145 ILE D O   1 
ATOM   8767  C  CB  . ILE D  1 145 ? 2.139  -42.706 -75.415  1.00 25.04 ? 145 ILE D CB  1 
ATOM   8768  C  CG1 . ILE D  1 145 ? 2.215  -42.961 -76.922  1.00 26.26 ? 145 ILE D CG1 1 
ATOM   8769  C  CG2 . ILE D  1 145 ? 1.921  -41.229 -75.116  1.00 23.66 ? 145 ILE D CG2 1 
ATOM   8770  C  CD1 . ILE D  1 145 ? 3.280  -42.153 -77.634  1.00 23.05 ? 145 ILE D CD1 1 
ATOM   8771  N  N   . THR D  1 146 ? 4.325  -42.949 -72.474  1.00 22.44 ? 146 THR D N   1 
ATOM   8772  C  CA  . THR D  1 146 ? 4.244  -42.780 -71.025  1.00 23.01 ? 146 THR D CA  1 
ATOM   8773  C  C   . THR D  1 146 ? 3.647  -41.415 -70.710  1.00 22.28 ? 146 THR D C   1 
ATOM   8774  O  O   . THR D  1 146 ? 3.450  -40.590 -71.601  1.00 23.55 ? 146 THR D O   1 
ATOM   8775  C  CB  . THR D  1 146 ? 5.627  -42.887 -70.339  1.00 20.99 ? 146 THR D CB  1 
ATOM   8776  O  OG1 . THR D  1 146 ? 6.468  -41.799 -70.765  1.00 19.83 ? 146 THR D OG1 1 
ATOM   8777  C  CG2 . THR D  1 146 ? 6.293  -44.217 -70.657  1.00 19.92 ? 146 THR D CG2 1 
ATOM   8778  N  N   . LYS D  1 147 ? 3.357  -41.184 -69.438  1.00 22.72 ? 147 LYS D N   1 
ATOM   8779  C  CA  . LYS D  1 147 ? 2.790  -39.919 -68.998  1.00 25.87 ? 147 LYS D CA  1 
ATOM   8780  C  C   . LYS D  1 147 ? 3.704  -38.742 -69.365  1.00 25.86 ? 147 LYS D C   1 
ATOM   8781  O  O   . LYS D  1 147 ? 3.247  -37.739 -69.912  1.00 22.54 ? 147 LYS D O   1 
ATOM   8782  C  CB  . LYS D  1 147 ? 2.558  -39.960 -67.490  1.00 27.95 ? 147 LYS D CB  1 
ATOM   8783  C  CG  . LYS D  1 147 ? 1.863  -38.739 -66.920  1.00 43.16 ? 147 LYS D CG  1 
ATOM   8784  C  CD  . LYS D  1 147 ? 1.490  -38.971 -65.464  1.00 61.26 ? 147 LYS D CD  1 
ATOM   8785  C  CE  . LYS D  1 147 ? 0.707  -40.267 -65.304  1.00 67.42 ? 147 LYS D CE  1 
ATOM   8786  N  NZ  . LYS D  1 147 ? 0.346  -40.539 -63.886  1.00 77.40 ? 147 LYS D NZ  1 
ATOM   8787  N  N   . ASP D  1 148 ? 4.991  -38.869 -69.055  1.00 20.99 ? 148 ASP D N   1 
ATOM   8788  C  CA  . ASP D  1 148 ? 5.957  -37.805 -69.352  1.00 22.33 ? 148 ASP D CA  1 
ATOM   8789  C  C   . ASP D  1 148 ? 6.188  -37.643 -70.854  1.00 21.31 ? 148 ASP D C   1 
ATOM   8790  O  O   . ASP D  1 148 ? 6.273  -36.524 -71.361  1.00 20.62 ? 148 ASP D O   1 
ATOM   8791  C  CB  . ASP D  1 148 ? 7.281  -38.055 -68.627  1.00 23.06 ? 148 ASP D CB  1 
ATOM   8792  C  CG  . ASP D  1 148 ? 7.229  -37.644 -67.165  1.00 25.50 ? 148 ASP D CG  1 
ATOM   8793  O  OD1 . ASP D  1 148 ? 8.254  -37.782 -66.460  1.00 26.91 ? 148 ASP D OD1 1 
ATOM   8794  O  OD2 . ASP D  1 148 ? 6.159  -37.177 -66.721  1.00 28.21 ? 148 ASP D OD2 1 
ATOM   8795  N  N   . VAL D  1 149 ? 6.294  -38.761 -71.565  1.00 19.15 ? 149 VAL D N   1 
ATOM   8796  C  CA  . VAL D  1 149 ? 6.400  -38.708 -73.017  1.00 19.42 ? 149 VAL D CA  1 
ATOM   8797  C  C   . VAL D  1 149 ? 5.218  -37.919 -73.592  1.00 20.80 ? 149 VAL D C   1 
ATOM   8798  O  O   . VAL D  1 149 ? 5.388  -37.107 -74.491  1.00 19.20 ? 149 VAL D O   1 
ATOM   8799  C  CB  . VAL D  1 149 ? 6.493  -40.120 -73.633  1.00 22.14 ? 149 VAL D CB  1 
ATOM   8800  C  CG1 . VAL D  1 149 ? 6.091  -40.109 -75.100  1.00 19.26 ? 149 VAL D CG1 1 
ATOM   8801  C  CG2 . VAL D  1 149 ? 7.905  -40.671 -73.459  1.00 20.04 ? 149 VAL D CG2 1 
ATOM   8802  N  N   . GLU D  1 150 ? 4.027  -38.132 -73.044  1.00 21.46 ? 150 GLU D N   1 
ATOM   8803  C  CA  . GLU D  1 150 ? 2.846  -37.408 -73.510  1.00 22.99 ? 150 GLU D CA  1 
ATOM   8804  C  C   . GLU D  1 150 ? 2.888  -35.917 -73.178  1.00 21.77 ? 150 GLU D C   1 
ATOM   8805  O  O   . GLU D  1 150 ? 2.434  -35.083 -73.967  1.00 20.82 ? 150 GLU D O   1 
ATOM   8806  C  CB  . GLU D  1 150 ? 1.567  -38.033 -72.955  1.00 26.48 ? 150 GLU D CB  1 
ATOM   8807  C  CG  . GLU D  1 150 ? 0.309  -37.302 -73.388  1.00 29.11 ? 150 GLU D CG  1 
ATOM   8808  C  CD  . GLU D  1 150 ? -0.950 -38.073 -73.062  1.00 39.24 ? 150 GLU D CD  1 
ATOM   8809  O  OE1 . GLU D  1 150 ? -2.044 -37.473 -73.121  1.00 43.83 ? 150 GLU D OE1 1 
ATOM   8810  O  OE2 . GLU D  1 150 ? -0.842 -39.276 -72.745  1.00 44.17 ? 150 GLU D OE2 1 
ATOM   8811  N  N   . LYS D  1 151 ? 3.409  -35.577 -72.005  1.00 19.08 ? 151 LYS D N   1 
ATOM   8812  C  CA  . LYS D  1 151 ? 3.574  -34.170 -71.644  1.00 21.01 ? 151 LYS D CA  1 
ATOM   8813  C  C   . LYS D  1 151 ? 4.394  -33.449 -72.703  1.00 17.26 ? 151 LYS D C   1 
ATOM   8814  O  O   . LYS D  1 151 ? 4.071  -32.334 -73.100  1.00 18.87 ? 151 LYS D O   1 
ATOM   8815  C  CB  . LYS D  1 151 ? 4.277  -34.025 -70.293  1.00 22.34 ? 151 LYS D CB  1 
ATOM   8816  C  CG  . LYS D  1 151 ? 3.410  -34.317 -69.083  1.00 26.15 ? 151 LYS D CG  1 
ATOM   8817  C  CD  . LYS D  1 151 ? 4.263  -34.227 -67.828  1.00 31.19 ? 151 LYS D CD  1 
ATOM   8818  C  CE  . LYS D  1 151 ? 3.514  -34.705 -66.603  1.00 38.10 ? 151 LYS D CE  1 
ATOM   8819  N  NZ  . LYS D  1 151 ? 4.466  -34.838 -65.464  1.00 38.16 ? 151 LYS D NZ  1 
ATOM   8820  N  N   . VAL D  1 152 ? 5.466  -34.096 -73.148  1.00 16.54 ? 152 VAL D N   1 
ATOM   8821  C  CA  . VAL D  1 152 ? 6.388  -33.501 -74.107  1.00 15.07 ? 152 VAL D CA  1 
ATOM   8822  C  C   . VAL D  1 152 ? 5.712  -33.337 -75.468  1.00 17.16 ? 152 VAL D C   1 
ATOM   8823  O  O   . VAL D  1 152 ? 5.881  -32.313 -76.144  1.00 18.33 ? 152 VAL D O   1 
ATOM   8824  C  CB  . VAL D  1 152 ? 7.687  -34.340 -74.228  1.00 14.93 ? 152 VAL D CB  1 
ATOM   8825  C  CG1 . VAL D  1 152 ? 8.547  -33.843 -75.383  1.00 15.21 ? 152 VAL D CG1 1 
ATOM   8826  C  CG2 . VAL D  1 152 ? 8.472  -34.302 -72.916  1.00 14.46 ? 152 VAL D CG2 1 
ATOM   8827  N  N   . ILE D  1 153 ? 4.949  -34.345 -75.869  1.00 14.08 ? 153 ILE D N   1 
ATOM   8828  C  CA  . ILE D  1 153 ? 4.187  -34.256 -77.106  1.00 17.09 ? 153 ILE D CA  1 
ATOM   8829  C  C   . ILE D  1 153 ? 3.256  -33.044 -77.053  1.00 20.55 ? 153 ILE D C   1 
ATOM   8830  O  O   . ILE D  1 153 ? 3.198  -32.259 -77.992  1.00 21.73 ? 153 ILE D O   1 
ATOM   8831  C  CB  . ILE D  1 153 ? 3.361  -35.531 -77.361  1.00 17.19 ? 153 ILE D CB  1 
ATOM   8832  C  CG1 . ILE D  1 153 ? 4.295  -36.723 -77.626  1.00 18.48 ? 153 ILE D CG1 1 
ATOM   8833  C  CG2 . ILE D  1 153 ? 2.431  -35.327 -78.546  1.00 18.09 ? 153 ILE D CG2 1 
ATOM   8834  C  CD1 . ILE D  1 153 ? 3.595  -38.068 -77.607  1.00 21.34 ? 153 ILE D CD1 1 
ATOM   8835  N  N   . ARG D  1 154 ? 2.540  -32.893 -75.941  1.00 20.25 ? 154 ARG D N   1 
ATOM   8836  C  CA  . ARG D  1 154 ? 1.594  -31.791 -75.794  1.00 19.73 ? 154 ARG D CA  1 
ATOM   8837  C  C   . ARG D  1 154 ? 2.290  -30.434 -75.774  1.00 18.32 ? 154 ARG D C   1 
ATOM   8838  O  O   . ARG D  1 154 ? 1.779  -29.466 -76.334  1.00 19.03 ? 154 ARG D O   1 
ATOM   8839  C  CB  . ARG D  1 154 ? 0.709  -31.995 -74.557  1.00 21.64 ? 154 ARG D CB  1 
ATOM   8840  C  CG  . ARG D  1 154 ? -0.124 -33.264 -74.669  1.00 25.34 ? 154 ARG D CG  1 
ATOM   8841  C  CD  . ARG D  1 154 ? -1.130 -33.445 -73.545  1.00 28.74 ? 154 ARG D CD  1 
ATOM   8842  N  NE  . ARG D  1 154 ? -1.942 -34.634 -73.793  1.00 32.52 ? 154 ARG D NE  1 
ATOM   8843  C  CZ  . ARG D  1 154 ? -3.049 -34.646 -74.533  1.00 35.54 ? 154 ARG D CZ  1 
ATOM   8844  N  NH1 . ARG D  1 154 ? -3.717 -35.777 -74.715  1.00 34.54 ? 154 ARG D NH1 1 
ATOM   8845  N  NH2 . ARG D  1 154 ? -3.490 -33.528 -75.091  1.00 31.19 ? 154 ARG D NH2 1 
ATOM   8846  N  N   . ALA D  1 155 ? 3.466  -30.377 -75.157  1.00 16.77 ? 155 ALA D N   1 
ATOM   8847  C  CA  . ALA D  1 155 ? 4.278  -29.160 -75.147  1.00 15.75 ? 155 ALA D CA  1 
ATOM   8848  C  C   . ALA D  1 155 ? 4.732  -28.794 -76.552  1.00 16.64 ? 155 ALA D C   1 
ATOM   8849  O  O   . ALA D  1 155 ? 4.754  -27.616 -76.916  1.00 18.35 ? 155 ALA D O   1 
ATOM   8850  C  CB  . ALA D  1 155 ? 5.488  -29.326 -74.236  1.00 14.63 ? 155 ALA D CB  1 
ATOM   8851  N  N   . ALA D  1 156 ? 5.111  -29.798 -77.337  1.00 15.44 ? 156 ALA D N   1 
ATOM   8852  C  CA  . ALA D  1 156 ? 5.498  -29.561 -78.729  1.00 14.28 ? 156 ALA D CA  1 
ATOM   8853  C  C   . ALA D  1 156 ? 4.337  -28.948 -79.521  1.00 16.77 ? 156 ALA D C   1 
ATOM   8854  O  O   . ALA D  1 156 ? 4.538  -28.041 -80.327  1.00 15.97 ? 156 ALA D O   1 
ATOM   8855  C  CB  . ALA D  1 156 ? 5.959  -30.851 -79.379  1.00 14.27 ? 156 ALA D CB  1 
ATOM   8856  N  N   . ALA D  1 157 ? 3.125  -29.451 -79.298  1.00 16.96 ? 157 ALA D N   1 
ATOM   8857  C  CA  . ALA D  1 157 ? 1.943  -28.881 -79.960  1.00 17.81 ? 157 ALA D CA  1 
ATOM   8858  C  C   . ALA D  1 157 ? 1.751  -27.400 -79.633  1.00 18.00 ? 157 ALA D C   1 
ATOM   8859  O  O   . ALA D  1 157 ? 1.427  -26.604 -80.515  1.00 20.96 ? 157 ALA D O   1 
ATOM   8860  C  CB  . ALA D  1 157 ? 0.684  -29.668 -79.607  1.00 16.83 ? 157 ALA D CB  1 
ATOM   8861  N  N   . ILE D  1 158 ? 1.929  -27.036 -78.366  1.00 19.31 ? 158 ILE D N   1 
ATOM   8862  C  CA  . ILE D  1 158 ? 1.817  -25.639 -77.956  1.00 21.04 ? 158 ILE D CA  1 
ATOM   8863  C  C   . ILE D  1 158 ? 2.886  -24.803 -78.652  1.00 23.07 ? 158 ILE D C   1 
ATOM   8864  O  O   . ILE D  1 158 ? 2.608  -23.708 -79.139  1.00 19.67 ? 158 ILE D O   1 
ATOM   8865  C  CB  . ILE D  1 158 ? 1.944  -25.472 -76.430  1.00 24.58 ? 158 ILE D CB  1 
ATOM   8866  C  CG1 . ILE D  1 158 ? 0.785  -26.167 -75.723  1.00 24.27 ? 158 ILE D CG1 1 
ATOM   8867  C  CG2 . ILE D  1 158 ? 1.975  -23.998 -76.042  1.00 22.25 ? 158 ILE D CG2 1 
ATOM   8868  C  CD1 . ILE D  1 158 ? 0.978  -26.285 -74.226  1.00 24.92 ? 158 ILE D CD1 1 
ATOM   8869  N  N   . ALA D  1 159 ? 4.110  -25.320 -78.715  1.00 19.50 ? 159 ALA D N   1 
ATOM   8870  C  CA  . ALA D  1 159 ? 5.184  -24.585 -79.383  1.00 19.18 ? 159 ALA D CA  1 
ATOM   8871  C  C   . ALA D  1 159 ? 4.911  -24.397 -80.876  1.00 19.84 ? 159 ALA D C   1 
ATOM   8872  O  O   . ALA D  1 159 ? 5.174  -23.327 -81.431  1.00 18.99 ? 159 ALA D O   1 
ATOM   8873  C  CB  . ALA D  1 159 ? 6.531  -25.260 -79.160  1.00 20.26 ? 159 ALA D CB  1 
ATOM   8874  N  N   . ASN D  1 160 ? 4.377  -25.428 -81.528  1.00 20.55 ? 160 ASN D N   1 
ATOM   8875  C  CA  . ASN D  1 160 ? 4.048  -25.313 -82.950  1.00 18.16 ? 160 ASN D CA  1 
ATOM   8876  C  C   . ASN D  1 160 ? 2.963  -24.265 -83.198  1.00 20.45 ? 160 ASN D C   1 
ATOM   8877  O  O   . ASN D  1 160 ? 3.101  -23.416 -84.077  1.00 19.98 ? 160 ASN D O   1 
ATOM   8878  C  CB  . ASN D  1 160 ? 3.618  -26.659 -83.530  1.00 18.69 ? 160 ASN D CB  1 
ATOM   8879  C  CG  . ASN D  1 160 ? 2.842  -26.514 -84.829  1.00 21.76 ? 160 ASN D CG  1 
ATOM   8880  O  OD1 . ASN D  1 160 ? 1.611  -26.434 -84.820  1.00 22.64 ? 160 ASN D OD1 1 
ATOM   8881  N  ND2 . ASN D  1 160 ? 3.558  -26.461 -85.955  1.00 17.55 ? 160 ASN D ND2 1 
ATOM   8882  N  N   . LYS D  1 161 ? 1.888  -24.324 -82.418  1.00 20.19 ? 161 LYS D N   1 
ATOM   8883  C  CA  . LYS D  1 161 ? 0.771  -23.396 -82.589  1.00 22.65 ? 161 LYS D CA  1 
ATOM   8884  C  C   . LYS D  1 161 ? 1.203  -21.955 -82.353  1.00 22.72 ? 161 LYS D C   1 
ATOM   8885  O  O   . LYS D  1 161 ? 0.743  -21.036 -83.023  1.00 21.07 ? 161 LYS D O   1 
ATOM   8886  C  CB  . LYS D  1 161 ? -0.386 -23.772 -81.660  1.00 25.03 ? 161 LYS D CB  1 
ATOM   8887  C  CG  . LYS D  1 161 ? -1.112 -25.045 -82.078  1.00 26.86 ? 161 LYS D CG  1 
ATOM   8888  C  CD  . LYS D  1 161 ? -2.367 -25.273 -81.244  1.00 32.34 ? 161 LYS D CD  1 
ATOM   8889  C  CE  . LYS D  1 161 ? -2.021 -25.789 -79.858  1.00 31.61 ? 161 LYS D CE  1 
ATOM   8890  N  NZ  . LYS D  1 161 ? -3.231 -26.160 -79.073  1.00 34.43 ? 161 LYS D NZ  1 
ATOM   8891  N  N   . GLU D  1 162 ? 2.109  -21.764 -81.407  1.00 22.00 ? 162 GLU D N   1 
ATOM   8892  C  CA  . GLU D  1 162 ? 2.614  -20.431 -81.088  1.00 23.96 ? 162 GLU D CA  1 
ATOM   8893  C  C   . GLU D  1 162 ? 3.617  -19.873 -82.120  1.00 25.01 ? 162 GLU D C   1 
ATOM   8894  O  O   . GLU D  1 162 ? 3.566  -18.695 -82.460  1.00 25.05 ? 162 GLU D O   1 
ATOM   8895  C  CB  . GLU D  1 162 ? 3.238  -20.444 -79.691  1.00 25.57 ? 162 GLU D CB  1 
ATOM   8896  C  CG  . GLU D  1 162 ? 3.887  -19.135 -79.283  1.00 35.61 ? 162 GLU D CG  1 
ATOM   8897  C  CD  . GLU D  1 162 ? 2.872  -18.037 -79.036  1.00 44.97 ? 162 GLU D CD  1 
ATOM   8898  O  OE1 . GLU D  1 162 ? 3.244  -16.851 -79.158  1.00 57.47 ? 162 GLU D OE1 1 
ATOM   8899  O  OE2 . GLU D  1 162 ? 1.704  -18.361 -78.722  1.00 43.36 ? 162 GLU D OE2 1 
ATOM   8900  N  N   . THR D  1 163 ? 4.519  -20.715 -82.620  1.00 20.03 ? 163 THR D N   1 
ATOM   8901  C  CA  . THR D  1 163 ? 5.635  -20.241 -83.452  1.00 18.75 ? 163 THR D CA  1 
ATOM   8902  C  C   . THR D  1 163 ? 5.594  -20.751 -84.895  1.00 19.95 ? 163 THR D C   1 
ATOM   8903  O  O   . THR D  1 163 ? 6.334  -20.269 -85.753  1.00 18.69 ? 163 THR D O   1 
ATOM   8904  C  CB  . THR D  1 163 ? 6.993  -20.670 -82.858  1.00 18.10 ? 163 THR D CB  1 
ATOM   8905  O  OG1 . THR D  1 163 ? 7.145  -22.087 -83.008  1.00 17.86 ? 163 THR D OG1 1 
ATOM   8906  C  CG2 . THR D  1 163 ? 7.084  -20.297 -81.383  1.00 17.37 ? 163 THR D CG2 1 
ATOM   8907  N  N   . LYS D  1 164 ? 4.757  -21.749 -85.150  1.00 18.09 ? 164 LYS D N   1 
ATOM   8908  C  CA  . LYS D  1 164 ? 4.575  -22.283 -86.498  1.00 19.31 ? 164 LYS D CA  1 
ATOM   8909  C  C   . LYS D  1 164 ? 5.724  -23.165 -87.006  1.00 20.78 ? 164 LYS D C   1 
ATOM   8910  O  O   . LYS D  1 164 ? 5.706  -23.602 -88.156  1.00 18.86 ? 164 LYS D O   1 
ATOM   8911  C  CB  . LYS D  1 164 ? 4.286  -21.151 -87.498  1.00 22.90 ? 164 LYS D CB  1 
ATOM   8912  C  CG  . LYS D  1 164 ? 3.138  -20.234 -87.088  1.00 28.18 ? 164 LYS D CG  1 
ATOM   8913  C  CD  . LYS D  1 164 ? 1.914  -21.032 -86.664  1.00 30.27 ? 164 LYS D CD  1 
ATOM   8914  C  CE  . LYS D  1 164 ? 0.728  -20.124 -86.366  1.00 34.90 ? 164 LYS D CE  1 
ATOM   8915  N  NZ  . LYS D  1 164 ? 1.130  -18.923 -85.579  1.00 37.95 ? 164 LYS D NZ  1 
ATOM   8916  N  N   . VAL D  1 165 ? 6.717  -23.449 -86.167  1.00 19.62 ? 165 VAL D N   1 
ATOM   8917  C  CA  . VAL D  1 165 ? 7.755  -24.397 -86.588  1.00 17.13 ? 165 VAL D CA  1 
ATOM   8918  C  C   . VAL D  1 165 ? 7.206  -25.823 -86.629  1.00 17.69 ? 165 VAL D C   1 
ATOM   8919  O  O   . VAL D  1 165 ? 6.292  -26.168 -85.877  1.00 16.27 ? 165 VAL D O   1 
ATOM   8920  C  CB  . VAL D  1 165 ? 9.035  -24.322 -85.729  1.00 16.86 ? 165 VAL D CB  1 
ATOM   8921  C  CG1 . VAL D  1 165 ? 9.506  -22.879 -85.605  1.00 16.72 ? 165 VAL D CG1 1 
ATOM   8922  C  CG2 . VAL D  1 165 ? 8.816  -24.950 -84.357  1.00 15.49 ? 165 VAL D CG2 1 
ATOM   8923  N  N   . PRO D  1 166 ? 7.742  -26.653 -87.536  1.00 16.50 ? 166 PRO D N   1 
ATOM   8924  C  CA  . PRO D  1 166 ? 7.268  -28.025 -87.657  1.00 16.74 ? 166 PRO D CA  1 
ATOM   8925  C  C   . PRO D  1 166 ? 7.816  -28.926 -86.557  1.00 16.67 ? 166 PRO D C   1 
ATOM   8926  O  O   . PRO D  1 166 ? 8.685  -28.516 -85.777  1.00 15.92 ? 166 PRO D O   1 
ATOM   8927  C  CB  . PRO D  1 166 ? 7.821  -28.468 -89.015  1.00 18.87 ? 166 PRO D CB  1 
ATOM   8928  C  CG  . PRO D  1 166 ? 9.022  -27.613 -89.227  1.00 17.26 ? 166 PRO D CG  1 
ATOM   8929  C  CD  . PRO D  1 166 ? 8.668  -26.285 -88.621  1.00 16.00 ? 166 PRO D CD  1 
ATOM   8930  N  N   . ILE D  1 167 ? 7.298  -30.145 -86.500  1.00 15.74 ? 167 ILE D N   1 
ATOM   8931  C  CA  . ILE D  1 167 ? 7.679  -31.101 -85.471  1.00 17.32 ? 167 ILE D CA  1 
ATOM   8932  C  C   . ILE D  1 167 ? 8.253  -32.363 -86.103  1.00 16.74 ? 167 ILE D C   1 
ATOM   8933  O  O   . ILE D  1 167 ? 7.623  -32.974 -86.968  1.00 16.57 ? 167 ILE D O   1 
ATOM   8934  C  CB  . ILE D  1 167 ? 6.469  -31.475 -84.584  1.00 17.19 ? 167 ILE D CB  1 
ATOM   8935  C  CG1 . ILE D  1 167 ? 6.005  -30.255 -83.783  1.00 17.86 ? 167 ILE D CG1 1 
ATOM   8936  C  CG2 . ILE D  1 167 ? 6.801  -32.650 -83.662  1.00 15.79 ? 167 ILE D CG2 1 
ATOM   8937  C  CD1 . ILE D  1 167 ? 4.596  -30.372 -83.244  1.00 17.72 ? 167 ILE D CD1 1 
ATOM   8938  N  N   . ILE D  1 168 ? 9.453  -32.739 -85.668  1.00 15.03 ? 168 ILE D N   1 
ATOM   8939  C  CA  . ILE D  1 168 ? 10.045 -34.020 -86.044  1.00 13.94 ? 168 ILE D CA  1 
ATOM   8940  C  C   . ILE D  1 168 ? 9.913  -35.000 -84.877  1.00 16.62 ? 168 ILE D C   1 
ATOM   8941  O  O   . ILE D  1 168 ? 10.158 -34.638 -83.728  1.00 14.30 ? 168 ILE D O   1 
ATOM   8942  C  CB  . ILE D  1 168 ? 11.530 -33.866 -86.426  1.00 13.97 ? 168 ILE D CB  1 
ATOM   8943  C  CG1 . ILE D  1 168 ? 11.675 -32.909 -87.613  1.00 14.37 ? 168 ILE D CG1 1 
ATOM   8944  C  CG2 . ILE D  1 168 ? 12.146 -35.225 -86.755  1.00 14.27 ? 168 ILE D CG2 1 
ATOM   8945  C  CD1 . ILE D  1 168 ? 13.115 -32.632 -88.009  1.00 15.70 ? 168 ILE D CD1 1 
ATOM   8946  N  N   . THR D  1 169 ? 9.520  -36.238 -85.158  1.00 16.19 ? 169 THR D N   1 
ATOM   8947  C  CA  . THR D  1 169 ? 9.456  -37.224 -84.088  1.00 13.80 ? 169 THR D CA  1 
ATOM   8948  C  C   . THR D  1 169 ? 10.419 -38.395 -84.275  1.00 18.17 ? 169 THR D C   1 
ATOM   8949  O  O   . THR D  1 169 ? 10.867 -38.705 -85.384  1.00 16.15 ? 169 THR D O   1 
ATOM   8950  C  CB  . THR D  1 169 ? 8.022  -37.771 -83.860  1.00 17.36 ? 169 THR D CB  1 
ATOM   8951  O  OG1 . THR D  1 169 ? 7.796  -38.911 -84.701  1.00 17.98 ? 169 THR D OG1 1 
ATOM   8952  C  CG2 . THR D  1 169 ? 6.964  -36.697 -84.142  1.00 15.29 ? 169 THR D CG2 1 
ATOM   8953  N  N   . HIS D  1 170 ? 10.744 -39.009 -83.142  1.00 16.62 ? 170 HIS D N   1 
ATOM   8954  C  CA  . HIS D  1 170 ? 11.365 -40.310 -83.057  1.00 17.35 ? 170 HIS D CA  1 
ATOM   8955  C  C   . HIS D  1 170 ? 10.266 -41.231 -82.622  1.00 16.91 ? 170 HIS D C   1 
ATOM   8956  O  O   . HIS D  1 170 ? 9.574  -40.949 -81.656  1.00 18.49 ? 170 HIS D O   1 
ATOM   8957  C  CB  . HIS D  1 170 ? 12.445 -40.261 -81.984  1.00 15.58 ? 170 HIS D CB  1 
ATOM   8958  C  CG  . HIS D  1 170 ? 13.086 -41.592 -81.685  1.00 18.67 ? 170 HIS D CG  1 
ATOM   8959  N  ND1 . HIS D  1 170 ? 14.310 -41.931 -82.156  1.00 19.36 ? 170 HIS D ND1 1 
ATOM   8960  C  CD2 . HIS D  1 170 ? 12.645 -42.665 -80.908  1.00 16.86 ? 170 HIS D CD2 1 
ATOM   8961  C  CE1 . HIS D  1 170 ? 14.624 -43.169 -81.709  1.00 20.63 ? 170 HIS D CE1 1 
ATOM   8962  N  NE2 . HIS D  1 170 ? 13.605 -43.611 -80.943  1.00 21.04 ? 170 HIS D NE2 1 
ATOM   8963  N  N   . SER D  1 171 ? 10.066 -42.332 -83.333  1.00 18.27 ? 171 SER D N   1 
ATOM   8964  C  CA  . SER D  1 171 ? 9.102  -43.325 -82.882  1.00 19.34 ? 171 SER D CA  1 
ATOM   8965  C  C   . SER D  1 171 ? 9.659  -44.744 -83.017  1.00 20.58 ? 171 SER D C   1 
ATOM   8966  O  O   . SER D  1 171 ? 10.722 -44.948 -83.594  1.00 20.24 ? 171 SER D O   1 
ATOM   8967  C  CB  . SER D  1 171 ? 7.764  -43.174 -83.623  1.00 19.57 ? 171 SER D CB  1 
ATOM   8968  O  OG  . SER D  1 171 ? 7.721  -43.961 -84.797  1.00 22.42 ? 171 SER D OG  1 
ATOM   8969  N  N   . ASN D  1 172 ? 8.952  -45.714 -82.453  1.00 18.39 ? 172 ASN D N   1 
ATOM   8970  C  CA  . ASN D  1 172 ? 9.303  -47.111 -82.631  1.00 18.76 ? 172 ASN D CA  1 
ATOM   8971  C  C   . ASN D  1 172 ? 8.331  -47.673 -83.648  1.00 19.11 ? 172 ASN D C   1 
ATOM   8972  O  O   . ASN D  1 172 ? 7.111  -47.603 -83.455  1.00 19.10 ? 172 ASN D O   1 
ATOM   8973  C  CB  . ASN D  1 172 ? 9.212  -47.871 -81.305  1.00 21.27 ? 172 ASN D CB  1 
ATOM   8974  C  CG  . ASN D  1 172 ? 9.600  -49.332 -81.441  1.00 23.81 ? 172 ASN D CG  1 
ATOM   8975  O  OD1 . ASN D  1 172 ? 8.946  -50.097 -82.142  1.00 23.69 ? 172 ASN D OD1 1 
ATOM   8976  N  ND2 . ASN D  1 172 ? 10.664 -49.724 -80.762  1.00 25.55 ? 172 ASN D ND2 1 
ATOM   8977  N  N   . ALA D  1 173 ? 8.870  -48.198 -84.745  1.00 19.87 ? 173 ALA D N   1 
ATOM   8978  C  CA  . ALA D  1 173 ? 8.050  -48.585 -85.896  1.00 22.45 ? 173 ALA D CA  1 
ATOM   8979  C  C   . ALA D  1 173 ? 7.126  -49.772 -85.635  1.00 26.31 ? 173 ALA D C   1 
ATOM   8980  O  O   . ALA D  1 173 ? 6.256  -50.065 -86.454  1.00 25.62 ? 173 ALA D O   1 
ATOM   8981  C  CB  . ALA D  1 173 ? 8.932  -48.855 -87.113  1.00 22.91 ? 173 ALA D CB  1 
ATOM   8982  N  N   . HIS D  1 174 ? 7.293  -50.431 -84.490  1.00 29.37 ? 174 HIS D N   1 
ATOM   8983  C  CA  . HIS D  1 174 ? 6.580  -51.683 -84.223  1.00 30.83 ? 174 HIS D CA  1 
ATOM   8984  C  C   . HIS D  1 174 ? 5.517  -51.623 -83.158  1.00 29.60 ? 174 HIS D C   1 
ATOM   8985  O  O   . HIS D  1 174 ? 4.848  -52.621 -82.911  1.00 31.33 ? 174 HIS D O   1 
ATOM   8986  C  CB  . HIS D  1 174 ? 7.572  -52.799 -83.887  1.00 31.11 ? 174 HIS D CB  1 
ATOM   8987  C  CG  . HIS D  1 174 ? 8.669  -52.964 -84.908  1.00 32.42 ? 174 HIS D CG  1 
ATOM   8988  N  ND1 . HIS D  1 174 ? 8.435  -53.413 -86.157  1.00 33.91 ? 174 HIS D ND1 1 
ATOM   8989  C  CD2 . HIS D  1 174 ? 10.038 -52.714 -84.829  1.00 34.77 ? 174 HIS D CD2 1 
ATOM   8990  C  CE1 . HIS D  1 174 ? 9.591  -53.448 -86.844  1.00 33.36 ? 174 HIS D CE1 1 
ATOM   8991  N  NE2 . HIS D  1 174 ? 10.573 -53.021 -86.031  1.00 36.50 ? 174 HIS D NE2 1 
ATOM   8992  N  N   . ASN D  1 175 ? 5.333  -50.477 -82.509  1.00 28.74 ? 175 ASN D N   1 
ATOM   8993  C  CA  . ASN D  1 175 ? 4.371  -50.421 -81.404  1.00 27.07 ? 175 ASN D CA  1 
ATOM   8994  C  C   . ASN D  1 175 ? 3.354  -49.275 -81.450  1.00 31.82 ? 175 ASN D C   1 
ATOM   8995  O  O   . ASN D  1 175 ? 2.827  -48.873 -80.410  1.00 36.48 ? 175 ASN D O   1 
ATOM   8996  C  CB  . ASN D  1 175 ? 5.106  -50.390 -80.069  1.00 27.85 ? 175 ASN D CB  1 
ATOM   8997  C  CG  . ASN D  1 175 ? 5.788  -49.058 -79.818  1.00 23.73 ? 175 ASN D CG  1 
ATOM   8998  O  OD1 . ASN D  1 175 ? 5.776  -48.169 -80.674  1.00 21.15 ? 175 ASN D OD1 1 
ATOM   8999  N  ND2 . ASN D  1 175 ? 6.375  -48.910 -78.638  1.00 23.67 ? 175 ASN D ND2 1 
ATOM   9000  N  N   . ASN D  1 176 ? 3.086  -48.748 -82.641  1.00 30.74 ? 176 ASN D N   1 
ATOM   9001  C  CA  . ASN D  1 176 ? 2.068  -47.702 -82.817  1.00 30.15 ? 176 ASN D CA  1 
ATOM   9002  C  C   . ASN D  1 176 ? 2.372  -46.332 -82.195  1.00 27.76 ? 176 ASN D C   1 
ATOM   9003  O  O   . ASN D  1 176 ? 1.525  -45.436 -82.233  1.00 26.71 ? 176 ASN D O   1 
ATOM   9004  C  CB  . ASN D  1 176 ? 0.700  -48.191 -82.331  1.00 36.16 ? 176 ASN D CB  1 
ATOM   9005  C  CG  . ASN D  1 176 ? 0.057  -49.168 -83.293  1.00 45.73 ? 176 ASN D CG  1 
ATOM   9006  O  OD1 . ASN D  1 176 ? 0.256  -49.085 -84.506  1.00 49.85 ? 176 ASN D OD1 1 
ATOM   9007  N  ND2 . ASN D  1 176 ? -0.715 -50.105 -82.757  1.00 46.50 ? 176 ASN D ND2 1 
ATOM   9008  N  N   . THR D  1 177 ? 3.559  -46.158 -81.621  1.00 22.66 ? 177 THR D N   1 
ATOM   9009  C  CA  . THR D  1 177 ? 3.904  -44.852 -81.045  1.00 22.64 ? 177 THR D CA  1 
ATOM   9010  C  C   . THR D  1 177 ? 3.851  -43.740 -82.096  1.00 23.89 ? 177 THR D C   1 
ATOM   9011  O  O   . THR D  1 177 ? 3.421  -42.621 -81.809  1.00 25.52 ? 177 THR D O   1 
ATOM   9012  C  CB  . THR D  1 177 ? 5.278  -44.851 -80.354  1.00 20.08 ? 177 THR D CB  1 
ATOM   9013  O  OG1 . THR D  1 177 ? 6.245  -45.480 -81.202  1.00 20.94 ? 177 THR D OG1 1 
ATOM   9014  C  CG2 . THR D  1 177 ? 5.208  -45.604 -79.020  1.00 18.30 ? 177 THR D CG2 1 
ATOM   9015  N  N   . GLY D  1 178 ? 4.280  -44.044 -83.313  1.00 20.73 ? 178 GLY D N   1 
ATOM   9016  C  CA  . GLY D  1 178 ? 4.220  -43.049 -84.382  1.00 21.72 ? 178 GLY D CA  1 
ATOM   9017  C  C   . GLY D  1 178 ? 2.795  -42.586 -84.616  1.00 20.23 ? 178 GLY D C   1 
ATOM   9018  O  O   . GLY D  1 178 ? 2.517  -41.392 -84.685  1.00 21.11 ? 178 GLY D O   1 
ATOM   9019  N  N   . LEU D  1 179 ? 1.882  -43.542 -84.737  1.00 22.74 ? 179 LEU D N   1 
ATOM   9020  C  CA  . LEU D  1 179 ? 0.470  -43.229 -84.929  1.00 24.07 ? 179 LEU D CA  1 
ATOM   9021  C  C   . LEU D  1 179 ? -0.096 -42.432 -83.754  1.00 26.03 ? 179 LEU D C   1 
ATOM   9022  O  O   . LEU D  1 179 ? -0.897 -41.510 -83.941  1.00 26.52 ? 179 LEU D O   1 
ATOM   9023  C  CB  . LEU D  1 179 ? -0.333 -44.515 -85.116  1.00 25.91 ? 179 LEU D CB  1 
ATOM   9024  C  CG  . LEU D  1 179 ? -1.794 -44.315 -85.506  1.00 29.38 ? 179 LEU D CG  1 
ATOM   9025  C  CD1 . LEU D  1 179 ? -1.883 -43.752 -86.917  1.00 30.82 ? 179 LEU D CD1 1 
ATOM   9026  C  CD2 . LEU D  1 179 ? -2.561 -45.625 -85.382  1.00 29.69 ? 179 LEU D CD2 1 
ATOM   9027  N  N   . GLU D  1 180 ? 0.315  -42.799 -82.544  1.00 23.97 ? 180 GLU D N   1 
ATOM   9028  C  CA  . GLU D  1 180 ? -0.157 -42.127 -81.332  1.00 25.27 ? 180 GLU D CA  1 
ATOM   9029  C  C   . GLU D  1 180 ? 0.348  -40.685 -81.243  1.00 24.98 ? 180 GLU D C   1 
ATOM   9030  O  O   . GLU D  1 180 ? -0.385 -39.785 -80.833  1.00 23.00 ? 180 GLU D O   1 
ATOM   9031  C  CB  . GLU D  1 180 ? 0.259  -42.914 -80.086  1.00 25.73 ? 180 GLU D CB  1 
ATOM   9032  C  CG  . GLU D  1 180 ? -0.620 -44.116 -79.798  1.00 33.08 ? 180 GLU D CG  1 
ATOM   9033  C  CD  . GLU D  1 180 ? -2.020 -43.707 -79.380  1.00 38.04 ? 180 GLU D CD  1 
ATOM   9034  O  OE1 . GLU D  1 180 ? -2.276 -43.637 -78.163  1.00 44.30 ? 180 GLU D OE1 1 
ATOM   9035  O  OE2 . GLU D  1 180 ? -2.856 -43.427 -80.262  1.00 37.43 ? 180 GLU D OE2 1 
ATOM   9036  N  N   . GLN D  1 181 ? 1.602  -40.469 -81.622  1.00 23.80 ? 181 GLN D N   1 
ATOM   9037  C  CA  . GLN D  1 181 ? 2.150  -39.116 -81.650  1.00 21.55 ? 181 GLN D CA  1 
ATOM   9038  C  C   . GLN D  1 181 ? 1.320  -38.231 -82.574  1.00 22.70 ? 181 GLN D C   1 
ATOM   9039  O  O   . GLN D  1 181 ? 0.931  -37.119 -82.213  1.00 20.45 ? 181 GLN D O   1 
ATOM   9040  C  CB  . GLN D  1 181 ? 3.601  -39.134 -82.121  1.00 19.63 ? 181 GLN D CB  1 
ATOM   9041  C  CG  . GLN D  1 181 ? 4.566  -39.738 -81.116  1.00 20.85 ? 181 GLN D CG  1 
ATOM   9042  C  CD  . GLN D  1 181 ? 5.930  -40.007 -81.718  1.00 21.73 ? 181 GLN D CD  1 
ATOM   9043  O  OE1 . GLN D  1 181 ? 6.067  -40.171 -82.938  1.00 19.91 ? 181 GLN D OE1 1 
ATOM   9044  N  NE2 . GLN D  1 181 ? 6.950  -40.058 -80.869  1.00 21.41 ? 181 GLN D NE2 1 
ATOM   9045  N  N   . GLN D  1 182 ? 1.055  -38.736 -83.774  1.00 21.61 ? 182 GLN D N   1 
ATOM   9046  C  CA  . GLN D  1 182 ? 0.249  -38.011 -84.744  1.00 23.71 ? 182 GLN D CA  1 
ATOM   9047  C  C   . GLN D  1 182 ? -1.126 -37.706 -84.190  1.00 23.81 ? 182 GLN D C   1 
ATOM   9048  O  O   . GLN D  1 182 ? -1.621 -36.582 -84.320  1.00 23.95 ? 182 GLN D O   1 
ATOM   9049  C  CB  . GLN D  1 182 ? 0.110  -38.818 -86.030  1.00 24.06 ? 182 GLN D CB  1 
ATOM   9050  C  CG  . GLN D  1 182 ? -0.748 -38.154 -87.098  1.00 24.71 ? 182 GLN D CG  1 
ATOM   9051  C  CD  . GLN D  1 182 ? -0.891 -39.041 -88.317  1.00 26.84 ? 182 GLN D CD  1 
ATOM   9052  O  OE1 . GLN D  1 182 ? -1.318 -40.190 -88.206  1.00 27.06 ? 182 GLN D OE1 1 
ATOM   9053  N  NE2 . GLN D  1 182 ? -0.506 -38.527 -89.481  1.00 22.12 ? 182 GLN D NE2 1 
ATOM   9054  N  N   . ARG D  1 183 ? -1.752 -38.711 -83.582  1.00 22.51 ? 183 ARG D N   1 
ATOM   9055  C  CA  . ARG D  1 183 ? -3.093 -38.533 -83.050  1.00 24.22 ? 183 ARG D CA  1 
ATOM   9056  C  C   . ARG D  1 183 ? -3.119 -37.395 -82.029  1.00 24.62 ? 183 ARG D C   1 
ATOM   9057  O  O   . ARG D  1 183 ? -3.902 -36.449 -82.151  1.00 24.47 ? 183 ARG D O   1 
ATOM   9058  C  CB  . ARG D  1 183 ? -3.620 -39.833 -82.430  1.00 27.22 ? 183 ARG D CB  1 
ATOM   9059  C  CG  . ARG D  1 183 ? -5.042 -39.711 -81.898  1.00 30.73 ? 183 ARG D CG  1 
ATOM   9060  C  CD  . ARG D  1 183 ? -5.501 -40.967 -81.175  1.00 29.51 ? 183 ARG D CD  1 
ATOM   9061  N  NE  . ARG D  1 183 ? -4.648 -41.293 -80.037  1.00 29.26 ? 183 ARG D NE  1 
ATOM   9062  C  CZ  . ARG D  1 183 ? -4.709 -40.692 -78.849  1.00 32.44 ? 183 ARG D CZ  1 
ATOM   9063  N  NH1 . ARG D  1 183 ? -3.886 -41.059 -77.875  1.00 32.65 ? 183 ARG D NH1 1 
ATOM   9064  N  NH2 . ARG D  1 183 ? -5.582 -39.718 -78.636  1.00 31.39 ? 183 ARG D NH2 1 
ATOM   9065  N  N   . ILE D  1 184 ? -2.244 -37.477 -81.033  1.00 22.68 ? 184 ILE D N   1 
ATOM   9066  C  CA  . ILE D  1 184 ? -2.230 -36.478 -79.969  1.00 22.54 ? 184 ILE D CA  1 
ATOM   9067  C  C   . ILE D  1 184 ? -1.936 -35.072 -80.500  1.00 23.26 ? 184 ILE D C   1 
ATOM   9068  O  O   . ILE D  1 184 ? -2.615 -34.108 -80.134  1.00 22.74 ? 184 ILE D O   1 
ATOM   9069  C  CB  . ILE D  1 184 ? -1.252 -36.860 -78.842  1.00 23.33 ? 184 ILE D CB  1 
ATOM   9070  C  CG1 . ILE D  1 184 ? -1.701 -38.182 -78.199  1.00 24.42 ? 184 ILE D CG1 1 
ATOM   9071  C  CG2 . ILE D  1 184 ? -1.180 -35.741 -77.807  1.00 22.57 ? 184 ILE D CG2 1 
ATOM   9072  C  CD1 . ILE D  1 184 ? -0.681 -38.813 -77.273  1.00 27.10 ? 184 ILE D CD1 1 
ATOM   9073  N  N   . LEU D  1 185 ? -0.943 -34.955 -81.377  1.00 20.41 ? 185 LEU D N   1 
ATOM   9074  C  CA  . LEU D  1 185 ? -0.602 -33.653 -81.966  1.00 20.68 ? 185 LEU D CA  1 
ATOM   9075  C  C   . LEU D  1 185 ? -1.761 -33.040 -82.762  1.00 22.54 ? 185 LEU D C   1 
ATOM   9076  O  O   . LEU D  1 185 ? -2.059 -31.852 -82.626  1.00 23.08 ? 185 LEU D O   1 
ATOM   9077  C  CB  . LEU D  1 185 ? 0.644  -33.765 -82.852  1.00 19.18 ? 185 LEU D CB  1 
ATOM   9078  C  CG  . LEU D  1 185 ? 1.945  -34.051 -82.100  1.00 19.39 ? 185 LEU D CG  1 
ATOM   9079  C  CD1 . LEU D  1 185 ? 3.060  -34.421 -83.075  1.00 20.50 ? 185 LEU D CD1 1 
ATOM   9080  C  CD2 . LEU D  1 185 ? 2.325  -32.847 -81.242  1.00 16.97 ? 185 LEU D CD2 1 
ATOM   9081  N  N   . THR D  1 186 ? -2.409 -33.851 -83.590  1.00 24.14 ? 186 THR D N   1 
ATOM   9082  C  CA  . THR D  1 186 ? -3.509 -33.358 -84.409  1.00 26.31 ? 186 THR D CA  1 
ATOM   9083  C  C   . THR D  1 186 ? -4.709 -33.007 -83.533  1.00 27.63 ? 186 THR D C   1 
ATOM   9084  O  O   . THR D  1 186 ? -5.422 -32.044 -83.809  1.00 26.51 ? 186 THR D O   1 
ATOM   9085  C  CB  . THR D  1 186 ? -3.931 -34.374 -85.483  1.00 27.15 ? 186 THR D CB  1 
ATOM   9086  O  OG1 . THR D  1 186 ? -4.275 -35.609 -84.855  1.00 32.20 ? 186 THR D OG1 1 
ATOM   9087  C  CG2 . THR D  1 186 ? -2.797 -34.612 -86.472  1.00 26.34 ? 186 THR D CG2 1 
ATOM   9088  N  N   . GLU D  1 187 ? -4.927 -33.789 -82.479  1.00 26.27 ? 187 GLU D N   1 
ATOM   9089  C  CA  . GLU D  1 187 ? -5.983 -33.484 -81.516  1.00 30.38 ? 187 GLU D CA  1 
ATOM   9090  C  C   . GLU D  1 187 ? -5.742 -32.134 -80.857  1.00 28.99 ? 187 GLU D C   1 
ATOM   9091  O  O   . GLU D  1 187 ? -6.689 -31.423 -80.517  1.00 31.76 ? 187 GLU D O   1 
ATOM   9092  C  CB  . GLU D  1 187 ? -6.087 -34.570 -80.443  1.00 31.23 ? 187 GLU D CB  1 
ATOM   9093  C  CG  . GLU D  1 187 ? -6.875 -35.801 -80.861  1.00 40.06 ? 187 GLU D CG  1 
ATOM   9094  C  CD  . GLU D  1 187 ? -6.921 -36.857 -79.771  1.00 37.11 ? 187 GLU D CD  1 
ATOM   9095  O  OE1 . GLU D  1 187 ? -7.457 -37.954 -80.024  1.00 40.00 ? 187 GLU D OE1 1 
ATOM   9096  O  OE2 . GLU D  1 187 ? -6.412 -36.590 -78.664  1.00 38.33 ? 187 GLU D OE2 1 
ATOM   9097  N  N   . GLU D  1 188 ? -4.473 -31.780 -80.683  1.00 27.94 ? 188 GLU D N   1 
ATOM   9098  C  CA  . GLU D  1 188 ? -4.118 -30.513 -80.053  1.00 29.43 ? 188 GLU D CA  1 
ATOM   9099  C  C   . GLU D  1 188 ? -3.998 -29.366 -81.059  1.00 28.32 ? 188 GLU D C   1 
ATOM   9100  O  O   . GLU D  1 188 ? -3.457 -28.306 -80.739  1.00 31.71 ? 188 GLU D O   1 
ATOM   9101  C  CB  . GLU D  1 188 ? -2.835 -30.656 -79.226  1.00 28.57 ? 188 GLU D CB  1 
ATOM   9102  C  CG  . GLU D  1 188 ? -3.031 -31.412 -77.921  1.00 36.48 ? 188 GLU D CG  1 
ATOM   9103  C  CD  . GLU D  1 188 ? -4.248 -30.923 -77.153  1.00 50.68 ? 188 GLU D CD  1 
ATOM   9104  O  OE1 . GLU D  1 188 ? -4.381 -29.695 -76.963  1.00 46.55 ? 188 GLU D OE1 1 
ATOM   9105  O  OE2 . GLU D  1 188 ? -5.078 -31.765 -76.746  1.00 49.81 ? 188 GLU D OE2 1 
ATOM   9106  N  N   . GLY D  1 189 ? -4.487 -29.584 -82.277  1.00 26.68 ? 189 GLY D N   1 
ATOM   9107  C  CA  . GLY D  1 189 ? -4.556 -28.513 -83.271  1.00 27.84 ? 189 GLY D CA  1 
ATOM   9108  C  C   . GLY D  1 189 ? -3.335 -28.327 -84.163  1.00 29.06 ? 189 GLY D C   1 
ATOM   9109  O  O   . GLY D  1 189 ? -3.230 -27.331 -84.875  1.00 26.41 ? 189 GLY D O   1 
ATOM   9110  N  N   . VAL D  1 190 ? -2.399 -29.270 -84.121  1.00 26.29 ? 190 VAL D N   1 
ATOM   9111  C  CA  . VAL D  1 190 ? -1.262 -29.233 -85.036  1.00 22.00 ? 190 VAL D CA  1 
ATOM   9112  C  C   . VAL D  1 190 ? -1.682 -29.723 -86.424  1.00 22.00 ? 190 VAL D C   1 
ATOM   9113  O  O   . VAL D  1 190 ? -2.296 -30.780 -86.560  1.00 19.65 ? 190 VAL D O   1 
ATOM   9114  C  CB  . VAL D  1 190 ? -0.080 -30.079 -84.511  1.00 21.36 ? 190 VAL D CB  1 
ATOM   9115  C  CG1 . VAL D  1 190 ? 1.099  -30.022 -85.475  1.00 19.24 ? 190 VAL D CG1 1 
ATOM   9116  C  CG2 . VAL D  1 190 ? 0.345  -29.592 -83.131  1.00 18.95 ? 190 VAL D CG2 1 
ATOM   9117  N  N   . ASP D  1 191 ? -1.363 -28.935 -87.444  1.00 22.01 ? 191 ASP D N   1 
ATOM   9118  C  CA  . ASP D  1 191 ? -1.532 -29.341 -88.835  1.00 23.13 ? 191 ASP D CA  1 
ATOM   9119  C  C   . ASP D  1 191 ? -0.713 -30.615 -89.092  1.00 25.60 ? 191 ASP D C   1 
ATOM   9120  O  O   . ASP D  1 191 ? 0.490  -30.643 -88.830  1.00 21.62 ? 191 ASP D O   1 
ATOM   9121  C  CB  . ASP D  1 191 ? -1.069 -28.207 -89.749  1.00 24.73 ? 191 ASP D CB  1 
ATOM   9122  C  CG  . ASP D  1 191 ? -1.028 -28.601 -91.223  1.00 31.15 ? 191 ASP D CG  1 
ATOM   9123  O  OD1 . ASP D  1 191 ? -1.459 -29.718 -91.579  1.00 31.74 ? 191 ASP D OD1 1 
ATOM   9124  O  OD2 . ASP D  1 191 ? -0.550 -27.778 -92.029  1.00 34.49 ? 191 ASP D OD2 1 
ATOM   9125  N  N   . PRO D  1 192 ? -1.369 -31.676 -89.587  1.00 24.83 ? 192 PRO D N   1 
ATOM   9126  C  CA  . PRO D  1 192 ? -0.709 -32.963 -89.807  1.00 25.61 ? 192 PRO D CA  1 
ATOM   9127  C  C   . PRO D  1 192 ? 0.439  -32.833 -90.791  1.00 22.92 ? 192 PRO D C   1 
ATOM   9128  O  O   . PRO D  1 192 ? 1.395  -33.614 -90.736  1.00 24.91 ? 192 PRO D O   1 
ATOM   9129  C  CB  . PRO D  1 192 ? -1.819 -33.832 -90.418  1.00 27.78 ? 192 PRO D CB  1 
ATOM   9130  C  CG  . PRO D  1 192 ? -3.088 -33.195 -89.967  1.00 29.83 ? 192 PRO D CG  1 
ATOM   9131  C  CD  . PRO D  1 192 ? -2.802 -31.724 -89.920  1.00 27.15 ? 192 PRO D CD  1 
ATOM   9132  N  N   . GLY D  1 193 ? 0.332  -31.858 -91.689  1.00 23.01 ? 193 GLY D N   1 
ATOM   9133  C  CA  . GLY D  1 193 ? 1.379  -31.581 -92.673  1.00 20.52 ? 193 GLY D CA  1 
ATOM   9134  C  C   . GLY D  1 193 ? 2.618  -30.946 -92.065  1.00 18.99 ? 193 GLY D C   1 
ATOM   9135  O  O   . GLY D  1 193 ? 3.650  -30.824 -92.728  1.00 20.77 ? 193 GLY D O   1 
ATOM   9136  N  N   . LYS D  1 194 ? 2.525  -30.541 -90.800  1.00 19.90 ? 194 LYS D N   1 
ATOM   9137  C  CA  . LYS D  1 194 ? 3.679  -29.981 -90.093  1.00 21.14 ? 194 LYS D CA  1 
ATOM   9138  C  C   . LYS D  1 194 ? 4.338  -31.012 -89.162  1.00 18.82 ? 194 LYS D C   1 
ATOM   9139  O  O   . LYS D  1 194 ? 5.069  -30.649 -88.235  1.00 19.54 ? 194 LYS D O   1 
ATOM   9140  C  CB  . LYS D  1 194 ? 3.273  -28.729 -89.304  1.00 22.42 ? 194 LYS D CB  1 
ATOM   9141  C  CG  . LYS D  1 194 ? 2.671  -27.612 -90.151  1.00 26.87 ? 194 LYS D CG  1 
ATOM   9142  C  CD  . LYS D  1 194 ? 3.682  -27.014 -91.120  1.00 27.83 ? 194 LYS D CD  1 
ATOM   9143  C  CE  . LYS D  1 194 ? 4.739  -26.204 -90.384  1.00 31.13 ? 194 LYS D CE  1 
ATOM   9144  N  NZ  . LYS D  1 194 ? 5.746  -25.589 -91.297  1.00 30.44 ? 194 LYS D NZ  1 
ATOM   9145  N  N   . ILE D  1 195 ? 4.077  -32.293 -89.411  1.00 18.81 ? 195 ILE D N   1 
ATOM   9146  C  CA  . ILE D  1 195 ? 4.633  -33.369 -88.588  1.00 16.67 ? 195 ILE D CA  1 
ATOM   9147  C  C   . ILE D  1 195 ? 5.370  -34.384 -89.450  1.00 17.45 ? 195 ILE D C   1 
ATOM   9148  O  O   . ILE D  1 195 ? 4.850  -34.836 -90.471  1.00 16.98 ? 195 ILE D O   1 
ATOM   9149  C  CB  . ILE D  1 195 ? 3.536  -34.140 -87.824  1.00 19.20 ? 195 ILE D CB  1 
ATOM   9150  C  CG1 . ILE D  1 195 ? 2.581  -33.180 -87.111  1.00 17.76 ? 195 ILE D CG1 1 
ATOM   9151  C  CG2 . ILE D  1 195 ? 4.160  -35.138 -86.847  1.00 15.37 ? 195 ILE D CG2 1 
ATOM   9152  C  CD1 . ILE D  1 195 ? 1.342  -33.867 -86.559  1.00 18.51 ? 195 ILE D CD1 1 
ATOM   9153  N  N   . LEU D  1 196 ? 6.586  -34.725 -89.038  1.00 16.92 ? 196 LEU D N   1 
ATOM   9154  C  CA  . LEU D  1 196 ? 7.325  -35.829 -89.631  1.00 16.08 ? 196 LEU D CA  1 
ATOM   9155  C  C   . LEU D  1 196 ? 7.374  -36.960 -88.607  1.00 16.83 ? 196 LEU D C   1 
ATOM   9156  O  O   . LEU D  1 196 ? 8.006  -36.822 -87.564  1.00 17.65 ? 196 LEU D O   1 
ATOM   9157  C  CB  . LEU D  1 196 ? 8.744  -35.390 -90.019  1.00 15.56 ? 196 LEU D CB  1 
ATOM   9158  C  CG  . LEU D  1 196 ? 9.760  -36.484 -90.391  1.00 16.85 ? 196 LEU D CG  1 
ATOM   9159  C  CD1 . LEU D  1 196 ? 9.288  -37.312 -91.582  1.00 18.73 ? 196 LEU D CD1 1 
ATOM   9160  C  CD2 . LEU D  1 196 ? 11.133 -35.897 -90.674  1.00 15.17 ? 196 LEU D CD2 1 
ATOM   9161  N  N   . ILE D  1 197 ? 6.680  -38.061 -88.883  1.00 16.46 ? 197 ILE D N   1 
ATOM   9162  C  CA  . ILE D  1 197 ? 6.697  -39.205 -87.969  1.00 17.65 ? 197 ILE D CA  1 
ATOM   9163  C  C   . ILE D  1 197 ? 7.915  -40.068 -88.285  1.00 18.39 ? 197 ILE D C   1 
ATOM   9164  O  O   . ILE D  1 197 ? 8.025  -40.623 -89.379  1.00 18.67 ? 197 ILE D O   1 
ATOM   9165  C  CB  . ILE D  1 197 ? 5.409  -40.048 -88.068  1.00 19.39 ? 197 ILE D CB  1 
ATOM   9166  C  CG1 . ILE D  1 197 ? 4.186  -39.193 -87.701  1.00 20.26 ? 197 ILE D CG1 1 
ATOM   9167  C  CG2 . ILE D  1 197 ? 5.508  -41.273 -87.158  1.00 18.71 ? 197 ILE D CG2 1 
ATOM   9168  C  CD1 . ILE D  1 197 ? 4.217  -38.666 -86.276  1.00 19.83 ? 197 ILE D CD1 1 
ATOM   9169  N  N   . GLY D  1 198 ? 8.825  -40.172 -87.321  1.00 18.67 ? 198 GLY D N   1 
ATOM   9170  C  CA  . GLY D  1 198 ? 10.148 -40.739 -87.564  1.00 17.03 ? 198 GLY D CA  1 
ATOM   9171  C  C   . GLY D  1 198 ? 10.308 -42.247 -87.451  1.00 18.00 ? 198 GLY D C   1 
ATOM   9172  O  O   . GLY D  1 198 ? 9.581  -42.922 -86.706  1.00 19.21 ? 198 GLY D O   1 
ATOM   9173  N  N   . HIS D  1 199 ? 11.266 -42.763 -88.213  1.00 17.65 ? 199 HIS D N   1 
ATOM   9174  C  CA  . HIS D  1 199 ? 11.760 -44.130 -88.062  1.00 18.63 ? 199 HIS D CA  1 
ATOM   9175  C  C   . HIS D  1 199 ? 10.777 -45.171 -88.548  1.00 21.44 ? 199 HIS D C   1 
ATOM   9176  O  O   . HIS D  1 199 ? 10.868 -46.346 -88.185  1.00 22.14 ? 199 HIS D O   1 
ATOM   9177  C  CB  . HIS D  1 199 ? 12.204 -44.390 -86.618  1.00 19.46 ? 199 HIS D CB  1 
ATOM   9178  C  CG  . HIS D  1 199 ? 13.193 -43.361 -86.080  1.00 19.45 ? 199 HIS D CG  1 
ATOM   9179  N  ND1 . HIS D  1 199 ? 14.066 -42.710 -86.873  1.00 19.12 ? 199 HIS D ND1 1 
ATOM   9180  C  CD2 . HIS D  1 199 ? 13.430 -42.905 -84.777  1.00 18.73 ? 199 HIS D CD2 1 
ATOM   9181  C  CE1 . HIS D  1 199 ? 14.813 -41.863 -86.124  1.00 19.11 ? 199 HIS D CE1 1 
ATOM   9182  N  NE2 . HIS D  1 199 ? 14.424 -41.986 -84.837  1.00 19.01 ? 199 HIS D NE2 1 
ATOM   9183  N  N   . LEU D  1 200 ? 9.843  -44.748 -89.398  1.00 20.28 ? 200 LEU D N   1 
ATOM   9184  C  CA  . LEU D  1 200 ? 8.883  -45.665 -90.006  1.00 20.37 ? 200 LEU D CA  1 
ATOM   9185  C  C   . LEU D  1 200 ? 9.566  -46.582 -91.031  1.00 21.95 ? 200 LEU D C   1 
ATOM   9186  O  O   . LEU D  1 200 ? 9.039  -47.634 -91.398  1.00 22.73 ? 200 LEU D O   1 
ATOM   9187  C  CB  . LEU D  1 200 ? 7.738  -44.878 -90.644  1.00 21.47 ? 200 LEU D CB  1 
ATOM   9188  C  CG  . LEU D  1 200 ? 6.878  -44.059 -89.676  1.00 22.25 ? 200 LEU D CG  1 
ATOM   9189  C  CD1 . LEU D  1 200 ? 5.800  -43.290 -90.430  1.00 20.53 ? 200 LEU D CD1 1 
ATOM   9190  C  CD2 . LEU D  1 200 ? 6.249  -44.968 -88.621  1.00 21.16 ? 200 LEU D CD2 1 
ATOM   9191  N  N   . GLY D  1 201 ? 10.754 -46.190 -91.478  1.00 19.72 ? 201 GLY D N   1 
ATOM   9192  C  CA  . GLY D  1 201 ? 11.532 -47.038 -92.373  1.00 20.79 ? 201 GLY D CA  1 
ATOM   9193  C  C   . GLY D  1 201 ? 12.060 -48.280 -91.676  1.00 21.49 ? 201 GLY D C   1 
ATOM   9194  O  O   . GLY D  1 201 ? 12.592 -49.180 -92.324  1.00 23.49 ? 201 GLY D O   1 
ATOM   9195  N  N   . ASP D  1 202 ? 11.917 -48.332 -90.352  1.00 23.22 ? 202 ASP D N   1 
ATOM   9196  C  CA  . ASP D  1 202 ? 12.406 -49.476 -89.576  1.00 22.12 ? 202 ASP D CA  1 
ATOM   9197  C  C   . ASP D  1 202 ? 11.514 -50.707 -89.747  1.00 25.25 ? 202 ASP D C   1 
ATOM   9198  O  O   . ASP D  1 202 ? 11.844 -51.782 -89.253  1.00 22.44 ? 202 ASP D O   1 
ATOM   9199  C  CB  . ASP D  1 202 ? 12.519 -49.138 -88.082  1.00 20.75 ? 202 ASP D CB  1 
ATOM   9200  C  CG  . ASP D  1 202 ? 13.584 -48.088 -87.787  1.00 21.67 ? 202 ASP D CG  1 
ATOM   9201  O  OD1 . ASP D  1 202 ? 14.319 -47.694 -88.719  1.00 22.21 ? 202 ASP D OD1 1 
ATOM   9202  O  OD2 . ASP D  1 202 ? 13.682 -47.655 -86.616  1.00 21.06 ? 202 ASP D OD2 1 
ATOM   9203  N  N   . THR D  1 203 ? 10.388 -50.545 -90.436  1.00 23.65 ? 203 THR D N   1 
ATOM   9204  C  CA  . THR D  1 203 ? 9.472  -51.658 -90.665  1.00 25.38 ? 203 THR D CA  1 
ATOM   9205  C  C   . THR D  1 203 ? 9.133  -51.820 -92.141  1.00 28.90 ? 203 THR D C   1 
ATOM   9206  O  O   . THR D  1 203 ? 9.194  -50.861 -92.914  1.00 26.77 ? 203 THR D O   1 
ATOM   9207  C  CB  . THR D  1 203 ? 8.156  -51.493 -89.885  1.00 27.01 ? 203 THR D CB  1 
ATOM   9208  O  OG1 . THR D  1 203 ? 7.322  -52.635 -90.121  1.00 25.14 ? 203 THR D OG1 1 
ATOM   9209  C  CG2 . THR D  1 203 ? 7.409  -50.238 -90.347  1.00 26.91 ? 203 THR D CG2 1 
ATOM   9210  N  N   . ASP D  1 204 ? 8.771  -53.038 -92.531  1.00 29.49 ? 204 ASP D N   1 
ATOM   9211  C  CA  . ASP D  1 204 ? 8.311  -53.285 -93.893  1.00 33.86 ? 204 ASP D CA  1 
ATOM   9212  C  C   . ASP D  1 204 ? 6.789  -53.400 -93.945  1.00 35.35 ? 204 ASP D C   1 
ATOM   9213  O  O   . ASP D  1 204 ? 6.215  -53.751 -94.981  1.00 34.55 ? 204 ASP D O   1 
ATOM   9214  C  CB  . ASP D  1 204 ? 8.964  -54.543 -94.465  1.00 36.95 ? 204 ASP D CB  1 
ATOM   9215  C  CG  . ASP D  1 204 ? 8.668  -55.780 -93.641  1.00 41.80 ? 204 ASP D CG  1 
ATOM   9216  O  OD1 . ASP D  1 204 ? 9.272  -56.836 -93.911  1.00 48.10 ? 204 ASP D OD1 1 
ATOM   9217  O  OD2 . ASP D  1 204 ? 7.830  -55.696 -92.722  1.00 38.72 ? 204 ASP D OD2 1 
ATOM   9218  N  N   . ASN D  1 205 ? 6.145  -53.104 -92.819  1.00 29.76 ? 205 ASN D N   1 
ATOM   9219  C  CA  . ASN D  1 205 ? 4.685  -53.080 -92.732  1.00 32.86 ? 205 ASN D CA  1 
ATOM   9220  C  C   . ASN D  1 205 ? 4.122  -51.830 -93.411  1.00 34.55 ? 205 ASN D C   1 
ATOM   9221  O  O   . ASN D  1 205 ? 3.904  -50.806 -92.758  1.00 32.27 ? 205 ASN D O   1 
ATOM   9222  C  CB  . ASN D  1 205 ? 4.252  -53.129 -91.262  1.00 33.93 ? 205 ASN D CB  1 
ATOM   9223  C  CG  . ASN D  1 205 ? 2.739  -53.168 -91.087  1.00 36.94 ? 205 ASN D CG  1 
ATOM   9224  O  OD1 . ASN D  1 205 ? 1.979  -52.965 -92.031  1.00 36.21 ? 205 ASN D OD1 1 
ATOM   9225  N  ND2 . ASN D  1 205 ? 2.300  -53.417 -89.862  1.00 40.83 ? 205 ASN D ND2 1 
ATOM   9226  N  N   . ILE D  1 206 ? 3.894  -51.916 -94.721  1.00 33.32 ? 206 ILE D N   1 
ATOM   9227  C  CA  . ILE D  1 206 ? 3.478  -50.748 -95.506  1.00 34.24 ? 206 ILE D CA  1 
ATOM   9228  C  C   . ILE D  1 206 ? 2.105  -50.204 -95.129  1.00 33.33 ? 206 ILE D C   1 
ATOM   9229  O  O   . ILE D  1 206 ? 1.844  -49.015 -95.304  1.00 33.25 ? 206 ILE D O   1 
ATOM   9230  C  CB  . ILE D  1 206 ? 3.511  -51.008 -97.031  1.00 36.86 ? 206 ILE D CB  1 
ATOM   9231  C  CG1 . ILE D  1 206 ? 3.036  -52.421 -97.353  1.00 37.92 ? 206 ILE D CG1 1 
ATOM   9232  C  CG2 . ILE D  1 206 ? 4.906  -50.785 -97.593  1.00 39.03 ? 206 ILE D CG2 1 
ATOM   9233  C  CD1 . ILE D  1 206 ? 2.930  -52.692 -98.838  1.00 47.53 ? 206 ILE D CD1 1 
ATOM   9234  N  N   . ASP D  1 207 ? 1.224  -51.062 -94.621  1.00 32.95 ? 207 ASP D N   1 
ATOM   9235  C  CA  . ASP D  1 207 ? -0.122 -50.611 -94.265  1.00 33.84 ? 207 ASP D CA  1 
ATOM   9236  C  C   . ASP D  1 207 ? -0.080 -49.601 -93.122  1.00 30.48 ? 207 ASP D C   1 
ATOM   9237  O  O   . ASP D  1 207 ? -0.818 -48.616 -93.124  1.00 30.24 ? 207 ASP D O   1 
ATOM   9238  C  CB  . ASP D  1 207 ? -1.027 -51.792 -93.903  1.00 38.43 ? 207 ASP D CB  1 
ATOM   9239  C  CG  . ASP D  1 207 ? -1.429 -52.613 -95.119  1.00 46.97 ? 207 ASP D CG  1 
ATOM   9240  O  OD1 . ASP D  1 207 ? -1.624 -52.024 -96.202  1.00 45.46 ? 207 ASP D OD1 1 
ATOM   9241  O  OD2 . ASP D  1 207 ? -1.556 -53.849 -94.988  1.00 51.53 ? 207 ASP D OD2 1 
ATOM   9242  N  N   . TYR D  1 208 ? 0.789  -49.855 -92.150  1.00 27.08 ? 208 TYR D N   1 
ATOM   9243  C  CA  . TYR D  1 208 ? 0.952  -48.960 -91.013  1.00 27.17 ? 208 TYR D CA  1 
ATOM   9244  C  C   . TYR D  1 208 ? 1.528  -47.632 -91.480  1.00 26.87 ? 208 TYR D C   1 
ATOM   9245  O  O   . TYR D  1 208 ? 1.019  -46.567 -91.127  1.00 27.03 ? 208 TYR D O   1 
ATOM   9246  C  CB  . TYR D  1 208 ? 1.857  -49.597 -89.959  1.00 27.01 ? 208 TYR D CB  1 
ATOM   9247  C  CG  . TYR D  1 208 ? 2.192  -48.683 -88.800  1.00 28.25 ? 208 TYR D CG  1 
ATOM   9248  C  CD1 . TYR D  1 208 ? 1.214  -48.283 -87.900  1.00 29.02 ? 208 TYR D CD1 1 
ATOM   9249  C  CD2 . TYR D  1 208 ? 3.487  -48.226 -88.605  1.00 26.01 ? 208 TYR D CD2 1 
ATOM   9250  C  CE1 . TYR D  1 208 ? 1.514  -47.452 -86.837  1.00 26.71 ? 208 TYR D CE1 1 
ATOM   9251  C  CE2 . TYR D  1 208 ? 3.800  -47.388 -87.545  1.00 28.29 ? 208 TYR D CE2 1 
ATOM   9252  C  CZ  . TYR D  1 208 ? 2.810  -47.007 -86.665  1.00 27.85 ? 208 TYR D CZ  1 
ATOM   9253  O  OH  . TYR D  1 208 ? 3.113  -46.177 -85.610  1.00 28.75 ? 208 TYR D OH  1 
ATOM   9254  N  N   . ILE D  1 209 ? 2.581  -47.706 -92.292  1.00 27.74 ? 209 ILE D N   1 
ATOM   9255  C  CA  . ILE D  1 209 ? 3.230  -46.516 -92.832  1.00 24.51 ? 209 ILE D CA  1 
ATOM   9256  C  C   . ILE D  1 209 ? 2.236  -45.654 -93.615  1.00 26.54 ? 209 ILE D C   1 
ATOM   9257  O  O   . ILE D  1 209 ? 2.158  -44.444 -93.412  1.00 24.15 ? 209 ILE D O   1 
ATOM   9258  C  CB  . ILE D  1 209 ? 4.442  -46.881 -93.719  1.00 25.58 ? 209 ILE D CB  1 
ATOM   9259  C  CG1 . ILE D  1 209 ? 5.492  -47.638 -92.898  1.00 25.22 ? 209 ILE D CG1 1 
ATOM   9260  C  CG2 . ILE D  1 209 ? 5.047  -45.628 -94.340  1.00 22.52 ? 209 ILE D CG2 1 
ATOM   9261  C  CD1 . ILE D  1 209 ? 6.577  -48.304 -93.724  1.00 24.29 ? 209 ILE D CD1 1 
ATOM   9262  N  N   . LYS D  1 210 ? 1.465  -46.288 -94.495  1.00 24.59 ? 210 LYS D N   1 
ATOM   9263  C  CA  . LYS D  1 210 ? 0.478  -45.583 -95.309  1.00 26.16 ? 210 LYS D CA  1 
ATOM   9264  C  C   . LYS D  1 210 ? -0.598 -44.915 -94.461  1.00 29.39 ? 210 LYS D C   1 
ATOM   9265  O  O   . LYS D  1 210 ? -1.042 -43.803 -94.766  1.00 28.14 ? 210 LYS D O   1 
ATOM   9266  C  CB  . LYS D  1 210 ? -0.181 -46.540 -96.301  1.00 26.09 ? 210 LYS D CB  1 
ATOM   9267  C  CG  . LYS D  1 210 ? 0.701  -46.937 -97.474  1.00 25.92 ? 210 LYS D CG  1 
ATOM   9268  C  CD  . LYS D  1 210 ? -0.071 -47.825 -98.447  1.00 27.30 ? 210 LYS D CD  1 
ATOM   9269  C  CE  . LYS D  1 210 ? 0.789  -48.239 -99.631  1.00 26.12 ? 210 LYS D CE  1 
ATOM   9270  N  NZ  . LYS D  1 210 ? 0.009  -48.998 -100.652 1.00 31.17 ? 210 LYS D NZ  1 
ATOM   9271  N  N   . LYS D  1 211 ? -1.025 -45.601 -93.406  1.00 26.68 ? 211 LYS D N   1 
ATOM   9272  C  CA  . LYS D  1 211 ? -2.026 -45.052 -92.499  1.00 31.07 ? 211 LYS D CA  1 
ATOM   9273  C  C   . LYS D  1 211 ? -1.600 -43.669 -92.002  1.00 27.60 ? 211 LYS D C   1 
ATOM   9274  O  O   . LYS D  1 211 ? -2.384 -42.719 -92.019  1.00 28.53 ? 211 LYS D O   1 
ATOM   9275  C  CB  . LYS D  1 211 ? -2.248 -45.998 -91.318  1.00 34.23 ? 211 LYS D CB  1 
ATOM   9276  C  CG  . LYS D  1 211 ? -3.362 -45.567 -90.377  1.00 41.04 ? 211 LYS D CG  1 
ATOM   9277  C  CD  . LYS D  1 211 ? -3.515 -46.554 -89.233  1.00 44.56 ? 211 LYS D CD  1 
ATOM   9278  C  CE  . LYS D  1 211 ? -3.690 -47.968 -89.760  1.00 51.22 ? 211 LYS D CE  1 
ATOM   9279  N  NZ  . LYS D  1 211 ? -4.059 -48.923 -88.680  1.00 62.67 ? 211 LYS D NZ  1 
ATOM   9280  N  N   . ILE D  1 212 ? -0.348 -43.555 -91.578  1.00 26.09 ? 212 ILE D N   1 
ATOM   9281  C  CA  . ILE D  1 212 ? 0.164  -42.285 -91.070  1.00 24.10 ? 212 ILE D CA  1 
ATOM   9282  C  C   . ILE D  1 212 ? 0.222  -41.220 -92.170  1.00 23.69 ? 212 ILE D C   1 
ATOM   9283  O  O   . ILE D  1 212 ? -0.184 -40.078 -91.956  1.00 24.79 ? 212 ILE D O   1 
ATOM   9284  C  CB  . ILE D  1 212 ? 1.528  -42.471 -90.382  1.00 23.07 ? 212 ILE D CB  1 
ATOM   9285  C  CG1 . ILE D  1 212 ? 1.333  -43.239 -89.069  1.00 22.07 ? 212 ILE D CG1 1 
ATOM   9286  C  CG2 . ILE D  1 212 ? 2.178  -41.124 -90.114  1.00 19.92 ? 212 ILE D CG2 1 
ATOM   9287  C  CD1 . ILE D  1 212 ? 2.573  -43.926 -88.547  1.00 22.67 ? 212 ILE D CD1 1 
ATOM   9288  N  N   . ALA D  1 213 ? 0.708  -41.602 -93.350  1.00 23.06 ? 213 ALA D N   1 
ATOM   9289  C  CA  . ALA D  1 213 ? 0.726  -40.701 -94.505  1.00 25.44 ? 213 ALA D CA  1 
ATOM   9290  C  C   . ALA D  1 213 ? -0.680 -40.261 -94.911  1.00 25.46 ? 213 ALA D C   1 
ATOM   9291  O  O   . ALA D  1 213 ? -0.909 -39.089 -95.225  1.00 24.54 ? 213 ALA D O   1 
ATOM   9292  C  CB  . ALA D  1 213 ? 1.435  -41.355 -95.687  1.00 22.88 ? 213 ALA D CB  1 
ATOM   9293  N  N   . ASP D  1 214 ? -1.614 -41.207 -94.909  1.00 26.61 ? 214 ASP D N   1 
ATOM   9294  C  CA  . ASP D  1 214 ? -2.998 -40.931 -95.292  1.00 29.78 ? 214 ASP D CA  1 
ATOM   9295  C  C   . ASP D  1 214 ? -3.635 -39.900 -94.371  1.00 32.80 ? 214 ASP D C   1 
ATOM   9296  O  O   . ASP D  1 214 ? -4.492 -39.126 -94.791  1.00 28.95 ? 214 ASP D O   1 
ATOM   9297  C  CB  . ASP D  1 214 ? -3.834 -42.212 -95.261  1.00 30.95 ? 214 ASP D CB  1 
ATOM   9298  C  CG  . ASP D  1 214 ? -3.564 -43.112 -96.446  1.00 35.94 ? 214 ASP D CG  1 
ATOM   9299  O  OD1 . ASP D  1 214 ? -3.050 -42.612 -97.469  1.00 31.96 ? 214 ASP D OD1 1 
ATOM   9300  O  OD2 . ASP D  1 214 ? -3.871 -44.319 -96.353  1.00 43.45 ? 214 ASP D OD2 1 
ATOM   9301  N  N   . LYS D  1 215 ? -3.225 -39.905 -93.108  1.00 31.24 ? 215 LYS D N   1 
ATOM   9302  C  CA  . LYS D  1 215 ? -3.753 -38.945 -92.149  1.00 29.30 ? 215 LYS D CA  1 
ATOM   9303  C  C   . LYS D  1 215 ? -3.059 -37.578 -92.260  1.00 31.66 ? 215 LYS D C   1 
ATOM   9304  O  O   . LYS D  1 215 ? -3.374 -36.654 -91.514  1.00 31.40 ? 215 LYS D O   1 
ATOM   9305  C  CB  . LYS D  1 215 ? -3.681 -39.508 -90.727  1.00 32.97 ? 215 LYS D CB  1 
ATOM   9306  C  CG  . LYS D  1 215 ? -4.683 -40.632 -90.473  1.00 35.65 ? 215 LYS D CG  1 
ATOM   9307  C  CD  . LYS D  1 215 ? -4.494 -41.249 -89.096  1.00 37.31 ? 215 LYS D CD  1 
ATOM   9308  C  CE  . LYS D  1 215 ? -5.391 -42.462 -88.901  1.00 42.68 ? 215 LYS D CE  1 
ATOM   9309  N  NZ  . LYS D  1 215 ? -6.832 -42.096 -88.813  1.00 37.80 ? 215 LYS D NZ  1 
ATOM   9310  N  N   . GLY D  1 216 ? -2.116 -37.455 -93.194  1.00 26.77 ? 216 GLY D N   1 
ATOM   9311  C  CA  . GLY D  1 216 ? -1.586 -36.140 -93.566  1.00 22.24 ? 216 GLY D CA  1 
ATOM   9312  C  C   . GLY D  1 216 ? -0.145 -35.815 -93.193  1.00 20.80 ? 216 GLY D C   1 
ATOM   9313  O  O   . GLY D  1 216 ? 0.354  -34.752 -93.545  1.00 20.01 ? 216 GLY D O   1 
ATOM   9314  N  N   . SER D  1 217 ? 0.536  -36.722 -92.498  1.00 18.86 ? 217 SER D N   1 
ATOM   9315  C  CA  . SER D  1 217 ? 1.887  -36.435 -92.013  1.00 19.76 ? 217 SER D CA  1 
ATOM   9316  C  C   . SER D  1 217 ? 2.979  -37.003 -92.912  1.00 20.45 ? 217 SER D C   1 
ATOM   9317  O  O   . SER D  1 217 ? 2.758  -37.973 -93.639  1.00 20.59 ? 217 SER D O   1 
ATOM   9318  C  CB  . SER D  1 217 ? 2.069  -36.959 -90.584  1.00 19.52 ? 217 SER D CB  1 
ATOM   9319  O  OG  . SER D  1 217 ? 1.206  -36.286 -89.683  1.00 20.39 ? 217 SER D OG  1 
ATOM   9320  N  N   . PHE D  1 218 ? 4.163  -36.400 -92.851  1.00 17.50 ? 218 PHE D N   1 
ATOM   9321  C  CA  . PHE D  1 218 ? 5.315  -36.945 -93.550  1.00 18.55 ? 218 PHE D CA  1 
ATOM   9322  C  C   . PHE D  1 218 ? 5.783  -38.214 -92.853  1.00 20.61 ? 218 PHE D C   1 
ATOM   9323  O  O   . PHE D  1 218 ? 5.632  -38.361 -91.632  1.00 19.72 ? 218 PHE D O   1 
ATOM   9324  C  CB  . PHE D  1 218 ? 6.456  -35.924 -93.623  1.00 18.43 ? 218 PHE D CB  1 
ATOM   9325  C  CG  . PHE D  1 218 ? 6.183  -34.779 -94.562  1.00 18.21 ? 218 PHE D CG  1 
ATOM   9326  C  CD1 . PHE D  1 218 ? 5.783  -33.547 -94.076  1.00 18.21 ? 218 PHE D CD1 1 
ATOM   9327  C  CD2 . PHE D  1 218 ? 6.323  -34.942 -95.933  1.00 17.86 ? 218 PHE D CD2 1 
ATOM   9328  C  CE1 . PHE D  1 218 ? 5.535  -32.493 -94.939  1.00 20.89 ? 218 PHE D CE1 1 
ATOM   9329  C  CE2 . PHE D  1 218 ? 6.072  -33.893 -96.804  1.00 18.96 ? 218 PHE D CE2 1 
ATOM   9330  C  CZ  . PHE D  1 218 ? 5.677  -32.666 -96.305  1.00 19.11 ? 218 PHE D CZ  1 
ATOM   9331  N  N   . ILE D  1 219 ? 6.346  -39.133 -93.630  1.00 17.67 ? 219 ILE D N   1 
ATOM   9332  C  CA  . ILE D  1 219 ? 6.791  -40.404 -93.084  1.00 17.72 ? 219 ILE D CA  1 
ATOM   9333  C  C   . ILE D  1 219 ? 8.301  -40.548 -93.230  1.00 19.65 ? 219 ILE D C   1 
ATOM   9334  O  O   . ILE D  1 219 ? 8.844  -40.421 -94.328  1.00 17.98 ? 219 ILE D O   1 
ATOM   9335  C  CB  . ILE D  1 219 ? 6.040  -41.593 -93.728  1.00 23.29 ? 219 ILE D CB  1 
ATOM   9336  C  CG1 . ILE D  1 219 ? 6.141  -41.544 -95.255  1.00 21.98 ? 219 ILE D CG1 1 
ATOM   9337  C  CG2 . ILE D  1 219 ? 4.568  -41.564 -93.330  1.00 19.46 ? 219 ILE D CG2 1 
ATOM   9338  C  CD1 . ILE D  1 219 ? 5.390  -42.667 -95.939  1.00 25.40 ? 219 ILE D CD1 1 
ATOM   9339  N  N   . GLY D  1 220 ? 8.973  -40.804 -92.111  1.00 19.27 ? 220 GLY D N   1 
ATOM   9340  C  CA  . GLY D  1 220 ? 10.431 -40.839 -92.077  1.00 18.66 ? 220 GLY D CA  1 
ATOM   9341  C  C   . GLY D  1 220 ? 11.014 -42.202 -92.411  1.00 21.38 ? 220 GLY D C   1 
ATOM   9342  O  O   . GLY D  1 220 ? 11.035 -43.110 -91.574  1.00 20.04 ? 220 GLY D O   1 
ATOM   9343  N  N   . LEU D  1 221 ? 11.470 -42.349 -93.649  1.00 18.21 ? 221 LEU D N   1 
ATOM   9344  C  CA  . LEU D  1 221 ? 12.202 -43.539 -94.063  1.00 19.84 ? 221 LEU D CA  1 
ATOM   9345  C  C   . LEU D  1 221 ? 13.660 -43.157 -93.870  1.00 18.75 ? 221 LEU D C   1 
ATOM   9346  O  O   . LEU D  1 221 ? 14.406 -42.937 -94.831  1.00 19.67 ? 221 LEU D O   1 
ATOM   9347  C  CB  . LEU D  1 221 ? 11.888 -43.864 -95.521  1.00 17.81 ? 221 LEU D CB  1 
ATOM   9348  C  CG  . LEU D  1 221 ? 10.382 -43.905 -95.820  1.00 19.83 ? 221 LEU D CG  1 
ATOM   9349  C  CD1 . LEU D  1 221 ? 10.103 -44.291 -97.270  1.00 21.57 ? 221 LEU D CD1 1 
ATOM   9350  C  CD2 . LEU D  1 221 ? 9.682  -44.865 -94.870  1.00 18.75 ? 221 LEU D CD2 1 
ATOM   9351  N  N   . ASP D  1 222 ? 14.050 -43.069 -92.606  1.00 19.16 ? 222 ASP D N   1 
ATOM   9352  C  CA  . ASP D  1 222 ? 15.103 -42.141 -92.210  1.00 17.51 ? 222 ASP D CA  1 
ATOM   9353  C  C   . ASP D  1 222 ? 16.263 -42.761 -91.463  1.00 18.06 ? 222 ASP D C   1 
ATOM   9354  O  O   . ASP D  1 222 ? 17.009 -42.044 -90.803  1.00 19.02 ? 222 ASP D O   1 
ATOM   9355  C  CB  . ASP D  1 222 ? 14.493 -41.020 -91.353  1.00 18.56 ? 222 ASP D CB  1 
ATOM   9356  C  CG  . ASP D  1 222 ? 13.754 -41.555 -90.130  1.00 18.24 ? 222 ASP D CG  1 
ATOM   9357  O  OD1 . ASP D  1 222 ? 12.902 -40.831 -89.575  1.00 18.49 ? 222 ASP D OD1 1 
ATOM   9358  O  OD2 . ASP D  1 222 ? 14.027 -42.709 -89.727  1.00 17.86 ? 222 ASP D OD2 1 
ATOM   9359  N  N   . ARG D  1 223 ? 16.426 -44.079 -91.565  1.00 17.56 ? 223 ARG D N   1 
ATOM   9360  C  CA  . ARG D  1 223 ? 17.545 -44.744 -90.892  1.00 19.44 ? 223 ARG D CA  1 
ATOM   9361  C  C   . ARG D  1 223 ? 18.337 -45.636 -91.838  1.00 19.93 ? 223 ARG D C   1 
ATOM   9362  O  O   . ARG D  1 223 ? 18.796 -46.718 -91.464  1.00 20.55 ? 223 ARG D O   1 
ATOM   9363  C  CB  . ARG D  1 223 ? 17.061 -45.520 -89.658  1.00 18.65 ? 223 ARG D CB  1 
ATOM   9364  C  CG  . ARG D  1 223 ? 16.913 -44.642 -88.425  1.00 18.51 ? 223 ARG D CG  1 
ATOM   9365  C  CD  . ARG D  1 223 ? 16.238 -45.375 -87.276  1.00 20.43 ? 223 ARG D CD  1 
ATOM   9366  N  NE  . ARG D  1 223 ? 16.599 -44.775 -85.999  1.00 20.64 ? 223 ARG D NE  1 
ATOM   9367  C  CZ  . ARG D  1 223 ? 16.164 -45.201 -84.820  1.00 19.95 ? 223 ARG D CZ  1 
ATOM   9368  N  NH1 . ARG D  1 223 ? 15.336 -46.235 -84.750  1.00 20.71 ? 223 ARG D NH1 1 
ATOM   9369  N  NH2 . ARG D  1 223 ? 16.558 -44.588 -83.710  1.00 18.72 ? 223 ARG D NH2 1 
ATOM   9370  N  N   . TYR D  1 224 ? 18.506 -45.168 -93.068  1.00 20.83 ? 224 TYR D N   1 
ATOM   9371  C  CA  . TYR D  1 224 ? 19.239 -45.926 -94.070  1.00 25.85 ? 224 TYR D CA  1 
ATOM   9372  C  C   . TYR D  1 224 ? 20.666 -46.239 -93.619  1.00 26.13 ? 224 TYR D C   1 
ATOM   9373  O  O   . TYR D  1 224 ? 21.458 -45.336 -93.324  1.00 21.43 ? 224 TYR D O   1 
ATOM   9374  C  CB  . TYR D  1 224 ? 19.235 -45.187 -95.407  1.00 23.10 ? 224 TYR D CB  1 
ATOM   9375  C  CG  . TYR D  1 224 ? 18.116 -45.621 -96.320  1.00 23.71 ? 224 TYR D CG  1 
ATOM   9376  C  CD1 . TYR D  1 224 ? 16.925 -44.899 -96.406  1.00 24.85 ? 224 TYR D CD1 1 
ATOM   9377  C  CD2 . TYR D  1 224 ? 18.243 -46.765 -97.096  1.00 26.93 ? 224 TYR D CD2 1 
ATOM   9378  C  CE1 . TYR D  1 224 ? 15.900 -45.309 -97.252  1.00 22.72 ? 224 TYR D CE1 1 
ATOM   9379  C  CE2 . TYR D  1 224 ? 17.230 -47.178 -97.937  1.00 24.55 ? 224 TYR D CE2 1 
ATOM   9380  C  CZ  . TYR D  1 224 ? 16.063 -46.453 -98.014  1.00 24.92 ? 224 TYR D CZ  1 
ATOM   9381  O  OH  . TYR D  1 224 ? 15.069 -46.887 -98.864  1.00 26.57 ? 224 TYR D OH  1 
ATOM   9382  N  N   . GLY D  1 225 ? 20.985 -47.527 -93.571  1.00 22.96 ? 225 GLY D N   1 
ATOM   9383  C  CA  . GLY D  1 225 ? 22.290 -47.972 -93.104  1.00 23.35 ? 225 GLY D CA  1 
ATOM   9384  C  C   . GLY D  1 225 ? 22.225 -48.691 -91.770  1.00 25.98 ? 225 GLY D C   1 
ATOM   9385  O  O   . GLY D  1 225 ? 23.119 -49.468 -91.434  1.00 27.16 ? 225 GLY D O   1 
ATOM   9386  N  N   . LEU D  1 226 ? 21.169 -48.431 -91.001  1.00 22.45 ? 226 LEU D N   1 
ATOM   9387  C  CA  . LEU D  1 226 ? 21.011 -49.069 -89.698  1.00 25.50 ? 226 LEU D CA  1 
ATOM   9388  C  C   . LEU D  1 226 ? 20.326 -50.431 -89.832  1.00 27.32 ? 226 LEU D C   1 
ATOM   9389  O  O   . LEU D  1 226 ? 19.156 -50.600 -89.489  1.00 28.44 ? 226 LEU D O   1 
ATOM   9390  C  CB  . LEU D  1 226 ? 20.288 -48.138 -88.719  1.00 24.21 ? 226 LEU D CB  1 
ATOM   9391  C  CG  . LEU D  1 226 ? 21.185 -46.981 -88.243  1.00 28.73 ? 226 LEU D CG  1 
ATOM   9392  C  CD1 . LEU D  1 226 ? 20.392 -45.821 -87.653  1.00 21.46 ? 226 LEU D CD1 1 
ATOM   9393  C  CD2 . LEU D  1 226 ? 22.215 -47.485 -87.244  1.00 24.72 ? 226 LEU D CD2 1 
ATOM   9394  N  N   . ASP D  1 227 ? 21.082 -51.399 -90.345  1.00 30.87 ? 227 ASP D N   1 
ATOM   9395  C  CA  . ASP D  1 227 ? 20.565 -52.737 -90.634  1.00 32.37 ? 227 ASP D CA  1 
ATOM   9396  C  C   . ASP D  1 227 ? 19.905 -53.413 -89.441  1.00 31.79 ? 227 ASP D C   1 
ATOM   9397  O  O   . ASP D  1 227 ? 18.950 -54.168 -89.612  1.00 33.95 ? 227 ASP D O   1 
ATOM   9398  C  CB  . ASP D  1 227 ? 21.675 -53.634 -91.187  1.00 31.22 ? 227 ASP D CB  1 
ATOM   9399  C  CG  . ASP D  1 227 ? 22.147 -53.191 -92.554  1.00 38.76 ? 227 ASP D CG  1 
ATOM   9400  O  OD1 . ASP D  1 227 ? 21.440 -52.378 -93.194  1.00 34.34 ? 227 ASP D OD1 1 
ATOM   9401  O  OD2 . ASP D  1 227 ? 23.222 -53.654 -92.988  1.00 38.90 ? 227 ASP D OD2 1 
ATOM   9402  N  N   . LEU D  1 228 ? 20.410 -53.146 -88.238  1.00 32.13 ? 228 LEU D N   1 
ATOM   9403  C  CA  . LEU D  1 228 ? 19.858 -53.768 -87.034  1.00 33.07 ? 228 LEU D CA  1 
ATOM   9404  C  C   . LEU D  1 228 ? 18.377 -53.420 -86.853  1.00 35.45 ? 228 LEU D C   1 
ATOM   9405  O  O   . LEU D  1 228 ? 17.641 -54.146 -86.190  1.00 34.64 ? 228 LEU D O   1 
ATOM   9406  C  CB  . LEU D  1 228 ? 20.666 -53.392 -85.781  1.00 31.68 ? 228 LEU D CB  1 
ATOM   9407  C  CG  . LEU D  1 228 ? 20.552 -51.969 -85.221  1.00 29.21 ? 228 LEU D CG  1 
ATOM   9408  C  CD1 . LEU D  1 228 ? 21.178 -51.870 -83.836  1.00 26.62 ? 228 LEU D CD1 1 
ATOM   9409  C  CD2 . LEU D  1 228 ? 21.165 -50.941 -86.163  1.00 29.42 ? 228 LEU D CD2 1 
ATOM   9410  N  N   . PHE D  1 229 ? 17.941 -52.310 -87.442  1.00 31.10 ? 229 PHE D N   1 
ATOM   9411  C  CA  . PHE D  1 229 ? 16.517 -51.970 -87.437  1.00 32.65 ? 229 PHE D CA  1 
ATOM   9412  C  C   . PHE D  1 229 ? 15.823 -52.560 -88.662  1.00 32.76 ? 229 PHE D C   1 
ATOM   9413  O  O   . PHE D  1 229 ? 14.766 -53.180 -88.550  1.00 32.11 ? 229 PHE D O   1 
ATOM   9414  C  CB  . PHE D  1 229 ? 16.316 -50.454 -87.356  1.00 34.94 ? 229 PHE D CB  1 
ATOM   9415  C  CG  . PHE D  1 229 ? 16.895 -49.838 -86.111  1.00 35.87 ? 229 PHE D CG  1 
ATOM   9416  C  CD1 . PHE D  1 229 ? 16.629 -50.387 -84.864  1.00 40.53 ? 229 PHE D CD1 1 
ATOM   9417  C  CD2 . PHE D  1 229 ? 17.705 -48.716 -86.184  1.00 33.22 ? 229 PHE D CD2 1 
ATOM   9418  C  CE1 . PHE D  1 229 ? 17.157 -49.827 -83.713  1.00 37.39 ? 229 PHE D CE1 1 
ATOM   9419  C  CE2 . PHE D  1 229 ? 18.233 -48.151 -85.038  1.00 34.73 ? 229 PHE D CE2 1 
ATOM   9420  C  CZ  . PHE D  1 229 ? 17.963 -48.707 -83.801  1.00 35.33 ? 229 PHE D CZ  1 
ATOM   9421  N  N   . LEU D  1 230 ? 16.434 -52.364 -89.827  1.00 30.71 ? 230 LEU D N   1 
ATOM   9422  C  CA  . LEU D  1 230 ? 16.015 -53.024 -91.057  1.00 32.14 ? 230 LEU D CA  1 
ATOM   9423  C  C   . LEU D  1 230 ? 17.107 -52.847 -92.107  1.00 29.89 ? 230 LEU D C   1 
ATOM   9424  O  O   . LEU D  1 230 ? 17.578 -51.729 -92.330  1.00 29.77 ? 230 LEU D O   1 
ATOM   9425  C  CB  . LEU D  1 230 ? 14.681 -52.459 -91.560  1.00 32.27 ? 230 LEU D CB  1 
ATOM   9426  C  CG  . LEU D  1 230 ? 13.999 -53.225 -92.699  1.00 30.31 ? 230 LEU D CG  1 
ATOM   9427  C  CD1 . LEU D  1 230 ? 13.537 -54.598 -92.234  1.00 31.33 ? 230 LEU D CD1 1 
ATOM   9428  C  CD2 . LEU D  1 230 ? 12.831 -52.432 -93.267  1.00 27.10 ? 230 LEU D CD2 1 
ATOM   9429  N  N   . PRO D  1 231 ? 17.527 -53.953 -92.744  1.00 31.24 ? 231 PRO D N   1 
ATOM   9430  C  CA  . PRO D  1 231 ? 18.604 -53.917 -93.731  1.00 32.16 ? 231 PRO D CA  1 
ATOM   9431  C  C   . PRO D  1 231 ? 18.291 -52.999 -94.908  1.00 31.26 ? 231 PRO D C   1 
ATOM   9432  O  O   . PRO D  1 231 ? 17.128 -52.704 -95.178  1.00 29.49 ? 231 PRO D O   1 
ATOM   9433  C  CB  . PRO D  1 231 ? 18.701 -55.377 -94.199  1.00 36.66 ? 231 PRO D CB  1 
ATOM   9434  C  CG  . PRO D  1 231 ? 18.183 -56.170 -93.044  1.00 35.54 ? 231 PRO D CG  1 
ATOM   9435  C  CD  . PRO D  1 231 ? 17.066 -55.331 -92.486  1.00 35.81 ? 231 PRO D CD  1 
ATOM   9436  N  N   . VAL D  1 232 ? 19.335 -52.557 -95.599  1.00 26.50 ? 232 VAL D N   1 
ATOM   9437  C  CA  . VAL D  1 232 ? 19.190 -51.587 -96.676  1.00 29.78 ? 232 VAL D CA  1 
ATOM   9438  C  C   . VAL D  1 232 ? 18.238 -52.063 -97.773  1.00 32.08 ? 232 VAL D C   1 
ATOM   9439  O  O   . VAL D  1 232 ? 17.403 -51.299 -98.252  1.00 32.62 ? 232 VAL D O   1 
ATOM   9440  C  CB  . VAL D  1 232 ? 20.559 -51.227 -97.286  1.00 30.77 ? 232 VAL D CB  1 
ATOM   9441  C  CG1 . VAL D  1 232 ? 20.392 -50.264 -98.455  1.00 26.78 ? 232 VAL D CG1 1 
ATOM   9442  C  CG2 . VAL D  1 232 ? 21.466 -50.638 -96.216  1.00 25.90 ? 232 VAL D CG2 1 
ATOM   9443  N  N   . ASP D  1 233 ? 18.355 -53.330 -98.160  1.00 31.26 ? 233 ASP D N   1 
ATOM   9444  C  CA  . ASP D  1 233 ? 17.538 -53.860 -99.249  1.00 34.49 ? 233 ASP D CA  1 
ATOM   9445  C  C   . ASP D  1 233 ? 16.037 -53.891 -98.934  1.00 33.69 ? 233 ASP D C   1 
ATOM   9446  O  O   . ASP D  1 233 ? 15.215 -53.584 -99.799  1.00 35.98 ? 233 ASP D O   1 
ATOM   9447  C  CB  . ASP D  1 233 ? 18.040 -55.243 -99.703  1.00 39.31 ? 233 ASP D CB  1 
ATOM   9448  C  CG  . ASP D  1 233 ? 17.914 -56.308 -98.622  1.00 48.68 ? 233 ASP D CG  1 
ATOM   9449  O  OD1 . ASP D  1 233 ? 17.738 -55.966 -97.431  1.00 48.20 ? 233 ASP D OD1 1 
ATOM   9450  O  OD2 . ASP D  1 233 ? 17.998 -57.504 -98.971  1.00 59.61 ? 233 ASP D OD2 1 
ATOM   9451  N  N   . LYS D  1 234 ? 15.678 -54.253 -97.708  1.00 31.49 ? 234 LYS D N   1 
ATOM   9452  C  CA  . LYS D  1 234 ? 14.269 -54.254 -97.309  1.00 33.96 ? 234 LYS D CA  1 
ATOM   9453  C  C   . LYS D  1 234 ? 13.703 -52.839 -97.220  1.00 31.09 ? 234 LYS D C   1 
ATOM   9454  O  O   . LYS D  1 234 ? 12.547 -52.600 -97.567  1.00 31.39 ? 234 LYS D O   1 
ATOM   9455  C  CB  . LYS D  1 234 ? 14.066 -54.991 -95.986  1.00 33.69 ? 234 LYS D CB  1 
ATOM   9456  C  CG  . LYS D  1 234 ? 14.143 -56.504 -96.115  1.00 46.65 ? 234 LYS D CG  1 
ATOM   9457  C  CD  . LYS D  1 234 ? 13.095 -57.019 -97.087  1.00 46.02 ? 234 LYS D CD  1 
ATOM   9458  C  CE  . LYS D  1 234 ? 13.312 -58.488 -97.414  1.00 59.19 ? 234 LYS D CE  1 
ATOM   9459  N  NZ  . LYS D  1 234 ? 13.255 -59.337 -96.192  1.00 61.37 ? 234 LYS D NZ  1 
ATOM   9460  N  N   . ARG D  1 235 ? 14.514 -51.905 -96.738  1.00 28.11 ? 235 ARG D N   1 
ATOM   9461  C  CA  . ARG D  1 235 ? 14.118 -50.504 -96.736  1.00 26.96 ? 235 ARG D CA  1 
ATOM   9462  C  C   . ARG D  1 235 ? 13.844 -50.053 -98.167  1.00 25.93 ? 235 ARG D C   1 
ATOM   9463  O  O   . ARG D  1 235 ? 12.839 -49.403 -98.441  1.00 25.85 ? 235 ARG D O   1 
ATOM   9464  C  CB  . ARG D  1 235 ? 15.215 -49.635 -96.113  1.00 24.03 ? 235 ARG D CB  1 
ATOM   9465  C  CG  . ARG D  1 235 ? 15.412 -49.886 -94.627  1.00 25.23 ? 235 ARG D CG  1 
ATOM   9466  C  CD  . ARG D  1 235 ? 16.538 -49.041 -94.051  1.00 21.59 ? 235 ARG D CD  1 
ATOM   9467  N  NE  . ARG D  1 235 ? 16.644 -49.229 -92.605  1.00 23.48 ? 235 ARG D NE  1 
ATOM   9468  C  CZ  . ARG D  1 235 ? 16.059 -48.447 -91.707  1.00 25.51 ? 235 ARG D CZ  1 
ATOM   9469  N  NH1 . ARG D  1 235 ? 16.211 -48.697 -90.411  1.00 21.99 ? 235 ARG D NH1 1 
ATOM   9470  N  NH2 . ARG D  1 235 ? 15.328 -47.410 -92.106  1.00 22.73 ? 235 ARG D NH2 1 
ATOM   9471  N  N   . ASN D  1 236 ? 14.748 -50.412 -99.075  1.00 23.73 ? 236 ASN D N   1 
ATOM   9472  C  CA  . ASN D  1 236 ? 14.628 -50.015 -100.468 1.00 26.68 ? 236 ASN D CA  1 
ATOM   9473  C  C   . ASN D  1 236 ? 13.341 -50.552 -101.082 1.00 26.91 ? 236 ASN D C   1 
ATOM   9474  O  O   . ASN D  1 236 ? 12.607 -49.819 -101.745 1.00 27.98 ? 236 ASN D O   1 
ATOM   9475  C  CB  . ASN D  1 236 ? 15.848 -50.480 -101.273 1.00 25.44 ? 236 ASN D CB  1 
ATOM   9476  C  CG  . ASN D  1 236 ? 17.037 -49.547 -101.127 1.00 30.29 ? 236 ASN D CG  1 
ATOM   9477  O  OD1 . ASN D  1 236 ? 16.917 -48.435 -100.605 1.00 26.60 ? 236 ASN D OD1 1 
ATOM   9478  N  ND2 . ASN D  1 236 ? 18.194 -49.993 -101.600 1.00 28.15 ? 236 ASN D ND2 1 
ATOM   9479  N  N   . GLU D  1 237 ? 13.066 -51.832 -100.845 1.00 25.66 ? 237 GLU D N   1 
ATOM   9480  C  CA  . GLU D  1 237 ? 11.847 -52.447 -101.356 1.00 28.40 ? 237 GLU D CA  1 
ATOM   9481  C  C   . GLU D  1 237 ? 10.624 -51.676 -100.874 1.00 27.26 ? 237 GLU D C   1 
ATOM   9482  O  O   . GLU D  1 237 ? 9.728  -51.365 -101.660 1.00 26.23 ? 237 GLU D O   1 
ATOM   9483  C  CB  . GLU D  1 237 ? 11.759 -53.911 -100.929 1.00 34.90 ? 237 GLU D CB  1 
ATOM   9484  C  CG  . GLU D  1 237 ? 12.888 -54.773 -101.466 1.00 45.01 ? 237 GLU D CG  1 
ATOM   9485  C  CD  . GLU D  1 237 ? 12.841 -56.196 -100.940 1.00 56.36 ? 237 GLU D CD  1 
ATOM   9486  O  OE1 . GLU D  1 237 ? 13.884 -56.885 -100.993 1.00 55.38 ? 237 GLU D OE1 1 
ATOM   9487  O  OE2 . GLU D  1 237 ? 11.764 -56.623 -100.471 1.00 61.29 ? 237 GLU D OE2 1 
ATOM   9488  N  N   . THR D  1 238 ? 10.597 -51.364 -99.581  1.00 25.37 ? 238 THR D N   1 
ATOM   9489  C  CA  . THR D  1 238 ? 9.489  -50.615 -98.990  1.00 26.19 ? 238 THR D CA  1 
ATOM   9490  C  C   . THR D  1 238 ? 9.388  -49.206 -99.579  1.00 23.69 ? 238 THR D C   1 
ATOM   9491  O  O   . THR D  1 238 ? 8.311  -48.769 -99.995  1.00 25.42 ? 238 THR D O   1 
ATOM   9492  C  CB  . THR D  1 238 ? 9.646  -50.494 -97.460  1.00 25.60 ? 238 THR D CB  1 
ATOM   9493  O  OG1 . THR D  1 238 ? 9.837  -51.792 -96.889  1.00 28.30 ? 238 THR D OG1 1 
ATOM   9494  C  CG2 . THR D  1 238 ? 8.418  -49.851 -96.840  1.00 23.38 ? 238 THR D CG2 1 
ATOM   9495  N  N   . THR D  1 239 ? 10.513 -48.498 -99.594  1.00 24.42 ? 239 THR D N   1 
ATOM   9496  C  CA  . THR D  1 239 ? 10.569 -47.161 -100.171 1.00 23.16 ? 239 THR D CA  1 
ATOM   9497  C  C   . THR D  1 239 ? 10.034 -47.187 -101.596 1.00 24.31 ? 239 THR D C   1 
ATOM   9498  O  O   . THR D  1 239 ? 9.188  -46.375 -101.960 1.00 20.19 ? 239 THR D O   1 
ATOM   9499  C  CB  . THR D  1 239 ? 12.003 -46.606 -100.191 1.00 22.19 ? 239 THR D CB  1 
ATOM   9500  O  OG1 . THR D  1 239 ? 12.485 -46.480 -98.846  1.00 23.77 ? 239 THR D OG1 1 
ATOM   9501  C  CG2 . THR D  1 239 ? 12.038 -45.237 -100.888 1.00 19.47 ? 239 THR D CG2 1 
ATOM   9502  N  N   . LEU D  1 240 ? 10.529 -48.125 -102.400 1.00 22.69 ? 240 LEU D N   1 
ATOM   9503  C  CA  . LEU D  1 240 ? 10.099 -48.230 -103.795 1.00 23.48 ? 240 LEU D CA  1 
ATOM   9504  C  C   . LEU D  1 240 ? 8.595  -48.481 -103.887 1.00 24.98 ? 240 LEU D C   1 
ATOM   9505  O  O   . LEU D  1 240 ? 7.887  -47.826 -104.654 1.00 25.38 ? 240 LEU D O   1 
ATOM   9506  C  CB  . LEU D  1 240 ? 10.863 -49.347 -104.515 1.00 21.94 ? 240 LEU D CB  1 
ATOM   9507  C  CG  . LEU D  1 240 ? 10.512 -49.549 -105.991 1.00 23.28 ? 240 LEU D CG  1 
ATOM   9508  C  CD1 . LEU D  1 240 ? 10.897 -48.315 -106.800 1.00 21.97 ? 240 LEU D CD1 1 
ATOM   9509  C  CD2 . LEU D  1 240 ? 11.187 -50.803 -106.544 1.00 24.00 ? 240 LEU D CD2 1 
ATOM   9510  N  N   . ARG D  1 241 ? 8.115  -49.442 -103.106 1.00 25.67 ? 241 ARG D N   1 
ATOM   9511  C  CA  . ARG D  1 241 ? 6.695  -49.756 -103.065 1.00 27.94 ? 241 ARG D CA  1 
ATOM   9512  C  C   . ARG D  1 241 ? 5.845  -48.523 -102.737 1.00 25.39 ? 241 ARG D C   1 
ATOM   9513  O  O   . ARG D  1 241 ? 4.817  -48.286 -103.366 1.00 25.02 ? 241 ARG D O   1 
ATOM   9514  C  CB  . ARG D  1 241 ? 6.426  -50.876 -102.056 1.00 29.36 ? 241 ARG D CB  1 
ATOM   9515  C  CG  . ARG D  1 241 ? 4.952  -51.180 -101.846 1.00 41.56 ? 241 ARG D CG  1 
ATOM   9516  C  CD  . ARG D  1 241 ? 4.342  -51.860 -103.060 1.00 46.11 ? 241 ARG D CD  1 
ATOM   9517  N  NE  . ARG D  1 241 ? 2.887  -51.945 -102.967 1.00 51.33 ? 241 ARG D NE  1 
ATOM   9518  C  CZ  . ARG D  1 241 ? 2.231  -52.868 -102.269 1.00 60.57 ? 241 ARG D CZ  1 
ATOM   9519  N  NH1 . ARG D  1 241 ? 2.896  -53.792 -101.587 1.00 57.75 ? 241 ARG D NH1 1 
ATOM   9520  N  NH2 . ARG D  1 241 ? 0.905  -52.865 -102.249 1.00 63.00 ? 241 ARG D NH2 1 
ATOM   9521  N  N   . LEU D  1 242 ? 6.271  -47.742 -101.749 1.00 22.96 ? 242 LEU D N   1 
ATOM   9522  C  CA  . LEU D  1 242 ? 5.517  -46.556 -101.353 1.00 22.54 ? 242 LEU D CA  1 
ATOM   9523  C  C   . LEU D  1 242 ? 5.439  -45.535 -102.485 1.00 24.27 ? 242 LEU D C   1 
ATOM   9524  O  O   . LEU D  1 242 ? 4.395  -44.931 -102.723 1.00 25.44 ? 242 LEU D O   1 
ATOM   9525  C  CB  . LEU D  1 242 ? 6.124  -45.924 -100.096 1.00 24.34 ? 242 LEU D CB  1 
ATOM   9526  C  CG  . LEU D  1 242 ? 5.944  -46.751 -98.816  1.00 22.35 ? 242 LEU D CG  1 
ATOM   9527  C  CD1 . LEU D  1 242 ? 6.693  -46.117 -97.656  1.00 22.18 ? 242 LEU D CD1 1 
ATOM   9528  C  CD2 . LEU D  1 242 ? 4.471  -46.916 -98.476  1.00 23.47 ? 242 LEU D CD2 1 
ATOM   9529  N  N   . ILE D  1 243 ? 6.550  -45.354 -103.186 1.00 22.78 ? 243 ILE D N   1 
ATOM   9530  C  CA  . ILE D  1 243 ? 6.604  -44.425 -104.309 1.00 22.23 ? 243 ILE D CA  1 
ATOM   9531  C  C   . ILE D  1 243 ? 5.689  -44.873 -105.442 1.00 24.71 ? 243 ILE D C   1 
ATOM   9532  O  O   . ILE D  1 243 ? 4.938  -44.070 -106.009 1.00 24.36 ? 243 ILE D O   1 
ATOM   9533  C  CB  . ILE D  1 243 ? 8.046  -44.265 -104.824 1.00 19.74 ? 243 ILE D CB  1 
ATOM   9534  C  CG1 . ILE D  1 243 ? 8.859  -43.429 -103.830 1.00 19.63 ? 243 ILE D CG1 1 
ATOM   9535  C  CG2 . ILE D  1 243 ? 8.050  -43.632 -106.210 1.00 19.71 ? 243 ILE D CG2 1 
ATOM   9536  C  CD1 . ILE D  1 243 ? 10.351 -43.437 -104.090 1.00 19.64 ? 243 ILE D CD1 1 
ATOM   9537  N  N   . LYS D  1 244 ? 5.744  -46.160 -105.762 1.00 23.36 ? 244 LYS D N   1 
ATOM   9538  C  CA  . LYS D  1 244 ? 4.879  -46.713 -106.804 1.00 31.02 ? 244 LYS D CA  1 
ATOM   9539  C  C   . LYS D  1 244 ? 3.399  -46.577 -106.454 1.00 27.98 ? 244 LYS D C   1 
ATOM   9540  O  O   . LYS D  1 244 ? 2.571  -46.333 -107.331 1.00 26.18 ? 244 LYS D O   1 
ATOM   9541  C  CB  . LYS D  1 244 ? 5.247  -48.172 -107.106 1.00 35.36 ? 244 LYS D CB  1 
ATOM   9542  C  CG  . LYS D  1 244 ? 6.560  -48.306 -107.865 1.00 38.15 ? 244 LYS D CG  1 
ATOM   9543  C  CD  . LYS D  1 244 ? 6.556  -47.377 -109.071 1.00 47.05 ? 244 LYS D CD  1 
ATOM   9544  C  CE  . LYS D  1 244 ? 7.944  -46.850 -109.409 1.00 50.28 ? 244 LYS D CE  1 
ATOM   9545  N  NZ  . LYS D  1 244 ? 8.732  -47.801 -110.236 1.00 39.89 ? 244 LYS D NZ  1 
ATOM   9546  N  N   . ASP D  1 245 ? 3.074  -46.707 -105.171 1.00 27.68 ? 245 ASP D N   1 
ATOM   9547  C  CA  . ASP D  1 245 ? 1.691  -46.569 -104.714 1.00 29.05 ? 245 ASP D CA  1 
ATOM   9548  C  C   . ASP D  1 245 ? 1.242  -45.111 -104.530 1.00 28.17 ? 245 ASP D C   1 
ATOM   9549  O  O   . ASP D  1 245 ? 0.134  -44.851 -104.060 1.00 30.59 ? 245 ASP D O   1 
ATOM   9550  C  CB  . ASP D  1 245 ? 1.465  -47.369 -103.429 1.00 29.83 ? 245 ASP D CB  1 
ATOM   9551  C  CG  . ASP D  1 245 ? 1.556  -48.873 -103.653 1.00 36.85 ? 245 ASP D CG  1 
ATOM   9552  O  OD1 . ASP D  1 245 ? 1.456  -49.633 -102.667 1.00 35.03 ? 245 ASP D OD1 1 
ATOM   9553  O  OD2 . ASP D  1 245 ? 1.733  -49.295 -104.816 1.00 35.43 ? 245 ASP D OD2 1 
ATOM   9554  N  N   . GLY D  1 246 ? 2.109  -44.168 -104.882 1.00 26.43 ? 246 GLY D N   1 
ATOM   9555  C  CA  . GLY D  1 246 ? 1.739  -42.752 -104.904 1.00 25.28 ? 246 GLY D CA  1 
ATOM   9556  C  C   . GLY D  1 246 ? 2.038  -41.928 -103.660 1.00 26.58 ? 246 GLY D C   1 
ATOM   9557  O  O   . GLY D  1 246 ? 1.415  -40.889 -103.447 1.00 25.98 ? 246 GLY D O   1 
ATOM   9558  N  N   . TYR D  1 247 ? 2.995  -42.362 -102.843 1.00 23.57 ? 247 TYR D N   1 
ATOM   9559  C  CA  . TYR D  1 247 ? 3.272  -41.664 -101.584 1.00 24.65 ? 247 TYR D CA  1 
ATOM   9560  C  C   . TYR D  1 247 ? 4.504  -40.760 -101.593 1.00 22.17 ? 247 TYR D C   1 
ATOM   9561  O  O   . TYR D  1 247 ? 4.957  -40.321 -100.535 1.00 21.17 ? 247 TYR D O   1 
ATOM   9562  C  CB  . TYR D  1 247 ? 3.338  -42.655 -100.416 1.00 22.54 ? 247 TYR D CB  1 
ATOM   9563  C  CG  . TYR D  1 247 ? 1.973  -43.191 -100.055 1.00 24.54 ? 247 TYR D CG  1 
ATOM   9564  C  CD1 . TYR D  1 247 ? 1.394  -44.219 -100.790 1.00 25.94 ? 247 TYR D CD1 1 
ATOM   9565  C  CD2 . TYR D  1 247 ? 1.248  -42.645 -99.006  1.00 22.86 ? 247 TYR D CD2 1 
ATOM   9566  C  CE1 . TYR D  1 247 ? 0.138  -44.706 -100.477 1.00 24.85 ? 247 TYR D CE1 1 
ATOM   9567  C  CE2 . TYR D  1 247 ? -0.007 -43.127 -98.682  1.00 24.09 ? 247 TYR D CE2 1 
ATOM   9568  C  CZ  . TYR D  1 247 ? -0.557 -44.155 -99.423  1.00 25.81 ? 247 TYR D CZ  1 
ATOM   9569  O  OH  . TYR D  1 247 ? -1.802 -44.632 -99.103  1.00 25.74 ? 247 TYR D OH  1 
ATOM   9570  N  N   . SER D  1 248 ? 5.026  -40.472 -102.781 1.00 21.03 ? 248 SER D N   1 
ATOM   9571  C  CA  . SER D  1 248 ? 6.210  -39.624 -102.914 1.00 23.23 ? 248 SER D CA  1 
ATOM   9572  C  C   . SER D  1 248 ? 6.084  -38.317 -102.146 1.00 19.90 ? 248 SER D C   1 
ATOM   9573  O  O   . SER D  1 248 ? 7.048  -37.860 -101.541 1.00 21.10 ? 248 SER D O   1 
ATOM   9574  C  CB  . SER D  1 248 ? 6.493  -39.301 -104.385 1.00 25.69 ? 248 SER D CB  1 
ATOM   9575  O  OG  . SER D  1 248 ? 6.962  -40.442 -105.070 1.00 41.71 ? 248 SER D OG  1 
ATOM   9576  N  N   . ASP D  1 249 ? 4.902  -37.710 -102.184 1.00 19.62 ? 249 ASP D N   1 
ATOM   9577  C  CA  . ASP D  1 249 ? 4.726  -36.388 -101.591 1.00 22.20 ? 249 ASP D CA  1 
ATOM   9578  C  C   . ASP D  1 249 ? 4.646  -36.399 -100.059 1.00 20.50 ? 249 ASP D C   1 
ATOM   9579  O  O   . ASP D  1 249 ? 4.467  -35.347 -99.440  1.00 21.41 ? 249 ASP D O   1 
ATOM   9580  C  CB  . ASP D  1 249 ? 3.518  -35.660 -102.200 1.00 25.04 ? 249 ASP D CB  1 
ATOM   9581  C  CG  . ASP D  1 249 ? 2.191  -36.280 -101.806 1.00 32.31 ? 249 ASP D CG  1 
ATOM   9582  O  OD1 . ASP D  1 249 ? 2.185  -37.357 -101.173 1.00 36.90 ? 249 ASP D OD1 1 
ATOM   9583  O  OD2 . ASP D  1 249 ? 1.141  -35.689 -102.137 1.00 39.08 ? 249 ASP D OD2 1 
ATOM   9584  N  N   . LYS D  1 250 ? 4.786  -37.579 -99.455  1.00 17.06 ? 250 LYS D N   1 
ATOM   9585  C  CA  . LYS D  1 250 ? 4.810  -37.702 -97.986  1.00 18.75 ? 250 LYS D CA  1 
ATOM   9586  C  C   . LYS D  1 250 ? 6.112  -38.323 -97.476  1.00 18.52 ? 250 LYS D C   1 
ATOM   9587  O  O   . LYS D  1 250 ? 6.380  -38.342 -96.271  1.00 20.01 ? 250 LYS D O   1 
ATOM   9588  C  CB  . LYS D  1 250 ? 3.623  -38.533 -97.490  1.00 20.90 ? 250 LYS D CB  1 
ATOM   9589  C  CG  . LYS D  1 250 ? 2.267  -37.894 -97.745  1.00 22.89 ? 250 LYS D CG  1 
ATOM   9590  C  CD  . LYS D  1 250 ? 1.972  -36.812 -96.722  1.00 26.84 ? 250 LYS D CD  1 
ATOM   9591  C  CE  . LYS D  1 250 ? 0.720  -36.031 -97.094  1.00 32.15 ? 250 LYS D CE  1 
ATOM   9592  N  NZ  . LYS D  1 250 ? -0.423 -36.946 -97.357  1.00 38.21 ? 250 LYS D NZ  1 
ATOM   9593  N  N   . ILE D  1 251 ? 6.923  -38.815 -98.404  1.00 18.52 ? 251 ILE D N   1 
ATOM   9594  C  CA  . ILE D  1 251 ? 8.144  -39.528 -98.059  1.00 17.98 ? 251 ILE D CA  1 
ATOM   9595  C  C   . ILE D  1 251 ? 9.323  -38.598 -97.782  1.00 19.44 ? 251 ILE D C   1 
ATOM   9596  O  O   . ILE D  1 251 ? 9.608  -37.676 -98.551  1.00 17.94 ? 251 ILE D O   1 
ATOM   9597  C  CB  . ILE D  1 251 ? 8.554  -40.491 -99.184  1.00 18.80 ? 251 ILE D CB  1 
ATOM   9598  C  CG1 . ILE D  1 251 ? 7.628  -41.710 -99.204  1.00 19.46 ? 251 ILE D CG1 1 
ATOM   9599  C  CG2 . ILE D  1 251 ? 10.015 -40.901 -99.026  1.00 19.74 ? 251 ILE D CG2 1 
ATOM   9600  C  CD1 . ILE D  1 251 ? 7.866  -42.622 -100.382 1.00 19.14 ? 251 ILE D CD1 1 
ATOM   9601  N  N   . MET D  1 252 ? 10.003 -38.849 -96.671  1.00 19.02 ? 252 MET D N   1 
ATOM   9602  C  CA  . MET D  1 252 ? 11.274 -38.211 -96.401  1.00 18.05 ? 252 MET D CA  1 
ATOM   9603  C  C   . MET D  1 252 ? 12.326 -39.274 -96.119  1.00 19.10 ? 252 MET D C   1 
ATOM   9604  O  O   . MET D  1 252 ? 12.050 -40.261 -95.440  1.00 20.00 ? 252 MET D O   1 
ATOM   9605  C  CB  . MET D  1 252 ? 11.132 -37.226 -95.248  1.00 22.05 ? 252 MET D CB  1 
ATOM   9606  C  CG  . MET D  1 252 ? 10.339 -36.011 -95.691  1.00 30.49 ? 252 MET D CG  1 
ATOM   9607  S  SD  . MET D  1 252 ? 10.352 -34.637 -94.542  1.00 39.70 ? 252 MET D SD  1 
ATOM   9608  C  CE  . MET D  1 252 ? 10.504 -33.306 -95.717  1.00 26.63 ? 252 MET D CE  1 
ATOM   9609  N  N   . ILE D  1 253 ? 13.520 -39.075 -96.668  1.00 18.50 ? 253 ILE D N   1 
ATOM   9610  C  CA  . ILE D  1 253 ? 14.594 -40.069 -96.589  1.00 17.88 ? 253 ILE D CA  1 
ATOM   9611  C  C   . ILE D  1 253 ? 15.837 -39.463 -95.954  1.00 16.88 ? 253 ILE D C   1 
ATOM   9612  O  O   . ILE D  1 253 ? 16.227 -38.343 -96.292  1.00 16.55 ? 253 ILE D O   1 
ATOM   9613  C  CB  . ILE D  1 253 ? 14.944 -40.609 -97.996  1.00 17.54 ? 253 ILE D CB  1 
ATOM   9614  C  CG1 . ILE D  1 253 ? 13.746 -41.358 -98.589  1.00 18.72 ? 253 ILE D CG1 1 
ATOM   9615  C  CG2 . ILE D  1 253 ? 16.171 -41.516 -97.948  1.00 19.38 ? 253 ILE D CG2 1 
ATOM   9616  C  CD1 . ILE D  1 253 ? 13.976 -41.877 -100.001 1.00 18.87 ? 253 ILE D CD1 1 
ATOM   9617  N  N   . SER D  1 254 ? 16.451 -40.195 -95.027  1.00 17.34 ? 254 SER D N   1 
ATOM   9618  C  CA  . SER D  1 254 ? 17.706 -39.767 -94.407  1.00 18.41 ? 254 SER D CA  1 
ATOM   9619  C  C   . SER D  1 254 ? 18.406 -40.984 -93.790  1.00 18.87 ? 254 SER D C   1 
ATOM   9620  O  O   . SER D  1 254 ? 17.923 -42.107 -93.941  1.00 16.91 ? 254 SER D O   1 
ATOM   9621  C  CB  . SER D  1 254 ? 17.447 -38.684 -93.350  1.00 18.44 ? 254 SER D CB  1 
ATOM   9622  O  OG  . SER D  1 254 ? 18.339 -37.590 -93.521  1.00 21.21 ? 254 SER D OG  1 
ATOM   9623  N  N   . HIS D  1 255 ? 19.534 -40.765 -93.111  1.00 16.49 ? 255 HIS D N   1 
ATOM   9624  C  CA  . HIS D  1 255 ? 20.305 -41.866 -92.512  1.00 18.64 ? 255 HIS D CA  1 
ATOM   9625  C  C   . HIS D  1 255 ? 20.235 -41.931 -91.008  1.00 19.01 ? 255 HIS D C   1 
ATOM   9626  O  O   . HIS D  1 255 ? 20.568 -42.971 -90.426  1.00 18.39 ? 255 HIS D O   1 
ATOM   9627  C  CB  . HIS D  1 255 ? 21.784 -41.784 -92.894  1.00 18.53 ? 255 HIS D CB  1 
ATOM   9628  C  CG  . HIS D  1 255 ? 22.038 -41.474 -94.349  1.00 19.41 ? 255 HIS D CG  1 
ATOM   9629  N  ND1 . HIS D  1 255 ? 22.038 -40.215 -94.833  1.00 21.21 ? 255 HIS D ND1 1 
ATOM   9630  C  CD2 . HIS D  1 255 ? 22.334 -42.311 -95.426  1.00 19.09 ? 255 HIS D CD2 1 
ATOM   9631  C  CE1 . HIS D  1 255 ? 22.305 -40.244 -96.155  1.00 21.11 ? 255 HIS D CE1 1 
ATOM   9632  N  NE2 . HIS D  1 255 ? 22.490 -41.527 -96.515  1.00 20.53 ? 255 HIS D NE2 1 
ATOM   9633  N  N   . ASP D  1 256 ? 19.831 -40.834 -90.364  1.00 16.19 ? 256 ASP D N   1 
ATOM   9634  C  CA  . ASP D  1 256 ? 19.952 -40.689 -88.899  1.00 18.19 ? 256 ASP D CA  1 
ATOM   9635  C  C   . ASP D  1 256 ? 21.403 -40.977 -88.521  1.00 18.79 ? 256 ASP D C   1 
ATOM   9636  O  O   . ASP D  1 256 ? 21.687 -41.562 -87.476  1.00 18.86 ? 256 ASP D O   1 
ATOM   9637  C  CB  . ASP D  1 256 ? 19.004 -41.661 -88.182  1.00 17.64 ? 256 ASP D CB  1 
ATOM   9638  C  CG  . ASP D  1 256 ? 18.751 -41.315 -86.686  1.00 19.20 ? 256 ASP D CG  1 
ATOM   9639  O  OD1 . ASP D  1 256 ? 18.882 -40.144 -86.191  1.00 14.72 ? 256 ASP D OD1 1 
ATOM   9640  O  OD2 . ASP D  1 256 ? 18.343 -42.278 -85.997  1.00 19.49 ? 256 ASP D OD2 1 
ATOM   9641  N  N   . TYR D  1 257 ? 22.330 -40.572 -89.383  1.00 20.19 ? 257 TYR D N   1 
ATOM   9642  C  CA  . TYR D  1 257 ? 23.731 -40.887 -89.140  1.00 23.23 ? 257 TYR D CA  1 
ATOM   9643  C  C   . TYR D  1 257 ? 24.290 -40.046 -87.997  1.00 22.89 ? 257 TYR D C   1 
ATOM   9644  O  O   . TYR D  1 257 ? 24.023 -38.851 -87.904  1.00 23.76 ? 257 TYR D O   1 
ATOM   9645  C  CB  . TYR D  1 257 ? 24.598 -40.727 -90.397  1.00 21.32 ? 257 TYR D CB  1 
ATOM   9646  C  CG  . TYR D  1 257 ? 26.015 -41.213 -90.162  1.00 22.03 ? 257 TYR D CG  1 
ATOM   9647  C  CD1 . TYR D  1 257 ? 27.083 -40.323 -90.112  1.00 22.51 ? 257 TYR D CD1 1 
ATOM   9648  C  CD2 . TYR D  1 257 ? 26.276 -42.563 -89.943  1.00 20.53 ? 257 TYR D CD2 1 
ATOM   9649  C  CE1 . TYR D  1 257 ? 28.373 -40.770 -89.874  1.00 20.63 ? 257 TYR D CE1 1 
ATOM   9650  C  CE2 . TYR D  1 257 ? 27.563 -43.019 -89.707  1.00 21.89 ? 257 TYR D CE2 1 
ATOM   9651  C  CZ  . TYR D  1 257 ? 28.605 -42.116 -89.670  1.00 23.92 ? 257 TYR D CZ  1 
ATOM   9652  O  OH  . TYR D  1 257 ? 29.886 -42.562 -89.432  1.00 23.49 ? 257 TYR D OH  1 
ATOM   9653  N  N   . CYS D  1 258 ? 25.055 -40.683 -87.118  1.00 23.16 ? 258 CYS D N   1 
ATOM   9654  C  CA  . CYS D  1 258 ? 25.710 -39.956 -86.036  1.00 25.82 ? 258 CYS D CA  1 
ATOM   9655  C  C   . CYS D  1 258 ? 27.200 -39.927 -86.305  1.00 23.24 ? 258 CYS D C   1 
ATOM   9656  O  O   . CYS D  1 258 ? 27.871 -40.949 -86.206  1.00 26.47 ? 258 CYS D O   1 
ATOM   9657  C  CB  . CYS D  1 258 ? 25.419 -40.608 -84.685  1.00 24.59 ? 258 CYS D CB  1 
ATOM   9658  S  SG  . CYS D  1 258 ? 23.655 -40.746 -84.326  1.00 25.67 ? 258 CYS D SG  1 
ATOM   9659  N  N   . CYS D  1 259 ? 27.710 -38.753 -86.655  1.00 22.19 ? 259 CYS D N   1 
ATOM   9660  C  CA  . CYS D  1 259 ? 29.108 -38.624 -87.033  1.00 24.37 ? 259 CYS D CA  1 
ATOM   9661  C  C   . CYS D  1 259 ? 29.984 -39.100 -85.888  1.00 27.08 ? 259 CYS D C   1 
ATOM   9662  O  O   . CYS D  1 259 ? 31.092 -39.604 -86.100  1.00 22.53 ? 259 CYS D O   1 
ATOM   9663  C  CB  . CYS D  1 259 ? 29.412 -37.185 -87.418  1.00 25.36 ? 259 CYS D CB  1 
ATOM   9664  S  SG  . CYS D  1 259 ? 28.445 -36.658 -88.847  1.00 25.91 ? 259 CYS D SG  1 
ATOM   9665  N  N   . THR D  1 260 ? 29.459 -38.928 -84.677  1.00 20.36 ? 260 THR D N   1 
ATOM   9666  C  CA  . THR D  1 260 ? 29.973 -39.569 -83.478  1.00 25.63 ? 260 THR D CA  1 
ATOM   9667  C  C   . THR D  1 260 ? 28.777 -39.829 -82.568  1.00 25.78 ? 260 THR D C   1 
ATOM   9668  O  O   . THR D  1 260 ? 27.889 -38.982 -82.438  1.00 21.61 ? 260 THR D O   1 
ATOM   9669  C  CB  . THR D  1 260 ? 30.954 -38.660 -82.719  1.00 27.01 ? 260 THR D CB  1 
ATOM   9670  O  OG1 . THR D  1 260 ? 32.009 -38.250 -83.597  1.00 34.83 ? 260 THR D OG1 1 
ATOM   9671  C  CG2 . THR D  1 260 ? 31.546 -39.397 -81.513  1.00 35.46 ? 260 THR D CG2 1 
ATOM   9672  N  N   . ILE D  1 261 ? 28.742 -41.008 -81.960  1.00 24.08 ? 261 ILE D N   1 
ATOM   9673  C  CA  . ILE D  1 261 ? 27.751 -41.314 -80.925  1.00 24.53 ? 261 ILE D CA  1 
ATOM   9674  C  C   . ILE D  1 261 ? 28.443 -42.100 -79.814  1.00 27.08 ? 261 ILE D C   1 
ATOM   9675  O  O   . ILE D  1 261 ? 29.378 -42.868 -80.083  1.00 23.10 ? 261 ILE D O   1 
ATOM   9676  C  CB  . ILE D  1 261 ? 26.517 -42.059 -81.490  1.00 25.27 ? 261 ILE D CB  1 
ATOM   9677  C  CG1 . ILE D  1 261 ? 25.522 -42.393 -80.369  1.00 27.33 ? 261 ILE D CG1 1 
ATOM   9678  C  CG2 . ILE D  1 261 ? 26.931 -43.307 -82.260  1.00 30.88 ? 261 ILE D CG2 1 
ATOM   9679  C  CD1 . ILE D  1 261 ? 24.118 -42.682 -80.871  1.00 28.22 ? 261 ILE D CD1 1 
ATOM   9680  N  N   . ASP D  1 262 ? 28.009 -41.893 -78.571  1.00 23.27 ? 262 ASP D N   1 
ATOM   9681  C  CA  . ASP D  1 262 ? 28.766 -42.385 -77.416  1.00 23.24 ? 262 ASP D CA  1 
ATOM   9682  C  C   . ASP D  1 262 ? 28.281 -43.718 -76.832  1.00 25.26 ? 262 ASP D C   1 
ATOM   9683  O  O   . ASP D  1 262 ? 28.902 -44.265 -75.918  1.00 24.29 ? 262 ASP D O   1 
ATOM   9684  C  CB  . ASP D  1 262 ? 28.844 -41.306 -76.318  1.00 20.94 ? 262 ASP D CB  1 
ATOM   9685  C  CG  . ASP D  1 262 ? 27.485 -40.995 -75.680  1.00 20.71 ? 262 ASP D CG  1 
ATOM   9686  O  OD1 . ASP D  1 262 ? 26.439 -41.377 -76.249  1.00 23.16 ? 262 ASP D OD1 1 
ATOM   9687  O  OD2 . ASP D  1 262 ? 27.467 -40.352 -74.603  1.00 18.61 ? 262 ASP D OD2 1 
ATOM   9688  N  N   . ILE D  1 263 ? 27.180 -44.248 -77.353  1.00 24.19 ? 263 ILE D N   1 
ATOM   9689  C  CA  . ILE D  1 263 ? 26.613 -45.461 -76.764  1.00 25.89 ? 263 ILE D CA  1 
ATOM   9690  C  C   . ILE D  1 263 ? 27.477 -46.685 -77.067  1.00 25.06 ? 263 ILE D C   1 
ATOM   9691  O  O   . ILE D  1 263 ? 28.169 -46.732 -78.084  1.00 26.70 ? 263 ILE D O   1 
ATOM   9692  C  CB  . ILE D  1 263 ? 25.153 -45.692 -77.204  1.00 22.48 ? 263 ILE D CB  1 
ATOM   9693  C  CG1 . ILE D  1 263 ? 25.092 -46.164 -78.658  1.00 25.30 ? 263 ILE D CG1 1 
ATOM   9694  C  CG2 . ILE D  1 263 ? 24.331 -44.421 -77.009  1.00 21.69 ? 263 ILE D CG2 1 
ATOM   9695  C  CD1 . ILE D  1 263 ? 23.687 -46.444 -79.144  1.00 25.50 ? 263 ILE D CD1 1 
ATOM   9696  N  N   . GLY D  1 264 ? 27.439 -47.668 -76.172  1.00 24.78 ? 264 GLY D N   1 
ATOM   9697  C  CA  . GLY D  1 264 ? 28.263 -48.864 -76.310  1.00 26.92 ? 264 GLY D CA  1 
ATOM   9698  C  C   . GLY D  1 264 ? 27.920 -49.670 -77.545  1.00 31.65 ? 264 GLY D C   1 
ATOM   9699  O  O   . GLY D  1 264 ? 28.763 -50.398 -78.081  1.00 31.42 ? 264 GLY D O   1 
ATOM   9700  N  N   . THR D  1 265 ? 26.675 -49.541 -77.996  1.00 29.90 ? 265 THR D N   1 
ATOM   9701  C  CA  . THR D  1 265 ? 26.202 -50.269 -79.168  1.00 33.71 ? 265 THR D CA  1 
ATOM   9702  C  C   . THR D  1 265 ? 26.956 -49.823 -80.421  1.00 38.50 ? 265 THR D C   1 
ATOM   9703  O  O   . THR D  1 265 ? 27.047 -50.570 -81.400  1.00 36.10 ? 265 THR D O   1 
ATOM   9704  C  CB  . THR D  1 265 ? 24.690 -50.056 -79.388  1.00 37.78 ? 265 THR D CB  1 
ATOM   9705  O  OG1 . THR D  1 265 ? 23.996 -50.208 -78.141  1.00 33.96 ? 265 THR D OG1 1 
ATOM   9706  C  CG2 . THR D  1 265 ? 24.142 -51.058 -80.400  1.00 38.55 ? 265 THR D CG2 1 
ATOM   9707  N  N   . ALA D  1 266 ? 27.499 -48.607 -80.381  1.00 29.47 ? 266 ALA D N   1 
ATOM   9708  C  CA  . ALA D  1 266 ? 28.218 -48.051 -81.528  1.00 32.23 ? 266 ALA D CA  1 
ATOM   9709  C  C   . ALA D  1 266 ? 29.725 -48.308 -81.496  1.00 35.60 ? 266 ALA D C   1 
ATOM   9710  O  O   . ALA D  1 266 ? 30.471 -47.733 -82.290  1.00 35.96 ? 266 ALA D O   1 
ATOM   9711  C  CB  . ALA D  1 266 ? 27.933 -46.561 -81.670  1.00 37.42 ? 266 ALA D CB  1 
ATOM   9712  N  N   . LYS D  1 267 ? 30.177 -49.171 -80.588  1.00 33.67 ? 267 LYS D N   1 
ATOM   9713  C  CA  . LYS D  1 267 ? 31.574 -49.586 -80.594  1.00 43.13 ? 267 LYS D CA  1 
ATOM   9714  C  C   . LYS D  1 267 ? 31.932 -50.128 -81.982  1.00 45.96 ? 267 LYS D C   1 
ATOM   9715  O  O   . LYS D  1 267 ? 31.144 -50.858 -82.590  1.00 37.93 ? 267 LYS D O   1 
ATOM   9716  C  CB  . LYS D  1 267 ? 31.839 -50.639 -79.511  1.00 40.47 ? 267 LYS D CB  1 
ATOM   9717  C  CG  . LYS D  1 267 ? 31.682 -50.120 -78.088  1.00 35.47 ? 267 LYS D CG  1 
ATOM   9718  C  CD  . LYS D  1 267 ? 31.909 -51.226 -77.063  1.00 42.40 ? 267 LYS D CD  1 
ATOM   9719  C  CE  . LYS D  1 267 ? 31.745 -50.706 -75.642  1.00 37.73 ? 267 LYS D CE  1 
ATOM   9720  N  NZ  . LYS D  1 267 ? 31.744 -51.789 -74.620  1.00 41.80 ? 267 LYS D NZ  1 
ATOM   9721  N  N   . PRO D  1 268 ? 33.113 -49.748 -82.500  1.00 49.98 ? 268 PRO D N   1 
ATOM   9722  C  CA  . PRO D  1 268 ? 33.555 -50.178 -83.827  1.00 54.14 ? 268 PRO D CA  1 
ATOM   9723  C  C   . PRO D  1 268 ? 33.385 -51.677 -84.062  1.00 53.63 ? 268 PRO D C   1 
ATOM   9724  O  O   . PRO D  1 268 ? 33.087 -52.093 -85.183  1.00 50.72 ? 268 PRO D O   1 
ATOM   9725  C  CB  . PRO D  1 268 ? 35.036 -49.795 -83.835  1.00 52.77 ? 268 PRO D CB  1 
ATOM   9726  C  CG  . PRO D  1 268 ? 35.095 -48.584 -82.966  1.00 55.78 ? 268 PRO D CG  1 
ATOM   9727  C  CD  . PRO D  1 268 ? 34.039 -48.767 -81.903  1.00 50.90 ? 268 PRO D CD  1 
ATOM   9728  N  N   . GLU D  1 269 ? 33.566 -52.478 -83.015  1.00 53.54 ? 269 GLU D N   1 
ATOM   9729  C  CA  . GLU D  1 269 ? 33.438 -53.928 -83.131  1.00 53.19 ? 269 GLU D CA  1 
ATOM   9730  C  C   . GLU D  1 269 ? 32.099 -54.343 -83.735  1.00 51.13 ? 269 GLU D C   1 
ATOM   9731  O  O   . GLU D  1 269 ? 32.035 -55.294 -84.513  1.00 41.22 ? 269 GLU D O   1 
ATOM   9732  C  CB  . GLU D  1 269 ? 33.605 -54.610 -81.768  1.00 60.19 ? 269 GLU D CB  1 
ATOM   9733  C  CG  . GLU D  1 269 ? 34.884 -54.265 -81.024  1.00 65.62 ? 269 GLU D CG  1 
ATOM   9734  C  CD  . GLU D  1 269 ? 34.762 -52.984 -80.222  1.00 66.35 ? 269 GLU D CD  1 
ATOM   9735  O  OE1 . GLU D  1 269 ? 34.743 -51.895 -80.832  1.00 61.88 ? 269 GLU D OE1 1 
ATOM   9736  O  OE2 . GLU D  1 269 ? 34.694 -53.066 -78.977  1.00 69.42 ? 269 GLU D OE2 1 
ATOM   9737  N  N   . TYR D  1 270 ? 31.033 -53.630 -83.379  1.00 43.35 ? 270 TYR D N   1 
ATOM   9738  C  CA  . TYR D  1 270 ? 29.683 -54.047 -83.761  1.00 42.92 ? 270 TYR D CA  1 
ATOM   9739  C  C   . TYR D  1 270 ? 29.233 -53.551 -85.137  1.00 37.39 ? 270 TYR D C   1 
ATOM   9740  O  O   . TYR D  1 270 ? 28.170 -53.940 -85.619  1.00 35.98 ? 270 TYR D O   1 
ATOM   9741  C  CB  . TYR D  1 270 ? 28.665 -53.623 -82.696  1.00 41.11 ? 270 TYR D CB  1 
ATOM   9742  C  CG  . TYR D  1 270 ? 29.011 -54.094 -81.305  1.00 45.21 ? 270 TYR D CG  1 
ATOM   9743  C  CD1 . TYR D  1 270 ? 29.613 -55.334 -81.098  1.00 46.90 ? 270 TYR D CD1 1 
ATOM   9744  C  CD2 . TYR D  1 270 ? 28.731 -53.308 -80.197  1.00 44.41 ? 270 TYR D CD2 1 
ATOM   9745  C  CE1 . TYR D  1 270 ? 29.931 -55.771 -79.827  1.00 48.68 ? 270 TYR D CE1 1 
ATOM   9746  C  CE2 . TYR D  1 270 ? 29.043 -53.738 -78.921  1.00 52.41 ? 270 TYR D CE2 1 
ATOM   9747  C  CZ  . TYR D  1 270 ? 29.642 -54.967 -78.741  1.00 56.17 ? 270 TYR D CZ  1 
ATOM   9748  O  OH  . TYR D  1 270 ? 29.953 -55.390 -77.469  1.00 61.54 ? 270 TYR D OH  1 
ATOM   9749  N  N   . LYS D  1 271 ? 30.037 -52.699 -85.766  1.00 35.49 ? 271 LYS D N   1 
ATOM   9750  C  CA  . LYS D  1 271 ? 29.627 -52.055 -87.014  1.00 36.50 ? 271 LYS D CA  1 
ATOM   9751  C  C   . LYS D  1 271 ? 29.360 -53.035 -88.160  1.00 37.81 ? 271 LYS D C   1 
ATOM   9752  O  O   . LYS D  1 271 ? 28.372 -52.888 -88.885  1.00 36.77 ? 271 LYS D O   1 
ATOM   9753  C  CB  . LYS D  1 271 ? 30.642 -50.988 -87.440  1.00 40.10 ? 271 LYS D CB  1 
ATOM   9754  C  CG  . LYS D  1 271 ? 30.164 -50.105 -88.584  1.00 44.71 ? 271 LYS D CG  1 
ATOM   9755  C  CD  . LYS D  1 271 ? 31.148 -48.980 -88.878  1.00 46.41 ? 271 LYS D CD  1 
ATOM   9756  C  CE  . LYS D  1 271 ? 30.850 -48.312 -90.214  1.00 46.73 ? 271 LYS D CE  1 
ATOM   9757  N  NZ  . LYS D  1 271 ? 29.491 -47.698 -90.259  1.00 44.26 ? 271 LYS D NZ  1 
ATOM   9758  N  N   . PRO D  1 272 ? 30.240 -54.040 -88.328  1.00 41.41 ? 272 PRO D N   1 
ATOM   9759  C  CA  . PRO D  1 272 ? 30.110 -54.999 -89.427  1.00 43.61 ? 272 PRO D CA  1 
ATOM   9760  C  C   . PRO D  1 272 ? 28.756 -55.708 -89.469  1.00 44.02 ? 272 PRO D C   1 
ATOM   9761  O  O   . PRO D  1 272 ? 28.237 -55.969 -90.553  1.00 48.71 ? 272 PRO D O   1 
ATOM   9762  C  CB  . PRO D  1 272 ? 31.230 -56.009 -89.146  1.00 40.04 ? 272 PRO D CB  1 
ATOM   9763  C  CG  . PRO D  1 272 ? 32.255 -55.221 -88.408  1.00 43.40 ? 272 PRO D CG  1 
ATOM   9764  C  CD  . PRO D  1 272 ? 31.477 -54.254 -87.555  1.00 42.18 ? 272 PRO D CD  1 
ATOM   9765  N  N   . LYS D  1 273 ? 28.184 -56.017 -88.309  1.00 42.42 ? 273 LYS D N   1 
ATOM   9766  C  CA  A LYS D  1 273 ? 26.909 -56.726 -88.275  0.50 43.49 ? 273 LYS D CA  1 
ATOM   9767  C  CA  B LYS D  1 273 ? 26.909 -56.734 -88.260  0.50 42.90 ? 273 LYS D CA  1 
ATOM   9768  C  C   . LYS D  1 273 ? 25.706 -55.805 -88.094  1.00 38.95 ? 273 LYS D C   1 
ATOM   9769  O  O   . LYS D  1 273 ? 24.618 -56.098 -88.586  1.00 40.47 ? 273 LYS D O   1 
ATOM   9770  C  CB  A LYS D  1 273 ? 26.919 -57.818 -87.200  0.50 44.40 ? 273 LYS D CB  1 
ATOM   9771  C  CB  B LYS D  1 273 ? 26.904 -57.768 -87.132  0.50 42.69 ? 273 LYS D CB  1 
ATOM   9772  C  CG  A LYS D  1 273 ? 28.146 -57.806 -86.306  0.50 50.84 ? 273 LYS D CG  1 
ATOM   9773  C  CG  B LYS D  1 273 ? 28.264 -58.035 -86.512  0.50 48.26 ? 273 LYS D CG  1 
ATOM   9774  C  CD  A LYS D  1 273 ? 29.363 -58.329 -87.054  0.50 46.82 ? 273 LYS D CD  1 
ATOM   9775  C  CD  B LYS D  1 273 ? 28.478 -57.158 -85.289  0.50 42.76 ? 273 LYS D CD  1 
ATOM   9776  C  CE  A LYS D  1 273 ? 30.550 -58.522 -86.126  0.50 44.99 ? 273 LYS D CE  1 
ATOM   9777  C  CE  B LYS D  1 273 ? 29.925 -57.195 -84.838  0.50 39.87 ? 273 LYS D CE  1 
ATOM   9778  N  NZ  A LYS D  1 273 ? 31.769 -58.926 -86.878  0.50 39.66 ? 273 LYS D NZ  1 
ATOM   9779  N  NZ  B LYS D  1 273 ? 30.812 -56.586 -85.865  0.50 36.48 ? 273 LYS D NZ  1 
ATOM   9780  N  N   . LEU D  1 274 ? 25.901 -54.689 -87.399  1.00 34.62 ? 274 LEU D N   1 
ATOM   9781  C  CA  . LEU D  1 274 ? 24.776 -53.803 -87.077  1.00 33.05 ? 274 LEU D CA  1 
ATOM   9782  C  C   . LEU D  1 274 ? 24.521 -52.683 -88.093  1.00 27.78 ? 274 LEU D C   1 
ATOM   9783  O  O   . LEU D  1 274 ? 23.370 -52.323 -88.352  1.00 31.57 ? 274 LEU D O   1 
ATOM   9784  C  CB  . LEU D  1 274 ? 24.946 -53.208 -85.672  1.00 32.54 ? 274 LEU D CB  1 
ATOM   9785  C  CG  . LEU D  1 274 ? 25.039 -54.179 -84.492  1.00 31.51 ? 274 LEU D CG  1 
ATOM   9786  C  CD1 . LEU D  1 274 ? 24.832 -53.420 -83.187  1.00 29.61 ? 274 LEU D CD1 1 
ATOM   9787  C  CD2 . LEU D  1 274 ? 24.041 -55.322 -84.621  1.00 31.13 ? 274 LEU D CD2 1 
ATOM   9788  N  N   . ALA D  1 275 ? 25.592 -52.123 -88.648  1.00 27.65 ? 275 ALA D N   1 
ATOM   9789  C  CA  . ALA D  1 275 ? 25.477 -50.965 -89.532  1.00 26.84 ? 275 ALA D CA  1 
ATOM   9790  C  C   . ALA D  1 275 ? 26.711 -50.812 -90.428  1.00 27.98 ? 275 ALA D C   1 
ATOM   9791  O  O   . ALA D  1 275 ? 27.376 -49.772 -90.412  1.00 26.30 ? 275 ALA D O   1 
ATOM   9792  C  CB  . ALA D  1 275 ? 25.256 -49.706 -88.705  1.00 29.05 ? 275 ALA D CB  1 
ATOM   9793  N  N   . PRO D  1 276 ? 27.003 -51.841 -91.237  1.00 27.90 ? 276 PRO D N   1 
ATOM   9794  C  CA  . PRO D  1 276 ? 28.224 -51.906 -92.052  1.00 31.35 ? 276 PRO D CA  1 
ATOM   9795  C  C   . PRO D  1 276 ? 28.410 -50.748 -93.045  1.00 33.08 ? 276 PRO D C   1 
ATOM   9796  O  O   . PRO D  1 276 ? 29.529 -50.248 -93.199  1.00 34.80 ? 276 PRO D O   1 
ATOM   9797  C  CB  . PRO D  1 276 ? 28.089 -53.246 -92.799  1.00 32.33 ? 276 PRO D CB  1 
ATOM   9798  C  CG  . PRO D  1 276 ? 26.639 -53.592 -92.735  1.00 32.84 ? 276 PRO D CG  1 
ATOM   9799  C  CD  . PRO D  1 276 ? 26.125 -53.006 -91.449  1.00 30.64 ? 276 PRO D CD  1 
ATOM   9800  N  N   . ARG D  1 277 ? 27.336 -50.318 -93.704  1.00 32.01 ? 277 ARG D N   1 
ATOM   9801  C  CA  . ARG D  1 277 ? 27.449 -49.278 -94.736  1.00 34.05 ? 277 ARG D CA  1 
ATOM   9802  C  C   . ARG D  1 277 ? 26.898 -47.915 -94.296  1.00 32.10 ? 277 ARG D C   1 
ATOM   9803  O  O   . ARG D  1 277 ? 26.740 -47.002 -95.108  1.00 26.19 ? 277 ARG D O   1 
ATOM   9804  C  CB  . ARG D  1 277 ? 26.755 -49.723 -96.027  1.00 33.67 ? 277 ARG D CB  1 
ATOM   9805  C  CG  . ARG D  1 277 ? 27.303 -51.004 -96.639  1.00 38.88 ? 277 ARG D CG  1 
ATOM   9806  C  CD  . ARG D  1 277 ? 27.005 -51.025 -98.130  1.00 45.15 ? 277 ARG D CD  1 
ATOM   9807  N  NE  . ARG D  1 277 ? 27.635 -49.884 -98.792  1.00 61.79 ? 277 ARG D NE  1 
ATOM   9808  C  CZ  . ARG D  1 277 ? 27.235 -49.352 -99.945  1.00 62.70 ? 277 ARG D CZ  1 
ATOM   9809  N  NH1 . ARG D  1 277 ? 26.185 -49.845 -100.589 1.00 50.24 ? 277 ARG D NH1 1 
ATOM   9810  N  NH2 . ARG D  1 277 ? 27.889 -48.312 -100.448 1.00 54.54 ? 277 ARG D NH2 1 
ATOM   9811  N  N   . TRP D  1 278 ? 26.622 -47.794 -93.004  1.00 27.60 ? 278 TRP D N   1 
ATOM   9812  C  CA  . TRP D  1 278 ? 26.013 -46.605 -92.419  1.00 26.21 ? 278 TRP D CA  1 
ATOM   9813  C  C   . TRP D  1 278 ? 26.950 -45.428 -92.435  1.00 26.14 ? 278 TRP D C   1 
ATOM   9814  O  O   . TRP D  1 278 ? 28.027 -45.476 -91.846  1.00 25.56 ? 278 TRP D O   1 
ATOM   9815  C  CB  . TRP D  1 278 ? 25.594 -46.948 -90.990  1.00 25.09 ? 278 TRP D CB  1 
ATOM   9816  C  CG  . TRP D  1 278 ? 24.754 -45.932 -90.253  1.00 22.70 ? 278 TRP D CG  1 
ATOM   9817  C  CD1 . TRP D  1 278 ? 23.665 -45.204 -90.730  1.00 23.52 ? 278 TRP D CD1 1 
ATOM   9818  C  CD2 . TRP D  1 278 ? 24.879 -45.549 -88.839  1.00 22.72 ? 278 TRP D CD2 1 
ATOM   9819  N  NE1 . TRP D  1 278 ? 23.142 -44.403 -89.744  1.00 23.47 ? 278 TRP D NE1 1 
ATOM   9820  C  CE2 . TRP D  1 278 ? 23.823 -44.566 -88.583  1.00 22.96 ? 278 TRP D CE2 1 
ATOM   9821  C  CE3 . TRP D  1 278 ? 25.735 -45.905 -87.803  1.00 25.82 ? 278 TRP D CE3 1 
ATOM   9822  C  CZ2 . TRP D  1 278 ? 23.655 -43.978 -87.342  1.00 23.04 ? 278 TRP D CZ2 1 
ATOM   9823  C  CZ3 . TRP D  1 278 ? 25.557 -45.302 -86.555  1.00 26.67 ? 278 TRP D CZ3 1 
ATOM   9824  C  CH2 . TRP D  1 278 ? 24.541 -44.360 -86.333  1.00 28.34 ? 278 TRP D CH2 1 
ATOM   9825  N  N   . SER D  1 279 ? 26.547 -44.368 -93.136  1.00 24.78 ? 279 SER D N   1 
ATOM   9826  C  CA  . SER D  1 279 ? 27.260 -43.090 -93.154  1.00 21.62 ? 279 SER D CA  1 
ATOM   9827  C  C   . SER D  1 279 ? 26.280 -42.021 -93.641  1.00 23.23 ? 279 SER D C   1 
ATOM   9828  O  O   . SER D  1 279 ? 25.122 -42.326 -93.915  1.00 25.07 ? 279 SER D O   1 
ATOM   9829  C  CB  . SER D  1 279 ? 28.470 -43.141 -94.086  1.00 24.71 ? 279 SER D CB  1 
ATOM   9830  O  OG  . SER D  1 279 ? 28.076 -42.966 -95.438  1.00 23.23 ? 279 SER D OG  1 
ATOM   9831  N  N   . ILE D  1 280 ? 26.740 -40.780 -93.773  1.00 20.26 ? 280 ILE D N   1 
ATOM   9832  C  CA  . ILE D  1 280 ? 25.842 -39.695 -94.178  1.00 20.55 ? 280 ILE D CA  1 
ATOM   9833  C  C   . ILE D  1 280 ? 25.679 -39.613 -95.700  1.00 21.86 ? 280 ILE D C   1 
ATOM   9834  O  O   . ILE D  1 280 ? 24.962 -38.748 -96.209  1.00 20.55 ? 280 ILE D O   1 
ATOM   9835  C  CB  . ILE D  1 280 ? 26.292 -38.332 -93.611  1.00 23.34 ? 280 ILE D CB  1 
ATOM   9836  C  CG1 . ILE D  1 280 ? 25.097 -37.382 -93.489  1.00 19.06 ? 280 ILE D CG1 1 
ATOM   9837  C  CG2 . ILE D  1 280 ? 27.410 -37.730 -94.462  1.00 21.29 ? 280 ILE D CG2 1 
ATOM   9838  C  CD1 . ILE D  1 280 ? 25.401 -36.114 -92.718  1.00 22.25 ? 280 ILE D CD1 1 
ATOM   9839  N  N   . THR D  1 281 ? 26.325 -40.525 -96.428  1.00 20.11 ? 281 THR D N   1 
ATOM   9840  C  CA  . THR D  1 281 ? 26.197 -40.538 -97.886  1.00 21.38 ? 281 THR D CA  1 
ATOM   9841  C  C   . THR D  1 281 ? 25.729 -41.880 -98.459  1.00 22.22 ? 281 THR D C   1 
ATOM   9842  O  O   . THR D  1 281 ? 25.778 -42.088 -99.670  1.00 23.11 ? 281 THR D O   1 
ATOM   9843  C  CB  . THR D  1 281 ? 27.508 -40.118 -98.584  1.00 21.48 ? 281 THR D CB  1 
ATOM   9844  O  OG1 . THR D  1 281 ? 28.548 -41.056 -98.269  1.00 22.22 ? 281 THR D OG1 1 
ATOM   9845  C  CG2 . THR D  1 281 ? 27.931 -38.727 -98.139  1.00 22.19 ? 281 THR D CG2 1 
ATOM   9846  N  N   . LEU D  1 282 ? 25.263 -42.783 -97.602  1.00 20.43 ? 282 LEU D N   1 
ATOM   9847  C  CA  . LEU D  1 282 ? 24.799 -44.088 -98.074  1.00 23.49 ? 282 LEU D CA  1 
ATOM   9848  C  C   . LEU D  1 282 ? 23.748 -43.995 -99.188  1.00 25.52 ? 282 LEU D C   1 
ATOM   9849  O  O   . LEU D  1 282 ? 23.819 -44.735 -100.172 1.00 22.46 ? 282 LEU D O   1 
ATOM   9850  C  CB  . LEU D  1 282 ? 24.265 -44.937 -96.916  1.00 27.96 ? 282 LEU D CB  1 
ATOM   9851  C  CG  . LEU D  1 282 ? 23.604 -46.257 -97.325  1.00 28.09 ? 282 LEU D CG  1 
ATOM   9852  C  CD1 . LEU D  1 282 ? 24.486 -46.998 -98.320  1.00 29.47 ? 282 LEU D CD1 1 
ATOM   9853  C  CD2 . LEU D  1 282 ? 23.332 -47.121 -96.102  1.00 30.28 ? 282 LEU D CD2 1 
ATOM   9854  N  N   . ILE D  1 283 ? 22.780 -43.088 -99.049  1.00 20.94 ? 283 ILE D N   1 
ATOM   9855  C  CA  . ILE D  1 283 ? 21.709 -42.997 -100.046 1.00 23.36 ? 283 ILE D CA  1 
ATOM   9856  C  C   . ILE D  1 283 ? 22.210 -42.597 -101.430 1.00 20.75 ? 283 ILE D C   1 
ATOM   9857  O  O   . ILE D  1 283 ? 21.554 -42.880 -102.430 1.00 24.04 ? 283 ILE D O   1 
ATOM   9858  C  CB  . ILE D  1 283 ? 20.560 -42.046 -99.634  1.00 25.26 ? 283 ILE D CB  1 
ATOM   9859  C  CG1 . ILE D  1 283 ? 21.073 -40.619 -99.482  1.00 22.76 ? 283 ILE D CG1 1 
ATOM   9860  C  CG2 . ILE D  1 283 ? 19.869 -42.539 -98.369  1.00 25.45 ? 283 ILE D CG2 1 
ATOM   9861  C  CD1 . ILE D  1 283 ? 19.973 -39.602 -99.299  1.00 26.81 ? 283 ILE D CD1 1 
ATOM   9862  N  N   . PHE D  1 284 ? 23.364 -41.943 -101.495 1.00 19.82 ? 284 PHE D N   1 
ATOM   9863  C  CA  . PHE D  1 284 ? 23.926 -41.567 -102.794 1.00 23.93 ? 284 PHE D CA  1 
ATOM   9864  C  C   . PHE D  1 284 ? 24.672 -42.735 -103.427 1.00 23.21 ? 284 PHE D C   1 
ATOM   9865  O  O   . PHE D  1 284 ? 24.842 -42.784 -104.638 1.00 22.60 ? 284 PHE D O   1 
ATOM   9866  C  CB  . PHE D  1 284 ? 24.844 -40.347 -102.675 1.00 20.36 ? 284 PHE D CB  1 
ATOM   9867  C  CG  . PHE D  1 284 ? 24.164 -39.149 -102.078 1.00 24.78 ? 284 PHE D CG  1 
ATOM   9868  C  CD1 . PHE D  1 284 ? 24.393 -38.792 -100.758 1.00 23.85 ? 284 PHE D CD1 1 
ATOM   9869  C  CD2 . PHE D  1 284 ? 23.273 -38.401 -102.829 1.00 24.85 ? 284 PHE D CD2 1 
ATOM   9870  C  CE1 . PHE D  1 284 ? 23.753 -37.700 -100.197 1.00 25.88 ? 284 PHE D CE1 1 
ATOM   9871  C  CE2 . PHE D  1 284 ? 22.628 -37.312 -102.274 1.00 28.30 ? 284 PHE D CE2 1 
ATOM   9872  C  CZ  . PHE D  1 284 ? 22.870 -36.959 -100.959 1.00 24.40 ? 284 PHE D CZ  1 
ATOM   9873  N  N   . GLU D  1 285 ? 25.108 -43.669 -102.591 1.00 21.09 ? 285 GLU D N   1 
ATOM   9874  C  CA  . GLU D  1 285 ? 25.865 -44.823 -103.042 1.00 27.40 ? 285 GLU D CA  1 
ATOM   9875  C  C   . GLU D  1 285 ? 24.935 -45.982 -103.351 1.00 28.72 ? 285 GLU D C   1 
ATOM   9876  O  O   . GLU D  1 285 ? 25.222 -46.798 -104.217 1.00 30.24 ? 285 GLU D O   1 
ATOM   9877  C  CB  . GLU D  1 285 ? 26.875 -45.241 -101.962 1.00 26.04 ? 285 GLU D CB  1 
ATOM   9878  C  CG  . GLU D  1 285 ? 27.832 -44.125 -101.573 1.00 28.96 ? 285 GLU D CG  1 
ATOM   9879  C  CD  . GLU D  1 285 ? 28.300 -44.216 -100.133 1.00 35.53 ? 285 GLU D CD  1 
ATOM   9880  O  OE1 . GLU D  1 285 ? 27.994 -45.226 -99.461  1.00 37.92 ? 285 GLU D OE1 1 
ATOM   9881  O  OE2 . GLU D  1 285 ? 28.971 -43.270 -99.666  1.00 30.43 ? 285 GLU D OE2 1 
ATOM   9882  N  N   . ASP D  1 286 ? 23.811 -46.049 -102.647 1.00 28.20 ? 286 ASP D N   1 
ATOM   9883  C  CA  . ASP D  1 286 ? 22.934 -47.210 -102.744 1.00 29.62 ? 286 ASP D CA  1 
ATOM   9884  C  C   . ASP D  1 286 ? 21.488 -46.859 -103.102 1.00 27.18 ? 286 ASP D C   1 
ATOM   9885  O  O   . ASP D  1 286 ? 20.989 -47.235 -104.163 1.00 28.45 ? 286 ASP D O   1 
ATOM   9886  C  CB  . ASP D  1 286 ? 22.972 -48.004 -101.431 1.00 32.20 ? 286 ASP D CB  1 
ATOM   9887  C  CG  . ASP D  1 286 ? 22.240 -49.336 -101.528 1.00 38.13 ? 286 ASP D CG  1 
ATOM   9888  O  OD1 . ASP D  1 286 ? 21.088 -49.359 -102.016 1.00 35.51 ? 286 ASP D OD1 1 
ATOM   9889  O  OD2 . ASP D  1 286 ? 22.820 -50.359 -101.106 1.00 42.36 ? 286 ASP D OD2 1 
ATOM   9890  N  N   . THR D  1 287 ? 20.827 -46.133 -102.210 1.00 24.91 ? 287 THR D N   1 
ATOM   9891  C  CA  . THR D  1 287 ? 19.388 -45.922 -102.292 1.00 23.69 ? 287 THR D CA  1 
ATOM   9892  C  C   . THR D  1 287 ? 18.910 -45.188 -103.543 1.00 22.96 ? 287 THR D C   1 
ATOM   9893  O  O   . THR D  1 287 ? 18.042 -45.684 -104.260 1.00 21.16 ? 287 THR D O   1 
ATOM   9894  C  CB  . THR D  1 287 ? 18.872 -45.166 -101.056 1.00 22.82 ? 287 THR D CB  1 
ATOM   9895  O  OG1 . THR D  1 287 ? 19.282 -45.860 -99.869  1.00 29.26 ? 287 THR D OG1 1 
ATOM   9896  C  CG2 . THR D  1 287 ? 17.365 -45.082 -101.097 1.00 19.39 ? 287 THR D CG2 1 
ATOM   9897  N  N   . ILE D  1 288 ? 19.464 -44.002 -103.791 1.00 20.06 ? 288 ILE D N   1 
ATOM   9898  C  CA  . ILE D  1 288 ? 19.043 -43.200 -104.942 1.00 20.98 ? 288 ILE D CA  1 
ATOM   9899  C  C   . ILE D  1 288 ? 19.325 -43.909 -106.272 1.00 20.86 ? 288 ILE D C   1 
ATOM   9900  O  O   . ILE D  1 288 ? 18.468 -43.941 -107.150 1.00 18.97 ? 288 ILE D O   1 
ATOM   9901  C  CB  . ILE D  1 288 ? 19.628 -41.769 -104.891 1.00 19.27 ? 288 ILE D CB  1 
ATOM   9902  C  CG1 . ILE D  1 288 ? 19.007 -41.008 -103.710 1.00 20.29 ? 288 ILE D CG1 1 
ATOM   9903  C  CG2 . ILE D  1 288 ? 19.364 -41.019 -106.193 1.00 21.33 ? 288 ILE D CG2 1 
ATOM   9904  C  CD1 . ILE D  1 288 ? 19.590 -39.632 -103.475 1.00 19.83 ? 288 ILE D CD1 1 
ATOM   9905  N  N   . PRO D  1 289 ? 20.518 -44.512 -106.411 1.00 21.47 ? 289 PRO D N   1 
ATOM   9906  C  CA  . PRO D  1 289 ? 20.793 -45.318 -107.602 1.00 20.98 ? 289 PRO D CA  1 
ATOM   9907  C  C   . PRO D  1 289 ? 19.822 -46.498 -107.766 1.00 21.79 ? 289 PRO D C   1 
ATOM   9908  O  O   . PRO D  1 289 ? 19.406 -46.803 -108.887 1.00 19.67 ? 289 PRO D O   1 
ATOM   9909  C  CB  . PRO D  1 289 ? 22.225 -45.811 -107.365 1.00 23.45 ? 289 PRO D CB  1 
ATOM   9910  C  CG  . PRO D  1 289 ? 22.838 -44.738 -106.519 1.00 23.64 ? 289 PRO D CG  1 
ATOM   9911  C  CD  . PRO D  1 289 ? 21.731 -44.291 -105.597 1.00 19.94 ? 289 PRO D CD  1 
ATOM   9912  N  N   . PHE D  1 290 ? 19.462 -47.148 -106.660 1.00 19.16 ? 290 PHE D N   1 
ATOM   9913  C  CA  . PHE D  1 290 ? 18.461 -48.209 -106.692 1.00 21.03 ? 290 PHE D CA  1 
ATOM   9914  C  C   . PHE D  1 290 ? 17.100 -47.702 -107.165 1.00 22.91 ? 290 PHE D C   1 
ATOM   9915  O  O   . PHE D  1 290 ? 16.466 -48.314 -108.029 1.00 20.04 ? 290 PHE D O   1 
ATOM   9916  C  CB  . PHE D  1 290 ? 18.297 -48.857 -105.317 1.00 21.11 ? 290 PHE D CB  1 
ATOM   9917  C  CG  . PHE D  1 290 ? 17.106 -49.769 -105.225 1.00 22.56 ? 290 PHE D CG  1 
ATOM   9918  C  CD1 . PHE D  1 290 ? 17.210 -51.105 -105.583 1.00 22.74 ? 290 PHE D CD1 1 
ATOM   9919  C  CD2 . PHE D  1 290 ? 15.880 -49.291 -104.798 1.00 21.80 ? 290 PHE D CD2 1 
ATOM   9920  C  CE1 . PHE D  1 290 ? 16.115 -51.948 -105.505 1.00 25.58 ? 290 PHE D CE1 1 
ATOM   9921  C  CE2 . PHE D  1 290 ? 14.781 -50.128 -104.724 1.00 23.15 ? 290 PHE D CE2 1 
ATOM   9922  C  CZ  . PHE D  1 290 ? 14.899 -51.459 -105.073 1.00 23.51 ? 290 PHE D CZ  1 
ATOM   9923  N  N   . LEU D  1 291 ? 16.642 -46.593 -106.588 1.00 20.69 ? 291 LEU D N   1 
ATOM   9924  C  CA  . LEU D  1 291 ? 15.357 -46.034 -106.988 1.00 20.48 ? 291 LEU D CA  1 
ATOM   9925  C  C   . LEU D  1 291 ? 15.364 -45.655 -108.464 1.00 21.86 ? 291 LEU D C   1 
ATOM   9926  O  O   . LEU D  1 291 ? 14.437 -45.996 -109.211 1.00 22.79 ? 291 LEU D O   1 
ATOM   9927  C  CB  . LEU D  1 291 ? 14.991 -44.822 -106.128 1.00 18.83 ? 291 LEU D CB  1 
ATOM   9928  C  CG  . LEU D  1 291 ? 14.695 -45.121 -104.660 1.00 19.53 ? 291 LEU D CG  1 
ATOM   9929  C  CD1 . LEU D  1 291 ? 14.337 -43.838 -103.925 1.00 21.02 ? 291 LEU D CD1 1 
ATOM   9930  C  CD2 . LEU D  1 291 ? 13.569 -46.137 -104.528 1.00 20.38 ? 291 LEU D CD2 1 
ATOM   9931  N  N   . LYS D  1 292 ? 16.415 -44.965 -108.893 1.00 19.02 ? 292 LYS D N   1 
ATOM   9932  C  CA  . LYS D  1 292 ? 16.475 -44.505 -110.275 1.00 21.13 ? 292 LYS D CA  1 
ATOM   9933  C  C   . LYS D  1 292 ? 16.477 -45.656 -111.279 1.00 21.70 ? 292 LYS D C   1 
ATOM   9934  O  O   . LYS D  1 292 ? 15.914 -45.534 -112.363 1.00 22.77 ? 292 LYS D O   1 
ATOM   9935  C  CB  . LYS D  1 292 ? 17.671 -43.574 -110.501 1.00 24.55 ? 292 LYS D CB  1 
ATOM   9936  C  CG  . LYS D  1 292 ? 17.508 -42.200 -109.860 1.00 28.34 ? 292 LYS D CG  1 
ATOM   9937  C  CD  . LYS D  1 292 ? 18.179 -41.130 -110.704 1.00 34.57 ? 292 LYS D CD  1 
ATOM   9938  C  CE  . LYS D  1 292 ? 19.608 -40.862 -110.265 1.00 42.77 ? 292 LYS D CE  1 
ATOM   9939  N  NZ  . LYS D  1 292 ? 19.702 -39.628 -109.434 1.00 45.03 ? 292 LYS D NZ  1 
ATOM   9940  N  N   . ARG D  1 293 ? 17.093 -46.779 -110.916 1.00 20.37 ? 293 ARG D N   1 
ATOM   9941  C  CA  . ARG D  1 293 ? 17.141 -47.923 -111.823 1.00 22.34 ? 293 ARG D CA  1 
ATOM   9942  C  C   . ARG D  1 293 ? 15.885 -48.783 -111.727 1.00 24.28 ? 293 ARG D C   1 
ATOM   9943  O  O   . ARG D  1 293 ? 15.765 -49.793 -112.420 1.00 24.67 ? 293 ARG D O   1 
ATOM   9944  C  CB  . ARG D  1 293 ? 18.402 -48.769 -111.608 1.00 20.73 ? 293 ARG D CB  1 
ATOM   9945  C  CG  . ARG D  1 293 ? 18.433 -49.608 -110.345 1.00 20.30 ? 293 ARG D CG  1 
ATOM   9946  C  CD  . ARG D  1 293 ? 19.770 -50.328 -110.231 1.00 21.14 ? 293 ARG D CD  1 
ATOM   9947  N  NE  . ARG D  1 293 ? 19.835 -51.247 -109.097 1.00 20.96 ? 293 ARG D NE  1 
ATOM   9948  C  CZ  . ARG D  1 293 ? 20.521 -51.018 -107.983 1.00 21.29 ? 293 ARG D CZ  1 
ATOM   9949  N  NH1 . ARG D  1 293 ? 20.522 -51.921 -107.010 1.00 21.78 ? 293 ARG D NH1 1 
ATOM   9950  N  NH2 . ARG D  1 293 ? 21.200 -49.882 -107.836 1.00 20.23 ? 293 ARG D NH2 1 
ATOM   9951  N  N   . ASN D  1 294 ? 14.953 -48.375 -110.873 1.00 23.72 ? 294 ASN D N   1 
ATOM   9952  C  CA  . ASN D  1 294 ? 13.674 -49.068 -110.753 1.00 25.91 ? 294 ASN D CA  1 
ATOM   9953  C  C   . ASN D  1 294 ? 12.505 -48.149 -111.112 1.00 28.39 ? 294 ASN D C   1 
ATOM   9954  O  O   . ASN D  1 294 ? 11.406 -48.272 -110.570 1.00 30.78 ? 294 ASN D O   1 
ATOM   9955  C  CB  . ASN D  1 294 ? 13.514 -49.665 -109.351 1.00 24.48 ? 294 ASN D CB  1 
ATOM   9956  C  CG  . ASN D  1 294 ? 14.372 -50.904 -109.148 1.00 29.32 ? 294 ASN D CG  1 
ATOM   9957  O  OD1 . ASN D  1 294 ? 15.493 -50.830 -108.632 1.00 26.05 ? 294 ASN D OD1 1 
ATOM   9958  N  ND2 . ASN D  1 294 ? 13.860 -52.049 -109.581 1.00 25.15 ? 294 ASN D ND2 1 
ATOM   9959  N  N   . GLY D  1 295 ? 12.764 -47.214 -112.020 1.00 26.42 ? 295 GLY D N   1 
ATOM   9960  C  CA  . GLY D  1 295 ? 11.706 -46.424 -112.632 1.00 26.65 ? 295 GLY D CA  1 
ATOM   9961  C  C   . GLY D  1 295 ? 11.337 -45.145 -111.905 1.00 28.57 ? 295 GLY D C   1 
ATOM   9962  O  O   . GLY D  1 295 ? 10.379 -44.480 -112.287 1.00 27.52 ? 295 GLY D O   1 
ATOM   9963  N  N   . VAL D  1 296 ? 12.084 -44.789 -110.862 1.00 24.41 ? 296 VAL D N   1 
ATOM   9964  C  CA  . VAL D  1 296 ? 11.831 -43.524 -110.165 1.00 22.88 ? 296 VAL D CA  1 
ATOM   9965  C  C   . VAL D  1 296 ? 12.541 -42.367 -110.870 1.00 24.03 ? 296 VAL D C   1 
ATOM   9966  O  O   . VAL D  1 296 ? 13.769 -42.321 -110.909 1.00 26.12 ? 296 VAL D O   1 
ATOM   9967  C  CB  . VAL D  1 296 ? 12.271 -43.584 -108.688 1.00 21.92 ? 296 VAL D CB  1 
ATOM   9968  C  CG1 . VAL D  1 296 ? 11.915 -42.283 -107.972 1.00 20.49 ? 296 VAL D CG1 1 
ATOM   9969  C  CG2 . VAL D  1 296 ? 11.627 -44.780 -107.993 1.00 20.38 ? 296 VAL D CG2 1 
ATOM   9970  N  N   . ASN D  1 297 ? 11.774 -41.432 -111.429 1.00 25.62 ? 297 ASN D N   1 
ATOM   9971  C  CA  . ASN D  1 297 ? 12.383 -40.337 -112.187 1.00 26.70 ? 297 ASN D CA  1 
ATOM   9972  C  C   . ASN D  1 297 ? 12.959 -39.220 -111.326 1.00 30.68 ? 297 ASN D C   1 
ATOM   9973  O  O   . ASN D  1 297 ? 12.718 -39.156 -110.120 1.00 26.87 ? 297 ASN D O   1 
ATOM   9974  C  CB  . ASN D  1 297 ? 11.434 -39.776 -113.261 1.00 29.03 ? 297 ASN D CB  1 
ATOM   9975  C  CG  . ASN D  1 297 ? 10.214 -39.090 -112.680 1.00 31.57 ? 297 ASN D CG  1 
ATOM   9976  O  OD1 . ASN D  1 297 ? 10.224 -38.606 -111.546 1.00 33.78 ? 297 ASN D OD1 1 
ATOM   9977  N  ND2 . ASN D  1 297 ? 9.151  -39.034 -113.468 1.00 37.22 ? 297 ASN D ND2 1 
ATOM   9978  N  N   . GLU D  1 298 ? 13.726 -38.348 -111.970 1.00 28.29 ? 298 GLU D N   1 
ATOM   9979  C  CA  . GLU D  1 298 ? 14.410 -37.260 -111.298 1.00 32.94 ? 298 GLU D CA  1 
ATOM   9980  C  C   . GLU D  1 298 ? 13.450 -36.320 -110.566 1.00 32.53 ? 298 GLU D C   1 
ATOM   9981  O  O   . GLU D  1 298 ? 13.813 -35.708 -109.557 1.00 31.77 ? 298 GLU D O   1 
ATOM   9982  C  CB  . GLU D  1 298 ? 15.252 -36.481 -112.312 1.00 39.32 ? 298 GLU D CB  1 
ATOM   9983  C  CG  . GLU D  1 298 ? 16.509 -35.862 -111.724 1.00 57.48 ? 298 GLU D CG  1 
ATOM   9984  C  CD  . GLU D  1 298 ? 17.484 -36.907 -111.217 1.00 63.33 ? 298 GLU D CD  1 
ATOM   9985  O  OE1 . GLU D  1 298 ? 17.654 -37.939 -111.901 1.00 66.13 ? 298 GLU D OE1 1 
ATOM   9986  O  OE2 . GLU D  1 298 ? 18.077 -36.699 -110.137 1.00 65.67 ? 298 GLU D OE2 1 
ATOM   9987  N  N   . GLU D  1 299 ? 12.230 -36.199 -111.078 1.00 27.84 ? 299 GLU D N   1 
ATOM   9988  C  CA  . GLU D  1 299 ? 11.229 -35.339 -110.456 1.00 30.41 ? 299 GLU D CA  1 
ATOM   9989  C  C   . GLU D  1 299 ? 10.783 -35.876 -109.100 1.00 28.32 ? 299 GLU D C   1 
ATOM   9990  O  O   . GLU D  1 299 ? 10.484 -35.101 -108.190 1.00 21.70 ? 299 GLU D O   1 
ATOM   9991  C  CB  . GLU D  1 299 ? 10.016 -35.159 -111.372 1.00 33.87 ? 299 GLU D CB  1 
ATOM   9992  C  CG  . GLU D  1 299 ? 10.305 -34.350 -112.626 1.00 46.97 ? 299 GLU D CG  1 
ATOM   9993  C  CD  . GLU D  1 299 ? 9.081  -34.175 -113.508 1.00 59.84 ? 299 GLU D CD  1 
ATOM   9994  O  OE1 . GLU D  1 299 ? 9.203  -34.377 -114.734 1.00 64.10 ? 299 GLU D OE1 1 
ATOM   9995  O  OE2 . GLU D  1 299 ? 7.998  -33.842 -112.978 1.00 63.58 ? 299 GLU D OE2 1 
ATOM   9996  N  N   . VAL D  1 300 ? 10.733 -37.201 -108.972 1.00 22.48 ? 300 VAL D N   1 
ATOM   9997  C  CA  . VAL D  1 300 ? 10.336 -37.837 -107.720 1.00 22.84 ? 300 VAL D CA  1 
ATOM   9998  C  C   . VAL D  1 300 ? 11.435 -37.680 -106.677 1.00 22.50 ? 300 VAL D C   1 
ATOM   9999  O  O   . VAL D  1 300 ? 11.158 -37.408 -105.507 1.00 19.97 ? 300 VAL D O   1 
ATOM   10000 C  CB  . VAL D  1 300 ? 10.031 -39.338 -107.894 1.00 20.47 ? 300 VAL D CB  1 
ATOM   10001 C  CG1 . VAL D  1 300 ? 9.783  -39.981 -106.540 1.00 21.60 ? 300 VAL D CG1 1 
ATOM   10002 C  CG2 . VAL D  1 300 ? 8.831  -39.539 -108.812 1.00 23.60 ? 300 VAL D CG2 1 
ATOM   10003 N  N   . ILE D  1 301 ? 12.679 -37.868 -107.107 1.00 20.53 ? 301 ILE D N   1 
ATOM   10004 C  CA  . ILE D  1 301 ? 13.826 -37.598 -106.250 1.00 20.29 ? 301 ILE D CA  1 
ATOM   10005 C  C   . ILE D  1 301 ? 13.780 -36.142 -105.760 1.00 20.82 ? 301 ILE D C   1 
ATOM   10006 O  O   . ILE D  1 301 ? 13.926 -35.872 -104.570 1.00 17.06 ? 301 ILE D O   1 
ATOM   10007 C  CB  . ILE D  1 301 ? 15.155 -37.882 -106.985 1.00 21.57 ? 301 ILE D CB  1 
ATOM   10008 C  CG1 . ILE D  1 301 ? 15.186 -39.332 -107.492 1.00 23.61 ? 301 ILE D CG1 1 
ATOM   10009 C  CG2 . ILE D  1 301 ? 16.346 -37.627 -106.072 1.00 22.06 ? 301 ILE D CG2 1 
ATOM   10010 C  CD1 . ILE D  1 301 ? 15.086 -40.372 -106.390 1.00 24.29 ? 301 ILE D CD1 1 
ATOM   10011 N  N   . ALA D  1 302 ? 13.560 -35.204 -106.675 1.00 21.10 ? 302 ALA D N   1 
ATOM   10012 C  CA  . ALA D  1 302 ? 13.444 -33.795 -106.291 1.00 23.08 ? 302 ALA D CA  1 
ATOM   10013 C  C   . ALA D  1 302 ? 12.289 -33.570 -105.318 1.00 20.95 ? 302 ALA D C   1 
ATOM   10014 O  O   . ALA D  1 302 ? 12.372 -32.735 -104.421 1.00 21.65 ? 302 ALA D O   1 
ATOM   10015 C  CB  . ALA D  1 302 ? 13.283 -32.909 -107.520 1.00 24.62 ? 302 ALA D CB  1 
ATOM   10016 N  N   . THR D  1 303 ? 11.200 -34.308 -105.496 1.00 22.40 ? 303 THR D N   1 
ATOM   10017 C  CA  . THR D  1 303 ? 10.062 -34.153 -104.595 1.00 21.49 ? 303 THR D CA  1 
ATOM   10018 C  C   . THR D  1 303 ? 10.457 -34.572 -103.175 1.00 19.16 ? 303 THR D C   1 
ATOM   10019 O  O   . THR D  1 303 ? 10.139 -33.894 -102.203 1.00 18.37 ? 303 THR D O   1 
ATOM   10020 C  CB  . THR D  1 303 ? 8.853  -34.974 -105.073 1.00 21.88 ? 303 THR D CB  1 
ATOM   10021 O  OG1 . THR D  1 303 ? 8.342  -34.391 -106.277 1.00 22.57 ? 303 THR D OG1 1 
ATOM   10022 C  CG2 . THR D  1 303 ? 7.751  -35.002 -104.018 1.00 21.12 ? 303 THR D CG2 1 
ATOM   10023 N  N   . ILE D  1 304 ? 11.165 -35.687 -103.069 1.00 16.41 ? 304 ILE D N   1 
ATOM   10024 C  CA  . ILE D  1 304 ? 11.524 -36.230 -101.769 1.00 16.73 ? 304 ILE D CA  1 
ATOM   10025 C  C   . ILE D  1 304 ? 12.556 -35.381 -101.032 1.00 14.97 ? 304 ILE D C   1 
ATOM   10026 O  O   . ILE D  1 304 ? 12.406 -35.109 -99.845  1.00 13.68 ? 304 ILE D O   1 
ATOM   10027 C  CB  . ILE D  1 304 ? 12.021 -37.682 -101.886 1.00 17.93 ? 304 ILE D CB  1 
ATOM   10028 C  CG1 . ILE D  1 304 ? 10.878 -38.587 -102.368 1.00 16.54 ? 304 ILE D CG1 1 
ATOM   10029 C  CG2 . ILE D  1 304 ? 12.575 -38.161 -100.548 1.00 16.30 ? 304 ILE D CG2 1 
ATOM   10030 C  CD1 . ILE D  1 304 ? 11.300 -40.006 -102.672 1.00 22.01 ? 304 ILE D CD1 1 
ATOM   10031 N  N   . PHE D  1 305 ? 13.598 -34.953 -101.738 1.00 17.02 ? 305 PHE D N   1 
ATOM   10032 C  CA  . PHE D  1 305 ? 14.721 -34.285 -101.091 1.00 16.87 ? 305 PHE D CA  1 
ATOM   10033 C  C   . PHE D  1 305 ? 14.694 -32.757 -101.142 1.00 18.65 ? 305 PHE D C   1 
ATOM   10034 O  O   . PHE D  1 305 ? 15.454 -32.097 -100.433 1.00 18.39 ? 305 PHE D O   1 
ATOM   10035 C  CB  . PHE D  1 305 ? 16.035 -34.825 -101.652 1.00 17.22 ? 305 PHE D CB  1 
ATOM   10036 C  CG  . PHE D  1 305 ? 16.247 -36.289 -101.367 1.00 19.43 ? 305 PHE D CG  1 
ATOM   10037 C  CD1 . PHE D  1 305 ? 16.006 -37.243 -102.344 1.00 16.59 ? 305 PHE D CD1 1 
ATOM   10038 C  CD2 . PHE D  1 305 ? 16.659 -36.708 -100.113 1.00 16.52 ? 305 PHE D CD2 1 
ATOM   10039 C  CE1 . PHE D  1 305 ? 16.189 -38.591 -102.084 1.00 18.14 ? 305 PHE D CE1 1 
ATOM   10040 C  CE2 . PHE D  1 305 ? 16.845 -38.054 -99.842  1.00 17.20 ? 305 PHE D CE2 1 
ATOM   10041 C  CZ  . PHE D  1 305 ? 16.609 -38.999 -100.831 1.00 17.88 ? 305 PHE D CZ  1 
ATOM   10042 N  N   . LYS D  1 306 ? 13.827 -32.196 -101.977 1.00 18.71 ? 306 LYS D N   1 
ATOM   10043 C  CA  . LYS D  1 306 ? 13.748 -30.744 -102.106 1.00 19.10 ? 306 LYS D CA  1 
ATOM   10044 C  C   . LYS D  1 306 ? 12.362 -30.221 -101.772 1.00 20.14 ? 306 LYS D C   1 
ATOM   10045 O  O   . LYS D  1 306 ? 12.210 -29.379 -100.891 1.00 18.81 ? 306 LYS D O   1 
ATOM   10046 C  CB  . LYS D  1 306 ? 14.145 -30.301 -103.515 1.00 21.96 ? 306 LYS D CB  1 
ATOM   10047 C  CG  . LYS D  1 306 ? 15.612 -30.535 -103.847 1.00 25.05 ? 306 LYS D CG  1 
ATOM   10048 C  CD  . LYS D  1 306 ? 15.853 -30.492 -105.350 1.00 33.72 ? 306 LYS D CD  1 
ATOM   10049 C  CE  . LYS D  1 306 ? 15.867 -29.072 -105.879 1.00 40.58 ? 306 LYS D CE  1 
ATOM   10050 N  NZ  . LYS D  1 306 ? 17.162 -28.407 -105.569 1.00 72.05 ? 306 LYS D NZ  1 
ATOM   10051 N  N   . GLU D  1 307 ? 11.347 -30.729 -102.465 1.00 22.51 ? 307 GLU D N   1 
ATOM   10052 C  CA  . GLU D  1 307 ? 9.995  -30.200 -102.305 1.00 23.84 ? 307 GLU D CA  1 
ATOM   10053 C  C   . GLU D  1 307 ? 9.376  -30.510 -100.940 1.00 20.96 ? 307 GLU D C   1 
ATOM   10054 O  O   . GLU D  1 307 ? 8.750  -29.649 -100.319 1.00 19.96 ? 307 GLU D O   1 
ATOM   10055 C  CB  . GLU D  1 307 ? 9.083  -30.690 -103.433 1.00 28.09 ? 307 GLU D CB  1 
ATOM   10056 C  CG  . GLU D  1 307 ? 7.849  -29.823 -103.634 1.00 49.31 ? 307 GLU D CG  1 
ATOM   10057 C  CD  . GLU D  1 307 ? 8.194  -28.373 -103.947 1.00 59.58 ? 307 GLU D CD  1 
ATOM   10058 O  OE1 . GLU D  1 307 ? 9.269  -28.125 -104.538 1.00 54.93 ? 307 GLU D OE1 1 
ATOM   10059 O  OE2 . GLU D  1 307 ? 7.390  -27.479 -103.604 1.00 60.35 ? 307 GLU D OE2 1 
ATOM   10060 N  N   . ASN D  1 308 ? 9.548  -31.738 -100.470 1.00 18.52 ? 308 ASN D N   1 
ATOM   10061 C  CA  . ASN D  1 308 ? 8.954  -32.136 -99.195  1.00 18.63 ? 308 ASN D CA  1 
ATOM   10062 C  C   . ASN D  1 308 ? 9.562  -31.384 -97.988  1.00 17.89 ? 308 ASN D C   1 
ATOM   10063 O  O   . ASN D  1 308 ? 8.837  -30.890 -97.129  1.00 19.20 ? 308 ASN D O   1 
ATOM   10064 C  CB  . ASN D  1 308 ? 9.012  -33.664 -99.026  1.00 17.85 ? 308 ASN D CB  1 
ATOM   10065 C  CG  . ASN D  1 308 ? 8.029  -34.390 -99.938  1.00 19.29 ? 308 ASN D CG  1 
ATOM   10066 O  OD1 . ASN D  1 308 ? 7.184  -33.766 -100.585 1.00 15.65 ? 308 ASN D OD1 1 
ATOM   10067 N  ND2 . ASN D  1 308 ? 8.123  -35.712 -99.980  1.00 16.92 ? 308 ASN D ND2 1 
ATOM   10068 N  N   . PRO D  1 309 ? 10.897 -31.291 -97.920  1.00 18.29 ? 309 PRO D N   1 
ATOM   10069 C  CA  . PRO D  1 309 ? 11.488 -30.446 -96.880  1.00 17.63 ? 309 PRO D CA  1 
ATOM   10070 C  C   . PRO D  1 309 ? 11.011 -28.993 -96.988  1.00 18.05 ? 309 PRO D C   1 
ATOM   10071 O  O   . PRO D  1 309 ? 10.693 -28.364 -95.977  1.00 15.22 ? 309 PRO D O   1 
ATOM   10072 C  CB  . PRO D  1 309 ? 12.986 -30.539 -97.175  1.00 17.94 ? 309 PRO D CB  1 
ATOM   10073 C  CG  . PRO D  1 309 ? 13.137 -31.902 -97.772  1.00 21.87 ? 309 PRO D CG  1 
ATOM   10074 C  CD  . PRO D  1 309 ? 11.920 -32.066 -98.644  1.00 17.14 ? 309 PRO D CD  1 
ATOM   10075 N  N   . LYS D  1 310 ? 10.953 -28.466 -98.205  1.00 18.07 ? 310 LYS D N   1 
ATOM   10076 C  CA  . LYS D  1 310 ? 10.474 -27.098 -98.391  1.00 20.26 ? 310 LYS D CA  1 
ATOM   10077 C  C   . LYS D  1 310 ? 9.064  -26.930 -97.831  1.00 18.42 ? 310 LYS D C   1 
ATOM   10078 O  O   . LYS D  1 310 ? 8.810  -26.019 -97.048  1.00 18.96 ? 310 LYS D O   1 
ATOM   10079 C  CB  . LYS D  1 310 ? 10.518 -26.686 -99.861  1.00 22.28 ? 310 LYS D CB  1 
ATOM   10080 C  CG  . LYS D  1 310 ? 9.772  -25.388 -100.134 1.00 30.65 ? 310 LYS D CG  1 
ATOM   10081 C  CD  . LYS D  1 310 ? 9.718  -25.080 -101.622 1.00 37.67 ? 310 LYS D CD  1 
ATOM   10082 C  CE  . LYS D  1 310 ? 8.906  -23.824 -101.888 1.00 45.18 ? 310 LYS D CE  1 
ATOM   10083 N  NZ  . LYS D  1 310 ? 8.865  -23.499 -103.341 1.00 55.08 ? 310 LYS D NZ  1 
ATOM   10084 N  N   . LYS D  1 311 ? 8.151  -27.818 -98.218  1.00 18.73 ? 311 LYS D N   1 
ATOM   10085 C  CA  . LYS D  1 311 ? 6.783  -27.778 -97.693  1.00 19.97 ? 311 LYS D CA  1 
ATOM   10086 C  C   . LYS D  1 311 ? 6.731  -27.931 -96.173  1.00 19.84 ? 311 LYS D C   1 
ATOM   10087 O  O   . LYS D  1 311 ? 5.975  -27.238 -95.491  1.00 17.83 ? 311 LYS D O   1 
ATOM   10088 C  CB  . LYS D  1 311 ? 5.913  -28.848 -98.359  1.00 26.26 ? 311 LYS D CB  1 
ATOM   10089 C  CG  . LYS D  1 311 ? 5.579  -28.549 -99.809  1.00 33.13 ? 311 LYS D CG  1 
ATOM   10090 C  CD  . LYS D  1 311 ? 4.721  -29.646 -100.418 1.00 38.68 ? 311 LYS D CD  1 
ATOM   10091 C  CE  . LYS D  1 311 ? 4.623  -29.492 -101.927 1.00 50.16 ? 311 LYS D CE  1 
ATOM   10092 N  NZ  . LYS D  1 311 ? 3.768  -30.547 -102.540 1.00 61.01 ? 311 LYS D NZ  1 
ATOM   10093 N  N   . PHE D  1 312 ? 7.539  -28.845 -95.652  1.00 18.41 ? 312 PHE D N   1 
ATOM   10094 C  CA  . PHE D  1 312 ? 7.596  -29.116 -94.215  1.00 18.74 ? 312 PHE D CA  1 
ATOM   10095 C  C   . PHE D  1 312 ? 7.910  -27.844 -93.435  1.00 17.10 ? 312 PHE D C   1 
ATOM   10096 O  O   . PHE D  1 312 ? 7.340  -27.593 -92.371  1.00 19.77 ? 312 PHE D O   1 
ATOM   10097 C  CB  . PHE D  1 312 ? 8.664  -30.183 -93.949  1.00 16.35 ? 312 PHE D CB  1 
ATOM   10098 C  CG  . PHE D  1 312 ? 8.744  -30.634 -92.517  1.00 18.10 ? 312 PHE D CG  1 
ATOM   10099 C  CD1 . PHE D  1 312 ? 9.923  -30.496 -91.804  1.00 16.12 ? 312 PHE D CD1 1 
ATOM   10100 C  CD2 . PHE D  1 312 ? 7.650  -31.212 -91.893  1.00 15.74 ? 312 PHE D CD2 1 
ATOM   10101 C  CE1 . PHE D  1 312 ? 10.019 -30.924 -90.492  1.00 15.29 ? 312 PHE D CE1 1 
ATOM   10102 C  CE2 . PHE D  1 312 ? 7.731  -31.634 -90.581  1.00 18.20 ? 312 PHE D CE2 1 
ATOM   10103 C  CZ  . PHE D  1 312 ? 8.918  -31.492 -89.879  1.00 17.26 ? 312 PHE D CZ  1 
ATOM   10104 N  N   . PHE D  1 313 ? 8.803  -27.029 -93.988  1.00 16.53 ? 313 PHE D N   1 
ATOM   10105 C  CA  . PHE D  1 313 ? 9.232  -25.799 -93.336  1.00 17.97 ? 313 PHE D CA  1 
ATOM   10106 C  C   . PHE D  1 313 ? 8.466  -24.569 -93.811  1.00 22.61 ? 313 PHE D C   1 
ATOM   10107 O  O   . PHE D  1 313 ? 8.848  -23.450 -93.490  1.00 23.57 ? 313 PHE D O   1 
ATOM   10108 C  CB  . PHE D  1 313 ? 10.733 -25.581 -93.553  1.00 16.98 ? 313 PHE D CB  1 
ATOM   10109 C  CG  . PHE D  1 313 ? 11.600 -26.426 -92.665  1.00 16.84 ? 313 PHE D CG  1 
ATOM   10110 C  CD1 . PHE D  1 313 ? 12.293 -27.513 -93.177  1.00 18.96 ? 313 PHE D CD1 1 
ATOM   10111 C  CD2 . PHE D  1 313 ? 11.709 -26.139 -91.310  1.00 16.39 ? 313 PHE D CD2 1 
ATOM   10112 C  CE1 . PHE D  1 313 ? 13.085 -28.297 -92.354  1.00 21.50 ? 313 PHE D CE1 1 
ATOM   10113 C  CE2 . PHE D  1 313 ? 12.498 -26.917 -90.484  1.00 18.09 ? 313 PHE D CE2 1 
ATOM   10114 C  CZ  . PHE D  1 313 ? 13.195 -27.991 -91.007  1.00 18.29 ? 313 PHE D CZ  1 
ATOM   10115 N  N   . SER D  1 314 ? 7.395  -24.765 -94.577  1.00 24.91 ? 314 SER D N   1 
ATOM   10116 C  CA  . SER D  1 314 ? 6.638  -23.622 -95.104  1.00 26.39 ? 314 SER D CA  1 
ATOM   10117 C  C   . SER D  1 314 ? 5.318  -23.380 -94.385  1.00 31.93 ? 314 SER D C   1 
ATOM   10118 O  O   . SER D  1 314 ? 4.884  -24.143 -93.522  1.00 34.74 ? 314 SER D O   1 
ATOM   10119 C  CB  . SER D  1 314 ? 6.379  -23.779 -96.600  1.00 24.28 ? 314 SER D CB  1 
ATOM   10120 O  OG  . SER D  1 314 ? 7.595  -23.739 -97.319  1.00 30.15 ? 314 SER D OG  1 
ATOM   10121 O  OXT . SER D  1 314 ? 4.647  -22.392 -94.675  1.00 45.97 ? 314 SER D OXT 1 
HETATM 10122 FE FE  . FE2 E  2 .   ? 65.386 -38.343 13.160   1.00 12.57 ? 401 FE2 A FE  1 
HETATM 10123 CO CO  . CO  F  3 .   ? 62.929 -40.423 12.017   1.00 17.04 ? 402 CO  A CO  1 
HETATM 10124 C  C1  . EDO G  4 .   ? 63.382 -35.978 9.954    1.00 49.63 ? 403 EDO A C1  1 
HETATM 10125 O  O1  . EDO G  4 .   ? 64.208 -36.491 11.006   1.00 58.76 ? 403 EDO A O1  1 
HETATM 10126 C  C2  . EDO G  4 .   ? 62.333 -37.025 9.608    1.00 51.99 ? 403 EDO A C2  1 
HETATM 10127 O  O2  . EDO G  4 .   ? 62.486 -38.146 10.486   1.00 39.07 ? 403 EDO A O2  1 
HETATM 10128 C  C1  . GOL H  5 .   ? 86.713 -42.361 13.842   1.00 30.22 ? 404 GOL A C1  1 
HETATM 10129 O  O1  . GOL H  5 .   ? 85.475 -41.641 13.779   1.00 23.15 ? 404 GOL A O1  1 
HETATM 10130 C  C2  . GOL H  5 .   ? 87.475 -42.022 15.122   1.00 33.51 ? 404 GOL A C2  1 
HETATM 10131 O  O2  . GOL H  5 .   ? 86.627 -42.149 16.271   1.00 23.10 ? 404 GOL A O2  1 
HETATM 10132 C  C3  . GOL H  5 .   ? 88.674 -42.955 15.279   1.00 37.14 ? 404 GOL A C3  1 
HETATM 10133 O  O3  . GOL H  5 .   ? 88.944 -43.609 14.033   1.00 56.52 ? 404 GOL A O3  1 
HETATM 10134 C  C1  . GOL I  5 .   ? 74.578 -60.897 15.695   1.00 33.85 ? 405 GOL A C1  1 
HETATM 10135 O  O1  . GOL I  5 .   ? 74.713 -61.011 14.275   1.00 40.93 ? 405 GOL A O1  1 
HETATM 10136 C  C2  . GOL I  5 .   ? 74.592 -59.421 16.087   1.00 30.71 ? 405 GOL A C2  1 
HETATM 10137 O  O2  . GOL I  5 .   ? 73.443 -58.760 15.544   1.00 25.19 ? 405 GOL A O2  1 
HETATM 10138 C  C3  . GOL I  5 .   ? 75.864 -58.750 15.576   1.00 31.44 ? 405 GOL A C3  1 
HETATM 10139 O  O3  . GOL I  5 .   ? 75.958 -57.430 16.130   1.00 25.26 ? 405 GOL A O3  1 
HETATM 10140 C  C1  . GOL J  5 .   ? 88.329 -42.696 3.799    1.00 47.16 ? 406 GOL A C1  1 
HETATM 10141 O  O1  . GOL J  5 .   ? 87.135 -41.943 3.566    1.00 33.51 ? 406 GOL A O1  1 
HETATM 10142 C  C2  . GOL J  5 .   ? 88.744 -43.340 2.487    1.00 52.18 ? 406 GOL A C2  1 
HETATM 10143 O  O2  . GOL J  5 .   ? 89.303 -42.335 1.635    1.00 55.38 ? 406 GOL A O2  1 
HETATM 10144 C  C3  . GOL J  5 .   ? 87.504 -43.929 1.825    1.00 49.01 ? 406 GOL A C3  1 
HETATM 10145 O  O3  . GOL J  5 .   ? 87.168 -43.161 0.665    1.00 41.73 ? 406 GOL A O3  1 
HETATM 10146 C  C1  . EDO K  4 .   ? 66.137 -43.176 -14.055  1.00 43.41 ? 407 EDO A C1  1 
HETATM 10147 O  O1  . EDO K  4 .   ? 65.574 -44.165 -14.925  1.00 50.67 ? 407 EDO A O1  1 
HETATM 10148 C  C2  . EDO K  4 .   ? 67.470 -42.699 -14.618  1.00 45.43 ? 407 EDO A C2  1 
HETATM 10149 O  O2  . EDO K  4 .   ? 68.041 -41.712 -13.749  1.00 46.57 ? 407 EDO A O2  1 
HETATM 10150 C  C1  . EDO L  4 .   ? 25.268 -18.322 -35.837  1.00 53.93 ? 401 EDO B C1  1 
HETATM 10151 O  O1  . EDO L  4 .   ? 24.642 -19.342 -35.042  1.00 43.52 ? 401 EDO B O1  1 
HETATM 10152 C  C2  . EDO L  4 .   ? 25.393 -17.029 -35.031  1.00 44.95 ? 401 EDO B C2  1 
HETATM 10153 O  O2  . EDO L  4 .   ? 25.106 -15.907 -35.878  1.00 50.71 ? 401 EDO B O2  1 
HETATM 10154 FE FE  . FE2 M  2 .   ? 20.769 -36.462 -51.190  1.00 12.56 ? 402 FE2 B FE  1 
HETATM 10155 CO CO  . CO  N  3 .   ? 18.810 -39.221 -51.758  1.00 15.25 ? 403 CO  B CO  1 
HETATM 10156 C  C1  . GOL O  5 .   ? 16.623 -34.392 -53.734  1.00 55.18 ? 404 GOL B C1  1 
HETATM 10157 O  O1  . GOL O  5 .   ? 16.468 -34.457 -52.311  1.00 54.73 ? 404 GOL B O1  1 
HETATM 10158 C  C2  . GOL O  5 .   ? 17.786 -35.279 -54.165  1.00 53.15 ? 404 GOL B C2  1 
HETATM 10159 O  O2  . GOL O  5 .   ? 18.838 -35.209 -53.194  1.00 64.55 ? 404 GOL B O2  1 
HETATM 10160 C  C3  . GOL O  5 .   ? 17.316 -36.722 -54.269  1.00 52.31 ? 404 GOL B C3  1 
HETATM 10161 O  O3  . GOL O  5 .   ? 17.939 -37.497 -53.238  1.00 49.28 ? 404 GOL B O3  1 
HETATM 10162 C  C1  . GOL P  5 .   ? 44.104 -35.752 -52.037  1.00 37.39 ? 405 GOL B C1  1 
HETATM 10163 O  O1  . GOL P  5 .   ? 44.940 -34.809 -52.714  1.00 45.61 ? 405 GOL B O1  1 
HETATM 10164 C  C2  . GOL P  5 .   ? 42.672 -35.233 -51.979  1.00 28.69 ? 405 GOL B C2  1 
HETATM 10165 O  O2  . GOL P  5 .   ? 42.516 -34.315 -50.893  1.00 18.50 ? 405 GOL B O2  1 
HETATM 10166 C  C3  . GOL P  5 .   ? 42.304 -34.547 -53.293  1.00 25.70 ? 405 GOL B C3  1 
HETATM 10167 O  O3  . GOL P  5 .   ? 40.881 -34.612 -53.425  1.00 21.07 ? 405 GOL B O3  1 
HETATM 10168 C  C1  . GOL Q  5 .   ? 36.537 -52.803 -48.574  1.00 27.39 ? 406 GOL B C1  1 
HETATM 10169 O  O1  . GOL Q  5 .   ? 36.149 -51.559 -47.973  1.00 23.96 ? 406 GOL B O1  1 
HETATM 10170 C  C2  . GOL Q  5 .   ? 35.641 -53.929 -48.071  1.00 26.20 ? 406 GOL B C2  1 
HETATM 10171 O  O2  . GOL Q  5 .   ? 34.263 -53.619 -48.319  1.00 23.68 ? 406 GOL B O2  1 
HETATM 10172 C  C3  . GOL Q  5 .   ? 36.000 -55.210 -48.811  1.00 31.69 ? 406 GOL B C3  1 
HETATM 10173 O  O3  . GOL Q  5 .   ? 35.314 -56.301 -48.188  1.00 38.29 ? 406 GOL B O3  1 
HETATM 10174 C  C1  A PEG R  6 .   ? 40.235 -35.982 -63.804  0.50 41.21 ? 407 PEG B C1  1 
HETATM 10175 C  C1  B PEG R  6 .   ? 39.272 -36.275 -63.655  0.50 33.22 ? 407 PEG B C1  1 
HETATM 10176 O  O1  A PEG R  6 .   ? 39.138 -36.829 -64.185  0.50 32.66 ? 407 PEG B O1  1 
HETATM 10177 O  O1  B PEG R  6 .   ? 38.806 -37.030 -64.778  0.50 28.43 ? 407 PEG B O1  1 
HETATM 10178 C  C2  A PEG R  6 .   ? 41.484 -36.823 -63.558  0.50 39.85 ? 407 PEG B C2  1 
HETATM 10179 C  C2  B PEG R  6 .   ? 40.622 -36.809 -63.186  0.50 33.58 ? 407 PEG B C2  1 
HETATM 10180 O  O2  A PEG R  6 .   ? 42.636 -35.986 -63.635  0.50 51.18 ? 407 PEG B O2  1 
HETATM 10181 O  O2  B PEG R  6 .   ? 41.669 -35.961 -63.643  0.50 31.99 ? 407 PEG B O2  1 
HETATM 10182 C  C3  A PEG R  6 .   ? 43.825 -36.740 -63.872  0.50 46.57 ? 407 PEG B C3  1 
HETATM 10183 C  C3  B PEG R  6 .   ? 42.682 -36.708 -64.318  0.50 39.85 ? 407 PEG B C3  1 
HETATM 10184 C  C4  A PEG R  6 .   ? 43.936 -37.059 -65.359  0.50 46.27 ? 407 PEG B C4  1 
HETATM 10185 C  C4  B PEG R  6 .   ? 43.761 -35.766 -64.840  0.50 40.42 ? 407 PEG B C4  1 
HETATM 10186 O  O4  A PEG R  6 .   ? 43.639 -38.445 -65.567  0.50 41.94 ? 407 PEG B O4  1 
HETATM 10187 O  O4  B PEG R  6 .   ? 44.951 -35.923 -64.056  0.50 46.19 ? 407 PEG B O4  1 
HETATM 10188 FE FE  . FE2 S  2 .   ? 67.030 -37.424 -20.589  1.00 12.85 ? 401 FE2 C FE  1 
HETATM 10189 CO CO  . CO  T  3 .   ? 63.931 -38.662 -19.717  1.00 16.27 ? 402 CO  C CO  1 
HETATM 10190 C  C1  . GOL U  5 .   ? 50.136 -32.000 -36.632  1.00 43.73 ? 403 GOL C C1  1 
HETATM 10191 O  O1  . GOL U  5 .   ? 48.754 -32.357 -36.511  1.00 47.20 ? 403 GOL C O1  1 
HETATM 10192 C  C2  . GOL U  5 .   ? 50.629 -32.397 -38.021  1.00 48.25 ? 403 GOL C C2  1 
HETATM 10193 O  O2  . GOL U  5 .   ? 49.674 -31.994 -39.009  1.00 52.69 ? 403 GOL C O2  1 
HETATM 10194 C  C3  . GOL U  5 .   ? 51.958 -31.711 -38.299  1.00 39.13 ? 403 GOL C C3  1 
HETATM 10195 O  O3  . GOL U  5 .   ? 51.890 -30.358 -37.842  1.00 36.21 ? 403 GOL C O3  1 
HETATM 10196 O  O1  . PG4 V  7 .   ? 66.028 -39.918 -17.982  1.00 52.85 ? 404 PG4 C O1  1 
HETATM 10197 C  C1  . PG4 V  7 .   ? 66.834 -40.580 -17.000  1.00 45.39 ? 404 PG4 C C1  1 
HETATM 10198 C  C2  . PG4 V  7 .   ? 68.141 -41.057 -17.626  1.00 53.91 ? 404 PG4 C C2  1 
HETATM 10199 O  O2  . PG4 V  7 .   ? 67.973 -41.276 -19.027  1.00 60.90 ? 404 PG4 C O2  1 
HETATM 10200 C  C3  . PG4 V  7 .   ? 67.530 -42.601 -19.318  1.00 61.94 ? 404 PG4 C C3  1 
HETATM 10201 C  C4  . PG4 V  7 .   ? 68.702 -43.484 -19.740  1.00 59.60 ? 404 PG4 C C4  1 
HETATM 10202 O  O3  . PG4 V  7 .   ? 68.565 -44.771 -19.132  1.00 61.79 ? 404 PG4 C O3  1 
HETATM 10203 C  C5  . PG4 V  7 .   ? 68.783 -45.840 -20.050  1.00 63.82 ? 404 PG4 C C5  1 
HETATM 10204 C  C6  . PG4 V  7 .   ? 69.114 -47.122 -19.291  1.00 56.87 ? 404 PG4 C C6  1 
HETATM 10205 O  O4  . PG4 V  7 .   ? 70.514 -47.381 -19.390  1.00 58.31 ? 404 PG4 C O4  1 
HETATM 10206 C  C7  . PG4 V  7 .   ? 70.806 -48.579 -20.109  1.00 47.10 ? 404 PG4 C C7  1 
HETATM 10207 C  C8  . PG4 V  7 .   ? 71.909 -48.295 -21.122  1.00 52.80 ? 404 PG4 C C8  1 
HETATM 10208 O  O5  . PG4 V  7 .   ? 72.983 -49.226 -20.944  1.00 49.96 ? 404 PG4 C O5  1 
HETATM 10209 C  C1  . GOL W  5 .   ? 73.200 -15.785 -9.402   1.00 42.05 ? 405 GOL C C1  1 
HETATM 10210 O  O1  . GOL W  5 .   ? 73.365 -17.205 -9.437   1.00 33.88 ? 405 GOL C O1  1 
HETATM 10211 C  C2  . GOL W  5 .   ? 73.427 -15.299 -7.980   1.00 41.72 ? 405 GOL C C2  1 
HETATM 10212 O  O2  . GOL W  5 .   ? 73.949 -13.968 -8.025   1.00 56.88 ? 405 GOL C O2  1 
HETATM 10213 C  C3  . GOL W  5 .   ? 72.097 -15.318 -7.231   1.00 51.70 ? 405 GOL C C3  1 
HETATM 10214 O  O3  . GOL W  5 .   ? 71.974 -16.534 -6.479   1.00 47.13 ? 405 GOL C O3  1 
HETATM 10215 C  C1  . EDO X  4 .   ? 57.952 -35.600 0.827    1.00 40.19 ? 406 EDO C C1  1 
HETATM 10216 O  O1  . EDO X  4 .   ? 56.992 -36.629 1.105    1.00 48.17 ? 406 EDO C O1  1 
HETATM 10217 C  C2  . EDO X  4 .   ? 57.539 -34.814 -0.410   1.00 45.35 ? 406 EDO C C2  1 
HETATM 10218 O  O2  . EDO X  4 .   ? 57.443 -33.416 -0.099   1.00 33.96 ? 406 EDO C O2  1 
HETATM 10219 C  C1  . GOL Y  5 .   ? 52.380 -18.532 -22.932  1.00 39.24 ? 407 GOL C C1  1 
HETATM 10220 O  O1  . GOL Y  5 .   ? 51.177 -18.902 -23.608  1.00 37.83 ? 407 GOL C O1  1 
HETATM 10221 C  C2  . GOL Y  5 .   ? 53.566 -19.040 -23.741  1.00 33.15 ? 407 GOL C C2  1 
HETATM 10222 O  O2  . GOL Y  5 .   ? 53.725 -20.441 -23.500  1.00 27.51 ? 407 GOL C O2  1 
HETATM 10223 C  C3  . GOL Y  5 .   ? 54.821 -18.285 -23.312  1.00 33.20 ? 407 GOL C C3  1 
HETATM 10224 O  O3  . GOL Y  5 .   ? 55.981 -18.910 -23.879  1.00 27.23 ? 407 GOL C O3  1 
HETATM 10225 FE FE  . FE2 Z  2 .   ? 18.006 -39.244 -84.813  1.00 14.66 ? 401 FE2 D FE  1 
HETATM 10226 CO CO  . CO  AA 3 .   ? 15.430 -41.098 -83.467  1.00 19.35 ? 402 CO  D CO  1 
HETATM 10227 C  C1  . EDO BA 4 .   ? 15.464 -14.702 -103.485 1.00 44.01 ? 403 EDO D C1  1 
HETATM 10228 O  O1  . EDO BA 4 .   ? 14.960 -13.394 -103.197 1.00 63.05 ? 403 EDO D O1  1 
HETATM 10229 C  C2  . EDO BA 4 .   ? 15.975 -15.325 -102.195 1.00 46.50 ? 403 EDO D C2  1 
HETATM 10230 O  O2  . EDO BA 4 .   ? 17.055 -16.210 -102.498 1.00 26.66 ? 403 EDO D O2  1 
HETATM 10231 O  O1  . PG4 CA 7 .   ? 18.453 -41.696 -81.781  1.00 50.01 ? 404 PG4 D O1  1 
HETATM 10232 C  C1  . PG4 CA 7 .   ? 19.796 -42.124 -81.515  1.00 56.06 ? 404 PG4 D C1  1 
HETATM 10233 C  C2  . PG4 CA 7 .   ? 20.497 -42.499 -82.819  1.00 58.84 ? 404 PG4 D C2  1 
HETATM 10234 O  O2  . PG4 CA 7 .   ? 20.085 -43.798 -83.254  1.00 55.83 ? 404 PG4 D O2  1 
HETATM 10235 C  C3  . PG4 CA 7 .   ? 21.155 -44.546 -83.838  1.00 52.45 ? 404 PG4 D C3  1 
HETATM 10236 C  C4  . PG4 CA 7 .   ? 21.130 -45.990 -83.340  1.00 51.81 ? 404 PG4 D C4  1 
HETATM 10237 O  O3  . PG4 CA 7 .   ? 22.460 -46.452 -83.087  1.00 53.01 ? 404 PG4 D O3  1 
HETATM 10238 C  C5  . PG4 CA 7 .   ? 22.560 -47.877 -83.138  1.00 52.84 ? 404 PG4 D C5  1 
HETATM 10239 C  C6  . PG4 CA 7 .   ? 24.012 -48.302 -82.937  1.00 57.84 ? 404 PG4 D C6  1 
HETATM 10240 O  O4  . PG4 CA 7 .   ? 24.581 -48.733 -84.172  1.00 52.82 ? 404 PG4 D O4  1 
HETATM 10241 C  C7  . PG4 CA 7 .   ? 25.867 -49.321 -83.985  1.00 55.25 ? 404 PG4 D C7  1 
HETATM 10242 C  C8  . PG4 CA 7 .   ? 26.581 -49.441 -85.327  1.00 56.24 ? 404 PG4 D C8  1 
HETATM 10243 O  O5  . PG4 CA 7 .   ? 27.763 -48.630 -85.325  1.00 51.90 ? 404 PG4 D O5  1 
HETATM 10244 C  C1  . GOL DA 5 .   ? 3.256  -21.105 -73.952  1.00 53.58 ? 405 GOL D C1  1 
HETATM 10245 O  O1  . GOL DA 5 .   ? 2.924  -20.103 -74.921  1.00 57.35 ? 405 GOL D O1  1 
HETATM 10246 C  C2  . GOL DA 5 .   ? 2.339  -20.941 -72.747  1.00 62.70 ? 405 GOL D C2  1 
HETATM 10247 O  O2  . GOL DA 5 .   ? 2.963  -20.077 -71.792  1.00 69.13 ? 405 GOL D O2  1 
HETATM 10248 C  C3  . GOL DA 5 .   ? 1.024  -20.320 -73.201  1.00 60.98 ? 405 GOL D C3  1 
HETATM 10249 O  O3  . GOL DA 5 .   ? 0.233  -21.323 -73.846  1.00 63.09 ? 405 GOL D O3  1 
HETATM 10250 C  C1  . EDO EA 4 .   ? 31.546 -37.030 -104.548 1.00 47.92 ? 406 EDO D C1  1 
HETATM 10251 O  O1  . EDO EA 4 .   ? 31.017 -37.134 -105.876 1.00 51.62 ? 406 EDO D O1  1 
HETATM 10252 C  C2  . EDO EA 4 .   ? 31.618 -38.420 -103.934 1.00 40.42 ? 406 EDO D C2  1 
HETATM 10253 O  O2  . EDO EA 4 .   ? 32.986 -38.829 -103.831 1.00 60.99 ? 406 EDO D O2  1 
HETATM 10254 C  C1  . GOL FA 5 .   ? -1.328 -24.529 -87.608  1.00 42.06 ? 407 GOL D C1  1 
HETATM 10255 O  O1  . GOL FA 5 .   ? -2.161 -24.711 -86.460  1.00 42.53 ? 407 GOL D O1  1 
HETATM 10256 C  C2  . GOL FA 5 .   ? 0.072  -25.044 -87.292  1.00 35.49 ? 407 GOL D C2  1 
HETATM 10257 O  O2  . GOL FA 5 .   ? 0.003  -26.456 -87.040  1.00 31.64 ? 407 GOL D O2  1 
HETATM 10258 C  C3  . GOL FA 5 .   ? 0.980  -24.771 -88.490  1.00 42.26 ? 407 GOL D C3  1 
HETATM 10259 O  O3  . GOL FA 5 .   ? 2.369  -24.867 -88.140  1.00 36.38 ? 407 GOL D O3  1 
HETATM 10260 C  C1  . EDO GA 4 .   ? 2.253  -33.215 -99.178  1.00 41.83 ? 408 EDO D C1  1 
HETATM 10261 O  O1  . EDO GA 4 .   ? 3.585  -32.853 -99.569  1.00 43.60 ? 408 EDO D O1  1 
HETATM 10262 C  C2  . EDO GA 4 .   ? 2.199  -33.383 -97.664  1.00 50.92 ? 408 EDO D C2  1 
HETATM 10263 O  O2  . EDO GA 4 .   ? 2.081  -32.102 -97.028  1.00 44.80 ? 408 EDO D O2  1 
HETATM 10264 O  O   . HOH HA 8 .   ? 57.742 -46.581 4.035    1.00 14.51 ? 501 HOH A O   1 
HETATM 10265 O  O   . HOH HA 8 .   ? 54.229 -42.007 23.711   1.00 20.96 ? 502 HOH A O   1 
HETATM 10266 O  O   . HOH HA 8 .   ? 56.089 -48.714 14.039   1.00 16.22 ? 503 HOH A O   1 
HETATM 10267 O  O   . HOH HA 8 .   ? 65.194 -43.830 16.671   1.00 14.82 ? 504 HOH A O   1 
HETATM 10268 O  O   . HOH HA 8 .   ? 71.712 -26.674 11.879   1.00 20.07 ? 505 HOH A O   1 
HETATM 10269 O  O   . HOH HA 8 .   ? 82.870 -36.173 18.831   1.00 15.05 ? 506 HOH A O   1 
HETATM 10270 O  O   . HOH HA 8 .   ? 73.140 -33.762 11.242   1.00 18.65 ? 507 HOH A O   1 
HETATM 10271 O  O   . HOH HA 8 .   ? 68.882 -40.922 24.678   1.00 14.67 ? 508 HOH A O   1 
HETATM 10272 O  O   . HOH HA 8 .   ? 58.082 -40.006 23.527   1.00 16.12 ? 509 HOH A O   1 
HETATM 10273 O  O   . HOH HA 8 .   ? 75.192 -39.454 10.887   1.00 16.77 ? 510 HOH A O   1 
HETATM 10274 O  O   . HOH HA 8 .   ? 64.626 -49.110 4.799    1.00 19.25 ? 511 HOH A O   1 
HETATM 10275 O  O   . HOH HA 8 .   ? 58.533 -40.905 19.229   1.00 15.95 ? 512 HOH A O   1 
HETATM 10276 O  O   . HOH HA 8 .   ? 65.212 -46.444 4.609    1.00 16.08 ? 513 HOH A O   1 
HETATM 10277 O  O   . HOH HA 8 .   ? 55.591 -33.668 21.997   1.00 17.85 ? 514 HOH A O   1 
HETATM 10278 O  O   . HOH HA 8 .   ? 67.896 -43.158 25.956   1.00 15.71 ? 515 HOH A O   1 
HETATM 10279 O  O   . HOH HA 8 .   ? 60.917 -50.082 34.323   1.00 18.82 ? 516 HOH A O   1 
HETATM 10280 O  O   . HOH HA 8 .   ? 74.402 -42.353 4.611    1.00 18.50 ? 517 HOH A O   1 
HETATM 10281 O  O   . HOH HA 8 .   ? 70.210 -22.562 -8.647   1.00 15.57 ? 518 HOH A O   1 
HETATM 10282 O  O   . HOH HA 8 .   ? 56.537 -41.709 25.096   1.00 20.38 ? 519 HOH A O   1 
HETATM 10283 O  O   . HOH HA 8 .   ? 80.850 -41.546 14.633   1.00 14.18 ? 520 HOH A O   1 
HETATM 10284 O  O   . HOH HA 8 .   ? 74.995 -33.579 9.188    1.00 23.07 ? 521 HOH A O   1 
HETATM 10285 O  O   . HOH HA 8 .   ? 54.922 -42.160 13.871   1.00 20.19 ? 522 HOH A O   1 
HETATM 10286 O  O   . HOH HA 8 .   ? 60.088 -49.897 -3.527   1.00 21.95 ? 523 HOH A O   1 
HETATM 10287 O  O   . HOH HA 8 .   ? 70.604 -21.110 -6.190   1.00 19.93 ? 524 HOH A O   1 
HETATM 10288 O  O   . HOH HA 8 .   ? 77.524 -38.569 31.700   1.00 21.52 ? 525 HOH A O   1 
HETATM 10289 O  O   . HOH HA 8 .   ? 61.621 -42.866 -1.249   1.00 21.59 ? 526 HOH A O   1 
HETATM 10290 O  O   . HOH HA 8 .   ? 56.169 -28.914 21.828   1.00 24.88 ? 527 HOH A O   1 
HETATM 10291 O  O   . HOH HA 8 .   ? 73.743 -31.953 7.511    1.00 28.25 ? 528 HOH A O   1 
HETATM 10292 O  O   . HOH HA 8 .   ? 58.905 -58.184 15.353   1.00 22.86 ? 529 HOH A O   1 
HETATM 10293 O  O   . HOH HA 8 .   ? 65.413 -37.467 1.057    1.00 25.96 ? 530 HOH A O   1 
HETATM 10294 O  O   . HOH HA 8 .   ? 76.740 -27.815 33.738   1.00 27.41 ? 531 HOH A O   1 
HETATM 10295 O  O   . HOH HA 8 .   ? 67.087 -34.681 -2.196   1.00 21.03 ? 532 HOH A O   1 
HETATM 10296 O  O   . HOH HA 8 .   ? 85.692 -38.430 23.888   1.00 21.75 ? 533 HOH A O   1 
HETATM 10297 O  O   . HOH HA 8 .   ? 67.506 -58.635 23.577   1.00 27.97 ? 534 HOH A O   1 
HETATM 10298 O  O   . HOH HA 8 .   ? 51.387 -49.754 14.673   1.00 28.96 ? 535 HOH A O   1 
HETATM 10299 O  O   . HOH HA 8 .   ? 60.115 -62.005 25.726   1.00 25.23 ? 536 HOH A O   1 
HETATM 10300 O  O   . HOH HA 8 .   ? 82.339 -52.045 1.554    1.00 24.21 ? 537 HOH A O   1 
HETATM 10301 O  O   . HOH HA 8 .   ? 78.602 -50.588 -3.386   1.00 21.86 ? 538 HOH A O   1 
HETATM 10302 O  O   . HOH HA 8 .   ? 69.828 -22.899 5.949    1.00 28.50 ? 539 HOH A O   1 
HETATM 10303 O  O   . HOH HA 8 .   ? 87.603 -39.532 22.300   1.00 19.79 ? 540 HOH A O   1 
HETATM 10304 O  O   . HOH HA 8 .   ? 63.433 -19.199 -4.415   1.00 25.26 ? 541 HOH A O   1 
HETATM 10305 O  O   . HOH HA 8 .   ? 78.046 -26.031 27.325   1.00 31.09 ? 542 HOH A O   1 
HETATM 10306 O  O   . HOH HA 8 .   ? 57.097 -51.885 -3.279   1.00 28.03 ? 543 HOH A O   1 
HETATM 10307 O  O   . HOH HA 8 .   ? 54.283 -52.638 5.534    1.00 30.26 ? 544 HOH A O   1 
HETATM 10308 O  O   . HOH HA 8 .   ? 79.625 -48.452 17.135   1.00 20.23 ? 545 HOH A O   1 
HETATM 10309 O  O   . HOH HA 8 .   ? 71.694 -21.339 30.908   1.00 41.47 ? 546 HOH A O   1 
HETATM 10310 O  O   . HOH HA 8 .   ? 83.274 -50.525 23.463   1.00 44.67 ? 547 HOH A O   1 
HETATM 10311 O  O   . HOH HA 8 .   ? 64.527 -32.387 3.585    1.00 27.87 ? 548 HOH A O   1 
HETATM 10312 O  O   . HOH HA 8 .   ? 79.984 -52.942 -4.050   1.00 29.23 ? 549 HOH A O   1 
HETATM 10313 O  O   . HOH HA 8 .   ? 80.015 -47.615 32.399   1.00 40.70 ? 550 HOH A O   1 
HETATM 10314 O  O   . HOH HA 8 .   ? 82.920 -47.876 12.979   1.00 31.49 ? 551 HOH A O   1 
HETATM 10315 O  O   . HOH HA 8 .   ? 82.748 -40.406 13.016   1.00 32.60 ? 552 HOH A O   1 
HETATM 10316 O  O   . HOH HA 8 .   ? 66.241 -36.182 -4.452   1.00 34.45 ? 553 HOH A O   1 
HETATM 10317 O  O   . HOH HA 8 .   ? 69.832 -58.254 -4.175   1.00 24.38 ? 554 HOH A O   1 
HETATM 10318 O  O   . HOH HA 8 .   ? 51.328 -31.807 26.221   1.00 32.84 ? 555 HOH A O   1 
HETATM 10319 O  O   . HOH HA 8 .   ? 67.539 -24.890 16.549   1.00 25.98 ? 556 HOH A O   1 
HETATM 10320 O  O   . HOH HA 8 .   ? 85.312 -41.321 -0.286   1.00 25.46 ? 557 HOH A O   1 
HETATM 10321 O  O   . HOH HA 8 .   ? 64.883 -40.081 0.836    1.00 19.53 ? 558 HOH A O   1 
HETATM 10322 O  O   . HOH HA 8 .   ? 86.939 -44.853 26.304   1.00 31.50 ? 559 HOH A O   1 
HETATM 10323 O  O   . HOH HA 8 .   ? 58.550 -58.898 28.505   1.00 23.69 ? 560 HOH A O   1 
HETATM 10324 O  O   . HOH HA 8 .   ? 58.152 -38.553 9.816    1.00 31.83 ? 561 HOH A O   1 
HETATM 10325 O  O   . HOH HA 8 .   ? 78.868 -47.827 -8.588   1.00 30.79 ? 562 HOH A O   1 
HETATM 10326 O  O   . HOH HA 8 .   ? 89.445 -37.266 8.290    1.00 30.35 ? 563 HOH A O   1 
HETATM 10327 O  O   . HOH HA 8 .   ? 62.743 -56.220 -1.465   1.00 25.70 ? 564 HOH A O   1 
HETATM 10328 O  O   . HOH HA 8 .   ? 88.272 -34.768 8.046    1.00 34.96 ? 565 HOH A O   1 
HETATM 10329 O  O   . HOH HA 8 .   ? 70.755 -22.186 24.345   1.00 30.07 ? 566 HOH A O   1 
HETATM 10330 O  O   . HOH HA 8 .   ? 89.483 -45.965 26.123   1.00 35.89 ? 567 HOH A O   1 
HETATM 10331 O  O   . HOH HA 8 .   ? 58.259 -55.456 0.621    1.00 31.43 ? 568 HOH A O   1 
HETATM 10332 O  O   . HOH HA 8 .   ? 56.959 -41.411 11.573   1.00 28.34 ? 569 HOH A O   1 
HETATM 10333 O  O   . HOH HA 8 .   ? 81.247 -33.411 4.264    1.00 26.00 ? 570 HOH A O   1 
HETATM 10334 O  O   . HOH HA 8 .   ? 67.594 -36.671 -0.576   1.00 27.53 ? 571 HOH A O   1 
HETATM 10335 O  O   . HOH HA 8 .   ? 64.162 -57.844 0.026    1.00 35.15 ? 572 HOH A O   1 
HETATM 10336 O  O   . HOH HA 8 .   ? 64.265 -35.205 0.368    1.00 38.55 ? 573 HOH A O   1 
HETATM 10337 O  O   . HOH HA 8 .   ? 74.966 -26.427 -2.437   1.00 28.36 ? 574 HOH A O   1 
HETATM 10338 O  O   . HOH HA 8 .   ? 64.086 -26.357 13.741   1.00 43.00 ? 575 HOH A O   1 
HETATM 10339 O  O   . HOH HA 8 .   ? 62.295 -25.153 7.282    1.00 27.50 ? 576 HOH A O   1 
HETATM 10340 O  O   . HOH HA 8 .   ? 72.547 -59.122 -2.662   1.00 33.92 ? 577 HOH A O   1 
HETATM 10341 O  O   . HOH HA 8 .   ? 65.918 -23.821 21.477   1.00 33.06 ? 578 HOH A O   1 
HETATM 10342 O  O   . HOH HA 8 .   ? 83.129 -52.409 13.347   1.00 37.35 ? 579 HOH A O   1 
HETATM 10343 O  O   . HOH HA 8 .   ? 70.563 -64.068 6.489    1.00 26.96 ? 580 HOH A O   1 
HETATM 10344 O  O   . HOH HA 8 .   ? 84.560 -42.430 2.606    1.00 28.71 ? 581 HOH A O   1 
HETATM 10345 O  O   . HOH HA 8 .   ? 68.579 -62.260 2.518    1.00 32.80 ? 582 HOH A O   1 
HETATM 10346 O  O   . HOH HA 8 .   ? 75.490 -26.007 -5.452   1.00 34.51 ? 583 HOH A O   1 
HETATM 10347 O  O   . HOH HA 8 .   ? 65.648 -34.576 3.874    1.00 34.05 ? 584 HOH A O   1 
HETATM 10348 O  O   . HOH HA 8 .   ? 81.144 -34.496 25.642   1.00 25.30 ? 585 HOH A O   1 
HETATM 10349 O  O   . HOH HA 8 .   ? 51.385 -43.746 2.932    1.00 45.39 ? 586 HOH A O   1 
HETATM 10350 O  O   . HOH HA 8 .   ? 68.281 -51.934 -5.679   1.00 32.39 ? 587 HOH A O   1 
HETATM 10351 O  O   . HOH HA 8 .   ? 77.328 -49.909 -5.537   1.00 31.24 ? 588 HOH A O   1 
HETATM 10352 O  O   . HOH HA 8 .   ? 64.774 -25.341 11.255   1.00 32.43 ? 589 HOH A O   1 
HETATM 10353 O  O   . HOH HA 8 .   ? 57.157 -60.008 15.329   1.00 27.55 ? 590 HOH A O   1 
HETATM 10354 O  O   . HOH HA 8 .   ? 62.909 -62.051 6.323    1.00 36.32 ? 591 HOH A O   1 
HETATM 10355 O  O   . HOH HA 8 .   ? 77.985 -57.067 1.474    1.00 37.40 ? 592 HOH A O   1 
HETATM 10356 O  O   . HOH HA 8 .   ? 62.353 -63.218 14.006   1.00 38.04 ? 593 HOH A O   1 
HETATM 10357 O  O   . HOH HA 8 .   ? 57.465 -48.321 -5.764   1.00 42.80 ? 594 HOH A O   1 
HETATM 10358 O  O   . HOH HA 8 .   ? 78.682 -45.123 29.303   1.00 46.33 ? 595 HOH A O   1 
HETATM 10359 O  O   . HOH HA 8 .   ? 78.383 -56.349 19.889   1.00 41.04 ? 596 HOH A O   1 
HETATM 10360 O  O   . HOH HA 8 .   ? 84.386 -25.026 14.331   1.00 34.05 ? 597 HOH A O   1 
HETATM 10361 O  O   . HOH HA 8 .   ? 63.687 -53.152 33.795   1.00 32.57 ? 598 HOH A O   1 
HETATM 10362 O  O   . HOH HA 8 .   ? 60.196 -26.278 27.818   1.00 36.99 ? 599 HOH A O   1 
HETATM 10363 O  O   . HOH HA 8 .   ? 82.896 -50.490 27.265   1.00 33.44 ? 600 HOH A O   1 
HETATM 10364 O  O   . HOH HA 8 .   ? 58.290 -28.761 33.571   1.00 34.15 ? 601 HOH A O   1 
HETATM 10365 O  O   . HOH HA 8 .   ? 53.964 -52.433 8.115    1.00 34.45 ? 602 HOH A O   1 
HETATM 10366 O  O   . HOH HA 8 .   ? 53.155 -34.158 31.382   1.00 37.18 ? 603 HOH A O   1 
HETATM 10367 O  O   . HOH HA 8 .   ? 82.258 -22.231 20.542   1.00 30.17 ? 604 HOH A O   1 
HETATM 10368 O  O   . HOH HA 8 .   ? 82.755 -50.967 -1.056   1.00 31.90 ? 605 HOH A O   1 
HETATM 10369 O  O   . HOH HA 8 .   ? 81.753 -49.576 16.473   1.00 22.33 ? 606 HOH A O   1 
HETATM 10370 O  O   . HOH HA 8 .   ? 73.444 -63.814 12.991   1.00 37.52 ? 607 HOH A O   1 
HETATM 10371 O  O   . HOH HA 8 .   ? 64.979 -33.257 36.937   1.00 35.22 ? 608 HOH A O   1 
HETATM 10372 O  O   . HOH HA 8 .   ? 65.682 -32.321 34.658   1.00 28.95 ? 609 HOH A O   1 
HETATM 10373 O  O   . HOH HA 8 .   ? 52.591 -35.283 37.426   1.00 38.38 ? 610 HOH A O   1 
HETATM 10374 O  O   . HOH HA 8 .   ? 64.859 -67.021 9.808    1.00 39.05 ? 611 HOH A O   1 
HETATM 10375 O  O   . HOH HA 8 .   ? 62.153 -63.168 21.425   1.00 47.25 ? 612 HOH A O   1 
HETATM 10376 O  O   . HOH HA 8 .   ? 78.997 -50.850 18.828   1.00 37.80 ? 613 HOH A O   1 
HETATM 10377 O  O   . HOH HA 8 .   ? 68.273 -18.900 4.318    1.00 50.20 ? 614 HOH A O   1 
HETATM 10378 O  O   . HOH HA 8 .   ? 78.166 -32.063 29.522   1.00 34.68 ? 615 HOH A O   1 
HETATM 10379 O  O   . HOH HA 8 .   ? 57.015 -22.031 20.178   1.00 29.47 ? 616 HOH A O   1 
HETATM 10380 O  O   . HOH HA 8 .   ? 49.347 -40.526 17.963   1.00 29.47 ? 617 HOH A O   1 
HETATM 10381 O  O   . HOH HA 8 .   ? 75.124 -20.733 3.133    1.00 34.43 ? 618 HOH A O   1 
HETATM 10382 O  O   . HOH HA 8 .   ? 77.299 -30.455 32.836   1.00 37.48 ? 619 HOH A O   1 
HETATM 10383 O  O   . HOH HA 8 .   ? 78.231 -18.727 12.043   1.00 47.92 ? 620 HOH A O   1 
HETATM 10384 O  O   . HOH HA 8 .   ? 76.831 -29.171 2.334    1.00 48.40 ? 621 HOH A O   1 
HETATM 10385 O  O   . HOH HA 8 .   ? 56.000 -28.876 36.834   1.00 51.06 ? 622 HOH A O   1 
HETATM 10386 O  O   . HOH HA 8 .   ? 58.939 -60.059 4.215    1.00 53.04 ? 623 HOH A O   1 
HETATM 10387 O  O   . HOH HA 8 .   ? 50.480 -47.103 6.340    1.00 35.03 ? 624 HOH A O   1 
HETATM 10388 O  O   . HOH HA 8 .   ? 54.442 -40.369 12.202   1.00 41.18 ? 625 HOH A O   1 
HETATM 10389 O  O   . HOH HA 8 .   ? 64.019 -25.017 19.845   1.00 39.09 ? 626 HOH A O   1 
HETATM 10390 O  O   . HOH HA 8 .   ? 64.739 -41.990 -3.305   1.00 31.02 ? 627 HOH A O   1 
HETATM 10391 O  O   . HOH HA 8 .   ? 66.501 -52.651 -9.725   1.00 38.01 ? 628 HOH A O   1 
HETATM 10392 O  O   . HOH HA 8 .   ? 87.912 -33.096 12.467   1.00 40.93 ? 629 HOH A O   1 
HETATM 10393 O  O   . HOH HA 8 .   ? 86.006 -32.352 14.353   1.00 31.25 ? 630 HOH A O   1 
HETATM 10394 O  O   . HOH HA 8 .   ? 68.900 -27.154 6.670    1.00 31.27 ? 631 HOH A O   1 
HETATM 10395 O  O   . HOH HA 8 .   ? 85.298 -49.238 -0.072   1.00 37.63 ? 632 HOH A O   1 
HETATM 10396 O  O   . HOH HA 8 .   ? 80.690 -26.318 24.654   1.00 34.59 ? 633 HOH A O   1 
HETATM 10397 O  O   . HOH HA 8 .   ? 64.423 -40.672 -5.543   1.00 45.00 ? 634 HOH A O   1 
HETATM 10398 O  O   . HOH HA 8 .   ? 55.036 -20.859 21.397   1.00 43.40 ? 635 HOH A O   1 
HETATM 10399 O  O   . HOH HA 8 .   ? 75.323 -29.160 -2.039   1.00 40.67 ? 636 HOH A O   1 
HETATM 10400 O  O   . HOH HA 8 .   ? 57.897 -47.284 -8.199   1.00 48.32 ? 637 HOH A O   1 
HETATM 10401 O  O   . HOH HA 8 .   ? 51.178 -28.450 21.342   1.00 37.14 ? 638 HOH A O   1 
HETATM 10402 O  O   . HOH HA 8 .   ? 75.796 -60.126 -4.489   1.00 48.07 ? 639 HOH A O   1 
HETATM 10403 O  O   . HOH HA 8 .   ? 85.301 -29.764 8.925    1.00 40.37 ? 640 HOH A O   1 
HETATM 10404 O  O   . HOH HA 8 .   ? 76.621 -36.125 32.337   1.00 42.35 ? 641 HOH A O   1 
HETATM 10405 O  O   . HOH HA 8 .   ? 71.707 -54.599 23.861   1.00 34.80 ? 642 HOH A O   1 
HETATM 10406 O  O   . HOH HA 8 .   ? 69.605 -60.070 22.617   1.00 35.41 ? 643 HOH A O   1 
HETATM 10407 O  O   . HOH HA 8 .   ? 47.329 -50.754 24.363   1.00 44.66 ? 644 HOH A O   1 
HETATM 10408 O  O   . HOH HA 8 .   ? 65.778 -47.166 -7.956   1.00 44.51 ? 645 HOH A O   1 
HETATM 10409 O  O   . HOH HA 8 .   ? 74.376 -19.619 -3.989   1.00 43.52 ? 646 HOH A O   1 
HETATM 10410 O  O   . HOH HA 8 .   ? 74.126 -22.044 0.394    1.00 44.10 ? 647 HOH A O   1 
HETATM 10411 O  O   . HOH HA 8 .   ? 77.323 -46.169 31.624   1.00 43.45 ? 648 HOH A O   1 
HETATM 10412 O  O   . HOH HA 8 .   ? 53.105 -33.300 36.514   1.00 50.18 ? 649 HOH A O   1 
HETATM 10413 O  O   . HOH HA 8 .   ? 66.115 -23.762 3.683    1.00 45.39 ? 650 HOH A O   1 
HETATM 10414 O  O   . HOH HA 8 .   ? 69.151 -55.026 30.333   1.00 33.51 ? 651 HOH A O   1 
HETATM 10415 O  O   . HOH HA 8 .   ? 59.369 -40.490 -0.817   1.00 47.52 ? 652 HOH A O   1 
HETATM 10416 O  O   . HOH HA 8 .   ? 47.672 -47.218 28.656   1.00 60.93 ? 653 HOH A O   1 
HETATM 10417 O  O   . HOH HA 8 .   ? 85.814 -36.775 -0.943   1.00 44.98 ? 654 HOH A O   1 
HETATM 10418 O  O   . HOH HA 8 .   ? 86.337 -29.361 6.418    1.00 41.59 ? 655 HOH A O   1 
HETATM 10419 O  O   . HOH HA 8 .   ? 51.211 -39.659 15.712   1.00 30.15 ? 656 HOH A O   1 
HETATM 10420 O  O   . HOH HA 8 .   ? 62.444 -26.818 25.023   1.00 35.96 ? 657 HOH A O   1 
HETATM 10421 O  O   . HOH HA 8 .   ? 85.751 -54.957 4.618    1.00 45.81 ? 658 HOH A O   1 
HETATM 10422 O  O   . HOH HA 8 .   ? 74.354 -55.662 24.065   1.00 43.27 ? 659 HOH A O   1 
HETATM 10423 O  O   . HOH HA 8 .   ? 70.333 -49.996 34.190   1.00 40.68 ? 660 HOH A O   1 
HETATM 10424 O  O   . HOH HA 8 .   ? 51.878 -56.157 24.094   1.00 35.02 ? 661 HOH A O   1 
HETATM 10425 O  O   . HOH HA 8 .   ? 71.705 -16.650 3.051    1.00 45.72 ? 662 HOH A O   1 
HETATM 10426 O  O   . HOH HA 8 .   ? 75.652 -62.999 12.685   1.00 49.99 ? 663 HOH A O   1 
HETATM 10427 O  O   . HOH HA 8 .   ? 48.876 -45.889 17.032   1.00 46.25 ? 664 HOH A O   1 
HETATM 10428 O  O   . HOH HA 8 .   ? 85.611 -26.616 22.117   1.00 39.96 ? 665 HOH A O   1 
HETATM 10429 O  O   . HOH HA 8 .   ? 79.350 -18.569 14.806   1.00 43.68 ? 666 HOH A O   1 
HETATM 10430 O  O   . HOH HA 8 .   ? 90.124 -37.433 20.768   1.00 32.05 ? 667 HOH A O   1 
HETATM 10431 O  O   . HOH HA 8 .   ? 52.443 -54.947 8.667    1.00 35.96 ? 668 HOH A O   1 
HETATM 10432 O  O   . HOH HA 8 .   ? 79.027 -27.314 29.180   1.00 45.84 ? 669 HOH A O   1 
HETATM 10433 O  O   . HOH HA 8 .   ? 52.769 -48.125 -0.224   1.00 48.44 ? 670 HOH A O   1 
HETATM 10434 O  O   . HOH HA 8 .   ? 66.212 -40.708 -1.460   1.00 37.51 ? 671 HOH A O   1 
HETATM 10435 O  O   . HOH HA 8 .   ? 81.585 -54.755 24.554   1.00 53.47 ? 672 HOH A O   1 
HETATM 10436 O  O   . HOH HA 8 .   ? 69.256 -22.177 19.299   1.00 42.67 ? 673 HOH A O   1 
HETATM 10437 O  O   . HOH HA 8 .   ? 74.565 -50.814 30.814   1.00 34.47 ? 674 HOH A O   1 
HETATM 10438 O  O   . HOH HA 8 .   ? 76.151 -18.730 5.287    1.00 44.89 ? 675 HOH A O   1 
HETATM 10439 O  O   . HOH HA 8 .   ? 76.804 -57.764 18.651   1.00 43.97 ? 676 HOH A O   1 
HETATM 10440 O  O   . HOH HA 8 .   ? 56.766 -57.335 3.091    1.00 62.53 ? 677 HOH A O   1 
HETATM 10441 O  O   . HOH HA 8 .   ? 75.719 -30.402 -8.784   1.00 36.43 ? 678 HOH A O   1 
HETATM 10442 O  O   . HOH HA 8 .   ? 51.079 -42.869 32.889   1.00 31.25 ? 679 HOH A O   1 
HETATM 10443 O  O   . HOH HA 8 .   ? 60.803 -44.304 -8.681   1.00 37.67 ? 680 HOH A O   1 
HETATM 10444 O  O   . HOH HA 8 .   ? 90.028 -42.653 11.753   1.00 37.89 ? 681 HOH A O   1 
HETATM 10445 O  O   . HOH HA 8 .   ? 81.850 -54.538 1.783    1.00 34.95 ? 682 HOH A O   1 
HETATM 10446 O  O   . HOH HA 8 .   ? 71.828 -34.419 33.976   1.00 45.52 ? 683 HOH A O   1 
HETATM 10447 O  O   . HOH HA 8 .   ? 69.496 -54.761 25.895   1.00 40.53 ? 684 HOH A O   1 
HETATM 10448 O  O   . HOH HA 8 .   ? 61.703 -55.204 34.867   1.00 46.12 ? 685 HOH A O   1 
HETATM 10449 O  O   . HOH HA 8 .   ? 84.431 -51.328 2.860    1.00 29.33 ? 686 HOH A O   1 
HETATM 10450 O  O   . HOH HA 8 .   ? 65.842 -40.768 42.881   1.00 42.74 ? 687 HOH A O   1 
HETATM 10451 O  O   . HOH HA 8 .   ? 83.865 -35.014 26.085   1.00 54.41 ? 688 HOH A O   1 
HETATM 10452 O  O   . HOH HA 8 .   ? 89.470 -31.311 11.230   1.00 43.68 ? 689 HOH A O   1 
HETATM 10453 O  O   . HOH HA 8 .   ? 54.176 -47.187 -2.447   1.00 53.06 ? 690 HOH A O   1 
HETATM 10454 O  O   . HOH HA 8 .   ? 56.596 -59.358 21.152   1.00 45.83 ? 691 HOH A O   1 
HETATM 10455 O  O   . HOH HA 8 .   ? 87.726 -32.290 16.543   1.00 34.00 ? 692 HOH A O   1 
HETATM 10456 O  O   . HOH HA 8 .   ? 88.326 -49.652 10.301   1.00 43.43 ? 693 HOH A O   1 
HETATM 10457 O  O   . HOH HA 8 .   ? 90.337 -43.784 17.421   1.00 47.10 ? 694 HOH A O   1 
HETATM 10458 O  O   . HOH HA 8 .   ? 61.754 -39.467 42.380   1.00 48.88 ? 695 HOH A O   1 
HETATM 10459 O  O   . HOH HA 8 .   ? 91.216 -44.218 20.362   1.00 51.02 ? 696 HOH A O   1 
HETATM 10460 O  O   . HOH HA 8 .   ? 50.974 -56.135 26.350   1.00 41.88 ? 697 HOH A O   1 
HETATM 10461 O  O   . HOH HA 8 .   ? 60.552 -42.732 -3.938   1.00 42.05 ? 698 HOH A O   1 
HETATM 10462 O  O   . HOH HA 8 .   ? 63.755 -38.773 12.768   1.00 25.39 ? 699 HOH A O   1 
HETATM 10463 O  O   . HOH HA 8 .   ? 87.781 -45.188 -0.917   1.00 44.16 ? 700 HOH A O   1 
HETATM 10464 O  O   . HOH HA 8 .   ? 52.045 -21.958 14.754   1.00 54.11 ? 701 HOH A O   1 
HETATM 10465 O  O   . HOH HA 8 .   ? 89.114 -41.919 23.553   1.00 41.24 ? 702 HOH A O   1 
HETATM 10466 O  O   . HOH HA 8 .   ? 49.355 -54.166 18.639   1.00 45.53 ? 703 HOH A O   1 
HETATM 10467 O  O   . HOH HA 8 .   ? 84.994 -52.868 19.758   1.00 58.55 ? 704 HOH A O   1 
HETATM 10468 O  O   . HOH HA 8 .   ? 74.106 -54.100 21.524   1.00 64.31 ? 705 HOH A O   1 
HETATM 10469 O  O   . HOH HA 8 .   ? 62.248 -35.142 12.163   1.00 52.27 ? 706 HOH A O   1 
HETATM 10470 O  O   . HOH HA 8 .   ? 70.192 -40.458 37.174   1.00 49.87 ? 707 HOH A O   1 
HETATM 10471 O  O   . HOH HA 8 .   ? 64.079 -38.873 41.202   1.00 50.80 ? 708 HOH A O   1 
HETATM 10472 O  O   . HOH HA 8 .   ? 54.463 -59.464 23.266   1.00 45.32 ? 709 HOH A O   1 
HETATM 10473 O  O   . HOH HA 8 .   ? 79.302 -32.802 28.071   1.00 42.88 ? 710 HOH A O   1 
HETATM 10474 O  O   . HOH HA 8 .   ? 90.655 -41.164 4.106    1.00 73.25 ? 711 HOH A O   1 
HETATM 10475 O  O   . HOH HA 8 .   ? 80.418 -28.851 4.930    1.00 37.73 ? 712 HOH A O   1 
HETATM 10476 O  O   . HOH HA 8 .   ? 52.917 -41.721 40.179   1.00 52.01 ? 713 HOH A O   1 
HETATM 10477 O  O   . HOH HA 8 .   ? 65.378 -49.458 -6.815   1.00 41.44 ? 714 HOH A O   1 
HETATM 10478 O  O   . HOH HA 8 .   ? 86.765 -35.390 24.562   1.00 41.23 ? 715 HOH A O   1 
HETATM 10479 O  O   . HOH HA 8 .   ? 77.491 -23.809 29.669   1.00 48.84 ? 716 HOH A O   1 
HETATM 10480 O  O   . HOH HA 8 .   ? 50.259 -19.938 15.741   1.00 46.29 ? 717 HOH A O   1 
HETATM 10481 O  O   . HOH HA 8 .   ? 53.174 -55.421 30.638   1.00 45.43 ? 718 HOH A O   1 
HETATM 10482 O  O   . HOH HA 8 .   ? 55.217 -60.882 7.113    1.00 52.54 ? 719 HOH A O   1 
HETATM 10483 O  O   . HOH HA 8 .   ? 71.619 -39.594 34.945   1.00 40.70 ? 720 HOH A O   1 
HETATM 10484 O  O   . HOH IA 8 .   ? 26.740 -30.346 -54.742  1.00 17.19 ? 501 HOH B O   1 
HETATM 10485 O  O   . HOH IA 8 .   ? 26.305 -36.719 -40.105  1.00 12.93 ? 502 HOH B O   1 
HETATM 10486 O  O   . HOH IA 8 .   ? 21.749 -45.296 -58.869  1.00 17.22 ? 503 HOH B O   1 
HETATM 10487 O  O   . HOH IA 8 .   ? 37.590 -29.439 -48.381  1.00 16.11 ? 504 HOH B O   1 
HETATM 10488 O  O   . HOH IA 8 .   ? 30.090 -35.400 -54.710  1.00 14.87 ? 505 HOH B O   1 
HETATM 10489 O  O   . HOH IA 8 .   ? 15.663 -39.866 -43.895  1.00 18.16 ? 506 HOH B O   1 
HETATM 10490 O  O   . HOH IA 8 .   ? 14.578 -48.576 -48.027  1.00 17.51 ? 507 HOH B O   1 
HETATM 10491 O  O   . HOH IA 8 .   ? 14.483 -47.427 -58.394  1.00 18.90 ? 508 HOH B O   1 
HETATM 10492 O  O   . HOH IA 8 .   ? 23.623 -23.745 -54.364  1.00 17.18 ? 509 HOH B O   1 
HETATM 10493 O  O   . HOH IA 8 .   ? 12.460 -41.428 -38.682  1.00 18.47 ? 510 HOH B O   1 
HETATM 10494 O  O   . HOH IA 8 .   ? 25.967 -38.850 -38.579  1.00 19.37 ? 511 HOH B O   1 
HETATM 10495 O  O   . HOH IA 8 .   ? 15.546 -38.655 -39.812  1.00 18.92 ? 512 HOH B O   1 
HETATM 10496 O  O   . HOH IA 8 .   ? 29.419 -39.307 -60.563  1.00 17.77 ? 513 HOH B O   1 
HETATM 10497 O  O   . HOH IA 8 .   ? 21.864 -48.009 -58.214  1.00 18.40 ? 514 HOH B O   1 
HETATM 10498 O  O   . HOH IA 8 .   ? 28.284 -30.062 -57.009  1.00 21.67 ? 515 HOH B O   1 
HETATM 10499 O  O   . HOH IA 8 .   ? 14.591 -40.369 -37.812  1.00 20.31 ? 516 HOH B O   1 
HETATM 10500 O  O   . HOH IA 8 .   ? 18.843 -20.995 -72.439  1.00 17.02 ? 517 HOH B O   1 
HETATM 10501 O  O   . HOH IA 8 .   ? 36.610 -35.569 -51.842  1.00 13.81 ? 518 HOH B O   1 
HETATM 10502 O  O   . HOH IA 8 .   ? 11.964 -42.623 -48.541  1.00 24.71 ? 519 HOH B O   1 
HETATM 10503 O  O   . HOH IA 8 .   ? 37.386 -42.487 -48.541  1.00 21.08 ? 520 HOH B O   1 
HETATM 10504 O  O   . HOH IA 8 .   ? 16.595 -51.022 -65.916  1.00 23.94 ? 521 HOH B O   1 
HETATM 10505 O  O   . HOH IA 8 .   ? 14.522 -53.722 -65.055  1.00 28.11 ? 522 HOH B O   1 
HETATM 10506 O  O   . HOH IA 8 .   ? 26.187 -28.846 -58.551  1.00 26.00 ? 523 HOH B O   1 
HETATM 10507 O  O   . HOH IA 8 .   ? 10.619 -28.569 -41.896  1.00 22.69 ? 524 HOH B O   1 
HETATM 10508 O  O   . HOH IA 8 .   ? 11.353 -33.295 -41.284  1.00 23.54 ? 525 HOH B O   1 
HETATM 10509 O  O   . HOH IA 8 .   ? 19.823 -21.517 -60.001  1.00 25.39 ? 526 HOH B O   1 
HETATM 10510 O  O   . HOH IA 8 .   ? 20.044 -56.736 -46.480  1.00 20.32 ? 527 HOH B O   1 
HETATM 10511 O  O   . HOH IA 8 .   ? 10.689 -50.717 -46.578  1.00 26.63 ? 528 HOH B O   1 
HETATM 10512 O  O   . HOH IA 8 .   ? 19.114 -37.168 -63.183  1.00 22.69 ? 529 HOH B O   1 
HETATM 10513 O  O   . HOH IA 8 .   ? 36.551 -27.446 -41.567  1.00 22.84 ? 530 HOH B O   1 
HETATM 10514 O  O   . HOH IA 8 .   ? 28.129 -56.519 -67.119  1.00 25.61 ? 531 HOH B O   1 
HETATM 10515 O  O   . HOH IA 8 .   ? 43.491 -31.097 -45.447  1.00 21.95 ? 532 HOH B O   1 
HETATM 10516 O  O   . HOH IA 8 .   ? 19.420 -34.304 -66.893  1.00 19.66 ? 533 HOH B O   1 
HETATM 10517 O  O   . HOH IA 8 .   ? 19.250 -39.819 -63.292  1.00 22.12 ? 534 HOH B O   1 
HETATM 10518 O  O   . HOH IA 8 .   ? 22.348 -46.240 -28.536  1.00 22.73 ? 535 HOH B O   1 
HETATM 10519 O  O   . HOH IA 8 .   ? 34.570 -47.093 -68.302  1.00 22.47 ? 536 HOH B O   1 
HETATM 10520 O  O   . HOH IA 8 .   ? 34.777 -31.422 -34.719  1.00 21.45 ? 537 HOH B O   1 
HETATM 10521 O  O   . HOH IA 8 .   ? 12.738 -53.923 -56.150  1.00 28.41 ? 538 HOH B O   1 
HETATM 10522 O  O   . HOH IA 8 .   ? 43.159 -30.295 -60.048  1.00 26.45 ? 539 HOH B O   1 
HETATM 10523 O  O   . HOH IA 8 .   ? 20.839 -36.075 -65.279  1.00 21.72 ? 540 HOH B O   1 
HETATM 10524 O  O   . HOH IA 8 .   ? 17.096 -32.085 -60.948  1.00 21.23 ? 541 HOH B O   1 
HETATM 10525 O  O   . HOH IA 8 .   ? 38.008 -34.300 -53.932  1.00 29.10 ? 542 HOH B O   1 
HETATM 10526 O  O   . HOH IA 8 .   ? 41.641 -30.166 -43.682  1.00 22.32 ? 543 HOH B O   1 
HETATM 10527 O  O   . HOH IA 8 .   ? 18.547 -21.417 -44.562  1.00 30.22 ? 544 HOH B O   1 
HETATM 10528 O  O   . HOH IA 8 .   ? 39.217 -46.815 -64.216  1.00 26.53 ? 545 HOH B O   1 
HETATM 10529 O  O   . HOH IA 8 .   ? 42.634 -41.926 -38.564  1.00 29.02 ? 546 HOH B O   1 
HETATM 10530 O  O   . HOH IA 8 .   ? 16.588 -43.551 -64.448  1.00 24.85 ? 547 HOH B O   1 
HETATM 10531 O  O   . HOH IA 8 .   ? 36.133 -49.229 -68.979  1.00 29.53 ? 548 HOH B O   1 
HETATM 10532 O  O   . HOH IA 8 .   ? 24.739 -24.575 -68.994  1.00 27.28 ? 549 HOH B O   1 
HETATM 10533 O  O   . HOH IA 8 .   ? 31.519 -19.878 -40.602  1.00 29.26 ? 550 HOH B O   1 
HETATM 10534 O  O   . HOH IA 8 .   ? 31.388 -56.664 -66.371  1.00 34.80 ? 551 HOH B O   1 
HETATM 10535 O  O   . HOH IA 8 .   ? 17.213 -35.390 -63.877  1.00 30.23 ? 552 HOH B O   1 
HETATM 10536 O  O   . HOH IA 8 .   ? 24.526 -51.141 -69.249  1.00 29.83 ? 553 HOH B O   1 
HETATM 10537 O  O   . HOH IA 8 .   ? 38.551 -55.083 -50.755  1.00 27.16 ? 554 HOH B O   1 
HETATM 10538 O  O   . HOH IA 8 .   ? 13.329 -25.453 -57.699  1.00 31.16 ? 555 HOH B O   1 
HETATM 10539 O  O   . HOH IA 8 .   ? 33.434 -29.024 -62.719  1.00 23.34 ? 556 HOH B O   1 
HETATM 10540 O  O   . HOH IA 8 .   ? 21.816 -49.957 -69.734  1.00 36.07 ? 557 HOH B O   1 
HETATM 10541 O  O   . HOH IA 8 .   ? 11.775 -20.884 -69.881  1.00 28.64 ? 558 HOH B O   1 
HETATM 10542 O  O   . HOH IA 8 .   ? 13.371 -41.701 -51.199  1.00 26.52 ? 559 HOH B O   1 
HETATM 10543 O  O   . HOH IA 8 .   ? 22.137 -27.159 -30.289  1.00 30.72 ? 560 HOH B O   1 
HETATM 10544 O  O   . HOH IA 8 .   ? 19.553 -22.350 -49.346  1.00 27.17 ? 561 HOH B O   1 
HETATM 10545 O  O   . HOH IA 8 .   ? 37.757 -44.234 -46.563  1.00 31.13 ? 562 HOH B O   1 
HETATM 10546 O  O   . HOH IA 8 .   ? 24.327 -18.436 -64.324  1.00 38.29 ? 563 HOH B O   1 
HETATM 10547 O  O   . HOH IA 8 .   ? 10.365 -33.200 -31.653  1.00 33.83 ? 564 HOH B O   1 
HETATM 10548 O  O   . HOH IA 8 .   ? 16.691 -24.278 -54.398  1.00 32.18 ? 565 HOH B O   1 
HETATM 10549 O  O   . HOH IA 8 .   ? 16.053 -53.563 -29.913  1.00 39.62 ? 566 HOH B O   1 
HETATM 10550 O  O   . HOH IA 8 .   ? 39.857 -42.983 -49.454  1.00 26.16 ? 567 HOH B O   1 
HETATM 10551 O  O   . HOH IA 8 .   ? 27.936 -27.035 -64.033  1.00 37.78 ? 568 HOH B O   1 
HETATM 10552 O  O   . HOH IA 8 .   ? 42.524 -42.672 -41.826  1.00 37.56 ? 569 HOH B O   1 
HETATM 10553 O  O   . HOH IA 8 .   ? 21.217 -56.023 -63.693  1.00 31.73 ? 570 HOH B O   1 
HETATM 10554 O  O   . HOH IA 8 .   ? 35.685 -19.029 -53.927  1.00 25.42 ? 571 HOH B O   1 
HETATM 10555 O  O   . HOH IA 8 .   ? 7.268  -31.724 -36.627  1.00 31.65 ? 572 HOH B O   1 
HETATM 10556 O  O   . HOH IA 8 .   ? 22.418 -41.295 -47.127  1.00 14.63 ? 573 HOH B O   1 
HETATM 10557 O  O   . HOH IA 8 .   ? 45.965 -39.333 -49.849  1.00 36.85 ? 574 HOH B O   1 
HETATM 10558 O  O   . HOH IA 8 .   ? 20.883 -47.489 -71.087  1.00 42.54 ? 575 HOH B O   1 
HETATM 10559 O  O   . HOH IA 8 .   ? 26.530 -20.625 -33.751  1.00 29.22 ? 576 HOH B O   1 
HETATM 10560 O  O   . HOH IA 8 .   ? 15.152 -44.291 -66.895  1.00 35.05 ? 577 HOH B O   1 
HETATM 10561 O  O   . HOH IA 8 .   ? 45.475 -32.051 -44.316  1.00 33.87 ? 578 HOH B O   1 
HETATM 10562 O  O   . HOH IA 8 .   ? 31.664 -24.806 -62.404  1.00 34.37 ? 579 HOH B O   1 
HETATM 10563 O  O   . HOH IA 8 .   ? 21.148 -52.361 -29.511  1.00 31.40 ? 580 HOH B O   1 
HETATM 10564 O  O   . HOH IA 8 .   ? 29.303 -53.735 -39.778  1.00 27.58 ? 581 HOH B O   1 
HETATM 10565 O  O   . HOH IA 8 .   ? 42.593 -56.052 -57.991  1.00 34.90 ? 582 HOH B O   1 
HETATM 10566 O  O   . HOH IA 8 .   ? 22.254 -18.291 -70.918  1.00 33.44 ? 583 HOH B O   1 
HETATM 10567 O  O   . HOH IA 8 .   ? 25.859 -17.658 -43.107  1.00 32.42 ? 584 HOH B O   1 
HETATM 10568 O  O   . HOH IA 8 .   ? 33.141 -29.097 -33.737  1.00 28.84 ? 585 HOH B O   1 
HETATM 10569 O  O   . HOH IA 8 .   ? 10.675 -42.025 -28.926  1.00 35.42 ? 586 HOH B O   1 
HETATM 10570 O  O   . HOH IA 8 .   ? 7.813  -49.393 -54.802  1.00 34.75 ? 587 HOH B O   1 
HETATM 10571 O  O   . HOH IA 8 .   ? 5.633  -29.372 -41.885  1.00 33.56 ? 588 HOH B O   1 
HETATM 10572 O  O   . HOH IA 8 .   ? 38.961 -36.183 -67.020  1.00 24.77 ? 589 HOH B O   1 
HETATM 10573 O  O   . HOH IA 8 .   ? 37.168 -37.700 -36.876  1.00 36.97 ? 590 HOH B O   1 
HETATM 10574 O  O   . HOH IA 8 .   ? 40.090 -41.097 -53.367  1.00 28.60 ? 591 HOH B O   1 
HETATM 10575 O  O   . HOH IA 8 .   ? 36.919 -23.482 -59.185  1.00 36.64 ? 592 HOH B O   1 
HETATM 10576 O  O   . HOH IA 8 .   ? 28.629 -18.609 -63.113  1.00 45.89 ? 593 HOH B O   1 
HETATM 10577 O  O   . HOH IA 8 .   ? 18.759 -36.473 -69.052  1.00 26.15 ? 594 HOH B O   1 
HETATM 10578 O  O   . HOH IA 8 .   ? 40.645 -25.935 -55.562  1.00 39.14 ? 595 HOH B O   1 
HETATM 10579 O  O   . HOH IA 8 .   ? 33.075 -46.920 -70.628  1.00 29.27 ? 596 HOH B O   1 
HETATM 10580 O  O   . HOH IA 8 .   ? 30.040 -58.799 -47.296  1.00 29.40 ? 597 HOH B O   1 
HETATM 10581 O  O   . HOH IA 8 .   ? 41.909 -27.379 -43.437  1.00 39.77 ? 598 HOH B O   1 
HETATM 10582 O  O   . HOH IA 8 .   ? 29.462 -49.259 -36.473  1.00 42.31 ? 599 HOH B O   1 
HETATM 10583 O  O   . HOH IA 8 .   ? 20.418 -15.456 -54.892  1.00 51.50 ? 600 HOH B O   1 
HETATM 10584 O  O   . HOH IA 8 .   ? 13.629 -38.768 -53.213  1.00 28.52 ? 601 HOH B O   1 
HETATM 10585 O  O   . HOH IA 8 .   ? 24.890 -16.123 -62.166  1.00 42.14 ? 602 HOH B O   1 
HETATM 10586 O  O   . HOH IA 8 .   ? 25.331 -21.150 -64.896  1.00 41.04 ? 603 HOH B O   1 
HETATM 10587 O  O   . HOH IA 8 .   ? 18.570 -59.041 -46.477  1.00 38.94 ? 604 HOH B O   1 
HETATM 10588 O  O   . HOH IA 8 .   ? 33.776 -34.756 -29.181  1.00 40.75 ? 605 HOH B O   1 
HETATM 10589 O  O   . HOH IA 8 .   ? 16.086 -24.769 -39.702  1.00 39.10 ? 606 HOH B O   1 
HETATM 10590 O  O   . HOH IA 8 .   ? 26.303 -30.861 -28.893  1.00 45.70 ? 607 HOH B O   1 
HETATM 10591 O  O   . HOH IA 8 .   ? 19.120 -19.902 -57.890  1.00 34.20 ? 608 HOH B O   1 
HETATM 10592 O  O   . HOH IA 8 .   ? 33.898 -16.174 -48.012  1.00 37.75 ? 609 HOH B O   1 
HETATM 10593 O  O   . HOH IA 8 .   ? 31.496 -23.154 -60.672  1.00 38.04 ? 610 HOH B O   1 
HETATM 10594 O  O   . HOH IA 8 .   ? 36.974 -54.928 -57.503  1.00 36.55 ? 611 HOH B O   1 
HETATM 10595 O  O   . HOH IA 8 .   ? 31.353 -20.764 -34.220  1.00 39.32 ? 612 HOH B O   1 
HETATM 10596 O  O   . HOH IA 8 .   ? 33.390 -20.223 -42.694  1.00 33.74 ? 613 HOH B O   1 
HETATM 10597 O  O   . HOH IA 8 .   ? 8.049  -41.012 -46.746  1.00 27.89 ? 614 HOH B O   1 
HETATM 10598 O  O   . HOH IA 8 .   ? 14.335 -55.715 -36.819  1.00 35.71 ? 615 HOH B O   1 
HETATM 10599 O  O   . HOH IA 8 .   ? 27.525 -14.794 -55.655  1.00 37.57 ? 616 HOH B O   1 
HETATM 10600 O  O   . HOH IA 8 .   ? 21.119 -40.811 -71.955  1.00 37.50 ? 617 HOH B O   1 
HETATM 10601 O  O   . HOH IA 8 .   ? 20.382 -40.385 -65.645  1.00 34.45 ? 618 HOH B O   1 
HETATM 10602 O  O   . HOH IA 8 .   ? 22.535 -41.059 -23.468  1.00 43.87 ? 619 HOH B O   1 
HETATM 10603 O  O   . HOH IA 8 .   ? 32.830 -46.160 -77.247  1.00 45.01 ? 620 HOH B O   1 
HETATM 10604 O  O   . HOH IA 8 .   ? 29.043 -34.235 -28.177  1.00 33.56 ? 621 HOH B O   1 
HETATM 10605 O  O   . HOH IA 8 .   ? 20.257 -60.527 -60.831  1.00 46.60 ? 622 HOH B O   1 
HETATM 10606 O  O   . HOH IA 8 .   ? 32.194 -57.995 -57.725  1.00 39.65 ? 623 HOH B O   1 
HETATM 10607 O  O   . HOH IA 8 .   ? 26.107 -35.045 -21.750  1.00 43.66 ? 624 HOH B O   1 
HETATM 10608 O  O   . HOH IA 8 .   ? 13.570 -50.584 -67.319  1.00 34.97 ? 625 HOH B O   1 
HETATM 10609 O  O   . HOH IA 8 .   ? 21.709 -14.278 -51.494  1.00 45.41 ? 626 HOH B O   1 
HETATM 10610 O  O   . HOH IA 8 .   ? 18.234 -23.914 -59.524  1.00 37.20 ? 627 HOH B O   1 
HETATM 10611 O  O   . HOH IA 8 .   ? 42.481 -43.572 -35.792  1.00 43.19 ? 628 HOH B O   1 
HETATM 10612 O  O   . HOH IA 8 .   ? 42.325 -40.343 -52.574  1.00 33.73 ? 629 HOH B O   1 
HETATM 10613 O  O   . HOH IA 8 .   ? 30.037 -56.673 -58.410  1.00 32.21 ? 630 HOH B O   1 
HETATM 10614 O  O   . HOH IA 8 .   ? 14.569 -23.859 -36.314  1.00 42.09 ? 631 HOH B O   1 
HETATM 10615 O  O   . HOH IA 8 .   ? 36.882 -17.505 -51.995  1.00 41.57 ? 632 HOH B O   1 
HETATM 10616 O  O   . HOH IA 8 .   ? 7.107  -46.360 -58.328  1.00 45.94 ? 633 HOH B O   1 
HETATM 10617 O  O   . HOH IA 8 .   ? 14.276 -29.040 -29.778  1.00 33.19 ? 634 HOH B O   1 
HETATM 10618 O  O   . HOH IA 8 .   ? 13.023 -40.187 -22.690  1.00 52.31 ? 635 HOH B O   1 
HETATM 10619 O  O   . HOH IA 8 .   ? 37.585 -51.463 -45.630  1.00 33.62 ? 636 HOH B O   1 
HETATM 10620 O  O   . HOH IA 8 .   ? 23.303 -20.540 -66.118  1.00 39.46 ? 637 HOH B O   1 
HETATM 10621 O  O   . HOH IA 8 .   ? 20.422 -25.832 -59.171  1.00 35.59 ? 638 HOH B O   1 
HETATM 10622 O  O   . HOH IA 8 .   ? 22.585 -44.226 -24.496  1.00 48.56 ? 639 HOH B O   1 
HETATM 10623 O  O   . HOH IA 8 .   ? 29.534 -33.298 -30.593  1.00 30.13 ? 640 HOH B O   1 
HETATM 10624 O  O   . HOH IA 8 .   ? 16.468 -41.375 -62.910  1.00 36.45 ? 641 HOH B O   1 
HETATM 10625 O  O   . HOH IA 8 .   ? 19.163 -42.169 -66.979  1.00 33.53 ? 642 HOH B O   1 
HETATM 10626 O  O   . HOH IA 8 .   ? 33.478 -25.403 -37.834  1.00 32.80 ? 643 HOH B O   1 
HETATM 10627 O  O   . HOH IA 8 .   ? 39.039 -25.462 -53.411  1.00 36.25 ? 644 HOH B O   1 
HETATM 10628 O  O   . HOH IA 8 .   ? 39.493 -49.416 -63.343  1.00 33.62 ? 645 HOH B O   1 
HETATM 10629 O  O   . HOH IA 8 .   ? 33.489 -44.537 -73.959  1.00 34.63 ? 646 HOH B O   1 
HETATM 10630 O  O   . HOH IA 8 .   ? 45.282 -28.934 -47.345  1.00 36.65 ? 647 HOH B O   1 
HETATM 10631 O  O   . HOH IA 8 .   ? 31.900 -15.694 -50.552  1.00 42.38 ? 648 HOH B O   1 
HETATM 10632 O  O   . HOH IA 8 .   ? 6.719  -42.028 -43.705  1.00 36.86 ? 649 HOH B O   1 
HETATM 10633 O  O   . HOH IA 8 .   ? 35.210 -58.956 -50.404  1.00 36.75 ? 650 HOH B O   1 
HETATM 10634 O  O   . HOH IA 8 .   ? 39.417 -39.774 -33.669  1.00 41.96 ? 651 HOH B O   1 
HETATM 10635 O  O   . HOH IA 8 .   ? 25.541 -48.797 -29.206  1.00 34.17 ? 652 HOH B O   1 
HETATM 10636 O  O   . HOH IA 8 .   ? 38.898 -46.133 -66.876  1.00 37.32 ? 653 HOH B O   1 
HETATM 10637 O  O   . HOH IA 8 .   ? 16.373 -25.431 -51.241  1.00 44.37 ? 654 HOH B O   1 
HETATM 10638 O  O   . HOH IA 8 .   ? 16.516 -23.110 -60.858  1.00 54.93 ? 655 HOH B O   1 
HETATM 10639 O  O   . HOH IA 8 .   ? 41.240 -37.520 -66.540  1.00 46.75 ? 656 HOH B O   1 
HETATM 10640 O  O   . HOH IA 8 .   ? 18.776 -58.073 -39.780  1.00 43.86 ? 657 HOH B O   1 
HETATM 10641 O  O   . HOH IA 8 .   ? 9.321  -38.836 -28.896  1.00 45.29 ? 658 HOH B O   1 
HETATM 10642 O  O   . HOH IA 8 .   ? 32.242 -30.913 -31.659  1.00 40.52 ? 659 HOH B O   1 
HETATM 10643 O  O   . HOH IA 8 .   ? 19.772 -59.379 -57.149  1.00 45.38 ? 660 HOH B O   1 
HETATM 10644 O  O   . HOH IA 8 .   ? 22.379 -62.491 -48.498  1.00 43.89 ? 661 HOH B O   1 
HETATM 10645 O  O   . HOH IA 8 .   ? 7.401  -47.034 -52.047  1.00 48.32 ? 662 HOH B O   1 
HETATM 10646 O  O   . HOH IA 8 .   ? 17.088 -56.143 -60.972  1.00 38.43 ? 663 HOH B O   1 
HETATM 10647 O  O   . HOH IA 8 .   ? 44.108 -26.153 -50.206  1.00 42.12 ? 664 HOH B O   1 
HETATM 10648 O  O   . HOH IA 8 .   ? 8.115  -50.930 -36.538  1.00 45.95 ? 665 HOH B O   1 
HETATM 10649 O  O   . HOH IA 8 .   ? 14.559 -20.338 -63.562  1.00 43.05 ? 666 HOH B O   1 
HETATM 10650 O  O   . HOH IA 8 .   ? 31.528 -44.049 -30.286  1.00 41.40 ? 667 HOH B O   1 
HETATM 10651 O  O   . HOH IA 8 .   ? 3.134  -25.338 -49.562  1.00 54.80 ? 668 HOH B O   1 
HETATM 10652 O  O   . HOH IA 8 .   ? 11.623 -55.848 -44.990  1.00 41.97 ? 669 HOH B O   1 
HETATM 10653 O  O   . HOH IA 8 .   ? 31.108 -18.326 -58.967  1.00 51.06 ? 670 HOH B O   1 
HETATM 10654 O  O   . HOH IA 8 .   ? 8.722  -41.416 -49.738  1.00 56.76 ? 671 HOH B O   1 
HETATM 10655 O  O   . HOH IA 8 .   ? 37.057 -38.282 -34.163  1.00 43.54 ? 672 HOH B O   1 
HETATM 10656 O  O   . HOH IA 8 .   ? 41.083 -45.508 -63.057  1.00 40.53 ? 673 HOH B O   1 
HETATM 10657 O  O   . HOH IA 8 .   ? 28.543 -24.324 -62.568  1.00 47.73 ? 674 HOH B O   1 
HETATM 10658 O  O   . HOH IA 8 .   ? 15.895 -27.860 -25.694  1.00 46.92 ? 675 HOH B O   1 
HETATM 10659 O  O   . HOH IA 8 .   ? 18.942 -33.713 -60.720  1.00 33.16 ? 676 HOH B O   1 
HETATM 10660 O  O   . HOH IA 8 .   ? 45.195 -33.000 -36.826  1.00 42.72 ? 677 HOH B O   1 
HETATM 10661 O  O   . HOH IA 8 .   ? 24.481 -22.953 -66.628  1.00 46.54 ? 678 HOH B O   1 
HETATM 10662 O  O   . HOH IA 8 .   ? 9.996  -50.729 -62.053  1.00 40.97 ? 679 HOH B O   1 
HETATM 10663 O  O   . HOH IA 8 .   ? 43.505 -40.564 -50.612  1.00 48.11 ? 680 HOH B O   1 
HETATM 10664 O  O   . HOH IA 8 .   ? 36.209 -52.657 -63.212  1.00 47.05 ? 681 HOH B O   1 
HETATM 10665 O  O   . HOH IA 8 .   ? 27.956 -15.408 -49.929  1.00 49.73 ? 682 HOH B O   1 
HETATM 10666 O  O   . HOH IA 8 .   ? 36.518 -59.163 -56.079  1.00 56.26 ? 683 HOH B O   1 
HETATM 10667 O  O   . HOH IA 8 .   ? 34.332 -26.855 -32.947  1.00 39.67 ? 684 HOH B O   1 
HETATM 10668 O  O   . HOH IA 8 .   ? 46.204 -35.109 -50.706  1.00 37.30 ? 685 HOH B O   1 
HETATM 10669 O  O   . HOH IA 8 .   ? 45.010 -34.795 -55.349  1.00 39.80 ? 686 HOH B O   1 
HETATM 10670 O  O   . HOH IA 8 .   ? 40.929 -24.631 -51.716  1.00 38.51 ? 687 HOH B O   1 
HETATM 10671 O  O   . HOH IA 8 .   ? 24.702 -19.404 -71.561  1.00 42.60 ? 688 HOH B O   1 
HETATM 10672 O  O   . HOH IA 8 .   ? 33.923 -55.091 -69.871  1.00 37.77 ? 689 HOH B O   1 
HETATM 10673 O  O   . HOH IA 8 .   ? 45.425 -41.727 -56.051  1.00 55.95 ? 690 HOH B O   1 
HETATM 10674 O  O   . HOH IA 8 .   ? 24.659 -24.395 -72.039  1.00 34.75 ? 691 HOH B O   1 
HETATM 10675 O  O   . HOH IA 8 .   ? 41.478 -28.026 -59.824  1.00 38.51 ? 692 HOH B O   1 
HETATM 10676 O  O   . HOH IA 8 .   ? 24.979 -59.081 -39.378  1.00 43.88 ? 693 HOH B O   1 
HETATM 10677 O  O   . HOH IA 8 .   ? 25.799 -28.819 -74.963  1.00 39.18 ? 694 HOH B O   1 
HETATM 10678 O  O   . HOH IA 8 .   ? 11.912 -53.461 -59.810  1.00 46.36 ? 695 HOH B O   1 
HETATM 10679 O  O   . HOH IA 8 .   ? 32.932 -20.492 -38.469  1.00 42.87 ? 696 HOH B O   1 
HETATM 10680 O  O   . HOH IA 8 .   ? 18.649 -19.090 -39.804  1.00 42.68 ? 697 HOH B O   1 
HETATM 10681 O  O   . HOH IA 8 .   ? 21.949 -17.487 -48.915  1.00 49.68 ? 698 HOH B O   1 
HETATM 10682 O  O   . HOH IA 8 .   ? 38.180 -42.830 -32.527  1.00 43.25 ? 699 HOH B O   1 
HETATM 10683 O  O   . HOH IA 8 .   ? 22.808 -58.333 -46.093  1.00 43.18 ? 700 HOH B O   1 
HETATM 10684 O  O   . HOH IA 8 .   ? 26.239 -26.934 -68.343  1.00 42.85 ? 701 HOH B O   1 
HETATM 10685 O  O   . HOH IA 8 .   ? 26.456 -56.098 -74.217  1.00 46.77 ? 702 HOH B O   1 
HETATM 10686 O  O   . HOH IA 8 .   ? 15.299 -46.019 -71.262  1.00 45.10 ? 703 HOH B O   1 
HETATM 10687 O  O   . HOH IA 8 .   ? 9.676  -38.045 -26.250  1.00 50.44 ? 704 HOH B O   1 
HETATM 10688 O  O   . HOH IA 8 .   ? 45.637 -29.880 -52.116  1.00 60.66 ? 705 HOH B O   1 
HETATM 10689 O  O   . HOH IA 8 .   ? 38.389 -21.762 -57.543  1.00 51.83 ? 706 HOH B O   1 
HETATM 10690 O  O   . HOH IA 8 .   ? 11.766 -43.518 -26.721  1.00 49.03 ? 707 HOH B O   1 
HETATM 10691 O  O   . HOH IA 8 .   ? 37.174 -18.626 -45.329  1.00 49.37 ? 708 HOH B O   1 
HETATM 10692 O  O   . HOH IA 8 .   ? 23.047 -57.270 -62.459  1.00 46.01 ? 709 HOH B O   1 
HETATM 10693 O  O   . HOH IA 8 .   ? 11.851 -18.933 -67.213  1.00 36.68 ? 710 HOH B O   1 
HETATM 10694 O  O   . HOH IA 8 .   ? 29.860 -54.192 -75.321  1.00 43.10 ? 711 HOH B O   1 
HETATM 10695 O  O   . HOH IA 8 .   ? 43.359 -49.667 -51.793  1.00 51.29 ? 712 HOH B O   1 
HETATM 10696 O  O   . HOH IA 8 .   ? 10.663 -42.412 -57.704  1.00 53.18 ? 713 HOH B O   1 
HETATM 10697 O  O   . HOH IA 8 .   ? 20.605 -52.078 -71.159  1.00 41.58 ? 714 HOH B O   1 
HETATM 10698 O  O   . HOH IA 8 .   ? 16.683 -56.886 -36.783  1.00 44.21 ? 715 HOH B O   1 
HETATM 10699 O  O   . HOH IA 8 .   ? 8.883  -35.495 -31.151  1.00 39.67 ? 716 HOH B O   1 
HETATM 10700 O  O   . HOH IA 8 .   ? 40.127 -31.795 -40.456  1.00 38.65 ? 717 HOH B O   1 
HETATM 10701 O  O   . HOH IA 8 .   ? 19.189 -37.392 -51.257  1.00 20.53 ? 718 HOH B O   1 
HETATM 10702 O  O   . HOH IA 8 .   ? 34.447 -37.706 -37.685  1.00 30.73 ? 719 HOH B O   1 
HETATM 10703 O  O   . HOH IA 8 .   ? 44.810 -35.843 -41.154  1.00 29.65 ? 720 HOH B O   1 
HETATM 10704 O  O   . HOH IA 8 .   ? 47.266 -36.369 -40.192  1.00 40.73 ? 721 HOH B O   1 
HETATM 10705 O  O   . HOH IA 8 .   ? 41.896 -32.251 -53.652  1.00 39.56 ? 722 HOH B O   1 
HETATM 10706 O  O   . HOH IA 8 .   ? 16.600 -60.990 -42.565  1.00 63.85 ? 723 HOH B O   1 
HETATM 10707 O  O   . HOH IA 8 .   ? 29.346 -19.709 -59.168  1.00 55.58 ? 724 HOH B O   1 
HETATM 10708 O  O   . HOH IA 8 .   ? 33.300 -17.726 -59.739  1.00 52.10 ? 725 HOH B O   1 
HETATM 10709 O  O   . HOH IA 8 .   ? 15.620 -59.784 -44.904  1.00 61.78 ? 726 HOH B O   1 
HETATM 10710 O  O   . HOH IA 8 .   ? 26.757 -17.658 -40.810  1.00 53.48 ? 727 HOH B O   1 
HETATM 10711 O  O   . HOH IA 8 .   ? 45.492 -37.605 -54.141  1.00 46.92 ? 728 HOH B O   1 
HETATM 10712 O  O   . HOH IA 8 .   ? 45.053 -37.962 -51.564  1.00 61.92 ? 729 HOH B O   1 
HETATM 10713 O  O   . HOH IA 8 .   ? 41.260 -30.055 -66.468  1.00 39.89 ? 730 HOH B O   1 
HETATM 10714 O  O   . HOH IA 8 .   ? 28.669 -58.348 -60.282  1.00 50.75 ? 731 HOH B O   1 
HETATM 10715 O  O   . HOH IA 8 .   ? 40.285 -53.761 -48.066  1.00 68.53 ? 732 HOH B O   1 
HETATM 10716 O  O   . HOH IA 8 .   ? 45.482 -38.286 -61.235  1.00 40.96 ? 733 HOH B O   1 
HETATM 10717 O  O   . HOH IA 8 .   ? 10.056 -40.762 -48.448  1.00 76.91 ? 734 HOH B O   1 
HETATM 10718 O  O   . HOH IA 8 .   ? 16.914 -59.301 -48.313  1.00 55.34 ? 735 HOH B O   1 
HETATM 10719 O  O   . HOH JA 8 .   ? 55.353 -40.605 -12.502  1.00 14.49 ? 501 HOH C O   1 
HETATM 10720 O  O   . HOH JA 8 .   ? 65.105 -32.387 -33.372  1.00 16.70 ? 502 HOH C O   1 
HETATM 10721 O  O   . HOH JA 8 .   ? 62.055 -41.910 -27.234  1.00 15.63 ? 503 HOH C O   1 
HETATM 10722 O  O   . HOH JA 8 .   ? 60.949 -42.996 -33.300  1.00 15.05 ? 504 HOH C O   1 
HETATM 10723 O  O   . HOH JA 8 .   ? 59.311 -44.973 -32.141  1.00 16.01 ? 505 HOH C O   1 
HETATM 10724 O  O   . HOH JA 8 .   ? 59.174 -34.090 -12.466  1.00 18.81 ? 506 HOH C O   1 
HETATM 10725 O  O   . HOH JA 8 .   ? 67.420 -32.499 -31.907  1.00 16.64 ? 507 HOH C O   1 
HETATM 10726 O  O   . HOH JA 8 .   ? 77.660 -22.798 -24.679  1.00 18.19 ? 508 HOH C O   1 
HETATM 10727 O  O   . HOH JA 8 .   ? 62.988 -42.515 -31.506  1.00 16.06 ? 509 HOH C O   1 
HETATM 10728 O  O   . HOH JA 8 .   ? 63.583 -23.697 -46.269  1.00 18.55 ? 510 HOH C O   1 
HETATM 10729 O  O   . HOH JA 8 .   ? 62.339 -34.857 -24.439  1.00 20.28 ? 511 HOH C O   1 
HETATM 10730 O  O   . HOH JA 8 .   ? 74.593 -32.964 -17.591  1.00 18.39 ? 512 HOH C O   1 
HETATM 10731 O  O   . HOH JA 8 .   ? 82.658 -42.238 0.067    1.00 18.13 ? 513 HOH C O   1 
HETATM 10732 O  O   . HOH JA 8 .   ? 75.224 -31.312 -15.472  1.00 22.03 ? 514 HOH C O   1 
HETATM 10733 O  O   . HOH JA 8 .   ? 70.544 -28.431 -17.549  1.00 18.50 ? 515 HOH C O   1 
HETATM 10734 O  O   . HOH JA 8 .   ? 73.824 -16.716 -21.954  1.00 22.50 ? 516 HOH C O   1 
HETATM 10735 O  O   . HOH JA 8 .   ? 53.626 -40.678 -22.721  1.00 17.03 ? 517 HOH C O   1 
HETATM 10736 O  O   . HOH JA 8 .   ? 67.033 -27.957 -11.560  1.00 19.60 ? 518 HOH C O   1 
HETATM 10737 O  O   . HOH JA 8 .   ? 67.094 -47.840 -29.963  1.00 23.90 ? 519 HOH C O   1 
HETATM 10738 O  O   . HOH JA 8 .   ? 56.346 -34.616 -42.812  1.00 21.53 ? 520 HOH C O   1 
HETATM 10739 O  O   . HOH JA 8 .   ? 80.030 -37.610 -18.127  1.00 24.44 ? 521 HOH C O   1 
HETATM 10740 O  O   . HOH JA 8 .   ? 47.061 -33.276 -24.304  1.00 21.65 ? 522 HOH C O   1 
HETATM 10741 O  O   . HOH JA 8 .   ? 56.527 -33.377 -12.883  1.00 23.59 ? 523 HOH C O   1 
HETATM 10742 O  O   . HOH JA 8 .   ? 74.187 -25.552 -38.048  1.00 22.17 ? 524 HOH C O   1 
HETATM 10743 O  O   . HOH JA 8 .   ? 58.766 -44.720 -22.253  1.00 17.03 ? 525 HOH C O   1 
HETATM 10744 O  O   . HOH JA 8 .   ? 81.027 -42.025 2.352    1.00 17.30 ? 526 HOH C O   1 
HETATM 10745 O  O   . HOH JA 8 .   ? 73.440 -38.991 -44.165  1.00 30.46 ? 527 HOH C O   1 
HETATM 10746 O  O   . HOH JA 8 .   ? 52.811 -37.229 -4.864   1.00 20.99 ? 528 HOH C O   1 
HETATM 10747 O  O   . HOH JA 8 .   ? 61.057 -20.767 -3.622   1.00 23.60 ? 529 HOH C O   1 
HETATM 10748 O  O   . HOH JA 8 .   ? 76.393 -33.298 -13.932  1.00 34.14 ? 530 HOH C O   1 
HETATM 10749 O  O   . HOH JA 8 .   ? 64.071 -37.643 -8.328   1.00 19.78 ? 531 HOH C O   1 
HETATM 10750 O  O   . HOH JA 8 .   ? 71.622 -42.621 -47.008  1.00 19.13 ? 532 HOH C O   1 
HETATM 10751 O  O   . HOH JA 8 .   ? 69.538 -38.757 -4.896   1.00 23.02 ? 533 HOH C O   1 
HETATM 10752 O  O   . HOH JA 8 .   ? 65.268 -19.885 -23.744  1.00 22.06 ? 534 HOH C O   1 
HETATM 10753 O  O   . HOH JA 8 .   ? 81.952 -41.593 -12.340  1.00 22.51 ? 535 HOH C O   1 
HETATM 10754 O  O   . HOH JA 8 .   ? 71.661 -22.176 -20.869  1.00 19.02 ? 536 HOH C O   1 
HETATM 10755 O  O   . HOH JA 8 .   ? 66.656 -38.406 -8.535   1.00 22.49 ? 537 HOH C O   1 
HETATM 10756 O  O   . HOH JA 8 .   ? 68.269 -37.045 -6.467   1.00 23.37 ? 538 HOH C O   1 
HETATM 10757 O  O   . HOH JA 8 .   ? 66.326 -49.268 -39.502  1.00 30.87 ? 539 HOH C O   1 
HETATM 10758 O  O   . HOH JA 8 .   ? 72.617 -19.235 -5.707   1.00 23.06 ? 540 HOH C O   1 
HETATM 10759 O  O   . HOH JA 8 .   ? 59.980 -39.224 -6.720   1.00 26.28 ? 541 HOH C O   1 
HETATM 10760 O  O   . HOH JA 8 .   ? 47.355 -23.022 -23.665  1.00 27.87 ? 542 HOH C O   1 
HETATM 10761 O  O   . HOH JA 8 .   ? 73.661 -17.647 -19.529  1.00 26.03 ? 543 HOH C O   1 
HETATM 10762 O  O   . HOH JA 8 .   ? 60.201 -43.562 -19.918  1.00 24.96 ? 544 HOH C O   1 
HETATM 10763 O  O   . HOH JA 8 .   ? 70.984 -41.742 -10.789  1.00 25.47 ? 545 HOH C O   1 
HETATM 10764 O  O   . HOH JA 8 .   ? 62.294 -16.403 -8.160   1.00 27.16 ? 546 HOH C O   1 
HETATM 10765 O  O   . HOH JA 8 .   ? 77.253 -16.817 -27.590  1.00 27.16 ? 547 HOH C O   1 
HETATM 10766 O  O   . HOH JA 8 .   ? 65.263 -17.424 -22.943  1.00 25.51 ? 548 HOH C O   1 
HETATM 10767 O  O   . HOH JA 8 .   ? 80.028 -42.039 -22.938  1.00 26.22 ? 549 HOH C O   1 
HETATM 10768 O  O   . HOH JA 8 .   ? 71.814 -19.181 -8.507   1.00 24.19 ? 550 HOH C O   1 
HETATM 10769 O  O   . HOH JA 8 .   ? 50.338 -44.334 -23.941  1.00 28.76 ? 551 HOH C O   1 
HETATM 10770 O  O   . HOH JA 8 .   ? 50.289 -24.859 -4.025   1.00 29.99 ? 552 HOH C O   1 
HETATM 10771 O  O   . HOH JA 8 .   ? 55.219 -31.248 -41.436  1.00 31.66 ? 553 HOH C O   1 
HETATM 10772 O  O   . HOH JA 8 .   ? 48.465 -40.639 -14.630  1.00 26.48 ? 554 HOH C O   1 
HETATM 10773 O  O   . HOH JA 8 .   ? 73.339 -21.154 -19.100  1.00 34.73 ? 555 HOH C O   1 
HETATM 10774 O  O   . HOH JA 8 .   ? 61.935 -37.028 -4.453   1.00 26.61 ? 556 HOH C O   1 
HETATM 10775 O  O   . HOH JA 8 .   ? 82.441 -22.476 -19.982  1.00 33.23 ? 557 HOH C O   1 
HETATM 10776 O  O   . HOH JA 8 .   ? 80.579 -43.337 -27.869  1.00 30.40 ? 558 HOH C O   1 
HETATM 10777 O  O   . HOH JA 8 .   ? 71.701 -49.644 -29.531  1.00 26.41 ? 559 HOH C O   1 
HETATM 10778 O  O   . HOH JA 8 .   ? 77.486 -18.789 -29.542  1.00 26.38 ? 560 HOH C O   1 
HETATM 10779 O  O   . HOH JA 8 .   ? 78.030 -26.291 -10.163  1.00 31.88 ? 561 HOH C O   1 
HETATM 10780 O  O   . HOH JA 8 .   ? 53.301 -15.386 -21.242  1.00 35.55 ? 562 HOH C O   1 
HETATM 10781 O  O   . HOH JA 8 .   ? 67.621 -38.563 -2.625   1.00 31.83 ? 563 HOH C O   1 
HETATM 10782 O  O   . HOH JA 8 .   ? 46.415 -41.982 -35.786  1.00 38.07 ? 564 HOH C O   1 
HETATM 10783 O  O   . HOH JA 8 .   ? 63.511 -22.312 1.941    1.00 30.85 ? 565 HOH C O   1 
HETATM 10784 O  O   . HOH JA 8 .   ? 46.063 -40.374 -33.413  1.00 25.78 ? 566 HOH C O   1 
HETATM 10785 O  O   . HOH JA 8 .   ? 43.886 -27.533 -15.104  1.00 31.84 ? 567 HOH C O   1 
HETATM 10786 O  O   . HOH JA 8 .   ? 79.853 -15.766 -26.251  1.00 42.49 ? 568 HOH C O   1 
HETATM 10787 O  O   . HOH JA 8 .   ? 57.882 -50.148 -26.807  1.00 30.33 ? 569 HOH C O   1 
HETATM 10788 O  O   . HOH JA 8 .   ? 62.940 -26.580 -43.028  1.00 28.64 ? 570 HOH C O   1 
HETATM 10789 O  O   . HOH JA 8 .   ? 78.054 -44.386 -17.889  1.00 33.22 ? 571 HOH C O   1 
HETATM 10790 O  O   . HOH JA 8 .   ? 67.882 -41.991 -52.152  1.00 33.95 ? 572 HOH C O   1 
HETATM 10791 O  O   . HOH JA 8 .   ? 81.037 -49.473 -2.350   1.00 29.33 ? 573 HOH C O   1 
HETATM 10792 O  O   . HOH JA 8 .   ? 46.216 -38.361 -14.860  1.00 32.05 ? 574 HOH C O   1 
HETATM 10793 O  O   . HOH JA 8 .   ? 49.519 -38.821 -5.761   1.00 32.38 ? 575 HOH C O   1 
HETATM 10794 O  O   . HOH JA 8 .   ? 60.671 -21.192 3.707    1.00 38.76 ? 576 HOH C O   1 
HETATM 10795 O  O   . HOH JA 8 .   ? 80.396 -35.750 -3.612   1.00 26.31 ? 577 HOH C O   1 
HETATM 10796 O  O   . HOH JA 8 .   ? 67.577 -34.213 -50.283  1.00 27.57 ? 578 HOH C O   1 
HETATM 10797 O  O   . HOH JA 8 .   ? 59.307 -40.420 -4.015   1.00 33.01 ? 579 HOH C O   1 
HETATM 10798 O  O   . HOH JA 8 .   ? 40.618 -29.227 -15.938  1.00 36.00 ? 580 HOH C O   1 
HETATM 10799 O  O   . HOH JA 8 .   ? 65.514 -42.640 -51.524  1.00 33.90 ? 581 HOH C O   1 
HETATM 10800 O  O   . HOH JA 8 .   ? 62.138 -19.336 -25.418  1.00 37.73 ? 582 HOH C O   1 
HETATM 10801 O  O   . HOH JA 8 .   ? 82.153 -20.648 -12.201  1.00 37.62 ? 583 HOH C O   1 
HETATM 10802 O  O   . HOH JA 8 .   ? 59.474 -49.062 -24.092  1.00 31.68 ? 584 HOH C O   1 
HETATM 10803 O  O   . HOH JA 8 .   ? 66.521 -38.461 -49.820  1.00 25.05 ? 585 HOH C O   1 
HETATM 10804 O  O   . HOH JA 8 .   ? 51.614 -25.531 -31.900  1.00 27.37 ? 586 HOH C O   1 
HETATM 10805 O  O   . HOH JA 8 .   ? 52.015 -46.858 -15.677  1.00 36.64 ? 587 HOH C O   1 
HETATM 10806 O  O   . HOH JA 8 .   ? 63.455 -43.617 -17.776  1.00 32.59 ? 588 HOH C O   1 
HETATM 10807 O  O   . HOH JA 8 .   ? 56.838 -23.797 -31.785  1.00 45.11 ? 589 HOH C O   1 
HETATM 10808 O  O   . HOH JA 8 .   ? 48.847 -31.786 -7.123   1.00 27.51 ? 590 HOH C O   1 
HETATM 10809 O  O   . HOH JA 8 .   ? 60.937 -22.505 -1.658   1.00 27.46 ? 591 HOH C O   1 
HETATM 10810 O  O   . HOH JA 8 .   ? 72.583 -14.657 -31.995  1.00 30.75 ? 592 HOH C O   1 
HETATM 10811 O  O   . HOH JA 8 .   ? 74.461 -38.831 -41.687  1.00 32.86 ? 593 HOH C O   1 
HETATM 10812 O  O   . HOH JA 8 .   ? 79.281 -44.685 -10.446  1.00 42.47 ? 594 HOH C O   1 
HETATM 10813 O  O   . HOH JA 8 .   ? 59.647 -15.789 -8.662   1.00 32.69 ? 595 HOH C O   1 
HETATM 10814 O  O   . HOH JA 8 .   ? 81.512 -29.307 -10.237  1.00 39.71 ? 596 HOH C O   1 
HETATM 10815 O  O   . HOH JA 8 .   ? 50.880 -19.815 -2.830   1.00 53.01 ? 597 HOH C O   1 
HETATM 10816 O  O   . HOH JA 8 .   ? 86.115 -37.596 -8.878   1.00 41.87 ? 598 HOH C O   1 
HETATM 10817 O  O   . HOH JA 8 .   ? 56.012 -17.833 -26.186  1.00 33.51 ? 599 HOH C O   1 
HETATM 10818 O  O   . HOH JA 8 .   ? 80.929 -41.948 -35.483  1.00 39.54 ? 600 HOH C O   1 
HETATM 10819 O  O   . HOH JA 8 .   ? 82.131 -36.017 -6.073   1.00 46.99 ? 601 HOH C O   1 
HETATM 10820 O  O   . HOH JA 8 .   ? 78.876 -24.868 -31.513  1.00 30.01 ? 602 HOH C O   1 
HETATM 10821 O  O   . HOH JA 8 .   ? 59.629 -18.580 -3.097   1.00 37.15 ? 603 HOH C O   1 
HETATM 10822 O  O   . HOH JA 8 .   ? 50.731 -21.866 -5.202   1.00 35.20 ? 604 HOH C O   1 
HETATM 10823 O  O   . HOH JA 8 .   ? 48.967 -46.583 -33.467  1.00 48.39 ? 605 HOH C O   1 
HETATM 10824 O  O   . HOH JA 8 .   ? 84.994 -31.322 -32.729  1.00 35.14 ? 606 HOH C O   1 
HETATM 10825 O  O   . HOH JA 8 .   ? 44.830 -35.111 -30.536  1.00 36.87 ? 607 HOH C O   1 
HETATM 10826 O  O   . HOH JA 8 .   ? 73.224 -40.711 -46.409  1.00 33.42 ? 608 HOH C O   1 
HETATM 10827 O  O   . HOH JA 8 .   ? 70.434 -21.309 -37.260  1.00 39.44 ? 609 HOH C O   1 
HETATM 10828 O  O   . HOH JA 8 .   ? 87.728 -26.904 -19.349  1.00 32.37 ? 610 HOH C O   1 
HETATM 10829 O  O   . HOH JA 8 .   ? 44.449 -21.050 -18.588  1.00 31.68 ? 611 HOH C O   1 
HETATM 10830 O  O   . HOH JA 8 .   ? 59.909 -46.035 -20.549  1.00 36.36 ? 612 HOH C O   1 
HETATM 10831 O  O   . HOH JA 8 .   ? 64.067 -36.177 -5.825   1.00 35.70 ? 613 HOH C O   1 
HETATM 10832 O  O   . HOH JA 8 .   ? 63.603 -15.411 -19.880  1.00 49.17 ? 614 HOH C O   1 
HETATM 10833 O  O   . HOH JA 8 .   ? 78.939 -17.138 -13.432  1.00 38.23 ? 615 HOH C O   1 
HETATM 10834 O  O   . HOH JA 8 .   ? 55.065 -25.427 -33.472  1.00 37.90 ? 616 HOH C O   1 
HETATM 10835 O  O   . HOH JA 8 .   ? 57.636 -46.829 -41.851  1.00 32.37 ? 617 HOH C O   1 
HETATM 10836 O  O   . HOH JA 8 .   ? 88.474 -37.513 -10.475  1.00 43.86 ? 618 HOH C O   1 
HETATM 10837 O  O   . HOH JA 8 .   ? 63.844 -49.959 -39.988  1.00 34.79 ? 619 HOH C O   1 
HETATM 10838 O  O   . HOH JA 8 .   ? 69.790 -39.527 -11.082  1.00 30.23 ? 620 HOH C O   1 
HETATM 10839 O  O   . HOH JA 8 .   ? 76.259 -46.807 -14.129  1.00 35.39 ? 621 HOH C O   1 
HETATM 10840 O  O   . HOH JA 8 .   ? 48.080 -45.634 -25.059  1.00 52.91 ? 622 HOH C O   1 
HETATM 10841 O  O   . HOH JA 8 .   ? 76.871 -44.943 -31.936  1.00 34.71 ? 623 HOH C O   1 
HETATM 10842 O  O   . HOH JA 8 .   ? 70.972 -39.051 -50.106  1.00 50.21 ? 624 HOH C O   1 
HETATM 10843 O  O   . HOH JA 8 .   ? 54.995 -27.787 -31.872  1.00 35.35 ? 625 HOH C O   1 
HETATM 10844 O  O   . HOH JA 8 .   ? 79.013 -32.544 -8.272   1.00 46.15 ? 626 HOH C O   1 
HETATM 10845 O  O   . HOH JA 8 .   ? 61.247 -49.132 -41.992  1.00 31.82 ? 627 HOH C O   1 
HETATM 10846 O  O   . HOH JA 8 .   ? 80.571 -19.205 -13.281  1.00 36.42 ? 628 HOH C O   1 
HETATM 10847 O  O   . HOH JA 8 .   ? 83.561 -38.212 -6.241   1.00 40.74 ? 629 HOH C O   1 
HETATM 10848 O  O   . HOH JA 8 .   ? 83.095 -42.525 -14.579  1.00 32.91 ? 630 HOH C O   1 
HETATM 10849 O  O   . HOH JA 8 .   ? 65.775 -15.416 -6.313   1.00 42.44 ? 631 HOH C O   1 
HETATM 10850 O  O   . HOH JA 8 .   ? 72.153 -34.353 -43.851  1.00 45.94 ? 632 HOH C O   1 
HETATM 10851 O  O   . HOH JA 8 .   ? 81.701 -20.312 -17.566  1.00 58.23 ? 633 HOH C O   1 
HETATM 10852 O  O   . HOH JA 8 .   ? 46.373 -28.187 -27.180  1.00 41.05 ? 634 HOH C O   1 
HETATM 10853 O  O   . HOH JA 8 .   ? 67.842 -40.657 -7.804   1.00 38.19 ? 635 HOH C O   1 
HETATM 10854 O  O   . HOH JA 8 .   ? 86.053 -39.527 -1.771   1.00 39.98 ? 636 HOH C O   1 
HETATM 10855 O  O   . HOH JA 8 .   ? 63.212 -16.810 -5.712   1.00 33.78 ? 637 HOH C O   1 
HETATM 10856 O  O   . HOH JA 8 .   ? 71.197 -46.662 -41.683  1.00 42.36 ? 638 HOH C O   1 
HETATM 10857 O  O   . HOH JA 8 .   ? 83.263 -24.304 -14.208  1.00 39.88 ? 639 HOH C O   1 
HETATM 10858 O  O   . HOH JA 8 .   ? 78.517 -44.595 -26.514  1.00 37.77 ? 640 HOH C O   1 
HETATM 10859 O  O   . HOH JA 8 .   ? 50.509 -30.154 -1.421   1.00 52.11 ? 641 HOH C O   1 
HETATM 10860 O  O   . HOH JA 8 .   ? 47.769 -42.011 -43.110  1.00 51.15 ? 642 HOH C O   1 
HETATM 10861 O  O   . HOH JA 8 .   ? 75.974 -33.633 2.141    1.00 36.32 ? 643 HOH C O   1 
HETATM 10862 O  O   . HOH JA 8 .   ? 59.709 -30.219 -43.360  1.00 35.79 ? 644 HOH C O   1 
HETATM 10863 O  O   . HOH JA 8 .   ? 61.694 -39.842 -8.336   1.00 38.77 ? 645 HOH C O   1 
HETATM 10864 O  O   . HOH JA 8 .   ? 78.347 -33.920 -4.121   1.00 40.26 ? 646 HOH C O   1 
HETATM 10865 O  O   . HOH JA 8 .   ? 84.677 -44.756 -10.396  1.00 53.32 ? 647 HOH C O   1 
HETATM 10866 O  O   . HOH JA 8 .   ? 57.969 -16.837 -27.109  1.00 46.78 ? 648 HOH C O   1 
HETATM 10867 O  O   . HOH JA 8 .   ? 59.667 -52.426 -26.670  1.00 44.64 ? 649 HOH C O   1 
HETATM 10868 O  O   . HOH JA 8 .   ? 51.617 -34.931 -2.213   1.00 43.91 ? 650 HOH C O   1 
HETATM 10869 O  O   . HOH JA 8 .   ? 73.227 -34.061 -41.442  1.00 50.06 ? 651 HOH C O   1 
HETATM 10870 O  O   . HOH JA 8 .   ? 63.957 -14.612 -9.335   1.00 41.56 ? 652 HOH C O   1 
HETATM 10871 O  O   . HOH JA 8 .   ? 50.344 -47.945 -26.790  1.00 38.72 ? 653 HOH C O   1 
HETATM 10872 O  O   . HOH JA 8 .   ? 76.869 -44.139 -20.646  1.00 41.55 ? 654 HOH C O   1 
HETATM 10873 O  O   . HOH JA 8 .   ? 70.289 -29.947 -41.909  1.00 42.79 ? 655 HOH C O   1 
HETATM 10874 O  O   . HOH JA 8 .   ? 49.064 -18.045 -21.012  1.00 40.25 ? 656 HOH C O   1 
HETATM 10875 O  O   . HOH JA 8 .   ? 58.839 -26.557 -38.503  1.00 36.49 ? 657 HOH C O   1 
HETATM 10876 O  O   . HOH JA 8 .   ? 65.081 -54.546 -39.402  1.00 41.07 ? 658 HOH C O   1 
HETATM 10877 O  O   . HOH JA 8 .   ? 43.508 -30.718 -14.626  1.00 41.59 ? 659 HOH