data_4KEU
# 
_entry.id   4KEU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4KEU         
RCSB  RCSB079249   
WWPDB D_1000079249 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2VC5 'Wild type SsoPox'                               unspecified 
PDB 2VC7 'Wild type SsoPox in complex with lactone mimic' unspecified 
PDB 3UF9 'Wild type SsoPox in complex with fensulfothion' unspecified 
PDB 4KER 'SsoPox W263V mutant'                            unspecified 
PDB 4KES 'SsoPox W263T mutant'                            unspecified 
PDB 4KET 'SsoPox W263I mutant'                            unspecified 
PDB 4KEV 'SsoPox W263L mutant'                            unspecified 
PDB 4KEZ 'SsoPox W263F mutant'                            unspecified 
PDB 4KF1 'SsoPox W263I in complex with C10HTL'            unspecified 
# 
_pdbx_database_status.entry_id                        4KEU 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-04-26 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gotthard, G.'  1 
'Hiblot, J.'    2 
'Chabriere, E.' 3 
'Elias, M.'     4 
# 
_citation.id                        primary 
_citation.title                     
'Differential Active Site Loop Conformations Mediate Promiscuous Activities in the Lactonase SsoPox.' 
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            8 
_citation.page_first                e75272 
_citation.page_last                 e75272 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24086491 
_citation.pdbx_database_id_DOI      10.1371/journal.pone.0075272 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hiblot, J.'    1 
primary 'Gotthard, G.'  2 
primary 'Elias, M.'     3 
primary 'Chabriere, E.' 4 
# 
_cell.length_a           86.820 
_cell.length_b           103.880 
_cell.length_c           151.610 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4KEU 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         4KEU 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Aryldialkylphosphatase 35602.891 4   3.1.8.1 W263M ? ? 
2 non-polymer syn 'FE (II) ION'          55.845    4   ?       ?     ? ? 
3 non-polymer syn 'COBALT (II) ION'      58.933    4   ?       ?     ? ? 
4 non-polymer syn 1,2-ETHANEDIOL         62.068    5   ?       ?     ? ? 
5 non-polymer syn GLYCEROL               92.094    6   ?       ?     ? ? 
6 water       nat water                  18.015    332 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Paraoxonase, SsoPox, Phosphotriesterase-like lactonase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MRIPLVGKDSIESKDIGFTLIHEHLRVFSEAVRQQWPHLYNEDEEFRNAVNEVKRAMQFGVKTIVDPTVMGLGRDIRFME
KVVKATGINLVAGTGIYIYIDLPFYFLNRSIDEIADLFIHDIKEGIQGTLNKAGFV(KCX)IAADEPGITKDVEKVIRAA
AIANKETKVPIITHSNAHNNTGLEQQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLDRYGLDLFLPVDKRN
ETTLRLIKDGYSDKIMISHDYCCTIDMGTAKPEYKPKLAPRWSITLIFEDTIPFLKRNGVNEEVIATIFKENPKKFFS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MRIPLVGKDSIESKDIGFTLIHEHLRVFSEAVRQQWPHLYNEDEEFRNAVNEVKRAMQFGVKTIVDPTVMGLGRDIRFME
KVVKATGINLVAGTGIYIYIDLPFYFLNRSIDEIADLFIHDIKEGIQGTLNKAGFVKIAADEPGITKDVEKVIRAAAIAN
KETKVPIITHSNAHNNTGLEQQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLDRYGLDLFLPVDKRNETTL
RLIKDGYSDKIMISHDYCCTIDMGTAKPEYKPKLAPRWSITLIFEDTIPFLKRNGVNEEVIATIFKENPKKFFS
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   ILE n 
1 4   PRO n 
1 5   LEU n 
1 6   VAL n 
1 7   GLY n 
1 8   LYS n 
1 9   ASP n 
1 10  SER n 
1 11  ILE n 
1 12  GLU n 
1 13  SER n 
1 14  LYS n 
1 15  ASP n 
1 16  ILE n 
1 17  GLY n 
1 18  PHE n 
1 19  THR n 
1 20  LEU n 
1 21  ILE n 
1 22  HIS n 
1 23  GLU n 
1 24  HIS n 
1 25  LEU n 
1 26  ARG n 
1 27  VAL n 
1 28  PHE n 
1 29  SER n 
1 30  GLU n 
1 31  ALA n 
1 32  VAL n 
1 33  ARG n 
1 34  GLN n 
1 35  GLN n 
1 36  TRP n 
1 37  PRO n 
1 38  HIS n 
1 39  LEU n 
1 40  TYR n 
1 41  ASN n 
1 42  GLU n 
1 43  ASP n 
1 44  GLU n 
1 45  GLU n 
1 46  PHE n 
1 47  ARG n 
1 48  ASN n 
1 49  ALA n 
1 50  VAL n 
1 51  ASN n 
1 52  GLU n 
1 53  VAL n 
1 54  LYS n 
1 55  ARG n 
1 56  ALA n 
1 57  MET n 
1 58  GLN n 
1 59  PHE n 
1 60  GLY n 
1 61  VAL n 
1 62  LYS n 
1 63  THR n 
1 64  ILE n 
1 65  VAL n 
1 66  ASP n 
1 67  PRO n 
1 68  THR n 
1 69  VAL n 
1 70  MET n 
1 71  GLY n 
1 72  LEU n 
1 73  GLY n 
1 74  ARG n 
1 75  ASP n 
1 76  ILE n 
1 77  ARG n 
1 78  PHE n 
1 79  MET n 
1 80  GLU n 
1 81  LYS n 
1 82  VAL n 
1 83  VAL n 
1 84  LYS n 
1 85  ALA n 
1 86  THR n 
1 87  GLY n 
1 88  ILE n 
1 89  ASN n 
1 90  LEU n 
1 91  VAL n 
1 92  ALA n 
1 93  GLY n 
1 94  THR n 
1 95  GLY n 
1 96  ILE n 
1 97  TYR n 
1 98  ILE n 
1 99  TYR n 
1 100 ILE n 
1 101 ASP n 
1 102 LEU n 
1 103 PRO n 
1 104 PHE n 
1 105 TYR n 
1 106 PHE n 
1 107 LEU n 
1 108 ASN n 
1 109 ARG n 
1 110 SER n 
1 111 ILE n 
1 112 ASP n 
1 113 GLU n 
1 114 ILE n 
1 115 ALA n 
1 116 ASP n 
1 117 LEU n 
1 118 PHE n 
1 119 ILE n 
1 120 HIS n 
1 121 ASP n 
1 122 ILE n 
1 123 LYS n 
1 124 GLU n 
1 125 GLY n 
1 126 ILE n 
1 127 GLN n 
1 128 GLY n 
1 129 THR n 
1 130 LEU n 
1 131 ASN n 
1 132 LYS n 
1 133 ALA n 
1 134 GLY n 
1 135 PHE n 
1 136 VAL n 
1 137 KCX n 
1 138 ILE n 
1 139 ALA n 
1 140 ALA n 
1 141 ASP n 
1 142 GLU n 
1 143 PRO n 
1 144 GLY n 
1 145 ILE n 
1 146 THR n 
1 147 LYS n 
1 148 ASP n 
1 149 VAL n 
1 150 GLU n 
1 151 LYS n 
1 152 VAL n 
1 153 ILE n 
1 154 ARG n 
1 155 ALA n 
1 156 ALA n 
1 157 ALA n 
1 158 ILE n 
1 159 ALA n 
1 160 ASN n 
1 161 LYS n 
1 162 GLU n 
1 163 THR n 
1 164 LYS n 
1 165 VAL n 
1 166 PRO n 
1 167 ILE n 
1 168 ILE n 
1 169 THR n 
1 170 HIS n 
1 171 SER n 
1 172 ASN n 
1 173 ALA n 
1 174 HIS n 
1 175 ASN n 
1 176 ASN n 
1 177 THR n 
1 178 GLY n 
1 179 LEU n 
1 180 GLU n 
1 181 GLN n 
1 182 GLN n 
1 183 ARG n 
1 184 ILE n 
1 185 LEU n 
1 186 THR n 
1 187 GLU n 
1 188 GLU n 
1 189 GLY n 
1 190 VAL n 
1 191 ASP n 
1 192 PRO n 
1 193 GLY n 
1 194 LYS n 
1 195 ILE n 
1 196 LEU n 
1 197 ILE n 
1 198 GLY n 
1 199 HIS n 
1 200 LEU n 
1 201 GLY n 
1 202 ASP n 
1 203 THR n 
1 204 ASP n 
1 205 ASN n 
1 206 ILE n 
1 207 ASP n 
1 208 TYR n 
1 209 ILE n 
1 210 LYS n 
1 211 LYS n 
1 212 ILE n 
1 213 ALA n 
1 214 ASP n 
1 215 LYS n 
1 216 GLY n 
1 217 SER n 
1 218 PHE n 
1 219 ILE n 
1 220 GLY n 
1 221 LEU n 
1 222 ASP n 
1 223 ARG n 
1 224 TYR n 
1 225 GLY n 
1 226 LEU n 
1 227 ASP n 
1 228 LEU n 
1 229 PHE n 
1 230 LEU n 
1 231 PRO n 
1 232 VAL n 
1 233 ASP n 
1 234 LYS n 
1 235 ARG n 
1 236 ASN n 
1 237 GLU n 
1 238 THR n 
1 239 THR n 
1 240 LEU n 
1 241 ARG n 
1 242 LEU n 
1 243 ILE n 
1 244 LYS n 
1 245 ASP n 
1 246 GLY n 
1 247 TYR n 
1 248 SER n 
1 249 ASP n 
1 250 LYS n 
1 251 ILE n 
1 252 MET n 
1 253 ILE n 
1 254 SER n 
1 255 HIS n 
1 256 ASP n 
1 257 TYR n 
1 258 CYS n 
1 259 CYS n 
1 260 THR n 
1 261 ILE n 
1 262 ASP n 
1 263 MET n 
1 264 GLY n 
1 265 THR n 
1 266 ALA n 
1 267 LYS n 
1 268 PRO n 
1 269 GLU n 
1 270 TYR n 
1 271 LYS n 
1 272 PRO n 
1 273 LYS n 
1 274 LEU n 
1 275 ALA n 
1 276 PRO n 
1 277 ARG n 
1 278 TRP n 
1 279 SER n 
1 280 ILE n 
1 281 THR n 
1 282 LEU n 
1 283 ILE n 
1 284 PHE n 
1 285 GLU n 
1 286 ASP n 
1 287 THR n 
1 288 ILE n 
1 289 PRO n 
1 290 PHE n 
1 291 LEU n 
1 292 LYS n 
1 293 ARG n 
1 294 ASN n 
1 295 GLY n 
1 296 VAL n 
1 297 ASN n 
1 298 GLU n 
1 299 GLU n 
1 300 VAL n 
1 301 ILE n 
1 302 ALA n 
1 303 THR n 
1 304 ILE n 
1 305 PHE n 
1 306 LYS n 
1 307 GLU n 
1 308 ASN n 
1 309 PRO n 
1 310 LYS n 
1 311 LYS n 
1 312 PHE n 
1 313 PHE n 
1 314 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'php, php SSO2522, SSO2522' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sulfolobus solfataricus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2287 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PHP_SULSO 
_struct_ref.pdbx_db_accession          Q97VT7 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MRIPLVGKDSIESKDIGFTLIHEHLRVFSEAVRQQWPHLYNEDEEFRNAVNEVKRAMQFGVKTIVDPTVMGLGRDIRFME
KVVKATGINLVAGTGIYIYIDLPFYFLNRSIDEIADLFIHDIKEGIQGTLNKAGFVKIAADEPGITKDVEKVIRAAAIAN
KETKVPIITHSNAHNNTGLEQQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLDRYGLDLFLPVDKRNETTL
RLIKDGYSDKIMISHDYCCTIDWGTAKPEYKPKLAPRWSITLIFEDTIPFLKRNGVNEEVIATIFKENPKKFFS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4KEU A 1 ? 314 ? Q97VT7 1 ? 314 ? 1 314 
2 1 4KEU B 1 ? 314 ? Q97VT7 1 ? 314 ? 1 314 
3 1 4KEU C 1 ? 314 ? Q97VT7 1 ? 314 ? 1 314 
4 1 4KEU D 1 ? 314 ? Q97VT7 1 ? 314 ? 1 314 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4KEU MET A 263 ? UNP Q97VT7 TRP 263 'ENGINEERED MUTATION' 263 1 
2 4KEU MET B 263 ? UNP Q97VT7 TRP 263 'ENGINEERED MUTATION' 263 2 
3 4KEU MET C 263 ? UNP Q97VT7 TRP 263 'ENGINEERED MUTATION' 263 3 
4 4KEU MET D 263 ? UNP Q97VT7 TRP 263 'ENGINEERED MUTATION' 263 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                    ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ?                               'C4 H7 N O4'     133.103 
CO  non-polymer         . 'COBALT (II) ION'           ?                               'Co 2'           58.933  
CYS 'L-peptide linking' y CYSTEINE                    ?                               'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL              'ETHYLENE GLYCOL'               'C2 H6 O2'       62.068  
FE2 non-polymer         . 'FE (II) ION'               ?                               'Fe 2'           55.845  
GLN 'L-peptide linking' y GLUTAMINE                   ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                     ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                    'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE                   ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                       ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                  ?                               'C6 H13 N O2'    131.173 
KCX 'L-peptide linking' n 'LYSINE NZ-CARBOXYLIC ACID' ?                               'C7 H14 N2 O4'   190.197 
LEU 'L-peptide linking' y LEUCINE                     ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                      ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                  ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE               ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                     ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                      ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                   ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                    ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                      ?                               'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4KEU 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.40 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   48.76 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    '50 mM Tris-HCl, 23-25% PEG8000, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2011-05-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.99987 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_wavelength_list        0.99987 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
# 
_reflns.entry_id                     4KEU 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.2 
_reflns.d_resolution_low             49.14 
_reflns.number_all                   ? 
_reflns.number_obs                   70219 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 4KEU 
_refine.ls_d_res_high                            2.200 
_refine.ls_d_res_low                             49.14 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.91 
_refine.ls_number_reflns_obs                     70219 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1725 
_refine.ls_R_factor_R_work                       0.1702 
_refine.ls_wR_factor_R_work                      0.1593 
_refine.ls_R_factor_R_free                       0.2153 
_refine.ls_wR_factor_R_free                      0.1982 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3511 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               35.7085 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            3.7100 
_refine.aniso_B[2][2]                            -1.1300 
_refine.aniso_B[3][3]                            -2.5900 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9620 
_refine.correlation_coeff_Fo_to_Fc_free          0.9410 
_refine.overall_SU_R_Cruickshank_DPI             0.2502 
_refine.overall_SU_R_free                        0.1918 
_refine.pdbx_overall_ESU_R                       0.2500 
_refine.pdbx_overall_ESU_R_Free                  0.1920 
_refine.overall_SU_ML                            0.1340 
_refine.overall_SU_B                             11.0670 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8613 
_refine.B_iso_max                                124.940 
_refine.B_iso_min                                15.620 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10028 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         64 
_refine_hist.number_atoms_solvent             332 
_refine_hist.number_atoms_total               10424 
_refine_hist.d_res_high                       2.200 
_refine_hist.d_res_low                        49.14 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       10444 0.022  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    14056 0.674  1.971  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 1276  4.374  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 478   30.367 24.226 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 1900  11.958 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 66    13.162 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         1578  0.043  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   7774  0.002  0.021  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.200 
_refine_ls_shell.d_res_low                        2.257 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.79 
_refine_ls_shell.number_reflns_R_work             4584 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2160 
_refine_ls_shell.R_factor_R_free                  0.2700 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             245 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                4829 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4KEU 
_struct.title                     'Crystal structure of SsoPox W263M' 
_struct.pdbx_descriptor           'Aryldialkylphosphatase (E.C.3.1.8.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4KEU 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            '(beta/alpha)8-hydrolase, lactonase, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 3 ? 
G  N N 4 ? 
H  N N 4 ? 
I  N N 5 ? 
J  N N 5 ? 
K  N N 4 ? 
L  N N 2 ? 
M  N N 3 ? 
N  N N 5 ? 
O  N N 2 ? 
P  N N 3 ? 
Q  N N 5 ? 
R  N N 2 ? 
S  N N 3 ? 
T  N N 4 ? 
U  N N 4 ? 
V  N N 5 ? 
W  N N 5 ? 
X  N N 6 ? 
Y  N N 6 ? 
Z  N N 6 ? 
AA N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 12  ? ILE A 16  ? GLU A 12  ILE A 16  5 ? 5  
HELX_P HELX_P2  2  SER A 29  ? TRP A 36  ? SER A 29  TRP A 36  1 ? 8  
HELX_P HELX_P3  3  PRO A 37  ? TYR A 40  ? PRO A 37  TYR A 40  5 ? 4  
HELX_P HELX_P4  4  ASN A 41  ? PHE A 59  ? ASN A 41  PHE A 59  1 ? 19 
HELX_P HELX_P5  5  ASP A 75  ? GLY A 87  ? ASP A 75  GLY A 87  1 ? 13 
HELX_P HELX_P6  6  PRO A 103 ? LEU A 107 ? PRO A 103 LEU A 107 5 ? 5  
HELX_P HELX_P7  7  SER A 110 ? GLU A 124 ? SER A 110 GLU A 124 1 ? 15 
HELX_P HELX_P8  8  THR A 146 ? LYS A 164 ? THR A 146 LYS A 164 1 ? 19 
HELX_P HELX_P9  9  ASN A 176 ? GLU A 188 ? ASN A 176 GLU A 188 1 ? 13 
HELX_P HELX_P10 10 ASP A 191 ? GLY A 193 ? ASP A 191 GLY A 193 5 ? 3  
HELX_P HELX_P11 11 HIS A 199 ? THR A 203 ? HIS A 199 THR A 203 5 ? 5  
HELX_P HELX_P12 12 ASN A 205 ? LYS A 215 ? ASN A 205 LYS A 215 1 ? 11 
HELX_P HELX_P13 13 PRO A 231 ? ASP A 245 ? PRO A 231 ASP A 245 1 ? 15 
HELX_P HELX_P14 14 MET A 263 ? GLU A 269 ? MET A 263 GLU A 269 5 ? 7  
HELX_P HELX_P15 15 TYR A 270 ? ALA A 275 ? TYR A 270 ALA A 275 1 ? 6  
HELX_P HELX_P16 16 THR A 281 ? ASP A 286 ? THR A 281 ASP A 286 1 ? 6  
HELX_P HELX_P17 17 ASP A 286 ? ASN A 294 ? ASP A 286 ASN A 294 1 ? 9  
HELX_P HELX_P18 18 ASN A 297 ? LYS A 306 ? ASN A 297 LYS A 306 1 ? 10 
HELX_P HELX_P19 19 LYS A 306 ? PHE A 313 ? LYS A 306 PHE A 313 1 ? 8  
HELX_P HELX_P20 20 GLU B 12  ? ILE B 16  ? GLU B 12  ILE B 16  5 ? 5  
HELX_P HELX_P21 21 SER B 29  ? TRP B 36  ? SER B 29  TRP B 36  1 ? 8  
HELX_P HELX_P22 22 PRO B 37  ? TYR B 40  ? PRO B 37  TYR B 40  5 ? 4  
HELX_P HELX_P23 23 ASN B 41  ? PHE B 59  ? ASN B 41  PHE B 59  1 ? 19 
HELX_P HELX_P24 24 ASP B 75  ? GLY B 87  ? ASP B 75  GLY B 87  1 ? 13 
HELX_P HELX_P25 25 PRO B 103 ? LEU B 107 ? PRO B 103 LEU B 107 5 ? 5  
HELX_P HELX_P26 26 SER B 110 ? GLU B 124 ? SER B 110 GLU B 124 1 ? 15 
HELX_P HELX_P27 27 THR B 146 ? LYS B 164 ? THR B 146 LYS B 164 1 ? 19 
HELX_P HELX_P28 28 ASN B 176 ? GLU B 188 ? ASN B 176 GLU B 188 1 ? 13 
HELX_P HELX_P29 29 ASP B 191 ? GLY B 193 ? ASP B 191 GLY B 193 5 ? 3  
HELX_P HELX_P30 30 HIS B 199 ? THR B 203 ? HIS B 199 THR B 203 5 ? 5  
HELX_P HELX_P31 31 ASN B 205 ? LYS B 215 ? ASN B 205 LYS B 215 1 ? 11 
HELX_P HELX_P32 32 PRO B 231 ? ASP B 245 ? PRO B 231 ASP B 245 1 ? 15 
HELX_P HELX_P33 33 GLY B 246 ? ASP B 249 ? GLY B 246 ASP B 249 5 ? 4  
HELX_P HELX_P34 34 ALA B 266 ? ALA B 275 ? ALA B 266 ALA B 275 1 ? 10 
HELX_P HELX_P35 35 THR B 281 ? ASP B 286 ? THR B 281 ASP B 286 1 ? 6  
HELX_P HELX_P36 36 ASP B 286 ? ASN B 294 ? ASP B 286 ASN B 294 1 ? 9  
HELX_P HELX_P37 37 ASN B 297 ? LYS B 306 ? ASN B 297 LYS B 306 1 ? 10 
HELX_P HELX_P38 38 LYS B 306 ? SER B 314 ? LYS B 306 SER B 314 1 ? 9  
HELX_P HELX_P39 39 GLU C 12  ? ILE C 16  ? GLU C 12  ILE C 16  5 ? 5  
HELX_P HELX_P40 40 SER C 29  ? TRP C 36  ? SER C 29  TRP C 36  1 ? 8  
HELX_P HELX_P41 41 PRO C 37  ? TYR C 40  ? PRO C 37  TYR C 40  5 ? 4  
HELX_P HELX_P42 42 ASN C 41  ? PHE C 59  ? ASN C 41  PHE C 59  1 ? 19 
HELX_P HELX_P43 43 ASP C 75  ? GLY C 87  ? ASP C 75  GLY C 87  1 ? 13 
HELX_P HELX_P44 44 PRO C 103 ? LEU C 107 ? PRO C 103 LEU C 107 5 ? 5  
HELX_P HELX_P45 45 SER C 110 ? GLU C 124 ? SER C 110 GLU C 124 1 ? 15 
HELX_P HELX_P46 46 THR C 146 ? LYS C 164 ? THR C 146 LYS C 164 1 ? 19 
HELX_P HELX_P47 47 ASN C 176 ? GLU C 188 ? ASN C 176 GLU C 188 1 ? 13 
HELX_P HELX_P48 48 ASP C 191 ? GLY C 193 ? ASP C 191 GLY C 193 5 ? 3  
HELX_P HELX_P49 49 HIS C 199 ? THR C 203 ? HIS C 199 THR C 203 5 ? 5  
HELX_P HELX_P50 50 ASN C 205 ? LYS C 215 ? ASN C 205 LYS C 215 1 ? 11 
HELX_P HELX_P51 51 PRO C 231 ? ASP C 245 ? PRO C 231 ASP C 245 1 ? 15 
HELX_P HELX_P52 52 TYR C 247 ? ASP C 249 ? TYR C 247 ASP C 249 5 ? 3  
HELX_P HELX_P53 53 MET C 263 ? GLU C 269 ? MET C 263 GLU C 269 5 ? 7  
HELX_P HELX_P54 54 TYR C 270 ? ALA C 275 ? TYR C 270 ALA C 275 1 ? 6  
HELX_P HELX_P55 55 THR C 281 ? ASP C 286 ? THR C 281 ASP C 286 1 ? 6  
HELX_P HELX_P56 56 ASP C 286 ? ARG C 293 ? ASP C 286 ARG C 293 1 ? 8  
HELX_P HELX_P57 57 ASN C 297 ? LYS C 306 ? ASN C 297 LYS C 306 1 ? 10 
HELX_P HELX_P58 58 LYS C 306 ? PHE C 313 ? LYS C 306 PHE C 313 1 ? 8  
HELX_P HELX_P59 59 GLU D 12  ? ILE D 16  ? GLU D 12  ILE D 16  5 ? 5  
HELX_P HELX_P60 60 SER D 29  ? TRP D 36  ? SER D 29  TRP D 36  1 ? 8  
HELX_P HELX_P61 61 PRO D 37  ? TYR D 40  ? PRO D 37  TYR D 40  5 ? 4  
HELX_P HELX_P62 62 ASN D 41  ? PHE D 59  ? ASN D 41  PHE D 59  1 ? 19 
HELX_P HELX_P63 63 ASP D 75  ? GLY D 87  ? ASP D 75  GLY D 87  1 ? 13 
HELX_P HELX_P64 64 PRO D 103 ? LEU D 107 ? PRO D 103 LEU D 107 5 ? 5  
HELX_P HELX_P65 65 SER D 110 ? GLU D 124 ? SER D 110 GLU D 124 1 ? 15 
HELX_P HELX_P66 66 THR D 146 ? LYS D 164 ? THR D 146 LYS D 164 1 ? 19 
HELX_P HELX_P67 67 ASN D 176 ? GLU D 188 ? ASN D 176 GLU D 188 1 ? 13 
HELX_P HELX_P68 68 ASP D 191 ? GLY D 193 ? ASP D 191 GLY D 193 5 ? 3  
HELX_P HELX_P69 69 HIS D 199 ? THR D 203 ? HIS D 199 THR D 203 5 ? 5  
HELX_P HELX_P70 70 ASN D 205 ? LYS D 215 ? ASN D 205 LYS D 215 1 ? 11 
HELX_P HELX_P71 71 PRO D 231 ? ASP D 245 ? PRO D 231 ASP D 245 1 ? 15 
HELX_P HELX_P72 72 TYR D 247 ? ASP D 249 ? TYR D 247 ASP D 249 5 ? 3  
HELX_P HELX_P73 73 LYS D 267 ? GLU D 269 ? LYS D 267 GLU D 269 5 ? 3  
HELX_P HELX_P74 74 TYR D 270 ? ALA D 275 ? TYR D 270 ALA D 275 1 ? 6  
HELX_P HELX_P75 75 THR D 281 ? ASP D 286 ? THR D 281 ASP D 286 1 ? 6  
HELX_P HELX_P76 76 ASP D 286 ? ARG D 293 ? ASP D 286 ARG D 293 1 ? 8  
HELX_P HELX_P77 77 ASN D 297 ? LYS D 306 ? ASN D 297 LYS D 306 1 ? 10 
HELX_P HELX_P78 78 LYS D 306 ? PHE D 313 ? LYS D 306 PHE D 313 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A VAL 136 C   ? ? ? 1_555 A  KCX 137 N  ? ? A VAL 136 A KCX 137 1_555 ? ? ? ? ? ? ? 1.305 ? 
covale2  covale ? ? A KCX 137 C   ? ? ? 1_555 A  ILE 138 N  ? ? A KCX 137 A ILE 138 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale3  covale ? ? B VAL 136 C   ? ? ? 1_555 B  KCX 137 N  ? ? B VAL 136 B KCX 137 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale4  covale ? ? B KCX 137 C   ? ? ? 1_555 B  ILE 138 N  ? ? B KCX 137 B ILE 138 1_555 ? ? ? ? ? ? ? 1.364 ? 
covale5  covale ? ? C VAL 136 C   ? ? ? 1_555 C  KCX 137 N  ? ? C VAL 136 C KCX 137 1_555 ? ? ? ? ? ? ? 1.347 ? 
covale6  covale ? ? C KCX 137 C   ? ? ? 1_555 C  ILE 138 N  ? ? C KCX 137 C ILE 138 1_555 ? ? ? ? ? ? ? 1.351 ? 
covale7  covale ? ? D VAL 136 C   ? ? ? 1_555 D  KCX 137 N  ? ? D VAL 136 D KCX 137 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale8  covale ? ? D KCX 137 C   ? ? ? 1_555 D  ILE 138 N  ? ? D KCX 137 D ILE 138 1_555 ? ? ? ? ? ? ? 1.317 ? 
metalc1  metalc ? ? D KCX 137 OQ2 ? ? ? 1_555 S  CO  .   CO ? ? D KCX 137 D CO  402 1_555 ? ? ? ? ? ? ? 1.812 ? 
metalc2  metalc ? ? B KCX 137 OQ1 ? ? ? 1_555 M  CO  .   CO ? ? B KCX 137 B CO  403 1_555 ? ? ? ? ? ? ? 1.823 ? 
metalc3  metalc ? ? C KCX 137 OQ1 ? ? ? 1_555 P  CO  .   CO ? ? C KCX 137 C CO  402 1_555 ? ? ? ? ? ? ? 1.844 ? 
metalc4  metalc ? ? A KCX 137 OQ2 ? ? ? 1_555 F  CO  .   CO ? ? A KCX 137 A CO  402 1_555 ? ? ? ? ? ? ? 1.869 ? 
metalc5  metalc ? ? A HIS 199 NE2 ? ? ? 1_555 F  CO  .   CO ? ? A HIS 199 A CO  402 1_555 ? ? ? ? ? ? ? 1.912 ? 
metalc6  metalc ? ? C HIS 170 ND1 ? ? ? 1_555 P  CO  .   CO ? ? C HIS 170 C CO  402 1_555 ? ? ? ? ? ? ? 1.916 ? 
metalc7  metalc ? ? C HIS 199 NE2 ? ? ? 1_555 P  CO  .   CO ? ? C HIS 199 C CO  402 1_555 ? ? ? ? ? ? ? 1.921 ? 
metalc8  metalc ? ? B HIS 199 NE2 ? ? ? 1_555 M  CO  .   CO ? ? B HIS 199 B CO  403 1_555 ? ? ? ? ? ? ? 1.925 ? 
metalc9  metalc ? ? B HIS 170 ND1 ? ? ? 1_555 M  CO  .   CO ? ? B HIS 170 B CO  403 1_555 ? ? ? ? ? ? ? 1.935 ? 
metalc10 metalc ? ? D HIS 199 NE2 ? ? ? 1_555 S  CO  .   CO ? ? D HIS 199 D CO  402 1_555 ? ? ? ? ? ? ? 1.950 ? 
metalc11 metalc ? ? A HIS 170 ND1 ? ? ? 1_555 F  CO  .   CO ? ? A HIS 170 A CO  402 1_555 ? ? ? ? ? ? ? 1.959 ? 
metalc12 metalc ? ? D HIS 170 ND1 ? ? ? 1_555 S  CO  .   CO ? ? D HIS 170 D CO  402 1_555 ? ? ? ? ? ? ? 1.960 ? 
metalc13 metalc ? ? P CO  .   CO  ? ? ? 1_555 Z  HOH .   O  ? ? C CO  402 C HOH 573 1_555 ? ? ? ? ? ? ? 1.876 ? 
metalc14 metalc ? ? F CO  .   CO  ? ? ? 1_555 X  HOH .   O  ? ? A CO  402 A HOH 580 1_555 ? ? ? ? ? ? ? 2.003 ? 
metalc15 metalc ? ? S CO  .   CO  ? ? ? 1_555 AA HOH .   O  ? ? D CO  402 D HOH 581 1_555 ? ? ? ? ? ? ? 2.019 ? 
metalc16 metalc ? ? M CO  .   CO  ? ? ? 1_555 Y  HOH .   O  ? ? B CO  403 B HOH 582 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc17 metalc ? ? L FE2 .   FE  ? ? ? 1_555 Y  HOH .   O  ? ? B FE2 402 B HOH 582 1_555 ? ? ? ? ? ? ? 1.733 ? 
metalc18 metalc ? ? R FE2 .   FE  ? ? ? 1_555 AA HOH .   O  ? ? D FE2 401 D HOH 581 1_555 ? ? ? ? ? ? ? 1.889 ? 
metalc19 metalc ? ? D HIS 24  NE2 ? ? ? 1_555 R  FE2 .   FE ? ? D HIS 24  D FE2 401 1_555 ? ? ? ? ? ? ? 1.926 ? 
metalc20 metalc ? ? A HIS 24  NE2 ? ? ? 1_555 E  FE2 .   FE ? ? A HIS 24  A FE2 401 1_555 ? ? ? ? ? ? ? 1.929 ? 
metalc21 metalc ? ? B KCX 137 OQ2 ? ? ? 1_555 L  FE2 .   FE ? ? B KCX 137 B FE2 402 1_555 ? ? ? ? ? ? ? 1.944 ? 
metalc22 metalc ? ? C ASP 256 OD1 ? ? ? 1_555 O  FE2 .   FE ? ? C ASP 256 C FE2 401 1_555 ? ? ? ? ? ? ? 1.950 ? 
metalc23 metalc ? ? C KCX 137 OQ2 ? ? ? 1_555 O  FE2 .   FE ? ? C KCX 137 C FE2 401 1_555 ? ? ? ? ? ? ? 1.955 ? 
metalc24 metalc ? ? B HIS 24  NE2 ? ? ? 1_555 L  FE2 .   FE ? ? B HIS 24  B FE2 402 1_555 ? ? ? ? ? ? ? 1.958 ? 
metalc25 metalc ? ? O FE2 .   FE  ? ? ? 1_555 Z  HOH .   O  ? ? C FE2 401 C HOH 573 1_555 ? ? ? ? ? ? ? 1.969 ? 
metalc26 metalc ? ? A KCX 137 OQ1 ? ? ? 1_555 E  FE2 .   FE ? ? A KCX 137 A FE2 401 1_555 ? ? ? ? ? ? ? 1.976 ? 
metalc27 metalc ? ? D KCX 137 OQ1 ? ? ? 1_555 R  FE2 .   FE ? ? D KCX 137 D FE2 401 1_555 ? ? ? ? ? ? ? 1.977 ? 
metalc28 metalc ? ? D ASP 256 OD1 ? ? ? 1_555 R  FE2 .   FE ? ? D ASP 256 D FE2 401 1_555 ? ? ? ? ? ? ? 1.987 ? 
metalc29 metalc ? ? D HIS 22  NE2 ? ? ? 1_555 R  FE2 .   FE ? ? D HIS 22  D FE2 401 1_555 ? ? ? ? ? ? ? 1.993 ? 
metalc30 metalc ? ? C HIS 24  NE2 ? ? ? 1_555 O  FE2 .   FE ? ? C HIS 24  C FE2 401 1_555 ? ? ? ? ? ? ? 1.996 ? 
metalc31 metalc ? ? A HIS 22  NE2 ? ? ? 1_555 E  FE2 .   FE ? ? A HIS 22  A FE2 401 1_555 ? ? ? ? ? ? ? 1.997 ? 
metalc32 metalc ? ? A ASP 256 OD1 ? ? ? 1_555 E  FE2 .   FE ? ? A ASP 256 A FE2 401 1_555 ? ? ? ? ? ? ? 2.012 ? 
metalc33 metalc ? ? B ASP 256 OD1 ? ? ? 1_555 L  FE2 .   FE ? ? B ASP 256 B FE2 402 1_555 ? ? ? ? ? ? ? 2.013 ? 
metalc34 metalc ? ? B HIS 22  NE2 ? ? ? 1_555 L  FE2 .   FE ? ? B HIS 22  B FE2 402 1_555 ? ? ? ? ? ? ? 2.014 ? 
metalc35 metalc ? ? E FE2 .   FE  ? ? ? 1_555 X  HOH .   O  ? ? A FE2 401 A HOH 580 1_555 ? ? ? ? ? ? ? 2.015 ? 
metalc36 metalc ? ? C HIS 22  NE2 ? ? ? 1_555 O  FE2 .   FE ? ? C HIS 22  C FE2 401 1_555 ? ? ? ? ? ? ? 2.023 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
C ? 6 ? 
D ? 2 ? 
E ? 3 ? 
F ? 6 ? 
G ? 2 ? 
H ? 3 ? 
I ? 6 ? 
J ? 2 ? 
K ? 3 ? 
L ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? parallel      
G 1 2 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? parallel      
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
I 5 6 ? parallel      
J 1 2 ? anti-parallel 
K 1 2 ? parallel      
K 2 3 ? parallel      
L 1 2 ? parallel      
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
L 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 3   ? LEU A 5   ? ILE A 3   LEU A 5   
A 2 LYS A 8   ? ILE A 11  ? LYS A 8   ILE A 11  
B 1 THR A 19  ? LEU A 20  ? THR A 19  LEU A 20  
B 2 THR A 63  ? ASP A 66  ? THR A 63  ASP A 66  
B 3 ASN A 89  ? ALA A 92  ? ASN A 89  ALA A 92  
C 1 THR A 94  ? GLY A 95  ? THR A 94  GLY A 95  
C 2 VAL A 136 ? ALA A 139 ? VAL A 136 ALA A 139 
C 3 ILE A 167 ? HIS A 170 ? ILE A 167 HIS A 170 
C 4 ILE A 195 ? ILE A 197 ? ILE A 195 ILE A 197 
C 5 PHE A 218 ? LEU A 221 ? PHE A 218 LEU A 221 
C 6 ILE A 251 ? ILE A 253 ? ILE A 251 ILE A 253 
D 1 ILE B 3   ? LEU B 5   ? ILE B 3   LEU B 5   
D 2 LYS B 8   ? ILE B 11  ? LYS B 8   ILE B 11  
E 1 THR B 19  ? LEU B 20  ? THR B 19  LEU B 20  
E 2 THR B 63  ? ASP B 66  ? THR B 63  ASP B 66  
E 3 ASN B 89  ? ALA B 92  ? ASN B 89  ALA B 92  
F 1 THR B 94  ? ILE B 96  ? THR B 94  ILE B 96  
F 2 VAL B 136 ? ALA B 139 ? VAL B 136 ALA B 139 
F 3 ILE B 167 ? HIS B 170 ? ILE B 167 HIS B 170 
F 4 ILE B 195 ? ILE B 197 ? ILE B 195 ILE B 197 
F 5 PHE B 218 ? LEU B 221 ? PHE B 218 LEU B 221 
F 6 ILE B 251 ? ILE B 253 ? ILE B 251 ILE B 253 
G 1 ILE C 3   ? LEU C 5   ? ILE C 3   LEU C 5   
G 2 LYS C 8   ? ILE C 11  ? LYS C 8   ILE C 11  
H 1 THR C 19  ? LEU C 20  ? THR C 19  LEU C 20  
H 2 THR C 63  ? ASP C 66  ? THR C 63  ASP C 66  
H 3 ASN C 89  ? ALA C 92  ? ASN C 89  ALA C 92  
I 1 THR C 94  ? GLY C 95  ? THR C 94  GLY C 95  
I 2 VAL C 136 ? ALA C 139 ? VAL C 136 ALA C 139 
I 3 ILE C 167 ? HIS C 170 ? ILE C 167 HIS C 170 
I 4 ILE C 195 ? ILE C 197 ? ILE C 195 ILE C 197 
I 5 PHE C 218 ? LEU C 221 ? PHE C 218 LEU C 221 
I 6 ILE C 251 ? ILE C 253 ? ILE C 251 ILE C 253 
J 1 ILE D 3   ? LEU D 5   ? ILE D 3   LEU D 5   
J 2 LYS D 8   ? ILE D 11  ? LYS D 8   ILE D 11  
K 1 THR D 19  ? LEU D 20  ? THR D 19  LEU D 20  
K 2 THR D 63  ? ASP D 66  ? THR D 63  ASP D 66  
K 3 ASN D 89  ? ALA D 92  ? ASN D 89  ALA D 92  
L 1 THR D 94  ? ILE D 96  ? THR D 94  ILE D 96  
L 2 VAL D 136 ? ALA D 139 ? VAL D 136 ALA D 139 
L 3 ILE D 167 ? HIS D 170 ? ILE D 167 HIS D 170 
L 4 ILE D 195 ? ILE D 197 ? ILE D 195 ILE D 197 
L 5 PHE D 218 ? LEU D 221 ? PHE D 218 LEU D 221 
L 6 ILE D 251 ? ILE D 253 ? ILE D 251 ILE D 253 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 3   ? N ILE A 3   O ILE A 11  ? O ILE A 11  
B 1 2 N LEU A 20  ? N LEU A 20  O VAL A 65  ? O VAL A 65  
B 2 3 N ILE A 64  ? N ILE A 64  O ASN A 89  ? O ASN A 89  
C 1 2 N THR A 94  ? N THR A 94  O KCX A 137 ? O KCX A 137 
C 2 3 N VAL A 136 ? N VAL A 136 O ILE A 168 ? O ILE A 168 
C 3 4 N ILE A 167 ? N ILE A 167 O LEU A 196 ? O LEU A 196 
C 4 5 N ILE A 197 ? N ILE A 197 O GLY A 220 ? O GLY A 220 
C 5 6 N LEU A 221 ? N LEU A 221 O MET A 252 ? O MET A 252 
D 1 2 N ILE B 3   ? N ILE B 3   O ILE B 11  ? O ILE B 11  
E 1 2 N LEU B 20  ? N LEU B 20  O VAL B 65  ? O VAL B 65  
E 2 3 N ILE B 64  ? N ILE B 64  O ASN B 89  ? O ASN B 89  
F 1 2 N THR B 94  ? N THR B 94  O KCX B 137 ? O KCX B 137 
F 2 3 N VAL B 136 ? N VAL B 136 O ILE B 168 ? O ILE B 168 
F 3 4 N ILE B 167 ? N ILE B 167 O LEU B 196 ? O LEU B 196 
F 4 5 N ILE B 197 ? N ILE B 197 O GLY B 220 ? O GLY B 220 
F 5 6 N LEU B 221 ? N LEU B 221 O MET B 252 ? O MET B 252 
G 1 2 N ILE C 3   ? N ILE C 3   O ILE C 11  ? O ILE C 11  
H 1 2 N LEU C 20  ? N LEU C 20  O VAL C 65  ? O VAL C 65  
H 2 3 N ILE C 64  ? N ILE C 64  O ASN C 89  ? O ASN C 89  
I 1 2 N THR C 94  ? N THR C 94  O KCX C 137 ? O KCX C 137 
I 2 3 N VAL C 136 ? N VAL C 136 O ILE C 168 ? O ILE C 168 
I 3 4 N ILE C 167 ? N ILE C 167 O LEU C 196 ? O LEU C 196 
I 4 5 N ILE C 197 ? N ILE C 197 O GLY C 220 ? O GLY C 220 
I 5 6 N LEU C 221 ? N LEU C 221 O MET C 252 ? O MET C 252 
J 1 2 N ILE D 3   ? N ILE D 3   O ILE D 11  ? O ILE D 11  
K 1 2 N LEU D 20  ? N LEU D 20  O VAL D 65  ? O VAL D 65  
K 2 3 N ILE D 64  ? N ILE D 64  O ASN D 89  ? O ASN D 89  
L 1 2 N THR D 94  ? N THR D 94  O KCX D 137 ? O KCX D 137 
L 2 3 N VAL D 136 ? N VAL D 136 O ILE D 168 ? O ILE D 168 
L 3 4 N ILE D 167 ? N ILE D 167 O LEU D 196 ? O LEU D 196 
L 4 5 N ILE D 197 ? N ILE D 197 O GLY D 220 ? O GLY D 220 
L 5 6 N LEU D 221 ? N LEU D 221 O MET D 252 ? O MET D 252 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE FE2 A 401' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CO A 402'  
AC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE EDO A 403' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE EDO A 404' 
AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL A 405' 
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL A 406' 
AC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE EDO B 401' 
AC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE FE2 B 402' 
AC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CO B 403'  
BC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL B 404' 
BC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE FE2 C 401' 
BC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CO C 402'  
BC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE GOL C 403' 
BC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE FE2 D 401' 
BC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CO D 402'  
BC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE EDO D 403' 
BC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE EDO D 404' 
BC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL D 405' 
CC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL D 406' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6 HIS A  22  ? HIS A 22  . ? 1_555 ? 
2   AC1 6 HIS A  24  ? HIS A 24  . ? 1_555 ? 
3   AC1 6 KCX A  137 ? KCX A 137 . ? 1_555 ? 
4   AC1 6 ASP A  256 ? ASP A 256 . ? 1_555 ? 
5   AC1 6 CO  F  .   ? CO  A 402 . ? 1_555 ? 
6   AC1 6 HOH X  .   ? HOH A 580 . ? 1_555 ? 
7   AC2 5 KCX A  137 ? KCX A 137 . ? 1_555 ? 
8   AC2 5 HIS A  170 ? HIS A 170 . ? 1_555 ? 
9   AC2 5 HIS A  199 ? HIS A 199 . ? 1_555 ? 
10  AC2 5 FE2 E  .   ? FE2 A 401 . ? 1_555 ? 
11  AC2 5 HOH X  .   ? HOH A 580 . ? 1_555 ? 
12  AC3 7 SER A  171 ? SER A 171 . ? 1_555 ? 
13  AC3 7 ASN A  172 ? ASN A 172 . ? 1_555 ? 
14  AC3 7 ALA A  173 ? ALA A 173 . ? 1_555 ? 
15  AC3 7 HIS A  199 ? HIS A 199 . ? 1_555 ? 
16  AC3 7 ASP A  202 ? ASP A 202 . ? 1_555 ? 
17  AC3 7 PHE A  229 ? PHE A 229 . ? 1_555 ? 
18  AC3 7 HOH X  .   ? HOH A 530 . ? 1_555 ? 
19  AC4 6 ILE A  98  ? ILE A 98  . ? 1_555 ? 
20  AC4 6 TYR A  99  ? TYR A 99  . ? 1_555 ? 
21  AC4 6 ILE A  100 ? ILE A 100 . ? 1_555 ? 
22  AC4 6 ASP A  101 ? ASP A 101 . ? 1_555 ? 
23  AC4 6 HOH X  .   ? HOH A 560 . ? 1_555 ? 
24  AC4 6 PHE C  104 ? PHE C 104 . ? 1_555 ? 
25  AC5 5 ASN A  160 ? ASN A 160 . ? 1_555 ? 
26  AC5 5 LYS A  164 ? LYS A 164 . ? 1_555 ? 
27  AC5 5 GLY A  189 ? GLY A 189 . ? 1_555 ? 
28  AC5 5 ASP A  191 ? ASP A 191 . ? 1_555 ? 
29  AC5 5 LYS A  194 ? LYS A 194 . ? 1_555 ? 
30  AC6 6 HIS A  120 ? HIS A 120 . ? 1_555 ? 
31  AC6 6 GLY A  125 ? GLY A 125 . ? 1_555 ? 
32  AC6 6 GLY A  128 ? GLY A 128 . ? 1_555 ? 
33  AC6 6 THR A  129 ? THR A 129 . ? 1_555 ? 
34  AC6 6 HOH X  .   ? HOH A 539 . ? 1_555 ? 
35  AC6 6 HOH X  .   ? HOH A 584 . ? 1_555 ? 
36  AC7 1 PHE B  59  ? PHE B 59  . ? 1_555 ? 
37  AC8 6 HIS B  22  ? HIS B 22  . ? 1_555 ? 
38  AC8 6 HIS B  24  ? HIS B 24  . ? 1_555 ? 
39  AC8 6 KCX B  137 ? KCX B 137 . ? 1_555 ? 
40  AC8 6 ASP B  256 ? ASP B 256 . ? 1_555 ? 
41  AC8 6 CO  M  .   ? CO  B 403 . ? 1_555 ? 
42  AC8 6 HOH Y  .   ? HOH B 582 . ? 1_555 ? 
43  AC9 5 KCX B  137 ? KCX B 137 . ? 1_555 ? 
44  AC9 5 HIS B  170 ? HIS B 170 . ? 1_555 ? 
45  AC9 5 HIS B  199 ? HIS B 199 . ? 1_555 ? 
46  AC9 5 FE2 L  .   ? FE2 B 402 . ? 1_555 ? 
47  AC9 5 HOH Y  .   ? HOH B 582 . ? 1_555 ? 
48  BC1 7 ASN B  160 ? ASN B 160 . ? 1_555 ? 
49  BC1 7 LYS B  164 ? LYS B 164 . ? 1_555 ? 
50  BC1 7 GLY B  189 ? GLY B 189 . ? 1_555 ? 
51  BC1 7 VAL B  190 ? VAL B 190 . ? 1_555 ? 
52  BC1 7 ASP B  191 ? ASP B 191 . ? 1_555 ? 
53  BC1 7 LYS B  194 ? LYS B 194 . ? 1_555 ? 
54  BC1 7 HOH Y  .   ? HOH B 574 . ? 1_555 ? 
55  BC2 6 HIS C  22  ? HIS C 22  . ? 1_555 ? 
56  BC2 6 HIS C  24  ? HIS C 24  . ? 1_555 ? 
57  BC2 6 KCX C  137 ? KCX C 137 . ? 1_555 ? 
58  BC2 6 ASP C  256 ? ASP C 256 . ? 1_555 ? 
59  BC2 6 CO  P  .   ? CO  C 402 . ? 1_555 ? 
60  BC2 6 HOH Z  .   ? HOH C 573 . ? 1_555 ? 
61  BC3 6 KCX C  137 ? KCX C 137 . ? 1_555 ? 
62  BC3 6 HIS C  170 ? HIS C 170 . ? 1_555 ? 
63  BC3 6 HIS C  199 ? HIS C 199 . ? 1_555 ? 
64  BC3 6 ARG C  223 ? ARG C 223 . ? 1_555 ? 
65  BC3 6 FE2 O  .   ? FE2 C 401 . ? 1_555 ? 
66  BC3 6 HOH Z  .   ? HOH C 573 . ? 1_555 ? 
67  BC4 3 ASN C  160 ? ASN C 160 . ? 1_555 ? 
68  BC4 3 LYS C  164 ? LYS C 164 . ? 1_555 ? 
69  BC4 3 ASP C  191 ? ASP C 191 . ? 1_555 ? 
70  BC5 6 HIS D  22  ? HIS D 22  . ? 1_555 ? 
71  BC5 6 HIS D  24  ? HIS D 24  . ? 1_555 ? 
72  BC5 6 KCX D  137 ? KCX D 137 . ? 1_555 ? 
73  BC5 6 ASP D  256 ? ASP D 256 . ? 1_555 ? 
74  BC5 6 CO  S  .   ? CO  D 402 . ? 1_555 ? 
75  BC5 6 HOH AA .   ? HOH D 581 . ? 1_555 ? 
76  BC6 5 KCX D  137 ? KCX D 137 . ? 1_555 ? 
77  BC6 5 HIS D  170 ? HIS D 170 . ? 1_555 ? 
78  BC6 5 HIS D  199 ? HIS D 199 . ? 1_555 ? 
79  BC6 5 FE2 R  .   ? FE2 D 401 . ? 1_555 ? 
80  BC6 5 HOH AA .   ? HOH D 581 . ? 1_555 ? 
81  BC7 6 ASN D  172 ? ASN D 172 . ? 1_555 ? 
82  BC7 6 ALA D  173 ? ALA D 173 . ? 1_555 ? 
83  BC7 6 HIS D  174 ? HIS D 174 . ? 1_555 ? 
84  BC7 6 ASP D  202 ? ASP D 202 . ? 1_555 ? 
85  BC7 6 PHE D  229 ? PHE D 229 . ? 1_555 ? 
86  BC7 6 HOH AA .   ? HOH D 528 . ? 1_555 ? 
87  BC8 6 PHE B  104 ? PHE B 104 . ? 1_555 ? 
88  BC8 6 ILE D  98  ? ILE D 98  . ? 1_555 ? 
89  BC8 6 TYR D  99  ? TYR D 99  . ? 1_555 ? 
90  BC8 6 ILE D  100 ? ILE D 100 . ? 1_555 ? 
91  BC8 6 ASP D  101 ? ASP D 101 . ? 1_555 ? 
92  BC8 6 HOH AA .   ? HOH D 553 . ? 1_555 ? 
93  BC9 6 ASN D  160 ? ASN D 160 . ? 1_555 ? 
94  BC9 6 LYS D  164 ? LYS D 164 . ? 1_555 ? 
95  BC9 6 GLY D  189 ? GLY D 189 . ? 1_555 ? 
96  BC9 6 VAL D  190 ? VAL D 190 . ? 1_555 ? 
97  BC9 6 ASP D  191 ? ASP D 191 . ? 1_555 ? 
98  BC9 6 HOH AA .   ? HOH D 545 . ? 1_555 ? 
99  CC1 4 HIS D  120 ? HIS D 120 . ? 1_555 ? 
100 CC1 4 GLU D  124 ? GLU D 124 . ? 1_555 ? 
101 CC1 4 GLY D  128 ? GLY D 128 . ? 1_555 ? 
102 CC1 4 THR D  129 ? THR D 129 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4KEU 
_atom_sites.fract_transf_matrix[1][1]   0.011518 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009626 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006596 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CO 
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   A MET A  1 1   ? -46.655 -12.796 28.411  0.50 54.70  ? 1   MET A N   1 
ATOM   2     N  N   B MET A  1 1   ? -45.258 -14.006 29.613  0.50 50.86  ? 1   MET A N   1 
ATOM   3     C  CA  A MET A  1 1   ? -46.186 -12.283 29.729  0.50 55.47  ? 1   MET A CA  1 
ATOM   4     C  CA  B MET A  1 1   ? -46.090 -12.784 29.489  0.50 52.07  ? 1   MET A CA  1 
ATOM   5     C  C   A MET A  1 1   ? -45.179 -11.134 29.569  0.50 56.01  ? 1   MET A C   1 
ATOM   6     C  C   B MET A  1 1   ? -45.219 -11.545 29.348  0.50 52.12  ? 1   MET A C   1 
ATOM   7     O  O   A MET A  1 1   ? -45.554 -9.961  29.626  0.50 63.70  ? 1   MET A O   1 
ATOM   8     O  O   B MET A  1 1   ? -45.720 -10.419 29.361  0.50 58.26  ? 1   MET A O   1 
ATOM   9     C  CB  A MET A  1 1   ? -45.578 -13.406 30.554  0.50 56.04  ? 1   MET A CB  1 
ATOM   10    C  CB  B MET A  1 1   ? -47.012 -12.641 30.702  0.50 53.68  ? 1   MET A CB  1 
ATOM   11    C  CG  A MET A  1 1   ? -46.588 -14.415 31.062  0.50 56.83  ? 1   MET A CG  1 
ATOM   12    C  CG  B MET A  1 1   ? -47.963 -13.799 30.891  0.50 57.41  ? 1   MET A CG  1 
ATOM   13    S  SD  A MET A  1 1   ? -47.831 -13.669 32.146  0.50 64.13  ? 1   MET A SD  1 
ATOM   14    S  SD  B MET A  1 1   ? -47.117 -15.386 30.906  0.50 58.49  ? 1   MET A SD  1 
ATOM   15    C  CE  A MET A  1 1   ? -48.693 -15.125 32.715  0.50 61.58  ? 1   MET A CE  1 
ATOM   16    C  CE  B MET A  1 1   ? -48.467 -16.489 31.354  0.50 60.17  ? 1   MET A CE  1 
ATOM   17    N  N   A ARG A  1 2   ? -43.896 -11.477 29.368  0.50 50.50  ? 2   ARG A N   1 
ATOM   18    N  N   B ARG A  1 2   ? -43.907 -11.755 29.209  0.50 47.08  ? 2   ARG A N   1 
ATOM   19    C  CA  A ARG A  1 2   ? -42.857 -10.456 29.239  0.50 42.99  ? 2   ARG A CA  1 
ATOM   20    C  CA  B ARG A  1 2   ? -42.969 -10.649 29.098  0.50 41.88  ? 2   ARG A CA  1 
ATOM   21    C  C   A ARG A  1 2   ? -41.553 -10.989 28.517  0.50 36.13  ? 2   ARG A C   1 
ATOM   22    C  C   B ARG A  1 2   ? -41.644 -11.103 28.426  0.50 35.72  ? 2   ARG A C   1 
ATOM   23    O  O   A ARG A  1 2   ? -41.072 -10.378 27.586  0.50 35.10  ? 2   ARG A O   1 
ATOM   24    O  O   B ARG A  1 2   ? -41.219 -10.531 27.440  0.50 34.74  ? 2   ARG A O   1 
ATOM   25    C  CB  A ARG A  1 2   ? -42.512 -9.860  30.620  0.50 48.46  ? 2   ARG A CB  1 
ATOM   26    C  CB  B ARG A  1 2   ? -42.693 -10.053 30.469  0.50 47.15  ? 2   ARG A CB  1 
ATOM   27    C  CG  A ARG A  1 2   ? -42.038 -8.399  30.584  0.50 49.89  ? 2   ARG A CG  1 
ATOM   28    C  CG  B ARG A  1 2   ? -42.329 -8.599  30.446  0.50 48.47  ? 2   ARG A CG  1 
ATOM   29    C  CD  A ARG A  1 2   ? -40.798 -8.235  29.737  0.50 48.34  ? 2   ARG A CD  1 
ATOM   30    C  CD  B ARG A  1 2   ? -43.379 -7.793  29.716  0.50 47.49  ? 2   ARG A CD  1 
ATOM   31    N  NE  A ARG A  1 2   ? -40.327 -6.852  29.718  0.50 48.43  ? 2   ARG A NE  1 
ATOM   32    N  NE  B ARG A  1 2   ? -43.300 -6.382  30.038  0.50 46.28  ? 2   ARG A NE  1 
ATOM   33    C  CZ  A ARG A  1 2   ? -40.660 -5.963  28.789  0.50 46.73  ? 2   ARG A CZ  1 
ATOM   34    C  CZ  B ARG A  1 2   ? -44.025 -5.793  30.980  0.50 47.40  ? 2   ARG A CZ  1 
ATOM   35    N  NH1 A ARG A  1 2   ? -40.187 -4.734  28.851  0.50 45.70  ? 2   ARG A NH1 1 
ATOM   36    N  NH1 B ARG A  1 2   ? -44.887 -6.500  31.690  0.50 49.35  ? 2   ARG A NH1 1 
ATOM   37    N  NH2 A ARG A  1 2   ? -41.468 -6.307  27.800  0.50 46.87  ? 2   ARG A NH2 1 
ATOM   38    N  NH2 B ARG A  1 2   ? -43.891 -4.498  31.209  0.50 48.64  ? 2   ARG A NH2 1 
ATOM   39    N  N   . ILE A  1 3   ? -41.025 -12.128 28.983  1.00 31.51  ? 3   ILE A N   1 
ATOM   40    C  CA  . ILE A  1 3   ? -39.760 -12.706 28.390  1.00 29.55  ? 3   ILE A CA  1 
ATOM   41    C  C   . ILE A  1 3   ? -40.033 -13.956 27.536  1.00 28.22  ? 3   ILE A C   1 
ATOM   42    O  O   . ILE A  1 3   ? -40.470 -14.995 28.059  1.00 25.81  ? 3   ILE A O   1 
ATOM   43    C  CB  . ILE A  1 3   ? -38.721 -13.048 29.466  1.00 32.68  ? 3   ILE A CB  1 
ATOM   44    C  CG1 . ILE A  1 3   ? -38.520 -11.868 30.407  1.00 33.76  ? 3   ILE A CG1 1 
ATOM   45    C  CG2 . ILE A  1 3   ? -37.380 -13.479 28.810  1.00 28.67  ? 3   ILE A CG2 1 
ATOM   46    C  CD1 . ILE A  1 3   ? -38.252 -10.554 29.687  1.00 39.63  ? 3   ILE A CD1 1 
ATOM   47    N  N   . PRO A  1 4   ? -39.768 -13.859 26.209  1.00 26.84  ? 4   PRO A N   1 
ATOM   48    C  CA  . PRO A  1 4   ? -40.009 -14.972 25.303  1.00 26.51  ? 4   PRO A CA  1 
ATOM   49    C  C   . PRO A  1 4   ? -39.040 -16.096 25.552  1.00 25.44  ? 4   PRO A C   1 
ATOM   50    O  O   . PRO A  1 4   ? -37.873 -15.850 25.897  1.00 24.71  ? 4   PRO A O   1 
ATOM   51    C  CB  . PRO A  1 4   ? -39.764 -14.344 23.896  1.00 26.51  ? 4   PRO A CB  1 
ATOM   52    C  CG  . PRO A  1 4   ? -38.823 -13.208 24.152  1.00 23.96  ? 4   PRO A CG  1 
ATOM   53    C  CD  . PRO A  1 4   ? -39.176 -12.671 25.509  1.00 23.65  ? 4   PRO A CD  1 
ATOM   54    N  N   . LEU A  1 5   ? -39.509 -17.322 25.392  1.00 24.47  ? 5   LEU A N   1 
ATOM   55    C  CA  . LEU A  1 5   ? -38.679 -18.504 25.610  1.00 24.73  ? 5   LEU A CA  1 
ATOM   56    C  C   . LEU A  1 5   ? -38.731 -19.375 24.426  1.00 26.84  ? 5   LEU A C   1 
ATOM   57    O  O   . LEU A  1 5   ? -39.769 -19.496 23.786  1.00 28.94  ? 5   LEU A O   1 
ATOM   58    C  CB  . LEU A  1 5   ? -39.181 -19.298 26.849  1.00 22.44  ? 5   LEU A CB  1 
ATOM   59    C  CG  . LEU A  1 5   ? -39.067 -18.645 28.209  1.00 22.68  ? 5   LEU A CG  1 
ATOM   60    C  CD1 . LEU A  1 5   ? -39.604 -19.591 29.295  1.00 21.58  ? 5   LEU A CD1 1 
ATOM   61    C  CD2 . LEU A  1 5   ? -37.612 -18.243 28.504  1.00 21.84  ? 5   LEU A CD2 1 
ATOM   62    N  N   . VAL A  1 6   ? -37.632 -19.998 24.111  1.00 22.99  ? 6   VAL A N   1 
ATOM   63    C  CA  . VAL A  1 6   ? -37.607 -20.933 23.030  1.00 22.58  ? 6   VAL A CA  1 
ATOM   64    C  C   . VAL A  1 6   ? -38.476 -22.154 23.378  1.00 26.33  ? 6   VAL A C   1 
ATOM   65    O  O   . VAL A  1 6   ? -38.268 -22.802 24.404  1.00 26.78  ? 6   VAL A O   1 
ATOM   66    C  CB  . VAL A  1 6   ? -36.180 -21.400 22.715  1.00 19.11  ? 6   VAL A CB  1 
ATOM   67    C  CG1 . VAL A  1 6   ? -36.189 -22.402 21.560  1.00 18.44  ? 6   VAL A CG1 1 
ATOM   68    C  CG2 . VAL A  1 6   ? -35.299 -20.206 22.378  1.00 16.75  ? 6   VAL A CG2 1 
ATOM   69    N  N   . GLY A  1 7   ? -39.458 -22.448 22.518  1.00 25.78  ? 7   GLY A N   1 
ATOM   70    C  CA  . GLY A  1 7   ? -40.302 -23.652 22.682  1.00 25.33  ? 7   GLY A CA  1 
ATOM   71    C  C   . GLY A  1 7   ? -41.244 -23.624 23.885  1.00 25.55  ? 7   GLY A C   1 
ATOM   72    O  O   . GLY A  1 7   ? -41.772 -24.644 24.274  1.00 27.91  ? 7   GLY A O   1 
ATOM   73    N  N   . LYS A  1 8   ? -41.448 -22.439 24.467  1.00 25.87  ? 8   LYS A N   1 
ATOM   74    C  CA  . LYS A  1 8   ? -42.391 -22.285 25.630  1.00 25.95  ? 8   LYS A CA  1 
ATOM   75    C  C   . LYS A  1 8   ? -43.110 -20.978 25.569  1.00 26.31  ? 8   LYS A C   1 
ATOM   76    O  O   . LYS A  1 8   ? -42.726 -20.077 24.808  1.00 24.25  ? 8   LYS A O   1 
ATOM   77    C  CB  . LYS A  1 8   ? -41.639 -22.370 26.959  1.00 25.26  ? 8   LYS A CB  1 
ATOM   78    C  CG  . LYS A  1 8   ? -40.892 -23.652 27.203  1.00 27.34  ? 8   LYS A CG  1 
ATOM   79    C  CD  . LYS A  1 8   ? -40.291 -23.639 28.629  1.00 29.40  ? 8   LYS A CD  1 
ATOM   80    C  CE  . LYS A  1 8   ? -39.507 -24.895 28.938  1.00 28.69  ? 8   LYS A CE  1 
ATOM   81    N  NZ  . LYS A  1 8   ? -38.975 -24.854 30.358  1.00 29.53  ? 8   LYS A NZ  1 
ATOM   82    N  N   . ASP A  1 9   ? -44.163 -20.849 26.373  1.00 25.74  ? 9   ASP A N   1 
ATOM   83    C  CA  . ASP A  1 9   ? -44.846 -19.572 26.533  1.00 29.43  ? 9   ASP A CA  1 
ATOM   84    C  C   . ASP A  1 9   ? -43.945 -18.647 27.218  1.00 29.07  ? 9   ASP A C   1 
ATOM   85    O  O   . ASP A  1 9   ? -43.119 -19.068 28.039  1.00 29.01  ? 9   ASP A O   1 
ATOM   86    C  CB  . ASP A  1 9   ? -46.131 -19.742 27.369  1.00 33.18  ? 9   ASP A CB  1 
ATOM   87    C  CG  . ASP A  1 9   ? -47.168 -20.596 26.679  1.00 40.79  ? 9   ASP A CG  1 
ATOM   88    O  OD1 . ASP A  1 9   ? -48.047 -21.138 27.379  1.00 53.67  ? 9   ASP A OD1 1 
ATOM   89    O  OD2 . ASP A  1 9   ? -47.109 -20.729 25.445  1.00 43.57  ? 9   ASP A OD2 1 
ATOM   90    N  N   . SER A  1 10  ? -44.068 -17.367 26.910  1.00 27.57  ? 10  SER A N   1 
ATOM   91    C  CA  . SER A  1 10  ? -43.261 -16.367 27.544  1.00 26.80  ? 10  SER A CA  1 
ATOM   92    C  C   . SER A  1 10  ? -43.597 -16.290 29.063  1.00 28.44  ? 10  SER A C   1 
ATOM   93    O  O   . SER A  1 10  ? -44.700 -16.678 29.490  1.00 25.87  ? 10  SER A O   1 
ATOM   94    C  CB  . SER A  1 10  ? -43.475 -15.023 26.889  1.00 28.73  ? 10  SER A CB  1 
ATOM   95    O  OG  . SER A  1 10  ? -44.795 -14.581 27.073  1.00 32.61  ? 10  SER A OG  1 
ATOM   96    N  N   . ILE A  1 11  ? -42.653 -15.791 29.853  1.00 26.86  ? 11  ILE A N   1 
ATOM   97    C  CA  . ILE A  1 11  ? -42.815 -15.741 31.309  1.00 27.91  ? 11  ILE A CA  1 
ATOM   98    C  C   . ILE A  1 11  ? -42.586 -14.361 31.841  1.00 29.88  ? 11  ILE A C   1 
ATOM   99    O  O   . ILE A  1 11  ? -41.867 -13.560 31.236  1.00 30.45  ? 11  ILE A O   1 
ATOM   100   C  CB  . ILE A  1 11  ? -41.823 -16.676 32.004  1.00 28.24  ? 11  ILE A CB  1 
ATOM   101   C  CG1 . ILE A  1 11  ? -40.375 -16.342 31.557  1.00 25.72  ? 11  ILE A CG1 1 
ATOM   102   C  CG2 . ILE A  1 11  ? -42.156 -18.120 31.711  1.00 27.62  ? 11  ILE A CG2 1 
ATOM   103   C  CD1 . ILE A  1 11  ? -39.297 -17.016 32.392  1.00 27.45  ? 11  ILE A CD1 1 
ATOM   104   N  N   . GLU A  1 12  ? -43.183 -14.066 32.974  1.00 30.76  ? 12  GLU A N   1 
ATOM   105   C  CA  . GLU A  1 12  ? -42.888 -12.842 33.663  1.00 31.65  ? 12  GLU A CA  1 
ATOM   106   C  C   . GLU A  1 12  ? -41.470 -12.945 34.254  1.00 29.20  ? 12  GLU A C   1 
ATOM   107   O  O   . GLU A  1 12  ? -41.031 -13.995 34.579  1.00 25.75  ? 12  GLU A O   1 
ATOM   108   C  CB  . GLU A  1 12  ? -43.907 -12.579 34.750  1.00 30.52  ? 12  GLU A CB  1 
ATOM   109   C  CG  . GLU A  1 12  ? -45.370 -12.538 34.230  1.00 37.28  ? 12  GLU A CG  1 
ATOM   110   C  CD  . GLU A  1 12  ? -46.388 -12.154 35.323  1.00 40.91  ? 12  GLU A CD  1 
ATOM   111   O  OE1 . GLU A  1 12  ? -47.372 -12.906 35.514  1.00 44.43  ? 12  GLU A OE1 1 
ATOM   112   O  OE2 . GLU A  1 12  ? -46.194 -11.105 35.985  1.00 46.27  ? 12  GLU A OE2 1 
ATOM   113   N  N   . SER A  1 13  ? -40.785 -11.813 34.359  1.00 31.66  ? 13  SER A N   1 
ATOM   114   C  CA  . SER A  1 13  ? -39.378 -11.791 34.841  1.00 33.74  ? 13  SER A CA  1 
ATOM   115   C  C   . SER A  1 13  ? -39.233 -12.446 36.217  1.00 32.88  ? 13  SER A C   1 
ATOM   116   O  O   . SER A  1 13  ? -38.174 -12.936 36.565  1.00 30.75  ? 13  SER A O   1 
ATOM   117   C  CB  . SER A  1 13  ? -38.860 -10.369 34.892  1.00 35.73  ? 13  SER A CB  1 
ATOM   118   O  OG  . SER A  1 13  ? -39.606 -9.593  35.826  1.00 34.25  ? 13  SER A OG  1 
ATOM   119   N  N   . LYS A  1 14  ? -40.307 -12.446 36.980  1.00 34.32  ? 14  LYS A N   1 
ATOM   120   C  CA  . LYS A  1 14  ? -40.287 -13.001 38.313  1.00 34.33  ? 14  LYS A CA  1 
ATOM   121   C  C   . LYS A  1 14  ? -40.091 -14.522 38.279  1.00 32.71  ? 14  LYS A C   1 
ATOM   122   O  O   . LYS A  1 14  ? -39.777 -15.116 39.259  1.00 32.25  ? 14  LYS A O   1 
ATOM   123   C  CB  . LYS A  1 14  ? -41.582 -12.656 39.051  1.00 33.03  ? 14  LYS A CB  1 
ATOM   124   C  CG  . LYS A  1 14  ? -42.800 -13.556 38.668  1.00 35.50  ? 14  LYS A CG  1 
ATOM   125   C  CD  . LYS A  1 14  ? -44.143 -12.904 39.102  1.00 35.09  ? 14  LYS A CD  1 
ATOM   126   C  CE  . LYS A  1 14  ? -45.269 -13.950 39.249  1.00 32.91  ? 14  LYS A CE  1 
ATOM   127   N  NZ  . LYS A  1 14  ? -45.380 -14.867 38.094  1.00 33.61  ? 14  LYS A NZ  1 
ATOM   128   N  N   . ASP A  1 15  ? -40.286 -15.113 37.120  1.00 30.54  ? 15  ASP A N   1 
ATOM   129   C  CA  . ASP A  1 15  ? -40.194 -16.568 36.979  1.00 30.45  ? 15  ASP A CA  1 
ATOM   130   C  C   . ASP A  1 15  ? -38.866 -17.032 36.332  1.00 27.54  ? 15  ASP A C   1 
ATOM   131   O  O   . ASP A  1 15  ? -38.694 -18.198 36.054  1.00 26.51  ? 15  ASP A O   1 
ATOM   132   C  CB  . ASP A  1 15  ? -41.391 -17.105 36.178  1.00 34.64  ? 15  ASP A CB  1 
ATOM   133   C  CG  . ASP A  1 15  ? -42.739 -16.970 36.954  1.00 37.65  ? 15  ASP A CG  1 
ATOM   134   O  OD1 . ASP A  1 15  ? -42.815 -17.458 38.103  1.00 37.35  ? 15  ASP A OD1 1 
ATOM   135   O  OD2 . ASP A  1 15  ? -43.689 -16.382 36.401  1.00 40.71  ? 15  ASP A OD2 1 
ATOM   136   N  N   . ILE A  1 16  ? -37.950 -16.099 36.102  1.00 26.35  ? 16  ILE A N   1 
ATOM   137   C  CA  . ILE A  1 16  ? -36.630 -16.454 35.467  1.00 26.95  ? 16  ILE A CA  1 
ATOM   138   C  C   . ILE A  1 16  ? -35.870 -17.408 36.350  1.00 24.39  ? 16  ILE A C   1 
ATOM   139   O  O   . ILE A  1 16  ? -35.326 -18.412 35.877  1.00 23.82  ? 16  ILE A O   1 
ATOM   140   C  CB  . ILE A  1 16  ? -35.775 -15.214 35.180  1.00 33.00  ? 16  ILE A CB  1 
ATOM   141   C  CG1 . ILE A  1 16  ? -36.583 -14.184 34.426  1.00 44.47  ? 16  ILE A CG1 1 
ATOM   142   C  CG2 . ILE A  1 16  ? -34.541 -15.588 34.364  1.00 28.78  ? 16  ILE A CG2 1 
ATOM   143   C  CD1 . ILE A  1 16  ? -36.974 -14.617 33.044  1.00 46.61  ? 16  ILE A CD1 1 
ATOM   144   N  N   . GLY A  1 17  ? -35.844 -17.110 37.657  1.00 21.74  ? 17  GLY A N   1 
ATOM   145   C  CA  . GLY A  1 17  ? -35.169 -17.954 38.613  1.00 21.51  ? 17  GLY A CA  1 
ATOM   146   C  C   . GLY A  1 17  ? -33.667 -17.902 38.437  1.00 22.87  ? 17  GLY A C   1 
ATOM   147   O  O   . GLY A  1 17  ? -33.118 -16.932 37.824  1.00 21.18  ? 17  GLY A O   1 
ATOM   148   N  N   . PHE A  1 18  ? -32.977 -18.918 38.947  1.00 21.49  ? 18  PHE A N   1 
ATOM   149   C  CA  . PHE A  1 18  ? -31.551 -18.951 38.866  1.00 23.36  ? 18  PHE A CA  1 
ATOM   150   C  C   . PHE A  1 18  ? -31.114 -19.002 37.392  1.00 23.51  ? 18  PHE A C   1 
ATOM   151   O  O   . PHE A  1 18  ? -31.424 -19.983 36.657  1.00 23.98  ? 18  PHE A O   1 
ATOM   152   C  CB  . PHE A  1 18  ? -30.980 -20.146 39.646  1.00 21.25  ? 18  PHE A CB  1 
ATOM   153   C  CG  . PHE A  1 18  ? -29.505 -20.053 39.886  1.00 20.02  ? 18  PHE A CG  1 
ATOM   154   C  CD1 . PHE A  1 18  ? -29.005 -19.825 41.164  1.00 22.30  ? 18  PHE A CD1 1 
ATOM   155   C  CD2 . PHE A  1 18  ? -28.611 -20.179 38.840  1.00 20.38  ? 18  PHE A CD2 1 
ATOM   156   C  CE1 . PHE A  1 18  ? -27.616 -19.731 41.392  1.00 20.67  ? 18  PHE A CE1 1 
ATOM   157   C  CE2 . PHE A  1 18  ? -27.216 -20.084 39.066  1.00 20.50  ? 18  PHE A CE2 1 
ATOM   158   C  CZ  . PHE A  1 18  ? -26.737 -19.859 40.342  1.00 21.06  ? 18  PHE A CZ  1 
ATOM   159   N  N   . THR A  1 19  ? -30.404 -17.971 36.964  1.00 20.55  ? 19  THR A N   1 
ATOM   160   C  CA  . THR A  1 19  ? -30.098 -17.780 35.567  1.00 20.91  ? 19  THR A CA  1 
ATOM   161   C  C   . THR A  1 19  ? -28.601 -17.762 35.267  1.00 21.56  ? 19  THR A C   1 
ATOM   162   O  O   . THR A  1 19  ? -27.801 -17.166 36.024  1.00 21.92  ? 19  THR A O   1 
ATOM   163   C  CB  . THR A  1 19  ? -30.705 -16.427 35.051  1.00 22.53  ? 19  THR A CB  1 
ATOM   164   O  OG1 . THR A  1 19  ? -32.107 -16.414 35.278  1.00 25.89  ? 19  THR A OG1 1 
ATOM   165   C  CG2 . THR A  1 19  ? -30.426 -16.234 33.559  1.00 24.09  ? 19  THR A CG2 1 
ATOM   166   N  N   . LEU A  1 20  ? -28.214 -18.429 34.157  1.00 19.87  ? 20  LEU A N   1 
ATOM   167   C  CA  . LEU A  1 20  ? -26.897 -18.244 33.568  1.00 19.64  ? 20  LEU A CA  1 
ATOM   168   C  C   . LEU A  1 20  ? -27.075 -17.305 32.406  1.00 19.87  ? 20  LEU A C   1 
ATOM   169   O  O   . LEU A  1 20  ? -27.680 -17.684 31.349  1.00 20.54  ? 20  LEU A O   1 
ATOM   170   C  CB  . LEU A  1 20  ? -26.313 -19.583 33.095  1.00 18.81  ? 20  LEU A CB  1 
ATOM   171   C  CG  . LEU A  1 20  ? -25.996 -20.613 34.191  1.00 20.09  ? 20  LEU A CG  1 
ATOM   172   C  CD1 . LEU A  1 20  ? -25.354 -21.870 33.606  1.00 19.83  ? 20  LEU A CD1 1 
ATOM   173   C  CD2 . LEU A  1 20  ? -25.100 -20.003 35.276  1.00 21.04  ? 20  LEU A CD2 1 
ATOM   174   N  N   . ILE A  1 21  ? -26.579 -16.077 32.562  1.00 19.71  ? 21  ILE A N   1 
ATOM   175   C  CA  . ILE A  1 21  ? -26.883 -14.982 31.631  1.00 19.88  ? 21  ILE A CA  1 
ATOM   176   C  C   . ILE A  1 21  ? -26.115 -15.053 30.233  1.00 20.77  ? 21  ILE A C   1 
ATOM   177   O  O   . ILE A  1 21  ? -26.475 -14.380 29.306  1.00 22.54  ? 21  ILE A O   1 
ATOM   178   C  CB  . ILE A  1 21  ? -26.615 -13.597 32.291  1.00 21.37  ? 21  ILE A CB  1 
ATOM   179   C  CG1 . ILE A  1 21  ? -27.352 -12.459 31.521  1.00 22.21  ? 21  ILE A CG1 1 
ATOM   180   C  CG2 . ILE A  1 21  ? -25.115 -13.331 32.390  1.00 22.81  ? 21  ILE A CG2 1 
ATOM   181   C  CD1 . ILE A  1 21  ? -28.862 -12.389 31.807  1.00 19.75  ? 21  ILE A CD1 1 
ATOM   182   N  N   . HIS A  1 22  ? -25.104 -15.851 30.153  1.00 19.33  ? 22  HIS A N   1 
ATOM   183   C  CA  . HIS A  1 22  ? -24.296 -15.904 28.928  1.00 18.34  ? 22  HIS A CA  1 
ATOM   184   C  C   . HIS A  1 22  ? -23.673 -17.266 28.717  1.00 18.82  ? 22  HIS A C   1 
ATOM   185   O  O   . HIS A  1 22  ? -22.514 -17.545 29.202  1.00 17.70  ? 22  HIS A O   1 
ATOM   186   C  CB  . HIS A  1 22  ? -23.180 -14.774 28.940  1.00 16.69  ? 22  HIS A CB  1 
ATOM   187   C  CG  . HIS A  1 22  ? -22.449 -14.579 27.551  1.00 17.74  ? 22  HIS A CG  1 
ATOM   188   N  ND1 . HIS A  1 22  ? -22.217 -13.326 26.992  1.00 17.84  ? 22  HIS A ND1 1 
ATOM   189   C  CD2 . HIS A  1 22  ? -21.923 -15.519 26.636  1.00 17.92  ? 22  HIS A CD2 1 
ATOM   190   C  CE1 . HIS A  1 22  ? -21.572 -13.472 25.800  1.00 20.21  ? 22  HIS A CE1 1 
ATOM   191   N  NE2 . HIS A  1 22  ? -21.387 -14.802 25.572  1.00 21.43  ? 22  HIS A NE2 1 
ATOM   192   N  N   . GLU A  1 23  ? -24.402 -18.142 28.013  1.00 17.29  ? 23  GLU A N   1 
ATOM   193   C  CA  . GLU A  1 23  ? -23.881 -19.451 27.627  1.00 19.77  ? 23  GLU A CA  1 
ATOM   194   C  C   . GLU A  1 23  ? -24.299 -19.763 26.210  1.00 20.78  ? 23  GLU A C   1 
ATOM   195   O  O   . GLU A  1 23  ? -25.324 -19.287 25.748  1.00 23.86  ? 23  GLU A O   1 
ATOM   196   C  CB  . GLU A  1 23  ? -24.402 -20.580 28.589  1.00 18.85  ? 23  GLU A CB  1 
ATOM   197   C  CG  . GLU A  1 23  ? -24.304 -20.259 30.095  1.00 22.52  ? 23  GLU A CG  1 
ATOM   198   C  CD  . GLU A  1 23  ? -22.863 -20.228 30.620  1.00 25.68  ? 23  GLU A CD  1 
ATOM   199   O  OE1 . GLU A  1 23  ? -22.634 -19.586 31.695  1.00 24.15  ? 23  GLU A OE1 1 
ATOM   200   O  OE2 . GLU A  1 23  ? -21.934 -20.855 29.951  1.00 24.61  ? 23  GLU A OE2 1 
ATOM   201   N  N   . HIS A  1 24  ? -23.493 -20.578 25.509  1.00 20.36  ? 24  HIS A N   1 
ATOM   202   C  CA  . HIS A  1 24  ? -23.817 -20.987 24.116  1.00 20.03  ? 24  HIS A CA  1 
ATOM   203   C  C   . HIS A  1 24  ? -24.057 -22.494 24.017  1.00 22.27  ? 24  HIS A C   1 
ATOM   204   O  O   . HIS A  1 24  ? -23.216 -23.276 24.395  1.00 21.69  ? 24  HIS A O   1 
ATOM   205   C  CB  . HIS A  1 24  ? -22.698 -20.590 23.162  1.00 18.41  ? 24  HIS A CB  1 
ATOM   206   C  CG  . HIS A  1 24  ? -22.329 -19.109 23.215  1.00 18.87  ? 24  HIS A CG  1 
ATOM   207   N  ND1 . HIS A  1 24  ? -22.953 -18.165 22.447  1.00 16.66  ? 24  HIS A ND1 1 
ATOM   208   C  CD2 . HIS A  1 24  ? -21.362 -18.423 23.966  1.00 16.54  ? 24  HIS A CD2 1 
ATOM   209   C  CE1 . HIS A  1 24  ? -22.410 -16.942 22.707  1.00 15.99  ? 24  HIS A CE1 1 
ATOM   210   N  NE2 . HIS A  1 24  ? -21.451 -17.092 23.621  1.00 17.42  ? 24  HIS A NE2 1 
ATOM   211   N  N   . LEU A  1 25  ? -25.228 -22.885 23.496  1.00 22.80  ? 25  LEU A N   1 
ATOM   212   C  CA  . LEU A  1 25  ? -25.502 -24.285 23.235  1.00 24.00  ? 25  LEU A CA  1 
ATOM   213   C  C   . LEU A  1 25  ? -24.604 -24.788 22.115  1.00 24.00  ? 25  LEU A C   1 
ATOM   214   O  O   . LEU A  1 25  ? -24.137 -25.908 22.147  1.00 24.67  ? 25  LEU A O   1 
ATOM   215   C  CB  . LEU A  1 25  ? -26.976 -24.491 22.849  1.00 21.63  ? 25  LEU A CB  1 
ATOM   216   C  CG  . LEU A  1 25  ? -28.007 -24.167 23.912  1.00 24.67  ? 25  LEU A CG  1 
ATOM   217   C  CD1 . LEU A  1 25  ? -29.403 -24.476 23.401  1.00 25.41  ? 25  LEU A CD1 1 
ATOM   218   C  CD2 . LEU A  1 25  ? -27.717 -24.945 25.181  1.00 22.43  ? 25  LEU A CD2 1 
ATOM   219   N  N   . ARG A  1 26  ? -24.372 -23.924 21.110  1.00 24.46  ? 26  ARG A N   1 
ATOM   220   C  CA  . ARG A  1 26  ? -23.520 -24.270 19.985  1.00 26.46  ? 26  ARG A CA  1 
ATOM   221   C  C   . ARG A  1 26  ? -23.110 -23.022 19.206  1.00 28.31  ? 26  ARG A C   1 
ATOM   222   O  O   . ARG A  1 26  ? -23.917 -22.113 19.004  1.00 27.38  ? 26  ARG A O   1 
ATOM   223   C  CB  . ARG A  1 26  ? -24.243 -25.267 19.043  1.00 25.48  ? 26  ARG A CB  1 
ATOM   224   C  CG  . ARG A  1 26  ? -23.425 -25.674 17.841  1.00 24.06  ? 26  ARG A CG  1 
ATOM   225   C  CD  . ARG A  1 26  ? -24.187 -26.615 16.952  1.00 24.23  ? 26  ARG A CD  1 
ATOM   226   N  NE  . ARG A  1 26  ? -25.362 -25.965 16.345  1.00 27.67  ? 26  ARG A NE  1 
ATOM   227   C  CZ  . ARG A  1 26  ? -26.177 -26.552 15.496  1.00 25.03  ? 26  ARG A CZ  1 
ATOM   228   N  NH1 . ARG A  1 26  ? -27.221 -25.879 14.996  1.00 24.05  ? 26  ARG A NH1 1 
ATOM   229   N  NH2 . ARG A  1 26  ? -25.961 -27.832 15.126  1.00 25.40  ? 26  ARG A NH2 1 
ATOM   230   N  N   . VAL A  1 27  ? -21.854 -22.983 18.771  1.00 26.67  ? 27  VAL A N   1 
ATOM   231   C  CA  . VAL A  1 27  ? -21.361 -21.879 17.972  1.00 27.62  ? 27  VAL A CA  1 
ATOM   232   C  C   . VAL A  1 27  ? -20.641 -22.383 16.712  1.00 26.10  ? 27  VAL A C   1 
ATOM   233   O  O   . VAL A  1 27  ? -19.872 -23.323 16.775  1.00 23.08  ? 27  VAL A O   1 
ATOM   234   C  CB  . VAL A  1 27  ? -20.387 -20.964 18.781  1.00 27.13  ? 27  VAL A CB  1 
ATOM   235   C  CG1 . VAL A  1 27  ? -19.712 -19.976 17.859  1.00 28.41  ? 27  VAL A CG1 1 
ATOM   236   C  CG2 . VAL A  1 27  ? -21.130 -20.231 19.872  1.00 25.38  ? 27  VAL A CG2 1 
ATOM   237   N  N   . PHE A  1 28  ? -20.915 -21.725 15.559  1.00 24.34  ? 28  PHE A N   1 
ATOM   238   C  CA  . PHE A  1 28  ? -20.210 -22.037 14.282  1.00 24.24  ? 28  PHE A CA  1 
ATOM   239   C  C   . PHE A  1 28  ? -20.304 -20.894 13.316  1.00 24.58  ? 28  PHE A C   1 
ATOM   240   O  O   . PHE A  1 28  ? -21.217 -20.051 13.415  1.00 23.36  ? 28  PHE A O   1 
ATOM   241   C  CB  . PHE A  1 28  ? -20.782 -23.334 13.625  1.00 20.33  ? 28  PHE A CB  1 
ATOM   242   C  CG  . PHE A  1 28  ? -22.250 -23.219 13.203  1.00 22.59  ? 28  PHE A CG  1 
ATOM   243   C  CD1 . PHE A  1 28  ? -22.606 -22.638 11.948  1.00 19.78  ? 28  PHE A CD1 1 
ATOM   244   C  CD2 . PHE A  1 28  ? -23.281 -23.686 14.047  1.00 20.14  ? 28  PHE A CD2 1 
ATOM   245   C  CE1 . PHE A  1 28  ? -23.963 -22.530 11.559  1.00 20.74  ? 28  PHE A CE1 1 
ATOM   246   C  CE2 . PHE A  1 28  ? -24.643 -23.577 13.656  1.00 20.65  ? 28  PHE A CE2 1 
ATOM   247   C  CZ  . PHE A  1 28  ? -24.979 -22.999 12.412  1.00 21.54  ? 28  PHE A CZ  1 
ATOM   248   N  N   . SER A  1 29  ? -19.355 -20.840 12.357  1.00 23.31  ? 29  SER A N   1 
ATOM   249   C  CA  . SER A  1 29  ? -19.423 -19.860 11.268  1.00 26.81  ? 29  SER A CA  1 
ATOM   250   C  C   . SER A  1 29  ? -20.447 -20.326 10.236  1.00 26.76  ? 29  SER A C   1 
ATOM   251   O  O   . SER A  1 29  ? -20.294 -21.394 9.642   1.00 27.53  ? 29  SER A O   1 
ATOM   252   C  CB  . SER A  1 29  ? -18.048 -19.689 10.604  1.00 27.80  ? 29  SER A CB  1 
ATOM   253   O  OG  . SER A  1 29  ? -17.002 -19.492 11.601  1.00 33.58  ? 29  SER A OG  1 
ATOM   254   N  N   . GLU A  1 30  ? -21.487 -19.527 10.028  1.00 24.53  ? 30  GLU A N   1 
ATOM   255   C  CA  . GLU A  1 30  ? -22.586 -19.900 9.067   1.00 24.89  ? 30  GLU A CA  1 
ATOM   256   C  C   . GLU A  1 30  ? -22.059 -20.316 7.700   1.00 24.50  ? 30  GLU A C   1 
ATOM   257   O  O   . GLU A  1 30  ? -22.505 -21.296 7.137   1.00 26.52  ? 30  GLU A O   1 
ATOM   258   C  CB  . GLU A  1 30  ? -23.588 -18.749 8.902   1.00 23.09  ? 30  GLU A CB  1 
ATOM   259   C  CG  . GLU A  1 30  ? -24.509 -18.546 10.073  1.00 25.79  ? 30  GLU A CG  1 
ATOM   260   C  CD  . GLU A  1 30  ? -23.979 -17.532 11.078  1.00 27.47  ? 30  GLU A CD  1 
ATOM   261   O  OE1 . GLU A  1 30  ? -22.742 -17.344 11.154  1.00 25.65  ? 30  GLU A OE1 1 
ATOM   262   O  OE2 . GLU A  1 30  ? -24.798 -16.927 11.788  1.00 24.55  ? 30  GLU A OE2 1 
ATOM   263   N  N   . ALA A  1 31  ? -21.098 -19.541 7.171   1.00 24.07  ? 31  ALA A N   1 
ATOM   264   C  CA  . ALA A  1 31  ? -20.572 -19.774 5.813   1.00 24.70  ? 31  ALA A CA  1 
ATOM   265   C  C   . ALA A  1 31  ? -19.811 -21.068 5.722   1.00 23.12  ? 31  ALA A C   1 
ATOM   266   O  O   . ALA A  1 31  ? -19.919 -21.798 4.731   1.00 23.00  ? 31  ALA A O   1 
ATOM   267   C  CB  . ALA A  1 31  ? -19.682 -18.577 5.359   1.00 22.79  ? 31  ALA A CB  1 
ATOM   268   N  N   . VAL A  1 32  ? -19.044 -21.364 6.746   1.00 24.22  ? 32  VAL A N   1 
ATOM   269   C  CA  . VAL A  1 32  ? -18.259 -22.589 6.776   1.00 22.05  ? 32  VAL A CA  1 
ATOM   270   C  C   . VAL A  1 32  ? -19.161 -23.818 6.818   1.00 23.16  ? 32  VAL A C   1 
ATOM   271   O  O   . VAL A  1 32  ? -19.025 -24.730 5.995   1.00 23.06  ? 32  VAL A O   1 
ATOM   272   C  CB  . VAL A  1 32  ? -17.311 -22.611 7.972   1.00 23.33  ? 32  VAL A CB  1 
ATOM   273   C  CG1 . VAL A  1 32  ? -16.555 -23.921 8.024   1.00 22.20  ? 32  VAL A CG1 1 
ATOM   274   C  CG2 . VAL A  1 32  ? -16.338 -21.416 7.901   1.00 21.86  ? 32  VAL A CG2 1 
ATOM   275   N  N   . ARG A  1 33  ? -20.078 -23.841 7.761   1.00 21.70  ? 33  ARG A N   1 
ATOM   276   C  CA  . ARG A  1 33  ? -20.979 -24.961 7.896   1.00 24.96  ? 33  ARG A CA  1 
ATOM   277   C  C   . ARG A  1 33  ? -21.829 -25.157 6.625   1.00 25.82  ? 33  ARG A C   1 
ATOM   278   O  O   . ARG A  1 33  ? -22.072 -26.253 6.212   1.00 23.82  ? 33  ARG A O   1 
ATOM   279   C  CB  . ARG A  1 33  ? -21.869 -24.780 9.076   1.00 24.08  ? 33  ARG A CB  1 
ATOM   280   C  CG  . ARG A  1 33  ? -22.729 -25.969 9.354   1.00 26.50  ? 33  ARG A CG  1 
ATOM   281   C  CD  . ARG A  1 33  ? -23.079 -26.051 10.812  1.00 30.07  ? 33  ARG A CD  1 
ATOM   282   N  NE  . ARG A  1 33  ? -23.598 -27.354 11.166  1.00 33.55  ? 33  ARG A NE  1 
ATOM   283   C  CZ  . ARG A  1 33  ? -23.509 -27.881 12.370  1.00 29.65  ? 33  ARG A CZ  1 
ATOM   284   N  NH1 . ARG A  1 33  ? -22.907 -27.211 13.343  1.00 27.65  ? 33  ARG A NH1 1 
ATOM   285   N  NH2 . ARG A  1 33  ? -24.013 -29.084 12.609  1.00 29.87  ? 33  ARG A NH2 1 
ATOM   286   N  N   . GLN A  1 34  ? -22.254 -24.077 6.046   1.00 26.32  ? 34  GLN A N   1 
ATOM   287   C  CA  . GLN A  1 34  ? -23.052 -24.136 4.872   1.00 26.91  ? 34  GLN A CA  1 
ATOM   288   C  C   . GLN A  1 34  ? -22.229 -24.677 3.663   1.00 25.79  ? 34  GLN A C   1 
ATOM   289   O  O   . GLN A  1 34  ? -22.743 -25.411 2.840   1.00 25.97  ? 34  GLN A O   1 
ATOM   290   C  CB  . GLN A  1 34  ? -23.610 -22.772 4.554   1.00 29.78  ? 34  GLN A CB  1 
ATOM   291   C  CG  . GLN A  1 34  ? -24.513 -22.743 3.358   1.00 35.41  ? 34  GLN A CG  1 
ATOM   292   C  CD  . GLN A  1 34  ? -25.327 -21.453 3.278   1.00 35.05  ? 34  GLN A CD  1 
ATOM   293   O  OE1 . GLN A  1 34  ? -25.498 -20.740 4.285   1.00 36.10  ? 34  GLN A OE1 1 
ATOM   294   N  NE2 . GLN A  1 34  ? -25.828 -21.151 2.107   1.00 36.61  ? 34  GLN A NE2 1 
ATOM   295   N  N   . GLN A  1 35  ? -20.959 -24.298 3.591   1.00 23.02  ? 35  GLN A N   1 
ATOM   296   C  CA  . GLN A  1 35  ? -20.096 -24.711 2.438   1.00 23.98  ? 35  GLN A CA  1 
ATOM   297   C  C   . GLN A  1 35  ? -19.382 -26.073 2.659   1.00 25.91  ? 35  GLN A C   1 
ATOM   298   O  O   . GLN A  1 35  ? -19.096 -26.784 1.706   1.00 25.83  ? 35  GLN A O   1 
ATOM   299   C  CB  . GLN A  1 35  ? -19.087 -23.637 2.104   1.00 22.21  ? 35  GLN A CB  1 
ATOM   300   C  CG  . GLN A  1 35  ? -19.710 -22.330 1.627   1.00 23.17  ? 35  GLN A CG  1 
ATOM   301   C  CD  . GLN A  1 35  ? -20.710 -22.530 0.474   1.00 22.40  ? 35  GLN A CD  1 
ATOM   302   O  OE1 . GLN A  1 35  ? -20.594 -23.469 -0.307  1.00 24.95  ? 35  GLN A OE1 1 
ATOM   303   N  NE2 . GLN A  1 35  ? -21.687 -21.639 0.380   1.00 21.69  ? 35  GLN A NE2 1 
ATOM   304   N  N   . TRP A  1 36  ? -19.107 -26.412 3.926   1.00 23.56  ? 36  TRP A N   1 
ATOM   305   C  CA  . TRP A  1 36  ? -18.408 -27.675 4.245   1.00 24.38  ? 36  TRP A CA  1 
ATOM   306   C  C   . TRP A  1 36  ? -19.031 -28.409 5.412   1.00 24.84  ? 36  TRP A C   1 
ATOM   307   O  O   . TRP A  1 36  ? -18.451 -28.505 6.446   1.00 25.76  ? 36  TRP A O   1 
ATOM   308   C  CB  . TRP A  1 36  ? -16.945 -27.411 4.493   1.00 22.29  ? 36  TRP A CB  1 
ATOM   309   C  CG  . TRP A  1 36  ? -16.247 -26.864 3.269   1.00 23.14  ? 36  TRP A CG  1 
ATOM   310   C  CD1 . TRP A  1 36  ? -15.891 -27.565 2.140   1.00 23.75  ? 36  TRP A CD1 1 
ATOM   311   C  CD2 . TRP A  1 36  ? -15.826 -25.499 3.040   1.00 22.32  ? 36  TRP A CD2 1 
ATOM   312   N  NE1 . TRP A  1 36  ? -15.270 -26.719 1.220   1.00 26.16  ? 36  TRP A NE1 1 
ATOM   313   C  CE2 . TRP A  1 36  ? -15.215 -25.459 1.732   1.00 24.07  ? 36  TRP A CE2 1 
ATOM   314   C  CE3 . TRP A  1 36  ? -15.900 -24.321 3.789   1.00 22.38  ? 36  TRP A CE3 1 
ATOM   315   C  CZ2 . TRP A  1 36  ? -14.684 -24.275 1.182   1.00 23.38  ? 36  TRP A CZ2 1 
ATOM   316   C  CZ3 . TRP A  1 36  ? -15.365 -23.125 3.232   1.00 22.11  ? 36  TRP A CZ3 1 
ATOM   317   C  CH2 . TRP A  1 36  ? -14.769 -23.118 1.949   1.00 23.05  ? 36  TRP A CH2 1 
ATOM   318   N  N   . PRO A  1 37  ? -20.258 -28.944 5.209   1.00 26.12  ? 37  PRO A N   1 
ATOM   319   C  CA  . PRO A  1 37  ? -21.001 -29.651 6.239   1.00 24.83  ? 37  PRO A CA  1 
ATOM   320   C  C   . PRO A  1 37  ? -20.249 -30.904 6.790   1.00 26.47  ? 37  PRO A C   1 
ATOM   321   O  O   . PRO A  1 37  ? -20.507 -31.329 7.916   1.00 27.09  ? 37  PRO A O   1 
ATOM   322   C  CB  . PRO A  1 37  ? -22.301 -30.073 5.509   1.00 24.44  ? 37  PRO A CB  1 
ATOM   323   C  CG  . PRO A  1 37  ? -21.972 -29.923 4.027   1.00 23.85  ? 37  PRO A CG  1 
ATOM   324   C  CD  . PRO A  1 37  ? -21.027 -28.832 3.940   1.00 24.39  ? 37  PRO A CD  1 
ATOM   325   N  N   . HIS A  1 38  ? -19.334 -31.467 6.000   1.00 27.88  ? 38  HIS A N   1 
ATOM   326   C  CA  . HIS A  1 38  ? -18.560 -32.695 6.453   1.00 27.72  ? 38  HIS A CA  1 
ATOM   327   C  C   . HIS A  1 38  ? -17.734 -32.428 7.695   1.00 29.42  ? 38  HIS A C   1 
ATOM   328   O  O   . HIS A  1 38  ? -17.308 -33.333 8.352   1.00 29.78  ? 38  HIS A O   1 
ATOM   329   C  CB  . HIS A  1 38  ? -17.686 -33.224 5.348   1.00 29.17  ? 38  HIS A CB  1 
ATOM   330   C  CG  . HIS A  1 38  ? -16.452 -32.378 5.078   1.00 29.46  ? 38  HIS A CG  1 
ATOM   331   N  ND1 . HIS A  1 38  ? -16.474 -31.278 4.269   1.00 27.97  ? 38  HIS A ND1 1 
ATOM   332   C  CD2 . HIS A  1 38  ? -15.107 -32.509 5.531   1.00 30.52  ? 38  HIS A CD2 1 
ATOM   333   C  CE1 . HIS A  1 38  ? -15.221 -30.735 4.212   1.00 28.98  ? 38  HIS A CE1 1 
ATOM   334   N  NE2 . HIS A  1 38  ? -14.393 -31.487 4.980   1.00 30.49  ? 38  HIS A NE2 1 
ATOM   335   N  N   . LEU A  1 39  ? -17.520 -31.141 8.002   1.00 31.07  ? 39  LEU A N   1 
ATOM   336   C  CA  . LEU A  1 39  ? -16.723 -30.740 9.167   1.00 29.26  ? 39  LEU A CA  1 
ATOM   337   C  C   . LEU A  1 39  ? -17.513 -30.868 10.506  1.00 29.59  ? 39  LEU A C   1 
ATOM   338   O  O   . LEU A  1 39  ? -16.948 -30.793 11.547  1.00 28.37  ? 39  LEU A O   1 
ATOM   339   C  CB  . LEU A  1 39  ? -16.231 -29.289 9.004   1.00 29.35  ? 39  LEU A CB  1 
ATOM   340   C  CG  . LEU A  1 39  ? -15.233 -28.989 7.894   1.00 30.28  ? 39  LEU A CG  1 
ATOM   341   C  CD1 . LEU A  1 39  ? -15.076 -27.486 7.717   1.00 27.74  ? 39  LEU A CD1 1 
ATOM   342   C  CD2 . LEU A  1 39  ? -13.889 -29.645 8.192   1.00 26.66  ? 39  LEU A CD2 1 
ATOM   343   N  N   . TYR A  1 40  ? -18.818 -31.052 10.418  1.00 29.50  ? 40  TYR A N   1 
ATOM   344   C  CA  . TYR A  1 40  ? -19.688 -31.003 11.644  1.00 32.08  ? 40  TYR A CA  1 
ATOM   345   C  C   . TYR A  1 40  ? -20.441 -32.229 11.871  1.00 34.04  ? 40  TYR A C   1 
ATOM   346   O  O   . TYR A  1 40  ? -20.750 -32.956 10.946  1.00 34.88  ? 40  TYR A O   1 
ATOM   347   C  CB  . TYR A  1 40  ? -20.658 -29.797 11.569  1.00 30.44  ? 40  TYR A CB  1 
ATOM   348   C  CG  . TYR A  1 40  ? -19.955 -28.467 11.368  1.00 32.01  ? 40  TYR A CG  1 
ATOM   349   C  CD1 . TYR A  1 40  ? -19.620 -28.014 10.076  1.00 30.58  ? 40  TYR A CD1 1 
ATOM   350   C  CD2 . TYR A  1 40  ? -19.610 -27.653 12.472  1.00 31.97  ? 40  TYR A CD2 1 
ATOM   351   C  CE1 . TYR A  1 40  ? -18.973 -26.802 9.884   1.00 32.60  ? 40  TYR A CE1 1 
ATOM   352   C  CE2 . TYR A  1 40  ? -18.961 -26.433 12.292  1.00 32.09  ? 40  TYR A CE2 1 
ATOM   353   C  CZ  . TYR A  1 40  ? -18.642 -26.006 10.997  1.00 31.84  ? 40  TYR A CZ  1 
ATOM   354   O  OH  . TYR A  1 40  ? -18.008 -24.821 10.811  1.00 31.07  ? 40  TYR A OH  1 
ATOM   355   N  N   . ASN A  1 41  ? -20.761 -32.484 13.139  1.00 33.99  ? 41  ASN A N   1 
ATOM   356   C  CA  . ASN A  1 41  ? -21.543 -33.610 13.506  1.00 35.33  ? 41  ASN A CA  1 
ATOM   357   C  C   . ASN A  1 41  ? -22.770 -33.182 14.371  1.00 34.66  ? 41  ASN A C   1 
ATOM   358   O  O   . ASN A  1 41  ? -22.652 -32.961 15.581  1.00 32.42  ? 41  ASN A O   1 
ATOM   359   C  CB  . ASN A  1 41  ? -20.685 -34.647 14.247  1.00 35.69  ? 41  ASN A CB  1 
ATOM   360   C  CG  . ASN A  1 41  ? -21.424 -35.967 14.477  1.00 40.64  ? 41  ASN A CG  1 
ATOM   361   O  OD1 . ASN A  1 41  ? -22.625 -35.983 14.755  1.00 44.01  ? 41  ASN A OD1 1 
ATOM   362   N  ND2 . ASN A  1 41  ? -20.716 -37.055 14.364  1.00 45.35  ? 41  ASN A ND2 1 
ATOM   363   N  N   . GLU A  1 42  ? -23.907 -33.069 13.725  1.00 36.57  ? 42  GLU A N   1 
ATOM   364   C  CA  . GLU A  1 42  ? -25.125 -32.630 14.357  1.00 36.84  ? 42  GLU A CA  1 
ATOM   365   C  C   . GLU A  1 42  ? -25.477 -33.460 15.648  1.00 36.62  ? 42  GLU A C   1 
ATOM   366   O  O   . GLU A  1 42  ? -25.875 -32.891 16.674  1.00 34.71  ? 42  GLU A O   1 
ATOM   367   C  CB  . GLU A  1 42  ? -26.301 -32.684 13.333  1.00 43.70  ? 42  GLU A CB  1 
ATOM   368   C  CG  . GLU A  1 42  ? -27.687 -32.716 13.951  1.00 62.11  ? 42  GLU A CG  1 
ATOM   369   C  CD  . GLU A  1 42  ? -28.171 -31.345 14.392  1.00 65.84  ? 42  GLU A CD  1 
ATOM   370   O  OE1 . GLU A  1 42  ? -27.702 -30.337 13.827  1.00 62.63  ? 42  GLU A OE1 1 
ATOM   371   O  OE2 . GLU A  1 42  ? -29.040 -31.280 15.309  1.00 70.58  ? 42  GLU A OE2 1 
ATOM   372   N  N   . ASP A  1 43  ? -25.322 -34.782 15.566  1.00 34.74  ? 43  ASP A N   1 
ATOM   373   C  CA  . ASP A  1 43  ? -25.676 -35.685 16.697  1.00 36.74  ? 43  ASP A CA  1 
ATOM   374   C  C   . ASP A  1 43  ? -24.840 -35.426 17.888  1.00 33.87  ? 43  ASP A C   1 
ATOM   375   O  O   . ASP A  1 43  ? -25.345 -35.335 18.989  1.00 35.04  ? 43  ASP A O   1 
ATOM   376   C  CB  . ASP A  1 43  ? -25.550 -37.181 16.276  1.00 35.67  ? 43  ASP A CB  1 
ATOM   377   C  CG  . ASP A  1 43  ? -26.549 -37.571 15.221  1.00 43.67  ? 43  ASP A CG  1 
ATOM   378   O  OD1 . ASP A  1 43  ? -27.608 -36.925 15.138  1.00 47.27  ? 43  ASP A OD1 1 
ATOM   379   O  OD2 . ASP A  1 43  ? -26.278 -38.535 14.467  1.00 51.01  ? 43  ASP A OD2 1 
ATOM   380   N  N   . GLU A  1 44  ? -23.533 -35.309 17.678  1.00 32.63  ? 44  GLU A N   1 
ATOM   381   C  CA  . GLU A  1 44  ? -22.622 -35.069 18.755  1.00 31.92  ? 44  GLU A CA  1 
ATOM   382   C  C   . GLU A  1 44  ? -22.887 -33.663 19.428  1.00 30.05  ? 44  GLU A C   1 
ATOM   383   O  O   . GLU A  1 44  ? -22.910 -33.541 20.685  1.00 30.16  ? 44  GLU A O   1 
ATOM   384   C  CB  . GLU A  1 44  ? -21.200 -35.163 18.274  1.00 35.64  ? 44  GLU A CB  1 
ATOM   385   C  CG  . GLU A  1 44  ? -20.182 -35.188 19.384  1.00 48.81  ? 44  GLU A CG  1 
ATOM   386   C  CD  . GLU A  1 44  ? -18.768 -35.313 18.872  1.00 58.78  ? 44  GLU A CD  1 
ATOM   387   O  OE1 . GLU A  1 44  ? -17.852 -35.482 19.699  1.00 68.60  ? 44  GLU A OE1 1 
ATOM   388   O  OE2 . GLU A  1 44  ? -18.568 -35.243 17.623  1.00 56.75  ? 44  GLU A OE2 1 
ATOM   389   N  N   . GLU A  1 45  ? -23.082 -32.634 18.597  1.00 26.06  ? 45  GLU A N   1 
ATOM   390   C  CA  . GLU A  1 45  ? -23.396 -31.296 19.103  1.00 24.60  ? 45  GLU A CA  1 
ATOM   391   C  C   . GLU A  1 45  ? -24.623 -31.352 19.998  1.00 25.10  ? 45  GLU A C   1 
ATOM   392   O  O   . GLU A  1 45  ? -24.658 -30.735 21.082  1.00 23.27  ? 45  GLU A O   1 
ATOM   393   C  CB  . GLU A  1 45  ? -23.634 -30.347 17.956  1.00 24.05  ? 45  GLU A CB  1 
ATOM   394   C  CG  . GLU A  1 45  ? -22.388 -30.063 17.134  1.00 30.78  ? 45  GLU A CG  1 
ATOM   395   C  CD  . GLU A  1 45  ? -22.708 -29.477 15.739  1.00 33.04  ? 45  GLU A CD  1 
ATOM   396   O  OE1 . GLU A  1 45  ? -23.933 -29.509 15.311  1.00 31.56  ? 45  GLU A OE1 1 
ATOM   397   O  OE2 . GLU A  1 45  ? -21.778 -29.006 15.080  1.00 32.87  ? 45  GLU A OE2 1 
ATOM   398   N  N   . PHE A  1 46  ? -25.627 -32.093 19.555  1.00 26.85  ? 46  PHE A N   1 
ATOM   399   C  CA  . PHE A  1 46  ? -26.864 -32.206 20.284  1.00 27.35  ? 46  PHE A CA  1 
ATOM   400   C  C   . PHE A  1 46  ? -26.649 -32.887 21.663  1.00 27.70  ? 46  PHE A C   1 
ATOM   401   O  O   . PHE A  1 46  ? -27.130 -32.397 22.681  1.00 29.19  ? 46  PHE A O   1 
ATOM   402   C  CB  . PHE A  1 46  ? -27.896 -32.969 19.460  1.00 25.79  ? 46  PHE A CB  1 
ATOM   403   C  CG  . PHE A  1 46  ? -29.228 -33.103 20.131  1.00 28.29  ? 46  PHE A CG  1 
ATOM   404   C  CD1 . PHE A  1 46  ? -29.707 -34.348 20.508  1.00 29.64  ? 46  PHE A CD1 1 
ATOM   405   C  CD2 . PHE A  1 46  ? -30.022 -31.969 20.391  1.00 26.83  ? 46  PHE A CD2 1 
ATOM   406   C  CE1 . PHE A  1 46  ? -30.971 -34.476 21.142  1.00 30.86  ? 46  PHE A CE1 1 
ATOM   407   C  CE2 . PHE A  1 46  ? -31.274 -32.098 21.021  1.00 26.77  ? 46  PHE A CE2 1 
ATOM   408   C  CZ  . PHE A  1 46  ? -31.739 -33.348 21.391  1.00 26.15  ? 46  PHE A CZ  1 
ATOM   409   N  N   . ARG A  1 47  ? -25.908 -34.025 21.669  1.00 28.64  ? 47  ARG A N   1 
ATOM   410   C  CA  . ARG A  1 47  ? -25.632 -34.779 22.928  1.00 33.15  ? 47  ARG A CA  1 
ATOM   411   C  C   . ARG A  1 47  ? -24.889 -33.940 23.927  1.00 32.68  ? 47  ARG A C   1 
ATOM   412   O  O   . ARG A  1 47  ? -25.212 -33.948 25.116  1.00 29.69  ? 47  ARG A O   1 
ATOM   413   C  CB  . ARG A  1 47  ? -24.834 -36.069 22.640  1.00 36.76  ? 47  ARG A CB  1 
ATOM   414   C  CG  . ARG A  1 47  ? -25.584 -37.110 21.827  1.00 49.83  ? 47  ARG A CG  1 
ATOM   415   C  CD  . ARG A  1 47  ? -24.846 -38.487 21.855  1.00 56.33  ? 47  ARG A CD  1 
ATOM   416   N  NE  . ARG A  1 47  ? -23.399 -38.357 21.535  1.00 61.22  ? 47  ARG A NE  1 
ATOM   417   C  CZ  . ARG A  1 47  ? -22.875 -38.513 20.305  1.00 59.11  ? 47  ARG A CZ  1 
ATOM   418   N  NH1 . ARG A  1 47  ? -23.666 -38.806 19.269  1.00 55.53  ? 47  ARG A NH1 1 
ATOM   419   N  NH2 . ARG A  1 47  ? -21.569 -38.377 20.117  1.00 58.42  ? 47  ARG A NH2 1 
ATOM   420   N  N   . ASN A  1 48  ? -23.870 -33.212 23.450  1.00 28.90  ? 48  ASN A N   1 
ATOM   421   C  CA  . ASN A  1 48  ? -23.075 -32.343 24.317  1.00 29.88  ? 48  ASN A CA  1 
ATOM   422   C  C   . ASN A  1 48  ? -23.904 -31.234 24.946  1.00 33.22  ? 48  ASN A C   1 
ATOM   423   O  O   . ASN A  1 48  ? -23.823 -30.990 26.164  1.00 36.68  ? 48  ASN A O   1 
ATOM   424   C  CB  . ASN A  1 48  ? -21.899 -31.747 23.546  1.00 32.28  ? 48  ASN A CB  1 
ATOM   425   C  CG  . ASN A  1 48  ? -20.841 -32.802 23.172  1.00 38.43  ? 48  ASN A CG  1 
ATOM   426   O  OD1 . ASN A  1 48  ? -20.803 -33.861 23.735  1.00 38.19  ? 48  ASN A OD1 1 
ATOM   427   N  ND2 . ASN A  1 48  ? -19.993 -32.475 22.217  1.00 41.58  ? 48  ASN A ND2 1 
ATOM   428   N  N   . ALA A  1 49  ? -24.705 -30.556 24.125  1.00 28.74  ? 49  ALA A N   1 
ATOM   429   C  CA  . ALA A  1 49  ? -25.539 -29.471 24.611  1.00 28.58  ? 49  ALA A CA  1 
ATOM   430   C  C   . ALA A  1 49  ? -26.576 -29.989 25.628  1.00 27.58  ? 49  ALA A C   1 
ATOM   431   O  O   . ALA A  1 49  ? -26.747 -29.419 26.680  1.00 27.49  ? 49  ALA A O   1 
ATOM   432   C  CB  . ALA A  1 49  ? -26.225 -28.771 23.460  1.00 26.60  ? 49  ALA A CB  1 
ATOM   433   N  N   . VAL A  1 50  ? -27.249 -31.083 25.280  1.00 26.41  ? 50  VAL A N   1 
ATOM   434   C  CA  . VAL A  1 50  ? -28.234 -31.685 26.163  1.00 28.07  ? 50  VAL A CA  1 
ATOM   435   C  C   . VAL A  1 50  ? -27.593 -32.096 27.514  1.00 30.22  ? 50  VAL A C   1 
ATOM   436   O  O   . VAL A  1 50  ? -28.145 -31.809 28.596  1.00 27.06  ? 50  VAL A O   1 
ATOM   437   C  CB  . VAL A  1 50  ? -28.925 -32.905 25.498  1.00 28.11  ? 50  VAL A CB  1 
ATOM   438   C  CG1 . VAL A  1 50  ? -29.653 -33.757 26.539  1.00 24.58  ? 50  VAL A CG1 1 
ATOM   439   C  CG2 . VAL A  1 50  ? -29.886 -32.436 24.414  1.00 27.52  ? 50  VAL A CG2 1 
ATOM   440   N  N   . ASN A  1 51  ? -26.424 -32.746 27.443  1.00 29.75  ? 51  ASN A N   1 
ATOM   441   C  CA  . ASN A  1 51  ? -25.691 -33.162 28.658  1.00 28.48  ? 51  ASN A CA  1 
ATOM   442   C  C   . ASN A  1 51  ? -25.255 -31.991 29.529  1.00 27.30  ? 51  ASN A C   1 
ATOM   443   O  O   . ASN A  1 51  ? -25.376 -32.041 30.721  1.00 28.30  ? 51  ASN A O   1 
ATOM   444   C  CB  . ASN A  1 51  ? -24.488 -34.029 28.294  1.00 30.33  ? 51  ASN A CB  1 
ATOM   445   C  CG  . ASN A  1 51  ? -24.888 -35.366 27.765  1.00 34.08  ? 51  ASN A CG  1 
ATOM   446   O  OD1 . ASN A  1 51  ? -24.057 -36.118 27.250  1.00 37.41  ? 51  ASN A OD1 1 
ATOM   447   N  ND2 . ASN A  1 51  ? -26.197 -35.696 27.884  1.00 35.93  ? 51  ASN A ND2 1 
ATOM   448   N  N   . GLU A  1 52  ? -24.737 -30.930 28.898  1.00 26.43  ? 52  GLU A N   1 
ATOM   449   C  CA  . GLU A  1 52  ? -24.337 -29.711 29.641  1.00 25.41  ? 52  GLU A CA  1 
ATOM   450   C  C   . GLU A  1 52  ? -25.519 -29.086 30.343  1.00 23.24  ? 52  GLU A C   1 
ATOM   451   O  O   . GLU A  1 52  ? -25.460 -28.801 31.497  1.00 22.46  ? 52  GLU A O   1 
ATOM   452   C  CB  . GLU A  1 52  ? -23.678 -28.674 28.696  1.00 26.71  ? 52  GLU A CB  1 
ATOM   453   C  CG  . GLU A  1 52  ? -22.257 -29.026 28.274  1.00 30.37  ? 52  GLU A CG  1 
ATOM   454   C  CD  . GLU A  1 52  ? -21.303 -29.218 29.485  1.00 33.74  ? 52  GLU A CD  1 
ATOM   455   O  OE1 . GLU A  1 52  ? -20.783 -30.323 29.647  1.00 36.81  ? 52  GLU A OE1 1 
ATOM   456   O  OE2 . GLU A  1 52  ? -21.095 -28.235 30.270  1.00 36.10  ? 52  GLU A OE2 1 
ATOM   457   N  N   . VAL A  1 53  ? -26.600 -28.876 29.601  1.00 22.71  ? 53  VAL A N   1 
ATOM   458   C  CA  . VAL A  1 53  ? -27.791 -28.259 30.153  1.00 22.02  ? 53  VAL A CA  1 
ATOM   459   C  C   . VAL A  1 53  ? -28.360 -29.086 31.321  1.00 23.06  ? 53  VAL A C   1 
ATOM   460   O  O   . VAL A  1 53  ? -28.735 -28.541 32.345  1.00 25.43  ? 53  VAL A O   1 
ATOM   461   C  CB  . VAL A  1 53  ? -28.880 -28.053 29.069  1.00 21.55  ? 53  VAL A CB  1 
ATOM   462   C  CG1 . VAL A  1 53  ? -30.180 -27.575 29.700  1.00 23.00  ? 53  VAL A CG1 1 
ATOM   463   C  CG2 . VAL A  1 53  ? -28.397 -27.062 28.014  1.00 21.01  ? 53  VAL A CG2 1 
ATOM   464   N  N   . LYS A  1 54  ? -28.411 -30.397 31.150  1.00 23.92  ? 54  LYS A N   1 
ATOM   465   C  CA  . LYS A  1 54  ? -28.904 -31.288 32.229  1.00 24.23  ? 54  LYS A CA  1 
ATOM   466   C  C   . LYS A  1 54  ? -28.077 -31.150 33.514  1.00 23.74  ? 54  LYS A C   1 
ATOM   467   O  O   . LYS A  1 54  ? -28.629 -31.101 34.601  1.00 26.03  ? 54  LYS A O   1 
ATOM   468   C  CB  . LYS A  1 54  ? -28.951 -32.746 31.769  1.00 25.94  ? 54  LYS A CB  1 
ATOM   469   C  CG  . LYS A  1 54  ? -30.151 -33.071 30.901  1.00 26.68  ? 54  LYS A CG  1 
ATOM   470   C  CD  . LYS A  1 54  ? -30.175 -34.533 30.508  1.00 30.91  ? 54  LYS A CD  1 
ATOM   471   C  CE  . LYS A  1 54  ? -31.500 -34.897 29.847  1.00 31.65  ? 54  LYS A CE  1 
ATOM   472   N  NZ  . LYS A  1 54  ? -31.530 -36.317 29.417  1.00 34.94  ? 54  LYS A NZ  1 
ATOM   473   N  N   . ARG A  1 55  ? -26.756 -31.077 33.378  1.00 22.74  ? 55  ARG A N   1 
ATOM   474   C  CA  . ARG A  1 55  ? -25.905 -30.924 34.552  1.00 26.37  ? 55  ARG A CA  1 
ATOM   475   C  C   . ARG A  1 55  ? -26.142 -29.591 35.227  1.00 25.99  ? 55  ARG A C   1 
ATOM   476   O  O   . ARG A  1 55  ? -26.163 -29.507 36.444  1.00 26.57  ? 55  ARG A O   1 
ATOM   477   C  CB  . ARG A  1 55  ? -24.445 -31.078 34.208  1.00 28.78  ? 55  ARG A CB  1 
ATOM   478   C  CG  . ARG A  1 55  ? -23.560 -31.447 35.464  1.00 35.36  ? 55  ARG A CG  1 
ATOM   479   C  CD  . ARG A  1 55  ? -22.096 -31.299 35.181  1.00 39.53  ? 55  ARG A CD  1 
ATOM   480   N  NE  . ARG A  1 55  ? -21.819 -31.576 33.840  1.00 48.61  ? 55  ARG A NE  1 
ATOM   481   C  CZ  . ARG A  1 55  ? -21.373 -30.700 32.990  1.00 43.49  ? 55  ARG A CZ  1 
ATOM   482   N  NH1 . ARG A  1 55  ? -21.123 -29.452 33.380  1.00 44.21  ? 55  ARG A NH1 1 
ATOM   483   N  NH2 . ARG A  1 55  ? -21.156 -31.050 31.758  1.00 52.44  ? 55  ARG A NH2 1 
ATOM   484   N  N   . ALA A  1 56  ? -26.323 -28.522 34.413  1.00 22.39  ? 56  ALA A N   1 
ATOM   485   C  CA  . ALA A  1 56  ? -26.599 -27.207 34.955  1.00 22.76  ? 56  ALA A CA  1 
ATOM   486   C  C   . ALA A  1 56  ? -27.909 -27.215 35.737  1.00 22.57  ? 56  ALA A C   1 
ATOM   487   O  O   . ALA A  1 56  ? -28.015 -26.592 36.812  1.00 23.43  ? 56  ALA A O   1 
ATOM   488   C  CB  . ALA A  1 56  ? -26.642 -26.151 33.832  1.00 19.97  ? 56  ALA A CB  1 
ATOM   489   N  N   . MET A  1 57  ? -28.902 -27.920 35.214  1.00 21.09  ? 57  MET A N   1 
ATOM   490   C  CA  . MET A  1 57  ? -30.204 -27.992 35.869  1.00 23.55  ? 57  MET A CA  1 
ATOM   491   C  C   . MET A  1 57  ? -30.137 -28.796 37.177  1.00 24.22  ? 57  MET A C   1 
ATOM   492   O  O   . MET A  1 57  ? -30.894 -28.566 38.072  1.00 25.10  ? 57  MET A O   1 
ATOM   493   C  CB  . MET A  1 57  ? -31.272 -28.583 34.914  1.00 23.21  ? 57  MET A CB  1 
ATOM   494   C  CG  . MET A  1 57  ? -31.430 -27.797 33.617  1.00 25.21  ? 57  MET A CG  1 
ATOM   495   S  SD  . MET A  1 57  ? -32.794 -28.354 32.581  1.00 28.00  ? 57  MET A SD  1 
ATOM   496   C  CE  . MET A  1 57  ? -34.216 -27.895 33.593  1.00 27.41  ? 57  MET A CE  1 
ATOM   497   N  N   . GLN A  1 58  ? -29.212 -29.730 37.251  1.00 24.58  ? 58  GLN A N   1 
ATOM   498   C  CA  . GLN A  1 58  ? -29.035 -30.509 38.457  1.00 28.84  ? 58  GLN A CA  1 
ATOM   499   C  C   . GLN A  1 58  ? -28.472 -29.638 39.599  1.00 27.98  ? 58  GLN A C   1 
ATOM   500   O  O   . GLN A  1 58  ? -28.654 -29.935 40.724  1.00 29.91  ? 58  GLN A O   1 
ATOM   501   C  CB  . GLN A  1 58  ? -28.132 -31.706 38.200  1.00 29.42  ? 58  GLN A CB  1 
ATOM   502   C  CG  . GLN A  1 58  ? -28.765 -32.760 37.337  1.00 33.64  ? 58  GLN A CG  1 
ATOM   503   C  CD  . GLN A  1 58  ? -27.792 -33.839 36.919  1.00 39.77  ? 58  GLN A CD  1 
ATOM   504   O  OE1 . GLN A  1 58  ? -28.187 -34.952 36.620  1.00 48.47  ? 58  GLN A OE1 1 
ATOM   505   N  NE2 . GLN A  1 58  ? -26.498 -33.503 36.897  1.00 39.54  ? 58  GLN A NE2 1 
ATOM   506   N  N   . PHE A  1 59  ? -27.784 -28.544 39.235  1.00 26.99  ? 59  PHE A N   1 
ATOM   507   C  CA  . PHE A  1 59  ? -27.290 -27.573 40.236  1.00 27.19  ? 59  PHE A CA  1 
ATOM   508   C  C   . PHE A  1 59  ? -28.329 -26.482 40.545  1.00 25.08  ? 59  PHE A C   1 
ATOM   509   O  O   . PHE A  1 59  ? -28.081 -25.608 41.341  1.00 27.48  ? 59  PHE A O   1 
ATOM   510   C  CB  . PHE A  1 59  ? -25.991 -26.933 39.785  1.00 27.61  ? 59  PHE A CB  1 
ATOM   511   C  CG  . PHE A  1 59  ? -24.779 -27.792 40.009  1.00 27.66  ? 59  PHE A CG  1 
ATOM   512   C  CD1 . PHE A  1 59  ? -24.243 -27.957 41.305  1.00 29.30  ? 59  PHE A CD1 1 
ATOM   513   C  CD2 . PHE A  1 59  ? -24.165 -28.424 38.959  1.00 26.27  ? 59  PHE A CD2 1 
ATOM   514   C  CE1 . PHE A  1 59  ? -23.113 -28.752 41.512  1.00 27.94  ? 59  PHE A CE1 1 
ATOM   515   C  CE2 . PHE A  1 59  ? -23.026 -29.224 39.165  1.00 28.06  ? 59  PHE A CE2 1 
ATOM   516   C  CZ  . PHE A  1 59  ? -22.508 -29.380 40.440  1.00 29.17  ? 59  PHE A CZ  1 
ATOM   517   N  N   . GLY A  1 60  ? -29.478 -26.555 39.898  1.00 22.61  ? 60  GLY A N   1 
ATOM   518   C  CA  . GLY A  1 60  ? -30.579 -25.602 40.177  1.00 23.32  ? 60  GLY A CA  1 
ATOM   519   C  C   . GLY A  1 60  ? -30.752 -24.484 39.134  1.00 22.72  ? 60  GLY A C   1 
ATOM   520   O  O   . GLY A  1 60  ? -31.533 -23.566 39.331  1.00 24.12  ? 60  GLY A O   1 
ATOM   521   N  N   . VAL A  1 61  ? -30.027 -24.570 38.040  1.00 21.91  ? 61  VAL A N   1 
ATOM   522   C  CA  . VAL A  1 61  ? -30.165 -23.588 36.990  1.00 21.15  ? 61  VAL A CA  1 
ATOM   523   C  C   . VAL A  1 61  ? -31.542 -23.708 36.357  1.00 21.84  ? 61  VAL A C   1 
ATOM   524   O  O   . VAL A  1 61  ? -31.959 -24.774 35.999  1.00 22.92  ? 61  VAL A O   1 
ATOM   525   C  CB  . VAL A  1 61  ? -29.082 -23.747 35.916  1.00 20.35  ? 61  VAL A CB  1 
ATOM   526   C  CG1 . VAL A  1 61  ? -29.397 -22.882 34.718  1.00 18.83  ? 61  VAL A CG1 1 
ATOM   527   C  CG2 . VAL A  1 61  ? -27.723 -23.394 36.491  1.00 18.58  ? 61  VAL A CG2 1 
ATOM   528   N  N   . LYS A  1 62  ? -32.229 -22.600 36.234  1.00 23.72  ? 62  LYS A N   1 
ATOM   529   C  CA  . LYS A  1 62  ? -33.583 -22.608 35.716  1.00 25.91  ? 62  LYS A CA  1 
ATOM   530   C  C   . LYS A  1 62  ? -33.669 -21.975 34.317  1.00 25.89  ? 62  LYS A C   1 
ATOM   531   O  O   . LYS A  1 62  ? -34.475 -22.404 33.473  1.00 24.60  ? 62  LYS A O   1 
ATOM   532   C  CB  . LYS A  1 62  ? -34.528 -21.890 36.685  1.00 30.15  ? 62  LYS A CB  1 
ATOM   533   C  CG  . LYS A  1 62  ? -35.959 -21.836 36.215  1.00 43.02  ? 62  LYS A CG  1 
ATOM   534   C  CD  . LYS A  1 62  ? -36.855 -21.177 37.246  1.00 49.31  ? 62  LYS A CD  1 
ATOM   535   C  CE  . LYS A  1 62  ? -38.323 -21.243 36.827  1.00 46.31  ? 62  LYS A CE  1 
ATOM   536   N  NZ  . LYS A  1 62  ? -39.198 -20.629 37.844  1.00 51.30  ? 62  LYS A NZ  1 
ATOM   537   N  N   . THR A  1 63  ? -32.843 -20.967 34.076  1.00 21.08  ? 63  THR A N   1 
ATOM   538   C  CA  . THR A  1 63  ? -32.868 -20.284 32.856  1.00 19.64  ? 63  THR A CA  1 
ATOM   539   C  C   . THR A  1 63  ? -31.469 -20.062 32.326  1.00 19.76  ? 63  THR A C   1 
ATOM   540   O  O   . THR A  1 63  ? -30.548 -19.726 33.078  1.00 19.90  ? 63  THR A O   1 
ATOM   541   C  CB  . THR A  1 63  ? -33.580 -18.938 32.995  1.00 21.33  ? 63  THR A CB  1 
ATOM   542   O  OG1 . THR A  1 63  ? -34.889 -19.152 33.438  1.00 23.83  ? 63  THR A OG1 1 
ATOM   543   C  CG2 . THR A  1 63  ? -33.618 -18.176 31.608  1.00 19.70  ? 63  THR A CG2 1 
ATOM   544   N  N   . ILE A  1 64  ? -31.312 -20.252 31.039  1.00 18.89  ? 64  ILE A N   1 
ATOM   545   C  CA  . ILE A  1 64  ? -30.106 -19.978 30.392  1.00 18.97  ? 64  ILE A CA  1 
ATOM   546   C  C   . ILE A  1 64  ? -30.341 -18.930 29.263  1.00 19.22  ? 64  ILE A C   1 
ATOM   547   O  O   . ILE A  1 64  ? -31.286 -19.068 28.443  1.00 19.17  ? 64  ILE A O   1 
ATOM   548   C  CB  . ILE A  1 64  ? -29.474 -21.285 29.785  1.00 17.55  ? 64  ILE A CB  1 
ATOM   549   C  CG1 . ILE A  1 64  ? -28.959 -22.209 30.913  1.00 16.37  ? 64  ILE A CG1 1 
ATOM   550   C  CG2 . ILE A  1 64  ? -28.356 -20.944 28.804  1.00 16.11  ? 64  ILE A CG2 1 
ATOM   551   C  CD1 . ILE A  1 64  ? -28.504 -23.601 30.418  1.00 16.02  ? 64  ILE A CD1 1 
ATOM   552   N  N   . VAL A  1 65  ? -29.515 -17.899 29.237  1.00 18.91  ? 65  VAL A N   1 
ATOM   553   C  CA  . VAL A  1 65  ? -29.574 -16.911 28.175  1.00 17.38  ? 65  VAL A CA  1 
ATOM   554   C  C   . VAL A  1 65  ? -28.445 -17.184 27.184  1.00 20.36  ? 65  VAL A C   1 
ATOM   555   O  O   . VAL A  1 65  ? -27.240 -17.216 27.563  1.00 17.15  ? 65  VAL A O   1 
ATOM   556   C  CB  . VAL A  1 65  ? -29.487 -15.478 28.719  1.00 17.61  ? 65  VAL A CB  1 
ATOM   557   C  CG1 . VAL A  1 65  ? -29.512 -14.464 27.576  1.00 15.96  ? 65  VAL A CG1 1 
ATOM   558   C  CG2 . VAL A  1 65  ? -30.669 -15.204 29.742  1.00 17.42  ? 65  VAL A CG2 1 
ATOM   559   N  N   . ASP A  1 66  ? -28.812 -17.399 25.941  1.00 21.40  ? 66  ASP A N   1 
ATOM   560   C  CA  . ASP A  1 66  ? -27.870 -17.812 24.932  1.00 24.41  ? 66  ASP A CA  1 
ATOM   561   C  C   . ASP A  1 66  ? -27.739 -16.758 23.840  1.00 21.20  ? 66  ASP A C   1 
ATOM   562   O  O   . ASP A  1 66  ? -28.592 -16.650 22.984  1.00 22.43  ? 66  ASP A O   1 
ATOM   563   C  CB  . ASP A  1 66  ? -28.311 -19.196 24.326  1.00 25.10  ? 66  ASP A CB  1 
ATOM   564   C  CG  . ASP A  1 66  ? -27.406 -19.665 23.238  1.00 28.83  ? 66  ASP A CG  1 
ATOM   565   O  OD1 . ASP A  1 66  ? -26.734 -18.812 22.604  1.00 29.10  ? 66  ASP A OD1 1 
ATOM   566   O  OD2 . ASP A  1 66  ? -27.363 -20.896 22.989  1.00 32.22  ? 66  ASP A OD2 1 
ATOM   567   N  N   . PRO A  1 67  ? -26.635 -15.961 23.886  1.00 21.77  ? 67  PRO A N   1 
ATOM   568   C  CA  . PRO A  1 67  ? -26.414 -14.838 22.933  1.00 21.43  ? 67  PRO A CA  1 
ATOM   569   C  C   . PRO A  1 67  ? -25.769 -15.258 21.591  1.00 21.97  ? 67  PRO A C   1 
ATOM   570   O  O   . PRO A  1 67  ? -24.973 -14.498 21.021  1.00 23.91  ? 67  PRO A O   1 
ATOM   571   C  CB  . PRO A  1 67  ? -25.485 -13.910 23.702  1.00 21.25  ? 67  PRO A CB  1 
ATOM   572   C  CG  . PRO A  1 67  ? -24.692 -14.817 24.595  1.00 22.23  ? 67  PRO A CG  1 
ATOM   573   C  CD  . PRO A  1 67  ? -25.573 -16.038 24.905  1.00 21.49  ? 67  PRO A CD  1 
ATOM   574   N  N   . THR A  1 68  ? -26.113 -16.445 21.101  1.00 19.38  ? 68  THR A N   1 
ATOM   575   C  CA  . THR A  1 68  ? -25.698 -16.864 19.773  1.00 19.61  ? 68  THR A CA  1 
ATOM   576   C  C   . THR A  1 68  ? -26.529 -16.146 18.745  1.00 19.58  ? 68  THR A C   1 
ATOM   577   O  O   . THR A  1 68  ? -27.762 -16.275 18.725  1.00 19.89  ? 68  THR A O   1 
ATOM   578   C  CB  . THR A  1 68  ? -25.873 -18.433 19.568  1.00 20.54  ? 68  THR A CB  1 
ATOM   579   O  OG1 . THR A  1 68  ? -25.353 -19.124 20.689  1.00 22.51  ? 68  THR A OG1 1 
ATOM   580   C  CG2 . THR A  1 68  ? -25.158 -18.885 18.348  1.00 20.17  ? 68  THR A CG2 1 
ATOM   581   N  N   . VAL A  1 69  ? -25.879 -15.375 17.892  1.00 18.71  ? 69  VAL A N   1 
ATOM   582   C  CA  . VAL A  1 69  ? -26.599 -14.592 16.858  1.00 18.27  ? 69  VAL A CA  1 
ATOM   583   C  C   . VAL A  1 69  ? -25.885 -14.671 15.541  1.00 18.77  ? 69  VAL A C   1 
ATOM   584   O  O   . VAL A  1 69  ? -24.933 -15.462 15.383  1.00 20.24  ? 69  VAL A O   1 
ATOM   585   C  CB  . VAL A  1 69  ? -26.776 -13.098 17.289  1.00 19.04  ? 69  VAL A CB  1 
ATOM   586   C  CG1 . VAL A  1 69  ? -27.621 -13.010 18.543  1.00 18.32  ? 69  VAL A CG1 1 
ATOM   587   C  CG2 . VAL A  1 69  ? -25.394 -12.420 17.503  1.00 17.45  ? 69  VAL A CG2 1 
ATOM   588   N  N   . MET A  1 70  ? -26.322 -13.868 14.573  1.00 18.80  ? 70  MET A N   1 
ATOM   589   C  CA  . MET A  1 70  ? -25.679 -13.867 13.252  1.00 19.99  ? 70  MET A CA  1 
ATOM   590   C  C   . MET A  1 70  ? -24.203 -13.722 13.415  1.00 19.81  ? 70  MET A C   1 
ATOM   591   O  O   . MET A  1 70  ? -23.724 -12.775 14.067  1.00 22.31  ? 70  MET A O   1 
ATOM   592   C  CB  . MET A  1 70  ? -26.199 -12.745 12.395  1.00 19.68  ? 70  MET A CB  1 
ATOM   593   C  CG  . MET A  1 70  ? -25.842 -12.900 10.896  1.00 22.75  ? 70  MET A CG  1 
ATOM   594   S  SD  . MET A  1 70  ? -25.216 -11.378 10.154  1.00 25.36  ? 70  MET A SD  1 
ATOM   595   C  CE  . MET A  1 70  ? -23.480 -11.418 10.718  1.00 20.83  ? 70  MET A CE  1 
ATOM   596   N  N   . GLY A  1 71  ? -23.470 -14.624 12.841  1.00 22.49  ? 71  GLY A N   1 
ATOM   597   C  CA  . GLY A  1 71  ? -21.989 -14.607 12.959  1.00 18.80  ? 71  GLY A CA  1 
ATOM   598   C  C   . GLY A  1 71  ? -21.500 -15.686 13.914  1.00 21.25  ? 71  GLY A C   1 
ATOM   599   O  O   . GLY A  1 71  ? -20.334 -16.036 13.909  1.00 20.83  ? 71  GLY A O   1 
ATOM   600   N  N   . LEU A  1 72  ? -22.439 -16.220 14.755  1.00 18.41  ? 72  LEU A N   1 
ATOM   601   C  CA  . LEU A  1 72  ? -22.112 -17.281 15.712  1.00 18.83  ? 72  LEU A CA  1 
ATOM   602   C  C   . LEU A  1 72  ? -22.895 -18.570 15.428  1.00 18.93  ? 72  LEU A C   1 
ATOM   603   O  O   . LEU A  1 72  ? -22.783 -19.562 16.172  1.00 19.33  ? 72  LEU A O   1 
ATOM   604   C  CB  . LEU A  1 72  ? -22.356 -16.801 17.183  1.00 18.38  ? 72  LEU A CB  1 
ATOM   605   C  CG  . LEU A  1 72  ? -21.474 -15.604 17.667  1.00 19.81  ? 72  LEU A CG  1 
ATOM   606   C  CD1 . LEU A  1 72  ? -21.902 -15.118 19.017  1.00 17.97  ? 72  LEU A CD1 1 
ATOM   607   C  CD2 . LEU A  1 72  ? -19.951 -15.977 17.665  1.00 20.23  ? 72  LEU A CD2 1 
ATOM   608   N  N   . GLY A  1 73  ? -23.679 -18.554 14.366  1.00 21.04  ? 73  GLY A N   1 
ATOM   609   C  CA  . GLY A  1 73  ? -24.406 -19.742 13.936  1.00 22.12  ? 73  GLY A CA  1 
ATOM   610   C  C   . GLY A  1 73  ? -25.713 -20.009 14.704  1.00 22.66  ? 73  GLY A C   1 
ATOM   611   O  O   . GLY A  1 73  ? -26.054 -21.154 14.978  1.00 24.57  ? 73  GLY A O   1 
ATOM   612   N  N   . ARG A  1 74  ? -26.428 -18.962 15.033  1.00 24.71  ? 74  ARG A N   1 
ATOM   613   C  CA  . ARG A  1 74  ? -27.720 -19.118 15.711  1.00 21.81  ? 74  ARG A CA  1 
ATOM   614   C  C   . ARG A  1 74  ? -28.595 -20.036 14.924  1.00 24.22  ? 74  ARG A C   1 
ATOM   615   O  O   . ARG A  1 74  ? -28.750 -19.872 13.700  1.00 21.30  ? 74  ARG A O   1 
ATOM   616   C  CB  . ARG A  1 74  ? -28.406 -17.776 15.882  1.00 20.29  ? 74  ARG A CB  1 
ATOM   617   C  CG  . ARG A  1 74  ? -29.807 -17.868 16.579  1.00 18.31  ? 74  ARG A CG  1 
ATOM   618   C  CD  . ARG A  1 74  ? -30.497 -16.504 16.634  1.00 18.49  ? 74  ARG A CD  1 
ATOM   619   N  NE  . ARG A  1 74  ? -30.796 -16.003 15.312  1.00 19.82  ? 74  ARG A NE  1 
ATOM   620   C  CZ  . ARG A  1 74  ? -31.454 -14.895 15.071  1.00 20.29  ? 74  ARG A CZ  1 
ATOM   621   N  NH1 . ARG A  1 74  ? -31.899 -14.148 16.080  1.00 20.09  ? 74  ARG A NH1 1 
ATOM   622   N  NH2 . ARG A  1 74  ? -31.681 -14.514 13.810  1.00 20.85  ? 74  ARG A NH2 1 
ATOM   623   N  N   . ASP A  1 75  ? -29.184 -21.008 15.605  1.00 24.24  ? 75  ASP A N   1 
ATOM   624   C  CA  . ASP A  1 75  ? -30.058 -21.969 14.971  1.00 23.63  ? 75  ASP A CA  1 
ATOM   625   C  C   . ASP A  1 75  ? -31.216 -22.287 15.906  1.00 23.78  ? 75  ASP A C   1 
ATOM   626   O  O   . ASP A  1 75  ? -31.109 -23.181 16.789  1.00 23.29  ? 75  ASP A O   1 
ATOM   627   C  CB  . ASP A  1 75  ? -29.280 -23.239 14.619  1.00 24.63  ? 75  ASP A CB  1 
ATOM   628   C  CG  . ASP A  1 75  ? -30.144 -24.287 13.892  1.00 31.15  ? 75  ASP A CG  1 
ATOM   629   O  OD1 . ASP A  1 75  ? -29.584 -25.166 13.289  1.00 39.84  ? 75  ASP A OD1 1 
ATOM   630   O  OD2 . ASP A  1 75  ? -31.374 -24.197 13.952  1.00 33.18  ? 75  ASP A OD2 1 
ATOM   631   N  N   . ILE A  1 76  ? -32.330 -21.558 15.725  1.00 21.30  ? 76  ILE A N   1 
ATOM   632   C  CA  . ILE A  1 76  ? -33.465 -21.635 16.622  1.00 22.54  ? 76  ILE A CA  1 
ATOM   633   C  C   . ILE A  1 76  ? -34.078 -23.055 16.685  1.00 23.83  ? 76  ILE A C   1 
ATOM   634   O  O   . ILE A  1 76  ? -34.688 -23.443 17.709  1.00 21.83  ? 76  ILE A O   1 
ATOM   635   C  CB  . ILE A  1 76  ? -34.575 -20.620 16.217  1.00 22.03  ? 76  ILE A CB  1 
ATOM   636   C  CG1 . ILE A  1 76  ? -35.542 -20.368 17.395  1.00 21.42  ? 76  ILE A CG1 1 
ATOM   637   C  CG2 . ILE A  1 76  ? -35.315 -21.105 14.976  1.00 21.48  ? 76  ILE A CG2 1 
ATOM   638   C  CD1 . ILE A  1 76  ? -34.911 -19.598 18.563  1.00 19.98  ? 76  ILE A CD1 1 
ATOM   639   N  N   . ARG A  1 77  ? -33.925 -23.810 15.618  1.00 23.40  ? 77  ARG A N   1 
ATOM   640   C  CA  . ARG A  1 77  ? -34.474 -25.180 15.566  1.00 28.03  ? 77  ARG A CA  1 
ATOM   641   C  C   . ARG A  1 77  ? -33.654 -26.142 16.394  1.00 25.76  ? 77  ARG A C   1 
ATOM   642   O  O   . ARG A  1 77  ? -34.199 -27.033 17.043  1.00 29.65  ? 77  ARG A O   1 
ATOM   643   C  CB  . ARG A  1 77  ? -34.597 -25.658 14.118  1.00 29.96  ? 77  ARG A CB  1 
ATOM   644   C  CG  . ARG A  1 77  ? -35.836 -25.086 13.407  1.00 31.76  ? 77  ARG A CG  1 
ATOM   645   C  CD  . ARG A  1 77  ? -35.716 -25.157 11.882  1.00 32.48  ? 77  ARG A CD  1 
ATOM   646   N  NE  . ARG A  1 77  ? -36.849 -24.486 11.237  1.00 31.61  ? 77  ARG A NE  1 
ATOM   647   C  CZ  . ARG A  1 77  ? -36.912 -23.166 10.997  1.00 32.09  ? 77  ARG A CZ  1 
ATOM   648   N  NH1 . ARG A  1 77  ? -35.882 -22.354 11.348  1.00 29.34  ? 77  ARG A NH1 1 
ATOM   649   N  NH2 . ARG A  1 77  ? -37.964 -22.660 10.424  1.00 29.95  ? 77  ARG A NH2 1 
ATOM   650   N  N   . PHE A  1 78  ? -32.323 -25.954 16.376  1.00 24.93  ? 78  PHE A N   1 
ATOM   651   C  CA  . PHE A  1 78  ? -31.414 -26.728 17.230  1.00 22.50  ? 78  PHE A CA  1 
ATOM   652   C  C   . PHE A  1 78  ? -31.711 -26.431 18.694  1.00 22.32  ? 78  PHE A C   1 
ATOM   653   O  O   . PHE A  1 78  ? -31.743 -27.345 19.541  1.00 23.05  ? 78  PHE A O   1 
ATOM   654   C  CB  . PHE A  1 78  ? -29.962 -26.379 16.905  1.00 22.85  ? 78  PHE A CB  1 
ATOM   655   C  CG  . PHE A  1 78  ? -28.941 -27.088 17.789  1.00 23.96  ? 78  PHE A CG  1 
ATOM   656   C  CD1 . PHE A  1 78  ? -28.383 -26.445 18.887  1.00 24.51  ? 78  PHE A CD1 1 
ATOM   657   C  CD2 . PHE A  1 78  ? -28.537 -28.412 17.505  1.00 25.67  ? 78  PHE A CD2 1 
ATOM   658   C  CE1 . PHE A  1 78  ? -27.437 -27.104 19.700  1.00 25.16  ? 78  PHE A CE1 1 
ATOM   659   C  CE2 . PHE A  1 78  ? -27.588 -29.068 18.317  1.00 24.03  ? 78  PHE A CE2 1 
ATOM   660   C  CZ  . PHE A  1 78  ? -27.048 -28.426 19.399  1.00 24.16  ? 78  PHE A CZ  1 
ATOM   661   N  N   . MET A  1 79  ? -31.941 -25.162 18.994  1.00 21.37  ? 79  MET A N   1 
ATOM   662   C  CA  . MET A  1 79  ? -32.239 -24.731 20.379  1.00 21.71  ? 79  MET A CA  1 
ATOM   663   C  C   . MET A  1 79  ? -33.527 -25.332 20.885  1.00 22.58  ? 79  MET A C   1 
ATOM   664   O  O   . MET A  1 79  ? -33.592 -25.798 22.001  1.00 22.61  ? 79  MET A O   1 
ATOM   665   C  CB  . MET A  1 79  ? -32.291 -23.201 20.473  1.00 20.74  ? 79  MET A CB  1 
ATOM   666   C  CG  . MET A  1 79  ? -30.940 -22.503 20.102  1.00 23.20  ? 79  MET A CG  1 
ATOM   667   S  SD  . MET A  1 79  ? -31.079 -20.675 19.940  1.00 26.80  ? 79  MET A SD  1 
ATOM   668   C  CE  . MET A  1 79  ? -30.929 -20.172 21.616  1.00 29.18  ? 79  MET A CE  1 
ATOM   669   N  N   . GLU A  1 80  ? -34.557 -25.329 20.061  1.00 23.44  ? 80  GLU A N   1 
ATOM   670   C  CA  . GLU A  1 80  ? -35.850 -25.909 20.505  1.00 28.19  ? 80  GLU A CA  1 
ATOM   671   C  C   . GLU A  1 80  ? -35.770 -27.431 20.737  1.00 25.19  ? 80  GLU A C   1 
ATOM   672   O  O   . GLU A  1 80  ? -36.452 -27.950 21.568  1.00 26.64  ? 80  GLU A O   1 
ATOM   673   C  CB  . GLU A  1 80  ? -37.054 -25.505 19.564  1.00 28.86  ? 80  GLU A CB  1 
ATOM   674   C  CG  . GLU A  1 80  ? -36.833 -25.683 18.157  1.00 46.51  ? 80  GLU A CG  1 
ATOM   675   C  CD  . GLU A  1 80  ? -37.959 -25.025 17.303  1.00 52.88  ? 80  GLU A CD  1 
ATOM   676   O  OE1 . GLU A  1 80  ? -37.884 -25.094 16.067  1.00 59.68  ? 80  GLU A OE1 1 
ATOM   677   O  OE2 . GLU A  1 80  ? -38.907 -24.443 17.902  1.00 52.51  ? 80  GLU A OE2 1 
ATOM   678   N  N   . LYS A  1 81  ? -34.888 -28.123 19.978  1.00 26.06  ? 81  LYS A N   1 
ATOM   679   C  CA  . LYS A  1 81  ? -34.615 -29.568 20.235  1.00 27.83  ? 81  LYS A CA  1 
ATOM   680   C  C   . LYS A  1 81  ? -34.010 -29.763 21.635  1.00 26.47  ? 81  LYS A C   1 
ATOM   681   O  O   . LYS A  1 81  ? -34.427 -30.622 22.378  1.00 28.94  ? 81  LYS A O   1 
ATOM   682   C  CB  . LYS A  1 81  ? -33.679 -30.147 19.184  1.00 32.67  ? 81  LYS A CB  1 
ATOM   683   C  CG  . LYS A  1 81  ? -34.309 -30.364 17.833  1.00 34.84  ? 81  LYS A CG  1 
ATOM   684   C  CD  . LYS A  1 81  ? -33.321 -31.022 16.864  1.00 35.94  ? 81  LYS A CD  1 
ATOM   685   C  CE  . LYS A  1 81  ? -33.906 -31.109 15.449  1.00 41.28  ? 81  LYS A CE  1 
ATOM   686   N  NZ  . LYS A  1 81  ? -33.054 -31.934 14.553  1.00 52.22  ? 81  LYS A NZ  1 
ATOM   687   N  N   . VAL A  1 82  ? -33.023 -28.950 21.965  1.00 27.92  ? 82  VAL A N   1 
ATOM   688   C  CA  . VAL A  1 82  ? -32.393 -29.020 23.266  1.00 26.13  ? 82  VAL A CA  1 
ATOM   689   C  C   . VAL A  1 82  ? -33.422 -28.714 24.394  1.00 27.22  ? 82  VAL A C   1 
ATOM   690   O  O   . VAL A  1 82  ? -33.472 -29.413 25.404  1.00 28.26  ? 82  VAL A O   1 
ATOM   691   C  CB  . VAL A  1 82  ? -31.182 -28.061 23.367  1.00 25.90  ? 82  VAL A CB  1 
ATOM   692   C  CG1 . VAL A  1 82  ? -30.696 -27.946 24.840  1.00 24.15  ? 82  VAL A CG1 1 
ATOM   693   C  CG2 . VAL A  1 82  ? -30.071 -28.531 22.470  1.00 22.02  ? 82  VAL A CG2 1 
ATOM   694   N  N   . VAL A  1 83  ? -34.233 -27.671 24.195  1.00 26.54  ? 83  VAL A N   1 
ATOM   695   C  CA  . VAL A  1 83  ? -35.286 -27.341 25.144  1.00 24.81  ? 83  VAL A CA  1 
ATOM   696   C  C   . VAL A  1 83  ? -36.240 -28.545 25.337  1.00 26.97  ? 83  VAL A C   1 
ATOM   697   O  O   . VAL A  1 83  ? -36.522 -28.961 26.481  1.00 25.75  ? 83  VAL A O   1 
ATOM   698   C  CB  . VAL A  1 83  ? -36.087 -26.106 24.702  1.00 24.44  ? 83  VAL A CB  1 
ATOM   699   C  CG1 . VAL A  1 83  ? -37.440 -26.008 25.492  1.00 25.53  ? 83  VAL A CG1 1 
ATOM   700   C  CG2 . VAL A  1 83  ? -35.261 -24.848 24.878  1.00 22.44  ? 83  VAL A CG2 1 
ATOM   701   N  N   . LYS A  1 84  ? -36.723 -29.100 24.229  1.00 28.73  ? 84  LYS A N   1 
ATOM   702   C  CA  . LYS A  1 84  ? -37.629 -30.262 24.291  1.00 31.37  ? 84  LYS A CA  1 
ATOM   703   C  C   . LYS A  1 84  ? -37.015 -31.427 25.049  1.00 28.12  ? 84  LYS A C   1 
ATOM   704   O  O   . LYS A  1 84  ? -37.685 -32.130 25.706  1.00 27.74  ? 84  LYS A O   1 
ATOM   705   C  CB  . LYS A  1 84  ? -38.071 -30.724 22.852  1.00 34.37  ? 84  LYS A CB  1 
ATOM   706   C  CG  . LYS A  1 84  ? -39.103 -29.812 22.189  1.00 42.24  ? 84  LYS A CG  1 
ATOM   707   C  CD  . LYS A  1 84  ? -39.866 -30.541 21.062  1.00 53.86  ? 84  LYS A CD  1 
ATOM   708   C  CE  . LYS A  1 84  ? -38.931 -30.949 19.899  1.00 67.31  ? 84  LYS A CE  1 
ATOM   709   N  NZ  . LYS A  1 84  ? -38.453 -29.763 19.096  1.00 73.29  ? 84  LYS A NZ  1 
ATOM   710   N  N   . ALA A  1 85  ? -35.703 -31.593 24.926  1.00 25.24  ? 85  ALA A N   1 
ATOM   711   C  CA  . ALA A  1 85  ? -35.012 -32.734 25.547  1.00 26.31  ? 85  ALA A CA  1 
ATOM   712   C  C   . ALA A  1 85  ? -34.609 -32.488 27.047  1.00 30.08  ? 85  ALA A C   1 
ATOM   713   O  O   . ALA A  1 85  ? -34.300 -33.436 27.774  1.00 29.77  ? 85  ALA A O   1 
ATOM   714   C  CB  . ALA A  1 85  ? -33.797 -33.128 24.734  1.00 25.50  ? 85  ALA A CB  1 
ATOM   715   N  N   . THR A  1 86  ? -34.618 -31.220 27.479  1.00 27.50  ? 86  THR A N   1 
ATOM   716   C  CA  . THR A  1 86  ? -34.156 -30.881 28.852  1.00 26.13  ? 86  THR A CA  1 
ATOM   717   C  C   . THR A  1 86  ? -35.241 -30.210 29.723  1.00 26.66  ? 86  THR A C   1 
ATOM   718   O  O   . THR A  1 86  ? -35.282 -30.411 30.936  1.00 30.09  ? 86  THR A O   1 
ATOM   719   C  CB  . THR A  1 86  ? -32.887 -29.978 28.826  1.00 24.18  ? 86  THR A CB  1 
ATOM   720   O  OG1 . THR A  1 86  ? -33.204 -28.716 28.215  1.00 25.39  ? 86  THR A OG1 1 
ATOM   721   C  CG2 . THR A  1 86  ? -31.756 -30.652 28.046  1.00 21.07  ? 86  THR A CG2 1 
ATOM   722   N  N   . GLY A  1 87  ? -36.094 -29.425 29.104  1.00 27.40  ? 87  GLY A N   1 
ATOM   723   C  CA  . GLY A  1 87  ? -37.144 -28.643 29.872  1.00 26.05  ? 87  GLY A CA  1 
ATOM   724   C  C   . GLY A  1 87  ? -36.585 -27.277 30.413  1.00 26.65  ? 87  GLY A C   1 
ATOM   725   O  O   . GLY A  1 87  ? -37.254 -26.574 31.182  1.00 26.85  ? 87  GLY A O   1 
ATOM   726   N  N   . ILE A  1 88  ? -35.383 -26.930 29.997  1.00 23.15  ? 88  ILE A N   1 
ATOM   727   C  CA  . ILE A  1 88  ? -34.757 -25.631 30.410  1.00 22.45  ? 88  ILE A CA  1 
ATOM   728   C  C   . ILE A  1 88  ? -35.529 -24.427 29.878  1.00 21.70  ? 88  ILE A C   1 
ATOM   729   O  O   . ILE A  1 88  ? -36.125 -24.487 28.801  1.00 22.57  ? 88  ILE A O   1 
ATOM   730   C  CB  . ILE A  1 88  ? -33.290 -25.523 29.911  1.00 20.74  ? 88  ILE A CB  1 
ATOM   731   C  CG1 . ILE A  1 88  ? -32.581 -24.333 30.560  1.00 22.39  ? 88  ILE A CG1 1 
ATOM   732   C  CG2 . ILE A  1 88  ? -33.250 -25.399 28.392  1.00 19.55  ? 88  ILE A CG2 1 
ATOM   733   C  CD1 . ILE A  1 88  ? -32.164 -24.571 32.040  1.00 21.34  ? 88  ILE A CD1 1 
ATOM   734   N  N   . ASN A  1 89  ? -35.525 -23.323 30.655  1.00 21.88  ? 89  ASN A N   1 
ATOM   735   C  CA  . ASN A  1 89  ? -35.935 -22.039 30.145  1.00 22.42  ? 89  ASN A CA  1 
ATOM   736   C  C   . ASN A  1 89  ? -34.799 -21.463 29.329  1.00 21.94  ? 89  ASN A C   1 
ATOM   737   O  O   . ASN A  1 89  ? -33.729 -21.238 29.843  1.00 24.83  ? 89  ASN A O   1 
ATOM   738   C  CB  . ASN A  1 89  ? -36.262 -21.081 31.287  1.00 22.86  ? 89  ASN A CB  1 
ATOM   739   C  CG  . ASN A  1 89  ? -37.608 -21.377 31.944  1.00 24.26  ? 89  ASN A CG  1 
ATOM   740   O  OD1 . ASN A  1 89  ? -38.436 -22.095 31.398  1.00 24.13  ? 89  ASN A OD1 1 
ATOM   741   N  ND2 . ASN A  1 89  ? -37.822 -20.806 33.122  1.00 24.02  ? 89  ASN A ND2 1 
ATOM   742   N  N   . LEU A  1 90  ? -35.037 -21.232 28.063  1.00 22.84  ? 90  LEU A N   1 
ATOM   743   C  CA  . LEU A  1 90  ? -33.968 -20.729 27.157  1.00 19.92  ? 90  LEU A CA  1 
ATOM   744   C  C   . LEU A  1 90  ? -34.371 -19.435 26.492  1.00 20.23  ? 90  LEU A C   1 
ATOM   745   O  O   . LEU A  1 90  ? -35.390 -19.373 25.790  1.00 21.63  ? 90  LEU A O   1 
ATOM   746   C  CB  . LEU A  1 90  ? -33.623 -21.797 26.089  1.00 20.09  ? 90  LEU A CB  1 
ATOM   747   C  CG  . LEU A  1 90  ? -32.468 -21.512 25.129  1.00 21.95  ? 90  LEU A CG  1 
ATOM   748   C  CD1 . LEU A  1 90  ? -31.097 -21.508 25.871  1.00 21.44  ? 90  LEU A CD1 1 
ATOM   749   C  CD2 . LEU A  1 90  ? -32.462 -22.512 24.007  1.00 24.33  ? 90  LEU A CD2 1 
ATOM   750   N  N   . VAL A  1 91  ? -33.590 -18.389 26.716  1.00 19.19  ? 91  VAL A N   1 
ATOM   751   C  CA  . VAL A  1 91  ? -33.847 -17.100 26.077  1.00 18.44  ? 91  VAL A CA  1 
ATOM   752   C  C   . VAL A  1 91  ? -32.938 -16.923 24.909  1.00 20.91  ? 91  VAL A C   1 
ATOM   753   O  O   . VAL A  1 91  ? -31.657 -16.927 25.062  1.00 19.70  ? 91  VAL A O   1 
ATOM   754   C  CB  . VAL A  1 91  ? -33.649 -15.945 27.040  1.00 18.20  ? 91  VAL A CB  1 
ATOM   755   C  CG1 . VAL A  1 91  ? -34.142 -14.642 26.415  1.00 17.27  ? 91  VAL A CG1 1 
ATOM   756   C  CG2 . VAL A  1 91  ? -34.394 -16.231 28.390  1.00 17.03  ? 91  VAL A CG2 1 
ATOM   757   N  N   . ALA A  1 92  ? -33.538 -16.780 23.714  1.00 20.04  ? 92  ALA A N   1 
ATOM   758   C  CA  . ALA A  1 92  ? -32.776 -16.549 22.499  1.00 21.24  ? 92  ALA A CA  1 
ATOM   759   C  C   . ALA A  1 92  ? -32.765 -15.117 22.218  1.00 19.47  ? 92  ALA A C   1 
ATOM   760   O  O   . ALA A  1 92  ? -33.606 -14.372 22.729  1.00 21.22  ? 92  ALA A O   1 
ATOM   761   C  CB  . ALA A  1 92  ? -33.400 -17.334 21.309  1.00 20.38  ? 92  ALA A CB  1 
ATOM   762   N  N   . GLY A  1 93  ? -31.828 -14.684 21.421  1.00 17.82  ? 93  GLY A N   1 
ATOM   763   C  CA  . GLY A  1 93  ? -31.736 -13.284 21.075  1.00 17.80  ? 93  GLY A CA  1 
ATOM   764   C  C   . GLY A  1 93  ? -31.576 -13.044 19.581  1.00 19.64  ? 93  GLY A C   1 
ATOM   765   O  O   . GLY A  1 93  ? -31.603 -14.002 18.756  1.00 18.67  ? 93  GLY A O   1 
ATOM   766   N  N   . THR A  1 94  ? -31.418 -11.799 19.227  1.00 19.82  ? 94  THR A N   1 
ATOM   767   C  CA  . THR A  1 94  ? -31.143 -11.426 17.926  1.00 18.07  ? 94  THR A CA  1 
ATOM   768   C  C   . THR A  1 94  ? -29.984 -10.484 17.974  1.00 20.01  ? 94  THR A C   1 
ATOM   769   O  O   . THR A  1 94  ? -29.523 -10.131 19.045  1.00 19.58  ? 94  THR A O   1 
ATOM   770   C  CB  . THR A  1 94  ? -32.368 -10.711 17.269  1.00 18.41  ? 94  THR A CB  1 
ATOM   771   O  OG1 . THR A  1 94  ? -32.092 -10.449 15.889  1.00 20.34  ? 94  THR A OG1 1 
ATOM   772   C  CG2 . THR A  1 94  ? -32.692 -9.385  18.000  1.00 15.81  ? 94  THR A CG2 1 
ATOM   773   N  N   . GLY A  1 95  ? -29.500 -10.077 16.821  1.00 21.66  ? 95  GLY A N   1 
ATOM   774   C  CA  . GLY A  1 95  ? -28.352 -9.181  16.763  1.00 19.91  ? 95  GLY A CA  1 
ATOM   775   C  C   . GLY A  1 95  ? -27.357 -9.584  15.730  1.00 20.89  ? 95  GLY A C   1 
ATOM   776   O  O   . GLY A  1 95  ? -27.630 -10.426 14.905  1.00 19.30  ? 95  GLY A O   1 
ATOM   777   N  N   . ILE A  1 96  ? -26.162 -8.957  15.781  1.00 19.29  ? 96  ILE A N   1 
ATOM   778   C  CA  . ILE A  1 96  ? -25.097 -9.221  14.816  1.00 21.71  ? 96  ILE A CA  1 
ATOM   779   C  C   . ILE A  1 96  ? -23.795 -9.219  15.505  1.00 23.23  ? 96  ILE A C   1 
ATOM   780   O  O   . ILE A  1 96  ? -23.502 -8.316  16.302  1.00 21.70  ? 96  ILE A O   1 
ATOM   781   C  CB  . ILE A  1 96  ? -25.061 -8.143  13.687  1.00 22.63  ? 96  ILE A CB  1 
ATOM   782   C  CG1 . ILE A  1 96  ? -26.261 -8.291  12.773  1.00 20.79  ? 96  ILE A CG1 1 
ATOM   783   C  CG2 . ILE A  1 96  ? -23.757 -8.248  12.878  1.00 20.78  ? 96  ILE A CG2 1 
ATOM   784   C  CD1 . ILE A  1 96  ? -26.336 -7.220  11.686  1.00 22.32  ? 96  ILE A CD1 1 
ATOM   785   N  N   . TYR A  1 97  ? -22.985 -10.222 15.217  1.00 21.28  ? 97  TYR A N   1 
ATOM   786   C  CA  . TYR A  1 97  ? -21.734 -10.380 15.857  1.00 23.00  ? 97  TYR A CA  1 
ATOM   787   C  C   . TYR A  1 97  ? -20.614 -10.232 14.839  1.00 24.27  ? 97  TYR A C   1 
ATOM   788   O  O   . TYR A  1 97  ? -20.365 -11.146 14.038  1.00 23.83  ? 97  TYR A O   1 
ATOM   789   C  CB  . TYR A  1 97  ? -21.671 -11.764 16.518  1.00 21.89  ? 97  TYR A CB  1 
ATOM   790   C  CG  . TYR A  1 97  ? -20.425 -12.036 17.346  1.00 21.67  ? 97  TYR A CG  1 
ATOM   791   C  CD1 . TYR A  1 97  ? -19.220 -12.379 16.739  1.00 25.05  ? 97  TYR A CD1 1 
ATOM   792   C  CD2 . TYR A  1 97  ? -20.467 -11.980 18.768  1.00 21.83  ? 97  TYR A CD2 1 
ATOM   793   C  CE1 . TYR A  1 97  ? -18.089 -12.643 17.492  1.00 25.34  ? 97  TYR A CE1 1 
ATOM   794   C  CE2 . TYR A  1 97  ? -19.355 -12.240 19.521  1.00 24.72  ? 97  TYR A CE2 1 
ATOM   795   C  CZ  . TYR A  1 97  ? -18.161 -12.573 18.893  1.00 27.19  ? 97  TYR A CZ  1 
ATOM   796   O  OH  . TYR A  1 97  ? -17.060 -12.835 19.645  1.00 34.09  ? 97  TYR A OH  1 
ATOM   797   N  N   . ILE A  1 98  ? -19.940 -9.062  14.863  1.00 25.11  ? 98  ILE A N   1 
ATOM   798   C  CA  . ILE A  1 98  ? -18.791 -8.789  13.965  1.00 28.78  ? 98  ILE A CA  1 
ATOM   799   C  C   . ILE A  1 98  ? -17.708 -8.013  14.708  1.00 30.10  ? 98  ILE A C   1 
ATOM   800   O  O   . ILE A  1 98  ? -17.973 -7.405  15.756  1.00 29.85  ? 98  ILE A O   1 
ATOM   801   C  CB  . ILE A  1 98  ? -19.214 -7.963  12.718  1.00 26.62  ? 98  ILE A CB  1 
ATOM   802   C  CG1 . ILE A  1 98  ? -19.888 -6.649  13.155  1.00 27.91  ? 98  ILE A CG1 1 
ATOM   803   C  CG2 . ILE A  1 98  ? -20.125 -8.774  11.817  1.00 24.68  ? 98  ILE A CG2 1 
ATOM   804   C  CD1 . ILE A  1 98  ? -19.919 -5.580  12.074  1.00 31.04  ? 98  ILE A CD1 1 
ATOM   805   N  N   . TYR A  1 99  ? -16.486 -8.033  14.170  1.00 28.29  ? 99  TYR A N   1 
ATOM   806   C  CA  . TYR A  1 99  ? -15.372 -7.273  14.765  1.00 30.03  ? 99  TYR A CA  1 
ATOM   807   C  C   . TYR A  1 99  ? -14.951 -6.109  13.878  1.00 29.73  ? 99  TYR A C   1 
ATOM   808   O  O   . TYR A  1 99  ? -14.478 -5.101  14.361  1.00 30.16  ? 99  TYR A O   1 
ATOM   809   C  CB  . TYR A  1 99  ? -14.156 -8.177  15.029  1.00 30.66  ? 99  TYR A CB  1 
ATOM   810   C  CG  . TYR A  1 99  ? -14.365 -9.274  16.121  1.00 34.46  ? 99  TYR A CG  1 
ATOM   811   C  CD1 . TYR A  1 99  ? -15.503 -9.271  16.955  1.00 34.95  ? 99  TYR A CD1 1 
ATOM   812   C  CD2 . TYR A  1 99  ? -13.389 -10.292 16.321  1.00 36.08  ? 99  TYR A CD2 1 
ATOM   813   C  CE1 . TYR A  1 99  ? -15.679 -10.255 17.938  1.00 34.62  ? 99  TYR A CE1 1 
ATOM   814   C  CE2 . TYR A  1 99  ? -13.551 -11.274 17.298  1.00 38.02  ? 99  TYR A CE2 1 
ATOM   815   C  CZ  . TYR A  1 99  ? -14.681 -11.266 18.103  1.00 37.60  ? 99  TYR A CZ  1 
ATOM   816   O  OH  . TYR A  1 99  ? -14.832 -12.241 19.065  1.00 37.08  ? 99  TYR A OH  1 
ATOM   817   N  N   . ILE A  1 100 ? -15.123 -6.269  12.569  1.00 32.12  ? 100 ILE A N   1 
ATOM   818   C  CA  . ILE A  1 100 ? -14.670 -5.257  11.617  1.00 29.94  ? 100 ILE A CA  1 
ATOM   819   C  C   . ILE A  1 100 ? -15.793 -4.775  10.706  1.00 29.12  ? 100 ILE A C   1 
ATOM   820   O  O   . ILE A  1 100 ? -16.360 -3.716  10.927  1.00 29.34  ? 100 ILE A O   1 
ATOM   821   C  CB  . ILE A  1 100 ? -13.462 -5.770  10.763  1.00 32.13  ? 100 ILE A CB  1 
ATOM   822   C  CG1 . ILE A  1 100 ? -12.343 -6.302  11.687  1.00 34.92  ? 100 ILE A CG1 1 
ATOM   823   C  CG2 . ILE A  1 100 ? -12.942 -4.660  9.848   1.00 32.39  ? 100 ILE A CG2 1 
ATOM   824   C  CD1 . ILE A  1 100 ? -11.164 -6.941  10.950  1.00 34.15  ? 100 ILE A CD1 1 
ATOM   825   N  N   . ASP A  1 101 ? -16.110 -5.558  9.686   1.00 29.72  ? 101 ASP A N   1 
ATOM   826   C  CA  . ASP A  1 101 ? -17.152 -5.162  8.709   1.00 30.85  ? 101 ASP A CA  1 
ATOM   827   C  C   . ASP A  1 101 ? -18.350 -6.069  8.723   1.00 28.07  ? 101 ASP A C   1 
ATOM   828   O  O   . ASP A  1 101 ? -18.275 -7.202  9.157   1.00 27.29  ? 101 ASP A O   1 
ATOM   829   C  CB  . ASP A  1 101 ? -16.568 -5.103  7.293   1.00 36.62  ? 101 ASP A CB  1 
ATOM   830   C  CG  . ASP A  1 101 ? -15.630 -3.940  7.101   1.00 46.54  ? 101 ASP A CG  1 
ATOM   831   O  OD1 . ASP A  1 101 ? -15.449 -3.141  8.069   1.00 50.35  ? 101 ASP A OD1 1 
ATOM   832   O  OD2 . ASP A  1 101 ? -15.065 -3.808  5.988   1.00 52.73  ? 101 ASP A OD2 1 
ATOM   833   N  N   . LEU A  1 102 ? -19.470 -5.547  8.236   1.00 28.80  ? 102 LEU A N   1 
ATOM   834   C  CA  . LEU A  1 102 ? -20.654 -6.308  8.062   1.00 28.90  ? 102 LEU A CA  1 
ATOM   835   C  C   . LEU A  1 102 ? -20.548 -7.093  6.798   1.00 28.48  ? 102 LEU A C   1 
ATOM   836   O  O   . LEU A  1 102 ? -19.759 -6.770  5.945   1.00 29.39  ? 102 LEU A O   1 
ATOM   837   C  CB  . LEU A  1 102 ? -21.875 -5.365  7.973   1.00 26.80  ? 102 LEU A CB  1 
ATOM   838   C  CG  . LEU A  1 102 ? -22.306 -4.692  9.253   1.00 30.56  ? 102 LEU A CG  1 
ATOM   839   C  CD1 . LEU A  1 102 ? -23.069 -3.407  8.958   1.00 26.88  ? 102 LEU A CD1 1 
ATOM   840   C  CD2 . LEU A  1 102 ? -23.162 -5.653  10.093  1.00 25.79  ? 102 LEU A CD2 1 
ATOM   841   N  N   . PRO A  1 103 ? -21.341 -8.144  6.675   1.00 28.38  ? 103 PRO A N   1 
ATOM   842   C  CA  . PRO A  1 103 ? -21.448 -8.880  5.398   1.00 28.48  ? 103 PRO A CA  1 
ATOM   843   C  C   . PRO A  1 103 ? -21.791 -7.907  4.235   1.00 30.98  ? 103 PRO A C   1 
ATOM   844   O  O   . PRO A  1 103 ? -22.447 -6.874  4.457   1.00 30.04  ? 103 PRO A O   1 
ATOM   845   C  CB  . PRO A  1 103 ? -22.602 -9.826  5.645   1.00 29.36  ? 103 PRO A CB  1 
ATOM   846   C  CG  . PRO A  1 103 ? -22.554 -10.096 7.129   1.00 31.55  ? 103 PRO A CG  1 
ATOM   847   C  CD  . PRO A  1 103 ? -22.105 -8.792  7.758   1.00 28.89  ? 103 PRO A CD  1 
ATOM   848   N  N   A PHE A  1 104 ? -21.353 -8.241  3.035   0.50 32.52  ? 104 PHE A N   1 
ATOM   849   N  N   B PHE A  1 104 ? -21.352 -8.248  3.007   0.50 31.54  ? 104 PHE A N   1 
ATOM   850   C  CA  A PHE A  1 104 ? -21.562 -7.377  1.872   0.50 32.40  ? 104 PHE A CA  1 
ATOM   851   C  CA  B PHE A  1 104 ? -21.585 -7.367  1.834   0.50 30.87  ? 104 PHE A CA  1 
ATOM   852   C  C   A PHE A  1 104 ? -23.052 -7.008  1.682   0.50 31.65  ? 104 PHE A C   1 
ATOM   853   C  C   B PHE A  1 104 ? -23.061 -7.020  1.650   0.50 30.73  ? 104 PHE A C   1 
ATOM   854   O  O   A PHE A  1 104 ? -23.373 -5.986  1.087   0.50 30.85  ? 104 PHE A O   1 
ATOM   855   O  O   B PHE A  1 104 ? -23.393 -6.018  1.029   0.50 30.11  ? 104 PHE A O   1 
ATOM   856   C  CB  A PHE A  1 104 ? -21.004 -8.033  0.610   0.50 33.90  ? 104 PHE A CB  1 
ATOM   857   C  CB  B PHE A  1 104 ? -20.988 -7.990  0.512   0.50 30.83  ? 104 PHE A CB  1 
ATOM   858   C  CG  A PHE A  1 104 ? -19.570 -8.485  0.745   0.50 36.38  ? 104 PHE A CG  1 
ATOM   859   C  CG  B PHE A  1 104 ? -21.665 -9.279  0.073   0.50 30.96  ? 104 PHE A CG  1 
ATOM   860   C  CD1 A PHE A  1 104 ? -19.264 -9.823  0.904   0.50 37.30  ? 104 PHE A CD1 1 
ATOM   861   C  CD1 B PHE A  1 104 ? -20.931 -10.465 -0.053  0.50 31.83  ? 104 PHE A CD1 1 
ATOM   862   C  CD2 A PHE A  1 104 ? -18.532 -7.564  0.723   0.50 36.66  ? 104 PHE A CD2 1 
ATOM   863   C  CD2 B PHE A  1 104 ? -23.024 -9.305  -0.215  0.50 31.89  ? 104 PHE A CD2 1 
ATOM   864   C  CE1 A PHE A  1 104 ? -17.947 -10.236 1.032   0.50 38.74  ? 104 PHE A CE1 1 
ATOM   865   C  CE1 B PHE A  1 104 ? -21.549 -11.645 -0.458  0.50 28.85  ? 104 PHE A CE1 1 
ATOM   866   C  CE2 A PHE A  1 104 ? -17.221 -7.977  0.852   0.50 36.22  ? 104 PHE A CE2 1 
ATOM   867   C  CE2 B PHE A  1 104 ? -23.644 -10.486 -0.617  0.50 29.90  ? 104 PHE A CE2 1 
ATOM   868   C  CZ  A PHE A  1 104 ? -16.931 -9.310  1.005   0.50 35.64  ? 104 PHE A CZ  1 
ATOM   869   C  CZ  B PHE A  1 104 ? -22.899 -11.655 -0.738  0.50 31.34  ? 104 PHE A CZ  1 
ATOM   870   N  N   . TYR A  1 105 ? -23.941 -7.852  2.200   1.00 30.65  ? 105 TYR A N   1 
ATOM   871   C  CA  . TYR A  1 105 ? -25.386 -7.597  2.110   1.00 28.29  ? 105 TYR A CA  1 
ATOM   872   C  C   . TYR A  1 105 ? -25.761 -6.168  2.613   1.00 29.69  ? 105 TYR A C   1 
ATOM   873   O  O   . TYR A  1 105 ? -26.725 -5.556  2.123   1.00 28.07  ? 105 TYR A O   1 
ATOM   874   C  CB  . TYR A  1 105 ? -26.179 -8.625  2.897   1.00 26.47  ? 105 TYR A CB  1 
ATOM   875   C  CG  . TYR A  1 105 ? -27.640 -8.220  3.072   1.00 28.00  ? 105 TYR A CG  1 
ATOM   876   C  CD1 . TYR A  1 105 ? -28.590 -8.514  2.081   1.00 27.23  ? 105 TYR A CD1 1 
ATOM   877   C  CD2 . TYR A  1 105 ? -28.069 -7.516  4.218   1.00 26.23  ? 105 TYR A CD2 1 
ATOM   878   C  CE1 . TYR A  1 105 ? -29.944 -8.131  2.223   1.00 27.05  ? 105 TYR A CE1 1 
ATOM   879   C  CE2 . TYR A  1 105 ? -29.416 -7.130  4.370   1.00 28.70  ? 105 TYR A CE2 1 
ATOM   880   C  CZ  . TYR A  1 105 ? -30.350 -7.448  3.353   1.00 27.89  ? 105 TYR A CZ  1 
ATOM   881   O  OH  . TYR A  1 105 ? -31.683 -7.075  3.484   1.00 31.80  ? 105 TYR A OH  1 
ATOM   882   N  N   . PHE A  1 106 ? -24.992 -5.654  3.592   1.00 28.06  ? 106 PHE A N   1 
ATOM   883   C  CA  . PHE A  1 106 ? -25.345 -4.362  4.253   1.00 30.57  ? 106 PHE A CA  1 
ATOM   884   C  C   . PHE A  1 106 ? -24.737 -3.124  3.579   1.00 32.42  ? 106 PHE A C   1 
ATOM   885   O  O   . PHE A  1 106 ? -24.989 -1.996  4.005   1.00 30.98  ? 106 PHE A O   1 
ATOM   886   C  CB  . PHE A  1 106 ? -24.990 -4.399  5.751   1.00 28.10  ? 106 PHE A CB  1 
ATOM   887   C  CG  . PHE A  1 106 ? -25.724 -5.460  6.516   1.00 27.56  ? 106 PHE A CG  1 
ATOM   888   C  CD1 . PHE A  1 106 ? -25.129 -6.723  6.753   1.00 26.42  ? 106 PHE A CD1 1 
ATOM   889   C  CD2 . PHE A  1 106 ? -27.024 -5.223  7.006   1.00 29.30  ? 106 PHE A CD2 1 
ATOM   890   C  CE1 . PHE A  1 106 ? -25.811 -7.708  7.461   1.00 26.53  ? 106 PHE A CE1 1 
ATOM   891   C  CE2 . PHE A  1 106 ? -27.715 -6.219  7.721   1.00 27.45  ? 106 PHE A CE2 1 
ATOM   892   C  CZ  . PHE A  1 106 ? -27.115 -7.454  7.947   1.00 24.34  ? 106 PHE A CZ  1 
ATOM   893   N  N   . LEU A  1 107 ? -23.945 -3.337  2.539   1.00 34.52  ? 107 LEU A N   1 
ATOM   894   C  CA  . LEU A  1 107 ? -23.404 -2.237  1.784   1.00 39.87  ? 107 LEU A CA  1 
ATOM   895   C  C   . LEU A  1 107 ? -24.538 -1.361  1.266   1.00 39.90  ? 107 LEU A C   1 
ATOM   896   O  O   . LEU A  1 107 ? -25.424 -1.837  0.546   1.00 41.74  ? 107 LEU A O   1 
ATOM   897   C  CB  . LEU A  1 107 ? -22.543 -2.745  0.616   1.00 43.04  ? 107 LEU A CB  1 
ATOM   898   C  CG  . LEU A  1 107 ? -21.113 -3.202  0.982   1.00 56.55  ? 107 LEU A CG  1 
ATOM   899   C  CD1 . LEU A  1 107 ? -20.487 -4.037  -0.135  1.00 54.19  ? 107 LEU A CD1 1 
ATOM   900   C  CD2 . LEU A  1 107 ? -20.221 -1.995  1.342   1.00 48.47  ? 107 LEU A CD2 1 
ATOM   901   N  N   . ASN A  1 108 ? -24.514 -0.080  1.646   1.00 38.60  ? 108 ASN A N   1 
ATOM   902   C  CA  . ASN A  1 108 ? -25.556 0.868   1.244   1.00 45.17  ? 108 ASN A CA  1 
ATOM   903   C  C   . ASN A  1 108 ? -26.948 0.575   1.886   1.00 41.76  ? 108 ASN A C   1 
ATOM   904   O  O   . ASN A  1 108 ? -27.962 0.823   1.292   1.00 48.07  ? 108 ASN A O   1 
ATOM   905   C  CB  . ASN A  1 108 ? -25.670 0.933   -0.277  1.00 52.33  ? 108 ASN A CB  1 
ATOM   906   C  CG  . ASN A  1 108 ? -24.424 1.489   -0.928  1.00 58.46  ? 108 ASN A CG  1 
ATOM   907   O  OD1 . ASN A  1 108 ? -24.056 1.090   -2.035  1.00 64.45  ? 108 ASN A OD1 1 
ATOM   908   N  ND2 . ASN A  1 108 ? -23.750 2.423   -0.232  1.00 56.89  ? 108 ASN A ND2 1 
ATOM   909   N  N   . ARG A  1 109 ? -26.938 0.045   3.090   1.00 38.10  ? 109 ARG A N   1 
ATOM   910   C  CA  . ARG A  1 109 ? -28.179 -0.141  3.854   1.00 36.20  ? 109 ARG A CA  1 
ATOM   911   C  C   . ARG A  1 109 ? -28.114 0.646   5.125   1.00 31.07  ? 109 ARG A C   1 
ATOM   912   O  O   . ARG A  1 109 ? -27.109 0.705   5.747   1.00 29.52  ? 109 ARG A O   1 
ATOM   913   C  CB  . ARG A  1 109 ? -28.441 -1.645  4.138   1.00 33.37  ? 109 ARG A CB  1 
ATOM   914   C  CG  . ARG A  1 109 ? -28.770 -2.454  2.876   1.00 35.25  ? 109 ARG A CG  1 
ATOM   915   C  CD  . ARG A  1 109 ? -29.203 -3.851  3.200   1.00 35.03  ? 109 ARG A CD  1 
ATOM   916   N  NE  . ARG A  1 109 ? -29.395 -4.665  1.968   1.00 38.36  ? 109 ARG A NE  1 
ATOM   917   C  CZ  . ARG A  1 109 ? -30.529 -4.680  1.236   1.00 37.90  ? 109 ARG A CZ  1 
ATOM   918   N  NH1 . ARG A  1 109 ? -30.613 -5.438  0.150   1.00 36.07  ? 109 ARG A NH1 1 
ATOM   919   N  NH2 . ARG A  1 109 ? -31.555 -3.944  1.594   1.00 36.11  ? 109 ARG A NH2 1 
ATOM   920   N  N   . SER A  1 110 ? -29.213 1.257   5.488   1.00 31.01  ? 110 SER A N   1 
ATOM   921   C  CA  . SER A  1 110 ? -29.238 2.176   6.622   1.00 31.46  ? 110 SER A CA  1 
ATOM   922   C  C   . SER A  1 110 ? -29.184 1.452   7.974   1.00 32.61  ? 110 SER A C   1 
ATOM   923   O  O   . SER A  1 110 ? -29.421 0.231   8.064   1.00 31.03  ? 110 SER A O   1 
ATOM   924   C  CB  . SER A  1 110 ? -30.463 3.025   6.568   1.00 31.50  ? 110 SER A CB  1 
ATOM   925   O  OG  . SER A  1 110 ? -31.605 2.267   6.893   1.00 32.93  ? 110 SER A OG  1 
ATOM   926   N  N   . ILE A  1 111 ? -28.875 2.199   9.009   1.00 31.90  ? 111 ILE A N   1 
ATOM   927   C  CA  . ILE A  1 111 ? -28.905 1.706   10.292  1.00 31.41  ? 111 ILE A CA  1 
ATOM   928   C  C   . ILE A  1 111 ? -30.356 1.202   10.637  1.00 29.95  ? 111 ILE A C   1 
ATOM   929   O  O   . ILE A  1 111 ? -30.523 0.195   11.307  1.00 30.55  ? 111 ILE A O   1 
ATOM   930   C  CB  . ILE A  1 111 ? -28.449 2.774   11.311  1.00 32.36  ? 111 ILE A CB  1 
ATOM   931   C  CG1 . ILE A  1 111 ? -26.928 2.986   11.199  1.00 35.30  ? 111 ILE A CG1 1 
ATOM   932   C  CG2 . ILE A  1 111 ? -28.817 2.359   12.710  1.00 36.39  ? 111 ILE A CG2 1 
ATOM   933   C  CD1 . ILE A  1 111 ? -26.389 4.101   12.066  1.00 31.70  ? 111 ILE A CD1 1 
ATOM   934   N  N   . ASP A  1 112 ? -31.370 1.921   10.142  1.00 28.99  ? 112 ASP A N   1 
ATOM   935   C  CA  . ASP A  1 112 ? -32.805 1.508   10.349  1.00 32.56  ? 112 ASP A CA  1 
ATOM   936   C  C   . ASP A  1 112 ? -33.098 0.151   9.765   1.00 30.55  ? 112 ASP A C   1 
ATOM   937   O  O   . ASP A  1 112 ? -33.840 -0.601  10.320  1.00 30.65  ? 112 ASP A O   1 
ATOM   938   C  CB  . ASP A  1 112 ? -33.776 2.556   9.764   1.00 37.26  ? 112 ASP A CB  1 
ATOM   939   C  CG  . ASP A  1 112 ? -33.851 3.809   10.604  1.00 47.35  ? 112 ASP A CG  1 
ATOM   940   O  OD1 . ASP A  1 112 ? -34.753 3.898   11.452  1.00 51.53  ? 112 ASP A OD1 1 
ATOM   941   O  OD2 . ASP A  1 112 ? -32.995 4.701   10.425  1.00 57.44  ? 112 ASP A OD2 1 
ATOM   942   N  N   . GLU A  1 113 ? -32.493 -0.147  8.605   1.00 30.73  ? 113 GLU A N   1 
ATOM   943   C  CA  . GLU A  1 113 ? -32.669 -1.458  7.964   1.00 32.41  ? 113 GLU A CA  1 
ATOM   944   C  C   . GLU A  1 113 ? -32.155 -2.536  8.834   1.00 28.41  ? 113 GLU A C   1 
ATOM   945   O  O   . GLU A  1 113 ? -32.773 -3.578  8.967   1.00 29.37  ? 113 GLU A O   1 
ATOM   946   C  CB  . GLU A  1 113 ? -31.953 -1.505  6.600   1.00 33.46  ? 113 GLU A CB  1 
ATOM   947   C  CG  . GLU A  1 113 ? -32.640 -0.743  5.517   1.00 41.28  ? 113 GLU A CG  1 
ATOM   948   C  CD  . GLU A  1 113 ? -32.117 -1.107  4.126   1.00 43.72  ? 113 GLU A CD  1 
ATOM   949   O  OE1 . GLU A  1 113 ? -31.680 -0.207  3.413   1.00 42.50  ? 113 GLU A OE1 1 
ATOM   950   O  OE2 . GLU A  1 113 ? -32.147 -2.326  3.763   1.00 39.62  ? 113 GLU A OE2 1 
ATOM   951   N  N   . ILE A  1 114 ? -31.001 -2.296  9.440   1.00 28.19  ? 114 ILE A N   1 
ATOM   952   C  CA  . ILE A  1 114 ? -30.411 -3.247  10.327  1.00 27.38  ? 114 ILE A CA  1 
ATOM   953   C  C   . ILE A  1 114 ? -31.291 -3.436  11.565  1.00 27.55  ? 114 ILE A C   1 
ATOM   954   O  O   . ILE A  1 114 ? -31.566 -4.537  11.960  1.00 26.38  ? 114 ILE A O   1 
ATOM   955   C  CB  . ILE A  1 114 ? -29.005 -2.812  10.770  1.00 28.06  ? 114 ILE A CB  1 
ATOM   956   C  CG1 . ILE A  1 114 ? -28.069 -2.712  9.559   1.00 24.96  ? 114 ILE A CG1 1 
ATOM   957   C  CG2 . ILE A  1 114 ? -28.450 -3.789  11.819  1.00 25.19  ? 114 ILE A CG2 1 
ATOM   958   C  CD1 . ILE A  1 114 ? -26.594 -2.364  9.929   1.00 26.13  ? 114 ILE A CD1 1 
ATOM   959   N  N   . ALA A  1 115 ? -31.724 -2.324  12.159  1.00 27.58  ? 115 ALA A N   1 
ATOM   960   C  CA  . ALA A  1 115 ? -32.594 -2.378  13.325  1.00 26.37  ? 115 ALA A CA  1 
ATOM   961   C  C   . ALA A  1 115 ? -33.884 -3.138  13.017  1.00 25.13  ? 115 ALA A C   1 
ATOM   962   O  O   . ALA A  1 115 ? -34.432 -3.836  13.893  1.00 26.85  ? 115 ALA A O   1 
ATOM   963   C  CB  . ALA A  1 115 ? -32.905 -0.979  13.825  1.00 25.15  ? 115 ALA A CB  1 
ATOM   964   N  N   . ASP A  1 116 ? -34.380 -3.004  11.757  1.00 24.05  ? 116 ASP A N   1 
ATOM   965   C  CA  . ASP A  1 116 ? -35.632 -3.728  11.312  1.00 24.34  ? 116 ASP A CA  1 
ATOM   966   C  C   . ASP A  1 116 ? -35.480 -5.247  11.421  1.00 25.06  ? 116 ASP A C   1 
ATOM   967   O  O   . ASP A  1 116 ? -36.419 -5.940  11.727  1.00 25.00  ? 116 ASP A O   1 
ATOM   968   C  CB  . ASP A  1 116 ? -35.998 -3.352  9.895   1.00 26.34  ? 116 ASP A CB  1 
ATOM   969   C  CG  . ASP A  1 116 ? -36.566 -1.928  9.785   1.00 33.03  ? 116 ASP A CG  1 
ATOM   970   O  OD1 . ASP A  1 116 ? -36.562 -1.371  8.656   1.00 36.44  ? 116 ASP A OD1 1 
ATOM   971   O  OD2 . ASP A  1 116 ? -37.009 -1.376  10.815  1.00 35.66  ? 116 ASP A OD2 1 
ATOM   972   N  N   . LEU A  1 117 ? -34.264 -5.749  11.150  1.00 23.41  ? 117 LEU A N   1 
ATOM   973   C  CA  . LEU A  1 117 ? -33.999 -7.150  11.275  1.00 23.21  ? 117 LEU A CA  1 
ATOM   974   C  C   . LEU A  1 117 ? -34.164 -7.586  12.738  1.00 21.87  ? 117 LEU A C   1 
ATOM   975   O  O   . LEU A  1 117 ? -34.792 -8.607  13.023  1.00 23.60  ? 117 LEU A O   1 
ATOM   976   C  CB  . LEU A  1 117 ? -32.583 -7.483  10.786  1.00 23.62  ? 117 LEU A CB  1 
ATOM   977   C  CG  . LEU A  1 117 ? -32.227 -7.038  9.389   1.00 27.21  ? 117 LEU A CG  1 
ATOM   978   C  CD1 . LEU A  1 117 ? -30.771 -7.394  9.073   1.00 25.48  ? 117 LEU A CD1 1 
ATOM   979   C  CD2 . LEU A  1 117 ? -33.177 -7.659  8.372   1.00 27.76  ? 117 LEU A CD2 1 
ATOM   980   N  N   . PHE A  1 118 ? -33.591 -6.802  13.664  1.00 20.85  ? 118 PHE A N   1 
ATOM   981   C  CA  . PHE A  1 118 ? -33.689 -7.127  15.082  1.00 21.24  ? 118 PHE A CA  1 
ATOM   982   C  C   . PHE A  1 118 ? -35.159 -7.104  15.532  1.00 20.83  ? 118 PHE A C   1 
ATOM   983   O  O   . PHE A  1 118 ? -35.653 -8.064  16.158  1.00 19.75  ? 118 PHE A O   1 
ATOM   984   C  CB  . PHE A  1 118 ? -32.839 -6.147  15.949  1.00 18.31  ? 118 PHE A CB  1 
ATOM   985   C  CG  . PHE A  1 118 ? -31.332 -6.091  15.547  1.00 21.40  ? 118 PHE A CG  1 
ATOM   986   C  CD1 . PHE A  1 118 ? -30.766 -7.092  14.758  1.00 19.11  ? 118 PHE A CD1 1 
ATOM   987   C  CD2 . PHE A  1 118 ? -30.504 -5.039  15.998  1.00 21.10  ? 118 PHE A CD2 1 
ATOM   988   C  CE1 . PHE A  1 118 ? -29.417 -7.045  14.403  1.00 22.53  ? 118 PHE A CE1 1 
ATOM   989   C  CE2 . PHE A  1 118 ? -29.131 -4.992  15.642  1.00 21.25  ? 118 PHE A CE2 1 
ATOM   990   C  CZ  . PHE A  1 118 ? -28.596 -5.980  14.857  1.00 23.65  ? 118 PHE A CZ  1 
ATOM   991   N  N   . ILE A  1 119 ? -35.843 -6.024  15.211  1.00 20.69  ? 119 ILE A N   1 
ATOM   992   C  CA  . ILE A  1 119 ? -37.260 -5.868  15.572  1.00 23.71  ? 119 ILE A CA  1 
ATOM   993   C  C   . ILE A  1 119 ? -38.127 -7.025  15.000  1.00 23.14  ? 119 ILE A C   1 
ATOM   994   O  O   . ILE A  1 119 ? -39.044 -7.516  15.668  1.00 28.27  ? 119 ILE A O   1 
ATOM   995   C  CB  . ILE A  1 119 ? -37.821 -4.484  15.110  1.00 24.39  ? 119 ILE A CB  1 
ATOM   996   C  CG1 . ILE A  1 119 ? -37.026 -3.340  15.766  1.00 26.64  ? 119 ILE A CG1 1 
ATOM   997   C  CG2 . ILE A  1 119 ? -39.278 -4.362  15.443  1.00 25.57  ? 119 ILE A CG2 1 
ATOM   998   C  CD1 . ILE A  1 119 ? -37.443 -1.931  15.281  1.00 27.23  ? 119 ILE A CD1 1 
ATOM   999   N  N   . HIS A  1 120 ? -37.830 -7.445  13.792  1.00 22.34  ? 120 HIS A N   1 
ATOM   1000  C  CA  . HIS A  1 120 ? -38.538 -8.582  13.195  1.00 24.38  ? 120 HIS A CA  1 
ATOM   1001  C  C   . HIS A  1 120 ? -38.403 -9.840  14.076  1.00 23.77  ? 120 HIS A C   1 
ATOM   1002  O  O   . HIS A  1 120 ? -39.384 -10.527 14.344  1.00 23.36  ? 120 HIS A O   1 
ATOM   1003  C  CB  . HIS A  1 120 ? -38.029 -8.865  11.789  1.00 27.09  ? 120 HIS A CB  1 
ATOM   1004  C  CG  . HIS A  1 120 ? -38.478 -10.228 11.230  1.00 28.27  ? 120 HIS A CG  1 
ATOM   1005  N  ND1 . HIS A  1 120 ? -39.422 -10.349 10.275  1.00 27.14  ? 120 HIS A ND1 1 
ATOM   1006  C  CD2 . HIS A  1 120 ? -38.068 -11.546 11.547  1.00 26.54  ? 120 HIS A CD2 1 
ATOM   1007  C  CE1 . HIS A  1 120 ? -39.613 -11.675 9.989   1.00 27.63  ? 120 HIS A CE1 1 
ATOM   1008  N  NE2 . HIS A  1 120 ? -38.794 -12.394 10.760  1.00 27.52  ? 120 HIS A NE2 1 
ATOM   1009  N  N   . ASP A  1 121 ? -37.160 -10.129 14.520  1.00 19.84  ? 121 ASP A N   1 
ATOM   1010  C  CA  . ASP A  1 121 ? -36.891 -11.288 15.380  1.00 19.66  ? 121 ASP A CA  1 
ATOM   1011  C  C   . ASP A  1 121 ? -37.586 -11.153 16.688  1.00 20.80  ? 121 ASP A C   1 
ATOM   1012  O  O   . ASP A  1 121 ? -38.022 -12.108 17.242  1.00 20.91  ? 121 ASP A O   1 
ATOM   1013  C  CB  . ASP A  1 121 ? -35.359 -11.455 15.616  1.00 19.60  ? 121 ASP A CB  1 
ATOM   1014  C  CG  . ASP A  1 121 ? -34.644 -12.004 14.416  1.00 20.26  ? 121 ASP A CG  1 
ATOM   1015  O  OD1 . ASP A  1 121 ? -35.311 -12.369 13.446  1.00 22.12  ? 121 ASP A OD1 1 
ATOM   1016  O  OD2 . ASP A  1 121 ? -33.398 -12.073 14.448  1.00 23.31  ? 121 ASP A OD2 1 
ATOM   1017  N  N   . ILE A  1 122 ? -37.685 -9.901  17.189  1.00 21.03  ? 122 ILE A N   1 
ATOM   1018  C  CA  . ILE A  1 122 ? -38.329 -9.633  18.475  1.00 22.20  ? 122 ILE A CA  1 
ATOM   1019  C  C   . ILE A  1 122 ? -39.895 -9.709  18.390  1.00 24.35  ? 122 ILE A C   1 
ATOM   1020  O  O   . ILE A  1 122 ? -40.512 -10.262 19.224  1.00 25.03  ? 122 ILE A O   1 
ATOM   1021  C  CB  . ILE A  1 122 ? -37.901 -8.254  19.056  1.00 22.20  ? 122 ILE A CB  1 
ATOM   1022  C  CG1 . ILE A  1 122 ? -36.365 -8.224  19.321  1.00 19.60  ? 122 ILE A CG1 1 
ATOM   1023  C  CG2 . ILE A  1 122 ? -38.701 -7.925  20.342  1.00 23.04  ? 122 ILE A CG2 1 
ATOM   1024  C  CD1 . ILE A  1 122 ? -35.789 -6.830  19.415  1.00 18.67  ? 122 ILE A CD1 1 
ATOM   1025  N  N   . LYS A  1 123 ? -40.469 -9.129  17.338  1.00 24.63  ? 123 LYS A N   1 
ATOM   1026  C  CA  . LYS A  1 123 ? -41.927 -9.039  17.225  1.00 28.34  ? 123 LYS A CA  1 
ATOM   1027  C  C   . LYS A  1 123 ? -42.552 -10.203 16.435  1.00 29.94  ? 123 LYS A C   1 
ATOM   1028  O  O   . LYS A  1 123 ? -43.623 -10.659 16.762  1.00 31.73  ? 123 LYS A O   1 
ATOM   1029  C  CB  . LYS A  1 123 ? -42.345 -7.696  16.594  1.00 31.05  ? 123 LYS A CB  1 
ATOM   1030  C  CG  . LYS A  1 123 ? -42.039 -6.463  17.454  1.00 33.69  ? 123 LYS A CG  1 
ATOM   1031  C  CD  . LYS A  1 123 ? -42.630 -5.184  16.803  1.00 39.29  ? 123 LYS A CD  1 
ATOM   1032  C  CE  . LYS A  1 123 ? -42.399 -3.935  17.679  1.00 44.52  ? 123 LYS A CE  1 
ATOM   1033  N  NZ  . LYS A  1 123 ? -42.971 -2.701  17.049  1.00 40.40  ? 123 LYS A NZ  1 
ATOM   1034  N  N   . GLU A  1 124 ? -41.855 -10.663 15.388  1.00 26.83  ? 124 GLU A N   1 
ATOM   1035  C  CA  . GLU A  1 124 ? -42.405 -11.711 14.481  1.00 29.62  ? 124 GLU A CA  1 
ATOM   1036  C  C   . GLU A  1 124 ? -41.943 -13.114 14.844  1.00 30.76  ? 124 GLU A C   1 
ATOM   1037  O  O   . GLU A  1 124 ? -42.756 -14.049 14.919  1.00 30.96  ? 124 GLU A O   1 
ATOM   1038  C  CB  . GLU A  1 124 ? -42.039 -11.403 13.018  1.00 31.37  ? 124 GLU A CB  1 
ATOM   1039  C  CG  . GLU A  1 124 ? -42.382 -10.002 12.580  1.00 39.54  ? 124 GLU A CG  1 
ATOM   1040  C  CD  . GLU A  1 124 ? -43.824 -9.657  12.834  1.00 48.12  ? 124 GLU A CD  1 
ATOM   1041  O  OE1 . GLU A  1 124 ? -44.708 -10.541 12.607  1.00 53.24  ? 124 GLU A OE1 1 
ATOM   1042  O  OE2 . GLU A  1 124 ? -44.094 -8.516  13.258  1.00 50.15  ? 124 GLU A OE2 1 
ATOM   1043  N  N   . GLY A  1 125 ? -40.637 -13.269 15.057  1.00 25.08  ? 125 GLY A N   1 
ATOM   1044  C  CA  . GLY A  1 125 ? -40.088 -14.516 15.363  1.00 25.70  ? 125 GLY A CA  1 
ATOM   1045  C  C   . GLY A  1 125 ? -38.755 -14.733 14.662  1.00 26.50  ? 125 GLY A C   1 
ATOM   1046  O  O   . GLY A  1 125 ? -38.373 -13.960 13.774  1.00 24.89  ? 125 GLY A O   1 
ATOM   1047  N  N   . ILE A  1 126 ? -38.059 -15.792 15.052  1.00 25.78  ? 126 ILE A N   1 
ATOM   1048  C  CA  . ILE A  1 126 ? -36.709 -16.065 14.557  1.00 24.15  ? 126 ILE A CA  1 
ATOM   1049  C  C   . ILE A  1 126 ? -36.681 -17.160 13.493  1.00 24.30  ? 126 ILE A C   1 
ATOM   1050  O  O   . ILE A  1 126 ? -37.233 -18.236 13.681  1.00 24.15  ? 126 ILE A O   1 
ATOM   1051  C  CB  . ILE A  1 126 ? -35.767 -16.484 15.727  1.00 21.44  ? 126 ILE A CB  1 
ATOM   1052  C  CG1 . ILE A  1 126 ? -35.595 -15.315 16.732  1.00 21.32  ? 126 ILE A CG1 1 
ATOM   1053  C  CG2 . ILE A  1 126 ? -34.434 -16.958 15.200  1.00 20.58  ? 126 ILE A CG2 1 
ATOM   1054  C  CD1 . ILE A  1 126 ? -34.988 -15.748 18.081  1.00 19.50  ? 126 ILE A CD1 1 
ATOM   1055  N  N   . GLN A  1 127 ? -36.023 -16.866 12.367  1.00 25.50  ? 127 GLN A N   1 
ATOM   1056  C  CA  . GLN A  1 127 ? -35.788 -17.883 11.289  1.00 24.73  ? 127 GLN A CA  1 
ATOM   1057  C  C   . GLN A  1 127 ? -37.044 -18.672 10.860  1.00 25.34  ? 127 GLN A C   1 
ATOM   1058  O  O   . GLN A  1 127 ? -36.981 -19.904 10.644  1.00 27.40  ? 127 GLN A O   1 
ATOM   1059  C  CB  . GLN A  1 127 ? -34.662 -18.851 11.705  1.00 22.67  ? 127 GLN A CB  1 
ATOM   1060  C  CG  . GLN A  1 127 ? -33.307 -18.193 11.786  1.00 23.72  ? 127 GLN A CG  1 
ATOM   1061  C  CD  . GLN A  1 127 ? -32.251 -19.080 12.439  1.00 24.74  ? 127 GLN A CD  1 
ATOM   1062  O  OE1 . GLN A  1 127 ? -31.124 -19.177 11.955  1.00 29.21  ? 127 GLN A OE1 1 
ATOM   1063  N  NE2 . GLN A  1 127 ? -32.606 -19.710 13.516  1.00 22.65  ? 127 GLN A NE2 1 
ATOM   1064  N  N   . GLY A  1 128 ? -38.158 -17.982 10.731  1.00 27.07  ? 128 GLY A N   1 
ATOM   1065  C  CA  . GLY A  1 128 ? -39.425 -18.625 10.231  1.00 27.79  ? 128 GLY A CA  1 
ATOM   1066  C  C   . GLY A  1 128 ? -40.278 -19.276 11.327  1.00 30.27  ? 128 GLY A C   1 
ATOM   1067  O  O   . GLY A  1 128 ? -41.276 -19.866 11.048  1.00 33.25  ? 128 GLY A O   1 
ATOM   1068  N  N   . THR A  1 129 ? -39.845 -19.149 12.576  1.00 30.54  ? 129 THR A N   1 
ATOM   1069  C  CA  . THR A  1 129 ? -40.606 -19.712 13.711  1.00 28.25  ? 129 THR A CA  1 
ATOM   1070  C  C   . THR A  1 129 ? -41.251 -18.626 14.489  1.00 29.05  ? 129 THR A C   1 
ATOM   1071  O  O   . THR A  1 129 ? -41.000 -17.419 14.239  1.00 29.99  ? 129 THR A O   1 
ATOM   1072  C  CB  . THR A  1 129 ? -39.702 -20.513 14.660  1.00 27.05  ? 129 THR A CB  1 
ATOM   1073  O  OG1 . THR A  1 129 ? -38.795 -19.613 15.336  1.00 24.37  ? 129 THR A OG1 1 
ATOM   1074  C  CG2 . THR A  1 129 ? -38.905 -21.557 13.892  1.00 24.36  ? 129 THR A CG2 1 
ATOM   1075  N  N   . LEU A  1 130 ? -42.076 -19.005 15.447  1.00 25.56  ? 130 LEU A N   1 
ATOM   1076  C  CA  . LEU A  1 130 ? -42.725 -18.051 16.284  1.00 26.57  ? 130 LEU A CA  1 
ATOM   1077  C  C   . LEU A  1 130 ? -41.952 -17.820 17.580  1.00 26.89  ? 130 LEU A C   1 
ATOM   1078  O  O   . LEU A  1 130 ? -42.409 -17.120 18.451  1.00 27.93  ? 130 LEU A O   1 
ATOM   1079  C  CB  . LEU A  1 130 ? -44.177 -18.485 16.585  1.00 27.46  ? 130 LEU A CB  1 
ATOM   1080  C  CG  . LEU A  1 130 ? -45.069 -18.548 15.365  1.00 29.47  ? 130 LEU A CG  1 
ATOM   1081  C  CD1 . LEU A  1 130 ? -46.509 -18.853 15.762  1.00 29.56  ? 130 LEU A CD1 1 
ATOM   1082  C  CD2 . LEU A  1 130 ? -44.985 -17.238 14.570  1.00 27.60  ? 130 LEU A CD2 1 
ATOM   1083  N  N   . ASN A  1 131 ? -40.760 -18.430 17.686  1.00 26.03  ? 131 ASN A N   1 
ATOM   1084  C  CA  . ASN A  1 131 ? -39.874 -18.166 18.817  1.00 25.25  ? 131 ASN A CA  1 
ATOM   1085  C  C   . ASN A  1 131 ? -39.270 -16.751 18.685  1.00 22.87  ? 131 ASN A C   1 
ATOM   1086  O  O   . ASN A  1 131 ? -38.635 -16.450 17.723  1.00 24.51  ? 131 ASN A O   1 
ATOM   1087  C  CB  . ASN A  1 131 ? -38.779 -19.202 18.895  1.00 23.87  ? 131 ASN A CB  1 
ATOM   1088  C  CG  . ASN A  1 131 ? -39.306 -20.574 19.042  1.00 24.77  ? 131 ASN A CG  1 
ATOM   1089  O  OD1 . ASN A  1 131 ? -39.064 -21.450 18.184  1.00 30.91  ? 131 ASN A OD1 1 
ATOM   1090  N  ND2 . ASN A  1 131 ? -40.033 -20.806 20.096  1.00 24.96  ? 131 ASN A ND2 1 
ATOM   1091  N  N   . LYS A  1 132 ? -39.498 -15.920 19.672  1.00 23.05  ? 132 LYS A N   1 
ATOM   1092  C  CA  . LYS A  1 132 ? -39.080 -14.512 19.601  1.00 22.50  ? 132 LYS A CA  1 
ATOM   1093  C  C   . LYS A  1 132 ? -37.815 -14.258 20.331  1.00 23.81  ? 132 LYS A C   1 
ATOM   1094  O  O   . LYS A  1 132 ? -37.482 -14.961 21.269  1.00 25.76  ? 132 LYS A O   1 
ATOM   1095  C  CB  . LYS A  1 132 ? -40.217 -13.589 20.128  1.00 25.19  ? 132 LYS A CB  1 
ATOM   1096  C  CG  . LYS A  1 132 ? -41.432 -13.550 19.205  1.00 25.38  ? 132 LYS A CG  1 
ATOM   1097  C  CD  . LYS A  1 132 ? -42.644 -13.040 19.903  1.00 32.61  ? 132 LYS A CD  1 
ATOM   1098  C  CE  . LYS A  1 132 ? -43.844 -13.075 18.982  1.00 33.72  ? 132 LYS A CE  1 
ATOM   1099  N  NZ  . LYS A  1 132 ? -43.888 -14.362 18.217  1.00 33.18  ? 132 LYS A NZ  1 
ATOM   1100  N  N   . ALA A  1 133 ? -37.077 -13.240 19.884  1.00 23.12  ? 133 ALA A N   1 
ATOM   1101  C  CA  . ALA A  1 133 ? -35.852 -12.844 20.526  1.00 21.52  ? 133 ALA A CA  1 
ATOM   1102  C  C   . ALA A  1 133 ? -36.174 -12.042 21.749  1.00 22.45  ? 133 ALA A C   1 
ATOM   1103  O  O   . ALA A  1 133 ? -37.085 -11.230 21.732  1.00 20.76  ? 133 ALA A O   1 
ATOM   1104  C  CB  . ALA A  1 133 ? -34.982 -12.014 19.554  1.00 18.82  ? 133 ALA A CB  1 
ATOM   1105  N  N   . GLY A  1 134 ? -35.408 -12.269 22.841  1.00 21.63  ? 134 GLY A N   1 
ATOM   1106  C  CA  . GLY A  1 134 ? -35.659 -11.560 24.136  1.00 20.40  ? 134 GLY A CA  1 
ATOM   1107  C  C   . GLY A  1 134 ? -34.582 -10.458 24.468  1.00 21.79  ? 134 GLY A C   1 
ATOM   1108  O  O   . GLY A  1 134 ? -34.622 -9.845  25.520  1.00 25.82  ? 134 GLY A O   1 
ATOM   1109  N  N   . PHE A  1 135 ? -33.656 -10.243 23.552  1.00 17.79  ? 135 PHE A N   1 
ATOM   1110  C  CA  . PHE A  1 135 ? -32.595 -9.255  23.750  1.00 18.09  ? 135 PHE A CA  1 
ATOM   1111  C  C   . PHE A  1 135 ? -31.829 -9.118  22.488  1.00 18.49  ? 135 PHE A C   1 
ATOM   1112  O  O   . PHE A  1 135 ? -32.008 -9.938  21.531  1.00 20.70  ? 135 PHE A O   1 
ATOM   1113  C  CB  . PHE A  1 135 ? -31.650 -9.715  24.877  1.00 16.58  ? 135 PHE A CB  1 
ATOM   1114  C  CG  . PHE A  1 135 ? -30.970 -10.983 24.584  1.00 18.64  ? 135 PHE A CG  1 
ATOM   1115  C  CD1 . PHE A  1 135 ? -31.553 -12.210 24.942  1.00 16.90  ? 135 PHE A CD1 1 
ATOM   1116  C  CD2 . PHE A  1 135 ? -29.739 -10.995 23.907  1.00 17.99  ? 135 PHE A CD2 1 
ATOM   1117  C  CE1 . PHE A  1 135 ? -30.915 -13.416 24.644  1.00 18.95  ? 135 PHE A CE1 1 
ATOM   1118  C  CE2 . PHE A  1 135 ? -29.104 -12.198 23.612  1.00 17.67  ? 135 PHE A CE2 1 
ATOM   1119  C  CZ  . PHE A  1 135 ? -29.694 -13.411 23.982  1.00 16.59  ? 135 PHE A CZ  1 
ATOM   1120  N  N   . VAL A  1 136 ? -30.963 -8.113  22.427  1.00 17.54  ? 136 VAL A N   1 
ATOM   1121  C  CA  . VAL A  1 136 ? -30.120 -7.916  21.286  1.00 18.82  ? 136 VAL A CA  1 
ATOM   1122  C  C   . VAL A  1 136 ? -28.633 -8.073  21.684  1.00 18.92  ? 136 VAL A C   1 
ATOM   1123  O  O   . VAL A  1 136 ? -28.212 -7.622  22.760  1.00 21.43  ? 136 VAL A O   1 
ATOM   1124  C  CB  . VAL A  1 136 ? -30.329 -6.527  20.659  1.00 21.97  ? 136 VAL A CB  1 
ATOM   1125  C  CG1 . VAL A  1 136 ? -29.502 -6.391  19.391  1.00 21.26  ? 136 VAL A CG1 1 
ATOM   1126  C  CG2 . VAL A  1 136 ? -31.822 -6.282  20.374  1.00 22.46  ? 136 VAL A CG2 1 
HETATM 1127  N  N   . KCX A  1 137 ? -27.870 -8.701  20.831  1.00 19.46  ? 137 KCX A N   1 
HETATM 1128  C  CA  . KCX A  1 137 ? -26.473 -8.929  21.090  1.00 18.91  ? 137 KCX A CA  1 
HETATM 1129  C  CB  . KCX A  1 137 ? -26.204 -10.465 21.015  1.00 19.28  ? 137 KCX A CB  1 
HETATM 1130  C  CG  . KCX A  1 137 ? -24.700 -10.810 20.987  1.00 20.90  ? 137 KCX A CG  1 
HETATM 1131  C  CD  . KCX A  1 137 ? -24.063 -10.638 22.354  1.00 19.72  ? 137 KCX A CD  1 
HETATM 1132  C  CE  . KCX A  1 137 ? -22.544 -11.041 22.313  1.00 20.55  ? 137 KCX A CE  1 
HETATM 1133  N  NZ  . KCX A  1 137 ? -22.355 -12.535 22.216  1.00 19.94  ? 137 KCX A NZ  1 
HETATM 1134  C  C   . KCX A  1 137 ? -25.629 -8.161  20.070  1.00 20.19  ? 137 KCX A C   1 
HETATM 1135  O  O   . KCX A  1 137 ? -25.927 -8.157  18.885  1.00 21.10  ? 137 KCX A O   1 
HETATM 1136  C  CX  . KCX A  1 137 ? -21.224 -13.155 22.684  1.00 20.64  ? 137 KCX A CX  1 
HETATM 1137  O  OQ1 . KCX A  1 137 ? -21.135 -14.475 22.563  1.00 21.31  ? 137 KCX A OQ1 1 
HETATM 1138  O  OQ2 . KCX A  1 137 ? -20.228 -12.512 23.248  1.00 18.42  ? 137 KCX A OQ2 1 
ATOM   1139  N  N   . ILE A  1 138 ? -24.584 -7.500  20.554  1.00 22.28  ? 138 ILE A N   1 
ATOM   1140  C  CA  . ILE A  1 138 ? -23.635 -6.769  19.684  1.00 21.17  ? 138 ILE A CA  1 
ATOM   1141  C  C   . ILE A  1 138 ? -22.266 -6.995  20.177  1.00 22.45  ? 138 ILE A C   1 
ATOM   1142  O  O   . ILE A  1 138 ? -22.078 -7.433  21.321  1.00 18.54  ? 138 ILE A O   1 
ATOM   1143  C  CB  . ILE A  1 138 ? -23.903 -5.253  19.689  1.00 23.29  ? 138 ILE A CB  1 
ATOM   1144  C  CG1 . ILE A  1 138 ? -23.638 -4.676  21.079  1.00 21.45  ? 138 ILE A CG1 1 
ATOM   1145  C  CG2 . ILE A  1 138 ? -25.338 -4.948  19.207  1.00 23.24  ? 138 ILE A CG2 1 
ATOM   1146  C  CD1 . ILE A  1 138 ? -24.067 -3.258  21.236  1.00 25.07  ? 138 ILE A CD1 1 
ATOM   1147  N  N   . ALA A  1 139 ? -21.249 -6.683  19.330  1.00 20.01  ? 139 ALA A N   1 
ATOM   1148  C  CA  . ALA A  1 139 ? -19.863 -6.978  19.688  1.00 20.12  ? 139 ALA A CA  1 
ATOM   1149  C  C   . ALA A  1 139 ? -18.853 -5.953  19.190  1.00 21.04  ? 139 ALA A C   1 
ATOM   1150  O  O   . ALA A  1 139 ? -19.117 -5.192  18.274  1.00 20.56  ? 139 ALA A O   1 
ATOM   1151  C  CB  . ALA A  1 139 ? -19.471 -8.395  19.183  1.00 19.51  ? 139 ALA A CB  1 
ATOM   1152  N  N   . ALA A  1 140 ? -17.692 -5.966  19.820  1.00 20.85  ? 140 ALA A N   1 
ATOM   1153  C  CA  . ALA A  1 140 ? -16.560 -5.241  19.387  1.00 22.95  ? 140 ALA A CA  1 
ATOM   1154  C  C   . ALA A  1 140 ? -15.391 -5.855  20.071  1.00 25.52  ? 140 ALA A C   1 
ATOM   1155  O  O   . ALA A  1 140 ? -15.501 -6.293  21.227  1.00 22.52  ? 140 ALA A O   1 
ATOM   1156  C  CB  . ALA A  1 140 ? -16.687 -3.746  19.775  1.00 22.90  ? 140 ALA A CB  1 
ATOM   1157  N  N   . ASP A  1 141 ? -14.267 -5.913  19.398  1.00 26.53  ? 141 ASP A N   1 
ATOM   1158  C  CA  . ASP A  1 141 ? -13.109 -6.502  19.981  1.00 26.34  ? 141 ASP A CA  1 
ATOM   1159  C  C   . ASP A  1 141 ? -11.845 -5.690  19.679  1.00 29.06  ? 141 ASP A C   1 
ATOM   1160  O  O   . ASP A  1 141 ? -11.881 -4.442  19.668  1.00 30.11  ? 141 ASP A O   1 
ATOM   1161  C  CB  . ASP A  1 141 ? -12.958 -7.986  19.515  1.00 26.09  ? 141 ASP A CB  1 
ATOM   1162  C  CG  . ASP A  1 141 ? -12.215 -8.865  20.558  1.00 30.07  ? 141 ASP A CG  1 
ATOM   1163  O  OD1 . ASP A  1 141 ? -10.990 -8.755  20.662  1.00 35.79  ? 141 ASP A OD1 1 
ATOM   1164  O  OD2 . ASP A  1 141 ? -12.883 -9.660  21.250  1.00 29.52  ? 141 ASP A OD2 1 
ATOM   1165  N  N   . GLU A  1 142 ? -10.723 -6.394  19.436  1.00 31.33  ? 142 GLU A N   1 
ATOM   1166  C  CA  . GLU A  1 142 ? -9.388  -5.719  19.212  1.00 36.52  ? 142 GLU A CA  1 
ATOM   1167  C  C   . GLU A  1 142 ? -9.424  -4.507  18.228  1.00 33.50  ? 142 GLU A C   1 
ATOM   1168  O  O   . GLU A  1 142 ? -8.819  -3.488  18.495  1.00 34.25  ? 142 GLU A O   1 
ATOM   1169  C  CB  . GLU A  1 142 ? -8.320  -6.740  18.777  1.00 42.98  ? 142 GLU A CB  1 
ATOM   1170  C  CG  . GLU A  1 142 ? -8.014  -7.784  19.832  1.00 54.07  ? 142 GLU A CG  1 
ATOM   1171  C  CD  . GLU A  1 142 ? -6.940  -8.766  19.397  1.00 73.56  ? 142 GLU A CD  1 
ATOM   1172  O  OE1 . GLU A  1 142 ? -6.361  -8.578  18.298  1.00 83.65  ? 142 GLU A OE1 1 
ATOM   1173  O  OE2 . GLU A  1 142 ? -6.671  -9.729  20.156  1.00 76.38  ? 142 GLU A OE2 1 
ATOM   1174  N  N   . PRO A  1 143 ? -10.152 -4.655  17.067  1.00 30.44  ? 143 PRO A N   1 
ATOM   1175  C  CA  . PRO A  1 143 ? -10.216 -3.552  16.065  1.00 30.41  ? 143 PRO A CA  1 
ATOM   1176  C  C   . PRO A  1 143 ? -10.988 -2.284  16.573  1.00 30.58  ? 143 PRO A C   1 
ATOM   1177  O  O   . PRO A  1 143 ? -10.974 -1.279  15.931  1.00 28.40  ? 143 PRO A O   1 
ATOM   1178  C  CB  . PRO A  1 143 ? -10.944 -4.199  14.873  1.00 29.12  ? 143 PRO A CB  1 
ATOM   1179  C  CG  . PRO A  1 143 ? -10.785 -5.685  15.089  1.00 30.10  ? 143 PRO A CG  1 
ATOM   1180  C  CD  . PRO A  1 143 ? -10.801 -5.872  16.581  1.00 30.42  ? 143 PRO A CD  1 
ATOM   1181  N  N   . GLY A  1 144 ? -11.630 -2.391  17.723  1.00 30.39  ? 144 GLY A N   1 
ATOM   1182  C  CA  . GLY A  1 144 ? -12.341 -1.237  18.318  1.00 28.40  ? 144 GLY A CA  1 
ATOM   1183  C  C   . GLY A  1 144 ? -13.687 -0.965  17.656  1.00 30.25  ? 144 GLY A C   1 
ATOM   1184  O  O   . GLY A  1 144 ? -14.262 -1.842  17.028  1.00 30.91  ? 144 GLY A O   1 
ATOM   1185  N  N   . ILE A  1 145 ? -14.183 0.275   17.807  1.00 28.55  ? 145 ILE A N   1 
ATOM   1186  C  CA  . ILE A  1 145 ? -15.448 0.663   17.247  1.00 29.76  ? 145 ILE A CA  1 
ATOM   1187  C  C   . ILE A  1 145 ? -15.304 1.136   15.784  1.00 29.83  ? 145 ILE A C   1 
ATOM   1188  O  O   . ILE A  1 145 ? -15.222 2.330   15.513  1.00 31.66  ? 145 ILE A O   1 
ATOM   1189  C  CB  . ILE A  1 145 ? -16.121 1.792   18.077  1.00 29.65  ? 145 ILE A CB  1 
ATOM   1190  C  CG1 . ILE A  1 145 ? -16.116 1.445   19.567  1.00 28.31  ? 145 ILE A CG1 1 
ATOM   1191  C  CG2 . ILE A  1 145 ? -17.549 2.049   17.580  1.00 28.36  ? 145 ILE A CG2 1 
ATOM   1192  C  CD1 . ILE A  1 145 ? -16.898 0.145   19.916  1.00 24.87  ? 145 ILE A CD1 1 
ATOM   1193  N  N   . THR A  1 146 ? -15.278 0.189   14.868  1.00 27.97  ? 146 THR A N   1 
ATOM   1194  C  CA  . THR A  1 146 ? -15.222 0.493   13.456  1.00 26.76  ? 146 THR A CA  1 
ATOM   1195  C  C   . THR A  1 146 ? -16.568 1.037   12.996  1.00 29.19  ? 146 THR A C   1 
ATOM   1196  O  O   . THR A  1 146 ? -17.562 0.975   13.740  1.00 30.40  ? 146 THR A O   1 
ATOM   1197  C  CB  . THR A  1 146 ? -14.899 -0.749  12.646  1.00 28.84  ? 146 THR A CB  1 
ATOM   1198  O  OG1 . THR A  1 146 ? -15.972 -1.705  12.778  1.00 30.04  ? 146 THR A OG1 1 
ATOM   1199  C  CG2 . THR A  1 146 ? -13.577 -1.390  13.136  1.00 27.07  ? 146 THR A CG2 1 
ATOM   1200  N  N   . LYS A  1 147 ? -16.612 1.564   11.779  1.00 31.45  ? 147 LYS A N   1 
ATOM   1201  C  CA  . LYS A  1 147 ? -17.878 2.148   11.222  1.00 33.51  ? 147 LYS A CA  1 
ATOM   1202  C  C   . LYS A  1 147 ? -19.028 1.181   11.306  1.00 31.76  ? 147 LYS A C   1 
ATOM   1203  O  O   . LYS A  1 147 ? -20.100 1.525   11.800  1.00 34.86  ? 147 LYS A O   1 
ATOM   1204  C  CB  . LYS A  1 147 ? -17.681 2.596   9.763   1.00 35.89  ? 147 LYS A CB  1 
ATOM   1205  C  CG  . LYS A  1 147 ? -16.543 3.547   9.555   1.00 41.96  ? 147 LYS A CG  1 
ATOM   1206  C  CD  . LYS A  1 147 ? -16.685 4.763   10.408  1.00 44.60  ? 147 LYS A CD  1 
ATOM   1207  C  CE  . LYS A  1 147 ? -15.467 5.648   10.300  1.00 53.01  ? 147 LYS A CE  1 
ATOM   1208  N  NZ  . LYS A  1 147 ? -15.485 6.727   11.323  1.00 61.39  ? 147 LYS A NZ  1 
ATOM   1209  N  N   . ASP A  1 148 ? -18.812 -0.049  10.815  1.00 31.54  ? 148 ASP A N   1 
ATOM   1210  C  CA  . ASP A  1 148 ? -19.887 -1.069  10.785  1.00 30.28  ? 148 ASP A CA  1 
ATOM   1211  C  C   . ASP A  1 148 ? -20.275 -1.552  12.203  1.00 28.02  ? 148 ASP A C   1 
ATOM   1212  O  O   . ASP A  1 148 ? -21.467 -1.711  12.512  1.00 26.47  ? 148 ASP A O   1 
ATOM   1213  C  CB  . ASP A  1 148 ? -19.500 -2.239  9.893   1.00 30.28  ? 148 ASP A CB  1 
ATOM   1214  C  CG  . ASP A  1 148 ? -19.627 -1.899  8.377   1.00 33.96  ? 148 ASP A CG  1 
ATOM   1215  O  OD1 . ASP A  1 148 ? -19.356 -2.775  7.547   1.00 37.22  ? 148 ASP A OD1 1 
ATOM   1216  O  OD2 . ASP A  1 148 ? -19.999 -0.751  8.053   1.00 33.29  ? 148 ASP A OD2 1 
ATOM   1217  N  N   . VAL A  1 149 ? -19.271 -1.777  13.050  1.00 26.95  ? 149 VAL A N   1 
ATOM   1218  C  CA  . VAL A  1 149 ? -19.515 -2.109  14.455  1.00 24.15  ? 149 VAL A CA  1 
ATOM   1219  C  C   . VAL A  1 149 ? -20.397 -1.016  15.111  1.00 25.09  ? 149 VAL A C   1 
ATOM   1220  O  O   . VAL A  1 149 ? -21.294 -1.319  15.933  1.00 24.75  ? 149 VAL A O   1 
ATOM   1221  C  CB  . VAL A  1 149 ? -18.194 -2.252  15.240  1.00 25.35  ? 149 VAL A CB  1 
ATOM   1222  C  CG1 . VAL A  1 149 ? -18.443 -2.181  16.763  1.00 22.41  ? 149 VAL A CG1 1 
ATOM   1223  C  CG2 . VAL A  1 149 ? -17.475 -3.554  14.853  1.00 26.16  ? 149 VAL A CG2 1 
ATOM   1224  N  N   . GLU A  1 150 ? -20.150 0.235   14.738  1.00 25.65  ? 150 GLU A N   1 
ATOM   1225  C  CA  . GLU A  1 150 ? -20.895 1.340   15.259  1.00 27.93  ? 150 GLU A CA  1 
ATOM   1226  C  C   . GLU A  1 150 ? -22.377 1.348   14.724  1.00 27.37  ? 150 GLU A C   1 
ATOM   1227  O  O   . GLU A  1 150 ? -23.287 1.653   15.455  1.00 28.99  ? 150 GLU A O   1 
ATOM   1228  C  CB  . GLU A  1 150 ? -20.199 2.666   14.935  1.00 32.52  ? 150 GLU A CB  1 
ATOM   1229  C  CG  . GLU A  1 150 ? -20.835 3.878   15.607  1.00 39.62  ? 150 GLU A CG  1 
ATOM   1230  C  CD  . GLU A  1 150 ? -20.001 5.135   15.458  1.00 46.44  ? 150 GLU A CD  1 
ATOM   1231  O  OE1 . GLU A  1 150 ? -20.166 6.046   16.274  1.00 48.92  ? 150 GLU A OE1 1 
ATOM   1232  O  OE2 . GLU A  1 150 ? -19.167 5.202   14.510  1.00 55.18  ? 150 GLU A OE2 1 
ATOM   1233  N  N   . LYS A  1 151 ? -22.563 1.001   13.414  1.00 25.88  ? 151 LYS A N   1 
ATOM   1234  C  CA  . LYS A  1 151 ? -23.935 0.858   12.827  1.00 28.16  ? 151 LYS A CA  1 
ATOM   1235  C  C   . LYS A  1 151 ? -24.745 -0.138  13.619  1.00 26.11  ? 151 LYS A C   1 
ATOM   1236  O  O   . LYS A  1 151 ? -25.922 0.094   13.919  1.00 26.12  ? 151 LYS A O   1 
ATOM   1237  C  CB  . LYS A  1 151 ? -23.873 0.382   11.355  1.00 31.26  ? 151 LYS A CB  1 
ATOM   1238  C  CG  . LYS A  1 151 ? -23.194 1.333   10.367  1.00 38.06  ? 151 LYS A CG  1 
ATOM   1239  C  CD  . LYS A  1 151 ? -23.522 0.897   8.906   1.00 41.85  ? 151 LYS A CD  1 
ATOM   1240  C  CE  . LYS A  1 151 ? -22.428 1.296   7.926   1.00 46.02  ? 151 LYS A CE  1 
ATOM   1241  N  NZ  . LYS A  1 151 ? -22.317 2.757   7.768   1.00 55.63  ? 151 LYS A NZ  1 
ATOM   1242  N  N   . VAL A  1 152 ? -24.114 -1.272  13.953  1.00 21.85  ? 152 VAL A N   1 
ATOM   1243  C  CA  . VAL A  1 152 ? -24.769 -2.308  14.664  1.00 23.76  ? 152 VAL A CA  1 
ATOM   1244  C  C   . VAL A  1 152 ? -25.190 -1.840  16.081  1.00 23.20  ? 152 VAL A C   1 
ATOM   1245  O  O   . VAL A  1 152 ? -26.311 -2.085  16.515  1.00 21.64  ? 152 VAL A O   1 
ATOM   1246  C  CB  . VAL A  1 152 ? -23.877 -3.596  14.757  1.00 23.07  ? 152 VAL A CB  1 
ATOM   1247  C  CG1 . VAL A  1 152 ? -24.517 -4.621  15.660  1.00 21.82  ? 152 VAL A CG1 1 
ATOM   1248  C  CG2 . VAL A  1 152 ? -23.633 -4.182  13.351  1.00 21.14  ? 152 VAL A CG2 1 
ATOM   1249  N  N   . ILE A  1 153 ? -24.288 -1.165  16.769  1.00 24.28  ? 153 ILE A N   1 
ATOM   1250  C  CA  . ILE A  1 153 ? -24.587 -0.624  18.096  1.00 24.60  ? 153 ILE A CA  1 
ATOM   1251  C  C   . ILE A  1 153 ? -25.825 0.287   18.048  1.00 25.86  ? 153 ILE A C   1 
ATOM   1252  O  O   . ILE A  1 153 ? -26.758 0.148   18.870  1.00 25.05  ? 153 ILE A O   1 
ATOM   1253  C  CB  . ILE A  1 153 ? -23.399 0.170   18.660  1.00 27.91  ? 153 ILE A CB  1 
ATOM   1254  C  CG1 . ILE A  1 153 ? -22.170 -0.747  18.827  1.00 27.96  ? 153 ILE A CG1 1 
ATOM   1255  C  CG2 . ILE A  1 153 ? -23.778 0.835   19.976  1.00 26.36  ? 153 ILE A CG2 1 
ATOM   1256  C  CD1 . ILE A  1 153 ? -20.906 -0.024  19.227  1.00 25.40  ? 153 ILE A CD1 1 
ATOM   1257  N  N   . ARG A  1 154 ? -25.842 1.214   17.086  1.00 27.07  ? 154 ARG A N   1 
ATOM   1258  C  CA  . ARG A  1 154 ? -26.969 2.156   16.951  1.00 28.01  ? 154 ARG A CA  1 
ATOM   1259  C  C   . ARG A  1 154 ? -28.248 1.443   16.579  1.00 24.70  ? 154 ARG A C   1 
ATOM   1260  O  O   . ARG A  1 154 ? -29.332 1.824   17.026  1.00 22.86  ? 154 ARG A O   1 
ATOM   1261  C  CB  . ARG A  1 154 ? -26.632 3.280   15.938  1.00 30.67  ? 154 ARG A CB  1 
ATOM   1262  C  CG  . ARG A  1 154 ? -25.411 4.086   16.348  1.00 34.08  ? 154 ARG A CG  1 
ATOM   1263  C  CD  . ARG A  1 154 ? -25.148 5.268   15.446  1.00 37.02  ? 154 ARG A CD  1 
ATOM   1264  N  NE  . ARG A  1 154 ? -23.960 5.992   15.898  1.00 39.40  ? 154 ARG A NE  1 
ATOM   1265  C  CZ  . ARG A  1 154 ? -23.965 6.894   16.879  1.00 43.42  ? 154 ARG A CZ  1 
ATOM   1266  N  NH1 . ARG A  1 154 ? -22.823 7.508   17.240  1.00 41.06  ? 154 ARG A NH1 1 
ATOM   1267  N  NH2 . ARG A  1 154 ? -25.104 7.191   17.504  1.00 38.35  ? 154 ARG A NH2 1 
ATOM   1268  N  N   . ALA A  1 155 ? -28.131 0.397   15.774  1.00 23.06  ? 155 ALA A N   1 
ATOM   1269  C  CA  . ALA A  1 155 ? -29.297 -0.402  15.425  1.00 24.79  ? 155 ALA A CA  1 
ATOM   1270  C  C   . ALA A  1 155 ? -29.883 -1.081  16.688  1.00 22.51  ? 155 ALA A C   1 
ATOM   1271  O  O   . ALA A  1 155 ? -31.098 -1.122  16.873  1.00 24.32  ? 155 ALA A O   1 
ATOM   1272  C  CB  . ALA A  1 155 ? -28.952 -1.438  14.360  1.00 21.48  ? 155 ALA A CB  1 
ATOM   1273  N  N   . ALA A  1 156 ? -29.012 -1.596  17.542  1.00 20.94  ? 156 ALA A N   1 
ATOM   1274  C  CA  . ALA A  1 156 ? -29.463 -2.217  18.796  1.00 22.56  ? 156 ALA A CA  1 
ATOM   1275  C  C   . ALA A  1 156 ? -30.240 -1.215  19.631  1.00 25.34  ? 156 ALA A C   1 
ATOM   1276  O  O   . ALA A  1 156 ? -31.315 -1.532  20.163  1.00 29.24  ? 156 ALA A O   1 
ATOM   1277  C  CB  . ALA A  1 156 ? -28.300 -2.761  19.568  1.00 21.31  ? 156 ALA A CB  1 
ATOM   1278  N  N   . ALA A  1 157 ? -29.702 0.010   19.743  1.00 24.05  ? 157 ALA A N   1 
ATOM   1279  C  CA  . ALA A  1 157 ? -30.389 1.094   20.479  1.00 24.99  ? 157 ALA A CA  1 
ATOM   1280  C  C   . ALA A  1 157 ? -31.791 1.300   19.950  1.00 24.95  ? 157 ALA A C   1 
ATOM   1281  O  O   . ALA A  1 157 ? -32.750 1.373   20.716  1.00 25.76  ? 157 ALA A O   1 
ATOM   1282  C  CB  . ALA A  1 157 ? -29.588 2.396   20.390  1.00 23.41  ? 157 ALA A CB  1 
ATOM   1283  N  N   . ILE A  1 158 ? -31.910 1.395   18.635  1.00 24.68  ? 158 ILE A N   1 
ATOM   1284  C  CA  . ILE A  1 158 ? -33.196 1.560   17.997  1.00 23.45  ? 158 ILE A CA  1 
ATOM   1285  C  C   . ILE A  1 158 ? -34.152 0.442   18.387  1.00 24.15  ? 158 ILE A C   1 
ATOM   1286  O  O   . ILE A  1 158 ? -35.311 0.706   18.798  1.00 26.58  ? 158 ILE A O   1 
ATOM   1287  C  CB  . ILE A  1 158 ? -33.061 1.615   16.464  1.00 23.51  ? 158 ILE A CB  1 
ATOM   1288  C  CG1 . ILE A  1 158 ? -32.326 2.914   16.041  1.00 25.53  ? 158 ILE A CG1 1 
ATOM   1289  C  CG2 . ILE A  1 158 ? -34.432 1.523   15.805  1.00 22.61  ? 158 ILE A CG2 1 
ATOM   1290  C  CD1 . ILE A  1 158 ? -32.055 3.016   14.567  1.00 25.14  ? 158 ILE A CD1 1 
ATOM   1291  N  N   . ALA A  1 159 ? -33.685 -0.814  18.272  1.00 22.72  ? 159 ALA A N   1 
ATOM   1292  C  CA  . ALA A  1 159 ? -34.515 -1.977  18.629  1.00 24.12  ? 159 ALA A CA  1 
ATOM   1293  C  C   . ALA A  1 159 ? -34.921 -1.952  20.123  1.00 25.20  ? 159 ALA A C   1 
ATOM   1294  O  O   . ALA A  1 159 ? -36.053 -2.298  20.476  1.00 25.77  ? 159 ALA A O   1 
ATOM   1295  C  CB  . ALA A  1 159 ? -33.793 -3.282  18.287  1.00 23.37  ? 159 ALA A CB  1 
ATOM   1296  N  N   . ASN A  1 160 ? -33.997 -1.544  20.982  1.00 24.43  ? 160 ASN A N   1 
ATOM   1297  C  CA  . ASN A  1 160 ? -34.296 -1.445  22.429  1.00 26.46  ? 160 ASN A CA  1 
ATOM   1298  C  C   . ASN A  1 160 ? -35.405 -0.445  22.719  1.00 28.00  ? 160 ASN A C   1 
ATOM   1299  O  O   . ASN A  1 160 ? -36.290 -0.701  23.545  1.00 29.74  ? 160 ASN A O   1 
ATOM   1300  C  CB  . ASN A  1 160 ? -33.072 -1.070  23.199  1.00 23.55  ? 160 ASN A CB  1 
ATOM   1301  C  CG  . ASN A  1 160 ? -33.395 -0.574  24.581  1.00 25.38  ? 160 ASN A CG  1 
ATOM   1302  O  OD1 . ASN A  1 160 ? -33.362 0.636   24.843  1.00 27.22  ? 160 ASN A OD1 1 
ATOM   1303  N  ND2 . ASN A  1 160 ? -33.740 -1.514  25.499  1.00 23.49  ? 160 ASN A ND2 1 
ATOM   1304  N  N   . LYS A  1 161 ? -35.360 0.685   22.046  1.00 30.59  ? 161 LYS A N   1 
ATOM   1305  C  CA  . LYS A  1 161 ? -36.325 1.759   22.294  1.00 33.19  ? 161 LYS A CA  1 
ATOM   1306  C  C   . LYS A  1 161 ? -37.686 1.420   21.775  1.00 34.51  ? 161 LYS A C   1 
ATOM   1307  O  O   . LYS A  1 161 ? -38.692 1.879   22.312  1.00 38.46  ? 161 LYS A O   1 
ATOM   1308  C  CB  . LYS A  1 161 ? -35.821 3.096   21.695  1.00 35.74  ? 161 LYS A CB  1 
ATOM   1309  C  CG  . LYS A  1 161 ? -34.617 3.702   22.467  1.00 38.57  ? 161 LYS A CG  1 
ATOM   1310  C  CD  . LYS A  1 161 ? -34.153 5.002   21.864  1.00 41.00  ? 161 LYS A CD  1 
ATOM   1311  C  CE  . LYS A  1 161 ? -33.541 4.789   20.513  1.00 45.64  ? 161 LYS A CE  1 
ATOM   1312  N  NZ  . LYS A  1 161 ? -32.995 6.046   19.957  1.00 49.65  ? 161 LYS A NZ  1 
ATOM   1313  N  N   . GLU A  1 162 ? -37.734 0.602   20.734  1.00 34.37  ? 162 GLU A N   1 
ATOM   1314  C  CA  . GLU A  1 162 ? -39.010 0.171   20.159  1.00 34.29  ? 162 GLU A CA  1 
ATOM   1315  C  C   . GLU A  1 162 ? -39.595 -0.998  20.874  1.00 29.99  ? 162 GLU A C   1 
ATOM   1316  O  O   . GLU A  1 162 ? -40.768 -1.122  20.959  1.00 29.89  ? 162 GLU A O   1 
ATOM   1317  C  CB  . GLU A  1 162 ? -38.848 -0.165  18.659  1.00 38.24  ? 162 GLU A CB  1 
ATOM   1318  C  CG  . GLU A  1 162 ? -38.940 1.016   17.779  1.00 49.39  ? 162 GLU A CG  1 
ATOM   1319  C  CD  . GLU A  1 162 ? -40.239 1.781   17.987  1.00 50.64  ? 162 GLU A CD  1 
ATOM   1320  O  OE1 . GLU A  1 162 ? -41.340 1.147   17.881  1.00 42.84  ? 162 GLU A OE1 1 
ATOM   1321  O  OE2 . GLU A  1 162 ? -40.174 3.013   18.263  1.00 56.03  ? 162 GLU A OE2 1 
ATOM   1322  N  N   . THR A  1 163 ? -38.738 -1.871  21.399  1.00 27.25  ? 163 THR A N   1 
ATOM   1323  C  CA  . THR A  1 163 ? -39.219 -3.165  21.996  1.00 25.82  ? 163 THR A CA  1 
ATOM   1324  C  C   . THR A  1 163 ? -38.954 -3.280  23.479  1.00 26.58  ? 163 THR A C   1 
ATOM   1325  O  O   . THR A  1 163 ? -39.586 -4.067  24.160  1.00 23.60  ? 163 THR A O   1 
ATOM   1326  C  CB  . THR A  1 163 ? -38.594 -4.349  21.306  1.00 23.82  ? 163 THR A CB  1 
ATOM   1327  O  OG1 . THR A  1 163 ? -37.157 -4.330  21.519  1.00 23.80  ? 163 THR A OG1 1 
ATOM   1328  C  CG2 . THR A  1 163 ? -38.896 -4.313  19.776  1.00 23.70  ? 163 THR A CG2 1 
ATOM   1329  N  N   . LYS A  1 164 ? -38.001 -2.498  23.976  1.00 27.22  ? 164 LYS A N   1 
ATOM   1330  C  CA  . LYS A  1 164 ? -37.644 -2.524  25.416  1.00 29.89  ? 164 LYS A CA  1 
ATOM   1331  C  C   . LYS A  1 164 ? -36.801 -3.795  25.865  1.00 30.21  ? 164 LYS A C   1 
ATOM   1332  O  O   . LYS A  1 164 ? -36.521 -3.968  27.046  1.00 28.36  ? 164 LYS A O   1 
ATOM   1333  C  CB  . LYS A  1 164 ? -38.900 -2.363  26.300  1.00 35.87  ? 164 LYS A CB  1 
ATOM   1334  C  CG  . LYS A  1 164 ? -39.404 -0.922  26.388  1.00 41.36  ? 164 LYS A CG  1 
ATOM   1335  C  CD  . LYS A  1 164 ? -40.428 -0.759  27.480  1.00 44.92  ? 164 LYS A CD  1 
ATOM   1336  C  CE  . LYS A  1 164 ? -40.432 0.660   28.012  1.00 52.11  ? 164 LYS A CE  1 
ATOM   1337  N  NZ  . LYS A  1 164 ? -40.485 1.673   26.906  1.00 56.89  ? 164 LYS A NZ  1 
ATOM   1338  N  N   . VAL A  1 165 ? -36.418 -4.651  24.903  1.00 26.16  ? 165 VAL A N   1 
ATOM   1339  C  CA  . VAL A  1 165 ? -35.559 -5.784  25.230  1.00 23.41  ? 165 VAL A CA  1 
ATOM   1340  C  C   . VAL A  1 165 ? -34.168 -5.280  25.562  1.00 22.39  ? 165 VAL A C   1 
ATOM   1341  O  O   . VAL A  1 165 ? -33.706 -4.310  24.980  1.00 23.22  ? 165 VAL A O   1 
ATOM   1342  C  CB  . VAL A  1 165 ? -35.491 -6.832  24.082  1.00 22.92  ? 165 VAL A CB  1 
ATOM   1343  C  CG1 . VAL A  1 165 ? -36.898 -7.349  23.742  1.00 23.21  ? 165 VAL A CG1 1 
ATOM   1344  C  CG2 . VAL A  1 165 ? -34.801 -6.250  22.849  1.00 21.31  ? 165 VAL A CG2 1 
ATOM   1345  N  N   . PRO A  1 166 ? -33.505 -5.929  26.515  1.00 21.81  ? 166 PRO A N   1 
ATOM   1346  C  CA  . PRO A  1 166 ? -32.159 -5.528  26.960  1.00 20.09  ? 166 PRO A CA  1 
ATOM   1347  C  C   . PRO A  1 166 ? -31.091 -5.820  25.913  1.00 22.11  ? 166 PRO A C   1 
ATOM   1348  O  O   . PRO A  1 166 ? -31.369 -6.467  24.898  1.00 19.94  ? 166 PRO A O   1 
ATOM   1349  C  CB  . PRO A  1 166 ? -31.934 -6.394  28.183  1.00 21.51  ? 166 PRO A CB  1 
ATOM   1350  C  CG  . PRO A  1 166 ? -32.817 -7.593  27.962  1.00 19.99  ? 166 PRO A CG  1 
ATOM   1351  C  CD  . PRO A  1 166 ? -34.015 -7.091  27.267  1.00 20.24  ? 166 PRO A CD  1 
ATOM   1352  N  N   . ILE A  1 167 ? -29.872 -5.350  26.169  1.00 20.73  ? 167 ILE A N   1 
ATOM   1353  C  CA  . ILE A  1 167 ? -28.797 -5.508  25.244  1.00 20.58  ? 167 ILE A CA  1 
ATOM   1354  C  C   . ILE A  1 167 ? -27.590 -6.147  25.907  1.00 20.65  ? 167 ILE A C   1 
ATOM   1355  O  O   . ILE A  1 167 ? -27.122 -5.683  26.933  1.00 17.43  ? 167 ILE A O   1 
ATOM   1356  C  CB  . ILE A  1 167 ? -28.380 -4.132  24.625  1.00 21.01  ? 167 ILE A CB  1 
ATOM   1357  C  CG1 . ILE A  1 167 ? -29.561 -3.522  23.841  1.00 20.90  ? 167 ILE A CG1 1 
ATOM   1358  C  CG2 . ILE A  1 167 ? -27.135 -4.291  23.734  1.00 19.27  ? 167 ILE A CG2 1 
ATOM   1359  C  CD1 . ILE A  1 167 ? -29.326 -2.086  23.370  1.00 21.20  ? 167 ILE A CD1 1 
ATOM   1360  N  N   . ILE A  1 168 ? -27.102 -7.221  25.317  1.00 20.13  ? 168 ILE A N   1 
ATOM   1361  C  CA  . ILE A  1 168 ? -25.921 -7.853  25.784  1.00 20.99  ? 168 ILE A CA  1 
ATOM   1362  C  C   . ILE A  1 168 ? -24.813 -7.576  24.814  1.00 20.69  ? 168 ILE A C   1 
ATOM   1363  O  O   . ILE A  1 168 ? -25.018 -7.635  23.592  1.00 21.10  ? 168 ILE A O   1 
ATOM   1364  C  CB  . ILE A  1 168 ? -26.122 -9.430  25.932  1.00 20.99  ? 168 ILE A CB  1 
ATOM   1365  C  CG1 . ILE A  1 168 ? -27.219 -9.731  26.915  1.00 20.94  ? 168 ILE A CG1 1 
ATOM   1366  C  CG2 . ILE A  1 168 ? -24.813 -10.108 26.349  1.00 19.48  ? 168 ILE A CG2 1 
ATOM   1367  C  CD1 . ILE A  1 168 ? -27.640 -11.226 26.954  1.00 22.02  ? 168 ILE A CD1 1 
ATOM   1368  N  N   . THR A  1 169 ? -23.639 -7.265  25.318  1.00 20.96  ? 169 THR A N   1 
ATOM   1369  C  CA  . THR A  1 169 ? -22.521 -6.992  24.434  1.00 21.47  ? 169 THR A CA  1 
ATOM   1370  C  C   . THR A  1 169 ? -21.381 -7.934  24.623  1.00 21.58  ? 169 THR A C   1 
ATOM   1371  O  O   . THR A  1 169 ? -21.254 -8.565  25.631  1.00 24.06  ? 169 THR A O   1 
ATOM   1372  C  CB  . THR A  1 169 ? -21.980 -5.504  24.583  1.00 23.24  ? 169 THR A CB  1 
ATOM   1373  O  OG1 . THR A  1 169 ? -21.036 -5.434  25.658  1.00 23.59  ? 169 THR A OG1 1 
ATOM   1374  C  CG2 . THR A  1 169 ? -23.112 -4.539  24.824  1.00 22.58  ? 169 THR A CG2 1 
ATOM   1375  N  N   . HIS A  1 170 ? -20.571 -8.020  23.611  1.00 22.80  ? 170 HIS A N   1 
ATOM   1376  C  CA  . HIS A  1 170 ? -19.332 -8.642  23.669  1.00 22.39  ? 170 HIS A CA  1 
ATOM   1377  C  C   . HIS A  1 170 ? -18.327 -7.556  23.561  1.00 21.46  ? 170 HIS A C   1 
ATOM   1378  O  O   . HIS A  1 170 ? -18.460 -6.671  22.716  1.00 21.58  ? 170 HIS A O   1 
ATOM   1379  C  CB  . HIS A  1 170 ? -19.181 -9.616  22.465  1.00 22.12  ? 170 HIS A CB  1 
ATOM   1380  C  CG  . HIS A  1 170 ? -17.766 -10.136 22.262  1.00 22.52  ? 170 HIS A CG  1 
ATOM   1381  N  ND1 . HIS A  1 170 ? -17.417 -11.463 22.477  1.00 19.66  ? 170 HIS A ND1 1 
ATOM   1382  C  CD2 . HIS A  1 170 ? -16.576 -9.477  21.837  1.00 23.56  ? 170 HIS A CD2 1 
ATOM   1383  C  CE1 . HIS A  1 170 ? -16.096 -11.627 22.210  1.00 22.89  ? 170 HIS A CE1 1 
ATOM   1384  N  NE2 . HIS A  1 170 ? -15.578 -10.415 21.819  1.00 25.01  ? 170 HIS A NE2 1 
ATOM   1385  N  N   . SER A  1 171 ? -17.317 -7.577  24.405  1.00 24.49  ? 171 SER A N   1 
ATOM   1386  C  CA  . SER A  1 171 ? -16.252 -6.551  24.317  1.00 26.17  ? 171 SER A CA  1 
ATOM   1387  C  C   . SER A  1 171 ? -14.868 -7.106  24.634  1.00 28.57  ? 171 SER A C   1 
ATOM   1388  O  O   . SER A  1 171 ? -14.729 -8.230  25.094  1.00 24.72  ? 171 SER A O   1 
ATOM   1389  C  CB  . SER A  1 171 ? -16.566 -5.352  25.231  1.00 26.04  ? 171 SER A CB  1 
ATOM   1390  O  OG  . SER A  1 171 ? -16.265 -5.639  26.552  1.00 30.90  ? 171 SER A OG  1 
ATOM   1391  N  N   . ASN A  1 172 ? -13.852 -6.305  24.365  1.00 27.31  ? 172 ASN A N   1 
ATOM   1392  C  CA  . ASN A  1 172 ? -12.544 -6.625  24.726  1.00 27.29  ? 172 ASN A CA  1 
ATOM   1393  C  C   . ASN A  1 172 ? -12.199 -5.856  25.963  1.00 28.14  ? 172 ASN A C   1 
ATOM   1394  O  O   . ASN A  1 172 ? -12.237 -4.626  25.972  1.00 28.65  ? 172 ASN A O   1 
ATOM   1395  C  CB  . ASN A  1 172 ? -11.562 -6.281  23.571  1.00 30.92  ? 172 ASN A CB  1 
ATOM   1396  C  CG  . ASN A  1 172 ? -10.151 -6.751  23.845  1.00 32.54  ? 172 ASN A CG  1 
ATOM   1397  O  OD1 . ASN A  1 172 ? -9.544  -6.388  24.866  1.00 35.26  ? 172 ASN A OD1 1 
ATOM   1398  N  ND2 . ASN A  1 172 ? -9.615  -7.548  22.947  1.00 30.63  ? 172 ASN A ND2 1 
ATOM   1399  N  N   . ALA A  1 173 ? -11.870 -6.567  27.015  1.00 27.28  ? 173 ALA A N   1 
ATOM   1400  C  CA  . ALA A  1 173 ? -11.689 -5.948  28.337  1.00 29.96  ? 173 ALA A CA  1 
ATOM   1401  C  C   . ALA A  1 173 ? -10.498 -5.016  28.408  1.00 31.11  ? 173 ALA A C   1 
ATOM   1402  O  O   . ALA A  1 173 ? -10.379 -4.259  29.330  1.00 35.28  ? 173 ALA A O   1 
ATOM   1403  C  CB  . ALA A  1 173 ? -11.583 -7.027  29.419  1.00 26.84  ? 173 ALA A CB  1 
ATOM   1404  N  N   . HIS A  1 174 ? -9.617  -5.079  27.399  1.00 32.85  ? 174 HIS A N   1 
ATOM   1405  C  CA  . HIS A  1 174 ? -8.299  -4.337  27.460  1.00 33.41  ? 174 HIS A CA  1 
ATOM   1406  C  C   . HIS A  1 174 ? -8.178  -3.120  26.547  1.00 34.80  ? 174 HIS A C   1 
ATOM   1407  O  O   . HIS A  1 174 ? -7.140  -2.487  26.515  1.00 35.90  ? 174 HIS A O   1 
ATOM   1408  C  CB  . HIS A  1 174 ? -7.146  -5.284  27.181  1.00 32.30  ? 174 HIS A CB  1 
ATOM   1409  C  CG  . HIS A  1 174 ? -7.132  -6.464  28.041  1.00 34.54  ? 174 HIS A CG  1 
ATOM   1410  N  ND1 . HIS A  1 174 ? -6.899  -6.393  29.387  1.00 39.85  ? 174 HIS A ND1 1 
ATOM   1411  C  CD2 . HIS A  1 174 ? -7.321  -7.811  27.750  1.00 33.80  ? 174 HIS A CD2 1 
ATOM   1412  C  CE1 . HIS A  1 174 ? -6.945  -7.620  29.907  1.00 38.43  ? 174 HIS A CE1 1 
ATOM   1413  N  NE2 . HIS A  1 174 ? -7.202  -8.492  28.912  1.00 39.72  ? 174 HIS A NE2 1 
ATOM   1414  N  N   . ASN A  1 175 ? -9.230  -2.792  25.806  1.00 30.59  ? 175 ASN A N   1 
ATOM   1415  C  CA  . ASN A  1 175 ? -9.130  -1.653  24.833  1.00 33.48  ? 175 ASN A CA  1 
ATOM   1416  C  C   . ASN A  1 175 ? -10.273 -0.611  24.895  1.00 36.23  ? 175 ASN A C   1 
ATOM   1417  O  O   . ASN A  1 175 ? -10.392 0.213   24.024  1.00 44.85  ? 175 ASN A O   1 
ATOM   1418  C  CB  . ASN A  1 175 ? -8.965  -2.163  23.419  1.00 30.08  ? 175 ASN A CB  1 
ATOM   1419  C  CG  . ASN A  1 175 ? -10.214 -2.698  22.863  1.00 28.39  ? 175 ASN A CG  1 
ATOM   1420  O  OD1 . ASN A  1 175 ? -11.250 -2.798  23.574  1.00 27.52  ? 175 ASN A OD1 1 
ATOM   1421  N  ND2 . ASN A  1 175 ? -10.183 -3.058  21.601  1.00 27.58  ? 175 ASN A ND2 1 
ATOM   1422  N  N   . ASN A  1 176 ? -11.086 -0.680  25.913  1.00 35.66  ? 176 ASN A N   1 
ATOM   1423  C  CA  . ASN A  1 176 ? -12.054 0.357   26.147  1.00 35.74  ? 176 ASN A CA  1 
ATOM   1424  C  C   . ASN A  1 176 ? -13.374 0.210   25.297  1.00 32.24  ? 176 ASN A C   1 
ATOM   1425  O  O   . ASN A  1 176 ? -14.278 1.085   25.358  1.00 28.24  ? 176 ASN A O   1 
ATOM   1426  C  CB  . ASN A  1 176 ? -11.428 1.699   25.870  1.00 40.65  ? 176 ASN A CB  1 
ATOM   1427  C  CG  . ASN A  1 176 ? -11.955 2.751   26.728  1.00 51.95  ? 176 ASN A CG  1 
ATOM   1428  O  OD1 . ASN A  1 176 ? -11.918 2.641   27.969  1.00 53.17  ? 176 ASN A OD1 1 
ATOM   1429  N  ND2 . ASN A  1 176 ? -12.462 3.827   26.111  1.00 58.43  ? 176 ASN A ND2 1 
ATOM   1430  N  N   . THR A  1 177 ? -13.469 -0.860  24.530  1.00 29.17  ? 177 THR A N   1 
ATOM   1431  C  CA  . THR A  1 177 ? -14.652 -1.082  23.676  1.00 28.23  ? 177 THR A CA  1 
ATOM   1432  C  C   . THR A  1 177 ? -15.963 -1.122  24.512  1.00 28.59  ? 177 THR A C   1 
ATOM   1433  O  O   . THR A  1 177 ? -17.008 -0.598  24.082  1.00 30.09  ? 177 THR A O   1 
ATOM   1434  C  CB  . THR A  1 177 ? -14.523 -2.353  22.866  1.00 27.22  ? 177 THR A CB  1 
ATOM   1435  O  OG1 . THR A  1 177 ? -13.988 -3.384  23.688  1.00 24.15  ? 177 THR A OG1 1 
ATOM   1436  C  CG2 . THR A  1 177 ? -13.576 -2.130  21.655  1.00 27.39  ? 177 THR A CG2 1 
ATOM   1437  N  N   . GLY A  1 178 ? -15.893 -1.742  25.702  1.00 27.39  ? 178 GLY A N   1 
ATOM   1438  C  CA  . GLY A  1 178 ? -17.057 -1.819  26.598  1.00 25.78  ? 178 GLY A CA  1 
ATOM   1439  C  C   . GLY A  1 178 ? -17.564 -0.443  26.984  1.00 25.56  ? 178 GLY A C   1 
ATOM   1440  O  O   . GLY A  1 178 ? -18.781 -0.147  26.872  1.00 25.36  ? 178 GLY A O   1 
ATOM   1441  N  N   . LEU A  1 179 ? -16.657 0.402   27.432  1.00 24.19  ? 179 LEU A N   1 
ATOM   1442  C  CA  . LEU A  1 179 ? -16.997 1.745   27.806  1.00 26.88  ? 179 LEU A CA  1 
ATOM   1443  C  C   . LEU A  1 179 ? -17.650 2.520   26.605  1.00 27.68  ? 179 LEU A C   1 
ATOM   1444  O  O   . LEU A  1 179 ? -18.635 3.259   26.781  1.00 30.17  ? 179 LEU A O   1 
ATOM   1445  C  CB  . LEU A  1 179 ? -15.748 2.488   28.309  1.00 29.03  ? 179 LEU A CB  1 
ATOM   1446  C  CG  . LEU A  1 179 ? -15.939 3.889   28.856  1.00 32.72  ? 179 LEU A CG  1 
ATOM   1447  C  CD1 . LEU A  1 179 ? -16.766 3.853   30.112  1.00 34.01  ? 179 LEU A CD1 1 
ATOM   1448  C  CD2 . LEU A  1 179 ? -14.583 4.537   29.124  1.00 34.39  ? 179 LEU A CD2 1 
ATOM   1449  N  N   . GLU A  1 180 ? -17.095 2.330   25.416  1.00 27.12  ? 180 GLU A N   1 
ATOM   1450  C  CA  . GLU A  1 180 ? -17.586 2.999   24.225  0.70 25.83  ? 180 GLU A CA  1 
ATOM   1451  C  C   . GLU A  1 180 ? -18.955 2.506   23.824  1.00 25.68  ? 180 GLU A C   1 
ATOM   1452  O  O   . GLU A  1 180 ? -19.772 3.266   23.387  1.00 27.91  ? 180 GLU A O   1 
ATOM   1453  C  CB  . GLU A  1 180 ? -16.597 2.831   23.066  0.70 26.07  ? 180 GLU A CB  1 
ATOM   1454  C  CG  . GLU A  1 180 ? -15.421 3.738   23.155  0.70 30.11  ? 180 GLU A CG  1 
ATOM   1455  C  CD  . GLU A  1 180 ? -15.815 5.207   23.024  0.70 33.28  ? 180 GLU A CD  1 
ATOM   1456  O  OE1 . GLU A  1 180 ? -16.108 5.649   21.890  0.70 35.13  ? 180 GLU A OE1 1 
ATOM   1457  O  OE2 . GLU A  1 180 ? -15.827 5.907   24.042  0.70 36.82  ? 180 GLU A OE2 1 
ATOM   1458  N  N   . GLN A  1 181 ? -19.193 1.195   23.981  1.00 26.75  ? 181 GLN A N   1 
ATOM   1459  C  CA  . GLN A  1 181 ? -20.510 0.622   23.691  1.00 26.09  ? 181 GLN A CA  1 
ATOM   1460  C  C   . GLN A  1 181 ? -21.544 1.251   24.555  1.00 26.98  ? 181 GLN A C   1 
ATOM   1461  O  O   . GLN A  1 181 ? -22.610 1.673   24.073  1.00 26.37  ? 181 GLN A O   1 
ATOM   1462  C  CB  . GLN A  1 181 ? -20.507 -0.922  23.917  1.00 24.93  ? 181 GLN A CB  1 
ATOM   1463  C  CG  . GLN A  1 181 ? -19.763 -1.732  22.851  1.00 23.11  ? 181 GLN A CG  1 
ATOM   1464  C  CD  . GLN A  1 181 ? -19.507 -3.203  23.302  1.00 24.53  ? 181 GLN A CD  1 
ATOM   1465  O  OE1 . GLN A  1 181 ? -19.449 -3.498  24.510  1.00 23.19  ? 181 GLN A OE1 1 
ATOM   1466  N  NE2 . GLN A  1 181 ? -19.359 -4.102  22.339  1.00 21.34  ? 181 GLN A NE2 1 
ATOM   1467  N  N   . GLN A  1 182 ? -21.251 1.320   25.862  1.00 27.13  ? 182 GLN A N   1 
ATOM   1468  C  CA  . GLN A  1 182 ? -22.178 1.912   26.842  1.00 26.91  ? 182 GLN A CA  1 
ATOM   1469  C  C   . GLN A  1 182 ? -22.449 3.387   26.533  1.00 28.51  ? 182 GLN A C   1 
ATOM   1470  O  O   . GLN A  1 182 ? -23.587 3.851   26.627  1.00 28.81  ? 182 GLN A O   1 
ATOM   1471  C  CB  . GLN A  1 182 ? -21.621 1.774   28.244  1.00 25.78  ? 182 GLN A CB  1 
ATOM   1472  C  CG  . GLN A  1 182 ? -22.448 2.446   29.310  1.00 28.00  ? 182 GLN A CG  1 
ATOM   1473  C  CD  . GLN A  1 182 ? -21.784 2.408   30.642  1.00 29.18  ? 182 GLN A CD  1 
ATOM   1474  O  OE1 . GLN A  1 182 ? -20.664 2.912   30.807  1.00 28.49  ? 182 GLN A OE1 1 
ATOM   1475  N  NE2 . GLN A  1 182 ? -22.468 1.794   31.644  1.00 28.06  ? 182 GLN A NE2 1 
ATOM   1476  N  N   . ARG A  1 183 ? -21.403 4.111   26.167  1.00 27.97  ? 183 ARG A N   1 
ATOM   1477  C  CA  . ARG A  1 183 ? -21.534 5.527   25.843  1.00 31.40  ? 183 ARG A CA  1 
ATOM   1478  C  C   . ARG A  1 183 ? -22.427 5.736   24.639  1.00 31.77  ? 183 ARG A C   1 
ATOM   1479  O  O   . ARG A  1 183 ? -23.363 6.513   24.688  1.00 34.80  ? 183 ARG A O   1 
ATOM   1480  C  CB  . ARG A  1 183 ? -20.154 6.167   25.587  1.00 31.89  ? 183 ARG A CB  1 
ATOM   1481  C  CG  . ARG A  1 183 ? -20.236 7.662   25.141  1.00 35.23  ? 183 ARG A CG  1 
ATOM   1482  C  CD  . ARG A  1 183 ? -18.844 8.248   24.758  1.00 33.69  ? 183 ARG A CD  1 
ATOM   1483  N  NE  . ARG A  1 183 ? -18.277 7.615   23.554  1.00 34.40  ? 183 ARG A NE  1 
ATOM   1484  C  CZ  . ARG A  1 183 ? -18.711 7.847   22.292  1.00 35.56  ? 183 ARG A CZ  1 
ATOM   1485  N  NH1 . ARG A  1 183 ? -18.132 7.227   21.261  1.00 34.96  ? 183 ARG A NH1 1 
ATOM   1486  N  NH2 . ARG A  1 183 ? -19.717 8.684   22.074  1.00 34.03  ? 183 ARG A NH2 1 
ATOM   1487  N  N   . ILE A  1 184 ? -22.125 5.035   23.550  1.00 29.31  ? 184 ILE A N   1 
ATOM   1488  C  CA  . ILE A  1 184 ? -22.902 5.170   22.334  1.00 27.98  ? 184 ILE A CA  1 
ATOM   1489  C  C   . ILE A  1 184 ? -24.383 4.780   22.573  1.00 26.79  ? 184 ILE A C   1 
ATOM   1490  O  O   . ILE A  1 184 ? -25.269 5.493   22.204  1.00 27.63  ? 184 ILE A O   1 
ATOM   1491  C  CB  . ILE A  1 184 ? -22.304 4.341   21.183  1.00 26.55  ? 184 ILE A CB  1 
ATOM   1492  C  CG1 . ILE A  1 184 ? -20.969 4.940   20.740  1.00 26.13  ? 184 ILE A CG1 1 
ATOM   1493  C  CG2 . ILE A  1 184 ? -23.275 4.275   20.003  1.00 25.04  ? 184 ILE A CG2 1 
ATOM   1494  C  CD1 . ILE A  1 184 ? -20.214 4.088   19.716  1.00 26.27  ? 184 ILE A CD1 1 
ATOM   1495  N  N   . LEU A  1 185 ? -24.599 3.636   23.214  1.00 25.07  ? 185 LEU A N   1 
ATOM   1496  C  CA  . LEU A  1 185 ? -25.973 3.168   23.524  1.00 25.08  ? 185 LEU A CA  1 
ATOM   1497  C  C   . LEU A  1 185 ? -26.770 4.191   24.375  1.00 26.58  ? 185 LEU A C   1 
ATOM   1498  O  O   . LEU A  1 185 ? -27.902 4.540   24.038  1.00 29.21  ? 185 LEU A O   1 
ATOM   1499  C  CB  . LEU A  1 185 ? -25.939 1.797   24.223  1.00 22.63  ? 185 LEU A CB  1 
ATOM   1500  C  CG  . LEU A  1 185 ? -25.530 0.600   23.321  1.00 20.87  ? 185 LEU A CG  1 
ATOM   1501  C  CD1 . LEU A  1 185 ? -25.338 -0.664  24.137  1.00 17.26  ? 185 LEU A CD1 1 
ATOM   1502  C  CD2 . LEU A  1 185 ? -26.565 0.386   22.208  1.00 20.94  ? 185 LEU A CD2 1 
ATOM   1503  N  N   . THR A  1 186 ? -26.170 4.659   25.460  1.00 26.40  ? 186 THR A N   1 
ATOM   1504  C  CA  . THR A  1 186 ? -26.870 5.587   26.379  1.00 29.21  ? 186 THR A CA  1 
ATOM   1505  C  C   . THR A  1 186 ? -27.092 6.981   25.757  1.00 31.86  ? 186 THR A C   1 
ATOM   1506  O  O   . THR A  1 186 ? -28.059 7.655   26.077  1.00 30.77  ? 186 THR A O   1 
ATOM   1507  C  CB  . THR A  1 186 ? -26.142 5.717   27.752  1.00 30.20  ? 186 THR A CB  1 
ATOM   1508  O  OG1 . THR A  1 186 ? -24.784 6.074   27.542  1.00 30.06  ? 186 THR A OG1 1 
ATOM   1509  C  CG2 . THR A  1 186 ? -26.206 4.397   28.515  1.00 27.44  ? 186 THR A CG2 1 
ATOM   1510  N  N   . GLU A  1 187 ? -26.198 7.390   24.877  1.00 30.84  ? 187 GLU A N   1 
ATOM   1511  C  CA  . GLU A  1 187 ? -26.383 8.638   24.164  1.00 38.01  ? 187 GLU A CA  1 
ATOM   1512  C  C   . GLU A  1 187 ? -27.549 8.516   23.153  1.00 39.63  ? 187 GLU A C   1 
ATOM   1513  O  O   . GLU A  1 187 ? -28.176 9.495   22.808  1.00 38.81  ? 187 GLU A O   1 
ATOM   1514  C  CB  . GLU A  1 187 ? -25.097 9.063   23.460  1.00 39.11  ? 187 GLU A CB  1 
ATOM   1515  C  CG  . GLU A  1 187 ? -23.998 9.560   24.425  1.00 42.71  ? 187 GLU A CG  1 
ATOM   1516  C  CD  . GLU A  1 187 ? -22.743 10.012  23.705  1.00 46.05  ? 187 GLU A CD  1 
ATOM   1517  O  OE1 . GLU A  1 187 ? -21.884 10.662  24.349  1.00 55.56  ? 187 GLU A OE1 1 
ATOM   1518  O  OE2 . GLU A  1 187 ? -22.614 9.726   22.506  1.00 49.90  ? 187 GLU A OE2 1 
ATOM   1519  N  N   . GLU A  1 188 ? -27.821 7.282   22.703  1.00 37.55  ? 188 GLU A N   1 
ATOM   1520  C  CA  . GLU A  1 188 ? -28.927 7.033   21.786  1.00 34.77  ? 188 GLU A CA  1 
ATOM   1521  C  C   . GLU A  1 188 ? -30.248 6.781   22.540  1.00 32.16  ? 188 GLU A C   1 
ATOM   1522  O  O   . GLU A  1 188 ? -31.228 6.390   21.954  1.00 35.36  ? 188 GLU A O   1 
ATOM   1523  C  CB  . GLU A  1 188 ? -28.605 5.861   20.849  1.00 37.09  ? 188 GLU A CB  1 
ATOM   1524  C  CG  . GLU A  1 188 ? -27.492 6.163   19.841  1.00 41.59  ? 188 GLU A CG  1 
ATOM   1525  C  CD  . GLU A  1 188 ? -27.901 7.239   18.810  1.00 51.53  ? 188 GLU A CD  1 
ATOM   1526  O  OE1 . GLU A  1 188 ? -28.563 6.889   17.811  1.00 58.69  ? 188 GLU A OE1 1 
ATOM   1527  O  OE2 . GLU A  1 188 ? -27.545 8.421   19.007  1.00 61.31  ? 188 GLU A OE2 1 
ATOM   1528  N  N   . GLY A  1 189 ? -30.235 7.008   23.848  1.00 32.72  ? 189 GLY A N   1 
ATOM   1529  C  CA  . GLY A  1 189 ? -31.466 6.930   24.653  1.00 30.72  ? 189 GLY A CA  1 
ATOM   1530  C  C   . GLY A  1 189 ? -31.710 5.579   25.377  1.00 30.84  ? 189 GLY A C   1 
ATOM   1531  O  O   . GLY A  1 189 ? -32.725 5.396   26.011  1.00 30.57  ? 189 GLY A O   1 
ATOM   1532  N  N   . VAL A  1 190 ? -30.779 4.667   25.266  1.00 30.05  ? 190 VAL A N   1 
ATOM   1533  C  CA  . VAL A  1 190 ? -30.899 3.392   25.954  1.00 27.69  ? 190 VAL A CA  1 
ATOM   1534  C  C   . VAL A  1 190 ? -30.653 3.552   27.482  1.00 27.79  ? 190 VAL A C   1 
ATOM   1535  O  O   . VAL A  1 190 ? -29.614 4.099   27.910  1.00 31.06  ? 190 VAL A O   1 
ATOM   1536  C  CB  . VAL A  1 190 ? -29.905 2.323   25.383  1.00 27.46  ? 190 VAL A CB  1 
ATOM   1537  C  CG1 . VAL A  1 190 ? -30.063 0.992   26.127  1.00 26.99  ? 190 VAL A CG1 1 
ATOM   1538  C  CG2 . VAL A  1 190 ? -30.116 2.136   23.895  1.00 23.84  ? 190 VAL A CG2 1 
ATOM   1539  N  N   . ASP A  1 191 ? -31.591 3.086   28.273  1.00 27.20  ? 191 ASP A N   1 
ATOM   1540  C  CA  . ASP A  1 191 ? -31.424 3.031   29.705  1.00 29.63  ? 191 ASP A CA  1 
ATOM   1541  C  C   . ASP A  1 191 ? -30.171 2.189   30.053  1.00 29.27  ? 191 ASP A C   1 
ATOM   1542  O  O   . ASP A  1 191 ? -30.078 1.028   29.675  1.00 31.51  ? 191 ASP A O   1 
ATOM   1543  C  CB  . ASP A  1 191 ? -32.673 2.421   30.357  1.00 31.73  ? 191 ASP A CB  1 
ATOM   1544  C  CG  . ASP A  1 191 ? -32.517 2.225   31.899  1.00 36.60  ? 191 ASP A CG  1 
ATOM   1545  O  OD1 . ASP A  1 191 ? -31.379 2.294   32.406  1.00 39.46  ? 191 ASP A OD1 1 
ATOM   1546  O  OD2 . ASP A  1 191 ? -33.538 2.001   32.569  1.00 44.24  ? 191 ASP A OD2 1 
ATOM   1547  N  N   . PRO A  1 192 ? -29.233 2.778   30.762  1.00 31.21  ? 192 PRO A N   1 
ATOM   1548  C  CA  . PRO A  1 192 ? -27.963 2.081   31.089  1.00 28.21  ? 192 PRO A CA  1 
ATOM   1549  C  C   . PRO A  1 192 ? -28.192 0.734   31.778  1.00 27.73  ? 192 PRO A C   1 
ATOM   1550  O  O   . PRO A  1 192 ? -27.354 -0.225  31.614  1.00 23.66  ? 192 PRO A O   1 
ATOM   1551  C  CB  . PRO A  1 192 ? -27.257 3.066   32.053  1.00 29.26  ? 192 PRO A CB  1 
ATOM   1552  C  CG  . PRO A  1 192 ? -28.345 4.011   32.506  1.00 29.83  ? 192 PRO A CG  1 
ATOM   1553  C  CD  . PRO A  1 192 ? -29.295 4.118   31.362  1.00 30.31  ? 192 PRO A CD  1 
ATOM   1554  N  N   . GLY A  1 193 ? -29.302 0.634   32.549  1.00 24.92  ? 193 GLY A N   1 
ATOM   1555  C  CA  . GLY A  1 193 ? -29.639 -0.591  33.273  1.00 22.44  ? 193 GLY A CA  1 
ATOM   1556  C  C   . GLY A  1 193 ? -30.224 -1.686  32.351  1.00 23.46  ? 193 GLY A C   1 
ATOM   1557  O  O   . GLY A  1 193 ? -30.559 -2.775  32.802  1.00 23.47  ? 193 GLY A O   1 
ATOM   1558  N  N   . LYS A  1 194 ? -30.340 -1.376  31.088  1.00 24.67  ? 194 LYS A N   1 
ATOM   1559  C  CA  . LYS A  1 194 ? -30.795 -2.333  30.115  1.00 25.13  ? 194 LYS A CA  1 
ATOM   1560  C  C   . LYS A  1 194 ? -29.599 -2.870  29.269  1.00 24.67  ? 194 LYS A C   1 
ATOM   1561  O  O   . LYS A  1 194 ? -29.792 -3.487  28.216  1.00 24.66  ? 194 LYS A O   1 
ATOM   1562  C  CB  . LYS A  1 194 ? -31.855 -1.708  29.211  1.00 26.00  ? 194 LYS A CB  1 
ATOM   1563  C  CG  . LYS A  1 194 ? -33.295 -1.792  29.780  1.00 29.26  ? 194 LYS A CG  1 
ATOM   1564  C  CD  . LYS A  1 194 ? -33.840 -3.203  29.627  1.00 32.86  ? 194 LYS A CD  1 
ATOM   1565  C  CE  . LYS A  1 194 ? -35.210 -3.345  30.208  1.00 34.11  ? 194 LYS A CE  1 
ATOM   1566  N  NZ  . LYS A  1 194 ? -35.729 -4.754  30.016  1.00 33.86  ? 194 LYS A NZ  1 
ATOM   1567  N  N   . ILE A  1 195 ? -28.383 -2.625  29.752  1.00 23.57  ? 195 ILE A N   1 
ATOM   1568  C  CA  . ILE A  1 195 ? -27.168 -3.047  29.041  1.00 22.34  ? 195 ILE A CA  1 
ATOM   1569  C  C   . ILE A  1 195 ? -26.297 -3.910  29.902  1.00 23.55  ? 195 ILE A C   1 
ATOM   1570  O  O   . ILE A  1 195 ? -26.083 -3.612  31.090  1.00 22.98  ? 195 ILE A O   1 
ATOM   1571  C  CB  . ILE A  1 195 ? -26.329 -1.837  28.603  1.00 22.76  ? 195 ILE A CB  1 
ATOM   1572  C  CG1 . ILE A  1 195 ? -27.183 -0.833  27.848  1.00 22.03  ? 195 ILE A CG1 1 
ATOM   1573  C  CG2 . ILE A  1 195 ? -25.132 -2.291  27.754  1.00 21.80  ? 195 ILE A CG2 1 
ATOM   1574  C  CD1 . ILE A  1 195 ? -26.521 0.533   27.694  1.00 19.79  ? 195 ILE A CD1 1 
ATOM   1575  N  N   . LEU A  1 196 ? -25.784 -4.990  29.318  1.00 22.84  ? 196 LEU A N   1 
ATOM   1576  C  CA  . LEU A  1 196 ? -24.794 -5.787  29.948  1.00 21.42  ? 196 LEU A CA  1 
ATOM   1577  C  C   . LEU A  1 196 ? -23.529 -5.692  29.154  1.00 21.43  ? 196 LEU A C   1 
ATOM   1578  O  O   . LEU A  1 196 ? -23.473 -6.133  28.032  1.00 22.21  ? 196 LEU A O   1 
ATOM   1579  C  CB  . LEU A  1 196 ? -25.258 -7.275  30.053  1.00 19.31  ? 196 LEU A CB  1 
ATOM   1580  C  CG  . LEU A  1 196 ? -24.162 -8.353  30.455  1.00 18.75  ? 196 LEU A CG  1 
ATOM   1581  C  CD1 . LEU A  1 196 ? -23.536 -8.069  31.831  1.00 17.83  ? 196 LEU A CD1 1 
ATOM   1582  C  CD2 . LEU A  1 196 ? -24.732 -9.740  30.411  1.00 17.65  ? 196 LEU A CD2 1 
ATOM   1583  N  N   . ILE A  1 197 ? -22.509 -5.088  29.739  1.00 20.81  ? 197 ILE A N   1 
ATOM   1584  C  CA  . ILE A  1 197 ? -21.213 -4.967  29.072  1.00 21.35  ? 197 ILE A CA  1 
ATOM   1585  C  C   . ILE A  1 197 ? -20.396 -6.218  29.357  1.00 21.30  ? 197 ILE A C   1 
ATOM   1586  O  O   . ILE A  1 197 ? -20.075 -6.519  30.526  1.00 21.89  ? 197 ILE A O   1 
ATOM   1587  C  CB  . ILE A  1 197 ? -20.450 -3.710  29.536  1.00 22.67  ? 197 ILE A CB  1 
ATOM   1588  C  CG1 . ILE A  1 197 ? -21.308 -2.408  29.274  1.00 19.97  ? 197 ILE A CG1 1 
ATOM   1589  C  CG2 . ILE A  1 197 ? -19.090 -3.621  28.857  1.00 21.90  ? 197 ILE A CG2 1 
ATOM   1590  C  CD1 . ILE A  1 197 ? -21.589 -2.133  27.799  1.00 22.88  ? 197 ILE A CD1 1 
ATOM   1591  N  N   . GLY A  1 198 ? -20.057 -6.954  28.296  1.00 21.84  ? 198 GLY A N   1 
ATOM   1592  C  CA  . GLY A  1 198 ? -19.543 -8.303  28.440  1.00 22.43  ? 198 GLY A CA  1 
ATOM   1593  C  C   . GLY A  1 198 ? -18.037 -8.473  28.530  1.00 25.15  ? 198 GLY A C   1 
ATOM   1594  O  O   . GLY A  1 198 ? -17.257 -7.615  28.072  1.00 24.62  ? 198 GLY A O   1 
ATOM   1595  N  N   . HIS A  1 199 ? -17.636 -9.584  29.132  1.00 21.74  ? 199 HIS A N   1 
ATOM   1596  C  CA  . HIS A  1 199 ? -16.246 -10.018 29.167  1.00 22.81  ? 199 HIS A CA  1 
ATOM   1597  C  C   . HIS A  1 199 ? -15.335 -9.111  29.943  1.00 25.88  ? 199 HIS A C   1 
ATOM   1598  O  O   . HIS A  1 199 ? -14.108 -9.140  29.764  1.00 26.33  ? 199 HIS A O   1 
ATOM   1599  C  CB  . HIS A  1 199 ? -15.715 -10.272 27.738  1.00 22.32  ? 199 HIS A CB  1 
ATOM   1600  C  CG  . HIS A  1 199 ? -16.655 -11.128 26.881  1.00 22.63  ? 199 HIS A CG  1 
ATOM   1601  N  ND1 . HIS A  1 199 ? -17.486 -12.104 27.426  1.00 22.77  ? 199 HIS A ND1 1 
ATOM   1602  C  CD2 . HIS A  1 199 ? -16.883 -11.148 25.509  1.00 23.00  ? 199 HIS A CD2 1 
ATOM   1603  C  CE1 . HIS A  1 199 ? -18.206 -12.695 26.429  1.00 22.89  ? 199 HIS A CE1 1 
ATOM   1604  N  NE2 . HIS A  1 199 ? -17.855 -12.131 25.264  1.00 23.46  ? 199 HIS A NE2 1 
ATOM   1605  N  N   . LEU A  1 200 ? -15.918 -8.316  30.823  1.00 25.40  ? 200 LEU A N   1 
ATOM   1606  C  CA  . LEU A  1 200 ? -15.146 -7.475  31.731  1.00 26.94  ? 200 LEU A CA  1 
ATOM   1607  C  C   . LEU A  1 200 ? -14.352 -8.339  32.747  1.00 29.33  ? 200 LEU A C   1 
ATOM   1608  O  O   . LEU A  1 200 ? -13.365 -7.878  33.338  1.00 29.11  ? 200 LEU A O   1 
ATOM   1609  C  CB  . LEU A  1 200 ? -16.064 -6.511  32.466  1.00 28.47  ? 200 LEU A CB  1 
ATOM   1610  C  CG  . LEU A  1 200 ? -16.289 -5.124  31.841  1.00 30.51  ? 200 LEU A CG  1 
ATOM   1611  C  CD1 . LEU A  1 200 ? -16.071 -5.150  30.345  1.00 29.64  ? 200 LEU A CD1 1 
ATOM   1612  C  CD2 . LEU A  1 200 ? -17.683 -4.638  32.168  1.00 24.20  ? 200 LEU A CD2 1 
ATOM   1613  N  N   . GLY A  1 201 ? -14.797 -9.586  32.941  1.00 30.69  ? 201 GLY A N   1 
ATOM   1614  C  CA  . GLY A  1 201 ? -14.103 -10.516 33.832  1.00 27.07  ? 201 GLY A CA  1 
ATOM   1615  C  C   . GLY A  1 201 ? -12.749 -10.900 33.285  1.00 29.71  ? 201 GLY A C   1 
ATOM   1616  O  O   . GLY A  1 201 ? -11.907 -11.501 34.008  1.00 33.03  ? 201 GLY A O   1 
ATOM   1617  N  N   . ASP A  1 202 ? -12.514 -10.566 32.006  1.00 28.00  ? 202 ASP A N   1 
ATOM   1618  C  CA  . ASP A  1 202 ? -11.241 -10.865 31.350  1.00 28.83  ? 202 ASP A CA  1 
ATOM   1619  C  C   . ASP A  1 202 ? -10.093 -10.000 31.897  1.00 31.55  ? 202 ASP A C   1 
ATOM   1620  O  O   . ASP A  1 202 ? -8.935  -10.216 31.562  1.00 29.96  ? 202 ASP A O   1 
ATOM   1621  C  CB  . ASP A  1 202 ? -11.354 -10.669 29.832  1.00 30.63  ? 202 ASP A CB  1 
ATOM   1622  C  CG  . ASP A  1 202 ? -12.262 -11.730 29.155  1.00 32.93  ? 202 ASP A CG  1 
ATOM   1623  O  OD1 . ASP A  1 202 ? -12.853 -12.589 29.884  1.00 31.27  ? 202 ASP A OD1 1 
ATOM   1624  O  OD2 . ASP A  1 202 ? -12.377 -11.701 27.901  1.00 31.00  ? 202 ASP A OD2 1 
ATOM   1625  N  N   . THR A  1 203 ? -10.427 -9.022  32.724  1.00 30.79  ? 203 THR A N   1 
ATOM   1626  C  CA  . THR A  1 203 ? -9.408  -8.139  33.302  1.00 34.61  ? 203 THR A CA  1 
ATOM   1627  C  C   . THR A  1 203 ? -9.526  -8.057  34.798  1.00 37.07  ? 203 THR A C   1 
ATOM   1628  O  O   . THR A  1 203 ? -10.580 -8.309  35.359  1.00 32.77  ? 203 THR A O   1 
ATOM   1629  C  CB  . THR A  1 203 ? -9.484  -6.693  32.704  1.00 36.29  ? 203 THR A CB  1 
ATOM   1630  O  OG1 . THR A  1 203 ? -8.429  -5.911  33.224  1.00 39.06  ? 203 THR A OG1 1 
ATOM   1631  C  CG2 . THR A  1 203 ? -10.815 -6.030  33.055  1.00 33.81  ? 203 THR A CG2 1 
ATOM   1632  N  N   . ASP A  1 204 ? -8.429  -7.702  35.450  1.00 40.26  ? 204 ASP A N   1 
ATOM   1633  C  CA  . ASP A  1 204 ? -8.429  -7.508  36.875  1.00 42.55  ? 204 ASP A CA  1 
ATOM   1634  C  C   . ASP A  1 204 ? -8.374  -6.005  37.212  1.00 41.38  ? 204 ASP A C   1 
ATOM   1635  O  O   . ASP A  1 204 ? -8.322  -5.623  38.376  1.00 41.50  ? 204 ASP A O   1 
ATOM   1636  C  CB  . ASP A  1 204 ? -7.259  -8.254  37.528  1.00 44.59  ? 204 ASP A CB  1 
ATOM   1637  C  CG  . ASP A  1 204 ? -5.921  -7.834  36.973  1.00 49.75  ? 204 ASP A CG  1 
ATOM   1638  O  OD1 . ASP A  1 204 ? -4.934  -8.518  37.247  1.00 53.00  ? 204 ASP A OD1 1 
ATOM   1639  O  OD2 . ASP A  1 204 ? -5.864  -6.812  36.259  1.00 52.67  ? 204 ASP A OD2 1 
ATOM   1640  N  N   . ASN A  1 205 ? -8.387  -5.162  36.155  1.00 37.38  ? 205 ASN A N   1 
ATOM   1641  C  CA  . ASN A  1 205 ? -8.428  -3.706  36.317  1.00 38.63  ? 205 ASN A CA  1 
ATOM   1642  C  C   . ASN A  1 205 ? -9.761  -3.241  36.946  1.00 37.54  ? 205 ASN A C   1 
ATOM   1643  O  O   . ASN A  1 205 ? -10.705 -2.882  36.240  1.00 38.25  ? 205 ASN A O   1 
ATOM   1644  C  CB  . ASN A  1 205 ? -8.209  -3.018  34.981  1.00 34.68  ? 205 ASN A CB  1 
ATOM   1645  C  CG  . ASN A  1 205 ? -8.225  -1.494  35.095  1.00 39.57  ? 205 ASN A CG  1 
ATOM   1646  O  OD1 . ASN A  1 205 ? -8.733  -0.941  36.055  1.00 38.74  ? 205 ASN A OD1 1 
ATOM   1647  N  ND2 . ASN A  1 205 ? -7.678  -0.838  34.120  1.00 43.43  ? 205 ASN A ND2 1 
ATOM   1648  N  N   . ILE A  1 206 ? -9.809  -3.253  38.267  1.00 39.73  ? 206 ILE A N   1 
ATOM   1649  C  CA  . ILE A  1 206 ? -11.031 -2.951  39.015  1.00 41.72  ? 206 ILE A CA  1 
ATOM   1650  C  C   . ILE A  1 206 ? -11.631 -1.549  38.677  1.00 39.49  ? 206 ILE A C   1 
ATOM   1651  O  O   . ILE A  1 206 ? -12.849 -1.391  38.600  1.00 39.61  ? 206 ILE A O   1 
ATOM   1652  C  CB  . ILE A  1 206 ? -10.787 -3.056  40.549  1.00 47.52  ? 206 ILE A CB  1 
ATOM   1653  C  CG1 . ILE A  1 206 ? -10.186 -4.433  40.901  1.00 56.95  ? 206 ILE A CG1 1 
ATOM   1654  C  CG2 . ILE A  1 206 ? -12.080 -2.815  41.319  1.00 49.74  ? 206 ILE A CG2 1 
ATOM   1655  C  CD1 . ILE A  1 206 ? -9.605  -4.512  42.311  1.00 59.52  ? 206 ILE A CD1 1 
ATOM   1656  N  N   . ASP A  1 207 ? -10.767 -0.563  38.485  1.00 37.16  ? 207 ASP A N   1 
ATOM   1657  C  CA  . ASP A  1 207 ? -11.219 0.811   38.207  1.00 40.48  ? 207 ASP A CA  1 
ATOM   1658  C  C   . ASP A  1 207 ? -12.027 0.915   36.872  1.00 38.22  ? 207 ASP A C   1 
ATOM   1659  O  O   . ASP A  1 207 ? -13.068 1.597   36.808  1.00 34.28  ? 207 ASP A O   1 
ATOM   1660  C  CB  . ASP A  1 207 ? -10.035 1.783   38.204  1.00 44.27  ? 207 ASP A CB  1 
ATOM   1661  C  CG  . ASP A  1 207 ? -9.406  1.969   39.626  1.00 52.18  ? 207 ASP A CG  1 
ATOM   1662  O  OD1 . ASP A  1 207 ? -10.064 1.583   40.635  1.00 53.96  ? 207 ASP A OD1 1 
ATOM   1663  O  OD2 . ASP A  1 207 ? -8.280  2.494   39.714  1.00 55.11  ? 207 ASP A OD2 1 
ATOM   1664  N  N   . TYR A  1 208 ? -11.547 0.250   35.841  1.00 34.08  ? 208 TYR A N   1 
ATOM   1665  C  CA  . TYR A  1 208 ? -12.238 0.237   34.588  1.00 34.16  ? 208 TYR A CA  1 
ATOM   1666  C  C   . TYR A  1 208 ? -13.646 -0.436  34.744  1.00 31.55  ? 208 TYR A C   1 
ATOM   1667  O  O   . TYR A  1 208 ? -14.638 0.066   34.247  1.00 28.75  ? 208 TYR A O   1 
ATOM   1668  C  CB  . TYR A  1 208 ? -11.411 -0.485  33.521  1.00 30.82  ? 208 TYR A CB  1 
ATOM   1669  C  CG  . TYR A  1 208 ? -12.120 -0.606  32.167  1.00 31.52  ? 208 TYR A CG  1 
ATOM   1670  C  CD1 . TYR A  1 208 ? -12.497 0.549   31.437  1.00 30.39  ? 208 TYR A CD1 1 
ATOM   1671  C  CD2 . TYR A  1 208 ? -12.409 -1.863  31.614  1.00 27.79  ? 208 TYR A CD2 1 
ATOM   1672  C  CE1 . TYR A  1 208 ? -13.138 0.445   30.216  1.00 30.07  ? 208 TYR A CE1 1 
ATOM   1673  C  CE2 . TYR A  1 208 ? -13.053 -1.979  30.385  1.00 29.58  ? 208 TYR A CE2 1 
ATOM   1674  C  CZ  . TYR A  1 208 ? -13.418 -0.825  29.685  1.00 31.52  ? 208 TYR A CZ  1 
ATOM   1675  O  OH  . TYR A  1 208 ? -14.051 -0.937  28.475  1.00 36.98  ? 208 TYR A OH  1 
ATOM   1676  N  N   . ILE A  1 209 ? -13.683 -1.550  35.446  1.00 30.37  ? 209 ILE A N   1 
ATOM   1677  C  CA  . ILE A  1 209 ? -14.927 -2.282  35.654  1.00 29.02  ? 209 ILE A CA  1 
ATOM   1678  C  C   . ILE A  1 209 ? -15.938 -1.450  36.460  1.00 30.25  ? 209 ILE A C   1 
ATOM   1679  O  O   . ILE A  1 209 ? -17.131 -1.412  36.129  1.00 27.07  ? 209 ILE A O   1 
ATOM   1680  C  CB  . ILE A  1 209 ? -14.676 -3.621  36.356  1.00 29.44  ? 209 ILE A CB  1 
ATOM   1681  C  CG1 . ILE A  1 209 ? -13.680 -4.487  35.519  1.00 27.70  ? 209 ILE A CG1 1 
ATOM   1682  C  CG2 . ILE A  1 209 ? -15.977 -4.355  36.585  1.00 27.82  ? 209 ILE A CG2 1 
ATOM   1683  C  CD1 . ILE A  1 209 ? -13.300 -5.811  36.180  1.00 29.90  ? 209 ILE A CD1 1 
ATOM   1684  N  N   . LYS A  1 210 ? -15.451 -0.779  37.522  1.00 30.92  ? 210 LYS A N   1 
ATOM   1685  C  CA  . LYS A  1 210 ? -16.331 0.132   38.359  1.00 32.20  ? 210 LYS A CA  1 
ATOM   1686  C  C   . LYS A  1 210 ? -16.801 1.296   37.563  1.00 32.18  ? 210 LYS A C   1 
ATOM   1687  O  O   . LYS A  1 210 ? -17.963 1.751   37.705  1.00 31.98  ? 210 LYS A O   1 
ATOM   1688  C  CB  . LYS A  1 210 ? -15.589 0.620   39.586  1.00 30.75  ? 210 LYS A CB  1 
ATOM   1689  C  CG  . LYS A  1 210 ? -15.487 -0.388  40.687  1.00 32.23  ? 210 LYS A CG  1 
ATOM   1690  C  CD  . LYS A  1 210 ? -14.761 0.209   41.892  1.00 35.55  ? 210 LYS A CD  1 
ATOM   1691  C  CE  . LYS A  1 210 ? -14.778 -0.727  43.067  1.00 39.15  ? 210 LYS A CE  1 
ATOM   1692  N  NZ  . LYS A  1 210 ? -14.125 -0.116  44.251  1.00 41.18  ? 210 LYS A NZ  1 
ATOM   1693  N  N   . LYS A  1 211 ? -15.919 1.810   36.720  1.00 31.99  ? 211 LYS A N   1 
ATOM   1694  C  CA  . LYS A  1 211 ? -16.238 2.915   35.861  1.00 33.39  ? 211 LYS A CA  1 
ATOM   1695  C  C   . LYS A  1 211 ? -17.541 2.597   35.042  1.00 29.87  ? 211 LYS A C   1 
ATOM   1696  O  O   . LYS A  1 211 ? -18.450 3.401   34.977  1.00 28.01  ? 211 LYS A O   1 
ATOM   1697  C  CB  . LYS A  1 211 ? -15.060 3.191   34.927  1.00 35.66  ? 211 LYS A CB  1 
ATOM   1698  C  CG  . LYS A  1 211 ? -15.100 4.518   34.184  1.00 44.42  ? 211 LYS A CG  1 
ATOM   1699  C  CD  . LYS A  1 211 ? -13.718 4.771   33.467  1.00 48.16  ? 211 LYS A CD  1 
ATOM   1700  C  CE  . LYS A  1 211 ? -13.812 5.850   32.393  1.00 55.96  ? 211 LYS A CE  1 
ATOM   1701  N  NZ  . LYS A  1 211 ? -13.993 7.196   32.958  1.00 63.50  ? 211 LYS A NZ  1 
ATOM   1702  N  N   . ILE A  1 212 ? -17.587 1.400   34.449  1.00 26.88  ? 212 ILE A N   1 
ATOM   1703  C  CA  . ILE A  1 212 ? -18.748 0.973   33.646  1.00 24.47  ? 212 ILE A CA  1 
ATOM   1704  C  C   . ILE A  1 212 ? -20.000 0.715   34.526  1.00 23.70  ? 212 ILE A C   1 
ATOM   1705  O  O   . ILE A  1 212 ? -21.169 1.153   34.163  1.00 23.32  ? 212 ILE A O   1 
ATOM   1706  C  CB  . ILE A  1 212 ? -18.413 -0.269  32.805  1.00 25.21  ? 212 ILE A CB  1 
ATOM   1707  C  CG1 . ILE A  1 212 ? -17.438 0.118   31.661  1.00 26.56  ? 212 ILE A CG1 1 
ATOM   1708  C  CG2 . ILE A  1 212 ? -19.699 -0.918  32.242  1.00 23.22  ? 212 ILE A CG2 1 
ATOM   1709  C  CD1 . ILE A  1 212 ? -16.673 -1.048  31.075  1.00 27.49  ? 212 ILE A CD1 1 
ATOM   1710  N  N   . ALA A  1 213 ? -19.801 0.036   35.654  1.00 21.28  ? 213 ALA A N   1 
ATOM   1711  C  CA  . ALA A  1 213 ? -20.896 -0.221  36.587  1.00 23.98  ? 213 ALA A CA  1 
ATOM   1712  C  C   . ALA A  1 213 ? -21.469 1.101   37.128  1.00 25.11  ? 213 ALA A C   1 
ATOM   1713  O  O   . ALA A  1 213 ? -22.708 1.267   37.243  1.00 29.02  ? 213 ALA A O   1 
ATOM   1714  C  CB  . ALA A  1 213 ? -20.426 -1.113  37.736  1.00 21.72  ? 213 ALA A CB  1 
ATOM   1715  N  N   . ASP A  1 214 ? -20.587 2.028   37.450  1.00 26.20  ? 214 ASP A N   1 
ATOM   1716  C  CA  . ASP A  1 214 ? -21.007 3.346   37.996  1.00 30.17  ? 214 ASP A CA  1 
ATOM   1717  C  C   . ASP A  1 214 ? -21.859 4.133   37.027  1.00 32.05  ? 214 ASP A C   1 
ATOM   1718  O  O   . ASP A  1 214 ? -22.636 4.956   37.428  1.00 32.80  ? 214 ASP A O   1 
ATOM   1719  C  CB  . ASP A  1 214 ? -19.800 4.164   38.418  1.00 30.51  ? 214 ASP A CB  1 
ATOM   1720  C  CG  . ASP A  1 214 ? -19.250 3.738   39.786  1.00 34.92  ? 214 ASP A CG  1 
ATOM   1721  O  OD1 . ASP A  1 214 ? -20.066 3.224   40.650  1.00 32.54  ? 214 ASP A OD1 1 
ATOM   1722  O  OD2 . ASP A  1 214 ? -18.031 3.909   40.015  1.00 37.92  ? 214 ASP A OD2 1 
ATOM   1723  N  N   . LYS A  1 215 ? -21.701 3.868   35.736  1.00 34.64  ? 215 LYS A N   1 
ATOM   1724  C  CA  . LYS A  1 215 ? -22.525 4.550   34.727  1.00 33.30  ? 215 LYS A CA  1 
ATOM   1725  C  C   . LYS A  1 215 ? -23.869 3.859   34.527  1.00 31.01  ? 215 LYS A C   1 
ATOM   1726  O  O   . LYS A  1 215 ? -24.643 4.243   33.677  1.00 32.70  ? 215 LYS A O   1 
ATOM   1727  C  CB  . LYS A  1 215 ? -21.762 4.720   33.402  1.00 36.48  ? 215 LYS A CB  1 
ATOM   1728  C  CG  . LYS A  1 215 ? -20.489 5.552   33.568  1.00 41.80  ? 215 LYS A CG  1 
ATOM   1729  C  CD  . LYS A  1 215 ? -20.120 6.276   32.339  1.00 43.69  ? 215 LYS A CD  1 
ATOM   1730  C  CE  . LYS A  1 215 ? -18.903 7.179   32.597  1.00 52.12  ? 215 LYS A CE  1 
ATOM   1731  N  NZ  . LYS A  1 215 ? -18.687 8.168   31.507  1.00 55.94  ? 215 LYS A NZ  1 
ATOM   1732  N  N   . GLY A  1 216 ? -24.133 2.809   35.351  1.00 26.39  ? 216 GLY A N   1 
ATOM   1733  C  CA  . GLY A  1 216 ? -25.477 2.219   35.439  1.00 24.94  ? 216 GLY A CA  1 
ATOM   1734  C  C   . GLY A  1 216 ? -25.718 0.902   34.674  1.00 23.78  ? 216 GLY A C   1 
ATOM   1735  O  O   . GLY A  1 216 ? -26.822 0.430   34.615  1.00 25.13  ? 216 GLY A O   1 
ATOM   1736  N  N   . SER A  1 217 ? -24.675 0.332   34.111  1.00 22.04  ? 217 SER A N   1 
ATOM   1737  C  CA  . SER A  1 217 ? -24.823 -0.934  33.331  1.00 22.39  ? 217 SER A CA  1 
ATOM   1738  C  C   . SER A  1 217 ? -24.317 -2.128  34.082  1.00 22.57  ? 217 SER A C   1 
ATOM   1739  O  O   . SER A  1 217 ? -23.428 -2.012  34.918  1.00 25.75  ? 217 SER A O   1 
ATOM   1740  C  CB  . SER A  1 217 ? -24.108 -0.820  31.996  1.00 21.28  ? 217 SER A CB  1 
ATOM   1741  O  OG  . SER A  1 217 ? -24.709 0.181   31.190  1.00 23.04  ? 217 SER A OG  1 
ATOM   1742  N  N   . PHE A  1 218 ? -24.893 -3.314  33.782  1.00 21.72  ? 218 PHE A N   1 
ATOM   1743  C  CA  . PHE A  1 218 ? -24.408 -4.542  34.355  1.00 20.01  ? 218 PHE A CA  1 
ATOM   1744  C  C   . PHE A  1 218 ? -22.996 -4.880  33.799  1.00 19.67  ? 218 PHE A C   1 
ATOM   1745  O  O   . PHE A  1 218 ? -22.675 -4.569  32.649  1.00 19.88  ? 218 PHE A O   1 
ATOM   1746  C  CB  . PHE A  1 218 ? -25.390 -5.692  34.099  1.00 19.98  ? 218 PHE A CB  1 
ATOM   1747  C  CG  . PHE A  1 218 ? -26.712 -5.537  34.830  1.00 20.19  ? 218 PHE A CG  1 
ATOM   1748  C  CD1 . PHE A  1 218 ? -27.837 -5.046  34.169  1.00 21.87  ? 218 PHE A CD1 1 
ATOM   1749  C  CD2 . PHE A  1 218 ? -26.824 -5.874  36.208  1.00 19.43  ? 218 PHE A CD2 1 
ATOM   1750  C  CE1 . PHE A  1 218 ? -29.061 -4.898  34.848  1.00 19.95  ? 218 PHE A CE1 1 
ATOM   1751  C  CE2 . PHE A  1 218 ? -28.033 -5.725  36.886  1.00 21.07  ? 218 PHE A CE2 1 
ATOM   1752  C  CZ  . PHE A  1 218 ? -29.153 -5.241  36.215  1.00 21.89  ? 218 PHE A CZ  1 
ATOM   1753  N  N   . ILE A  1 219 ? -22.185 -5.488  34.617  1.00 19.73  ? 219 ILE A N   1 
ATOM   1754  C  CA  . ILE A  1 219 ? -20.827 -5.834  34.222  1.00 21.55  ? 219 ILE A CA  1 
ATOM   1755  C  C   . ILE A  1 219 ? -20.679 -7.346  34.108  1.00 21.95  ? 219 ILE A C   1 
ATOM   1756  O  O   . ILE A  1 219 ? -20.972 -8.067  35.029  1.00 23.71  ? 219 ILE A O   1 
ATOM   1757  C  CB  . ILE A  1 219 ? -19.811 -5.282  35.209  1.00 21.36  ? 219 ILE A CB  1 
ATOM   1758  C  CG1 . ILE A  1 219 ? -20.161 -5.722  36.629  1.00 21.69  ? 219 ILE A CG1 1 
ATOM   1759  C  CG2 . ILE A  1 219 ? -19.774 -3.747  35.126  1.00 21.28  ? 219 ILE A CG2 1 
ATOM   1760  C  CD1 . ILE A  1 219 ? -19.192 -5.245  37.671  1.00 26.34  ? 219 ILE A CD1 1 
ATOM   1761  N  N   . GLY A  1 220 ? -20.228 -7.800  32.962  1.00 21.87  ? 220 GLY A N   1 
ATOM   1762  C  CA  . GLY A  1 220 ? -20.153 -9.224  32.692  1.00 21.92  ? 220 GLY A CA  1 
ATOM   1763  C  C   . GLY A  1 220 ? -18.878 -9.871  33.127  1.00 22.14  ? 220 GLY A C   1 
ATOM   1764  O  O   . GLY A  1 220 ? -17.862 -9.747  32.472  1.00 25.71  ? 220 GLY A O   1 
ATOM   1765  N  N   . LEU A  1 221 ? -18.932 -10.562 34.257  1.00 23.07  ? 221 LEU A N   1 
ATOM   1766  C  CA  . LEU A  1 221 ? -17.829 -11.417 34.696  1.00 24.71  ? 221 LEU A CA  1 
ATOM   1767  C  C   . LEU A  1 221 ? -18.196 -12.787 34.238  1.00 24.75  ? 221 LEU A C   1 
ATOM   1768  O  O   . LEU A  1 221 ? -18.551 -13.677 35.052  1.00 21.01  ? 221 LEU A O   1 
ATOM   1769  C  CB  . LEU A  1 221 ? -17.695 -11.365 36.198  1.00 26.11  ? 221 LEU A CB  1 
ATOM   1770  C  CG  . LEU A  1 221 ? -17.676 -9.901  36.825  1.00 26.12  ? 221 LEU A CG  1 
ATOM   1771  C  CD1 . LEU A  1 221 ? -17.672 -9.943  38.332  1.00 24.29  ? 221 LEU A CD1 1 
ATOM   1772  C  CD2 . LEU A  1 221 ? -16.494 -9.077  36.301  1.00 23.98  ? 221 LEU A CD2 1 
ATOM   1773  N  N   . ASP A  1 222 ? -18.116 -12.985 32.923  1.00 23.73  ? 222 ASP A N   1 
ATOM   1774  C  CA  . ASP A  1 222 ? -18.899 -13.989 32.264  1.00 24.10  ? 222 ASP A CA  1 
ATOM   1775  C  C   . ASP A  1 222 ? -18.093 -15.013 31.465  1.00 23.79  ? 222 ASP A C   1 
ATOM   1776  O  O   . ASP A  1 222 ? -18.652 -15.720 30.603  1.00 22.55  ? 222 ASP A O   1 
ATOM   1777  C  CB  . ASP A  1 222 ? -19.907 -13.293 31.325  1.00 23.95  ? 222 ASP A CB  1 
ATOM   1778  C  CG  . ASP A  1 222 ? -19.202 -12.274 30.333  1.00 26.23  ? 222 ASP A CG  1 
ATOM   1779  O  OD1 . ASP A  1 222 ? -19.889 -11.372 29.807  1.00 26.20  ? 222 ASP A OD1 1 
ATOM   1780  O  OD2 . ASP A  1 222 ? -17.944 -12.412 30.115  1.00 24.33  ? 222 ASP A OD2 1 
ATOM   1781  N  N   . ARG A  1 223 ? -16.819 -15.105 31.728  1.00 25.32  ? 223 ARG A N   1 
ATOM   1782  C  CA  . ARG A  1 223 ? -15.979 -16.106 31.027  1.00 26.51  ? 223 ARG A CA  1 
ATOM   1783  C  C   . ARG A  1 223 ? -15.227 -17.032 32.003  1.00 29.63  ? 223 ARG A C   1 
ATOM   1784  O  O   . ARG A  1 223 ? -14.071 -17.451 31.742  1.00 30.13  ? 223 ARG A O   1 
ATOM   1785  C  CB  . ARG A  1 223 ? -15.019 -15.427 30.041  1.00 25.34  ? 223 ARG A CB  1 
ATOM   1786  C  CG  . ARG A  1 223 ? -15.672 -15.103 28.662  1.00 25.21  ? 223 ARG A CG  1 
ATOM   1787  C  CD  . ARG A  1 223 ? -14.774 -14.252 27.797  1.00 25.60  ? 223 ARG A CD  1 
ATOM   1788  N  NE  . ARG A  1 223 ? -15.068 -14.427 26.386  1.00 25.01  ? 223 ARG A NE  1 
ATOM   1789  C  CZ  . ARG A  1 223 ? -14.461 -13.747 25.394  1.00 25.84  ? 223 ARG A CZ  1 
ATOM   1790  N  NH1 . ARG A  1 223 ? -13.539 -12.840 25.675  1.00 22.09  ? 223 ARG A NH1 1 
ATOM   1791  N  NH2 . ARG A  1 223 ? -14.797 -13.979 24.118  1.00 25.21  ? 223 ARG A NH2 1 
ATOM   1792  N  N   . TYR A  1 224 ? -15.872 -17.355 33.099  1.00 27.97  ? 224 TYR A N   1 
ATOM   1793  C  CA  . TYR A  1 224 ? -15.290 -18.243 34.074  1.00 31.65  ? 224 TYR A CA  1 
ATOM   1794  C  C   . TYR A  1 224 ? -14.892 -19.571 33.455  1.00 34.46  ? 224 TYR A C   1 
ATOM   1795  O  O   . TYR A  1 224 ? -15.751 -20.294 32.841  1.00 30.56  ? 224 TYR A O   1 
ATOM   1796  C  CB  . TYR A  1 224 ? -16.240 -18.466 35.234  1.00 27.80  ? 224 TYR A CB  1 
ATOM   1797  C  CG  . TYR A  1 224 ? -15.951 -17.587 36.418  1.00 28.98  ? 224 TYR A CG  1 
ATOM   1798  C  CD1 . TYR A  1 224 ? -16.727 -16.461 36.688  1.00 26.58  ? 224 TYR A CD1 1 
ATOM   1799  C  CD2 . TYR A  1 224 ? -14.861 -17.879 37.294  1.00 28.18  ? 224 TYR A CD2 1 
ATOM   1800  C  CE1 . TYR A  1 224 ? -16.452 -15.647 37.788  1.00 27.96  ? 224 TYR A CE1 1 
ATOM   1801  C  CE2 . TYR A  1 224 ? -14.585 -17.081 38.381  1.00 27.27  ? 224 TYR A CE2 1 
ATOM   1802  C  CZ  . TYR A  1 224 ? -15.370 -15.970 38.636  1.00 28.29  ? 224 TYR A CZ  1 
ATOM   1803  O  OH  . TYR A  1 224 ? -15.093 -15.193 39.705  1.00 29.59  ? 224 TYR A OH  1 
ATOM   1804  N  N   . GLY A  1 225 ? -13.598 -19.920 33.596  1.00 31.62  ? 225 GLY A N   1 
ATOM   1805  C  CA  . GLY A  1 225 ? -13.075 -21.166 33.052  1.00 33.03  ? 225 GLY A CA  1 
ATOM   1806  C  C   . GLY A  1 225 ? -12.109 -20.932 31.900  1.00 36.98  ? 225 GLY A C   1 
ATOM   1807  O  O   . GLY A  1 225 ? -11.244 -21.738 31.643  1.00 42.33  ? 225 GLY A O   1 
ATOM   1808  N  N   . LEU A  1 226 ? -12.279 -19.815 31.209  1.00 38.29  ? 226 LEU A N   1 
ATOM   1809  C  CA  . LEU A  1 226 ? -11.399 -19.463 30.098  1.00 37.62  ? 226 LEU A CA  1 
ATOM   1810  C  C   . LEU A  1 226 ? -10.128 -18.828 30.611  1.00 36.09  ? 226 LEU A C   1 
ATOM   1811  O  O   . LEU A  1 226 ? -9.989  -17.619 30.615  1.00 36.82  ? 226 LEU A O   1 
ATOM   1812  C  CB  . LEU A  1 226 ? -12.111 -18.535 29.131  1.00 35.88  ? 226 LEU A CB  1 
ATOM   1813  C  CG  . LEU A  1 226 ? -13.249 -19.193 28.345  1.00 39.08  ? 226 LEU A CG  1 
ATOM   1814  C  CD1 . LEU A  1 226 ? -14.214 -18.161 27.788  1.00 43.58  ? 226 LEU A CD1 1 
ATOM   1815  C  CD2 . LEU A  1 226 ? -12.697 -20.081 27.238  1.00 40.75  ? 226 LEU A CD2 1 
ATOM   1816  N  N   . ASP A  1 227 ? -9.198  -19.667 31.048  1.00 39.48  ? 227 ASP A N   1 
ATOM   1817  C  CA  . ASP A  1 227 ? -7.940  -19.193 31.677  1.00 43.13  ? 227 ASP A CA  1 
ATOM   1818  C  C   . ASP A  1 227 ? -7.104  -18.332 30.759  1.00 41.55  ? 227 ASP A C   1 
ATOM   1819  O  O   . ASP A  1 227 ? -6.453  -17.420 31.206  1.00 42.12  ? 227 ASP A O   1 
ATOM   1820  C  CB  . ASP A  1 227 ? -7.113  -20.381 32.186  1.00 45.19  ? 227 ASP A CB  1 
ATOM   1821  C  CG  . ASP A  1 227 ? -7.736  -21.047 33.406  1.00 52.33  ? 227 ASP A CG  1 
ATOM   1822  O  OD1 . ASP A  1 227 ? -8.560  -20.379 34.109  1.00 51.17  ? 227 ASP A OD1 1 
ATOM   1823  O  OD2 . ASP A  1 227 ? -7.414  -22.219 33.670  1.00 55.13  ? 227 ASP A OD2 1 
ATOM   1824  N  N   . LEU A  1 228 ? -7.133  -18.634 29.454  1.00 40.97  ? 228 LEU A N   1 
ATOM   1825  C  CA  . LEU A  1 228 ? -6.330  -17.874 28.475  1.00 44.86  ? 228 LEU A CA  1 
ATOM   1826  C  C   . LEU A  1 228 ? -6.606  -16.363 28.572  1.00 45.84  ? 228 LEU A C   1 
ATOM   1827  O  O   . LEU A  1 228 ? -5.713  -15.553 28.383  1.00 50.29  ? 228 LEU A O   1 
ATOM   1828  C  CB  . LEU A  1 228 ? -6.574  -18.382 27.037  1.00 45.58  ? 228 LEU A CB  1 
ATOM   1829  C  CG  . LEU A  1 228 ? -7.914  -18.036 26.387  1.00 51.34  ? 228 LEU A CG  1 
ATOM   1830  C  CD1 . LEU A  1 228 ? -7.909  -18.416 24.899  1.00 52.37  ? 228 LEU A CD1 1 
ATOM   1831  C  CD2 . LEU A  1 228 ? -9.068  -18.707 27.117  1.00 49.28  ? 228 LEU A CD2 1 
ATOM   1832  N  N   . PHE A  1 229 ? -7.855  -16.007 28.873  1.00 46.57  ? 229 PHE A N   1 
ATOM   1833  C  CA  . PHE A  1 229 ? -8.224  -14.616 29.050  1.00 42.12  ? 229 PHE A CA  1 
ATOM   1834  C  C   . PHE A  1 229 ? -7.877  -14.143 30.461  1.00 41.52  ? 229 PHE A C   1 
ATOM   1835  O  O   . PHE A  1 229 ? -7.338  -13.090 30.639  1.00 42.92  ? 229 PHE A O   1 
ATOM   1836  C  CB  . PHE A  1 229 ? -9.712  -14.413 28.773  1.00 46.84  ? 229 PHE A CB  1 
ATOM   1837  C  CG  . PHE A  1 229 ? -10.107 -14.675 27.331  1.00 51.34  ? 229 PHE A CG  1 
ATOM   1838  C  CD1 . PHE A  1 229 ? -9.491  -13.980 26.284  1.00 52.76  ? 229 PHE A CD1 1 
ATOM   1839  C  CD2 . PHE A  1 229 ? -11.094 -15.600 27.023  1.00 50.29  ? 229 PHE A CD2 1 
ATOM   1840  C  CE1 . PHE A  1 229 ? -9.854  -14.216 24.961  1.00 57.24  ? 229 PHE A CE1 1 
ATOM   1841  C  CE2 . PHE A  1 229 ? -11.459 -15.837 25.698  1.00 54.31  ? 229 PHE A CE2 1 
ATOM   1842  C  CZ  . PHE A  1 229 ? -10.835 -15.142 24.671  1.00 54.55  ? 229 PHE A CZ  1 
ATOM   1843  N  N   . LEU A  1 230 ? -8.215  -14.956 31.447  1.00 40.56  ? 230 LEU A N   1 
ATOM   1844  C  CA  . LEU A  1 230 ? -7.858  -14.683 32.852  1.00 40.14  ? 230 LEU A CA  1 
ATOM   1845  C  C   . LEU A  1 230 ? -8.164  -15.913 33.715  1.00 41.64  ? 230 LEU A C   1 
ATOM   1846  O  O   . LEU A  1 230 ? -9.336  -16.438 33.704  1.00 34.55  ? 230 LEU A O   1 
ATOM   1847  C  CB  . LEU A  1 230 ? -8.608  -13.445 33.394  1.00 38.86  ? 230 LEU A CB  1 
ATOM   1848  C  CG  . LEU A  1 230 ? -8.116  -12.893 34.774  1.00 39.08  ? 230 LEU A CG  1 
ATOM   1849  C  CD1 . LEU A  1 230 ? -6.730  -12.190 34.649  1.00 37.77  ? 230 LEU A CD1 1 
ATOM   1850  C  CD2 . LEU A  1 230 ? -9.139  -11.966 35.401  1.00 33.63  ? 230 LEU A CD2 1 
ATOM   1851  N  N   . PRO A  1 231 ? -7.133  -16.403 34.477  1.00 41.13  ? 231 PRO A N   1 
ATOM   1852  C  CA  . PRO A  1 231 ? -7.255  -17.611 35.340  1.00 40.85  ? 231 PRO A CA  1 
ATOM   1853  C  C   . PRO A  1 231 ? -8.413  -17.510 36.313  1.00 38.36  ? 231 PRO A C   1 
ATOM   1854  O  O   . PRO A  1 231 ? -8.803  -16.397 36.715  1.00 37.90  ? 231 PRO A O   1 
ATOM   1855  C  CB  . PRO A  1 231 ? -5.929  -17.626 36.102  1.00 41.11  ? 231 PRO A CB  1 
ATOM   1856  C  CG  . PRO A  1 231 ? -4.982  -16.863 35.228  1.00 47.15  ? 231 PRO A CG  1 
ATOM   1857  C  CD  . PRO A  1 231 ? -5.795  -15.795 34.568  1.00 44.44  ? 231 PRO A CD  1 
ATOM   1858  N  N   . VAL A  1 232 ? -8.958  -18.655 36.699  1.00 35.15  ? 232 VAL A N   1 
ATOM   1859  C  CA  . VAL A  1 232 ? -10.099 -18.696 37.612  1.00 35.13  ? 232 VAL A CA  1 
ATOM   1860  C  C   . VAL A  1 232 ? -9.827  -17.955 38.920  1.00 36.24  ? 232 VAL A C   1 
ATOM   1861  O  O   . VAL A  1 232 ? -10.661 -17.196 39.385  1.00 35.88  ? 232 VAL A O   1 
ATOM   1862  C  CB  . VAL A  1 232 ? -10.529 -20.155 37.928  1.00 36.67  ? 232 VAL A CB  1 
ATOM   1863  C  CG1 . VAL A  1 232 ? -11.622 -20.169 39.000  1.00 33.43  ? 232 VAL A CG1 1 
ATOM   1864  C  CG2 . VAL A  1 232 ? -11.002 -20.854 36.664  1.00 36.66  ? 232 VAL A CG2 1 
ATOM   1865  N  N   . ASP A  1 233 ? -8.639  -18.188 39.514  1.00 42.39  ? 233 ASP A N   1 
ATOM   1866  C  CA  . ASP A  1 233 ? -8.285  -17.545 40.786  1.00 43.58  ? 233 ASP A CA  1 
ATOM   1867  C  C   . ASP A  1 233 ? -8.228  -15.965 40.671  1.00 39.50  ? 233 ASP A C   1 
ATOM   1868  O  O   . ASP A  1 233 ? -8.623  -15.267 41.576  1.00 37.80  ? 233 ASP A O   1 
ATOM   1869  C  CB  . ASP A  1 233 ? -6.963  -18.106 41.347  1.00 53.78  ? 233 ASP A CB  1 
ATOM   1870  C  CG  . ASP A  1 233 ? -5.792  -17.832 40.451  1.00 65.94  ? 233 ASP A CG  1 
ATOM   1871  O  OD1 . ASP A  1 233 ? -6.009  -17.456 39.274  1.00 76.18  ? 233 ASP A OD1 1 
ATOM   1872  O  OD2 . ASP A  1 233 ? -4.647  -17.992 40.912  1.00 77.77  ? 233 ASP A OD2 1 
ATOM   1873  N  N   . LYS A  1 234 ? -7.731  -15.463 39.533  1.00 39.88  ? 234 LYS A N   1 
ATOM   1874  C  CA  . LYS A  1 234 ? -7.689  -13.987 39.276  1.00 40.89  ? 234 LYS A CA  1 
ATOM   1875  C  C   . LYS A  1 234 ? -9.098  -13.425 39.150  1.00 38.75  ? 234 LYS A C   1 
ATOM   1876  O  O   . LYS A  1 234 ? -9.392  -12.331 39.649  1.00 35.73  ? 234 LYS A O   1 
ATOM   1877  C  CB  . LYS A  1 234 ? -6.904  -13.681 38.022  1.00 46.50  ? 234 LYS A CB  1 
ATOM   1878  C  CG  . LYS A  1 234 ? -5.473  -14.207 38.026  1.00 56.01  ? 234 LYS A CG  1 
ATOM   1879  C  CD  . LYS A  1 234 ? -4.611  -13.452 38.992  1.00 57.89  ? 234 LYS A CD  1 
ATOM   1880  C  CE  . LYS A  1 234 ? -3.162  -13.874 38.874  1.00 62.63  ? 234 LYS A CE  1 
ATOM   1881  N  NZ  . LYS A  1 234 ? -2.291  -13.100 39.797  1.00 72.99  ? 234 LYS A NZ  1 
ATOM   1882  N  N   . ARG A  1 235 ? -9.973  -14.172 38.469  1.00 34.21  ? 235 ARG A N   1 
ATOM   1883  C  CA  . ARG A  1 235 ? -11.359 -13.766 38.324  1.00 33.72  ? 235 ARG A CA  1 
ATOM   1884  C  C   . ARG A  1 235 ? -12.019 -13.751 39.660  1.00 35.45  ? 235 ARG A C   1 
ATOM   1885  O  O   . ARG A  1 235 ? -12.712 -12.774 40.021  1.00 35.75  ? 235 ARG A O   1 
ATOM   1886  C  CB  . ARG A  1 235 ? -12.100 -14.713 37.386  1.00 31.32  ? 235 ARG A CB  1 
ATOM   1887  C  CG  . ARG A  1 235 ? -11.648 -14.635 35.963  1.00 30.15  ? 235 ARG A CG  1 
ATOM   1888  C  CD  . ARG A  1 235 ? -12.335 -15.703 35.091  1.00 27.53  ? 235 ARG A CD  1 
ATOM   1889  N  NE  . ARG A  1 235 ? -11.911 -15.603 33.716  1.00 28.56  ? 235 ARG A NE  1 
ATOM   1890  C  CZ  . ARG A  1 235 ? -12.499 -14.825 32.806  1.00 29.54  ? 235 ARG A CZ  1 
ATOM   1891  N  NH1 . ARG A  1 235 ? -12.040 -14.792 31.579  1.00 26.76  ? 235 ARG A NH1 1 
ATOM   1892  N  NH2 . ARG A  1 235 ? -13.583 -14.067 33.147  1.00 28.97  ? 235 ARG A NH2 1 
ATOM   1893  N  N   . ASN A  1 236 ? -11.811 -14.844 40.436  1.00 36.77  ? 236 ASN A N   1 
ATOM   1894  C  CA  . ASN A  1 236 ? -12.373 -14.954 41.773  1.00 35.27  ? 236 ASN A CA  1 
ATOM   1895  C  C   . ASN A  1 236 ? -11.976 -13.790 42.679  1.00 35.87  ? 236 ASN A C   1 
ATOM   1896  O  O   . ASN A  1 236 ? -12.824 -13.219 43.379  1.00 32.98  ? 236 ASN A O   1 
ATOM   1897  C  CB  . ASN A  1 236 ? -11.983 -16.307 42.420  1.00 33.80  ? 236 ASN A CB  1 
ATOM   1898  C  CG  . ASN A  1 236 ? -12.856 -17.488 41.907  1.00 36.80  ? 236 ASN A CG  1 
ATOM   1899  O  OD1 . ASN A  1 236 ? -13.890 -17.275 41.204  1.00 36.88  ? 236 ASN A OD1 1 
ATOM   1900  N  ND2 . ASN A  1 236 ? -12.448 -18.749 42.259  1.00 32.24  ? 236 ASN A ND2 1 
ATOM   1901  N  N   . GLU A  1 237 ? -10.673 -13.430 42.666  1.00 34.76  ? 237 GLU A N   1 
ATOM   1902  C  CA  . GLU A  1 237 ? -10.187 -12.323 43.485  1.00 39.14  ? 237 GLU A CA  1 
ATOM   1903  C  C   . GLU A  1 237 ? -10.879 -11.008 43.079  1.00 34.80  ? 237 GLU A C   1 
ATOM   1904  O  O   . GLU A  1 237 ? -11.236 -10.212 43.915  1.00 34.80  ? 237 GLU A O   1 
ATOM   1905  C  CB  . GLU A  1 237 ? -8.645  -12.184 43.376  1.00 45.15  ? 237 GLU A CB  1 
ATOM   1906  C  CG  . GLU A  1 237 ? -8.148  -11.756 41.977  1.00 61.06  ? 237 GLU A CG  1 
ATOM   1907  C  CD  . GLU A  1 237 ? -6.603  -11.501 41.926  1.00 71.76  ? 237 GLU A CD  1 
ATOM   1908  O  OE1 . GLU A  1 237 ? -5.876  -11.943 42.872  1.00 63.15  ? 237 GLU A OE1 1 
ATOM   1909  O  OE2 . GLU A  1 237 ? -6.135  -10.866 40.944  1.00 73.37  ? 237 GLU A OE2 1 
ATOM   1910  N  N   . THR A  1 238 ? -11.063 -10.820 41.761  1.00 34.58  ? 238 THR A N   1 
ATOM   1911  C  CA  . THR A  1 238 ? -11.731 -9.617  41.228  1.00 31.37  ? 238 THR A CA  1 
ATOM   1912  C  C   . THR A  1 238 ? -13.193 -9.599  41.591  1.00 29.50  ? 238 THR A C   1 
ATOM   1913  O  O   . THR A  1 238 ? -13.729 -8.575  41.974  1.00 32.63  ? 238 THR A O   1 
ATOM   1914  C  CB  . THR A  1 238 ? -11.603 -9.539  39.698  1.00 31.86  ? 238 THR A CB  1 
ATOM   1915  O  OG1 . THR A  1 238 ? -10.218 -9.538  39.328  1.00 34.36  ? 238 THR A OG1 1 
ATOM   1916  C  CG2 . THR A  1 238 ? -12.275 -8.267  39.165  1.00 34.61  ? 238 THR A CG2 1 
ATOM   1917  N  N   . THR A  1 239 ? -13.833 -10.737 41.469  1.00 28.45  ? 239 THR A N   1 
ATOM   1918  C  CA  . THR A  1 239 ? -15.256 -10.853 41.763  1.00 26.94  ? 239 THR A CA  1 
ATOM   1919  C  C   . THR A  1 239 ? -15.540 -10.569 43.231  1.00 26.99  ? 239 THR A C   1 
ATOM   1920  O  O   . THR A  1 239 ? -16.417 -9.758  43.560  1.00 28.40  ? 239 THR A O   1 
ATOM   1921  C  CB  . THR A  1 239 ? -15.759 -12.210 41.423  1.00 27.15  ? 239 THR A CB  1 
ATOM   1922  O  OG1 . THR A  1 239 ? -15.437 -12.504 40.051  1.00 25.45  ? 239 THR A OG1 1 
ATOM   1923  C  CG2 . THR A  1 239 ? -17.278 -12.280 41.617  1.00 25.85  ? 239 THR A CG2 1 
ATOM   1924  N  N   . LEU A  1 240 ? -14.794 -11.243 44.119  1.00 26.65  ? 240 LEU A N   1 
ATOM   1925  C  CA  . LEU A  1 240 ? -14.902 -11.012 45.548  1.00 29.63  ? 240 LEU A CA  1 
ATOM   1926  C  C   . LEU A  1 240 ? -14.665 -9.478  45.902  1.00 29.75  ? 240 LEU A C   1 
ATOM   1927  O  O   . LEU A  1 240 ? -15.436 -8.869  46.672  1.00 30.35  ? 240 LEU A O   1 
ATOM   1928  C  CB  . LEU A  1 240 ? -13.903 -11.886 46.310  1.00 30.95  ? 240 LEU A CB  1 
ATOM   1929  C  CG  . LEU A  1 240 ? -13.899 -11.729 47.825  1.00 33.06  ? 240 LEU A CG  1 
ATOM   1930  C  CD1 . LEU A  1 240 ? -15.270 -12.098 48.406  1.00 28.82  ? 240 LEU A CD1 1 
ATOM   1931  C  CD2 . LEU A  1 240 ? -12.777 -12.573 48.468  1.00 29.74  ? 240 LEU A CD2 1 
ATOM   1932  N  N   . ARG A  1 241 ? -13.618 -8.905  45.337  1.00 29.77  ? 241 ARG A N   1 
ATOM   1933  C  CA  . ARG A  1 241 ? -13.311 -7.502  45.562  1.00 33.67  ? 241 ARG A CA  1 
ATOM   1934  C  C   . ARG A  1 241 ? -14.521 -6.596  45.202  1.00 32.47  ? 241 ARG A C   1 
ATOM   1935  O  O   . ARG A  1 241 ? -14.938 -5.746  46.001  1.00 32.54  ? 241 ARG A O   1 
ATOM   1936  C  CB  . ARG A  1 241 ? -12.108 -7.091  44.765  1.00 36.91  ? 241 ARG A CB  1 
ATOM   1937  C  CG  . ARG A  1 241 ? -11.774 -5.649  44.896  1.00 45.62  ? 241 ARG A CG  1 
ATOM   1938  C  CD  . ARG A  1 241 ? -11.404 -5.299  46.328  1.00 54.07  ? 241 ARG A CD  1 
ATOM   1939  N  NE  . ARG A  1 241 ? -11.333 -3.861  46.535  1.00 63.43  ? 241 ARG A NE  1 
ATOM   1940  C  CZ  . ARG A  1 241 ? -10.319 -3.101  46.147  1.00 69.56  ? 241 ARG A CZ  1 
ATOM   1941  N  NH1 . ARG A  1 241 ? -9.275  -3.647  45.516  1.00 71.02  ? 241 ARG A NH1 1 
ATOM   1942  N  NH2 . ARG A  1 241 ? -10.341 -1.796  46.381  1.00 72.56  ? 241 ARG A NH2 1 
ATOM   1943  N  N   . LEU A  1 242 ? -15.070 -6.794  43.994  1.00 30.88  ? 242 LEU A N   1 
ATOM   1944  C  CA  . LEU A  1 242 ? -16.204 -6.022  43.544  1.00 29.28  ? 242 LEU A CA  1 
ATOM   1945  C  C   . LEU A  1 242 ? -17.369 -6.182  44.476  1.00 27.17  ? 242 LEU A C   1 
ATOM   1946  O  O   . LEU A  1 242 ? -18.072 -5.223  44.764  1.00 28.82  ? 242 LEU A O   1 
ATOM   1947  C  CB  . LEU A  1 242 ? -16.606 -6.436  42.113  1.00 31.96  ? 242 LEU A CB  1 
ATOM   1948  C  CG  . LEU A  1 242 ? -15.615 -6.062  41.014  1.00 31.15  ? 242 LEU A CG  1 
ATOM   1949  C  CD1 . LEU A  1 242 ? -15.926 -6.812  39.717  1.00 29.65  ? 242 LEU A CD1 1 
ATOM   1950  C  CD2 . LEU A  1 242 ? -15.604 -4.538  40.786  1.00 30.52  ? 242 LEU A CD2 1 
ATOM   1951  N  N   . ILE A  1 243 ? -17.584 -7.416  44.957  1.00 28.17  ? 243 ILE A N   1 
ATOM   1952  C  CA  . ILE A  1 243 ? -18.680 -7.693  45.932  1.00 29.06  ? 243 ILE A CA  1 
ATOM   1953  C  C   . ILE A  1 243 ? -18.442 -6.958  47.275  1.00 31.69  ? 243 ILE A C   1 
ATOM   1954  O  O   . ILE A  1 243 ? -19.354 -6.334  47.822  1.00 31.54  ? 243 ILE A O   1 
ATOM   1955  C  CB  . ILE A  1 243 ? -18.848 -9.181  46.184  1.00 28.73  ? 243 ILE A CB  1 
ATOM   1956  C  CG1 . ILE A  1 243 ? -19.484 -9.865  44.947  1.00 26.70  ? 243 ILE A CG1 1 
ATOM   1957  C  CG2 . ILE A  1 243 ? -19.704 -9.426  47.446  1.00 27.05  ? 243 ILE A CG2 1 
ATOM   1958  C  CD1 . ILE A  1 243 ? -19.404 -11.368 44.975  1.00 26.69  ? 243 ILE A CD1 1 
ATOM   1959  N  N   . LYS A  1 244 ? -17.226 -7.044  47.786  1.00 33.27  ? 244 LYS A N   1 
ATOM   1960  C  CA  . LYS A  1 244 ? -16.874 -6.342  49.027  1.00 40.08  ? 244 LYS A CA  1 
ATOM   1961  C  C   . LYS A  1 244 ? -17.087 -4.830  48.873  1.00 39.03  ? 244 LYS A C   1 
ATOM   1962  O  O   . LYS A  1 244 ? -17.511 -4.163  49.796  1.00 38.78  ? 244 LYS A O   1 
ATOM   1963  C  CB  . LYS A  1 244 ? -15.422 -6.628  49.424  1.00 42.56  ? 244 LYS A CB  1 
ATOM   1964  C  CG  . LYS A  1 244 ? -15.170 -8.038  49.916  1.00 44.05  ? 244 LYS A CG  1 
ATOM   1965  C  CD  . LYS A  1 244 ? -13.700 -8.226  50.280  1.00 53.96  ? 244 LYS A CD  1 
ATOM   1966  C  CE  . LYS A  1 244 ? -13.440 -9.599  50.854  1.00 58.48  ? 244 LYS A CE  1 
ATOM   1967  N  NZ  . LYS A  1 244 ? -12.006 -9.766  51.250  1.00 60.55  ? 244 LYS A NZ  1 
ATOM   1968  N  N   . ASP A  1 245 ? -16.789 -4.311  47.688  1.00 38.13  ? 245 ASP A N   1 
ATOM   1969  C  CA  . ASP A  1 245 ? -16.941 -2.884  47.427  1.00 35.48  ? 245 ASP A CA  1 
ATOM   1970  C  C   . ASP A  1 245 ? -18.420 -2.483  47.145  1.00 33.41  ? 245 ASP A C   1 
ATOM   1971  O  O   . ASP A  1 245 ? -18.709 -1.334  46.808  1.00 35.64  ? 245 ASP A O   1 
ATOM   1972  C  CB  . ASP A  1 245 ? -16.020 -2.439  46.295  1.00 36.84  ? 245 ASP A CB  1 
ATOM   1973  C  CG  . ASP A  1 245 ? -14.532 -2.399  46.726  1.00 38.07  ? 245 ASP A CG  1 
ATOM   1974  O  OD1 . ASP A  1 245 ? -13.650 -2.286  45.849  1.00 38.38  ? 245 ASP A OD1 1 
ATOM   1975  O  OD2 . ASP A  1 245 ? -14.273 -2.482  47.930  1.00 38.38  ? 245 ASP A OD2 1 
ATOM   1976  N  N   . GLY A  1 246 ? -19.330 -3.446  47.295  1.00 29.45  ? 246 GLY A N   1 
ATOM   1977  C  CA  . GLY A  1 246 ? -20.783 -3.173  47.195  1.00 32.16  ? 246 GLY A CA  1 
ATOM   1978  C  C   . GLY A  1 246 ? -21.333 -3.101  45.746  1.00 32.25  ? 246 GLY A C   1 
ATOM   1979  O  O   . GLY A  1 246 ? -22.294 -2.408  45.488  1.00 33.40  ? 246 GLY A O   1 
ATOM   1980  N  N   . TYR A  1 247 ? -20.705 -3.844  44.822  1.00 33.20  ? 247 TYR A N   1 
ATOM   1981  C  CA  . TYR A  1 247 ? -21.134 -3.815  43.350  1.00 34.07  ? 247 TYR A CA  1 
ATOM   1982  C  C   . TYR A  1 247 ? -22.004 -5.003  42.926  1.00 30.88  ? 247 TYR A C   1 
ATOM   1983  O  O   . TYR A  1 247 ? -22.208 -5.238  41.738  1.00 32.87  ? 247 TYR A O   1 
ATOM   1984  C  CB  . TYR A  1 247 ? -19.913 -3.654  42.420  1.00 29.53  ? 247 TYR A CB  1 
ATOM   1985  C  CG  . TYR A  1 247 ? -19.407 -2.224  42.364  1.00 31.97  ? 247 TYR A CG  1 
ATOM   1986  C  CD1 . TYR A  1 247 ? -18.584 -1.707  43.383  1.00 32.79  ? 247 TYR A CD1 1 
ATOM   1987  C  CD2 . TYR A  1 247 ? -19.760 -1.387  41.322  1.00 32.38  ? 247 TYR A CD2 1 
ATOM   1988  C  CE1 . TYR A  1 247 ? -18.129 -0.397  43.343  1.00 34.81  ? 247 TYR A CE1 1 
ATOM   1989  C  CE2 . TYR A  1 247 ? -19.306 -0.066  41.268  1.00 32.61  ? 247 TYR A CE2 1 
ATOM   1990  C  CZ  . TYR A  1 247 ? -18.492 0.421   42.284  1.00 35.34  ? 247 TYR A CZ  1 
ATOM   1991  O  OH  . TYR A  1 247 ? -18.049 1.701   42.238  1.00 34.95  ? 247 TYR A OH  1 
ATOM   1992  N  N   . SER A  1 248 ? -22.522 -5.737  43.912  1.00 29.80  ? 248 SER A N   1 
ATOM   1993  C  CA  . SER A  1 248 ? -23.441 -6.887  43.641  1.00 31.32  ? 248 SER A CA  1 
ATOM   1994  C  C   . SER A  1 248 ? -24.599 -6.478  42.781  1.00 27.53  ? 248 SER A C   1 
ATOM   1995  O  O   . SER A  1 248 ? -25.101 -7.256  42.023  1.00 27.82  ? 248 SER A O   1 
ATOM   1996  C  CB  . SER A  1 248 ? -23.963 -7.481  44.953  1.00 30.02  ? 248 SER A CB  1 
ATOM   1997  O  OG  . SER A  1 248 ? -22.963 -8.175  45.615  1.00 44.41  ? 248 SER A OG  1 
ATOM   1998  N  N   . ASP A  1 249 ? -25.019 -5.231  42.919  1.00 24.58  ? 249 ASP A N   1 
ATOM   1999  C  CA  . ASP A  1 249 ? -26.148 -4.727  42.176  1.00 26.71  ? 249 ASP A CA  1 
ATOM   2000  C  C   . ASP A  1 249 ? -25.909 -4.752  40.674  1.00 26.78  ? 249 ASP A C   1 
ATOM   2001  O  O   . ASP A  1 249 ? -26.842 -4.702  39.903  1.00 26.64  ? 249 ASP A O   1 
ATOM   2002  C  CB  . ASP A  1 249 ? -26.519 -3.267  42.640  1.00 26.94  ? 249 ASP A CB  1 
ATOM   2003  C  CG  . ASP A  1 249 ? -25.345 -2.265  42.460  1.00 29.36  ? 249 ASP A CG  1 
ATOM   2004  O  OD1 . ASP A  1 249 ? -24.211 -2.563  42.947  1.00 30.47  ? 249 ASP A OD1 1 
ATOM   2005  O  OD2 . ASP A  1 249 ? -25.564 -1.186  41.842  1.00 30.70  ? 249 ASP A OD2 1 
ATOM   2006  N  N   . LYS A  1 250 ? -24.662 -4.831  40.270  1.00 24.54  ? 250 LYS A N   1 
ATOM   2007  C  CA  . LYS A  1 250 ? -24.339 -4.763  38.828  1.00 27.48  ? 250 LYS A CA  1 
ATOM   2008  C  C   . LYS A  1 250 ? -23.587 -6.008  38.294  1.00 26.73  ? 250 LYS A C   1 
ATOM   2009  O  O   . LYS A  1 250 ? -23.422 -6.162  37.127  1.00 29.02  ? 250 LYS A O   1 
ATOM   2010  C  CB  . LYS A  1 250 ? -23.562 -3.482  38.518  1.00 28.22  ? 250 LYS A CB  1 
ATOM   2011  C  CG  . LYS A  1 250 ? -24.392 -2.212  38.711  1.00 30.52  ? 250 LYS A CG  1 
ATOM   2012  C  CD  . LYS A  1 250 ? -25.443 -2.070  37.576  1.00 34.74  ? 250 LYS A CD  1 
ATOM   2013  C  CE  . LYS A  1 250 ? -26.760 -1.514  38.089  1.00 38.89  ? 250 LYS A CE  1 
ATOM   2014  N  NZ  . LYS A  1 250 ? -26.595 -0.293  38.833  1.00 44.43  ? 250 LYS A NZ  1 
ATOM   2015  N  N   . ILE A  1 251 ? -23.166 -6.854  39.178  1.00 26.36  ? 251 ILE A N   1 
ATOM   2016  C  CA  . ILE A  1 251 ? -22.422 -8.001  38.801  1.00 27.24  ? 251 ILE A CA  1 
ATOM   2017  C  C   . ILE A  1 251 ? -23.310 -9.112  38.156  1.00 27.64  ? 251 ILE A C   1 
ATOM   2018  O  O   . ILE A  1 251 ? -24.356 -9.448  38.661  1.00 23.88  ? 251 ILE A O   1 
ATOM   2019  C  CB  . ILE A  1 251 ? -21.687 -8.603  39.994  1.00 27.38  ? 251 ILE A CB  1 
ATOM   2020  C  CG1 . ILE A  1 251 ? -20.560 -7.666  40.457  1.00 28.03  ? 251 ILE A CG1 1 
ATOM   2021  C  CG2 . ILE A  1 251 ? -21.128 -9.961  39.632  1.00 26.87  ? 251 ILE A CG2 1 
ATOM   2022  C  CD1 . ILE A  1 251 ? -19.972 -8.043  41.811  1.00 27.09  ? 251 ILE A CD1 1 
ATOM   2023  N  N   . MET A  1 252 ? -22.848 -9.636  37.044  1.00 29.78  ? 252 MET A N   1 
ATOM   2024  C  CA  . MET A  1 252 ? -23.432 -10.832 36.445  1.00 27.33  ? 252 MET A CA  1 
ATOM   2025  C  C   . MET A  1 252 ? -22.323 -11.821 36.141  1.00 25.01  ? 252 MET A C   1 
ATOM   2026  O  O   . MET A  1 252 ? -21.220 -11.425 35.721  1.00 21.98  ? 252 MET A O   1 
ATOM   2027  C  CB  . MET A  1 252 ? -24.219 -10.489 35.186  1.00 27.95  ? 252 MET A CB  1 
ATOM   2028  C  CG  . MET A  1 252 ? -25.687 -10.068 35.469  1.00 30.22  ? 252 MET A CG  1 
ATOM   2029  S  SD  . MET A  1 252 ? -26.544 -9.516  34.014  1.00 42.11  ? 252 MET A SD  1 
ATOM   2030  C  CE  . MET A  1 252 ? -28.210 -9.343  34.645  1.00 34.46  ? 252 MET A CE  1 
ATOM   2031  N  N   . ILE A  1 253 ? -22.602 -13.100 36.359  1.00 22.81  ? 253 ILE A N   1 
ATOM   2032  C  CA  . ILE A  1 253 ? -21.591 -14.139 36.251  1.00 23.24  ? 253 ILE A CA  1 
ATOM   2033  C  C   . ILE A  1 253 ? -22.038 -15.279 35.356  1.00 22.89  ? 253 ILE A C   1 
ATOM   2034  O  O   . ILE A  1 253 ? -23.187 -15.712 35.409  1.00 20.70  ? 253 ILE A O   1 
ATOM   2035  C  CB  . ILE A  1 253 ? -21.225 -14.710 37.657  1.00 22.16  ? 253 ILE A CB  1 
ATOM   2036  C  CG1 . ILE A  1 253 ? -20.587 -13.600 38.539  1.00 21.93  ? 253 ILE A CG1 1 
ATOM   2037  C  CG2 . ILE A  1 253 ? -20.313 -15.910 37.525  1.00 20.96  ? 253 ILE A CG2 1 
ATOM   2038  C  CD1 . ILE A  1 253 ? -20.254 -14.049 39.984  1.00 21.87  ? 253 ILE A CD1 1 
ATOM   2039  N  N   . SER A  1 254 ? -21.132 -15.760 34.533  1.00 24.71  ? 254 SER A N   1 
ATOM   2040  C  CA  . SER A  1 254 ? -21.418 -16.845 33.684  1.00 23.68  ? 254 SER A CA  1 
ATOM   2041  C  C   . SER A  1 254 ? -20.106 -17.425 33.122  1.00 24.32  ? 254 SER A C   1 
ATOM   2042  O  O   . SER A  1 254 ? -19.034 -17.001 33.508  1.00 25.20  ? 254 SER A O   1 
ATOM   2043  C  CB  . SER A  1 254 ? -22.342 -16.405 32.562  1.00 24.16  ? 254 SER A CB  1 
ATOM   2044  O  OG  . SER A  1 254 ? -23.315 -17.419 32.282  1.00 22.40  ? 254 SER A OG  1 
ATOM   2045  N  N   . HIS A  1 255 ? -20.215 -18.405 32.207  1.00 22.50  ? 255 HIS A N   1 
ATOM   2046  C  CA  . HIS A  1 255 ? -19.012 -19.109 31.683  1.00 24.03  ? 255 HIS A CA  1 
ATOM   2047  C  C   . HIS A  1 255 ? -18.704 -18.799 30.231  1.00 24.08  ? 255 HIS A C   1 
ATOM   2048  O  O   . HIS A  1 255 ? -17.572 -18.950 29.797  1.00 20.82  ? 255 HIS A O   1 
ATOM   2049  C  CB  . HIS A  1 255 ? -19.155 -20.638 31.847  1.00 24.84  ? 255 HIS A CB  1 
ATOM   2050  C  CG  . HIS A  1 255 ? -19.583 -21.068 33.212  1.00 25.21  ? 255 HIS A CG  1 
ATOM   2051  N  ND1 . HIS A  1 255 ? -20.901 -21.193 33.567  1.00 22.49  ? 255 HIS A ND1 1 
ATOM   2052  C  CD2 . HIS A  1 255 ? -18.841 -21.421 34.340  1.00 22.48  ? 255 HIS A CD2 1 
ATOM   2053  C  CE1 . HIS A  1 255 ? -20.977 -21.598 34.845  1.00 23.40  ? 255 HIS A CE1 1 
ATOM   2054  N  NE2 . HIS A  1 255 ? -19.726 -21.739 35.320  1.00 24.54  ? 255 HIS A NE2 1 
ATOM   2055  N  N   . ASP A  1 256 ? -19.733 -18.373 29.463  1.00 20.79  ? 256 ASP A N   1 
ATOM   2056  C  CA  . ASP A  1 256 ? -19.572 -18.188 28.012  1.00 24.22  ? 256 ASP A CA  1 
ATOM   2057  C  C   . ASP A  1 256 ? -19.184 -19.512 27.429  1.00 26.25  ? 256 ASP A C   1 
ATOM   2058  O  O   . ASP A  1 256 ? -18.387 -19.590 26.503  1.00 29.52  ? 256 ASP A O   1 
ATOM   2059  C  CB  . ASP A  1 256 ? -18.479 -17.135 27.723  1.00 23.88  ? 256 ASP A CB  1 
ATOM   2060  C  CG  . ASP A  1 256 ? -18.505 -16.598 26.206  1.00 22.34  ? 256 ASP A CG  1 
ATOM   2061  O  OD1 . ASP A  1 256 ? -19.608 -16.728 25.476  1.00 23.01  ? 256 ASP A OD1 1 
ATOM   2062  O  OD2 . ASP A  1 256 ? -17.468 -16.046 25.771  1.00 23.56  ? 256 ASP A OD2 1 
ATOM   2063  N  N   . TYR A  1 257 ? -19.734 -20.559 27.973  1.00 28.68  ? 257 TYR A N   1 
ATOM   2064  C  CA  . TYR A  1 257 ? -19.337 -21.876 27.585  1.00 33.74  ? 257 TYR A CA  1 
ATOM   2065  C  C   . TYR A  1 257 ? -20.001 -22.320 26.290  1.00 36.39  ? 257 TYR A C   1 
ATOM   2066  O  O   . TYR A  1 257 ? -21.192 -22.053 26.055  1.00 33.55  ? 257 TYR A O   1 
ATOM   2067  C  CB  . TYR A  1 257 ? -19.618 -22.892 28.708  1.00 30.61  ? 257 TYR A CB  1 
ATOM   2068  C  CG  . TYR A  1 257 ? -19.142 -24.234 28.394  1.00 32.35  ? 257 TYR A CG  1 
ATOM   2069  C  CD1 . TYR A  1 257 ? -20.038 -25.249 28.019  1.00 31.75  ? 257 TYR A CD1 1 
ATOM   2070  C  CD2 . TYR A  1 257 ? -17.768 -24.539 28.435  1.00 32.81  ? 257 TYR A CD2 1 
ATOM   2071  C  CE1 . TYR A  1 257 ? -19.586 -26.527 27.712  1.00 32.76  ? 257 TYR A CE1 1 
ATOM   2072  C  CE2 . TYR A  1 257 ? -17.304 -25.815 28.130  1.00 37.24  ? 257 TYR A CE2 1 
ATOM   2073  C  CZ  . TYR A  1 257 ? -18.211 -26.807 27.767  1.00 38.67  ? 257 TYR A CZ  1 
ATOM   2074  O  OH  . TYR A  1 257 ? -17.757 -28.064 27.464  1.00 46.74  ? 257 TYR A OH  1 
ATOM   2075  N  N   . CYS A  1 258 ? -19.233 -22.994 25.457  1.00 39.99  ? 258 CYS A N   1 
ATOM   2076  C  CA  . CYS A  1 258 ? -19.730 -23.509 24.217  1.00 46.91  ? 258 CYS A CA  1 
ATOM   2077  C  C   . CYS A  1 258 ? -19.778 -24.987 24.274  1.00 51.38  ? 258 CYS A C   1 
ATOM   2078  O  O   . CYS A  1 258 ? -18.761 -25.652 24.112  1.00 56.35  ? 258 CYS A O   1 
ATOM   2079  C  CB  . CYS A  1 258 ? -18.832 -23.074 23.069  1.00 46.52  ? 258 CYS A CB  1 
ATOM   2080  S  SG  . CYS A  1 258 ? -18.477 -21.343 23.050  1.00 52.03  ? 258 CYS A SG  1 
ATOM   2081  N  N   . CYS A  1 259 ? -20.959 -25.524 24.518  1.00 59.55  ? 259 CYS A N   1 
ATOM   2082  C  CA  . CYS A  1 259 ? -21.147 -26.939 24.519  1.00 63.17  ? 259 CYS A CA  1 
ATOM   2083  C  C   . CYS A  1 259 ? -20.504 -27.518 23.248  1.00 66.50  ? 259 CYS A C   1 
ATOM   2084  O  O   . CYS A  1 259 ? -20.158 -28.700 23.190  1.00 59.55  ? 259 CYS A O   1 
ATOM   2085  C  CB  . CYS A  1 259 ? -22.618 -27.265 24.575  1.00 58.03  ? 259 CYS A CB  1 
ATOM   2086  S  SG  . CYS A  1 259 ? -23.508 -26.404 25.946  1.00 56.36  ? 259 CYS A SG  1 
ATOM   2087  N  N   . THR A  1 260 ? -20.352 -26.641 22.224  1.00 66.49  ? 260 THR A N   1 
ATOM   2088  C  CA  . THR A  1 260 ? -19.603 -26.957 20.992  1.00 59.86  ? 260 THR A CA  1 
ATOM   2089  C  C   . THR A  1 260 ? -19.174 -25.649 20.292  1.00 55.73  ? 260 THR A C   1 
ATOM   2090  O  O   . THR A  1 260 ? -19.941 -24.668 20.250  1.00 46.20  ? 260 THR A O   1 
ATOM   2091  C  CB  . THR A  1 260 ? -20.426 -27.821 20.006  1.00 59.07  ? 260 THR A CB  1 
ATOM   2092  O  OG1 . THR A  1 260 ? -20.672 -29.106 20.579  1.00 61.12  ? 260 THR A OG1 1 
ATOM   2093  C  CG2 . THR A  1 260 ? -19.670 -27.998 18.694  1.00 61.61  ? 260 THR A CG2 1 
ATOM   2094  N  N   . ILE A  1 261 ? -17.966 -25.636 19.765  1.00 55.67  ? 261 ILE A N   1 
ATOM   2095  C  CA  . ILE A  1 261 ? -17.454 -24.472 19.049  1.00 58.14  ? 261 ILE A CA  1 
ATOM   2096  C  C   . ILE A  1 261 ? -16.453 -24.904 17.971  1.00 58.90  ? 261 ILE A C   1 
ATOM   2097  O  O   . ILE A  1 261 ? -15.550 -25.698 18.233  1.00 55.14  ? 261 ILE A O   1 
ATOM   2098  C  CB  . ILE A  1 261 ? -16.807 -23.405 20.037  1.00 60.66  ? 261 ILE A CB  1 
ATOM   2099  C  CG1 . ILE A  1 261 ? -16.330 -22.151 19.259  1.00 61.60  ? 261 ILE A CG1 1 
ATOM   2100  C  CG2 . ILE A  1 261 ? -15.682 -24.030 20.860  1.00 55.28  ? 261 ILE A CG2 1 
ATOM   2101  C  CD1 . ILE A  1 261 ? -15.922 -20.977 20.158  1.00 59.24  ? 261 ILE A CD1 1 
ATOM   2102  N  N   . ASP A  1 262 ? -16.627 -24.378 16.757  1.00 58.46  ? 262 ASP A N   1 
ATOM   2103  C  CA  . ASP A  1 262 ? -15.839 -24.838 15.601  1.00 58.43  ? 262 ASP A CA  1 
ATOM   2104  C  C   . ASP A  1 262 ? -14.458 -24.096 15.410  1.00 62.93  ? 262 ASP A C   1 
ATOM   2105  O  O   . ASP A  1 262 ? -13.673 -24.452 14.519  1.00 62.60  ? 262 ASP A O   1 
ATOM   2106  C  CB  . ASP A  1 262 ? -16.680 -24.764 14.299  1.00 57.86  ? 262 ASP A CB  1 
ATOM   2107  C  CG  . ASP A  1 262 ? -17.008 -23.298 13.875  1.00 53.46  ? 262 ASP A CG  1 
ATOM   2108  O  OD1 . ASP A  1 262 ? -16.853 -22.380 14.715  1.00 64.08  ? 262 ASP A OD1 1 
ATOM   2109  O  OD2 . ASP A  1 262 ? -17.416 -23.092 12.708  1.00 40.79  ? 262 ASP A OD2 1 
ATOM   2110  N  N   . MET A  1 263 ? -14.191 -23.082 16.246  1.00 67.97  ? 263 MET A N   1 
ATOM   2111  C  CA  . MET A  1 263 ? -12.889 -22.326 16.164  1.00 74.73  ? 263 MET A CA  1 
ATOM   2112  C  C   . MET A  1 263 ? -11.683 -23.265 16.264  1.00 75.76  ? 263 MET A C   1 
ATOM   2113  O  O   . MET A  1 263 ? -11.723 -24.271 16.984  1.00 68.01  ? 263 MET A O   1 
ATOM   2114  C  CB  . MET A  1 263 ? -12.809 -21.257 17.243  1.00 76.60  ? 263 MET A CB  1 
ATOM   2115  C  CG  . MET A  1 263 ? -13.752 -20.093 17.037  1.00 87.62  ? 263 MET A CG  1 
ATOM   2116  S  SD  . MET A  1 263 ? -13.393 -18.703 18.138  1.00 103.31 ? 263 MET A SD  1 
ATOM   2117  C  CE  . MET A  1 263 ? -11.718 -18.287 17.632  1.00 86.63  ? 263 MET A CE  1 
ATOM   2118  N  N   . GLY A  1 264 ? -10.604 -22.931 15.533  1.00 76.17  ? 264 GLY A N   1 
ATOM   2119  C  CA  . GLY A  1 264 ? -9.353  -23.751 15.557  1.00 80.40  ? 264 GLY A CA  1 
ATOM   2120  C  C   . GLY A  1 264 ? -8.674  -23.721 16.921  1.00 81.88  ? 264 GLY A C   1 
ATOM   2121  O  O   . GLY A  1 264 ? -7.799  -24.548 17.216  1.00 79.53  ? 264 GLY A O   1 
ATOM   2122  N  N   . THR A  1 265 ? -9.083  -22.763 17.753  1.00 79.13  ? 265 THR A N   1 
ATOM   2123  C  CA  . THR A  1 265 ? -8.543  -22.614 19.087  1.00 80.66  ? 265 THR A CA  1 
ATOM   2124  C  C   . THR A  1 265 ? -9.217  -23.591 20.071  1.00 83.12  ? 265 THR A C   1 
ATOM   2125  O  O   . THR A  1 265 ? -8.606  -24.016 21.061  1.00 89.93  ? 265 THR A O   1 
ATOM   2126  C  CB  . THR A  1 265 ? -8.740  -21.190 19.605  1.00 81.52  ? 265 THR A CB  1 
ATOM   2127  O  OG1 . THR A  1 265 ? -10.144 -20.891 19.659  1.00 80.15  ? 265 THR A OG1 1 
ATOM   2128  C  CG2 . THR A  1 265 ? -8.053  -20.188 18.688  1.00 73.40  ? 265 THR A CG2 1 
ATOM   2129  N  N   . ALA A  1 266 ? -10.483 -23.939 19.784  1.00 85.40  ? 266 ALA A N   1 
ATOM   2130  C  CA  . ALA A  1 266 ? -11.277 -24.821 20.672  1.00 80.63  ? 266 ALA A CA  1 
ATOM   2131  C  C   . ALA A  1 266 ? -10.989 -26.329 20.439  1.00 84.52  ? 266 ALA A C   1 
ATOM   2132  O  O   . ALA A  1 266 ? -11.831 -27.188 20.745  1.00 82.98  ? 266 ALA A O   1 
ATOM   2133  C  CB  . ALA A  1 266 ? -12.758 -24.532 20.516  1.00 76.51  ? 266 ALA A CB  1 
ATOM   2134  N  N   . LYS A  1 267 ? -9.802  -26.634 19.900  1.00 93.24  ? 267 LYS A N   1 
ATOM   2135  C  CA  . LYS A  1 267 ? -9.393  -28.024 19.681  1.00 95.32  ? 267 LYS A CA  1 
ATOM   2136  C  C   . LYS A  1 267 ? -9.074  -28.720 21.023  1.00 103.30 ? 267 LYS A C   1 
ATOM   2137  O  O   . LYS A  1 267 ? -8.547  -28.088 21.945  1.00 104.48 ? 267 LYS A O   1 
ATOM   2138  C  CB  . LYS A  1 267 ? -8.180  -28.095 18.727  1.00 85.71  ? 267 LYS A CB  1 
ATOM   2139  C  CG  . LYS A  1 267 ? -8.486  -27.656 17.291  1.00 73.97  ? 267 LYS A CG  1 
ATOM   2140  C  CD  . LYS A  1 267 ? -7.237  -27.701 16.409  1.00 67.34  ? 267 LYS A CD  1 
ATOM   2141  C  CE  . LYS A  1 267 ? -7.550  -27.242 14.986  1.00 62.04  ? 267 LYS A CE  1 
ATOM   2142  N  NZ  . LYS A  1 267 ? -6.352  -27.304 14.083  1.00 53.94  ? 267 LYS A NZ  1 
ATOM   2143  N  N   . PRO A  1 268 ? -9.401  -30.039 21.125  1.00 108.14 ? 268 PRO A N   1 
ATOM   2144  C  CA  . PRO A  1 268 ? -9.227  -30.819 22.368  1.00 107.80 ? 268 PRO A CA  1 
ATOM   2145  C  C   . PRO A  1 268 ? -7.806  -30.701 22.977  1.00 104.50 ? 268 PRO A C   1 
ATOM   2146  O  O   . PRO A  1 268 ? -7.661  -30.646 24.206  1.00 92.93  ? 268 PRO A O   1 
ATOM   2147  C  CB  . PRO A  1 268 ? -9.504  -32.280 21.913  1.00 107.20 ? 268 PRO A CB  1 
ATOM   2148  C  CG  . PRO A  1 268 ? -9.496  -32.226 20.399  1.00 104.78 ? 268 PRO A CG  1 
ATOM   2149  C  CD  . PRO A  1 268 ? -9.938  -30.861 20.036  1.00 104.13 ? 268 PRO A CD  1 
ATOM   2150  N  N   . GLU A  1 269 ? -6.774  -30.663 22.112  1.00 108.10 ? 269 GLU A N   1 
ATOM   2151  C  CA  . GLU A  1 269 ? -5.359  -30.606 22.585  1.00 109.03 ? 269 GLU A CA  1 
ATOM   2152  C  C   . GLU A  1 269 ? -4.951  -29.206 23.100  1.00 114.49 ? 269 GLU A C   1 
ATOM   2153  O  O   . GLU A  1 269 ? -3.795  -28.988 23.490  1.00 115.98 ? 269 GLU A O   1 
ATOM   2154  C  CB  . GLU A  1 269 ? -4.382  -31.082 21.478  1.00 104.44 ? 269 GLU A CB  1 
ATOM   2155  C  CG  . GLU A  1 269 ? -4.314  -30.166 20.248  1.00 99.40  ? 269 GLU A CG  1 
ATOM   2156  C  CD  . GLU A  1 269 ? -5.536  -30.296 19.343  1.00 100.46 ? 269 GLU A CD  1 
ATOM   2157  O  OE1 . GLU A  1 269 ? -6.407  -31.152 19.627  1.00 92.73  ? 269 GLU A OE1 1 
ATOM   2158  O  OE2 . GLU A  1 269 ? -5.621  -29.544 18.349  1.00 109.41 ? 269 GLU A OE2 1 
ATOM   2159  N  N   . TYR A  1 270 ? -5.902  -28.272 23.096  1.00 113.78 ? 270 TYR A N   1 
ATOM   2160  C  CA  . TYR A  1 270 ? -5.653  -26.911 23.605  1.00 110.06 ? 270 TYR A CA  1 
ATOM   2161  C  C   . TYR A  1 270 ? -6.451  -26.631 24.866  1.00 101.54 ? 270 TYR A C   1 
ATOM   2162  O  O   . TYR A  1 270 ? -6.239  -25.613 25.534  1.00 101.84 ? 270 TYR A O   1 
ATOM   2163  C  CB  . TYR A  1 270 ? -5.970  -25.851 22.525  1.00 113.87 ? 270 TYR A CB  1 
ATOM   2164  C  CG  . TYR A  1 270 ? -4.901  -25.713 21.469  1.00 115.85 ? 270 TYR A CG  1 
ATOM   2165  C  CD1 . TYR A  1 270 ? -3.674  -25.104 21.765  1.00 115.91 ? 270 TYR A CD1 1 
ATOM   2166  C  CD2 . TYR A  1 270 ? -5.108  -26.182 20.173  1.00 108.39 ? 270 TYR A CD2 1 
ATOM   2167  C  CE1 . TYR A  1 270 ? -2.692  -24.973 20.806  1.00 112.79 ? 270 TYR A CE1 1 
ATOM   2168  C  CE2 . TYR A  1 270 ? -4.132  -26.056 19.204  1.00 109.21 ? 270 TYR A CE2 1 
ATOM   2169  C  CZ  . TYR A  1 270 ? -2.919  -25.448 19.526  1.00 111.80 ? 270 TYR A CZ  1 
ATOM   2170  O  OH  . TYR A  1 270 ? -1.946  -25.319 18.573  1.00 112.51 ? 270 TYR A OH  1 
ATOM   2171  N  N   . LYS A  1 271 ? -7.374  -27.543 25.196  1.00 93.13  ? 271 LYS A N   1 
ATOM   2172  C  CA  . LYS A  1 271 ? -8.236  -27.381 26.368  1.00 80.69  ? 271 LYS A CA  1 
ATOM   2173  C  C   . LYS A  1 271 ? -7.418  -27.328 27.714  1.00 87.78  ? 271 LYS A C   1 
ATOM   2174  O  O   . LYS A  1 271 ? -7.505  -26.348 28.459  1.00 78.82  ? 271 LYS A O   1 
ATOM   2175  C  CB  . LYS A  1 271 ? -9.294  -28.492 26.420  1.00 76.83  ? 271 LYS A CB  1 
ATOM   2176  C  CG  . LYS A  1 271 ? -10.308 -28.335 27.538  1.00 73.56  ? 271 LYS A CG  1 
ATOM   2177  C  CD  . LYS A  1 271 ? -11.347 -29.447 27.504  1.00 74.61  ? 271 LYS A CD  1 
ATOM   2178  C  CE  . LYS A  1 271 ? -12.347 -29.308 28.649  1.00 70.25  ? 271 LYS A CE  1 
ATOM   2179  N  NZ  . LYS A  1 271 ? -13.056 -27.996 28.614  1.00 59.46  ? 271 LYS A NZ  1 
ATOM   2180  N  N   . PRO A  1 272 ? -6.622  -28.402 28.000  1.00 93.04  ? 272 PRO A N   1 
ATOM   2181  C  CA  . PRO A  1 272 ? -5.825  -28.466 29.242  1.00 93.52  ? 272 PRO A CA  1 
ATOM   2182  C  C   . PRO A  1 272 ? -4.909  -27.241 29.405  1.00 92.38  ? 272 PRO A C   1 
ATOM   2183  O  O   . PRO A  1 272 ? -4.531  -26.891 30.526  1.00 89.28  ? 272 PRO A O   1 
ATOM   2184  C  CB  . PRO A  1 272 ? -4.985  -29.733 29.051  1.00 97.44  ? 272 PRO A CB  1 
ATOM   2185  C  CG  . PRO A  1 272 ? -5.770  -30.566 28.083  1.00 96.10  ? 272 PRO A CG  1 
ATOM   2186  C  CD  . PRO A  1 272 ? -6.431  -29.601 27.156  1.00 90.45  ? 272 PRO A CD  1 
ATOM   2187  N  N   . LYS A  1 273 ? -4.571  -26.606 28.292  1.00 92.68  ? 273 LYS A N   1 
ATOM   2188  C  CA  . LYS A  1 273 ? -3.670  -25.482 28.299  1.00 90.28  ? 273 LYS A CA  1 
ATOM   2189  C  C   . LYS A  1 273 ? -4.404  -24.150 28.560  1.00 91.31  ? 273 LYS A C   1 
ATOM   2190  O  O   . LYS A  1 273 ? -3.951  -23.326 29.359  1.00 87.08  ? 273 LYS A O   1 
ATOM   2191  C  CB  . LYS A  1 273 ? -2.917  -25.393 26.952  1.00 94.26  ? 273 LYS A CB  1 
ATOM   2192  C  CG  . LYS A  1 273 ? -2.286  -26.699 26.484  1.00 97.30  ? 273 LYS A CG  1 
ATOM   2193  C  CD  . LYS A  1 273 ? -1.724  -26.556 25.052  1.00 98.93  ? 273 LYS A CD  1 
ATOM   2194  C  CE  . LYS A  1 273 ? -1.047  -27.840 24.582  1.00 96.30  ? 273 LYS A CE  1 
ATOM   2195  N  NZ  . LYS A  1 273 ? 0.131   -28.191 25.426  1.00 89.85  ? 273 LYS A NZ  1 
ATOM   2196  N  N   . LEU A  1 274 ? -5.536  -23.956 27.880  1.00 85.65  ? 274 LEU A N   1 
ATOM   2197  C  CA  . LEU A  1 274 ? -6.208  -22.650 27.864  1.00 69.65  ? 274 LEU A CA  1 
ATOM   2198  C  C   . LEU A  1 274 ? -7.531  -22.593 28.703  1.00 64.63  ? 274 LEU A C   1 
ATOM   2199  O  O   . LEU A  1 274 ? -7.933  -21.521 29.162  1.00 57.79  ? 274 LEU A O   1 
ATOM   2200  C  CB  . LEU A  1 274 ? -6.473  -22.208 26.415  1.00 70.19  ? 274 LEU A CB  1 
ATOM   2201  C  CG  . LEU A  1 274 ? -5.231  -22.217 25.473  1.00 71.42  ? 274 LEU A CG  1 
ATOM   2202  C  CD1 . LEU A  1 274 ? -5.621  -21.866 24.046  1.00 66.49  ? 274 LEU A CD1 1 
ATOM   2203  C  CD2 . LEU A  1 274 ? -4.141  -21.277 25.990  1.00 64.97  ? 274 LEU A CD2 1 
ATOM   2204  N  N   . ALA A  1 275 ? -8.187  -23.753 28.882  1.00 56.12  ? 275 ALA A N   1 
ATOM   2205  C  CA  . ALA A  1 275 ? -9.462  -23.816 29.656  1.00 51.37  ? 275 ALA A CA  1 
ATOM   2206  C  C   . ALA A  1 275 ? -9.710  -25.225 30.259  1.00 51.99  ? 275 ALA A C   1 
ATOM   2207  O  O   . ALA A  1 275 ? -10.684 -25.895 29.905  1.00 48.18  ? 275 ALA A O   1 
ATOM   2208  C  CB  . ALA A  1 275 ? -10.637 -23.388 28.785  1.00 45.55  ? 275 ALA A CB  1 
ATOM   2209  N  N   . PRO A  1 276 ? -8.812  -25.663 31.188  1.00 55.71  ? 276 PRO A N   1 
ATOM   2210  C  CA  . PRO A  1 276 ? -8.870  -27.020 31.776  1.00 54.57  ? 276 PRO A CA  1 
ATOM   2211  C  C   . PRO A  1 276 ? -10.234 -27.369 32.457  1.00 50.68  ? 276 PRO A C   1 
ATOM   2212  O  O   . PRO A  1 276 ? -10.804 -28.410 32.182  1.00 51.15  ? 276 PRO A O   1 
ATOM   2213  C  CB  . PRO A  1 276 ? -7.709  -27.007 32.826  1.00 54.00  ? 276 PRO A CB  1 
ATOM   2214  C  CG  . PRO A  1 276 ? -7.369  -25.543 33.012  1.00 50.09  ? 276 PRO A CG  1 
ATOM   2215  C  CD  . PRO A  1 276 ? -7.665  -24.882 31.709  1.00 50.71  ? 276 PRO A CD  1 
ATOM   2216  N  N   A ARG A  1 277 ? -10.720 -26.463 33.322  0.50 48.49  ? 277 ARG A N   1 
ATOM   2217  N  N   B ARG A  1 277 ? -10.717 -26.495 33.344  0.50 49.31  ? 277 ARG A N   1 
ATOM   2218  C  CA  A ARG A  1 277 ? -11.955 -26.694 34.100  0.50 47.61  ? 277 ARG A CA  1 
ATOM   2219  C  CA  B ARG A  1 277 ? -12.013 -26.762 34.064  0.50 48.72  ? 277 ARG A CA  1 
ATOM   2220  C  C   A ARG A  1 277 ? -13.186 -26.039 33.441  0.50 44.98  ? 277 ARG A C   1 
ATOM   2221  C  C   B ARG A  1 277 ? -13.184 -26.011 33.451  0.50 45.66  ? 277 ARG A C   1 
ATOM   2222  O  O   A ARG A  1 277 ? -14.254 -25.970 34.039  0.50 42.08  ? 277 ARG A O   1 
ATOM   2223  O  O   B ARG A  1 277 ? -14.219 -25.839 34.086  0.50 42.71  ? 277 ARG A O   1 
ATOM   2224  C  CB  A ARG A  1 277 ? -11.785 -26.155 35.519  0.50 50.78  ? 277 ARG A CB  1 
ATOM   2225  C  CB  B ARG A  1 277 ? -11.895 -26.439 35.577  0.50 53.52  ? 277 ARG A CB  1 
ATOM   2226  C  CG  A ARG A  1 277 ? -10.498 -26.606 36.211  0.50 56.34  ? 277 ARG A CG  1 
ATOM   2227  C  CG  B ARG A  1 277 ? -10.912 -27.330 36.338  0.50 58.84  ? 277 ARG A CG  1 
ATOM   2228  C  CD  A ARG A  1 277 ? -10.150 -25.690 37.412  0.50 57.84  ? 277 ARG A CD  1 
ATOM   2229  C  CD  B ARG A  1 277 ? -9.506  -26.749 36.313  0.50 66.36  ? 277 ARG A CD  1 
ATOM   2230  N  NE  A ARG A  1 277 ? -9.757  -24.322 36.981  0.50 53.80  ? 277 ARG A NE  1 
ATOM   2231  N  NE  B ARG A  1 277 ? -9.380  -25.558 37.193  0.50 69.83  ? 277 ARG A NE  1 
ATOM   2232  C  CZ  A ARG A  1 277 ? -8.491  -23.933 36.765  0.50 51.81  ? 277 ARG A CZ  1 
ATOM   2233  C  CZ  B ARG A  1 277 ? -10.305 -25.178 38.089  0.50 67.46  ? 277 ARG A CZ  1 
ATOM   2234  N  NH1 A ARG A  1 277 ? -7.493  -24.789 36.935  0.50 50.98  ? 277 ARG A NH1 1 
ATOM   2235  N  NH1 B ARG A  1 277 ? -11.420 -25.883 38.237  0.50 66.43  ? 277 ARG A NH1 1 
ATOM   2236  N  NH2 A ARG A  1 277 ? -8.232  -22.688 36.381  0.50 46.99  ? 277 ARG A NH2 1 
ATOM   2237  N  NH2 B ARG A  1 277 ? -10.106 -24.098 38.832  0.50 61.68  ? 277 ARG A NH2 1 
ATOM   2238  N  N   . TRP A  1 278 ? -13.015 -25.569 32.215  1.00 44.32  ? 278 TRP A N   1 
ATOM   2239  C  CA  . TRP A  1 278 ? -14.071 -24.833 31.510  1.00 40.54  ? 278 TRP A CA  1 
ATOM   2240  C  C   . TRP A  1 278 ? -15.305 -25.697 31.242  1.00 39.81  ? 278 TRP A C   1 
ATOM   2241  O  O   . TRP A  1 278 ? -15.232 -26.694 30.545  1.00 42.81  ? 278 TRP A O   1 
ATOM   2242  C  CB  . TRP A  1 278 ? -13.520 -24.252 30.209  1.00 38.93  ? 278 TRP A CB  1 
ATOM   2243  C  CG  . TRP A  1 278 ? -14.430 -23.247 29.521  1.00 35.94  ? 278 TRP A CG  1 
ATOM   2244  C  CD1 . TRP A  1 278 ? -15.207 -22.262 30.127  1.00 37.12  ? 278 TRP A CD1 1 
ATOM   2245  C  CD2 . TRP A  1 278 ? -14.635 -23.096 28.080  1.00 38.08  ? 278 TRP A CD2 1 
ATOM   2246  N  NE1 . TRP A  1 278 ? -15.903 -21.514 29.146  1.00 35.79  ? 278 TRP A NE1 1 
ATOM   2247  C  CE2 . TRP A  1 278 ? -15.574 -21.995 27.893  1.00 36.19  ? 278 TRP A CE2 1 
ATOM   2248  C  CE3 . TRP A  1 278 ? -14.139 -23.769 26.943  1.00 41.37  ? 278 TRP A CE3 1 
ATOM   2249  C  CZ2 . TRP A  1 278 ? -15.996 -21.585 26.639  1.00 37.38  ? 278 TRP A CZ2 1 
ATOM   2250  C  CZ3 . TRP A  1 278 ? -14.573 -23.349 25.665  1.00 40.65  ? 278 TRP A CZ3 1 
ATOM   2251  C  CH2 . TRP A  1 278 ? -15.483 -22.280 25.518  1.00 39.73  ? 278 TRP A CH2 1 
ATOM   2252  N  N   . SER A  1 279 ? -16.451 -25.291 31.831  1.00 39.39  ? 279 SER A N   1 
ATOM   2253  C  CA  . SER A  1 279 ? -17.751 -25.985 31.611  1.00 36.78  ? 279 SER A CA  1 
ATOM   2254  C  C   . SER A  1 279 ? -18.881 -25.108 32.067  1.00 33.42  ? 279 SER A C   1 
ATOM   2255  O  O   . SER A  1 279 ? -18.659 -24.056 32.654  1.00 31.71  ? 279 SER A O   1 
ATOM   2256  C  CB  . SER A  1 279 ? -17.796 -27.313 32.358  1.00 35.86  ? 279 SER A CB  1 
ATOM   2257  O  OG  . SER A  1 279 ? -18.142 -27.115 33.720  1.00 36.91  ? 279 SER A OG  1 
ATOM   2258  N  N   . ILE A  1 280 ? -20.092 -25.540 31.813  1.00 28.51  ? 280 ILE A N   1 
ATOM   2259  C  CA  . ILE A  1 280 ? -21.257 -24.747 32.133  1.00 29.21  ? 280 ILE A CA  1 
ATOM   2260  C  C   . ILE A  1 280 ? -21.613 -24.797 33.660  1.00 27.41  ? 280 ILE A C   1 
ATOM   2261  O  O   . ILE A  1 280 ? -22.529 -24.156 34.096  1.00 33.61  ? 280 ILE A O   1 
ATOM   2262  C  CB  . ILE A  1 280 ? -22.496 -25.188 31.286  1.00 28.98  ? 280 ILE A CB  1 
ATOM   2263  C  CG1 . ILE A  1 280 ? -23.465 -24.016 31.087  1.00 32.06  ? 280 ILE A CG1 1 
ATOM   2264  C  CG2 . ILE A  1 280 ? -23.185 -26.378 31.919  1.00 27.28  ? 280 ILE A CG2 1 
ATOM   2265  C  CD1 . ILE A  1 280 ? -24.683 -24.371 30.252  1.00 28.27  ? 280 ILE A CD1 1 
ATOM   2266  N  N   . THR A  1 281 ? -20.858 -25.567 34.425  1.00 26.29  ? 281 THR A N   1 
ATOM   2267  C  CA  . THR A  1 281 ? -21.128 -25.695 35.888  1.00 26.63  ? 281 THR A CA  1 
ATOM   2268  C  C   . THR A  1 281 ? -19.917 -25.368 36.759  1.00 26.52  ? 281 THR A C   1 
ATOM   2269  O  O   . THR A  1 281 ? -19.916 -25.648 37.955  1.00 28.51  ? 281 THR A O   1 
ATOM   2270  C  CB  . THR A  1 281 ? -21.658 -27.122 36.267  1.00 27.28  ? 281 THR A CB  1 
ATOM   2271  O  OG1 . THR A  1 281 ? -20.664 -28.098 35.969  1.00 24.33  ? 281 THR A OG1 1 
ATOM   2272  C  CG2 . THR A  1 281 ? -22.938 -27.447 35.502  1.00 27.85  ? 281 THR A CG2 1 
ATOM   2273  N  N   . LEU A  1 282 ? -18.897 -24.773 36.165  1.00 29.09  ? 282 LEU A N   1 
ATOM   2274  C  CA  . LEU A  1 282 ? -17.672 -24.439 36.917  1.00 29.91  ? 282 LEU A CA  1 
ATOM   2275  C  C   . LEU A  1 282 ? -17.936 -23.514 38.138  1.00 30.52  ? 282 LEU A C   1 
ATOM   2276  O  O   . LEU A  1 282 ? -17.281 -23.651 39.179  1.00 28.49  ? 282 LEU A O   1 
ATOM   2277  C  CB  . LEU A  1 282 ? -16.609 -23.816 36.007  1.00 31.56  ? 282 LEU A CB  1 
ATOM   2278  C  CG  . LEU A  1 282 ? -15.289 -23.416 36.750  1.00 36.32  ? 282 LEU A CG  1 
ATOM   2279  C  CD1 . LEU A  1 282 ? -14.648 -24.638 37.443  1.00 36.32  ? 282 LEU A CD1 1 
ATOM   2280  C  CD2 . LEU A  1 282 ? -14.307 -22.743 35.822  1.00 36.51  ? 282 LEU A CD2 1 
ATOM   2281  N  N   . ILE A  1 283 ? -18.893 -22.576 38.001  1.00 27.52  ? 283 ILE A N   1 
ATOM   2282  C  CA  . ILE A  1 283 ? -19.160 -21.601 39.110  1.00 29.32  ? 283 ILE A CA  1 
ATOM   2283  C  C   . ILE A  1 283 ? -19.732 -22.267 40.348  1.00 29.63  ? 283 ILE A C   1 
ATOM   2284  O  O   . ILE A  1 283 ? -19.579 -21.770 41.436  1.00 27.64  ? 283 ILE A O   1 
ATOM   2285  C  CB  . ILE A  1 283 ? -20.082 -20.437 38.675  1.00 28.89  ? 283 ILE A CB  1 
ATOM   2286  C  CG1 . ILE A  1 283 ? -21.413 -20.965 38.194  1.00 29.02  ? 283 ILE A CG1 1 
ATOM   2287  C  CG2 . ILE A  1 283 ? -19.389 -19.567 37.601  1.00 30.92  ? 283 ILE A CG2 1 
ATOM   2288  C  CD1 . ILE A  1 283 ? -22.411 -19.896 37.909  1.00 30.19  ? 283 ILE A CD1 1 
ATOM   2289  N  N   . PHE A  1 284 ? -20.404 -23.417 40.158  1.00 28.60  ? 284 PHE A N   1 
ATOM   2290  C  CA  . PHE A  1 284 ? -20.931 -24.191 41.302  1.00 30.61  ? 284 PHE A CA  1 
ATOM   2291  C  C   . PHE A  1 284 ? -19.846 -24.977 41.937  1.00 30.48  ? 284 PHE A C   1 
ATOM   2292  O  O   . PHE A  1 284 ? -19.853 -25.206 43.163  1.00 32.75  ? 284 PHE A O   1 
ATOM   2293  C  CB  . PHE A  1 284 ? -22.046 -25.128 40.853  1.00 30.83  ? 284 PHE A CB  1 
ATOM   2294  C  CG  . PHE A  1 284 ? -23.227 -24.439 40.351  1.00 34.48  ? 284 PHE A CG  1 
ATOM   2295  C  CD1 . PHE A  1 284 ? -23.447 -24.312 38.976  1.00 37.31  ? 284 PHE A CD1 1 
ATOM   2296  C  CD2 . PHE A  1 284 ? -24.149 -23.891 41.225  1.00 35.85  ? 284 PHE A CD2 1 
ATOM   2297  C  CE1 . PHE A  1 284 ? -24.566 -23.657 38.498  1.00 37.10  ? 284 PHE A CE1 1 
ATOM   2298  C  CE2 . PHE A  1 284 ? -25.270 -23.234 40.751  1.00 39.39  ? 284 PHE A CE2 1 
ATOM   2299  C  CZ  . PHE A  1 284 ? -25.478 -23.117 39.384  1.00 37.66  ? 284 PHE A CZ  1 
ATOM   2300  N  N   . GLU A  1 285 ? -18.896 -25.393 41.134  1.00 28.20  ? 285 GLU A N   1 
ATOM   2301  C  CA  . GLU A  1 285 ? -17.848 -26.252 41.586  1.00 31.30  ? 285 GLU A CA  1 
ATOM   2302  C  C   . GLU A  1 285 ? -16.720 -25.487 42.244  1.00 33.33  ? 285 GLU A C   1 
ATOM   2303  O  O   . GLU A  1 285 ? -15.984 -26.035 43.037  1.00 33.50  ? 285 GLU A O   1 
ATOM   2304  C  CB  . GLU A  1 285 ? -17.295 -27.068 40.412  1.00 30.79  ? 285 GLU A CB  1 
ATOM   2305  C  CG  . GLU A  1 285 ? -18.342 -27.862 39.669  1.00 33.32  ? 285 GLU A CG  1 
ATOM   2306  C  CD  . GLU A  1 285 ? -17.812 -28.469 38.430  1.00 35.23  ? 285 GLU A CD  1 
ATOM   2307  O  OE1 . GLU A  1 285 ? -16.589 -28.504 38.271  1.00 39.24  ? 285 GLU A OE1 1 
ATOM   2308  O  OE2 . GLU A  1 285 ? -18.617 -28.915 37.596  1.00 39.50  ? 285 GLU A OE2 1 
ATOM   2309  N  N   . ASP A  1 286 ? -16.593 -24.216 41.915  1.00 34.78  ? 286 ASP A N   1 
ATOM   2310  C  CA  . ASP A  1 286 ? -15.444 -23.434 42.385  1.00 33.52  ? 286 ASP A CA  1 
ATOM   2311  C  C   . ASP A  1 286 ? -15.810 -22.009 42.869  1.00 32.75  ? 286 ASP A C   1 
ATOM   2312  O  O   . ASP A  1 286 ? -15.651 -21.683 44.047  1.00 35.29  ? 286 ASP A O   1 
ATOM   2313  C  CB  . ASP A  1 286 ? -14.373 -23.365 41.284  1.00 35.64  ? 286 ASP A CB  1 
ATOM   2314  C  CG  . ASP A  1 286 ? -13.206 -22.562 41.676  1.00 39.00  ? 286 ASP A CG  1 
ATOM   2315  O  OD1 . ASP A  1 286 ? -13.372 -21.604 42.484  1.00 38.43  ? 286 ASP A OD1 1 
ATOM   2316  O  OD2 . ASP A  1 286 ? -12.106 -22.853 41.188  1.00 42.91  ? 286 ASP A OD2 1 
ATOM   2317  N  N   . THR A  1 287 ? -16.291 -21.185 41.956  1.00 30.48  ? 287 THR A N   1 
ATOM   2318  C  CA  . THR A  1 287 ? -16.535 -19.757 42.249  1.00 29.77  ? 287 THR A CA  1 
ATOM   2319  C  C   . THR A  1 287 ? -17.466 -19.515 43.456  1.00 27.92  ? 287 THR A C   1 
ATOM   2320  O  O   . THR A  1 287 ? -17.071 -18.872 44.441  1.00 26.49  ? 287 THR A O   1 
ATOM   2321  C  CB  . THR A  1 287 ? -17.093 -19.024 41.031  1.00 29.11  ? 287 THR A CB  1 
ATOM   2322  O  OG1 . THR A  1 287 ? -16.172 -19.135 39.955  1.00 33.20  ? 287 THR A OG1 1 
ATOM   2323  C  CG2 . THR A  1 287 ? -17.308 -17.556 41.355  1.00 26.05  ? 287 THR A CG2 1 
ATOM   2324  N  N   . ILE A  1 288 ? -18.688 -20.014 43.373  1.00 27.32  ? 288 ILE A N   1 
ATOM   2325  C  CA  . ILE A  1 288 ? -19.651 -19.794 44.429  1.00 27.72  ? 288 ILE A CA  1 
ATOM   2326  C  C   . ILE A  1 288 ? -19.112 -20.298 45.862  1.00 30.14  ? 288 ILE A C   1 
ATOM   2327  O  O   . ILE A  1 288 ? -19.151 -19.544 46.843  1.00 29.99  ? 288 ILE A O   1 
ATOM   2328  C  CB  . ILE A  1 288 ? -21.022 -20.402 44.093  1.00 27.55  ? 288 ILE A CB  1 
ATOM   2329  C  CG1 . ILE A  1 288 ? -21.611 -19.706 42.842  1.00 24.80  ? 288 ILE A CG1 1 
ATOM   2330  C  CG2 . ILE A  1 288 ? -21.966 -20.274 45.266  1.00 25.86  ? 288 ILE A CG2 1 
ATOM   2331  C  CD1 . ILE A  1 288 ? -23.038 -20.047 42.566  1.00 27.18  ? 288 ILE A CD1 1 
ATOM   2332  N  N   . PRO A  1 289 ? -18.613 -21.568 45.934  1.00 31.82  ? 289 PRO A N   1 
ATOM   2333  C  CA  . PRO A  1 289 ? -18.028 -22.038 47.188  1.00 31.81  ? 289 PRO A CA  1 
ATOM   2334  C  C   . PRO A  1 289 ? -16.915 -21.093 47.663  1.00 33.48  ? 289 PRO A C   1 
ATOM   2335  O  O   . PRO A  1 289 ? -16.834 -20.772 48.874  1.00 34.07  ? 289 PRO A O   1 
ATOM   2336  C  CB  . PRO A  1 289 ? -17.448 -23.421 46.810  1.00 31.99  ? 289 PRO A CB  1 
ATOM   2337  C  CG  . PRO A  1 289 ? -18.288 -23.877 45.691  1.00 30.20  ? 289 PRO A CG  1 
ATOM   2338  C  CD  . PRO A  1 289 ? -18.644 -22.624 44.907  1.00 30.05  ? 289 PRO A CD  1 
ATOM   2339  N  N   . PHE A  1 290 ? -16.065 -20.640 46.722  1.00 31.77  ? 290 PHE A N   1 
ATOM   2340  C  CA  . PHE A  1 290 ? -14.984 -19.680 47.050  1.00 34.75  ? 290 PHE A CA  1 
ATOM   2341  C  C   . PHE A  1 290 ? -15.538 -18.415 47.690  1.00 35.58  ? 290 PHE A C   1 
ATOM   2342  O  O   . PHE A  1 290 ? -15.013 -17.937 48.683  1.00 40.29  ? 290 PHE A O   1 
ATOM   2343  C  CB  . PHE A  1 290 ? -14.183 -19.325 45.815  1.00 36.34  ? 290 PHE A CB  1 
ATOM   2344  C  CG  . PHE A  1 290 ? -13.205 -18.141 46.025  1.00 39.05  ? 290 PHE A CG  1 
ATOM   2345  C  CD1 . PHE A  1 290 ? -11.937 -18.351 46.575  1.00 40.15  ? 290 PHE A CD1 1 
ATOM   2346  C  CD2 . PHE A  1 290 ? -13.573 -16.837 45.670  1.00 36.29  ? 290 PHE A CD2 1 
ATOM   2347  C  CE1 . PHE A  1 290 ? -11.062 -17.294 46.764  1.00 40.24  ? 290 PHE A CE1 1 
ATOM   2348  C  CE2 . PHE A  1 290 ? -12.695 -15.773 45.861  1.00 37.84  ? 290 PHE A CE2 1 
ATOM   2349  C  CZ  . PHE A  1 290 ? -11.441 -16.001 46.406  1.00 40.21  ? 290 PHE A CZ  1 
ATOM   2350  N  N   . LEU A  1 291 ? -16.594 -17.881 47.115  1.00 33.72  ? 291 LEU A N   1 
ATOM   2351  C  CA  . LEU A  1 291 ? -17.213 -16.675 47.643  1.00 34.70  ? 291 LEU A CA  1 
ATOM   2352  C  C   . LEU A  1 291 ? -17.815 -16.911 49.038  1.00 34.22  ? 291 LEU A C   1 
ATOM   2353  O  O   . LEU A  1 291 ? -17.634 -16.095 49.945  1.00 35.77  ? 291 LEU A O   1 
ATOM   2354  C  CB  . LEU A  1 291 ? -18.290 -16.131 46.665  1.00 32.08  ? 291 LEU A CB  1 
ATOM   2355  C  CG  . LEU A  1 291 ? -17.762 -15.617 45.310  1.00 31.27  ? 291 LEU A CG  1 
ATOM   2356  C  CD1 . LEU A  1 291 ? -18.910 -15.237 44.388  1.00 31.43  ? 291 LEU A CD1 1 
ATOM   2357  C  CD2 . LEU A  1 291 ? -16.789 -14.423 45.508  1.00 31.28  ? 291 LEU A CD2 1 
ATOM   2358  N  N   . LYS A  1 292 ? -18.537 -18.035 49.204  1.00 36.95  ? 292 LYS A N   1 
ATOM   2359  C  CA  . LYS A  1 292 ? -19.103 -18.369 50.505  1.00 38.24  ? 292 LYS A CA  1 
ATOM   2360  C  C   . LYS A  1 292 ? -17.964 -18.530 51.578  1.00 38.80  ? 292 LYS A C   1 
ATOM   2361  O  O   . LYS A  1 292 ? -18.075 -18.027 52.685  1.00 34.92  ? 292 LYS A O   1 
ATOM   2362  C  CB  . LYS A  1 292 ? -19.974 -19.619 50.428  1.00 41.04  ? 292 LYS A CB  1 
ATOM   2363  C  CG  . LYS A  1 292 ? -21.298 -19.413 49.644  1.00 45.64  ? 292 LYS A CG  1 
ATOM   2364  C  CD  . LYS A  1 292 ? -22.434 -20.290 50.208  1.00 58.62  ? 292 LYS A CD  1 
ATOM   2365  C  CE  . LYS A  1 292 ? -22.184 -21.777 49.963  1.00 66.93  ? 292 LYS A CE  1 
ATOM   2366  N  NZ  . LYS A  1 292 ? -22.419 -22.159 48.532  1.00 66.22  ? 292 LYS A NZ  1 
ATOM   2367  N  N   . ARG A  1 293 ? -16.880 -19.229 51.197  1.00 36.58  ? 293 ARG A N   1 
ATOM   2368  C  CA  . ARG A  1 293 ? -15.710 -19.372 52.064  1.00 41.13  ? 293 ARG A CA  1 
ATOM   2369  C  C   . ARG A  1 293 ? -15.155 -18.016 52.491  1.00 42.20  ? 293 ARG A C   1 
ATOM   2370  O  O   . ARG A  1 293 ? -14.538 -17.901 53.515  1.00 38.35  ? 293 ARG A O   1 
ATOM   2371  C  CB  . ARG A  1 293 ? -14.605 -20.186 51.360  1.00 42.94  ? 293 ARG A CB  1 
ATOM   2372  C  CG  . ARG A  1 293 ? -14.662 -21.636 51.627  1.00 43.51  ? 293 ARG A CG  1 
ATOM   2373  C  CD  . ARG A  1 293 ? -13.415 -22.334 51.140  1.00 44.32  ? 293 ARG A CD  1 
ATOM   2374  N  NE  . ARG A  1 293 ? -13.527 -22.747 49.760  1.00 54.44  ? 293 ARG A NE  1 
ATOM   2375  C  CZ  . ARG A  1 293 ? -12.871 -22.199 48.765  1.00 52.79  ? 293 ARG A CZ  1 
ATOM   2376  N  NH1 . ARG A  1 293 ? -12.031 -21.192 48.989  1.00 54.25  ? 293 ARG A NH1 1 
ATOM   2377  N  NH2 . ARG A  1 293 ? -13.042 -22.649 47.544  1.00 51.70  ? 293 ARG A NH2 1 
ATOM   2378  N  N   . ASN A  1 294 ? -15.393 -16.999 51.676  1.00 42.40  ? 294 ASN A N   1 
ATOM   2379  C  CA  . ASN A  1 294 ? -14.861 -15.675 51.935  1.00 36.90  ? 294 ASN A CA  1 
ATOM   2380  C  C   . ASN A  1 294 ? -15.891 -14.704 52.481  1.00 38.51  ? 294 ASN A C   1 
ATOM   2381  O  O   . ASN A  1 294 ? -15.751 -13.519 52.334  1.00 38.98  ? 294 ASN A O   1 
ATOM   2382  C  CB  . ASN A  1 294 ? -14.232 -15.118 50.694  1.00 40.20  ? 294 ASN A CB  1 
ATOM   2383  C  CG  . ASN A  1 294 ? -12.869 -15.676 50.446  1.00 43.73  ? 294 ASN A CG  1 
ATOM   2384  O  OD1 . ASN A  1 294 ? -12.699 -16.628 49.659  1.00 45.13  ? 294 ASN A OD1 1 
ATOM   2385  N  ND2 . ASN A  1 294 ? -11.878 -15.118 51.112  1.00 40.67  ? 294 ASN A ND2 1 
ATOM   2386  N  N   . GLY A  1 295 ? -16.937 -15.238 53.108  1.00 38.72  ? 295 GLY A N   1 
ATOM   2387  C  CA  . GLY A  1 295 ? -17.923 -14.393 53.826  1.00 39.31  ? 295 GLY A CA  1 
ATOM   2388  C  C   . GLY A  1 295 ? -19.091 -13.829 52.984  1.00 40.89  ? 295 GLY A C   1 
ATOM   2389  O  O   . GLY A  1 295 ? -19.914 -13.095 53.491  1.00 47.06  ? 295 GLY A O   1 
ATOM   2390  N  N   . VAL A  1 296 ? -19.142 -14.177 51.711  1.00 41.09  ? 296 VAL A N   1 
ATOM   2391  C  CA  . VAL A  1 296 ? -20.270 -13.756 50.865  1.00 38.03  ? 296 VAL A CA  1 
ATOM   2392  C  C   . VAL A  1 296 ? -21.469 -14.603 51.184  1.00 35.87  ? 296 VAL A C   1 
ATOM   2393  O  O   . VAL A  1 296 ? -21.421 -15.793 51.059  1.00 37.14  ? 296 VAL A O   1 
ATOM   2394  C  CB  . VAL A  1 296 ? -19.939 -13.879 49.372  1.00 37.94  ? 296 VAL A CB  1 
ATOM   2395  C  CG1 . VAL A  1 296 ? -21.159 -13.487 48.518  1.00 36.19  ? 296 VAL A CG1 1 
ATOM   2396  C  CG2 . VAL A  1 296 ? -18.750 -13.021 49.030  1.00 37.21  ? 296 VAL A CG2 1 
ATOM   2397  N  N   . ASN A  1 297 ? -22.558 -13.966 51.612  1.00 38.70  ? 297 ASN A N   1 
ATOM   2398  C  CA  . ASN A  1 297 ? -23.773 -14.723 52.041  1.00 39.29  ? 297 ASN A CA  1 
ATOM   2399  C  C   . ASN A  1 297 ? -24.702 -15.109 50.878  1.00 41.63  ? 297 ASN A C   1 
ATOM   2400  O  O   . ASN A  1 297 ? -24.490 -14.698 49.727  1.00 37.42  ? 297 ASN A O   1 
ATOM   2401  C  CB  . ASN A  1 297 ? -24.552 -13.960 53.134  1.00 42.44  ? 297 ASN A CB  1 
ATOM   2402  C  CG  . ASN A  1 297 ? -25.317 -12.763 52.587  1.00 52.02  ? 297 ASN A CG  1 
ATOM   2403  O  OD1 . ASN A  1 297 ? -25.535 -12.644 51.376  1.00 57.16  ? 297 ASN A OD1 1 
ATOM   2404  N  ND2 . ASN A  1 297 ? -25.728 -11.887 53.466  1.00 56.26  ? 297 ASN A ND2 1 
ATOM   2405  N  N   . GLU A  1 298 ? -25.729 -15.892 51.191  1.00 42.15  ? 298 GLU A N   1 
ATOM   2406  C  CA  . GLU A  1 298 ? -26.630 -16.412 50.190  1.00 43.54  ? 298 GLU A CA  1 
ATOM   2407  C  C   . GLU A  1 298 ? -27.462 -15.301 49.498  1.00 38.15  ? 298 GLU A C   1 
ATOM   2408  O  O   . GLU A  1 298 ? -27.862 -15.449 48.347  1.00 37.89  ? 298 GLU A O   1 
ATOM   2409  C  CB  . GLU A  1 298 ? -27.556 -17.469 50.799  1.00 45.16  ? 298 GLU A CB  1 
ATOM   2410  C  CG  . GLU A  1 298 ? -28.156 -18.414 49.782  1.00 56.74  ? 298 GLU A CG  1 
ATOM   2411  C  CD  . GLU A  1 298 ? -27.080 -19.186 48.985  1.00 64.23  ? 298 GLU A CD  1 
ATOM   2412  O  OE1 . GLU A  1 298 ? -26.051 -19.588 49.592  1.00 67.31  ? 298 GLU A OE1 1 
ATOM   2413  O  OE2 . GLU A  1 298 ? -27.272 -19.386 47.762  1.00 68.74  ? 298 GLU A OE2 1 
ATOM   2414  N  N   . GLU A  1 299 ? -27.711 -14.200 50.214  1.00 36.02  ? 299 GLU A N   1 
ATOM   2415  C  CA  . GLU A  1 299 ? -28.458 -13.056 49.631  1.00 38.91  ? 299 GLU A CA  1 
ATOM   2416  C  C   . GLU A  1 299 ? -27.724 -12.462 48.423  1.00 37.74  ? 299 GLU A C   1 
ATOM   2417  O  O   . GLU A  1 299 ? -28.337 -12.070 47.457  1.00 40.42  ? 299 GLU A O   1 
ATOM   2418  C  CB  . GLU A  1 299 ? -28.710 -11.956 50.684  1.00 45.79  ? 299 GLU A CB  1 
ATOM   2419  C  CG  . GLU A  1 299 ? -29.825 -12.276 51.695  1.00 62.14  ? 299 GLU A CG  1 
ATOM   2420  C  CD  . GLU A  1 299 ? -29.393 -13.288 52.761  1.00 71.51  ? 299 GLU A CD  1 
ATOM   2421  O  OE1 . GLU A  1 299 ? -30.250 -13.691 53.579  1.00 87.38  ? 299 GLU A OE1 1 
ATOM   2422  O  OE2 . GLU A  1 299 ? -28.197 -13.675 52.777  1.00 74.98  ? 299 GLU A OE2 1 
ATOM   2423  N  N   . VAL A  1 300 ? -26.397 -12.405 48.511  1.00 31.41  ? 300 VAL A N   1 
ATOM   2424  C  CA  . VAL A  1 300 ? -25.597 -11.844 47.461  1.00 32.33  ? 300 VAL A CA  1 
ATOM   2425  C  C   . VAL A  1 300 ? -25.603 -12.748 46.247  1.00 31.37  ? 300 VAL A C   1 
ATOM   2426  O  O   . VAL A  1 300 ? -25.737 -12.298 45.160  1.00 31.01  ? 300 VAL A O   1 
ATOM   2427  C  CB  . VAL A  1 300 ? -24.150 -11.620 47.918  1.00 33.85  ? 300 VAL A CB  1 
ATOM   2428  C  CG1 . VAL A  1 300 ? -23.287 -11.154 46.749  1.00 36.63  ? 300 VAL A CG1 1 
ATOM   2429  C  CG2 . VAL A  1 300 ? -24.102 -10.606 49.075  1.00 33.65  ? 300 VAL A CG2 1 
ATOM   2430  N  N   . ILE A  1 301 ? -25.451 -14.047 46.477  1.00 32.23  ? 301 ILE A N   1 
ATOM   2431  C  CA  . ILE A  1 301 ? -25.517 -15.016 45.410  1.00 31.39  ? 301 ILE A CA  1 
ATOM   2432  C  C   . ILE A  1 301 ? -26.852 -14.909 44.687  1.00 30.97  ? 301 ILE A C   1 
ATOM   2433  O  O   . ILE A  1 301 ? -26.908 -14.924 43.439  1.00 29.98  ? 301 ILE A O   1 
ATOM   2434  C  CB  . ILE A  1 301 ? -25.339 -16.451 45.940  1.00 31.82  ? 301 ILE A CB  1 
ATOM   2435  C  CG1 . ILE A  1 301 ? -24.032 -16.570 46.729  1.00 33.65  ? 301 ILE A CG1 1 
ATOM   2436  C  CG2 . ILE A  1 301 ? -25.371 -17.461 44.787  1.00 27.69  ? 301 ILE A CG2 1 
ATOM   2437  C  CD1 . ILE A  1 301 ? -22.797 -16.145 45.938  1.00 37.25  ? 301 ILE A CD1 1 
ATOM   2438  N  N   . ALA A  1 302 ? -27.936 -14.790 45.462  1.00 28.87  ? 302 ALA A N   1 
ATOM   2439  C  CA  . ALA A  1 302 ? -29.257 -14.656 44.898  1.00 28.50  ? 302 ALA A CA  1 
ATOM   2440  C  C   . ALA A  1 302 ? -29.387 -13.350 44.069  1.00 29.32  ? 302 ALA A C   1 
ATOM   2441  O  O   . ALA A  1 302 ? -30.042 -13.325 43.031  1.00 29.17  ? 302 ALA A O   1 
ATOM   2442  C  CB  . ALA A  1 302 ? -30.315 -14.701 45.998  1.00 28.85  ? 302 ALA A CB  1 
ATOM   2443  N  N   . THR A  1 303 ? -28.768 -12.292 44.542  1.00 27.75  ? 303 THR A N   1 
ATOM   2444  C  CA  . THR A  1 303 ? -28.814 -11.016 43.843  1.00 28.42  ? 303 THR A CA  1 
ATOM   2445  C  C   . THR A  1 303 ? -28.164 -11.124 42.466  1.00 26.87  ? 303 THR A C   1 
ATOM   2446  O  O   . THR A  1 303 ? -28.732 -10.648 41.438  1.00 25.27  ? 303 THR A O   1 
ATOM   2447  C  CB  . THR A  1 303 ? -28.111 -9.903  44.657  1.00 30.95  ? 303 THR A CB  1 
ATOM   2448  O  OG1 . THR A  1 303 ? -28.853 -9.645  45.837  1.00 32.32  ? 303 THR A OG1 1 
ATOM   2449  C  CG2 . THR A  1 303 ? -28.010 -8.627  43.847  1.00 28.89  ? 303 THR A CG2 1 
ATOM   2450  N  N   . ILE A  1 304 ? -26.993 -11.741 42.425  1.00 23.26  ? 304 ILE A N   1 
ATOM   2451  C  CA  . ILE A  1 304 ? -26.252 -11.882 41.203  1.00 23.99  ? 304 ILE A CA  1 
ATOM   2452  C  C   . ILE A  1 304 ? -26.980 -12.819 40.151  1.00 25.71  ? 304 ILE A C   1 
ATOM   2453  O  O   . ILE A  1 304 ? -27.149 -12.439 38.959  1.00 26.32  ? 304 ILE A O   1 
ATOM   2454  C  CB  . ILE A  1 304 ? -24.870 -12.426 41.466  1.00 22.82  ? 304 ILE A CB  1 
ATOM   2455  C  CG1 . ILE A  1 304 ? -24.032 -11.395 42.270  1.00 24.31  ? 304 ILE A CG1 1 
ATOM   2456  C  CG2 . ILE A  1 304 ? -24.183 -12.784 40.154  1.00 21.95  ? 304 ILE A CG2 1 
ATOM   2457  C  CD1 . ILE A  1 304 ? -22.711 -11.938 42.779  1.00 24.39  ? 304 ILE A CD1 1 
ATOM   2458  N  N   . PHE A  1 305 ? -27.394 -14.002 40.597  1.00 22.59  ? 305 PHE A N   1 
ATOM   2459  C  CA  . PHE A  1 305 ? -27.936 -15.019 39.677  1.00 23.87  ? 305 PHE A CA  1 
ATOM   2460  C  C   . PHE A  1 305 ? -29.445 -14.971 39.523  1.00 24.18  ? 305 PHE A C   1 
ATOM   2461  O  O   . PHE A  1 305 ? -29.998 -15.617 38.627  1.00 23.51  ? 305 PHE A O   1 
ATOM   2462  C  CB  . PHE A  1 305 ? -27.486 -16.414 40.095  1.00 22.55  ? 305 PHE A CB  1 
ATOM   2463  C  CG  . PHE A  1 305 ? -26.012 -16.614 40.005  1.00 22.04  ? 305 PHE A CG  1 
ATOM   2464  C  CD1 . PHE A  1 305 ? -25.195 -16.465 41.145  1.00 21.07  ? 305 PHE A CD1 1 
ATOM   2465  C  CD2 . PHE A  1 305 ? -25.404 -16.942 38.771  1.00 20.56  ? 305 PHE A CD2 1 
ATOM   2466  C  CE1 . PHE A  1 305 ? -23.806 -16.647 41.060  1.00 22.49  ? 305 PHE A CE1 1 
ATOM   2467  C  CE2 . PHE A  1 305 ? -24.006 -17.128 38.679  1.00 20.47  ? 305 PHE A CE2 1 
ATOM   2468  C  CZ  . PHE A  1 305 ? -23.209 -16.983 39.815  1.00 19.76  ? 305 PHE A CZ  1 
ATOM   2469  N  N   . LYS A  1 306 ? -30.115 -14.214 40.373  1.00 21.96  ? 306 LYS A N   1 
ATOM   2470  C  CA  . LYS A  1 306 ? -31.600 -14.123 40.288  1.00 25.29  ? 306 LYS A CA  1 
ATOM   2471  C  C   . LYS A  1 306 ? -32.118 -12.689 40.096  1.00 26.70  ? 306 LYS A C   1 
ATOM   2472  O  O   . LYS A  1 306 ? -32.748 -12.389 39.099  1.00 26.56  ? 306 LYS A O   1 
ATOM   2473  C  CB  . LYS A  1 306 ? -32.261 -14.788 41.504  1.00 26.53  ? 306 LYS A CB  1 
ATOM   2474  C  CG  . LYS A  1 306 ? -31.970 -16.292 41.615  1.00 27.21  ? 306 LYS A CG  1 
ATOM   2475  C  CD  . LYS A  1 306 ? -32.685 -16.911 42.793  1.00 33.07  ? 306 LYS A CD  1 
ATOM   2476  C  CE  . LYS A  1 306 ? -32.306 -18.344 42.953  1.00 37.96  ? 306 LYS A CE  1 
ATOM   2477  N  NZ  . LYS A  1 306 ? -33.070 -18.996 44.028  1.00 49.68  ? 306 LYS A NZ  1 
ATOM   2478  N  N   . GLU A  1 307 ? -31.842 -11.824 41.048  1.00 28.90  ? 307 GLU A N   1 
ATOM   2479  C  CA  . GLU A  1 307 ? -32.357 -10.421 40.981  1.00 30.92  ? 307 GLU A CA  1 
ATOM   2480  C  C   . GLU A  1 307 ? -31.829 -9.648  39.801  1.00 27.13  ? 307 GLU A C   1 
ATOM   2481  O  O   . GLU A  1 307 ? -32.567 -9.050  39.103  1.00 28.59  ? 307 GLU A O   1 
ATOM   2482  C  CB  . GLU A  1 307 ? -32.088 -9.652  42.308  1.00 30.94  ? 307 GLU A CB  1 
ATOM   2483  C  CG  . GLU A  1 307 ? -33.200 -9.808  43.337  1.00 42.34  ? 307 GLU A CG  1 
ATOM   2484  C  CD  . GLU A  1 307 ? -34.585 -9.263  42.819  1.00 50.07  ? 307 GLU A CD  1 
ATOM   2485  O  OE1 . GLU A  1 307 ? -34.597 -8.243  42.051  1.00 57.51  ? 307 GLU A OE1 1 
ATOM   2486  O  OE2 . GLU A  1 307 ? -35.615 -9.840  43.176  1.00 60.59  ? 307 GLU A OE2 1 
ATOM   2487  N  N   . ASN A  1 308 ? -30.511 -9.679  39.598  1.00 25.54  ? 308 ASN A N   1 
ATOM   2488  C  CA  . ASN A  1 308 ? -29.903 -8.933  38.489  1.00 24.66  ? 308 ASN A CA  1 
ATOM   2489  C  C   . ASN A  1 308 ? -30.516 -9.308  37.085  1.00 25.39  ? 308 ASN A C   1 
ATOM   2490  O  O   . ASN A  1 308 ? -30.986 -8.414  36.333  1.00 25.43  ? 308 ASN A O   1 
ATOM   2491  C  CB  . ASN A  1 308 ? -28.364 -9.076  38.495  1.00 23.82  ? 308 ASN A CB  1 
ATOM   2492  C  CG  . ASN A  1 308 ? -27.703 -8.241  39.597  1.00 23.85  ? 308 ASN A CG  1 
ATOM   2493  O  OD1 . ASN A  1 308 ? -28.361 -7.502  40.285  1.00 24.09  ? 308 ASN A OD1 1 
ATOM   2494  N  ND2 . ASN A  1 308 ? -26.355 -8.380  39.746  1.00 24.36  ? 308 ASN A ND2 1 
ATOM   2495  N  N   . PRO A  1 309 ? -30.508 -10.592 36.749  1.00 23.26  ? 309 PRO A N   1 
ATOM   2496  C  CA  . PRO A  1 309 ? -31.155 -11.041 35.520  1.00 24.29  ? 309 PRO A CA  1 
ATOM   2497  C  C   . PRO A  1 309 ? -32.628 -10.582 35.459  1.00 27.10  ? 309 PRO A C   1 
ATOM   2498  O  O   . PRO A  1 309 ? -33.109 -10.158 34.394  1.00 24.31  ? 309 PRO A O   1 
ATOM   2499  C  CB  . PRO A  1 309 ? -31.080 -12.563 35.624  1.00 24.58  ? 309 PRO A CB  1 
ATOM   2500  C  CG  . PRO A  1 309 ? -29.853 -12.820 36.445  1.00 24.13  ? 309 PRO A CG  1 
ATOM   2501  C  CD  . PRO A  1 309 ? -29.803 -11.695 37.447  1.00 23.45  ? 309 PRO A CD  1 
ATOM   2502  N  N   . LYS A  1 310 ? -33.327 -10.664 36.589  1.00 28.86  ? 310 LYS A N   1 
ATOM   2503  C  CA  . LYS A  1 310 ? -34.708 -10.231 36.651  1.00 28.59  ? 310 LYS A CA  1 
ATOM   2504  C  C   . LYS A  1 310 ? -34.842 -8.725  36.290  1.00 28.73  ? 310 LYS A C   1 
ATOM   2505  O  O   . LYS A  1 310 ? -35.659 -8.353  35.474  1.00 28.54  ? 310 LYS A O   1 
ATOM   2506  C  CB  . LYS A  1 310 ? -35.298 -10.496 38.022  1.00 29.46  ? 310 LYS A CB  1 
ATOM   2507  C  CG  . LYS A  1 310 ? -36.742 -10.031 38.168  1.00 31.17  ? 310 LYS A CG  1 
ATOM   2508  C  CD  . LYS A  1 310 ? -37.277 -10.310 39.567  1.00 37.34  ? 310 LYS A CD  1 
ATOM   2509  C  CE  . LYS A  1 310 ? -38.706 -9.837  39.712  1.00 39.43  ? 310 LYS A CE  1 
ATOM   2510  N  NZ  . LYS A  1 310 ? -39.250 -10.139 41.053  1.00 49.03  ? 310 LYS A NZ  1 
ATOM   2511  N  N   . LYS A  1 311 ? -34.024 -7.889  36.917  1.00 28.24  ? 311 LYS A N   1 
ATOM   2512  C  CA  . LYS A  1 311 ? -34.044 -6.426  36.628  1.00 29.01  ? 311 LYS A CA  1 
ATOM   2513  C  C   . LYS A  1 311 ? -33.676 -6.169  35.198  1.00 26.93  ? 311 LYS A C   1 
ATOM   2514  O  O   . LYS A  1 311 ? -34.276 -5.336  34.530  1.00 28.34  ? 311 LYS A O   1 
ATOM   2515  C  CB  . LYS A  1 311 ? -33.094 -5.674  37.570  1.00 30.97  ? 311 LYS A CB  1 
ATOM   2516  C  CG  . LYS A  1 311 ? -33.493 -5.748  39.047  1.00 33.41  ? 311 LYS A CG  1 
ATOM   2517  C  CD  . LYS A  1 311 ? -32.508 -4.977  39.936  1.00 39.47  ? 311 LYS A CD  1 
ATOM   2518  C  CE  . LYS A  1 311 ? -31.098 -5.568  39.849  1.00 44.07  ? 311 LYS A CE  1 
ATOM   2519  N  NZ  . LYS A  1 311 ? -30.105 -4.769  40.611  1.00 45.53  ? 311 LYS A NZ  1 
ATOM   2520  N  N   . PHE A  1 312 ? -32.701 -6.892  34.731  1.00 27.81  ? 312 PHE A N   1 
ATOM   2521  C  CA  . PHE A  1 312 ? -32.211 -6.779  33.382  1.00 27.18  ? 312 PHE A CA  1 
ATOM   2522  C  C   . PHE A  1 312 ? -33.352 -7.029  32.308  1.00 28.77  ? 312 PHE A C   1 
ATOM   2523  O  O   . PHE A  1 312 ? -33.425 -6.334  31.300  1.00 27.48  ? 312 PHE A O   1 
ATOM   2524  C  CB  . PHE A  1 312 ? -31.050 -7.780  33.188  1.00 25.23  ? 312 PHE A CB  1 
ATOM   2525  C  CG  . PHE A  1 312 ? -30.364 -7.684  31.856  1.00 25.71  ? 312 PHE A CG  1 
ATOM   2526  C  CD1 . PHE A  1 312 ? -30.424 -8.749  30.946  1.00 23.16  ? 312 PHE A CD1 1 
ATOM   2527  C  CD2 . PHE A  1 312 ? -29.625 -6.541  31.505  1.00 25.15  ? 312 PHE A CD2 1 
ATOM   2528  C  CE1 . PHE A  1 312 ? -29.775 -8.668  29.707  1.00 23.12  ? 312 PHE A CE1 1 
ATOM   2529  C  CE2 . PHE A  1 312 ? -28.979 -6.464  30.272  1.00 23.98  ? 312 PHE A CE2 1 
ATOM   2530  C  CZ  . PHE A  1 312 ? -29.058 -7.531  29.373  1.00 22.09  ? 312 PHE A CZ  1 
ATOM   2531  N  N   . PHE A  1 313 ? -34.209 -8.016  32.568  1.00 27.86  ? 313 PHE A N   1 
ATOM   2532  C  CA  . PHE A  1 313 ? -35.308 -8.355  31.640  1.00 28.72  ? 313 PHE A CA  1 
ATOM   2533  C  C   . PHE A  1 313 ? -36.657 -7.694  32.042  1.00 32.27  ? 313 PHE A C   1 
ATOM   2534  O  O   . PHE A  1 313 ? -37.713 -7.985  31.435  1.00 32.96  ? 313 PHE A O   1 
ATOM   2535  C  CB  . PHE A  1 313 ? -35.492 -9.855  31.557  1.00 26.93  ? 313 PHE A CB  1 
ATOM   2536  C  CG  . PHE A  1 313 ? -34.438 -10.554 30.765  1.00 26.27  ? 313 PHE A CG  1 
ATOM   2537  C  CD1 . PHE A  1 313 ? -33.387 -11.209 31.402  1.00 26.11  ? 313 PHE A CD1 1 
ATOM   2538  C  CD2 . PHE A  1 313 ? -34.492 -10.573 29.354  1.00 26.89  ? 313 PHE A CD2 1 
ATOM   2539  C  CE1 . PHE A  1 313 ? -32.411 -11.865 30.663  1.00 24.04  ? 313 PHE A CE1 1 
ATOM   2540  C  CE2 . PHE A  1 313 ? -33.521 -11.225 28.617  1.00 21.65  ? 313 PHE A CE2 1 
ATOM   2541  C  CZ  . PHE A  1 313 ? -32.481 -11.870 29.261  1.00 23.75  ? 313 PHE A CZ  1 
ATOM   2542  N  N   . SER A  1 314 ? -36.623 -6.828  33.052  1.00 30.73  ? 314 SER A N   1 
ATOM   2543  C  CA  . SER A  1 314 ? -37.884 -6.149  33.544  1.00 40.98  ? 314 SER A CA  1 
ATOM   2544  C  C   . SER A  1 314 ? -38.112 -4.792  32.883  1.00 46.95  ? 314 SER A C   1 
ATOM   2545  O  O   . SER A  1 314 ? -37.187 -4.182  32.309  1.00 50.36  ? 314 SER A O   1 
ATOM   2546  C  CB  . SER A  1 314 ? -37.861 -5.999  35.045  1.00 39.00  ? 314 SER A CB  1 
ATOM   2547  O  OG  . SER A  1 314 ? -37.824 -7.253  35.670  1.00 43.37  ? 314 SER A OG  1 
ATOM   2548  O  OXT . SER A  1 314 ? -39.215 -4.271  32.904  1.00 52.44  ? 314 SER A OXT 1 
ATOM   2549  N  N   A MET B  1 1   ? -44.159 -46.831 54.012  0.50 56.17  ? 1   MET B N   1 
ATOM   2550  N  N   B MET B  1 1   ? -44.103 -46.756 54.210  0.50 60.40  ? 1   MET B N   1 
ATOM   2551  C  CA  A MET B  1 1   ? -44.473 -48.185 54.560  0.50 52.99  ? 1   MET B CA  1 
ATOM   2552  C  CA  B MET B  1 1   ? -44.635 -48.027 54.796  0.50 55.46  ? 1   MET B CA  1 
ATOM   2553  C  C   A MET B  1 1   ? -43.238 -49.107 54.572  0.50 48.94  ? 1   MET B C   1 
ATOM   2554  C  C   B MET B  1 1   ? -43.525 -49.057 55.060  0.50 50.83  ? 1   MET B C   1 
ATOM   2555  O  O   A MET B  1 1   ? -43.221 -50.131 53.911  0.50 48.67  ? 1   MET B O   1 
ATOM   2556  O  O   B MET B  1 1   ? -43.774 -50.249 55.061  0.50 50.29  ? 1   MET B O   1 
ATOM   2557  C  CB  A MET B  1 1   ? -45.597 -48.825 53.770  0.50 61.61  ? 1   MET B CB  1 
ATOM   2558  C  CB  B MET B  1 1   ? -45.696 -48.618 53.896  0.50 62.41  ? 1   MET B CB  1 
ATOM   2559  C  CG  A MET B  1 1   ? -45.520 -48.575 52.276  0.50 63.13  ? 1   MET B CG  1 
ATOM   2560  C  CG  B MET B  1 1   ? -45.489 -48.324 52.442  0.50 62.18  ? 1   MET B CG  1 
ATOM   2561  S  SD  A MET B  1 1   ? -45.593 -46.811 51.878  0.50 73.31  ? 1   MET B SD  1 
ATOM   2562  S  SD  B MET B  1 1   ? -45.409 -46.548 52.130  0.50 67.59  ? 1   MET B SD  1 
ATOM   2563  C  CE  A MET B  1 1   ? -45.690 -46.861 50.070  0.50 63.58  ? 1   MET B CE  1 
ATOM   2564  C  CE  B MET B  1 1   ? -45.468 -46.510 50.319  0.50 65.41  ? 1   MET B CE  1 
ATOM   2565  N  N   A ARG B  1 2   ? -42.205 -48.716 55.343  0.50 44.93  ? 2   ARG B N   1 
ATOM   2566  N  N   B ARG B  1 2   ? -42.292 -48.568 55.284  0.50 46.69  ? 2   ARG B N   1 
ATOM   2567  C  CA  A ARG B  1 2   ? -40.993 -49.533 55.477  0.50 40.09  ? 2   ARG B CA  1 
ATOM   2568  C  CA  B ARG B  1 2   ? -41.168 -49.454 55.642  0.50 41.83  ? 2   ARG B CA  1 
ATOM   2569  C  C   A ARG B  1 2   ? -39.834 -48.711 56.147  0.50 40.13  ? 2   ARG B C   1 
ATOM   2570  C  C   B ARG B  1 2   ? -39.913 -48.660 56.231  0.50 41.01  ? 2   ARG B C   1 
ATOM   2571  O  O   A ARG B  1 2   ? -39.133 -49.217 57.030  0.50 40.94  ? 2   ARG B O   1 
ATOM   2572  O  O   B ARG B  1 2   ? -39.222 -49.159 57.129  0.50 41.39  ? 2   ARG B O   1 
ATOM   2573  C  CB  A ARG B  1 2   ? -40.561 -50.070 54.128  0.50 42.55  ? 2   ARG B CB  1 
ATOM   2574  C  CB  B ARG B  1 2   ? -40.773 -50.353 54.466  0.50 43.44  ? 2   ARG B CB  1 
ATOM   2575  C  CG  A ARG B  1 2   ? -40.285 -51.613 54.093  0.50 43.45  ? 2   ARG B CG  1 
ATOM   2576  C  CG  B ARG B  1 2   ? -39.946 -51.565 54.870  0.50 47.33  ? 2   ARG B CG  1 
ATOM   2577  C  CD  A ARG B  1 2   ? -38.887 -51.987 54.629  0.50 49.40  ? 2   ARG B CD  1 
ATOM   2578  C  CD  B ARG B  1 2   ? -38.497 -51.399 54.490  0.50 50.88  ? 2   ARG B CD  1 
ATOM   2579  N  NE  A ARG B  1 2   ? -38.865 -52.174 56.090  0.50 47.51  ? 2   ARG B NE  1 
ATOM   2580  N  NE  B ARG B  1 2   ? -38.213 -52.012 53.197  0.50 52.18  ? 2   ARG B NE  1 
ATOM   2581  C  CZ  A ARG B  1 2   ? -37.883 -52.801 56.748  0.50 45.29  ? 2   ARG B CZ  1 
ATOM   2582  C  CZ  B ARG B  1 2   ? -38.672 -51.558 52.038  0.50 50.28  ? 2   ARG B CZ  1 
ATOM   2583  N  NH1 A ARG B  1 2   ? -36.857 -53.303 56.083  0.50 43.01  ? 2   ARG B NH1 1 
ATOM   2584  N  NH1 B ARG B  1 2   ? -38.361 -52.184 50.908  0.50 48.98  ? 2   ARG B NH1 1 
ATOM   2585  N  NH2 A ARG B  1 2   ? -37.937 -52.927 58.062  0.50 48.69  ? 2   ARG B NH2 1 
ATOM   2586  N  NH2 B ARG B  1 2   ? -39.448 -50.479 52.004  0.50 43.99  ? 2   ARG B NH2 1 
ATOM   2587  N  N   . ILE B  1 3   ? -39.658 -47.442 55.708  1.00 33.76  ? 3   ILE B N   1 
ATOM   2588  C  CA  . ILE B  1 3   ? -38.608 -46.511 56.341  1.00 31.53  ? 3   ILE B CA  1 
ATOM   2589  C  C   . ILE B  1 3   ? -39.276 -45.318 56.975  1.00 30.93  ? 3   ILE B C   1 
ATOM   2590  O  O   . ILE B  1 3   ? -39.880 -44.492 56.275  1.00 34.33  ? 3   ILE B O   1 
ATOM   2591  C  CB  . ILE B  1 3   ? -37.548 -46.008 55.337  1.00 32.59  ? 3   ILE B CB  1 
ATOM   2592  C  CG1 . ILE B  1 3   ? -36.958 -47.144 54.559  1.00 33.10  ? 3   ILE B CG1 1 
ATOM   2593  C  CG2 . ILE B  1 3   ? -36.424 -45.222 56.084  1.00 25.11  ? 3   ILE B CG2 1 
ATOM   2594  C  CD1 . ILE B  1 3   ? -35.952 -46.697 53.536  1.00 33.63  ? 3   ILE B CD1 1 
ATOM   2595  N  N   . PRO B  1 4   ? -39.187 -45.207 58.312  1.00 29.23  ? 4   PRO B N   1 
ATOM   2596  C  CA  . PRO B  1 4   ? -39.819 -44.096 59.011  1.00 28.19  ? 4   PRO B CA  1 
ATOM   2597  C  C   . PRO B  1 4   ? -39.064 -42.795 58.785  1.00 25.11  ? 4   PRO B C   1 
ATOM   2598  O  O   . PRO B  1 4   ? -37.844 -42.805 58.639  1.00 25.96  ? 4   PRO B O   1 
ATOM   2599  C  CB  . PRO B  1 4   ? -39.731 -44.523 60.503  1.00 26.73  ? 4   PRO B CB  1 
ATOM   2600  C  CG  . PRO B  1 4   ? -38.520 -45.380 60.568  1.00 27.55  ? 4   PRO B CG  1 
ATOM   2601  C  CD  . PRO B  1 4   ? -38.488 -46.133 59.246  1.00 28.16  ? 4   PRO B CD  1 
ATOM   2602  N  N   . LEU B  1 5   ? -39.798 -41.686 58.754  1.00 24.83  ? 5   LEU B N   1 
ATOM   2603  C  CA  . LEU B  1 5   ? -39.221 -40.378 58.516  1.00 24.62  ? 5   LEU B CA  1 
ATOM   2604  C  C   . LEU B  1 5   ? -39.660 -39.439 59.568  1.00 24.21  ? 5   LEU B C   1 
ATOM   2605  O  O   . LEU B  1 5   ? -40.748 -39.556 60.086  1.00 28.76  ? 5   LEU B O   1 
ATOM   2606  C  CB  . LEU B  1 5   ? -39.662 -39.832 57.121  1.00 22.86  ? 5   LEU B CB  1 
ATOM   2607  C  CG  . LEU B  1 5   ? -39.337 -40.651 55.882  1.00 23.36  ? 5   LEU B CG  1 
ATOM   2608  C  CD1 . LEU B  1 5   ? -39.890 -39.937 54.589  1.00 21.48  ? 5   LEU B CD1 1 
ATOM   2609  C  CD2 . LEU B  1 5   ? -37.850 -40.889 55.770  1.00 21.20  ? 5   LEU B CD2 1 
ATOM   2610  N  N   . VAL B  1 6   ? -38.826 -38.497 59.890  1.00 24.58  ? 6   VAL B N   1 
ATOM   2611  C  CA  . VAL B  1 6   ? -39.172 -37.520 60.858  1.00 26.52  ? 6   VAL B CA  1 
ATOM   2612  C  C   . VAL B  1 6   ? -40.285 -36.557 60.301  1.00 26.72  ? 6   VAL B C   1 
ATOM   2613  O  O   . VAL B  1 6   ? -40.104 -35.912 59.273  1.00 27.69  ? 6   VAL B O   1 
ATOM   2614  C  CB  . VAL B  1 6   ? -37.965 -36.704 61.290  1.00 26.08  ? 6   VAL B CB  1 
ATOM   2615  C  CG1 . VAL B  1 6   ? -38.370 -35.680 62.370  1.00 26.89  ? 6   VAL B CG1 1 
ATOM   2616  C  CG2 . VAL B  1 6   ? -36.851 -37.625 61.806  1.00 21.98  ? 6   VAL B CG2 1 
ATOM   2617  N  N   . GLY B  1 7   ? -41.416 -36.504 60.996  1.00 28.41  ? 7   GLY B N   1 
ATOM   2618  C  CA  . GLY B  1 7   ? -42.531 -35.576 60.624  1.00 27.84  ? 7   GLY B CA  1 
ATOM   2619  C  C   . GLY B  1 7   ? -43.228 -35.923 59.322  1.00 30.35  ? 7   GLY B C   1 
ATOM   2620  O  O   . GLY B  1 7   ? -43.900 -35.087 58.734  1.00 32.85  ? 7   GLY B O   1 
ATOM   2621  N  N   . LYS B  1 8   ? -43.070 -37.157 58.879  1.00 31.24  ? 8   LYS B N   1 
ATOM   2622  C  CA  . LYS B  1 8   ? -43.709 -37.622 57.627  1.00 32.07  ? 8   LYS B CA  1 
ATOM   2623  C  C   . LYS B  1 8   ? -44.129 -39.011 57.749  1.00 32.71  ? 8   LYS B C   1 
ATOM   2624  O  O   . LYS B  1 8   ? -43.700 -39.710 58.632  1.00 31.68  ? 8   LYS B O   1 
ATOM   2625  C  CB  . LYS B  1 8   ? -42.729 -37.513 56.445  1.00 29.24  ? 8   LYS B CB  1 
ATOM   2626  C  CG  . LYS B  1 8   ? -42.536 -36.149 55.906  1.00 30.54  ? 8   LYS B CG  1 
ATOM   2627  C  CD  . LYS B  1 8   ? -41.648 -36.198 54.635  1.00 27.68  ? 8   LYS B CD  1 
ATOM   2628  C  CE  . LYS B  1 8   ? -41.324 -34.828 54.133  1.00 27.49  ? 8   LYS B CE  1 
ATOM   2629  N  NZ  . LYS B  1 8   ? -40.510 -34.891 52.885  1.00 29.17  ? 8   LYS B NZ  1 
ATOM   2630  N  N   . ASP B  1 9   ? -44.977 -39.446 56.829  1.00 35.18  ? 9   ASP B N   1 
ATOM   2631  C  CA  . ASP B  1 9   ? -45.369 -40.835 56.756  1.00 38.57  ? 9   ASP B CA  1 
ATOM   2632  C  C   . ASP B  1 9   ? -44.216 -41.705 56.218  1.00 38.46  ? 9   ASP B C   1 
ATOM   2633  O  O   . ASP B  1 9   ? -43.360 -41.232 55.462  1.00 36.91  ? 9   ASP B O   1 
ATOM   2634  C  CB  . ASP B  1 9   ? -46.606 -41.001 55.878  1.00 41.96  ? 9   ASP B CB  1 
ATOM   2635  C  CG  . ASP B  1 9   ? -47.846 -40.455 56.522  1.00 46.28  ? 9   ASP B CG  1 
ATOM   2636  O  OD1 . ASP B  1 9   ? -48.757 -40.057 55.798  1.00 50.20  ? 9   ASP B OD1 1 
ATOM   2637  O  OD2 . ASP B  1 9   ? -47.904 -40.421 57.767  1.00 50.69  ? 9   ASP B OD2 1 
ATOM   2638  N  N   . SER B  1 10  ? -44.212 -42.951 56.617  1.00 35.33  ? 10  SER B N   1 
ATOM   2639  C  CA  . SER B  1 10  ? -43.229 -43.881 56.214  1.00 35.37  ? 10  SER B CA  1 
ATOM   2640  C  C   . SER B  1 10  ? -43.129 -44.003 54.631  1.00 36.94  ? 10  SER B C   1 
ATOM   2641  O  O   . SER B  1 10  ? -44.064 -43.726 53.936  1.00 37.58  ? 10  SER B O   1 
ATOM   2642  C  CB  . SER B  1 10  ? -43.542 -45.253 56.827  1.00 35.46  ? 10  SER B CB  1 
ATOM   2643  O  OG  . SER B  1 10  ? -42.592 -46.180 56.474  1.00 58.00  ? 10  SER B OG  1 
ATOM   2644  N  N   . ILE B  1 11  ? -41.962 -44.429 54.134  1.00 36.76  ? 11  ILE B N   1 
ATOM   2645  C  CA  . ILE B  1 11  ? -41.771 -44.634 52.650  1.00 37.27  ? 11  ILE B CA  1 
ATOM   2646  C  C   . ILE B  1 11  ? -41.139 -45.948 52.354  1.00 36.34  ? 11  ILE B C   1 
ATOM   2647  O  O   . ILE B  1 11  ? -40.420 -46.497 53.178  1.00 40.61  ? 11  ILE B O   1 
ATOM   2648  C  CB  . ILE B  1 11  ? -40.895 -43.542 52.028  1.00 36.57  ? 11  ILE B CB  1 
ATOM   2649  C  CG1 . ILE B  1 11  ? -39.492 -43.521 52.709  1.00 34.21  ? 11  ILE B CG1 1 
ATOM   2650  C  CG2 . ILE B  1 11  ? -41.574 -42.198 52.118  1.00 38.65  ? 11  ILE B CG2 1 
ATOM   2651  C  CD1 . ILE B  1 11  ? -38.469 -42.711 51.963  1.00 42.63  ? 11  ILE B CD1 1 
ATOM   2652  N  N   . GLU B  1 12  ? -41.399 -46.467 51.165  1.00 37.30  ? 12  GLU B N   1 
ATOM   2653  C  CA  . GLU B  1 12  ? -40.730 -47.657 50.707  1.00 38.00  ? 12  GLU B CA  1 
ATOM   2654  C  C   . GLU B  1 12  ? -39.316 -47.305 50.344  1.00 38.25  ? 12  GLU B C   1 
ATOM   2655  O  O   . GLU B  1 12  ? -39.032 -46.164 49.918  1.00 38.46  ? 12  GLU B O   1 
ATOM   2656  C  CB  . GLU B  1 12  ? -41.440 -48.244 49.515  1.00 37.57  ? 12  GLU B CB  1 
ATOM   2657  C  CG  . GLU B  1 12  ? -42.884 -48.657 49.793  1.00 44.33  ? 12  GLU B CG  1 
ATOM   2658  C  CD  . GLU B  1 12  ? -43.526 -49.336 48.612  1.00 46.66  ? 12  GLU B CD  1 
ATOM   2659  O  OE1 . GLU B  1 12  ? -44.536 -48.808 48.094  1.00 54.52  ? 12  GLU B OE1 1 
ATOM   2660  O  OE2 . GLU B  1 12  ? -43.018 -50.392 48.186  1.00 48.98  ? 12  GLU B OE2 1 
ATOM   2661  N  N   . SER B  1 13  ? -38.424 -48.250 50.502  1.00 38.87  ? 13  SER B N   1 
ATOM   2662  C  CA  . SER B  1 13  ? -37.008 -48.004 50.283  1.00 41.31  ? 13  SER B CA  1 
ATOM   2663  C  C   . SER B  1 13  ? -36.711 -47.573 48.839  1.00 40.66  ? 13  SER B C   1 
ATOM   2664  O  O   . SER B  1 13  ? -35.755 -46.822 48.587  1.00 39.66  ? 13  SER B O   1 
ATOM   2665  C  CB  . SER B  1 13  ? -36.192 -49.240 50.636  1.00 46.08  ? 13  SER B CB  1 
ATOM   2666  O  OG  . SER B  1 13  ? -36.433 -50.286 49.715  1.00 52.43  ? 13  SER B OG  1 
ATOM   2667  N  N   . LYS B  1 14  ? -37.532 -48.048 47.891  1.00 37.41  ? 14  LYS B N   1 
ATOM   2668  C  CA  . LYS B  1 14  ? -37.324 -47.727 46.472  1.00 36.72  ? 14  LYS B CA  1 
ATOM   2669  C  C   . LYS B  1 14  ? -37.580 -46.257 46.181  1.00 35.19  ? 14  LYS B C   1 
ATOM   2670  O  O   . LYS B  1 14  ? -37.220 -45.766 45.141  1.00 35.43  ? 14  LYS B O   1 
ATOM   2671  C  CB  . LYS B  1 14  ? -38.216 -48.619 45.561  1.00 36.81  ? 14  LYS B CB  1 
ATOM   2672  C  CG  . LYS B  1 14  ? -39.739 -48.474 45.818  1.00 38.23  ? 14  LYS B CG  1 
ATOM   2673  C  CD  . LYS B  1 14  ? -40.563 -49.198 44.721  1.00 40.30  ? 14  LYS B CD  1 
ATOM   2674  C  CE  . LYS B  1 14  ? -42.047 -49.215 45.058  1.00 46.11  ? 14  LYS B CE  1 
ATOM   2675  N  NZ  . LYS B  1 14  ? -42.579 -47.846 45.303  1.00 49.86  ? 14  LYS B NZ  1 
ATOM   2676  N  N   . ASP B  1 15  ? -38.212 -45.563 47.131  1.00 32.83  ? 15  ASP B N   1 
ATOM   2677  C  CA  . ASP B  1 15  ? -38.525 -44.129 46.965  1.00 34.80  ? 15  ASP B CA  1 
ATOM   2678  C  C   . ASP B  1 15  ? -37.560 -43.222 47.740  1.00 34.81  ? 15  ASP B C   1 
ATOM   2679  O  O   . ASP B  1 15  ? -37.755 -42.010 47.804  1.00 36.76  ? 15  ASP B O   1 
ATOM   2680  C  CB  . ASP B  1 15  ? -39.942 -43.850 47.389  1.00 39.08  ? 15  ASP B CB  1 
ATOM   2681  C  CG  . ASP B  1 15  ? -40.933 -44.483 46.501  1.00 42.30  ? 15  ASP B CG  1 
ATOM   2682  O  OD1 . ASP B  1 15  ? -41.969 -44.907 46.992  1.00 45.42  ? 15  ASP B OD1 1 
ATOM   2683  O  OD2 . ASP B  1 15  ? -40.672 -44.570 45.288  1.00 48.87  ? 15  ASP B OD2 1 
ATOM   2684  N  N   . ILE B  1 16  ? -36.528 -43.814 48.317  1.00 32.76  ? 16  ILE B N   1 
ATOM   2685  C  CA  . ILE B  1 16  ? -35.567 -43.068 49.093  1.00 32.14  ? 16  ILE B CA  1 
ATOM   2686  C  C   . ILE B  1 16  ? -34.842 -41.992 48.226  1.00 28.87  ? 16  ILE B C   1 
ATOM   2687  O  O   . ILE B  1 16  ? -34.579 -40.869 48.694  1.00 28.27  ? 16  ILE B O   1 
ATOM   2688  C  CB  . ILE B  1 16  ? -34.520 -44.005 49.765  1.00 36.94  ? 16  ILE B CB  1 
ATOM   2689  C  CG1 . ILE B  1 16  ? -33.754 -43.265 50.837  1.00 39.88  ? 16  ILE B CG1 1 
ATOM   2690  C  CG2 . ILE B  1 16  ? -33.564 -44.600 48.712  1.00 40.05  ? 16  ILE B CG2 1 
ATOM   2691  C  CD1 . ILE B  1 16  ? -32.732 -44.127 51.560  1.00 43.13  ? 16  ILE B CD1 1 
ATOM   2692  N  N   . GLY B  1 17  ? -34.532 -42.350 46.979  1.00 25.76  ? 17  GLY B N   1 
ATOM   2693  C  CA  . GLY B  1 17  ? -33.875 -41.406 46.023  1.00 26.07  ? 17  GLY B CA  1 
ATOM   2694  C  C   . GLY B  1 17  ? -32.419 -41.099 46.389  1.00 26.19  ? 17  GLY B C   1 
ATOM   2695  O  O   . GLY B  1 17  ? -31.786 -41.837 47.163  1.00 24.39  ? 17  GLY B O   1 
ATOM   2696  N  N   . PHE B  1 18  ? -31.889 -40.016 45.830  1.00 26.52  ? 18  PHE B N   1 
ATOM   2697  C  CA  . PHE B  1 18  ? -30.560 -39.617 46.103  1.00 21.99  ? 18  PHE B CA  1 
ATOM   2698  C  C   . PHE B  1 18  ? -30.425 -39.307 47.619  1.00 21.60  ? 18  PHE B C   1 
ATOM   2699  O  O   . PHE B  1 18  ? -31.147 -38.473 48.156  1.00 22.82  ? 18  PHE B O   1 
ATOM   2700  C  CB  . PHE B  1 18  ? -30.193 -38.403 45.281  1.00 21.01  ? 18  PHE B CB  1 
ATOM   2701  C  CG  . PHE B  1 18  ? -28.727 -38.103 45.273  1.00 22.98  ? 18  PHE B CG  1 
ATOM   2702  C  CD1 . PHE B  1 18  ? -27.965 -38.300 44.121  1.00 22.50  ? 18  PHE B CD1 1 
ATOM   2703  C  CD2 . PHE B  1 18  ? -28.084 -37.632 46.433  1.00 22.34  ? 18  PHE B CD2 1 
ATOM   2704  C  CE1 . PHE B  1 18  ? -26.579 -38.018 44.120  1.00 20.99  ? 18  PHE B CE1 1 
ATOM   2705  C  CE2 . PHE B  1 18  ? -26.725 -37.359 46.429  1.00 21.78  ? 18  PHE B CE2 1 
ATOM   2706  C  CZ  . PHE B  1 18  ? -25.973 -37.554 45.265  1.00 22.16  ? 18  PHE B CZ  1 
ATOM   2707  N  N   . THR B  1 19  ? -29.511 -39.983 48.274  1.00 21.95  ? 19  THR B N   1 
ATOM   2708  C  CA  . THR B  1 19  ? -29.427 -39.933 49.737  1.00 22.69  ? 19  THR B CA  1 
ATOM   2709  C  C   . THR B  1 19  ? -28.041 -39.563 50.247  1.00 23.44  ? 19  THR B C   1 
ATOM   2710  O  O   . THR B  1 19  ? -27.014 -40.011 49.695  1.00 22.77  ? 19  THR B O   1 
ATOM   2711  C  CB  . THR B  1 19  ? -29.830 -41.296 50.354  1.00 25.72  ? 19  THR B CB  1 
ATOM   2712  O  OG1 . THR B  1 19  ? -31.173 -41.637 49.946  1.00 27.90  ? 19  THR B OG1 1 
ATOM   2713  C  CG2 . THR B  1 19  ? -29.751 -41.252 51.888  1.00 23.37  ? 19  THR B CG2 1 
ATOM   2714  N  N   . LEU B  1 20  ? -28.004 -38.722 51.303  1.00 22.77  ? 20  LEU B N   1 
ATOM   2715  C  CA  . LEU B  1 20  ? -26.785 -38.521 52.074  1.00 23.74  ? 20  LEU B CA  1 
ATOM   2716  C  C   . LEU B  1 20  ? -26.900 -39.373 53.324  1.00 22.02  ? 20  LEU B C   1 
ATOM   2717  O  O   . LEU B  1 20  ? -27.714 -39.108 54.181  1.00 23.04  ? 20  LEU B O   1 
ATOM   2718  C  CB  . LEU B  1 20  ? -26.583 -37.045 52.424  1.00 23.41  ? 20  LEU B CB  1 
ATOM   2719  C  CG  . LEU B  1 20  ? -26.174 -36.117 51.236  1.00 24.69  ? 20  LEU B CG  1 
ATOM   2720  C  CD1 . LEU B  1 20  ? -25.941 -34.693 51.708  1.00 21.95  ? 20  LEU B CD1 1 
ATOM   2721  C  CD2 . LEU B  1 20  ? -24.926 -36.660 50.496  1.00 23.26  ? 20  LEU B CD2 1 
ATOM   2722  N  N   . ILE B  1 21  ? -26.075 -40.413 53.403  1.00 22.24  ? 21  ILE B N   1 
ATOM   2723  C  CA  . ILE B  1 21  ? -26.249 -41.455 54.400  1.00 22.52  ? 21  ILE B CA  1 
ATOM   2724  C  C   . ILE B  1 21  ? -25.747 -41.068 55.843  1.00 23.71  ? 21  ILE B C   1 
ATOM   2725  O  O   . ILE B  1 21  ? -26.076 -41.730 56.805  1.00 23.16  ? 21  ILE B O   1 
ATOM   2726  C  CB  . ILE B  1 21  ? -25.563 -42.793 53.948  1.00 25.10  ? 21  ILE B CB  1 
ATOM   2727  C  CG1 . ILE B  1 21  ? -26.136 -44.004 54.743  1.00 28.03  ? 21  ILE B CG1 1 
ATOM   2728  C  CG2 . ILE B  1 21  ? -24.065 -42.699 54.081  1.00 21.66  ? 21  ILE B CG2 1 
ATOM   2729  C  CD1 . ILE B  1 21  ? -27.570 -44.370 54.354  1.00 27.70  ? 21  ILE B CD1 1 
ATOM   2730  N  N   . HIS B  1 22  ? -24.969 -39.999 55.944  1.00 22.38  ? 22  HIS B N   1 
ATOM   2731  C  CA  . HIS B  1 22  ? -24.386 -39.608 57.230  1.00 22.68  ? 22  HIS B CA  1 
ATOM   2732  C  C   . HIS B  1 22  ? -24.145 -38.073 57.335  1.00 22.80  ? 22  HIS B C   1 
ATOM   2733  O  O   . HIS B  1 22  ? -23.027 -37.564 57.007  1.00 20.90  ? 22  HIS B O   1 
ATOM   2734  C  CB  . HIS B  1 22  ? -23.075 -40.363 57.477  1.00 21.79  ? 22  HIS B CB  1 
ATOM   2735  C  CG  . HIS B  1 22  ? -22.570 -40.286 58.955  1.00 21.08  ? 22  HIS B CG  1 
ATOM   2736  N  ND1 . HIS B  1 22  ? -22.156 -41.403 59.662  1.00 20.79  ? 22  HIS B ND1 1 
ATOM   2737  C  CD2 . HIS B  1 22  ? -22.438 -39.186 59.843  1.00 21.42  ? 22  HIS B CD2 1 
ATOM   2738  C  CE1 . HIS B  1 22  ? -21.776 -41.033 60.909  1.00 21.42  ? 22  HIS B CE1 1 
ATOM   2739  N  NE2 . HIS B  1 22  ? -21.946 -39.677 61.028  1.00 23.37  ? 22  HIS B NE2 1 
ATOM   2740  N  N   . GLU B  1 23  ? -25.166 -37.350 57.780  1.00 22.04  ? 23  GLU B N   1 
ATOM   2741  C  CA  . GLU B  1 23  ? -25.054 -35.900 58.015  1.00 23.02  ? 23  GLU B CA  1 
ATOM   2742  C  C   . GLU B  1 23  ? -25.734 -35.572 59.289  1.00 24.99  ? 23  GLU B C   1 
ATOM   2743  O  O   . GLU B  1 23  ? -26.746 -36.208 59.646  1.00 30.18  ? 23  GLU B O   1 
ATOM   2744  C  CB  . GLU B  1 23  ? -25.705 -35.100 56.851  1.00 23.08  ? 23  GLU B CB  1 
ATOM   2745  C  CG  . GLU B  1 23  ? -25.284 -35.574 55.411  1.00 23.08  ? 23  GLU B CG  1 
ATOM   2746  C  CD  . GLU B  1 23  ? -23.838 -35.234 55.080  1.00 27.92  ? 23  GLU B CD  1 
ATOM   2747  O  OE1 . GLU B  1 23  ? -23.270 -35.854 54.131  1.00 28.27  ? 23  GLU B OE1 1 
ATOM   2748  O  OE2 . GLU B  1 23  ? -23.262 -34.351 55.762  1.00 27.13  ? 23  GLU B OE2 1 
ATOM   2749  N  N   . HIS B  1 24  ? -25.218 -34.582 60.007  1.00 22.86  ? 24  HIS B N   1 
ATOM   2750  C  CA  . HIS B  1 24  ? -25.842 -34.153 61.288  1.00 25.60  ? 24  HIS B CA  1 
ATOM   2751  C  C   . HIS B  1 24  ? -26.482 -32.781 61.179  1.00 25.44  ? 24  HIS B C   1 
ATOM   2752  O  O   . HIS B  1 24  ? -25.843 -31.820 60.746  1.00 25.01  ? 24  HIS B O   1 
ATOM   2753  C  CB  . HIS B  1 24  ? -24.810 -34.159 62.433  1.00 20.86  ? 24  HIS B CB  1 
ATOM   2754  C  CG  . HIS B  1 24  ? -24.169 -35.530 62.689  1.00 21.26  ? 24  HIS B CG  1 
ATOM   2755  N  ND1 . HIS B  1 24  ? -24.734 -36.464 63.495  1.00 20.36  ? 24  HIS B ND1 1 
ATOM   2756  C  CD2 . HIS B  1 24  ? -22.983 -36.082 62.232  1.00 19.71  ? 24  HIS B CD2 1 
ATOM   2757  C  CE1 . HIS B  1 24  ? -23.953 -37.547 63.531  1.00 20.98  ? 24  HIS B CE1 1 
ATOM   2758  N  NE2 . HIS B  1 24  ? -22.886 -37.320 62.767  1.00 22.33  ? 24  HIS B NE2 1 
ATOM   2759  N  N   . LEU B  1 25  ? -27.754 -32.684 61.577  1.00 29.28  ? 25  LEU B N   1 
ATOM   2760  C  CA  . LEU B  1 25  ? -28.448 -31.366 61.622  1.00 29.16  ? 25  LEU B CA  1 
ATOM   2761  C  C   . LEU B  1 25  ? -27.892 -30.556 62.718  1.00 28.92  ? 25  LEU B C   1 
ATOM   2762  O  O   . LEU B  1 25  ? -27.685 -29.333 62.572  1.00 27.97  ? 25  LEU B O   1 
ATOM   2763  C  CB  . LEU B  1 25  ? -29.948 -31.544 61.822  1.00 26.48  ? 25  LEU B CB  1 
ATOM   2764  C  CG  . LEU B  1 25  ? -30.728 -32.162 60.662  1.00 28.81  ? 25  LEU B CG  1 
ATOM   2765  C  CD1 . LEU B  1 25  ? -32.230 -32.099 60.945  1.00 28.83  ? 25  LEU B CD1 1 
ATOM   2766  C  CD2 . LEU B  1 25  ? -30.399 -31.452 59.364  1.00 26.11  ? 25  LEU B CD2 1 
ATOM   2767  N  N   . ARG B  1 26  ? -27.632 -31.208 63.841  1.00 27.22  ? 26  ARG B N   1 
ATOM   2768  C  CA  . ARG B  1 26  ? -27.067 -30.539 65.014  1.00 27.82  ? 26  ARG B CA  1 
ATOM   2769  C  C   . ARG B  1 26  ? -26.478 -31.557 65.973  1.00 29.78  ? 26  ARG B C   1 
ATOM   2770  O  O   . ARG B  1 26  ? -27.057 -32.619 66.194  1.00 30.63  ? 26  ARG B O   1 
ATOM   2771  C  CB  . ARG B  1 26  ? -28.132 -29.726 65.725  1.00 27.29  ? 26  ARG B CB  1 
ATOM   2772  C  CG  . ARG B  1 26  ? -27.609 -28.921 66.884  1.00 27.44  ? 26  ARG B CG  1 
ATOM   2773  C  CD  . ARG B  1 26  ? -28.688 -28.128 67.523  1.00 27.39  ? 26  ARG B CD  1 
ATOM   2774  N  NE  . ARG B  1 26  ? -29.733 -28.986 68.104  1.00 29.25  ? 26  ARG B NE  1 
ATOM   2775  C  CZ  . ARG B  1 26  ? -30.785 -28.527 68.785  1.00 28.03  ? 26  ARG B CZ  1 
ATOM   2776  N  NH1 . ARG B  1 26  ? -31.680 -29.371 69.277  1.00 24.30  ? 26  ARG B NH1 1 
ATOM   2777  N  NH2 . ARG B  1 26  ? -30.936 -27.222 68.972  1.00 27.02  ? 26  ARG B NH2 1 
ATOM   2778  N  N   . VAL B  1 27  ? -25.322 -31.224 66.547  1.00 28.18  ? 27  VAL B N   1 
ATOM   2779  C  CA  . VAL B  1 27  ? -24.664 -32.077 67.491  1.00 26.91  ? 27  VAL B CA  1 
ATOM   2780  C  C   . VAL B  1 27  ? -24.267 -31.293 68.750  1.00 29.00  ? 27  VAL B C   1 
ATOM   2781  O  O   . VAL B  1 27  ? -23.705 -30.206 68.657  1.00 29.90  ? 27  VAL B O   1 
ATOM   2782  C  CB  . VAL B  1 27  ? -23.389 -32.711 66.884  1.00 30.39  ? 27  VAL B CB  1 
ATOM   2783  C  CG1 . VAL B  1 27  ? -22.535 -33.313 67.970  1.00 28.25  ? 27  VAL B CG1 1 
ATOM   2784  C  CG2 . VAL B  1 27  ? -23.761 -33.770 65.843  1.00 29.19  ? 27  VAL B CG2 1 
ATOM   2785  N  N   . PHE B  1 28  ? -24.568 -31.861 69.936  1.00 27.30  ? 28  PHE B N   1 
ATOM   2786  C  CA  . PHE B  1 28  ? -24.132 -31.252 71.216  1.00 25.66  ? 28  PHE B CA  1 
ATOM   2787  C  C   . PHE B  1 28  ? -24.103 -32.281 72.364  1.00 25.98  ? 28  PHE B C   1 
ATOM   2788  O  O   . PHE B  1 28  ? -24.720 -33.345 72.276  1.00 25.74  ? 28  PHE B O   1 
ATOM   2789  C  CB  . PHE B  1 28  ? -25.029 -30.077 71.592  1.00 24.07  ? 28  PHE B CB  1 
ATOM   2790  C  CG  . PHE B  1 28  ? -26.421 -30.458 71.845  1.00 24.33  ? 28  PHE B CG  1 
ATOM   2791  C  CD1 . PHE B  1 28  ? -26.795 -30.997 73.066  1.00 23.43  ? 28  PHE B CD1 1 
ATOM   2792  C  CD2 . PHE B  1 28  ? -27.394 -30.295 70.859  1.00 24.23  ? 28  PHE B CD2 1 
ATOM   2793  C  CE1 . PHE B  1 28  ? -28.119 -31.368 73.309  1.00 22.24  ? 28  PHE B CE1 1 
ATOM   2794  C  CE2 . PHE B  1 28  ? -28.719 -30.663 71.098  1.00 23.09  ? 28  PHE B CE2 1 
ATOM   2795  C  CZ  . PHE B  1 28  ? -29.075 -31.197 72.328  1.00 25.43  ? 28  PHE B CZ  1 
ATOM   2796  N  N   . SER B  1 29  ? -23.377 -31.943 73.435  1.00 25.37  ? 29  SER B N   1 
ATOM   2797  C  CA  . SER B  1 29  ? -23.322 -32.761 74.600  1.00 28.96  ? 29  SER B CA  1 
ATOM   2798  C  C   . SER B  1 29  ? -24.567 -32.519 75.458  1.00 28.88  ? 29  SER B C   1 
ATOM   2799  O  O   . SER B  1 29  ? -24.772 -31.432 75.951  1.00 30.76  ? 29  SER B O   1 
ATOM   2800  C  CB  . SER B  1 29  ? -22.067 -32.445 75.406  1.00 34.06  ? 29  SER B CB  1 
ATOM   2801  O  OG  . SER B  1 29  ? -20.887 -32.560 74.594  1.00 35.22  ? 29  SER B OG  1 
ATOM   2802  N  N   . GLU B  1 30  ? -25.399 -33.562 75.617  1.00 26.25  ? 30  GLU B N   1 
ATOM   2803  C  CA  . GLU B  1 30  ? -26.643 -33.447 76.393  1.00 27.52  ? 30  GLU B CA  1 
ATOM   2804  C  C   . GLU B  1 30  ? -26.427 -32.762 77.734  1.00 28.65  ? 30  GLU B C   1 
ATOM   2805  O  O   . GLU B  1 30  ? -27.109 -31.824 78.063  1.00 31.88  ? 30  GLU B O   1 
ATOM   2806  C  CB  . GLU B  1 30  ? -27.300 -34.848 76.618  1.00 28.82  ? 30  GLU B CB  1 
ATOM   2807  C  CG  . GLU B  1 30  ? -27.973 -35.455 75.377  1.00 30.59  ? 30  GLU B CG  1 
ATOM   2808  C  CD  . GLU B  1 30  ? -27.044 -36.313 74.568  1.00 31.16  ? 30  GLU B CD  1 
ATOM   2809  O  OE1 . GLU B  1 30  ? -25.819 -36.210 74.756  1.00 31.76  ? 30  GLU B OE1 1 
ATOM   2810  O  OE2 . GLU B  1 30  ? -27.534 -37.093 73.749  1.00 29.70  ? 30  GLU B OE2 1 
ATOM   2811  N  N   . ALA B  1 31  ? -25.462 -33.252 78.495  1.00 27.87  ? 31  ALA B N   1 
ATOM   2812  C  CA  . ALA B  1 31  ? -25.205 -32.731 79.860  1.00 29.47  ? 31  ALA B CA  1 
ATOM   2813  C  C   . ALA B  1 31  ? -24.814 -31.265 79.856  1.00 29.07  ? 31  ALA B C   1 
ATOM   2814  O  O   . ALA B  1 31  ? -25.288 -30.471 80.700  1.00 26.66  ? 31  ALA B O   1 
ATOM   2815  C  CB  . ALA B  1 31  ? -24.139 -33.568 80.557  1.00 27.31  ? 31  ALA B CB  1 
ATOM   2816  N  N   . VAL B  1 32  ? -23.969 -30.894 78.931  1.00 31.30  ? 32  VAL B N   1 
ATOM   2817  C  CA  . VAL B  1 32  ? -23.506 -29.547 78.852  1.00 29.75  ? 32  VAL B CA  1 
ATOM   2818  C  C   . VAL B  1 32  ? -24.645 -28.583 78.535  1.00 30.70  ? 32  VAL B C   1 
ATOM   2819  O  O   . VAL B  1 32  ? -24.817 -27.565 79.216  1.00 30.86  ? 32  VAL B O   1 
ATOM   2820  C  CB  . VAL B  1 32  ? -22.405 -29.390 77.802  1.00 29.82  ? 32  VAL B CB  1 
ATOM   2821  C  CG1 . VAL B  1 32  ? -22.031 -27.925 77.653  1.00 30.18  ? 32  VAL B CG1 1 
ATOM   2822  C  CG2 . VAL B  1 32  ? -21.187 -30.219 78.187  1.00 26.80  ? 32  VAL B CG2 1 
ATOM   2823  N  N   . ARG B  1 33  ? -25.424 -28.899 77.504  1.00 29.60  ? 33  ARG B N   1 
ATOM   2824  C  CA  . ARG B  1 33  ? -26.529 -28.013 77.091  1.00 29.79  ? 33  ARG B CA  1 
ATOM   2825  C  C   . ARG B  1 33  ? -27.575 -27.867 78.202  1.00 28.72  ? 33  ARG B C   1 
ATOM   2826  O  O   . ARG B  1 33  ? -28.136 -26.790 78.406  1.00 26.64  ? 33  ARG B O   1 
ATOM   2827  C  CB  . ARG B  1 33  ? -27.185 -28.514 75.812  1.00 28.78  ? 33  ARG B CB  1 
ATOM   2828  C  CG  . ARG B  1 33  ? -28.039 -27.473 75.132  1.00 34.00  ? 33  ARG B CG  1 
ATOM   2829  C  CD  . ARG B  1 33  ? -28.677 -28.001 73.872  1.00 36.70  ? 33  ARG B CD  1 
ATOM   2830  N  NE  . ARG B  1 33  ? -29.503 -26.978 73.206  1.00 36.67  ? 33  ARG B NE  1 
ATOM   2831  C  CZ  . ARG B  1 33  ? -29.201 -26.414 72.031  1.00 37.93  ? 33  ARG B CZ  1 
ATOM   2832  N  NH1 . ARG B  1 33  ? -28.096 -26.776 71.378  1.00 34.91  ? 33  ARG B NH1 1 
ATOM   2833  N  NH2 . ARG B  1 33  ? -30.014 -25.490 71.503  1.00 35.89  ? 33  ARG B NH2 1 
ATOM   2834  N  N   . GLN B  1 34  ? -27.824 -28.940 78.902  1.00 27.86  ? 34  GLN B N   1 
ATOM   2835  C  CA  . GLN B  1 34  ? -28.808 -28.938 79.961  1.00 30.01  ? 34  GLN B CA  1 
ATOM   2836  C  C   . GLN B  1 34  ? -28.350 -28.096 81.178  1.00 28.23  ? 34  GLN B C   1 
ATOM   2837  O  O   . GLN B  1 34  ? -29.152 -27.468 81.830  1.00 29.13  ? 34  GLN B O   1 
ATOM   2838  C  CB  . GLN B  1 34  ? -29.140 -30.395 80.403  1.00 29.14  ? 34  GLN B CB  1 
ATOM   2839  C  CG  . GLN B  1 34  ? -30.268 -30.487 81.399  1.00 37.82  ? 34  GLN B CG  1 
ATOM   2840  C  CD  . GLN B  1 34  ? -30.701 -31.933 81.676  1.00 42.45  ? 34  GLN B CD  1 
ATOM   2841  O  OE1 . GLN B  1 34  ? -30.451 -32.840 80.872  1.00 39.21  ? 34  GLN B OE1 1 
ATOM   2842  N  NE2 . GLN B  1 34  ? -31.350 -32.143 82.809  1.00 49.97  ? 34  GLN B NE2 1 
ATOM   2843  N  N   . GLN B  1 35  ? -27.041 -28.102 81.454  1.00 28.41  ? 35  GLN B N   1 
ATOM   2844  C  CA  . GLN B  1 35  ? -26.506 -27.406 82.645  1.00 29.18  ? 35  GLN B CA  1 
ATOM   2845  C  C   . GLN B  1 35  ? -26.143 -25.948 82.375  1.00 30.73  ? 35  GLN B C   1 
ATOM   2846  O  O   . GLN B  1 35  ? -26.170 -25.102 83.298  1.00 29.00  ? 35  GLN B O   1 
ATOM   2847  C  CB  . GLN B  1 35  ? -25.306 -28.166 83.222  1.00 29.99  ? 35  GLN B CB  1 
ATOM   2848  C  CG  . GLN B  1 35  ? -25.677 -29.546 83.802  1.00 32.98  ? 35  GLN B CG  1 
ATOM   2849  C  CD  . GLN B  1 35  ? -26.847 -29.466 84.809  1.00 33.72  ? 35  GLN B CD  1 
ATOM   2850  O  OE1 . GLN B  1 35  ? -27.054 -28.430 85.462  1.00 33.82  ? 35  GLN B OE1 1 
ATOM   2851  N  NE2 . GLN B  1 35  ? -27.619 -30.575 84.933  1.00 28.35  ? 35  GLN B NE2 1 
ATOM   2852  N  N   . TRP B  1 36  ? -25.814 -25.643 81.117  1.00 30.57  ? 36  TRP B N   1 
ATOM   2853  C  CA  . TRP B  1 36  ? -25.419 -24.282 80.730  1.00 30.68  ? 36  TRP B CA  1 
ATOM   2854  C  C   . TRP B  1 36  ? -26.016 -23.897 79.439  1.00 29.67  ? 36  TRP B C   1 
ATOM   2855  O  O   . TRP B  1 36  ? -25.325 -23.812 78.436  1.00 27.49  ? 36  TRP B O   1 
ATOM   2856  C  CB  . TRP B  1 36  ? -23.880 -24.163 80.674  1.00 28.73  ? 36  TRP B CB  1 
ATOM   2857  C  CG  . TRP B  1 36  ? -23.239 -24.451 81.994  1.00 31.37  ? 36  TRP B CG  1 
ATOM   2858  C  CD1 . TRP B  1 36  ? -23.205 -23.616 83.108  1.00 28.74  ? 36  TRP B CD1 1 
ATOM   2859  C  CD2 . TRP B  1 36  ? -22.538 -25.667 82.379  1.00 29.00  ? 36  TRP B CD2 1 
ATOM   2860  N  NE1 . TRP B  1 36  ? -22.527 -24.234 84.149  1.00 30.06  ? 36  TRP B NE1 1 
ATOM   2861  C  CE2 . TRP B  1 36  ? -22.105 -25.492 83.738  1.00 30.73  ? 36  TRP B CE2 1 
ATOM   2862  C  CE3 . TRP B  1 36  ? -22.238 -26.858 81.726  1.00 31.11  ? 36  TRP B CE3 1 
ATOM   2863  C  CZ2 . TRP B  1 36  ? -21.399 -26.468 84.424  1.00 31.08  ? 36  TRP B CZ2 1 
ATOM   2864  C  CZ3 . TRP B  1 36  ? -21.517 -27.850 82.425  1.00 32.23  ? 36  TRP B CZ3 1 
ATOM   2865  C  CH2 . TRP B  1 36  ? -21.111 -27.651 83.744  1.00 31.58  ? 36  TRP B CH2 1 
ATOM   2866  N  N   . PRO B  1 37  ? -27.332 -23.659 79.435  1.00 32.33  ? 37  PRO B N   1 
ATOM   2867  C  CA  . PRO B  1 37  ? -28.057 -23.278 78.211  1.00 32.83  ? 37  PRO B CA  1 
ATOM   2868  C  C   . PRO B  1 37  ? -27.526 -21.950 77.573  1.00 33.75  ? 37  PRO B C   1 
ATOM   2869  O  O   . PRO B  1 37  ? -27.757 -21.701 76.392  1.00 34.51  ? 37  PRO B O   1 
ATOM   2870  C  CB  . PRO B  1 37  ? -29.506 -23.101 78.699  1.00 31.47  ? 37  PRO B CB  1 
ATOM   2871  C  CG  . PRO B  1 37  ? -29.396 -22.984 80.211  1.00 33.38  ? 37  PRO B CG  1 
ATOM   2872  C  CD  . PRO B  1 37  ? -28.233 -23.805 80.590  1.00 30.86  ? 37  PRO B CD  1 
ATOM   2873  N  N   . HIS B  1 38  ? -26.820 -21.136 78.362  1.00 32.91  ? 38  HIS B N   1 
ATOM   2874  C  CA  . HIS B  1 38  ? -26.301 -19.831 77.858  1.00 35.88  ? 38  HIS B CA  1 
ATOM   2875  C  C   . HIS B  1 38  ? -25.273 -20.006 76.777  1.00 35.10  ? 38  HIS B C   1 
ATOM   2876  O  O   . HIS B  1 38  ? -25.002 -19.094 76.023  1.00 34.96  ? 38  HIS B O   1 
ATOM   2877  C  CB  . HIS B  1 38  ? -25.737 -18.953 79.026  1.00 35.01  ? 38  HIS B CB  1 
ATOM   2878  C  CG  . HIS B  1 38  ? -24.358 -19.399 79.535  1.00 33.92  ? 38  HIS B CG  1 
ATOM   2879  N  ND1 . HIS B  1 38  ? -24.198 -20.353 80.526  1.00 35.81  ? 38  HIS B ND1 1 
ATOM   2880  C  CD2 . HIS B  1 38  ? -23.059 -18.987 79.174  1.00 34.16  ? 38  HIS B CD2 1 
ATOM   2881  C  CE1 . HIS B  1 38  ? -22.869 -20.532 80.768  1.00 34.94  ? 38  HIS B CE1 1 
ATOM   2882  N  NE2 . HIS B  1 38  ? -22.171 -19.706 79.951  1.00 35.93  ? 38  HIS B NE2 1 
ATOM   2883  N  N   . LEU B  1 39  ? -24.704 -21.193 76.698  1.00 37.04  ? 39  LEU B N   1 
ATOM   2884  C  CA  . LEU B  1 39  ? -23.689 -21.494 75.674  1.00 35.42  ? 39  LEU B CA  1 
ATOM   2885  C  C   . LEU B  1 39  ? -24.310 -21.740 74.284  1.00 36.36  ? 39  LEU B C   1 
ATOM   2886  O  O   . LEU B  1 39  ? -23.585 -21.807 73.266  1.00 32.24  ? 39  LEU B O   1 
ATOM   2887  C  CB  . LEU B  1 39  ? -22.882 -22.704 76.077  1.00 33.90  ? 39  LEU B CB  1 
ATOM   2888  C  CG  . LEU B  1 39  ? -21.944 -22.543 77.251  1.00 35.92  ? 39  LEU B CG  1 
ATOM   2889  C  CD1 . LEU B  1 39  ? -21.338 -23.890 77.627  1.00 34.41  ? 39  LEU B CD1 1 
ATOM   2890  C  CD2 . LEU B  1 39  ? -20.853 -21.525 76.934  1.00 32.95  ? 39  LEU B CD2 1 
ATOM   2891  N  N   . TYR B  1 40  ? -25.634 -21.870 74.236  1.00 33.66  ? 40  TYR B N   1 
ATOM   2892  C  CA  . TYR B  1 40  ? -26.299 -22.322 73.011  1.00 35.62  ? 40  TYR B CA  1 
ATOM   2893  C  C   . TYR B  1 40  ? -27.303 -21.328 72.455  1.00 39.76  ? 40  TYR B C   1 
ATOM   2894  O  O   . TYR B  1 40  ? -27.917 -20.574 73.192  1.00 36.14  ? 40  TYR B O   1 
ATOM   2895  C  CB  . TYR B  1 40  ? -26.961 -23.682 73.244  1.00 33.63  ? 40  TYR B CB  1 
ATOM   2896  C  CG  . TYR B  1 40  ? -25.972 -24.768 73.587  1.00 34.37  ? 40  TYR B CG  1 
ATOM   2897  C  CD1 . TYR B  1 40  ? -25.586 -25.004 74.929  1.00 33.82  ? 40  TYR B CD1 1 
ATOM   2898  C  CD2 . TYR B  1 40  ? -25.400 -25.562 72.585  1.00 31.33  ? 40  TYR B CD2 1 
ATOM   2899  C  CE1 . TYR B  1 40  ? -24.669 -26.001 75.249  1.00 33.67  ? 40  TYR B CE1 1 
ATOM   2900  C  CE2 . TYR B  1 40  ? -24.485 -26.559 72.891  1.00 34.75  ? 40  TYR B CE2 1 
ATOM   2901  C  CZ  . TYR B  1 40  ? -24.117 -26.780 74.228  1.00 36.94  ? 40  TYR B CZ  1 
ATOM   2902  O  OH  . TYR B  1 40  ? -23.205 -27.772 74.534  1.00 36.60  ? 40  TYR B OH  1 
ATOM   2903  N  N   . ASN B  1 41  ? -27.463 -21.353 71.113  1.00 40.38  ? 41  ASN B N   1 
ATOM   2904  C  CA  . ASN B  1 41  ? -28.348 -20.447 70.418  1.00 39.64  ? 41  ASN B CA  1 
ATOM   2905  C  C   . ASN B  1 41  ? -29.214 -21.200 69.408  1.00 37.02  ? 41  ASN B C   1 
ATOM   2906  O  O   . ASN B  1 41  ? -28.830 -21.371 68.259  1.00 35.96  ? 41  ASN B O   1 
ATOM   2907  C  CB  . ASN B  1 41  ? -27.535 -19.366 69.710  1.00 39.33  ? 41  ASN B CB  1 
ATOM   2908  C  CG  . ASN B  1 41  ? -28.403 -18.277 69.113  1.00 43.44  ? 41  ASN B CG  1 
ATOM   2909  O  OD1 . ASN B  1 41  ? -29.618 -18.451 68.938  1.00 44.47  ? 41  ASN B OD1 1 
ATOM   2910  N  ND2 . ASN B  1 41  ? -27.793 -17.153 68.795  1.00 45.89  ? 41  ASN B ND2 1 
ATOM   2911  N  N   . GLU B  1 42  ? -30.379 -21.639 69.850  1.00 36.36  ? 42  GLU B N   1 
ATOM   2912  C  CA  . GLU B  1 42  ? -31.225 -22.499 69.042  1.00 36.78  ? 42  GLU B CA  1 
ATOM   2913  C  C   . GLU B  1 42  ? -31.634 -21.860 67.711  1.00 37.47  ? 42  GLU B C   1 
ATOM   2914  O  O   . GLU B  1 42  ? -31.810 -22.555 66.719  1.00 34.24  ? 42  GLU B O   1 
ATOM   2915  C  CB  . GLU B  1 42  ? -32.466 -22.925 69.822  1.00 42.85  ? 42  GLU B CB  1 
ATOM   2916  C  CG  . GLU B  1 42  ? -33.201 -24.106 69.194  1.00 52.92  ? 42  GLU B CG  1 
ATOM   2917  C  CD  . GLU B  1 42  ? -34.478 -24.441 69.904  1.00 67.33  ? 42  GLU B CD  1 
ATOM   2918  O  OE1 . GLU B  1 42  ? -35.162 -25.393 69.473  1.00 74.62  ? 42  GLU B OE1 1 
ATOM   2919  O  OE2 . GLU B  1 42  ? -34.811 -23.753 70.903  1.00 77.49  ? 42  GLU B OE2 1 
ATOM   2920  N  N   . ASP B  1 43  ? -31.787 -20.522 67.706  1.00 38.33  ? 43  ASP B N   1 
ATOM   2921  C  CA  . ASP B  1 43  ? -32.180 -19.790 66.477  1.00 39.05  ? 43  ASP B CA  1 
ATOM   2922  C  C   . ASP B  1 43  ? -31.113 -19.875 65.413  1.00 36.99  ? 43  ASP B C   1 
ATOM   2923  O  O   . ASP B  1 43  ? -31.398 -20.197 64.264  1.00 36.82  ? 43  ASP B O   1 
ATOM   2924  C  CB  . ASP B  1 43  ? -32.503 -18.330 66.793  1.00 44.61  ? 43  ASP B CB  1 
ATOM   2925  C  CG  . ASP B  1 43  ? -33.815 -18.174 67.543  1.00 50.42  ? 43  ASP B CG  1 
ATOM   2926  O  OD1 . ASP B  1 43  ? -34.531 -19.191 67.719  1.00 51.54  ? 43  ASP B OD1 1 
ATOM   2927  O  OD2 . ASP B  1 43  ? -34.133 -17.044 67.953  1.00 62.92  ? 43  ASP B OD2 1 
ATOM   2928  N  N   . GLU B  1 44  ? -29.886 -19.590 65.790  1.00 34.81  ? 44  GLU B N   1 
ATOM   2929  C  CA  . GLU B  1 44  ? -28.814 -19.690 64.897  1.00 38.04  ? 44  GLU B CA  1 
ATOM   2930  C  C   . GLU B  1 44  ? -28.648 -21.165 64.417  1.00 35.62  ? 44  GLU B C   1 
ATOM   2931  O  O   . GLU B  1 44  ? -28.369 -21.420 63.234  1.00 33.10  ? 44  GLU B O   1 
ATOM   2932  C  CB  . GLU B  1 44  ? -27.522 -19.196 65.547  1.00 47.11  ? 44  GLU B CB  1 
ATOM   2933  C  CG  . GLU B  1 44  ? -26.374 -19.016 64.566  1.00 63.60  ? 44  GLU B CG  1 
ATOM   2934  C  CD  . GLU B  1 44  ? -25.142 -18.414 65.209  1.00 81.01  ? 44  GLU B CD  1 
ATOM   2935  O  OE1 . GLU B  1 44  ? -24.313 -17.816 64.472  1.00 92.96  ? 44  GLU B OE1 1 
ATOM   2936  O  OE2 . GLU B  1 44  ? -24.995 -18.531 66.451  1.00 81.81  ? 44  GLU B OE2 1 
ATOM   2937  N  N   . GLU B  1 45  ? -28.826 -22.114 65.339  1.00 30.24  ? 45  GLU B N   1 
ATOM   2938  C  CA  . GLU B  1 45  ? -28.723 -23.561 64.988  1.00 29.70  ? 45  GLU B CA  1 
ATOM   2939  C  C   . GLU B  1 45  ? -29.771 -23.942 63.959  1.00 28.02  ? 45  GLU B C   1 
ATOM   2940  O  O   . GLU B  1 45  ? -29.465 -24.581 62.956  1.00 23.66  ? 45  GLU B O   1 
ATOM   2941  C  CB  . GLU B  1 45  ? -28.861 -24.443 66.248  1.00 30.07  ? 45  GLU B CB  1 
ATOM   2942  C  CG  . GLU B  1 45  ? -27.676 -24.341 67.208  1.00 32.81  ? 45  GLU B CG  1 
ATOM   2943  C  CD  . GLU B  1 45  ? -28.003 -24.861 68.622  1.00 35.98  ? 45  GLU B CD  1 
ATOM   2944  O  OE1 . GLU B  1 45  ? -29.205 -25.207 68.892  1.00 34.90  ? 45  GLU B OE1 1 
ATOM   2945  O  OE2 . GLU B  1 45  ? -27.084 -24.919 69.452  1.00 42.52  ? 45  GLU B OE2 1 
ATOM   2946  N  N   . PHE B  1 46  ? -31.021 -23.539 64.217  1.00 29.42  ? 46  PHE B N   1 
ATOM   2947  C  CA  . PHE B  1 46  ? -32.092 -23.789 63.316  1.00 32.26  ? 46  PHE B CA  1 
ATOM   2948  C  C   . PHE B  1 46  ? -31.777 -23.196 61.898  1.00 35.09  ? 46  PHE B C   1 
ATOM   2949  O  O   . PHE B  1 46  ? -31.893 -23.899 60.876  1.00 36.43  ? 46  PHE B O   1 
ATOM   2950  C  CB  . PHE B  1 46  ? -33.393 -23.198 63.869  1.00 35.10  ? 46  PHE B CB  1 
ATOM   2951  C  CG  . PHE B  1 46  ? -34.581 -23.416 62.992  1.00 35.67  ? 46  PHE B CG  1 
ATOM   2952  C  CD1 . PHE B  1 46  ? -35.191 -22.348 62.350  1.00 36.12  ? 46  PHE B CD1 1 
ATOM   2953  C  CD2 . PHE B  1 46  ? -35.105 -24.693 62.808  1.00 36.72  ? 46  PHE B CD2 1 
ATOM   2954  C  CE1 . PHE B  1 46  ? -36.305 -22.548 61.534  1.00 37.91  ? 46  PHE B CE1 1 
ATOM   2955  C  CE2 . PHE B  1 46  ? -36.222 -24.895 61.989  1.00 35.04  ? 46  PHE B CE2 1 
ATOM   2956  C  CZ  . PHE B  1 46  ? -36.814 -23.825 61.357  1.00 36.20  ? 46  PHE B CZ  1 
ATOM   2957  N  N   . ARG B  1 47  ? -31.369 -21.911 61.861  1.00 37.34  ? 47  ARG B N   1 
ATOM   2958  C  CA  . ARG B  1 47  ? -31.060 -21.222 60.568  1.00 36.71  ? 47  ARG B CA  1 
ATOM   2959  C  C   . ARG B  1 47  ? -29.974 -21.922 59.800  1.00 35.00  ? 47  ARG B C   1 
ATOM   2960  O  O   . ARG B  1 47  ? -30.083 -22.109 58.598  1.00 32.64  ? 47  ARG B O   1 
ATOM   2961  C  CB  . ARG B  1 47  ? -30.663 -19.768 60.802  1.00 43.74  ? 47  ARG B CB  1 
ATOM   2962  C  CG  . ARG B  1 47  ? -31.786 -18.868 61.269  1.00 53.18  ? 47  ARG B CG  1 
ATOM   2963  C  CD  . ARG B  1 47  ? -31.416 -17.388 61.058  1.00 60.51  ? 47  ARG B CD  1 
ATOM   2964  N  NE  . ARG B  1 47  ? -29.997 -17.130 61.373  1.00 66.71  ? 47  ARG B NE  1 
ATOM   2965  C  CZ  . ARG B  1 47  ? -29.550 -16.719 62.567  1.00 72.29  ? 47  ARG B CZ  1 
ATOM   2966  N  NH1 . ARG B  1 47  ? -30.410 -16.510 63.571  1.00 61.11  ? 47  ARG B NH1 1 
ATOM   2967  N  NH2 . ARG B  1 47  ? -28.236 -16.513 62.759  1.00 72.98  ? 47  ARG B NH2 1 
ATOM   2968  N  N   . ASN B  1 48  ? -28.907 -22.304 60.493  1.00 33.47  ? 48  ASN B N   1 
ATOM   2969  C  CA  . ASN B  1 48  ? -27.808 -23.001 59.850  1.00 35.00  ? 48  ASN B CA  1 
ATOM   2970  C  C   . ASN B  1 48  ? -28.259 -24.338 59.225  1.00 34.42  ? 48  ASN B C   1 
ATOM   2971  O  O   . ASN B  1 48  ? -27.912 -24.649 58.078  1.00 32.32  ? 48  ASN B O   1 
ATOM   2972  C  CB  . ASN B  1 48  ? -26.659 -23.230 60.831  1.00 42.02  ? 48  ASN B CB  1 
ATOM   2973  C  CG  . ASN B  1 48  ? -25.932 -21.942 61.193  1.00 46.27  ? 48  ASN B CG  1 
ATOM   2974  O  OD1 . ASN B  1 48  ? -26.000 -20.970 60.476  1.00 54.76  ? 48  ASN B OD1 1 
ATOM   2975  N  ND2 . ASN B  1 48  ? -25.234 -21.952 62.318  1.00 48.75  ? 48  ASN B ND2 1 
ATOM   2976  N  N   . ALA B  1 49  ? -29.038 -25.114 59.980  1.00 30.23  ? 49  ALA B N   1 
ATOM   2977  C  CA  . ALA B  1 49  ? -29.513 -26.415 59.495  1.00 30.53  ? 49  ALA B CA  1 
ATOM   2978  C  C   . ALA B  1 49  ? -30.493 -26.253 58.299  1.00 29.40  ? 49  ALA B C   1 
ATOM   2979  O  O   . ALA B  1 49  ? -30.373 -26.958 57.277  1.00 28.14  ? 49  ALA B O   1 
ATOM   2980  C  CB  . ALA B  1 49  ? -30.156 -27.203 60.616  1.00 26.54  ? 49  ALA B CB  1 
ATOM   2981  N  N   . VAL B  1 50  ? -31.440 -25.331 58.432  1.00 31.01  ? 50  VAL B N   1 
ATOM   2982  C  CA  . VAL B  1 50  ? -32.408 -25.083 57.376  1.00 29.47  ? 50  VAL B CA  1 
ATOM   2983  C  C   . VAL B  1 50  ? -31.709 -24.713 56.069  1.00 30.68  ? 50  VAL B C   1 
ATOM   2984  O  O   . VAL B  1 50  ? -32.021 -25.253 55.021  1.00 28.11  ? 50  VAL B O   1 
ATOM   2985  C  CB  . VAL B  1 50  ? -33.396 -23.981 57.760  1.00 29.73  ? 50  VAL B CB  1 
ATOM   2986  C  CG1 . VAL B  1 50  ? -34.140 -23.457 56.507  1.00 28.26  ? 50  VAL B CG1 1 
ATOM   2987  C  CG2 . VAL B  1 50  ? -34.380 -24.496 58.798  1.00 29.27  ? 50  VAL B CG2 1 
ATOM   2988  N  N   . ASN B  1 51  ? -30.747 -23.791 56.154  1.00 31.22  ? 51  ASN B N   1 
ATOM   2989  C  CA  . ASN B  1 51  ? -30.018 -23.310 54.954  1.00 35.87  ? 51  ASN B CA  1 
ATOM   2990  C  C   . ASN B  1 51  ? -29.159 -24.387 54.276  1.00 35.68  ? 51  ASN B C   1 
ATOM   2991  O  O   . ASN B  1 51  ? -29.112 -24.465 53.064  1.00 34.74  ? 51  ASN B O   1 
ATOM   2992  C  CB  . ASN B  1 51  ? -29.169 -22.075 55.291  1.00 36.76  ? 51  ASN B CB  1 
ATOM   2993  C  CG  . ASN B  1 51  ? -30.037 -20.839 55.665  1.00 44.41  ? 51  ASN B CG  1 
ATOM   2994  O  OD1 . ASN B  1 51  ? -31.224 -20.730 55.250  1.00 44.88  ? 51  ASN B OD1 1 
ATOM   2995  N  ND2 . ASN B  1 51  ? -29.460 -19.922 56.434  1.00 45.35  ? 51  ASN B ND2 1 
ATOM   2996  N  N   . GLU B  1 52  ? -28.481 -25.209 55.076  1.00 33.17  ? 52  GLU B N   1 
ATOM   2997  C  CA  . GLU B  1 52  ? -27.664 -26.293 54.523  1.00 31.04  ? 52  GLU B CA  1 
ATOM   2998  C  C   . GLU B  1 52  ? -28.520 -27.320 53.826  1.00 28.99  ? 52  GLU B C   1 
ATOM   2999  O  O   . GLU B  1 52  ? -28.204 -27.750 52.727  1.00 30.36  ? 52  GLU B O   1 
ATOM   3000  C  CB  . GLU B  1 52  ? -26.826 -26.957 55.613  1.00 32.36  ? 52  GLU B CB  1 
ATOM   3001  C  CG  . GLU B  1 52  ? -25.657 -26.144 56.048  1.00 34.82  ? 52  GLU B CG  1 
ATOM   3002  C  CD  . GLU B  1 52  ? -24.638 -25.951 54.935  1.00 39.13  ? 52  GLU B CD  1 
ATOM   3003  O  OE1 . GLU B  1 52  ? -24.421 -24.796 54.524  1.00 37.27  ? 52  GLU B OE1 1 
ATOM   3004  O  OE2 . GLU B  1 52  ? -24.061 -26.961 54.468  1.00 45.10  ? 52  GLU B OE2 1 
ATOM   3005  N  N   . VAL B  1 53  ? -29.618 -27.717 54.472  1.00 26.06  ? 53  VAL B N   1 
ATOM   3006  C  CA  . VAL B  1 53  ? -30.505 -28.703 53.904  1.00 24.88  ? 53  VAL B CA  1 
ATOM   3007  C  C   . VAL B  1 53  ? -31.141 -28.202 52.569  1.00 27.19  ? 53  VAL B C   1 
ATOM   3008  O  O   . VAL B  1 53  ? -31.314 -28.981 51.622  1.00 28.78  ? 53  VAL B O   1 
ATOM   3009  C  CB  . VAL B  1 53  ? -31.621 -29.119 54.901  1.00 25.21  ? 53  VAL B CB  1 
ATOM   3010  C  CG1 . VAL B  1 53  ? -32.694 -29.945 54.196  1.00 23.82  ? 53  VAL B CG1 1 
ATOM   3011  C  CG2 . VAL B  1 53  ? -31.023 -29.896 56.087  1.00 25.64  ? 53  VAL B CG2 1 
ATOM   3012  N  N   . LYS B  1 54  ? -31.479 -26.901 52.514  1.00 25.70  ? 54  LYS B N   1 
ATOM   3013  C  CA  . LYS B  1 54  ? -32.056 -26.292 51.260  1.00 28.55  ? 54  LYS B CA  1 
ATOM   3014  C  C   . LYS B  1 54  ? -31.091 -26.360 50.104  1.00 28.93  ? 54  LYS B C   1 
ATOM   3015  O  O   . LYS B  1 54  ? -31.471 -26.676 49.024  1.00 31.86  ? 54  LYS B O   1 
ATOM   3016  C  CB  . LYS B  1 54  ? -32.498 -24.845 51.496  1.00 27.83  ? 54  LYS B CB  1 
ATOM   3017  C  CG  . LYS B  1 54  ? -33.729 -24.719 52.297  1.00 29.13  ? 54  LYS B CG  1 
ATOM   3018  C  CD  . LYS B  1 54  ? -34.171 -23.287 52.388  1.00 32.71  ? 54  LYS B CD  1 
ATOM   3019  C  CE  . LYS B  1 54  ? -35.562 -23.188 52.970  1.00 37.18  ? 54  LYS B CE  1 
ATOM   3020  N  NZ  . LYS B  1 54  ? -36.033 -21.770 53.057  1.00 43.99  ? 54  LYS B NZ  1 
ATOM   3021  N  N   . ARG B  1 55  ? -29.801 -26.042 50.361  1.00 27.94  ? 55  ARG B N   1 
ATOM   3022  C  CA  . ARG B  1 55  ? -28.791 -26.148 49.317  1.00 28.64  ? 55  ARG B CA  1 
ATOM   3023  C  C   . ARG B  1 55  ? -28.638 -27.615 48.874  1.00 29.80  ? 55  ARG B C   1 
ATOM   3024  O  O   . ARG B  1 55  ? -28.506 -27.902 47.689  1.00 30.95  ? 55  ARG B O   1 
ATOM   3025  C  CB  . ARG B  1 55  ? -27.446 -25.588 49.776  1.00 29.18  ? 55  ARG B CB  1 
ATOM   3026  C  CG  . ARG B  1 55  ? -26.471 -25.192 48.557  1.00 36.28  ? 55  ARG B CG  1 
ATOM   3027  C  CD  . ARG B  1 55  ? -25.041 -24.870 49.039  1.00 33.13  ? 55  ARG B CD  1 
ATOM   3028  N  NE  . ARG B  1 55  ? -25.057 -24.302 50.350  1.00 41.13  ? 55  ARG B NE  1 
ATOM   3029  C  CZ  . ARG B  1 55  ? -24.544 -24.877 51.406  1.00 35.32  ? 55  ARG B CZ  1 
ATOM   3030  N  NH1 . ARG B  1 55  ? -23.940 -26.039 51.299  1.00 37.36  ? 55  ARG B NH1 1 
ATOM   3031  N  NH2 . ARG B  1 55  ? -24.614 -24.292 52.557  1.00 44.17  ? 55  ARG B NH2 1 
ATOM   3032  N  N   . ALA B  1 56  ? -28.661 -28.545 49.856  1.00 25.79  ? 56  ALA B N   1 
ATOM   3033  C  CA  . ALA B  1 56  ? -28.601 -29.991 49.548  1.00 23.14  ? 56  ALA B CA  1 
ATOM   3034  C  C   . ALA B  1 56  ? -29.690 -30.369 48.631  1.00 22.09  ? 56  ALA B C   1 
ATOM   3035  O  O   . ALA B  1 56  ? -29.464 -31.060 47.633  1.00 19.76  ? 56  ALA B O   1 
ATOM   3036  C  CB  . ALA B  1 56  ? -28.680 -30.832 50.851  1.00 22.46  ? 56  ALA B CB  1 
ATOM   3037  N  N   . MET B  1 57  ? -30.921 -29.915 48.952  1.00 22.08  ? 57  MET B N   1 
ATOM   3038  C  CA  . MET B  1 57  ? -32.104 -30.226 48.129  1.00 22.56  ? 57  MET B CA  1 
ATOM   3039  C  C   . MET B  1 57  ? -31.995 -29.623 46.724  1.00 24.11  ? 57  MET B C   1 
ATOM   3040  O  O   . MET B  1 57  ? -32.329 -30.281 45.722  1.00 23.26  ? 57  MET B O   1 
ATOM   3041  C  CB  . MET B  1 57  ? -33.390 -29.752 48.834  1.00 22.33  ? 57  MET B CB  1 
ATOM   3042  C  CG  . MET B  1 57  ? -33.601 -30.419 50.249  1.00 22.79  ? 57  MET B CG  1 
ATOM   3043  S  SD  . MET B  1 57  ? -35.182 -29.988 51.054  1.00 28.36  ? 57  MET B SD  1 
ATOM   3044  C  CE  . MET B  1 57  ? -36.370 -30.673 49.868  1.00 22.45  ? 57  MET B CE  1 
ATOM   3045  N  N   . GLN B  1 58  ? -31.519 -28.384 46.646  1.00 25.20  ? 58  GLN B N   1 
ATOM   3046  C  CA  . GLN B  1 58  ? -31.308 -27.735 45.356  1.00 27.21  ? 58  GLN B CA  1 
ATOM   3047  C  C   . GLN B  1 58  ? -30.358 -28.570 44.443  1.00 26.96  ? 58  GLN B C   1 
ATOM   3048  O  O   . GLN B  1 58  ? -30.508 -28.574 43.204  1.00 28.00  ? 58  GLN B O   1 
ATOM   3049  C  CB  . GLN B  1 58  ? -30.751 -26.333 45.539  1.00 27.46  ? 58  GLN B CB  1 
ATOM   3050  C  CG  . GLN B  1 58  ? -30.450 -25.617 44.218  1.00 33.73  ? 58  GLN B CG  1 
ATOM   3051  C  CD  . GLN B  1 58  ? -30.063 -24.185 44.411  1.00 36.26  ? 58  GLN B CD  1 
ATOM   3052  O  OE1 . GLN B  1 58  ? -30.483 -23.548 45.361  1.00 38.62  ? 58  GLN B OE1 1 
ATOM   3053  N  NE2 . GLN B  1 58  ? -29.230 -23.649 43.476  1.00 34.64  ? 58  GLN B NE2 1 
ATOM   3054  N  N   . PHE B  1 59  ? -29.391 -29.266 45.062  1.00 26.55  ? 59  PHE B N   1 
ATOM   3055  C  CA  . PHE B  1 59  ? -28.420 -30.096 44.286  1.00 26.27  ? 59  PHE B CA  1 
ATOM   3056  C  C   . PHE B  1 59  ? -28.907 -31.489 44.073  1.00 27.56  ? 59  PHE B C   1 
ATOM   3057  O  O   . PHE B  1 59  ? -28.190 -32.316 43.584  1.00 27.70  ? 59  PHE B O   1 
ATOM   3058  C  CB  . PHE B  1 59  ? -27.036 -30.115 44.955  1.00 27.28  ? 59  PHE B CB  1 
ATOM   3059  C  CG  . PHE B  1 59  ? -26.317 -28.791 44.907  1.00 28.87  ? 59  PHE B CG  1 
ATOM   3060  C  CD1 . PHE B  1 59  ? -26.828 -27.722 44.147  1.00 32.31  ? 59  PHE B CD1 1 
ATOM   3061  C  CD2 . PHE B  1 59  ? -25.136 -28.613 45.580  1.00 28.02  ? 59  PHE B CD2 1 
ATOM   3062  C  CE1 . PHE B  1 59  ? -26.164 -26.505 44.100  1.00 32.45  ? 59  PHE B CE1 1 
ATOM   3063  C  CE2 . PHE B  1 59  ? -24.464 -27.391 45.533  1.00 31.02  ? 59  PHE B CE2 1 
ATOM   3064  C  CZ  . PHE B  1 59  ? -24.982 -26.341 44.791  1.00 32.42  ? 59  PHE B CZ  1 
ATOM   3065  N  N   . GLY B  1 60  ? -30.166 -31.756 44.470  1.00 26.81  ? 60  GLY B N   1 
ATOM   3066  C  CA  . GLY B  1 60  ? -30.804 -33.035 44.150  1.00 27.09  ? 60  GLY B CA  1 
ATOM   3067  C  C   . GLY B  1 60  ? -30.932 -34.046 45.308  1.00 27.75  ? 60  GLY B C   1 
ATOM   3068  O  O   . GLY B  1 60  ? -31.394 -35.175 45.102  1.00 26.95  ? 60  GLY B O   1 
ATOM   3069  N  N   . VAL B  1 61  ? -30.537 -33.656 46.495  1.00 24.30  ? 61  VAL B N   1 
ATOM   3070  C  CA  . VAL B  1 61  ? -30.661 -34.565 47.644  1.00 23.26  ? 61  VAL B CA  1 
ATOM   3071  C  C   . VAL B  1 61  ? -32.126 -34.743 48.008  1.00 25.73  ? 61  VAL B C   1 
ATOM   3072  O  O   . VAL B  1 61  ? -32.851 -33.782 48.141  1.00 22.78  ? 61  VAL B O   1 
ATOM   3073  C  CB  . VAL B  1 61  ? -29.906 -34.065 48.847  1.00 23.28  ? 61  VAL B CB  1 
ATOM   3074  C  CG1 . VAL B  1 61  ? -30.197 -34.956 50.060  1.00 22.30  ? 61  VAL B CG1 1 
ATOM   3075  C  CG2 . VAL B  1 61  ? -28.406 -34.025 48.552  1.00 20.66  ? 61  VAL B CG2 1 
ATOM   3076  N  N   . LYS B  1 62  ? -32.548 -35.985 48.160  1.00 24.32  ? 62  LYS B N   1 
ATOM   3077  C  CA  . LYS B  1 62  ? -33.933 -36.274 48.517  1.00 26.21  ? 62  LYS B CA  1 
ATOM   3078  C  C   . LYS B  1 62  ? -34.060 -36.676 49.967  1.00 26.88  ? 62  LYS B C   1 
ATOM   3079  O  O   . LYS B  1 62  ? -35.020 -36.331 50.628  1.00 24.32  ? 62  LYS B O   1 
ATOM   3080  C  CB  . LYS B  1 62  ? -34.502 -37.390 47.612  1.00 25.78  ? 62  LYS B CB  1 
ATOM   3081  C  CG  . LYS B  1 62  ? -35.941 -37.707 47.877  1.00 32.02  ? 62  LYS B CG  1 
ATOM   3082  C  CD  . LYS B  1 62  ? -36.534 -38.628 46.788  1.00 36.83  ? 62  LYS B CD  1 
ATOM   3083  C  CE  . LYS B  1 62  ? -38.045 -38.860 47.018  1.00 40.08  ? 62  LYS B CE  1 
ATOM   3084  N  NZ  . LYS B  1 62  ? -38.651 -39.713 45.960  1.00 43.86  ? 62  LYS B NZ  1 
ATOM   3085  N  N   . THR B  1 63  ? -33.064 -37.414 50.463  1.00 24.30  ? 63  THR B N   1 
ATOM   3086  C  CA  . THR B  1 63  ? -33.140 -37.987 51.781  1.00 21.51  ? 63  THR B CA  1 
ATOM   3087  C  C   . THR B  1 63  ? -31.857 -37.818 52.529  1.00 20.96  ? 63  THR B C   1 
ATOM   3088  O  O   . THR B  1 63  ? -30.788 -38.016 51.987  1.00 21.63  ? 63  THR B O   1 
ATOM   3089  C  CB  . THR B  1 63  ? -33.508 -39.529 51.712  1.00 21.43  ? 63  THR B CB  1 
ATOM   3090  O  OG1 . THR B  1 63  ? -34.796 -39.692 51.095  1.00 21.91  ? 63  THR B OG1 1 
ATOM   3091  C  CG2 . THR B  1 63  ? -33.524 -40.154 53.107  1.00 20.75  ? 63  THR B CG2 1 
ATOM   3092  N  N   . ILE B  1 64  ? -31.966 -37.439 53.783  1.00 20.08  ? 64  ILE B N   1 
ATOM   3093  C  CA  . ILE B  1 64  ? -30.825 -37.330 54.630  1.00 21.85  ? 64  ILE B CA  1 
ATOM   3094  C  C   . ILE B  1 64  ? -30.973 -38.251 55.842  1.00 23.57  ? 64  ILE B C   1 
ATOM   3095  O  O   . ILE B  1 64  ? -32.022 -38.231 56.553  1.00 23.25  ? 64  ILE B O   1 
ATOM   3096  C  CB  . ILE B  1 64  ? -30.595 -35.858 55.100  1.00 21.47  ? 64  ILE B CB  1 
ATOM   3097  C  CG1 . ILE B  1 64  ? -30.238 -34.974 53.908  1.00 19.59  ? 64  ILE B CG1 1 
ATOM   3098  C  CG2 . ILE B  1 64  ? -29.507 -35.793 56.158  1.00 19.51  ? 64  ILE B CG2 1 
ATOM   3099  C  CD1 . ILE B  1 64  ? -30.065 -33.494 54.260  1.00 21.82  ? 64  ILE B CD1 1 
ATOM   3100  N  N   . VAL B  1 65  ? -29.955 -39.076 56.067  1.00 22.29  ? 65  VAL B N   1 
ATOM   3101  C  CA  . VAL B  1 65  ? -29.911 -39.944 57.204  1.00 22.29  ? 65  VAL B CA  1 
ATOM   3102  C  C   . VAL B  1 65  ? -29.033 -39.287 58.299  1.00 24.73  ? 65  VAL B C   1 
ATOM   3103  O  O   . VAL B  1 65  ? -27.816 -39.002 58.073  1.00 20.17  ? 65  VAL B O   1 
ATOM   3104  C  CB  . VAL B  1 65  ? -29.343 -41.296 56.836  1.00 23.11  ? 65  VAL B CB  1 
ATOM   3105  C  CG1 . VAL B  1 65  ? -29.252 -42.192 58.065  1.00 22.06  ? 65  VAL B CG1 1 
ATOM   3106  C  CG2 . VAL B  1 65  ? -30.205 -41.951 55.740  1.00 21.62  ? 65  VAL B CG2 1 
ATOM   3107  N  N   . ASP B  1 66  ? -29.635 -39.031 59.459  1.00 24.90  ? 66  ASP B N   1 
ATOM   3108  C  CA  . ASP B  1 66  ? -28.965 -38.308 60.518  1.00 25.19  ? 66  ASP B CA  1 
ATOM   3109  C  C   . ASP B  1 66  ? -28.696 -39.227 61.727  1.00 26.14  ? 66  ASP B C   1 
ATOM   3110  O  O   . ASP B  1 66  ? -29.578 -39.518 62.476  1.00 23.55  ? 66  ASP B O   1 
ATOM   3111  C  CB  . ASP B  1 66  ? -29.803 -37.084 60.938  1.00 28.17  ? 66  ASP B CB  1 
ATOM   3112  C  CG  . ASP B  1 66  ? -29.108 -36.230 61.964  1.00 31.09  ? 66  ASP B CG  1 
ATOM   3113  O  OD1 . ASP B  1 66  ? -28.180 -36.742 62.640  1.00 29.74  ? 66  ASP B OD1 1 
ATOM   3114  O  OD2 . ASP B  1 66  ? -29.493 -35.021 62.111  1.00 32.82  ? 66  ASP B OD2 1 
ATOM   3115  N  N   . PRO B  1 67  ? -27.427 -39.677 61.881  1.00 23.73  ? 67  PRO B N   1 
ATOM   3116  C  CA  . PRO B  1 67  ? -27.056 -40.628 62.927  1.00 21.98  ? 67  PRO B CA  1 
ATOM   3117  C  C   . PRO B  1 67  ? -26.770 -39.959 64.298  1.00 21.24  ? 67  PRO B C   1 
ATOM   3118  O  O   . PRO B  1 67  ? -25.972 -40.435 65.036  1.00 23.74  ? 67  PRO B O   1 
ATOM   3119  C  CB  . PRO B  1 67  ? -25.782 -41.284 62.368  1.00 22.40  ? 67  PRO B CB  1 
ATOM   3120  C  CG  . PRO B  1 67  ? -25.139 -40.233 61.569  1.00 25.56  ? 67  PRO B CG  1 
ATOM   3121  C  CD  . PRO B  1 67  ? -26.287 -39.324 61.026  1.00 22.31  ? 67  PRO B CD  1 
ATOM   3122  N  N   . THR B  1 68  ? -27.453 -38.863 64.579  1.00 18.99  ? 68  THR B N   1 
ATOM   3123  C  CA  . THR B  1 68  ? -27.356 -38.218 65.853  1.00 20.08  ? 68  THR B CA  1 
ATOM   3124  C  C   . THR B  1 68  ? -28.159 -39.009 66.888  1.00 22.10  ? 68  THR B C   1 
ATOM   3125  O  O   . THR B  1 68  ? -29.413 -39.064 66.820  1.00 22.51  ? 68  THR B O   1 
ATOM   3126  C  CB  . THR B  1 68  ? -27.902 -36.742 65.792  1.00 21.80  ? 68  THR B CB  1 
ATOM   3127  O  OG1 . THR B  1 68  ? -27.269 -36.048 64.751  1.00 23.48  ? 68  THR B OG1 1 
ATOM   3128  C  CG2 . THR B  1 68  ? -27.645 -36.004 67.126  1.00 20.64  ? 68  THR B CG2 1 
ATOM   3129  N  N   . VAL B  1 69  ? -27.456 -39.628 67.835  1.00 22.00  ? 69  VAL B N   1 
ATOM   3130  C  CA  . VAL B  1 69  ? -28.101 -40.425 68.874  1.00 21.35  ? 69  VAL B CA  1 
ATOM   3131  C  C   . VAL B  1 69  ? -27.633 -39.989 70.289  1.00 23.05  ? 69  VAL B C   1 
ATOM   3132  O  O   . VAL B  1 69  ? -26.963 -38.952 70.440  1.00 23.20  ? 69  VAL B O   1 
ATOM   3133  C  CB  . VAL B  1 69  ? -27.849 -41.961 68.668  1.00 21.97  ? 69  VAL B CB  1 
ATOM   3134  C  CG1 . VAL B  1 69  ? -28.463 -42.425 67.390  1.00 21.03  ? 69  VAL B CG1 1 
ATOM   3135  C  CG2 . VAL B  1 69  ? -26.336 -42.285 68.699  1.00 20.36  ? 69  VAL B CG2 1 
ATOM   3136  N  N   . MET B  1 70  ? -27.995 -40.788 71.324  1.00 22.25  ? 70  MET B N   1 
ATOM   3137  C  CA  . MET B  1 70  ? -27.555 -40.498 72.703  1.00 21.37  ? 70  MET B CA  1 
ATOM   3138  C  C   . MET B  1 70  ? -26.095 -40.277 72.733  1.00 21.82  ? 70  MET B C   1 
ATOM   3139  O  O   . MET B  1 70  ? -25.313 -41.131 72.270  1.00 24.98  ? 70  MET B O   1 
ATOM   3140  C  CB  . MET B  1 70  ? -27.905 -41.654 73.646  1.00 23.89  ? 70  MET B CB  1 
ATOM   3141  C  CG  . MET B  1 70  ? -27.882 -41.253 75.150  1.00 25.36  ? 70  MET B CG  1 
ATOM   3142  S  SD  . MET B  1 70  ? -26.926 -42.397 76.190  1.00 29.02  ? 70  MET B SD  1 
ATOM   3143  C  CE  . MET B  1 70  ? -25.225 -41.925 75.749  1.00 23.66  ? 70  MET B CE  1 
ATOM   3144  N  N   . GLY B  1 71  ? -25.686 -39.163 73.274  1.00 22.38  ? 71  GLY B N   1 
ATOM   3145  C  CA  . GLY B  1 71  ? -24.281 -38.826 73.325  1.00 20.44  ? 71  GLY B CA  1 
ATOM   3146  C  C   . GLY B  1 71  ? -23.931 -37.748 72.326  1.00 24.05  ? 71  GLY B C   1 
ATOM   3147  O  O   . GLY B  1 71  ? -22.889 -37.106 72.433  1.00 24.73  ? 71  GLY B O   1 
ATOM   3148  N  N   . LEU B  1 72  ? -24.823 -37.542 71.331  1.00 23.21  ? 72  LEU B N   1 
ATOM   3149  C  CA  . LEU B  1 72  ? -24.607 -36.529 70.306  1.00 22.22  ? 72  LEU B CA  1 
ATOM   3150  C  C   . LEU B  1 72  ? -25.718 -35.454 70.331  1.00 26.55  ? 72  LEU B C   1 
ATOM   3151  O  O   . LEU B  1 72  ? -25.724 -34.498 69.483  1.00 29.55  ? 72  LEU B O   1 
ATOM   3152  C  CB  . LEU B  1 72  ? -24.526 -37.161 68.948  1.00 23.90  ? 72  LEU B CB  1 
ATOM   3153  C  CG  . LEU B  1 72  ? -23.337 -38.081 68.709  1.00 25.03  ? 72  LEU B CG  1 
ATOM   3154  C  CD1 . LEU B  1 72  ? -23.339 -38.586 67.272  1.00 27.89  ? 72  LEU B CD1 1 
ATOM   3155  C  CD2 . LEU B  1 72  ? -22.017 -37.368 69.032  1.00 22.25  ? 72  LEU B CD2 1 
ATOM   3156  N  N   . GLY B  1 73  ? -26.645 -35.594 71.263  1.00 23.12  ? 73  GLY B N   1 
ATOM   3157  C  CA  . GLY B  1 73  ? -27.660 -34.601 71.465  1.00 24.87  ? 73  GLY B CA  1 
ATOM   3158  C  C   . GLY B  1 73  ? -28.854 -34.723 70.540  1.00 24.15  ? 73  GLY B C   1 
ATOM   3159  O  O   . GLY B  1 73  ? -29.433 -33.726 70.140  1.00 24.20  ? 73  GLY B O   1 
ATOM   3160  N  N   . ARG B  1 74  ? -29.225 -35.961 70.200  1.00 22.75  ? 74  ARG B N   1 
ATOM   3161  C  CA  . ARG B  1 74  ? -30.379 -36.191 69.390  1.00 23.98  ? 74  ARG B CA  1 
ATOM   3162  C  C   . ARG B  1 74  ? -31.568 -35.436 69.950  1.00 26.72  ? 74  ARG B C   1 
ATOM   3163  O  O   . ARG B  1 74  ? -31.854 -35.515 71.150  1.00 24.96  ? 74  ARG B O   1 
ATOM   3164  C  CB  . ARG B  1 74  ? -30.710 -37.687 69.324  1.00 22.44  ? 74  ARG B CB  1 
ATOM   3165  C  CG  . ARG B  1 74  ? -32.029 -37.999 68.555  1.00 23.39  ? 74  ARG B CG  1 
ATOM   3166  C  CD  . ARG B  1 74  ? -32.363 -39.498 68.576  1.00 22.28  ? 74  ARG B CD  1 
ATOM   3167  N  NE  . ARG B  1 74  ? -32.706 -39.967 69.929  1.00 21.05  ? 74  ARG B NE  1 
ATOM   3168  C  CZ  . ARG B  1 74  ? -33.183 -41.179 70.203  1.00 22.36  ? 74  ARG B CZ  1 
ATOM   3169  N  NH1 . ARG B  1 74  ? -33.379 -42.049 69.229  1.00 23.11  ? 74  ARG B NH1 1 
ATOM   3170  N  NH2 . ARG B  1 74  ? -33.469 -41.520 71.464  1.00 21.39  ? 74  ARG B NH2 1 
ATOM   3171  N  N   . ASP B  1 75  ? -32.266 -34.704 69.079  1.00 25.98  ? 75  ASP B N   1 
ATOM   3172  C  CA  . ASP B  1 75  ? -33.471 -33.958 69.474  1.00 27.19  ? 75  ASP B CA  1 
ATOM   3173  C  C   . ASP B  1 75  ? -34.494 -34.045 68.386  1.00 29.98  ? 75  ASP B C   1 
ATOM   3174  O  O   . ASP B  1 75  ? -34.435 -33.282 67.371  1.00 27.64  ? 75  ASP B O   1 
ATOM   3175  C  CB  . ASP B  1 75  ? -33.127 -32.486 69.767  1.00 30.34  ? 75  ASP B CB  1 
ATOM   3176  C  CG  . ASP B  1 75  ? -34.352 -31.671 70.238  1.00 32.64  ? 75  ASP B CG  1 
ATOM   3177  O  OD1 . ASP B  1 75  ? -34.157 -30.671 70.936  1.00 39.63  ? 75  ASP B OD1 1 
ATOM   3178  O  OD2 . ASP B  1 75  ? -35.507 -32.056 69.897  1.00 33.29  ? 75  ASP B OD2 1 
ATOM   3179  N  N   . ILE B  1 76  ? -35.442 -34.948 68.554  1.00 28.51  ? 76  ILE B N   1 
ATOM   3180  C  CA  . ILE B  1 76  ? -36.372 -35.234 67.542  1.00 27.37  ? 76  ILE B CA  1 
ATOM   3181  C  C   . ILE B  1 76  ? -37.298 -34.009 67.194  1.00 30.84  ? 76  ILE B C   1 
ATOM   3182  O  O   . ILE B  1 76  ? -37.735 -33.865 66.059  1.00 31.18  ? 76  ILE B O   1 
ATOM   3183  C  CB  . ILE B  1 76  ? -37.244 -36.460 67.900  1.00 29.66  ? 76  ILE B CB  1 
ATOM   3184  C  CG1 . ILE B  1 76  ? -37.873 -37.033 66.651  1.00 27.21  ? 76  ILE B CG1 1 
ATOM   3185  C  CG2 . ILE B  1 76  ? -38.306 -36.087 68.939  1.00 26.67  ? 76  ILE B CG2 1 
ATOM   3186  C  CD1 . ILE B  1 76  ? -36.868 -37.455 65.621  1.00 25.50  ? 76  ILE B CD1 1 
ATOM   3187  N  N   . ARG B  1 77  ? -37.570 -33.162 68.181  1.00 29.48  ? 77  ARG B N   1 
ATOM   3188  C  CA  . ARG B  1 77  ? -38.436 -31.971 67.954  1.00 28.71  ? 77  ARG B CA  1 
ATOM   3189  C  C   . ARG B  1 77  ? -37.717 -30.889 67.138  1.00 29.94  ? 77  ARG B C   1 
ATOM   3190  O  O   . ARG B  1 77  ? -38.343 -30.182 66.327  1.00 29.04  ? 77  ARG B O   1 
ATOM   3191  C  CB  . ARG B  1 77  ? -38.967 -31.411 69.286  1.00 28.12  ? 77  ARG B CB  1 
ATOM   3192  C  CG  . ARG B  1 77  ? -40.085 -32.257 69.879  1.00 27.52  ? 77  ARG B CG  1 
ATOM   3193  C  CD  . ARG B  1 77  ? -40.297 -31.976 71.350  1.00 28.74  ? 77  ARG B CD  1 
ATOM   3194  N  NE  . ARG B  1 77  ? -41.227 -32.941 71.943  1.00 29.75  ? 77  ARG B NE  1 
ATOM   3195  C  CZ  . ARG B  1 77  ? -40.873 -34.144 72.399  1.00 33.09  ? 77  ARG B CZ  1 
ATOM   3196  N  NH1 . ARG B  1 77  ? -39.589 -34.542 72.337  1.00 28.44  ? 77  ARG B NH1 1 
ATOM   3197  N  NH2 . ARG B  1 77  ? -41.785 -34.950 72.916  1.00 34.19  ? 77  ARG B NH2 1 
ATOM   3198  N  N   . PHE B  1 78  ? -36.418 -30.764 67.344  1.00 25.22  ? 78  PHE B N   1 
ATOM   3199  C  CA  . PHE B  1 78  ? -35.637 -29.907 66.540  1.00 27.74  ? 78  PHE B CA  1 
ATOM   3200  C  C   . PHE B  1 78  ? -35.631 -30.427 65.078  1.00 26.49  ? 78  PHE B C   1 
ATOM   3201  O  O   . PHE B  1 78  ? -35.749 -29.676 64.160  1.00 26.95  ? 78  PHE B O   1 
ATOM   3202  C  CB  . PHE B  1 78  ? -34.232 -29.828 67.060  1.00 27.93  ? 78  PHE B CB  1 
ATOM   3203  C  CG  . PHE B  1 78  ? -33.343 -29.000 66.233  1.00 30.48  ? 78  PHE B CG  1 
ATOM   3204  C  CD1 . PHE B  1 78  ? -32.509 -29.582 65.282  1.00 28.52  ? 78  PHE B CD1 1 
ATOM   3205  C  CD2 . PHE B  1 78  ? -33.323 -27.605 66.379  1.00 31.62  ? 78  PHE B CD2 1 
ATOM   3206  C  CE1 . PHE B  1 78  ? -31.662 -28.789 64.492  1.00 27.51  ? 78  PHE B CE1 1 
ATOM   3207  C  CE2 . PHE B  1 78  ? -32.483 -26.822 65.593  1.00 29.88  ? 78  PHE B CE2 1 
ATOM   3208  C  CZ  . PHE B  1 78  ? -31.655 -27.418 64.651  1.00 27.84  ? 78  PHE B CZ  1 
ATOM   3209  N  N   . MET B  1 79  ? -35.492 -31.736 64.924  1.00 28.03  ? 79  MET B N   1 
ATOM   3210  C  CA  . MET B  1 79  ? -35.481 -32.344 63.619  1.00 27.12  ? 79  MET B CA  1 
ATOM   3211  C  C   . MET B  1 79  ? -36.824 -32.119 62.904  1.00 28.76  ? 79  MET B C   1 
ATOM   3212  O  O   . MET B  1 79  ? -36.858 -31.850 61.689  1.00 26.61  ? 79  MET B O   1 
ATOM   3213  C  CB  . MET B  1 79  ? -35.155 -33.849 63.725  1.00 27.24  ? 79  MET B CB  1 
ATOM   3214  C  CG  . MET B  1 79  ? -33.791 -34.138 64.415  1.00 27.82  ? 79  MET B CG  1 
ATOM   3215  S  SD  . MET B  1 79  ? -33.391 -35.919 64.596  1.00 30.71  ? 79  MET B SD  1 
ATOM   3216  C  CE  . MET B  1 79  ? -32.892 -36.339 62.952  1.00 29.32  ? 79  MET B CE  1 
ATOM   3217  N  N   . GLU B  1 80  ? -37.936 -32.224 63.668  1.00 28.13  ? 80  GLU B N   1 
ATOM   3218  C  CA  . GLU B  1 80  ? -39.289 -31.956 63.117  1.00 30.32  ? 80  GLU B CA  1 
ATOM   3219  C  C   . GLU B  1 80  ? -39.369 -30.563 62.525  1.00 30.57  ? 80  GLU B C   1 
ATOM   3220  O  O   . GLU B  1 80  ? -39.875 -30.378 61.415  1.00 33.23  ? 80  GLU B O   1 
ATOM   3221  C  CB  . GLU B  1 80  ? -40.361 -32.119 64.199  1.00 31.66  ? 80  GLU B CB  1 
ATOM   3222  C  CG  . GLU B  1 80  ? -40.786 -33.550 64.470  1.00 36.57  ? 80  GLU B CG  1 
ATOM   3223  C  CD  . GLU B  1 80  ? -41.861 -33.659 65.652  1.00 41.76  ? 80  GLU B CD  1 
ATOM   3224  O  OE1 . GLU B  1 80  ? -41.906 -32.756 66.501  1.00 48.79  ? 80  GLU B OE1 1 
ATOM   3225  O  OE2 . GLU B  1 80  ? -42.615 -34.647 65.684  1.00 43.70  ? 80  GLU B OE2 1 
ATOM   3226  N  N   . LYS B  1 81  ? -38.866 -29.567 63.274  1.00 31.10  ? 81  LYS B N   1 
ATOM   3227  C  CA  . LYS B  1 81  ? -38.904 -28.161 62.813  1.00 32.73  ? 81  LYS B CA  1 
ATOM   3228  C  C   . LYS B  1 81  ? -38.191 -28.000 61.497  1.00 32.30  ? 81  LYS B C   1 
ATOM   3229  O  O   . LYS B  1 81  ? -38.703 -27.379 60.585  1.00 31.19  ? 81  LYS B O   1 
ATOM   3230  C  CB  . LYS B  1 81  ? -38.298 -27.234 63.848  1.00 37.19  ? 81  LYS B CB  1 
ATOM   3231  C  CG  . LYS B  1 81  ? -39.142 -27.042 65.083  1.00 41.20  ? 81  LYS B CG  1 
ATOM   3232  C  CD  . LYS B  1 81  ? -38.671 -25.823 65.882  1.00 44.01  ? 81  LYS B CD  1 
ATOM   3233  C  CE  . LYS B  1 81  ? -38.803 -24.526 65.046  1.00 56.19  ? 81  LYS B CE  1 
ATOM   3234  N  NZ  . LYS B  1 81  ? -38.319 -23.305 65.785  1.00 62.36  ? 81  LYS B NZ  1 
ATOM   3235  N  N   . VAL B  1 82  ? -36.989 -28.573 61.401  1.00 31.41  ? 82  VAL B N   1 
ATOM   3236  C  CA  . VAL B  1 82  ? -36.201 -28.491 60.172  1.00 29.04  ? 82  VAL B CA  1 
ATOM   3237  C  C   . VAL B  1 82  ? -36.926 -29.137 58.997  1.00 27.99  ? 82  VAL B C   1 
ATOM   3238  O  O   . VAL B  1 82  ? -36.944 -28.599 57.905  1.00 28.20  ? 82  VAL B O   1 
ATOM   3239  C  CB  . VAL B  1 82  ? -34.832 -29.132 60.338  1.00 28.60  ? 82  VAL B CB  1 
ATOM   3240  C  CG1 . VAL B  1 82  ? -34.151 -29.288 58.985  1.00 25.28  ? 82  VAL B CG1 1 
ATOM   3241  C  CG2 . VAL B  1 82  ? -33.975 -28.298 61.284  1.00 31.36  ? 82  VAL B CG2 1 
ATOM   3242  N  N   . VAL B  1 83  ? -37.514 -30.282 59.232  1.00 26.68  ? 83  VAL B N   1 
ATOM   3243  C  CA  . VAL B  1 83  ? -38.260 -30.947 58.212  1.00 28.08  ? 83  VAL B CA  1 
ATOM   3244  C  C   . VAL B  1 83  ? -39.388 -30.028 57.692  1.00 28.96  ? 83  VAL B C   1 
ATOM   3245  O  O   . VAL B  1 83  ? -39.586 -29.891 56.479  1.00 28.38  ? 83  VAL B O   1 
ATOM   3246  C  CB  . VAL B  1 83  ? -38.860 -32.281 58.722  1.00 26.07  ? 83  VAL B CB  1 
ATOM   3247  C  CG1 . VAL B  1 83  ? -39.871 -32.856 57.695  1.00 24.91  ? 83  VAL B CG1 1 
ATOM   3248  C  CG2 . VAL B  1 83  ? -37.758 -33.274 59.007  1.00 23.93  ? 83  VAL B CG2 1 
ATOM   3249  N  N   . LYS B  1 84  ? -40.106 -29.400 58.615  1.00 29.92  ? 84  LYS B N   1 
ATOM   3250  C  CA  . LYS B  1 84  ? -41.190 -28.514 58.250  1.00 32.22  ? 84  LYS B CA  1 
ATOM   3251  C  C   . LYS B  1 84  ? -40.693 -27.343 57.403  1.00 31.18  ? 84  LYS B C   1 
ATOM   3252  O  O   . LYS B  1 84  ? -41.301 -26.992 56.431  1.00 34.76  ? 84  LYS B O   1 
ATOM   3253  C  CB  . LYS B  1 84  ? -41.908 -27.998 59.493  1.00 31.54  ? 84  LYS B CB  1 
ATOM   3254  C  CG  . LYS B  1 84  ? -42.715 -29.051 60.216  1.00 32.43  ? 84  LYS B CG  1 
ATOM   3255  C  CD  . LYS B  1 84  ? -43.418 -28.467 61.405  1.00 35.65  ? 84  LYS B CD  1 
ATOM   3256  C  CE  . LYS B  1 84  ? -44.075 -29.539 62.239  1.00 37.83  ? 84  LYS B CE  1 
ATOM   3257  N  NZ  . LYS B  1 84  ? -44.870 -28.944 63.348  1.00 41.06  ? 84  LYS B NZ  1 
ATOM   3258  N  N   . ALA B  1 85  ? -39.570 -26.760 57.802  1.00 30.78  ? 85  ALA B N   1 
ATOM   3259  C  CA  . ALA B  1 85  ? -39.012 -25.596 57.097  1.00 32.32  ? 85  ALA B CA  1 
ATOM   3260  C  C   . ALA B  1 85  ? -38.403 -25.945 55.703  1.00 32.40  ? 85  ALA B C   1 
ATOM   3261  O  O   . ALA B  1 85  ? -38.220 -25.072 54.876  1.00 37.56  ? 85  ALA B O   1 
ATOM   3262  C  CB  . ALA B  1 85  ? -37.971 -24.883 57.975  1.00 30.81  ? 85  ALA B CB  1 
ATOM   3263  N  N   . THR B  1 86  ? -38.111 -27.230 55.471  1.00 28.70  ? 86  THR B N   1 
ATOM   3264  C  CA  . THR B  1 86  ? -37.379 -27.647 54.211  1.00 28.13  ? 86  THR B CA  1 
ATOM   3265  C  C   . THR B  1 86  ? -38.145 -28.643 53.344  1.00 27.65  ? 86  THR B C   1 
ATOM   3266  O  O   . THR B  1 86  ? -38.015 -28.633 52.121  1.00 29.05  ? 86  THR B O   1 
ATOM   3267  C  CB  . THR B  1 86  ? -36.038 -28.257 54.535  1.00 28.00  ? 86  THR B CB  1 
ATOM   3268  O  OG1 . THR B  1 86  ? -36.238 -29.467 55.310  1.00 25.65  ? 86  THR B OG1 1 
ATOM   3269  C  CG2 . THR B  1 86  ? -35.168 -27.266 55.338  1.00 23.59  ? 86  THR B CG2 1 
ATOM   3270  N  N   . GLY B  1 87  ? -38.926 -29.519 53.981  1.00 26.19  ? 87  GLY B N   1 
ATOM   3271  C  CA  . GLY B  1 87  ? -39.663 -30.603 53.233  1.00 27.40  ? 87  GLY B CA  1 
ATOM   3272  C  C   . GLY B  1 87  ? -38.768 -31.865 52.939  1.00 27.53  ? 87  GLY B C   1 
ATOM   3273  O  O   . GLY B  1 87  ? -39.167 -32.763 52.205  1.00 27.97  ? 87  GLY B O   1 
ATOM   3274  N  N   . ILE B  1 88  ? -37.576 -31.892 53.527  1.00 26.48  ? 88  ILE B N   1 
ATOM   3275  C  CA  . ILE B  1 88  ? -36.626 -32.997 53.315  1.00 24.36  ? 88  ILE B CA  1 
ATOM   3276  C  C   . ILE B  1 88  ? -37.146 -34.317 53.890  1.00 24.60  ? 88  ILE B C   1 
ATOM   3277  O  O   . ILE B  1 88  ? -37.871 -34.324 54.901  1.00 25.64  ? 88  ILE B O   1 
ATOM   3278  C  CB  . ILE B  1 88  ? -35.234 -32.680 53.976  1.00 24.45  ? 88  ILE B CB  1 
ATOM   3279  C  CG1 . ILE B  1 88  ? -34.192 -33.730 53.593  1.00 23.49  ? 88  ILE B CG1 1 
ATOM   3280  C  CG2 . ILE B  1 88  ? -35.365 -32.591 55.506  1.00 23.92  ? 88  ILE B CG2 1 
ATOM   3281  C  CD1 . ILE B  1 88  ? -33.622 -33.558 52.195  1.00 20.00  ? 88  ILE B CD1 1 
ATOM   3282  N  N   . ASN B  1 89  ? -36.784 -35.460 53.226  1.00 24.32  ? 89  ASN B N   1 
ATOM   3283  C  CA  . ASN B  1 89  ? -36.932 -36.806 53.861  1.00 25.33  ? 89  ASN B CA  1 
ATOM   3284  C  C   . ASN B  1 89  ? -35.828 -36.970 54.844  1.00 24.00  ? 89  ASN B C   1 
ATOM   3285  O  O   . ASN B  1 89  ? -34.673 -36.967 54.472  1.00 23.73  ? 89  ASN B O   1 
ATOM   3286  C  CB  . ASN B  1 89  ? -36.842 -37.925 52.825  1.00 25.07  ? 89  ASN B CB  1 
ATOM   3287  C  CG  . ASN B  1 89  ? -38.091 -38.038 51.956  1.00 27.55  ? 89  ASN B CG  1 
ATOM   3288  O  OD1 . ASN B  1 89  ? -39.167 -37.515 52.295  1.00 26.23  ? 89  ASN B OD1 1 
ATOM   3289  N  ND2 . ASN B  1 89  ? -37.959 -38.724 50.844  1.00 26.53  ? 89  ASN B ND2 1 
ATOM   3290  N  N   . LEU B  1 90  ? -36.170 -37.109 56.108  1.00 22.98  ? 90  LEU B N   1 
ATOM   3291  C  CA  . LEU B  1 90  ? -35.157 -37.247 57.168  1.00 23.69  ? 90  LEU B CA  1 
ATOM   3292  C  C   . LEU B  1 90  ? -35.356 -38.540 57.958  1.00 25.35  ? 90  LEU B C   1 
ATOM   3293  O  O   . LEU B  1 90  ? -36.428 -38.773 58.530  1.00 24.59  ? 90  LEU B O   1 
ATOM   3294  C  CB  . LEU B  1 90  ? -35.196 -36.021 58.122  1.00 23.25  ? 90  LEU B CB  1 
ATOM   3295  C  CG  . LEU B  1 90  ? -34.205 -35.986 59.297  1.00 25.95  ? 90  LEU B CG  1 
ATOM   3296  C  CD1 . LEU B  1 90  ? -32.783 -35.797 58.805  1.00 23.37  ? 90  LEU B CD1 1 
ATOM   3297  C  CD2 . LEU B  1 90  ? -34.588 -34.887 60.288  1.00 24.64  ? 90  LEU B CD2 1 
ATOM   3298  N  N   . VAL B  1 91  ? -34.331 -39.379 57.978  1.00 23.22  ? 91  VAL B N   1 
ATOM   3299  C  CA  . VAL B  1 91  ? -34.377 -40.603 58.730  1.00 21.47  ? 91  VAL B CA  1 
ATOM   3300  C  C   . VAL B  1 91  ? -33.611 -40.435 60.020  1.00 23.53  ? 91  VAL B C   1 
ATOM   3301  O  O   . VAL B  1 91  ? -32.374 -40.180 60.003  1.00 20.16  ? 91  VAL B O   1 
ATOM   3302  C  CB  . VAL B  1 91  ? -33.756 -41.778 57.939  1.00 22.60  ? 91  VAL B CB  1 
ATOM   3303  C  CG1 . VAL B  1 91  ? -34.013 -43.130 58.675  1.00 18.97  ? 91  VAL B CG1 1 
ATOM   3304  C  CG2 . VAL B  1 91  ? -34.299 -41.818 56.518  1.00 21.29  ? 91  VAL B CG2 1 
ATOM   3305  N  N   . ALA B  1 92  ? -34.318 -40.559 61.154  1.00 21.35  ? 92  ALA B N   1 
ATOM   3306  C  CA  . ALA B  1 92  ? -33.666 -40.506 62.481  1.00 24.32  ? 92  ALA B CA  1 
ATOM   3307  C  C   . ALA B  1 92  ? -33.325 -41.898 62.947  1.00 24.22  ? 92  ALA B C   1 
ATOM   3308  O  O   . ALA B  1 92  ? -33.884 -42.888 62.447  1.00 25.00  ? 92  ALA B O   1 
ATOM   3309  C  CB  . ALA B  1 92  ? -34.573 -39.798 63.510  1.00 20.58  ? 92  ALA B CB  1 
ATOM   3310  N  N   . GLY B  1 93  ? -32.419 -41.992 63.902  1.00 24.32  ? 93  GLY B N   1 
ATOM   3311  C  CA  . GLY B  1 93  ? -32.009 -43.284 64.419  1.00 24.64  ? 93  GLY B CA  1 
ATOM   3312  C  C   . GLY B  1 93  ? -32.006 -43.367 65.935  1.00 24.84  ? 93  GLY B C   1 
ATOM   3313  O  O   . GLY B  1 93  ? -32.283 -42.394 66.622  1.00 22.21  ? 93  GLY B O   1 
ATOM   3314  N  N   . THR B  1 94  ? -31.701 -44.535 66.442  1.00 23.75  ? 94  THR B N   1 
ATOM   3315  C  CA  . THR B  1 94  ? -31.541 -44.724 67.824  1.00 22.43  ? 94  THR B CA  1 
ATOM   3316  C  C   . THR B  1 94  ? -30.162 -45.274 68.052  1.00 25.11  ? 94  THR B C   1 
ATOM   3317  O  O   . THR B  1 94  ? -29.415 -45.465 67.113  1.00 26.07  ? 94  THR B O   1 
ATOM   3318  C  CB  . THR B  1 94  ? -32.626 -45.707 68.399  1.00 22.24  ? 94  THR B CB  1 
ATOM   3319  O  OG1 . THR B  1 94  ? -32.564 -45.721 69.842  1.00 22.14  ? 94  THR B OG1 1 
ATOM   3320  C  CG2 . THR B  1 94  ? -32.429 -47.138 67.844  1.00 19.77  ? 94  THR B CG2 1 
ATOM   3321  N  N   . GLY B  1 95  ? -29.816 -45.518 69.293  1.00 25.29  ? 95  GLY B N   1 
ATOM   3322  C  CA  . GLY B  1 95  ? -28.499 -46.062 69.608  1.00 24.83  ? 95  GLY B CA  1 
ATOM   3323  C  C   . GLY B  1 95  ? -27.773 -45.289 70.656  1.00 24.79  ? 95  GLY B C   1 
ATOM   3324  O  O   . GLY B  1 95  ? -28.356 -44.430 71.330  1.00 24.30  ? 95  GLY B O   1 
ATOM   3325  N  N   . ILE B  1 96  ? -26.474 -45.589 70.812  1.00 22.73  ? 96  ILE B N   1 
ATOM   3326  C  CA  . ILE B  1 96  ? -25.661 -44.937 71.794  1.00 23.35  ? 96  ILE B CA  1 
ATOM   3327  C  C   . ILE B  1 96  ? -24.305 -44.659 71.250  1.00 23.77  ? 96  ILE B C   1 
ATOM   3328  O  O   . ILE B  1 96  ? -23.703 -45.504 70.602  1.00 24.75  ? 96  ILE B O   1 
ATOM   3329  C  CB  . ILE B  1 96  ? -25.518 -45.806 73.098  1.00 26.49  ? 96  ILE B CB  1 
ATOM   3330  C  CG1 . ILE B  1 96  ? -26.826 -45.810 73.882  1.00 24.73  ? 96  ILE B CG1 1 
ATOM   3331  C  CG2 . ILE B  1 96  ? -24.368 -45.285 73.962  1.00 23.96  ? 96  ILE B CG2 1 
ATOM   3332  C  CD1 . ILE B  1 96  ? -26.828 -46.760 75.104  1.00 27.78  ? 96  ILE B CD1 1 
ATOM   3333  N  N   . TYR B  1 97  ? -23.814 -43.469 71.514  1.00 23.33  ? 97  TYR B N   1 
ATOM   3334  C  CA  . TYR B  1 97  ? -22.545 -43.044 71.028  1.00 22.42  ? 97  TYR B CA  1 
ATOM   3335  C  C   . TYR B  1 97  ? -21.549 -42.827 72.238  1.00 23.75  ? 97  TYR B C   1 
ATOM   3336  O  O   . TYR B  1 97  ? -21.606 -41.814 72.918  1.00 24.15  ? 97  TYR B O   1 
ATOM   3337  C  CB  . TYR B  1 97  ? -22.717 -41.766 70.249  1.00 24.08  ? 97  TYR B CB  1 
ATOM   3338  C  CG  . TYR B  1 97  ? -21.461 -41.236 69.546  1.00 25.10  ? 97  TYR B CG  1 
ATOM   3339  C  CD1 . TYR B  1 97  ? -20.507 -40.505 70.241  1.00 26.21  ? 97  TYR B CD1 1 
ATOM   3340  C  CD2 . TYR B  1 97  ? -21.261 -41.450 68.151  1.00 25.40  ? 97  TYR B CD2 1 
ATOM   3341  C  CE1 . TYR B  1 97  ? -19.369 -40.008 69.603  1.00 30.25  ? 97  TYR B CE1 1 
ATOM   3342  C  CE2 . TYR B  1 97  ? -20.133 -40.959 67.502  1.00 25.36  ? 97  TYR B CE2 1 
ATOM   3343  C  CZ  . TYR B  1 97  ? -19.188 -40.239 68.222  1.00 31.60  ? 97  TYR B CZ  1 
ATOM   3344  O  OH  . TYR B  1 97  ? -18.089 -39.756 67.595  1.00 31.32  ? 97  TYR B OH  1 
ATOM   3345  N  N   . ILE B  1 98  ? -20.669 -43.815 72.476  1.00 22.44  ? 98  ILE B N   1 
ATOM   3346  C  CA  . ILE B  1 98  ? -19.624 -43.696 73.543  1.00 25.03  ? 98  ILE B CA  1 
ATOM   3347  C  C   . ILE B  1 98  ? -18.284 -44.176 73.042  1.00 26.58  ? 98  ILE B C   1 
ATOM   3348  O  O   . ILE B  1 98  ? -18.214 -44.964 72.103  1.00 27.87  ? 98  ILE B O   1 
ATOM   3349  C  CB  . ILE B  1 98  ? -19.997 -44.502 74.815  1.00 23.67  ? 98  ILE B CB  1 
ATOM   3350  C  CG1 . ILE B  1 98  ? -20.247 -45.971 74.462  1.00 21.53  ? 98  ILE B CG1 1 
ATOM   3351  C  CG2 . ILE B  1 98  ? -21.219 -43.885 75.510  1.00 22.65  ? 98  ILE B CG2 1 
ATOM   3352  C  CD1 . ILE B  1 98  ? -20.142 -46.932 75.669  1.00 20.98  ? 98  ILE B CD1 1 
ATOM   3353  N  N   . TYR B  1 99  ? -17.211 -43.703 73.667  1.00 26.37  ? 99  TYR B N   1 
ATOM   3354  C  CA  . TYR B  1 99  ? -15.864 -44.173 73.319  1.00 29.48  ? 99  TYR B CA  1 
ATOM   3355  C  C   . TYR B  1 99  ? -15.314 -45.107 74.373  1.00 28.92  ? 99  TYR B C   1 
ATOM   3356  O  O   . TYR B  1 99  ? -14.538 -45.998 74.070  1.00 30.60  ? 99  TYR B O   1 
ATOM   3357  C  CB  . TYR B  1 99  ? -14.885 -42.988 73.109  1.00 30.58  ? 99  TYR B CB  1 
ATOM   3358  C  CG  . TYR B  1 99  ? -15.166 -42.147 71.882  1.00 33.01  ? 99  TYR B CG  1 
ATOM   3359  C  CD1 . TYR B  1 99  ? -16.085 -42.576 70.897  1.00 31.93  ? 99  TYR B CD1 1 
ATOM   3360  C  CD2 . TYR B  1 99  ? -14.498 -40.937 71.679  1.00 36.71  ? 99  TYR B CD2 1 
ATOM   3361  C  CE1 . TYR B  1 99  ? -16.338 -41.810 69.771  1.00 33.59  ? 99  TYR B CE1 1 
ATOM   3362  C  CE2 . TYR B  1 99  ? -14.741 -40.157 70.549  1.00 36.62  ? 99  TYR B CE2 1 
ATOM   3363  C  CZ  . TYR B  1 99  ? -15.657 -40.592 69.597  1.00 34.01  ? 99  TYR B CZ  1 
ATOM   3364  O  OH  . TYR B  1 99  ? -15.889 -39.842 68.509  1.00 30.62  ? 99  TYR B OH  1 
ATOM   3365  N  N   . ILE B  1 100 ? -15.719 -44.900 75.617  1.00 28.00  ? 100 ILE B N   1 
ATOM   3366  C  CA  . ILE B  1 100 ? -15.172 -45.665 76.707  1.00 28.14  ? 100 ILE B CA  1 
ATOM   3367  C  C   . ILE B  1 100 ? -16.249 -46.337 77.556  1.00 27.10  ? 100 ILE B C   1 
ATOM   3368  O  O   . ILE B  1 100 ? -16.484 -47.512 77.431  1.00 28.99  ? 100 ILE B O   1 
ATOM   3369  C  CB  . ILE B  1 100 ? -14.291 -44.800 77.596  1.00 28.55  ? 100 ILE B CB  1 
ATOM   3370  C  CG1 . ILE B  1 100 ? -13.255 -44.035 76.732  1.00 30.34  ? 100 ILE B CG1 1 
ATOM   3371  C  CG2 . ILE B  1 100 ? -13.600 -45.659 78.656  1.00 27.85  ? 100 ILE B CG2 1 
ATOM   3372  C  CD1 . ILE B  1 100 ? -12.512 -42.925 77.479  1.00 33.36  ? 100 ILE B CD1 1 
ATOM   3373  N  N   . ASP B  1 101 ? -16.877 -45.571 78.413  1.00 29.32  ? 101 ASP B N   1 
ATOM   3374  C  CA  . ASP B  1 101 ? -17.873 -46.104 79.336  1.00 31.03  ? 101 ASP B CA  1 
ATOM   3375  C  C   . ASP B  1 101 ? -19.220 -45.552 79.072  1.00 26.58  ? 101 ASP B C   1 
ATOM   3376  O  O   . ASP B  1 101 ? -19.356 -44.494 78.487  1.00 26.60  ? 101 ASP B O   1 
ATOM   3377  C  CB  . ASP B  1 101 ? -17.465 -45.799 80.823  1.00 36.37  ? 101 ASP B CB  1 
ATOM   3378  C  CG  . ASP B  1 101 ? -16.346 -46.745 81.346  1.00 48.04  ? 101 ASP B CG  1 
ATOM   3379  O  OD1 . ASP B  1 101 ? -15.876 -47.602 80.572  1.00 49.13  ? 101 ASP B OD1 1 
ATOM   3380  O  OD2 . ASP B  1 101 ? -15.954 -46.612 82.542  1.00 51.08  ? 101 ASP B OD2 1 
ATOM   3381  N  N   . LEU B  1 102 ? -20.241 -46.288 79.513  1.00 25.56  ? 102 LEU B N   1 
ATOM   3382  C  CA  . LEU B  1 102 ? -21.630 -45.847 79.435  1.00 26.05  ? 102 LEU B CA  1 
ATOM   3383  C  C   . LEU B  1 102 ? -21.941 -44.929 80.579  1.00 27.12  ? 102 LEU B C   1 
ATOM   3384  O  O   . LEU B  1 102 ? -21.228 -44.902 81.545  1.00 26.20  ? 102 LEU B O   1 
ATOM   3385  C  CB  . LEU B  1 102 ? -22.580 -47.077 79.496  1.00 24.35  ? 102 LEU B CB  1 
ATOM   3386  C  CG  . LEU B  1 102 ? -22.716 -47.926 78.227  1.00 26.20  ? 102 LEU B CG  1 
ATOM   3387  C  CD1 . LEU B  1 102 ? -23.126 -49.350 78.576  1.00 24.58  ? 102 LEU B CD1 1 
ATOM   3388  C  CD2 . LEU B  1 102 ? -23.725 -47.301 77.288  1.00 26.73  ? 102 LEU B CD2 1 
ATOM   3389  N  N   . PRO B  1 103 ? -23.043 -44.147 80.461  1.00 27.23  ? 103 PRO B N   1 
ATOM   3390  C  CA  . PRO B  1 103 ? -23.511 -43.352 81.589  1.00 29.67  ? 103 PRO B CA  1 
ATOM   3391  C  C   . PRO B  1 103 ? -23.800 -44.267 82.799  1.00 32.02  ? 103 PRO B C   1 
ATOM   3392  O  O   . PRO B  1 103 ? -24.135 -45.474 82.615  1.00 32.88  ? 103 PRO B O   1 
ATOM   3393  C  CB  . PRO B  1 103 ? -24.811 -42.735 81.062  1.00 28.59  ? 103 PRO B CB  1 
ATOM   3394  C  CG  . PRO B  1 103 ? -24.621 -42.681 79.585  1.00 26.50  ? 103 PRO B CG  1 
ATOM   3395  C  CD  . PRO B  1 103 ? -23.852 -43.919 79.249  1.00 25.58  ? 103 PRO B CD  1 
ATOM   3396  N  N   . PHE B  1 104 ? -23.682 -43.718 84.011  1.00 31.68  ? 104 PHE B N   1 
ATOM   3397  C  CA  A PHE B  1 104 ? -23.862 -44.501 85.250  0.50 31.28  ? 104 PHE B CA  1 
ATOM   3398  C  CA  B PHE B  1 104 ? -23.858 -44.524 85.238  0.50 31.59  ? 104 PHE B CA  1 
ATOM   3399  C  C   . PHE B  1 104 ? -25.224 -45.232 85.302  1.00 30.32  ? 104 PHE B C   1 
ATOM   3400  O  O   . PHE B  1 104 ? -25.378 -46.211 85.991  1.00 27.83  ? 104 PHE B O   1 
ATOM   3401  C  CB  A PHE B  1 104 ? -23.694 -43.598 86.490  0.50 31.84  ? 104 PHE B CB  1 
ATOM   3402  C  CB  B PHE B  1 104 ? -23.617 -43.665 86.524  0.50 32.85  ? 104 PHE B CB  1 
ATOM   3403  C  CG  A PHE B  1 104 ? -22.405 -42.789 86.492  0.50 33.20  ? 104 PHE B CG  1 
ATOM   3404  C  CG  B PHE B  1 104 ? -24.520 -42.479 86.642  0.50 33.79  ? 104 PHE B CG  1 
ATOM   3405  C  CD1 A PHE B  1 104 ? -21.173 -43.411 86.705  0.50 32.28  ? 104 PHE B CD1 1 
ATOM   3406  C  CD1 B PHE B  1 104 ? -25.864 -42.637 86.967  0.50 35.98  ? 104 PHE B CD1 1 
ATOM   3407  C  CD2 A PHE B  1 104 ? -22.430 -41.410 86.288  0.50 33.99  ? 104 PHE B CD2 1 
ATOM   3408  C  CD2 B PHE B  1 104 ? -24.027 -41.185 86.441  0.50 33.88  ? 104 PHE B CD2 1 
ATOM   3409  C  CE1 A PHE B  1 104 ? -20.000 -42.676 86.709  0.50 32.76  ? 104 PHE B CE1 1 
ATOM   3410  C  CE1 B PHE B  1 104 ? -26.693 -41.541 87.079  0.50 35.83  ? 104 PHE B CE1 1 
ATOM   3411  C  CE2 A PHE B  1 104 ? -21.253 -40.673 86.293  0.50 34.71  ? 104 PHE B CE2 1 
ATOM   3412  C  CE2 B PHE B  1 104 ? -24.859 -40.088 86.555  0.50 32.81  ? 104 PHE B CE2 1 
ATOM   3413  C  CZ  A PHE B  1 104 ? -20.039 -41.308 86.503  0.50 32.53  ? 104 PHE B CZ  1 
ATOM   3414  C  CZ  B PHE B  1 104 ? -26.185 -40.259 86.873  0.50 33.45  ? 104 PHE B CZ  1 
ATOM   3415  N  N   . TYR B  1 105 ? -26.177 -44.735 84.584  1.00 30.10  ? 105 TYR B N   1 
ATOM   3416  C  CA  . TYR B  1 105 ? -27.462 -45.353 84.576  1.00 30.08  ? 105 TYR B CA  1 
ATOM   3417  C  C   . TYR B  1 105 ? -27.349 -46.873 84.217  1.00 29.76  ? 105 TYR B C   1 
ATOM   3418  O  O   . TYR B  1 105 ? -28.129 -47.684 84.685  1.00 32.08  ? 105 TYR B O   1 
ATOM   3419  C  CB  . TYR B  1 105 ? -28.399 -44.654 83.596  1.00 30.92  ? 105 TYR B CB  1 
ATOM   3420  C  CG  . TYR B  1 105 ? -29.631 -45.446 83.295  1.00 29.05  ? 105 TYR B CG  1 
ATOM   3421  C  CD1 . TYR B  1 105 ? -30.751 -45.378 84.127  1.00 28.71  ? 105 TYR B CD1 1 
ATOM   3422  C  CD2 . TYR B  1 105 ? -29.688 -46.285 82.182  1.00 28.42  ? 105 TYR B CD2 1 
ATOM   3423  C  CE1 . TYR B  1 105 ? -31.892 -46.119 83.852  1.00 27.08  ? 105 TYR B CE1 1 
ATOM   3424  C  CE2 . TYR B  1 105 ? -30.812 -47.022 81.903  1.00 27.39  ? 105 TYR B CE2 1 
ATOM   3425  C  CZ  . TYR B  1 105 ? -31.918 -46.937 82.742  1.00 27.20  ? 105 TYR B CZ  1 
ATOM   3426  O  OH  . TYR B  1 105 ? -33.019 -47.662 82.464  1.00 31.44  ? 105 TYR B OH  1 
ATOM   3427  N  N   . PHE B  1 106 ? -26.360 -47.214 83.387  1.00 29.61  ? 106 PHE B N   1 
ATOM   3428  C  CA  . PHE B  1 106 ? -26.236 -48.576 82.860  1.00 30.27  ? 106 PHE B CA  1 
ATOM   3429  C  C   . PHE B  1 106 ? -25.418 -49.546 83.768  1.00 32.51  ? 106 PHE B C   1 
ATOM   3430  O  O   . PHE B  1 106 ? -25.311 -50.714 83.472  1.00 33.18  ? 106 PHE B O   1 
ATOM   3431  C  CB  . PHE B  1 106 ? -25.657 -48.554 81.441  1.00 29.47  ? 106 PHE B CB  1 
ATOM   3432  C  CG  . PHE B  1 106 ? -26.541 -47.883 80.443  1.00 27.59  ? 106 PHE B CG  1 
ATOM   3433  C  CD1 . PHE B  1 106 ? -26.356 -46.523 80.116  1.00 25.24  ? 106 PHE B CD1 1 
ATOM   3434  C  CD2 . PHE B  1 106 ? -27.569 -48.584 79.823  1.00 26.43  ? 106 PHE B CD2 1 
ATOM   3435  C  CE1 . PHE B  1 106 ? -27.178 -45.904 79.195  1.00 26.70  ? 106 PHE B CE1 1 
ATOM   3436  C  CE2 . PHE B  1 106 ? -28.392 -47.966 78.899  1.00 24.73  ? 106 PHE B CE2 1 
ATOM   3437  C  CZ  . PHE B  1 106 ? -28.202 -46.628 78.582  1.00 24.31  ? 106 PHE B CZ  1 
ATOM   3438  N  N   . LEU B  1 107 ? -24.860 -49.034 84.853  1.00 36.17  ? 107 LEU B N   1 
ATOM   3439  C  CA  . LEU B  1 107 ? -24.175 -49.903 85.821  1.00 39.14  ? 107 LEU B CA  1 
ATOM   3440  C  C   . LEU B  1 107 ? -25.103 -51.016 86.247  1.00 40.54  ? 107 LEU B C   1 
ATOM   3441  O  O   . LEU B  1 107 ? -26.243 -50.760 86.692  1.00 37.62  ? 107 LEU B O   1 
ATOM   3442  C  CB  . LEU B  1 107 ? -23.719 -49.111 87.038  1.00 44.36  ? 107 LEU B CB  1 
ATOM   3443  C  CG  . LEU B  1 107 ? -22.429 -48.331 86.886  1.00 50.26  ? 107 LEU B CG  1 
ATOM   3444  C  CD1 . LEU B  1 107 ? -22.097 -47.597 88.175  1.00 51.20  ? 107 LEU B CD1 1 
ATOM   3445  C  CD2 . LEU B  1 107 ? -21.285 -49.267 86.483  1.00 48.53  ? 107 LEU B CD2 1 
ATOM   3446  N  N   . ASN B  1 108 ? -24.635 -52.260 86.109  1.00 41.94  ? 108 ASN B N   1 
ATOM   3447  C  CA  . ASN B  1 108 ? -25.454 -53.464 86.480  1.00 46.29  ? 108 ASN B CA  1 
ATOM   3448  C  C   . ASN B  1 108 ? -26.742 -53.647 85.647  1.00 44.09  ? 108 ASN B C   1 
ATOM   3449  O  O   . ASN B  1 108 ? -27.705 -54.174 86.126  1.00 47.26  ? 108 ASN B O   1 
ATOM   3450  C  CB  . ASN B  1 108 ? -25.787 -53.449 87.951  1.00 51.89  ? 108 ASN B CB  1 
ATOM   3451  C  CG  . ASN B  1 108 ? -24.603 -53.706 88.803  1.00 58.67  ? 108 ASN B CG  1 
ATOM   3452  O  OD1 . ASN B  1 108 ? -24.416 -53.065 89.831  1.00 71.67  ? 108 ASN B OD1 1 
ATOM   3453  N  ND2 . ASN B  1 108 ? -23.768 -54.651 88.385  1.00 57.21  ? 108 ASN B ND2 1 
ATOM   3454  N  N   . ARG B  1 109 ? -26.719 -53.197 84.404  1.00 41.44  ? 109 ARG B N   1 
ATOM   3455  C  CA  . ARG B  1 109 ? -27.847 -53.432 83.500  1.00 36.72  ? 109 ARG B CA  1 
ATOM   3456  C  C   . ARG B  1 109 ? -27.437 -54.335 82.339  1.00 33.54  ? 109 ARG B C   1 
ATOM   3457  O  O   . ARG B  1 109 ? -26.337 -54.269 81.871  1.00 35.68  ? 109 ARG B O   1 
ATOM   3458  C  CB  . ARG B  1 109 ? -28.436 -52.111 82.997  1.00 39.14  ? 109 ARG B CB  1 
ATOM   3459  C  CG  . ARG B  1 109 ? -29.148 -51.315 84.083  1.00 37.21  ? 109 ARG B CG  1 
ATOM   3460  C  CD  . ARG B  1 109 ? -29.952 -50.190 83.511  1.00 37.96  ? 109 ARG B CD  1 
ATOM   3461  N  NE  . ARG B  1 109 ? -30.436 -49.281 84.564  1.00 40.43  ? 109 ARG B NE  1 
ATOM   3462  C  CZ  . ARG B  1 109 ? -31.571 -49.448 85.230  1.00 39.46  ? 109 ARG B CZ  1 
ATOM   3463  N  NH1 . ARG B  1 109 ? -31.921 -48.586 86.155  1.00 39.36  ? 109 ARG B NH1 1 
ATOM   3464  N  NH2 . ARG B  1 109 ? -32.352 -50.483 84.965  1.00 37.69  ? 109 ARG B NH2 1 
ATOM   3465  N  N   . SER B  1 110 ? -28.361 -55.184 81.896  1.00 31.87  ? 110 SER B N   1 
ATOM   3466  C  CA  . SER B  1 110 ? -28.057 -56.185 80.869  1.00 33.18  ? 110 SER B CA  1 
ATOM   3467  C  C   . SER B  1 110 ? -27.974 -55.582 79.493  1.00 35.56  ? 110 SER B C   1 
ATOM   3468  O  O   . SER B  1 110 ? -28.445 -54.452 79.257  1.00 31.25  ? 110 SER B O   1 
ATOM   3469  C  CB  . SER B  1 110 ? -29.109 -57.289 80.873  1.00 34.77  ? 110 SER B CB  1 
ATOM   3470  O  OG  . SER B  1 110 ? -30.352 -56.809 80.348  1.00 38.70  ? 110 SER B OG  1 
ATOM   3471  N  N   . ILE B  1 111 ? -27.374 -56.340 78.568  1.00 32.49  ? 111 ILE B N   1 
ATOM   3472  C  CA  . ILE B  1 111 ? -27.308 -55.962 77.204  1.00 32.69  ? 111 ILE B CA  1 
ATOM   3473  C  C   . ILE B  1 111 ? -28.705 -55.914 76.613  1.00 33.41  ? 111 ILE B C   1 
ATOM   3474  O  O   . ILE B  1 111 ? -28.971 -55.147 75.708  1.00 29.75  ? 111 ILE B O   1 
ATOM   3475  C  CB  . ILE B  1 111 ? -26.439 -56.957 76.391  1.00 34.11  ? 111 ILE B CB  1 
ATOM   3476  C  CG1 . ILE B  1 111 ? -24.936 -56.790 76.764  1.00 32.62  ? 111 ILE B CG1 1 
ATOM   3477  C  CG2 . ILE B  1 111 ? -26.656 -56.764 74.904  1.00 32.53  ? 111 ILE B CG2 1 
ATOM   3478  C  CD1 . ILE B  1 111 ? -24.006 -57.903 76.177  1.00 31.99  ? 111 ILE B CD1 1 
ATOM   3479  N  N   . ASP B  1 112 ? -29.611 -56.761 77.157  1.00 33.77  ? 112 ASP B N   1 
ATOM   3480  C  CA  . ASP B  1 112 ? -31.021 -56.784 76.730  1.00 34.39  ? 112 ASP B CA  1 
ATOM   3481  C  C   . ASP B  1 112 ? -31.751 -55.473 77.083  1.00 33.62  ? 112 ASP B C   1 
ATOM   3482  O  O   . ASP B  1 112 ? -32.534 -54.989 76.320  1.00 34.40  ? 112 ASP B O   1 
ATOM   3483  C  CB  . ASP B  1 112 ? -31.760 -57.977 77.359  1.00 40.76  ? 112 ASP B CB  1 
ATOM   3484  C  CG  . ASP B  1 112 ? -31.273 -59.317 76.825  1.00 48.72  ? 112 ASP B CG  1 
ATOM   3485  O  OD1 . ASP B  1 112 ? -31.163 -60.257 77.614  1.00 60.75  ? 112 ASP B OD1 1 
ATOM   3486  O  OD2 . ASP B  1 112 ? -31.000 -59.418 75.603  1.00 56.30  ? 112 ASP B OD2 1 
ATOM   3487  N  N   . GLU B  1 113 ? -31.472 -54.928 78.272  1.00 31.11  ? 113 GLU B N   1 
ATOM   3488  C  CA  . GLU B  1 113 ? -32.097 -53.670 78.692  1.00 32.19  ? 113 GLU B CA  1 
ATOM   3489  C  C   . GLU B  1 113 ? -31.703 -52.548 77.755  1.00 28.55  ? 113 GLU B C   1 
ATOM   3490  O  O   . GLU B  1 113 ? -32.523 -51.710 77.403  1.00 30.90  ? 113 GLU B O   1 
ATOM   3491  C  CB  . GLU B  1 113 ? -31.717 -53.320 80.137  1.00 33.52  ? 113 GLU B CB  1 
ATOM   3492  C  CG  . GLU B  1 113 ? -32.096 -54.376 81.136  1.00 42.55  ? 113 GLU B CG  1 
ATOM   3493  C  CD  . GLU B  1 113 ? -31.771 -53.979 82.557  1.00 42.05  ? 113 GLU B CD  1 
ATOM   3494  O  OE1 . GLU B  1 113 ? -30.959 -54.666 83.185  1.00 47.31  ? 113 GLU B OE1 1 
ATOM   3495  O  OE2 . GLU B  1 113 ? -32.331 -52.966 83.042  1.00 42.71  ? 113 GLU B OE2 1 
ATOM   3496  N  N   . ILE B  1 114 ? -30.430 -52.537 77.350  1.00 25.86  ? 114 ILE B N   1 
ATOM   3497  C  CA  . ILE B  1 114 ? -29.956 -51.580 76.400  1.00 25.32  ? 114 ILE B CA  1 
ATOM   3498  C  C   . ILE B  1 114 ? -30.699 -51.740 75.082  1.00 24.65  ? 114 ILE B C   1 
ATOM   3499  O  O   . ILE B  1 114 ? -31.189 -50.768 74.516  1.00 24.64  ? 114 ILE B O   1 
ATOM   3500  C  CB  . ILE B  1 114 ? -28.451 -51.740 76.139  1.00 26.85  ? 114 ILE B CB  1 
ATOM   3501  C  CG1 . ILE B  1 114 ? -27.659 -51.579 77.443  1.00 29.79  ? 114 ILE B CG1 1 
ATOM   3502  C  CG2 . ILE B  1 114 ? -27.978 -50.730 75.066  1.00 22.73  ? 114 ILE B CG2 1 
ATOM   3503  C  CD1 . ILE B  1 114 ? -26.153 -51.810 77.285  1.00 30.01  ? 114 ILE B CD1 1 
ATOM   3504  N  N   . ALA B  1 115 ? -30.776 -52.980 74.595  1.00 24.55  ? 115 ALA B N   1 
ATOM   3505  C  CA  . ALA B  1 115 ? -31.478 -53.271 73.337  1.00 26.98  ? 115 ALA B CA  1 
ATOM   3506  C  C   . ALA B  1 115 ? -32.929 -52.809 73.402  1.00 28.26  ? 115 ALA B C   1 
ATOM   3507  O  O   . ALA B  1 115 ? -33.488 -52.305 72.400  1.00 30.91  ? 115 ALA B O   1 
ATOM   3508  C  CB  . ALA B  1 115 ? -31.408 -54.736 73.024  1.00 25.07  ? 115 ALA B CB  1 
ATOM   3509  N  N   . ASP B  1 116 ? -33.548 -52.977 74.571  1.00 28.50  ? 116 ASP B N   1 
ATOM   3510  C  CA  . ASP B  1 116 ? -34.951 -52.549 74.773  1.00 29.61  ? 116 ASP B CA  1 
ATOM   3511  C  C   . ASP B  1 116 ? -35.129 -51.039 74.502  1.00 28.27  ? 116 ASP B C   1 
ATOM   3512  O  O   . ASP B  1 116 ? -36.165 -50.613 74.031  1.00 27.83  ? 116 ASP B O   1 
ATOM   3513  C  CB  . ASP B  1 116 ? -35.425 -52.899 76.171  1.00 28.59  ? 116 ASP B CB  1 
ATOM   3514  C  CG  . ASP B  1 116 ? -35.618 -54.442 76.370  1.00 33.49  ? 116 ASP B CG  1 
ATOM   3515  O  OD1 . ASP B  1 116 ? -35.662 -54.912 77.562  1.00 35.51  ? 116 ASP B OD1 1 
ATOM   3516  O  OD2 . ASP B  1 116 ? -35.720 -55.151 75.367  1.00 33.47  ? 116 ASP B OD2 1 
ATOM   3517  N  N   . LEU B  1 117 ? -34.100 -50.253 74.805  1.00 25.90  ? 117 LEU B N   1 
ATOM   3518  C  CA  . LEU B  1 117 ? -34.157 -48.843 74.559  1.00 26.01  ? 117 LEU B CA  1 
ATOM   3519  C  C   . LEU B  1 117 ? -34.218 -48.572 73.052  1.00 26.30  ? 117 LEU B C   1 
ATOM   3520  O  O   . LEU B  1 117 ? -35.039 -47.752 72.581  1.00 26.55  ? 117 LEU B O   1 
ATOM   3521  C  CB  . LEU B  1 117 ? -32.953 -48.126 75.185  1.00 25.12  ? 117 LEU B CB  1 
ATOM   3522  C  CG  . LEU B  1 117 ? -32.823 -48.242 76.697  1.00 29.18  ? 117 LEU B CG  1 
ATOM   3523  C  CD1 . LEU B  1 117 ? -31.557 -47.523 77.194  1.00 25.57  ? 117 LEU B CD1 1 
ATOM   3524  C  CD2 . LEU B  1 117 ? -34.082 -47.700 77.404  1.00 26.41  ? 117 LEU B CD2 1 
ATOM   3525  N  N   . PHE B  1 118 ? -33.360 -49.258 72.294  1.00 22.60  ? 118 PHE B N   1 
ATOM   3526  C  CA  . PHE B  1 118 ? -33.347 -49.116 70.884  1.00 25.00  ? 118 PHE B CA  1 
ATOM   3527  C  C   . PHE B  1 118 ? -34.697 -49.558 70.289  1.00 25.98  ? 118 PHE B C   1 
ATOM   3528  O  O   . PHE B  1 118 ? -35.276 -48.870 69.474  1.00 25.24  ? 118 PHE B O   1 
ATOM   3529  C  CB  . PHE B  1 118 ? -32.211 -49.932 70.265  1.00 23.38  ? 118 PHE B CB  1 
ATOM   3530  C  CG  . PHE B  1 118 ? -30.834 -49.595 70.826  1.00 23.34  ? 118 PHE B CG  1 
ATOM   3531  C  CD1 . PHE B  1 118 ? -30.626 -48.413 71.561  1.00 22.04  ? 118 PHE B CD1 1 
ATOM   3532  C  CD2 . PHE B  1 118 ? -29.744 -50.445 70.599  1.00 21.47  ? 118 PHE B CD2 1 
ATOM   3533  C  CE1 . PHE B  1 118 ? -29.361 -48.104 72.069  1.00 24.50  ? 118 PHE B CE1 1 
ATOM   3534  C  CE2 . PHE B  1 118 ? -28.477 -50.138 71.104  1.00 22.58  ? 118 PHE B CE2 1 
ATOM   3535  C  CZ  . PHE B  1 118 ? -28.286 -48.968 71.839  1.00 24.83  ? 118 PHE B CZ  1 
ATOM   3536  N  N   . ILE B  1 119 ? -35.165 -50.699 70.722  1.00 27.09  ? 119 ILE B N   1 
ATOM   3537  C  CA  . ILE B  1 119 ? -36.390 -51.258 70.219  1.00 26.97  ? 119 ILE B CA  1 
ATOM   3538  C  C   . ILE B  1 119 ? -37.595 -50.333 70.518  1.00 27.77  ? 119 ILE B C   1 
ATOM   3539  O  O   . ILE B  1 119 ? -38.495 -50.196 69.701  1.00 32.65  ? 119 ILE B O   1 
ATOM   3540  C  CB  . ILE B  1 119 ? -36.622 -52.687 70.775  1.00 26.80  ? 119 ILE B CB  1 
ATOM   3541  C  CG1 . ILE B  1 119 ? -35.499 -53.608 70.303  1.00 25.32  ? 119 ILE B CG1 1 
ATOM   3542  C  CG2 . ILE B  1 119 ? -37.978 -53.238 70.333  1.00 26.95  ? 119 ILE B CG2 1 
ATOM   3543  C  CD1 . ILE B  1 119 ? -35.597 -55.011 70.817  1.00 23.44  ? 119 ILE B CD1 1 
ATOM   3544  N  N   . HIS B  1 120 ? -37.583 -49.697 71.680  1.00 26.74  ? 120 HIS B N   1 
ATOM   3545  C  CA  . HIS B  1 120 ? -38.618 -48.738 72.011  1.00 26.02  ? 120 HIS B CA  1 
ATOM   3546  C  C   . HIS B  1 120 ? -38.628 -47.593 71.011  1.00 27.06  ? 120 HIS B C   1 
ATOM   3547  O  O   . HIS B  1 120 ? -39.705 -47.166 70.540  1.00 24.72  ? 120 HIS B O   1 
ATOM   3548  C  CB  . HIS B  1 120 ? -38.440 -48.200 73.430  1.00 27.39  ? 120 HIS B CB  1 
ATOM   3549  C  CG  . HIS B  1 120 ? -39.377 -47.032 73.768  1.00 29.18  ? 120 HIS B CG  1 
ATOM   3550  N  ND1 . HIS B  1 120 ? -40.505 -47.184 74.526  1.00 31.22  ? 120 HIS B ND1 1 
ATOM   3551  C  CD2 . HIS B  1 120 ? -39.325 -45.669 73.413  1.00 29.96  ? 120 HIS B CD2 1 
ATOM   3552  C  CE1 . HIS B  1 120 ? -41.135 -45.978 74.648  1.00 29.42  ? 120 HIS B CE1 1 
ATOM   3553  N  NE2 . HIS B  1 120 ? -40.423 -45.059 73.977  1.00 31.29  ? 120 HIS B NE2 1 
ATOM   3554  N  N   . ASP B  1 121 ? -37.430 -47.083 70.669  1.00 22.10  ? 121 ASP B N   1 
ATOM   3555  C  CA  . ASP B  1 121 ? -37.321 -45.970 69.682  1.00 24.69  ? 121 ASP B CA  1 
ATOM   3556  C  C   . ASP B  1 121 ? -37.798 -46.396 68.278  1.00 25.02  ? 121 ASP B C   1 
ATOM   3557  O  O   . ASP B  1 121 ? -38.535 -45.647 67.594  1.00 22.98  ? 121 ASP B O   1 
ATOM   3558  C  CB  . ASP B  1 121 ? -35.892 -45.427 69.627  1.00 24.24  ? 121 ASP B CB  1 
ATOM   3559  C  CG  . ASP B  1 121 ? -35.570 -44.518 70.804  1.00 24.66  ? 121 ASP B CG  1 
ATOM   3560  O  OD1 . ASP B  1 121 ? -36.508 -44.208 71.594  1.00 24.07  ? 121 ASP B OD1 1 
ATOM   3561  O  OD2 . ASP B  1 121 ? -34.399 -44.107 70.941  1.00 22.60  ? 121 ASP B OD2 1 
ATOM   3562  N  N   . ILE B  1 122 ? -37.388 -47.587 67.861  1.00 25.12  ? 122 ILE B N   1 
ATOM   3563  C  CA  . ILE B  1 122 ? -37.763 -48.126 66.576  1.00 24.64  ? 122 ILE B CA  1 
ATOM   3564  C  C   . ILE B  1 122 ? -39.318 -48.446 66.475  1.00 26.98  ? 122 ILE B C   1 
ATOM   3565  O  O   . ILE B  1 122 ? -39.959 -48.130 65.479  1.00 27.75  ? 122 ILE B O   1 
ATOM   3566  C  CB  . ILE B  1 122 ? -36.967 -49.414 66.268  1.00 24.35  ? 122 ILE B CB  1 
ATOM   3567  C  CG1 . ILE B  1 122 ? -35.476 -49.105 66.152  1.00 22.47  ? 122 ILE B CG1 1 
ATOM   3568  C  CG2 . ILE B  1 122 ? -37.496 -50.094 64.984  1.00 23.41  ? 122 ILE B CG2 1 
ATOM   3569  C  CD1 . ILE B  1 122 ? -34.593 -50.325 66.272  1.00 21.78  ? 122 ILE B CD1 1 
ATOM   3570  N  N   . LYS B  1 123 ? -39.872 -49.060 67.521  1.00 28.56  ? 123 LYS B N   1 
ATOM   3571  C  CA  . LYS B  1 123 ? -41.320 -49.556 67.473  1.00 29.26  ? 123 LYS B CA  1 
ATOM   3572  C  C   . LYS B  1 123 ? -42.341 -48.601 68.076  1.00 31.80  ? 123 LYS B C   1 
ATOM   3573  O  O   . LYS B  1 123 ? -43.479 -48.525 67.601  1.00 35.62  ? 123 LYS B O   1 
ATOM   3574  C  CB  . LYS B  1 123 ? -41.434 -50.920 68.110  1.00 31.03  ? 123 LYS B CB  1 
ATOM   3575  C  CG  . LYS B  1 123 ? -40.845 -52.036 67.261  1.00 33.62  ? 123 LYS B CG  1 
ATOM   3576  C  CD  . LYS B  1 123 ? -40.653 -53.307 68.066  1.00 44.21  ? 123 LYS B CD  1 
ATOM   3577  C  CE  . LYS B  1 123 ? -41.957 -53.796 68.652  1.00 53.19  ? 123 LYS B CE  1 
ATOM   3578  N  NZ  . LYS B  1 123 ? -41.740 -54.942 69.584  1.00 64.05  ? 123 LYS B NZ  1 
ATOM   3579  N  N   . GLU B  1 124 ? -41.944 -47.869 69.118  1.00 30.92  ? 124 GLU B N   1 
ATOM   3580  C  CA  . GLU B  1 124 ? -42.884 -46.960 69.820  1.00 33.11  ? 124 GLU B CA  1 
ATOM   3581  C  C   . GLU B  1 124 ? -42.754 -45.554 69.349  1.00 35.15  ? 124 GLU B C   1 
ATOM   3582  O  O   . GLU B  1 124 ? -43.746 -44.911 69.006  1.00 35.93  ? 124 GLU B O   1 
ATOM   3583  C  CB  . GLU B  1 124 ? -42.670 -47.024 71.353  1.00 36.90  ? 124 GLU B CB  1 
ATOM   3584  C  CG  . GLU B  1 124 ? -42.796 -48.407 71.940  1.00 44.90  ? 124 GLU B CG  1 
ATOM   3585  C  CD  . GLU B  1 124 ? -44.164 -49.013 71.711  1.00 52.70  ? 124 GLU B CD  1 
ATOM   3586  O  OE1 . GLU B  1 124 ? -45.141 -48.241 71.515  1.00 59.03  ? 124 GLU B OE1 1 
ATOM   3587  O  OE2 . GLU B  1 124 ? -44.272 -50.254 71.728  1.00 62.23  ? 124 GLU B OE2 1 
ATOM   3588  N  N   . GLY B  1 125 ? -41.526 -45.053 69.330  1.00 31.61  ? 125 GLY B N   1 
ATOM   3589  C  CA  . GLY B  1 125 ? -41.271 -43.706 68.928  1.00 29.82  ? 125 GLY B CA  1 
ATOM   3590  C  C   . GLY B  1 125 ? -40.144 -43.093 69.719  1.00 29.08  ? 125 GLY B C   1 
ATOM   3591  O  O   . GLY B  1 125 ? -39.686 -43.661 70.685  1.00 27.78  ? 125 GLY B O   1 
ATOM   3592  N  N   . ILE B  1 126 ? -39.717 -41.915 69.307  1.00 26.42  ? 126 ILE B N   1 
ATOM   3593  C  CA  . ILE B  1 126 ? -38.574 -41.281 69.889  1.00 26.96  ? 126 ILE B CA  1 
ATOM   3594  C  C   . ILE B  1 126 ? -38.944 -40.110 70.834  1.00 28.10  ? 126 ILE B C   1 
ATOM   3595  O  O   . ILE B  1 126 ? -39.755 -39.226 70.480  1.00 27.59  ? 126 ILE B O   1 
ATOM   3596  C  CB  . ILE B  1 126 ? -37.598 -40.760 68.783  1.00 27.44  ? 126 ILE B CB  1 
ATOM   3597  C  CG1 . ILE B  1 126 ? -37.050 -41.956 67.923  1.00 27.39  ? 126 ILE B CG1 1 
ATOM   3598  C  CG2 . ILE B  1 126 ? -36.478 -39.956 69.394  1.00 24.40  ? 126 ILE B CG2 1 
ATOM   3599  C  CD1 . ILE B  1 126 ? -36.262 -41.523 66.673  1.00 23.60  ? 126 ILE B CD1 1 
ATOM   3600  N  N   . GLN B  1 127 ? -38.342 -40.115 72.031  1.00 28.07  ? 127 GLN B N   1 
ATOM   3601  C  CA  . GLN B  1 127 ? -38.494 -38.997 72.996  1.00 30.70  ? 127 GLN B CA  1 
ATOM   3602  C  C   . GLN B  1 127 ? -39.952 -38.523 73.155  1.00 30.79  ? 127 GLN B C   1 
ATOM   3603  O  O   . GLN B  1 127 ? -40.234 -37.310 73.148  1.00 33.82  ? 127 GLN B O   1 
ATOM   3604  C  CB  . GLN B  1 127 ? -37.580 -37.820 72.603  1.00 27.36  ? 127 GLN B CB  1 
ATOM   3605  C  CG  . GLN B  1 127 ? -36.099 -38.179 72.585  1.00 29.41  ? 127 GLN B CG  1 
ATOM   3606  C  CD  . GLN B  1 127 ? -35.231 -37.068 72.037  1.00 30.69  ? 127 GLN B CD  1 
ATOM   3607  O  OE1 . GLN B  1 127 ? -34.241 -36.684 72.650  1.00 38.12  ? 127 GLN B OE1 1 
ATOM   3608  N  NE2 . GLN B  1 127 ? -35.596 -36.551 70.905  1.00 29.46  ? 127 GLN B NE2 1 
ATOM   3609  N  N   . GLY B  1 128 ? -40.849 -39.456 73.293  1.00 30.30  ? 128 GLY B N   1 
ATOM   3610  C  CA  . GLY B  1 128 ? -42.234 -39.137 73.558  1.00 32.33  ? 128 GLY B CA  1 
ATOM   3611  C  C   . GLY B  1 128 ? -43.071 -38.818 72.327  1.00 34.62  ? 128 GLY B C   1 
ATOM   3612  O  O   . GLY B  1 128 ? -44.241 -38.560 72.435  1.00 33.94  ? 128 GLY B O   1 
ATOM   3613  N  N   . THR B  1 129 ? -42.455 -38.840 71.155  1.00 32.88  ? 129 THR B N   1 
ATOM   3614  C  CA  . THR B  1 129 ? -43.218 -38.570 69.889  1.00 32.44  ? 129 THR B CA  1 
ATOM   3615  C  C   . THR B  1 129 ? -43.496 -39.840 69.138  1.00 32.70  ? 129 THR B C   1 
ATOM   3616  O  O   . THR B  1 129 ? -43.082 -40.924 69.555  1.00 34.64  ? 129 THR B O   1 
ATOM   3617  C  CB  . THR B  1 129 ? -42.473 -37.604 68.970  1.00 29.42  ? 129 THR B CB  1 
ATOM   3618  O  OG1 . THR B  1 129 ? -41.347 -38.286 68.362  1.00 31.11  ? 129 THR B OG1 1 
ATOM   3619  C  CG2 . THR B  1 129 ? -41.986 -36.407 69.746  1.00 30.24  ? 129 THR B CG2 1 
ATOM   3620  N  N   . LEU B  1 130 ? -44.188 -39.713 68.023  1.00 32.04  ? 130 LEU B N   1 
ATOM   3621  C  CA  . LEU B  1 130 ? -44.520 -40.842 67.203  1.00 33.02  ? 130 LEU B CA  1 
ATOM   3622  C  C   . LEU B  1 130 ? -43.494 -41.043 66.034  1.00 32.62  ? 130 LEU B C   1 
ATOM   3623  O  O   . LEU B  1 130 ? -43.650 -41.944 65.204  1.00 33.77  ? 130 LEU B O   1 
ATOM   3624  C  CB  . LEU B  1 130 ? -45.952 -40.701 66.656  1.00 33.63  ? 130 LEU B CB  1 
ATOM   3625  C  CG  . LEU B  1 130 ? -47.055 -40.724 67.744  1.00 37.57  ? 130 LEU B CG  1 
ATOM   3626  C  CD1 . LEU B  1 130 ? -48.420 -40.326 67.180  1.00 38.58  ? 130 LEU B CD1 1 
ATOM   3627  C  CD2 . LEU B  1 130 ? -47.117 -42.102 68.417  1.00 39.09  ? 130 LEU B CD2 1 
ATOM   3628  N  N   . ASN B  1 131 ? -42.460 -40.193 65.994  1.00 32.07  ? 131 ASN B N   1 
ATOM   3629  C  CA  . ASN B  1 131 ? -41.352 -40.367 65.020  1.00 29.05  ? 131 ASN B CA  1 
ATOM   3630  C  C   . ASN B  1 131 ? -40.541 -41.535 65.386  1.00 28.16  ? 131 ASN B C   1 
ATOM   3631  O  O   . ASN B  1 131 ? -39.985 -41.587 66.463  1.00 32.30  ? 131 ASN B O   1 
ATOM   3632  C  CB  . ASN B  1 131 ? -40.473 -39.130 64.990  1.00 29.18  ? 131 ASN B CB  1 
ATOM   3633  C  CG  . ASN B  1 131 ? -41.222 -37.903 64.591  1.00 32.34  ? 131 ASN B CG  1 
ATOM   3634  O  OD1 . ASN B  1 131 ? -41.316 -36.929 65.367  1.00 35.82  ? 131 ASN B OD1 1 
ATOM   3635  N  ND2 . ASN B  1 131 ? -41.774 -37.916 63.397  1.00 24.50  ? 131 ASN B ND2 1 
ATOM   3636  N  N   . LYS B  1 132 ? -40.453 -42.488 64.504  1.00 25.92  ? 132 LYS B N   1 
ATOM   3637  C  CA  . LYS B  1 132 ? -39.721 -43.715 64.803  1.00 26.82  ? 132 LYS B CA  1 
ATOM   3638  C  C   . LYS B  1 132 ? -38.305 -43.739 64.183  1.00 25.26  ? 132 LYS B C   1 
ATOM   3639  O  O   . LYS B  1 132 ? -38.045 -43.094 63.160  1.00 23.30  ? 132 LYS B O   1 
ATOM   3640  C  CB  . LYS B  1 132 ? -40.536 -44.947 64.377  1.00 28.34  ? 132 LYS B CB  1 
ATOM   3641  C  CG  . LYS B  1 132 ? -41.822 -45.114 65.184  1.00 33.88  ? 132 LYS B CG  1 
ATOM   3642  C  CD  . LYS B  1 132 ? -42.664 -46.236 64.679  1.00 38.65  ? 132 LYS B CD  1 
ATOM   3643  C  CE  . LYS B  1 132 ? -43.992 -46.288 65.415  1.00 38.95  ? 132 LYS B CE  1 
ATOM   3644  N  NZ  . LYS B  1 132 ? -44.815 -47.442 64.971  1.00 48.46  ? 132 LYS B NZ  1 
ATOM   3645  N  N   . ALA B  1 133 ? -37.403 -44.487 64.828  1.00 26.61  ? 133 ALA B N   1 
ATOM   3646  C  CA  . ALA B  1 133 ? -36.041 -44.616 64.377  1.00 24.66  ? 133 ALA B CA  1 
ATOM   3647  C  C   . ALA B  1 133 ? -35.936 -45.668 63.250  1.00 25.08  ? 133 ALA B C   1 
ATOM   3648  O  O   . ALA B  1 133 ? -36.521 -46.723 63.336  1.00 27.06  ? 133 ALA B O   1 
ATOM   3649  C  CB  . ALA B  1 133 ? -35.158 -44.995 65.525  1.00 27.48  ? 133 ALA B CB  1 
ATOM   3650  N  N   . GLY B  1 134 ? -35.173 -45.347 62.206  1.00 23.38  ? 134 GLY B N   1 
ATOM   3651  C  CA  . GLY B  1 134 ? -35.033 -46.259 61.028  1.00 22.07  ? 134 GLY B CA  1 
ATOM   3652  C  C   . GLY B  1 134 ? -33.702 -47.036 60.986  1.00 23.02  ? 134 GLY B C   1 
ATOM   3653  O  O   . GLY B  1 134 ? -33.408 -47.736 60.001  1.00 21.51  ? 134 GLY B O   1 
ATOM   3654  N  N   . PHE B  1 135 ? -32.902 -46.911 62.054  1.00 22.07  ? 135 PHE B N   1 
ATOM   3655  C  CA  . PHE B  1 135 ? -31.633 -47.589 62.126  1.00 22.22  ? 135 PHE B CA  1 
ATOM   3656  C  C   . PHE B  1 135 ? -31.007 -47.427 63.533  1.00 22.17  ? 135 PHE B C   1 
ATOM   3657  O  O   . PHE B  1 135 ? -31.439 -46.629 64.302  1.00 23.60  ? 135 PHE B O   1 
ATOM   3658  C  CB  . PHE B  1 135 ? -30.676 -47.038 61.065  1.00 21.06  ? 135 PHE B CB  1 
ATOM   3659  C  CG  . PHE B  1 135 ? -30.313 -45.581 61.276  1.00 22.02  ? 135 PHE B CG  1 
ATOM   3660  C  CD1 . PHE B  1 135 ? -31.115 -44.555 60.739  1.00 21.07  ? 135 PHE B CD1 1 
ATOM   3661  C  CD2 . PHE B  1 135 ? -29.192 -45.231 62.019  1.00 21.33  ? 135 PHE B CD2 1 
ATOM   3662  C  CE1 . PHE B  1 135 ? -30.796 -43.238 60.944  1.00 22.03  ? 135 PHE B CE1 1 
ATOM   3663  C  CE2 . PHE B  1 135 ? -28.865 -43.907 62.217  1.00 22.31  ? 135 PHE B CE2 1 
ATOM   3664  C  CZ  . PHE B  1 135 ? -29.667 -42.904 61.681  1.00 22.90  ? 135 PHE B CZ  1 
ATOM   3665  N  N   . VAL B  1 136 ? -29.986 -48.221 63.817  1.00 21.83  ? 136 VAL B N   1 
ATOM   3666  C  CA  . VAL B  1 136 ? -29.240 -48.100 65.071  1.00 21.27  ? 136 VAL B CA  1 
ATOM   3667  C  C   . VAL B  1 136 ? -27.856 -47.621 64.786  1.00 19.40  ? 136 VAL B C   1 
ATOM   3668  O  O   . VAL B  1 136 ? -27.213 -48.075 63.814  1.00 19.78  ? 136 VAL B O   1 
ATOM   3669  C  CB  . VAL B  1 136 ? -29.168 -49.469 65.846  1.00 20.54  ? 136 VAL B CB  1 
ATOM   3670  C  CG1 . VAL B  1 136 ? -28.495 -49.281 67.218  1.00 18.57  ? 136 VAL B CG1 1 
ATOM   3671  C  CG2 . VAL B  1 136 ? -30.540 -50.068 65.995  1.00 19.91  ? 136 VAL B CG2 1 
HETATM 3672  N  N   . KCX B  1 137 ? -27.374 -46.705 65.608  1.00 19.23  ? 137 KCX B N   1 
HETATM 3673  C  CA  . KCX B  1 137 ? -26.011 -46.153 65.458  1.00 20.04  ? 137 KCX B CA  1 
HETATM 3674  C  CB  . KCX B  1 137 ? -26.089 -44.610 65.303  1.00 19.85  ? 137 KCX B CB  1 
HETATM 3675  C  CG  . KCX B  1 137 ? -24.694 -43.902 65.571  1.00 20.81  ? 137 KCX B CG  1 
HETATM 3676  C  CD  . KCX B  1 137 ? -23.787 -43.966 64.327  1.00 20.57  ? 137 KCX B CD  1 
HETATM 3677  C  CE  . KCX B  1 137 ? -22.485 -43.199 64.551  1.00 20.70  ? 137 KCX B CE  1 
HETATM 3678  N  NZ  . KCX B  1 137 ? -22.679 -41.741 64.450  1.00 21.76  ? 137 KCX B NZ  1 
HETATM 3679  C  C   . KCX B  1 137 ? -25.172 -46.506 66.673  1.00 21.84  ? 137 KCX B C   1 
HETATM 3680  O  O   . KCX B  1 137 ? -25.628 -46.372 67.818  1.00 24.26  ? 137 KCX B O   1 
HETATM 3681  C  CX  . KCX B  1 137 ? -21.695 -40.913 64.079  1.00 21.24  ? 137 KCX B CX  1 
HETATM 3682  O  OQ1 . KCX B  1 137 ? -20.526 -41.313 63.784  1.00 20.71  ? 137 KCX B OQ1 1 
HETATM 3683  O  OQ2 . KCX B  1 137 ? -21.955 -39.605 64.013  1.00 22.11  ? 137 KCX B OQ2 1 
ATOM   3684  N  N   . ILE B  1 138 ? -23.913 -46.965 66.420  1.00 21.90  ? 138 ILE B N   1 
ATOM   3685  C  CA  . ILE B  1 138 ? -22.969 -47.303 67.487  1.00 21.69  ? 138 ILE B CA  1 
ATOM   3686  C  C   . ILE B  1 138 ? -21.572 -46.743 67.148  1.00 21.92  ? 138 ILE B C   1 
ATOM   3687  O  O   . ILE B  1 138 ? -21.277 -46.427 65.964  1.00 20.69  ? 138 ILE B O   1 
ATOM   3688  C  CB  . ILE B  1 138 ? -22.864 -48.832 67.691  1.00 25.19  ? 138 ILE B CB  1 
ATOM   3689  C  CG1 . ILE B  1 138 ? -22.371 -49.508 66.403  1.00 25.10  ? 138 ILE B CG1 1 
ATOM   3690  C  CG2 . ILE B  1 138 ? -24.199 -49.407 68.109  1.00 25.02  ? 138 ILE B CG2 1 
ATOM   3691  C  CD1 . ILE B  1 138 ? -22.107 -50.981 66.546  1.00 29.30  ? 138 ILE B CD1 1 
ATOM   3692  N  N   . ALA B  1 139 ? -20.711 -46.632 68.152  1.00 19.67  ? 139 ALA B N   1 
ATOM   3693  C  CA  . ALA B  1 139 ? -19.426 -46.047 67.944  1.00 21.31  ? 139 ALA B CA  1 
ATOM   3694  C  C   . ALA B  1 139 ? -18.294 -46.774 68.646  1.00 22.02  ? 139 ALA B C   1 
ATOM   3695  O  O   . ALA B  1 139 ? -18.495 -47.464 69.681  1.00 23.70  ? 139 ALA B O   1 
ATOM   3696  C  CB  . ALA B  1 139 ? -19.444 -44.550 68.372  1.00 20.56  ? 139 ALA B CB  1 
ATOM   3697  N  N   . ALA B  1 140 ? -17.126 -46.630 68.098  1.00 21.74  ? 140 ALA B N   1 
ATOM   3698  C  CA  . ALA B  1 140 ? -15.864 -47.012 68.778  1.00 24.21  ? 140 ALA B CA  1 
ATOM   3699  C  C   . ALA B  1 140 ? -14.839 -46.175 68.210  1.00 24.95  ? 140 ALA B C   1 
ATOM   3700  O  O   . ALA B  1 140 ? -14.918 -45.813 67.044  1.00 22.83  ? 140 ALA B O   1 
ATOM   3701  C  CB  . ALA B  1 140 ? -15.539 -48.503 68.548  1.00 20.82  ? 140 ALA B CB  1 
ATOM   3702  N  N   . ASP B  1 141 ? -13.852 -45.820 68.994  1.00 26.92  ? 141 ASP B N   1 
ATOM   3703  C  CA  . ASP B  1 141 ? -12.837 -44.967 68.512  1.00 28.66  ? 141 ASP B CA  1 
ATOM   3704  C  C   . ASP B  1 141 ? -11.435 -45.349 69.048  1.00 31.03  ? 141 ASP B C   1 
ATOM   3705  O  O   . ASP B  1 141 ? -11.126 -46.515 69.213  1.00 29.45  ? 141 ASP B O   1 
ATOM   3706  C  CB  . ASP B  1 141 ? -13.165 -43.507 68.840  1.00 29.04  ? 141 ASP B CB  1 
ATOM   3707  C  CG  . ASP B  1 141 ? -12.465 -42.529 67.904  1.00 33.98  ? 141 ASP B CG  1 
ATOM   3708  O  OD1 . ASP B  1 141 ? -11.229 -42.350 68.039  1.00 34.22  ? 141 ASP B OD1 1 
ATOM   3709  O  OD2 . ASP B  1 141 ? -13.149 -41.942 67.036  1.00 30.21  ? 141 ASP B OD2 1 
ATOM   3710  N  N   . GLU B  1 142 ? -10.621 -44.342 69.310  1.00 30.18  ? 142 GLU B N   1 
ATOM   3711  C  CA  . GLU B  1 142 ? -9.225  -44.554 69.686  1.00 35.12  ? 142 GLU B CA  1 
ATOM   3712  C  C   . GLU B  1 142 ? -9.035  -45.590 70.871  1.00 32.92  ? 142 GLU B C   1 
ATOM   3713  O  O   . GLU B  1 142 ? -8.138  -46.476 70.803  1.00 34.12  ? 142 GLU B O   1 
ATOM   3714  C  CB  . GLU B  1 142 ? -8.553  -43.219 70.012  1.00 40.78  ? 142 GLU B CB  1 
ATOM   3715  C  CG  . GLU B  1 142 ? -7.106  -43.149 69.612  1.00 56.10  ? 142 GLU B CG  1 
ATOM   3716  C  CD  . GLU B  1 142 ? -6.639  -41.707 69.332  1.00 71.79  ? 142 GLU B CD  1 
ATOM   3717  O  OE1 . GLU B  1 142 ? -7.100  -40.778 70.039  1.00 79.91  ? 142 GLU B OE1 1 
ATOM   3718  O  OE2 . GLU B  1 142 ? -5.812  -41.513 68.402  1.00 80.28  ? 142 GLU B OE2 1 
ATOM   3719  N  N   . PRO B  1 143 ? -9.878  -45.475 71.949  1.00 30.35  ? 143 PRO B N   1 
ATOM   3720  C  CA  . PRO B  1 143 ? -9.750  -46.415 73.111  1.00 29.02  ? 143 PRO B CA  1 
ATOM   3721  C  C   . PRO B  1 143 ? -10.064 -47.880 72.732  1.00 30.95  ? 143 PRO B C   1 
ATOM   3722  O  O   . PRO B  1 143 ? -9.890  -48.747 73.522  1.00 37.20  ? 143 PRO B O   1 
ATOM   3723  C  CB  . PRO B  1 143 ? -10.797 -45.881 74.121  1.00 30.79  ? 143 PRO B CB  1 
ATOM   3724  C  CG  . PRO B  1 143 ? -11.119 -44.440 73.638  1.00 29.97  ? 143 PRO B CG  1 
ATOM   3725  C  CD  . PRO B  1 143 ? -10.962 -44.473 72.151  1.00 31.29  ? 143 PRO B CD  1 
ATOM   3726  N  N   . GLY B  1 144 ? -10.539 -48.103 71.486  1.00 30.83  ? 144 GLY B N   1 
ATOM   3727  C  CA  . GLY B  1 144 ? -10.824 -49.478 70.990  1.00 26.80  ? 144 GLY B CA  1 
ATOM   3728  C  C   . GLY B  1 144 ? -12.138 -50.052 71.500  1.00 28.78  ? 144 GLY B C   1 
ATOM   3729  O  O   . GLY B  1 144 ? -13.059 -49.293 71.928  1.00 28.76  ? 144 GLY B O   1 
ATOM   3730  N  N   . ILE B  1 145 ? -12.251 -51.363 71.465  1.00 30.96  ? 145 ILE B N   1 
ATOM   3731  C  CA  . ILE B  1 145 ? -13.481 -52.039 71.877  1.00 31.94  ? 145 ILE B CA  1 
ATOM   3732  C  C   . ILE B  1 145 ? -13.516 -52.317 73.413  1.00 32.40  ? 145 ILE B C   1 
ATOM   3733  O  O   . ILE B  1 145 ? -13.194 -53.373 73.842  1.00 34.86  ? 145 ILE B O   1 
ATOM   3734  C  CB  . ILE B  1 145 ? -13.696 -53.391 71.090  1.00 31.51  ? 145 ILE B CB  1 
ATOM   3735  C  CG1 . ILE B  1 145 ? -13.602 -53.159 69.551  1.00 28.26  ? 145 ILE B CG1 1 
ATOM   3736  C  CG2 . ILE B  1 145 ? -15.012 -54.021 71.460  1.00 31.06  ? 145 ILE B CG2 1 
ATOM   3737  C  CD1 . ILE B  1 145 ? -14.701 -52.225 68.983  1.00 27.29  ? 145 ILE B CD1 1 
ATOM   3738  N  N   . THR B  1 146 ? -13.921 -51.306 74.197  1.00 31.15  ? 146 THR B N   1 
ATOM   3739  C  CA  . THR B  1 146 ? -14.064 -51.470 75.668  1.00 30.63  ? 146 THR B CA  1 
ATOM   3740  C  C   . THR B  1 146 ? -15.221 -52.390 75.982  1.00 31.46  ? 146 THR B C   1 
ATOM   3741  O  O   . THR B  1 146 ? -16.017 -52.762 75.072  1.00 31.92  ? 146 THR B O   1 
ATOM   3742  C  CB  . THR B  1 146 ? -14.309 -50.119 76.376  1.00 30.95  ? 146 THR B CB  1 
ATOM   3743  O  OG1 . THR B  1 146 ? -15.601 -49.573 75.961  1.00 26.17  ? 146 THR B OG1 1 
ATOM   3744  C  CG2 . THR B  1 146 ? -13.210 -49.131 76.047  1.00 27.42  ? 146 THR B CG2 1 
ATOM   3745  N  N   . LYS B  1 147 ? -15.348 -52.762 77.246  1.00 29.02  ? 147 LYS B N   1 
ATOM   3746  C  CA  . LYS B  1 147 ? -16.435 -53.619 77.679  1.00 30.11  ? 147 LYS B CA  1 
ATOM   3747  C  C   . LYS B  1 147 ? -17.779 -52.963 77.422  1.00 27.68  ? 147 LYS B C   1 
ATOM   3748  O  O   . LYS B  1 147 ? -18.668 -53.580 76.991  1.00 25.11  ? 147 LYS B O   1 
ATOM   3749  C  CB  . LYS B  1 147 ? -16.292 -53.970 79.183  1.00 35.08  ? 147 LYS B CB  1 
ATOM   3750  C  CG  . LYS B  1 147 ? -14.913 -54.549 79.565  1.00 47.19  ? 147 LYS B CG  1 
ATOM   3751  C  CD  . LYS B  1 147 ? -14.610 -55.849 78.803  1.00 46.37  ? 147 LYS B CD  1 
ATOM   3752  C  CE  . LYS B  1 147 ? -15.425 -57.014 79.347  1.00 54.95  ? 147 LYS B CE  1 
ATOM   3753  N  NZ  . LYS B  1 147 ? -15.059 -58.309 78.688  1.00 60.06  ? 147 LYS B NZ  1 
ATOM   3754  N  N   . ASP B  1 148 ? -17.879 -51.666 77.720  1.00 27.94  ? 148 ASP B N   1 
ATOM   3755  C  CA  . ASP B  1 148 ? -19.134 -50.928 77.484  1.00 29.00  ? 148 ASP B CA  1 
ATOM   3756  C  C   . ASP B  1 148 ? -19.428 -50.727 75.966  1.00 26.39  ? 148 ASP B C   1 
ATOM   3757  O  O   . ASP B  1 148 ? -20.558 -50.874 75.529  1.00 24.44  ? 148 ASP B O   1 
ATOM   3758  C  CB  . ASP B  1 148 ? -19.139 -49.599 78.235  1.00 30.18  ? 148 ASP B CB  1 
ATOM   3759  C  CG  . ASP B  1 148 ? -19.436 -49.777 79.719  1.00 35.97  ? 148 ASP B CG  1 
ATOM   3760  O  OD1 . ASP B  1 148 ? -19.498 -48.743 80.475  1.00 35.84  ? 148 ASP B OD1 1 
ATOM   3761  O  OD2 . ASP B  1 148 ? -19.614 -50.933 80.138  1.00 37.65  ? 148 ASP B OD2 1 
ATOM   3762  N  N   . VAL B  1 149 ? -18.398 -50.396 75.197  1.00 25.42  ? 149 VAL B N   1 
ATOM   3763  C  CA  . VAL B  1 149 ? -18.543 -50.283 73.775  1.00 27.09  ? 149 VAL B CA  1 
ATOM   3764  C  C   . VAL B  1 149 ? -19.053 -51.627 73.176  1.00 26.76  ? 149 VAL B C   1 
ATOM   3765  O  O   . VAL B  1 149 ? -19.945 -51.643 72.287  1.00 26.81  ? 149 VAL B O   1 
ATOM   3766  C  CB  . VAL B  1 149 ? -17.212 -49.880 73.092  1.00 27.31  ? 149 VAL B CB  1 
ATOM   3767  C  CG1 . VAL B  1 149 ? -17.255 -50.211 71.605  1.00 27.54  ? 149 VAL B CG1 1 
ATOM   3768  C  CG2 . VAL B  1 149 ? -16.930 -48.399 73.309  1.00 26.19  ? 149 VAL B CG2 1 
ATOM   3769  N  N   . GLU B  1 150 ? -18.496 -52.733 73.665  1.00 26.36  ? 150 GLU B N   1 
ATOM   3770  C  CA  . GLU B  1 150 ? -18.886 -54.069 73.202  1.00 28.47  ? 150 GLU B CA  1 
ATOM   3771  C  C   . GLU B  1 150 ? -20.352 -54.383 73.537  1.00 27.20  ? 150 GLU B C   1 
ATOM   3772  O  O   . GLU B  1 150 ? -21.071 -54.904 72.723  1.00 25.51  ? 150 GLU B O   1 
ATOM   3773  C  CB  . GLU B  1 150 ? -17.961 -55.150 73.804  1.00 30.27  ? 150 GLU B CB  1 
ATOM   3774  C  CG  . GLU B  1 150 ? -18.283 -56.558 73.325  1.00 34.71  ? 150 GLU B CG  1 
ATOM   3775  C  CD  . GLU B  1 150 ? -17.427 -57.618 73.984  1.00 39.72  ? 150 GLU B CD  1 
ATOM   3776  O  OE1 . GLU B  1 150 ? -17.626 -58.797 73.688  1.00 43.35  ? 150 GLU B OE1 1 
ATOM   3777  O  OE2 . GLU B  1 150 ? -16.561 -57.264 74.798  1.00 42.72  ? 150 GLU B OE2 1 
ATOM   3778  N  N   . LYS B  1 151 ? -20.765 -54.052 74.749  1.00 26.31  ? 151 LYS B N   1 
ATOM   3779  C  CA  . LYS B  1 151 ? -22.177 -54.234 75.154  1.00 28.27  ? 151 LYS B CA  1 
ATOM   3780  C  C   . LYS B  1 151 ? -23.145 -53.492 74.206  1.00 25.78  ? 151 LYS B C   1 
ATOM   3781  O  O   . LYS B  1 151 ? -24.219 -54.037 73.827  1.00 28.82  ? 151 LYS B O   1 
ATOM   3782  C  CB  . LYS B  1 151 ? -22.388 -53.781 76.596  1.00 27.81  ? 151 LYS B CB  1 
ATOM   3783  C  CG  . LYS B  1 151 ? -21.700 -54.671 77.617  1.00 33.03  ? 151 LYS B CG  1 
ATOM   3784  C  CD  . LYS B  1 151 ? -21.542 -53.975 78.953  1.00 39.72  ? 151 LYS B CD  1 
ATOM   3785  C  CE  . LYS B  1 151 ? -22.872 -53.715 79.604  1.00 46.51  ? 151 LYS B CE  1 
ATOM   3786  N  NZ  . LYS B  1 151 ? -22.699 -53.094 80.945  1.00 58.71  ? 151 LYS B NZ  1 
ATOM   3787  N  N   . VAL B  1 152 ? -22.773 -52.249 73.818  1.00 23.48  ? 152 VAL B N   1 
ATOM   3788  C  CA  . VAL B  1 152 ? -23.602 -51.455 72.924  1.00 22.31  ? 152 VAL B CA  1 
ATOM   3789  C  C   . VAL B  1 152 ? -23.686 -52.100 71.538  1.00 21.64  ? 152 VAL B C   1 
ATOM   3790  O  O   . VAL B  1 152 ? -24.711 -52.136 70.950  1.00 19.95  ? 152 VAL B O   1 
ATOM   3791  C  CB  . VAL B  1 152 ? -23.083 -49.991 72.806  1.00 23.18  ? 152 VAL B CB  1 
ATOM   3792  C  CG1 . VAL B  1 152 ? -23.839 -49.241 71.727  1.00 21.27  ? 152 VAL B CG1 1 
ATOM   3793  C  CG2 . VAL B  1 152 ? -23.211 -49.275 74.145  1.00 23.95  ? 152 VAL B CG2 1 
ATOM   3794  N  N   . ILE B  1 153 ? -22.561 -52.611 71.054  1.00 22.04  ? 153 ILE B N   1 
ATOM   3795  C  CA  . ILE B  1 153 ? -22.528 -53.293 69.780  1.00 23.25  ? 153 ILE B CA  1 
ATOM   3796  C  C   . ILE B  1 153 ? -23.509 -54.508 69.761  1.00 25.44  ? 153 ILE B C   1 
ATOM   3797  O  O   . ILE B  1 153 ? -24.277 -54.697 68.790  1.00 22.47  ? 153 ILE B O   1 
ATOM   3798  C  CB  . ILE B  1 153 ? -21.088 -53.787 69.427  1.00 24.88  ? 153 ILE B CB  1 
ATOM   3799  C  CG1 . ILE B  1 153 ? -20.174 -52.615 69.212  1.00 23.54  ? 153 ILE B CG1 1 
ATOM   3800  C  CG2 . ILE B  1 153 ? -21.113 -54.691 68.180  1.00 21.17  ? 153 ILE B CG2 1 
ATOM   3801  C  CD1 . ILE B  1 153 ? -18.713 -52.991 69.118  1.00 26.01  ? 153 ILE B CD1 1 
ATOM   3802  N  N   . ARG B  1 154 ? -23.484 -55.306 70.826  1.00 26.15  ? 154 ARG B N   1 
ATOM   3803  C  CA  . ARG B  1 154 ? -24.361 -56.509 70.908  1.00 27.49  ? 154 ARG B CA  1 
ATOM   3804  C  C   . ARG B  1 154 ? -25.828 -56.146 71.059  1.00 27.07  ? 154 ARG B C   1 
ATOM   3805  O  O   . ARG B  1 154 ? -26.694 -56.846 70.560  1.00 30.38  ? 154 ARG B O   1 
ATOM   3806  C  CB  . ARG B  1 154 ? -23.894 -57.464 72.044  1.00 27.15  ? 154 ARG B CB  1 
ATOM   3807  C  CG  . ARG B  1 154 ? -22.467 -57.946 71.857  1.00 25.27  ? 154 ARG B CG  1 
ATOM   3808  C  CD  . ARG B  1 154 ? -22.054 -59.004 72.900  1.00 27.10  ? 154 ARG B CD  1 
ATOM   3809  N  NE  . ARG B  1 154 ? -20.645 -59.316 72.767  1.00 26.46  ? 154 ARG B NE  1 
ATOM   3810  C  CZ  . ARG B  1 154 ? -20.150 -60.189 71.883  1.00 27.59  ? 154 ARG B CZ  1 
ATOM   3811  N  NH1 . ARG B  1 154 ? -18.860 -60.398 71.822  1.00 29.62  ? 154 ARG B NH1 1 
ATOM   3812  N  NH2 . ARG B  1 154 ? -20.971 -60.852 71.055  1.00 23.36  ? 154 ARG B NH2 1 
ATOM   3813  N  N   . ALA B  1 155 ? -26.102 -55.041 71.747  1.00 26.47  ? 155 ALA B N   1 
ATOM   3814  C  CA  . ALA B  1 155 ? -27.488 -54.541 71.876  1.00 28.13  ? 155 ALA B CA  1 
ATOM   3815  C  C   . ALA B  1 155 ? -28.035 -54.097 70.495  1.00 27.40  ? 155 ALA B C   1 
ATOM   3816  O  O   . ALA B  1 155 ? -29.226 -54.234 70.207  1.00 28.05  ? 155 ALA B O   1 
ATOM   3817  C  CB  . ALA B  1 155 ? -27.552 -53.398 72.862  1.00 27.23  ? 155 ALA B CB  1 
ATOM   3818  N  N   . ALA B  1 156 ? -27.164 -53.571 69.676  1.00 28.35  ? 156 ALA B N   1 
ATOM   3819  C  CA  . ALA B  1 156 ? -27.529 -53.167 68.355  1.00 26.91  ? 156 ALA B CA  1 
ATOM   3820  C  C   . ALA B  1 156 ? -27.886 -54.395 67.521  1.00 26.08  ? 156 ALA B C   1 
ATOM   3821  O  O   . ALA B  1 156 ? -28.803 -54.367 66.743  1.00 27.15  ? 156 ALA B O   1 
ATOM   3822  C  CB  . ALA B  1 156 ? -26.389 -52.392 67.706  1.00 21.81  ? 156 ALA B CB  1 
ATOM   3823  N  N   . ALA B  1 157 ? -27.127 -55.475 67.710  1.00 26.15  ? 157 ALA B N   1 
ATOM   3824  C  CA  . ALA B  1 157 ? -27.390 -56.714 67.013  1.00 28.21  ? 157 ALA B CA  1 
ATOM   3825  C  C   . ALA B  1 157 ? -28.756 -57.207 67.355  1.00 29.35  ? 157 ALA B C   1 
ATOM   3826  O  O   . ALA B  1 157 ? -29.527 -57.597 66.470  1.00 30.00  ? 157 ALA B O   1 
ATOM   3827  C  CB  . ALA B  1 157 ? -26.315 -57.785 67.370  1.00 25.44  ? 157 ALA B CB  1 
ATOM   3828  N  N   . ILE B  1 158 ? -29.086 -57.191 68.672  1.00 27.60  ? 158 ILE B N   1 
ATOM   3829  C  CA  . ILE B  1 158 ? -30.386 -57.617 69.130  1.00 27.76  ? 158 ILE B CA  1 
ATOM   3830  C  C   . ILE B  1 158 ? -31.492 -56.778 68.488  1.00 28.96  ? 158 ILE B C   1 
ATOM   3831  O  O   . ILE B  1 158 ? -32.518 -57.312 68.057  1.00 29.50  ? 158 ILE B O   1 
ATOM   3832  C  CB  . ILE B  1 158 ? -30.503 -57.537 70.675  1.00 29.03  ? 158 ILE B CB  1 
ATOM   3833  C  CG1 . ILE B  1 158 ? -29.541 -58.553 71.340  1.00 27.33  ? 158 ILE B CG1 1 
ATOM   3834  C  CG2 . ILE B  1 158 ? -31.925 -57.800 71.116  1.00 25.50  ? 158 ILE B CG2 1 
ATOM   3835  C  CD1 . ILE B  1 158 ? -29.463 -58.419 72.827  1.00 29.39  ? 158 ILE B CD1 1 
ATOM   3836  N  N   . ALA B  1 159 ? -31.281 -55.456 68.426  1.00 28.21  ? 159 ALA B N   1 
ATOM   3837  C  CA  . ALA B  1 159 ? -32.278 -54.546 67.805  1.00 28.00  ? 159 ALA B CA  1 
ATOM   3838  C  C   . ALA B  1 159 ? -32.465 -54.861 66.319  1.00 28.09  ? 159 ALA B C   1 
ATOM   3839  O  O   . ALA B  1 159 ? -33.603 -54.903 65.814  1.00 31.99  ? 159 ALA B O   1 
ATOM   3840  C  CB  . ALA B  1 159 ? -31.874 -53.091 67.999  1.00 28.60  ? 159 ALA B CB  1 
ATOM   3841  N  N   . ASN B  1 160 ? -31.352 -55.083 65.617  1.00 26.51  ? 160 ASN B N   1 
ATOM   3842  C  CA  . ASN B  1 160 ? -31.402 -55.439 64.192  1.00 28.99  ? 160 ASN B CA  1 
ATOM   3843  C  C   . ASN B  1 160 ? -32.157 -56.769 63.936  1.00 33.30  ? 160 ASN B C   1 
ATOM   3844  O  O   . ASN B  1 160 ? -33.047 -56.849 63.042  1.00 34.30  ? 160 ASN B O   1 
ATOM   3845  C  CB  . ASN B  1 160 ? -30.014 -55.531 63.619  1.00 28.04  ? 160 ASN B CB  1 
ATOM   3846  C  CG  . ASN B  1 160 ? -29.984 -56.255 62.278  1.00 27.52  ? 160 ASN B CG  1 
ATOM   3847  O  OD1 . ASN B  1 160 ? -29.568 -57.422 62.195  1.00 29.86  ? 160 ASN B OD1 1 
ATOM   3848  N  ND2 . ASN B  1 160 ? -30.444 -55.568 61.210  1.00 25.73  ? 160 ASN B ND2 1 
ATOM   3849  N  N   . LYS B  1 161 ? -31.806 -57.795 64.693  1.00 32.64  ? 161 LYS B N   1 
ATOM   3850  C  CA  . LYS B  1 161 ? -32.430 -59.104 64.529  1.00 37.56  ? 161 LYS B CA  1 
ATOM   3851  C  C   . LYS B  1 161 ? -33.917 -59.041 64.861  1.00 38.99  ? 161 LYS B C   1 
ATOM   3852  O  O   . LYS B  1 161 ? -34.695 -59.743 64.297  1.00 41.55  ? 161 LYS B O   1 
ATOM   3853  C  CB  . LYS B  1 161 ? -31.738 -60.131 65.384  1.00 35.59  ? 161 LYS B CB  1 
ATOM   3854  C  CG  . LYS B  1 161 ? -30.292 -60.371 64.988  1.00 39.98  ? 161 LYS B CG  1 
ATOM   3855  C  CD  . LYS B  1 161 ? -29.525 -61.077 66.084  1.00 42.38  ? 161 LYS B CD  1 
ATOM   3856  C  CE  . LYS B  1 161 ? -29.904 -62.514 66.175  1.00 41.20  ? 161 LYS B CE  1 
ATOM   3857  N  NZ  . LYS B  1 161 ? -29.246 -63.170 67.326  1.00 44.85  ? 161 LYS B NZ  1 
ATOM   3858  N  N   . GLU B  1 162 ? -34.278 -58.163 65.792  1.00 39.10  ? 162 GLU B N   1 
ATOM   3859  C  CA  . GLU B  1 162 ? -35.689 -57.990 66.198  1.00 39.41  ? 162 GLU B CA  1 
ATOM   3860  C  C   . GLU B  1 162 ? -36.523 -57.158 65.187  1.00 41.35  ? 162 GLU B C   1 
ATOM   3861  O  O   . GLU B  1 162 ? -37.636 -57.491 64.894  1.00 40.91  ? 162 GLU B O   1 
ATOM   3862  C  CB  . GLU B  1 162 ? -35.772 -57.346 67.576  1.00 45.62  ? 162 GLU B CB  1 
ATOM   3863  C  CG  . GLU B  1 162 ? -35.875 -58.311 68.693  1.00 60.60  ? 162 GLU B CG  1 
ATOM   3864  C  CD  . GLU B  1 162 ? -37.248 -58.904 68.808  1.00 68.76  ? 162 GLU B CD  1 
ATOM   3865  O  OE1 . GLU B  1 162 ? -38.243 -58.150 68.628  1.00 71.28  ? 162 GLU B OE1 1 
ATOM   3866  O  OE2 . GLU B  1 162 ? -37.351 -60.115 69.078  1.00 72.81  ? 162 GLU B OE2 1 
ATOM   3867  N  N   . THR B  1 163 ? -35.935 -56.078 64.677  1.00 35.30  ? 163 THR B N   1 
ATOM   3868  C  CA  . THR B  1 163 ? -36.691 -55.093 63.890  1.00 32.43  ? 163 THR B CA  1 
ATOM   3869  C  C   . THR B  1 163 ? -36.223 -54.983 62.411  1.00 31.58  ? 163 THR B C   1 
ATOM   3870  O  O   . THR B  1 163 ? -36.855 -54.369 61.629  1.00 31.50  ? 163 THR B O   1 
ATOM   3871  C  CB  . THR B  1 163 ? -36.605 -53.729 64.519  1.00 30.27  ? 163 THR B CB  1 
ATOM   3872  O  OG1 . THR B  1 163 ? -35.239 -53.265 64.465  1.00 29.50  ? 163 THR B OG1 1 
ATOM   3873  C  CG2 . THR B  1 163 ? -37.070 -53.787 65.998  1.00 29.45  ? 163 THR B CG2 1 
ATOM   3874  N  N   . LYS B  1 164 ? -35.102 -55.580 62.099  1.00 33.46  ? 164 LYS B N   1 
ATOM   3875  C  CA  . LYS B  1 164 ? -34.597 -55.586 60.708  1.00 33.48  ? 164 LYS B CA  1 
ATOM   3876  C  C   . LYS B  1 164 ? -33.933 -54.227 60.267  1.00 33.55  ? 164 LYS B C   1 
ATOM   3877  O  O   . LYS B  1 164 ? -33.362 -54.136 59.167  1.00 33.40  ? 164 LYS B O   1 
ATOM   3878  C  CB  . LYS B  1 164 ? -35.715 -55.966 59.728  1.00 37.99  ? 164 LYS B CB  1 
ATOM   3879  C  CG  . LYS B  1 164 ? -36.478 -57.233 60.109  1.00 39.58  ? 164 LYS B CG  1 
ATOM   3880  C  CD  . LYS B  1 164 ? -35.533 -58.403 60.333  1.00 44.11  ? 164 LYS B CD  1 
ATOM   3881  C  CE  . LYS B  1 164 ? -36.301 -59.666 60.749  1.00 53.45  ? 164 LYS B CE  1 
ATOM   3882  N  NZ  . LYS B  1 164 ? -35.384 -60.821 60.995  1.00 56.42  ? 164 LYS B NZ  1 
ATOM   3883  N  N   . VAL B  1 165 ? -34.022 -53.192 61.124  1.00 27.91  ? 165 VAL B N   1 
ATOM   3884  C  CA  . VAL B  1 165 ? -33.376 -51.883 60.800  1.00 25.54  ? 165 VAL B CA  1 
ATOM   3885  C  C   . VAL B  1 165 ? -31.886 -52.069 60.637  1.00 23.96  ? 165 VAL B C   1 
ATOM   3886  O  O   . VAL B  1 165 ? -31.281 -52.901 61.321  1.00 23.49  ? 165 VAL B O   1 
ATOM   3887  C  CB  . VAL B  1 165 ? -33.648 -50.811 61.884  1.00 24.99  ? 165 VAL B CB  1 
ATOM   3888  C  CG1 . VAL B  1 165 ? -35.146 -50.626 62.086  1.00 24.65  ? 165 VAL B CG1 1 
ATOM   3889  C  CG2 . VAL B  1 165 ? -32.941 -51.185 63.215  1.00 23.82  ? 165 VAL B CG2 1 
ATOM   3890  N  N   . PRO B  1 166 ? -31.280 -51.316 59.729  1.00 23.64  ? 166 PRO B N   1 
ATOM   3891  C  CA  . PRO B  1 166 ? -29.852 -51.440 59.524  1.00 23.53  ? 166 PRO B CA  1 
ATOM   3892  C  C   . PRO B  1 166 ? -29.038 -50.778 60.648  1.00 24.08  ? 166 PRO B C   1 
ATOM   3893  O  O   . PRO B  1 166 ? -29.613 -50.091 61.536  1.00 23.54  ? 166 PRO B O   1 
ATOM   3894  C  CB  . PRO B  1 166 ? -29.624 -50.703 58.195  1.00 23.46  ? 166 PRO B CB  1 
ATOM   3895  C  CG  . PRO B  1 166 ? -30.735 -49.731 58.110  1.00 23.20  ? 166 PRO B CG  1 
ATOM   3896  C  CD  . PRO B  1 166 ? -31.906 -50.378 58.765  1.00 22.32  ? 166 PRO B CD  1 
ATOM   3897  N  N   . ILE B  1 167 ? -27.723 -50.979 60.615  1.00 22.63  ? 167 ILE B N   1 
ATOM   3898  C  CA  . ILE B  1 167 ? -26.840 -50.441 61.623  1.00 22.51  ? 167 ILE B CA  1 
ATOM   3899  C  C   . ILE B  1 167 ? -25.749 -49.607 61.002  1.00 21.11  ? 167 ILE B C   1 
ATOM   3900  O  O   . ILE B  1 167 ? -25.085 -50.040 60.066  1.00 23.79  ? 167 ILE B O   1 
ATOM   3901  C  CB  . ILE B  1 167 ? -26.178 -51.570 62.449  1.00 21.65  ? 167 ILE B CB  1 
ATOM   3902  C  CG1 . ILE B  1 167 ? -27.236 -52.383 63.177  1.00 23.30  ? 167 ILE B CG1 1 
ATOM   3903  C  CG2 . ILE B  1 167 ? -25.156 -50.989 63.442  1.00 21.13  ? 167 ILE B CG2 1 
ATOM   3904  C  CD1 . ILE B  1 167 ? -26.698 -53.684 63.800  1.00 24.15  ? 167 ILE B CD1 1 
ATOM   3905  N  N   . ILE B  1 168 ? -25.562 -48.397 61.532  1.00 20.20  ? 168 ILE B N   1 
ATOM   3906  C  CA  . ILE B  1 168 ? -24.468 -47.505 61.096  1.00 20.00  ? 168 ILE B CA  1 
ATOM   3907  C  C   . ILE B  1 168 ? -23.483 -47.361 62.216  1.00 21.15  ? 168 ILE B C   1 
ATOM   3908  O  O   . ILE B  1 168 ? -23.868 -47.216 63.365  1.00 21.60  ? 168 ILE B O   1 
ATOM   3909  C  CB  . ILE B  1 168 ? -24.998 -46.130 60.738  1.00 22.14  ? 168 ILE B CB  1 
ATOM   3910  C  CG1 . ILE B  1 168 ? -26.059 -46.235 59.626  1.00 20.96  ? 168 ILE B CG1 1 
ATOM   3911  C  CG2 . ILE B  1 168 ? -23.848 -45.195 60.318  1.00 21.61  ? 168 ILE B CG2 1 
ATOM   3912  C  CD1 . ILE B  1 168 ? -26.619 -44.903 59.201  1.00 23.83  ? 168 ILE B CD1 1 
ATOM   3913  N  N   . THR B  1 169 ? -22.216 -47.400 61.908  1.00 21.79  ? 169 THR B N   1 
ATOM   3914  C  CA  . THR B  1 169 ? -21.212 -47.297 62.968  1.00 24.01  ? 169 THR B CA  1 
ATOM   3915  C  C   . THR B  1 169 ? -20.306 -46.160 62.799  1.00 27.42  ? 169 THR B C   1 
ATOM   3916  O  O   . THR B  1 169 ? -20.172 -45.593 61.699  1.00 25.97  ? 169 THR B O   1 
ATOM   3917  C  CB  . THR B  1 169 ? -20.340 -48.571 63.067  1.00 24.56  ? 169 THR B CB  1 
ATOM   3918  O  OG1 . THR B  1 169 ? -19.261 -48.484 62.140  1.00 24.15  ? 169 THR B OG1 1 
ATOM   3919  C  CG2 . THR B  1 169 ? -21.186 -49.857 62.798  1.00 23.04  ? 169 THR B CG2 1 
ATOM   3920  N  N   . HIS B  1 170 ? -19.670 -45.801 63.885  1.00 27.69  ? 170 HIS B N   1 
ATOM   3921  C  CA  . HIS B  1 170 ? -18.625 -44.884 63.896  1.00 24.74  ? 170 HIS B CA  1 
ATOM   3922  C  C   . HIS B  1 170 ? -17.403 -45.648 64.320  1.00 24.44  ? 170 HIS B C   1 
ATOM   3923  O  O   . HIS B  1 170 ? -17.425 -46.324 65.317  1.00 23.33  ? 170 HIS B O   1 
ATOM   3924  C  CB  . HIS B  1 170 ? -18.936 -43.759 64.918  1.00 23.10  ? 170 HIS B CB  1 
ATOM   3925  C  CG  . HIS B  1 170 ? -17.759 -42.854 65.224  1.00 25.75  ? 170 HIS B CG  1 
ATOM   3926  N  ND1 . HIS B  1 170 ? -17.717 -41.524 64.833  1.00 24.60  ? 170 HIS B ND1 1 
ATOM   3927  C  CD2 . HIS B  1 170 ? -16.549 -43.098 65.923  1.00 26.47  ? 170 HIS B CD2 1 
ATOM   3928  C  CE1 . HIS B  1 170 ? -16.555 -40.972 65.252  1.00 28.60  ? 170 HIS B CE1 1 
ATOM   3929  N  NE2 . HIS B  1 170 ? -15.837 -41.930 65.918  1.00 29.28  ? 170 HIS B NE2 1 
ATOM   3930  N  N   . SER B  1 171 ? -16.336 -45.563 63.539  1.00 23.29  ? 171 SER B N   1 
ATOM   3931  C  CA  . SER B  1 171 ? -15.082 -46.241 63.900  1.00 23.76  ? 171 SER B CA  1 
ATOM   3932  C  C   . SER B  1 171 ? -13.920 -45.350 63.699  1.00 24.61  ? 171 SER B C   1 
ATOM   3933  O  O   . SER B  1 171 ? -14.033 -44.309 63.075  1.00 26.82  ? 171 SER B O   1 
ATOM   3934  C  CB  . SER B  1 171 ? -14.896 -47.548 63.065  1.00 22.75  ? 171 SER B CB  1 
ATOM   3935  O  OG  . SER B  1 171 ? -14.391 -47.263 61.757  1.00 24.59  ? 171 SER B OG  1 
ATOM   3936  N  N   . ASN B  1 172 ? -12.787 -45.747 64.241  1.00 25.57  ? 172 ASN B N   1 
ATOM   3937  C  CA  . ASN B  1 172 ? -11.543 -45.068 63.994  1.00 24.88  ? 172 ASN B CA  1 
ATOM   3938  C  C   . ASN B  1 172 ? -10.776 -45.819 62.915  1.00 27.98  ? 172 ASN B C   1 
ATOM   3939  O  O   . ASN B  1 172 ? -10.387 -47.001 63.106  1.00 26.74  ? 172 ASN B O   1 
ATOM   3940  C  CB  . ASN B  1 172 ? -10.712 -44.971 65.282  1.00 26.71  ? 172 ASN B CB  1 
ATOM   3941  C  CG  . ASN B  1 172 ? -9.367  -44.261 65.066  1.00 31.28  ? 172 ASN B CG  1 
ATOM   3942  O  OD1 . ASN B  1 172 ? -8.524  -44.716 64.270  1.00 30.21  ? 172 ASN B OD1 1 
ATOM   3943  N  ND2 . ASN B  1 172 ? -9.162  -43.144 65.773  1.00 27.44  ? 172 ASN B ND2 1 
ATOM   3944  N  N   . ALA B  1 173 ? -10.557 -45.164 61.797  1.00 26.06  ? 173 ALA B N   1 
ATOM   3945  C  CA  . ALA B  1 173 ? -10.043 -45.827 60.605  1.00 29.45  ? 173 ALA B CA  1 
ATOM   3946  C  C   . ALA B  1 173 ? -8.620  -46.448 60.775  1.00 33.47  ? 173 ALA B C   1 
ATOM   3947  O  O   . ALA B  1 173 ? -8.160  -47.197 59.905  1.00 31.89  ? 173 ALA B O   1 
ATOM   3948  C  CB  . ALA B  1 173 ? -10.066 -44.856 59.400  1.00 28.84  ? 173 ALA B CB  1 
ATOM   3949  N  N   . HIS B  1 174 ? -7.946  -46.137 61.900  1.00 32.26  ? 174 HIS B N   1 
ATOM   3950  C  CA  . HIS B  1 174 ? -6.489  -46.515 62.064  1.00 34.09  ? 174 HIS B CA  1 
ATOM   3951  C  C   . HIS B  1 174 ? -6.206  -47.604 63.080  1.00 36.95  ? 174 HIS B C   1 
ATOM   3952  O  O   . HIS B  1 174 ? -5.048  -47.989 63.264  1.00 37.01  ? 174 HIS B O   1 
ATOM   3953  C  CB  . HIS B  1 174 ? -5.653  -45.284 62.382  1.00 32.30  ? 174 HIS B CB  1 
ATOM   3954  C  CG  . HIS B  1 174 ? -5.823  -44.174 61.403  1.00 35.66  ? 174 HIS B CG  1 
ATOM   3955  N  ND1 . HIS B  1 174 ? -5.424  -44.271 60.103  1.00 35.02  ? 174 HIS B ND1 1 
ATOM   3956  C  CD2 . HIS B  1 174 ? -6.369  -42.895 61.548  1.00 37.87  ? 174 HIS B CD2 1 
ATOM   3957  C  CE1 . HIS B  1 174 ? -5.702  -43.133 59.470  1.00 35.65  ? 174 HIS B CE1 1 
ATOM   3958  N  NE2 . HIS B  1 174 ? -6.281  -42.287 60.350  1.00 42.67  ? 174 HIS B NE2 1 
ATOM   3959  N  N   . ASN B  1 175 ? -7.254  -48.120 63.747  1.00 33.84  ? 175 ASN B N   1 
ATOM   3960  C  CA  . ASN B  1 175 ? -7.039  -49.140 64.812  1.00 31.73  ? 175 ASN B CA  1 
ATOM   3961  C  C   . ASN B  1 175 ? -7.925  -50.433 64.713  1.00 36.01  ? 175 ASN B C   1 
ATOM   3962  O  O   . ASN B  1 175 ? -8.053  -51.172 65.682  1.00 38.23  ? 175 ASN B O   1 
ATOM   3963  C  CB  . ASN B  1 175 ? -7.176  -48.515 66.184  1.00 31.61  ? 175 ASN B CB  1 
ATOM   3964  C  CG  . ASN B  1 175 ? -8.598  -48.144 66.513  1.00 31.15  ? 175 ASN B CG  1 
ATOM   3965  O  OD1 . ASN B  1 175 ? -9.513  -48.275 65.666  1.00 28.34  ? 175 ASN B OD1 1 
ATOM   3966  N  ND2 . ASN B  1 175 ? -8.816  -47.680 67.733  1.00 30.71  ? 175 ASN B ND2 1 
ATOM   3967  N  N   . ASN B  1 176 ? -8.508  -50.673 63.557  1.00 32.58  ? 176 ASN B N   1 
ATOM   3968  C  CA  . ASN B  1 176 ? -9.277  -51.944 63.324  1.00 34.25  ? 176 ASN B CA  1 
ATOM   3969  C  C   . ASN B  1 176 ? -10.604 -52.048 64.051  1.00 30.55  ? 176 ASN B C   1 
ATOM   3970  O  O   . ASN B  1 176 ? -11.213 -53.110 64.078  1.00 29.15  ? 176 ASN B O   1 
ATOM   3971  C  CB  . ASN B  1 176 ? -8.392  -53.202 63.659  1.00 39.99  ? 176 ASN B CB  1 
ATOM   3972  C  CG  . ASN B  1 176 ? -7.505  -53.623 62.496  1.00 48.92  ? 176 ASN B CG  1 
ATOM   3973  O  OD1 . ASN B  1 176 ? -6.941  -52.782 61.787  1.00 52.55  ? 176 ASN B OD1 1 
ATOM   3974  N  ND2 . ASN B  1 176 ? -7.380  -54.918 62.296  1.00 62.67  ? 176 ASN B ND2 1 
ATOM   3975  N  N   . THR B  1 177 ? -11.049 -50.964 64.636  1.00 29.18  ? 177 THR B N   1 
ATOM   3976  C  CA  . THR B  1 177 ? -12.344 -50.966 65.336  1.00 27.12  ? 177 THR B CA  1 
ATOM   3977  C  C   . THR B  1 177 ? -13.516 -51.287 64.374  1.00 28.15  ? 177 THR B C   1 
ATOM   3978  O  O   . THR B  1 177 ? -14.493 -51.988 64.758  1.00 29.45  ? 177 THR B O   1 
ATOM   3979  C  CB  . THR B  1 177 ? -12.606 -49.645 66.057  1.00 26.75  ? 177 THR B CB  1 
ATOM   3980  O  OG1 . THR B  1 177 ? -12.250 -48.546 65.203  1.00 23.79  ? 177 THR B OG1 1 
ATOM   3981  C  CG2 . THR B  1 177 ? -11.758 -49.567 67.383  1.00 26.15  ? 177 THR B CG2 1 
ATOM   3982  N  N   . GLY B  1 178 ? -13.423 -50.793 63.146  1.00 26.69  ? 178 GLY B N   1 
ATOM   3983  C  CA  . GLY B  1 178 ? -14.472 -51.053 62.129  1.00 24.66  ? 178 GLY B CA  1 
ATOM   3984  C  C   . GLY B  1 178 ? -14.602 -52.523 61.838  1.00 25.16  ? 178 GLY B C   1 
ATOM   3985  O  O   . GLY B  1 178 ? -15.701 -53.062 61.799  1.00 27.20  ? 178 GLY B O   1 
ATOM   3986  N  N   . LEU B  1 179 ? -13.473 -53.172 61.643  1.00 26.34  ? 179 LEU B N   1 
ATOM   3987  C  CA  . LEU B  1 179 ? -13.433 -54.577 61.366  1.00 25.39  ? 179 LEU B CA  1 
ATOM   3988  C  C   . LEU B  1 179 ? -13.950 -55.401 62.583  1.00 25.58  ? 179 LEU B C   1 
ATOM   3989  O  O   . LEU B  1 179 ? -14.652 -56.411 62.414  1.00 28.07  ? 179 LEU B O   1 
ATOM   3990  C  CB  . LEU B  1 179 ? -11.994 -55.002 60.997  1.00 26.79  ? 179 LEU B CB  1 
ATOM   3991  C  CG  . LEU B  1 179 ? -11.789 -56.399 60.394  1.00 29.57  ? 179 LEU B CG  1 
ATOM   3992  C  CD1 . LEU B  1 179 ? -12.475 -56.510 59.045  1.00 27.79  ? 179 LEU B CD1 1 
ATOM   3993  C  CD2 . LEU B  1 179 ? -10.289 -56.718 60.268  1.00 30.44  ? 179 LEU B CD2 1 
ATOM   3994  N  N   . GLU B  1 180 ? -13.594 -54.951 63.806  1.00 24.79  ? 180 GLU B N   1 
ATOM   3995  C  CA  . GLU B  1 180 ? -14.088 -55.593 65.055  0.70 26.08  ? 180 GLU B CA  1 
ATOM   3996  C  C   . GLU B  1 180 ? -15.566 -55.463 65.168  1.00 27.24  ? 180 GLU B C   1 
ATOM   3997  O  O   . GLU B  1 180 ? -16.247 -56.403 65.520  1.00 31.65  ? 180 GLU B O   1 
ATOM   3998  C  CB  . GLU B  1 180 ? -13.418 -54.972 66.287  0.70 26.48  ? 180 GLU B CB  1 
ATOM   3999  C  CG  . GLU B  1 180 ? -12.037 -55.484 66.568  0.70 27.63  ? 180 GLU B CG  1 
ATOM   4000  C  CD  . GLU B  1 180 ? -12.022 -56.965 66.864  0.70 30.23  ? 180 GLU B CD  1 
ATOM   4001  O  OE1 . GLU B  1 180 ? -11.970 -57.330 68.052  0.70 30.52  ? 180 GLU B OE1 1 
ATOM   4002  O  OE2 . GLU B  1 180 ? -12.076 -57.766 65.909  0.70 30.52  ? 180 GLU B OE2 1 
ATOM   4003  N  N   . GLN B  1 181 ? -16.077 -54.273 64.865  1.00 26.31  ? 181 GLN B N   1 
ATOM   4004  C  CA  . GLN B  1 181 ? -17.521 -54.029 64.912  1.00 24.51  ? 181 GLN B CA  1 
ATOM   4005  C  C   . GLN B  1 181 ? -18.250 -54.971 63.972  1.00 24.86  ? 181 GLN B C   1 
ATOM   4006  O  O   . GLN B  1 181 ? -19.265 -55.594 64.348  1.00 26.04  ? 181 GLN B O   1 
ATOM   4007  C  CB  . GLN B  1 181 ? -17.833 -52.580 64.537  1.00 23.15  ? 181 GLN B CB  1 
ATOM   4008  C  CG  . GLN B  1 181 ? -17.353 -51.537 65.548  1.00 23.06  ? 181 GLN B CG  1 
ATOM   4009  C  CD  . GLN B  1 181 ? -17.518 -50.114 65.022  1.00 24.63  ? 181 GLN B CD  1 
ATOM   4010  O  OE1 . GLN B  1 181 ? -17.418 -49.878 63.837  1.00 23.72  ? 181 GLN B OE1 1 
ATOM   4011  N  NE2 . GLN B  1 181 ? -17.778 -49.174 65.918  1.00 23.59  ? 181 GLN B NE2 1 
ATOM   4012  N  N   . GLN B  1 182 ? -17.747 -55.078 62.745  1.00 23.93  ? 182 GLN B N   1 
ATOM   4013  C  CA  . GLN B  1 182 ? -18.324 -55.953 61.766  1.00 24.07  ? 182 GLN B CA  1 
ATOM   4014  C  C   . GLN B  1 182 ? -18.265 -57.407 62.238  1.00 26.27  ? 182 GLN B C   1 
ATOM   4015  O  O   . GLN B  1 182 ? -19.227 -58.140 62.123  1.00 26.54  ? 182 GLN B O   1 
ATOM   4016  C  CB  . GLN B  1 182 ? -17.583 -55.807 60.406  1.00 24.04  ? 182 GLN B CB  1 
ATOM   4017  C  CG  . GLN B  1 182 ? -18.162 -56.664 59.274  1.00 24.27  ? 182 GLN B CG  1 
ATOM   4018  C  CD  . GLN B  1 182 ? -17.269 -56.660 58.001  1.00 27.85  ? 182 GLN B CD  1 
ATOM   4019  O  OE1 . GLN B  1 182 ? -16.033 -56.878 58.077  1.00 25.27  ? 182 GLN B OE1 1 
ATOM   4020  N  NE2 . GLN B  1 182 ? -17.893 -56.418 56.829  1.00 25.70  ? 182 GLN B NE2 1 
ATOM   4021  N  N   . ARG B  1 183 ? -17.112 -57.799 62.776  1.00 27.85  ? 183 ARG B N   1 
ATOM   4022  C  CA  . ARG B  1 183 ? -16.895 -59.146 63.214  1.00 31.23  ? 183 ARG B CA  1 
ATOM   4023  C  C   . ARG B  1 183 ? -17.867 -59.520 64.365  1.00 31.46  ? 183 ARG B C   1 
ATOM   4024  O  O   . ARG B  1 183 ? -18.529 -60.548 64.320  1.00 33.43  ? 183 ARG B O   1 
ATOM   4025  C  CB  . ARG B  1 183 ? -15.404 -59.328 63.651  1.00 34.41  ? 183 ARG B CB  1 
ATOM   4026  C  CG  . ARG B  1 183 ? -14.918 -60.774 63.728  1.00 37.13  ? 183 ARG B CG  1 
ATOM   4027  C  CD  . ARG B  1 183 ? -14.935 -61.266 65.115  1.00 42.59  ? 183 ARG B CD  1 
ATOM   4028  N  NE  . ARG B  1 183 ? -14.253 -60.345 66.019  1.00 49.84  ? 183 ARG B NE  1 
ATOM   4029  C  CZ  . ARG B  1 183 ? -14.353 -60.388 67.338  1.00 48.76  ? 183 ARG B CZ  1 
ATOM   4030  N  NH1 . ARG B  1 183 ? -13.693 -59.492 68.097  1.00 47.18  ? 183 ARG B NH1 1 
ATOM   4031  N  NH2 . ARG B  1 183 ? -15.102 -61.305 67.910  1.00 41.13  ? 183 ARG B NH2 1 
ATOM   4032  N  N   . ILE B  1 184 ? -17.938 -58.673 65.358  1.00 29.40  ? 184 ILE B N   1 
ATOM   4033  C  CA  . ILE B  1 184 ? -18.813 -58.896 66.481  1.00 29.15  ? 184 ILE B CA  1 
ATOM   4034  C  C   . ILE B  1 184 ? -20.302 -58.961 66.048  1.00 28.44  ? 184 ILE B C   1 
ATOM   4035  O  O   . ILE B  1 184 ? -21.039 -59.851 66.470  1.00 28.42  ? 184 ILE B O   1 
ATOM   4036  C  CB  . ILE B  1 184 ? -18.635 -57.820 67.538  1.00 27.65  ? 184 ILE B CB  1 
ATOM   4037  C  CG1 . ILE B  1 184 ? -17.234 -57.959 68.200  1.00 28.35  ? 184 ILE B CG1 1 
ATOM   4038  C  CG2 . ILE B  1 184 ? -19.741 -57.911 68.579  1.00 27.60  ? 184 ILE B CG2 1 
ATOM   4039  C  CD1 . ILE B  1 184 ? -16.894 -56.858 69.170  1.00 25.89  ? 184 ILE B CD1 1 
ATOM   4040  N  N   . LEU B  1 185 ? -20.717 -58.018 65.201  1.00 27.23  ? 185 LEU B N   1 
ATOM   4041  C  CA  . LEU B  1 185 ? -22.129 -57.973 64.707  1.00 26.62  ? 185 LEU B CA  1 
ATOM   4042  C  C   . LEU B  1 185 ? -22.508 -59.217 63.880  1.00 27.72  ? 185 LEU B C   1 
ATOM   4043  O  O   . LEU B  1 185 ? -23.630 -59.752 64.010  1.00 28.04  ? 185 LEU B O   1 
ATOM   4044  C  CB  . LEU B  1 185 ? -22.381 -56.704 63.892  1.00 23.31  ? 185 LEU B CB  1 
ATOM   4045  C  CG  . LEU B  1 185 ? -22.492 -55.373 64.693  1.00 23.65  ? 185 LEU B CG  1 
ATOM   4046  C  CD1 . LEU B  1 185 ? -22.570 -54.173 63.751  1.00 22.05  ? 185 LEU B CD1 1 
ATOM   4047  C  CD2 . LEU B  1 185 ? -23.674 -55.400 65.621  1.00 21.17  ? 185 LEU B CD2 1 
ATOM   4048  N  N   . THR B  1 186 ? -21.586 -59.673 63.030  1.00 28.01  ? 186 THR B N   1 
ATOM   4049  C  CA  . THR B  1 186 ? -21.851 -60.835 62.189  1.00 29.45  ? 186 THR B CA  1 
ATOM   4050  C  C   . THR B  1 186 ? -21.896 -62.134 63.030  1.00 30.23  ? 186 THR B C   1 
ATOM   4051  O  O   . THR B  1 186 ? -22.748 -62.940 62.844  1.00 29.80  ? 186 THR B O   1 
ATOM   4052  C  CB  . THR B  1 186 ? -20.827 -60.961 61.021  1.00 28.66  ? 186 THR B CB  1 
ATOM   4053  O  OG1 . THR B  1 186 ? -19.499 -60.852 61.531  1.00 33.42  ? 186 THR B OG1 1 
ATOM   4054  C  CG2 . THR B  1 186 ? -21.054 -59.863 60.007  1.00 27.28  ? 186 THR B CG2 1 
ATOM   4055  N  N   . GLU B  1 187 ? -20.932 -62.287 63.980  1.00 31.57  ? 187 GLU B N   1 
ATOM   4056  C  CA  . GLU B  1 187 ? -20.961 -63.463 64.953  1.00 34.74  ? 187 GLU B CA  1 
ATOM   4057  C  C   . GLU B  1 187 ? -22.267 -63.501 65.679  1.00 33.02  ? 187 GLU B C   1 
ATOM   4058  O  O   . GLU B  1 187 ? -22.744 -64.540 66.023  1.00 36.61  ? 187 GLU B O   1 
ATOM   4059  C  CB  . GLU B  1 187 ? -19.829 -63.369 65.961  1.00 34.59  ? 187 GLU B CB  1 
ATOM   4060  C  CG  . GLU B  1 187 ? -18.465 -63.558 65.387  1.00 42.73  ? 187 GLU B CG  1 
ATOM   4061  C  CD  . GLU B  1 187 ? -17.375 -63.419 66.435  1.00 46.16  ? 187 GLU B CD  1 
ATOM   4062  O  OE1 . GLU B  1 187 ? -16.194 -63.397 66.059  1.00 52.77  ? 187 GLU B OE1 1 
ATOM   4063  O  OE2 . GLU B  1 187 ? -17.716 -63.329 67.659  1.00 51.87  ? 187 GLU B OE2 1 
ATOM   4064  N  N   . GLU B  1 188 ? -22.847 -62.306 65.924  1.00 33.85  ? 188 GLU B N   1 
ATOM   4065  C  CA  . GLU B  1 188 ? -24.166 -62.193 66.619  1.00 30.97  ? 188 GLU B CA  1 
ATOM   4066  C  C   . GLU B  1 188 ? -25.314 -62.533 65.693  1.00 31.87  ? 188 GLU B C   1 
ATOM   4067  O  O   . GLU B  1 188 ? -26.456 -62.646 66.127  1.00 37.23  ? 188 GLU B O   1 
ATOM   4068  C  CB  . GLU B  1 188 ? -24.356 -60.792 67.191  1.00 29.07  ? 188 GLU B CB  1 
ATOM   4069  C  CG  . GLU B  1 188 ? -23.521 -60.495 68.467  1.00 29.76  ? 188 GLU B CG  1 
ATOM   4070  C  CD  . GLU B  1 188 ? -24.080 -61.201 69.727  1.00 33.20  ? 188 GLU B CD  1 
ATOM   4071  O  OE1 . GLU B  1 188 ? -25.130 -61.884 69.617  1.00 35.38  ? 188 GLU B OE1 1 
ATOM   4072  O  OE2 . GLU B  1 188 ? -23.460 -61.064 70.829  1.00 34.93  ? 188 GLU B OE2 1 
ATOM   4073  N  N   . GLY B  1 189 ? -25.014 -62.686 64.408  1.00 29.79  ? 189 GLY B N   1 
ATOM   4074  C  CA  . GLY B  1 189 ? -26.036 -63.071 63.419  1.00 28.30  ? 189 GLY B CA  1 
ATOM   4075  C  C   . GLY B  1 189 ? -26.642 -61.904 62.620  1.00 28.42  ? 189 GLY B C   1 
ATOM   4076  O  O   . GLY B  1 189 ? -27.715 -62.036 62.035  1.00 29.36  ? 189 GLY B O   1 
ATOM   4077  N  N   . VAL B  1 190 ? -25.963 -60.781 62.599  1.00 28.50  ? 190 VAL B N   1 
ATOM   4078  C  CA  . VAL B  1 190 ? -26.406 -59.679 61.786  1.00 26.64  ? 190 VAL B CA  1 
ATOM   4079  C  C   . VAL B  1 190 ? -25.959 -59.883 60.334  1.00 26.58  ? 190 VAL B C   1 
ATOM   4080  O  O   . VAL B  1 190 ? -24.796 -60.204 60.068  1.00 26.61  ? 190 VAL B O   1 
ATOM   4081  C  CB  . VAL B  1 190 ? -25.884 -58.299 62.319  1.00 27.38  ? 190 VAL B CB  1 
ATOM   4082  C  CG1 . VAL B  1 190 ? -26.332 -57.158 61.393  1.00 26.25  ? 190 VAL B CG1 1 
ATOM   4083  C  CG2 . VAL B  1 190 ? -26.368 -58.059 63.738  1.00 24.98  ? 190 VAL B CG2 1 
ATOM   4084  N  N   . ASP B  1 191 ? -26.883 -59.718 59.416  1.00 26.68  ? 191 ASP B N   1 
ATOM   4085  C  CA  . ASP B  1 191 ? -26.581 -59.771 58.028  1.00 29.06  ? 191 ASP B CA  1 
ATOM   4086  C  C   . ASP B  1 191 ? -25.556 -58.638 57.676  1.00 29.24  ? 191 ASP B C   1 
ATOM   4087  O  O   . ASP B  1 191 ? -25.816 -57.463 57.929  1.00 29.37  ? 191 ASP B O   1 
ATOM   4088  C  CB  . ASP B  1 191 ? -27.884 -59.614 57.202  1.00 35.25  ? 191 ASP B CB  1 
ATOM   4089  C  CG  . ASP B  1 191 ? -27.624 -59.474 55.689  1.00 37.86  ? 191 ASP B CG  1 
ATOM   4090  O  OD1 . ASP B  1 191 ? -26.466 -59.568 55.266  1.00 40.76  ? 191 ASP B OD1 1 
ATOM   4091  O  OD2 . ASP B  1 191 ? -28.598 -59.270 54.945  1.00 41.82  ? 191 ASP B OD2 1 
ATOM   4092  N  N   . PRO B  1 192 ? -24.384 -59.024 57.099  1.00 28.41  ? 192 PRO B N   1 
ATOM   4093  C  CA  . PRO B  1 192 ? -23.272 -58.057 56.781  1.00 26.45  ? 192 PRO B CA  1 
ATOM   4094  C  C   . PRO B  1 192 ? -23.735 -56.886 55.919  1.00 28.93  ? 192 PRO B C   1 
ATOM   4095  O  O   . PRO B  1 192 ? -23.238 -55.713 56.101  1.00 27.69  ? 192 PRO B O   1 
ATOM   4096  C  CB  . PRO B  1 192 ? -22.263 -58.919 56.004  1.00 26.95  ? 192 PRO B CB  1 
ATOM   4097  C  CG  . PRO B  1 192 ? -22.584 -60.349 56.394  1.00 28.97  ? 192 PRO B CG  1 
ATOM   4098  C  CD  . PRO B  1 192 ? -24.065 -60.403 56.670  1.00 29.80  ? 192 PRO B CD  1 
ATOM   4099  N  N   . GLY B  1 193 ? -24.655 -57.156 54.989  1.00 25.98  ? 193 GLY B N   1 
ATOM   4100  C  CA  . GLY B  1 193 ? -25.205 -56.104 54.105  1.00 28.01  ? 193 GLY B CA  1 
ATOM   4101  C  C   . GLY B  1 193 ? -26.115 -55.131 54.859  1.00 27.99  ? 193 GLY B C   1 
ATOM   4102  O  O   . GLY B  1 193 ? -26.620 -54.179 54.290  1.00 30.85  ? 193 GLY B O   1 
ATOM   4103  N  N   . LYS B  1 194 ? -26.309 -55.389 56.138  1.00 28.04  ? 194 LYS B N   1 
ATOM   4104  C  CA  . LYS B  1 194 ? -27.132 -54.522 56.987  1.00 27.33  ? 194 LYS B CA  1 
ATOM   4105  C  C   . LYS B  1 194 ? -26.263 -53.634 57.894  1.00 27.79  ? 194 LYS B C   1 
ATOM   4106  O  O   . LYS B  1 194 ? -26.761 -53.023 58.859  1.00 30.15  ? 194 LYS B O   1 
ATOM   4107  C  CB  . LYS B  1 194 ? -28.093 -55.361 57.831  1.00 29.18  ? 194 LYS B CB  1 
ATOM   4108  C  CG  . LYS B  1 194 ? -29.374 -55.724 57.119  1.00 33.21  ? 194 LYS B CG  1 
ATOM   4109  C  CD  . LYS B  1 194 ? -30.216 -54.517 56.939  1.00 36.18  ? 194 LYS B CD  1 
ATOM   4110  C  CE  . LYS B  1 194 ? -31.398 -54.787 56.106  1.00 37.05  ? 194 LYS B CE  1 
ATOM   4111  N  NZ  . LYS B  1 194 ? -32.232 -53.561 55.973  1.00 35.53  ? 194 LYS B NZ  1 
ATOM   4112  N  N   . ILE B  1 195 ? -24.978 -53.565 57.587  1.00 24.76  ? 195 ILE B N   1 
ATOM   4113  C  CA  . ILE B  1 195 ? -24.056 -52.777 58.371  1.00 23.63  ? 195 ILE B CA  1 
ATOM   4114  C  C   . ILE B  1 195 ? -23.292 -51.822 57.517  1.00 23.29  ? 195 ILE B C   1 
ATOM   4115  O  O   . ILE B  1 195 ? -22.828 -52.172 56.466  1.00 23.11  ? 195 ILE B O   1 
ATOM   4116  C  CB  . ILE B  1 195 ? -23.026 -53.673 59.103  1.00 23.11  ? 195 ILE B CB  1 
ATOM   4117  C  CG1 . ILE B  1 195 ? -23.721 -54.880 59.752  1.00 22.22  ? 195 ILE B CG1 1 
ATOM   4118  C  CG2 . ILE B  1 195 ? -22.234 -52.849 60.129  1.00 22.44  ? 195 ILE B CG2 1 
ATOM   4119  C  CD1 . ILE B  1 195 ? -22.756 -55.944 60.253  1.00 21.10  ? 195 ILE B CD1 1 
ATOM   4120  N  N   . LEU B  1 196 ? -23.171 -50.587 57.992  1.00 24.13  ? 196 LEU B N   1 
ATOM   4121  C  CA  . LEU B  1 196 ? -22.299 -49.608 57.380  1.00 23.12  ? 196 LEU B CA  1 
ATOM   4122  C  C   . LEU B  1 196 ? -21.194 -49.268 58.347  1.00 21.43  ? 196 LEU B C   1 
ATOM   4123  O  O   . LEU B  1 196 ? -21.446 -48.727 59.402  1.00 21.04  ? 196 LEU B O   1 
ATOM   4124  C  CB  . LEU B  1 196 ? -23.083 -48.332 57.016  1.00 22.54  ? 196 LEU B CB  1 
ATOM   4125  C  CG  . LEU B  1 196 ? -22.226 -47.088 56.647  1.00 20.62  ? 196 LEU B CG  1 
ATOM   4126  C  CD1 . LEU B  1 196 ? -21.366 -47.369 55.408  1.00 21.86  ? 196 LEU B CD1 1 
ATOM   4127  C  CD2 . LEU B  1 196 ? -23.095 -45.879 56.433  1.00 19.62  ? 196 LEU B CD2 1 
ATOM   4128  N  N   . ILE B  1 197 ? -19.950 -49.612 57.985  1.00 23.60  ? 197 ILE B N   1 
ATOM   4129  C  CA  . ILE B  1 197 ? -18.793 -49.299 58.832  1.00 20.96  ? 197 ILE B CA  1 
ATOM   4130  C  C   . ILE B  1 197 ? -18.284 -47.939 58.483  1.00 22.77  ? 197 ILE B C   1 
ATOM   4131  O  O   . ILE B  1 197 ? -17.796 -47.715 57.370  1.00 21.20  ? 197 ILE B O   1 
ATOM   4132  C  CB  . ILE B  1 197 ? -17.654 -50.351 58.668  1.00 22.42  ? 197 ILE B CB  1 
ATOM   4133  C  CG1 . ILE B  1 197 ? -18.155 -51.744 59.040  1.00 22.98  ? 197 ILE B CG1 1 
ATOM   4134  C  CG2 . ILE B  1 197 ? -16.445 -49.971 59.520  1.00 21.74  ? 197 ILE B CG2 1 
ATOM   4135  C  CD1 . ILE B  1 197 ? -18.614 -51.875 60.511  1.00 23.18  ? 197 ILE B CD1 1 
ATOM   4136  N  N   . GLY B  1 198 ? -18.382 -47.008 59.437  1.00 22.30  ? 198 GLY B N   1 
ATOM   4137  C  CA  . GLY B  1 198 ? -18.150 -45.620 59.157  1.00 20.47  ? 198 GLY B CA  1 
ATOM   4138  C  C   . GLY B  1 198 ? -16.727 -45.134 59.253  1.00 24.32  ? 198 GLY B C   1 
ATOM   4139  O  O   . GLY B  1 198 ? -15.862 -45.750 59.961  1.00 22.85  ? 198 GLY B O   1 
ATOM   4140  N  N   . HIS B  1 199 ? -16.450 -44.027 58.535  1.00 21.94  ? 199 HIS B N   1 
ATOM   4141  C  CA  . HIS B  1 199 ? -15.197 -43.281 58.677  1.00 22.62  ? 199 HIS B CA  1 
ATOM   4142  C  C   . HIS B  1 199 ? -13.983 -44.006 58.117  1.00 23.79  ? 199 HIS B C   1 
ATOM   4143  O  O   . HIS B  1 199 ? -12.812 -43.679 58.462  1.00 25.75  ? 199 HIS B O   1 
ATOM   4144  C  CB  . HIS B  1 199 ? -14.989 -42.859 60.138  1.00 22.38  ? 199 HIS B CB  1 
ATOM   4145  C  CG  . HIS B  1 199 ? -16.233 -42.148 60.763  1.00 22.92  ? 199 HIS B CG  1 
ATOM   4146  N  ND1 . HIS B  1 199 ? -17.160 -41.480 60.004  1.00 22.62  ? 199 HIS B ND1 1 
ATOM   4147  C  CD2 . HIS B  1 199 ? -16.659 -42.017 62.108  1.00 24.27  ? 199 HIS B CD2 1 
ATOM   4148  C  CE1 . HIS B  1 199 ? -18.132 -40.958 60.823  1.00 23.35  ? 199 HIS B CE1 1 
ATOM   4149  N  NE2 . HIS B  1 199 ? -17.830 -41.278 62.096  1.00 24.20  ? 199 HIS B NE2 1 
ATOM   4150  N  N   . LEU B  1 200 ? -14.241 -44.970 57.252  1.00 24.19  ? 200 LEU B N   1 
ATOM   4151  C  CA  . LEU B  1 200 ? -13.209 -45.674 56.562  1.00 24.42  ? 200 LEU B CA  1 
ATOM   4152  C  C   . LEU B  1 200 ? -12.493 -44.743 55.570  1.00 27.52  ? 200 LEU B C   1 
ATOM   4153  O  O   . LEU B  1 200 ? -11.321 -44.960 55.225  1.00 29.65  ? 200 LEU B O   1 
ATOM   4154  C  CB  . LEU B  1 200 ? -13.798 -46.888 55.829  1.00 23.43  ? 200 LEU B CB  1 
ATOM   4155  C  CG  . LEU B  1 200 ? -13.786 -48.246 56.601  1.00 28.03  ? 200 LEU B CG  1 
ATOM   4156  C  CD1 . LEU B  1 200 ? -13.816 -48.025 58.081  1.00 26.41  ? 200 LEU B CD1 1 
ATOM   4157  C  CD2 . LEU B  1 200 ? -14.953 -49.127 56.167  1.00 23.58  ? 200 LEU B CD2 1 
ATOM   4158  N  N   . GLY B  1 201 ? -13.202 -43.711 55.122  1.00 27.86  ? 201 GLY B N   1 
ATOM   4159  C  CA  . GLY B  1 201 ? -12.628 -42.718 54.259  1.00 28.31  ? 201 GLY B CA  1 
ATOM   4160  C  C   . GLY B  1 201 ? -11.465 -41.941 54.924  1.00 28.32  ? 201 GLY B C   1 
ATOM   4161  O  O   . GLY B  1 201 ? -10.707 -41.224 54.238  1.00 32.11  ? 201 GLY B O   1 
ATOM   4162  N  N   . ASP B  1 202 ? -11.325 -42.091 56.266  1.00 26.98  ? 202 ASP B N   1 
ATOM   4163  C  CA  . ASP B  1 202 ? -10.237 -41.391 57.031  1.00 29.99  ? 202 ASP B CA  1 
ATOM   4164  C  C   . ASP B  1 202 ? -8.855  -41.982 56.749  1.00 32.95  ? 202 ASP B C   1 
ATOM   4165  O  O   . ASP B  1 202 ? -7.836  -41.447 57.197  1.00 33.43  ? 202 ASP B O   1 
ATOM   4166  C  CB  . ASP B  1 202 ? -10.520 -41.414 58.562  1.00 29.00  ? 202 ASP B CB  1 
ATOM   4167  C  CG  . ASP B  1 202 ? -11.792 -40.643 58.943  1.00 31.26  ? 202 ASP B CG  1 
ATOM   4168  O  OD1 . ASP B  1 202 ? -12.399 -39.960 58.041  1.00 30.68  ? 202 ASP B OD1 1 
ATOM   4169  O  OD2 . ASP B  1 202 ? -12.190 -40.709 60.130  1.00 32.71  ? 202 ASP B OD2 1 
ATOM   4170  N  N   . THR B  1 203 ? -8.821  -43.067 56.020  1.00 31.66  ? 203 THR B N   1 
ATOM   4171  C  CA  . THR B  1 203 ? -7.575  -43.683 55.678  1.00 33.06  ? 203 THR B CA  1 
ATOM   4172  C  C   . THR B  1 203 ? -7.465  -43.906 54.197  1.00 33.48  ? 203 THR B C   1 
ATOM   4173  O  O   . THR B  1 203 ? -8.481  -44.000 53.491  1.00 31.00  ? 203 THR B O   1 
ATOM   4174  C  CB  . THR B  1 203 ? -7.400  -45.053 56.404  1.00 30.79  ? 203 THR B CB  1 
ATOM   4175  O  OG1 . THR B  1 203 ? -6.118  -45.544 56.159  1.00 32.77  ? 203 THR B OG1 1 
ATOM   4176  C  CG2 . THR B  1 203 ? -8.421  -46.061 55.899  1.00 30.20  ? 203 THR B CG2 1 
ATOM   4177  N  N   . ASP B  1 204 ? -6.232  -43.987 53.710  1.00 37.15  ? 204 ASP B N   1 
ATOM   4178  C  CA  . ASP B  1 204 ? -5.977  -44.351 52.299  1.00 40.25  ? 204 ASP B CA  1 
ATOM   4179  C  C   . ASP B  1 204 ? -5.445  -45.807 52.202  1.00 40.43  ? 204 ASP B C   1 
ATOM   4180  O  O   . ASP B  1 204 ? -4.996  -46.247 51.147  1.00 39.08  ? 204 ASP B O   1 
ATOM   4181  C  CB  . ASP B  1 204 ? -5.005  -43.363 51.634  1.00 42.19  ? 204 ASP B CB  1 
ATOM   4182  C  CG  . ASP B  1 204 ? -3.619  -43.331 52.324  1.00 50.06  ? 204 ASP B CG  1 
ATOM   4183  O  OD1 . ASP B  1 204 ? -3.343  -44.219 53.167  1.00 46.52  ? 204 ASP B OD1 1 
ATOM   4184  O  OD2 . ASP B  1 204 ? -2.820  -42.415 52.011  1.00 54.99  ? 204 ASP B OD2 1 
ATOM   4185  N  N   . ASN B  1 205 ? -5.511  -46.533 53.330  1.00 38.02  ? 205 ASN B N   1 
ATOM   4186  C  CA  . ASN B  1 205 ? -5.147  -47.945 53.362  1.00 40.61  ? 205 ASN B CA  1 
ATOM   4187  C  C   . ASN B  1 205 ? -6.232  -48.799 52.722  1.00 37.10  ? 205 ASN B C   1 
ATOM   4188  O  O   . ASN B  1 205 ? -7.087  -49.340 53.406  1.00 39.60  ? 205 ASN B O   1 
ATOM   4189  C  CB  . ASN B  1 205 ? -4.900  -48.396 54.800  1.00 40.69  ? 205 ASN B CB  1 
ATOM   4190  C  CG  . ASN B  1 205 ? -4.454  -49.841 54.890  1.00 40.31  ? 205 ASN B CG  1 
ATOM   4191  O  OD1 . ASN B  1 205 ? -4.500  -50.582 53.910  1.00 40.08  ? 205 ASN B OD1 1 
ATOM   4192  N  ND2 . ASN B  1 205 ? -4.032  -50.240 56.045  1.00 40.97  ? 205 ASN B ND2 1 
ATOM   4193  N  N   . ILE B  1 206 ? -6.185  -48.909 51.397  1.00 37.68  ? 206 ILE B N   1 
ATOM   4194  C  CA  . ILE B  1 206 ? -7.237  -49.611 50.632  1.00 37.04  ? 206 ILE B CA  1 
ATOM   4195  C  C   . ILE B  1 206 ? -7.384  -51.120 51.005  1.00 37.29  ? 206 ILE B C   1 
ATOM   4196  O  O   . ILE B  1 206 ? -8.470  -51.688 50.894  1.00 35.10  ? 206 ILE B O   1 
ATOM   4197  C  CB  . ILE B  1 206 ? -7.034  -49.453 49.095  1.00 43.98  ? 206 ILE B CB  1 
ATOM   4198  C  CG1 . ILE B  1 206 ? -5.631  -49.900 48.683  1.00 46.52  ? 206 ILE B CG1 1 
ATOM   4199  C  CG2 . ILE B  1 206 ? -7.272  -47.997 48.669  1.00 41.59  ? 206 ILE B CG2 1 
ATOM   4200  C  CD1 . ILE B  1 206 ? -5.325  -51.376 48.991  1.00 54.35  ? 206 ILE B CD1 1 
ATOM   4201  N  N   . ASP B  1 207 ? -6.286  -51.740 51.444  1.00 38.28  ? 207 ASP B N   1 
ATOM   4202  C  CA  . ASP B  1 207 ? -6.320  -53.172 51.853  1.00 39.44  ? 207 ASP B CA  1 
ATOM   4203  C  C   . ASP B  1 207 ? -7.234  -53.375 53.027  1.00 36.43  ? 207 ASP B C   1 
ATOM   4204  O  O   . ASP B  1 207 ? -8.005  -54.343 53.069  1.00 33.12  ? 207 ASP B O   1 
ATOM   4205  C  CB  . ASP B  1 207 ? -4.915  -53.680 52.182  1.00 40.17  ? 207 ASP B CB  1 
ATOM   4206  C  CG  . ASP B  1 207 ? -4.112  -53.960 50.967  1.00 47.71  ? 207 ASP B CG  1 
ATOM   4207  O  OD1 . ASP B  1 207 ? -4.701  -54.368 49.947  1.00 48.06  ? 207 ASP B OD1 1 
ATOM   4208  O  OD2 . ASP B  1 207 ? -2.879  -53.782 51.014  1.00 57.50  ? 207 ASP B OD2 1 
ATOM   4209  N  N   . TYR B  1 208 ? -7.158  -52.461 53.998  1.00 33.21  ? 208 TYR B N   1 
ATOM   4210  C  CA  . TYR B  1 208 ? -8.019  -52.519 55.153  1.00 32.72  ? 208 TYR B CA  1 
ATOM   4211  C  C   . TYR B  1 208 ? -9.470  -52.292 54.760  1.00 31.81  ? 208 TYR B C   1 
ATOM   4212  O  O   . TYR B  1 208 ? -10.355 -53.072 55.134  1.00 33.00  ? 208 TYR B O   1 
ATOM   4213  C  CB  . TYR B  1 208 ? -7.584  -51.488 56.223  1.00 31.93  ? 208 TYR B CB  1 
ATOM   4214  C  CG  . TYR B  1 208 ? -8.516  -51.438 57.433  1.00 29.82  ? 208 TYR B CG  1 
ATOM   4215  C  CD1 . TYR B  1 208 ? -8.674  -52.551 58.262  1.00 29.76  ? 208 TYR B CD1 1 
ATOM   4216  C  CD2 . TYR B  1 208 ? -9.238  -50.269 57.742  1.00 30.35  ? 208 TYR B CD2 1 
ATOM   4217  C  CE1 . TYR B  1 208 ? -9.524  -52.515 59.366  1.00 30.84  ? 208 TYR B CE1 1 
ATOM   4218  C  CE2 . TYR B  1 208 ? -10.092 -50.217 58.847  1.00 30.78  ? 208 TYR B CE2 1 
ATOM   4219  C  CZ  . TYR B  1 208 ? -10.236 -51.335 59.655  1.00 32.49  ? 208 TYR B CZ  1 
ATOM   4220  O  OH  . TYR B  1 208 ? -11.077 -51.290 60.740  1.00 36.50  ? 208 TYR B OH  1 
ATOM   4221  N  N   . ILE B  1 209 ? -9.717  -51.233 54.004  1.00 29.56  ? 209 ILE B N   1 
ATOM   4222  C  CA  . ILE B  1 209 ? -11.065 -50.923 53.569  1.00 30.18  ? 209 ILE B CA  1 
ATOM   4223  C  C   . ILE B  1 209 ? -11.704 -52.121 52.793  1.00 32.73  ? 209 ILE B C   1 
ATOM   4224  O  O   . ILE B  1 209 ? -12.850 -52.520 53.075  1.00 35.72  ? 209 ILE B O   1 
ATOM   4225  C  CB  . ILE B  1 209 ? -11.107 -49.664 52.702  1.00 27.29  ? 209 ILE B CB  1 
ATOM   4226  C  CG1 . ILE B  1 209 ? -10.588 -48.455 53.494  1.00 27.23  ? 209 ILE B CG1 1 
ATOM   4227  C  CG2 . ILE B  1 209 ? -12.535 -49.412 52.197  1.00 28.51  ? 209 ILE B CG2 1 
ATOM   4228  C  CD1 . ILE B  1 209 ? -10.405 -47.172 52.644  1.00 29.51  ? 209 ILE B CD1 1 
ATOM   4229  N  N   . LYS B  1 210 ? -10.947 -52.688 51.825  1.00 32.19  ? 210 LYS B N   1 
ATOM   4230  C  CA  . LYS B  1 210 ? -11.458 -53.850 50.996  1.00 33.31  ? 210 LYS B CA  1 
ATOM   4231  C  C   . LYS B  1 210 ? -11.766 -55.009 51.847  1.00 34.72  ? 210 LYS B C   1 
ATOM   4232  O  O   . LYS B  1 210 ? -12.713 -55.754 51.583  1.00 37.99  ? 210 LYS B O   1 
ATOM   4233  C  CB  . LYS B  1 210 ? -10.453 -54.241 49.949  1.00 32.69  ? 210 LYS B CB  1 
ATOM   4234  C  CG  . LYS B  1 210 ? -10.257 -53.215 48.879  1.00 35.12  ? 210 LYS B CG  1 
ATOM   4235  C  CD  . LYS B  1 210 ? -9.270  -53.696 47.848  1.00 37.98  ? 210 LYS B CD  1 
ATOM   4236  C  CE  . LYS B  1 210 ? -8.959  -52.610 46.850  1.00 38.03  ? 210 LYS B CE  1 
ATOM   4237  N  NZ  . LYS B  1 210 ? -8.070  -53.093 45.781  1.00 39.29  ? 210 LYS B NZ  1 
ATOM   4238  N  N   . LYS B  1 211 ? -10.979 -55.186 52.884  1.00 33.23  ? 211 LYS B N   1 
ATOM   4239  C  CA  . LYS B  1 211 ? -11.161 -56.268 53.790  1.00 35.93  ? 211 LYS B CA  1 
ATOM   4240  C  C   . LYS B  1 211 ? -12.606 -56.255 54.331  1.00 34.05  ? 211 LYS B C   1 
ATOM   4241  O  O   . LYS B  1 211 ? -13.265 -57.287 54.402  1.00 36.81  ? 211 LYS B O   1 
ATOM   4242  C  CB  . LYS B  1 211 ? -10.163 -56.152 54.939  1.00 35.84  ? 211 LYS B CB  1 
ATOM   4243  C  CG  . LYS B  1 211 ? -9.785  -57.443 55.572  1.00 40.86  ? 211 LYS B CG  1 
ATOM   4244  C  CD  . LYS B  1 211 ? -8.601  -57.243 56.544  1.00 47.50  ? 211 LYS B CD  1 
ATOM   4245  C  CE  . LYS B  1 211 ? -8.098  -58.572 57.101  1.00 55.57  ? 211 LYS B CE  1 
ATOM   4246  N  NZ  . LYS B  1 211 ? -7.039  -58.374 58.139  1.00 57.88  ? 211 LYS B NZ  1 
ATOM   4247  N  N   . ILE B  1 212 ? -13.078 -55.077 54.689  1.00 32.52  ? 212 ILE B N   1 
ATOM   4248  C  CA  . ILE B  1 212 ? -14.407 -54.920 55.245  1.00 27.50  ? 212 ILE B CA  1 
ATOM   4249  C  C   . ILE B  1 212 ? -15.516 -55.080 54.159  1.00 27.47  ? 212 ILE B C   1 
ATOM   4250  O  O   . ILE B  1 212 ? -16.577 -55.663 54.418  1.00 28.96  ? 212 ILE B O   1 
ATOM   4251  C  CB  . ILE B  1 212 ? -14.543 -53.580 55.952  1.00 27.45  ? 212 ILE B CB  1 
ATOM   4252  C  CG1 . ILE B  1 212 ? -13.577 -53.535 57.190  1.00 27.87  ? 212 ILE B CG1 1 
ATOM   4253  C  CG2 . ILE B  1 212 ? -15.977 -53.334 56.365  1.00 23.36  ? 212 ILE B CG2 1 
ATOM   4254  C  CD1 . ILE B  1 212 ? -13.564 -52.218 57.916  1.00 26.88  ? 212 ILE B CD1 1 
ATOM   4255  N  N   . ALA B  1 213 ? -15.253 -54.581 52.976  1.00 27.57  ? 213 ALA B N   1 
ATOM   4256  C  CA  . ALA B  1 213 ? -16.191 -54.713 51.881  1.00 26.44  ? 213 ALA B CA  1 
ATOM   4257  C  C   . ALA B  1 213 ? -16.296 -56.186 51.438  1.00 27.37  ? 213 ALA B C   1 
ATOM   4258  O  O   . ALA B  1 213 ? -17.360 -56.659 51.085  1.00 29.16  ? 213 ALA B O   1 
ATOM   4259  C  CB  . ALA B  1 213 ? -15.776 -53.840 50.726  1.00 24.54  ? 213 ALA B CB  1 
ATOM   4260  N  N   . ASP B  1 214 ? -15.176 -56.885 51.469  1.00 27.82  ? 214 ASP B N   1 
ATOM   4261  C  CA  . ASP B  1 214 ? -15.143 -58.301 51.090  1.00 29.74  ? 214 ASP B CA  1 
ATOM   4262  C  C   . ASP B  1 214 ? -15.995 -59.134 52.011  1.00 31.59  ? 214 ASP B C   1 
ATOM   4263  O  O   . ASP B  1 214 ? -16.571 -60.111 51.598  1.00 29.45  ? 214 ASP B O   1 
ATOM   4264  C  CB  . ASP B  1 214 ? -13.716 -58.825 51.100  1.00 30.86  ? 214 ASP B CB  1 
ATOM   4265  C  CG  . ASP B  1 214 ? -12.902 -58.293 49.972  1.00 36.48  ? 214 ASP B CG  1 
ATOM   4266  O  OD1 . ASP B  1 214 ? -13.507 -57.789 48.964  1.00 31.77  ? 214 ASP B OD1 1 
ATOM   4267  O  OD2 . ASP B  1 214 ? -11.643 -58.365 50.055  1.00 39.83  ? 214 ASP B OD2 1 
ATOM   4268  N  N   . LYS B  1 215 ? -16.070 -58.736 53.285  1.00 31.14  ? 215 LYS B N   1 
ATOM   4269  C  CA  . LYS B  1 215 ? -16.847 -59.479 54.229  1.00 31.68  ? 215 LYS B CA  1 
ATOM   4270  C  C   . LYS B  1 215 ? -18.339 -59.101 54.170  1.00 28.34  ? 215 LYS B C   1 
ATOM   4271  O  O   . LYS B  1 215 ? -19.100 -59.576 54.913  1.00 28.71  ? 215 LYS B O   1 
ATOM   4272  C  CB  . LYS B  1 215 ? -16.283 -59.338 55.650  1.00 38.39  ? 215 LYS B CB  1 
ATOM   4273  C  CG  . LYS B  1 215 ? -14.773 -59.655 55.739  1.00 46.02  ? 215 LYS B CG  1 
ATOM   4274  C  CD  . LYS B  1 215 ? -14.435 -60.433 56.980  1.00 49.31  ? 215 LYS B CD  1 
ATOM   4275  C  CE  . LYS B  1 215 ? -14.946 -61.868 56.880  1.00 56.16  ? 215 LYS B CE  1 
ATOM   4276  N  NZ  . LYS B  1 215 ? -14.534 -62.687 58.054  1.00 57.30  ? 215 LYS B NZ  1 
ATOM   4277  N  N   . GLY B  1 216 ? -18.698 -58.206 53.226  1.00 26.54  ? 216 GLY B N   1 
ATOM   4278  C  CA  . GLY B  1 216 ? -20.153 -57.962 52.886  1.00 25.45  ? 216 GLY B CA  1 
ATOM   4279  C  C   . GLY B  1 216 ? -20.797 -56.655 53.395  1.00 27.42  ? 216 GLY B C   1 
ATOM   4280  O  O   . GLY B  1 216 ? -21.966 -56.420 53.169  1.00 25.28  ? 216 GLY B O   1 
ATOM   4281  N  N   . SER B  1 217 ? -20.036 -55.828 54.060  1.00 24.44  ? 217 SER B N   1 
ATOM   4282  C  CA  . SER B  1 217 ? -20.614 -54.582 54.639  1.00 25.22  ? 217 SER B CA  1 
ATOM   4283  C  C   . SER B  1 217 ? -20.342 -53.361 53.779  1.00 24.66  ? 217 SER B C   1 
ATOM   4284  O  O   . SER B  1 217 ? -19.402 -53.342 53.001  1.00 22.71  ? 217 SER B O   1 
ATOM   4285  C  CB  . SER B  1 217 ? -20.097 -54.358 56.053  1.00 25.60  ? 217 SER B CB  1 
ATOM   4286  O  OG  . SER B  1 217 ? -20.538 -55.395 56.923  1.00 27.61  ? 217 SER B OG  1 
ATOM   4287  N  N   . PHE B  1 218 ? -21.189 -52.331 53.925  1.00 23.74  ? 218 PHE B N   1 
ATOM   4288  C  CA  . PHE B  1 218 ? -20.967 -51.094 53.261  1.00 21.84  ? 218 PHE B CA  1 
ATOM   4289  C  C   . PHE B  1 218 ? -19.772 -50.348 53.921  1.00 22.27  ? 218 PHE B C   1 
ATOM   4290  O  O   . PHE B  1 218 ? -19.561 -50.435 55.155  1.00 20.99  ? 218 PHE B O   1 
ATOM   4291  C  CB  . PHE B  1 218 ? -22.213 -50.242 53.289  1.00 20.95  ? 218 PHE B CB  1 
ATOM   4292  C  CG  . PHE B  1 218 ? -23.340 -50.785 52.432  1.00 23.46  ? 218 PHE B CG  1 
ATOM   4293  C  CD1 . PHE B  1 218 ? -24.452 -51.362 53.011  1.00 23.22  ? 218 PHE B CD1 1 
ATOM   4294  C  CD2 . PHE B  1 218 ? -23.265 -50.724 51.022  1.00 22.62  ? 218 PHE B CD2 1 
ATOM   4295  C  CE1 . PHE B  1 218 ? -25.487 -51.866 52.220  1.00 26.38  ? 218 PHE B CE1 1 
ATOM   4296  C  CE2 . PHE B  1 218 ? -24.284 -51.224 50.236  1.00 24.53  ? 218 PHE B CE2 1 
ATOM   4297  C  CZ  . PHE B  1 218 ? -25.399 -51.793 50.828  1.00 26.78  ? 218 PHE B CZ  1 
ATOM   4298  N  N   . ILE B  1 219 ? -19.009 -49.653 53.114  1.00 23.72  ? 219 ILE B N   1 
ATOM   4299  C  CA  . ILE B  1 219 ? -17.823 -48.929 53.604  1.00 25.55  ? 219 ILE B CA  1 
ATOM   4300  C  C   . ILE B  1 219 ? -18.074 -47.442 53.560  1.00 26.72  ? 219 ILE B C   1 
ATOM   4301  O  O   . ILE B  1 219 ? -18.508 -46.902 52.531  1.00 25.74  ? 219 ILE B O   1 
ATOM   4302  C  CB  . ILE B  1 219 ? -16.575 -49.281 52.787  1.00 26.82  ? 219 ILE B CB  1 
ATOM   4303  C  CG1 . ILE B  1 219 ? -16.844 -49.089 51.291  1.00 28.34  ? 219 ILE B CG1 1 
ATOM   4304  C  CG2 . ILE B  1 219 ? -16.142 -50.735 53.068  1.00 25.76  ? 219 ILE B CG2 1 
ATOM   4305  C  CD1 . ILE B  1 219 ? -15.694 -49.511 50.401  1.00 26.67  ? 219 ILE B CD1 1 
ATOM   4306  N  N   . GLY B  1 220 ? -17.812 -46.768 54.677  1.00 24.14  ? 220 GLY B N   1 
ATOM   4307  C  CA  . GLY B  1 220 ? -18.171 -45.344 54.822  1.00 22.91  ? 220 GLY B CA  1 
ATOM   4308  C  C   . GLY B  1 220 ? -17.075 -44.359 54.475  1.00 23.14  ? 220 GLY B C   1 
ATOM   4309  O  O   . GLY B  1 220 ? -16.251 -44.044 55.289  1.00 23.47  ? 220 GLY B O   1 
ATOM   4310  N  N   . LEU B  1 221 ? -17.091 -43.876 53.234  1.00 23.27  ? 221 LEU B N   1 
ATOM   4311  C  CA  . LEU B  1 221 ? -16.204 -42.791 52.812  1.00 23.97  ? 221 LEU B CA  1 
ATOM   4312  C  C   . LEU B  1 221 ? -16.960 -41.553 53.058  1.00 24.82  ? 221 LEU B C   1 
ATOM   4313  O  O   . LEU B  1 221 ? -17.377 -40.851 52.119  1.00 26.36  ? 221 LEU B O   1 
ATOM   4314  C  CB  . LEU B  1 221 ? -15.880 -42.935 51.349  1.00 24.29  ? 221 LEU B CB  1 
ATOM   4315  C  CG  . LEU B  1 221 ? -15.602 -44.396 50.906  1.00 23.76  ? 221 LEU B CG  1 
ATOM   4316  C  CD1 . LEU B  1 221 ? -15.268 -44.474 49.417  1.00 22.68  ? 221 LEU B CD1 1 
ATOM   4317  C  CD2 . LEU B  1 221 ? -14.481 -45.037 51.770  1.00 21.54  ? 221 LEU B CD2 1 
ATOM   4318  N  N   . ASP B  1 222 ? -17.152 -41.250 54.340  1.00 25.82  ? 222 ASP B N   1 
ATOM   4319  C  CA  . ASP B  1 222 ? -18.272 -40.415 54.773  1.00 26.00  ? 222 ASP B CA  1 
ATOM   4320  C  C   . ASP B  1 222 ? -17.883 -39.158 55.523  1.00 24.97  ? 222 ASP B C   1 
ATOM   4321  O  O   . ASP B  1 222 ? -18.713 -38.558 56.187  1.00 22.82  ? 222 ASP B O   1 
ATOM   4322  C  CB  . ASP B  1 222 ? -19.202 -41.258 55.655  1.00 24.38  ? 222 ASP B CB  1 
ATOM   4323  C  CG  . ASP B  1 222 ? -18.440 -41.920 56.874  1.00 23.89  ? 222 ASP B CG  1 
ATOM   4324  O  OD1 . ASP B  1 222 ? -18.959 -42.901 57.449  1.00 27.32  ? 222 ASP B OD1 1 
ATOM   4325  O  OD2 . ASP B  1 222 ? -17.331 -41.437 57.222  1.00 25.08  ? 222 ASP B OD2 1 
ATOM   4326  N  N   . ARG B  1 223 ? -16.634 -38.760 55.427  1.00 26.67  ? 223 ARG B N   1 
ATOM   4327  C  CA  . ARG B  1 223 ? -16.188 -37.505 56.100  1.00 28.74  ? 223 ARG B CA  1 
ATOM   4328  C  C   . ARG B  1 223 ? -15.538 -36.477 55.117  1.00 30.74  ? 223 ARG B C   1 
ATOM   4329  O  O   . ARG B  1 223 ? -14.612 -35.730 55.493  1.00 31.24  ? 223 ARG B O   1 
ATOM   4330  C  CB  . ARG B  1 223 ? -15.261 -37.807 57.261  1.00 27.63  ? 223 ARG B CB  1 
ATOM   4331  C  CG  . ARG B  1 223 ? -15.983 -38.102 58.551  1.00 28.57  ? 223 ARG B CG  1 
ATOM   4332  C  CD  . ARG B  1 223 ? -15.035 -38.622 59.600  1.00 28.66  ? 223 ARG B CD  1 
ATOM   4333  N  NE  . ARG B  1 223 ? -15.553 -38.433 60.938  1.00 27.79  ? 223 ARG B NE  1 
ATOM   4334  C  CZ  . ARG B  1 223 ? -14.952 -38.866 62.038  1.00 26.60  ? 223 ARG B CZ  1 
ATOM   4335  N  NH1 . ARG B  1 223 ? -13.809 -39.529 61.956  1.00 26.46  ? 223 ARG B NH1 1 
ATOM   4336  N  NH2 . ARG B  1 223 ? -15.491 -38.644 63.206  1.00 29.54  ? 223 ARG B NH2 1 
ATOM   4337  N  N   . TYR B  1 224 ? -16.032 -36.448 53.885  1.00 27.05  ? 224 TYR B N   1 
ATOM   4338  C  CA  . TYR B  1 224 ? -15.562 -35.477 52.903  1.00 29.20  ? 224 TYR B CA  1 
ATOM   4339  C  C   . TYR B  1 224 ? -15.635 -34.045 53.438  1.00 28.61  ? 224 TYR B C   1 
ATOM   4340  O  O   . TYR B  1 224 ? -16.695 -33.587 53.889  1.00 25.93  ? 224 TYR B O   1 
ATOM   4341  C  CB  . TYR B  1 224 ? -16.347 -35.605 51.588  1.00 26.25  ? 224 TYR B CB  1 
ATOM   4342  C  CG  . TYR B  1 224 ? -15.712 -36.518 50.627  1.00 28.69  ? 224 TYR B CG  1 
ATOM   4343  C  CD1 . TYR B  1 224 ? -16.215 -37.802 50.412  1.00 26.45  ? 224 TYR B CD1 1 
ATOM   4344  C  CD2 . TYR B  1 224 ? -14.555 -36.121 49.910  1.00 33.24  ? 224 TYR B CD2 1 
ATOM   4345  C  CE1 . TYR B  1 224 ? -15.606 -38.668 49.503  1.00 29.16  ? 224 TYR B CE1 1 
ATOM   4346  C  CE2 . TYR B  1 224 ? -13.939 -36.977 49.002  1.00 33.70  ? 224 TYR B CE2 1 
ATOM   4347  C  CZ  . TYR B  1 224 ? -14.458 -38.241 48.797  1.00 30.82  ? 224 TYR B CZ  1 
ATOM   4348  O  OH  . TYR B  1 224 ? -13.857 -39.068 47.916  1.00 35.62  ? 224 TYR B OH  1 
ATOM   4349  N  N   . GLY B  1 225 ? -14.502 -33.344 53.389  1.00 29.29  ? 225 GLY B N   1 
ATOM   4350  C  CA  . GLY B  1 225 ? -14.423 -31.954 53.903  1.00 32.74  ? 225 GLY B CA  1 
ATOM   4351  C  C   . GLY B  1 225 ? -13.575 -31.856 55.158  1.00 36.41  ? 225 GLY B C   1 
ATOM   4352  O  O   . GLY B  1 225 ? -12.921 -30.841 55.398  1.00 39.70  ? 225 GLY B O   1 
ATOM   4353  N  N   . LEU B  1 226 ? -13.588 -32.931 55.969  1.00 36.06  ? 226 LEU B N   1 
ATOM   4354  C  CA  . LEU B  1 226 ? -12.797 -32.983 57.208  1.00 35.79  ? 226 LEU B CA  1 
ATOM   4355  C  C   . LEU B  1 226 ? -11.323 -33.345 56.902  1.00 39.58  ? 226 LEU B C   1 
ATOM   4356  O  O   . LEU B  1 226 ? -10.872 -34.493 57.144  1.00 35.05  ? 226 LEU B O   1 
ATOM   4357  C  CB  . LEU B  1 226 ? -13.411 -33.968 58.188  1.00 34.52  ? 226 LEU B CB  1 
ATOM   4358  C  CG  . LEU B  1 226 ? -14.826 -33.538 58.710  1.00 36.14  ? 226 LEU B CG  1 
ATOM   4359  C  CD1 . LEU B  1 226 ? -15.596 -34.705 59.318  1.00 31.40  ? 226 LEU B CD1 1 
ATOM   4360  C  CD2 . LEU B  1 226 ? -14.706 -32.380 59.700  1.00 36.88  ? 226 LEU B CD2 1 
ATOM   4361  N  N   . ASP B  1 227 ? -10.584 -32.362 56.370  1.00 39.93  ? 227 ASP B N   1 
ATOM   4362  C  CA  . ASP B  1 227 ? -9.207  -32.571 55.919  1.00 41.23  ? 227 ASP B CA  1 
ATOM   4363  C  C   . ASP B  1 227 ? -8.248  -32.997 57.046  1.00 40.90  ? 227 ASP B C   1 
ATOM   4364  O  O   . ASP B  1 227 ? -7.223  -33.613 56.785  1.00 41.31  ? 227 ASP B O   1 
ATOM   4365  C  CB  . ASP B  1 227 ? -8.669  -31.295 55.201  1.00 43.82  ? 227 ASP B CB  1 
ATOM   4366  C  CG  . ASP B  1 227 ? -9.423  -30.989 53.905  1.00 47.24  ? 227 ASP B CG  1 
ATOM   4367  O  OD1 . ASP B  1 227 ? -10.047 -31.919 53.345  1.00 49.31  ? 227 ASP B OD1 1 
ATOM   4368  O  OD2 . ASP B  1 227 ? -9.388  -29.825 53.452  1.00 54.71  ? 227 ASP B OD2 1 
ATOM   4369  N  N   . LEU B  1 228 ? -8.596  -32.660 58.301  1.00 43.91  ? 228 LEU B N   1 
ATOM   4370  C  CA  . LEU B  1 228 ? -7.744  -33.044 59.465  1.00 47.09  ? 228 LEU B CA  1 
ATOM   4371  C  C   . LEU B  1 228 ? -7.671  -34.579 59.630  1.00 49.10  ? 228 LEU B C   1 
ATOM   4372  O  O   . LEU B  1 228 ? -6.693  -35.107 60.145  1.00 51.44  ? 228 LEU B O   1 
ATOM   4373  C  CB  . LEU B  1 228 ? -8.232  -32.378 60.764  1.00 50.41  ? 228 LEU B CB  1 
ATOM   4374  C  CG  . LEU B  1 228 ? -9.524  -32.922 61.417  1.00 54.75  ? 228 LEU B CG  1 
ATOM   4375  C  CD1 . LEU B  1 228 ? -9.699  -32.349 62.809  1.00 48.67  ? 228 LEU B CD1 1 
ATOM   4376  C  CD2 . LEU B  1 228 ? -10.751 -32.636 60.549  1.00 55.18  ? 228 LEU B CD2 1 
ATOM   4377  N  N   . PHE B  1 229 ? -8.721  -35.278 59.183  1.00 46.82  ? 229 PHE B N   1 
ATOM   4378  C  CA  . PHE B  1 229 ? -8.715  -36.748 59.186  1.00 42.91  ? 229 PHE B CA  1 
ATOM   4379  C  C   . PHE B  1 229 ? -8.090  -37.283 57.882  1.00 44.17  ? 229 PHE B C   1 
ATOM   4380  O  O   . PHE B  1 229 ? -7.261  -38.177 57.910  1.00 44.11  ? 229 PHE B O   1 
ATOM   4381  C  CB  . PHE B  1 229 ? -10.106 -37.295 59.379  1.00 38.31  ? 229 PHE B CB  1 
ATOM   4382  C  CG  . PHE B  1 229 ? -10.724 -36.906 60.662  1.00 42.82  ? 229 PHE B CG  1 
ATOM   4383  C  CD1 . PHE B  1 229 ? -10.086 -37.185 61.872  1.00 47.91  ? 229 PHE B CD1 1 
ATOM   4384  C  CD2 . PHE B  1 229 ? -11.945 -36.265 60.691  1.00 44.95  ? 229 PHE B CD2 1 
ATOM   4385  C  CE1 . PHE B  1 229 ? -10.659 -36.824 63.068  1.00 48.87  ? 229 PHE B CE1 1 
ATOM   4386  C  CE2 . PHE B  1 229 ? -12.524 -35.901 61.892  1.00 46.56  ? 229 PHE B CE2 1 
ATOM   4387  C  CZ  . PHE B  1 229 ? -11.883 -36.181 63.080  1.00 47.60  ? 229 PHE B CZ  1 
ATOM   4388  N  N   . LEU B  1 230 ? -8.515  -36.712 56.741  1.00 37.27  ? 230 LEU B N   1 
ATOM   4389  C  CA  . LEU B  1 230 ? -7.869  -36.997 55.427  1.00 36.90  ? 230 LEU B CA  1 
ATOM   4390  C  C   . LEU B  1 230 ? -8.274  -35.970 54.422  1.00 38.65  ? 230 LEU B C   1 
ATOM   4391  O  O   . LEU B  1 230 ? -9.438  -35.750 54.214  1.00 37.48  ? 230 LEU B O   1 
ATOM   4392  C  CB  . LEU B  1 230 ? -8.224  -38.391 54.929  1.00 34.21  ? 230 LEU B CB  1 
ATOM   4393  C  CG  . LEU B  1 230 ? -7.360  -38.920 53.776  1.00 36.51  ? 230 LEU B CG  1 
ATOM   4394  C  CD1 . LEU B  1 230 ? -5.868  -38.987 54.186  1.00 36.60  ? 230 LEU B CD1 1 
ATOM   4395  C  CD2 . LEU B  1 230 ? -7.855  -40.284 53.295  1.00 37.25  ? 230 LEU B CD2 1 
ATOM   4396  N  N   . PRO B  1 231 ? -7.277  -35.307 53.788  1.00 42.18  ? 231 PRO B N   1 
ATOM   4397  C  CA  . PRO B  1 231 ? -7.544  -34.258 52.790  1.00 42.70  ? 231 PRO B CA  1 
ATOM   4398  C  C   . PRO B  1 231 ? -8.491  -34.729 51.650  1.00 40.86  ? 231 PRO B C   1 
ATOM   4399  O  O   . PRO B  1 231 ? -8.449  -35.891 51.242  1.00 40.17  ? 231 PRO B O   1 
ATOM   4400  C  CB  . PRO B  1 231 ? -6.133  -33.927 52.228  1.00 42.96  ? 231 PRO B CB  1 
ATOM   4401  C  CG  . PRO B  1 231 ? -5.211  -34.989 52.808  1.00 50.47  ? 231 PRO B CG  1 
ATOM   4402  C  CD  . PRO B  1 231 ? -5.843  -35.462 54.058  1.00 46.07  ? 231 PRO B CD  1 
ATOM   4403  N  N   . VAL B  1 232 ? -9.312  -33.823 51.166  1.00 36.76  ? 232 VAL B N   1 
ATOM   4404  C  CA  . VAL B  1 232 ? -10.262 -34.122 50.082  1.00 37.33  ? 232 VAL B CA  1 
ATOM   4405  C  C   . VAL B  1 232 ? -9.612  -34.902 48.895  1.00 37.99  ? 232 VAL B C   1 
ATOM   4406  O  O   . VAL B  1 232 ? -10.116 -35.948 48.481  1.00 38.82  ? 232 VAL B O   1 
ATOM   4407  C  CB  . VAL B  1 232 ? -10.912 -32.845 49.544  1.00 35.42  ? 232 VAL B CB  1 
ATOM   4408  C  CG1 . VAL B  1 232 ? -11.767 -33.155 48.309  1.00 37.28  ? 232 VAL B CG1 1 
ATOM   4409  C  CG2 . VAL B  1 232 ? -11.745 -32.170 50.636  1.00 34.51  ? 232 VAL B CG2 1 
ATOM   4410  N  N   . ASP B  1 233 ? -8.517  -34.384 48.372  1.00 34.85  ? 233 ASP B N   1 
ATOM   4411  C  CA  . ASP B  1 233 ? -7.873  -35.001 47.193  1.00 41.31  ? 233 ASP B CA  1 
ATOM   4412  C  C   . ASP B  1 233 ? -7.386  -36.446 47.473  1.00 38.49  ? 233 ASP B C   1 
ATOM   4413  O  O   . ASP B  1 233 ? -7.438  -37.323 46.582  1.00 38.49  ? 233 ASP B O   1 
ATOM   4414  C  CB  . ASP B  1 233 ? -6.709  -34.110 46.650  1.00 47.32  ? 233 ASP B CB  1 
ATOM   4415  C  CG  . ASP B  1 233 ? -5.589  -33.912 47.674  1.00 58.18  ? 233 ASP B CG  1 
ATOM   4416  O  OD1 . ASP B  1 233 ? -5.810  -34.209 48.875  1.00 72.28  ? 233 ASP B OD1 1 
ATOM   4417  O  OD2 . ASP B  1 233 ? -4.490  -33.456 47.276  1.00 74.20  ? 233 ASP B OD2 1 
ATOM   4418  N  N   . LYS B  1 234 ? -6.921  -36.687 48.694  1.00 37.49  ? 234 LYS B N   1 
ATOM   4419  C  CA  . LYS B  1 234 ? -6.521  -38.023 49.097  1.00 37.28  ? 234 LYS B CA  1 
ATOM   4420  C  C   . LYS B  1 234 ? -7.757  -38.937 49.201  1.00 34.22  ? 234 LYS B C   1 
ATOM   4421  O  O   . LYS B  1 234 ? -7.713  -40.088 48.813  1.00 31.46  ? 234 LYS B O   1 
ATOM   4422  C  CB  . LYS B  1 234 ? -5.770  -37.985 50.419  1.00 40.00  ? 234 LYS B CB  1 
ATOM   4423  C  CG  . LYS B  1 234 ? -4.326  -37.514 50.293  1.00 48.87  ? 234 LYS B CG  1 
ATOM   4424  C  CD  . LYS B  1 234 ? -3.458  -38.580 49.619  1.00 49.57  ? 234 LYS B CD  1 
ATOM   4425  C  CE  . LYS B  1 234 ? -3.360  -39.846 50.499  1.00 50.29  ? 234 LYS B CE  1 
ATOM   4426  N  NZ  . LYS B  1 234 ? -2.739  -40.997 49.776  1.00 46.97  ? 234 LYS B NZ  1 
ATOM   4427  N  N   . ARG B  1 235 ? -8.849  -38.399 49.730  1.00 30.67  ? 235 ARG B N   1 
ATOM   4428  C  CA  . ARG B  1 235 ? -10.105 -39.149 49.772  1.00 32.12  ? 235 ARG B CA  1 
ATOM   4429  C  C   . ARG B  1 235 ? -10.538 -39.488 48.359  1.00 30.93  ? 235 ARG B C   1 
ATOM   4430  O  O   . ARG B  1 235 ? -10.807 -40.646 48.043  1.00 32.07  ? 235 ARG B O   1 
ATOM   4431  C  CB  . ARG B  1 235 ? -11.193 -38.351 50.496  1.00 29.49  ? 235 ARG B CB  1 
ATOM   4432  C  CG  . ARG B  1 235 ? -10.923 -38.161 51.966  1.00 32.44  ? 235 ARG B CG  1 
ATOM   4433  C  CD  . ARG B  1 235 ? -11.961 -37.278 52.626  1.00 29.41  ? 235 ARG B CD  1 
ATOM   4434  N  NE  . ARG B  1 235 ? -11.722 -37.177 54.063  1.00 28.58  ? 235 ARG B NE  1 
ATOM   4435  C  CZ  . ARG B  1 235 ? -12.314 -37.953 54.982  1.00 32.96  ? 235 ARG B CZ  1 
ATOM   4436  N  NH1 . ARG B  1 235 ? -12.026 -37.791 56.280  1.00 34.50  ? 235 ARG B NH1 1 
ATOM   4437  N  NH2 . ARG B  1 235 ? -13.213 -38.904 54.602  1.00 28.17  ? 235 ARG B NH2 1 
ATOM   4438  N  N   . ASN B  1 236 ? -10.587 -38.467 47.497  1.00 29.74  ? 236 ASN B N   1 
ATOM   4439  C  CA  . ASN B  1 236 ? -10.990 -38.658 46.105  1.00 29.99  ? 236 ASN B CA  1 
ATOM   4440  C  C   . ASN B  1 236 ? -10.235 -39.771 45.426  1.00 33.47  ? 236 ASN B C   1 
ATOM   4441  O  O   . ASN B  1 236 ? -10.822 -40.573 44.700  1.00 31.63  ? 236 ASN B O   1 
ATOM   4442  C  CB  . ASN B  1 236 ? -10.838 -37.359 45.318  1.00 30.11  ? 236 ASN B CB  1 
ATOM   4443  C  CG  . ASN B  1 236 ? -11.967 -36.403 45.566  1.00 29.13  ? 236 ASN B CG  1 
ATOM   4444  O  OD1 . ASN B  1 236 ? -13.036 -36.797 46.075  1.00 33.00  ? 236 ASN B OD1 1 
ATOM   4445  N  ND2 . ASN B  1 236 ? -11.762 -35.134 45.214  1.00 25.72  ? 236 ASN B ND2 1 
ATOM   4446  N  N   . GLU B  1 237 ? -8.910  -39.827 45.663  1.00 35.01  ? 237 GLU B N   1 
ATOM   4447  C  CA  . GLU B  1 237 ? -8.058  -40.846 45.026  1.00 36.93  ? 237 GLU B CA  1 
ATOM   4448  C  C   . GLU B  1 237 ? -8.353  -42.232 45.558  1.00 34.28  ? 237 GLU B C   1 
ATOM   4449  O  O   . GLU B  1 237 ? -8.371  -43.185 44.818  1.00 37.20  ? 237 GLU B O   1 
ATOM   4450  C  CB  . GLU B  1 237 ? -6.596  -40.509 45.209  1.00 39.70  ? 237 GLU B CB  1 
ATOM   4451  C  CG  . GLU B  1 237 ? -6.142  -39.304 44.404  1.00 51.30  ? 237 GLU B CG  1 
ATOM   4452  C  CD  . GLU B  1 237 ? -4.638  -39.161 44.370  1.00 66.40  ? 237 GLU B CD  1 
ATOM   4453  O  OE1 . GLU B  1 237 ? -4.114  -38.641 43.363  1.00 79.83  ? 237 GLU B OE1 1 
ATOM   4454  O  OE2 . GLU B  1 237 ? -3.966  -39.578 45.362  1.00 70.41  ? 237 GLU B OE2 1 
ATOM   4455  N  N   . THR B  1 238 ? -8.583  -42.325 46.855  1.00 34.58  ? 238 THR B N   1 
ATOM   4456  C  CA  . THR B  1 238 ? -8.950  -43.591 47.478  1.00 31.44  ? 238 THR B CA  1 
ATOM   4457  C  C   . THR B  1 238 ? -10.330 -44.038 46.967  1.00 29.08  ? 238 THR B C   1 
ATOM   4458  O  O   . THR B  1 238 ? -10.528 -45.193 46.616  1.00 28.23  ? 238 THR B O   1 
ATOM   4459  C  CB  . THR B  1 238 ? -8.992  -43.469 48.989  1.00 31.50  ? 238 THR B CB  1 
ATOM   4460  O  OG1 . THR B  1 238 ? -7.719  -43.016 49.472  1.00 38.00  ? 238 THR B OG1 1 
ATOM   4461  C  CG2 . THR B  1 238 ? -9.336  -44.838 49.641  1.00 33.45  ? 238 THR B CG2 1 
ATOM   4462  N  N   . THR B  1 239 ? -11.270 -43.095 46.931  1.00 27.74  ? 239 THR B N   1 
ATOM   4463  C  CA  . THR B  1 239 ? -12.616 -43.353 46.415  1.00 28.75  ? 239 THR B CA  1 
ATOM   4464  C  C   . THR B  1 239 ? -12.563 -43.842 44.949  1.00 31.61  ? 239 THR B C   1 
ATOM   4465  O  O   . THR B  1 239 ? -13.235 -44.830 44.579  1.00 34.47  ? 239 THR B O   1 
ATOM   4466  C  CB  . THR B  1 239 ? -13.482 -42.099 46.496  1.00 27.42  ? 239 THR B CB  1 
ATOM   4467  O  OG1 . THR B  1 239 ? -13.579 -41.677 47.854  1.00 30.50  ? 239 THR B OG1 1 
ATOM   4468  C  CG2 . THR B  1 239 ? -14.898 -42.369 45.937  1.00 25.65  ? 239 THR B CG2 1 
ATOM   4469  N  N   . LEU B  1 240 ? -11.761 -43.149 44.122  1.00 32.47  ? 240 LEU B N   1 
ATOM   4470  C  CA  . LEU B  1 240 ? -11.589 -43.523 42.697  1.00 32.66  ? 240 LEU B CA  1 
ATOM   4471  C  C   . LEU B  1 240 ? -10.929 -44.908 42.551  1.00 33.30  ? 240 LEU B C   1 
ATOM   4472  O  O   . LEU B  1 240 ? -11.330 -45.721 41.707  1.00 31.56  ? 240 LEU B O   1 
ATOM   4473  C  CB  . LEU B  1 240 ? -10.763 -42.473 41.971  1.00 30.47  ? 240 LEU B CB  1 
ATOM   4474  C  CG  . LEU B  1 240 ? -10.477 -42.735 40.526  1.00 32.40  ? 240 LEU B CG  1 
ATOM   4475  C  CD1 . LEU B  1 240 ? -11.777 -42.740 39.714  1.00 29.50  ? 240 LEU B CD1 1 
ATOM   4476  C  CD2 . LEU B  1 240 ? -9.488  -41.695 39.974  1.00 30.47  ? 240 LEU B CD2 1 
ATOM   4477  N  N   . ARG B  1 241 ? -9.932  -45.160 43.356  1.00 35.58  ? 241 ARG B N   1 
ATOM   4478  C  CA  . ARG B  1 241 ? -9.254  -46.410 43.324  1.00 37.63  ? 241 ARG B CA  1 
ATOM   4479  C  C   . ARG B  1 241 ? -10.230 -47.557 43.630  1.00 34.58  ? 241 ARG B C   1 
ATOM   4480  O  O   . ARG B  1 241 ? -10.254 -48.564 42.932  1.00 34.90  ? 241 ARG B O   1 
ATOM   4481  C  CB  . ARG B  1 241 ? -8.094  -46.418 44.325  1.00 39.23  ? 241 ARG B CB  1 
ATOM   4482  C  CG  . ARG B  1 241 ? -7.465  -47.778 44.527  1.00 44.56  ? 241 ARG B CG  1 
ATOM   4483  C  CD  . ARG B  1 241 ? -6.898  -48.331 43.224  1.00 50.72  ? 241 ARG B CD  1 
ATOM   4484  N  NE  . ARG B  1 241 ? -6.448  -49.703 43.373  1.00 52.83  ? 241 ARG B NE  1 
ATOM   4485  C  CZ  . ARG B  1 241 ? -5.270  -50.047 43.862  1.00 58.67  ? 241 ARG B CZ  1 
ATOM   4486  N  NH1 . ARG B  1 241 ? -4.410  -49.109 44.256  1.00 60.61  ? 241 ARG B NH1 1 
ATOM   4487  N  NH2 . ARG B  1 241 ? -4.942  -51.326 43.962  1.00 56.95  ? 241 ARG B NH2 1 
ATOM   4488  N  N   . LEU B  1 242 ? -11.035 -47.381 44.680  1.00 32.61  ? 242 LEU B N   1 
ATOM   4489  C  CA  . LEU B  1 242 ? -11.997 -48.399 45.086  1.00 30.58  ? 242 LEU B CA  1 
ATOM   4490  C  C   . LEU B  1 242 ? -13.015 -48.662 44.006  1.00 30.64  ? 242 LEU B C   1 
ATOM   4491  O  O   . LEU B  1 242 ? -13.378 -49.802 43.757  1.00 32.88  ? 242 LEU B O   1 
ATOM   4492  C  CB  . LEU B  1 242 ? -12.693 -47.991 46.374  1.00 32.16  ? 242 LEU B CB  1 
ATOM   4493  C  CG  . LEU B  1 242 ? -11.858 -48.069 47.628  1.00 31.11  ? 242 LEU B CG  1 
ATOM   4494  C  CD1 . LEU B  1 242 ? -12.561 -47.390 48.780  1.00 26.74  ? 242 LEU B CD1 1 
ATOM   4495  C  CD2 . LEU B  1 242 ? -11.523 -49.551 47.968  1.00 28.08  ? 242 LEU B CD2 1 
ATOM   4496  N  N   . ILE B  1 243 ? -13.486 -47.594 43.362  1.00 30.06  ? 243 ILE B N   1 
ATOM   4497  C  CA  . ILE B  1 243 ? -14.460 -47.724 42.277  1.00 28.05  ? 243 ILE B CA  1 
ATOM   4498  C  C   . ILE B  1 243 ? -13.869 -48.479 41.101  1.00 30.32  ? 243 ILE B C   1 
ATOM   4499  O  O   . ILE B  1 243 ? -14.500 -49.351 40.549  1.00 30.31  ? 243 ILE B O   1 
ATOM   4500  C  CB  . ILE B  1 243 ? -14.963 -46.359 41.806  1.00 28.22  ? 243 ILE B CB  1 
ATOM   4501  C  CG1 . ILE B  1 243 ? -15.921 -45.763 42.847  1.00 25.57  ? 243 ILE B CG1 1 
ATOM   4502  C  CG2 . ILE B  1 243 ? -15.649 -46.480 40.405  1.00 24.88  ? 243 ILE B CG2 1 
ATOM   4503  C  CD1 . ILE B  1 243 ? -16.261 -44.313 42.611  1.00 23.90  ? 243 ILE B CD1 1 
ATOM   4504  N  N   . LYS B  1 244 ? -12.639 -48.132 40.729  1.00 33.05  ? 244 LYS B N   1 
ATOM   4505  C  CA  . LYS B  1 244 ? -11.965 -48.807 39.616  1.00 36.41  ? 244 LYS B CA  1 
ATOM   4506  C  C   . LYS B  1 244 ? -11.663 -50.282 39.935  1.00 35.76  ? 244 LYS B C   1 
ATOM   4507  O  O   . LYS B  1 244 ? -11.575 -51.093 39.054  1.00 33.81  ? 244 LYS B O   1 
ATOM   4508  C  CB  . LYS B  1 244 ? -10.666 -48.044 39.193  1.00 41.34  ? 244 LYS B CB  1 
ATOM   4509  C  CG  . LYS B  1 244 ? -10.949 -46.745 38.370  1.00 44.94  ? 244 LYS B CG  1 
ATOM   4510  C  CD  . LYS B  1 244 ? -9.666  -46.140 37.768  1.00 50.89  ? 244 LYS B CD  1 
ATOM   4511  C  CE  . LYS B  1 244 ? -8.812  -45.452 38.828  1.00 55.54  ? 244 LYS B CE  1 
ATOM   4512  N  NZ  . LYS B  1 244 ? -7.752  -44.572 38.207  1.00 52.81  ? 244 LYS B NZ  1 
ATOM   4513  N  N   . ASP B  1 245 ? -11.519 -50.599 41.221  1.00 35.22  ? 245 ASP B N   1 
ATOM   4514  C  CA  . ASP B  1 245 ? -11.291 -51.992 41.637  1.00 37.02  ? 245 ASP B CA  1 
ATOM   4515  C  C   . ASP B  1 245 ? -12.593 -52.773 41.692  1.00 36.26  ? 245 ASP B C   1 
ATOM   4516  O  O   . ASP B  1 245 ? -12.592 -53.967 41.934  1.00 38.51  ? 245 ASP B O   1 
ATOM   4517  C  CB  . ASP B  1 245 ? -10.551 -52.060 42.989  1.00 39.56  ? 245 ASP B CB  1 
ATOM   4518  C  CG  . ASP B  1 245 ? -9.040  -51.798 42.849  1.00 43.59  ? 245 ASP B CG  1 
ATOM   4519  O  OD1 . ASP B  1 245 ? -8.329  -51.862 43.864  1.00 44.34  ? 245 ASP B OD1 1 
ATOM   4520  O  OD2 . ASP B  1 245 ? -8.582  -51.533 41.715  1.00 48.95  ? 245 ASP B OD2 1 
ATOM   4521  N  N   . GLY B  1 246 ? -13.720 -52.071 41.465  1.00 33.32  ? 246 GLY B N   1 
ATOM   4522  C  CA  . GLY B  1 246 ? -15.043 -52.738 41.325  1.00 32.11  ? 246 GLY B CA  1 
ATOM   4523  C  C   . GLY B  1 246 ? -15.922 -52.731 42.581  1.00 31.78  ? 246 GLY B C   1 
ATOM   4524  O  O   . GLY B  1 246 ? -16.916 -53.420 42.635  1.00 32.96  ? 246 GLY B O   1 
ATOM   4525  N  N   . TYR B  1 247 ? -15.547 -51.920 43.582  1.00 30.26  ? 247 TYR B N   1 
ATOM   4526  C  CA  . TYR B  1 247 ? -16.264 -51.929 44.906  1.00 29.37  ? 247 TYR B CA  1 
ATOM   4527  C  C   . TYR B  1 247 ? -17.453 -50.920 45.026  1.00 27.60  ? 247 TYR B C   1 
ATOM   4528  O  O   . TYR B  1 247 ? -17.881 -50.614 46.103  1.00 26.80  ? 247 TYR B O   1 
ATOM   4529  C  CB  . TYR B  1 247 ? -15.274 -51.730 46.062  1.00 29.19  ? 247 TYR B CB  1 
ATOM   4530  C  CG  . TYR B  1 247 ? -14.455 -52.950 46.362  1.00 30.18  ? 247 TYR B CG  1 
ATOM   4531  C  CD1 . TYR B  1 247 ? -13.274 -53.228 45.637  1.00 30.94  ? 247 TYR B CD1 1 
ATOM   4532  C  CD2 . TYR B  1 247 ? -14.840 -53.838 47.353  1.00 31.03  ? 247 TYR B CD2 1 
ATOM   4533  C  CE1 . TYR B  1 247 ? -12.511 -54.364 45.904  1.00 33.25  ? 247 TYR B CE1 1 
ATOM   4534  C  CE2 . TYR B  1 247 ? -14.079 -54.984 47.635  1.00 35.65  ? 247 TYR B CE2 1 
ATOM   4535  C  CZ  . TYR B  1 247 ? -12.909 -55.236 46.899  1.00 33.36  ? 247 TYR B CZ  1 
ATOM   4536  O  OH  . TYR B  1 247 ? -12.180 -56.321 47.158  1.00 34.09  ? 247 TYR B OH  1 
ATOM   4537  N  N   . SER B  1 248 ? -17.953 -50.444 43.899  1.00 27.98  ? 248 SER B N   1 
ATOM   4538  C  CA  . SER B  1 248 ? -19.091 -49.447 43.903  1.00 29.74  ? 248 SER B CA  1 
ATOM   4539  C  C   . SER B  1 248 ? -20.284 -49.955 44.654  1.00 25.11  ? 248 SER B C   1 
ATOM   4540  O  O   . SER B  1 248 ? -21.010 -49.190 45.252  1.00 24.01  ? 248 SER B O   1 
ATOM   4541  C  CB  . SER B  1 248 ? -19.499 -49.086 42.477  1.00 29.88  ? 248 SER B CB  1 
ATOM   4542  O  OG  . SER B  1 248 ? -18.562 -48.245 41.895  1.00 41.83  ? 248 SER B OG  1 
ATOM   4543  N  N   . ASP B  1 249 ? -20.486 -51.263 44.609  1.00 23.91  ? 249 ASP B N   1 
ATOM   4544  C  CA  . ASP B  1 249 ? -21.646 -51.898 45.247  1.00 24.61  ? 249 ASP B CA  1 
ATOM   4545  C  C   . ASP B  1 249 ? -21.571 -51.805 46.780  1.00 23.72  ? 249 ASP B C   1 
ATOM   4546  O  O   . ASP B  1 249 ? -22.532 -52.028 47.446  1.00 21.29  ? 249 ASP B O   1 
ATOM   4547  C  CB  . ASP B  1 249 ? -21.753 -53.368 44.820  1.00 25.00  ? 249 ASP B CB  1 
ATOM   4548  C  CG  . ASP B  1 249 ? -20.483 -54.201 45.214  1.00 27.14  ? 249 ASP B CG  1 
ATOM   4549  O  OD1 . ASP B  1 249 ? -19.386 -53.910 44.675  1.00 29.04  ? 249 ASP B OD1 1 
ATOM   4550  O  OD2 . ASP B  1 249 ? -20.606 -55.136 46.063  1.00 28.75  ? 249 ASP B OD2 1 
ATOM   4551  N  N   . LYS B  1 250 ? -20.373 -51.471 47.310  1.00 21.67  ? 250 LYS B N   1 
ATOM   4552  C  CA  . LYS B  1 250 ? -20.174 -51.362 48.817  1.00 22.25  ? 250 LYS B CA  1 
ATOM   4553  C  C   . LYS B  1 250 ? -19.944 -49.910 49.292  1.00 23.54  ? 250 LYS B C   1 
ATOM   4554  O  O   . LYS B  1 250 ? -20.037 -49.620 50.485  1.00 25.46  ? 250 LYS B O   1 
ATOM   4555  C  CB  . LYS B  1 250 ? -19.014 -52.250 49.284  1.00 23.95  ? 250 LYS B CB  1 
ATOM   4556  C  CG  . LYS B  1 250 ? -19.225 -53.732 49.052  1.00 25.41  ? 250 LYS B CG  1 
ATOM   4557  C  CD  . LYS B  1 250 ? -20.506 -54.243 49.752  1.00 26.22  ? 250 LYS B CD  1 
ATOM   4558  C  CE  . LYS B  1 250 ? -20.704 -55.737 49.486  1.00 28.46  ? 250 LYS B CE  1 
ATOM   4559  N  NZ  . LYS B  1 250 ? -22.029 -56.223 49.928  1.00 33.67  ? 250 LYS B NZ  1 
ATOM   4560  N  N   . ILE B  1 251 ? -19.643 -49.021 48.361  1.00 21.94  ? 251 ILE B N   1 
ATOM   4561  C  CA  . ILE B  1 251 ? -19.293 -47.658 48.710  1.00 22.20  ? 251 ILE B CA  1 
ATOM   4562  C  C   . ILE B  1 251 ? -20.500 -46.801 49.074  1.00 21.87  ? 251 ILE B C   1 
ATOM   4563  O  O   . ILE B  1 251 ? -21.541 -46.833 48.394  1.00 21.94  ? 251 ILE B O   1 
ATOM   4564  C  CB  . ILE B  1 251 ? -18.528 -46.965 47.580  1.00 22.26  ? 251 ILE B CB  1 
ATOM   4565  C  CG1 . ILE B  1 251 ? -17.132 -47.587 47.414  1.00 22.94  ? 251 ILE B CG1 1 
ATOM   4566  C  CG2 . ILE B  1 251 ? -18.418 -45.443 47.855  1.00 20.57  ? 251 ILE B CG2 1 
ATOM   4567  C  CD1 . ILE B  1 251 ? -16.438 -47.192 46.115  1.00 22.67  ? 251 ILE B CD1 1 
ATOM   4568  N  N   . MET B  1 252 ? -20.358 -46.046 50.148  1.00 21.73  ? 252 MET B N   1 
ATOM   4569  C  CA  . MET B  1 252 ? -21.288 -45.012 50.487  1.00 23.64  ? 252 MET B CA  1 
ATOM   4570  C  C   . MET B  1 252 ? -20.501 -43.737 50.805  1.00 23.67  ? 252 MET B C   1 
ATOM   4571  O  O   . MET B  1 252 ? -19.408 -43.795 51.416  1.00 26.11  ? 252 MET B O   1 
ATOM   4572  C  CB  . MET B  1 252 ? -22.145 -45.417 51.658  1.00 26.09  ? 252 MET B CB  1 
ATOM   4573  C  CG  . MET B  1 252 ? -23.364 -46.300 51.275  1.00 27.77  ? 252 MET B CG  1 
ATOM   4574  S  SD  . MET B  1 252 ? -24.185 -46.930 52.722  1.00 35.08  ? 252 MET B SD  1 
ATOM   4575  C  CE  . MET B  1 252 ? -25.730 -47.506 52.024  1.00 31.89  ? 252 MET B CE  1 
ATOM   4576  N  N   . ILE B  1 253 ? -21.029 -42.607 50.389  1.00 21.68  ? 253 ILE B N   1 
ATOM   4577  C  CA  . ILE B  1 253 ? -20.325 -41.357 50.509  1.00 22.42  ? 253 ILE B CA  1 
ATOM   4578  C  C   . ILE B  1 253 ? -21.151 -40.316 51.229  1.00 22.46  ? 253 ILE B C   1 
ATOM   4579  O  O   . ILE B  1 253 ? -22.394 -40.233 51.039  1.00 21.63  ? 253 ILE B O   1 
ATOM   4580  C  CB  . ILE B  1 253 ? -19.921 -40.806 49.111  1.00 23.95  ? 253 ILE B CB  1 
ATOM   4581  C  CG1 . ILE B  1 253 ? -18.881 -41.724 48.452  1.00 24.06  ? 253 ILE B CG1 1 
ATOM   4582  C  CG2 . ILE B  1 253 ? -19.413 -39.299 49.218  1.00 22.65  ? 253 ILE B CG2 1 
ATOM   4583  C  CD1 . ILE B  1 253 ? -18.428 -41.259 47.071  1.00 26.36  ? 253 ILE B CD1 1 
ATOM   4584  N  N   . SER B  1 254 ? -20.489 -39.516 52.053  1.00 23.38  ? 254 SER B N   1 
ATOM   4585  C  CA  . SER B  1 254 ? -21.158 -38.451 52.784  1.00 23.03  ? 254 SER B CA  1 
ATOM   4586  C  C   . SER B  1 254 ? -20.111 -37.486 53.407  1.00 22.52  ? 254 SER B C   1 
ATOM   4587  O  O   . SER B  1 254 ? -18.892 -37.661 53.205  1.00 21.23  ? 254 SER B O   1 
ATOM   4588  C  CB  . SER B  1 254 ? -22.076 -39.035 53.864  1.00 24.41  ? 254 SER B CB  1 
ATOM   4589  O  OG  . SER B  1 254 ? -23.362 -38.358 53.876  1.00 24.63  ? 254 SER B OG  1 
ATOM   4590  N  N   . HIS B  1 255 ? -20.596 -36.468 54.165  1.00 22.76  ? 255 HIS B N   1 
ATOM   4591  C  CA  . HIS B  1 255 ? -19.725 -35.446 54.716  1.00 24.60  ? 255 HIS B CA  1 
ATOM   4592  C  C   . HIS B  1 255 ? -19.564 -35.534 56.218  1.00 25.66  ? 255 HIS B C   1 
ATOM   4593  O  O   . HIS B  1 255 ? -18.557 -35.076 56.760  1.00 23.57  ? 255 HIS B O   1 
ATOM   4594  C  CB  . HIS B  1 255 ? -20.240 -34.032 54.364  1.00 26.43  ? 255 HIS B CB  1 
ATOM   4595  C  CG  . HIS B  1 255 ? -20.598 -33.855 52.938  1.00 28.84  ? 255 HIS B CG  1 
ATOM   4596  N  ND1 . HIS B  1 255 ? -21.847 -34.075 52.467  1.00 24.94  ? 255 HIS B ND1 1 
ATOM   4597  C  CD2 . HIS B  1 255 ? -19.832 -33.439 51.837  1.00 26.46  ? 255 HIS B CD2 1 
ATOM   4598  C  CE1 . HIS B  1 255 ? -21.875 -33.825 51.145  1.00 26.72  ? 255 HIS B CE1 1 
ATOM   4599  N  NE2 . HIS B  1 255 ? -20.648 -33.438 50.762  1.00 25.68  ? 255 HIS B NE2 1 
ATOM   4600  N  N   . ASP B  1 256 ? -20.579 -36.109 56.916  1.00 25.55  ? 256 ASP B N   1 
ATOM   4601  C  CA  . ASP B  1 256 ? -20.589 -36.091 58.352  1.00 29.63  ? 256 ASP B CA  1 
ATOM   4602  C  C   . ASP B  1 256 ? -20.616 -34.575 58.804  1.00 30.42  ? 256 ASP B C   1 
ATOM   4603  O  O   . ASP B  1 256 ? -20.086 -34.211 59.863  1.00 29.76  ? 256 ASP B O   1 
ATOM   4604  C  CB  . ASP B  1 256 ? -19.334 -36.809 58.911  1.00 26.29  ? 256 ASP B CB  1 
ATOM   4605  C  CG  . ASP B  1 256 ? -19.448 -37.158 60.512  1.00 26.48  ? 256 ASP B CG  1 
ATOM   4606  O  OD1 . ASP B  1 256 ? -20.644 -37.300 61.078  1.00 23.84  ? 256 ASP B OD1 1 
ATOM   4607  O  OD2 . ASP B  1 256 ? -18.353 -37.306 61.163  1.00 27.90  ? 256 ASP B OD2 1 
ATOM   4608  N  N   . TYR B  1 257 ? -21.220 -33.738 57.982  1.00 36.82  ? 257 TYR B N   1 
ATOM   4609  C  CA  . TYR B  1 257 ? -21.260 -32.320 58.263  1.00 41.75  ? 257 TYR B CA  1 
ATOM   4610  C  C   . TYR B  1 257 ? -22.189 -32.013 59.387  1.00 42.58  ? 257 TYR B C   1 
ATOM   4611  O  O   . TYR B  1 257 ? -23.259 -32.638 59.524  1.00 41.63  ? 257 TYR B O   1 
ATOM   4612  C  CB  . TYR B  1 257 ? -21.663 -31.499 56.999  1.00 39.17  ? 257 TYR B CB  1 
ATOM   4613  C  CG  . TYR B  1 257 ? -21.584 -30.016 57.221  1.00 37.54  ? 257 TYR B CG  1 
ATOM   4614  C  CD1 . TYR B  1 257 ? -22.739 -29.257 57.430  1.00 38.10  ? 257 TYR B CD1 1 
ATOM   4615  C  CD2 . TYR B  1 257 ? -20.339 -29.357 57.250  1.00 40.25  ? 257 TYR B CD2 1 
ATOM   4616  C  CE1 . TYR B  1 257 ? -22.668 -27.888 57.644  1.00 35.99  ? 257 TYR B CE1 1 
ATOM   4617  C  CE2 . TYR B  1 257 ? -20.252 -27.978 57.466  1.00 39.63  ? 257 TYR B CE2 1 
ATOM   4618  C  CZ  . TYR B  1 257 ? -21.403 -27.247 57.663  1.00 42.55  ? 257 TYR B CZ  1 
ATOM   4619  O  OH  . TYR B  1 257 ? -21.321 -25.874 57.878  1.00 43.75  ? 257 TYR B OH  1 
ATOM   4620  N  N   . CYS B  1 258 ? -21.800 -31.061 60.205  1.00 43.86  ? 258 CYS B N   1 
ATOM   4621  C  CA  . CYS B  1 258 ? -22.612 -30.622 61.300  1.00 57.40  ? 258 CYS B CA  1 
ATOM   4622  C  C   . CYS B  1 258 ? -23.010 -29.164 61.097  1.00 58.17  ? 258 CYS B C   1 
ATOM   4623  O  O   . CYS B  1 258 ? -22.246 -28.248 61.421  1.00 65.28  ? 258 CYS B O   1 
ATOM   4624  C  CB  . CYS B  1 258 ? -21.859 -30.779 62.612  1.00 54.41  ? 258 CYS B CB  1 
ATOM   4625  S  SG  . CYS B  1 258 ? -21.162 -32.406 62.859  1.00 54.43  ? 258 CYS B SG  1 
ATOM   4626  N  N   . CYS B  1 259 ? -24.197 -28.954 60.553  1.00 54.52  ? 259 CYS B N   1 
ATOM   4627  C  CA  . CYS B  1 259 ? -24.705 -27.621 60.330  1.00 59.93  ? 259 CYS B CA  1 
ATOM   4628  C  C   . CYS B  1 259 ? -24.492 -26.772 61.593  1.00 65.99  ? 259 CYS B C   1 
ATOM   4629  O  O   . CYS B  1 259 ? -24.484 -25.538 61.540  1.00 66.13  ? 259 CYS B O   1 
ATOM   4630  C  CB  . CYS B  1 259 ? -26.158 -27.680 59.974  1.00 54.38  ? 259 CYS B CB  1 
ATOM   4631  S  SG  . CYS B  1 259 ? -26.538 -28.924 58.712  1.00 50.33  ? 259 CYS B SG  1 
ATOM   4632  N  N   . THR B  1 260 ? -24.319 -27.457 62.722  1.00 58.66  ? 260 THR B N   1 
ATOM   4633  C  CA  . THR B  1 260 ? -23.997 -26.821 63.982  1.00 54.67  ? 260 THR B CA  1 
ATOM   4634  C  C   . THR B  1 260 ? -23.438 -27.864 64.976  1.00 56.20  ? 260 THR B C   1 
ATOM   4635  O  O   . THR B  1 260 ? -23.998 -28.958 65.134  1.00 48.10  ? 260 THR B O   1 
ATOM   4636  C  CB  . THR B  1 260 ? -25.219 -26.076 64.594  1.00 55.56  ? 260 THR B CB  1 
ATOM   4637  O  OG1 . THR B  1 260 ? -26.444 -26.709 64.162  1.00 61.91  ? 260 THR B OG1 1 
ATOM   4638  C  CG2 . THR B  1 260 ? -25.229 -24.608 64.150  1.00 45.37  ? 260 THR B CG2 1 
ATOM   4639  N  N   . ILE B  1 261 ? -22.344 -27.527 65.613  1.00 55.27  ? 261 ILE B N   1 
ATOM   4640  C  CA  . ILE B  1 261 ? -21.686 -28.436 66.486  1.00 54.13  ? 261 ILE B CA  1 
ATOM   4641  C  C   . ILE B  1 261 ? -20.995 -27.682 67.662  1.00 57.13  ? 261 ILE B C   1 
ATOM   4642  O  O   . ILE B  1 261 ? -20.267 -26.703 67.447  1.00 52.41  ? 261 ILE B O   1 
ATOM   4643  C  CB  . ILE B  1 261 ? -20.644 -29.338 65.695  1.00 54.59  ? 261 ILE B CB  1 
ATOM   4644  C  CG1 . ILE B  1 261 ? -20.120 -30.465 66.577  1.00 53.21  ? 261 ILE B CG1 1 
ATOM   4645  C  CG2 . ILE B  1 261 ? -19.510 -28.488 65.121  1.00 48.25  ? 261 ILE B CG2 1 
ATOM   4646  C  CD1 . ILE B  1 261 ? -19.444 -31.585 65.799  1.00 52.44  ? 261 ILE B CD1 1 
ATOM   4647  N  N   . ASP B  1 262 ? -21.245 -28.158 68.905  1.00 53.74  ? 262 ASP B N   1 
ATOM   4648  C  CA  . ASP B  1 262 ? -20.767 -27.444 70.139  1.00 52.67  ? 262 ASP B CA  1 
ATOM   4649  C  C   . ASP B  1 262 ? -19.294 -27.755 70.516  1.00 49.39  ? 262 ASP B C   1 
ATOM   4650  O  O   . ASP B  1 262 ? -18.670 -26.999 71.253  1.00 49.91  ? 262 ASP B O   1 
ATOM   4651  C  CB  . ASP B  1 262 ? -21.677 -27.751 71.323  1.00 51.70  ? 262 ASP B CB  1 
ATOM   4652  C  CG  . ASP B  1 262 ? -21.465 -29.173 71.879  1.00 50.22  ? 262 ASP B CG  1 
ATOM   4653  O  OD1 . ASP B  1 262 ? -20.831 -30.011 71.170  1.00 54.38  ? 262 ASP B OD1 1 
ATOM   4654  O  OD2 . ASP B  1 262 ? -21.924 -29.446 73.007  1.00 41.30  ? 262 ASP B OD2 1 
ATOM   4655  N  N   . MET B  1 263 ? -18.761 -28.875 70.003  1.00 55.21  ? 263 MET B N   1 
ATOM   4656  C  CA  . MET B  1 263 ? -17.348 -29.308 70.339  1.00 63.37  ? 263 MET B CA  1 
ATOM   4657  C  C   . MET B  1 263 ? -16.324 -28.152 70.178  1.00 62.97  ? 263 MET B C   1 
ATOM   4658  O  O   . MET B  1 263 ? -16.397 -27.365 69.217  1.00 54.93  ? 263 MET B O   1 
ATOM   4659  C  CB  . MET B  1 263 ? -16.930 -30.513 69.500  1.00 71.39  ? 263 MET B CB  1 
ATOM   4660  C  CG  . MET B  1 263 ? -16.812 -30.222 68.002  1.00 93.93  ? 263 MET B CG  1 
ATOM   4661  S  SD  . MET B  1 263 ? -16.260 -31.653 67.041  1.00 111.17 ? 263 MET B SD  1 
ATOM   4662  C  CE  . MET B  1 263 ? -14.639 -31.943 67.758  1.00 106.70 ? 263 MET B CE  1 
ATOM   4663  N  N   . GLY B  1 264 ? -15.372 -28.064 71.129  1.00 65.82  ? 264 GLY B N   1 
ATOM   4664  C  CA  . GLY B  1 264 ? -14.352 -26.993 71.118  1.00 75.38  ? 264 GLY B CA  1 
ATOM   4665  C  C   . GLY B  1 264 ? -13.452 -27.044 69.899  1.00 79.33  ? 264 GLY B C   1 
ATOM   4666  O  O   . GLY B  1 264 ? -12.937 -26.008 69.446  1.00 74.60  ? 264 GLY B O   1 
ATOM   4667  N  N   . THR B  1 265 ? -13.260 -28.249 69.361  1.00 81.83  ? 265 THR B N   1 
ATOM   4668  C  CA  . THR B  1 265 ? -12.412 -28.443 68.197  1.00 90.05  ? 265 THR B CA  1 
ATOM   4669  C  C   . THR B  1 265 ? -13.012 -27.775 66.936  1.00 95.41  ? 265 THR B C   1 
ATOM   4670  O  O   . THR B  1 265 ? -12.294 -27.487 65.973  1.00 103.13 ? 265 THR B O   1 
ATOM   4671  C  CB  . THR B  1 265 ? -12.166 -29.946 67.918  1.00 89.64  ? 265 THR B CB  1 
ATOM   4672  O  OG1 . THR B  1 265 ? -11.618 -30.566 69.081  1.00 86.19  ? 265 THR B OG1 1 
ATOM   4673  C  CG2 . THR B  1 265 ? -11.198 -30.128 66.740  1.00 88.02  ? 265 THR B CG2 1 
ATOM   4674  N  N   . ALA B  1 266 ? -14.333 -27.533 66.960  1.00 98.20  ? 266 ALA B N   1 
ATOM   4675  C  CA  . ALA B  1 266 ? -15.022 -26.885 65.829  1.00 95.00  ? 266 ALA B CA  1 
ATOM   4676  C  C   . ALA B  1 266 ? -14.681 -25.390 65.749  1.00 102.67 ? 266 ALA B C   1 
ATOM   4677  O  O   . ALA B  1 266 ? -13.678 -25.006 65.145  1.00 119.06 ? 266 ALA B O   1 
ATOM   4678  C  CB  . ALA B  1 266 ? -16.525 -27.087 65.931  1.00 86.64  ? 266 ALA B CB  1 
ATOM   4679  N  N   . LYS B  1 267 ? -15.525 -24.554 66.367  1.00 106.55 ? 267 LYS B N   1 
ATOM   4680  C  CA  . LYS B  1 267 ? -15.317 -23.081 66.361  1.00 106.85 ? 267 LYS B CA  1 
ATOM   4681  C  C   . LYS B  1 267 ? -15.047 -22.553 64.959  1.00 111.03 ? 267 LYS B C   1 
ATOM   4682  O  O   . LYS B  1 267 ? -14.387 -23.214 64.159  1.00 112.29 ? 267 LYS B O   1 
ATOM   4683  C  CB  . LYS B  1 267 ? -14.171 -22.686 67.304  1.00 102.27 ? 267 LYS B CB  1 
ATOM   4684  C  CG  . LYS B  1 267 ? -14.488 -22.858 68.778  1.00 88.87  ? 267 LYS B CG  1 
ATOM   4685  C  CD  . LYS B  1 267 ? -13.409 -22.239 69.642  1.00 84.32  ? 267 LYS B CD  1 
ATOM   4686  C  CE  . LYS B  1 267 ? -13.801 -22.249 71.102  1.00 81.45  ? 267 LYS B CE  1 
ATOM   4687  N  NZ  . LYS B  1 267 ? -12.824 -21.502 71.939  1.00 71.93  ? 267 LYS B NZ  1 
ATOM   4688  N  N   . PRO B  1 268 ? -15.561 -21.345 64.656  1.00 116.55 ? 268 PRO B N   1 
ATOM   4689  C  CA  . PRO B  1 268 ? -15.377 -20.728 63.341  1.00 113.39 ? 268 PRO B CA  1 
ATOM   4690  C  C   . PRO B  1 268 ? -13.897 -20.366 63.062  1.00 117.05 ? 268 PRO B C   1 
ATOM   4691  O  O   . PRO B  1 268 ? -13.534 -20.065 61.916  1.00 124.94 ? 268 PRO B O   1 
ATOM   4692  C  CB  . PRO B  1 268 ? -16.236 -19.452 63.429  1.00 105.95 ? 268 PRO B CB  1 
ATOM   4693  C  CG  . PRO B  1 268 ? -16.337 -19.164 64.889  1.00 105.70 ? 268 PRO B CG  1 
ATOM   4694  C  CD  . PRO B  1 268 ? -16.355 -20.490 65.565  1.00 111.50 ? 268 PRO B CD  1 
ATOM   4695  N  N   . GLU B  1 269 ? -13.062 -20.403 64.109  1.00 112.29 ? 269 GLU B N   1 
ATOM   4696  C  CA  . GLU B  1 269 ? -11.635 -20.096 63.966  1.00 106.11 ? 269 GLU B CA  1 
ATOM   4697  C  C   . GLU B  1 269 ? -10.881 -21.214 63.246  1.00 100.97 ? 269 GLU B C   1 
ATOM   4698  O  O   . GLU B  1 269 ? -10.138 -20.962 62.294  1.00 98.86  ? 269 GLU B O   1 
ATOM   4699  C  CB  . GLU B  1 269 ? -10.985 -19.820 65.353  1.00 106.40 ? 269 GLU B CB  1 
ATOM   4700  C  CG  . GLU B  1 269 ? -11.341 -18.453 65.968  1.00 103.81 ? 269 GLU B CG  1 
ATOM   4701  C  CD  . GLU B  1 269 ? -12.758 -18.406 66.538  1.00 105.45 ? 269 GLU B CD  1 
ATOM   4702  O  OE1 . GLU B  1 269 ? -13.368 -19.489 66.728  1.00 99.33  ? 269 GLU B OE1 1 
ATOM   4703  O  OE2 . GLU B  1 269 ? -13.259 -17.286 66.799  1.00 102.66 ? 269 GLU B OE2 1 
ATOM   4704  N  N   . TYR B  1 270 ? -11.080 -22.454 63.707  1.00 95.26  ? 270 TYR B N   1 
ATOM   4705  C  CA  . TYR B  1 270 ? -10.353 -23.623 63.152  1.00 93.52  ? 270 TYR B CA  1 
ATOM   4706  C  C   . TYR B  1 270 ? -10.896 -24.067 61.776  1.00 87.58  ? 270 TYR B C   1 
ATOM   4707  O  O   . TYR B  1 270 ? -10.198 -24.734 61.009  1.00 77.41  ? 270 TYR B O   1 
ATOM   4708  C  CB  . TYR B  1 270 ? -10.381 -24.796 64.142  1.00 97.07  ? 270 TYR B CB  1 
ATOM   4709  C  CG  . TYR B  1 270 ? -9.816  -24.454 65.512  1.00 102.45 ? 270 TYR B CG  1 
ATOM   4710  C  CD1 . TYR B  1 270 ? -8.432  -24.430 65.734  1.00 105.32 ? 270 TYR B CD1 1 
ATOM   4711  C  CD2 . TYR B  1 270 ? -10.666 -24.153 66.587  1.00 97.67  ? 270 TYR B CD2 1 
ATOM   4712  C  CE1 . TYR B  1 270 ? -7.912  -24.119 66.977  1.00 105.91 ? 270 TYR B CE1 1 
ATOM   4713  C  CE2 . TYR B  1 270 ? -10.157 -23.840 67.835  1.00 99.03  ? 270 TYR B CE2 1 
ATOM   4714  C  CZ  . TYR B  1 270 ? -8.777  -23.823 68.031  1.00 108.10 ? 270 TYR B CZ  1 
ATOM   4715  O  OH  . TYR B  1 270 ? -8.263  -23.512 69.269  1.00 102.08 ? 270 TYR B OH  1 
ATOM   4716  N  N   . LYS B  1 271 ? -12.141 -23.688 61.482  1.00 85.09  ? 271 LYS B N   1 
ATOM   4717  C  CA  . LYS B  1 271 ? -12.783 -24.043 60.212  1.00 75.67  ? 271 LYS B CA  1 
ATOM   4718  C  C   . LYS B  1 271 ? -11.785 -23.971 58.991  1.00 79.16  ? 271 LYS B C   1 
ATOM   4719  O  O   . LYS B  1 271 ? -11.471 -24.995 58.385  1.00 76.70  ? 271 LYS B O   1 
ATOM   4720  C  CB  . LYS B  1 271 ? -14.003 -23.149 59.959  1.00 75.86  ? 271 LYS B CB  1 
ATOM   4721  C  CG  . LYS B  1 271 ? -14.799 -23.504 58.701  1.00 78.92  ? 271 LYS B CG  1 
ATOM   4722  C  CD  . LYS B  1 271 ? -15.622 -24.780 58.898  1.00 72.22  ? 271 LYS B CD  1 
ATOM   4723  C  CE  . LYS B  1 271 ? -16.478 -25.077 57.672  1.00 66.95  ? 271 LYS B CE  1 
ATOM   4724  N  NZ  . LYS B  1 271 ? -17.364 -23.926 57.326  1.00 69.30  ? 271 LYS B NZ  1 
ATOM   4725  N  N   . PRO B  1 272 ? -11.297 -22.725 58.650  1.00 75.83  ? 272 PRO B N   1 
ATOM   4726  C  CA  . PRO B  1 272 ? -10.394 -22.516 57.488  1.00 71.88  ? 272 PRO B CA  1 
ATOM   4727  C  C   . PRO B  1 272 ? -9.138  -23.434 57.496  1.00 70.86  ? 272 PRO B C   1 
ATOM   4728  O  O   . PRO B  1 272 ? -8.615  -23.778 56.427  1.00 69.71  ? 272 PRO B O   1 
ATOM   4729  C  CB  . PRO B  1 272 ? -9.980  -21.043 57.629  1.00 65.11  ? 272 PRO B CB  1 
ATOM   4730  C  CG  . PRO B  1 272 ? -11.110 -20.407 58.363  1.00 66.06  ? 272 PRO B CG  1 
ATOM   4731  C  CD  . PRO B  1 272 ? -11.612 -21.453 59.335  1.00 71.28  ? 272 PRO B CD  1 
ATOM   4732  N  N   . LYS B  1 273 ? -8.676  -23.821 58.686  1.00 72.65  ? 273 LYS B N   1 
ATOM   4733  C  CA  . LYS B  1 273 ? -7.456  -24.643 58.802  1.00 72.76  ? 273 LYS B CA  1 
ATOM   4734  C  C   . LYS B  1 273 ? -7.741  -26.184 58.813  1.00 74.42  ? 273 LYS B C   1 
ATOM   4735  O  O   . LYS B  1 273 ? -7.058  -26.959 58.117  1.00 74.32  ? 273 LYS B O   1 
ATOM   4736  C  CB  . LYS B  1 273 ? -6.631  -24.235 60.050  1.00 78.52  ? 273 LYS B CB  1 
ATOM   4737  C  CG  . LYS B  1 273 ? -5.242  -24.924 60.141  1.00 85.52  ? 273 LYS B CG  1 
ATOM   4738  C  CD  . LYS B  1 273 ? -4.406  -24.677 58.857  1.00 86.98  ? 273 LYS B CD  1 
ATOM   4739  C  CE  . LYS B  1 273 ? -3.064  -25.427 58.897  1.00 88.75  ? 273 LYS B CE  1 
ATOM   4740  N  NZ  . LYS B  1 273 ? -2.139  -24.881 59.933  1.00 87.11  ? 273 LYS B NZ  1 
ATOM   4741  N  N   . LEU B  1 274 ? -8.744  -26.603 59.599  1.00 65.66  ? 274 LEU B N   1 
ATOM   4742  C  CA  . LEU B  1 274 ? -9.052  -28.052 59.763  1.00 64.33  ? 274 LEU B CA  1 
ATOM   4743  C  C   . LEU B  1 274 ? -9.990  -28.614 58.651  1.00 64.39  ? 274 LEU B C   1 
ATOM   4744  O  O   . LEU B  1 274 ? -9.750  -29.704 58.115  1.00 62.21  ? 274 LEU B O   1 
ATOM   4745  C  CB  . LEU B  1 274 ? -9.645  -28.328 61.149  1.00 62.64  ? 274 LEU B CB  1 
ATOM   4746  C  CG  . LEU B  1 274 ? -8.768  -27.975 62.357  1.00 65.34  ? 274 LEU B CG  1 
ATOM   4747  C  CD1 . LEU B  1 274 ? -9.466  -28.357 63.654  1.00 59.59  ? 274 LEU B CD1 1 
ATOM   4748  C  CD2 . LEU B  1 274 ? -7.399  -28.651 62.258  1.00 61.08  ? 274 LEU B CD2 1 
ATOM   4749  N  N   . ALA B  1 275 ? -11.055 -27.857 58.327  1.00 57.85  ? 275 ALA B N   1 
ATOM   4750  C  CA  . ALA B  1 275 ? -12.036 -28.287 57.317  1.00 53.38  ? 275 ALA B CA  1 
ATOM   4751  C  C   . ALA B  1 275 ? -12.538 -27.090 56.495  1.00 51.58  ? 275 ALA B C   1 
ATOM   4752  O  O   . ALA B  1 275 ? -13.710 -26.700 56.602  1.00 46.35  ? 275 ALA B O   1 
ATOM   4753  C  CB  . ALA B  1 275 ? -13.192 -28.996 57.980  1.00 52.94  ? 275 ALA B CB  1 
ATOM   4754  N  N   . PRO B  1 276 ? -11.636 -26.503 55.655  1.00 47.40  ? 276 PRO B N   1 
ATOM   4755  C  CA  . PRO B  1 276 ? -11.909 -25.252 54.898  1.00 45.78  ? 276 PRO B CA  1 
ATOM   4756  C  C   . PRO B  1 276 ? -13.140 -25.336 53.952  1.00 44.43  ? 276 PRO B C   1 
ATOM   4757  O  O   . PRO B  1 276 ? -13.966 -24.444 53.949  1.00 40.87  ? 276 PRO B O   1 
ATOM   4758  C  CB  . PRO B  1 276 ? -10.612 -25.046 54.079  1.00 48.47  ? 276 PRO B CB  1 
ATOM   4759  C  CG  . PRO B  1 276 ? -9.946  -26.407 54.061  1.00 47.63  ? 276 PRO B CG  1 
ATOM   4760  C  CD  . PRO B  1 276 ? -10.289 -27.044 55.361  1.00 46.00  ? 276 PRO B CD  1 
ATOM   4761  N  N   . ARG B  1 277 ? -13.230 -26.415 53.163  1.00 40.96  ? 277 ARG B N   1 
ATOM   4762  C  CA  . ARG B  1 277 ? -14.306 -26.547 52.161  1.00 39.72  ? 277 ARG B CA  1 
ATOM   4763  C  C   . ARG B  1 277 ? -15.369 -27.549 52.603  1.00 41.61  ? 277 ARG B C   1 
ATOM   4764  O  O   . ARG B  1 277 ? -16.084 -28.148 51.765  1.00 42.22  ? 277 ARG B O   1 
ATOM   4765  C  CB  . ARG B  1 277 ? -13.713 -26.923 50.787  1.00 40.72  ? 277 ARG B CB  1 
ATOM   4766  C  CG  . ARG B  1 277 ? -12.557 -25.987 50.361  1.00 45.12  ? 277 ARG B CG  1 
ATOM   4767  C  CD  . ARG B  1 277 ? -12.144 -26.175 48.913  1.00 53.31  ? 277 ARG B CD  1 
ATOM   4768  N  NE  . ARG B  1 277 ? -11.677 -27.513 48.641  1.00 58.11  ? 277 ARG B NE  1 
ATOM   4769  C  CZ  . ARG B  1 277 ? -12.218 -28.320 47.739  1.00 61.48  ? 277 ARG B CZ  1 
ATOM   4770  N  NH1 . ARG B  1 277 ? -11.727 -29.527 47.556  1.00 63.30  ? 277 ARG B NH1 1 
ATOM   4771  N  NH2 . ARG B  1 277 ? -13.251 -27.909 47.008  1.00 67.08  ? 277 ARG B NH2 1 
ATOM   4772  N  N   . TRP B  1 278 ? -15.485 -27.717 53.920  1.00 39.35  ? 278 TRP B N   1 
ATOM   4773  C  CA  . TRP B  1 278 ? -16.389 -28.667 54.510  1.00 37.58  ? 278 TRP B CA  1 
ATOM   4774  C  C   . TRP B  1 278 ? -17.831 -28.116 54.602  1.00 35.13  ? 278 TRP B C   1 
ATOM   4775  O  O   . TRP B  1 278 ? -18.071 -27.055 55.193  1.00 34.27  ? 278 TRP B O   1 
ATOM   4776  C  CB  . TRP B  1 278 ? -15.849 -29.097 55.925  1.00 37.12  ? 278 TRP B CB  1 
ATOM   4777  C  CG  . TRP B  1 278 ? -16.686 -30.161 56.672  1.00 36.46  ? 278 TRP B CG  1 
ATOM   4778  C  CD1 . TRP B  1 278 ? -17.192 -31.387 56.148  1.00 36.87  ? 278 TRP B CD1 1 
ATOM   4779  C  CD2 . TRP B  1 278 ? -17.086 -30.128 58.091  1.00 37.42  ? 278 TRP B CD2 1 
ATOM   4780  N  NE1 . TRP B  1 278 ? -17.898 -32.098 57.159  1.00 32.90  ? 278 TRP B NE1 1 
ATOM   4781  C  CE2 . TRP B  1 278 ? -17.851 -31.362 58.358  1.00 37.64  ? 278 TRP B CE2 1 
ATOM   4782  C  CE3 . TRP B  1 278 ? -16.892 -29.199 59.150  1.00 39.24  ? 278 TRP B CE3 1 
ATOM   4783  C  CZ2 . TRP B  1 278 ? -18.389 -31.646 59.605  1.00 39.22  ? 278 TRP B CZ2 1 
ATOM   4784  C  CZ3 . TRP B  1 278 ? -17.441 -29.492 60.416  1.00 36.53  ? 278 TRP B CZ3 1 
ATOM   4785  C  CH2 . TRP B  1 278 ? -18.178 -30.695 60.642  1.00 36.90  ? 278 TRP B CH2 1 
ATOM   4786  N  N   . SER B  1 279 ? -18.781 -28.848 53.995  1.00 34.42  ? 279 SER B N   1 
ATOM   4787  C  CA  . SER B  1 279 ? -20.238 -28.478 54.051  1.00 31.46  ? 279 SER B CA  1 
ATOM   4788  C  C   . SER B  1 279 ? -21.067 -29.625 53.538  1.00 31.42  ? 279 SER B C   1 
ATOM   4789  O  O   . SER B  1 279 ? -20.528 -30.639 53.099  1.00 33.50  ? 279 SER B O   1 
ATOM   4790  C  CB  . SER B  1 279 ? -20.517 -27.232 53.233  1.00 29.14  ? 279 SER B CB  1 
ATOM   4791  O  OG  . SER B  1 279 ? -20.775 -27.564 51.869  1.00 30.27  ? 279 SER B OG  1 
ATOM   4792  N  N   . ILE B  1 280 ? -22.366 -29.472 53.575  1.00 26.97  ? 280 ILE B N   1 
ATOM   4793  C  CA  . ILE B  1 280 ? -23.248 -30.534 53.180  1.00 26.08  ? 280 ILE B CA  1 
ATOM   4794  C  C   . ILE B  1 280 ? -23.354 -30.717 51.606  1.00 27.13  ? 280 ILE B C   1 
ATOM   4795  O  O   . ILE B  1 280 ? -24.029 -31.615 51.132  1.00 28.00  ? 280 ILE B O   1 
ATOM   4796  C  CB  . ILE B  1 280 ? -24.658 -30.349 53.778  1.00 27.24  ? 280 ILE B CB  1 
ATOM   4797  C  CG1 . ILE B  1 280 ? -25.348 -31.707 53.952  1.00 27.51  ? 280 ILE B CG1 1 
ATOM   4798  C  CG2 . ILE B  1 280 ? -25.491 -29.403 52.922  1.00 27.21  ? 280 ILE B CG2 1 
ATOM   4799  C  CD1 . ILE B  1 280 ? -26.680 -31.622 54.699  1.00 23.77  ? 280 ILE B CD1 1 
ATOM   4800  N  N   . THR B  1 281 ? -22.678 -29.863 50.855  1.00 27.85  ? 281 THR B N   1 
ATOM   4801  C  CA  . THR B  1 281 ? -22.716 -29.954 49.349  1.00 30.80  ? 281 THR B CA  1 
ATOM   4802  C  C   . THR B  1 281 ? -21.338 -30.090 48.737  1.00 31.63  ? 281 THR B C   1 
ATOM   4803  O  O   . THR B  1 281 ? -21.172 -29.917 47.544  1.00 32.74  ? 281 THR B O   1 
ATOM   4804  C  CB  . THR B  1 281 ? -23.407 -28.730 48.723  1.00 34.41  ? 281 THR B CB  1 
ATOM   4805  O  OG1 . THR B  1 281 ? -22.657 -27.561 49.019  1.00 29.77  ? 281 THR B OG1 1 
ATOM   4806  C  CG2 . THR B  1 281 ? -24.866 -28.571 49.275  1.00 31.80  ? 281 THR B CG2 1 
ATOM   4807  N  N   . LEU B  1 282 ? -20.348 -30.402 49.560  1.00 30.10  ? 282 LEU B N   1 
ATOM   4808  C  CA  . LEU B  1 282 ? -18.984 -30.529 49.076  1.00 30.28  ? 282 LEU B CA  1 
ATOM   4809  C  C   . LEU B  1 282 ? -18.831 -31.621 47.967  1.00 29.52  ? 282 LEU B C   1 
ATOM   4810  O  O   . LEU B  1 282 ? -18.135 -31.414 46.987  1.00 28.64  ? 282 LEU B O   1 
ATOM   4811  C  CB  . LEU B  1 282 ? -18.009 -30.807 50.232  1.00 30.75  ? 282 LEU B CB  1 
ATOM   4812  C  CG  . LEU B  1 282 ? -16.572 -31.123 49.785  1.00 35.16  ? 282 LEU B CG  1 
ATOM   4813  C  CD1 . LEU B  1 282 ? -16.011 -29.984 48.909  1.00 39.72  ? 282 LEU B CD1 1 
ATOM   4814  C  CD2 . LEU B  1 282 ? -15.678 -31.375 50.967  1.00 33.34  ? 282 LEU B CD2 1 
ATOM   4815  N  N   . ILE B  1 283 ? -19.488 -32.764 48.145  1.00 29.21  ? 283 ILE B N   1 
ATOM   4816  C  CA  . ILE B  1 283 ? -19.327 -33.871 47.173  1.00 30.14  ? 283 ILE B CA  1 
ATOM   4817  C  C   . ILE B  1 283 ? -19.883 -33.504 45.761  1.00 30.86  ? 283 ILE B C   1 
ATOM   4818  O  O   . ILE B  1 283 ? -19.415 -34.044 44.730  1.00 31.37  ? 283 ILE B O   1 
ATOM   4819  C  CB  . ILE B  1 283 ? -19.904 -35.269 47.711  1.00 31.35  ? 283 ILE B CB  1 
ATOM   4820  C  CG1 . ILE B  1 283 ? -21.377 -35.174 48.023  1.00 31.54  ? 283 ILE B CG1 1 
ATOM   4821  C  CG2 . ILE B  1 283 ? -19.108 -35.742 48.932  1.00 31.36  ? 283 ILE B CG2 1 
ATOM   4822  C  CD1 . ILE B  1 283 ? -22.263 -35.366 46.826  1.00 39.60  ? 283 ILE B CD1 1 
ATOM   4823  N  N   . PHE B  1 284 ? -20.854 -32.574 45.722  1.00 29.22  ? 284 PHE B N   1 
ATOM   4824  C  CA  . PHE B  1 284 ? -21.390 -32.073 44.435  1.00 27.72  ? 284 PHE B CA  1 
ATOM   4825  C  C   . PHE B  1 284 ? -20.424 -31.112 43.773  1.00 27.93  ? 284 PHE B C   1 
ATOM   4826  O  O   . PHE B  1 284 ? -20.360 -31.031 42.551  1.00 26.40  ? 284 PHE B O   1 
ATOM   4827  C  CB  . PHE B  1 284 ? -22.729 -31.379 44.640  1.00 28.13  ? 284 PHE B CB  1 
ATOM   4828  C  CG  . PHE B  1 284 ? -23.772 -32.255 45.178  1.00 29.27  ? 284 PHE B CG  1 
ATOM   4829  C  CD1 . PHE B  1 284 ? -24.117 -32.203 46.530  1.00 25.58  ? 284 PHE B CD1 1 
ATOM   4830  C  CD2 . PHE B  1 284 ? -24.435 -33.164 44.348  1.00 28.96  ? 284 PHE B CD2 1 
ATOM   4831  C  CE1 . PHE B  1 284 ? -25.103 -33.034 47.043  1.00 29.51  ? 284 PHE B CE1 1 
ATOM   4832  C  CE2 . PHE B  1 284 ? -25.427 -34.001 44.860  1.00 31.27  ? 284 PHE B CE2 1 
ATOM   4833  C  CZ  . PHE B  1 284 ? -25.760 -33.937 46.206  1.00 27.55  ? 284 PHE B CZ  1 
ATOM   4834  N  N   . GLU B  1 285 ? -19.664 -30.378 44.599  1.00 26.19  ? 285 GLU B N   1 
ATOM   4835  C  CA  . GLU B  1 285 ? -18.766 -29.306 44.104  1.00 30.41  ? 285 GLU B CA  1 
ATOM   4836  C  C   . GLU B  1 285 ? -17.448 -29.827 43.693  1.00 31.85  ? 285 GLU B C   1 
ATOM   4837  O  O   . GLU B  1 285 ? -16.804 -29.277 42.798  1.00 34.39  ? 285 GLU B O   1 
ATOM   4838  C  CB  . GLU B  1 285 ? -18.564 -28.238 45.197  1.00 27.68  ? 285 GLU B CB  1 
ATOM   4839  C  CG  . GLU B  1 285 ? -19.835 -27.668 45.729  1.00 31.95  ? 285 GLU B CG  1 
ATOM   4840  C  CD  . GLU B  1 285 ? -19.661 -27.040 47.102  1.00 33.78  ? 285 GLU B CD  1 
ATOM   4841  O  OE1 . GLU B  1 285 ? -18.503 -26.974 47.595  1.00 36.22  ? 285 GLU B OE1 1 
ATOM   4842  O  OE2 . GLU B  1 285 ? -20.650 -26.628 47.678  1.00 32.05  ? 285 GLU B OE2 1 
ATOM   4843  N  N   . ASP B  1 286 ? -17.019 -30.884 44.332  1.00 33.50  ? 286 ASP B N   1 
ATOM   4844  C  CA  . ASP B  1 286 ? -15.692 -31.376 44.153  1.00 32.95  ? 286 ASP B CA  1 
ATOM   4845  C  C   . ASP B  1 286 ? -15.668 -32.866 43.763  1.00 34.29  ? 286 ASP B C   1 
ATOM   4846  O  O   . ASP B  1 286 ? -15.380 -33.214 42.619  1.00 37.38  ? 286 ASP B O   1 
ATOM   4847  C  CB  . ASP B  1 286 ? -14.881 -31.152 45.444  1.00 37.22  ? 286 ASP B CB  1 
ATOM   4848  C  CG  . ASP B  1 286 ? -13.460 -31.634 45.330  1.00 41.31  ? 286 ASP B CG  1 
ATOM   4849  O  OD1 . ASP B  1 286 ? -13.232 -32.648 44.670  1.00 39.80  ? 286 ASP B OD1 1 
ATOM   4850  O  OD2 . ASP B  1 286 ? -12.570 -30.990 45.914  1.00 44.99  ? 286 ASP B OD2 1 
ATOM   4851  N  N   . THR B  1 287 ? -15.984 -33.730 44.732  1.00 29.34  ? 287 THR B N   1 
ATOM   4852  C  CA  . THR B  1 287 ? -15.873 -35.198 44.560  1.00 27.87  ? 287 THR B CA  1 
ATOM   4853  C  C   . THR B  1 287 ? -16.561 -35.754 43.259  1.00 26.12  ? 287 THR B C   1 
ATOM   4854  O  O   . THR B  1 287 ? -15.914 -36.343 42.429  1.00 29.97  ? 287 THR B O   1 
ATOM   4855  C  CB  . THR B  1 287 ? -16.411 -35.933 45.774  1.00 30.82  ? 287 THR B CB  1 
ATOM   4856  O  OG1 . THR B  1 287 ? -15.694 -35.509 46.942  1.00 32.27  ? 287 THR B OG1 1 
ATOM   4857  C  CG2 . THR B  1 287 ? -16.264 -37.484 45.597  1.00 27.20  ? 287 THR B CG2 1 
ATOM   4858  N  N   . ILE B  1 288 ? -17.864 -35.551 43.135  1.00 25.50  ? 288 ILE B N   1 
ATOM   4859  C  CA  . ILE B  1 288 ? -18.605 -36.094 41.996  1.00 27.61  ? 288 ILE B CA  1 
ATOM   4860  C  C   . ILE B  1 288 ? -18.024 -35.618 40.629  1.00 31.86  ? 288 ILE B C   1 
ATOM   4861  O  O   . ILE B  1 288 ? -17.788 -36.439 39.724  1.00 35.35  ? 288 ILE B O   1 
ATOM   4862  C  CB  . ILE B  1 288 ? -20.107 -35.771 42.074  1.00 26.43  ? 288 ILE B CB  1 
ATOM   4863  C  CG1 . ILE B  1 288 ? -20.769 -36.569 43.224  1.00 26.02  ? 288 ILE B CG1 1 
ATOM   4864  C  CG2 . ILE B  1 288 ? -20.787 -36.096 40.759  1.00 24.03  ? 288 ILE B CG2 1 
ATOM   4865  C  CD1 . ILE B  1 288 ? -22.321 -36.460 43.244  1.00 24.41  ? 288 ILE B CD1 1 
ATOM   4866  N  N   . PRO B  1 289 ? -17.801 -34.302 40.487  1.00 30.91  ? 289 PRO B N   1 
ATOM   4867  C  CA  . PRO B  1 289 ? -17.186 -33.785 39.268  1.00 33.85  ? 289 PRO B CA  1 
ATOM   4868  C  C   . PRO B  1 289 ? -15.810 -34.409 39.038  1.00 34.32  ? 289 PRO B C   1 
ATOM   4869  O  O   . PRO B  1 289 ? -15.451 -34.734 37.890  1.00 37.76  ? 289 PRO B O   1 
ATOM   4870  C  CB  . PRO B  1 289 ? -17.052 -32.276 39.555  1.00 31.71  ? 289 PRO B CB  1 
ATOM   4871  C  CG  . PRO B  1 289 ? -18.113 -31.995 40.580  1.00 30.23  ? 289 PRO B CG  1 
ATOM   4872  C  CD  . PRO B  1 289 ? -18.172 -33.219 41.431  1.00 29.47  ? 289 PRO B CD  1 
ATOM   4873  N  N   . PHE B  1 290 ? -15.044 -34.582 40.123  1.00 33.01  ? 290 PHE B N   1 
ATOM   4874  C  CA  . PHE B  1 290 ? -13.705 -35.237 40.046  1.00 30.91  ? 290 PHE B CA  1 
ATOM   4875  C  C   . PHE B  1 290 ? -13.801 -36.644 39.472  1.00 31.10  ? 290 PHE B C   1 
ATOM   4876  O  O   . PHE B  1 290 ? -13.003 -37.032 38.624  1.00 32.74  ? 290 PHE B O   1 
ATOM   4877  C  CB  . PHE B  1 290 ? -13.049 -35.274 41.419  1.00 32.19  ? 290 PHE B CB  1 
ATOM   4878  C  CG  . PHE B  1 290 ? -11.828 -36.189 41.495  1.00 38.35  ? 290 PHE B CG  1 
ATOM   4879  C  CD1 . PHE B  1 290 ? -10.560 -35.720 41.133  1.00 36.34  ? 290 PHE B CD1 1 
ATOM   4880  C  CD2 . PHE B  1 290 ? -11.955 -37.524 41.935  1.00 36.75  ? 290 PHE B CD2 1 
ATOM   4881  C  CE1 . PHE B  1 290 ? -9.446  -36.551 41.204  1.00 41.21  ? 290 PHE B CE1 1 
ATOM   4882  C  CE2 . PHE B  1 290 ? -10.850 -38.353 42.005  1.00 39.97  ? 290 PHE B CE2 1 
ATOM   4883  C  CZ  . PHE B  1 290 ? -9.586  -37.867 41.639  1.00 43.00  ? 290 PHE B CZ  1 
ATOM   4884  N  N   . LEU B  1 291 ? -14.784 -37.409 39.936  1.00 30.71  ? 291 LEU B N   1 
ATOM   4885  C  CA  . LEU B  1 291 ? -14.956 -38.780 39.470  1.00 32.92  ? 291 LEU B CA  1 
ATOM   4886  C  C   . LEU B  1 291 ? -15.342 -38.810 37.996  1.00 33.77  ? 291 LEU B C   1 
ATOM   4887  O  O   . LEU B  1 291 ? -14.814 -39.604 37.220  1.00 31.12  ? 291 LEU B O   1 
ATOM   4888  C  CB  . LEU B  1 291 ? -16.021 -39.532 40.332  1.00 29.83  ? 291 LEU B CB  1 
ATOM   4889  C  CG  . LEU B  1 291 ? -15.683 -39.725 41.819  1.00 31.85  ? 291 LEU B CG  1 
ATOM   4890  C  CD1 . LEU B  1 291 ? -16.883 -40.254 42.590  1.00 29.44  ? 291 LEU B CD1 1 
ATOM   4891  C  CD2 . LEU B  1 291 ? -14.478 -40.645 41.991  1.00 33.02  ? 291 LEU B CD2 1 
ATOM   4892  N  N   . LYS B  1 292 ? -16.251 -37.951 37.621  1.00 34.90  ? 292 LYS B N   1 
ATOM   4893  C  CA  . LYS B  1 292 ? -16.700 -37.886 36.257  1.00 37.84  ? 292 LYS B CA  1 
ATOM   4894  C  C   . LYS B  1 292 ? -15.548 -37.511 35.303  1.00 36.50  ? 292 LYS B C   1 
ATOM   4895  O  O   . LYS B  1 292 ? -15.458 -38.029 34.217  1.00 38.72  ? 292 LYS B O   1 
ATOM   4896  C  CB  . LYS B  1 292 ? -17.894 -36.919 36.125  1.00 37.23  ? 292 LYS B CB  1 
ATOM   4897  C  CG  . LYS B  1 292 ? -19.184 -37.484 36.770  1.00 39.26  ? 292 LYS B CG  1 
ATOM   4898  C  CD  . LYS B  1 292 ? -20.092 -36.403 37.293  1.00 46.21  ? 292 LYS B CD  1 
ATOM   4899  C  CE  . LYS B  1 292 ? -21.025 -35.909 36.250  1.00 51.63  ? 292 LYS B CE  1 
ATOM   4900  N  NZ  . LYS B  1 292 ? -22.145 -35.146 36.864  1.00 50.67  ? 292 LYS B NZ  1 
ATOM   4901  N  N   . ARG B  1 293 ? -14.670 -36.613 35.748  1.00 33.67  ? 293 ARG B N   1 
ATOM   4902  C  CA  . ARG B  1 293 ? -13.472 -36.255 34.946  1.00 39.44  ? 293 ARG B CA  1 
ATOM   4903  C  C   . ARG B  1 293 ? -12.561 -37.441 34.785  1.00 40.59  ? 293 ARG B C   1 
ATOM   4904  O  O   . ARG B  1 293 ? -11.707 -37.455 33.918  1.00 38.83  ? 293 ARG B O   1 
ATOM   4905  C  CB  . ARG B  1 293 ? -12.695 -35.071 35.584  1.00 38.91  ? 293 ARG B CB  1 
ATOM   4906  C  CG  . ARG B  1 293 ? -13.413 -33.729 35.504  1.00 37.85  ? 293 ARG B CG  1 
ATOM   4907  C  CD  . ARG B  1 293 ? -12.451 -32.554 35.811  1.00 43.34  ? 293 ARG B CD  1 
ATOM   4908  N  NE  . ARG B  1 293 ? -11.742 -32.725 37.096  1.00 42.99  ? 293 ARG B NE  1 
ATOM   4909  C  CZ  . ARG B  1 293 ? -12.192 -32.267 38.275  1.00 43.63  ? 293 ARG B CZ  1 
ATOM   4910  N  NH1 . ARG B  1 293 ? -11.482 -32.468 39.385  1.00 37.11  ? 293 ARG B NH1 1 
ATOM   4911  N  NH2 . ARG B  1 293 ? -13.354 -31.607 38.341  1.00 41.76  ? 293 ARG B NH2 1 
ATOM   4912  N  N   . ASN B  1 294 ? -12.751 -38.460 35.639  1.00 39.89  ? 294 ASN B N   1 
ATOM   4913  C  CA  . ASN B  1 294 ? -11.912 -39.660 35.587  1.00 37.92  ? 294 ASN B CA  1 
ATOM   4914  C  C   . ASN B  1 294 ? -12.631 -40.901 35.069  1.00 37.45  ? 294 ASN B C   1 
ATOM   4915  O  O   . ASN B  1 294 ? -12.290 -41.997 35.422  1.00 40.75  ? 294 ASN B O   1 
ATOM   4916  C  CB  . ASN B  1 294 ? -11.278 -39.940 36.942  1.00 37.85  ? 294 ASN B CB  1 
ATOM   4917  C  CG  . ASN B  1 294 ? -10.226 -38.951 37.292  1.00 43.17  ? 294 ASN B CG  1 
ATOM   4918  O  OD1 . ASN B  1 294 ? -10.520 -37.855 37.763  1.00 50.12  ? 294 ASN B OD1 1 
ATOM   4919  N  ND2 . ASN B  1 294 ? -8.979  -39.320 37.074  1.00 44.14  ? 294 ASN B ND2 1 
ATOM   4920  N  N   . GLY B  1 295 ? -13.630 -40.698 34.231  1.00 37.36  ? 295 GLY B N   1 
ATOM   4921  C  CA  . GLY B  1 295 ? -14.262 -41.801 33.527  1.00 39.10  ? 295 GLY B CA  1 
ATOM   4922  C  C   . GLY B  1 295 ? -15.358 -42.533 34.285  1.00 40.27  ? 295 GLY B C   1 
ATOM   4923  O  O   . GLY B  1 295 ? -15.962 -43.459 33.758  1.00 44.00  ? 295 GLY B O   1 
ATOM   4924  N  N   . VAL B  1 296 ? -15.610 -42.132 35.509  1.00 36.80  ? 296 VAL B N   1 
ATOM   4925  C  CA  . VAL B  1 296 ? -16.713 -42.712 36.267  1.00 34.43  ? 296 VAL B CA  1 
ATOM   4926  C  C   . VAL B  1 296 ? -18.028 -42.180 35.718  1.00 35.54  ? 296 VAL B C   1 
ATOM   4927  O  O   . VAL B  1 296 ? -18.235 -41.009 35.674  1.00 39.23  ? 296 VAL B O   1 
ATOM   4928  C  CB  . VAL B  1 296 ? -16.618 -42.379 37.748  1.00 32.58  ? 296 VAL B CB  1 
ATOM   4929  C  CG1 . VAL B  1 296 ? -17.769 -43.045 38.513  1.00 30.42  ? 296 VAL B CG1 1 
ATOM   4930  C  CG2 . VAL B  1 296 ? -15.287 -42.820 38.299  1.00 31.10  ? 296 VAL B CG2 1 
ATOM   4931  N  N   . ASN B  1 297 ? -18.900 -43.074 35.300  1.00 40.84  ? 297 ASN B N   1 
ATOM   4932  C  CA  . ASN B  1 297 ? -20.184 -42.666 34.676  1.00 43.71  ? 297 ASN B CA  1 
ATOM   4933  C  C   . ASN B  1 297 ? -21.332 -42.394 35.699  1.00 46.77  ? 297 ASN B C   1 
ATOM   4934  O  O   . ASN B  1 297 ? -21.180 -42.621 36.894  1.00 42.82  ? 297 ASN B O   1 
ATOM   4935  C  CB  . ASN B  1 297 ? -20.626 -43.690 33.641  1.00 47.14  ? 297 ASN B CB  1 
ATOM   4936  C  CG  . ASN B  1 297 ? -20.916 -45.012 34.238  1.00 49.77  ? 297 ASN B CG  1 
ATOM   4937  O  OD1 . ASN B  1 297 ? -21.216 -45.116 35.420  1.00 57.07  ? 297 ASN B OD1 1 
ATOM   4938  N  ND2 . ASN B  1 297 ? -20.835 -46.052 33.430  1.00 50.15  ? 297 ASN B ND2 1 
ATOM   4939  N  N   . GLU B  1 298 ? -22.474 -41.907 35.182  1.00 49.91  ? 298 GLU B N   1 
ATOM   4940  C  CA  . GLU B  1 298 ? -23.638 -41.570 36.016  1.00 49.65  ? 298 GLU B CA  1 
ATOM   4941  C  C   . GLU B  1 298 ? -24.178 -42.766 36.763  1.00 44.83  ? 298 GLU B C   1 
ATOM   4942  O  O   . GLU B  1 298 ? -24.744 -42.626 37.854  1.00 41.40  ? 298 GLU B O   1 
ATOM   4943  C  CB  . GLU B  1 298 ? -24.753 -40.953 35.151  1.00 55.32  ? 298 GLU B CB  1 
ATOM   4944  C  CG  . GLU B  1 298 ? -24.442 -39.571 34.638  1.00 72.77  ? 298 GLU B CG  1 
ATOM   4945  C  CD  . GLU B  1 298 ? -24.295 -38.550 35.761  1.00 83.86  ? 298 GLU B CD  1 
ATOM   4946  O  OE1 . GLU B  1 298 ? -23.753 -37.451 35.504  1.00 99.96  ? 298 GLU B OE1 1 
ATOM   4947  O  OE2 . GLU B  1 298 ? -24.720 -38.851 36.904  1.00 86.03  ? 298 GLU B OE2 1 
ATOM   4948  N  N   . GLU B  1 299 ? -24.016 -43.938 36.185  1.00 41.27  ? 299 GLU B N   1 
ATOM   4949  C  CA  . GLU B  1 299 ? -24.539 -45.158 36.784  1.00 43.84  ? 299 GLU B CA  1 
ATOM   4950  C  C   . GLU B  1 299 ? -23.848 -45.466 38.077  1.00 37.45  ? 299 GLU B C   1 
ATOM   4951  O  O   . GLU B  1 299 ? -24.475 -45.856 39.035  1.00 41.03  ? 299 GLU B O   1 
ATOM   4952  C  CB  . GLU B  1 299 ? -24.409 -46.341 35.808  1.00 46.34  ? 299 GLU B CB  1 
ATOM   4953  C  CG  . GLU B  1 299 ? -25.309 -46.220 34.573  1.00 58.00  ? 299 GLU B CG  1 
ATOM   4954  C  CD  . GLU B  1 299 ? -25.038 -44.930 33.763  1.00 69.59  ? 299 GLU B CD  1 
ATOM   4955  O  OE1 . GLU B  1 299 ? -23.848 -44.654 33.446  1.00 71.34  ? 299 GLU B OE1 1 
ATOM   4956  O  OE2 . GLU B  1 299 ? -26.013 -44.205 33.448  1.00 78.34  ? 299 GLU B OE2 1 
ATOM   4957  N  N   . VAL B  1 300 ? -22.550 -45.285 38.101  1.00 33.96  ? 300 VAL B N   1 
ATOM   4958  C  CA  . VAL B  1 300 ? -21.801 -45.507 39.284  1.00 32.93  ? 300 VAL B CA  1 
ATOM   4959  C  C   . VAL B  1 300 ? -22.262 -44.539 40.414  1.00 28.03  ? 300 VAL B C   1 
ATOM   4960  O  O   . VAL B  1 300 ? -22.444 -44.944 41.536  1.00 26.29  ? 300 VAL B O   1 
ATOM   4961  C  CB  . VAL B  1 300 ? -20.299 -45.337 39.041  1.00 34.39  ? 300 VAL B CB  1 
ATOM   4962  C  CG1 . VAL B  1 300 ? -19.527 -45.502 40.346  1.00 33.03  ? 300 VAL B CG1 1 
ATOM   4963  C  CG2 . VAL B  1 300 ? -19.817 -46.335 38.001  1.00 35.61  ? 300 VAL B CG2 1 
ATOM   4964  N  N   . ILE B  1 301 ? -22.441 -43.275 40.076  1.00 29.18  ? 301 ILE B N   1 
ATOM   4965  C  CA  . ILE B  1 301 ? -22.930 -42.280 41.065  1.00 30.03  ? 301 ILE B CA  1 
ATOM   4966  C  C   . ILE B  1 301 ? -24.311 -42.672 41.587  1.00 30.69  ? 301 ILE B C   1 
ATOM   4967  O  O   . ILE B  1 301 ? -24.592 -42.581 42.831  1.00 28.05  ? 301 ILE B O   1 
ATOM   4968  C  CB  . ILE B  1 301 ? -22.966 -40.850 40.480  1.00 32.07  ? 301 ILE B CB  1 
ATOM   4969  C  CG1 . ILE B  1 301 ? -21.567 -40.262 40.443  1.00 33.20  ? 301 ILE B CG1 1 
ATOM   4970  C  CG2 . ILE B  1 301 ? -23.875 -39.951 41.315  1.00 28.13  ? 301 ILE B CG2 1 
ATOM   4971  C  CD1 . ILE B  1 301 ? -20.623 -41.007 39.596  1.00 39.67  ? 301 ILE B CD1 1 
ATOM   4972  N  N   . ALA B  1 302 ? -25.187 -43.120 40.669  1.00 28.67  ? 302 ALA B N   1 
ATOM   4973  C  CA  . ALA B  1 302 ? -26.534 -43.581 41.047  1.00 30.05  ? 302 ALA B CA  1 
ATOM   4974  C  C   . ALA B  1 302 ? -26.453 -44.782 41.969  1.00 29.34  ? 302 ALA B C   1 
ATOM   4975  O  O   . ALA B  1 302 ? -27.205 -44.886 42.923  1.00 32.38  ? 302 ALA B O   1 
ATOM   4976  C  CB  . ALA B  1 302 ? -27.353 -43.910 39.810  1.00 30.35  ? 302 ALA B CB  1 
ATOM   4977  N  N   . THR B  1 303 ? -25.522 -45.697 41.677  1.00 28.91  ? 303 THR B N   1 
ATOM   4978  C  CA  . THR B  1 303 ? -25.304 -46.868 42.535  1.00 27.99  ? 303 THR B CA  1 
ATOM   4979  C  C   . THR B  1 303 ? -24.982 -46.437 43.962  1.00 26.03  ? 303 THR B C   1 
ATOM   4980  O  O   . THR B  1 303 ? -25.588 -46.933 44.939  1.00 27.94  ? 303 THR B O   1 
ATOM   4981  C  CB  . THR B  1 303 ? -24.148 -47.758 42.003  1.00 29.97  ? 303 THR B CB  1 
ATOM   4982  O  OG1 . THR B  1 303 ? -24.547 -48.385 40.806  1.00 34.85  ? 303 THR B OG1 1 
ATOM   4983  C  CG2 . THR B  1 303 ? -23.768 -48.839 43.035  1.00 26.19  ? 303 THR B CG2 1 
ATOM   4984  N  N   . ILE B  1 304 ? -24.055 -45.524 44.084  1.00 23.56  ? 304 ILE B N   1 
ATOM   4985  C  CA  . ILE B  1 304 ? -23.576 -45.087 45.372  1.00 23.32  ? 304 ILE B CA  1 
ATOM   4986  C  C   . ILE B  1 304 ? -24.631 -44.292 46.203  1.00 22.84  ? 304 ILE B C   1 
ATOM   4987  O  O   . ILE B  1 304 ? -24.798 -44.534 47.376  1.00 23.74  ? 304 ILE B O   1 
ATOM   4988  C  CB  . ILE B  1 304 ? -22.291 -44.243 45.229  1.00 22.07  ? 304 ILE B CB  1 
ATOM   4989  C  CG1 . ILE B  1 304 ? -21.144 -45.120 44.734  1.00 22.56  ? 304 ILE B CG1 1 
ATOM   4990  C  CG2 . ILE B  1 304 ? -21.933 -43.592 46.550  1.00 20.97  ? 304 ILE B CG2 1 
ATOM   4991  C  CD1 . ILE B  1 304 ? -19.864 -44.349 44.418  1.00 24.06  ? 304 ILE B CD1 1 
ATOM   4992  N  N   . PHE B  1 305 ? -25.316 -43.372 45.561  1.00 23.83  ? 305 PHE B N   1 
ATOM   4993  C  CA  . PHE B  1 305 ? -26.216 -42.434 46.283  1.00 21.34  ? 305 PHE B CA  1 
ATOM   4994  C  C   . PHE B  1 305 ? -27.698 -42.829 46.251  1.00 24.31  ? 305 PHE B C   1 
ATOM   4995  O  O   . PHE B  1 305 ? -28.499 -42.291 46.996  1.00 25.15  ? 305 PHE B O   1 
ATOM   4996  C  CB  . PHE B  1 305 ? -26.032 -41.035 45.760  1.00 19.95  ? 305 PHE B CB  1 
ATOM   4997  C  CG  . PHE B  1 305 ? -24.686 -40.482 46.016  1.00 22.20  ? 305 PHE B CG  1 
ATOM   4998  C  CD1 . PHE B  1 305 ? -23.728 -40.490 45.036  1.00 22.52  ? 305 PHE B CD1 1 
ATOM   4999  C  CD2 . PHE B  1 305 ? -24.348 -39.956 47.298  1.00 20.83  ? 305 PHE B CD2 1 
ATOM   5000  C  CE1 . PHE B  1 305 ? -22.464 -39.983 45.284  1.00 21.66  ? 305 PHE B CE1 1 
ATOM   5001  C  CE2 . PHE B  1 305 ? -23.097 -39.458 47.539  1.00 19.07  ? 305 PHE B CE2 1 
ATOM   5002  C  CZ  . PHE B  1 305 ? -22.154 -39.466 46.542  1.00 20.91  ? 305 PHE B CZ  1 
ATOM   5003  N  N   . LYS B  1 306 ? -28.043 -43.752 45.405  1.00 23.21  ? 306 LYS B N   1 
ATOM   5004  C  CA  . LYS B  1 306 ? -29.412 -44.204 45.336  1.00 27.44  ? 306 LYS B CA  1 
ATOM   5005  C  C   . LYS B  1 306 ? -29.535 -45.695 45.633  1.00 26.72  ? 306 LYS B C   1 
ATOM   5006  O  O   . LYS B  1 306 ? -30.249 -46.094 46.540  1.00 30.46  ? 306 LYS B O   1 
ATOM   5007  C  CB  . LYS B  1 306 ? -30.038 -43.872 43.945  1.00 27.59  ? 306 LYS B CB  1 
ATOM   5008  C  CG  . LYS B  1 306 ? -30.057 -42.384 43.619  1.00 32.46  ? 306 LYS B CG  1 
ATOM   5009  C  CD  . LYS B  1 306 ? -30.693 -42.111 42.248  1.00 37.39  ? 306 LYS B CD  1 
ATOM   5010  C  CE  . LYS B  1 306 ? -30.619 -40.620 41.894  1.00 38.83  ? 306 LYS B CE  1 
ATOM   5011  N  NZ  . LYS B  1 306 ? -31.281 -40.322 40.587  1.00 44.74  ? 306 LYS B NZ  1 
ATOM   5012  N  N   . GLU B  1 307 ? -28.833 -46.498 44.872  1.00 27.54  ? 307 GLU B N   1 
ATOM   5013  C  CA  . GLU B  1 307 ? -28.986 -47.920 44.948  1.00 30.24  ? 307 GLU B CA  1 
ATOM   5014  C  C   . GLU B  1 307 ? -28.457 -48.532 46.312  1.00 28.26  ? 307 GLU B C   1 
ATOM   5015  O  O   . GLU B  1 307 ? -29.154 -49.330 46.955  1.00 26.90  ? 307 GLU B O   1 
ATOM   5016  C  CB  . GLU B  1 307 ? -28.329 -48.596 43.757  1.00 31.37  ? 307 GLU B CB  1 
ATOM   5017  C  CG  . GLU B  1 307 ? -28.696 -50.042 43.614  1.00 47.54  ? 307 GLU B CG  1 
ATOM   5018  C  CD  . GLU B  1 307 ? -30.234 -50.264 43.566  1.00 49.59  ? 307 GLU B CD  1 
ATOM   5019  O  OE1 . GLU B  1 307 ? -30.919 -49.585 42.745  1.00 49.34  ? 307 GLU B OE1 1 
ATOM   5020  O  OE2 . GLU B  1 307 ? -30.740 -51.111 44.345  1.00 45.35  ? 307 GLU B OE2 1 
ATOM   5021  N  N   . ASN B  1 308 ? -27.248 -48.143 46.719  1.00 25.05  ? 308 ASN B N   1 
ATOM   5022  C  CA  . ASN B  1 308 ? -26.682 -48.653 47.964  1.00 24.43  ? 308 ASN B CA  1 
ATOM   5023  C  C   . ASN B  1 308 ? -27.557 -48.325 49.222  1.00 24.49  ? 308 ASN B C   1 
ATOM   5024  O  O   . ASN B  1 308 ? -27.865 -49.191 49.979  1.00 27.91  ? 308 ASN B O   1 
ATOM   5025  C  CB  . ASN B  1 308 ? -25.217 -48.192 48.146  1.00 23.24  ? 308 ASN B CB  1 
ATOM   5026  C  CG  . ASN B  1 308 ? -24.290 -48.841 47.160  1.00 24.83  ? 308 ASN B CG  1 
ATOM   5027  O  OD1 . ASN B  1 308 ? -24.658 -49.766 46.499  1.00 27.31  ? 308 ASN B OD1 1 
ATOM   5028  N  ND2 . ASN B  1 308 ? -23.070 -48.338 47.065  1.00 27.87  ? 308 ASN B ND2 1 
ATOM   5029  N  N   . PRO B  1 309 ? -27.944 -47.023 49.399  1.00 25.94  ? 309 PRO B N   1 
ATOM   5030  C  CA  . PRO B  1 309 ? -28.883 -46.674 50.497  1.00 27.12  ? 309 PRO B CA  1 
ATOM   5031  C  C   . PRO B  1 309 ? -30.179 -47.459 50.381  1.00 27.54  ? 309 PRO B C   1 
ATOM   5032  O  O   . PRO B  1 309 ? -30.789 -47.811 51.394  1.00 25.37  ? 309 PRO B O   1 
ATOM   5033  C  CB  . PRO B  1 309 ? -29.149 -45.197 50.265  1.00 26.39  ? 309 PRO B CB  1 
ATOM   5034  C  CG  . PRO B  1 309 ? -27.911 -44.702 49.565  1.00 24.79  ? 309 PRO B CG  1 
ATOM   5035  C  CD  . PRO B  1 309 ? -27.478 -45.828 48.674  1.00 24.19  ? 309 PRO B CD  1 
ATOM   5036  N  N   . LYS B  1 310 ? -30.593 -47.726 49.157  1.00 27.65  ? 310 LYS B N   1 
ATOM   5037  C  CA  . LYS B  1 310 ? -31.802 -48.488 48.904  1.00 30.75  ? 310 LYS B CA  1 
ATOM   5038  C  C   . LYS B  1 310 ? -31.679 -49.923 49.498  1.00 29.00  ? 310 LYS B C   1 
ATOM   5039  O  O   . LYS B  1 310 ? -32.536 -50.364 50.277  1.00 26.92  ? 310 LYS B O   1 
ATOM   5040  C  CB  . LYS B  1 310 ? -32.065 -48.557 47.428  1.00 33.74  ? 310 LYS B CB  1 
ATOM   5041  C  CG  . LYS B  1 310 ? -33.452 -49.035 47.052  1.00 37.59  ? 310 LYS B CG  1 
ATOM   5042  C  CD  . LYS B  1 310 ? -33.772 -48.631 45.597  1.00 47.07  ? 310 LYS B CD  1 
ATOM   5043  C  CE  . LYS B  1 310 ? -33.508 -47.076 45.374  1.00 53.73  ? 310 LYS B CE  1 
ATOM   5044  N  NZ  . LYS B  1 310 ? -33.543 -46.669 43.916  1.00 50.23  ? 310 LYS B NZ  1 
ATOM   5045  N  N   . LYS B  1 311 ? -30.619 -50.623 49.124  1.00 30.06  ? 311 LYS B N   1 
ATOM   5046  C  CA  . LYS B  1 311 ? -30.363 -51.962 49.657  1.00 31.88  ? 311 LYS B CA  1 
ATOM   5047  C  C   . LYS B  1 311 ? -30.220 -51.908 51.173  1.00 28.74  ? 311 LYS B C   1 
ATOM   5048  O  O   . LYS B  1 311 ? -30.825 -52.679 51.887  1.00 29.60  ? 311 LYS B O   1 
ATOM   5049  C  CB  . LYS B  1 311 ? -29.103 -52.549 49.040  1.00 33.45  ? 311 LYS B CB  1 
ATOM   5050  C  CG  . LYS B  1 311 ? -29.183 -52.789 47.542  1.00 37.17  ? 311 LYS B CG  1 
ATOM   5051  C  CD  . LYS B  1 311 ? -27.835 -53.316 47.000  1.00 44.87  ? 311 LYS B CD  1 
ATOM   5052  C  CE  . LYS B  1 311 ? -27.963 -53.825 45.549  1.00 52.01  ? 311 LYS B CE  1 
ATOM   5053  N  NZ  . LYS B  1 311 ? -28.334 -52.731 44.598  1.00 57.91  ? 311 LYS B NZ  1 
ATOM   5054  N  N   . PHE B  1 312 ? -29.418 -50.990 51.636  1.00 27.93  ? 312 PHE B N   1 
ATOM   5055  C  CA  . PHE B  1 312 ? -29.166 -50.813 53.079  1.00 25.18  ? 312 PHE B CA  1 
ATOM   5056  C  C   . PHE B  1 312 ? -30.481 -50.819 53.915  1.00 26.51  ? 312 PHE B C   1 
ATOM   5057  O  O   . PHE B  1 312 ? -30.548 -51.431 54.958  1.00 25.58  ? 312 PHE B O   1 
ATOM   5058  C  CB  . PHE B  1 312 ? -28.409 -49.523 53.305  1.00 21.22  ? 312 PHE B CB  1 
ATOM   5059  C  CG  . PHE B  1 312 ? -27.851 -49.367 54.706  1.00 21.64  ? 312 PHE B CG  1 
ATOM   5060  C  CD1 . PHE B  1 312 ? -28.139 -48.225 55.463  1.00 21.84  ? 312 PHE B CD1 1 
ATOM   5061  C  CD2 . PHE B  1 312 ? -27.027 -50.355 55.266  1.00 21.48  ? 312 PHE B CD2 1 
ATOM   5062  C  CE1 . PHE B  1 312 ? -27.618 -48.073 56.751  1.00 21.19  ? 312 PHE B CE1 1 
ATOM   5063  C  CE2 . PHE B  1 312 ? -26.515 -50.207 56.534  1.00 21.11  ? 312 PHE B CE2 1 
ATOM   5064  C  CZ  . PHE B  1 312 ? -26.813 -49.049 57.285  1.00 21.60  ? 312 PHE B CZ  1 
ATOM   5065  N  N   . PHE B  1 313 ? -31.506 -50.128 53.414  1.00 26.88  ? 313 PHE B N   1 
ATOM   5066  C  CA  . PHE B  1 313 ? -32.763 -49.945 54.173  1.00 27.63  ? 313 PHE B CA  1 
ATOM   5067  C  C   . PHE B  1 313 ? -33.874 -50.931 53.790  1.00 33.38  ? 313 PHE B C   1 
ATOM   5068  O  O   . PHE B  1 313 ? -35.004 -50.842 54.312  1.00 34.48  ? 313 PHE B O   1 
ATOM   5069  C  CB  . PHE B  1 313 ? -33.272 -48.528 54.013  1.00 25.80  ? 313 PHE B CB  1 
ATOM   5070  C  CG  . PHE B  1 313 ? -32.555 -47.528 54.863  1.00 26.09  ? 313 PHE B CG  1 
ATOM   5071  C  CD1 . PHE B  1 313 ? -31.615 -46.681 54.313  1.00 26.16  ? 313 PHE B CD1 1 
ATOM   5072  C  CD2 . PHE B  1 313 ? -32.839 -47.424 56.254  1.00 25.63  ? 313 PHE B CD2 1 
ATOM   5073  C  CE1 . PHE B  1 313 ? -30.947 -45.742 55.109  1.00 30.85  ? 313 PHE B CE1 1 
ATOM   5074  C  CE2 . PHE B  1 313 ? -32.175 -46.487 57.053  1.00 24.26  ? 313 PHE B CE2 1 
ATOM   5075  C  CZ  . PHE B  1 313 ? -31.238 -45.653 56.497  1.00 27.35  ? 313 PHE B CZ  1 
ATOM   5076  N  N   . SER B  1 314 ? -33.581 -51.844 52.906  1.00 33.32  ? 314 SER B N   1 
ATOM   5077  C  CA  . SER B  1 314 ? -34.579 -52.826 52.504  1.00 41.94  ? 314 SER B CA  1 
ATOM   5078  C  C   . SER B  1 314 ? -34.227 -54.254 52.995  1.00 48.75  ? 314 SER B C   1 
ATOM   5079  O  O   . SER B  1 314 ? -33.351 -54.440 53.882  1.00 45.86  ? 314 SER B O   1 
ATOM   5080  C  CB  . SER B  1 314 ? -34.807 -52.799 50.963  1.00 46.45  ? 314 SER B CB  1 
ATOM   5081  O  OG  . SER B  1 314 ? -33.624 -52.960 50.277  1.00 55.97  ? 314 SER B OG  1 
ATOM   5082  O  OXT . SER B  1 314 ? -34.802 -55.238 52.541  1.00 60.43  ? 314 SER B OXT 1 
ATOM   5083  N  N   . MET C  1 1   ? -15.115 -36.138 -19.325 1.00 69.01  ? 1   MET C N   1 
ATOM   5084  C  CA  . MET C  1 1   ? -14.017 -36.720 -18.485 1.00 60.64  ? 1   MET C CA  1 
ATOM   5085  C  C   . MET C  1 1   ? -12.792 -35.814 -18.443 1.00 56.42  ? 1   MET C C   1 
ATOM   5086  O  O   . MET C  1 1   ? -11.752 -36.154 -18.970 1.00 59.17  ? 1   MET C O   1 
ATOM   5087  C  CB  . MET C  1 1   ? -13.631 -38.090 -18.996 1.00 68.62  ? 1   MET C CB  1 
ATOM   5088  C  CG  . MET C  1 1   ? -13.657 -38.208 -20.488 1.00 76.06  ? 1   MET C CG  1 
ATOM   5089  S  SD  . MET C  1 1   ? -15.336 -38.117 -21.131 1.00 89.46  ? 1   MET C SD  1 
ATOM   5090  C  CE  . MET C  1 1   ? -16.046 -39.653 -20.457 1.00 80.88  ? 1   MET C CE  1 
ATOM   5091  N  N   A ARG C  1 2   ? -12.946 -34.665 -17.796 0.50 49.00  ? 2   ARG C N   1 
ATOM   5092  N  N   B ARG C  1 2   ? -12.933 -34.630 -17.809 0.50 49.02  ? 2   ARG C N   1 
ATOM   5093  C  CA  A ARG C  1 2   ? -11.853 -33.761 -17.561 0.50 44.58  ? 2   ARG C CA  1 
ATOM   5094  C  CA  B ARG C  1 2   ? -11.802 -33.623 -17.742 0.50 44.06  ? 2   ARG C CA  1 
ATOM   5095  C  C   A ARG C  1 2   ? -12.361 -32.478 -16.864 0.50 40.37  ? 2   ARG C C   1 
ATOM   5096  C  C   B ARG C  1 2   ? -12.271 -32.328 -17.071 0.50 39.25  ? 2   ARG C C   1 
ATOM   5097  O  O   A ARG C  1 2   ? -11.723 -31.969 -15.964 0.50 40.94  ? 2   ARG C O   1 
ATOM   5098  O  O   B ARG C  1 2   ? -11.518 -31.674 -16.380 0.50 38.31  ? 2   ARG C O   1 
ATOM   5099  C  CB  A ARG C  1 2   ? -11.132 -33.423 -18.849 0.50 45.85  ? 2   ARG C CB  1 
ATOM   5100  C  CB  B ARG C  1 2   ? -11.259 -33.334 -19.136 0.50 46.83  ? 2   ARG C CB  1 
ATOM   5101  C  CG  A ARG C  1 2   ? -9.766  -32.825 -18.631 0.50 49.40  ? 2   ARG C CG  1 
ATOM   5102  C  CG  B ARG C  1 2   ? -9.745  -32.948 -19.192 0.50 49.37  ? 2   ARG C CG  1 
ATOM   5103  C  CD  A ARG C  1 2   ? -9.068  -32.541 -19.927 0.50 52.40  ? 2   ARG C CD  1 
ATOM   5104  C  CD  B ARG C  1 2   ? -9.442  -31.656 -18.428 0.50 49.81  ? 2   ARG C CD  1 
ATOM   5105  N  NE  A ARG C  1 2   ? -7.783  -31.910 -19.707 0.50 56.79  ? 2   ARG C NE  1 
ATOM   5106  N  NE  B ARG C  1 2   ? -9.032  -31.912 -17.043 0.50 50.49  ? 2   ARG C NE  1 
ATOM   5107  C  CZ  A ARG C  1 2   ? -7.297  -31.606 -18.505 0.50 58.14  ? 2   ARG C CZ  1 
ATOM   5108  C  CZ  B ARG C  1 2   ? -7.765  -32.067 -16.655 0.50 48.16  ? 2   ARG C CZ  1 
ATOM   5109  N  NH1 A ARG C  1 2   ? -8.000  -31.881 -17.412 0.50 60.89  ? 2   ARG C NH1 1 
ATOM   5110  N  NH1 B ARG C  1 2   ? -7.482  -32.294 -15.386 0.50 42.90  ? 2   ARG C NH1 1 
ATOM   5111  N  NH2 A ARG C  1 2   ? -6.112  -31.030 -18.396 0.50 59.51  ? 2   ARG C NH2 1 
ATOM   5112  N  NH2 B ARG C  1 2   ? -6.787  -31.994 -17.543 0.50 54.36  ? 2   ARG C NH2 1 
ATOM   5113  N  N   . ILE C  1 3   ? -13.529 -31.976 -17.303 1.00 34.27  ? 3   ILE C N   1 
ATOM   5114  C  CA  . ILE C  1 3   ? -14.168 -30.833 -16.614 1.00 31.47  ? 3   ILE C CA  1 
ATOM   5115  C  C   . ILE C  1 3   ? -15.466 -31.291 -16.013 1.00 30.44  ? 3   ILE C C   1 
ATOM   5116  O  O   . ILE C  1 3   ? -16.409 -31.688 -16.757 1.00 27.58  ? 3   ILE C O   1 
ATOM   5117  C  CB  . ILE C  1 3   ? -14.456 -29.651 -17.554 1.00 31.53  ? 3   ILE C CB  1 
ATOM   5118  C  CG1 . ILE C  1 3   ? -13.205 -29.186 -18.238 1.00 31.31  ? 3   ILE C CG1 1 
ATOM   5119  C  CG2 . ILE C  1 3   ? -15.086 -28.486 -16.761 1.00 33.21  ? 3   ILE C CG2 1 
ATOM   5120  C  CD1 . ILE C  1 3   ? -13.435 -27.974 -19.183 1.00 33.56  ? 3   ILE C CD1 1 
ATOM   5121  N  N   . PRO C  1 4   ? -15.558 -31.262 -14.666 1.00 25.09  ? 4   PRO C N   1 
ATOM   5122  C  CA  . PRO C  1 4   ? -16.791 -31.653 -13.978 1.00 25.27  ? 4   PRO C CA  1 
ATOM   5123  C  C   . PRO C  1 4   ? -17.880 -30.671 -14.239 1.00 24.52  ? 4   PRO C C   1 
ATOM   5124  O  O   . PRO C  1 4   ? -17.622 -29.453 -14.287 1.00 22.10  ? 4   PRO C O   1 
ATOM   5125  C  CB  . PRO C  1 4   ? -16.388 -31.611 -12.479 1.00 23.46  ? 4   PRO C CB  1 
ATOM   5126  C  CG  . PRO C  1 4   ? -15.260 -30.636 -12.424 1.00 24.63  ? 4   PRO C CG  1 
ATOM   5127  C  CD  . PRO C  1 4   ? -14.507 -30.815 -13.724 1.00 26.19  ? 4   PRO C CD  1 
ATOM   5128  N  N   . LEU C  1 5   ? -19.105 -31.171 -14.418 1.00 24.24  ? 5   LEU C N   1 
ATOM   5129  C  CA  . LEU C  1 5   ? -20.297 -30.297 -14.636 1.00 24.67  ? 5   LEU C CA  1 
ATOM   5130  C  C   . LEU C  1 5   ? -21.318 -30.578 -13.613 1.00 26.79  ? 5   LEU C C   1 
ATOM   5131  O  O   . LEU C  1 5   ? -21.448 -31.684 -13.170 1.00 28.29  ? 5   LEU C O   1 
ATOM   5132  C  CB  . LEU C  1 5   ? -20.905 -30.540 -16.033 1.00 25.56  ? 5   LEU C CB  1 
ATOM   5133  C  CG  . LEU C  1 5   ? -20.063 -30.279 -17.277 1.00 24.42  ? 5   LEU C CG  1 
ATOM   5134  C  CD1 . LEU C  1 5   ? -20.887 -30.573 -18.547 1.00 21.34  ? 5   LEU C CD1 1 
ATOM   5135  C  CD2 . LEU C  1 5   ? -19.520 -28.840 -17.292 1.00 22.86  ? 5   LEU C CD2 1 
ATOM   5136  N  N   . VAL C  1 6   ? -22.064 -29.572 -13.237 1.00 25.03  ? 6   VAL C N   1 
ATOM   5137  C  CA  . VAL C  1 6   ? -23.100 -29.743 -12.270 1.00 25.43  ? 6   VAL C CA  1 
ATOM   5138  C  C   . VAL C  1 6   ? -24.313 -30.456 -12.882 1.00 28.09  ? 6   VAL C C   1 
ATOM   5139  O  O   . VAL C  1 6   ? -24.881 -29.996 -13.876 1.00 24.95  ? 6   VAL C O   1 
ATOM   5140  C  CB  . VAL C  1 6   ? -23.549 -28.389 -11.678 1.00 26.99  ? 6   VAL C CB  1 
ATOM   5141  C  CG1 . VAL C  1 6   ? -24.720 -28.585 -10.734 1.00 24.60  ? 6   VAL C CG1 1 
ATOM   5142  C  CG2 . VAL C  1 6   ? -22.379 -27.708 -10.962 1.00 26.91  ? 6   VAL C CG2 1 
ATOM   5143  N  N   . GLY C  1 7   ? -24.699 -31.601 -12.277 1.00 27.65  ? 7   GLY C N   1 
ATOM   5144  C  CA  . GLY C  1 7   ? -25.881 -32.370 -12.736 1.00 26.54  ? 7   GLY C CA  1 
ATOM   5145  C  C   . GLY C  1 7   ? -25.668 -33.101 -14.073 1.00 28.51  ? 7   GLY C C   1 
ATOM   5146  O  O   . GLY C  1 7   ? -26.596 -33.497 -14.699 1.00 31.56  ? 7   GLY C O   1 
ATOM   5147  N  N   . LYS C  1 8   ? -24.402 -33.257 -14.473 1.00 28.76  ? 8   LYS C N   1 
ATOM   5148  C  CA  . LYS C  1 8   ? -24.059 -33.915 -15.738 1.00 31.27  ? 8   LYS C CA  1 
ATOM   5149  C  C   . LYS C  1 8   ? -22.784 -34.628 -15.622 1.00 33.77  ? 8   LYS C C   1 
ATOM   5150  O  O   . LYS C  1 8   ? -22.017 -34.401 -14.692 1.00 30.38  ? 8   LYS C O   1 
ATOM   5151  C  CB  . LYS C  1 8   ? -23.921 -32.871 -16.882 1.00 31.46  ? 8   LYS C CB  1 
ATOM   5152  C  CG  . LYS C  1 8   ? -25.198 -32.258 -17.365 1.00 31.44  ? 8   LYS C CG  1 
ATOM   5153  C  CD  . LYS C  1 8   ? -24.903 -31.344 -18.567 1.00 33.69  ? 8   LYS C CD  1 
ATOM   5154  C  CE  . LYS C  1 8   ? -26.123 -30.597 -19.030 1.00 31.07  ? 8   LYS C CE  1 
ATOM   5155  N  NZ  . LYS C  1 8   ? -25.830 -29.855 -20.278 1.00 30.38  ? 8   LYS C NZ  1 
ATOM   5156  N  N   . ASP C  1 9   ? -22.517 -35.504 -16.590 1.00 34.29  ? 9   ASP C N   1 
ATOM   5157  C  CA  . ASP C  1 9   ? -21.254 -36.152 -16.688 1.00 36.26  ? 9   ASP C CA  1 
ATOM   5158  C  C   . ASP C  1 9   ? -20.180 -35.130 -17.080 1.00 34.57  ? 9   ASP C C   1 
ATOM   5159  O  O   . ASP C  1 9   ? -20.470 -34.139 -17.761 1.00 36.96  ? 9   ASP C O   1 
ATOM   5160  C  CB  . ASP C  1 9   ? -21.314 -37.265 -17.727 1.00 41.55  ? 9   ASP C CB  1 
ATOM   5161  C  CG  . ASP C  1 9   ? -22.315 -38.363 -17.355 1.00 46.17  ? 9   ASP C CG  1 
ATOM   5162  O  OD1 . ASP C  1 9   ? -22.869 -38.987 -18.266 1.00 60.89  ? 9   ASP C OD1 1 
ATOM   5163  O  OD2 . ASP C  1 9   ? -22.539 -38.588 -16.137 1.00 49.30  ? 9   ASP C OD2 1 
ATOM   5164  N  N   . SER C  1 10  ? -18.959 -35.366 -16.652 1.00 31.97  ? 10  SER C N   1 
ATOM   5165  C  CA  . SER C  1 10  ? -17.870 -34.478 -16.977 1.00 32.69  ? 10  SER C CA  1 
ATOM   5166  C  C   . SER C  1 10  ? -17.631 -34.466 -18.493 1.00 33.93  ? 10  SER C C   1 
ATOM   5167  O  O   . SER C  1 10  ? -17.957 -35.397 -19.171 1.00 32.71  ? 10  SER C O   1 
ATOM   5168  C  CB  . SER C  1 10  ? -16.619 -34.900 -16.260 1.00 32.55  ? 10  SER C CB  1 
ATOM   5169  O  OG  . SER C  1 10  ? -16.155 -36.132 -16.747 1.00 36.67  ? 10  SER C OG  1 
ATOM   5170  N  N   . ILE C  1 11  ? -17.066 -33.395 -18.988 1.00 33.70  ? 11  ILE C N   1 
ATOM   5171  C  CA  . ILE C  1 11  ? -16.806 -33.273 -20.402 1.00 34.17  ? 11  ILE C CA  1 
ATOM   5172  C  C   . ILE C  1 11  ? -15.367 -33.087 -20.668 1.00 35.88  ? 11  ILE C C   1 
ATOM   5173  O  O   . ILE C  1 11  ? -14.625 -32.634 -19.812 1.00 33.49  ? 11  ILE C O   1 
ATOM   5174  C  CB  . ILE C  1 11  ? -17.568 -32.077 -21.019 1.00 31.89  ? 11  ILE C CB  1 
ATOM   5175  C  CG1 . ILE C  1 11  ? -17.133 -30.760 -20.351 1.00 31.34  ? 11  ILE C CG1 1 
ATOM   5176  C  CG2 . ILE C  1 11  ? -19.054 -32.277 -20.891 1.00 38.89  ? 11  ILE C CG2 1 
ATOM   5177  C  CD1 . ILE C  1 11  ? -17.721 -29.527 -20.995 1.00 29.00  ? 11  ILE C CD1 1 
ATOM   5178  N  N   . GLU C  1 12  ? -14.955 -33.438 -21.863 1.00 35.77  ? 12  GLU C N   1 
ATOM   5179  C  CA  . GLU C  1 12  ? -13.665 -33.153 -22.296 1.00 36.46  ? 12  GLU C CA  1 
ATOM   5180  C  C   . GLU C  1 12  ? -13.606 -31.664 -22.459 1.00 32.31  ? 12  GLU C C   1 
ATOM   5181  O  O   . GLU C  1 12  ? -14.571 -31.058 -22.886 1.00 29.61  ? 12  GLU C O   1 
ATOM   5182  C  CB  . GLU C  1 12  ? -13.416 -33.808 -23.631 1.00 45.28  ? 12  GLU C CB  1 
ATOM   5183  C  CG  . GLU C  1 12  ? -12.092 -34.424 -23.762 1.00 58.25  ? 12  GLU C CG  1 
ATOM   5184  C  CD  . GLU C  1 12  ? -12.125 -35.878 -23.486 1.00 65.20  ? 12  GLU C CD  1 
ATOM   5185  O  OE1 . GLU C  1 12  ? -12.801 -36.610 -24.246 1.00 69.28  ? 12  GLU C OE1 1 
ATOM   5186  O  OE2 . GLU C  1 12  ? -11.481 -36.314 -22.519 1.00 82.99  ? 12  GLU C OE2 1 
ATOM   5187  N  N   . SER C  1 13  ? -12.476 -31.062 -22.120 1.00 32.26  ? 13  SER C N   1 
ATOM   5188  C  CA  . SER C  1 13  ? -12.348 -29.601 -22.214 1.00 33.12  ? 13  SER C CA  1 
ATOM   5189  C  C   . SER C  1 13  ? -12.498 -29.091 -23.679 1.00 32.09  ? 13  SER C C   1 
ATOM   5190  O  O   . SER C  1 13  ? -12.945 -27.989 -23.904 1.00 30.54  ? 13  SER C O   1 
ATOM   5191  C  CB  . SER C  1 13  ? -11.008 -29.098 -21.575 1.00 34.51  ? 13  SER C CB  1 
ATOM   5192  O  OG  . SER C  1 13  ? -9.900  -29.552 -22.289 1.00 40.77  ? 13  SER C OG  1 
ATOM   5193  N  N   . LYS C  1 14  ? -12.117 -29.935 -24.656 1.00 28.74  ? 14  LYS C N   1 
ATOM   5194  C  CA  . LYS C  1 14  ? -12.266 -29.571 -26.080 1.00 31.36  ? 14  LYS C CA  1 
ATOM   5195  C  C   . LYS C  1 14  ? -13.757 -29.440 -26.494 1.00 27.93  ? 14  LYS C C   1 
ATOM   5196  O  O   . LYS C  1 14  ? -14.047 -28.905 -27.470 1.00 26.19  ? 14  LYS C O   1 
ATOM   5197  C  CB  . LYS C  1 14  ? -11.536 -30.582 -26.995 1.00 36.50  ? 14  LYS C CB  1 
ATOM   5198  C  CG  . LYS C  1 14  ? -11.887 -32.042 -26.722 1.00 44.77  ? 14  LYS C CG  1 
ATOM   5199  C  CD  . LYS C  1 14  ? -11.319 -32.978 -27.812 1.00 50.45  ? 14  LYS C CD  1 
ATOM   5200  C  CE  . LYS C  1 14  ? -12.236 -33.016 -29.065 1.00 60.55  ? 14  LYS C CE  1 
ATOM   5201  N  NZ  . LYS C  1 14  ? -13.578 -33.678 -28.772 1.00 60.33  ? 14  LYS C NZ  1 
ATOM   5202  N  N   . ASP C  1 15  ? -14.661 -29.966 -25.660 1.00 26.79  ? 15  ASP C N   1 
ATOM   5203  C  CA  . ASP C  1 15  ? -16.138 -29.919 -25.962 1.00 29.02  ? 15  ASP C CA  1 
ATOM   5204  C  C   . ASP C  1 15  ? -16.852 -28.792 -25.223 1.00 27.82  ? 15  ASP C C   1 
ATOM   5205  O  O   . ASP C  1 15  ? -18.052 -28.715 -25.242 1.00 29.01  ? 15  ASP C O   1 
ATOM   5206  C  CB  . ASP C  1 15  ? -16.808 -31.257 -25.614 1.00 28.11  ? 15  ASP C CB  1 
ATOM   5207  C  CG  . ASP C  1 15  ? -16.343 -32.391 -26.498 1.00 29.93  ? 15  ASP C CG  1 
ATOM   5208  O  OD1 . ASP C  1 15  ? -15.955 -32.134 -27.643 1.00 34.12  ? 15  ASP C OD1 1 
ATOM   5209  O  OD2 . ASP C  1 15  ? -16.381 -33.531 -26.046 1.00 29.93  ? 15  ASP C OD2 1 
ATOM   5210  N  N   . ILE C  1 16  ? -16.096 -27.931 -24.583 1.00 24.77  ? 16  ILE C N   1 
ATOM   5211  C  CA  . ILE C  1 16  ? -16.687 -26.866 -23.757 1.00 27.89  ? 16  ILE C CA  1 
ATOM   5212  C  C   . ILE C  1 16  ? -17.573 -25.871 -24.582 1.00 26.67  ? 16  ILE C C   1 
ATOM   5213  O  O   . ILE C  1 16  ? -18.557 -25.320 -24.063 1.00 25.87  ? 16  ILE C O   1 
ATOM   5214  C  CB  . ILE C  1 16  ? -15.597 -26.077 -22.948 1.00 26.29  ? 16  ILE C CB  1 
ATOM   5215  C  CG1 . ILE C  1 16  ? -16.243 -25.228 -21.885 1.00 28.17  ? 16  ILE C CG1 1 
ATOM   5216  C  CG2 . ILE C  1 16  ? -14.740 -25.226 -23.882 1.00 24.78  ? 16  ILE C CG2 1 
ATOM   5217  C  CD1 . ILE C  1 16  ? -15.258 -24.585 -20.929 1.00 29.69  ? 16  ILE C CD1 1 
ATOM   5218  N  N   . GLY C  1 17  ? -17.210 -25.659 -25.847 1.00 25.51  ? 17  GLY C N   1 
ATOM   5219  C  CA  . GLY C  1 17  ? -17.957 -24.739 -26.716 1.00 23.80  ? 17  GLY C CA  1 
ATOM   5220  C  C   . GLY C  1 17  ? -17.905 -23.268 -26.204 1.00 25.33  ? 17  GLY C C   1 
ATOM   5221  O  O   . GLY C  1 17  ? -17.050 -22.913 -25.376 1.00 26.68  ? 17  GLY C O   1 
ATOM   5222  N  N   . PHE C  1 18  ? -18.817 -22.437 -26.707 1.00 24.27  ? 18  PHE C N   1 
ATOM   5223  C  CA  . PHE C  1 18  ? -18.874 -21.027 -26.317 1.00 26.00  ? 18  PHE C CA  1 
ATOM   5224  C  C   . PHE C  1 18  ? -19.133 -20.920 -24.849 1.00 24.14  ? 18  PHE C C   1 
ATOM   5225  O  O   . PHE C  1 18  ? -20.128 -21.463 -24.341 1.00 24.71  ? 18  PHE C O   1 
ATOM   5226  C  CB  . PHE C  1 18  ? -19.975 -20.295 -27.105 1.00 27.58  ? 18  PHE C CB  1 
ATOM   5227  C  CG  . PHE C  1 18  ? -19.819 -18.791 -27.118 1.00 30.14  ? 18  PHE C CG  1 
ATOM   5228  C  CD1 . PHE C  1 18  ? -19.368 -18.119 -28.285 1.00 31.88  ? 18  PHE C CD1 1 
ATOM   5229  C  CD2 . PHE C  1 18  ? -20.108 -18.041 -25.996 1.00 28.53  ? 18  PHE C CD2 1 
ATOM   5230  C  CE1 . PHE C  1 18  ? -19.223 -16.737 -28.296 1.00 31.52  ? 18  PHE C CE1 1 
ATOM   5231  C  CE2 . PHE C  1 18  ? -19.962 -16.636 -26.009 1.00 30.09  ? 18  PHE C CE2 1 
ATOM   5232  C  CZ  . PHE C  1 18  ? -19.523 -15.996 -27.150 1.00 28.24  ? 18  PHE C CZ  1 
ATOM   5233  N  N   . THR C  1 19  ? -18.247 -20.209 -24.142 1.00 23.40  ? 19  THR C N   1 
ATOM   5234  C  CA  . THR C  1 19  ? -18.274 -20.184 -22.699 1.00 26.06  ? 19  THR C CA  1 
ATOM   5235  C  C   . THR C  1 19  ? -18.334 -18.781 -22.118 1.00 25.79  ? 19  THR C C   1 
ATOM   5236  O  O   . THR C  1 19  ? -17.667 -17.852 -22.617 1.00 25.15  ? 19  THR C O   1 
ATOM   5237  C  CB  . THR C  1 19  ? -16.997 -20.906 -22.097 1.00 27.88  ? 19  THR C CB  1 
ATOM   5238  O  OG1 . THR C  1 19  ? -16.962 -22.283 -22.529 1.00 29.76  ? 19  THR C OG1 1 
ATOM   5239  C  CG2 . THR C  1 19  ? -17.010 -20.849 -20.604 1.00 25.35  ? 19  THR C CG2 1 
ATOM   5240  N  N   . LEU C  1 20  ? -19.139 -18.619 -21.059 1.00 24.79  ? 20  LEU C N   1 
ATOM   5241  C  CA  . LEU C  1 20  ? -19.067 -17.422 -20.220 1.00 24.87  ? 20  LEU C CA  1 
ATOM   5242  C  C   . LEU C  1 20  ? -18.292 -17.790 -18.951 1.00 23.22  ? 20  LEU C C   1 
ATOM   5243  O  O   . LEU C  1 20  ? -18.801 -18.466 -18.086 1.00 23.45  ? 20  LEU C O   1 
ATOM   5244  C  CB  . LEU C  1 20  ? -20.422 -16.920 -19.886 1.00 22.65  ? 20  LEU C CB  1 
ATOM   5245  C  CG  . LEU C  1 20  ? -21.213 -16.398 -21.059 1.00 23.64  ? 20  LEU C CG  1 
ATOM   5246  C  CD1 . LEU C  1 20  ? -22.597 -15.932 -20.614 1.00 20.78  ? 20  LEU C CD1 1 
ATOM   5247  C  CD2 . LEU C  1 20  ? -20.445 -15.255 -21.769 1.00 21.07  ? 20  LEU C CD2 1 
ATOM   5248  N  N   . ILE C  1 21  ? -17.054 -17.328 -18.880 1.00 22.88  ? 21  ILE C N   1 
ATOM   5249  C  CA  . ILE C  1 21  ? -16.107 -17.745 -17.847 1.00 24.33  ? 21  ILE C CA  1 
ATOM   5250  C  C   . ILE C  1 21  ? -16.424 -17.185 -16.381 1.00 26.04  ? 21  ILE C C   1 
ATOM   5251  O  O   . ILE C  1 21  ? -15.843 -17.673 -15.375 1.00 28.03  ? 21  ILE C O   1 
ATOM   5252  C  CB  . ILE C  1 21  ? -14.658 -17.343 -18.236 1.00 25.97  ? 21  ILE C CB  1 
ATOM   5253  C  CG1 . ILE C  1 21  ? -13.610 -18.204 -17.479 1.00 29.49  ? 21  ILE C CG1 1 
ATOM   5254  C  CG2 . ILE C  1 21  ? -14.432 -15.854 -18.001 1.00 28.14  ? 21  ILE C CG2 1 
ATOM   5255  C  CD1 . ILE C  1 21  ? -13.540 -19.649 -17.951 1.00 24.88  ? 21  ILE C CD1 1 
ATOM   5256  N  N   . HIS C  1 22  ? -17.316 -16.187 -16.281 1.00 20.01  ? 22  HIS C N   1 
ATOM   5257  C  CA  . HIS C  1 22  ? -17.593 -15.546 -14.952 1.00 21.81  ? 22  HIS C CA  1 
ATOM   5258  C  C   . HIS C  1 22  ? -18.968 -14.968 -14.862 1.00 22.52  ? 22  HIS C C   1 
ATOM   5259  O  O   . HIS C  1 22  ? -19.187 -13.796 -15.181 1.00 22.35  ? 22  HIS C O   1 
ATOM   5260  C  CB  . HIS C  1 22  ? -16.539 -14.462 -14.646 1.00 22.24  ? 22  HIS C CB  1 
ATOM   5261  C  CG  . HIS C  1 22  ? -16.511 -14.008 -13.161 1.00 21.48  ? 22  HIS C CG  1 
ATOM   5262  N  ND1 . HIS C  1 22  ? -15.345 -13.926 -12.432 1.00 19.92  ? 22  HIS C ND1 1 
ATOM   5263  C  CD2 . HIS C  1 22  ? -17.540 -13.610 -12.294 1.00 21.02  ? 22  HIS C CD2 1 
ATOM   5264  C  CE1 . HIS C  1 22  ? -15.630 -13.495 -11.162 1.00 19.98  ? 22  HIS C CE1 1 
ATOM   5265  N  NE2 . HIS C  1 22  ? -16.952 -13.300 -11.069 1.00 22.42  ? 22  HIS C NE2 1 
ATOM   5266  N  N   . GLU C  1 23  ? -19.910 -15.785 -14.425 1.00 23.37  ? 23  GLU C N   1 
ATOM   5267  C  CA  . GLU C  1 23  ? -21.262 -15.343 -14.169 1.00 21.63  ? 23  GLU C CA  1 
ATOM   5268  C  C   . GLU C  1 23  ? -21.767 -16.009 -12.898 1.00 24.14  ? 23  GLU C C   1 
ATOM   5269  O  O   . GLU C  1 23  ? -21.298 -17.086 -12.527 1.00 27.20  ? 23  GLU C O   1 
ATOM   5270  C  CB  . GLU C  1 23  ? -22.189 -15.715 -15.354 1.00 23.33  ? 23  GLU C CB  1 
ATOM   5271  C  CG  . GLU C  1 23  ? -21.607 -15.408 -16.748 1.00 23.36  ? 23  GLU C CG  1 
ATOM   5272  C  CD  . GLU C  1 23  ? -21.577 -13.900 -17.068 1.00 26.66  ? 23  GLU C CD  1 
ATOM   5273  O  OE1 . GLU C  1 23  ? -20.834 -13.496 -18.004 1.00 30.95  ? 23  GLU C OE1 1 
ATOM   5274  O  OE2 . GLU C  1 23  ? -22.281 -13.144 -16.402 1.00 27.27  ? 23  GLU C OE2 1 
ATOM   5275  N  N   . HIS C  1 24  ? -22.737 -15.375 -12.233 1.00 22.55  ? 24  HIS C N   1 
ATOM   5276  C  CA  . HIS C  1 24  ? -23.343 -15.940 -11.009 1.00 21.70  ? 24  HIS C CA  1 
ATOM   5277  C  C   . HIS C  1 24  ? -24.820 -16.195 -11.188 1.00 25.06  ? 24  HIS C C   1 
ATOM   5278  O  O   . HIS C  1 24  ? -25.560 -15.307 -11.588 1.00 25.70  ? 24  HIS C O   1 
ATOM   5279  C  CB  . HIS C  1 24  ? -23.128 -14.992 -9.809  1.00 20.03  ? 24  HIS C CB  1 
ATOM   5280  C  CG  . HIS C  1 24  ? -21.668 -14.685 -9.518  1.00 18.67  ? 24  HIS C CG  1 
ATOM   5281  N  ND1 . HIS C  1 24  ? -20.902 -15.464 -8.706  1.00 19.55  ? 24  HIS C ND1 1 
ATOM   5282  C  CD2 . HIS C  1 24  ? -20.830 -13.628 -9.958  1.00 18.84  ? 24  HIS C CD2 1 
ATOM   5283  C  CE1 . HIS C  1 24  ? -19.635 -14.934 -8.627  1.00 17.75  ? 24  HIS C CE1 1 
ATOM   5284  N  NE2 . HIS C  1 24  ? -19.594 -13.822 -9.388  1.00 20.58  ? 24  HIS C NE2 1 
ATOM   5285  N  N   . LEU C  1 25  ? -25.258 -17.403 -10.890 1.00 23.38  ? 25  LEU C N   1 
ATOM   5286  C  CA  . LEU C  1 25  ? -26.674 -17.702 -10.921 1.00 24.75  ? 25  LEU C CA  1 
ATOM   5287  C  C   . LEU C  1 25  ? -27.362 -17.012 -9.755  1.00 26.38  ? 25  LEU C C   1 
ATOM   5288  O  O   . LEU C  1 25  ? -28.514 -16.459 -9.896  1.00 25.95  ? 25  LEU C O   1 
ATOM   5289  C  CB  . LEU C  1 25  ? -26.910 -19.204 -10.859 1.00 26.75  ? 25  LEU C CB  1 
ATOM   5290  C  CG  . LEU C  1 25  ? -26.293 -20.028 -11.990 1.00 28.67  ? 25  LEU C CG  1 
ATOM   5291  C  CD1 . LEU C  1 25  ? -26.626 -21.502 -11.807 1.00 30.59  ? 25  LEU C CD1 1 
ATOM   5292  C  CD2 . LEU C  1 25  ? -26.766 -19.527 -13.360 1.00 27.64  ? 25  LEU C CD2 1 
ATOM   5293  N  N   . ARG C  1 26  ? -26.700 -17.019 -8.608  1.00 23.98  ? 26  ARG C N   1 
ATOM   5294  C  CA  . ARG C  1 26  ? -27.217 -16.359 -7.426  1.00 26.60  ? 26  ARG C CA  1 
ATOM   5295  C  C   . ARG C  1 26  ? -26.106 -16.073 -6.452  1.00 27.61  ? 26  ARG C C   1 
ATOM   5296  O  O   . ARG C  1 26  ? -25.182 -16.869 -6.301  1.00 31.09  ? 26  ARG C O   1 
ATOM   5297  C  CB  . ARG C  1 26  ? -28.307 -17.228 -6.751  1.00 25.96  ? 26  ARG C CB  1 
ATOM   5298  C  CG  . ARG C  1 26  ? -28.915 -16.596 -5.514  1.00 24.82  ? 26  ARG C CG  1 
ATOM   5299  C  CD  . ARG C  1 26  ? -29.968 -17.472 -4.915  1.00 24.54  ? 26  ARG C CD  1 
ATOM   5300  N  NE  . ARG C  1 26  ? -29.415 -18.761 -4.457  1.00 24.22  ? 26  ARG C NE  1 
ATOM   5301  C  CZ  . ARG C  1 26  ? -30.131 -19.711 -3.863  1.00 23.50  ? 26  ARG C CZ  1 
ATOM   5302  N  NH1 . ARG C  1 26  ? -31.445 -19.531 -3.650  1.00 23.25  ? 26  ARG C NH1 1 
ATOM   5303  N  NH2 . ARG C  1 26  ? -29.547 -20.845 -3.483  1.00 23.62  ? 26  ARG C NH2 1 
ATOM   5304  N  N   . VAL C  1 27  ? -26.189 -14.928 -5.796  1.00 27.79  ? 27  VAL C N   1 
ATOM   5305  C  CA  . VAL C  1 27  ? -25.231 -14.548 -4.799  1.00 26.02  ? 27  VAL C CA  1 
ATOM   5306  C  C   . VAL C  1 27  ? -25.937 -14.044 -3.559  1.00 26.94  ? 27  VAL C C   1 
ATOM   5307  O  O   . VAL C  1 27  ? -26.969 -13.347 -3.654  1.00 26.89  ? 27  VAL C O   1 
ATOM   5308  C  CB  . VAL C  1 27  ? -24.280 -13.415 -5.313  1.00 29.21  ? 27  VAL C CB  1 
ATOM   5309  C  CG1 . VAL C  1 27  ? -23.424 -12.892 -4.178  1.00 28.23  ? 27  VAL C CG1 1 
ATOM   5310  C  CG2 . VAL C  1 27  ? -23.405 -13.919 -6.462  1.00 25.90  ? 27  VAL C CG2 1 
ATOM   5311  N  N   . PHE C  1 28  ? -25.383 -14.388 -2.375  1.00 23.97  ? 28  PHE C N   1 
ATOM   5312  C  CA  . PHE C  1 28  ? -25.913 -13.894 -1.090  1.00 22.59  ? 28  PHE C CA  1 
ATOM   5313  C  C   . PHE C  1 28  ? -24.947 -14.171 0.023   1.00 23.08  ? 28  PHE C C   1 
ATOM   5314  O  O   . PHE C  1 28  ? -24.080 -15.029 -0.103  1.00 22.45  ? 28  PHE C O   1 
ATOM   5315  C  CB  . PHE C  1 28  ? -27.309 -14.540 -0.768  1.00 20.05  ? 28  PHE C CB  1 
ATOM   5316  C  CG  . PHE C  1 28  ? -27.262 -16.104 -0.572  1.00 21.36  ? 28  PHE C CG  1 
ATOM   5317  C  CD1 . PHE C  1 28  ? -26.859 -16.669 0.666   1.00 19.48  ? 28  PHE C CD1 1 
ATOM   5318  C  CD2 . PHE C  1 28  ? -27.628 -16.962 -1.605  1.00 20.40  ? 28  PHE C CD2 1 
ATOM   5319  C  CE1 . PHE C  1 28  ? -26.821 -18.060 0.841   1.00 19.47  ? 28  PHE C CE1 1 
ATOM   5320  C  CE2 . PHE C  1 28  ? -27.594 -18.361 -1.424  1.00 21.57  ? 28  PHE C CE2 1 
ATOM   5321  C  CZ  . PHE C  1 28  ? -27.188 -18.900 -0.200  1.00 21.88  ? 28  PHE C CZ  1 
ATOM   5322  N  N   . SER C  1 29  ? -25.093 -13.430 1.138   1.00 23.40  ? 29  SER C N   1 
ATOM   5323  C  CA  . SER C  1 29  ? -24.287 -13.668 2.339   1.00 24.83  ? 29  SER C CA  1 
ATOM   5324  C  C   . SER C  1 29  ? -24.861 -14.825 3.108   1.00 24.00  ? 29  SER C C   1 
ATOM   5325  O  O   . SER C  1 29  ? -26.045 -14.783 3.541   1.00 22.70  ? 29  SER C O   1 
ATOM   5326  C  CB  . SER C  1 29  ? -24.270 -12.433 3.214   1.00 26.64  ? 29  SER C CB  1 
ATOM   5327  O  OG  . SER C  1 29  ? -23.964 -11.274 2.453   1.00 34.73  ? 29  SER C OG  1 
ATOM   5328  N  N   . GLU C  1 30  ? -24.062 -15.867 3.297   1.00 24.98  ? 30  GLU C N   1 
ATOM   5329  C  CA  . GLU C  1 30  ? -24.538 -17.095 4.031   1.00 25.90  ? 30  GLU C CA  1 
ATOM   5330  C  C   . GLU C  1 30  ? -25.173 -16.759 5.352   1.00 25.69  ? 30  GLU C C   1 
ATOM   5331  O  O   . GLU C  1 30  ? -26.269 -17.262 5.676   1.00 25.54  ? 30  GLU C O   1 
ATOM   5332  C  CB  . GLU C  1 30  ? -23.385 -18.092 4.255   1.00 25.28  ? 30  GLU C CB  1 
ATOM   5333  C  CG  . GLU C  1 30  ? -22.973 -18.878 3.017   1.00 27.91  ? 30  GLU C CG  1 
ATOM   5334  C  CD  . GLU C  1 30  ? -21.959 -18.159 2.173   1.00 29.10  ? 30  GLU C CD  1 
ATOM   5335  O  OE1 . GLU C  1 30  ? -21.844 -16.903 2.293   1.00 29.68  ? 30  GLU C OE1 1 
ATOM   5336  O  OE2 . GLU C  1 30  ? -21.265 -18.834 1.383   1.00 30.95  ? 30  GLU C OE2 1 
ATOM   5337  N  N   . ALA C  1 31  ? -24.494 -15.907 6.142   1.00 21.26  ? 31  ALA C N   1 
ATOM   5338  C  CA  . ALA C  1 31  ? -24.961 -15.597 7.519   1.00 20.28  ? 31  ALA C CA  1 
ATOM   5339  C  C   . ALA C  1 31  ? -26.263 -14.874 7.518   1.00 20.89  ? 31  ALA C C   1 
ATOM   5340  O  O   . ALA C  1 31  ? -27.140 -15.159 8.341   1.00 20.24  ? 31  ALA C O   1 
ATOM   5341  C  CB  . ALA C  1 31  ? -23.900 -14.807 8.288   1.00 19.18  ? 31  ALA C CB  1 
ATOM   5342  N  N   . VAL C  1 32  ? -26.423 -13.928 6.585   1.00 18.97  ? 32  VAL C N   1 
ATOM   5343  C  CA  . VAL C  1 32  ? -27.656 -13.143 6.511   1.00 20.29  ? 32  VAL C CA  1 
ATOM   5344  C  C   . VAL C  1 32  ? -28.858 -13.997 6.079   1.00 20.05  ? 32  VAL C C   1 
ATOM   5345  O  O   . VAL C  1 32  ? -29.901 -13.929 6.672   1.00 21.17  ? 32  VAL C O   1 
ATOM   5346  C  CB  . VAL C  1 32  ? -27.512 -11.915 5.564   1.00 20.31  ? 32  VAL C CB  1 
ATOM   5347  C  CG1 . VAL C  1 32  ? -28.822 -11.109 5.524   1.00 18.50  ? 32  VAL C CG1 1 
ATOM   5348  C  CG2 . VAL C  1 32  ? -26.348 -11.037 6.007   1.00 18.88  ? 32  VAL C CG2 1 
ATOM   5349  N  N   . ARG C  1 33  ? -28.683 -14.797 5.040   1.00 21.00  ? 33  ARG C N   1 
ATOM   5350  C  CA  . ARG C  1 33  ? -29.785 -15.631 4.555   1.00 23.30  ? 33  ARG C CA  1 
ATOM   5351  C  C   . ARG C  1 33  ? -30.180 -16.661 5.601   1.00 23.80  ? 33  ARG C C   1 
ATOM   5352  O  O   . ARG C  1 33  ? -31.345 -16.961 5.774   1.00 24.64  ? 33  ARG C O   1 
ATOM   5353  C  CB  . ARG C  1 33  ? -29.431 -16.322 3.245   1.00 23.80  ? 33  ARG C CB  1 
ATOM   5354  C  CG  . ARG C  1 33  ? -30.633 -17.012 2.606   1.00 25.43  ? 33  ARG C CG  1 
ATOM   5355  C  CD  . ARG C  1 33  ? -30.299 -17.667 1.321   1.00 26.38  ? 33  ARG C CD  1 
ATOM   5356  N  NE  . ARG C  1 33  ? -31.521 -18.112 0.610   1.00 29.55  ? 33  ARG C NE  1 
ATOM   5357  C  CZ  . ARG C  1 33  ? -31.936 -17.612 -0.564  1.00 28.13  ? 33  ARG C CZ  1 
ATOM   5358  N  NH1 . ARG C  1 33  ? -31.223 -16.660 -1.180  1.00 26.77  ? 33  ARG C NH1 1 
ATOM   5359  N  NH2 . ARG C  1 33  ? -33.042 -18.069 -1.124  1.00 25.58  ? 33  ARG C NH2 1 
ATOM   5360  N  N   . GLN C  1 34  ? -29.201 -17.184 6.288   1.00 21.82  ? 34  GLN C N   1 
ATOM   5361  C  CA  . GLN C  1 34  ? -29.432 -18.146 7.306   1.00 24.18  ? 34  GLN C CA  1 
ATOM   5362  C  C   . GLN C  1 34  ? -30.227 -17.524 8.545   1.00 23.27  ? 34  GLN C C   1 
ATOM   5363  O  O   . GLN C  1 34  ? -31.118 -18.167 9.116   1.00 23.18  ? 34  GLN C O   1 
ATOM   5364  C  CB  . GLN C  1 34  ? -28.101 -18.743 7.772   1.00 25.96  ? 34  GLN C CB  1 
ATOM   5365  C  CG  . GLN C  1 34  ? -28.230 -19.786 8.803   1.00 33.74  ? 34  GLN C CG  1 
ATOM   5366  C  CD  . GLN C  1 34  ? -26.972 -20.632 8.930   1.00 32.51  ? 34  GLN C CD  1 
ATOM   5367  O  OE1 . GLN C  1 34  ? -26.212 -20.780 7.977   1.00 39.35  ? 34  GLN C OE1 1 
ATOM   5368  N  NE2 . GLN C  1 34  ? -26.760 -21.174 10.076  1.00 40.30  ? 34  GLN C NE2 1 
ATOM   5369  N  N   . GLN C  1 35  ? -29.884 -16.307 8.913   1.00 22.35  ? 35  GLN C N   1 
ATOM   5370  C  CA  . GLN C  1 35  ? -30.482 -15.680 10.091  1.00 21.55  ? 35  GLN C CA  1 
ATOM   5371  C  C   . GLN C  1 35  ? -31.778 -14.957 9.777   1.00 20.78  ? 35  GLN C C   1 
ATOM   5372  O  O   . GLN C  1 35  ? -32.616 -14.804 10.636  1.00 21.90  ? 35  GLN C O   1 
ATOM   5373  C  CB  . GLN C  1 35  ? -29.491 -14.729 10.755  1.00 21.06  ? 35  GLN C CB  1 
ATOM   5374  C  CG  . GLN C  1 35  ? -28.237 -15.406 11.241  1.00 21.81  ? 35  GLN C CG  1 
ATOM   5375  C  CD  . GLN C  1 35  ? -28.527 -16.564 12.179  1.00 22.59  ? 35  GLN C CD  1 
ATOM   5376  O  OE1 . GLN C  1 35  ? -29.640 -16.642 12.801  1.00 22.76  ? 35  GLN C OE1 1 
ATOM   5377  N  NE2 . GLN C  1 35  ? -27.538 -17.499 12.316  1.00 19.14  ? 35  GLN C NE2 1 
ATOM   5378  N  N   . TRP C  1 36  ? -31.934 -14.514 8.520   1.00 20.81  ? 36  TRP C N   1 
ATOM   5379  C  CA  . TRP C  1 36  ? -33.148 -13.772 8.108   1.00 21.49  ? 36  TRP C CA  1 
ATOM   5380  C  C   . TRP C  1 36  ? -33.670 -14.208 6.759   1.00 22.59  ? 36  TRP C C   1 
ATOM   5381  O  O   . TRP C  1 36  ? -33.676 -13.454 5.838   1.00 21.96  ? 36  TRP C O   1 
ATOM   5382  C  CB  . TRP C  1 36  ? -32.891 -12.230 8.143   1.00 21.07  ? 36  TRP C CB  1 
ATOM   5383  C  CG  . TRP C  1 36  ? -32.562 -11.718 9.555   1.00 20.85  ? 36  TRP C CG  1 
ATOM   5384  C  CD1 . TRP C  1 36  ? -33.449 -11.553 10.610  1.00 20.61  ? 36  TRP C CD1 1 
ATOM   5385  C  CD2 . TRP C  1 36  ? -31.265 -11.329 10.061  1.00 19.71  ? 36  TRP C CD2 1 
ATOM   5386  N  NE1 . TRP C  1 36  ? -32.777 -11.082 11.735  1.00 19.91  ? 36  TRP C NE1 1 
ATOM   5387  C  CE2 . TRP C  1 36  ? -31.449 -10.934 11.439  1.00 20.51  ? 36  TRP C CE2 1 
ATOM   5388  C  CE3 . TRP C  1 36  ? -29.979 -11.266 9.502   1.00 20.19  ? 36  TRP C CE3 1 
ATOM   5389  C  CZ2 . TRP C  1 36  ? -30.375 -10.482 12.250  1.00 20.88  ? 36  TRP C CZ2 1 
ATOM   5390  C  CZ3 . TRP C  1 36  ? -28.898 -10.814 10.320  1.00 20.78  ? 36  TRP C CZ3 1 
ATOM   5391  C  CH2 . TRP C  1 36  ? -29.109 -10.431 11.670  1.00 21.03  ? 36  TRP C CH2 1 
ATOM   5392  N  N   . PRO C  1 37  ? -34.125 -15.464 6.667   1.00 25.19  ? 37  PRO C N   1 
ATOM   5393  C  CA  . PRO C  1 37  ? -34.670 -16.009 5.415   1.00 25.54  ? 37  PRO C CA  1 
ATOM   5394  C  C   . PRO C  1 37  ? -35.791 -15.152 4.822   1.00 26.56  ? 37  PRO C C   1 
ATOM   5395  O  O   . PRO C  1 37  ? -36.009 -15.183 3.620   1.00 25.69  ? 37  PRO C O   1 
ATOM   5396  C  CB  . PRO C  1 37  ? -35.238 -17.419 5.847   1.00 25.48  ? 37  PRO C CB  1 
ATOM   5397  C  CG  . PRO C  1 37  ? -35.289 -17.366 7.362   1.00 28.29  ? 37  PRO C CG  1 
ATOM   5398  C  CD  . PRO C  1 37  ? -34.156 -16.454 7.762   1.00 25.90  ? 37  PRO C CD  1 
ATOM   5399  N  N   . HIS C  1 38  ? -36.510 -14.376 5.688   1.00 25.86  ? 38  HIS C N   1 
ATOM   5400  C  CA  . HIS C  1 38  ? -37.634 -13.559 5.215   1.00 26.52  ? 38  HIS C CA  1 
ATOM   5401  C  C   . HIS C  1 38  ? -37.207 -12.526 4.166   1.00 27.01  ? 38  HIS C C   1 
ATOM   5402  O  O   . HIS C  1 38  ? -38.023 -11.953 3.507   1.00 24.76  ? 38  HIS C O   1 
ATOM   5403  C  CB  . HIS C  1 38  ? -38.362 -12.869 6.395   1.00 27.74  ? 38  HIS C CB  1 
ATOM   5404  C  CG  . HIS C  1 38  ? -37.645 -11.649 6.929   1.00 29.03  ? 38  HIS C CG  1 
ATOM   5405  N  ND1 . HIS C  1 38  ? -36.702 -11.720 7.906   1.00 25.82  ? 38  HIS C ND1 1 
ATOM   5406  C  CD2 . HIS C  1 38  ? -37.762 -10.286 6.594   1.00 30.55  ? 38  HIS C CD2 1 
ATOM   5407  C  CE1 . HIS C  1 38  ? -36.249 -10.492 8.172   1.00 27.46  ? 38  HIS C CE1 1 
ATOM   5408  N  NE2 . HIS C  1 38  ? -36.899 -9.612  7.369   1.00 29.82  ? 38  HIS C NE2 1 
ATOM   5409  N  N   . LEU C  1 39  ? -35.896 -12.314 4.036   1.00 26.49  ? 39  LEU C N   1 
ATOM   5410  C  CA  . LEU C  1 39  ? -35.375 -11.326 3.095   1.00 27.32  ? 39  LEU C CA  1 
ATOM   5411  C  C   . LEU C  1 39  ? -35.295 -11.861 1.685   1.00 28.59  ? 39  LEU C C   1 
ATOM   5412  O  O   . LEU C  1 39  ? -35.164 -11.121 0.765   1.00 30.47  ? 39  LEU C O   1 
ATOM   5413  C  CB  . LEU C  1 39  ? -33.981 -10.837 3.538   1.00 26.02  ? 39  LEU C CB  1 
ATOM   5414  C  CG  . LEU C  1 39  ? -33.910 -10.060 4.839   1.00 28.49  ? 39  LEU C CG  1 
ATOM   5415  C  CD1 . LEU C  1 39  ? -32.457 -9.803  5.239   1.00 25.86  ? 39  LEU C CD1 1 
ATOM   5416  C  CD2 . LEU C  1 39  ? -34.689 -8.741  4.725   1.00 30.99  ? 39  LEU C CD2 1 
ATOM   5417  N  N   . TYR C  1 40  ? -35.374 -13.153 1.541   1.00 28.19  ? 40  TYR C N   1 
ATOM   5418  C  CA  . TYR C  1 40  ? -35.137 -13.776 0.235   1.00 29.65  ? 40  TYR C CA  1 
ATOM   5419  C  C   . TYR C  1 40  ? -36.354 -14.449 -0.316  1.00 31.58  ? 40  TYR C C   1 
ATOM   5420  O  O   . TYR C  1 40  ? -37.190 -14.881 0.405   1.00 29.22  ? 40  TYR C O   1 
ATOM   5421  C  CB  . TYR C  1 40  ? -33.971 -14.758 0.327   1.00 28.56  ? 40  TYR C CB  1 
ATOM   5422  C  CG  . TYR C  1 40  ? -32.731 -14.125 0.825   1.00 29.80  ? 40  TYR C CG  1 
ATOM   5423  C  CD1 . TYR C  1 40  ? -32.507 -13.965 2.207   1.00 29.13  ? 40  TYR C CD1 1 
ATOM   5424  C  CD2 . TYR C  1 40  ? -31.769 -13.657 -0.053  1.00 26.95  ? 40  TYR C CD2 1 
ATOM   5425  C  CE1 . TYR C  1 40  ? -31.362 -13.370 2.674   1.00 28.70  ? 40  TYR C CE1 1 
ATOM   5426  C  CE2 . TYR C  1 40  ? -30.621 -13.061 0.404   1.00 27.98  ? 40  TYR C CE2 1 
ATOM   5427  C  CZ  . TYR C  1 40  ? -30.418 -12.917 1.780   1.00 30.69  ? 40  TYR C CZ  1 
ATOM   5428  O  OH  . TYR C  1 40  ? -29.275 -12.325 2.241   1.00 29.04  ? 40  TYR C OH  1 
ATOM   5429  N  N   . ASN C  1 41  ? -36.427 -14.521 -1.640  1.00 31.69  ? 41  ASN C N   1 
ATOM   5430  C  CA  . ASN C  1 41  ? -37.498 -15.191 -2.310  1.00 34.47  ? 41  ASN C CA  1 
ATOM   5431  C  C   . ASN C  1 41  ? -36.938 -16.209 -3.341  1.00 33.29  ? 41  ASN C C   1 
ATOM   5432  O  O   . ASN C  1 41  ? -36.582 -15.844 -4.448  1.00 30.70  ? 41  ASN C O   1 
ATOM   5433  C  CB  . ASN C  1 41  ? -38.415 -14.168 -2.997  1.00 37.64  ? 41  ASN C CB  1 
ATOM   5434  C  CG  . ASN C  1 41  ? -39.542 -14.819 -3.772  1.00 38.97  ? 41  ASN C CG  1 
ATOM   5435  O  OD1 . ASN C  1 41  ? -39.474 -15.999 -4.125  1.00 34.60  ? 41  ASN C OD1 1 
ATOM   5436  N  ND2 . ASN C  1 41  ? -40.579 -14.053 -4.046  1.00 46.09  ? 41  ASN C ND2 1 
ATOM   5437  N  N   . GLU C  1 42  ? -36.871 -17.482 -2.941  1.00 34.11  ? 42  GLU C N   1 
ATOM   5438  C  CA  . GLU C  1 42  ? -36.220 -18.516 -3.771  1.00 41.81  ? 42  GLU C CA  1 
ATOM   5439  C  C   . GLU C  1 42  ? -36.889 -18.716 -5.166  1.00 39.52  ? 42  GLU C C   1 
ATOM   5440  O  O   . GLU C  1 42  ? -36.217 -19.059 -6.137  1.00 39.76  ? 42  GLU C O   1 
ATOM   5441  C  CB  . GLU C  1 42  ? -36.135 -19.842 -3.032  1.00 41.34  ? 42  GLU C CB  1 
ATOM   5442  C  CG  . GLU C  1 42  ? -35.332 -20.893 -3.793  1.00 55.44  ? 42  GLU C CG  1 
ATOM   5443  C  CD  . GLU C  1 42  ? -35.035 -22.111 -2.979  1.00 61.97  ? 42  GLU C CD  1 
ATOM   5444  O  OE1 . GLU C  1 42  ? -34.133 -22.885 -3.382  1.00 63.25  ? 42  GLU C OE1 1 
ATOM   5445  O  OE2 . GLU C  1 42  ? -35.696 -22.312 -1.926  1.00 70.80  ? 42  GLU C OE2 1 
ATOM   5446  N  N   . ASP C  1 43  ? -38.195 -18.502 -5.236  1.00 39.72  ? 43  ASP C N   1 
ATOM   5447  C  CA  . ASP C  1 43  ? -38.933 -18.654 -6.512  1.00 39.85  ? 43  ASP C CA  1 
ATOM   5448  C  C   . ASP C  1 43  ? -38.470 -17.673 -7.521  1.00 35.35  ? 43  ASP C C   1 
ATOM   5449  O  O   . ASP C  1 43  ? -38.249 -18.024 -8.693  1.00 33.86  ? 43  ASP C O   1 
ATOM   5450  C  CB  . ASP C  1 43  ? -40.435 -18.499 -6.287  1.00 43.58  ? 43  ASP C CB  1 
ATOM   5451  C  CG  . ASP C  1 43  ? -40.970 -19.519 -5.438  1.00 48.77  ? 43  ASP C CG  1 
ATOM   5452  O  OD1 . ASP C  1 43  ? -40.407 -20.634 -5.424  1.00 52.79  ? 43  ASP C OD1 1 
ATOM   5453  O  OD2 . ASP C  1 43  ? -41.978 -19.252 -4.744  1.00 59.35  ? 43  ASP C OD2 1 
ATOM   5454  N  N   . GLU C  1 44  ? -38.316 -16.412 -7.095  1.00 32.56  ? 44  GLU C N   1 
ATOM   5455  C  CA  . GLU C  1 44  ? -37.856 -15.358 -7.990  1.00 34.98  ? 44  GLU C CA  1 
ATOM   5456  C  C   . GLU C  1 44  ? -36.469 -15.628 -8.427  1.00 30.53  ? 44  GLU C C   1 
ATOM   5457  O  O   . GLU C  1 44  ? -36.132 -15.436 -9.582  1.00 30.28  ? 44  GLU C O   1 
ATOM   5458  C  CB  . GLU C  1 44  ? -37.918 -13.995 -7.304  1.00 37.27  ? 44  GLU C CB  1 
ATOM   5459  C  CG  . GLU C  1 44  ? -39.275 -13.547 -6.957  1.00 56.12  ? 44  GLU C CG  1 
ATOM   5460  C  CD  . GLU C  1 44  ? -39.293 -12.114 -6.413  1.00 70.95  ? 44  GLU C CD  1 
ATOM   5461  O  OE1 . GLU C  1 44  ? -40.338 -11.698 -5.848  1.00 80.39  ? 44  GLU C OE1 1 
ATOM   5462  O  OE2 . GLU C  1 44  ? -38.254 -11.403 -6.552  1.00 69.38  ? 44  GLU C OE2 1 
ATOM   5463  N  N   . GLU C  1 45  ? -35.636 -16.075 -7.494  1.00 28.40  ? 45  GLU C N   1 
ATOM   5464  C  CA  . GLU C  1 45  ? -34.235 -16.358 -7.797  1.00 26.99  ? 45  GLU C CA  1 
ATOM   5465  C  C   . GLU C  1 45  ? -34.134 -17.422 -8.817  1.00 26.15  ? 45  GLU C C   1 
ATOM   5466  O  O   . GLU C  1 45  ? -33.392 -17.298 -9.779  1.00 27.03  ? 45  GLU C O   1 
ATOM   5467  C  CB  . GLU C  1 45  ? -33.468 -16.769 -6.501  1.00 26.06  ? 45  GLU C CB  1 
ATOM   5468  C  CG  . GLU C  1 45  ? -33.403 -15.655 -5.453  1.00 29.67  ? 45  GLU C CG  1 
ATOM   5469  C  CD  . GLU C  1 45  ? -33.016 -16.163 -4.058  1.00 34.29  ? 45  GLU C CD  1 
ATOM   5470  O  OE1 . GLU C  1 45  ? -33.127 -17.396 -3.803  1.00 37.12  ? 45  GLU C OE1 1 
ATOM   5471  O  OE2 . GLU C  1 45  ? -32.615 -15.341 -3.230  1.00 38.77  ? 45  GLU C OE2 1 
ATOM   5472  N  N   . PHE C  1 46  ? -34.892 -18.493 -8.623  1.00 27.70  ? 46  PHE C N   1 
ATOM   5473  C  CA  . PHE C  1 46  ? -34.889 -19.604 -9.554  1.00 28.67  ? 46  PHE C CA  1 
ATOM   5474  C  C   . PHE C  1 46  ? -35.381 -19.164 -10.958 1.00 29.91  ? 46  PHE C C   1 
ATOM   5475  O  O   . PHE C  1 46  ? -34.722 -19.443 -11.981 1.00 30.86  ? 46  PHE C O   1 
ATOM   5476  C  CB  . PHE C  1 46  ? -35.746 -20.766 -9.016  1.00 29.17  ? 46  PHE C CB  1 
ATOM   5477  C  CG  . PHE C  1 46  ? -35.803 -21.959 -9.937  1.00 30.03  ? 46  PHE C CG  1 
ATOM   5478  C  CD1 . PHE C  1 46  ? -36.978 -22.256 -10.656 1.00 28.24  ? 46  PHE C CD1 1 
ATOM   5479  C  CD2 . PHE C  1 46  ? -34.661 -22.809 -10.105 1.00 29.04  ? 46  PHE C CD2 1 
ATOM   5480  C  CE1 . PHE C  1 46  ? -37.031 -23.375 -11.523 1.00 31.32  ? 46  PHE C CE1 1 
ATOM   5481  C  CE2 . PHE C  1 46  ? -34.710 -23.924 -10.969 1.00 28.19  ? 46  PHE C CE2 1 
ATOM   5482  C  CZ  . PHE C  1 46  ? -35.890 -24.210 -11.678 1.00 31.73  ? 46  PHE C CZ  1 
ATOM   5483  N  N   . ARG C  1 47  ? -36.529 -18.476 -10.998 1.00 28.29  ? 47  ARG C N   1 
ATOM   5484  C  CA  . ARG C  1 47  ? -37.071 -17.977 -12.258 1.00 30.94  ? 47  ARG C CA  1 
ATOM   5485  C  C   . ARG C  1 47  ? -36.085 -17.048 -12.992 1.00 32.47  ? 47  ARG C C   1 
ATOM   5486  O  O   . ARG C  1 47  ? -35.872 -17.189 -14.183 1.00 35.92  ? 47  ARG C O   1 
ATOM   5487  C  CB  . ARG C  1 47  ? -38.416 -17.268 -12.038 1.00 36.06  ? 47  ARG C CB  1 
ATOM   5488  C  CG  . ARG C  1 47  ? -39.620 -18.207 -12.079 1.00 43.53  ? 47  ARG C CG  1 
ATOM   5489  C  CD  . ARG C  1 47  ? -40.985 -17.421 -12.024 1.00 51.76  ? 47  ARG C CD  1 
ATOM   5490  N  NE  . ARG C  1 47  ? -41.428 -17.169 -10.644 1.00 59.29  ? 47  ARG C NE  1 
ATOM   5491  C  CZ  . ARG C  1 47  ? -41.258 -16.016 -9.996  1.00 60.11  ? 47  ARG C CZ  1 
ATOM   5492  N  NH1 . ARG C  1 47  ? -41.694 -15.886 -8.744  1.00 63.71  ? 47  ARG C NH1 1 
ATOM   5493  N  NH2 . ARG C  1 47  ? -40.656 -14.989 -10.598 1.00 63.40  ? 47  ARG C NH2 1 
ATOM   5494  N  N   . ASN C  1 48  ? -35.495 -16.104 -12.263 1.00 29.51  ? 48  ASN C N   1 
ATOM   5495  C  CA  . ASN C  1 48  ? -34.544 -15.191 -12.855 1.00 30.82  ? 48  ASN C CA  1 
ATOM   5496  C  C   . ASN C  1 48  ? -33.314 -15.918 -13.448 1.00 30.87  ? 48  ASN C C   1 
ATOM   5497  O  O   . ASN C  1 48  ? -32.881 -15.612 -14.537 1.00 32.84  ? 48  ASN C O   1 
ATOM   5498  C  CB  . ASN C  1 48  ? -34.096 -14.112 -11.829 1.00 32.60  ? 48  ASN C CB  1 
ATOM   5499  C  CG  . ASN C  1 48  ? -35.199 -13.096 -11.528 1.00 38.79  ? 48  ASN C CG  1 
ATOM   5500  O  OD1 . ASN C  1 48  ? -36.196 -13.005 -12.255 1.00 48.89  ? 48  ASN C OD1 1 
ATOM   5501  N  ND2 . ASN C  1 48  ? -35.024 -12.339 -10.469 1.00 38.90  ? 48  ASN C ND2 1 
ATOM   5502  N  N   . ALA C  1 49  ? -32.786 -16.871 -12.711 1.00 27.72  ? 49  ALA C N   1 
ATOM   5503  C  CA  . ALA C  1 49  ? -31.608 -17.609 -13.147 1.00 29.65  ? 49  ALA C CA  1 
ATOM   5504  C  C   . ALA C  1 49  ? -31.907 -18.456 -14.401 1.00 29.98  ? 49  ALA C C   1 
ATOM   5505  O  O   . ALA C  1 49  ? -31.139 -18.458 -15.356 1.00 29.35  ? 49  ALA C O   1 
ATOM   5506  C  CB  . ALA C  1 49  ? -31.079 -18.487 -12.021 1.00 24.45  ? 49  ALA C CB  1 
ATOM   5507  N  N   . VAL C  1 50  ? -33.019 -19.162 -14.378 1.00 33.24  ? 50  VAL C N   1 
ATOM   5508  C  CA  . VAL C  1 50  ? -33.423 -19.960 -15.503 1.00 31.76  ? 50  VAL C CA  1 
ATOM   5509  C  C   . VAL C  1 50  ? -33.614 -19.081 -16.752 1.00 33.87  ? 50  VAL C C   1 
ATOM   5510  O  O   . VAL C  1 50  ? -33.127 -19.402 -17.813 1.00 32.08  ? 50  VAL C O   1 
ATOM   5511  C  CB  . VAL C  1 50  ? -34.729 -20.726 -15.218 1.00 29.62  ? 50  VAL C CB  1 
ATOM   5512  C  CG1 . VAL C  1 50  ? -35.230 -21.424 -16.487 1.00 30.01  ? 50  VAL C CG1 1 
ATOM   5513  C  CG2 . VAL C  1 50  ? -34.526 -21.727 -14.095 1.00 29.24  ? 50  VAL C CG2 1 
ATOM   5514  N  N   . ASN C  1 51  ? -34.338 -17.957 -16.590 1.00 32.67  ? 51  ASN C N   1 
ATOM   5515  C  CA  . ASN C  1 51  ? -34.608 -17.057 -17.713 1.00 34.57  ? 51  ASN C CA  1 
ATOM   5516  C  C   . ASN C  1 51  ? -33.333 -16.491 -18.327 1.00 34.28  ? 51  ASN C C   1 
ATOM   5517  O  O   . ASN C  1 51  ? -33.187 -16.454 -19.551 1.00 33.97  ? 51  ASN C O   1 
ATOM   5518  C  CB  . ASN C  1 51  ? -35.548 -15.922 -17.290 1.00 35.27  ? 51  ASN C CB  1 
ATOM   5519  C  CG  . ASN C  1 51  ? -36.988 -16.415 -17.013 1.00 42.32  ? 51  ASN C CG  1 
ATOM   5520  O  OD1 . ASN C  1 51  ? -37.823 -15.673 -16.467 1.00 44.16  ? 51  ASN C OD1 1 
ATOM   5521  N  ND2 . ASN C  1 51  ? -37.268 -17.644 -17.382 1.00 45.06  ? 51  ASN C ND2 1 
ATOM   5522  N  N   . GLU C  1 52  ? -32.416 -16.050 -17.480 1.00 29.34  ? 52  GLU C N   1 
ATOM   5523  C  CA  . GLU C  1 52  ? -31.169 -15.526 -17.944 1.00 30.52  ? 52  GLU C CA  1 
ATOM   5524  C  C   . GLU C  1 52  ? -30.364 -16.592 -18.689 1.00 28.36  ? 52  GLU C C   1 
ATOM   5525  O  O   . GLU C  1 52  ? -29.907 -16.361 -19.791 1.00 29.58  ? 52  GLU C O   1 
ATOM   5526  C  CB  . GLU C  1 52  ? -30.338 -14.946 -16.763 1.00 32.98  ? 52  GLU C CB  1 
ATOM   5527  C  CG  . GLU C  1 52  ? -30.891 -13.634 -16.202 1.00 36.08  ? 52  GLU C CG  1 
ATOM   5528  C  CD  . GLU C  1 52  ? -30.879 -12.480 -17.251 1.00 41.20  ? 52  GLU C CD  1 
ATOM   5529  O  OE1 . GLU C  1 52  ? -31.973 -12.046 -17.671 1.00 47.19  ? 52  GLU C OE1 1 
ATOM   5530  O  OE2 . GLU C  1 52  ? -29.760 -12.028 -17.649 1.00 39.26  ? 52  GLU C OE2 1 
ATOM   5531  N  N   . VAL C  1 53  ? -30.202 -17.770 -18.067 1.00 24.96  ? 53  VAL C N   1 
ATOM   5532  C  CA  . VAL C  1 53  ? -29.435 -18.849 -18.687 1.00 23.88  ? 53  VAL C CA  1 
ATOM   5533  C  C   . VAL C  1 53  ? -30.059 -19.275 -20.033 1.00 24.48  ? 53  VAL C C   1 
ATOM   5534  O  O   . VAL C  1 53  ? -29.352 -19.537 -20.987 1.00 24.79  ? 53  VAL C O   1 
ATOM   5535  C  CB  . VAL C  1 53  ? -29.306 -20.075 -17.767 1.00 24.29  ? 53  VAL C CB  1 
ATOM   5536  C  CG1 . VAL C  1 53  ? -28.688 -21.277 -18.547 1.00 23.11  ? 53  VAL C CG1 1 
ATOM   5537  C  CG2 . VAL C  1 53  ? -28.480 -19.739 -16.561 1.00 23.04  ? 53  VAL C CG2 1 
ATOM   5538  N  N   . LYS C  1 54  ? -31.398 -19.338 -20.085 1.00 25.64  ? 54  LYS C N   1 
ATOM   5539  C  CA  . LYS C  1 54  ? -32.095 -19.686 -21.355 1.00 26.60  ? 54  LYS C CA  1 
ATOM   5540  C  C   . LYS C  1 54  ? -31.821 -18.668 -22.445 1.00 27.62  ? 54  LYS C C   1 
ATOM   5541  O  O   . LYS C  1 54  ? -31.556 -19.032 -23.575 1.00 29.97  ? 54  LYS C O   1 
ATOM   5542  C  CB  . LYS C  1 54  ? -33.594 -19.845 -21.139 1.00 28.21  ? 54  LYS C CB  1 
ATOM   5543  C  CG  . LYS C  1 54  ? -33.995 -21.226 -20.620 1.00 29.82  ? 54  LYS C CG  1 
ATOM   5544  C  CD  . LYS C  1 54  ? -35.511 -21.334 -20.440 1.00 31.31  ? 54  LYS C CD  1 
ATOM   5545  C  CE  . LYS C  1 54  ? -35.916 -22.744 -20.103 1.00 32.17  ? 54  LYS C CE  1 
ATOM   5546  N  NZ  . LYS C  1 54  ? -37.358 -22.841 -19.822 1.00 39.49  ? 54  LYS C NZ  1 
ATOM   5547  N  N   . ARG C  1 55  ? -31.886 -17.371 -22.097 1.00 27.97  ? 55  ARG C N   1 
ATOM   5548  C  CA  . ARG C  1 55  ? -31.592 -16.320 -23.084 1.00 30.85  ? 55  ARG C CA  1 
ATOM   5549  C  C   . ARG C  1 55  ? -30.152 -16.413 -23.537 1.00 31.26  ? 55  ARG C C   1 
ATOM   5550  O  O   . ARG C  1 55  ? -29.841 -16.156 -24.685 1.00 31.90  ? 55  ARG C O   1 
ATOM   5551  C  CB  . ARG C  1 55  ? -31.883 -14.919 -22.524 1.00 31.27  ? 55  ARG C CB  1 
ATOM   5552  C  CG  . ARG C  1 55  ? -31.900 -13.806 -23.635 1.00 40.36  ? 55  ARG C CG  1 
ATOM   5553  C  CD  . ARG C  1 55  ? -32.361 -12.443 -23.097 1.00 40.70  ? 55  ARG C CD  1 
ATOM   5554  N  NE  . ARG C  1 55  ? -31.321 -11.784 -22.340 1.00 39.79  ? 55  ARG C NE  1 
ATOM   5555  C  CZ  . ARG C  1 55  ? -31.271 -11.744 -21.022 1.00 40.23  ? 55  ARG C CZ  1 
ATOM   5556  N  NH1 . ARG C  1 55  ? -30.260 -11.110 -20.410 1.00 39.32  ? 55  ARG C NH1 1 
ATOM   5557  N  NH2 . ARG C  1 55  ? -32.229 -12.332 -20.293 1.00 37.69  ? 55  ARG C NH2 1 
ATOM   5558  N  N   . ALA C  1 56  ? -29.271 -16.791 -22.618 1.00 29.84  ? 56  ALA C N   1 
ATOM   5559  C  CA  . ALA C  1 56  ? -27.860 -16.945 -22.938 1.00 29.07  ? 56  ALA C CA  1 
ATOM   5560  C  C   . ALA C  1 56  ? -27.647 -18.109 -23.928 1.00 29.02  ? 56  ALA C C   1 
ATOM   5561  O  O   . ALA C  1 56  ? -26.813 -18.020 -24.851 1.00 28.07  ? 56  ALA C O   1 
ATOM   5562  C  CB  . ALA C  1 56  ? -27.069 -17.166 -21.698 1.00 25.71  ? 56  ALA C CB  1 
ATOM   5563  N  N   . MET C  1 57  ? -28.387 -19.178 -23.741 1.00 28.85  ? 57  MET C N   1 
ATOM   5564  C  CA  . MET C  1 57  ? -28.271 -20.340 -24.629 1.00 30.42  ? 57  MET C CA  1 
ATOM   5565  C  C   . MET C  1 57  ? -28.807 -20.022 -26.021 1.00 29.74  ? 57  MET C C   1 
ATOM   5566  O  O   . MET C  1 57  ? -28.314 -20.527 -26.998 1.00 28.99  ? 57  MET C O   1 
ATOM   5567  C  CB  . MET C  1 57  ? -28.979 -21.564 -24.028 1.00 29.84  ? 57  MET C CB  1 
ATOM   5568  C  CG  . MET C  1 57  ? -28.286 -22.108 -22.762 1.00 33.46  ? 57  MET C CG  1 
ATOM   5569  S  SD  . MET C  1 57  ? -29.240 -23.368 -21.908 1.00 33.74  ? 57  MET C SD  1 
ATOM   5570  C  CE  . MET C  1 57  ? -29.043 -24.772 -23.019 1.00 31.76  ? 57  MET C CE  1 
ATOM   5571  N  N   . GLN C  1 58  ? -29.829 -19.153 -26.085 1.00 30.47  ? 58  GLN C N   1 
ATOM   5572  C  CA  . GLN C  1 58  ? -30.367 -18.707 -27.357 1.00 33.72  ? 58  GLN C CA  1 
ATOM   5573  C  C   . GLN C  1 58  ? -29.292 -17.961 -28.192 1.00 32.28  ? 58  GLN C C   1 
ATOM   5574  O  O   . GLN C  1 58  ? -29.332 -17.972 -29.407 1.00 34.03  ? 58  GLN C O   1 
ATOM   5575  C  CB  . GLN C  1 58  ? -31.567 -17.815 -27.148 1.00 36.32  ? 58  GLN C CB  1 
ATOM   5576  C  CG  . GLN C  1 58  ? -32.785 -18.535 -26.699 1.00 42.18  ? 58  GLN C CG  1 
ATOM   5577  C  CD  . GLN C  1 58  ? -33.988 -17.648 -26.660 1.00 55.95  ? 58  GLN C CD  1 
ATOM   5578  O  OE1 . GLN C  1 58  ? -35.099 -18.083 -26.937 1.00 67.07  ? 58  GLN C OE1 1 
ATOM   5579  N  NE2 . GLN C  1 58  ? -33.778 -16.374 -26.320 1.00 56.17  ? 58  GLN C NE2 1 
ATOM   5580  N  N   . PHE C  1 59  ? -28.349 -17.322 -27.509 1.00 28.94  ? 59  PHE C N   1 
ATOM   5581  C  CA  . PHE C  1 59  ? -27.257 -16.622 -28.184 1.00 29.52  ? 59  PHE C CA  1 
ATOM   5582  C  C   . PHE C  1 59  ? -26.076 -17.560 -28.517 1.00 30.51  ? 59  PHE C C   1 
ATOM   5583  O  O   . PHE C  1 59  ? -25.035 -17.109 -29.011 1.00 32.81  ? 59  PHE C O   1 
ATOM   5584  C  CB  . PHE C  1 59  ? -26.767 -15.436 -27.348 1.00 27.90  ? 59  PHE C CB  1 
ATOM   5585  C  CG  . PHE C  1 59  ? -27.593 -14.178 -27.525 1.00 31.64  ? 59  PHE C CG  1 
ATOM   5586  C  CD1 . PHE C  1 59  ? -27.610 -13.493 -28.768 1.00 30.54  ? 59  PHE C CD1 1 
ATOM   5587  C  CD2 . PHE C  1 59  ? -28.352 -13.652 -26.449 1.00 33.49  ? 59  PHE C CD2 1 
ATOM   5588  C  CE1 . PHE C  1 59  ? -28.369 -12.323 -28.932 1.00 35.06  ? 59  PHE C CE1 1 
ATOM   5589  C  CE2 . PHE C  1 59  ? -29.111 -12.483 -26.611 1.00 34.91  ? 59  PHE C CE2 1 
ATOM   5590  C  CZ  . PHE C  1 59  ? -29.121 -11.815 -27.855 1.00 36.35  ? 59  PHE C CZ  1 
ATOM   5591  N  N   . GLY C  1 60  ? -26.239 -18.855 -28.234 1.00 30.06  ? 60  GLY C N   1 
ATOM   5592  C  CA  . GLY C  1 60  ? -25.177 -19.862 -28.562 1.00 25.25  ? 60  GLY C CA  1 
ATOM   5593  C  C   . GLY C  1 60  ? -24.180 -20.205 -27.376 1.00 26.65  ? 60  GLY C C   1 
ATOM   5594  O  O   . GLY C  1 60  ? -23.187 -20.866 -27.583 1.00 28.64  ? 60  GLY C O   1 
ATOM   5595  N  N   . VAL C  1 61  ? -24.485 -19.740 -26.167 1.00 25.14  ? 61  VAL C N   1 
ATOM   5596  C  CA  . VAL C  1 61  ? -23.653 -20.081 -25.006 1.00 22.24  ? 61  VAL C CA  1 
ATOM   5597  C  C   . VAL C  1 61  ? -23.875 -21.539 -24.610 1.00 23.47  ? 61  VAL C C   1 
ATOM   5598  O  O   . VAL C  1 61  ? -25.011 -21.972 -24.425 1.00 24.16  ? 61  VAL C O   1 
ATOM   5599  C  CB  . VAL C  1 61  ? -23.947 -19.192 -23.813 1.00 23.68  ? 61  VAL C CB  1 
ATOM   5600  C  CG1 . VAL C  1 61  ? -23.161 -19.673 -22.582 1.00 20.21  ? 61  VAL C CG1 1 
ATOM   5601  C  CG2 . VAL C  1 61  ? -23.617 -17.737 -24.135 1.00 22.51  ? 61  VAL C CG2 1 
ATOM   5602  N  N   . LYS C  1 62  ? -22.787 -22.294 -24.481 1.00 22.61  ? 62  LYS C N   1 
ATOM   5603  C  CA  . LYS C  1 62  ? -22.892 -23.722 -24.103 1.00 25.54  ? 62  LYS C CA  1 
ATOM   5604  C  C   . LYS C  1 62  ? -22.536 -23.929 -22.676 1.00 24.77  ? 62  LYS C C   1 
ATOM   5605  O  O   . LYS C  1 62  ? -23.098 -24.791 -22.007 1.00 26.24  ? 62  LYS C O   1 
ATOM   5606  C  CB  . LYS C  1 62  ? -21.983 -24.589 -24.988 1.00 26.88  ? 62  LYS C CB  1 
ATOM   5607  C  CG  . LYS C  1 62  ? -22.158 -24.363 -26.489 1.00 29.05  ? 62  LYS C CG  1 
ATOM   5608  C  CD  . LYS C  1 62  ? -23.574 -24.662 -26.935 1.00 30.90  ? 62  LYS C CD  1 
ATOM   5609  C  CE  . LYS C  1 62  ? -23.714 -24.483 -28.429 1.00 37.29  ? 62  LYS C CE  1 
ATOM   5610  N  NZ  . LYS C  1 62  ? -25.131 -24.580 -28.863 1.00 48.32  ? 62  LYS C NZ  1 
ATOM   5611  N  N   . THR C  1 63  ? -21.605 -23.140 -22.186 1.00 21.88  ? 63  THR C N   1 
ATOM   5612  C  CA  . THR C  1 63  ? -21.062 -23.361 -20.852 1.00 21.97  ? 63  THR C CA  1 
ATOM   5613  C  C   . THR C  1 63  ? -20.949 -22.112 -20.071 1.00 22.78  ? 63  THR C C   1 
ATOM   5614  O  O   . THR C  1 63  ? -20.539 -21.032 -20.616 1.00 21.06  ? 63  THR C O   1 
ATOM   5615  C  CB  . THR C  1 63  ? -19.680 -24.024 -20.927 1.00 21.63  ? 63  THR C CB  1 
ATOM   5616  O  OG1 . THR C  1 63  ? -19.763 -25.204 -21.723 1.00 22.04  ? 63  THR C OG1 1 
ATOM   5617  C  CG2 . THR C  1 63  ? -19.169 -24.389 -19.511 1.00 22.02  ? 63  THR C CG2 1 
ATOM   5618  N  N   . ILE C  1 64  ? -21.297 -22.202 -18.787 1.00 21.41  ? 64  ILE C N   1 
ATOM   5619  C  CA  . ILE C  1 64  ? -21.183 -21.111 -17.901 1.00 21.09  ? 64  ILE C CA  1 
ATOM   5620  C  C   . ILE C  1 64  ? -20.360 -21.509 -16.707 1.00 21.63  ? 64  ILE C C   1 
ATOM   5621  O  O   . ILE C  1 64  ? -20.590 -22.552 -16.100 1.00 21.83  ? 64  ILE C O   1 
ATOM   5622  C  CB  . ILE C  1 64  ? -22.590 -20.605 -17.432 1.00 21.33  ? 64  ILE C CB  1 
ATOM   5623  C  CG1 . ILE C  1 64  ? -23.358 -20.030 -18.605 1.00 21.02  ? 64  ILE C CG1 1 
ATOM   5624  C  CG2 . ILE C  1 64  ? -22.451 -19.555 -16.324 1.00 18.55  ? 64  ILE C CG2 1 
ATOM   5625  C  CD1 . ILE C  1 64  ? -24.774 -19.549 -18.243 1.00 24.54  ? 64  ILE C CD1 1 
ATOM   5626  N  N   . VAL C  1 65  ? -19.383 -20.692 -16.381 1.00 22.81  ? 65  VAL C N   1 
ATOM   5627  C  CA  . VAL C  1 65  ? -18.552 -20.928 -15.237 1.00 21.34  ? 65  VAL C CA  1 
ATOM   5628  C  C   . VAL C  1 65  ? -18.994 -19.975 -14.101 1.00 24.16  ? 65  VAL C C   1 
ATOM   5629  O  O   . VAL C  1 65  ? -18.977 -18.744 -14.259 1.00 23.78  ? 65  VAL C O   1 
ATOM   5630  C  CB  . VAL C  1 65  ? -17.066 -20.716 -15.571 1.00 21.80  ? 65  VAL C CB  1 
ATOM   5631  C  CG1 . VAL C  1 65  ? -16.197 -20.983 -14.353 1.00 22.51  ? 65  VAL C CG1 1 
ATOM   5632  C  CG2 . VAL C  1 65  ? -16.653 -21.622 -16.734 1.00 19.12  ? 65  VAL C CG2 1 
ATOM   5633  N  N   . ASP C  1 66  ? -19.396 -20.551 -12.991 1.00 22.85  ? 66  ASP C N   1 
ATOM   5634  C  CA  . ASP C  1 66  ? -19.978 -19.810 -11.920 1.00 22.32  ? 66  ASP C CA  1 
ATOM   5635  C  C   . ASP C  1 66  ? -19.104 -19.868 -10.693 1.00 21.34  ? 66  ASP C C   1 
ATOM   5636  O  O   . ASP C  1 66  ? -19.110 -20.848 -9.984  1.00 20.21  ? 66  ASP C O   1 
ATOM   5637  C  CB  . ASP C  1 66  ? -21.390 -20.381 -11.599 1.00 25.45  ? 66  ASP C CB  1 
ATOM   5638  C  CG  . ASP C  1 66  ? -22.081 -19.636 -10.490 1.00 30.75  ? 66  ASP C CG  1 
ATOM   5639  O  OD1 . ASP C  1 66  ? -21.365 -18.994 -9.638  1.00 30.88  ? 66  ASP C OD1 1 
ATOM   5640  O  OD2 . ASP C  1 66  ? -23.345 -19.676 -10.440 1.00 31.98  ? 66  ASP C OD2 1 
ATOM   5641  N  N   . PRO C  1 67  ? -18.331 -18.788 -10.443 1.00 20.52  ? 67  PRO C N   1 
ATOM   5642  C  CA  . PRO C  1 67  ? -17.377 -18.740 -9.311  1.00 21.96  ? 67  PRO C CA  1 
ATOM   5643  C  C   . PRO C  1 67  ? -18.015 -18.325 -7.978  1.00 24.06  ? 67  PRO C C   1 
ATOM   5644  O  O   . PRO C  1 67  ? -17.375 -17.638 -7.168  1.00 21.24  ? 67  PRO C O   1 
ATOM   5645  C  CB  . PRO C  1 67  ? -16.339 -17.696 -9.767  1.00 21.27  ? 67  PRO C CB  1 
ATOM   5646  C  CG  . PRO C  1 67  ? -17.069 -16.813 -10.741 1.00 20.01  ? 67  PRO C CG  1 
ATOM   5647  C  CD  . PRO C  1 67  ? -18.242 -17.587 -11.311 1.00 21.22  ? 67  PRO C CD  1 
ATOM   5648  N  N   . THR C  1 68  ? -19.244 -18.737 -7.756  1.00 21.12  ? 68  THR C N   1 
ATOM   5649  C  CA  . THR C  1 68  ? -19.887 -18.502 -6.506  1.00 22.56  ? 68  THR C CA  1 
ATOM   5650  C  C   . THR C  1 68  ? -19.372 -19.514 -5.462  1.00 21.79  ? 68  THR C C   1 
ATOM   5651  O  O   . THR C  1 68  ? -19.630 -20.656 -5.560  1.00 23.78  ? 68  THR C O   1 
ATOM   5652  C  CB  . THR C  1 68  ? -21.392 -18.643 -6.627  1.00 21.45  ? 68  THR C CB  1 
ATOM   5653  O  OG1 . THR C  1 68  ? -21.860 -17.837 -7.702  1.00 20.41  ? 68  THR C OG1 1 
ATOM   5654  C  CG2 . THR C  1 68  ? -22.093 -18.203 -5.295  1.00 20.57  ? 68  THR C CG2 1 
ATOM   5655  N  N   . VAL C  1 69  ? -18.631 -19.019 -4.470  1.00 20.58  ? 69  VAL C N   1 
ATOM   5656  C  CA  . VAL C  1 69  ? -18.034 -19.860 -3.475  1.00 20.04  ? 69  VAL C CA  1 
ATOM   5657  C  C   . VAL C  1 69  ? -18.352 -19.352 -2.061  1.00 20.49  ? 69  VAL C C   1 
ATOM   5658  O  O   . VAL C  1 69  ? -19.200 -18.505 -1.888  1.00 21.69  ? 69  VAL C O   1 
ATOM   5659  C  CB  . VAL C  1 69  ? -16.479 -19.957 -3.673  1.00 20.84  ? 69  VAL C CB  1 
ATOM   5660  C  CG1 . VAL C  1 69  ? -16.159 -20.582 -5.021  1.00 21.90  ? 69  VAL C CG1 1 
ATOM   5661  C  CG2 . VAL C  1 69  ? -15.830 -18.577 -3.544  1.00 18.65  ? 69  VAL C CG2 1 
ATOM   5662  N  N   . MET C  1 70  ? -17.652 -19.899 -1.048  1.00 22.28  ? 70  MET C N   1 
ATOM   5663  C  CA  . MET C  1 70  ? -17.886 -19.484 0.350   1.00 23.09  ? 70  MET C CA  1 
ATOM   5664  C  C   . MET C  1 70  ? -17.767 -18.014 0.471   1.00 24.33  ? 70  MET C C   1 
ATOM   5665  O  O   . MET C  1 70  ? -16.733 -17.419 0.076   1.00 24.07  ? 70  MET C O   1 
ATOM   5666  C  CB  . MET C  1 70  ? -16.887 -20.158 1.314   1.00 23.11  ? 70  MET C CB  1 
ATOM   5667  C  CG  . MET C  1 70  ? -17.334 -20.082 2.831   1.00 23.66  ? 70  MET C CG  1 
ATOM   5668  S  SD  . MET C  1 70  ? -16.022 -19.462 3.975   1.00 26.48  ? 70  MET C SD  1 
ATOM   5669  C  CE  . MET C  1 70  ? -15.952 -17.716 3.503   1.00 23.42  ? 70  MET C CE  1 
ATOM   5670  N  N   . GLY C  1 71  ? -18.791 -17.392 1.009   1.00 22.76  ? 71  GLY C N   1 
ATOM   5671  C  CA  . GLY C  1 71  ? -18.801 -15.979 1.166   1.00 23.89  ? 71  GLY C CA  1 
ATOM   5672  C  C   . GLY C  1 71  ? -19.704 -15.320 0.164   1.00 24.24  ? 71  GLY C C   1 
ATOM   5673  O  O   . GLY C  1 71  ? -20.061 -14.183 0.314   1.00 25.81  ? 71  GLY C O   1 
ATOM   5674  N  N   . LEU C  1 72  ? -20.078 -16.079 -0.881  1.00 24.93  ? 72  LEU C N   1 
ATOM   5675  C  CA  . LEU C  1 72  ? -20.975 -15.580 -1.929  1.00 21.71  ? 72  LEU C CA  1 
ATOM   5676  C  C   . LEU C  1 72  ? -22.282 -16.398 -2.020  1.00 23.30  ? 72  LEU C C   1 
ATOM   5677  O  O   . LEU C  1 72  ? -23.156 -16.107 -2.860  1.00 26.01  ? 72  LEU C O   1 
ATOM   5678  C  CB  . LEU C  1 72  ? -20.276 -15.587 -3.266  1.00 22.52  ? 72  LEU C CB  1 
ATOM   5679  C  CG  . LEU C  1 72  ? -19.144 -14.606 -3.420  1.00 24.21  ? 72  LEU C CG  1 
ATOM   5680  C  CD1 . LEU C  1 72  ? -18.452 -14.798 -4.754  1.00 21.87  ? 72  LEU C CD1 1 
ATOM   5681  C  CD2 . LEU C  1 72  ? -19.668 -13.153 -3.268  1.00 21.96  ? 72  LEU C CD2 1 
ATOM   5682  N  N   . GLY C  1 73  ? -22.407 -17.414 -1.183  1.00 22.27  ? 73  GLY C N   1 
ATOM   5683  C  CA  . GLY C  1 73  ? -23.666 -18.200 -1.113  1.00 22.38  ? 73  GLY C CA  1 
ATOM   5684  C  C   . GLY C  1 73  ? -23.754 -19.399 -2.062  1.00 22.79  ? 73  GLY C C   1 
ATOM   5685  O  O   . GLY C  1 73  ? -24.856 -19.775 -2.507  1.00 22.36  ? 73  GLY C O   1 
ATOM   5686  N  N   . ARG C  1 74  ? -22.623 -20.008 -2.363  1.00 22.57  ? 74  ARG C N   1 
ATOM   5687  C  CA  . ARG C  1 74  ? -22.626 -21.192 -3.207  1.00 22.65  ? 74  ARG C CA  1 
ATOM   5688  C  C   . ARG C  1 74  ? -23.687 -22.176 -2.714  1.00 23.78  ? 74  ARG C C   1 
ATOM   5689  O  O   . ARG C  1 74  ? -23.770 -22.471 -1.501  1.00 20.95  ? 74  ARG C O   1 
ATOM   5690  C  CB  . ARG C  1 74  ? -21.252 -21.870 -3.207  1.00 22.18  ? 74  ARG C CB  1 
ATOM   5691  C  CG  . ARG C  1 74  ? -21.181 -23.125 -4.098  1.00 21.65  ? 74  ARG C CG  1 
ATOM   5692  C  CD  . ARG C  1 74  ? -19.807 -23.793 -4.026  1.00 20.68  ? 74  ARG C CD  1 
ATOM   5693  N  NE  . ARG C  1 74  ? -19.540 -24.342 -2.700  1.00 19.83  ? 74  ARG C NE  1 
ATOM   5694  C  CZ  . ARG C  1 74  ? -18.495 -25.121 -2.402  1.00 19.06  ? 74  ARG C CZ  1 
ATOM   5695  N  NH1 . ARG C  1 74  ? -17.587 -25.464 -3.377  1.00 15.62  ? 74  ARG C NH1 1 
ATOM   5696  N  NH2 . ARG C  1 74  ? -18.335 -25.575 -1.145  1.00 17.23  ? 74  ARG C NH2 1 
ATOM   5697  N  N   . ASP C  1 75  ? -24.479 -22.681 -3.631  1.00 22.44  ? 75  ASP C N   1 
ATOM   5698  C  CA  . ASP C  1 75  ? -25.527 -23.642 -3.307  1.00 24.14  ? 75  ASP C CA  1 
ATOM   5699  C  C   . ASP C  1 75  ? -25.667 -24.627 -4.446  1.00 23.96  ? 75  ASP C C   1 
ATOM   5700  O  O   . ASP C  1 75  ? -26.372 -24.363 -5.433  1.00 22.63  ? 75  ASP C O   1 
ATOM   5701  C  CB  . ASP C  1 75  ? -26.827 -22.930 -3.074  1.00 25.96  ? 75  ASP C CB  1 
ATOM   5702  C  CG  . ASP C  1 75  ? -27.918 -23.855 -2.581  1.00 32.23  ? 75  ASP C CG  1 
ATOM   5703  O  OD1 . ASP C  1 75  ? -28.700 -23.426 -1.754  1.00 41.93  ? 75  ASP C OD1 1 
ATOM   5704  O  OD2 . ASP C  1 75  ? -27.980 -25.033 -3.042  1.00 34.65  ? 75  ASP C OD2 1 
ATOM   5705  N  N   . ILE C  1 76  ? -25.001 -25.764 -4.320  1.00 21.88  ? 76  ILE C N   1 
ATOM   5706  C  CA  . ILE C  1 76  ? -24.915 -26.695 -5.385  1.00 22.72  ? 76  ILE C CA  1 
ATOM   5707  C  C   . ILE C  1 76  ? -26.332 -27.257 -5.818  1.00 24.32  ? 76  ILE C C   1 
ATOM   5708  O  O   . ILE C  1 76  ? -26.566 -27.539 -7.009  1.00 24.74  ? 76  ILE C O   1 
ATOM   5709  C  CB  . ILE C  1 76  ? -23.939 -27.865 -5.046  1.00 24.44  ? 76  ILE C CB  1 
ATOM   5710  C  CG1 . ILE C  1 76  ? -23.475 -28.548 -6.312  1.00 26.94  ? 76  ILE C CG1 1 
ATOM   5711  C  CG2 . ILE C  1 76  ? -24.584 -28.846 -4.076  1.00 23.85  ? 76  ILE C CG2 1 
ATOM   5712  C  CD1 . ILE C  1 76  ? -22.646 -27.643 -7.229  1.00 24.10  ? 76  ILE C CD1 1 
ATOM   5713  N  N   . ARG C  1 77  ? -27.240 -27.395 -4.856  1.00 23.45  ? 77  ARG C N   1 
ATOM   5714  C  CA  . ARG C  1 77  ? -28.595 -27.943 -5.147  1.00 25.91  ? 77  ARG C CA  1 
ATOM   5715  C  C   . ARG C  1 77  ? -29.461 -26.948 -5.936  1.00 25.53  ? 77  ARG C C   1 
ATOM   5716  O  O   . ARG C  1 77  ? -30.264 -27.347 -6.781  1.00 26.58  ? 77  ARG C O   1 
ATOM   5717  C  CB  . ARG C  1 77  ? -29.292 -28.391 -3.865  1.00 24.98  ? 77  ARG C CB  1 
ATOM   5718  C  CG  . ARG C  1 77  ? -28.715 -29.656 -3.284  1.00 23.59  ? 77  ARG C CG  1 
ATOM   5719  C  CD  . ARG C  1 77  ? -29.178 -29.876 -1.865  1.00 26.33  ? 77  ARG C CD  1 
ATOM   5720  N  NE  . ARG C  1 77  ? -28.525 -31.033 -1.258  1.00 28.95  ? 77  ARG C NE  1 
ATOM   5721  C  CZ  . ARG C  1 77  ? -27.281 -31.020 -0.764  1.00 32.47  ? 77  ARG C CZ  1 
ATOM   5722  N  NH1 . ARG C  1 77  ? -26.546 -29.894 -0.810  1.00 28.21  ? 77  ARG C NH1 1 
ATOM   5723  N  NH2 . ARG C  1 77  ? -26.774 -32.105 -0.234  1.00 32.82  ? 77  ARG C NH2 1 
ATOM   5724  N  N   . PHE C  1 78  ? -29.286 -25.653 -5.660  1.00 26.26  ? 78  PHE C N   1 
ATOM   5725  C  CA  . PHE C  1 78  ? -29.908 -24.646 -6.449  1.00 24.64  ? 78  PHE C CA  1 
ATOM   5726  C  C   . PHE C  1 78  ? -29.330 -24.698 -7.853  1.00 25.55  ? 78  PHE C C   1 
ATOM   5727  O  O   . PHE C  1 78  ? -30.042 -24.557 -8.833  1.00 25.73  ? 78  PHE C O   1 
ATOM   5728  C  CB  . PHE C  1 78  ? -29.674 -23.254 -5.838  1.00 24.60  ? 78  PHE C CB  1 
ATOM   5729  C  CG  . PHE C  1 78  ? -30.332 -22.099 -6.641  1.00 23.91  ? 78  PHE C CG  1 
ATOM   5730  C  CD1 . PHE C  1 78  ? -29.573 -21.308 -7.506  1.00 25.14  ? 78  PHE C CD1 1 
ATOM   5731  C  CD2 . PHE C  1 78  ? -31.687 -21.830 -6.513  1.00 22.58  ? 78  PHE C CD2 1 
ATOM   5732  C  CE1 . PHE C  1 78  ? -30.169 -20.263 -8.233  1.00 24.73  ? 78  PHE C CE1 1 
ATOM   5733  C  CE2 . PHE C  1 78  ? -32.280 -20.795 -7.231  1.00 25.47  ? 78  PHE C CE2 1 
ATOM   5734  C  CZ  . PHE C  1 78  ? -31.509 -20.011 -8.095  1.00 23.99  ? 78  PHE C CZ  1 
ATOM   5735  N  N   . MET C  1 79  ? -28.023 -24.913 -7.935  1.00 24.62  ? 79  MET C N   1 
ATOM   5736  C  CA  . MET C  1 79  ? -27.349 -24.960 -9.191  1.00 26.26  ? 79  MET C CA  1 
ATOM   5737  C  C   . MET C  1 79  ? -27.851 -26.134 -10.087 1.00 26.75  ? 79  MET C C   1 
ATOM   5738  O  O   . MET C  1 79  ? -28.101 -25.946 -11.288 1.00 24.31  ? 79  MET C O   1 
ATOM   5739  C  CB  . MET C  1 79  ? -25.811 -25.051 -8.989  1.00 24.90  ? 79  MET C CB  1 
ATOM   5740  C  CG  . MET C  1 79  ? -25.158 -23.743 -8.525  1.00 31.44  ? 79  MET C CG  1 
ATOM   5741  S  SD  . MET C  1 79  ? -23.386 -23.950 -8.180  1.00 29.92  ? 79  MET C SD  1 
ATOM   5742  C  CE  . MET C  1 79  ? -22.826 -22.253 -8.150  1.00 37.73  ? 79  MET C CE  1 
ATOM   5743  N  N   . GLU C  1 80  ? -27.992 -27.338 -9.502  1.00 27.18  ? 80  GLU C N   1 
ATOM   5744  C  CA  . GLU C  1 80  ? -28.472 -28.501 -10.303 1.00 30.26  ? 80  GLU C CA  1 
ATOM   5745  C  C   . GLU C  1 80  ? -29.961 -28.380 -10.724 1.00 29.37  ? 80  GLU C C   1 
ATOM   5746  O  O   . GLU C  1 80  ? -30.348 -28.872 -11.760 1.00 28.25  ? 80  GLU C O   1 
ATOM   5747  C  CB  . GLU C  1 80  ? -28.134 -29.916 -9.617  1.00 32.63  ? 80  GLU C CB  1 
ATOM   5748  C  CG  . GLU C  1 80  ? -28.348 -29.990 -8.178  1.00 41.93  ? 80  GLU C CG  1 
ATOM   5749  C  CD  . GLU C  1 80  ? -27.873 -31.354 -7.580  1.00 44.51  ? 80  GLU C CD  1 
ATOM   5750  O  OE1 . GLU C  1 80  ? -27.904 -31.501 -6.386  1.00 40.58  ? 80  GLU C OE1 1 
ATOM   5751  O  OE2 . GLU C  1 80  ? -27.477 -32.246 -8.360  1.00 48.82  ? 80  GLU C OE2 1 
ATOM   5752  N  N   . LYS C  1 81  ? -30.768 -27.699 -9.905  1.00 32.12  ? 81  LYS C N   1 
ATOM   5753  C  CA  . LYS C  1 81  ? -32.147 -27.365 -10.313 1.00 29.87  ? 81  LYS C CA  1 
ATOM   5754  C  C   . LYS C  1 81  ? -32.119 -26.492 -11.579 1.00 27.62  ? 81  LYS C C   1 
ATOM   5755  O  O   . LYS C  1 81  ? -32.880 -26.691 -12.472 1.00 28.27  ? 81  LYS C O   1 
ATOM   5756  C  CB  . LYS C  1 81  ? -32.871 -26.648 -9.221  1.00 34.07  ? 81  LYS C CB  1 
ATOM   5757  C  CG  . LYS C  1 81  ? -33.143 -27.483 -8.009  1.00 41.33  ? 81  LYS C CG  1 
ATOM   5758  C  CD  . LYS C  1 81  ? -33.991 -26.733 -7.022  1.00 43.02  ? 81  LYS C CD  1 
ATOM   5759  C  CE  . LYS C  1 81  ? -34.129 -27.491 -5.733  1.00 45.36  ? 81  LYS C CE  1 
ATOM   5760  N  NZ  . LYS C  1 81  ? -34.971 -26.747 -4.757  1.00 54.31  ? 81  LYS C NZ  1 
ATOM   5761  N  N   . VAL C  1 82  ? -31.204 -25.520 -11.615 1.00 24.23  ? 82  VAL C N   1 
ATOM   5762  C  CA  . VAL C  1 82  ? -31.084 -24.641 -12.781 1.00 24.18  ? 82  VAL C CA  1 
ATOM   5763  C  C   . VAL C  1 82  ? -30.595 -25.428 -14.033 1.00 25.53  ? 82  VAL C C   1 
ATOM   5764  O  O   . VAL C  1 82  ? -31.045 -25.181 -15.134 1.00 29.24  ? 82  VAL C O   1 
ATOM   5765  C  CB  . VAL C  1 82  ? -30.173 -23.460 -12.512 1.00 23.80  ? 82  VAL C CB  1 
ATOM   5766  C  CG1 . VAL C  1 82  ? -29.942 -22.655 -13.803 1.00 23.00  ? 82  VAL C CG1 1 
ATOM   5767  C  CG2 . VAL C  1 82  ? -30.775 -22.572 -11.441 1.00 25.73  ? 82  VAL C CG2 1 
ATOM   5768  N  N   . VAL C  1 83  ? -29.688 -26.373 -13.825 1.00 26.79  ? 83  VAL C N   1 
ATOM   5769  C  CA  . VAL C  1 83  ? -29.217 -27.190 -14.892 1.00 25.31  ? 83  VAL C CA  1 
ATOM   5770  C  C   . VAL C  1 83  ? -30.363 -28.070 -15.461 1.00 28.61  ? 83  VAL C C   1 
ATOM   5771  O  O   . VAL C  1 83  ? -30.516 -28.199 -16.678 1.00 29.32  ? 83  VAL C O   1 
ATOM   5772  C  CB  . VAL C  1 83  ? -28.042 -28.083 -14.453 1.00 24.78  ? 83  VAL C CB  1 
ATOM   5773  C  CG1 . VAL C  1 83  ? -27.770 -29.173 -15.503 1.00 22.56  ? 83  VAL C CG1 1 
ATOM   5774  C  CG2 . VAL C  1 83  ? -26.781 -27.229 -14.199 1.00 22.07  ? 83  VAL C CG2 1 
ATOM   5775  N  N   . LYS C  1 84  ? -31.142 -28.646 -14.589 1.00 30.32  ? 84  LYS C N   1 
ATOM   5776  C  CA  . LYS C  1 84  ? -32.257 -29.511 -15.023 1.00 35.41  ? 84  LYS C CA  1 
ATOM   5777  C  C   . LYS C  1 84  ? -33.312 -28.744 -15.792 1.00 33.37  ? 84  LYS C C   1 
ATOM   5778  O  O   . LYS C  1 84  ? -33.983 -29.291 -16.610 1.00 32.37  ? 84  LYS C O   1 
ATOM   5779  C  CB  . LYS C  1 84  ? -32.885 -30.238 -13.829 1.00 37.52  ? 84  LYS C CB  1 
ATOM   5780  C  CG  . LYS C  1 84  ? -32.077 -31.422 -13.347 1.00 45.69  ? 84  LYS C CG  1 
ATOM   5781  C  CD  . LYS C  1 84  ? -32.675 -32.044 -12.102 1.00 52.98  ? 84  LYS C CD  1 
ATOM   5782  C  CE  . LYS C  1 84  ? -31.777 -33.157 -11.563 1.00 55.34  ? 84  LYS C CE  1 
ATOM   5783  N  NZ  . LYS C  1 84  ? -32.235 -33.647 -10.246 1.00 65.61  ? 84  LYS C NZ  1 
ATOM   5784  N  N   . ALA C  1 85  ? -33.428 -27.461 -15.513 1.00 33.78  ? 85  ALA C N   1 
ATOM   5785  C  CA  . ALA C  1 85  ? -34.441 -26.627 -16.172 1.00 32.38  ? 85  ALA C CA  1 
ATOM   5786  C  C   . ALA C  1 85  ? -33.926 -25.964 -17.466 1.00 31.09  ? 85  ALA C C   1 
ATOM   5787  O  O   . ALA C  1 85  ? -34.687 -25.382 -18.198 1.00 32.68  ? 85  ALA C O   1 
ATOM   5788  C  CB  . ALA C  1 85  ? -34.968 -25.571 -15.211 1.00 28.00  ? 85  ALA C CB  1 
ATOM   5789  N  N   . THR C  1 86  ? -32.619 -26.071 -17.725 1.00 31.79  ? 86  THR C N   1 
ATOM   5790  C  CA  . THR C  1 86  ? -32.015 -25.360 -18.882 1.00 28.73  ? 86  THR C CA  1 
ATOM   5791  C  C   . THR C  1 86  ? -31.154 -26.270 -19.794 1.00 31.26  ? 86  THR C C   1 
ATOM   5792  O  O   . THR C  1 86  ? -31.130 -26.089 -21.014 1.00 31.02  ? 86  THR C O   1 
ATOM   5793  C  CB  . THR C  1 86  ? -31.178 -24.169 -18.429 1.00 27.37  ? 86  THR C CB  1 
ATOM   5794  O  OG1 . THR C  1 86  ? -30.038 -24.632 -17.714 1.00 27.92  ? 86  THR C OG1 1 
ATOM   5795  C  CG2 . THR C  1 86  ? -32.012 -23.240 -17.516 1.00 25.67  ? 86  THR C CG2 1 
ATOM   5796  N  N   . GLY C  1 87  ? -30.454 -27.234 -19.192 1.00 29.99  ? 87  GLY C N   1 
ATOM   5797  C  CA  . GLY C  1 87  ? -29.554 -28.128 -19.962 1.00 28.63  ? 87  GLY C CA  1 
ATOM   5798  C  C   . GLY C  1 87  ? -28.200 -27.495 -20.223 1.00 28.64  ? 87  GLY C C   1 
ATOM   5799  O  O   . GLY C  1 87  ? -27.395 -28.023 -20.973 1.00 29.48  ? 87  GLY C O   1 
ATOM   5800  N  N   . ILE C  1 88  ? -27.965 -26.360 -19.605 1.00 29.50  ? 88  ILE C N   1 
ATOM   5801  C  CA  . ILE C  1 88  ? -26.684 -25.660 -19.716 1.00 26.40  ? 88  ILE C CA  1 
ATOM   5802  C  C   . ILE C  1 88  ? -25.528 -26.504 -19.102 1.00 27.20  ? 88  ILE C C   1 
ATOM   5803  O  O   . ILE C  1 88  ? -25.742 -27.256 -18.180 1.00 27.19  ? 88  ILE C O   1 
ATOM   5804  C  CB  . ILE C  1 88  ? -26.744 -24.285 -18.989 1.00 27.47  ? 88  ILE C CB  1 
ATOM   5805  C  CG1 . ILE C  1 88  ? -25.476 -23.426 -19.289 1.00 28.26  ? 88  ILE C CG1 1 
ATOM   5806  C  CG2 . ILE C  1 88  ? -26.940 -24.483 -17.464 1.00 27.61  ? 88  ILE C CG2 1 
ATOM   5807  C  CD1 . ILE C  1 88  ? -25.371 -22.957 -20.733 1.00 25.48  ? 88  ILE C CD1 1 
ATOM   5808  N  N   . ASN C  1 89  ? -24.309 -26.364 -19.658 1.00 26.17  ? 89  ASN C N   1 
ATOM   5809  C  CA  . ASN C  1 89  ? -23.114 -26.885 -18.991 1.00 24.46  ? 89  ASN C CA  1 
ATOM   5810  C  C   . ASN C  1 89  ? -22.729 -25.907 -17.947 1.00 25.42  ? 89  ASN C C   1 
ATOM   5811  O  O   . ASN C  1 89  ? -22.518 -24.755 -18.239 1.00 22.80  ? 89  ASN C O   1 
ATOM   5812  C  CB  . ASN C  1 89  ? -21.942 -27.047 -19.979 1.00 24.57  ? 89  ASN C CB  1 
ATOM   5813  C  CG  . ASN C  1 89  ? -22.196 -28.144 -21.063 1.00 26.96  ? 89  ASN C CG  1 
ATOM   5814  O  OD1 . ASN C  1 89  ? -22.996 -29.082 -20.866 1.00 29.26  ? 89  ASN C OD1 1 
ATOM   5815  N  ND2 . ASN C  1 89  ? -21.515 -28.022 -22.172 1.00 25.33  ? 89  ASN C ND2 1 
ATOM   5816  N  N   . LEU C  1 90  ? -22.633 -26.358 -16.709 1.00 25.52  ? 90  LEU C N   1 
ATOM   5817  C  CA  . LEU C  1 90  ? -22.328 -25.450 -15.588 1.00 23.72  ? 90  LEU C CA  1 
ATOM   5818  C  C   . LEU C  1 90  ? -21.161 -25.953 -14.771 1.00 23.56  ? 90  LEU C C   1 
ATOM   5819  O  O   . LEU C  1 90  ? -21.204 -27.065 -14.212 1.00 23.13  ? 90  LEU C O   1 
ATOM   5820  C  CB  . LEU C  1 90  ? -23.569 -25.277 -14.692 1.00 24.73  ? 90  LEU C CB  1 
ATOM   5821  C  CG  . LEU C  1 90  ? -23.473 -24.319 -13.529 1.00 26.16  ? 90  LEU C CG  1 
ATOM   5822  C  CD1 . LEU C  1 90  ? -23.471 -22.879 -14.019 1.00 23.41  ? 90  LEU C CD1 1 
ATOM   5823  C  CD2 . LEU C  1 90  ? -24.639 -24.557 -12.577 1.00 26.37  ? 90  LEU C CD2 1 
ATOM   5824  N  N   . VAL C  1 91  ? -20.125 -25.156 -14.693 1.00 21.85  ? 91  VAL C N   1 
ATOM   5825  C  CA  . VAL C  1 91  ? -18.971 -25.497 -13.910 1.00 21.16  ? 91  VAL C CA  1 
ATOM   5826  C  C   . VAL C  1 91  ? -19.003 -24.769 -12.579 1.00 21.48  ? 91  VAL C C   1 
ATOM   5827  O  O   . VAL C  1 91  ? -18.969 -23.529 -12.539 1.00 19.95  ? 91  VAL C O   1 
ATOM   5828  C  CB  . VAL C  1 91  ? -17.678 -25.108 -14.626 1.00 21.58  ? 91  VAL C CB  1 
ATOM   5829  C  CG1 . VAL C  1 91  ? -16.462 -25.704 -13.895 1.00 18.88  ? 91  VAL C CG1 1 
ATOM   5830  C  CG2 . VAL C  1 91  ? -17.717 -25.562 -16.071 1.00 20.06  ? 91  VAL C CG2 1 
ATOM   5831  N  N   . ALA C  1 92  ? -19.069 -25.541 -11.477 1.00 21.79  ? 92  ALA C N   1 
ATOM   5832  C  CA  . ALA C  1 92  ? -18.998 -24.978 -10.122 1.00 21.13  ? 92  ALA C CA  1 
ATOM   5833  C  C   . ALA C  1 92  ? -17.569 -25.015 -9.619  1.00 22.30  ? 92  ALA C C   1 
ATOM   5834  O  O   . ALA C  1 92  ? -16.736 -25.775 -10.133 1.00 21.65  ? 92  ALA C O   1 
ATOM   5835  C  CB  . ALA C  1 92  ? -19.920 -25.749 -9.170  1.00 20.60  ? 92  ALA C CB  1 
ATOM   5836  N  N   . GLY C  1 93  ? -17.274 -24.206 -8.625  1.00 21.57  ? 93  GLY C N   1 
ATOM   5837  C  CA  . GLY C  1 93  ? -15.968 -24.159 -8.088  1.00 20.74  ? 93  GLY C CA  1 
ATOM   5838  C  C   . GLY C  1 93  ? -15.937 -24.241 -6.589  1.00 21.87  ? 93  GLY C C   1 
ATOM   5839  O  O   . GLY C  1 93  ? -16.987 -24.425 -5.926  1.00 20.80  ? 93  GLY C O   1 
ATOM   5840  N  N   . THR C  1 94  ? -14.772 -24.119 -6.048  1.00 21.58  ? 94  THR C N   1 
ATOM   5841  C  CA  . THR C  1 94  ? -14.598 -24.077 -4.651  1.00 22.87  ? 94  THR C CA  1 
ATOM   5842  C  C   . THR C  1 94  ? -13.659 -22.912 -4.326  1.00 24.21  ? 94  THR C C   1 
ATOM   5843  O  O   . THR C  1 94  ? -13.123 -22.277 -5.225  1.00 23.54  ? 94  THR C O   1 
ATOM   5844  C  CB  . THR C  1 94  ? -13.998 -25.403 -4.111  1.00 22.35  ? 94  THR C CB  1 
ATOM   5845  O  OG1 . THR C  1 94  ? -14.067 -25.423 -2.677  1.00 21.84  ? 94  THR C OG1 1 
ATOM   5846  C  CG2 . THR C  1 94  ? -12.520 -25.567 -4.568  1.00 18.63  ? 94  THR C CG2 1 
ATOM   5847  N  N   . GLY C  1 95  ? -13.470 -22.643 -3.057  1.00 25.97  ? 95  GLY C N   1 
ATOM   5848  C  CA  . GLY C  1 95  ? -12.622 -21.548 -2.642  1.00 23.20  ? 95  GLY C CA  1 
ATOM   5849  C  C   . GLY C  1 95  ? -13.256 -20.694 -1.547  1.00 24.89  ? 95  GLY C C   1 
ATOM   5850  O  O   . GLY C  1 95  ? -14.268 -21.060 -0.970  1.00 24.23  ? 95  GLY C O   1 
ATOM   5851  N  N   . ILE C  1 96  ? -12.648 -19.564 -1.275  1.00 25.26  ? 96  ILE C N   1 
ATOM   5852  C  CA  . ILE C  1 96  ? -13.122 -18.671 -0.261  1.00 23.09  ? 96  ILE C CA  1 
ATOM   5853  C  C   . ILE C  1 96  ? -13.032 -17.260 -0.750  1.00 24.38  ? 96  ILE C C   1 
ATOM   5854  O  O   . ILE C  1 96  ? -12.019 -16.853 -1.325  1.00 27.78  ? 96  ILE C O   1 
ATOM   5855  C  CB  . ILE C  1 96  ? -12.300 -18.814 1.046   1.00 22.62  ? 96  ILE C CB  1 
ATOM   5856  C  CG1 . ILE C  1 96  ? -12.505 -20.212 1.655   1.00 21.17  ? 96  ILE C CG1 1 
ATOM   5857  C  CG2 . ILE C  1 96  ? -12.668 -17.718 2.043   1.00 20.78  ? 96  ILE C CG2 1 
ATOM   5858  C  CD1 . ILE C  1 96  ? -11.638 -20.488 2.864   1.00 21.03  ? 96  ILE C CD1 1 
ATOM   5859  N  N   . TYR C  1 97  ? -14.082 -16.513 -0.534  1.00 23.12  ? 97  TYR C N   1 
ATOM   5860  C  CA  . TYR C  1 97  ? -14.160 -15.159 -0.979  1.00 24.34  ? 97  TYR C CA  1 
ATOM   5861  C  C   . TYR C  1 97  ? -14.201 -14.206 0.243   1.00 26.84  ? 97  TYR C C   1 
ATOM   5862  O  O   . TYR C  1 97  ? -15.211 -14.089 0.905   1.00 26.10  ? 97  TYR C O   1 
ATOM   5863  C  CB  . TYR C  1 97  ? -15.407 -14.983 -1.839  1.00 23.95  ? 97  TYR C CB  1 
ATOM   5864  C  CG  . TYR C  1 97  ? -15.616 -13.594 -2.432  1.00 25.80  ? 97  TYR C CG  1 
ATOM   5865  C  CD1 . TYR C  1 97  ? -16.135 -12.544 -1.653  1.00 26.17  ? 97  TYR C CD1 1 
ATOM   5866  C  CD2 . TYR C  1 97  ? -15.333 -13.339 -3.788  1.00 26.05  ? 97  TYR C CD2 1 
ATOM   5867  C  CE1 . TYR C  1 97  ? -16.339 -11.286 -2.198  1.00 29.05  ? 97  TYR C CE1 1 
ATOM   5868  C  CE2 . TYR C  1 97  ? -15.537 -12.078 -4.346  1.00 25.56  ? 97  TYR C CE2 1 
ATOM   5869  C  CZ  . TYR C  1 97  ? -16.033 -11.059 -3.566  1.00 28.48  ? 97  TYR C CZ  1 
ATOM   5870  O  OH  . TYR C  1 97  ? -16.232 -9.822  -4.118  1.00 32.53  ? 97  TYR C OH  1 
ATOM   5871  N  N   . ILE C  1 98  ? -13.069 -13.552 0.519   1.00 26.61  ? 98  ILE C N   1 
ATOM   5872  C  CA  . ILE C  1 98  ? -12.973 -12.583 1.637   1.00 28.24  ? 98  ILE C CA  1 
ATOM   5873  C  C   . ILE C  1 98  ? -12.163 -11.384 1.214   1.00 26.72  ? 98  ILE C C   1 
ATOM   5874  O  O   . ILE C  1 98  ? -11.373 -11.470 0.296   1.00 26.46  ? 98  ILE C O   1 
ATOM   5875  C  CB  . ILE C  1 98  ? -12.297 -13.203 2.875   1.00 28.91  ? 98  ILE C CB  1 
ATOM   5876  C  CG1 . ILE C  1 98  ? -10.884 -13.681 2.523   1.00 28.95  ? 98  ILE C CG1 1 
ATOM   5877  C  CG2 . ILE C  1 98  ? -13.141 -14.353 3.441   1.00 32.72  ? 98  ILE C CG2 1 
ATOM   5878  C  CD1 . ILE C  1 98  ? -9.987  -13.868 3.728   1.00 30.05  ? 98  ILE C CD1 1 
ATOM   5879  N  N   . TYR C  1 99  ? -12.363 -10.253 1.894   1.00 29.34  ? 99  TYR C N   1 
ATOM   5880  C  CA  . TYR C  1 99  ? -11.544 -9.044  1.627   1.00 32.33  ? 99  TYR C CA  1 
ATOM   5881  C  C   . TYR C  1 99  ? -10.553 -8.801  2.715   1.00 31.59  ? 99  TYR C C   1 
ATOM   5882  O  O   . TYR C  1 99  ? -9.444  -8.275  2.464   1.00 32.84  ? 99  TYR C O   1 
ATOM   5883  C  CB  . TYR C  1 99  ? -12.431 -7.785  1.443   1.00 35.86  ? 99  TYR C CB  1 
ATOM   5884  C  CG  . TYR C  1 99  ? -13.287 -7.778  0.168   1.00 41.94  ? 99  TYR C CG  1 
ATOM   5885  C  CD1 . TYR C  1 99  ? -13.050 -8.699  -0.875  1.00 45.04  ? 99  TYR C CD1 1 
ATOM   5886  C  CD2 . TYR C  1 99  ? -14.318 -6.826  -0.003  1.00 46.69  ? 99  TYR C CD2 1 
ATOM   5887  C  CE1 . TYR C  1 99  ? -13.827 -8.686  -2.035  1.00 44.23  ? 99  TYR C CE1 1 
ATOM   5888  C  CE2 . TYR C  1 99  ? -15.102 -6.800  -1.164  1.00 43.83  ? 99  TYR C CE2 1 
ATOM   5889  C  CZ  . TYR C  1 99  ? -14.865 -7.718  -2.172  1.00 46.69  ? 99  TYR C CZ  1 
ATOM   5890  O  OH  . TYR C  1 99  ? -15.629 -7.689  -3.299  1.00 41.14  ? 99  TYR C OH  1 
ATOM   5891  N  N   . ILE C  1 100 ? -10.919 -9.170  3.943   1.00 30.06  ? 100 ILE C N   1 
ATOM   5892  C  CA  . ILE C  1 100 ? -10.070 -8.864  5.117   1.00 30.63  ? 100 ILE C CA  1 
ATOM   5893  C  C   . ILE C  1 100 ? -9.704  -10.100 5.928   1.00 28.67  ? 100 ILE C C   1 
ATOM   5894  O  O   . ILE C  1 100 ? -8.620  -10.581 5.838   1.00 32.92  ? 100 ILE C O   1 
ATOM   5895  C  CB  . ILE C  1 100 ? -10.732 -7.799  6.039   1.00 31.05  ? 100 ILE C CB  1 
ATOM   5896  C  CG1 . ILE C  1 100 ? -11.178 -6.576  5.210   1.00 33.69  ? 100 ILE C CG1 1 
ATOM   5897  C  CG2 . ILE C  1 100 ? -9.777  -7.380  7.146   1.00 32.18  ? 100 ILE C CG2 1 
ATOM   5898  C  CD1 . ILE C  1 100 ? -11.798 -5.448  6.041   1.00 33.53  ? 100 ILE C CD1 1 
ATOM   5899  N  N   . ASP C  1 101 ? -10.632 -10.589 6.715   1.00 28.39  ? 101 ASP C N   1 
ATOM   5900  C  CA  . ASP C  1 101 ? -10.360 -11.743 7.578   1.00 33.33  ? 101 ASP C CA  1 
ATOM   5901  C  C   . ASP C  1 101 ? -11.177 -12.982 7.204   1.00 34.46  ? 101 ASP C C   1 
ATOM   5902  O  O   . ASP C  1 101 ? -12.229 -12.887 6.529   1.00 31.51  ? 101 ASP C O   1 
ATOM   5903  C  CB  . ASP C  1 101 ? -10.607 -11.386 9.060   1.00 37.13  ? 101 ASP C CB  1 
ATOM   5904  C  CG  . ASP C  1 101 ? -9.561  -10.423 9.615   1.00 49.43  ? 101 ASP C CG  1 
ATOM   5905  O  OD1 . ASP C  1 101 ? -8.663  -9.978  8.834   1.00 51.84  ? 101 ASP C OD1 1 
ATOM   5906  O  OD2 . ASP C  1 101 ? -9.629  -10.107 10.824  1.00 56.20  ? 101 ASP C OD2 1 
ATOM   5907  N  N   . LEU C  1 102 ? -10.693 -14.140 7.642   1.00 29.16  ? 102 LEU C N   1 
ATOM   5908  C  CA  . LEU C  1 102 ? -11.401 -15.349 7.510   1.00 29.33  ? 102 LEU C CA  1 
ATOM   5909  C  C   . LEU C  1 102 ? -12.404 -15.503 8.678   1.00 31.35  ? 102 LEU C C   1 
ATOM   5910  O  O   . LEU C  1 102 ? -12.183 -14.968 9.764   1.00 30.21  ? 102 LEU C O   1 
ATOM   5911  C  CB  . LEU C  1 102 ? -10.416 -16.543 7.514   1.00 27.25  ? 102 LEU C CB  1 
ATOM   5912  C  CG  . LEU C  1 102 ? -9.651  -16.811 6.222   1.00 27.85  ? 102 LEU C CG  1 
ATOM   5913  C  CD1 . LEU C  1 102 ? -8.445  -17.696 6.483   1.00 28.12  ? 102 LEU C CD1 1 
ATOM   5914  C  CD2 . LEU C  1 102 ? -10.576 -17.452 5.188   1.00 25.22  ? 102 LEU C CD2 1 
ATOM   5915  N  N   . PRO C  1 103 ? -13.501 -16.226 8.443   1.00 31.84  ? 103 PRO C N   1 
ATOM   5916  C  CA  . PRO C  1 103 ? -14.420 -16.567 9.506   1.00 33.36  ? 103 PRO C CA  1 
ATOM   5917  C  C   . PRO C  1 103 ? -13.657 -17.132 10.715  1.00 33.20  ? 103 PRO C C   1 
ATOM   5918  O  O   . PRO C  1 103 ? -12.595 -17.757 10.543  1.00 34.23  ? 103 PRO C O   1 
ATOM   5919  C  CB  . PRO C  1 103 ? -15.286 -17.660 8.874   1.00 31.66  ? 103 PRO C CB  1 
ATOM   5920  C  CG  . PRO C  1 103 ? -15.310 -17.315 7.420   1.00 30.20  ? 103 PRO C CG  1 
ATOM   5921  C  CD  . PRO C  1 103 ? -13.957 -16.737 7.119   1.00 31.20  ? 103 PRO C CD  1 
ATOM   5922  N  N   . PHE C  1 104 ? -14.200 -16.928 11.924  1.00 30.82  ? 104 PHE C N   1 
ATOM   5923  C  CA  A PHE C  1 104 ? -13.511 -17.361 13.159  0.50 31.85  ? 104 PHE C CA  1 
ATOM   5924  C  CA  B PHE C  1 104 ? -13.530 -17.355 13.166  0.50 31.00  ? 104 PHE C CA  1 
ATOM   5925  C  C   . PHE C  1 104 ? -13.160 -18.850 13.158  1.00 31.91  ? 104 PHE C C   1 
ATOM   5926  O  O   . PHE C  1 104 ? -12.229 -19.276 13.854  1.00 29.64  ? 104 PHE C O   1 
ATOM   5927  C  CB  A PHE C  1 104 ? -14.335 -16.974 14.449  0.50 32.30  ? 104 PHE C CB  1 
ATOM   5928  C  CB  B PHE C  1 104 ? -14.404 -17.020 14.396  0.50 29.79  ? 104 PHE C CB  1 
ATOM   5929  C  CG  A PHE C  1 104 ? -15.620 -17.727 14.601  0.50 32.69  ? 104 PHE C CG  1 
ATOM   5930  C  CG  B PHE C  1 104 ? -14.838 -15.563 14.461  0.50 29.98  ? 104 PHE C CG  1 
ATOM   5931  C  CD1 A PHE C  1 104 ? -16.825 -17.161 14.204  0.50 33.84  ? 104 PHE C CD1 1 
ATOM   5932  C  CD1 B PHE C  1 104 ? -13.904 -14.551 14.684  0.50 29.49  ? 104 PHE C CD1 1 
ATOM   5933  C  CD2 A PHE C  1 104 ? -15.634 -18.999 15.152  0.50 35.36  ? 104 PHE C CD2 1 
ATOM   5934  C  CD2 B PHE C  1 104 ? -16.178 -15.209 14.302  0.50 28.33  ? 104 PHE C CD2 1 
ATOM   5935  C  CE1 A PHE C  1 104 ? -18.020 -17.860 14.351  0.50 31.26  ? 104 PHE C CE1 1 
ATOM   5936  C  CE1 B PHE C  1 104 ? -14.299 -13.228 14.744  0.50 27.77  ? 104 PHE C CE1 1 
ATOM   5937  C  CE2 A PHE C  1 104 ? -16.823 -19.695 15.297  0.50 34.48  ? 104 PHE C CE2 1 
ATOM   5938  C  CE2 B PHE C  1 104 ? -16.569 -13.884 14.363  0.50 27.10  ? 104 PHE C CE2 1 
ATOM   5939  C  CZ  A PHE C  1 104 ? -18.014 -19.120 14.896  0.50 32.88  ? 104 PHE C CZ  1 
ATOM   5940  C  CZ  B PHE C  1 104 ? -15.630 -12.895 14.583  0.50 25.71  ? 104 PHE C CZ  1 
ATOM   5941  N  N   . TYR C  1 105 ? -13.897 -19.646 12.371  1.00 31.83  ? 105 TYR C N   1 
ATOM   5942  C  CA  . TYR C  1 105 ? -13.599 -21.049 12.277  1.00 29.40  ? 105 TYR C CA  1 
ATOM   5943  C  C   . TYR C  1 105 ? -12.128 -21.257 12.008  1.00 32.00  ? 105 TYR C C   1 
ATOM   5944  O  O   . TYR C  1 105 ? -11.527 -22.233 12.481  1.00 29.86  ? 105 TYR C O   1 
ATOM   5945  C  CB  . TYR C  1 105 ? -14.417 -21.731 11.153  1.00 29.26  ? 105 TYR C CB  1 
ATOM   5946  C  CG  . TYR C  1 105 ? -13.917 -23.162 10.853  1.00 27.50  ? 105 TYR C CG  1 
ATOM   5947  C  CD1 . TYR C  1 105 ? -14.243 -24.214 11.690  1.00 29.82  ? 105 TYR C CD1 1 
ATOM   5948  C  CD2 . TYR C  1 105 ? -13.091 -23.431 9.733   1.00 27.44  ? 105 TYR C CD2 1 
ATOM   5949  C  CE1 . TYR C  1 105 ? -13.784 -25.514 11.441  1.00 29.89  ? 105 TYR C CE1 1 
ATOM   5950  C  CE2 . TYR C  1 105 ? -12.628 -24.720 9.474   1.00 26.36  ? 105 TYR C CE2 1 
ATOM   5951  C  CZ  . TYR C  1 105 ? -12.982 -25.762 10.342  1.00 27.53  ? 105 TYR C CZ  1 
ATOM   5952  O  OH  . TYR C  1 105 ? -12.543 -27.026 10.110  1.00 29.73  ? 105 TYR C OH  1 
ATOM   5953  N  N   . PHE C  1 106 ? -11.532 -20.330 11.246  1.00 30.28  ? 106 PHE C N   1 
ATOM   5954  C  CA  . PHE C  1 106 ? -10.150 -20.511 10.740  1.00 30.39  ? 106 PHE C CA  1 
ATOM   5955  C  C   . PHE C  1 106 ? -9.032  -20.021 11.699  1.00 32.46  ? 106 PHE C C   1 
ATOM   5956  O  O   . PHE C  1 106 ? -7.872  -20.152 11.398  1.00 32.48  ? 106 PHE C O   1 
ATOM   5957  C  CB  . PHE C  1 106 ? -9.997  -19.870 9.363   1.00 29.94  ? 106 PHE C CB  1 
ATOM   5958  C  CG  . PHE C  1 106 ? -10.848 -20.506 8.311   1.00 29.18  ? 106 PHE C CG  1 
ATOM   5959  C  CD1 . PHE C  1 106 ? -12.061 -19.961 7.966   1.00 27.99  ? 106 PHE C CD1 1 
ATOM   5960  C  CD2 . PHE C  1 106 ? -10.437 -21.663 7.677   1.00 28.18  ? 106 PHE C CD2 1 
ATOM   5961  C  CE1 . PHE C  1 106 ? -12.848 -20.551 7.002   1.00 27.31  ? 106 PHE C CE1 1 
ATOM   5962  C  CE2 . PHE C  1 106 ? -11.227 -22.253 6.709   1.00 29.41  ? 106 PHE C CE2 1 
ATOM   5963  C  CZ  . PHE C  1 106 ? -12.424 -21.698 6.376   1.00 25.84  ? 106 PHE C CZ  1 
ATOM   5964  N  N   . LEU C  1 107 ? -9.410  -19.463 12.835  1.00 33.29  ? 107 LEU C N   1 
ATOM   5965  C  CA  . LEU C  1 107 ? -8.421  -19.091 13.834  1.00 40.13  ? 107 LEU C CA  1 
ATOM   5966  C  C   . LEU C  1 107 ? -7.585  -20.285 14.202  1.00 39.40  ? 107 LEU C C   1 
ATOM   5967  O  O   . LEU C  1 107 ? -8.113  -21.329 14.563  1.00 39.34  ? 107 LEU C O   1 
ATOM   5968  C  CB  . LEU C  1 107 ? -9.094  -18.507 15.091  1.00 45.61  ? 107 LEU C CB  1 
ATOM   5969  C  CG  . LEU C  1 107 ? -9.047  -16.989 15.240  1.00 56.09  ? 107 LEU C CG  1 
ATOM   5970  C  CD1 . LEU C  1 107 ? -7.585  -16.500 15.331  1.00 53.02  ? 107 LEU C CD1 1 
ATOM   5971  C  CD2 . LEU C  1 107 ? -9.784  -16.295 14.101  1.00 57.44  ? 107 LEU C CD2 1 
ATOM   5972  N  N   . ASN C  1 108 ? -6.283  -20.139 14.103  1.00 41.28  ? 108 ASN C N   1 
ATOM   5973  C  CA  . ASN C  1 108 ? -5.354  -21.228 14.469  1.00 42.49  ? 108 ASN C CA  1 
ATOM   5974  C  C   . ASN C  1 108 ? -5.439  -22.442 13.535  1.00 45.33  ? 108 ASN C C   1 
ATOM   5975  O  O   . ASN C  1 108 ? -5.181  -23.574 13.947  1.00 47.62  ? 108 ASN C O   1 
ATOM   5976  C  CB  . ASN C  1 108 ? -5.584  -21.662 15.907  1.00 46.39  ? 108 ASN C CB  1 
ATOM   5977  C  CG  . ASN C  1 108 ? -5.278  -20.587 16.878  1.00 55.07  ? 108 ASN C CG  1 
ATOM   5978  O  OD1 . ASN C  1 108 ? -4.309  -19.845 16.714  1.00 66.07  ? 108 ASN C OD1 1 
ATOM   5979  N  ND2 . ASN C  1 108 ? -6.091  -20.478 17.911  1.00 56.27  ? 108 ASN C ND2 1 
ATOM   5980  N  N   . ARG C  1 109 ? -5.801  -22.204 12.298  1.00 42.44  ? 109 ARG C N   1 
ATOM   5981  C  CA  . ARG C  1 109 ? -5.808  -23.248 11.328  1.00 37.44  ? 109 ARG C CA  1 
ATOM   5982  C  C   . ARG C  1 109 ? -4.830  -22.944 10.240  1.00 38.43  ? 109 ARG C C   1 
ATOM   5983  O  O   . ARG C  1 109 ? -4.664  -21.818 9.865   1.00 41.61  ? 109 ARG C O   1 
ATOM   5984  C  CB  . ARG C  1 109 ? -7.211  -23.462 10.774  1.00 38.76  ? 109 ARG C CB  1 
ATOM   5985  C  CG  . ARG C  1 109 ? -8.159  -24.062 11.796  1.00 42.05  ? 109 ARG C CG  1 
ATOM   5986  C  CD  . ARG C  1 109 ? -9.351  -24.676 11.160  1.00 43.04  ? 109 ARG C CD  1 
ATOM   5987  N  NE  . ARG C  1 109 ? -9.840  -25.814 11.945  1.00 56.53  ? 109 ARG C NE  1 
ATOM   5988  C  CZ  . ARG C  1 109 ? -10.733 -25.724 12.906  1.00 49.48  ? 109 ARG C CZ  1 
ATOM   5989  N  NH1 . ARG C  1 109 ? -11.246 -24.572 13.210  1.00 56.67  ? 109 ARG C NH1 1 
ATOM   5990  N  NH2 . ARG C  1 109 ? -11.108 -26.795 13.556  1.00 45.43  ? 109 ARG C NH2 1 
ATOM   5991  N  N   . SER C  1 110 ? -4.165  -23.973 9.746   1.00 35.59  ? 110 SER C N   1 
ATOM   5992  C  CA  . SER C  1 110 ? -3.085  -23.792 8.794   1.00 37.32  ? 110 SER C CA  1 
ATOM   5993  C  C   . SER C  1 110 ? -3.589  -23.614 7.377   1.00 36.24  ? 110 SER C C   1 
ATOM   5994  O  O   . SER C  1 110 ? -4.744  -23.910 7.071   1.00 32.43  ? 110 SER C O   1 
ATOM   5995  C  CB  . SER C  1 110 ? -2.122  -24.969 8.853   1.00 36.24  ? 110 SER C CB  1 
ATOM   5996  O  OG  . SER C  1 110 ? -2.776  -26.178 8.487   1.00 42.18  ? 110 SER C OG  1 
ATOM   5997  N  N   . ILE C  1 111 ? -2.716  -23.133 6.521   1.00 33.87  ? 111 ILE C N   1 
ATOM   5998  C  CA  . ILE C  1 111 ? -3.002  -23.003 5.145   1.00 35.98  ? 111 ILE C CA  1 
ATOM   5999  C  C   . ILE C  1 111 ? -3.403  -24.373 4.545   1.00 36.46  ? 111 ILE C C   1 
ATOM   6000  O  O   . ILE C  1 111 ? -4.260  -24.449 3.639   1.00 41.19  ? 111 ILE C O   1 
ATOM   6001  C  CB  . ILE C  1 111 ? -1.786  -22.435 4.384   1.00 35.77  ? 111 ILE C CB  1 
ATOM   6002  C  CG1 . ILE C  1 111 ? -1.543  -20.964 4.791   1.00 35.39  ? 111 ILE C CG1 1 
ATOM   6003  C  CG2 . ILE C  1 111 ? -1.988  -22.553 2.888   1.00 36.93  ? 111 ILE C CG2 1 
ATOM   6004  C  CD1 . ILE C  1 111 ? -0.208  -20.401 4.317   1.00 38.06  ? 111 ILE C CD1 1 
ATOM   6005  N  N   . ASP C  1 112 ? -2.798  -25.439 5.067   1.00 32.36  ? 112 ASP C N   1 
ATOM   6006  C  CA  . ASP C  1 112 ? -3.080  -26.833 4.595   1.00 36.12  ? 112 ASP C CA  1 
ATOM   6007  C  C   . ASP C  1 112 ? -4.513  -27.284 4.883   1.00 34.03  ? 112 ASP C C   1 
ATOM   6008  O  O   . ASP C  1 112 ? -5.141  -27.938 4.050   1.00 32.28  ? 112 ASP C O   1 
ATOM   6009  C  CB  . ASP C  1 112 ? -2.092  -27.811 5.211   1.00 39.06  ? 112 ASP C CB  1 
ATOM   6010  C  CG  . ASP C  1 112 ? -0.703  -27.630 4.684   1.00 45.52  ? 112 ASP C CG  1 
ATOM   6011  O  OD1 . ASP C  1 112 ? -0.500  -27.826 3.485   1.00 45.68  ? 112 ASP C OD1 1 
ATOM   6012  O  OD2 . ASP C  1 112 ? 0.195   -27.292 5.477   1.00 58.78  ? 112 ASP C OD2 1 
ATOM   6013  N  N   . GLU C  1 113 ? -5.025  -26.943 6.073   1.00 30.80  ? 113 GLU C N   1 
ATOM   6014  C  CA  . GLU C  1 113 ? -6.425  -27.289 6.431   1.00 33.18  ? 113 GLU C CA  1 
ATOM   6015  C  C   . GLU C  1 113 ? -7.383  -26.606 5.506   1.00 28.89  ? 113 GLU C C   1 
ATOM   6016  O  O   . GLU C  1 113 ? -8.405  -27.136 5.183   1.00 28.46  ? 113 GLU C O   1 
ATOM   6017  C  CB  . GLU C  1 113 ? -6.732  -26.912 7.884   1.00 34.29  ? 113 GLU C CB  1 
ATOM   6018  C  CG  . GLU C  1 113 ? -5.940  -27.706 8.903   1.00 39.10  ? 113 GLU C CG  1 
ATOM   6019  C  CD  . GLU C  1 113 ? -6.246  -27.292 10.338  1.00 45.26  ? 113 GLU C CD  1 
ATOM   6020  O  OE1 . GLU C  1 113 ? -5.312  -26.895 11.049  1.00 48.85  ? 113 GLU C OE1 1 
ATOM   6021  O  OE2 . GLU C  1 113 ? -7.426  -27.360 10.742  1.00 48.02  ? 113 GLU C OE2 1 
ATOM   6022  N  N   . ILE C  1 114 ? -7.026  -25.402 5.074   1.00 29.09  ? 114 ILE C N   1 
ATOM   6023  C  CA  . ILE C  1 114 ? -7.835  -24.677 4.143   1.00 28.78  ? 114 ILE C CA  1 
ATOM   6024  C  C   . ILE C  1 114 ? -7.808  -25.372 2.759   1.00 27.39  ? 114 ILE C C   1 
ATOM   6025  O  O   . ILE C  1 114 ? -8.846  -25.555 2.129   1.00 26.92  ? 114 ILE C O   1 
ATOM   6026  C  CB  . ILE C  1 114 ? -7.377  -23.206 4.010   1.00 28.41  ? 114 ILE C CB  1 
ATOM   6027  C  CG1 . ILE C  1 114 ? -7.499  -22.488 5.366   1.00 28.31  ? 114 ILE C CG1 1 
ATOM   6028  C  CG2 . ILE C  1 114 ? -8.187  -22.490 2.947   1.00 25.20  ? 114 ILE C CG2 1 
ATOM   6029  C  CD1 . ILE C  1 114 ? -6.970  -21.044 5.360   1.00 29.39  ? 114 ILE C CD1 1 
ATOM   6030  N  N   . ALA C  1 115 ? -6.624  -25.763 2.322   1.00 26.26  ? 115 ALA C N   1 
ATOM   6031  C  CA  . ALA C  1 115 ? -6.478  -26.457 1.048   1.00 28.18  ? 115 ALA C CA  1 
ATOM   6032  C  C   . ALA C  1 115 ? -7.281  -27.739 1.040   1.00 28.30  ? 115 ALA C C   1 
ATOM   6033  O  O   . ALA C  1 115 ? -7.921  -28.070 0.044   1.00 32.49  ? 115 ALA C O   1 
ATOM   6034  C  CB  . ALA C  1 115 ? -5.012  -26.740 0.756   1.00 26.72  ? 115 ALA C CB  1 
ATOM   6035  N  N   . ASP C  1 116 ? -7.246  -28.472 2.161   1.00 27.79  ? 116 ASP C N   1 
ATOM   6036  C  CA  . ASP C  1 116 ? -8.028  -29.728 2.292   1.00 26.99  ? 116 ASP C CA  1 
ATOM   6037  C  C   . ASP C  1 116 ? -9.481  -29.490 2.006   1.00 26.32  ? 116 ASP C C   1 
ATOM   6038  O  O   . ASP C  1 116 ? -10.160 -30.354 1.468   1.00 27.09  ? 116 ASP C O   1 
ATOM   6039  C  CB  . ASP C  1 116 ? -7.871  -30.321 3.682   1.00 30.59  ? 116 ASP C CB  1 
ATOM   6040  C  CG  . ASP C  1 116 ? -6.488  -30.877 3.925   1.00 36.99  ? 116 ASP C CG  1 
ATOM   6041  O  OD1 . ASP C  1 116 ? -6.187  -31.232 5.086   1.00 38.87  ? 116 ASP C OD1 1 
ATOM   6042  O  OD2 . ASP C  1 116 ? -5.702  -30.960 2.966   1.00 37.18  ? 116 ASP C OD2 1 
ATOM   6043  N  N   . LEU C  1 117 ? -9.974  -28.314 2.377   1.00 25.14  ? 117 LEU C N   1 
ATOM   6044  C  CA  . LEU C  1 117 ? -11.367 -27.962 2.098   1.00 24.40  ? 117 LEU C CA  1 
ATOM   6045  C  C   . LEU C  1 117 ? -11.593 -27.872 0.605   1.00 24.47  ? 117 LEU C C   1 
ATOM   6046  O  O   . LEU C  1 117 ? -12.585 -28.401 0.080   1.00 23.42  ? 117 LEU C O   1 
ATOM   6047  C  CB  . LEU C  1 117 ? -11.747 -26.632 2.775   1.00 24.90  ? 117 LEU C CB  1 
ATOM   6048  C  CG  . LEU C  1 117 ? -11.798 -26.621 4.319   1.00 25.43  ? 117 LEU C CG  1 
ATOM   6049  C  CD1 . LEU C  1 117 ? -12.260 -25.253 4.844   1.00 24.04  ? 117 LEU C CD1 1 
ATOM   6050  C  CD2 . LEU C  1 117 ? -12.698 -27.745 4.849   1.00 27.12  ? 117 LEU C CD2 1 
ATOM   6051  N  N   . PHE C  1 118 ? -10.665 -27.198 -0.100  1.00 23.10  ? 118 PHE C N   1 
ATOM   6052  C  CA  . PHE C  1 118 ? -10.765 -27.067 -1.542  1.00 23.78  ? 118 PHE C CA  1 
ATOM   6053  C  C   . PHE C  1 118 ? -10.617 -28.409 -2.207  1.00 25.15  ? 118 PHE C C   1 
ATOM   6054  O  O   . PHE C  1 118 ? -11.358 -28.740 -3.122  1.00 24.78  ? 118 PHE C O   1 
ATOM   6055  C  CB  . PHE C  1 118 ? -9.699  -26.087 -2.093  1.00 22.86  ? 118 PHE C CB  1 
ATOM   6056  C  CG  . PHE C  1 118 ? -9.773  -24.706 -1.498  1.00 24.04  ? 118 PHE C CG  1 
ATOM   6057  C  CD1 . PHE C  1 118 ? -10.927 -24.275 -0.821  1.00 22.48  ? 118 PHE C CD1 1 
ATOM   6058  C  CD2 . PHE C  1 118 ? -8.689  -23.805 -1.633  1.00 24.22  ? 118 PHE C CD2 1 
ATOM   6059  C  CE1 . PHE C  1 118 ? -10.992 -22.993 -0.277  1.00 24.16  ? 118 PHE C CE1 1 
ATOM   6060  C  CE2 . PHE C  1 118 ? -8.756  -22.504 -1.086  1.00 20.87  ? 118 PHE C CE2 1 
ATOM   6061  C  CZ  . PHE C  1 118 ? -9.886  -22.100 -0.416  1.00 23.10  ? 118 PHE C CZ  1 
ATOM   6062  N  N   . ILE C  1 119 ? -9.652  -29.182 -1.746  1.00 26.42  ? 119 ILE C N   1 
ATOM   6063  C  CA  . ILE C  1 119 ? -9.394  -30.464 -2.309  1.00 25.87  ? 119 ILE C CA  1 
ATOM   6064  C  C   . ILE C  1 119 ? -10.604 -31.416 -2.096  1.00 26.32  ? 119 ILE C C   1 
ATOM   6065  O  O   . ILE C  1 119 ? -10.937 -32.217 -2.974  1.00 28.18  ? 119 ILE C O   1 
ATOM   6066  C  CB  . ILE C  1 119 ? -8.106  -31.077 -1.737  1.00 29.11  ? 119 ILE C CB  1 
ATOM   6067  C  CG1 . ILE C  1 119 ? -6.868  -30.280 -2.246  1.00 29.38  ? 119 ILE C CG1 1 
ATOM   6068  C  CG2 . ILE C  1 119 ? -7.992  -32.556 -2.118  1.00 31.98  ? 119 ILE C CG2 1 
ATOM   6069  C  CD1 . ILE C  1 119 ? -5.598  -30.527 -1.443  1.00 26.91  ? 119 ILE C CD1 1 
ATOM   6070  N  N   . HIS C  1 120 ? -11.251 -31.310 -0.942  1.00 25.35  ? 120 HIS C N   1 
ATOM   6071  C  CA  . HIS C  1 120 ? -12.461 -32.104 -0.681  1.00 24.71  ? 120 HIS C CA  1 
ATOM   6072  C  C   . HIS C  1 120 ? -13.536 -31.845 -1.757  1.00 24.53  ? 120 HIS C C   1 
ATOM   6073  O  O   . HIS C  1 120 ? -14.131 -32.769 -2.276  1.00 25.41  ? 120 HIS C O   1 
ATOM   6074  C  CB  . HIS C  1 120 ? -13.016 -31.813 0.705   1.00 24.92  ? 120 HIS C CB  1 
ATOM   6075  C  CG  . HIS C  1 120 ? -14.398 -32.464 0.975   1.00 25.87  ? 120 HIS C CG  1 
ATOM   6076  N  ND1 . HIS C  1 120 ? -14.544 -33.612 1.697   1.00 24.90  ? 120 HIS C ND1 1 
ATOM   6077  C  CD2 . HIS C  1 120 ? -15.699 -32.080 0.584   1.00 24.23  ? 120 HIS C CD2 1 
ATOM   6078  C  CE1 . HIS C  1 120 ? -15.855 -33.936 1.764   1.00 24.94  ? 120 HIS C CE1 1 
ATOM   6079  N  NE2 . HIS C  1 120 ? -16.559 -33.007 1.087   1.00 24.02  ? 120 HIS C NE2 1 
ATOM   6080  N  N   . ASP C  1 121 ? -13.763 -30.562 -2.080  1.00 21.79  ? 121 ASP C N   1 
ATOM   6081  C  CA  . ASP C  1 121 ? -14.806 -30.181 -3.077  1.00 22.24  ? 121 ASP C CA  1 
ATOM   6082  C  C   . ASP C  1 121 ? -14.463 -30.667 -4.468  1.00 21.29  ? 121 ASP C C   1 
ATOM   6083  O  O   . ASP C  1 121 ? -15.355 -30.994 -5.268  1.00 20.63  ? 121 ASP C O   1 
ATOM   6084  C  CB  . ASP C  1 121 ? -15.002 -28.658 -3.105  1.00 20.15  ? 121 ASP C CB  1 
ATOM   6085  C  CG  . ASP C  1 121 ? -15.749 -28.128 -1.872  1.00 22.90  ? 121 ASP C CG  1 
ATOM   6086  O  OD1 . ASP C  1 121 ? -16.260 -28.943 -1.084  1.00 22.55  ? 121 ASP C OD1 1 
ATOM   6087  O  OD2 . ASP C  1 121 ? -15.822 -26.862 -1.709  1.00 20.65  ? 121 ASP C OD2 1 
ATOM   6088  N  N   . ILE C  1 122 ? -13.195 -30.707 -4.766  1.00 20.92  ? 122 ILE C N   1 
ATOM   6089  C  CA  . ILE C  1 122 ? -12.737 -31.081 -6.099  1.00 23.80  ? 122 ILE C CA  1 
ATOM   6090  C  C   . ILE C  1 122 ? -12.738 -32.599 -6.296  1.00 25.60  ? 122 ILE C C   1 
ATOM   6091  O  O   . ILE C  1 122 ? -13.153 -33.103 -7.359  1.00 27.52  ? 122 ILE C O   1 
ATOM   6092  C  CB  . ILE C  1 122 ? -11.337 -30.538 -6.368  1.00 23.50  ? 122 ILE C CB  1 
ATOM   6093  C  CG1 . ILE C  1 122 ? -11.345 -28.993 -6.297  1.00 23.05  ? 122 ILE C CG1 1 
ATOM   6094  C  CG2 . ILE C  1 122 ? -10.824 -31.026 -7.715  1.00 22.86  ? 122 ILE C CG2 1 
ATOM   6095  C  CD1 . ILE C  1 122 ? -9.973  -28.377 -6.181  1.00 24.37  ? 122 ILE C CD1 1 
ATOM   6096  N  N   . LYS C  1 123 ? -12.292 -33.326 -5.272  1.00 28.05  ? 123 LYS C N   1 
ATOM   6097  C  CA  . LYS C  1 123 ? -12.122 -34.805 -5.371  1.00 30.63  ? 123 LYS C CA  1 
ATOM   6098  C  C   . LYS C  1 123 ? -13.334 -35.615 -4.837  1.00 29.76  ? 123 LYS C C   1 
ATOM   6099  O  O   . LYS C  1 123 ? -13.646 -36.650 -5.351  1.00 28.80  ? 123 LYS C O   1 
ATOM   6100  C  CB  . LYS C  1 123 ? -10.835 -35.244 -4.660  1.00 32.25  ? 123 LYS C CB  1 
ATOM   6101  C  CG  . LYS C  1 123 ? -9.575  -34.656 -5.262  1.00 39.00  ? 123 LYS C CG  1 
ATOM   6102  C  CD  . LYS C  1 123 ? -8.353  -34.996 -4.434  1.00 46.18  ? 123 LYS C CD  1 
ATOM   6103  C  CE  . LYS C  1 123 ? -8.057  -36.475 -4.465  1.00 54.06  ? 123 LYS C CE  1 
ATOM   6104  N  NZ  . LYS C  1 123 ? -6.866  -36.820 -3.633  1.00 58.60  ? 123 LYS C NZ  1 
ATOM   6105  N  N   . GLU C  1 124 ? -13.988 -35.103 -3.792  1.00 29.22  ? 124 GLU C N   1 
ATOM   6106  C  CA  . GLU C  1 124 ? -15.121 -35.825 -3.158  1.00 30.50  ? 124 GLU C CA  1 
ATOM   6107  C  C   . GLU C  1 124 ? -16.461 -35.331 -3.657  1.00 29.54  ? 124 GLU C C   1 
ATOM   6108  O  O   . GLU C  1 124 ? -17.293 -36.102 -4.047  1.00 33.58  ? 124 GLU C O   1 
ATOM   6109  C  CB  . GLU C  1 124 ? -15.056 -35.704 -1.609  1.00 31.38  ? 124 GLU C CB  1 
ATOM   6110  C  CG  . GLU C  1 124 ? -13.760 -36.182 -1.000  1.00 39.86  ? 124 GLU C CG  1 
ATOM   6111  C  CD  . GLU C  1 124 ? -13.590 -37.700 -1.090  1.00 49.40  ? 124 GLU C CD  1 
ATOM   6112  O  OE1 . GLU C  1 124 ? -14.530 -38.447 -0.667  1.00 53.88  ? 124 GLU C OE1 1 
ATOM   6113  O  OE2 . GLU C  1 124 ? -12.536 -38.147 -1.569  1.00 53.58  ? 124 GLU C OE2 1 
ATOM   6114  N  N   . GLY C  1 125 ? -16.654 -34.025 -3.626  1.00 26.99  ? 125 GLY C N   1 
ATOM   6115  C  CA  . GLY C  1 125 ? -17.908 -33.438 -4.045  1.00 25.48  ? 125 GLY C CA  1 
ATOM   6116  C  C   . GLY C  1 125 ? -18.299 -32.217 -3.194  1.00 26.58  ? 125 GLY C C   1 
ATOM   6117  O  O   . GLY C  1 125 ? -17.746 -31.992 -2.123  1.00 25.57  ? 125 GLY C O   1 
ATOM   6118  N  N   . ILE C  1 126 ? -19.253 -31.459 -3.680  1.00 26.58  ? 126 ILE C N   1 
ATOM   6119  C  CA  . ILE C  1 126 ? -19.644 -30.222 -3.041  1.00 25.12  ? 126 ILE C CA  1 
ATOM   6120  C  C   . ILE C  1 126 ? -20.901 -30.382 -2.169  1.00 24.30  ? 126 ILE C C   1 
ATOM   6121  O  O   . ILE C  1 126 ? -21.952 -30.890 -2.635  1.00 23.29  ? 126 ILE C O   1 
ATOM   6122  C  CB  . ILE C  1 126 ? -19.872 -29.095 -4.093  1.00 21.65  ? 126 ILE C CB  1 
ATOM   6123  C  CG1 . ILE C  1 126 ? -18.558 -28.755 -4.793  1.00 21.70  ? 126 ILE C CG1 1 
ATOM   6124  C  CG2 . ILE C  1 126 ? -20.458 -27.852 -3.430  1.00 21.43  ? 126 ILE C CG2 1 
ATOM   6125  C  CD1 . ILE C  1 126 ? -18.733 -27.973 -6.079  1.00 23.45  ? 126 ILE C CD1 1 
ATOM   6126  N  N   . GLN C  1 127 ? -20.784 -29.958 -0.900  1.00 24.92  ? 127 GLN C N   1 
ATOM   6127  C  CA  . GLN C  1 127 ? -21.927 -29.935 0.046   1.00 23.55  ? 127 GLN C CA  1 
ATOM   6128  C  C   . GLN C  1 127 ? -22.688 -31.235 0.108   1.00 27.18  ? 127 GLN C C   1 
ATOM   6129  O  O   . GLN C  1 127 ? -23.964 -31.254 0.052   1.00 28.36  ? 127 GLN C O   1 
ATOM   6130  C  CB  . GLN C  1 127 ? -22.877 -28.758 -0.282  1.00 22.17  ? 127 GLN C CB  1 
ATOM   6131  C  CG  . GLN C  1 127 ? -22.200 -27.404 -0.197  1.00 22.80  ? 127 GLN C CG  1 
ATOM   6132  C  CD  . GLN C  1 127 ? -23.106 -26.247 -0.628  1.00 27.36  ? 127 GLN C CD  1 
ATOM   6133  O  OE1 . GLN C  1 127 ? -23.185 -25.212 0.055   1.00 34.49  ? 127 GLN C OE1 1 
ATOM   6134  N  NE2 . GLN C  1 127 ? -23.766 -26.408 -1.720  1.00 25.17  ? 127 GLN C NE2 1 
ATOM   6135  N  N   . GLY C  1 128 ? -21.959 -32.326 0.225   1.00 25.63  ? 128 GLY C N   1 
ATOM   6136  C  CA  . GLY C  1 128 ? -22.574 -33.629 0.420   1.00 25.49  ? 128 GLY C CA  1 
ATOM   6137  C  C   . GLY C  1 128 ? -23.054 -34.302 -0.853  1.00 25.38  ? 128 GLY C C   1 
ATOM   6138  O  O   . GLY C  1 128 ? -23.649 -35.362 -0.802  1.00 26.36  ? 128 GLY C O   1 
ATOM   6139  N  N   . THR C  1 129 ? -22.795 -33.672 -2.007  1.00 24.37  ? 129 THR C N   1 
ATOM   6140  C  CA  . THR C  1 129 ? -23.188 -34.263 -3.313  1.00 24.45  ? 129 THR C CA  1 
ATOM   6141  C  C   . THR C  1 129 ? -21.991 -34.747 -4.056  1.00 26.13  ? 129 THR C C   1 
ATOM   6142  O  O   . THR C  1 129 ? -20.830 -34.521 -3.626  1.00 22.54  ? 129 THR C O   1 
ATOM   6143  C  CB  . THR C  1 129 ? -23.945 -33.236 -4.217  1.00 25.89  ? 129 THR C CB  1 
ATOM   6144  O  OG1 . THR C  1 129 ? -23.018 -32.302 -4.758  1.00 27.45  ? 129 THR C OG1 1 
ATOM   6145  C  CG2 . THR C  1 129 ? -25.047 -32.486 -3.415  1.00 25.27  ? 129 THR C CG2 1 
ATOM   6146  N  N   . LEU C  1 130 ? -22.227 -35.404 -5.185  1.00 27.71  ? 130 LEU C N   1 
ATOM   6147  C  CA  . LEU C  1 130 ? -21.150 -35.901 -5.996  1.00 30.51  ? 130 LEU C CA  1 
ATOM   6148  C  C   . LEU C  1 130 ? -20.719 -34.881 -7.107  1.00 33.34  ? 130 LEU C C   1 
ATOM   6149  O  O   . LEU C  1 130 ? -19.799 -35.147 -7.868  1.00 32.74  ? 130 LEU C O   1 
ATOM   6150  C  CB  . LEU C  1 130 ? -21.502 -37.266 -6.599  1.00 28.10  ? 130 LEU C CB  1 
ATOM   6151  C  CG  . LEU C  1 130 ? -21.588 -38.423 -5.547  1.00 31.25  ? 130 LEU C CG  1 
ATOM   6152  C  CD1 . LEU C  1 130 ? -22.045 -39.747 -6.185  1.00 30.51  ? 130 LEU C CD1 1 
ATOM   6153  C  CD2 . LEU C  1 130 ? -20.267 -38.595 -4.837  1.00 32.69  ? 130 LEU C CD2 1 
ATOM   6154  N  N   . ASN C  1 131 ? -21.410 -33.716 -7.168  1.00 28.11  ? 131 ASN C N   1 
ATOM   6155  C  CA  . ASN C  1 131 ? -20.989 -32.632 -8.071  1.00 27.24  ? 131 ASN C CA  1 
ATOM   6156  C  C   . ASN C  1 131 ? -19.675 -32.113 -7.615  1.00 28.68  ? 131 ASN C C   1 
ATOM   6157  O  O   . ASN C  1 131 ? -19.522 -31.724 -6.446  1.00 28.60  ? 131 ASN C O   1 
ATOM   6158  C  CB  . ASN C  1 131 ? -22.013 -31.501 -8.077  1.00 26.19  ? 131 ASN C CB  1 
ATOM   6159  C  CG  . ASN C  1 131 ? -23.370 -31.949 -8.537  1.00 28.93  ? 131 ASN C CG  1 
ATOM   6160  O  OD1 . ASN C  1 131 ? -24.348 -31.949 -7.749  1.00 29.89  ? 131 ASN C OD1 1 
ATOM   6161  N  ND2 . ASN C  1 131 ? -23.469 -32.340 -9.805  1.00 23.05  ? 131 ASN C ND2 1 
ATOM   6162  N  N   . LYS C  1 132 ? -18.713 -32.098 -8.493  1.00 26.23  ? 132 LYS C N   1 
ATOM   6163  C  CA  . LYS C  1 132 ? -17.336 -31.707 -8.101  1.00 27.18  ? 132 LYS C CA  1 
ATOM   6164  C  C   . LYS C  1 132 ? -16.926 -30.327 -8.609  1.00 24.77  ? 132 LYS C C   1 
ATOM   6165  O  O   . LYS C  1 132 ? -17.402 -29.870 -9.617  1.00 23.65  ? 132 LYS C O   1 
ATOM   6166  C  CB  . LYS C  1 132 ? -16.344 -32.763 -8.545  1.00 27.65  ? 132 LYS C CB  1 
ATOM   6167  C  CG  . LYS C  1 132 ? -16.523 -34.109 -7.804  1.00 32.26  ? 132 LYS C CG  1 
ATOM   6168  C  CD  . LYS C  1 132 ? -15.711 -35.188 -8.425  1.00 37.74  ? 132 LYS C CD  1 
ATOM   6169  C  CE  . LYS C  1 132 ? -15.853 -36.480 -7.657  1.00 42.04  ? 132 LYS C CE  1 
ATOM   6170  N  NZ  . LYS C  1 132 ? -17.263 -36.856 -7.490  1.00 42.14  ? 132 LYS C NZ  1 
ATOM   6171  N  N   . ALA C  1 133 ? -16.033 -29.679 -7.867  1.00 25.11  ? 133 ALA C N   1 
ATOM   6172  C  CA  . ALA C  1 133 ? -15.533 -28.356 -8.227  1.00 23.99  ? 133 ALA C CA  1 
ATOM   6173  C  C   . ALA C  1 133 ? -14.534 -28.466 -9.321  1.00 23.32  ? 133 ALA C C   1 
ATOM   6174  O  O   . ALA C  1 133 ? -13.694 -29.350 -9.306  1.00 23.77  ? 133 ALA C O   1 
ATOM   6175  C  CB  . ALA C  1 133 ? -14.906 -27.667 -6.991  1.00 19.65  ? 133 ALA C CB  1 
ATOM   6176  N  N   . GLY C  1 134 ? -14.609 -27.557 -10.288 1.00 22.55  ? 134 GLY C N   1 
ATOM   6177  C  CA  . GLY C  1 134 ? -13.708 -27.600 -11.448 1.00 20.14  ? 134 GLY C CA  1 
ATOM   6178  C  C   . GLY C  1 134 ? -12.622 -26.517 -11.426 1.00 21.32  ? 134 GLY C C   1 
ATOM   6179  O  O   . GLY C  1 134 ? -11.839 -26.404 -12.354 1.00 22.99  ? 134 GLY C O   1 
ATOM   6180  N  N   . PHE C  1 135 ? -12.591 -25.725 -10.350 1.00 20.31  ? 135 PHE C N   1 
ATOM   6181  C  CA  . PHE C  1 135 ? -11.629 -24.667 -10.219 1.00 20.03  ? 135 PHE C CA  1 
ATOM   6182  C  C   . PHE C  1 135 ? -11.664 -24.124 -8.837  1.00 20.77  ? 135 PHE C C   1 
ATOM   6183  O  O   . PHE C  1 135 ? -12.594 -24.391 -8.084  1.00 23.96  ? 135 PHE C O   1 
ATOM   6184  C  CB  . PHE C  1 135 ? -11.942 -23.532 -11.230 1.00 19.79  ? 135 PHE C CB  1 
ATOM   6185  C  CG  . PHE C  1 135 ? -13.297 -22.849 -10.986 1.00 21.08  ? 135 PHE C CG  1 
ATOM   6186  C  CD1 . PHE C  1 135 ? -14.449 -23.316 -11.609 1.00 19.20  ? 135 PHE C CD1 1 
ATOM   6187  C  CD2 . PHE C  1 135 ? -13.399 -21.738 -10.110 1.00 21.71  ? 135 PHE C CD2 1 
ATOM   6188  C  CE1 . PHE C  1 135 ? -15.692 -22.697 -11.382 1.00 20.54  ? 135 PHE C CE1 1 
ATOM   6189  C  CE2 . PHE C  1 135 ? -14.630 -21.122 -9.878  1.00 22.89  ? 135 PHE C CE2 1 
ATOM   6190  C  CZ  . PHE C  1 135 ? -15.781 -21.600 -10.517 1.00 20.11  ? 135 PHE C CZ  1 
ATOM   6191  N  N   . VAL C  1 136 ? -10.643 -23.347 -8.480  1.00 23.37  ? 136 VAL C N   1 
ATOM   6192  C  CA  . VAL C  1 136 ? -10.612 -22.662 -7.184  1.00 24.47  ? 136 VAL C CA  1 
ATOM   6193  C  C   . VAL C  1 136 ? -10.759 -21.108 -7.369  1.00 26.88  ? 136 VAL C C   1 
ATOM   6194  O  O   . VAL C  1 136 ? -10.076 -20.509 -8.193  1.00 26.84  ? 136 VAL C O   1 
ATOM   6195  C  CB  . VAL C  1 136 ? -9.330  -22.967 -6.402  1.00 26.12  ? 136 VAL C CB  1 
ATOM   6196  C  CG1 . VAL C  1 136 ? -9.336  -22.232 -5.062  1.00 25.23  ? 136 VAL C CG1 1 
ATOM   6197  C  CG2 . VAL C  1 136 ? -9.177  -24.477 -6.186  1.00 22.81  ? 136 VAL C CG2 1 
HETATM 6198  N  N   . KCX C  1 137 ? -11.669 -20.496 -6.586  1.00 24.43  ? 137 KCX C N   1 
HETATM 6199  C  CA  . KCX C  1 137 ? -11.883 -19.053 -6.638  1.00 25.48  ? 137 KCX C CA  1 
HETATM 6200  C  CB  . KCX C  1 137 ? -13.405 -18.740 -6.817  1.00 25.38  ? 137 KCX C CB  1 
HETATM 6201  C  CG  . KCX C  1 137 ? -13.731 -17.256 -6.515  1.00 27.44  ? 137 KCX C CG  1 
HETATM 6202  C  CD  . KCX C  1 137 ? -13.287 -16.329 -7.675  1.00 26.84  ? 137 KCX C CD  1 
HETATM 6203  C  CE  . KCX C  1 137 ? -13.779 -14.869 -7.448  1.00 29.02  ? 137 KCX C CE  1 
HETATM 6204  N  NZ  . KCX C  1 137 ? -15.262 -14.738 -7.602  1.00 27.25  ? 137 KCX C NZ  1 
HETATM 6205  C  C   . KCX C  1 137 ? -11.327 -18.386 -5.358  1.00 25.27  ? 137 KCX C C   1 
HETATM 6206  O  O   . KCX C  1 137 ? -11.580 -18.853 -4.235  1.00 24.67  ? 137 KCX C O   1 
HETATM 6207  C  CX  . KCX C  1 137 ? -15.863 -13.564 -7.980  1.00 25.47  ? 137 KCX C CX  1 
HETATM 6208  O  OQ1 . KCX C  1 137 ? -15.211 -12.478 -8.237  1.00 28.68  ? 137 KCX C OQ1 1 
HETATM 6209  O  OQ2 . KCX C  1 137 ? -17.170 -13.538 -8.090  1.00 24.35  ? 137 KCX C OQ2 1 
ATOM   6210  N  N   . ILE C  1 138 ? -10.553 -17.295 -5.545  1.00 24.44  ? 138 ILE C N   1 
ATOM   6211  C  CA  . ILE C  1 138 ? -10.016 -16.511 -4.427  1.00 25.84  ? 138 ILE C CA  1 
ATOM   6212  C  C   . ILE C  1 138 ? -10.259 -15.019 -4.672  1.00 26.17  ? 138 ILE C C   1 
ATOM   6213  O  O   . ILE C  1 138 ? -10.585 -14.607 -5.800  1.00 23.15  ? 138 ILE C O   1 
ATOM   6214  C  CB  . ILE C  1 138 ? -8.519  -16.744 -4.241  1.00 28.98  ? 138 ILE C CB  1 
ATOM   6215  C  CG1 . ILE C  1 138 ? -7.746  -16.317 -5.517  1.00 31.97  ? 138 ILE C CG1 1 
ATOM   6216  C  CG2 . ILE C  1 138 ? -8.246  -18.199 -3.892  1.00 25.28  ? 138 ILE C CG2 1 
ATOM   6217  C  CD1 . ILE C  1 138 ? -6.245  -16.366 -5.372  1.00 37.98  ? 138 ILE C CD1 1 
ATOM   6218  N  N   . ALA C  1 139 ? -10.090 -14.208 -3.633  1.00 25.07  ? 139 ALA C N   1 
ATOM   6219  C  CA  . ALA C  1 139 ? -10.403 -12.801 -3.738  1.00 26.87  ? 139 ALA C CA  1 
ATOM   6220  C  C   . ALA C  1 139 ? -9.446  -11.886 -2.974  1.00 31.30  ? 139 ALA C C   1 
ATOM   6221  O  O   . ALA C  1 139 ? -8.740  -12.319 -2.008  1.00 30.44  ? 139 ALA C O   1 
ATOM   6222  C  CB  . ALA C  1 139 ? -11.864 -12.539 -3.294  1.00 24.48  ? 139 ALA C CB  1 
ATOM   6223  N  N   . ALA C  1 140 ? -9.417  -10.633 -3.404  1.00 30.93  ? 140 ALA C N   1 
ATOM   6224  C  CA  . ALA C  1 140 ? -8.700  -9.574  -2.741  1.00 33.85  ? 140 ALA C CA  1 
ATOM   6225  C  C   . ALA C  1 140 ? -9.238  -8.301  -3.302  1.00 37.70  ? 140 ALA C C   1 
ATOM   6226  O  O   . ALA C  1 140 ? -9.609  -8.248  -4.481  1.00 37.50  ? 140 ALA C O   1 
ATOM   6227  C  CB  . ALA C  1 140 ? -7.217  -9.685  -3.006  1.00 33.65  ? 140 ALA C CB  1 
ATOM   6228  N  N   . ASP C  1 141 ? -9.308  -7.274  -2.496  1.00 38.26  ? 141 ASP C N   1 
ATOM   6229  C  CA  . ASP C  1 141 ? -9.906  -6.047  -2.945  1.00 35.58  ? 141 ASP C CA  1 
ATOM   6230  C  C   . ASP C  1 141 ? -9.279  -4.819  -2.311  1.00 37.00  ? 141 ASP C C   1 
ATOM   6231  O  O   . ASP C  1 141 ? -8.078  -4.767  -2.099  1.00 35.29  ? 141 ASP C O   1 
ATOM   6232  C  CB  . ASP C  1 141 ? -11.432 -6.071  -2.687  1.00 36.19  ? 141 ASP C CB  1 
ATOM   6233  C  CG  . ASP C  1 141 ? -12.188 -5.114  -3.587  1.00 38.89  ? 141 ASP C CG  1 
ATOM   6234  O  OD1 . ASP C  1 141 ? -12.079 -3.893  -3.384  1.00 43.15  ? 141 ASP C OD1 1 
ATOM   6235  O  OD2 . ASP C  1 141 ? -12.889 -5.587  -4.492  1.00 34.26  ? 141 ASP C OD2 1 
ATOM   6236  N  N   . GLU C  1 142 ? -10.120 -3.827  -2.016  1.00 40.69  ? 142 GLU C N   1 
ATOM   6237  C  CA  . GLU C  1 142 ? -9.664  -2.536  -1.460  1.00 43.97  ? 142 GLU C CA  1 
ATOM   6238  C  C   . GLU C  1 142 ? -8.661  -2.692  -0.282  1.00 39.62  ? 142 GLU C C   1 
ATOM   6239  O  O   . GLU C  1 142 ? -7.640  -2.035  -0.255  1.00 39.36  ? 142 GLU C O   1 
ATOM   6240  C  CB  . GLU C  1 142 ? -10.895 -1.663  -1.032  1.00 49.10  ? 142 GLU C CB  1 
ATOM   6241  C  CG  . GLU C  1 142 ? -10.555 -0.221  -0.657  1.00 55.22  ? 142 GLU C CG  1 
ATOM   6242  C  CD  . GLU C  1 142 ? -9.944  -0.103  0.728   1.00 61.47  ? 142 GLU C CD  1 
ATOM   6243  O  OE1 . GLU C  1 142 ? -10.248 -0.961  1.596   1.00 61.24  ? 142 GLU C OE1 1 
ATOM   6244  O  OE2 . GLU C  1 142 ? -9.165  0.848   0.956   1.00 69.51  ? 142 GLU C OE2 1 
ATOM   6245  N  N   . PRO C  1 143 ? -8.985  -3.579  0.695   1.00 39.05  ? 143 PRO C N   1 
ATOM   6246  C  CA  . PRO C  1 143 ? -8.106  -3.761  1.870   1.00 35.75  ? 143 PRO C CA  1 
ATOM   6247  C  C   . PRO C  1 143 ? -6.737  -4.359  1.510   1.00 36.00  ? 143 PRO C C   1 
ATOM   6248  O  O   . PRO C  1 143 ? -5.850  -4.391  2.340   1.00 38.95  ? 143 PRO C O   1 
ATOM   6249  C  CB  . PRO C  1 143 ? -8.909  -4.731  2.767   1.00 35.25  ? 143 PRO C CB  1 
ATOM   6250  C  CG  . PRO C  1 143 ? -10.334 -4.620  2.271   1.00 37.11  ? 143 PRO C CG  1 
ATOM   6251  C  CD  . PRO C  1 143 ? -10.218 -4.377  0.800   1.00 37.76  ? 143 PRO C CD  1 
ATOM   6252  N  N   . GLY C  1 144 ? -6.587  -4.825  0.272   1.00 31.97  ? 144 GLY C N   1 
ATOM   6253  C  CA  . GLY C  1 144 ? -5.280  -5.361  -0.206  1.00 29.96  ? 144 GLY C CA  1 
ATOM   6254  C  C   . GLY C  1 144 ? -4.993  -6.839  0.234   1.00 30.88  ? 144 GLY C C   1 
ATOM   6255  O  O   . GLY C  1 144 ? -5.883  -7.555  0.638   1.00 28.21  ? 144 GLY C O   1 
ATOM   6256  N  N   . ILE C  1 145 ? -3.737  -7.246  0.132   1.00 33.31  ? 145 ILE C N   1 
ATOM   6257  C  CA  . ILE C  1 145 ? -3.349  -8.591  0.489   1.00 32.78  ? 145 ILE C CA  1 
ATOM   6258  C  C   . ILE C  1 145 ? -3.128  -8.716  1.998   1.00 33.38  ? 145 ILE C C   1 
ATOM   6259  O  O   . ILE C  1 145 ? -2.030  -8.609  2.468   1.00 36.20  ? 145 ILE C O   1 
ATOM   6260  C  CB  . ILE C  1 145 ? -2.053  -9.039  -0.274  1.00 31.29  ? 145 ILE C CB  1 
ATOM   6261  C  CG1 . ILE C  1 145 ? -2.203  -8.798  -1.780  1.00 29.76  ? 145 ILE C CG1 1 
ATOM   6262  C  CG2 . ILE C  1 145 ? -1.739  -10.499 0.012   1.00 32.54  ? 145 ILE C CG2 1 
ATOM   6263  C  CD1 . ILE C  1 145 ? -3.382  -9.572  -2.421  1.00 29.19  ? 145 ILE C CD1 1 
ATOM   6264  N  N   . THR C  1 146 ? -4.214  -8.936  2.742   1.00 34.04  ? 146 THR C N   1 
ATOM   6265  C  CA  . THR C  1 146 ? -4.117  -9.123  4.176   1.00 33.05  ? 146 THR C CA  1 
ATOM   6266  C  C   . THR C  1 146 ? -3.546  -10.512 4.482   1.00 33.06  ? 146 THR C C   1 
ATOM   6267  O  O   . THR C  1 146 ? -3.368  -11.351 3.559   1.00 32.59  ? 146 THR C O   1 
ATOM   6268  C  CB  . THR C  1 146 ? -5.502  -8.964  4.878   1.00 34.08  ? 146 THR C CB  1 
ATOM   6269  O  OG1 . THR C  1 146 ? -6.414  -9.990  4.408   1.00 33.39  ? 146 THR C OG1 1 
ATOM   6270  C  CG2 . THR C  1 146 ? -6.093  -7.596  4.600   1.00 29.74  ? 146 THR C CG2 1 
ATOM   6271  N  N   . LYS C  1 147 ? -3.254  -10.763 5.741   1.00 34.16  ? 147 LYS C N   1 
ATOM   6272  C  CA  . LYS C  1 147 ? -2.743  -12.066 6.150   1.00 39.13  ? 147 LYS C CA  1 
ATOM   6273  C  C   . LYS C  1 147 ? -3.712  -13.196 5.770   1.00 37.02  ? 147 LYS C C   1 
ATOM   6274  O  O   . LYS C  1 147 ? -3.317  -14.181 5.127   1.00 37.03  ? 147 LYS C O   1 
ATOM   6275  C  CB  . LYS C  1 147 ? -2.458  -12.097 7.653   1.00 39.81  ? 147 LYS C CB  1 
ATOM   6276  C  CG  . LYS C  1 147 ? -1.043  -11.679 8.024   1.00 52.59  ? 147 LYS C CG  1 
ATOM   6277  C  CD  . LYS C  1 147 ? -0.721  -12.035 9.477   1.00 56.79  ? 147 LYS C CD  1 
ATOM   6278  C  CE  . LYS C  1 147 ? 0.785   -11.899 9.769   1.00 63.93  ? 147 LYS C CE  1 
ATOM   6279  N  NZ  . LYS C  1 147 ? 1.276   -10.508 9.558   1.00 65.61  ? 147 LYS C NZ  1 
ATOM   6280  N  N   . ASP C  1 148 ? -4.966  -13.051 6.170   1.00 32.10  ? 148 ASP C N   1 
ATOM   6281  C  CA  . ASP C  1 148 ? -5.974  -14.062 5.885   1.00 37.40  ? 148 ASP C CA  1 
ATOM   6282  C  C   . ASP C  1 148 ? -6.218  -14.216 4.379   1.00 33.79  ? 148 ASP C C   1 
ATOM   6283  O  O   . ASP C  1 148 ? -6.387  -15.319 3.888   1.00 30.69  ? 148 ASP C O   1 
ATOM   6284  C  CB  . ASP C  1 148 ? -7.279  -13.747 6.620   1.00 36.96  ? 148 ASP C CB  1 
ATOM   6285  C  CG  . ASP C  1 148 ? -7.205  -14.090 8.117   1.00 40.92  ? 148 ASP C CG  1 
ATOM   6286  O  OD1 . ASP C  1 148 ? -8.117  -13.705 8.862   1.00 49.17  ? 148 ASP C OD1 1 
ATOM   6287  O  OD2 . ASP C  1 148 ? -6.221  -14.751 8.528   1.00 37.15  ? 148 ASP C OD2 1 
ATOM   6288  N  N   . VAL C  1 149 ? -6.225  -13.098 3.663   1.00 31.75  ? 149 VAL C N   1 
ATOM   6289  C  CA  . VAL C  1 149 ? -6.375  -13.126 2.230   1.00 34.37  ? 149 VAL C CA  1 
ATOM   6290  C  C   . VAL C  1 149 ? -5.207  -13.915 1.562   1.00 36.34  ? 149 VAL C C   1 
ATOM   6291  O  O   . VAL C  1 149 ? -5.424  -14.692 0.590   1.00 34.68  ? 149 VAL C O   1 
ATOM   6292  C  CB  . VAL C  1 149 ? -6.464  -11.692 1.632   1.00 33.71  ? 149 VAL C CB  1 
ATOM   6293  C  CG1 . VAL C  1 149 ? -6.118  -11.703 0.158   1.00 30.86  ? 149 VAL C CG1 1 
ATOM   6294  C  CG2 . VAL C  1 149 ? -7.859  -11.106 1.859   1.00 32.42  ? 149 VAL C CG2 1 
ATOM   6295  N  N   . GLU C  1 150 ? -3.998  -13.731 2.078   1.00 35.29  ? 150 GLU C N   1 
ATOM   6296  C  CA  . GLU C  1 150 ? -2.828  -14.428 1.533   1.00 38.67  ? 150 GLU C CA  1 
ATOM   6297  C  C   . GLU C  1 150 ? -2.882  -15.933 1.843   1.00 37.38  ? 150 GLU C C   1 
ATOM   6298  O  O   . GLU C  1 150 ? -2.540  -16.777 0.984   1.00 37.03  ? 150 GLU C O   1 
ATOM   6299  C  CB  . GLU C  1 150 ? -1.550  -13.832 2.063   1.00 40.27  ? 150 GLU C CB  1 
ATOM   6300  C  CG  . GLU C  1 150 ? -0.306  -14.509 1.539   1.00 41.91  ? 150 GLU C CG  1 
ATOM   6301  C  CD  . GLU C  1 150 ? 0.945   -13.829 1.974   1.00 48.02  ? 150 GLU C CD  1 
ATOM   6302  O  OE1 . GLU C  1 150 ? 2.031   -14.390 1.751   1.00 53.79  ? 150 GLU C OE1 1 
ATOM   6303  O  OE2 . GLU C  1 150 ? 0.854   -12.731 2.543   1.00 56.29  ? 150 GLU C OE2 1 
ATOM   6304  N  N   . LYS C  1 151 ? -3.303  -16.269 3.052   1.00 34.19  ? 151 LYS C N   1 
ATOM   6305  C  CA  . LYS C  1 151 ? -3.445  -17.652 3.437   1.00 34.03  ? 151 LYS C CA  1 
ATOM   6306  C  C   . LYS C  1 151 ? -4.361  -18.402 2.448   1.00 34.22  ? 151 LYS C C   1 
ATOM   6307  O  O   . LYS C  1 151 ? -4.068  -19.531 2.048   1.00 34.60  ? 151 LYS C O   1 
ATOM   6308  C  CB  . LYS C  1 151 ? -3.979  -17.763 4.886   1.00 35.56  ? 151 LYS C CB  1 
ATOM   6309  C  CG  . LYS C  1 151 ? -2.936  -17.347 5.953   1.00 40.92  ? 151 LYS C CG  1 
ATOM   6310  C  CD  . LYS C  1 151 ? -3.581  -17.003 7.281   1.00 43.12  ? 151 LYS C CD  1 
ATOM   6311  C  CE  . LYS C  1 151 ? -4.181  -18.203 7.925   1.00 47.39  ? 151 LYS C CE  1 
ATOM   6312  N  NZ  . LYS C  1 151 ? -4.726  -17.871 9.256   1.00 58.71  ? 151 LYS C NZ  1 
ATOM   6313  N  N   . VAL C  1 152 ? -5.460  -17.752 2.050   1.00 28.24  ? 152 VAL C N   1 
ATOM   6314  C  CA  . VAL C  1 152 ? -6.367  -18.324 1.096   1.00 27.72  ? 152 VAL C CA  1 
ATOM   6315  C  C   . VAL C  1 152 ? -5.674  -18.509 -0.292  1.00 27.32  ? 152 VAL C C   1 
ATOM   6316  O  O   . VAL C  1 152 ? -5.807  -19.577 -0.938  1.00 27.17  ? 152 VAL C O   1 
ATOM   6317  C  CB  . VAL C  1 152 ? -7.621  -17.469 0.932   1.00 24.41  ? 152 VAL C CB  1 
ATOM   6318  C  CG1 . VAL C  1 152 ? -8.472  -17.991 -0.222  1.00 25.27  ? 152 VAL C CG1 1 
ATOM   6319  C  CG2 . VAL C  1 152 ? -8.417  -17.446 2.231   1.00 25.99  ? 152 VAL C CG2 1 
ATOM   6320  N  N   . ILE C  1 153 ? -4.950  -17.487 -0.731  1.00 26.07  ? 153 ILE C N   1 
ATOM   6321  C  CA  . ILE C  1 153 ? -4.211  -17.567 -1.988  1.00 27.30  ? 153 ILE C CA  1 
ATOM   6322  C  C   . ILE C  1 153 ? -3.286  -18.782 -1.987  1.00 29.55  ? 153 ILE C C   1 
ATOM   6323  O  O   . ILE C  1 153 ? -3.284  -19.590 -2.948  1.00 28.13  ? 153 ILE C O   1 
ATOM   6324  C  CB  . ILE C  1 153 ? -3.380  -16.314 -2.237  1.00 27.48  ? 153 ILE C CB  1 
ATOM   6325  C  CG1 . ILE C  1 153 ? -4.292  -15.082 -2.390  1.00 27.93  ? 153 ILE C CG1 1 
ATOM   6326  C  CG2 . ILE C  1 153 ? -2.513  -16.492 -3.480  1.00 26.80  ? 153 ILE C CG2 1 
ATOM   6327  C  CD1 . ILE C  1 153 ? -3.528  -13.741 -2.397  1.00 26.61  ? 153 ILE C CD1 1 
ATOM   6328  N  N   . ARG C  1 154 ? -2.498  -18.925 -0.905  1.00 28.41  ? 154 ARG C N   1 
ATOM   6329  C  CA  . ARG C  1 154 ? -1.544  -20.036 -0.784  1.00 29.93  ? 154 ARG C CA  1 
ATOM   6330  C  C   . ARG C  1 154 ? -2.253  -21.413 -0.706  1.00 29.27  ? 154 ARG C C   1 
ATOM   6331  O  O   . ARG C  1 154 ? -1.742  -22.412 -1.213  1.00 31.12  ? 154 ARG C O   1 
ATOM   6332  C  CB  . ARG C  1 154 ? -0.635  -19.826 0.407   1.00 31.32  ? 154 ARG C CB  1 
ATOM   6333  C  CG  . ARG C  1 154 ? 0.283   -18.616 0.249   1.00 34.97  ? 154 ARG C CG  1 
ATOM   6334  C  CD  . ARG C  1 154 ? 1.112   -18.356 1.491   1.00 38.28  ? 154 ARG C CD  1 
ATOM   6335  N  NE  . ARG C  1 154 ? 1.908   -17.150 1.338   1.00 37.87  ? 154 ARG C NE  1 
ATOM   6336  C  CZ  . ARG C  1 154 ? 3.067   -17.095 0.671   1.00 43.83  ? 154 ARG C CZ  1 
ATOM   6337  N  NH1 . ARG C  1 154 ? 3.724   -15.948 0.576   1.00 44.92  ? 154 ARG C NH1 1 
ATOM   6338  N  NH2 . ARG C  1 154 ? 3.568   -18.201 0.094   1.00 37.69  ? 154 ARG C NH2 1 
ATOM   6339  N  N   . ALA C  1 155 ? -3.424  -21.443 -0.081  1.00 28.70  ? 155 ALA C N   1 
ATOM   6340  C  CA  . ALA C  1 155 ? -4.229  -22.652 -0.047  1.00 29.32  ? 155 ALA C CA  1 
ATOM   6341  C  C   . ALA C  1 155 ? -4.679  -23.047 -1.490  1.00 28.29  ? 155 ALA C C   1 
ATOM   6342  O  O   . ALA C  1 155 ? -4.646  -24.233 -1.868  1.00 27.28  ? 155 ALA C O   1 
ATOM   6343  C  CB  . ALA C  1 155 ? -5.428  -22.465 0.849   1.00 27.82  ? 155 ALA C CB  1 
ATOM   6344  N  N   . ALA C  1 156 ? -5.092  -22.048 -2.271  1.00 26.24  ? 156 ALA C N   1 
ATOM   6345  C  CA  . ALA C  1 156 ? -5.499  -22.273 -3.639  1.00 25.93  ? 156 ALA C CA  1 
ATOM   6346  C  C   . ALA C  1 156 ? -4.355  -22.873 -4.438  1.00 27.67  ? 156 ALA C C   1 
ATOM   6347  O  O   . ALA C  1 156 ? -4.558  -23.739 -5.238  1.00 26.64  ? 156 ALA C O   1 
ATOM   6348  C  CB  . ALA C  1 156 ? -5.966  -20.973 -4.275  1.00 23.21  ? 156 ALA C CB  1 
ATOM   6349  N  N   . ALA C  1 157 ? -3.133  -22.380 -4.192  1.00 25.28  ? 157 ALA C N   1 
ATOM   6350  C  CA  . ALA C  1 157 ? -1.937  -22.911 -4.880  1.00 30.03  ? 157 ALA C CA  1 
ATOM   6351  C  C   . ALA C  1 157 ? -1.749  -24.404 -4.581  1.00 30.72  ? 157 ALA C C   1 
ATOM   6352  O  O   . ALA C  1 157 ? -1.486  -25.201 -5.483  1.00 34.52  ? 157 ALA C O   1 
ATOM   6353  C  CB  . ALA C  1 157 ? -0.700  -22.126 -4.488  1.00 26.87  ? 157 ALA C CB  1 
ATOM   6354  N  N   . ILE C  1 158 ? -1.887  -24.771 -3.319  1.00 30.35  ? 158 ILE C N   1 
ATOM   6355  C  CA  . ILE C  1 158 ? -1.766  -26.162 -2.924  1.00 31.86  ? 158 ILE C CA  1 
ATOM   6356  C  C   . ILE C  1 158 ? -2.812  -27.013 -3.622  1.00 32.86  ? 158 ILE C C   1 
ATOM   6357  O  O   . ILE C  1 158 ? -2.512  -28.067 -4.117  1.00 34.47  ? 158 ILE C O   1 
ATOM   6358  C  CB  . ILE C  1 158 ? -1.897  -26.337 -1.395  1.00 33.32  ? 158 ILE C CB  1 
ATOM   6359  C  CG1 . ILE C  1 158 ? -0.787  -25.583 -0.679  1.00 33.37  ? 158 ILE C CG1 1 
ATOM   6360  C  CG2 . ILE C  1 158 ? -1.877  -27.843 -1.011  1.00 29.93  ? 158 ILE C CG2 1 
ATOM   6361  C  CD1 . ILE C  1 158 ? -0.872  -25.665 0.829   1.00 37.26  ? 158 ILE C CD1 1 
ATOM   6362  N  N   . ALA C  1 159 ? -4.065  -26.522 -3.656  1.00 31.60  ? 159 ALA C N   1 
ATOM   6363  C  CA  . ALA C  1 159 ? -5.159  -27.274 -4.288  1.00 31.40  ? 159 ALA C CA  1 
ATOM   6364  C  C   . ALA C  1 159 ? -4.919  -27.464 -5.799  1.00 30.61  ? 159 ALA C C   1 
ATOM   6365  O  O   . ALA C  1 159 ? -5.167  -28.554 -6.353  1.00 32.32  ? 159 ALA C O   1 
ATOM   6366  C  CB  . ALA C  1 159 ? -6.500  -26.592 -4.034  1.00 28.95  ? 159 ALA C CB  1 
ATOM   6367  N  N   . ASN C  1 160 ? -4.445  -26.420 -6.455  1.00 29.12  ? 160 ASN C N   1 
ATOM   6368  C  CA  . ASN C  1 160 ? -4.135  -26.499 -7.885  1.00 31.09  ? 160 ASN C CA  1 
ATOM   6369  C  C   . ASN C  1 160 ? -3.067  -27.524 -8.156  1.00 32.32  ? 160 ASN C C   1 
ATOM   6370  O  O   . ASN C  1 160 ? -3.199  -28.349 -9.052  1.00 35.42  ? 160 ASN C O   1 
ATOM   6371  C  CB  . ASN C  1 160 ? -3.690  -25.151 -8.410  1.00 27.70  ? 160 ASN C CB  1 
ATOM   6372  C  CG  . ASN C  1 160 ? -2.942  -25.260 -9.765  1.00 30.83  ? 160 ASN C CG  1 
ATOM   6373  O  OD1 . ASN C  1 160 ? -1.691  -25.257 -9.809  1.00 28.68  ? 160 ASN C OD1 1 
ATOM   6374  N  ND2 . ASN C  1 160 ? -3.704  -25.370 -10.863 1.00 27.62  ? 160 ASN C ND2 1 
ATOM   6375  N  N   . LYS C  1 161 ? -2.007  -27.470 -7.380  1.00 30.98  ? 161 LYS C N   1 
ATOM   6376  C  CA  . LYS C  1 161 ? -0.891  -28.385 -7.547  1.00 35.06  ? 161 LYS C CA  1 
ATOM   6377  C  C   . LYS C  1 161 ? -1.292  -29.842 -7.276  1.00 34.59  ? 161 LYS C C   1 
ATOM   6378  O  O   . LYS C  1 161 ? -0.719  -30.759 -7.836  1.00 35.42  ? 161 LYS C O   1 
ATOM   6379  C  CB  . LYS C  1 161 ? 0.290   -27.961 -6.651  1.00 35.35  ? 161 LYS C CB  1 
ATOM   6380  C  CG  . LYS C  1 161 ? 1.143   -26.815 -7.256  1.00 41.12  ? 161 LYS C CG  1 
ATOM   6381  C  CD  . LYS C  1 161 ? 1.841   -25.979 -6.170  1.00 48.68  ? 161 LYS C CD  1 
ATOM   6382  C  CE  . LYS C  1 161 ? 2.768   -26.805 -5.333  1.00 49.65  ? 161 LYS C CE  1 
ATOM   6383  N  NZ  . LYS C  1 161 ? 3.380   -25.984 -4.234  1.00 47.97  ? 161 LYS C NZ  1 
ATOM   6384  N  N   . GLU C  1 162 ? -2.290  -30.032 -6.422  1.00 33.04  ? 162 GLU C N   1 
ATOM   6385  C  CA  . GLU C  1 162 ? -2.785  -31.405 -6.092  1.00 34.85  ? 162 GLU C CA  1 
ATOM   6386  C  C   . GLU C  1 162 ? -3.790  -31.930 -7.104  1.00 35.70  ? 162 GLU C C   1 
ATOM   6387  O  O   . GLU C  1 162 ? -3.802  -33.082 -7.398  1.00 37.31  ? 162 GLU C O   1 
ATOM   6388  C  CB  . GLU C  1 162 ? -3.401  -31.433 -4.707  1.00 37.72  ? 162 GLU C CB  1 
ATOM   6389  C  CG  . GLU C  1 162 ? -2.429  -31.720 -3.611  1.00 50.27  ? 162 GLU C CG  1 
ATOM   6390  C  CD  . GLU C  1 162 ? -1.986  -33.195 -3.586  1.00 55.66  ? 162 GLU C CD  1 
ATOM   6391  O  OE1 . GLU C  1 162 ? -2.734  -34.065 -4.138  1.00 53.58  ? 162 GLU C OE1 1 
ATOM   6392  O  OE2 . GLU C  1 162 ? -0.913  -33.482 -3.022  1.00 63.04  ? 162 GLU C OE2 1 
ATOM   6393  N  N   . THR C  1 163 ? -4.641  -31.037 -7.627  1.00 32.55  ? 163 THR C N   1 
ATOM   6394  C  CA  . THR C  1 163 ? -5.779  -31.464 -8.472  1.00 30.33  ? 163 THR C CA  1 
ATOM   6395  C  C   . THR C  1 163 ? -5.683  -30.978 -9.911  1.00 30.51  ? 163 THR C C   1 
ATOM   6396  O  O   . THR C  1 163 ? -6.323  -31.490 -10.756 1.00 29.98  ? 163 THR C O   1 
ATOM   6397  C  CB  . THR C  1 163 ? -7.097  -30.995 -7.891  1.00 30.42  ? 163 THR C CB  1 
ATOM   6398  O  OG1 . THR C  1 163 ? -7.132  -29.553 -7.882  1.00 26.80  ? 163 THR C OG1 1 
ATOM   6399  C  CG2 . THR C  1 163 ? -7.274  -31.530 -6.449  1.00 28.47  ? 163 THR C CG2 1 
ATOM   6400  N  N   . LYS C  1 164 ? -4.868  -29.960 -10.142 1.00 30.04  ? 164 LYS C N   1 
ATOM   6401  C  CA  . LYS C  1 164 ? -4.656  -29.412 -11.525 1.00 30.48  ? 164 LYS C CA  1 
ATOM   6402  C  C   . LYS C  1 164 ? -5.768  -28.466 -12.015 1.00 32.81  ? 164 LYS C C   1 
ATOM   6403  O  O   . LYS C  1 164 ? -5.715  -27.974 -13.153 1.00 30.95  ? 164 LYS C O   1 
ATOM   6404  C  CB  . LYS C  1 164 ? -4.441  -30.551 -12.544 1.00 34.82  ? 164 LYS C CB  1 
ATOM   6405  C  CG  . LYS C  1 164 ? -2.992  -31.007 -12.672 1.00 36.98  ? 164 LYS C CG  1 
ATOM   6406  C  CD  . LYS C  1 164 ? -2.449  -31.482 -11.367 1.00 38.45  ? 164 LYS C CD  1 
ATOM   6407  C  CE  . LYS C  1 164 ? -0.953  -31.685 -11.443 1.00 41.94  ? 164 LYS C CE  1 
ATOM   6408  N  NZ  . LYS C  1 164 ? -0.429  -32.289 -10.219 1.00 51.38  ? 164 LYS C NZ  1 
ATOM   6409  N  N   . VAL C  1 165 ? -6.762  -28.210 -11.178 1.00 28.24  ? 165 VAL C N   1 
ATOM   6410  C  CA  . VAL C  1 165 ? -7.805  -27.306 -11.569 1.00 25.29  ? 165 VAL C CA  1 
ATOM   6411  C  C   . VAL C  1 165 ? -7.269  -25.887 -11.596 1.00 27.10  ? 165 VAL C C   1 
ATOM   6412  O  O   . VAL C  1 165 ? -6.372  -25.537 -10.815 1.00 21.76  ? 165 VAL C O   1 
ATOM   6413  C  CB  . VAL C  1 165 ? -9.059  -27.399 -10.644 1.00 24.47  ? 165 VAL C CB  1 
ATOM   6414  C  CG1 . VAL C  1 165 ? -9.552  -28.833 -10.566 1.00 22.72  ? 165 VAL C CG1 1 
ATOM   6415  C  CG2 . VAL C  1 165 ? -8.761  -26.821 -9.237  1.00 21.15  ? 165 VAL C CG2 1 
ATOM   6416  N  N   . PRO C  1 166 ? -7.793  -25.069 -12.502 1.00 26.66  ? 166 PRO C N   1 
ATOM   6417  C  CA  . PRO C  1 166 ? -7.357  -23.700 -12.659 1.00 25.66  ? 166 PRO C CA  1 
ATOM   6418  C  C   . PRO C  1 166 ? -7.825  -22.818 -11.513 1.00 26.82  ? 166 PRO C C   1 
ATOM   6419  O  O   . PRO C  1 166 ? -8.686  -23.256 -10.662 1.00 24.40  ? 166 PRO C O   1 
ATOM   6420  C  CB  . PRO C  1 166 ? -8.027  -23.267 -13.970 1.00 26.22  ? 166 PRO C CB  1 
ATOM   6421  C  CG  . PRO C  1 166 ? -9.203  -24.140 -14.094 1.00 30.68  ? 166 PRO C CG  1 
ATOM   6422  C  CD  . PRO C  1 166 ? -8.815  -25.446 -13.489 1.00 26.94  ? 166 PRO C CD  1 
ATOM   6423  N  N   . ILE C  1 167 ? -7.299  -21.605 -11.459 1.00 24.52  ? 167 ILE C N   1 
ATOM   6424  C  CA  . ILE C  1 167 ? -7.654  -20.669 -10.421 1.00 26.99  ? 167 ILE C CA  1 
ATOM   6425  C  C   . ILE C  1 167 ? -8.210  -19.398 -11.000 1.00 25.63  ? 167 ILE C C   1 
ATOM   6426  O  O   . ILE C  1 167 ? -7.604  -18.790 -11.868 1.00 24.69  ? 167 ILE C O   1 
ATOM   6427  C  CB  . ILE C  1 167 ? -6.420  -20.315 -9.529  1.00 28.01  ? 167 ILE C CB  1 
ATOM   6428  C  CG1 . ILE C  1 167 ? -5.885  -21.575 -8.826  1.00 28.34  ? 167 ILE C CG1 1 
ATOM   6429  C  CG2 . ILE C  1 167 ? -6.779  -19.237 -8.524  1.00 26.37  ? 167 ILE C CG2 1 
ATOM   6430  C  CD1 . ILE C  1 167 ? -4.667  -21.319 -7.957  1.00 30.80  ? 167 ILE C CD1 1 
ATOM   6431  N  N   . ILE C  1 168 ? -9.382  -19.001 -10.514 1.00 25.27  ? 168 ILE C N   1 
ATOM   6432  C  CA  . ILE C  1 168 ? -9.985  -17.743 -10.883 1.00 22.57  ? 168 ILE C CA  1 
ATOM   6433  C  C   . ILE C  1 168 ? -9.918  -16.801 -9.696  1.00 24.02  ? 168 ILE C C   1 
ATOM   6434  O  O   . ILE C  1 168 ? -10.103 -17.213 -8.578  1.00 24.05  ? 168 ILE C O   1 
ATOM   6435  C  CB  . ILE C  1 168 ? -11.456 -17.930 -11.291 1.00 22.94  ? 168 ILE C CB  1 
ATOM   6436  C  CG1 . ILE C  1 168 ? -11.557 -18.840 -12.523 1.00 22.27  ? 168 ILE C CG1 1 
ATOM   6437  C  CG2 . ILE C  1 168 ? -12.110 -16.580 -11.570 1.00 20.87  ? 168 ILE C CG2 1 
ATOM   6438  C  CD1 . ILE C  1 168 ? -12.971 -19.219 -12.889 1.00 24.68  ? 168 ILE C CD1 1 
ATOM   6439  N  N   . THR C  1 169 ? -9.645  -15.536 -9.946  1.00 22.69  ? 169 THR C N   1 
ATOM   6440  C  CA  . THR C  1 169 ? -9.522  -14.584 -8.848  1.00 26.90  ? 169 THR C CA  1 
ATOM   6441  C  C   . THR C  1 169 ? -10.417 -13.378 -8.999  1.00 27.88  ? 169 THR C C   1 
ATOM   6442  O  O   . THR C  1 169 ? -10.851 -13.023 -10.119 1.00 26.66  ? 169 THR C O   1 
ATOM   6443  C  CB  . THR C  1 169 ? -8.066  -14.068 -8.679  1.00 25.62  ? 169 THR C CB  1 
ATOM   6444  O  OG1 . THR C  1 169 ? -7.875  -12.918 -9.492  1.00 27.76  ? 169 THR C OG1 1 
ATOM   6445  C  CG2 . THR C  1 169 ? -7.058  -15.147 -9.059  1.00 26.53  ? 169 THR C CG2 1 
ATOM   6446  N  N   . HIS C  1 170 ? -10.697 -12.755 -7.877  1.00 28.43  ? 170 HIS C N   1 
ATOM   6447  C  CA  . HIS C  1 170 ? -11.329 -11.504 -7.827  1.00 28.73  ? 170 HIS C CA  1 
ATOM   6448  C  C   . HIS C  1 170 ? -10.310 -10.532 -7.346  1.00 29.17  ? 170 HIS C C   1 
ATOM   6449  O  O   . HIS C  1 170 ? -9.679  -10.755 -6.323  1.00 29.51  ? 170 HIS C O   1 
ATOM   6450  C  CB  . HIS C  1 170 ? -12.493 -11.556 -6.840  1.00 25.76  ? 170 HIS C CB  1 
ATOM   6451  C  CG  . HIS C  1 170 ? -13.081 -10.208 -6.515  1.00 28.83  ? 170 HIS C CG  1 
ATOM   6452  N  ND1 . HIS C  1 170 ? -14.364 -9.843  -6.889  1.00 31.27  ? 170 HIS C ND1 1 
ATOM   6453  C  CD2 . HIS C  1 170 ? -12.539 -9.090  -5.811  1.00 28.32  ? 170 HIS C CD2 1 
ATOM   6454  C  CE1 . HIS C  1 170 ? -14.616 -8.579  -6.453  1.00 28.36  ? 170 HIS C CE1 1 
ATOM   6455  N  NE2 . HIS C  1 170 ? -13.500 -8.117  -5.795  1.00 30.89  ? 170 HIS C NE2 1 
ATOM   6456  N  N   . SER C  1 171 ? -10.118 -9.459  -8.071  1.00 30.56  ? 171 SER C N   1 
ATOM   6457  C  CA  . SER C  1 171 ? -9.139  -8.415  -7.626  1.00 34.49  ? 171 SER C CA  1 
ATOM   6458  C  C   . SER C  1 171 ? -9.686  -7.017  -7.776  1.00 33.15  ? 171 SER C C   1 
ATOM   6459  O  O   . SER C  1 171 ? -10.795 -6.818  -8.298  1.00 30.46  ? 171 SER C O   1 
ATOM   6460  C  CB  . SER C  1 171 ? -7.808  -8.549  -8.383  1.00 34.46  ? 171 SER C CB  1 
ATOM   6461  O  OG  . SER C  1 171 ? -7.898  -7.998  -9.650  1.00 39.88  ? 171 SER C OG  1 
ATOM   6462  N  N   . ASN C  1 172 ? -8.921  -6.045  -7.305  1.00 32.53  ? 172 ASN C N   1 
ATOM   6463  C  CA  . ASN C  1 172 ? -9.256  -4.663  -7.482  1.00 31.21  ? 172 ASN C CA  1 
ATOM   6464  C  C   . ASN C  1 172 ? -8.346  -4.081  -8.480  1.00 33.76  ? 172 ASN C C   1 
ATOM   6465  O  O   . ASN C  1 172 ? -7.081  -4.056  -8.279  1.00 34.30  ? 172 ASN C O   1 
ATOM   6466  C  CB  . ASN C  1 172 ? -9.149  -3.907  -6.149  1.00 33.97  ? 172 ASN C CB  1 
ATOM   6467  C  CG  . ASN C  1 172 ? -9.616  -2.466  -6.257  1.00 36.47  ? 172 ASN C CG  1 
ATOM   6468  O  OD1 . ASN C  1 172 ? -9.097  -1.686  -7.064  1.00 37.00  ? 172 ASN C OD1 1 
ATOM   6469  N  ND2 . ASN C  1 172 ? -10.579 -2.110  -5.459  1.00 38.42  ? 172 ASN C ND2 1 
ATOM   6470  N  N   . ALA C  1 173 ? -8.917  -3.603  -9.575  1.00 36.10  ? 173 ALA C N   1 
ATOM   6471  C  CA  . ALA C  1 173 ? -8.125  -3.166  -10.744 1.00 37.68  ? 173 ALA C CA  1 
ATOM   6472  C  C   . ALA C  1 173 ? -7.206  -1.956  -10.476 1.00 40.44  ? 173 ALA C C   1 
ATOM   6473  O  O   . ALA C  1 173 ? -6.322  -1.660  -11.281 1.00 40.74  ? 173 ALA C O   1 
ATOM   6474  C  CB  . ALA C  1 173 ? -9.053  -2.881  -11.945 1.00 36.68  ? 173 ALA C CB  1 
ATOM   6475  N  N   . HIS C  1 174 ? -7.414  -1.268  -9.333  1.00 41.83  ? 174 HIS C N   1 
ATOM   6476  C  CA  . HIS C  1 174 ? -6.679  0.016   -9.058  1.00 45.45  ? 174 HIS C CA  1 
ATOM   6477  C  C   . HIS C  1 174 ? -5.644  -0.051  -7.948  1.00 47.06  ? 174 HIS C C   1 
ATOM   6478  O  O   . HIS C  1 174 ? -5.027  0.945   -7.633  1.00 55.94  ? 174 HIS C O   1 
ATOM   6479  C  CB  . HIS C  1 174 ? -7.675  1.163   -8.765  1.00 44.71  ? 174 HIS C CB  1 
ATOM   6480  C  CG  . HIS C  1 174 ? -8.775  1.268   -9.753  1.00 44.80  ? 174 HIS C CG  1 
ATOM   6481  N  ND1 . HIS C  1 174 ? -8.567  1.624   -11.048 1.00 42.99  ? 174 HIS C ND1 1 
ATOM   6482  C  CD2 . HIS C  1 174 ? -10.160 1.057   -9.621  1.00 43.27  ? 174 HIS C CD2 1 
ATOM   6483  C  CE1 . HIS C  1 174 ? -9.737  1.632   -11.698 1.00 46.14  ? 174 HIS C CE1 1 
ATOM   6484  N  NE2 . HIS C  1 174 ? -10.712 1.286   -10.824 1.00 45.31  ? 174 HIS C NE2 1 
ATOM   6485  N  N   . ASN C  1 175 ? -5.450  -1.228  -7.352  1.00 46.82  ? 175 ASN C N   1 
ATOM   6486  C  CA  . ASN C  1 175 ? -4.520  -1.331  -6.171  1.00 42.52  ? 175 ASN C CA  1 
ATOM   6487  C  C   . ASN C  1 175 ? -3.400  -2.445  -6.251  1.00 45.59  ? 175 ASN C C   1 
ATOM   6488  O  O   . ASN C  1 175 ? -2.718  -2.727  -5.244  1.00 48.29  ? 175 ASN C O   1 
ATOM   6489  C  CB  . ASN C  1 175 ? -5.310  -1.455  -4.864  1.00 41.18  ? 175 ASN C CB  1 
ATOM   6490  C  CG  . ASN C  1 175 ? -6.051  -2.764  -4.755  1.00 41.73  ? 175 ASN C CG  1 
ATOM   6491  O  OD1 . ASN C  1 175 ? -5.964  -3.617  -5.638  1.00 42.91  ? 175 ASN C OD1 1 
ATOM   6492  N  ND2 . ASN C  1 175 ? -6.790  -2.934  -3.667  1.00 44.05  ? 175 ASN C ND2 1 
ATOM   6493  N  N   . ASN C  1 176 ? -3.228  -3.044  -7.426  1.00 42.16  ? 176 ASN C N   1 
ATOM   6494  C  CA  . ASN C  1 176 ? -2.147  -4.090  -7.626  1.00 41.38  ? 176 ASN C CA  1 
ATOM   6495  C  C   . ASN C  1 176 ? -2.444  -5.481  -7.007  1.00 38.89  ? 176 ASN C C   1 
ATOM   6496  O  O   . ASN C  1 176 ? -1.590  -6.390  -7.061  1.00 37.05  ? 176 ASN C O   1 
ATOM   6497  C  CB  . ASN C  1 176 ? -0.797  -3.582  -7.122  1.00 47.70  ? 176 ASN C CB  1 
ATOM   6498  C  CG  . ASN C  1 176 ? -0.065  -2.775  -8.149  1.00 56.76  ? 176 ASN C CG  1 
ATOM   6499  O  OD1 . ASN C  1 176 ? -0.649  -2.320  -9.133  1.00 59.41  ? 176 ASN C OD1 1 
ATOM   6500  N  ND2 . ASN C  1 176 ? 1.220   -2.587  -7.937  1.00 65.58  ? 176 ASN C ND2 1 
ATOM   6501  N  N   . THR C  1 177 ? -3.628  -5.648  -6.423  1.00 33.77  ? 177 THR C N   1 
ATOM   6502  C  CA  . THR C  1 177 ? -3.995  -6.962  -5.832  1.00 34.22  ? 177 THR C CA  1 
ATOM   6503  C  C   . THR C  1 177 ? -3.916  -8.075  -6.895  1.00 34.09  ? 177 THR C C   1 
ATOM   6504  O  O   . THR C  1 177 ? -3.495  -9.176  -6.612  1.00 36.69  ? 177 THR C O   1 
ATOM   6505  C  CB  . THR C  1 177 ? -5.378  -6.948  -5.216  1.00 32.60  ? 177 THR C CB  1 
ATOM   6506  O  OG1 . THR C  1 177 ? -6.311  -6.326  -6.132  1.00 32.13  ? 177 THR C OG1 1 
ATOM   6507  C  CG2 . THR C  1 177 ? -5.367  -6.183  -3.905  1.00 30.78  ? 177 THR C CG2 1 
ATOM   6508  N  N   . GLY C  1 178 ? -4.318  -7.754  -8.103  1.00 32.55  ? 178 GLY C N   1 
ATOM   6509  C  CA  . GLY C  1 178 ? -4.245  -8.692  -9.191  1.00 34.59  ? 178 GLY C CA  1 
ATOM   6510  C  C   . GLY C  1 178 ? -2.821  -9.157  -9.438  1.00 35.26  ? 178 GLY C C   1 
ATOM   6511  O  O   . GLY C  1 178 ? -2.547  -10.346 -9.467  1.00 35.89  ? 178 GLY C O   1 
ATOM   6512  N  N   . LEU C  1 179 ? -1.918  -8.204  -9.612  1.00 37.38  ? 179 LEU C N   1 
ATOM   6513  C  CA  . LEU C  1 179 ? -0.511  -8.514  -9.840  1.00 41.30  ? 179 LEU C CA  1 
ATOM   6514  C  C   . LEU C  1 179 ? 0.100   -9.302  -8.628  1.00 38.92  ? 179 LEU C C   1 
ATOM   6515  O  O   . LEU C  1 179 ? 0.934   -10.201 -8.810  1.00 40.36  ? 179 LEU C O   1 
ATOM   6516  C  CB  . LEU C  1 179 ? 0.273   -7.246  -10.094 1.00 42.50  ? 179 LEU C CB  1 
ATOM   6517  C  CG  . LEU C  1 179 ? 1.729   -7.402  -10.473 1.00 45.02  ? 179 LEU C CG  1 
ATOM   6518  C  CD1 . LEU C  1 179 ? 1.864   -8.088  -11.826 1.00 44.98  ? 179 LEU C CD1 1 
ATOM   6519  C  CD2 . LEU C  1 179 ? 2.426   -6.035  -10.484 1.00 44.37  ? 179 LEU C CD2 1 
ATOM   6520  N  N   . GLU C  1 180 ? -0.330  -8.950  -7.418  1.00 39.18  ? 180 GLU C N   1 
ATOM   6521  C  CA  . GLU C  1 180 ? 0.125   -9.667  -6.180  1.00 39.64  ? 180 GLU C CA  1 
ATOM   6522  C  C   . GLU C  1 180 ? -0.338  -11.126 -6.173  1.00 38.87  ? 180 GLU C C   1 
ATOM   6523  O  O   . GLU C  1 180 ? 0.461   -12.042 -5.960  1.00 38.46  ? 180 GLU C O   1 
ATOM   6524  C  CB  . GLU C  1 180 ? -0.367  -8.953  -4.936  1.00 42.78  ? 180 GLU C CB  1 
ATOM   6525  C  CG  . GLU C  1 180 ? 0.463   -7.739  -4.546  1.00 49.23  ? 180 GLU C CG  1 
ATOM   6526  C  CD  . GLU C  1 180 ? 1.907   -8.108  -4.201  1.00 52.73  ? 180 GLU C CD  1 
ATOM   6527  O  OE1 . GLU C  1 180 ? 2.358   -7.766  -3.093  1.00 62.05  ? 180 GLU C OE1 1 
ATOM   6528  O  OE2 . GLU C  1 180 ? 2.577   -8.745  -5.038  1.00 52.73  ? 180 GLU C OE2 1 
ATOM   6529  N  N   . GLN C  1 181 ? -1.650  -11.333 -6.403  1.00 35.42  ? 181 GLN C N   1 
ATOM   6530  C  CA  . GLN C  1 181 ? -2.199  -12.659 -6.526  1.00 33.79  ? 181 GLN C CA  1 
ATOM   6531  C  C   . GLN C  1 181 ? -1.353  -13.500 -7.493  1.00 33.03  ? 181 GLN C C   1 
ATOM   6532  O  O   . GLN C  1 181 ? -0.897  -14.632 -7.150  1.00 33.64  ? 181 GLN C O   1 
ATOM   6533  C  CB  . GLN C  1 181 ? -3.640  -12.592 -7.031  1.00 30.25  ? 181 GLN C CB  1 
ATOM   6534  C  CG  . GLN C  1 181 ? -4.639  -12.024 -6.032  1.00 30.79  ? 181 GLN C CG  1 
ATOM   6535  C  CD  . GLN C  1 181 ? -6.016  -11.800 -6.658  1.00 32.86  ? 181 GLN C CD  1 
ATOM   6536  O  OE1 . GLN C  1 181 ? -6.153  -11.760 -7.889  1.00 33.40  ? 181 GLN C OE1 1 
ATOM   6537  N  NE2 . GLN C  1 181 ? -7.051  -11.653 -5.806  1.00 33.54  ? 181 GLN C NE2 1 
ATOM   6538  N  N   . GLN C  1 182 ? -1.137  -12.965 -8.691  1.00 34.45  ? 182 GLN C N   1 
ATOM   6539  C  CA  . GLN C  1 182 ? -0.350  -13.643 -9.697  1.00 37.23  ? 182 GLN C CA  1 
ATOM   6540  C  C   . GLN C  1 182 ? 1.059   -13.959 -9.199  1.00 34.72  ? 182 GLN C C   1 
ATOM   6541  O  O   . GLN C  1 182 ? 1.588   -15.034 -9.460  1.00 34.93  ? 182 GLN C O   1 
ATOM   6542  C  CB  . GLN C  1 182 ? -0.270  -12.807 -10.970 1.00 39.71  ? 182 GLN C CB  1 
ATOM   6543  C  CG  . GLN C  1 182 ? 0.591   -13.441 -12.077 1.00 39.53  ? 182 GLN C CG  1 
ATOM   6544  C  CD  . GLN C  1 182 ? 0.692   -12.564 -13.305 1.00 42.91  ? 182 GLN C CD  1 
ATOM   6545  O  OE1 . GLN C  1 182 ? 1.067   -11.378 -13.217 1.00 41.96  ? 182 GLN C OE1 1 
ATOM   6546  N  NE2 . GLN C  1 182 ? 0.360   -13.131 -14.471 1.00 42.17  ? 182 GLN C NE2 1 
ATOM   6547  N  N   . ARG C  1 183 ? 1.664   -13.017 -8.485  1.00 34.45  ? 183 ARG C N   1 
ATOM   6548  C  CA  . ARG C  1 183 ? 3.025   -13.215 -7.995  1.00 36.50  ? 183 ARG C CA  1 
ATOM   6549  C  C   . ARG C  1 183 ? 3.087   -14.337 -6.983  1.00 36.82  ? 183 ARG C C   1 
ATOM   6550  O  O   . ARG C  1 183 ? 3.874   -15.282 -7.135  1.00 38.28  ? 183 ARG C O   1 
ATOM   6551  C  CB  . ARG C  1 183 ? 3.598   -11.917 -7.386  1.00 36.04  ? 183 ARG C CB  1 
ATOM   6552  C  CG  . ARG C  1 183 ? 5.006   -12.101 -6.780  1.00 38.40  ? 183 ARG C CG  1 
ATOM   6553  C  CD  . ARG C  1 183 ? 5.524   -10.840 -6.146  1.00 38.91  ? 183 ARG C CD  1 
ATOM   6554  N  NE  . ARG C  1 183 ? 4.650   -10.353 -5.098  1.00 43.07  ? 183 ARG C NE  1 
ATOM   6555  C  CZ  . ARG C  1 183 ? 4.605   -10.855 -3.854  1.00 50.19  ? 183 ARG C CZ  1 
ATOM   6556  N  NH1 . ARG C  1 183 ? 3.761   -10.336 -2.953  1.00 53.16  ? 183 ARG C NH1 1 
ATOM   6557  N  NH2 . ARG C  1 183 ? 5.390   -11.873 -3.512  1.00 43.15  ? 183 ARG C NH2 1 
ATOM   6558  N  N   . ILE C  1 184 ? 2.252   -14.242 -5.936  1.00 33.70  ? 184 ILE C N   1 
ATOM   6559  C  CA  . ILE C  1 184 ? 2.257   -15.233 -4.880  1.00 34.23  ? 184 ILE C CA  1 
ATOM   6560  C  C   . ILE C  1 184 ? 1.991   -16.652 -5.439  1.00 35.15  ? 184 ILE C C   1 
ATOM   6561  O  O   . ILE C  1 184 ? 2.663   -17.588 -5.086  1.00 40.57  ? 184 ILE C O   1 
ATOM   6562  C  CB  . ILE C  1 184 ? 1.227   -14.899 -3.773  1.00 32.93  ? 184 ILE C CB  1 
ATOM   6563  C  CG1 . ILE C  1 184 ? 1.570   -13.546 -3.112  1.00 32.27  ? 184 ILE C CG1 1 
ATOM   6564  C  CG2 . ILE C  1 184 ? 1.188   -15.993 -2.743  1.00 31.49  ? 184 ILE C CG2 1 
ATOM   6565  C  CD1 . ILE C  1 184 ? 0.507   -13.042 -2.119  1.00 31.01  ? 184 ILE C CD1 1 
ATOM   6566  N  N   . LEU C  1 185 ? 0.999   -16.765 -6.320  1.00 35.99  ? 185 LEU C N   1 
ATOM   6567  C  CA  . LEU C  1 185 ? 0.635   -18.074 -6.922  1.00 35.73  ? 185 LEU C CA  1 
ATOM   6568  C  C   . LEU C  1 185 ? 1.787   -18.686 -7.721  1.00 37.30  ? 185 LEU C C   1 
ATOM   6569  O  O   . LEU C  1 185 ? 2.112   -19.866 -7.555  1.00 39.47  ? 185 LEU C O   1 
ATOM   6570  C  CB  . LEU C  1 185 ? -0.615  -17.937 -7.803  1.00 29.60  ? 185 LEU C CB  1 
ATOM   6571  C  CG  . LEU C  1 185 ? -1.898  -17.686 -7.052  1.00 30.70  ? 185 LEU C CG  1 
ATOM   6572  C  CD1 . LEU C  1 185 ? -3.047  -17.373 -8.016  1.00 27.43  ? 185 LEU C CD1 1 
ATOM   6573  C  CD2 . LEU C  1 185 ? -2.246  -18.896 -6.132  1.00 27.63  ? 185 LEU C CD2 1 
ATOM   6574  N  N   . THR C  1 186 ? 2.399   -17.887 -8.583  1.00 39.11  ? 186 THR C N   1 
ATOM   6575  C  CA  . THR C  1 186 ? 3.519   -18.370 -9.415  1.00 40.27  ? 186 THR C CA  1 
ATOM   6576  C  C   . THR C  1 186 ? 4.691   -18.742 -8.561  1.00 39.41  ? 186 THR C C   1 
ATOM   6577  O  O   . THR C  1 186 ? 5.324   -19.725 -8.796  1.00 39.00  ? 186 THR C O   1 
ATOM   6578  C  CB  . THR C  1 186 ? 3.946   -17.326 -10.467 1.00 37.18  ? 186 THR C CB  1 
ATOM   6579  O  OG1 . THR C  1 186 ? 4.188   -16.085 -9.830  1.00 40.25  ? 186 THR C OG1 1 
ATOM   6580  C  CG2 . THR C  1 186 ? 2.844   -17.145 -11.510 1.00 34.16  ? 186 THR C CG2 1 
ATOM   6581  N  N   . GLU C  1 187 ? 4.969   -17.925 -7.538  1.00 41.46  ? 187 GLU C N   1 
ATOM   6582  C  CA  . GLU C  1 187 ? 6.049   -18.236 -6.588  1.00 45.85  ? 187 GLU C CA  1 
ATOM   6583  C  C   . GLU C  1 187 ? 5.827   -19.576 -5.944  1.00 45.92  ? 187 GLU C C   1 
ATOM   6584  O  O   . GLU C  1 187 ? 6.758   -20.273 -5.644  1.00 53.26  ? 187 GLU C O   1 
ATOM   6585  C  CB  . GLU C  1 187 ? 6.164   -17.146 -5.510  1.00 47.76  ? 187 GLU C CB  1 
ATOM   6586  C  CG  . GLU C  1 187 ? 6.836   -15.864 -5.989  1.00 53.99  ? 187 GLU C CG  1 
ATOM   6587  C  CD  . GLU C  1 187 ? 6.931   -14.796 -4.885  1.00 54.78  ? 187 GLU C CD  1 
ATOM   6588  O  OE1 . GLU C  1 187 ? 7.259   -13.631 -5.208  1.00 53.56  ? 187 GLU C OE1 1 
ATOM   6589  O  OE2 . GLU C  1 187 ? 6.674   -15.130 -3.701  1.00 53.71  ? 187 GLU C OE2 1 
ATOM   6590  N  N   . GLU C  1 188 ? 4.555   -19.931 -5.737  1.00 46.22  ? 188 GLU C N   1 
ATOM   6591  C  CA  . GLU C  1 188 ? 4.206   -21.200 -5.089  1.00 46.09  ? 188 GLU C CA  1 
ATOM   6592  C  C   . GLU C  1 188 ? 4.151   -22.375 -6.076  1.00 40.44  ? 188 GLU C C   1 
ATOM   6593  O  O   . GLU C  1 188 ? 3.805   -23.491 -5.700  1.00 41.86  ? 188 GLU C O   1 
ATOM   6594  C  CB  . GLU C  1 188 ? 2.873   -21.075 -4.328  1.00 46.92  ? 188 GLU C CB  1 
ATOM   6595  C  CG  . GLU C  1 188 ? 2.925   -20.117 -3.167  1.00 54.56  ? 188 GLU C CG  1 
ATOM   6596  C  CD  . GLU C  1 188 ? 4.063   -20.441 -2.186  1.00 62.95  ? 188 GLU C CD  1 
ATOM   6597  O  OE1 . GLU C  1 188 ? 4.474   -21.620 -2.113  1.00 59.56  ? 188 GLU C OE1 1 
ATOM   6598  O  OE2 . GLU C  1 188 ? 4.532   -19.519 -1.499  1.00 72.00  ? 188 GLU C OE2 1 
ATOM   6599  N  N   . GLY C  1 189 ? 4.485   -22.111 -7.331  1.00 37.61  ? 189 GLY C N   1 
ATOM   6600  C  CA  . GLY C  1 189 ? 4.586   -23.182 -8.345  1.00 40.21  ? 189 GLY C CA  1 
ATOM   6601  C  C   . GLY C  1 189 ? 3.343   -23.349 -9.268  1.00 42.24  ? 189 GLY C C   1 
ATOM   6602  O  O   . GLY C  1 189 ? 3.252   -24.317 -10.022 1.00 38.45  ? 189 GLY C O   1 
ATOM   6603  N  N   . VAL C  1 190 ? 2.404   -22.405 -9.194  1.00 38.24  ? 190 VAL C N   1 
ATOM   6604  C  CA  . VAL C  1 190 ? 1.233   -22.456 -10.047 1.00 35.33  ? 190 VAL C CA  1 
ATOM   6605  C  C   . VAL C  1 190 ? 1.549   -21.951 -11.440 1.00 34.39  ? 190 VAL C C   1 
ATOM   6606  O  O   . VAL C  1 190 ? 2.022   -20.817 -11.613 1.00 34.67  ? 190 VAL C O   1 
ATOM   6607  C  CB  . VAL C  1 190 ? 0.050   -21.620 -9.471  1.00 31.53  ? 190 VAL C CB  1 
ATOM   6608  C  CG1 . VAL C  1 190 ? -1.117  -21.636 -10.439 1.00 27.87  ? 190 VAL C CG1 1 
ATOM   6609  C  CG2 . VAL C  1 190 ? -0.368  -22.150 -8.128  1.00 30.58  ? 190 VAL C CG2 1 
ATOM   6610  N  N   . ASP C  1 191 ? 1.293   -22.784 -12.428 1.00 32.72  ? 191 ASP C N   1 
ATOM   6611  C  CA  . ASP C  1 191 ? 1.418   -22.401 -13.790 1.00 35.90  ? 191 ASP C CA  1 
ATOM   6612  C  C   . ASP C  1 191 ? 0.563   -21.117 -14.075 1.00 34.73  ? 191 ASP C C   1 
ATOM   6613  O  O   . ASP C  1 191 ? -0.652  -21.120 -13.882 1.00 35.67  ? 191 ASP C O   1 
ATOM   6614  C  CB  . ASP C  1 191 ? 0.970   -23.556 -14.707 1.00 36.17  ? 191 ASP C CB  1 
ATOM   6615  C  CG  . ASP C  1 191 ? 0.978   -23.173 -16.192 1.00 38.53  ? 191 ASP C CG  1 
ATOM   6616  O  OD1 . ASP C  1 191 ? 1.352   -22.031 -16.512 1.00 40.17  ? 191 ASP C OD1 1 
ATOM   6617  O  OD2 . ASP C  1 191 ? 0.605   -24.029 -17.029 1.00 41.86  ? 191 ASP C OD2 1 
ATOM   6618  N  N   . PRO C  1 192 ? 1.221   -20.041 -14.538 1.00 34.20  ? 192 PRO C N   1 
ATOM   6619  C  CA  . PRO C  1 192 ? 0.547   -18.752 -14.782 1.00 35.38  ? 192 PRO C CA  1 
ATOM   6620  C  C   . PRO C  1 192 ? -0.612  -18.889 -15.739 1.00 33.13  ? 192 PRO C C   1 
ATOM   6621  O  O   . PRO C  1 192 ? -1.581  -18.180 -15.622 1.00 34.12  ? 192 PRO C O   1 
ATOM   6622  C  CB  . PRO C  1 192 ? 1.665   -17.881 -15.413 1.00 34.89  ? 192 PRO C CB  1 
ATOM   6623  C  CG  . PRO C  1 192 ? 2.943   -18.535 -14.983 1.00 36.78  ? 192 PRO C CG  1 
ATOM   6624  C  CD  . PRO C  1 192 ? 2.646   -20.003 -14.920 1.00 34.61  ? 192 PRO C CD  1 
ATOM   6625  N  N   . GLY C  1 193 ? -0.494  -19.812 -16.688 1.00 32.87  ? 193 GLY C N   1 
ATOM   6626  C  CA  . GLY C  1 193 ? -1.550  -20.044 -17.674 1.00 30.36  ? 193 GLY C CA  1 
ATOM   6627  C  C   . GLY C  1 193 ? -2.761  -20.738 -17.066 1.00 32.39  ? 193 GLY C C   1 
ATOM   6628  O  O   . GLY C  1 193 ? -3.771  -20.984 -17.753 1.00 32.42  ? 193 GLY C O   1 
ATOM   6629  N  N   . LYS C  1 194 ? -2.666  -21.060 -15.784 1.00 33.30  ? 194 LYS C N   1 
ATOM   6630  C  CA  . LYS C  1 194 ? -3.765  -21.670 -15.073 1.00 31.91  ? 194 LYS C CA  1 
ATOM   6631  C  C   . LYS C  1 194 ? -4.453  -20.655 -14.147 1.00 31.43  ? 194 LYS C C   1 
ATOM   6632  O  O   . LYS C  1 194 ? -5.225  -21.028 -13.262 1.00 32.48  ? 194 LYS C O   1 
ATOM   6633  C  CB  . LYS C  1 194 ? -3.284  -22.870 -14.281 1.00 33.45  ? 194 LYS C CB  1 
ATOM   6634  C  CG  . LYS C  1 194 ? -3.185  -24.160 -15.102 1.00 36.52  ? 194 LYS C CG  1 
ATOM   6635  C  CD  . LYS C  1 194 ? -4.540  -24.550 -15.629 1.00 47.13  ? 194 LYS C CD  1 
ATOM   6636  C  CE  . LYS C  1 194 ? -4.590  -25.993 -16.011 1.00 44.77  ? 194 LYS C CE  1 
ATOM   6637  N  NZ  . LYS C  1 194 ? -5.996  -26.425 -16.280 1.00 41.11  ? 194 LYS C NZ  1 
ATOM   6638  N  N   . ILE C  1 195 ? -4.168  -19.369 -14.363 1.00 29.97  ? 195 ILE C N   1 
ATOM   6639  C  CA  . ILE C  1 195 ? -4.730  -18.327 -13.536 1.00 28.46  ? 195 ILE C CA  1 
ATOM   6640  C  C   . ILE C  1 195 ? -5.484  -17.303 -14.346 1.00 28.19  ? 195 ILE C C   1 
ATOM   6641  O  O   . ILE C  1 195 ? -4.968  -16.762 -15.316 1.00 28.82  ? 195 ILE C O   1 
ATOM   6642  C  CB  . ILE C  1 195 ? -3.646  -17.592 -12.745 1.00 28.29  ? 195 ILE C CB  1 
ATOM   6643  C  CG1 . ILE C  1 195 ? -2.723  -18.599 -12.011 1.00 29.88  ? 195 ILE C CG1 1 
ATOM   6644  C  CG2 . ILE C  1 195 ? -4.285  -16.603 -11.772 1.00 25.46  ? 195 ILE C CG2 1 
ATOM   6645  C  CD1 . ILE C  1 195 ? -1.486  -17.951 -11.366 1.00 27.76  ? 195 ILE C CD1 1 
ATOM   6646  N  N   . LEU C  1 196 ? -6.694  -17.038 -13.945 1.00 27.58  ? 196 LEU C N   1 
ATOM   6647  C  CA  . LEU C  1 196 ? -7.452  -15.965 -14.510 1.00 26.05  ? 196 LEU C CA  1 
ATOM   6648  C  C   . LEU C  1 196 ? -7.520  -14.838 -13.516 1.00 26.91  ? 196 LEU C C   1 
ATOM   6649  O  O   . LEU C  1 196 ? -8.250  -14.928 -12.497 1.00 27.73  ? 196 LEU C O   1 
ATOM   6650  C  CB  . LEU C  1 196 ? -8.885  -16.439 -14.887 1.00 23.00  ? 196 LEU C CB  1 
ATOM   6651  C  CG  . LEU C  1 196 ? -9.943  -15.314 -15.205 1.00 24.44  ? 196 LEU C CG  1 
ATOM   6652  C  CD1 . LEU C  1 196 ? -9.520  -14.454 -16.391 1.00 23.19  ? 196 LEU C CD1 1 
ATOM   6653  C  CD2 . LEU C  1 196 ? -11.323 -15.907 -15.431 1.00 24.19  ? 196 LEU C CD2 1 
ATOM   6654  N  N   . ILE C  1 197 ? -6.754  -13.762 -13.774 1.00 27.35  ? 197 ILE C N   1 
ATOM   6655  C  CA  . ILE C  1 197 ? -6.783  -12.544 -12.883 1.00 27.00  ? 197 ILE C CA  1 
ATOM   6656  C  C   . ILE C  1 197 ? -7.994  -11.689 -13.206 1.00 26.48  ? 197 ILE C C   1 
ATOM   6657  O  O   . ILE C  1 197 ? -8.049  -11.051 -14.247 1.00 27.36  ? 197 ILE C O   1 
ATOM   6658  C  CB  . ILE C  1 197 ? -5.539  -11.723 -13.016 1.00 26.10  ? 197 ILE C CB  1 
ATOM   6659  C  CG1 . ILE C  1 197 ? -4.288  -12.573 -12.642 1.00 25.71  ? 197 ILE C CG1 1 
ATOM   6660  C  CG2 . ILE C  1 197 ? -5.633  -10.470 -12.131 1.00 23.87  ? 197 ILE C CG2 1 
ATOM   6661  C  CD1 . ILE C  1 197 ? -4.313  -13.114 -11.187 1.00 28.77  ? 197 ILE C CD1 1 
ATOM   6662  N  N   . GLY C  1 198 ? -8.963  -11.675 -12.291 1.00 26.66  ? 198 GLY C N   1 
ATOM   6663  C  CA  . GLY C  1 198 ? -10.296 -11.091 -12.575 1.00 29.27  ? 198 GLY C CA  1 
ATOM   6664  C  C   . GLY C  1 198 ? -10.495 -9.562  -12.362 1.00 29.23  ? 198 GLY C C   1 
ATOM   6665  O  O   . GLY C  1 198 ? -9.771  -8.913  -11.585 1.00 29.49  ? 198 GLY C O   1 
ATOM   6666  N  N   . HIS C  1 199 ? -11.491 -9.019  -13.072 1.00 29.71  ? 199 HIS C N   1 
ATOM   6667  C  CA  . HIS C  1 199 ? -11.942 -7.611  -12.908 1.00 32.74  ? 199 HIS C CA  1 
ATOM   6668  C  C   . HIS C  1 199 ? -10.930 -6.569  -13.401 1.00 37.23  ? 199 HIS C C   1 
ATOM   6669  O  O   . HIS C  1 199 ? -10.987 -5.410  -13.017 1.00 36.40  ? 199 HIS C O   1 
ATOM   6670  C  CB  . HIS C  1 199 ? -12.356 -7.345  -11.476 1.00 29.19  ? 199 HIS C CB  1 
ATOM   6671  C  CG  . HIS C  1 199 ? -13.306 -8.399  -10.909 1.00 29.56  ? 199 HIS C CG  1 
ATOM   6672  N  ND1 . HIS C  1 199 ? -14.232 -9.051  -11.682 1.00 29.70  ? 199 HIS C ND1 1 
ATOM   6673  C  CD2 . HIS C  1 199 ? -13.459 -8.893  -9.627  1.00 28.38  ? 199 HIS C CD2 1 
ATOM   6674  C  CE1 . HIS C  1 199 ? -14.920 -9.911  -10.923 1.00 30.03  ? 199 HIS C CE1 1 
ATOM   6675  N  NE2 . HIS C  1 199 ? -14.462 -9.825  -9.670  1.00 33.14  ? 199 HIS C NE2 1 
ATOM   6676  N  N   . LEU C  1 200 ? -10.022 -6.996  -14.258 1.00 35.97  ? 200 LEU C N   1 
ATOM   6677  C  CA  . LEU C  1 200 ? -9.070  -6.094  -14.857 1.00 35.44  ? 200 LEU C CA  1 
ATOM   6678  C  C   . LEU C  1 200 ? -9.776  -5.131  -15.879 1.00 35.55  ? 200 LEU C C   1 
ATOM   6679  O  O   . LEU C  1 200 ? -9.233  -4.086  -16.244 1.00 36.46  ? 200 LEU C O   1 
ATOM   6680  C  CB  . LEU C  1 200 ? -7.964  -6.867  -15.531 1.00 34.97  ? 200 LEU C CB  1 
ATOM   6681  C  CG  . LEU C  1 200 ? -7.000  -7.587  -14.582 1.00 36.87  ? 200 LEU C CG  1 
ATOM   6682  C  CD1 . LEU C  1 200 ? -6.066  -8.512  -15.348 1.00 29.74  ? 200 LEU C CD1 1 
ATOM   6683  C  CD2 . LEU C  1 200 ? -6.203  -6.569  -13.752 1.00 35.87  ? 200 LEU C CD2 1 
ATOM   6684  N  N   . GLY C  1 201 ? -10.978 -5.509  -16.312 1.00 32.48  ? 201 GLY C N   1 
ATOM   6685  C  CA  . GLY C  1 201 ? -11.767 -4.666  -17.226 1.00 33.14  ? 201 GLY C CA  1 
ATOM   6686  C  C   . GLY C  1 201 ? -12.277 -3.390  -16.540 1.00 31.50  ? 201 GLY C C   1 
ATOM   6687  O  O   . GLY C  1 201 ? -12.807 -2.485  -17.195 1.00 32.94  ? 201 GLY C O   1 
ATOM   6688  N  N   . ASP C  1 202 ? -12.107 -3.329  -15.214 1.00 31.77  ? 202 ASP C N   1 
ATOM   6689  C  CA  . ASP C  1 202 ? -12.574 -2.194  -14.416 1.00 34.54  ? 202 ASP C CA  1 
ATOM   6690  C  C   . ASP C  1 202 ? -11.646 -0.955  -14.546 1.00 36.61  ? 202 ASP C C   1 
ATOM   6691  O  O   . ASP C  1 202 ? -11.925 0.086   -13.995 1.00 34.55  ? 202 ASP C O   1 
ATOM   6692  C  CB  . ASP C  1 202 ? -12.703 -2.592  -12.956 1.00 33.87  ? 202 ASP C CB  1 
ATOM   6693  C  CG  . ASP C  1 202 ? -13.788 -3.655  -12.727 1.00 37.04  ? 202 ASP C CG  1 
ATOM   6694  O  OD1 . ASP C  1 202 ? -14.458 -4.047  -13.708 1.00 34.88  ? 202 ASP C OD1 1 
ATOM   6695  O  OD2 . ASP C  1 202 ? -13.965 -4.090  -11.563 1.00 35.57  ? 202 ASP C OD2 1 
ATOM   6696  N  N   . THR C  1 203 ? -10.561 -1.108  -15.270 1.00 38.07  ? 203 THR C N   1 
ATOM   6697  C  CA  . THR C  1 203 ? -9.634  -0.012  -15.480 1.00 39.71  ? 203 THR C CA  1 
ATOM   6698  C  C   . THR C  1 203 ? -9.302  0.138   -16.937 1.00 42.39  ? 203 THR C C   1 
ATOM   6699  O  O   . THR C  1 203 ? -9.349  -0.834  -17.700 1.00 41.83  ? 203 THR C O   1 
ATOM   6700  C  CB  . THR C  1 203 ? -8.334  -0.218  -14.703 1.00 36.95  ? 203 THR C CB  1 
ATOM   6701  O  OG1 . THR C  1 203 ? -7.513  0.946   -14.833 1.00 39.61  ? 203 THR C OG1 1 
ATOM   6702  C  CG2 . THR C  1 203 ? -7.576  -1.425  -15.241 1.00 38.64  ? 203 THR C CG2 1 
ATOM   6703  N  N   . ASP C  1 204 ? -8.971  1.357   -17.338 1.00 44.20  ? 204 ASP C N   1 
ATOM   6704  C  CA  . ASP C  1 204 ? -8.542  1.621   -18.696 1.00 49.35  ? 204 ASP C CA  1 
ATOM   6705  C  C   . ASP C  1 204 ? -7.035  1.687   -18.756 1.00 49.10  ? 204 ASP C C   1 
ATOM   6706  O  O   . ASP C  1 204 ? -6.458  1.926   -19.811 1.00 54.39  ? 204 ASP C O   1 
ATOM   6707  C  CB  . ASP C  1 204 ? -9.158  2.929   -19.217 1.00 52.69  ? 204 ASP C CB  1 
ATOM   6708  C  CG  . ASP C  1 204 ? -8.804  4.132   -18.347 1.00 60.14  ? 204 ASP C CG  1 
ATOM   6709  O  OD1 . ASP C  1 204 ? -9.719  4.904   -18.000 1.00 66.81  ? 204 ASP C OD1 1 
ATOM   6710  O  OD2 . ASP C  1 204 ? -7.609  4.295   -18.007 1.00 61.85  ? 204 ASP C OD2 1 
ATOM   6711  N  N   . ASN C  1 205 ? -6.384  1.472   -17.590 1.00 50.07  ? 205 ASN C N   1 
ATOM   6712  C  CA  . ASN C  1 205 ? -4.911  1.423   -17.522 1.00 46.24  ? 205 ASN C CA  1 
ATOM   6713  C  C   . ASN C  1 205 ? -4.382  0.231   -18.261 1.00 46.30  ? 205 ASN C C   1 
ATOM   6714  O  O   . ASN C  1 205 ? -4.083  -0.832  -17.653 1.00 44.93  ? 205 ASN C O   1 
ATOM   6715  C  CB  . ASN C  1 205 ? -4.436  1.400   -16.077 1.00 46.45  ? 205 ASN C CB  1 
ATOM   6716  C  CG  . ASN C  1 205 ? -2.909  1.379   -15.960 1.00 50.11  ? 205 ASN C CG  1 
ATOM   6717  O  OD1 . ASN C  1 205 ? -2.200  1.298   -16.960 1.00 47.54  ? 205 ASN C OD1 1 
ATOM   6718  N  ND2 . ASN C  1 205 ? -2.411  1.446   -14.740 1.00 53.57  ? 205 ASN C ND2 1 
ATOM   6719  N  N   . ILE C  1 206 ? -4.258  0.380   -19.560 1.00 46.07  ? 206 ILE C N   1 
ATOM   6720  C  CA  . ILE C  1 206 ? -3.855  -0.673  -20.415 1.00 46.65  ? 206 ILE C CA  1 
ATOM   6721  C  C   . ILE C  1 206 ? -2.450  -1.309  -20.008 1.00 48.72  ? 206 ILE C C   1 
ATOM   6722  O  O   . ILE C  1 206 ? -2.206  -2.515  -20.236 1.00 48.63  ? 206 ILE C O   1 
ATOM   6723  C  CB  . ILE C  1 206 ? -3.803  -0.193  -21.899 1.00 48.52  ? 206 ILE C CB  1 
ATOM   6724  C  CG1 . ILE C  1 206 ? -4.084  -1.338  -22.835 1.00 50.87  ? 206 ILE C CG1 1 
ATOM   6725  C  CG2 . ILE C  1 206 ? -2.460  0.476   -22.208 1.00 52.73  ? 206 ILE C CG2 1 
ATOM   6726  C  CD1 . ILE C  1 206 ? -5.495  -1.848  -22.747 1.00 50.23  ? 206 ILE C CD1 1 
ATOM   6727  N  N   . ASP C  1 207 ? -1.573  -0.492  -19.420 1.00 48.83  ? 207 ASP C N   1 
ATOM   6728  C  CA  . ASP C  1 207 ? -0.198  -0.949  -19.048 1.00 49.63  ? 207 ASP C CA  1 
ATOM   6729  C  C   . ASP C  1 207 ? -0.233  -2.007  -17.977 1.00 46.87  ? 207 ASP C C   1 
ATOM   6730  O  O   . ASP C  1 207 ? 0.435   -3.045  -18.086 1.00 42.49  ? 207 ASP C O   1 
ATOM   6731  C  CB  . ASP C  1 207 ? 0.649   0.231   -18.587 1.00 56.98  ? 207 ASP C CB  1 
ATOM   6732  C  CG  . ASP C  1 207 ? 0.910   1.232   -19.700 1.00 70.05  ? 207 ASP C CG  1 
ATOM   6733  O  OD1 . ASP C  1 207 ? 1.104   0.799   -20.862 1.00 73.03  ? 207 ASP C OD1 1 
ATOM   6734  O  OD2 . ASP C  1 207 ? 0.929   2.443   -19.416 1.00 78.92  ? 207 ASP C OD2 1 
ATOM   6735  N  N   . TYR C  1 208 ? -1.002  -1.751  -16.938 1.00 47.26  ? 208 TYR C N   1 
ATOM   6736  C  CA  . TYR C  1 208 ? -1.147  -2.684  -15.849 1.00 44.74  ? 208 TYR C CA  1 
ATOM   6737  C  C   . TYR C  1 208 ? -1.665  -4.030  -16.355 1.00 43.68  ? 208 TYR C C   1 
ATOM   6738  O  O   . TYR C  1 208 ? -1.080  -5.091  -16.060 1.00 38.15  ? 208 TYR C O   1 
ATOM   6739  C  CB  . TYR C  1 208 ? -2.097  -2.117  -14.794 1.00 40.79  ? 208 TYR C CB  1 
ATOM   6740  C  CG  . TYR C  1 208 ? -2.339  -3.035  -13.631 1.00 40.85  ? 208 TYR C CG  1 
ATOM   6741  C  CD1 . TYR C  1 208 ? -1.283  -3.443  -12.804 1.00 39.89  ? 208 TYR C CD1 1 
ATOM   6742  C  CD2 . TYR C  1 208 ? -3.626  -3.497  -13.336 1.00 38.72  ? 208 TYR C CD2 1 
ATOM   6743  C  CE1 . TYR C  1 208 ? -1.500  -4.287  -11.725 1.00 39.67  ? 208 TYR C CE1 1 
ATOM   6744  C  CE2 . TYR C  1 208 ? -3.859  -4.347  -12.252 1.00 35.63  ? 208 TYR C CE2 1 
ATOM   6745  C  CZ  . TYR C  1 208 ? -2.797  -4.739  -11.451 1.00 38.19  ? 208 TYR C CZ  1 
ATOM   6746  O  OH  . TYR C  1 208 ? -3.014  -5.567  -10.394 1.00 35.82  ? 208 TYR C OH  1 
ATOM   6747  N  N   . ILE C  1 209 ? -2.766  -3.989  -17.125 1.00 40.77  ? 209 ILE C N   1 
ATOM   6748  C  CA  . ILE C  1 209 ? -3.379  -5.203  -17.662 1.00 39.77  ? 209 ILE C CA  1 
ATOM   6749  C  C   . ILE C  1 209 ? -2.379  -6.006  -18.473 1.00 40.63  ? 209 ILE C C   1 
ATOM   6750  O  O   . ILE C  1 209 ? -2.268  -7.239  -18.309 1.00 41.10  ? 209 ILE C O   1 
ATOM   6751  C  CB  . ILE C  1 209 ? -4.619  -4.874  -18.542 1.00 40.32  ? 209 ILE C CB  1 
ATOM   6752  C  CG1 . ILE C  1 209 ? -5.629  -4.024  -17.747 1.00 37.35  ? 209 ILE C CG1 1 
ATOM   6753  C  CG2 . ILE C  1 209 ? -5.267  -6.159  -19.066 1.00 35.89  ? 209 ILE C CG2 1 
ATOM   6754  C  CD1 . ILE C  1 209 ? -6.790  -3.495  -18.586 1.00 36.77  ? 209 ILE C CD1 1 
ATOM   6755  N  N   . LYS C  1 210 ? -1.632  -5.314  -19.351 1.00 40.52  ? 210 LYS C N   1 
ATOM   6756  C  CA  . LYS C  1 210 ? -0.632  -5.978  -20.214 1.00 40.98  ? 210 LYS C CA  1 
ATOM   6757  C  C   . LYS C  1 210 ? 0.450   -6.671  -19.410 1.00 39.91  ? 210 LYS C C   1 
ATOM   6758  O  O   . LYS C  1 210 ? 0.901   -7.773  -19.773 1.00 39.80  ? 210 LYS C O   1 
ATOM   6759  C  CB  . LYS C  1 210 ? -0.003  -4.978  -21.192 1.00 45.10  ? 210 LYS C CB  1 
ATOM   6760  C  CG  . LYS C  1 210 ? -0.896  -4.595  -22.355 1.00 47.24  ? 210 LYS C CG  1 
ATOM   6761  C  CD  . LYS C  1 210 ? -0.194  -3.589  -23.275 1.00 49.37  ? 210 LYS C CD  1 
ATOM   6762  C  CE  . LYS C  1 210 ? -1.071  -3.197  -24.448 1.00 49.20  ? 210 LYS C CE  1 
ATOM   6763  N  NZ  . LYS C  1 210 ? -0.413  -2.152  -25.298 1.00 51.67  ? 210 LYS C NZ  1 
ATOM   6764  N  N   . LYS C  1 211 ? 0.880   -6.041  -18.320 1.00 38.45  ? 211 LYS C N   1 
ATOM   6765  C  CA  . LYS C  1 211 ? 1.926   -6.632  -17.481 1.00 42.07  ? 211 LYS C CA  1 
ATOM   6766  C  C   . LYS C  1 211 ? 1.504   -8.014  -16.988 1.00 39.21  ? 211 LYS C C   1 
ATOM   6767  O  O   . LYS C  1 211 ? 2.272   -8.958  -17.042 1.00 36.53  ? 211 LYS C O   1 
ATOM   6768  C  CB  . LYS C  1 211 ? 2.253   -5.733  -16.297 1.00 43.88  ? 211 LYS C CB  1 
ATOM   6769  C  CG  . LYS C  1 211 ? 3.390   -6.280  -15.412 1.00 48.33  ? 211 LYS C CG  1 
ATOM   6770  C  CD  . LYS C  1 211 ? 3.544   -5.480  -14.131 1.00 52.43  ? 211 LYS C CD  1 
ATOM   6771  C  CE  . LYS C  1 211 ? 4.058   -4.090  -14.405 1.00 52.59  ? 211 LYS C CE  1 
ATOM   6772  N  NZ  . LYS C  1 211 ? 4.339   -3.358  -13.143 1.00 57.65  ? 211 LYS C NZ  1 
ATOM   6773  N  N   . ILE C  1 212 ? 0.270   -8.115  -16.514 1.00 37.06  ? 212 ILE C N   1 
ATOM   6774  C  CA  . ILE C  1 212 ? -0.243  -9.374  -15.993 1.00 35.01  ? 212 ILE C CA  1 
ATOM   6775  C  C   . ILE C  1 212 ? -0.282  -10.477 -17.090 1.00 33.01  ? 212 ILE C C   1 
ATOM   6776  O  O   . ILE C  1 212 ? 0.149   -11.590 -16.862 1.00 32.39  ? 212 ILE C O   1 
ATOM   6777  C  CB  . ILE C  1 212 ? -1.626  -9.193  -15.361 1.00 35.16  ? 212 ILE C CB  1 
ATOM   6778  C  CG1 . ILE C  1 212 ? -1.510  -8.323  -14.096 1.00 34.58  ? 212 ILE C CG1 1 
ATOM   6779  C  CG2 . ILE C  1 212 ? -2.236  -10.535 -15.028 1.00 31.10  ? 212 ILE C CG2 1 
ATOM   6780  C  CD1 . ILE C  1 212 ? -2.821  -7.833  -13.573 1.00 41.06  ? 212 ILE C CD1 1 
ATOM   6781  N  N   . ALA C  1 213 ? -0.801  -10.123 -18.284 1.00 32.24  ? 213 ALA C N   1 
ATOM   6782  C  CA  . ALA C  1 213 ? -0.845  -11.066 -19.410 1.00 32.31  ? 213 ALA C CA  1 
ATOM   6783  C  C   . ALA C  1 213 ? 0.570   -11.468 -19.851 1.00 37.42  ? 213 ALA C C   1 
ATOM   6784  O  O   . ALA C  1 213 ? 0.821   -12.637 -20.201 1.00 35.38  ? 213 ALA C O   1 
ATOM   6785  C  CB  . ALA C  1 213 ? -1.615  -10.473 -20.569 1.00 32.88  ? 213 ALA C CB  1 
ATOM   6786  N  N   . ASP C  1 214 ? 1.496   -10.496 -19.840 1.00 37.50  ? 214 ASP C N   1 
ATOM   6787  C  CA  . ASP C  1 214 ? 2.896   -10.768 -20.194 1.00 43.74  ? 214 ASP C CA  1 
ATOM   6788  C  C   . ASP C  1 214 ? 3.502   -11.802 -19.251 1.00 43.10  ? 214 ASP C C   1 
ATOM   6789  O  O   . ASP C  1 214 ? 4.293   -12.628 -19.663 1.00 46.27  ? 214 ASP C O   1 
ATOM   6790  C  CB  . ASP C  1 214 ? 3.727   -9.475  -20.181 1.00 43.44  ? 214 ASP C CB  1 
ATOM   6791  C  CG  . ASP C  1 214 ? 3.386   -8.541  -21.354 1.00 49.53  ? 214 ASP C CG  1 
ATOM   6792  O  OD1 . ASP C  1 214 ? 2.908   -9.050  -22.422 1.00 50.40  ? 214 ASP C OD1 1 
ATOM   6793  O  OD2 . ASP C  1 214 ? 3.597   -7.307  -21.218 1.00 51.73  ? 214 ASP C OD2 1 
ATOM   6794  N  N   . LYS C  1 215 ? 3.107   -11.739 -17.959 1.00 40.40  ? 215 LYS C N   1 
ATOM   6795  C  CA  . LYS C  1 215 ? 3.545   -12.735 -16.964 1.00 41.20  ? 215 LYS C CA  1 
ATOM   6796  C  C   . LYS C  1 215 ? 2.901   -14.154 -17.250 1.00 39.89  ? 215 LYS C C   1 
ATOM   6797  O  O   . LYS C  1 215 ? 3.227   -15.114 -16.610 1.00 39.23  ? 215 LYS C O   1 
ATOM   6798  C  CB  . LYS C  1 215 ? 3.205   -12.280 -15.552 1.00 44.84  ? 215 LYS C CB  1 
ATOM   6799  C  CG  . LYS C  1 215 ? 3.829   -10.944 -15.139 1.00 47.87  ? 215 LYS C CG  1 
ATOM   6800  C  CD  . LYS C  1 215 ? 5.255   -11.109 -14.670 1.00 54.35  ? 215 LYS C CD  1 
ATOM   6801  C  CE  . LYS C  1 215 ? 5.794   -9.794  -14.082 1.00 53.65  ? 215 LYS C CE  1 
ATOM   6802  N  NZ  . LYS C  1 215 ? 7.160   -9.946  -13.567 1.00 49.89  ? 215 LYS C NZ  1 
ATOM   6803  N  N   . GLY C  1 216 ? 1.976   -14.210 -18.222 1.00 35.90  ? 216 GLY C N   1 
ATOM   6804  C  CA  . GLY C  1 216 ? 1.416   -15.528 -18.702 1.00 36.25  ? 216 GLY C CA  1 
ATOM   6805  C  C   . GLY C  1 216 ? -0.037  -15.898 -18.212 1.00 34.63  ? 216 GLY C C   1 
ATOM   6806  O  O   . GLY C  1 216 ? -0.536  -16.955 -18.522 1.00 36.53  ? 216 GLY C O   1 
ATOM   6807  N  N   . SER C  1 217 ? -0.662  -15.022 -17.470 1.00 30.94  ? 217 SER C N   1 
ATOM   6808  C  CA  . SER C  1 217 ? -2.031  -15.314 -16.946 1.00 33.02  ? 217 SER C CA  1 
ATOM   6809  C  C   . SER C  1 217 ? -3.111  -14.719 -17.823 1.00 31.84  ? 217 SER C C   1 
ATOM   6810  O  O   . SER C  1 217 ? -2.871  -13.775 -18.553 1.00 33.49  ? 217 SER C O   1 
ATOM   6811  C  CB  . SER C  1 217 ? -2.180  -14.812 -15.508 1.00 32.15  ? 217 SER C CB  1 
ATOM   6812  O  OG  . SER C  1 217 ? -1.246  -15.455 -14.640 1.00 31.69  ? 217 SER C OG  1 
ATOM   6813  N  N   . PHE C  1 218 ? -4.315  -15.292 -17.753 1.00 31.20  ? 218 PHE C N   1 
ATOM   6814  C  CA  . PHE C  1 218 ? -5.440  -14.738 -18.449 1.00 29.76  ? 218 PHE C CA  1 
ATOM   6815  C  C   . PHE C  1 218 ? -5.898  -13.508 -17.744 1.00 30.72  ? 218 PHE C C   1 
ATOM   6816  O  O   . PHE C  1 218 ? -5.734  -13.385 -16.512 1.00 28.60  ? 218 PHE C O   1 
ATOM   6817  C  CB  . PHE C  1 218 ? -6.601  -15.778 -18.545 1.00 29.01  ? 218 PHE C CB  1 
ATOM   6818  C  CG  . PHE C  1 218 ? -6.282  -16.977 -19.446 1.00 29.18  ? 218 PHE C CG  1 
ATOM   6819  C  CD1 . PHE C  1 218 ? -5.862  -18.180 -18.902 1.00 27.33  ? 218 PHE C CD1 1 
ATOM   6820  C  CD2 . PHE C  1 218 ? -6.402  -16.874 -20.864 1.00 30.65  ? 218 PHE C CD2 1 
ATOM   6821  C  CE1 . PHE C  1 218 ? -5.569  -19.274 -19.723 1.00 27.05  ? 218 PHE C CE1 1 
ATOM   6822  C  CE2 . PHE C  1 218 ? -6.109  -17.962 -21.686 1.00 28.39  ? 218 PHE C CE2 1 
ATOM   6823  C  CZ  . PHE C  1 218 ? -5.693  -19.160 -21.124 1.00 30.08  ? 218 PHE C CZ  1 
ATOM   6824  N  N   . ILE C  1 219 ? -6.469  -12.566 -18.501 1.00 28.39  ? 219 ILE C N   1 
ATOM   6825  C  CA  . ILE C  1 219 ? -6.950  -11.332 -17.931 1.00 28.94  ? 219 ILE C CA  1 
ATOM   6826  C  C   . ILE C  1 219 ? -8.471  -11.223 -18.061 1.00 29.22  ? 219 ILE C C   1 
ATOM   6827  O  O   . ILE C  1 219 ? -9.030  -11.403 -19.147 1.00 27.07  ? 219 ILE C O   1 
ATOM   6828  C  CB  . ILE C  1 219 ? -6.262  -10.095 -18.578 1.00 32.21  ? 219 ILE C CB  1 
ATOM   6829  C  CG1 . ILE C  1 219 ? -6.432  -10.120 -20.088 1.00 34.30  ? 219 ILE C CG1 1 
ATOM   6830  C  CG2 . ILE C  1 219 ? -4.767  -10.050 -18.196 1.00 30.33  ? 219 ILE C CG2 1 
ATOM   6831  C  CD1 . ILE C  1 219 ? -5.492  -9.183  -20.827 1.00 40.52  ? 219 ILE C CD1 1 
ATOM   6832  N  N   . GLY C  1 220 ? -9.130  -10.935 -16.947 1.00 31.50  ? 220 GLY C N   1 
ATOM   6833  C  CA  . GLY C  1 220 ? -10.557 -10.899 -16.905 1.00 29.92  ? 220 GLY C CA  1 
ATOM   6834  C  C   . GLY C  1 220 ? -11.159 -9.534  -17.196 1.00 31.95  ? 220 GLY C C   1 
ATOM   6835  O  O   . GLY C  1 220 ? -11.197 -8.664  -16.333 1.00 31.38  ? 220 GLY C O   1 
ATOM   6836  N  N   . LEU C  1 221 ? -11.614 -9.357  -18.408 1.00 30.10  ? 221 LEU C N   1 
ATOM   6837  C  CA  . LEU C  1 221 ? -12.374 -8.208  -18.769 1.00 31.41  ? 221 LEU C CA  1 
ATOM   6838  C  C   . LEU C  1 221 ? -13.800 -8.617  -18.592 1.00 30.74  ? 221 LEU C C   1 
ATOM   6839  O  O   . LEU C  1 221 ? -14.535 -8.812  -19.563 1.00 32.00  ? 221 LEU C O   1 
ATOM   6840  C  CB  . LEU C  1 221 ? -12.081 -7.826  -20.232 1.00 29.75  ? 221 LEU C CB  1 
ATOM   6841  C  CG  . LEU C  1 221 ? -10.544 -7.814  -20.606 1.00 33.93  ? 221 LEU C CG  1 
ATOM   6842  C  CD1 . LEU C  1 221 ? -10.308 -7.434  -22.074 1.00 31.30  ? 221 LEU C CD1 1 
ATOM   6843  C  CD2 . LEU C  1 221 ? -9.752  -6.899  -19.674 1.00 32.54  ? 221 LEU C CD2 1 
ATOM   6844  N  N   . ASP C  1 222 ? -14.203 -8.748  -17.334 1.00 31.97  ? 222 ASP C N   1 
ATOM   6845  C  CA  . ASP C  1 222 ? -15.329 -9.641  -16.963 1.00 33.34  ? 222 ASP C CA  1 
ATOM   6846  C  C   . ASP C  1 222 ? -16.480 -8.995  -16.261 1.00 35.97  ? 222 ASP C C   1 
ATOM   6847  O  O   . ASP C  1 222 ? -17.293 -9.701  -15.599 1.00 29.18  ? 222 ASP C O   1 
ATOM   6848  C  CB  . ASP C  1 222 ? -14.783 -10.796 -16.074 1.00 34.69  ? 222 ASP C CB  1 
ATOM   6849  C  CG  . ASP C  1 222 ? -13.882 -10.266 -14.873 1.00 35.83  ? 222 ASP C CG  1 
ATOM   6850  O  OD1 . ASP C  1 222 ? -13.021 -11.031 -14.385 1.00 36.77  ? 222 ASP C OD1 1 
ATOM   6851  O  OD2 . ASP C  1 222 ? -14.063 -9.074  -14.453 1.00 34.05  ? 222 ASP C OD2 1 
ATOM   6852  N  N   . ARG C  1 223 ? -16.600 -7.693  -16.369 1.00 37.86  ? 223 ARG C N   1 
ATOM   6853  C  CA  . ARG C  1 223 ? -17.709 -6.994  -15.701 1.00 36.38  ? 223 ARG C CA  1 
ATOM   6854  C  C   . ARG C  1 223 ? -18.534 -6.105  -16.657 1.00 36.13  ? 223 ARG C C   1 
ATOM   6855  O  O   . ARG C  1 223 ? -19.017 -5.051  -16.276 1.00 34.84  ? 223 ARG C O   1 
ATOM   6856  C  CB  . ARG C  1 223 ? -17.199 -6.190  -14.486 1.00 38.59  ? 223 ARG C CB  1 
ATOM   6857  C  CG  . ARG C  1 223 ? -17.057 -7.030  -13.230 1.00 37.31  ? 223 ARG C CG  1 
ATOM   6858  C  CD  . ARG C  1 223 ? -16.468 -6.251  -12.087 1.00 36.88  ? 223 ARG C CD  1 
ATOM   6859  N  NE  . ARG C  1 223 ? -16.748 -6.896  -10.811 1.00 36.15  ? 223 ARG C NE  1 
ATOM   6860  C  CZ  . ARG C  1 223 ? -16.208 -6.532  -9.639  1.00 33.33  ? 223 ARG C CZ  1 
ATOM   6861  N  NH1 . ARG C  1 223 ? -15.332 -5.513  -9.578  1.00 33.03  ? 223 ARG C NH1 1 
ATOM   6862  N  NH2 . ARG C  1 223 ? -16.533 -7.183  -8.535  1.00 31.30  ? 223 ARG C NH2 1 
ATOM   6863  N  N   . TYR C  1 224 ? -18.688 -6.554  -17.871 1.00 35.28  ? 224 TYR C N   1 
ATOM   6864  C  CA  . TYR C  1 224 ? -19.454 -5.827  -18.842 1.00 37.37  ? 224 TYR C CA  1 
ATOM   6865  C  C   . TYR C  1 224 ? -20.892 -5.527  -18.340 1.00 37.38  ? 224 TYR C C   1 
ATOM   6866  O  O   . TYR C  1 224 ? -21.676 -6.446  -18.062 1.00 31.21  ? 224 TYR C O   1 
ATOM   6867  C  CB  . TYR C  1 224 ? -19.488 -6.577  -20.172 1.00 35.80  ? 224 TYR C CB  1 
ATOM   6868  C  CG  . TYR C  1 224 ? -18.392 -6.188  -21.080 1.00 36.92  ? 224 TYR C CG  1 
ATOM   6869  C  CD1 . TYR C  1 224 ? -17.231 -6.923  -21.150 1.00 34.47  ? 224 TYR C CD1 1 
ATOM   6870  C  CD2 . TYR C  1 224 ? -18.503 -5.031  -21.892 1.00 40.55  ? 224 TYR C CD2 1 
ATOM   6871  C  CE1 . TYR C  1 224 ? -16.190 -6.542  -22.010 1.00 36.75  ? 224 TYR C CE1 1 
ATOM   6872  C  CE2 . TYR C  1 224 ? -17.474 -4.644  -22.750 1.00 35.96  ? 224 TYR C CE2 1 
ATOM   6873  C  CZ  . TYR C  1 224 ? -16.342 -5.373  -22.815 1.00 36.33  ? 224 TYR C CZ  1 
ATOM   6874  O  OH  . TYR C  1 224 ? -15.326 -4.976  -23.674 1.00 43.87  ? 224 TYR C OH  1 
ATOM   6875  N  N   . GLY C  1 225 ? -21.213 -4.238  -18.229 1.00 40.12  ? 225 GLY C N   1 
ATOM   6876  C  CA  . GLY C  1 225 ? -22.538 -3.807  -17.746 1.00 45.26  ? 225 GLY C CA  1 
ATOM   6877  C  C   . GLY C  1 225 ? -22.463 -3.105  -16.400 1.00 45.33  ? 225 GLY C C   1 
ATOM   6878  O  O   . GLY C  1 225 ? -23.349 -2.333  -16.043 1.00 47.88  ? 225 GLY C O   1 
ATOM   6879  N  N   . LEU C  1 226 ? -21.397 -3.382  -15.650 1.00 42.02  ? 226 LEU C N   1 
ATOM   6880  C  CA  . LEU C  1 226 ? -21.178 -2.732  -14.360 1.00 46.83  ? 226 LEU C CA  1 
ATOM   6881  C  C   . LEU C  1 226 ? -20.504 -1.378  -14.551 1.00 46.32  ? 226 LEU C C   1 
ATOM   6882  O  O   . LEU C  1 226 ? -19.280 -1.205  -14.254 1.00 41.11  ? 226 LEU C O   1 
ATOM   6883  C  CB  . LEU C  1 226 ? -20.355 -3.629  -13.437 1.00 47.69  ? 226 LEU C CB  1 
ATOM   6884  C  CG  . LEU C  1 226 ? -21.123 -4.865  -12.888 1.00 49.17  ? 226 LEU C CG  1 
ATOM   6885  C  CD1 . LEU C  1 226 ? -20.183 -5.870  -12.261 1.00 45.15  ? 226 LEU C CD1 1 
ATOM   6886  C  CD2 . LEU C  1 226 ? -22.200 -4.435  -11.896 1.00 47.67  ? 226 LEU C CD2 1 
ATOM   6887  N  N   . ASP C  1 227 ? -21.290 -0.408  -15.047 1.00 49.68  ? 227 ASP C N   1 
ATOM   6888  C  CA  . ASP C  1 227 ? -20.785 0.949   -15.364 1.00 53.01  ? 227 ASP C CA  1 
ATOM   6889  C  C   . ASP C  1 227 ? -20.153 1.640   -14.178 1.00 50.32  ? 227 ASP C C   1 
ATOM   6890  O  O   . ASP C  1 227 ? -19.238 2.416   -14.338 1.00 47.69  ? 227 ASP C O   1 
ATOM   6891  C  CB  . ASP C  1 227 ? -21.912 1.816   -15.941 1.00 55.77  ? 227 ASP C CB  1 
ATOM   6892  C  CG  . ASP C  1 227 ? -22.396 1.318   -17.285 1.00 58.53  ? 227 ASP C CG  1 
ATOM   6893  O  OD1 . ASP C  1 227 ? -21.676 0.521   -17.911 1.00 58.35  ? 227 ASP C OD1 1 
ATOM   6894  O  OD2 . ASP C  1 227 ? -23.494 1.724   -17.714 1.00 61.82  ? 227 ASP C OD2 1 
ATOM   6895  N  N   . LEU C  1 228 ? -20.655 1.344   -12.964 1.00 52.05  ? 228 LEU C N   1 
ATOM   6896  C  CA  . LEU C  1 228 ? -20.116 1.977   -11.732 1.00 55.45  ? 228 LEU C CA  1 
ATOM   6897  C  C   . LEU C  1 228 ? -18.600 1.712   -11.561 1.00 58.14  ? 228 LEU C C   1 
ATOM   6898  O  O   . LEU C  1 228 ? -17.899 2.481   -10.913 1.00 56.61  ? 228 LEU C O   1 
ATOM   6899  C  CB  . LEU C  1 228 ? -20.901 1.524   -10.474 1.00 54.57  ? 228 LEU C CB  1 
ATOM   6900  C  CG  . LEU C  1 228 ? -20.697 0.091   -9.952  1.00 58.65  ? 228 LEU C CG  1 
ATOM   6901  C  CD1 . LEU C  1 228 ? -21.377 -0.085  -8.589  1.00 55.51  ? 228 LEU C CD1 1 
ATOM   6902  C  CD2 . LEU C  1 228 ? -21.202 -0.953  -10.955 1.00 53.39  ? 228 LEU C CD2 1 
ATOM   6903  N  N   . PHE C  1 229 ? -18.117 0.611   -12.155 1.00 57.04  ? 229 PHE C N   1 
ATOM   6904  C  CA  . PHE C  1 229 ? -16.674 0.304   -12.152 1.00 56.65  ? 229 PHE C CA  1 
ATOM   6905  C  C   . PHE C  1 229 ? -16.017 0.859   -13.411 1.00 54.85  ? 229 PHE C C   1 
ATOM   6906  O  O   . PHE C  1 229 ? -14.877 1.296   -13.385 1.00 54.42  ? 229 PHE C O   1 
ATOM   6907  C  CB  . PHE C  1 229 ? -16.434 -1.211  -12.039 1.00 59.19  ? 229 PHE C CB  1 
ATOM   6908  C  CG  . PHE C  1 229 ? -17.009 -1.829  -10.777 1.00 62.72  ? 229 PHE C CG  1 
ATOM   6909  C  CD1 . PHE C  1 229 ? -16.478 -1.506  -9.511  1.00 63.19  ? 229 PHE C CD1 1 
ATOM   6910  C  CD2 . PHE C  1 229 ? -18.074 -2.733  -10.845 1.00 63.58  ? 229 PHE C CD2 1 
ATOM   6911  C  CE1 . PHE C  1 229 ? -17.004 -2.072  -8.356  1.00 61.23  ? 229 PHE C CE1 1 
ATOM   6912  C  CE2 . PHE C  1 229 ? -18.600 -3.301  -9.686  1.00 60.82  ? 229 PHE C CE2 1 
ATOM   6913  C  CZ  . PHE C  1 229 ? -18.065 -2.971  -8.442  1.00 60.54  ? 229 PHE C CZ  1 
ATOM   6914  N  N   . LEU C  1 230 ? -16.761 0.831   -14.512 1.00 56.34  ? 230 LEU C N   1 
ATOM   6915  C  CA  . LEU C  1 230 ? -16.313 1.415   -15.785 1.00 47.68  ? 230 LEU C CA  1 
ATOM   6916  C  C   . LEU C  1 230 ? -17.377 1.195   -16.836 1.00 42.88  ? 230 LEU C C   1 
ATOM   6917  O  O   . LEU C  1 230 ? -17.848 0.069   -17.021 1.00 46.13  ? 230 LEU C O   1 
ATOM   6918  C  CB  . LEU C  1 230 ? -14.969 0.800   -16.237 1.00 44.30  ? 230 LEU C CB  1 
ATOM   6919  C  CG  . LEU C  1 230 ? -14.186 1.590   -17.344 1.00 41.92  ? 230 LEU C CG  1 
ATOM   6920  C  CD1 . LEU C  1 230 ? -13.680 2.927   -16.810 1.00 36.61  ? 230 LEU C CD1 1 
ATOM   6921  C  CD2 . LEU C  1 230 ? -13.046 0.768   -17.913 1.00 37.36  ? 230 LEU C CD2 1 
ATOM   6922  N  N   . PRO C  1 231 ? -17.777 2.273   -17.528 1.00 40.98  ? 231 PRO C N   1 
ATOM   6923  C  CA  . PRO C  1 231 ? -18.838 2.208   -18.546 1.00 43.78  ? 231 PRO C CA  1 
ATOM   6924  C  C   . PRO C  1 231 ? -18.519 1.230   -19.677 1.00 41.65  ? 231 PRO C C   1 
ATOM   6925  O  O   . PRO C  1 231 ? -17.351 0.921   -19.926 1.00 40.30  ? 231 PRO C O   1 
ATOM   6926  C  CB  . PRO C  1 231 ? -18.899 3.668   -19.088 1.00 40.31  ? 231 PRO C CB  1 
ATOM   6927  C  CG  . PRO C  1 231 ? -18.330 4.499   -17.988 1.00 37.65  ? 231 PRO C CG  1 
ATOM   6928  C  CD  . PRO C  1 231 ? -17.265 3.654   -17.349 1.00 41.61  ? 231 PRO C CD  1 
ATOM   6929  N  N   . VAL C  1 232 ? -19.567 0.752   -20.354 1.00 40.16  ? 232 VAL C N   1 
ATOM   6930  C  CA  . VAL C  1 232 ? -19.426 -0.192  -21.414 1.00 40.26  ? 232 VAL C CA  1 
ATOM   6931  C  C   . VAL C  1 232 ? -18.490 0.326   -22.538 1.00 44.94  ? 232 VAL C C   1 
ATOM   6932  O  O   . VAL C  1 232 ? -17.641 -0.422  -23.044 1.00 42.72  ? 232 VAL C O   1 
ATOM   6933  C  CB  . VAL C  1 232 ? -20.811 -0.567  -22.025 1.00 40.88  ? 232 VAL C CB  1 
ATOM   6934  C  CG1 . VAL C  1 232 ? -20.644 -1.561  -23.164 1.00 39.18  ? 232 VAL C CG1 1 
ATOM   6935  C  CG2 . VAL C  1 232 ? -21.732 -1.127  -20.950 1.00 38.22  ? 232 VAL C CG2 1 
ATOM   6936  N  N   . ASP C  1 233 ? -18.652 1.609   -22.916 1.00 43.38  ? 233 ASP C N   1 
ATOM   6937  C  CA  . ASP C  1 233 ? -17.845 2.199   -24.033 1.00 45.20  ? 233 ASP C CA  1 
ATOM   6938  C  C   . ASP C  1 233 ? -16.325 2.235   -23.738 1.00 42.01  ? 233 ASP C C   1 
ATOM   6939  O  O   . ASP C  1 233 ? -15.526 1.985   -24.607 1.00 44.61  ? 233 ASP C O   1 
ATOM   6940  C  CB  . ASP C  1 233 ? -18.371 3.616   -24.431 1.00 50.58  ? 233 ASP C CB  1 
ATOM   6941  C  CG  . ASP C  1 233 ? -18.298 4.627   -23.273 1.00 58.79  ? 233 ASP C CG  1 
ATOM   6942  O  OD1 . ASP C  1 233 ? -17.790 4.266   -22.176 1.00 62.79  ? 233 ASP C OD1 1 
ATOM   6943  O  OD2 . ASP C  1 233 ? -18.743 5.763   -23.462 1.00 70.42  ? 233 ASP C OD2 1 
ATOM   6944  N  N   . LYS C  1 234 ? -15.964 2.547   -22.506 1.00 40.95  ? 234 LYS C N   1 
ATOM   6945  C  CA  . LYS C  1 234 ? -14.553 2.563   -22.114 1.00 43.81  ? 234 LYS C CA  1 
ATOM   6946  C  C   . LYS C  1 234 ? -13.989 1.143   -22.013 1.00 43.64  ? 234 LYS C C   1 
ATOM   6947  O  O   . LYS C  1 234 ? -12.804 0.912   -22.284 1.00 43.32  ? 234 LYS C O   1 
ATOM   6948  C  CB  . LYS C  1 234 ? -14.360 3.315   -20.801 1.00 48.63  ? 234 LYS C CB  1 
ATOM   6949  C  CG  . LYS C  1 234 ? -14.417 4.836   -20.950 1.00 56.22  ? 234 LYS C CG  1 
ATOM   6950  C  CD  . LYS C  1 234 ? -13.379 5.328   -21.988 1.00 59.50  ? 234 LYS C CD  1 
ATOM   6951  C  CE  . LYS C  1 234 ? -13.653 6.774   -22.423 1.00 63.19  ? 234 LYS C CE  1 
ATOM   6952  N  NZ  . LYS C  1 234 ? -13.512 7.733   -21.297 1.00 71.85  ? 234 LYS C NZ  1 
ATOM   6953  N  N   . ARG C  1 235 ? -14.838 0.200   -21.625 1.00 42.89  ? 235 ARG C N   1 
ATOM   6954  C  CA  . ARG C  1 235 ? -14.445 -1.194  -21.572 1.00 42.31  ? 235 ARG C CA  1 
ATOM   6955  C  C   . ARG C  1 235 ? -14.184 -1.696  -22.962 1.00 41.06  ? 235 ARG C C   1 
ATOM   6956  O  O   . ARG C  1 235 ? -13.148 -2.289  -23.232 1.00 37.57  ? 235 ARG C O   1 
ATOM   6957  C  CB  . ARG C  1 235 ? -15.543 -2.050  -20.891 1.00 39.83  ? 235 ARG C CB  1 
ATOM   6958  C  CG  . ARG C  1 235 ? -15.700 -1.789  -19.393 1.00 41.59  ? 235 ARG C CG  1 
ATOM   6959  C  CD  . ARG C  1 235 ? -16.789 -2.675  -18.780 1.00 39.45  ? 235 ARG C CD  1 
ATOM   6960  N  NE  . ARG C  1 235 ? -16.836 -2.545  -17.327 1.00 40.20  ? 235 ARG C NE  1 
ATOM   6961  C  CZ  . ARG C  1 235 ? -16.205 -3.356  -16.481 1.00 40.11  ? 235 ARG C CZ  1 
ATOM   6962  N  NH1 . ARG C  1 235 ? -16.303 -3.158  -15.183 1.00 39.60  ? 235 ARG C NH1 1 
ATOM   6963  N  NH2 . ARG C  1 235 ? -15.470 -4.381  -16.945 1.00 37.34  ? 235 ARG C NH2 1 
ATOM   6964  N  N   . ASN C  1 236 ? -15.134 -1.448  -23.860 1.00 39.44  ? 236 ASN C N   1 
ATOM   6965  C  CA  . ASN C  1 236 ? -14.990 -1.843  -25.236 1.00 40.37  ? 236 ASN C CA  1 
ATOM   6966  C  C   . ASN C  1 236 ? -13.715 -1.293  -25.869 1.00 40.23  ? 236 ASN C C   1 
ATOM   6967  O  O   . ASN C  1 236 ? -13.066 -1.972  -26.673 1.00 42.14  ? 236 ASN C O   1 
ATOM   6968  C  CB  . ASN C  1 236 ? -16.218 -1.419  -26.050 1.00 39.03  ? 236 ASN C CB  1 
ATOM   6969  C  CG  . ASN C  1 236 ? -17.423 -2.321  -25.803 1.00 41.98  ? 236 ASN C CG  1 
ATOM   6970  O  OD1 . ASN C  1 236 ? -17.286 -3.444  -25.286 1.00 44.50  ? 236 ASN C OD1 1 
ATOM   6971  N  ND2 . ASN C  1 236 ? -18.593 -1.849  -26.168 1.00 39.09  ? 236 ASN C ND2 1 
ATOM   6972  N  N   . GLU C  1 237 ? -13.354 -0.057  -25.505 1.00 40.85  ? 237 GLU C N   1 
ATOM   6973  C  CA  . GLU C  1 237 ? -12.141 0.583   -26.061 1.00 41.59  ? 237 GLU C CA  1 
ATOM   6974  C  C   . GLU C  1 237 ? -10.902 -0.130  -25.598 1.00 39.08  ? 237 GLU C C   1 
ATOM   6975  O  O   . GLU C  1 237 ? -10.012 -0.397  -26.383 1.00 39.07  ? 237 GLU C O   1 
ATOM   6976  C  CB  . GLU C  1 237 ? -12.083 2.054   -25.678 1.00 47.75  ? 237 GLU C CB  1 
ATOM   6977  C  CG  . GLU C  1 237 ? -13.231 2.872   -26.218 1.00 55.58  ? 237 GLU C CG  1 
ATOM   6978  C  CD  . GLU C  1 237 ? -13.167 4.323   -25.786 1.00 70.68  ? 237 GLU C CD  1 
ATOM   6979  O  OE1 . GLU C  1 237 ? -12.058 4.789   -25.394 1.00 76.49  ? 237 GLU C OE1 1 
ATOM   6980  O  OE2 . GLU C  1 237 ? -14.219 5.008   -25.835 1.00 70.07  ? 237 GLU C OE2 1 
ATOM   6981  N  N   . THR C  1 238 ? -10.847 -0.450  -24.289 1.00 38.99  ? 238 THR C N   1 
ATOM   6982  C  CA  . THR C  1 238 ? -9.710  -1.203  -23.723 1.00 40.88  ? 238 THR C CA  1 
ATOM   6983  C  C   . THR C  1 238 ? -9.593  -2.599  -24.372 1.00 39.07  ? 238 THR C C   1 
ATOM   6984  O  O   . THR C  1 238 ? -8.494  -3.015  -24.820 1.00 35.17  ? 238 THR C O   1 
ATOM   6985  C  CB  . THR C  1 238 ? -9.832  -1.365  -22.180 1.00 40.41  ? 238 THR C CB  1 
ATOM   6986  O  OG1 . THR C  1 238 ? -9.944  -0.097  -21.575 1.00 40.52  ? 238 THR C OG1 1 
ATOM   6987  C  CG2 . THR C  1 238 ? -8.613  -2.075  -21.622 1.00 43.17  ? 238 THR C CG2 1 
ATOM   6988  N  N   . THR C  1 239 ? -10.712 -3.313  -24.416 1.00 38.64  ? 239 THR C N   1 
ATOM   6989  C  CA  . THR C  1 239 ? -10.764 -4.644  -25.025 1.00 34.82  ? 239 THR C CA  1 
ATOM   6990  C  C   . THR C  1 239 ? -10.225 -4.609  -26.461 1.00 34.75  ? 239 THR C C   1 
ATOM   6991  O  O   . THR C  1 239 ? -9.305  -5.361  -26.813 1.00 35.80  ? 239 THR C O   1 
ATOM   6992  C  CB  . THR C  1 239 ? -12.194 -5.183  -25.035 1.00 34.57  ? 239 THR C CB  1 
ATOM   6993  O  OG1 . THR C  1 239 ? -12.723 -5.154  -23.709 1.00 36.30  ? 239 THR C OG1 1 
ATOM   6994  C  CG2 . THR C  1 239 ? -12.235 -6.641  -25.580 1.00 36.44  ? 239 THR C CG2 1 
ATOM   6995  N  N   . LEU C  1 240 ? -10.804 -3.720  -27.287 1.00 33.12  ? 240 LEU C N   1 
ATOM   6996  C  CA  . LEU C  1 240 ? -10.398 -3.578  -28.676 1.00 34.23  ? 240 LEU C CA  1 
ATOM   6997  C  C   . LEU C  1 240 ? -8.898  -3.251  -28.794 1.00 35.21  ? 240 LEU C C   1 
ATOM   6998  O  O   . LEU C  1 240 ? -8.193  -3.820  -29.627 1.00 35.20  ? 240 LEU C O   1 
ATOM   6999  C  CB  . LEU C  1 240 ? -11.225 -2.490  -29.368 1.00 35.78  ? 240 LEU C CB  1 
ATOM   7000  C  CG  . LEU C  1 240 ? -10.943 -2.280  -30.844 1.00 37.26  ? 240 LEU C CG  1 
ATOM   7001  C  CD1 . LEU C  1 240 ? -11.353 -3.530  -31.654 1.00 36.96  ? 240 LEU C CD1 1 
ATOM   7002  C  CD2 . LEU C  1 240 ? -11.651 -1.037  -31.365 1.00 34.26  ? 240 LEU C CD2 1 
ATOM   7003  N  N   . ARG C  1 241 ? -8.429  -2.331  -27.956 1.00 36.38  ? 241 ARG C N   1 
ATOM   7004  C  CA  . ARG C  1 241 ? -7.038  -1.938  -27.955 1.00 38.13  ? 241 ARG C CA  1 
ATOM   7005  C  C   . ARG C  1 241 ? -6.127  -3.132  -27.637 1.00 38.31  ? 241 ARG C C   1 
ATOM   7006  O  O   . ARG C  1 241 ? -5.128  -3.349  -28.300 1.00 39.20  ? 241 ARG C O   1 
ATOM   7007  C  CB  . ARG C  1 241 ? -6.802  -0.802  -26.943 1.00 42.46  ? 241 ARG C CB  1 
ATOM   7008  C  CG  . ARG C  1 241 ? -5.340  -0.438  -26.744 1.00 50.22  ? 241 ARG C CG  1 
ATOM   7009  C  CD  . ARG C  1 241 ? -4.764  0.249   -27.967 1.00 55.96  ? 241 ARG C CD  1 
ATOM   7010  N  NE  . ARG C  1 241 ? -3.289  0.280   -27.939 1.00 64.54  ? 241 ARG C NE  1 
ATOM   7011  C  CZ  . ARG C  1 241 ? -2.568  1.123   -27.195 1.00 65.44  ? 241 ARG C CZ  1 
ATOM   7012  N  NH1 . ARG C  1 241 ? -3.174  2.006   -26.409 1.00 62.86  ? 241 ARG C NH1 1 
ATOM   7013  N  NH2 . ARG C  1 241 ? -1.236  1.078   -27.235 1.00 65.50  ? 241 ARG C NH2 1 
ATOM   7014  N  N   . LEU C  1 242 ? -6.497  -3.901  -26.607 1.00 37.76  ? 242 LEU C N   1 
ATOM   7015  C  CA  . LEU C  1 242 ? -5.718  -5.080  -26.199 1.00 36.51  ? 242 LEU C CA  1 
ATOM   7016  C  C   . LEU C  1 242 ? -5.672  -6.122  -27.296 1.00 35.73  ? 242 LEU C C   1 
ATOM   7017  O  O   . LEU C  1 242 ? -4.629  -6.783  -27.511 1.00 36.12  ? 242 LEU C O   1 
ATOM   7018  C  CB  . LEU C  1 242 ? -6.303  -5.698  -24.892 1.00 37.05  ? 242 LEU C CB  1 
ATOM   7019  C  CG  . LEU C  1 242 ? -6.151  -4.865  -23.598 1.00 37.27  ? 242 LEU C CG  1 
ATOM   7020  C  CD1 . LEU C  1 242 ? -6.969  -5.464  -22.469 1.00 35.96  ? 242 LEU C CD1 1 
ATOM   7021  C  CD2 . LEU C  1 242 ? -4.677  -4.733  -23.195 1.00 37.35  ? 242 LEU C CD2 1 
ATOM   7022  N  N   . ILE C  1 243 ? -6.789  -6.287  -27.995 1.00 36.90  ? 243 ILE C N   1 
ATOM   7023  C  CA  . ILE C  1 243 ? -6.862  -7.223  -29.099 1.00 39.07  ? 243 ILE C CA  1 
ATOM   7024  C  C   . ILE C  1 243 ? -5.927  -6.792  -30.257 1.00 40.53  ? 243 ILE C C   1 
ATOM   7025  O  O   . ILE C  1 243 ? -5.200  -7.611  -30.812 1.00 41.84  ? 243 ILE C O   1 
ATOM   7026  C  CB  . ILE C  1 243 ? -8.328  -7.382  -29.626 1.00 38.15  ? 243 ILE C CB  1 
ATOM   7027  C  CG1 . ILE C  1 243 ? -9.162  -8.203  -28.642 1.00 37.03  ? 243 ILE C CG1 1 
ATOM   7028  C  CG2 . ILE C  1 243 ? -8.336  -8.028  -30.991 1.00 37.00  ? 243 ILE C CG2 1 
ATOM   7029  C  CD1 . ILE C  1 243 ? -10.641 -8.270  -28.991 1.00 35.96  ? 243 ILE C CD1 1 
ATOM   7030  N  N   . LYS C  1 244 ? -5.958  -5.498  -30.599 1.00 41.43  ? 244 LYS C N   1 
ATOM   7031  C  CA  . LYS C  1 244 ? -5.088  -4.957  -31.691 1.00 44.43  ? 244 LYS C CA  1 
ATOM   7032  C  C   . LYS C  1 244 ? -3.620  -5.076  -31.340 1.00 42.21  ? 244 LYS C C   1 
ATOM   7033  O  O   . LYS C  1 244 ? -2.789  -5.266  -32.207 1.00 44.53  ? 244 LYS C O   1 
ATOM   7034  C  CB  . LYS C  1 244 ? -5.445  -3.495  -32.010 1.00 46.11  ? 244 LYS C CB  1 
ATOM   7035  C  CG  . LYS C  1 244 ? -6.876  -3.294  -32.525 1.00 51.58  ? 244 LYS C CG  1 
ATOM   7036  C  CD  . LYS C  1 244 ? -7.159  -4.172  -33.770 1.00 57.07  ? 244 LYS C CD  1 
ATOM   7037  C  CE  . LYS C  1 244 ? -8.619  -4.032  -34.237 1.00 58.95  ? 244 LYS C CE  1 
ATOM   7038  N  NZ  . LYS C  1 244 ? -8.916  -4.899  -35.417 1.00 56.98  ? 244 LYS C NZ  1 
ATOM   7039  N  N   . ASP C  1 245 ? -3.306  -4.968  -30.045 1.00 40.52  ? 245 ASP C N   1 
ATOM   7040  C  CA  . ASP C  1 245 ? -1.921  -5.104  -29.583 1.00 38.44  ? 245 ASP C CA  1 
ATOM   7041  C  C   . ASP C  1 245 ? -1.531  -6.577  -29.430 1.00 37.40  ? 245 ASP C C   1 
ATOM   7042  O  O   . ASP C  1 245 ? -0.447  -6.887  -28.997 1.00 39.35  ? 245 ASP C O   1 
ATOM   7043  C  CB  . ASP C  1 245 ? -1.706  -4.348  -28.283 1.00 40.65  ? 245 ASP C CB  1 
ATOM   7044  C  CG  . ASP C  1 245 ? -1.757  -2.774  -28.479 1.00 48.06  ? 245 ASP C CG  1 
ATOM   7045  O  OD1 . ASP C  1 245 ? -1.785  -2.041  -27.461 1.00 50.68  ? 245 ASP C OD1 1 
ATOM   7046  O  OD2 . ASP C  1 245 ? -1.769  -2.312  -29.652 1.00 50.97  ? 245 ASP C OD2 1 
ATOM   7047  N  N   . GLY C  1 246 ? -2.464  -7.482  -29.799 1.00 35.95  ? 246 GLY C N   1 
ATOM   7048  C  CA  . GLY C  1 246 ? -2.170  -8.956  -29.866 1.00 34.45  ? 246 GLY C CA  1 
ATOM   7049  C  C   . GLY C  1 246 ? -2.330  -9.741  -28.531 1.00 35.35  ? 246 GLY C C   1 
ATOM   7050  O  O   . GLY C  1 246 ? -1.595  -10.649 -28.269 1.00 36.22  ? 246 GLY C O   1 
ATOM   7051  N  N   . TYR C  1 247 ? -3.296  -9.368  -27.733 1.00 34.35  ? 247 TYR C N   1 
ATOM   7052  C  CA  . TYR C  1 247 ? -3.532  -10.074 -26.441 1.00 36.62  ? 247 TYR C CA  1 
ATOM   7053  C  C   . TYR C  1 247 ? -4.794  -10.976 -26.457 1.00 35.08  ? 247 TYR C C   1 
ATOM   7054  O  O   . TYR C  1 247 ? -5.264  -11.385 -25.438 1.00 36.33  ? 247 TYR C O   1 
ATOM   7055  C  CB  . TYR C  1 247 ? -3.580  -9.079  -25.277 1.00 36.38  ? 247 TYR C CB  1 
ATOM   7056  C  CG  . TYR C  1 247 ? -2.243  -8.526  -24.931 1.00 39.59  ? 247 TYR C CG  1 
ATOM   7057  C  CD1 . TYR C  1 247 ? -1.707  -7.426  -25.639 1.00 39.72  ? 247 TYR C CD1 1 
ATOM   7058  C  CD2 . TYR C  1 247 ? -1.482  -9.087  -23.916 1.00 37.34  ? 247 TYR C CD2 1 
ATOM   7059  C  CE1 . TYR C  1 247 ? -0.469  -6.916  -25.329 1.00 43.46  ? 247 TYR C CE1 1 
ATOM   7060  C  CE2 . TYR C  1 247 ? -0.229  -8.582  -23.593 1.00 40.57  ? 247 TYR C CE2 1 
ATOM   7061  C  CZ  . TYR C  1 247 ? 0.276   -7.496  -24.301 1.00 45.21  ? 247 TYR C CZ  1 
ATOM   7062  O  OH  . TYR C  1 247 ? 1.502   -6.996  -23.991 1.00 44.26  ? 247 TYR C OH  1 
ATOM   7063  N  N   . SER C  1 248 ? -5.298  -11.267 -27.653 1.00 35.49  ? 248 SER C N   1 
ATOM   7064  C  CA  . SER C  1 248 ? -6.496  -12.114 -27.805 1.00 35.15  ? 248 SER C CA  1 
ATOM   7065  C  C   . SER C  1 248 ? -6.382  -13.434 -27.041 1.00 33.45  ? 248 SER C C   1 
ATOM   7066  O  O   . SER C  1 248 ? -7.305  -13.850 -26.412 1.00 31.45  ? 248 SER C O   1 
ATOM   7067  C  CB  . SER C  1 248 ? -6.767  -12.394 -29.269 1.00 34.71  ? 248 SER C CB  1 
ATOM   7068  O  OG  . SER C  1 248 ? -7.239  -11.262 -29.905 1.00 49.87  ? 248 SER C OG  1 
ATOM   7069  N  N   . ASP C  1 249 ? -5.205  -14.078 -27.124 1.00 36.27  ? 249 ASP C N   1 
ATOM   7070  C  CA  . ASP C  1 249 ? -5.009  -15.410 -26.515 1.00 36.73  ? 249 ASP C CA  1 
ATOM   7071  C  C   . ASP C  1 249 ? -4.892  -15.374 -24.937 1.00 35.23  ? 249 ASP C C   1 
ATOM   7072  O  O   . ASP C  1 249 ? -4.686  -16.407 -24.300 1.00 33.54  ? 249 ASP C O   1 
ATOM   7073  C  CB  . ASP C  1 249 ? -3.798  -16.116 -27.127 1.00 39.57  ? 249 ASP C CB  1 
ATOM   7074  C  CG  . ASP C  1 249 ? -2.530  -15.417 -26.846 1.00 47.60  ? 249 ASP C CG  1 
ATOM   7075  O  OD1 . ASP C  1 249 ? -2.574  -14.299 -26.275 1.00 52.88  ? 249 ASP C OD1 1 
ATOM   7076  O  OD2 . ASP C  1 249 ? -1.475  -15.958 -27.185 1.00 50.99  ? 249 ASP C OD2 1 
ATOM   7077  N  N   . LYS C  1 250 ? -5.031  -14.191 -24.356 1.00 30.72  ? 250 LYS C N   1 
ATOM   7078  C  CA  . LYS C  1 250 ? -4.984  -14.049 -22.859 1.00 32.79  ? 250 LYS C CA  1 
ATOM   7079  C  C   . LYS C  1 250 ? -6.241  -13.407 -22.326 1.00 30.60  ? 250 LYS C C   1 
ATOM   7080  O  O   . LYS C  1 250 ? -6.407  -13.247 -21.106 1.00 30.72  ? 250 LYS C O   1 
ATOM   7081  C  CB  . LYS C  1 250 ? -3.749  -13.236 -22.425 1.00 33.01  ? 250 LYS C CB  1 
ATOM   7082  C  CG  . LYS C  1 250 ? -2.403  -13.910 -22.751 1.00 37.59  ? 250 LYS C CG  1 
ATOM   7083  C  CD  . LYS C  1 250 ? -2.242  -15.220 -21.981 1.00 44.87  ? 250 LYS C CD  1 
ATOM   7084  C  CE  . LYS C  1 250 ? -0.930  -15.937 -22.353 1.00 46.40  ? 250 LYS C CE  1 
ATOM   7085  N  NZ  . LYS C  1 250 ? 0.269   -15.109 -22.031 1.00 51.14  ? 250 LYS C NZ  1 
ATOM   7086  N  N   . ILE C  1 251 ? -7.140  -13.039 -23.237 1.00 29.97  ? 251 ILE C N   1 
ATOM   7087  C  CA  . ILE C  1 251 ? -8.332  -12.292 -22.880 1.00 30.03  ? 251 ILE C CA  1 
ATOM   7088  C  C   . ILE C  1 251 ? -9.530  -13.178 -22.630 1.00 29.44  ? 251 ILE C C   1 
ATOM   7089  O  O   . ILE C  1 251 ? -9.805  -14.125 -23.399 1.00 29.27  ? 251 ILE C O   1 
ATOM   7090  C  CB  . ILE C  1 251 ? -8.700  -11.259 -23.982 1.00 32.46  ? 251 ILE C CB  1 
ATOM   7091  C  CG1 . ILE C  1 251 ? -7.747  -10.081 -23.946 1.00 32.38  ? 251 ILE C CG1 1 
ATOM   7092  C  CG2 . ILE C  1 251 ? -10.141 -10.786 -23.816 1.00 31.50  ? 251 ILE C CG2 1 
ATOM   7093  C  CD1 . ILE C  1 251 ? -8.044  -9.026  -25.006 1.00 37.47  ? 251 ILE C CD1 1 
ATOM   7094  N  N   . MET C  1 252 ? -10.248 -12.885 -21.566 1.00 29.44  ? 252 MET C N   1 
ATOM   7095  C  CA  . MET C  1 252 ? -11.484 -13.543 -21.290 1.00 28.69  ? 252 MET C CA  1 
ATOM   7096  C  C   . MET C  1 252 ? -12.549 -12.495 -20.948 1.00 27.99  ? 252 MET C C   1 
ATOM   7097  O  O   . MET C  1 252 ? -12.286 -11.541 -20.210 1.00 27.05  ? 252 MET C O   1 
ATOM   7098  C  CB  . MET C  1 252 ? -11.321 -14.560 -20.166 1.00 32.76  ? 252 MET C CB  1 
ATOM   7099  C  CG  . MET C  1 252 ? -10.135 -15.547 -20.392 1.00 39.48  ? 252 MET C CG  1 
ATOM   7100  S  SD  . MET C  1 252 ? -10.396 -17.217 -19.670 1.00 47.69  ? 252 MET C SD  1 
ATOM   7101  C  CE  . MET C  1 252 ? -11.604 -17.841 -20.765 1.00 37.37  ? 252 MET C CE  1 
ATOM   7102  N  N   . ILE C  1 253 ? -13.729 -12.671 -21.500 1.00 25.25  ? 253 ILE C N   1 
ATOM   7103  C  CA  . ILE C  1 253 ? -14.775 -11.683 -21.395 1.00 25.39  ? 253 ILE C CA  1 
ATOM   7104  C  C   . ILE C  1 253 ? -15.967 -12.255 -20.756 1.00 25.97  ? 253 ILE C C   1 
ATOM   7105  O  O   . ILE C  1 253 ? -16.357 -13.382 -21.056 1.00 27.57  ? 253 ILE C O   1 
ATOM   7106  C  CB  . ILE C  1 253 ? -15.180 -11.141 -22.818 1.00 24.76  ? 253 ILE C CB  1 
ATOM   7107  C  CG1 . ILE C  1 253 ? -14.004 -10.422 -23.471 1.00 27.79  ? 253 ILE C CG1 1 
ATOM   7108  C  CG2 . ILE C  1 253 ? -16.393 -10.233 -22.724 1.00 23.91  ? 253 ILE C CG2 1 
ATOM   7109  C  CD1 . ILE C  1 253 ? -14.330 -9.811  -24.869 1.00 27.11  ? 253 ILE C CD1 1 
ATOM   7110  N  N   . SER C  1 254 ? -16.587 -11.484 -19.851 1.00 27.27  ? 254 SER C N   1 
ATOM   7111  C  CA  . SER C  1 254 ? -17.786 -11.933 -19.180 1.00 26.99  ? 254 SER C CA  1 
ATOM   7112  C  C   . SER C  1 254 ? -18.536 -10.748 -18.547 1.00 28.41  ? 254 SER C C   1 
ATOM   7113  O  O   . SER C  1 254 ? -18.112 -9.615  -18.664 1.00 31.50  ? 254 SER C O   1 
ATOM   7114  C  CB  . SER C  1 254 ? -17.440 -12.989 -18.114 1.00 28.61  ? 254 SER C CB  1 
ATOM   7115  O  OG  . SER C  1 254 ? -18.380 -14.071 -18.142 1.00 28.91  ? 254 SER C OG  1 
ATOM   7116  N  N   . HIS C  1 255 ? -19.660 -11.038 -17.875 1.00 28.22  ? 255 HIS C N   1 
ATOM   7117  C  CA  . HIS C  1 255 ? -20.485 -9.984  -17.268 1.00 27.08  ? 255 HIS C CA  1 
ATOM   7118  C  C   . HIS C  1 255 ? -20.335 -9.901  -15.759 1.00 27.64  ? 255 HIS C C   1 
ATOM   7119  O  O   . HIS C  1 255 ? -20.542 -8.823  -15.164 1.00 29.52  ? 255 HIS C O   1 
ATOM   7120  C  CB  . HIS C  1 255 ? -21.973 -10.195 -17.608 1.00 28.20  ? 255 HIS C CB  1 
ATOM   7121  C  CG  . HIS C  1 255 ? -22.241 -10.397 -19.063 1.00 28.11  ? 255 HIS C CG  1 
ATOM   7122  N  ND1 . HIS C  1 255 ? -22.273 -11.624 -19.637 1.00 25.89  ? 255 HIS C ND1 1 
ATOM   7123  C  CD2 . HIS C  1 255 ? -22.510 -9.488  -20.079 1.00 28.30  ? 255 HIS C CD2 1 
ATOM   7124  C  CE1 . HIS C  1 255 ? -22.544 -11.497 -20.944 1.00 27.13  ? 255 HIS C CE1 1 
ATOM   7125  N  NE2 . HIS C  1 255 ? -22.688 -10.202 -21.218 1.00 30.55  ? 255 HIS C NE2 1 
ATOM   7126  N  N   . ASP C  1 256 ? -19.977 -11.039 -15.116 1.00 25.37  ? 256 ASP C N   1 
ATOM   7127  C  CA  . ASP C  1 256 ? -20.030 -11.144 -13.622 1.00 29.48  ? 256 ASP C CA  1 
ATOM   7128  C  C   . ASP C  1 256 ? -21.434 -10.830 -13.180 1.00 33.84  ? 256 ASP C C   1 
ATOM   7129  O  O   . ASP C  1 256 ? -21.655 -10.259 -12.100 1.00 36.90  ? 256 ASP C O   1 
ATOM   7130  C  CB  . ASP C  1 256 ? -19.035 -10.178 -12.967 1.00 30.14  ? 256 ASP C CB  1 
ATOM   7131  C  CG  . ASP C  1 256 ? -18.791 -10.497 -11.390 1.00 31.45  ? 256 ASP C CG  1 
ATOM   7132  O  OD1 . ASP C  1 256 ? -19.104 -11.678 -10.919 1.00 29.05  ? 256 ASP C OD1 1 
ATOM   7133  O  OD2 . ASP C  1 256 ? -18.280 -9.578  -10.665 1.00 34.24  ? 256 ASP C OD2 1 
ATOM   7134  N  N   . TYR C  1 257 ? -22.402 -11.192 -14.017 1.00 36.22  ? 257 TYR C N   1 
ATOM   7135  C  CA  . TYR C  1 257 ? -23.775 -10.875 -13.748 1.00 41.01  ? 257 TYR C CA  1 
ATOM   7136  C  C   . TYR C  1 257 ? -24.364 -11.761 -12.683 1.00 43.43  ? 257 TYR C C   1 
ATOM   7137  O  O   . TYR C  1 257 ? -24.214 -12.978 -12.717 1.00 42.78  ? 257 TYR C O   1 
ATOM   7138  C  CB  . TYR C  1 257 ? -24.633 -10.956 -15.041 1.00 36.51  ? 257 TYR C CB  1 
ATOM   7139  C  CG  . TYR C  1 257 ? -26.058 -10.566 -14.816 1.00 38.04  ? 257 TYR C CG  1 
ATOM   7140  C  CD1 . TYR C  1 257 ? -27.062 -11.521 -14.781 1.00 36.27  ? 257 TYR C CD1 1 
ATOM   7141  C  CD2 . TYR C  1 257 ? -26.414 -9.217  -14.609 1.00 42.60  ? 257 TYR C CD2 1 
ATOM   7142  C  CE1 . TYR C  1 257 ? -28.385 -11.163 -14.561 1.00 41.26  ? 257 TYR C CE1 1 
ATOM   7143  C  CE2 . TYR C  1 257 ? -27.741 -8.844  -14.387 1.00 40.91  ? 257 TYR C CE2 1 
ATOM   7144  C  CZ  . TYR C  1 257 ? -28.716 -9.805  -14.362 1.00 42.35  ? 257 TYR C CZ  1 
ATOM   7145  O  OH  . TYR C  1 257 ? -30.012 -9.447  -14.144 1.00 43.23  ? 257 TYR C OH  1 
ATOM   7146  N  N   . CYS C  1 258 ? -25.031 -11.147 -11.736 1.00 46.53  ? 258 CYS C N   1 
ATOM   7147  C  CA  . CYS C  1 258 ? -25.720 -11.860 -10.725 1.00 53.93  ? 258 CYS C CA  1 
ATOM   7148  C  C   . CYS C  1 258 ? -27.183 -11.824 -11.031 1.00 54.97  ? 258 CYS C C   1 
ATOM   7149  O  O   . CYS C  1 258 ? -27.817 -10.784 -10.918 1.00 54.22  ? 258 CYS C O   1 
ATOM   7150  C  CB  . CYS C  1 258 ? -25.464 -11.221 -9.354  1.00 52.83  ? 258 CYS C CB  1 
ATOM   7151  S  SG  . CYS C  1 258 ? -23.743 -10.834 -9.027  1.00 60.34  ? 258 CYS C SG  1 
ATOM   7152  N  N   . CYS C  1 259 ? -27.730 -12.961 -11.434 1.00 54.07  ? 259 CYS C N   1 
ATOM   7153  C  CA  . CYS C  1 259 ? -29.161 -13.053 -11.733 1.00 56.25  ? 259 CYS C CA  1 
ATOM   7154  C  C   . CYS C  1 259 ? -29.959 -12.584 -10.528 1.00 58.65  ? 259 CYS C C   1 
ATOM   7155  O  O   . CYS C  1 259 ? -31.063 -12.068 -10.663 1.00 59.81  ? 259 CYS C O   1 
ATOM   7156  C  CB  . CYS C  1 259 ? -29.529 -14.465 -12.104 1.00 49.82  ? 259 CYS C CB  1 
ATOM   7157  S  SG  . CYS C  1 259 ? -28.505 -15.155 -13.452 1.00 52.47  ? 259 CYS C SG  1 
ATOM   7158  N  N   . THR C  1 260 ? -29.377 -12.774 -9.340  1.00 60.16  ? 260 THR C N   1 
ATOM   7159  C  CA  . THR C  1 260 ? -29.923 -12.229 -8.106  1.00 57.70  ? 260 THR C CA  1 
ATOM   7160  C  C   . THR C  1 260 ? -28.803 -11.982 -7.126  1.00 58.33  ? 260 THR C C   1 
ATOM   7161  O  O   . THR C  1 260 ? -28.013 -12.883 -6.830  1.00 51.71  ? 260 THR C O   1 
ATOM   7162  C  CB  . THR C  1 260 ? -30.977 -13.174 -7.459  1.00 61.36  ? 260 THR C CB  1 
ATOM   7163  O  OG1 . THR C  1 260 ? -32.099 -13.310 -8.328  1.00 68.45  ? 260 THR C OG1 1 
ATOM   7164  C  CG2 . THR C  1 260 ? -31.455 -12.607 -6.094  1.00 56.42  ? 260 THR C CG2 1 
ATOM   7165  N  N   . ILE C  1 261 ? -28.722 -10.759 -6.628  1.00 58.22  ? 261 ILE C N   1 
ATOM   7166  C  CA  . ILE C  1 261 ? -27.710 -10.398 -5.656  1.00 53.63  ? 261 ILE C CA  1 
ATOM   7167  C  C   . ILE C  1 261 ? -28.365 -9.670  -4.464  1.00 53.60  ? 261 ILE C C   1 
ATOM   7168  O  O   . ILE C  1 261 ? -29.193 -8.774  -4.652  1.00 53.17  ? 261 ILE C O   1 
ATOM   7169  C  CB  . ILE C  1 261 ? -26.573 -9.524  -6.302  1.00 54.25  ? 261 ILE C CB  1 
ATOM   7170  C  CG1 . ILE C  1 261 ? -25.350 -9.439  -5.373  1.00 50.03  ? 261 ILE C CG1 1 
ATOM   7171  C  CG2 . ILE C  1 261 ? -27.107 -8.127  -6.707  1.00 51.67  ? 261 ILE C CG2 1 
ATOM   7172  C  CD1 . ILE C  1 261 ? -24.076 -8.987  -6.079  1.00 47.17  ? 261 ILE C CD1 1 
ATOM   7173  N  N   . ASP C  1 262 ? -27.989 -10.075 -3.232  1.00 57.99  ? 262 ASP C N   1 
ATOM   7174  C  CA  . ASP C  1 262 ? -28.695 -9.599  -1.996  1.00 54.53  ? 262 ASP C CA  1 
ATOM   7175  C  C   . ASP C  1 262 ? -28.239 -8.173  -1.456  1.00 63.85  ? 262 ASP C C   1 
ATOM   7176  O  O   . ASP C  1 262 ? -28.964 -7.535  -0.680  1.00 63.49  ? 262 ASP C O   1 
ATOM   7177  C  CB  . ASP C  1 262 ? -28.623 -10.679 -0.853  1.00 45.53  ? 262 ASP C CB  1 
ATOM   7178  C  CG  . ASP C  1 262 ? -27.156 -10.810 -0.215  1.00 42.44  ? 262 ASP C CG  1 
ATOM   7179  O  OD1 . ASP C  1 262 ? -26.194 -10.280 -0.807  1.00 47.83  ? 262 ASP C OD1 1 
ATOM   7180  O  OD2 . ASP C  1 262 ? -27.025 -11.448 0.869   1.00 33.89  ? 262 ASP C OD2 1 
ATOM   7181  N  N   . MET C  1 263 ? -27.061 -7.716  -1.880  1.00 67.65  ? 263 MET C N   1 
ATOM   7182  C  CA  . MET C  1 263 ? -26.505 -6.414  -1.379  1.00 69.36  ? 263 MET C CA  1 
ATOM   7183  C  C   . MET C  1 263 ? -27.311 -5.194  -1.854  1.00 67.80  ? 263 MET C C   1 
ATOM   7184  O  O   . MET C  1 263 ? -27.830 -5.172  -2.980  1.00 69.31  ? 263 MET C O   1 
ATOM   7185  C  CB  . MET C  1 263 ? -25.016 -6.272  -1.746  1.00 72.03  ? 263 MET C CB  1 
ATOM   7186  C  CG  . MET C  1 263 ? -24.680 -6.674  -3.157  1.00 85.53  ? 263 MET C CG  1 
ATOM   7187  S  SD  . MET C  1 263 ? -22.905 -6.944  -3.385  1.00 98.44  ? 263 MET C SD  1 
ATOM   7188  C  CE  . MET C  1 263 ? -22.260 -5.316  -2.983  1.00 89.87  ? 263 MET C CE  1 
ATOM   7189  N  N   . GLY C  1 264 ? -27.410 -4.180  -0.981  1.00 67.40  ? 264 GLY C N   1 
ATOM   7190  C  CA  . GLY C  1 264 ? -28.194 -2.960  -1.281  1.00 72.41  ? 264 GLY C CA  1 
ATOM   7191  C  C   . GLY C  1 264 ? -27.583 -2.101  -2.383  1.00 74.06  ? 264 GLY C C   1 
ATOM   7192  O  O   . GLY C  1 264 ? -28.261 -1.265  -2.975  1.00 72.94  ? 264 GLY C O   1 
ATOM   7193  N  N   . THR C  1 265 ? -26.292 -2.313  -2.651  1.00 72.76  ? 265 THR C N   1 
ATOM   7194  C  CA  . THR C  1 265 ? -25.582 -1.554  -3.694  1.00 86.82  ? 265 THR C CA  1 
ATOM   7195  C  C   . THR C  1 265 ? -26.113 -1.898  -5.083  1.00 98.11  ? 265 THR C C   1 
ATOM   7196  O  O   . THR C  1 265 ? -26.188 -1.027  -5.975  1.00 94.92  ? 265 THR C O   1 
ATOM   7197  C  CB  . THR C  1 265 ? -24.065 -1.817  -3.652  1.00 81.80  ? 265 THR C CB  1 
ATOM   7198  O  OG1 . THR C  1 265 ? -23.551 -1.457  -2.371  1.00 78.40  ? 265 THR C OG1 1 
ATOM   7199  C  CG2 . THR C  1 265 ? -23.337 -0.999  -4.747  1.00 79.99  ? 265 THR C CG2 1 
ATOM   7200  N  N   . ALA C  1 266 ? -26.480 -3.161  -5.273  1.00 102.57 ? 266 ALA C N   1 
ATOM   7201  C  CA  . ALA C  1 266 ? -27.001 -3.614  -6.532  1.00 101.78 ? 266 ALA C CA  1 
ATOM   7202  C  C   . ALA C  1 266 ? -28.498 -3.931  -6.428  1.00 96.34  ? 266 ALA C C   1 
ATOM   7203  O  O   . ALA C  1 266 ? -28.929 -5.040  -6.734  1.00 96.63  ? 266 ALA C O   1 
ATOM   7204  C  CB  . ALA C  1 266 ? -26.224 -4.839  -7.022  1.00 100.09 ? 266 ALA C CB  1 
ATOM   7205  N  N   . LYS C  1 267 ? -29.283 -2.939  -5.987  1.00 98.57  ? 267 LYS C N   1 
ATOM   7206  C  CA  . LYS C  1 267 ? -30.729 -3.101  -5.870  1.00 95.33  ? 267 LYS C CA  1 
ATOM   7207  C  C   . LYS C  1 267 ? -31.509 -2.183  -6.888  1.00 100.39 ? 267 LYS C C   1 
ATOM   7208  O  O   . LYS C  1 267 ? -31.008 -1.127  -7.294  1.00 85.26  ? 267 LYS C O   1 
ATOM   7209  C  CB  . LYS C  1 267 ? -31.195 -2.846  -4.428  1.00 88.64  ? 267 LYS C CB  1 
ATOM   7210  C  CG  . LYS C  1 267 ? -30.918 -1.453  -3.915  1.00 86.23  ? 267 LYS C CG  1 
ATOM   7211  C  CD  . LYS C  1 267 ? -31.252 -1.340  -2.433  1.00 80.98  ? 267 LYS C CD  1 
ATOM   7212  C  CE  . LYS C  1 267 ? -32.669 -1.818  -2.148  1.00 88.07  ? 267 LYS C CE  1 
ATOM   7213  N  NZ  . LYS C  1 267 ? -32.985 -1.789  -0.696  1.00 81.20  ? 267 LYS C NZ  1 
ATOM   7214  N  N   . PRO C  1 268 ? -32.743 -2.615  -7.282  1.00 108.18 ? 268 PRO C N   1 
ATOM   7215  C  CA  . PRO C  1 268 ? -33.586 -1.963  -8.297  1.00 109.75 ? 268 PRO C CA  1 
ATOM   7216  C  C   . PRO C  1 268 ? -33.340 -0.403  -8.458  1.00 108.20 ? 268 PRO C C   1 
ATOM   7217  O  O   . PRO C  1 268 ? -33.020 0.060   -9.552  1.00 103.83 ? 268 PRO C O   1 
ATOM   7218  C  CB  . PRO C  1 268 ? -34.991 -2.231  -7.793  1.00 105.92 ? 268 PRO C CB  1 
ATOM   7219  C  CG  . PRO C  1 268 ? -34.896 -3.598  -7.110  1.00 98.26  ? 268 PRO C CG  1 
ATOM   7220  C  CD  . PRO C  1 268 ? -33.419 -3.789  -6.690  1.00 108.41 ? 268 PRO C CD  1 
ATOM   7221  N  N   . GLU C  1 269 ? -33.500 0.349   -7.370  1.00 105.23 ? 269 GLU C N   1 
ATOM   7222  C  CA  . GLU C  1 269 ? -33.400 1.843   -7.423  1.00 101.88 ? 269 GLU C CA  1 
ATOM   7223  C  C   . GLU C  1 269 ? -32.083 2.368   -8.090  1.00 105.17 ? 269 GLU C C   1 
ATOM   7224  O  O   . GLU C  1 269 ? -32.116 3.307   -8.893  1.00 100.36 ? 269 GLU C O   1 
ATOM   7225  C  CB  . GLU C  1 269 ? -33.562 2.454   -6.019  1.00 105.05 ? 269 GLU C CB  1 
ATOM   7226  C  CG  . GLU C  1 269 ? -34.831 2.020   -5.282  1.00 110.86 ? 269 GLU C CG  1 
ATOM   7227  C  CD  . GLU C  1 269 ? -34.729 0.604   -4.716  1.00 105.17 ? 269 GLU C CD  1 
ATOM   7228  O  OE1 . GLU C  1 269 ? -35.780 0.006   -4.416  1.00 103.48 ? 269 GLU C OE1 1 
ATOM   7229  O  OE2 . GLU C  1 269 ? -33.595 0.098   -4.574  1.00 93.45  ? 269 GLU C OE2 1 
ATOM   7230  N  N   . TYR C  1 270 ? -30.945 1.747   -7.741  1.00 104.50 ? 270 TYR C N   1 
ATOM   7231  C  CA  . TYR C  1 270 ? -29.608 2.230   -8.213  1.00 94.04  ? 270 TYR C CA  1 
ATOM   7232  C  C   . TYR C  1 270 ? -29.196 1.669   -9.605  1.00 84.45  ? 270 TYR C C   1 
ATOM   7233  O  O   . TYR C  1 270 ? -28.224 2.145   -10.215 1.00 71.33  ? 270 TYR C O   1 
ATOM   7234  C  CB  . TYR C  1 270 ? -28.518 1.910   -7.173  1.00 99.62  ? 270 TYR C CB  1 
ATOM   7235  C  CG  . TYR C  1 270 ? -28.832 2.407   -5.771  1.00 105.28 ? 270 TYR C CG  1 
ATOM   7236  C  CD1 . TYR C  1 270 ? -28.739 3.765   -5.452  1.00 105.24 ? 270 TYR C CD1 1 
ATOM   7237  C  CD2 . TYR C  1 270 ? -29.213 1.520   -4.765  1.00 105.96 ? 270 TYR C CD2 1 
ATOM   7238  C  CE1 . TYR C  1 270 ? -29.021 4.222   -4.178  1.00 105.60 ? 270 TYR C CE1 1 
ATOM   7239  C  CE2 . TYR C  1 270 ? -29.498 1.966   -3.484  1.00 107.79 ? 270 TYR C CE2 1 
ATOM   7240  C  CZ  . TYR C  1 270 ? -29.401 3.317   -3.193  1.00 108.59 ? 270 TYR C CZ  1 
ATOM   7241  O  OH  . TYR C  1 270 ? -29.681 3.763   -1.928  1.00 113.04 ? 270 TYR C OH  1 
ATOM   7242  N  N   . LYS C  1 271 ? -29.937 0.669   -10.089 1.00 80.69  ? 271 LYS C N   1 
ATOM   7243  C  CA  . LYS C  1 271 ? -29.603 -0.003  -11.377 1.00 74.92  ? 271 LYS C CA  1 
ATOM   7244  C  C   . LYS C  1 271 ? -29.511 0.986   -12.594 1.00 80.03  ? 271 LYS C C   1 
ATOM   7245  O  O   . LYS C  1 271 ? -28.580 0.897   -13.397 1.00 83.34  ? 271 LYS C O   1 
ATOM   7246  C  CB  . LYS C  1 271 ? -30.601 -1.149  -11.678 1.00 71.50  ? 271 LYS C CB  1 
ATOM   7247  C  CG  . LYS C  1 271 ? -30.297 -1.933  -12.974 1.00 68.30  ? 271 LYS C CG  1 
ATOM   7248  C  CD  . LYS C  1 271 ? -31.304 -3.071  -13.190 1.00 64.33  ? 271 LYS C CD  1 
ATOM   7249  C  CE  . LYS C  1 271 ? -31.084 -3.774  -14.542 1.00 68.52  ? 271 LYS C CE  1 
ATOM   7250  N  NZ  . LYS C  1 271 ? -29.749 -4.465  -14.621 1.00 65.72  ? 271 LYS C NZ  1 
ATOM   7251  N  N   . PRO C  1 272 ? -30.501 1.931   -12.709 1.00 84.38  ? 272 PRO C N   1 
ATOM   7252  C  CA  . PRO C  1 272 ? -30.551 2.889   -13.845 1.00 82.36  ? 272 PRO C CA  1 
ATOM   7253  C  C   . PRO C  1 272 ? -29.286 3.776   -13.954 1.00 83.28  ? 272 PRO C C   1 
ATOM   7254  O  O   . PRO C  1 272 ? -28.992 4.306   -15.030 1.00 87.80  ? 272 PRO C O   1 
ATOM   7255  C  CB  . PRO C  1 272 ? -31.784 3.757   -13.520 1.00 82.72  ? 272 PRO C CB  1 
ATOM   7256  C  CG  . PRO C  1 272 ? -32.605 2.919   -12.587 1.00 81.85  ? 272 PRO C CG  1 
ATOM   7257  C  CD  . PRO C  1 272 ? -31.628 2.124   -11.778 1.00 83.56  ? 272 PRO C CD  1 
ATOM   7258  N  N   . LYS C  1 273 ? -28.556 3.924   -12.844 1.00 80.78  ? 273 LYS C N   1 
ATOM   7259  C  CA  . LYS C  1 273 ? -27.350 4.758   -12.825 1.00 77.79  ? 273 LYS C CA  1 
ATOM   7260  C  C   . LYS C  1 273 ? -26.063 3.917   -12.819 1.00 75.96  ? 273 LYS C C   1 
ATOM   7261  O  O   . LYS C  1 273 ? -25.107 4.221   -13.540 1.00 73.53  ? 273 LYS C O   1 
ATOM   7262  C  CB  . LYS C  1 273 ? -27.359 5.708   -11.600 1.00 81.66  ? 273 LYS C CB  1 
ATOM   7263  C  CG  . LYS C  1 273 ? -28.635 6.524   -11.441 1.00 85.77  ? 273 LYS C CG  1 
ATOM   7264  C  CD  . LYS C  1 273 ? -29.781 5.663   -10.949 1.00 87.48  ? 273 LYS C CD  1 
ATOM   7265  C  CE  . LYS C  1 273 ? -31.053 6.467   -10.814 1.00 87.84  ? 273 LYS C CE  1 
ATOM   7266  N  NZ  . LYS C  1 273 ? -32.196 5.618   -10.389 1.00 95.64  ? 273 LYS C NZ  1 
ATOM   7267  N  N   . LEU C  1 274 ? -26.048 2.861   -12.002 1.00 69.98  ? 274 LEU C N   1 
ATOM   7268  C  CA  . LEU C  1 274 ? -24.830 2.051   -11.808 1.00 69.58  ? 274 LEU C CA  1 
ATOM   7269  C  C   . LEU C  1 274 ? -24.623 0.965   -12.904 1.00 62.33  ? 274 LEU C C   1 
ATOM   7270  O  O   . LEU C  1 274 ? -23.496 0.681   -13.294 1.00 56.59  ? 274 LEU C O   1 
ATOM   7271  C  CB  . LEU C  1 274 ? -24.821 1.408   -10.408 1.00 69.16  ? 274 LEU C CB  1 
ATOM   7272  C  CG  . LEU C  1 274 ? -24.926 2.371   -9.206  1.00 74.18  ? 274 LEU C CG  1 
ATOM   7273  C  CD1 . LEU C  1 274 ? -24.853 1.605   -7.891  1.00 68.92  ? 274 LEU C CD1 1 
ATOM   7274  C  CD2 . LEU C  1 274 ? -23.842 3.457   -9.266  1.00 69.95  ? 274 LEU C CD2 1 
ATOM   7275  N  N   . ALA C  1 275 ? -25.728 0.373   -13.383 1.00 64.72  ? 275 ALA C N   1 
ATOM   7276  C  CA  . ALA C  1 275 ? -25.649 -0.716  -14.408 1.00 65.18  ? 275 ALA C CA  1 
ATOM   7277  C  C   . ALA C  1 275 ? -26.975 -0.881  -15.202 1.00 61.76  ? 275 ALA C C   1 
ATOM   7278  O  O   . ALA C  1 275 ? -27.669 -1.900  -15.066 1.00 60.91  ? 275 ALA C O   1 
ATOM   7279  C  CB  . ALA C  1 275 ? -25.250 -2.026  -13.756 1.00 62.70  ? 275 ALA C CB  1 
ATOM   7280  N  N   . PRO C  1 276 ? -27.314 0.137   -16.047 1.00 60.24  ? 276 PRO C N   1 
ATOM   7281  C  CA  . PRO C  1 276 ? -28.593 0.194   -16.814 1.00 56.67  ? 276 PRO C CA  1 
ATOM   7282  C  C   . PRO C  1 276 ? -28.813 -0.995  -17.800 1.00 54.71  ? 276 PRO C C   1 
ATOM   7283  O  O   . PRO C  1 276 ? -29.938 -1.450  -17.968 1.00 62.20  ? 276 PRO C O   1 
ATOM   7284  C  CB  . PRO C  1 276 ? -28.481 1.531   -17.591 1.00 55.16  ? 276 PRO C CB  1 
ATOM   7285  C  CG  . PRO C  1 276 ? -27.011 1.854   -17.592 1.00 53.89  ? 276 PRO C CG  1 
ATOM   7286  C  CD  . PRO C  1 276 ? -26.461 1.315   -16.309 1.00 54.98  ? 276 PRO C CD  1 
ATOM   7287  N  N   . ARG C  1 277 ? -27.747 -1.468  -18.430 1.00 48.17  ? 277 ARG C N   1 
ATOM   7288  C  CA  . ARG C  1 277 ? -27.868 -2.592  -19.423 1.00 53.95  ? 277 ARG C CA  1 
ATOM   7289  C  C   . ARG C  1 277 ? -27.060 -3.843  -18.998 1.00 52.03  ? 277 ARG C C   1 
ATOM   7290  O  O   . ARG C  1 277 ? -26.465 -4.552  -19.845 1.00 50.54  ? 277 ARG C O   1 
ATOM   7291  C  CB  . ARG C  1 277 ? -27.473 -2.122  -20.834 1.00 50.44  ? 277 ARG C CB  1 
ATOM   7292  C  CG  . ARG C  1 277 ? -28.423 -1.053  -21.411 1.00 56.82  ? 277 ARG C CG  1 
ATOM   7293  C  CD  . ARG C  1 277 ? -28.135 -0.755  -22.891 1.00 62.73  ? 277 ARG C CD  1 
ATOM   7294  N  NE  . ARG C  1 277 ? -26.782 -0.268  -23.101 1.00 73.44  ? 277 ARG C NE  1 
ATOM   7295  C  CZ  . ARG C  1 277 ? -25.846 -0.922  -23.795 1.00 73.65  ? 277 ARG C CZ  1 
ATOM   7296  N  NH1 . ARG C  1 277 ? -24.629 -0.397  -23.933 1.00 70.66  ? 277 ARG C NH1 1 
ATOM   7297  N  NH2 . ARG C  1 277 ? -26.127 -2.094  -24.358 1.00 77.50  ? 277 ARG C NH2 1 
ATOM   7298  N  N   . TRP C  1 278 ? -27.060 -4.106  -17.705 1.00 46.22  ? 278 TRP C N   1 
ATOM   7299  C  CA  . TRP C  1 278 ? -26.322 -5.190  -17.138 1.00 46.08  ? 278 TRP C CA  1 
ATOM   7300  C  C   . TRP C  1 278 ? -27.160 -6.465  -17.099 1.00 45.59  ? 278 TRP C C   1 
ATOM   7301  O  O   . TRP C  1 278 ? -28.131 -6.549  -16.374 1.00 49.57  ? 278 TRP C O   1 
ATOM   7302  C  CB  . TRP C  1 278 ? -25.860 -4.804  -15.730 1.00 47.56  ? 278 TRP C CB  1 
ATOM   7303  C  CG  . TRP C  1 278 ? -24.944 -5.809  -15.038 1.00 43.94  ? 278 TRP C CG  1 
ATOM   7304  C  CD1 . TRP C  1 278 ? -23.854 -6.493  -15.600 1.00 42.53  ? 278 TRP C CD1 1 
ATOM   7305  C  CD2 . TRP C  1 278 ? -25.001 -6.218  -13.628 1.00 42.91  ? 278 TRP C CD2 1 
ATOM   7306  N  NE1 . TRP C  1 278 ? -23.244 -7.318  -14.631 1.00 41.74  ? 278 TRP C NE1 1 
ATOM   7307  C  CE2 . TRP C  1 278 ? -23.921 -7.171  -13.413 1.00 43.15  ? 278 TRP C CE2 1 
ATOM   7308  C  CE3 . TRP C  1 278 ? -25.851 -5.887  -12.538 1.00 40.88  ? 278 TRP C CE3 1 
ATOM   7309  C  CZ2 . TRP C  1 278 ? -23.691 -7.771  -12.175 1.00 39.04  ? 278 TRP C CZ2 1 
ATOM   7310  C  CZ3 . TRP C  1 278 ? -25.617 -6.495  -11.293 1.00 41.51  ? 278 TRP C CZ3 1 
ATOM   7311  C  CH2 . TRP C  1 278 ? -24.551 -7.423  -11.115 1.00 41.89  ? 278 TRP C CH2 1 
ATOM   7312  N  N   . SER C  1 279 ? -26.762 -7.458  -17.922 1.00 43.69  ? 279 SER C N   1 
ATOM   7313  C  CA  . SER C  1 279 ? -27.415 -8.785  -17.947 1.00 37.52  ? 279 SER C CA  1 
ATOM   7314  C  C   . SER C  1 279 ? -26.413 -9.820  -18.417 1.00 41.57  ? 279 SER C C   1 
ATOM   7315  O  O   . SER C  1 279 ? -25.242 -9.497  -18.659 1.00 39.24  ? 279 SER C O   1 
ATOM   7316  C  CB  . SER C  1 279 ? -28.615 -8.778  -18.870 1.00 43.22  ? 279 SER C CB  1 
ATOM   7317  O  OG  . SER C  1 279 ? -28.212 -8.791  -20.225 1.00 37.45  ? 279 SER C OG  1 
ATOM   7318  N  N   . ILE C  1 280 ? -26.864 -11.068 -18.562 1.00 34.42  ? 280 ILE C N   1 
ATOM   7319  C  CA  . ILE C  1 280 ? -25.980 -12.149 -18.967 1.00 33.43  ? 280 ILE C CA  1 
ATOM   7320  C  C   . ILE C  1 280 ? -25.789 -12.196 -20.498 1.00 31.82  ? 280 ILE C C   1 
ATOM   7321  O  O   . ILE C  1 280 ? -25.019 -13.001 -21.010 1.00 32.35  ? 280 ILE C O   1 
ATOM   7322  C  CB  . ILE C  1 280 ? -26.501 -13.530 -18.467 1.00 35.56  ? 280 ILE C CB  1 
ATOM   7323  C  CG1 . ILE C  1 280 ? -25.371 -14.534 -18.399 1.00 34.27  ? 280 ILE C CG1 1 
ATOM   7324  C  CG2 . ILE C  1 280 ? -27.646 -14.032 -19.358 1.00 28.42  ? 280 ILE C CG2 1 
ATOM   7325  C  CD1 . ILE C  1 280 ? -25.765 -15.860 -17.745 1.00 35.20  ? 280 ILE C CD1 1 
ATOM   7326  N  N   . THR C  1 281 ? -26.488 -11.336 -21.204 1.00 31.91  ? 281 THR C N   1 
ATOM   7327  C  CA  . THR C  1 281 ? -26.406 -11.320 -22.669 1.00 32.57  ? 281 THR C CA  1 
ATOM   7328  C  C   . THR C  1 281 ? -25.922 -9.949  -23.244 1.00 33.30  ? 281 THR C C   1 
ATOM   7329  O  O   . THR C  1 281 ? -25.951 -9.735  -24.452 1.00 37.53  ? 281 THR C O   1 
ATOM   7330  C  CB  . THR C  1 281 ? -27.754 -11.711 -23.320 1.00 32.62  ? 281 THR C CB  1 
ATOM   7331  O  OG1 . THR C  1 281 ? -28.779 -10.823 -22.875 1.00 31.01  ? 281 THR C OG1 1 
ATOM   7332  C  CG2 . THR C  1 281 ? -28.136 -13.152 -22.950 1.00 31.03  ? 281 THR C CG2 1 
ATOM   7333  N  N   . LEU C  1 282 ? -25.478 -9.048  -22.361 1.00 33.55  ? 282 LEU C N   1 
ATOM   7334  C  CA  . LEU C  1 282 ? -25.028 -7.700  -22.799 1.00 33.02  ? 282 LEU C CA  1 
ATOM   7335  C  C   . LEU C  1 282 ? -23.952 -7.758  -23.931 1.00 31.54  ? 282 LEU C C   1 
ATOM   7336  O  O   . LEU C  1 282 ? -23.982 -6.959  -24.858 1.00 28.83  ? 282 LEU C O   1 
ATOM   7337  C  CB  . LEU C  1 282 ? -24.511 -6.883  -21.622 1.00 36.21  ? 282 LEU C CB  1 
ATOM   7338  C  CG  . LEU C  1 282 ? -23.914 -5.476  -21.977 1.00 38.44  ? 282 LEU C CG  1 
ATOM   7339  C  CD1 . LEU C  1 282 ? -24.962 -4.579  -22.669 1.00 41.42  ? 282 LEU C CD1 1 
ATOM   7340  C  CD2 . LEU C  1 282 ? -23.348 -4.796  -20.755 1.00 38.31  ? 282 LEU C CD2 1 
ATOM   7341  N  N   . ILE C  1 283 ? -23.016 -8.715  -23.830 1.00 29.54  ? 283 ILE C N   1 
ATOM   7342  C  CA  . ILE C  1 283 ? -21.901 -8.803  -24.825 1.00 32.47  ? 283 ILE C CA  1 
ATOM   7343  C  C   . ILE C  1 283 ? -22.378 -9.182  -26.229 1.00 30.43  ? 283 ILE C C   1 
ATOM   7344  O  O   . ILE C  1 283 ? -21.713 -8.895  -27.206 1.00 29.08  ? 283 ILE C O   1 
ATOM   7345  C  CB  . ILE C  1 283 ? -20.764 -9.776  -24.370 1.00 32.35  ? 283 ILE C CB  1 
ATOM   7346  C  CG1 . ILE C  1 283 ? -21.292 -11.167 -24.205 1.00 31.64  ? 283 ILE C CG1 1 
ATOM   7347  C  CG2 . ILE C  1 283 ? -20.111 -9.275  -23.077 1.00 31.81  ? 283 ILE C CG2 1 
ATOM   7348  C  CD1 . ILE C  1 283 ? -20.211 -12.200 -24.066 1.00 32.79  ? 283 ILE C CD1 1 
ATOM   7349  N  N   . PHE C  1 284 ? -23.538 -9.827  -26.313 1.00 30.06  ? 284 PHE C N   1 
ATOM   7350  C  CA  . PHE C  1 284 ? -24.098 -10.217 -27.626 1.00 34.58  ? 284 PHE C CA  1 
ATOM   7351  C  C   . PHE C  1 284 ? -24.856 -9.084  -28.232 1.00 37.33  ? 284 PHE C C   1 
ATOM   7352  O  O   . PHE C  1 284 ? -25.030 -9.025  -29.410 1.00 38.34  ? 284 PHE C O   1 
ATOM   7353  C  CB  . PHE C  1 284 ? -24.994 -11.450 -27.488 1.00 29.71  ? 284 PHE C CB  1 
ATOM   7354  C  CG  . PHE C  1 284 ? -24.310 -12.608 -26.895 1.00 34.99  ? 284 PHE C CG  1 
ATOM   7355  C  CD1 . PHE C  1 284 ? -24.495 -12.936 -25.537 1.00 31.92  ? 284 PHE C CD1 1 
ATOM   7356  C  CD2 . PHE C  1 284 ? -23.449 -13.390 -27.660 1.00 30.96  ? 284 PHE C CD2 1 
ATOM   7357  C  CE1 . PHE C  1 284 ? -23.846 -14.013 -24.980 1.00 32.03  ? 284 PHE C CE1 1 
ATOM   7358  C  CE2 . PHE C  1 284 ? -22.804 -14.459 -27.109 1.00 32.47  ? 284 PHE C CE2 1 
ATOM   7359  C  CZ  . PHE C  1 284 ? -23.001 -14.779 -25.754 1.00 32.52  ? 284 PHE C CZ  1 
ATOM   7360  N  N   . GLU C  1 285 ? -25.297 -8.171  -27.395 1.00 36.96  ? 285 GLU C N   1 
ATOM   7361  C  CA  . GLU C  1 285 ? -26.090 -7.070  -27.828 1.00 39.32  ? 285 GLU C CA  1 
ATOM   7362  C  C   . GLU C  1 285 ? -25.228 -5.862  -28.151 1.00 42.46  ? 285 GLU C C   1 
ATOM   7363  O  O   . GLU C  1 285 ? -25.543 -5.103  -29.019 1.00 44.02  ? 285 GLU C O   1 
ATOM   7364  C  CB  . GLU C  1 285 ? -27.133 -6.703  -26.730 1.00 39.56  ? 285 GLU C CB  1 
ATOM   7365  C  CG  . GLU C  1 285 ? -28.048 -7.869  -26.330 1.00 44.38  ? 285 GLU C CG  1 
ATOM   7366  C  CD  . GLU C  1 285 ? -28.583 -7.749  -24.875 1.00 46.41  ? 285 GLU C CD  1 
ATOM   7367  O  OE1 . GLU C  1 285 ? -28.386 -6.690  -24.247 1.00 46.49  ? 285 GLU C OE1 1 
ATOM   7368  O  OE2 . GLU C  1 285 ? -29.186 -8.719  -24.386 1.00 48.43  ? 285 GLU C OE2 1 
ATOM   7369  N  N   . ASP C  1 286 ? -24.131 -5.714  -27.435 1.00 44.64  ? 286 ASP C N   1 
ATOM   7370  C  CA  . ASP C  1 286 ? -23.304 -4.557  -27.575 1.00 45.04  ? 286 ASP C CA  1 
ATOM   7371  C  C   . ASP C  1 286 ? -21.809 -4.891  -27.900 1.00 42.39  ? 286 ASP C C   1 
ATOM   7372  O  O   . ASP C  1 286 ? -21.297 -4.533  -28.973 1.00 41.11  ? 286 ASP C O   1 
ATOM   7373  C  CB  . ASP C  1 286 ? -23.389 -3.681  -26.291 1.00 53.84  ? 286 ASP C CB  1 
ATOM   7374  C  CG  . ASP C  1 286 ? -22.424 -2.467  -26.330 1.00 62.55  ? 286 ASP C CG  1 
ATOM   7375  O  OD1 . ASP C  1 286 ? -21.283 -2.620  -26.838 1.00 60.54  ? 286 ASP C OD1 1 
ATOM   7376  O  OD2 . ASP C  1 286 ? -22.815 -1.381  -25.848 1.00 62.92  ? 286 ASP C OD2 1 
ATOM   7377  N  N   . THR C  1 287 ? -21.140 -5.570  -26.964 1.00 38.24  ? 287 THR C N   1 
ATOM   7378  C  CA  . THR C  1 287 ? -19.668 -5.793  -27.043 1.00 34.22  ? 287 THR C CA  1 
ATOM   7379  C  C   . THR C  1 287 ? -19.203 -6.531  -28.320 1.00 35.13  ? 287 THR C C   1 
ATOM   7380  O  O   . THR C  1 287 ? -18.392 -6.014  -29.077 1.00 34.95  ? 287 THR C O   1 
ATOM   7381  C  CB  . THR C  1 287 ? -19.152 -6.540  -25.819 1.00 35.15  ? 287 THR C CB  1 
ATOM   7382  O  OG1 . THR C  1 287 ? -19.511 -5.815  -24.625 1.00 36.94  ? 287 THR C OG1 1 
ATOM   7383  C  CG2 . THR C  1 287 ? -17.607 -6.694  -25.888 1.00 31.43  ? 287 THR C CG2 1 
ATOM   7384  N  N   . ILE C  1 288 ? -19.711 -7.728  -28.531 1.00 31.86  ? 288 ILE C N   1 
ATOM   7385  C  CA  . ILE C  1 288 ? -19.277 -8.537  -29.666 1.00 32.92  ? 288 ILE C CA  1 
ATOM   7386  C  C   . ILE C  1 288 ? -19.499 -7.807  -31.037 1.00 31.11  ? 288 ILE C C   1 
ATOM   7387  O  O   . ILE C  1 288 ? -18.570 -7.719  -31.855 1.00 34.42  ? 288 ILE C O   1 
ATOM   7388  C  CB  . ILE C  1 288 ? -19.936 -9.922  -29.671 1.00 32.21  ? 288 ILE C CB  1 
ATOM   7389  C  CG1 . ILE C  1 288 ? -19.452 -10.735 -28.464 1.00 35.79  ? 288 ILE C CG1 1 
ATOM   7390  C  CG2 . ILE C  1 288 ? -19.617 -10.664 -30.973 1.00 31.68  ? 288 ILE C CG2 1 
ATOM   7391  C  CD1 . ILE C  1 288 ? -20.026 -12.123 -28.393 1.00 35.71  ? 288 ILE C CD1 1 
ATOM   7392  N  N   . PRO C  1 289 ? -20.729 -7.291  -31.271 1.00 30.58  ? 289 PRO C N   1 
ATOM   7393  C  CA  . PRO C  1 289 ? -20.995 -6.509  -32.496 1.00 32.30  ? 289 PRO C CA  1 
ATOM   7394  C  C   . PRO C  1 289 ? -20.027 -5.302  -32.633 1.00 32.57  ? 289 PRO C C   1 
ATOM   7395  O  O   . PRO C  1 289 ? -19.571 -4.985  -33.761 1.00 35.14  ? 289 PRO C O   1 
ATOM   7396  C  CB  . PRO C  1 289 ? -22.439 -6.023  -32.298 1.00 29.45  ? 289 PRO C CB  1 
ATOM   7397  C  CG  . PRO C  1 289 ? -23.056 -7.054  -31.418 1.00 30.78  ? 289 PRO C CG  1 
ATOM   7398  C  CD  . PRO C  1 289 ? -21.949 -7.486  -30.469 1.00 28.59  ? 289 PRO C CD  1 
ATOM   7399  N  N   . PHE C  1 290 ? -19.707 -4.648  -31.506 1.00 29.62  ? 290 PHE C N   1 
ATOM   7400  C  CA  . PHE C  1 290 ? -18.744 -3.533  -31.525 1.00 32.13  ? 290 PHE C CA  1 
ATOM   7401  C  C   . PHE C  1 290 ? -17.394 -4.005  -32.002 1.00 35.45  ? 290 PHE C C   1 
ATOM   7402  O  O   . PHE C  1 290 ? -16.750 -3.351  -32.859 1.00 32.26  ? 290 PHE C O   1 
ATOM   7403  C  CB  . PHE C  1 290 ? -18.610 -2.900  -30.156 1.00 32.69  ? 290 PHE C CB  1 
ATOM   7404  C  CG  . PHE C  1 290 ? -17.380 -1.971  -30.019 1.00 33.44  ? 290 PHE C CG  1 
ATOM   7405  C  CD1 . PHE C  1 290 ? -17.454 -0.608  -30.403 1.00 35.66  ? 290 PHE C CD1 1 
ATOM   7406  C  CD2 . PHE C  1 290 ? -16.158 -2.463  -29.515 1.00 31.98  ? 290 PHE C CD2 1 
ATOM   7407  C  CE1 . PHE C  1 290 ? -16.335 0.233   -30.281 1.00 34.55  ? 290 PHE C CE1 1 
ATOM   7408  C  CE2 . PHE C  1 290 ? -15.036 -1.616  -29.392 1.00 31.98  ? 290 PHE C CE2 1 
ATOM   7409  C  CZ  . PHE C  1 290 ? -15.127 -0.274  -29.774 1.00 33.82  ? 290 PHE C CZ  1 
ATOM   7410  N  N   . LEU C  1 291 ? -16.940 -5.135  -31.462 1.00 31.57  ? 291 LEU C N   1 
ATOM   7411  C  CA  . LEU C  1 291 ? -15.636 -5.682  -31.846 1.00 32.70  ? 291 LEU C CA  1 
ATOM   7412  C  C   . LEU C  1 291 ? -15.612 -6.078  -33.305 1.00 32.10  ? 291 LEU C C   1 
ATOM   7413  O  O   . LEU C  1 291 ? -14.684 -5.777  -34.007 1.00 33.12  ? 291 LEU C O   1 
ATOM   7414  C  CB  . LEU C  1 291 ? -15.263 -6.878  -30.960 1.00 30.10  ? 291 LEU C CB  1 
ATOM   7415  C  CG  . LEU C  1 291 ? -15.040 -6.540  -29.496 1.00 29.90  ? 291 LEU C CG  1 
ATOM   7416  C  CD1 . LEU C  1 291 ? -14.730 -7.800  -28.690 1.00 30.11  ? 291 LEU C CD1 1 
ATOM   7417  C  CD2 . LEU C  1 291 ? -13.925 -5.514  -29.351 1.00 34.16  ? 291 LEU C CD2 1 
ATOM   7418  N  N   . LYS C  1 292 ? -16.655 -6.753  -33.749 1.00 33.90  ? 292 LYS C N   1 
ATOM   7419  C  CA  . LYS C  1 292 ? -16.711 -7.223  -35.108 1.00 33.29  ? 292 LYS C CA  1 
ATOM   7420  C  C   . LYS C  1 292 ? -16.797 -6.072  -36.128 1.00 34.32  ? 292 LYS C C   1 
ATOM   7421  O  O   . LYS C  1 292 ? -16.295 -6.179  -37.198 1.00 32.61  ? 292 LYS C O   1 
ATOM   7422  C  CB  . LYS C  1 292 ? -17.879 -8.223  -35.307 1.00 33.70  ? 292 LYS C CB  1 
ATOM   7423  C  CG  . LYS C  1 292 ? -17.662 -9.592  -34.593 1.00 36.38  ? 292 LYS C CG  1 
ATOM   7424  C  CD  . LYS C  1 292 ? -18.119 -10.759 -35.483 1.00 44.96  ? 292 LYS C CD  1 
ATOM   7425  C  CE  . LYS C  1 292 ? -19.617 -10.893 -35.516 1.00 47.79  ? 292 LYS C CE  1 
ATOM   7426  N  NZ  . LYS C  1 292 ? -20.119 -11.686 -34.371 1.00 52.61  ? 292 LYS C NZ  1 
ATOM   7427  N  N   . ARG C  1 293 ? -17.452 -4.975  -35.745 1.00 35.47  ? 293 ARG C N   1 
ATOM   7428  C  CA  . ARG C  1 293 ? -17.578 -3.815  -36.640 1.00 34.41  ? 293 ARG C CA  1 
ATOM   7429  C  C   . ARG C  1 293 ? -16.321 -2.992  -36.609 1.00 36.47  ? 293 ARG C C   1 
ATOM   7430  O  O   . ARG C  1 293 ? -16.226 -1.977  -37.264 1.00 36.73  ? 293 ARG C O   1 
ATOM   7431  C  CB  . ARG C  1 293 ? -18.803 -2.932  -36.249 1.00 33.32  ? 293 ARG C CB  1 
ATOM   7432  C  CG  . ARG C  1 293 ? -18.517 -1.932  -35.140 1.00 34.95  ? 293 ARG C CG  1 
ATOM   7433  C  CD  . ARG C  1 293 ? -19.627 -0.866  -35.036 1.00 36.71  ? 293 ARG C CD  1 
ATOM   7434  N  NE  . ARG C  1 293 ? -20.753 -1.352  -34.363 1.00 42.90  ? 293 ARG C NE  1 
ATOM   7435  C  CZ  . ARG C  1 293 ? -21.116 -0.980  -33.138 1.00 39.37  ? 293 ARG C CZ  1 
ATOM   7436  N  NH1 . ARG C  1 293 ? -20.408 -0.080  -32.473 1.00 36.51  ? 293 ARG C NH1 1 
ATOM   7437  N  NH2 . ARG C  1 293 ? -22.179 -1.494  -32.596 1.00 40.84  ? 293 ARG C NH2 1 
ATOM   7438  N  N   . ASN C  1 294 ? -15.342 -3.446  -35.830 1.00 37.17  ? 294 ASN C N   1 
ATOM   7439  C  CA  . ASN C  1 294 ? -14.068 -2.730  -35.702 1.00 36.57  ? 294 ASN C CA  1 
ATOM   7440  C  C   . ASN C  1 294 ? -12.857 -3.591  -36.047 1.00 38.72  ? 294 ASN C C   1 
ATOM   7441  O  O   . ASN C  1 294 ? -11.787 -3.461  -35.432 1.00 41.05  ? 294 ASN C O   1 
ATOM   7442  C  CB  . ASN C  1 294 ? -13.926 -2.124  -34.295 1.00 34.60  ? 294 ASN C CB  1 
ATOM   7443  C  CG  . ASN C  1 294 ? -14.732 -0.841  -34.128 1.00 34.96  ? 294 ASN C CG  1 
ATOM   7444  O  OD1 . ASN C  1 294 ? -15.715 -0.798  -33.379 1.00 35.97  ? 294 ASN C OD1 1 
ATOM   7445  N  ND2 . ASN C  1 294 ? -14.331 0.201   -34.837 1.00 37.94  ? 294 ASN C ND2 1 
ATOM   7446  N  N   . GLY C  1 295 ? -13.029 -4.478  -37.035 1.00 39.38  ? 295 GLY C N   1 
ATOM   7447  C  CA  . GLY C  1 295 ? -11.915 -5.263  -37.573 1.00 39.52  ? 295 GLY C CA  1 
ATOM   7448  C  C   . GLY C  1 295 ? -11.535 -6.531  -36.779 1.00 41.53  ? 295 GLY C C   1 
ATOM   7449  O  O   . GLY C  1 295 ? -10.478 -7.095  -36.993 1.00 42.13  ? 295 GLY C O   1 
ATOM   7450  N  N   . VAL C  1 296 ? -12.401 -6.958  -35.867 1.00 38.96  ? 296 VAL C N   1 
ATOM   7451  C  CA  . VAL C  1 296 ? -12.162 -8.219  -35.122 1.00 35.55  ? 296 VAL C CA  1 
ATOM   7452  C  C   . VAL C  1 296 ? -12.873 -9.361  -35.804 1.00 37.50  ? 296 VAL C C   1 
ATOM   7453  O  O   . VAL C  1 296 ? -14.133 -9.418  -35.815 1.00 36.41  ? 296 VAL C O   1 
ATOM   7454  C  CB  . VAL C  1 296 ? -12.620 -8.123  -33.643 1.00 37.17  ? 296 VAL C CB  1 
ATOM   7455  C  CG1 . VAL C  1 296 ? -12.356 -9.436  -32.918 1.00 31.43  ? 296 VAL C CG1 1 
ATOM   7456  C  CG2 . VAL C  1 296 ? -11.915 -6.963  -32.936 1.00 32.98  ? 296 VAL C CG2 1 
ATOM   7457  N  N   . ASN C  1 297 ? -12.088 -10.292 -36.395 1.00 33.93  ? 297 ASN C N   1 
ATOM   7458  C  CA  . ASN C  1 297 ? -12.673 -11.415 -37.161 1.00 36.15  ? 297 ASN C CA  1 
ATOM   7459  C  C   . ASN C  1 297 ? -13.241 -12.520 -36.280 1.00 38.54  ? 297 ASN C C   1 
ATOM   7460  O  O   . ASN C  1 297 ? -13.065 -12.508 -35.027 1.00 33.65  ? 297 ASN C O   1 
ATOM   7461  C  CB  . ASN C  1 297 ? -11.650 -11.992 -38.210 1.00 37.25  ? 297 ASN C CB  1 
ATOM   7462  C  CG  . ASN C  1 297 ? -10.402 -12.571 -37.560 1.00 39.07  ? 297 ASN C CG  1 
ATOM   7463  O  OD1 . ASN C  1 297 ? -10.433 -13.035 -36.400 1.00 40.14  ? 297 ASN C OD1 1 
ATOM   7464  N  ND2 . ASN C  1 297 ? -9.310  -12.556 -38.286 1.00 39.03  ? 297 ASN C ND2 1 
ATOM   7465  N  N   . GLU C  1 298 ? -13.916 -13.466 -36.909 1.00 40.76  ? 298 GLU C N   1 
ATOM   7466  C  CA  . GLU C  1 298 ? -14.609 -14.505 -36.205 1.00 44.06  ? 298 GLU C CA  1 
ATOM   7467  C  C   . GLU C  1 298 ? -13.635 -15.462 -35.484 1.00 46.45  ? 298 GLU C C   1 
ATOM   7468  O  O   . GLU C  1 298 ? -14.007 -16.119 -34.495 1.00 43.98  ? 298 GLU C O   1 
ATOM   7469  C  CB  . GLU C  1 298 ? -15.510 -15.289 -37.167 1.00 45.40  ? 298 GLU C CB  1 
ATOM   7470  C  CG  . GLU C  1 298 ? -16.682 -15.950 -36.501 1.00 57.80  ? 298 GLU C CG  1 
ATOM   7471  C  CD  . GLU C  1 298 ? -17.647 -14.937 -35.879 1.00 69.50  ? 298 GLU C CD  1 
ATOM   7472  O  OE1 . GLU C  1 298 ? -17.915 -13.888 -36.525 1.00 74.30  ? 298 GLU C OE1 1 
ATOM   7473  O  OE2 . GLU C  1 298 ? -18.141 -15.191 -34.739 1.00 70.06  ? 298 GLU C OE2 1 
ATOM   7474  N  N   . GLU C  1 299 ? -12.398 -15.535 -35.981 1.00 42.81  ? 299 GLU C N   1 
ATOM   7475  C  CA  . GLU C  1 299 ? -11.377 -16.376 -35.365 1.00 43.32  ? 299 GLU C CA  1 
ATOM   7476  C  C   . GLU C  1 299 ? -10.960 -15.833 -34.023 1.00 36.05  ? 299 GLU C C   1 
ATOM   7477  O  O   . GLU C  1 299 ? -10.625 -16.590 -33.117 1.00 35.17  ? 299 GLU C O   1 
ATOM   7478  C  CB  . GLU C  1 299 ? -10.136 -16.514 -36.288 1.00 48.13  ? 299 GLU C CB  1 
ATOM   7479  C  CG  . GLU C  1 299 ? -10.328 -17.478 -37.486 1.00 65.22  ? 299 GLU C CG  1 
ATOM   7480  C  CD  . GLU C  1 299 ? -10.979 -16.798 -38.716 1.00 77.31  ? 299 GLU C CD  1 
ATOM   7481  O  OE1 . GLU C  1 299 ? -10.613 -17.167 -39.860 1.00 85.26  ? 299 GLU C OE1 1 
ATOM   7482  O  OE2 . GLU C  1 299 ? -11.847 -15.898 -38.529 1.00 78.89  ? 299 GLU C OE2 1 
ATOM   7483  N  N   . VAL C  1 300 ? -10.974 -14.516 -33.890 1.00 31.31  ? 300 VAL C N   1 
ATOM   7484  C  CA  . VAL C  1 300 ? -10.594 -13.884 -32.639 1.00 29.42  ? 300 VAL C CA  1 
ATOM   7485  C  C   . VAL C  1 300 ? -11.697 -14.054 -31.572 1.00 28.63  ? 300 VAL C C   1 
ATOM   7486  O  O   . VAL C  1 300 ? -11.401 -14.319 -30.390 1.00 28.13  ? 300 VAL C O   1 
ATOM   7487  C  CB  . VAL C  1 300 ? -10.275 -12.403 -32.820 1.00 29.52  ? 300 VAL C CB  1 
ATOM   7488  C  CG1 . VAL C  1 300 ? -10.058 -11.744 -31.470 1.00 30.19  ? 300 VAL C CG1 1 
ATOM   7489  C  CG2 . VAL C  1 300 ? -9.045  -12.231 -33.705 1.00 31.29  ? 300 VAL C CG2 1 
ATOM   7490  N  N   . ILE C  1 301 ? -12.950 -13.908 -31.978 1.00 26.45  ? 301 ILE C N   1 
ATOM   7491  C  CA  A ILE C  1 301 ? -14.033 -14.079 -31.055 0.50 31.08  ? 301 ILE C CA  1 
ATOM   7492  C  CA  B ILE C  1 301 ? -14.068 -14.100 -31.076 0.50 27.40  ? 301 ILE C CA  1 
ATOM   7493  C  C   . ILE C  1 301 ? -14.077 -15.542 -30.552 1.00 29.51  ? 301 ILE C C   1 
ATOM   7494  O  O   . ILE C  1 301 ? -14.340 -15.790 -29.384 1.00 31.98  ? 301 ILE C O   1 
ATOM   7495  C  CB  A ILE C  1 301 ? -15.428 -13.651 -31.672 0.50 31.78  ? 301 ILE C CB  1 
ATOM   7496  C  CB  B ILE C  1 301 ? -15.423 -13.801 -31.776 0.50 24.13  ? 301 ILE C CB  1 
ATOM   7497  C  CG1 A ILE C  1 301 ? -16.112 -14.827 -32.351 0.50 36.19  ? 301 ILE C CG1 1 
ATOM   7498  C  CG1 B ILE C  1 301 ? -15.438 -12.362 -32.345 0.50 23.93  ? 301 ILE C CG1 1 
ATOM   7499  C  CG2 A ILE C  1 301 ? -15.262 -12.459 -32.613 0.50 32.91  ? 301 ILE C CG2 1 
ATOM   7500  C  CG2 B ILE C  1 301 ? -16.586 -14.028 -30.822 0.50 21.97  ? 301 ILE C CG2 1 
ATOM   7501  C  CD1 A ILE C  1 301 ? -16.849 -15.752 -31.384 0.50 40.38  ? 301 ILE C CD1 1 
ATOM   7502  C  CD1 B ILE C  1 301 ? -15.248 -11.283 -31.302 0.50 22.26  ? 301 ILE C CD1 1 
ATOM   7503  N  N   . ALA C  1 302 ? -13.788 -16.496 -31.453 1.00 28.28  ? 302 ALA C N   1 
ATOM   7504  C  CA  . ALA C  1 302 ? -13.738 -17.908 -31.082 1.00 30.31  ? 302 ALA C CA  1 
ATOM   7505  C  C   . ALA C  1 302 ? -12.551 -18.194 -30.138 1.00 29.13  ? 302 ALA C C   1 
ATOM   7506  O  O   . ALA C  1 302 ? -12.619 -19.059 -29.309 1.00 31.06  ? 302 ALA C O   1 
ATOM   7507  C  CB  . ALA C  1 302 ? -13.660 -18.785 -32.320 1.00 24.69  ? 302 ALA C CB  1 
ATOM   7508  N  N   . THR C  1 303 ? -11.490 -17.452 -30.296 1.00 31.43  ? 303 THR C N   1 
ATOM   7509  C  CA  . THR C  1 303 ? -10.327 -17.616 -29.438 1.00 31.19  ? 303 THR C CA  1 
ATOM   7510  C  C   . THR C  1 303 ? -10.632 -17.167 -28.015 1.00 31.14  ? 303 THR C C   1 
ATOM   7511  O  O   . THR C  1 303 ? -10.177 -17.771 -27.057 1.00 34.29  ? 303 THR C O   1 
ATOM   7512  C  CB  . THR C  1 303 ? -9.120  -16.827 -29.967 1.00 31.60  ? 303 THR C CB  1 
ATOM   7513  O  OG1 . THR C  1 303 ? -8.727  -17.354 -31.202 1.00 36.08  ? 303 THR C OG1 1 
ATOM   7514  C  CG2 . THR C  1 303 ? -7.941  -16.919 -28.987 1.00 29.71  ? 303 THR C CG2 1 
ATOM   7515  N  N   . ILE C  1 304 ? -11.407 -16.120 -27.890 1.00 29.61  ? 304 ILE C N   1 
ATOM   7516  C  CA  . ILE C  1 304 ? -11.698 -15.571 -26.615 1.00 27.81  ? 304 ILE C CA  1 
ATOM   7517  C  C   . ILE C  1 304 ? -12.748 -16.393 -25.839 1.00 26.95  ? 304 ILE C C   1 
ATOM   7518  O  O   . ILE C  1 304 ? -12.565 -16.682 -24.665 1.00 26.17  ? 304 ILE C O   1 
ATOM   7519  C  CB  . ILE C  1 304 ? -12.170 -14.099 -26.726 1.00 29.57  ? 304 ILE C CB  1 
ATOM   7520  C  CG1 . ILE C  1 304 ? -11.017 -13.204 -27.182 1.00 27.38  ? 304 ILE C CG1 1 
ATOM   7521  C  CG2 . ILE C  1 304 ? -12.729 -13.613 -25.392 1.00 26.91  ? 304 ILE C CG2 1 
ATOM   7522  C  CD1 . ILE C  1 304 ? -11.434 -11.762 -27.461 1.00 28.34  ? 304 ILE C CD1 1 
ATOM   7523  N  N   . PHE C  1 305 ? -13.836 -16.771 -26.520 1.00 25.52  ? 305 PHE C N   1 
ATOM   7524  C  CA  . PHE C  1 305 ? -14.988 -17.463 -25.856 1.00 27.20  ? 305 PHE C CA  1 
ATOM   7525  C  C   . PHE C  1 305 ? -14.966 -19.031 -25.958 1.00 28.05  ? 305 PHE C C   1 
ATOM   7526  O  O   . PHE C  1 305 ? -15.758 -19.719 -25.281 1.00 27.19  ? 305 PHE C O   1 
ATOM   7527  C  CB  . PHE C  1 305 ? -16.309 -16.923 -26.386 1.00 23.79  ? 305 PHE C CB  1 
ATOM   7528  C  CG  . PHE C  1 305 ? -16.497 -15.510 -26.143 1.00 22.74  ? 305 PHE C CG  1 
ATOM   7529  C  CD1 . PHE C  1 305 ? -16.230 -14.580 -27.136 1.00 21.77  ? 305 PHE C CD1 1 
ATOM   7530  C  CD2 . PHE C  1 305 ? -16.937 -15.052 -24.888 1.00 22.36  ? 305 PHE C CD2 1 
ATOM   7531  C  CE1 . PHE C  1 305 ? -16.404 -13.221 -26.900 1.00 22.65  ? 305 PHE C CE1 1 
ATOM   7532  C  CE2 . PHE C  1 305 ? -17.113 -13.704 -24.651 1.00 20.99  ? 305 PHE C CE2 1 
ATOM   7533  C  CZ  . PHE C  1 305 ? -16.845 -12.782 -25.660 1.00 20.52  ? 305 PHE C CZ  1 
ATOM   7534  N  N   . LYS C  1 306 ? -14.083 -19.565 -26.790 1.00 26.65  ? 306 LYS C N   1 
ATOM   7535  C  CA  . LYS C  1 306 ? -13.955 -21.037 -26.949 1.00 27.94  ? 306 LYS C CA  1 
ATOM   7536  C  C   . LYS C  1 306 ? -12.534 -21.533 -26.618 1.00 29.65  ? 306 LYS C C   1 
ATOM   7537  O  O   . LYS C  1 306 ? -12.352 -22.357 -25.748 1.00 29.93  ? 306 LYS C O   1 
ATOM   7538  C  CB  . LYS C  1 306 ? -14.325 -21.461 -28.352 1.00 31.11  ? 306 LYS C CB  1 
ATOM   7539  C  CG  . LYS C  1 306 ? -15.776 -21.300 -28.692 1.00 34.91  ? 306 LYS C CG  1 
ATOM   7540  C  CD  . LYS C  1 306 ? -16.090 -21.939 -30.060 1.00 40.82  ? 306 LYS C CD  1 
ATOM   7541  C  CE  . LYS C  1 306 ? -17.563 -21.796 -30.413 1.00 46.80  ? 306 LYS C CE  1 
ATOM   7542  N  NZ  . LYS C  1 306 ? -17.879 -22.407 -31.739 1.00 52.05  ? 306 LYS C NZ  1 
ATOM   7543  N  N   . GLU C  1 307 ? -11.551 -21.008 -27.329 1.00 28.62  ? 307 GLU C N   1 
ATOM   7544  C  CA  . GLU C  1 307 ? -10.172 -21.487 -27.212 1.00 31.10  ? 307 GLU C CA  1 
ATOM   7545  C  C   . GLU C  1 307 ? -9.530  -21.178 -25.829 1.00 30.33  ? 307 GLU C C   1 
ATOM   7546  O  O   . GLU C  1 307 ? -8.896  -22.041 -25.224 1.00 30.82  ? 307 GLU C O   1 
ATOM   7547  C  CB  . GLU C  1 307 ? -9.317  -20.913 -28.329 1.00 34.88  ? 307 GLU C CB  1 
ATOM   7548  C  CG  . GLU C  1 307 ? -8.133  -21.743 -28.658 1.00 52.74  ? 307 GLU C CG  1 
ATOM   7549  C  CD  . GLU C  1 307 ? -8.518  -23.182 -29.047 1.00 60.75  ? 307 GLU C CD  1 
ATOM   7550  O  OE1 . GLU C  1 307 ? -9.741  -23.442 -29.279 1.00 67.60  ? 307 GLU C OE1 1 
ATOM   7551  O  OE2 . GLU C  1 307 ? -7.617  -24.040 -29.121 1.00 61.22  ? 307 GLU C OE2 1 
ATOM   7552  N  N   . ASN C  1 308 ? -9.698  -19.955 -25.357 1.00 28.77  ? 308 ASN C N   1 
ATOM   7553  C  CA  . ASN C  1 308 ? -9.121  -19.560 -24.084 1.00 29.20  ? 308 ASN C CA  1 
ATOM   7554  C  C   . ASN C  1 308 ? -9.683  -20.387 -22.871 1.00 26.74  ? 308 ASN C C   1 
ATOM   7555  O  O   . ASN C  1 308 ? -8.924  -20.910 -22.081 1.00 28.10  ? 308 ASN C O   1 
ATOM   7556  C  CB  . ASN C  1 308 ? -9.268  -18.020 -23.852 1.00 27.48  ? 308 ASN C CB  1 
ATOM   7557  C  CG  . ASN C  1 308 ? -8.306  -17.185 -24.759 1.00 31.27  ? 308 ASN C CG  1 
ATOM   7558  O  OD1 . ASN C  1 308 ? -7.415  -17.740 -25.421 1.00 30.88  ? 308 ASN C OD1 1 
ATOM   7559  N  ND2 . ASN C  1 308 ? -8.494  -15.874 -24.774 1.00 30.25  ? 308 ASN C ND2 1 
ATOM   7560  N  N   . PRO C  1 309 ? -11.020 -20.479 -22.757 1.00 26.17  ? 309 PRO C N   1 
ATOM   7561  C  CA  . PRO C  1 309 ? -11.627 -21.336 -21.729 1.00 27.31  ? 309 PRO C CA  1 
ATOM   7562  C  C   . PRO C  1 309 ? -11.127 -22.822 -21.861 1.00 28.78  ? 309 PRO C C   1 
ATOM   7563  O  O   . PRO C  1 309 ? -10.810 -23.457 -20.868 1.00 26.23  ? 309 PRO C O   1 
ATOM   7564  C  CB  . PRO C  1 309 ? -13.108 -21.249 -22.036 1.00 26.75  ? 309 PRO C CB  1 
ATOM   7565  C  CG  . PRO C  1 309 ? -13.274 -19.942 -22.720 1.00 29.53  ? 309 PRO C CG  1 
ATOM   7566  C  CD  . PRO C  1 309 ? -12.028 -19.741 -23.524 1.00 27.81  ? 309 PRO C CD  1 
ATOM   7567  N  N   . LYS C  1 310 ? -11.064 -23.323 -23.102 1.00 30.20  ? 310 LYS C N   1 
ATOM   7568  C  CA  . LYS C  1 310 ? -10.566 -24.656 -23.356 1.00 34.46  ? 310 LYS C CA  1 
ATOM   7569  C  C   . LYS C  1 310 ? -9.154  -24.828 -22.767 1.00 33.52  ? 310 LYS C C   1 
ATOM   7570  O  O   . LYS C  1 310 ? -8.908  -25.737 -22.029 1.00 31.01  ? 310 LYS C O   1 
ATOM   7571  C  CB  . LYS C  1 310 ? -10.552 -24.947 -24.850 1.00 34.58  ? 310 LYS C CB  1 
ATOM   7572  C  CG  . LYS C  1 310 ? -9.947  -26.288 -25.211 1.00 43.41  ? 310 LYS C CG  1 
ATOM   7573  C  CD  . LYS C  1 310 ? -9.771  -26.428 -26.725 1.00 52.92  ? 310 LYS C CD  1 
ATOM   7574  C  CE  . LYS C  1 310 ? -9.150  -27.773 -27.091 1.00 59.78  ? 310 LYS C CE  1 
ATOM   7575  N  NZ  . LYS C  1 310 ? -9.009  -27.938 -28.578 1.00 64.13  ? 310 LYS C NZ  1 
ATOM   7576  N  N   . LYS C  1 311 ? -8.241  -23.913 -23.123 1.00 34.49  ? 311 LYS C N   1 
ATOM   7577  C  CA  . LYS C  1 311 ? -6.860  -23.952 -22.579 1.00 34.93  ? 311 LYS C CA  1 
ATOM   7578  C  C   . LYS C  1 311 ? -6.856  -23.812 -21.055 1.00 30.82  ? 311 LYS C C   1 
ATOM   7579  O  O   . LYS C  1 311 ? -6.243  -24.574 -20.374 1.00 31.31  ? 311 LYS C O   1 
ATOM   7580  C  CB  . LYS C  1 311 ? -5.997  -22.873 -23.216 1.00 40.57  ? 311 LYS C CB  1 
ATOM   7581  C  CG  . LYS C  1 311 ? -5.519  -23.217 -24.635 1.00 51.44  ? 311 LYS C CG  1 
ATOM   7582  C  CD  . LYS C  1 311 ? -4.733  -22.055 -25.269 1.00 58.59  ? 311 LYS C CD  1 
ATOM   7583  C  CE  . LYS C  1 311 ? -5.650  -20.851 -25.567 1.00 69.31  ? 311 LYS C CE  1 
ATOM   7584  N  NZ  . LYS C  1 311 ? -4.929  -19.749 -26.288 1.00 63.52  ? 311 LYS C NZ  1 
ATOM   7585  N  N   . PHE C  1 312 ? -7.558  -22.825 -20.561 1.00 30.67  ? 312 PHE C N   1 
ATOM   7586  C  CA  . PHE C  1 312 ? -7.650  -22.590 -19.118 1.00 29.28  ? 312 PHE C CA  1 
ATOM   7587  C  C   . PHE C  1 312 ? -7.953  -23.905 -18.339 1.00 25.94  ? 312 PHE C C   1 
ATOM   7588  O  O   . PHE C  1 312 ? -7.356  -24.172 -17.292 1.00 26.76  ? 312 PHE C O   1 
ATOM   7589  C  CB  . PHE C  1 312 ? -8.730  -21.519 -18.816 1.00 26.87  ? 312 PHE C CB  1 
ATOM   7590  C  CG  . PHE C  1 312 ? -8.745  -21.046 -17.365 1.00 26.24  ? 312 PHE C CG  1 
ATOM   7591  C  CD1 . PHE C  1 312 ? -9.898  -21.114 -16.615 1.00 25.20  ? 312 PHE C CD1 1 
ATOM   7592  C  CD2 . PHE C  1 312 ? -7.590  -20.534 -16.770 1.00 26.39  ? 312 PHE C CD2 1 
ATOM   7593  C  CE1 . PHE C  1 312 ? -9.915  -20.679 -15.301 1.00 25.54  ? 312 PHE C CE1 1 
ATOM   7594  C  CE2 . PHE C  1 312 ? -7.602  -20.104 -15.457 1.00 26.69  ? 312 PHE C CE2 1 
ATOM   7595  C  CZ  . PHE C  1 312 ? -8.760  -20.173 -14.723 1.00 25.29  ? 312 PHE C CZ  1 
ATOM   7596  N  N   . PHE C  1 313 ? -8.871  -24.699 -18.868 1.00 25.26  ? 313 PHE C N   1 
ATOM   7597  C  CA  . PHE C  1 313 ? -9.289  -25.945 -18.212 1.00 29.95  ? 313 PHE C CA  1 
ATOM   7598  C  C   . PHE C  1 313 ? -8.533  -27.165 -18.722 1.00 33.57  ? 313 PHE C C   1 
ATOM   7599  O  O   . PHE C  1 313 ? -8.959  -28.276 -18.522 1.00 38.16  ? 313 PHE C O   1 
ATOM   7600  C  CB  . PHE C  1 313 ? -10.810 -26.167 -18.389 1.00 25.92  ? 313 PHE C CB  1 
ATOM   7601  C  CG  . PHE C  1 313 ? -11.637 -25.330 -17.513 1.00 26.69  ? 313 PHE C CG  1 
ATOM   7602  C  CD1 . PHE C  1 313 ? -12.307 -24.231 -18.014 1.00 27.12  ? 313 PHE C CD1 1 
ATOM   7603  C  CD2 . PHE C  1 313 ? -11.766 -25.635 -16.139 1.00 26.00  ? 313 PHE C CD2 1 
ATOM   7604  C  CE1 . PHE C  1 313 ? -13.117 -23.418 -17.161 1.00 32.33  ? 313 PHE C CE1 1 
ATOM   7605  C  CE2 . PHE C  1 313 ? -12.556 -24.838 -15.298 1.00 28.88  ? 313 PHE C CE2 1 
ATOM   7606  C  CZ  . PHE C  1 313 ? -13.233 -23.729 -15.816 1.00 25.96  ? 313 PHE C CZ  1 
ATOM   7607  N  N   . SER C  1 314 ? -7.405  -26.936 -19.385 1.00 42.28  ? 314 SER C N   1 
ATOM   7608  C  CA  . SER C  1 314 ? -6.589  -28.054 -19.937 1.00 46.28  ? 314 SER C CA  1 
ATOM   7609  C  C   . SER C  1 314 ? -5.252  -28.185 -19.226 1.00 51.00  ? 314 SER C C   1 
ATOM   7610  O  O   . SER C  1 314 ? -4.903  -27.376 -18.365 1.00 52.20  ? 314 SER C O   1 
ATOM   7611  C  CB  . SER C  1 314 ? -6.373  -27.873 -21.419 1.00 44.62  ? 314 SER C CB  1 
ATOM   7612  O  OG  . SER C  1 314 ? -7.589  -27.994 -22.126 1.00 47.54  ? 314 SER C OG  1 
ATOM   7613  O  OXT . SER C  1 314 ? -4.496  -29.095 -19.494 1.00 56.93  ? 314 SER C OXT 1 
ATOM   7614  N  N   . MET D  1 1   ? -26.819 -11.418 101.306 1.00 75.99  ? 1   MET D N   1 
ATOM   7615  C  CA  . MET D  1 1   ? -26.236 -11.911 102.585 1.00 66.12  ? 1   MET D CA  1 
ATOM   7616  C  C   . MET D  1 1   ? -24.815 -12.536 102.378 1.00 63.96  ? 1   MET D C   1 
ATOM   7617  O  O   . MET D  1 1   ? -23.808 -11.827 102.423 1.00 69.76  ? 1   MET D O   1 
ATOM   7618  C  CB  . MET D  1 1   ? -27.174 -12.917 103.256 1.00 77.56  ? 1   MET D CB  1 
ATOM   7619  C  CG  . MET D  1 1   ? -28.504 -12.312 103.767 1.00 82.96  ? 1   MET D CG  1 
ATOM   7620  S  SD  . MET D  1 1   ? -28.318 -11.349 105.286 1.00 107.81 ? 1   MET D SD  1 
ATOM   7621  C  CE  . MET D  1 1   ? -30.037 -10.955 105.655 1.00 96.08  ? 1   MET D CE  1 
ATOM   7622  N  N   A ARG D  1 2   ? -24.769 -13.860 102.148 0.50 57.17  ? 2   ARG D N   1 
ATOM   7623  N  N   B ARG D  1 2   ? -24.762 -13.879 102.156 0.50 58.36  ? 2   ARG D N   1 
ATOM   7624  C  CA  A ARG D  1 2   ? -23.507 -14.545 101.904 0.50 51.10  ? 2   ARG D CA  1 
ATOM   7625  C  CA  B ARG D  1 2   ? -23.465 -14.604 102.058 0.50 53.16  ? 2   ARG D CA  1 
ATOM   7626  C  C   A ARG D  1 2   ? -23.706 -15.941 101.210 0.50 49.07  ? 2   ARG D C   1 
ATOM   7627  C  C   B ARG D  1 2   ? -23.616 -15.979 101.322 0.50 50.14  ? 2   ARG D C   1 
ATOM   7628  O  O   A ARG D  1 2   ? -23.121 -16.204 100.158 0.50 47.17  ? 2   ARG D O   1 
ATOM   7629  O  O   B ARG D  1 2   ? -22.918 -16.254 100.350 0.50 48.06  ? 2   ARG D O   1 
ATOM   7630  C  CB  A ARG D  1 2   ? -22.706 -14.694 103.202 0.50 53.97  ? 2   ARG D CB  1 
ATOM   7631  C  CB  B ARG D  1 2   ? -22.867 -14.814 103.459 0.50 57.65  ? 2   ARG D CB  1 
ATOM   7632  C  CG  A ARG D  1 2   ? -21.280 -15.120 102.986 0.50 52.92  ? 2   ARG D CG  1 
ATOM   7633  C  CG  B ARG D  1 2   ? -21.353 -15.076 103.489 0.50 55.99  ? 2   ARG D CG  1 
ATOM   7634  C  CD  A ARG D  1 2   ? -20.601 -14.244 101.933 0.50 52.40  ? 2   ARG D CD  1 
ATOM   7635  C  CD  B ARG D  1 2   ? -20.946 -16.170 102.518 0.50 58.58  ? 2   ARG D CD  1 
ATOM   7636  N  NE  A ARG D  1 2   ? -19.266 -14.720 101.605 0.50 52.27  ? 2   ARG D NE  1 
ATOM   7637  N  NE  B ARG D  1 2   ? -20.772 -15.658 101.159 0.50 55.06  ? 2   ARG D NE  1 
ATOM   7638  C  CZ  A ARG D  1 2   ? -18.667 -15.737 102.216 0.50 51.21  ? 2   ARG D CZ  1 
ATOM   7639  C  CZ  B ARG D  1 2   ? -21.002 -14.404 100.801 0.50 54.16  ? 2   ARG D CZ  1 
ATOM   7640  N  NH1 A ARG D  1 2   ? -17.449 -16.106 101.851 0.50 52.50  ? 2   ARG D NH1 1 
ATOM   7641  N  NH1 B ARG D  1 2   ? -20.815 -14.022 99.538  0.50 53.14  ? 2   ARG D NH1 1 
ATOM   7642  N  NH2 A ARG D  1 2   ? -19.288 -16.387 103.197 0.50 46.77  ? 2   ARG D NH2 1 
ATOM   7643  N  NH2 B ARG D  1 2   ? -21.417 -13.534 101.690 0.50 54.83  ? 2   ARG D NH2 1 
ATOM   7644  N  N   . ILE D  1 3   ? -24.535 -16.814 101.818 1.00 43.98  ? 3   ILE D N   1 
ATOM   7645  C  CA  . ILE D  1 3   ? -24.808 -18.167 101.210 1.00 37.10  ? 3   ILE D CA  1 
ATOM   7646  C  C   . ILE D  1 3   ? -26.111 -18.169 100.426 1.00 34.72  ? 3   ILE D C   1 
ATOM   7647  O  O   . ILE D  1 3   ? -27.197 -17.970 101.002 1.00 31.48  ? 3   ILE D O   1 
ATOM   7648  C  CB  . ILE D  1 3   ? -24.848 -19.301 102.282 1.00 36.30  ? 3   ILE D CB  1 
ATOM   7649  C  CG1 . ILE D  1 3   ? -23.584 -19.275 103.153 1.00 42.54  ? 3   ILE D CG1 1 
ATOM   7650  C  CG2 . ILE D  1 3   ? -25.014 -20.653 101.620 1.00 35.29  ? 3   ILE D CG2 1 
ATOM   7651  C  CD1 . ILE D  1 3   ? -22.293 -19.316 102.362 1.00 47.12  ? 3   ILE D CD1 1 
ATOM   7652  N  N   . PRO D  1 4   ? -26.022 -18.398 99.098  1.00 33.71  ? 4   PRO D N   1 
ATOM   7653  C  CA  . PRO D  1 4   ? -27.197 -18.412 98.250  1.00 34.03  ? 4   PRO D CA  1 
ATOM   7654  C  C   . PRO D  1 4   ? -28.062 -19.630 98.516  1.00 33.17  ? 4   PRO D C   1 
ATOM   7655  O  O   . PRO D  1 4   ? -27.539 -20.732 98.725  1.00 28.38  ? 4   PRO D O   1 
ATOM   7656  C  CB  . PRO D  1 4   ? -26.601 -18.482 96.829  1.00 32.65  ? 4   PRO D CB  1 
ATOM   7657  C  CG  . PRO D  1 4   ? -25.305 -19.141 97.008  1.00 30.71  ? 4   PRO D CG  1 
ATOM   7658  C  CD  . PRO D  1 4   ? -24.788 -18.681 98.338  1.00 32.60  ? 4   PRO D CD  1 
ATOM   7659  N  N   . LEU D  1 5   ? -29.379 -19.429 98.516  1.00 34.38  ? 5   LEU D N   1 
ATOM   7660  C  CA  . LEU D  1 5   ? -30.340 -20.516 98.718  1.00 34.69  ? 5   LEU D CA  1 
ATOM   7661  C  C   . LEU D  1 5   ? -31.269 -20.615 97.539  1.00 37.97  ? 5   LEU D C   1 
ATOM   7662  O  O   . LEU D  1 5   ? -31.597 -19.616 96.924  1.00 37.17  ? 5   LEU D O   1 
ATOM   7663  C  CB  . LEU D  1 5   ? -31.156 -20.280 99.990  1.00 34.94  ? 5   LEU D CB  1 
ATOM   7664  C  CG  . LEU D  1 5   ? -30.629 -20.830 101.323 1.00 37.19  ? 5   LEU D CG  1 
ATOM   7665  C  CD1 . LEU D  1 5   ? -29.136 -20.643 101.456 1.00 37.70  ? 5   LEU D CD1 1 
ATOM   7666  C  CD2 . LEU D  1 5   ? -31.380 -20.176 102.503 1.00 35.78  ? 5   LEU D CD2 1 
ATOM   7667  N  N   . VAL D  1 6   ? -31.702 -21.839 97.221  1.00 35.05  ? 6   VAL D N   1 
ATOM   7668  C  CA  . VAL D  1 6   ? -32.626 -22.046 96.145  1.00 34.48  ? 6   VAL D CA  1 
ATOM   7669  C  C   . VAL D  1 6   ? -34.011 -21.531 96.519  1.00 35.87  ? 6   VAL D C   1 
ATOM   7670  O  O   . VAL D  1 6   ? -34.600 -21.979 97.494  1.00 33.74  ? 6   VAL D O   1 
ATOM   7671  C  CB  . VAL D  1 6   ? -32.735 -23.540 95.766  1.00 34.38  ? 6   VAL D CB  1 
ATOM   7672  C  CG1 . VAL D  1 6   ? -33.787 -23.736 94.668  1.00 33.53  ? 6   VAL D CG1 1 
ATOM   7673  C  CG2 . VAL D  1 6   ? -31.377 -24.079 95.320  1.00 33.66  ? 6   VAL D CG2 1 
ATOM   7674  N  N   . GLY D  1 7   ? -34.527 -20.573 95.726  1.00 35.40  ? 7   GLY D N   1 
ATOM   7675  C  CA  . GLY D  1 7   ? -35.896 -20.019 95.952  1.00 33.64  ? 7   GLY D CA  1 
ATOM   7676  C  C   . GLY D  1 7   ? -36.021 -19.180 97.238  1.00 37.60  ? 7   GLY D C   1 
ATOM   7677  O  O   . GLY D  1 7   ? -37.133 -18.973 97.754  1.00 39.15  ? 7   GLY D O   1 
ATOM   7678  N  N   . LYS D  1 8   ? -34.885 -18.700 97.748  1.00 36.32  ? 8   LYS D N   1 
ATOM   7679  C  CA  . LYS D  1 8   ? -34.871 -17.878 98.986  1.00 37.82  ? 8   LYS D CA  1 
ATOM   7680  C  C   . LYS D  1 8   ? -33.842 -16.808 98.925  1.00 38.71  ? 8   LYS D C   1 
ATOM   7681  O  O   . LYS D  1 8   ? -32.881 -16.888 98.130  1.00 35.11  ? 8   LYS D O   1 
ATOM   7682  C  CB  . LYS D  1 8   ? -34.594 -18.762 100.229 1.00 36.88  ? 8   LYS D CB  1 
ATOM   7683  C  CG  . LYS D  1 8   ? -35.754 -19.578 100.700 1.00 36.56  ? 8   LYS D CG  1 
ATOM   7684  C  CD  . LYS D  1 8   ? -35.406 -20.297 102.010 1.00 34.37  ? 8   LYS D CD  1 
ATOM   7685  C  CE  . LYS D  1 8   ? -36.591 -21.041 102.565 1.00 34.13  ? 8   LYS D CE  1 
ATOM   7686  N  NZ  . LYS D  1 8   ? -36.206 -21.879 103.719 1.00 36.67  ? 8   LYS D NZ  1 
ATOM   7687  N  N   . ASP D  1 9   ? -34.012 -15.782 99.769  1.00 40.10  ? 9   ASP D N   1 
ATOM   7688  C  CA  . ASP D  1 9   ? -33.005 -14.796 99.952  1.00 43.14  ? 9   ASP D CA  1 
ATOM   7689  C  C   . ASP D  1 9   ? -31.743 -15.453 100.481 1.00 42.72  ? 9   ASP D C   1 
ATOM   7690  O  O   . ASP D  1 9   ? -31.809 -16.476 101.245 1.00 44.01  ? 9   ASP D O   1 
ATOM   7691  C  CB  . ASP D  1 9   ? -33.472 -13.729 100.945 1.00 48.96  ? 9   ASP D CB  1 
ATOM   7692  C  CG  . ASP D  1 9   ? -34.319 -12.675 100.306 1.00 57.09  ? 9   ASP D CG  1 
ATOM   7693  O  OD1 . ASP D  1 9   ? -34.934 -11.878 101.049 1.00 63.20  ? 9   ASP D OD1 1 
ATOM   7694  O  OD2 . ASP D  1 9   ? -34.376 -12.628 99.063  1.00 56.88  ? 9   ASP D OD2 1 
ATOM   7695  N  N   . SER D  1 10  ? -30.610 -14.910 100.107 1.00 40.14  ? 10  SER D N   1 
ATOM   7696  C  CA  . SER D  1 10  ? -29.359 -15.375 100.589 1.00 40.49  ? 10  SER D CA  1 
ATOM   7697  C  C   . SER D  1 10  ? -29.302 -15.247 102.157 1.00 42.33  ? 10  SER D C   1 
ATOM   7698  O  O   . SER D  1 10  ? -29.980 -14.395 102.746 1.00 42.13  ? 10  SER D O   1 
ATOM   7699  C  CB  . SER D  1 10  ? -28.231 -14.578 99.954  1.00 43.20  ? 10  SER D CB  1 
ATOM   7700  O  OG  . SER D  1 10  ? -26.988 -15.014 100.406 1.00 59.91  ? 10  SER D OG  1 
ATOM   7701  N  N   . ILE D  1 11  ? -28.506 -16.091 102.794 1.00 39.23  ? 11  ILE D N   1 
ATOM   7702  C  CA  . ILE D  1 11  ? -28.366 -16.055 104.284 1.00 39.75  ? 11  ILE D CA  1 
ATOM   7703  C  C   . ILE D  1 11  ? -26.948 -15.974 104.684 1.00 40.49  ? 11  ILE D C   1 
ATOM   7704  O  O   . ILE D  1 11  ? -26.060 -16.273 103.902 1.00 42.29  ? 11  ILE D O   1 
ATOM   7705  C  CB  . ILE D  1 11  ? -28.985 -17.296 104.946 1.00 42.44  ? 11  ILE D CB  1 
ATOM   7706  C  CG1 . ILE D  1 11  ? -28.221 -18.582 104.514 1.00 39.62  ? 11  ILE D CG1 1 
ATOM   7707  C  CG2 . ILE D  1 11  ? -30.473 -17.397 104.617 1.00 40.91  ? 11  ILE D CG2 1 
ATOM   7708  C  CD1 . ILE D  1 11  ? -28.565 -19.809 105.344 1.00 39.09  ? 11  ILE D CD1 1 
ATOM   7709  N  N   . GLU D  1 12  ? -26.714 -15.559 105.918 1.00 44.00  ? 12  GLU D N   1 
ATOM   7710  C  CA  . GLU D  1 12  ? -25.379 -15.517 106.457 1.00 43.44  ? 12  GLU D CA  1 
ATOM   7711  C  C   . GLU D  1 12  ? -25.011 -16.895 107.106 1.00 38.45  ? 12  GLU D C   1 
ATOM   7712  O  O   . GLU D  1 12  ? -25.866 -17.560 107.704 1.00 36.73  ? 12  GLU D O   1 
ATOM   7713  C  CB  . GLU D  1 12  ? -25.248 -14.380 107.460 1.00 47.10  ? 12  GLU D CB  1 
ATOM   7714  C  CG  . GLU D  1 12  ? -25.616 -12.999 106.863 1.00 52.88  ? 12  GLU D CG  1 
ATOM   7715  C  CD  . GLU D  1 12  ? -25.395 -11.858 107.825 1.00 58.37  ? 12  GLU D CD  1 
ATOM   7716  O  OE1 . GLU D  1 12  ? -24.692 -12.057 108.842 1.00 58.52  ? 12  GLU D OE1 1 
ATOM   7717  O  OE2 . GLU D  1 12  ? -25.929 -10.737 107.561 1.00 62.07  ? 12  GLU D OE2 1 
ATOM   7718  N  N   . SER D  1 13  ? -23.757 -17.298 106.968 1.00 36.87  ? 13  SER D N   1 
ATOM   7719  C  CA  . SER D  1 13  ? -23.318 -18.627 107.446 1.00 41.90  ? 13  SER D CA  1 
ATOM   7720  C  C   . SER D  1 13  ? -23.765 -18.905 108.904 1.00 39.92  ? 13  SER D C   1 
ATOM   7721  O  O   . SER D  1 13  ? -24.107 -20.018 109.248 1.00 37.00  ? 13  SER D O   1 
ATOM   7722  C  CB  . SER D  1 13  ? -21.792 -18.785 107.305 1.00 42.19  ? 13  SER D CB  1 
ATOM   7723  O  OG  . SER D  1 13  ? -21.116 -17.848 108.077 1.00 42.82  ? 13  SER D OG  1 
ATOM   7724  N  N   . LYS D  1 14  ? -23.757 -17.873 109.723 1.00 39.44  ? 14  LYS D N   1 
ATOM   7725  C  CA  . LYS D  1 14  ? -24.129 -17.998 111.107 1.00 42.14  ? 14  LYS D CA  1 
ATOM   7726  C  C   . LYS D  1 14  ? -25.576 -18.485 111.253 1.00 41.86  ? 14  LYS D C   1 
ATOM   7727  O  O   . LYS D  1 14  ? -25.986 -18.905 112.319 1.00 40.61  ? 14  LYS D O   1 
ATOM   7728  C  CB  . LYS D  1 14  ? -23.946 -16.629 111.844 1.00 46.99  ? 14  LYS D CB  1 
ATOM   7729  C  CG  . LYS D  1 14  ? -24.967 -15.530 111.404 1.00 53.16  ? 14  LYS D CG  1 
ATOM   7730  C  CD  . LYS D  1 14  ? -24.447 -14.101 111.716 1.00 61.94  ? 14  LYS D CD  1 
ATOM   7731  C  CE  . LYS D  1 14  ? -24.136 -13.927 113.194 1.00 64.92  ? 14  LYS D CE  1 
ATOM   7732  N  NZ  . LYS D  1 14  ? -25.348 -14.059 114.031 1.00 73.66  ? 14  LYS D NZ  1 
ATOM   7733  N  N   . ASP D  1 15  ? -26.337 -18.419 110.160 1.00 38.45  ? 15  ASP D N   1 
ATOM   7734  C  CA  . ASP D  1 15  ? -27.773 -18.761 110.197 1.00 37.25  ? 15  ASP D CA  1 
ATOM   7735  C  C   . ASP D  1 15  ? -28.084 -20.098 109.517 1.00 36.37  ? 15  ASP D C   1 
ATOM   7736  O  O   . ASP D  1 15  ? -29.252 -20.464 109.354 1.00 36.67  ? 15  ASP D O   1 
ATOM   7737  C  CB  . ASP D  1 15  ? -28.602 -17.643 109.552 1.00 36.22  ? 15  ASP D CB  1 
ATOM   7738  C  CG  . ASP D  1 15  ? -28.572 -16.350 110.360 1.00 43.14  ? 15  ASP D CG  1 
ATOM   7739  O  OD1 . ASP D  1 15  ? -28.547 -16.423 111.604 1.00 45.58  ? 15  ASP D OD1 1 
ATOM   7740  O  OD2 . ASP D  1 15  ? -28.580 -15.280 109.753 1.00 47.90  ? 15  ASP D OD2 1 
ATOM   7741  N  N   A ILE D  1 16  ? -27.039 -20.822 109.124 0.50 35.47  ? 16  ILE D N   1 
ATOM   7742  N  N   B ILE D  1 16  ? -27.048 -20.813 109.127 0.50 35.50  ? 16  ILE D N   1 
ATOM   7743  C  CA  A ILE D  1 16  ? -27.214 -22.127 108.438 0.50 35.81  ? 16  ILE D CA  1 
ATOM   7744  C  CA  B ILE D  1 16  ? -27.214 -22.085 108.435 0.50 35.79  ? 16  ILE D CA  1 
ATOM   7745  C  C   A ILE D  1 16  ? -27.871 -23.191 109.352 0.50 34.88  ? 16  ILE D C   1 
ATOM   7746  C  C   B ILE D  1 16  ? -27.898 -23.159 109.350 0.50 34.89  ? 16  ILE D C   1 
ATOM   7747  O  O   A ILE D  1 16  ? -28.627 -24.057 108.879 0.50 32.58  ? 16  ILE D O   1 
ATOM   7748  O  O   B ILE D  1 16  ? -28.692 -23.990 108.874 0.50 32.49  ? 16  ILE D O   1 
ATOM   7749  C  CB  A ILE D  1 16  ? -25.876 -22.666 107.865 0.50 34.86  ? 16  ILE D CB  1 
ATOM   7750  C  CB  B ILE D  1 16  ? -25.865 -22.623 107.913 0.50 34.65  ? 16  ILE D CB  1 
ATOM   7751  C  CG1 A ILE D  1 16  ? -24.801 -22.734 108.962 0.50 38.12  ? 16  ILE D CG1 1 
ATOM   7752  C  CG1 B ILE D  1 16  ? -26.088 -23.665 106.834 0.50 33.96  ? 16  ILE D CG1 1 
ATOM   7753  C  CG2 A ILE D  1 16  ? -25.404 -21.795 106.731 0.50 35.78  ? 16  ILE D CG2 1 
ATOM   7754  C  CG2 B ILE D  1 16  ? -25.034 -23.192 109.059 0.50 39.24  ? 16  ILE D CG2 1 
ATOM   7755  C  CD1 A ILE D  1 16  ? -25.086 -23.757 110.056 0.50 36.09  ? 16  ILE D CD1 1 
ATOM   7756  C  CD1 B ILE D  1 16  ? -24.810 -24.116 106.154 0.50 32.90  ? 16  ILE D CD1 1 
ATOM   7757  N  N   . GLY D  1 17  ? -27.586 -23.115 110.643 1.00 33.18  ? 17  GLY D N   1 
ATOM   7758  C  CA  . GLY D  1 17  ? -28.159 -24.070 111.615 1.00 33.58  ? 17  GLY D CA  1 
ATOM   7759  C  C   . GLY D  1 17  ? -27.733 -25.531 111.334 1.00 35.36  ? 17  GLY D C   1 
ATOM   7760  O  O   . GLY D  1 17  ? -26.732 -25.785 110.611 1.00 32.79  ? 17  GLY D O   1 
ATOM   7761  N  N   . PHE D  1 18  ? -28.481 -26.484 111.897 1.00 32.75  ? 18  PHE D N   1 
ATOM   7762  C  CA  . PHE D  1 18  ? -28.174 -27.890 111.713 1.00 32.10  ? 18  PHE D CA  1 
ATOM   7763  C  C   . PHE D  1 18  ? -28.198 -28.248 110.216 1.00 29.67  ? 18  PHE D C   1 
ATOM   7764  O  O   . PHE D  1 18  ? -29.245 -28.140 109.551 1.00 28.48  ? 18  PHE D O   1 
ATOM   7765  C  CB  . PHE D  1 18  ? -29.156 -28.765 112.490 1.00 32.77  ? 18  PHE D CB  1 
ATOM   7766  C  CG  . PHE D  1 18  ? -28.705 -30.180 112.646 1.00 34.36  ? 18  PHE D CG  1 
ATOM   7767  C  CD1 . PHE D  1 18  ? -28.287 -30.657 113.880 1.00 35.64  ? 18  PHE D CD1 1 
ATOM   7768  C  CD2 . PHE D  1 18  ? -28.685 -31.050 111.547 1.00 33.27  ? 18  PHE D CD2 1 
ATOM   7769  C  CE1 . PHE D  1 18  ? -27.865 -31.974 114.027 1.00 35.96  ? 18  PHE D CE1 1 
ATOM   7770  C  CE2 . PHE D  1 18  ? -28.264 -32.365 111.688 1.00 34.71  ? 18  PHE D CE2 1 
ATOM   7771  C  CZ  . PHE D  1 18  ? -27.854 -32.828 112.927 1.00 36.66  ? 18  PHE D CZ  1 
ATOM   7772  N  N   . THR D  1 19  ? -27.049 -28.678 109.700 1.00 28.63  ? 19  THR D N   1 
ATOM   7773  C  CA  . THR D  1 19  ? -26.877 -28.873 108.287 1.00 29.78  ? 19  THR D CA  1 
ATOM   7774  C  C   . THR D  1 19  ? -26.524 -30.350 107.886 1.00 31.75  ? 19  THR D C   1 
ATOM   7775  O  O   . THR D  1 19  ? -25.703 -31.014 108.549 1.00 28.77  ? 19  THR D O   1 
ATOM   7776  C  CB  . THR D  1 19  ? -25.757 -27.956 107.745 1.00 30.93  ? 19  THR D CB  1 
ATOM   7777  O  OG1 . THR D  1 19  ? -26.099 -26.597 107.970 1.00 37.22  ? 19  THR D OG1 1 
ATOM   7778  C  CG2 . THR D  1 19  ? -25.540 -28.192 106.240 1.00 28.88  ? 19  THR D CG2 1 
ATOM   7779  N  N   . LEU D  1 20  ? -27.163 -30.842 106.785 1.00 29.61  ? 20  LEU D N   1 
ATOM   7780  C  CA  . LEU D  1 20  ? -26.723 -32.074 106.123 1.00 26.86  ? 20  LEU D CA  1 
ATOM   7781  C  C   . LEU D  1 20  ? -25.927 -31.675 104.923 1.00 27.69  ? 20  LEU D C   1 
ATOM   7782  O  O   . LEU D  1 20  ? -26.477 -31.154 103.936 1.00 26.83  ? 20  LEU D O   1 
ATOM   7783  C  CB  . LEU D  1 20  ? -27.905 -32.931 105.713 1.00 26.30  ? 20  LEU D CB  1 
ATOM   7784  C  CG  . LEU D  1 20  ? -28.748 -33.544 106.843 1.00 26.58  ? 20  LEU D CG  1 
ATOM   7785  C  CD1 . LEU D  1 20  ? -29.863 -34.407 106.267 1.00 23.87  ? 20  LEU D CD1 1 
ATOM   7786  C  CD2 . LEU D  1 20  ? -27.886 -34.348 107.787 1.00 25.92  ? 20  LEU D CD2 1 
ATOM   7787  N  N   . ILE D  1 21  ? -24.646 -31.906 104.983 1.00 25.45  ? 21  ILE D N   1 
ATOM   7788  C  CA  . ILE D  1 21  ? -23.719 -31.340 104.022 1.00 26.04  ? 21  ILE D CA  1 
ATOM   7789  C  C   . ILE D  1 21  ? -23.681 -32.063 102.614 1.00 28.14  ? 21  ILE D C   1 
ATOM   7790  O  O   . ILE D  1 21  ? -23.084 -31.540 101.658 1.00 27.80  ? 21  ILE D O   1 
ATOM   7791  C  CB  . ILE D  1 21  ? -22.281 -31.293 104.598 1.00 27.67  ? 21  ILE D CB  1 
ATOM   7792  C  CG1 . ILE D  1 21  ? -21.416 -30.326 103.799 1.00 27.88  ? 21  ILE D CG1 1 
ATOM   7793  C  CG2 . ILE D  1 21  ? -21.668 -32.692 104.630 1.00 28.36  ? 21  ILE D CG2 1 
ATOM   7794  C  CD1 . ILE D  1 21  ? -21.744 -28.865 104.051 1.00 27.46  ? 21  ILE D CD1 1 
ATOM   7795  N  N   . HIS D  1 22  ? -24.301 -33.227 102.512 1.00 24.50  ? 22  HIS D N   1 
ATOM   7796  C  CA  . HIS D  1 22  ? -24.223 -34.016 101.246 1.00 23.75  ? 22  HIS D CA  1 
ATOM   7797  C  C   . HIS D  1 22  ? -25.403 -34.920 101.069 1.00 21.99  ? 22  HIS D C   1 
ATOM   7798  O  O   . HIS D  1 22  ? -25.393 -36.057 101.506 1.00 20.39  ? 22  HIS D O   1 
ATOM   7799  C  CB  . HIS D  1 22  ? -22.906 -34.829 101.201 1.00 21.32  ? 22  HIS D CB  1 
ATOM   7800  C  CG  . HIS D  1 22  ? -22.570 -35.411 99.806  1.00 24.05  ? 22  HIS D CG  1 
ATOM   7801  N  ND1 . HIS D  1 22  ? -21.324 -35.338 99.261  1.00 22.01  ? 22  HIS D ND1 1 
ATOM   7802  C  CD2 . HIS D  1 22  ? -23.375 -36.093 98.855  1.00 22.49  ? 22  HIS D CD2 1 
ATOM   7803  C  CE1 . HIS D  1 22  ? -21.327 -35.939 98.027  1.00 22.72  ? 22  HIS D CE1 1 
ATOM   7804  N  NE2 . HIS D  1 22  ? -22.567 -36.394 97.780  1.00 24.78  ? 22  HIS D NE2 1 
ATOM   7805  N  N   . GLU D  1 23  ? -26.429 -34.407 100.432 1.00 22.85  ? 23  GLU D N   1 
ATOM   7806  C  CA  . GLU D  1 23  ? -27.579 -35.180 100.110 1.00 25.15  ? 23  GLU D CA  1 
ATOM   7807  C  C   . GLU D  1 23  ? -28.056 -34.808 98.687  1.00 27.68  ? 23  GLU D C   1 
ATOM   7808  O  O   . GLU D  1 23  ? -27.749 -33.720 98.189  1.00 31.25  ? 23  GLU D O   1 
ATOM   7809  C  CB  . GLU D  1 23  ? -28.713 -34.927 101.136 1.00 25.61  ? 23  GLU D CB  1 
ATOM   7810  C  CG  . GLU D  1 23  ? -28.255 -34.973 102.650 1.00 25.91  ? 23  GLU D CG  1 
ATOM   7811  C  CD  . GLU D  1 23  ? -27.927 -36.400 103.138 1.00 30.24  ? 23  GLU D CD  1 
ATOM   7812  O  OE1 . GLU D  1 23  ? -27.270 -36.534 104.221 1.00 30.95  ? 23  GLU D OE1 1 
ATOM   7813  O  OE2 . GLU D  1 23  ? -28.323 -37.388 102.445 1.00 29.26  ? 23  GLU D OE2 1 
ATOM   7814  N  N   . HIS D  1 24  ? -28.799 -35.718 98.047  1.00 25.29  ? 24  HIS D N   1 
ATOM   7815  C  CA  . HIS D  1 24  ? -29.331 -35.476 96.688  1.00 24.50  ? 24  HIS D CA  1 
ATOM   7816  C  C   . HIS D  1 24  ? -30.809 -35.616 96.676  1.00 27.60  ? 24  HIS D C   1 
ATOM   7817  O  O   . HIS D  1 24  ? -31.331 -36.624 97.080  1.00 26.72  ? 24  HIS D O   1 
ATOM   7818  C  CB  . HIS D  1 24  ? -28.727 -36.483 95.674  1.00 21.70  ? 24  HIS D CB  1 
ATOM   7819  C  CG  . HIS D  1 24  ? -27.188 -36.471 95.614  1.00 21.69  ? 24  HIS D CG  1 
ATOM   7820  N  ND1 . HIS D  1 24  ? -26.488 -35.651 94.772  1.00 19.75  ? 24  HIS D ND1 1 
ATOM   7821  C  CD2 . HIS D  1 24  ? -26.230 -37.221 96.314  1.00 21.35  ? 24  HIS D CD2 1 
ATOM   7822  C  CE1 . HIS D  1 24  ? -25.159 -35.866 94.938  1.00 19.87  ? 24  HIS D CE1 1 
ATOM   7823  N  NE2 . HIS D  1 24  ? -24.997 -36.819 95.873  1.00 20.62  ? 24  HIS D NE2 1 
ATOM   7824  N  N   . LEU D  1 25  ? -31.507 -34.591 96.198  1.00 25.07  ? 25  LEU D N   1 
ATOM   7825  C  CA  . LEU D  1 25  ? -32.947 -34.691 96.033  1.00 28.32  ? 25  LEU D CA  1 
ATOM   7826  C  C   . LEU D  1 25  ? -33.267 -35.657 94.904  1.00 29.94  ? 25  LEU D C   1 
ATOM   7827  O  O   . LEU D  1 25  ? -34.243 -36.403 94.967  1.00 29.70  ? 25  LEU D O   1 
ATOM   7828  C  CB  . LEU D  1 25  ? -33.555 -33.331 95.744  1.00 30.28  ? 25  LEU D CB  1 
ATOM   7829  C  CG  . LEU D  1 25  ? -33.394 -32.275 96.847  1.00 29.26  ? 25  LEU D CG  1 
ATOM   7830  C  CD1 . LEU D  1 25  ? -34.004 -30.959 96.412  1.00 30.80  ? 25  LEU D CD1 1 
ATOM   7831  C  CD2 . LEU D  1 25  ? -34.020 -32.750 98.117  1.00 29.77  ? 25  LEU D CD2 1 
ATOM   7832  N  N   . ARG D  1 26  ? -32.417 -35.646 93.860  1.00 28.51  ? 26  ARG D N   1 
ATOM   7833  C  CA  . ARG D  1 26  ? -32.617 -36.500 92.683  1.00 27.88  ? 26  ARG D CA  1 
ATOM   7834  C  C   . ARG D  1 26  ? -31.364 -36.581 91.867  1.00 28.65  ? 26  ARG D C   1 
ATOM   7835  O  O   . ARG D  1 26  ? -30.689 -35.564 91.640  1.00 32.12  ? 26  ARG D O   1 
ATOM   7836  C  CB  . ARG D  1 26  ? -33.770 -35.954 91.803  1.00 25.06  ? 26  ARG D CB  1 
ATOM   7837  C  CG  . ARG D  1 26  ? -34.113 -36.850 90.601  1.00 26.11  ? 26  ARG D CG  1 
ATOM   7838  C  CD  . ARG D  1 26  ? -35.265 -36.273 89.777  1.00 27.25  ? 26  ARG D CD  1 
ATOM   7839  N  NE  . ARG D  1 26  ? -34.910 -34.963 89.149  1.00 28.25  ? 26  ARG D NE  1 
ATOM   7840  C  CZ  . ARG D  1 26  ? -35.726 -34.267 88.368  1.00 28.67  ? 26  ARG D CZ  1 
ATOM   7841  N  NH1 . ARG D  1 26  ? -36.946 -34.724 88.106  1.00 30.18  ? 26  ARG D NH1 1 
ATOM   7842  N  NH2 . ARG D  1 26  ? -35.331 -33.118 87.853  1.00 29.12  ? 26  ARG D NH2 1 
ATOM   7843  N  N   . VAL D  1 27  ? -31.041 -37.782 91.408  1.00 25.79  ? 27  VAL D N   1 
ATOM   7844  C  CA  . VAL D  1 27  ? -29.860 -37.997 90.582  1.00 28.26  ? 27  VAL D CA  1 
ATOM   7845  C  C   . VAL D  1 27  ? -30.208 -38.784 89.298  1.00 29.08  ? 27  VAL D C   1 
ATOM   7846  O  O   . VAL D  1 27  ? -30.889 -39.783 89.352  1.00 27.94  ? 27  VAL D O   1 
ATOM   7847  C  CB  . VAL D  1 27  ? -28.756 -38.755 91.359  1.00 26.65  ? 27  VAL D CB  1 
ATOM   7848  C  CG1 . VAL D  1 27  ? -27.702 -39.259 90.415  1.00 28.07  ? 27  VAL D CG1 1 
ATOM   7849  C  CG2 . VAL D  1 27  ? -28.131 -37.846 92.423  1.00 25.40  ? 27  VAL D CG2 1 
ATOM   7850  N  N   . PHE D  1 28  ? -29.720 -38.303 88.149  1.00 27.93  ? 28  PHE D N   1 
ATOM   7851  C  CA  . PHE D  1 28  ? -29.906 -39.024 86.885  1.00 26.92  ? 28  PHE D CA  1 
ATOM   7852  C  C   . PHE D  1 28  ? -28.862 -38.662 85.872  1.00 25.16  ? 28  PHE D C   1 
ATOM   7853  O  O   . PHE D  1 28  ? -28.212 -37.627 85.984  1.00 24.40  ? 28  PHE D O   1 
ATOM   7854  C  CB  . PHE D  1 28  ? -31.370 -38.782 86.297  1.00 26.71  ? 28  PHE D CB  1 
ATOM   7855  C  CG  . PHE D  1 28  ? -31.653 -37.316 85.897  1.00 27.74  ? 28  PHE D CG  1 
ATOM   7856  C  CD1 . PHE D  1 28  ? -31.190 -36.801 84.661  1.00 26.01  ? 28  PHE D CD1 1 
ATOM   7857  C  CD2 . PHE D  1 28  ? -32.385 -36.469 86.743  1.00 25.50  ? 28  PHE D CD2 1 
ATOM   7858  C  CE1 . PHE D  1 28  ? -31.453 -35.455 84.291  1.00 25.38  ? 28  PHE D CE1 1 
ATOM   7859  C  CE2 . PHE D  1 28  ? -32.645 -35.136 86.376  1.00 26.74  ? 28  PHE D CE2 1 
ATOM   7860  C  CZ  . PHE D  1 28  ? -32.170 -34.634 85.138  1.00 27.03  ? 28  PHE D CZ  1 
ATOM   7861  N  N   . SER D  1 29  ? -28.685 -39.533 84.866  1.00 23.85  ? 29  SER D N   1 
ATOM   7862  C  CA  . SER D  1 29  ? -27.803 -39.246 83.746  1.00 27.27  ? 29  SER D CA  1 
ATOM   7863  C  C   . SER D  1 29  ? -28.521 -38.331 82.740  1.00 28.03  ? 29  SER D C   1 
ATOM   7864  O  O   . SER D  1 29  ? -29.564 -38.712 82.164  1.00 27.46  ? 29  SER D O   1 
ATOM   7865  C  CB  . SER D  1 29  ? -27.373 -40.543 83.052  1.00 30.76  ? 29  SER D CB  1 
ATOM   7866  O  OG  . SER D  1 29  ? -26.699 -41.443 83.978  1.00 39.61  ? 29  SER D OG  1 
ATOM   7867  N  N   . GLU D  1 30  ? -27.981 -37.134 82.529  1.00 24.45  ? 30  GLU D N   1 
ATOM   7868  C  CA  . GLU D  1 30  ? -28.632 -36.156 81.627  1.00 25.54  ? 30  GLU D CA  1 
ATOM   7869  C  C   . GLU D  1 30  ? -28.973 -36.767 80.256  1.00 25.13  ? 30  GLU D C   1 
ATOM   7870  O  O   . GLU D  1 30  ? -30.120 -36.635 79.765  1.00 26.16  ? 30  GLU D O   1 
ATOM   7871  C  CB  . GLU D  1 30  ? -27.766 -34.908 81.442  1.00 25.46  ? 30  GLU D CB  1 
ATOM   7872  C  CG  . GLU D  1 30  ? -27.739 -33.980 82.634  1.00 30.16  ? 30  GLU D CG  1 
ATOM   7873  C  CD  . GLU D  1 30  ? -26.596 -34.288 83.605  1.00 29.98  ? 30  GLU D CD  1 
ATOM   7874  O  OE1 . GLU D  1 30  ? -26.068 -35.450 83.591  1.00 31.81  ? 30  GLU D OE1 1 
ATOM   7875  O  OE2 . GLU D  1 30  ? -26.230 -33.399 84.361  1.00 31.03  ? 30  GLU D OE2 1 
ATOM   7876  N  N   . ALA D  1 31  ? -27.984 -37.442 79.640  1.00 21.12  ? 31  ALA D N   1 
ATOM   7877  C  CA  . ALA D  1 31  ? -28.152 -38.000 78.277  1.00 23.24  ? 31  ALA D CA  1 
ATOM   7878  C  C   . ALA D  1 31  ? -29.195 -39.049 78.217  1.00 23.96  ? 31  ALA D C   1 
ATOM   7879  O  O   . ALA D  1 31  ? -29.963 -39.102 77.274  1.00 28.06  ? 31  ALA D O   1 
ATOM   7880  C  CB  . ALA D  1 31  ? -26.811 -38.542 77.739  1.00 22.21  ? 31  ALA D CB  1 
ATOM   7881  N  N   . VAL D  1 32  ? -29.231 -39.913 79.224  1.00 23.58  ? 32  VAL D N   1 
ATOM   7882  C  CA  . VAL D  1 32  ? -30.213 -41.011 79.247  1.00 22.52  ? 32  VAL D CA  1 
ATOM   7883  C  C   . VAL D  1 32  ? -31.654 -40.472 79.414  1.00 23.34  ? 32  VAL D C   1 
ATOM   7884  O  O   . VAL D  1 32  ? -32.535 -40.859 78.706  1.00 23.95  ? 32  VAL D O   1 
ATOM   7885  C  CB  . VAL D  1 32  ? -29.910 -42.036 80.359  1.00 22.83  ? 32  VAL D CB  1 
ATOM   7886  C  CG1 . VAL D  1 32  ? -31.005 -43.153 80.387  1.00 20.54  ? 32  VAL D CG1 1 
ATOM   7887  C  CG2 . VAL D  1 32  ? -28.541 -42.634 80.166  1.00 20.34  ? 32  VAL D CG2 1 
ATOM   7888  N  N   . ARG D  1 33  ? -31.847 -39.567 80.368  1.00 23.78  ? 33  ARG D N   1 
ATOM   7889  C  CA  . ARG D  1 33  ? -33.182 -38.979 80.600  1.00 26.94  ? 33  ARG D CA  1 
ATOM   7890  C  C   . ARG D  1 33  ? -33.666 -38.188 79.367  1.00 27.80  ? 33  ARG D C   1 
ATOM   7891  O  O   . ARG D  1 33  ? -34.826 -38.250 78.997  1.00 26.60  ? 33  ARG D O   1 
ATOM   7892  C  CB  . ARG D  1 33  ? -33.176 -38.087 81.824  1.00 28.05  ? 33  ARG D CB  1 
ATOM   7893  C  CG  . ARG D  1 33  ? -34.566 -37.481 82.161  1.00 30.44  ? 33  ARG D CG  1 
ATOM   7894  C  CD  . ARG D  1 33  ? -34.672 -37.161 83.625  1.00 29.80  ? 33  ARG D CD  1 
ATOM   7895  N  NE  . ARG D  1 33  ? -36.051 -36.942 84.044  1.00 30.45  ? 33  ARG D NE  1 
ATOM   7896  C  CZ  . ARG D  1 33  ? -36.478 -37.100 85.281  1.00 33.51  ? 33  ARG D CZ  1 
ATOM   7897  N  NH1 . ARG D  1 33  ? -35.628 -37.492 86.232  1.00 30.08  ? 33  ARG D NH1 1 
ATOM   7898  N  NH2 . ARG D  1 33  ? -37.770 -36.876 85.586  1.00 32.34  ? 33  ARG D NH2 1 
ATOM   7899  N  N   . GLN D  1 34  ? -32.770 -37.477 78.763  1.00 26.61  ? 34  GLN D N   1 
ATOM   7900  C  CA  . GLN D  1 34  ? -33.085 -36.683 77.631  1.00 30.31  ? 34  GLN D CA  1 
ATOM   7901  C  C   . GLN D  1 34  ? -33.469 -37.575 76.397  1.00 28.94  ? 34  GLN D C   1 
ATOM   7902  O  O   . GLN D  1 34  ? -34.339 -37.227 75.627  1.00 30.55  ? 34  GLN D O   1 
ATOM   7903  C  CB  . GLN D  1 34  ? -31.911 -35.785 77.291  1.00 32.08  ? 34  GLN D CB  1 
ATOM   7904  C  CG  . GLN D  1 34  ? -32.160 -34.841 76.210  1.00 38.21  ? 34  GLN D CG  1 
ATOM   7905  C  CD  . GLN D  1 34  ? -31.046 -33.807 76.081  1.00 43.55  ? 34  GLN D CD  1 
ATOM   7906  O  OE1 . GLN D  1 34  ? -30.448 -33.375 77.092  1.00 46.79  ? 34  GLN D OE1 1 
ATOM   7907  N  NE2 . GLN D  1 34  ? -30.763 -33.412 74.881  1.00 44.87  ? 34  GLN D NE2 1 
ATOM   7908  N  N   . GLN D  1 35  ? -32.801 -38.715 76.255  1.00 27.26  ? 35  GLN D N   1 
ATOM   7909  C  CA  . GLN D  1 35  ? -33.063 -39.618 75.105  1.00 25.72  ? 35  GLN D CA  1 
ATOM   7910  C  C   . GLN D  1 35  ? -34.202 -40.591 75.357  1.00 24.97  ? 35  GLN D C   1 
ATOM   7911  O  O   . GLN D  1 35  ? -34.889 -41.020 74.407  1.00 26.05  ? 35  GLN D O   1 
ATOM   7912  C  CB  . GLN D  1 35  ? -31.822 -40.360 74.727  1.00 23.04  ? 35  GLN D CB  1 
ATOM   7913  C  CG  . GLN D  1 35  ? -30.720 -39.464 74.253  1.00 24.67  ? 35  GLN D CG  1 
ATOM   7914  C  CD  . GLN D  1 35  ? -31.170 -38.535 73.151  1.00 24.86  ? 35  GLN D CD  1 
ATOM   7915  O  OE1 . GLN D  1 35  ? -32.096 -38.859 72.379  1.00 22.96  ? 35  GLN D OE1 1 
ATOM   7916  N  NE2 . GLN D  1 35  ? -30.529 -37.365 73.058  1.00 22.18  ? 35  GLN D NE2 1 
ATOM   7917  N  N   . TRP D  1 36  ? -34.413 -40.953 76.622  1.00 25.32  ? 36  TRP D N   1 
ATOM   7918  C  CA  . TRP D  1 36  ? -35.447 -41.935 76.965  1.00 25.98  ? 36  TRP D CA  1 
ATOM   7919  C  C   . TRP D  1 36  ? -36.236 -41.536 78.178  1.00 27.42  ? 36  TRP D C   1 
ATOM   7920  O  O   . TRP D  1 36  ? -36.120 -42.147 79.219  1.00 30.89  ? 36  TRP D O   1 
ATOM   7921  C  CB  . TRP D  1 36  ? -34.816 -43.343 77.150  1.00 25.69  ? 36  TRP D CB  1 
ATOM   7922  C  CG  . TRP D  1 36  ? -34.187 -43.877 75.881  1.00 22.89  ? 36  TRP D CG  1 
ATOM   7923  C  CD1 . TRP D  1 36  ? -34.856 -44.383 74.757  1.00 22.78  ? 36  TRP D CD1 1 
ATOM   7924  C  CD2 . TRP D  1 36  ? -32.761 -43.963 75.578  1.00 22.91  ? 36  TRP D CD2 1 
ATOM   7925  N  NE1 . TRP D  1 36  ? -33.934 -44.777 73.776  1.00 24.75  ? 36  TRP D NE1 1 
ATOM   7926  C  CE2 . TRP D  1 36  ? -32.643 -44.536 74.240  1.00 23.86  ? 36  TRP D CE2 1 
ATOM   7927  C  CE3 . TRP D  1 36  ? -31.597 -43.626 76.276  1.00 23.19  ? 36  TRP D CE3 1 
ATOM   7928  C  CZ2 . TRP D  1 36  ? -31.412 -44.761 73.630  1.00 24.07  ? 36  TRP D CZ2 1 
ATOM   7929  C  CZ3 . TRP D  1 36  ? -30.340 -43.854 75.655  1.00 25.75  ? 36  TRP D CZ3 1 
ATOM   7930  C  CH2 . TRP D  1 36  ? -30.257 -44.413 74.352  1.00 24.20  ? 36  TRP D CH2 1 
ATOM   7931  N  N   . PRO D  1 37  ? -37.064 -40.484 78.041  1.00 28.76  ? 37  PRO D N   1 
ATOM   7932  C  CA  . PRO D  1 37  ? -37.858 -39.962 79.138  1.00 29.47  ? 37  PRO D CA  1 
ATOM   7933  C  C   . PRO D  1 37  ? -38.852 -41.036 79.756  1.00 30.96  ? 37  PRO D C   1 
ATOM   7934  O  O   . PRO D  1 37  ? -39.237 -40.915 80.896  1.00 29.69  ? 37  PRO D O   1 
ATOM   7935  C  CB  . PRO D  1 37  ? -38.659 -38.789 78.478  1.00 29.15  ? 37  PRO D CB  1 
ATOM   7936  C  CG  . PRO D  1 37  ? -38.613 -39.076 77.008  1.00 30.83  ? 37  PRO D CG  1 
ATOM   7937  C  CD  . PRO D  1 37  ? -37.293 -39.732 76.775  1.00 28.36  ? 37  PRO D CD  1 
ATOM   7938  N  N   . HIS D  1 38  ? -39.224 -42.045 78.968  1.00 29.75  ? 38  HIS D N   1 
ATOM   7939  C  CA  . HIS D  1 38  ? -40.204 -43.063 79.428  1.00 31.22  ? 38  HIS D CA  1 
ATOM   7940  C  C   . HIS D  1 38  ? -39.678 -43.860 80.593  1.00 34.49  ? 38  HIS D C   1 
ATOM   7941  O  O   . HIS D  1 38  ? -40.417 -44.613 81.219  1.00 36.61  ? 38  HIS D O   1 
ATOM   7942  C  CB  . HIS D  1 38  ? -40.569 -43.992 78.306  1.00 31.38  ? 38  HIS D CB  1 
ATOM   7943  C  CG  . HIS D  1 38  ? -39.512 -44.989 77.988  1.00 30.17  ? 38  HIS D CG  1 
ATOM   7944  N  ND1 . HIS D  1 38  ? -38.498 -44.730 77.129  1.00 30.52  ? 38  HIS D ND1 1 
ATOM   7945  C  CD2 . HIS D  1 38  ? -39.310 -46.294 78.446  1.00 30.73  ? 38  HIS D CD2 1 
ATOM   7946  C  CE1 . HIS D  1 38  ? -37.701 -45.809 77.043  1.00 29.45  ? 38  HIS D CE1 1 
ATOM   7947  N  NE2 . HIS D  1 38  ? -38.192 -46.761 77.845  1.00 33.60  ? 38  HIS D NE2 1 
ATOM   7948  N  N   . LEU D  1 39  ? -38.391 -43.706 80.884  1.00 30.27  ? 39  LEU D N   1 
ATOM   7949  C  CA  . LEU D  1 39  ? -37.773 -44.430 81.968  1.00 31.22  ? 39  LEU D CA  1 
ATOM   7950  C  C   . LEU D  1 39  ? -37.999 -43.731 83.308  1.00 32.48  ? 39  LEU D C   1 
ATOM   7951  O  O   . LEU D  1 39  ? -37.744 -44.299 84.351  1.00 34.12  ? 39  LEU D O   1 
ATOM   7952  C  CB  . LEU D  1 39  ? -36.244 -44.581 81.720  1.00 28.71  ? 39  LEU D CB  1 
ATOM   7953  C  CG  . LEU D  1 39  ? -35.780 -45.474 80.564  1.00 28.21  ? 39  LEU D CG  1 
ATOM   7954  C  CD1 . LEU D  1 39  ? -34.311 -45.213 80.242  1.00 24.64  ? 39  LEU D CD1 1 
ATOM   7955  C  CD2 . LEU D  1 39  ? -36.021 -46.963 80.877  1.00 25.31  ? 39  LEU D CD2 1 
ATOM   7956  N  N   . TYR D  1 40  ? -38.478 -42.495 83.260  1.00 30.62  ? 40  TYR D N   1 
ATOM   7957  C  CA  . TYR D  1 40  ? -38.538 -41.656 84.466  1.00 33.44  ? 40  TYR D CA  1 
ATOM   7958  C  C   . TYR D  1 40  ? -39.950 -41.225 84.838  1.00 36.06  ? 40  TYR D C   1 
ATOM   7959  O  O   . TYR D  1 40  ? -40.816 -41.126 83.995  1.00 37.20  ? 40  TYR D O   1 
ATOM   7960  C  CB  . TYR D  1 40  ? -37.648 -40.436 84.295  1.00 31.77  ? 40  TYR D CB  1 
ATOM   7961  C  CG  . TYR D  1 40  ? -36.208 -40.777 84.080  1.00 30.41  ? 40  TYR D CG  1 
ATOM   7962  C  CD1 . TYR D  1 40  ? -35.713 -41.012 82.800  1.00 29.67  ? 40  TYR D CD1 1 
ATOM   7963  C  CD2 . TYR D  1 40  ? -35.322 -40.878 85.164  1.00 27.15  ? 40  TYR D CD2 1 
ATOM   7964  C  CE1 . TYR D  1 40  ? -34.371 -41.335 82.594  1.00 29.45  ? 40  TYR D CE1 1 
ATOM   7965  C  CE2 . TYR D  1 40  ? -33.990 -41.199 84.972  1.00 28.19  ? 40  TYR D CE2 1 
ATOM   7966  C  CZ  . TYR D  1 40  ? -33.515 -41.428 83.680  1.00 30.47  ? 40  TYR D CZ  1 
ATOM   7967  O  OH  . TYR D  1 40  ? -32.187 -41.748 83.482  1.00 33.60  ? 40  TYR D OH  1 
ATOM   7968  N  N   . ASN D  1 41  ? -40.153 -40.973 86.122  1.00 35.67  ? 41  ASN D N   1 
ATOM   7969  C  CA  . ASN D  1 41  ? -41.438 -40.538 86.630  1.00 38.35  ? 41  ASN D CA  1 
ATOM   7970  C  C   . ASN D  1 41  ? -41.244 -39.384 87.546  1.00 38.19  ? 41  ASN D C   1 
ATOM   7971  O  O   . ASN D  1 41  ? -40.936 -39.565 88.747  1.00 36.48  ? 41  ASN D O   1 
ATOM   7972  C  CB  . ASN D  1 41  ? -42.122 -41.687 87.370  1.00 39.48  ? 41  ASN D CB  1 
ATOM   7973  C  CG  . ASN D  1 41  ? -43.545 -41.355 87.783  1.00 46.68  ? 41  ASN D CG  1 
ATOM   7974  O  OD1 . ASN D  1 41  ? -43.879 -40.187 88.067  1.00 46.38  ? 41  ASN D OD1 1 
ATOM   7975  N  ND2 . ASN D  1 41  ? -44.385 -42.361 87.827  1.00 45.05  ? 41  ASN D ND2 1 
ATOM   7976  N  N   . GLU D  1 42  ? -41.409 -38.175 87.018  1.00 37.03  ? 42  GLU D N   1 
ATOM   7977  C  CA  . GLU D  1 42  ? -41.117 -36.950 87.808  1.00 40.90  ? 42  GLU D CA  1 
ATOM   7978  C  C   . GLU D  1 42  ? -42.062 -36.757 89.015  1.00 41.93  ? 42  GLU D C   1 
ATOM   7979  O  O   . GLU D  1 42  ? -41.657 -36.179 90.054  1.00 38.39  ? 42  GLU D O   1 
ATOM   7980  C  CB  . GLU D  1 42  ? -41.123 -35.716 86.932  1.00 45.48  ? 42  GLU D CB  1 
ATOM   7981  C  CG  . GLU D  1 42  ? -40.653 -34.463 87.661  1.00 58.27  ? 42  GLU D CG  1 
ATOM   7982  C  CD  . GLU D  1 42  ? -40.249 -33.360 86.729  1.00 70.00  ? 42  GLU D CD  1 
ATOM   7983  O  OE1 . GLU D  1 42  ? -39.749 -32.325 87.219  1.00 75.00  ? 42  GLU D OE1 1 
ATOM   7984  O  OE2 . GLU D  1 42  ? -40.425 -33.519 85.497  1.00 85.53  ? 42  GLU D OE2 1 
ATOM   7985  N  N   . ASP D  1 43  ? -43.309 -37.228 88.887  1.00 39.93  ? 43  ASP D N   1 
ATOM   7986  C  CA  . ASP D  1 43  ? -44.276 -37.120 89.993  1.00 42.74  ? 43  ASP D CA  1 
ATOM   7987  C  C   . ASP D  1 43  ? -43.781 -37.886 91.190  1.00 41.94  ? 43  ASP D C   1 
ATOM   7988  O  O   . ASP D  1 43  ? -43.757 -37.366 92.315  1.00 39.70  ? 43  ASP D O   1 
ATOM   7989  C  CB  . ASP D  1 43  ? -45.654 -37.634 89.567  1.00 46.45  ? 43  ASP D CB  1 
ATOM   7990  C  CG  . ASP D  1 43  ? -46.360 -36.689 88.567  1.00 51.86  ? 43  ASP D CG  1 
ATOM   7991  O  OD1 . ASP D  1 43  ? -45.865 -35.566 88.355  1.00 53.11  ? 43  ASP D OD1 1 
ATOM   7992  O  OD2 . ASP D  1 43  ? -47.398 -37.084 88.012  1.00 57.58  ? 43  ASP D OD2 1 
ATOM   7993  N  N   . GLU D  1 44  ? -43.379 -39.116 90.956  1.00 38.45  ? 44  GLU D N   1 
ATOM   7994  C  CA  . GLU D  1 44  ? -42.861 -39.947 91.985  1.00 38.85  ? 44  GLU D CA  1 
ATOM   7995  C  C   . GLU D  1 44  ? -41.582 -39.333 92.587  1.00 39.15  ? 44  GLU D C   1 
ATOM   7996  O  O   . GLU D  1 44  ? -41.400 -39.316 93.830  1.00 39.17  ? 44  GLU D O   1 
ATOM   7997  C  CB  . GLU D  1 44  ? -42.567 -41.336 91.432  1.00 42.14  ? 44  GLU D CB  1 
ATOM   7998  C  CG  . GLU D  1 44  ? -42.286 -42.369 92.476  1.00 56.47  ? 44  GLU D CG  1 
ATOM   7999  C  CD  . GLU D  1 44  ? -42.100 -43.750 91.887  1.00 72.17  ? 44  GLU D CD  1 
ATOM   8000  O  OE1 . GLU D  1 44  ? -41.896 -44.717 92.672  1.00 83.35  ? 44  GLU D OE1 1 
ATOM   8001  O  OE2 . GLU D  1 44  ? -42.157 -43.881 90.627  1.00 74.56  ? 44  GLU D OE2 1 
ATOM   8002  N  N   . GLU D  1 45  ? -40.705 -38.832 91.716  1.00 36.16  ? 45  GLU D N   1 
ATOM   8003  C  CA  . GLU D  1 45  ? -39.448 -38.204 92.153  1.00 36.32  ? 45  GLU D CA  1 
ATOM   8004  C  C   . GLU D  1 45  ? -39.713 -37.018 93.063  1.00 35.15  ? 45  GLU D C   1 
ATOM   8005  O  O   . GLU D  1 45  ? -39.058 -36.848 94.061  1.00 32.36  ? 45  GLU D O   1 
ATOM   8006  C  CB  . GLU D  1 45  ? -38.622 -37.767 90.947  1.00 32.45  ? 45  GLU D CB  1 
ATOM   8007  C  CG  . GLU D  1 45  ? -38.080 -38.926 90.122  1.00 33.38  ? 45  GLU D CG  1 
ATOM   8008  C  CD  . GLU D  1 45  ? -37.652 -38.504 88.728  1.00 37.14  ? 45  GLU D CD  1 
ATOM   8009  O  OE1 . GLU D  1 45  ? -37.783 -37.277 88.389  1.00 34.64  ? 45  GLU D OE1 1 
ATOM   8010  O  OE2 . GLU D  1 45  ? -37.192 -39.376 87.961  1.00 37.47  ? 45  GLU D OE2 1 
ATOM   8011  N  N   . PHE D  1 46  ? -40.682 -36.209 92.701  1.00 34.37  ? 46  PHE D N   1 
ATOM   8012  C  CA  . PHE D  1 46  ? -41.046 -35.062 93.506  1.00 38.10  ? 46  PHE D CA  1 
ATOM   8013  C  C   . PHE D  1 46  ? -41.578 -35.499 94.898  1.00 36.34  ? 46  PHE D C   1 
ATOM   8014  O  O   . PHE D  1 46  ? -41.168 -34.977 95.903  1.00 37.37  ? 46  PHE D O   1 
ATOM   8015  C  CB  . PHE D  1 46  ? -42.086 -34.203 92.783  1.00 39.89  ? 46  PHE D CB  1 
ATOM   8016  C  CG  . PHE D  1 46  ? -42.464 -32.953 93.525  1.00 39.62  ? 46  PHE D CG  1 
ATOM   8017  C  CD1 . PHE D  1 46  ? -43.712 -32.840 94.142  1.00 42.73  ? 46  PHE D CD1 1 
ATOM   8018  C  CD2 . PHE D  1 46  ? -41.578 -31.884 93.613  1.00 38.02  ? 46  PHE D CD2 1 
ATOM   8019  C  CE1 . PHE D  1 46  ? -44.065 -31.674 94.834  1.00 41.08  ? 46  PHE D CE1 1 
ATOM   8020  C  CE2 . PHE D  1 46  ? -41.929 -30.719 94.304  1.00 41.03  ? 46  PHE D CE2 1 
ATOM   8021  C  CZ  . PHE D  1 46  ? -43.173 -30.619 94.910  1.00 38.39  ? 46  PHE D CZ  1 
ATOM   8022  N  N   . ARG D  1 47  ? -42.487 -36.472 94.911  1.00 37.44  ? 47  ARG D N   1 
ATOM   8023  C  CA  . ARG D  1 47  ? -43.091 -36.948 96.186  1.00 43.36  ? 47  ARG D CA  1 
ATOM   8024  C  C   . ARG D  1 47  ? -42.050 -37.471 97.140  1.00 41.64  ? 47  ARG D C   1 
ATOM   8025  O  O   . ARG D  1 47  ? -42.093 -37.177 98.353  1.00 38.20  ? 47  ARG D O   1 
ATOM   8026  C  CB  . ARG D  1 47  ? -44.163 -38.028 95.926  1.00 44.88  ? 47  ARG D CB  1 
ATOM   8027  C  CG  . ARG D  1 47  ? -45.433 -37.502 95.292  1.00 60.64  ? 47  ARG D CG  1 
ATOM   8028  C  CD  . ARG D  1 47  ? -46.565 -38.543 95.358  1.00 67.27  ? 47  ARG D CD  1 
ATOM   8029  N  NE  . ARG D  1 47  ? -46.205 -39.800 94.680  1.00 74.04  ? 47  ARG D NE  1 
ATOM   8030  C  CZ  . ARG D  1 47  ? -46.435 -40.051 93.386  1.00 71.31  ? 47  ARG D CZ  1 
ATOM   8031  N  NH1 . ARG D  1 47  ? -47.025 -39.133 92.621  1.00 69.49  ? 47  ARG D NH1 1 
ATOM   8032  N  NH2 . ARG D  1 47  ? -46.073 -41.223 92.857  1.00 66.21  ? 47  ARG D NH2 1 
ATOM   8033  N  N   . ASN D  1 48  ? -41.104 -38.252 96.613  1.00 39.03  ? 48  ASN D N   1 
ATOM   8034  C  CA  . ASN D  1 48  ? -40.062 -38.840 97.433  1.00 39.10  ? 48  ASN D CA  1 
ATOM   8035  C  C   . ASN D  1 48  ? -39.151 -37.796 98.043  1.00 37.06  ? 48  ASN D C   1 
ATOM   8036  O  O   . ASN D  1 48  ? -38.845 -37.850 99.207  1.00 40.80  ? 48  ASN D O   1 
ATOM   8037  C  CB  . ASN D  1 48  ? -39.230 -39.857 96.614  1.00 43.51  ? 48  ASN D CB  1 
ATOM   8038  C  CG  . ASN D  1 48  ? -40.003 -41.116 96.288  1.00 47.70  ? 48  ASN D CG  1 
ATOM   8039  O  OD1 . ASN D  1 48  ? -41.072 -41.358 96.831  1.00 49.42  ? 48  ASN D OD1 1 
ATOM   8040  N  ND2 . ASN D  1 48  ? -39.461 -41.923 95.399  1.00 48.28  ? 48  ASN D ND2 1 
ATOM   8041  N  N   . ALA D  1 49  ? -38.723 -36.848 97.234  1.00 32.82  ? 49  ALA D N   1 
ATOM   8042  C  CA  . ALA D  1 49  ? -37.834 -35.828 97.693  1.00 35.57  ? 49  ALA D CA  1 
ATOM   8043  C  C   . ALA D  1 49  ? -38.501 -34.979 98.748  1.00 36.28  ? 49  ALA D C   1 
ATOM   8044  O  O   . ALA D  1 49  ? -37.897 -34.635 99.739  1.00 38.13  ? 49  ALA D O   1 
ATOM   8045  C  CB  . ALA D  1 49  ? -37.368 -34.962 96.525  1.00 32.87  ? 49  ALA D CB  1 
ATOM   8046  N  N   . VAL D  1 50  ? -39.775 -34.655 98.523  1.00 36.08  ? 50  VAL D N   1 
ATOM   8047  C  CA  . VAL D  1 50  ? -40.511 -33.777 99.418  1.00 36.04  ? 50  VAL D CA  1 
ATOM   8048  C  C   . VAL D  1 50  ? -40.677 -34.352 100.853 1.00 39.54  ? 50  VAL D C   1 
ATOM   8049  O  O   . VAL D  1 50  ? -40.433 -33.648 101.846 1.00 36.43  ? 50  VAL D O   1 
ATOM   8050  C  CB  . VAL D  1 50  ? -41.909 -33.409 98.845  1.00 35.18  ? 50  VAL D CB  1 
ATOM   8051  C  CG1 . VAL D  1 50  ? -42.789 -32.814 99.933  1.00 33.95  ? 50  VAL D CG1 1 
ATOM   8052  C  CG2 . VAL D  1 50  ? -41.766 -32.449 97.691  1.00 33.10  ? 50  VAL D CG2 1 
ATOM   8053  N  N   . ASN D  1 51  ? -41.094 -35.609 100.956 1.00 40.70  ? 51  ASN D N   1 
ATOM   8054  C  CA  . ASN D  1 51  ? -41.309 -36.205 102.281 1.00 45.84  ? 51  ASN D CA  1 
ATOM   8055  C  C   . ASN D  1 51  ? -39.993 -36.632 103.012 1.00 44.04  ? 51  ASN D C   1 
ATOM   8056  O  O   . ASN D  1 51  ? -39.957 -36.701 104.257 1.00 45.10  ? 51  ASN D O   1 
ATOM   8057  C  CB  . ASN D  1 51  ? -42.368 -37.370 102.240 1.00 53.62  ? 51  ASN D CB  1 
ATOM   8058  C  CG  . ASN D  1 51  ? -42.096 -38.339 101.204 1.00 56.26  ? 51  ASN D CG  1 
ATOM   8059  O  OD1 . ASN D  1 51  ? -41.001 -38.428 100.713 1.00 74.11  ? 51  ASN D OD1 1 
ATOM   8060  N  ND2 . ASN D  1 51  ? -43.122 -39.121 100.835 1.00 62.35  ? 51  ASN D ND2 1 
ATOM   8061  N  N   . GLU D  1 52  ? -38.923 -36.906 102.235 1.00 34.16  ? 52  GLU D N   1 
ATOM   8062  C  CA  . GLU D  1 52  ? -37.603 -37.138 102.834 1.00 34.85  ? 52  GLU D CA  1 
ATOM   8063  C  C   . GLU D  1 52  ? -37.116 -35.866 103.473 1.00 35.37  ? 52  GLU D C   1 
ATOM   8064  O  O   . GLU D  1 52  ? -36.585 -35.881 104.603 1.00 37.30  ? 52  GLU D O   1 
ATOM   8065  C  CB  . GLU D  1 52  ? -36.594 -37.617 101.785 1.00 37.23  ? 52  GLU D CB  1 
ATOM   8066  C  CG  . GLU D  1 52  ? -36.787 -39.045 101.347 1.00 41.71  ? 52  GLU D CG  1 
ATOM   8067  C  CD  . GLU D  1 52  ? -36.571 -40.044 102.482 1.00 45.28  ? 52  GLU D CD  1 
ATOM   8068  O  OE1 . GLU D  1 52  ? -37.392 -40.951 102.625 1.00 52.36  ? 52  GLU D OE1 1 
ATOM   8069  O  OE2 . GLU D  1 52  ? -35.564 -39.905 103.234 1.00 42.12  ? 52  GLU D OE2 1 
ATOM   8070  N  N   . VAL D  1 53  ? -37.301 -34.731 102.760 1.00 32.63  ? 53  VAL D N   1 
ATOM   8071  C  CA  . VAL D  1 53  ? -36.859 -33.442 103.258 1.00 31.70  ? 53  VAL D CA  1 
ATOM   8072  C  C   . VAL D  1 53  ? -37.592 -33.035 104.553 1.00 36.08  ? 53  VAL D C   1 
ATOM   8073  O  O   . VAL D  1 53  ? -36.959 -32.615 105.526 1.00 34.31  ? 53  VAL D O   1 
ATOM   8074  C  CB  . VAL D  1 53  ? -37.016 -32.323 102.200 1.00 31.14  ? 53  VAL D CB  1 
ATOM   8075  C  CG1 . VAL D  1 53  ? -36.911 -30.946 102.857 1.00 28.97  ? 53  VAL D CG1 1 
ATOM   8076  C  CG2 . VAL D  1 53  ? -35.969 -32.476 101.103 1.00 30.04  ? 53  VAL D CG2 1 
ATOM   8077  N  N   . LYS D  1 54  ? -38.910 -33.161 104.562 1.00 37.73  ? 54  LYS D N   1 
ATOM   8078  C  CA  . LYS D  1 54  ? -39.683 -32.761 105.742 1.00 41.46  ? 54  LYS D CA  1 
ATOM   8079  C  C   . LYS D  1 54  ? -39.472 -33.691 106.928 1.00 40.32  ? 54  LYS D C   1 
ATOM   8080  O  O   . LYS D  1 54  ? -39.609 -33.284 108.056 1.00 43.83  ? 54  LYS D O   1 
ATOM   8081  C  CB  . LYS D  1 54  ? -41.183 -32.597 105.418 1.00 44.50  ? 54  LYS D CB  1 
ATOM   8082  C  CG  . LYS D  1 54  ? -41.804 -33.732 104.729 1.00 48.03  ? 54  LYS D CG  1 
ATOM   8083  C  CD  . LYS D  1 54  ? -43.240 -33.389 104.344 1.00 47.18  ? 54  LYS D CD  1 
ATOM   8084  C  CE  . LYS D  1 54  ? -43.322 -31.983 103.731 1.00 44.31  ? 54  LYS D CE  1 
ATOM   8085  N  NZ  . LYS D  1 54  ? -44.728 -31.624 103.326 1.00 43.98  ? 54  LYS D NZ  1 
ATOM   8086  N  N   . ARG D  1 55  ? -39.128 -34.954 106.660 1.00 39.25  ? 55  ARG D N   1 
ATOM   8087  C  CA  . ARG D  1 55  ? -38.773 -35.834 107.732 1.00 40.43  ? 55  ARG D CA  1 
ATOM   8088  C  C   . ARG D  1 55  ? -37.476 -35.325 108.352 1.00 38.30  ? 55  ARG D C   1 
ATOM   8089  O  O   . ARG D  1 55  ? -37.337 -35.274 109.555 1.00 37.63  ? 55  ARG D O   1 
ATOM   8090  C  CB  . ARG D  1 55  ? -38.606 -37.270 107.257 1.00 40.55  ? 55  ARG D CB  1 
ATOM   8091  C  CG  . ARG D  1 55  ? -38.829 -38.312 108.400 1.00 48.61  ? 55  ARG D CG  1 
ATOM   8092  C  CD  . ARG D  1 55  ? -38.042 -39.613 108.186 1.00 46.63  ? 55  ARG D CD  1 
ATOM   8093  N  NE  . ARG D  1 55  ? -38.361 -40.246 106.939 1.00 52.62  ? 55  ARG D NE  1 
ATOM   8094  C  CZ  . ARG D  1 55  ? -37.460 -40.651 106.053 1.00 50.77  ? 55  ARG D CZ  1 
ATOM   8095  N  NH1 . ARG D  1 55  ? -36.144 -40.496 106.299 1.00 42.64  ? 55  ARG D NH1 1 
ATOM   8096  N  NH2 . ARG D  1 55  ? -37.853 -41.221 104.936 1.00 51.24  ? 55  ARG D NH2 1 
ATOM   8097  N  N   . ALA D  1 56  ? -36.529 -34.935 107.492 1.00 35.37  ? 56  ALA D N   1 
ATOM   8098  C  CA  . ALA D  1 56  ? -35.273 -34.372 107.946 1.00 35.59  ? 56  ALA D CA  1 
ATOM   8099  C  C   . ALA D  1 56  ? -35.526 -33.135 108.763 1.00 33.69  ? 56  ALA D C   1 
ATOM   8100  O  O   . ALA D  1 56  ? -34.902 -32.927 109.811 1.00 32.13  ? 56  ALA D O   1 
ATOM   8101  C  CB  . ALA D  1 56  ? -34.373 -34.049 106.753 1.00 30.36  ? 56  ALA D CB  1 
ATOM   8102  N  N   . MET D  1 57  ? -36.446 -32.308 108.294 1.00 34.42  ? 57  MET D N   1 
ATOM   8103  C  CA  . MET D  1 57  ? -36.783 -31.072 108.979 1.00 35.83  ? 57  MET D CA  1 
ATOM   8104  C  C   . MET D  1 57  ? -37.415 -31.347 110.340 1.00 37.28  ? 57  MET D C   1 
ATOM   8105  O  O   . MET D  1 57  ? -37.224 -30.592 111.276 1.00 37.67  ? 57  MET D O   1 
ATOM   8106  C  CB  . MET D  1 57  ? -37.710 -30.233 108.130 1.00 35.77  ? 57  MET D CB  1 
ATOM   8107  C  CG  . MET D  1 57  ? -37.064 -29.707 106.852 1.00 37.88  ? 57  MET D CG  1 
ATOM   8108  S  SD  . MET D  1 57  ? -38.183 -28.708 105.857 1.00 36.05  ? 57  MET D SD  1 
ATOM   8109  C  CE  . MET D  1 57  ? -38.433 -27.286 106.950 1.00 38.43  ? 57  MET D CE  1 
ATOM   8110  N  N   . GLN D  1 58  ? -38.172 -32.449 110.432 1.00 36.63  ? 58  GLN D N   1 
ATOM   8111  C  CA  . GLN D  1 58  ? -38.797 -32.850 111.697 1.00 40.58  ? 58  GLN D CA  1 
ATOM   8112  C  C   . GLN D  1 58  ? -37.736 -33.243 112.743 1.00 40.25  ? 58  GLN D C   1 
ATOM   8113  O  O   . GLN D  1 58  ? -37.946 -33.079 113.943 1.00 41.57  ? 58  GLN D O   1 
ATOM   8114  C  CB  . GLN D  1 58  ? -39.773 -33.995 111.475 1.00 39.88  ? 58  GLN D CB  1 
ATOM   8115  C  CG  . GLN D  1 58  ? -40.998 -33.611 110.663 1.00 49.52  ? 58  GLN D CG  1 
ATOM   8116  C  CD  . GLN D  1 58  ? -41.936 -34.788 110.417 1.00 60.02  ? 58  GLN D CD  1 
ATOM   8117  O  OE1 . GLN D  1 58  ? -42.992 -34.636 109.802 1.00 70.78  ? 58  GLN D OE1 1 
ATOM   8118  N  NE2 . GLN D  1 58  ? -41.549 -35.967 110.899 1.00 61.90  ? 58  GLN D NE2 1 
ATOM   8119  N  N   . PHE D  1 59  ? -36.605 -33.757 112.270 1.00 38.08  ? 59  PHE D N   1 
ATOM   8120  C  CA  . PHE D  1 59  ? -35.503 -34.105 113.152 1.00 34.03  ? 59  PHE D CA  1 
ATOM   8121  C  C   . PHE D  1 59  ? -34.643 -32.917 113.444 1.00 34.61  ? 59  PHE D C   1 
ATOM   8122  O  O   . PHE D  1 59  ? -33.653 -33.031 114.108 1.00 40.48  ? 59  PHE D O   1 
ATOM   8123  C  CB  . PHE D  1 59  ? -34.662 -35.213 112.549 1.00 39.45  ? 59  PHE D CB  1 
ATOM   8124  C  CG  . PHE D  1 59  ? -35.167 -36.595 112.855 1.00 40.58  ? 59  PHE D CG  1 
ATOM   8125  C  CD1 . PHE D  1 59  ? -34.965 -37.162 114.113 1.00 37.46  ? 59  PHE D CD1 1 
ATOM   8126  C  CD2 . PHE D  1 59  ? -35.832 -37.335 111.893 1.00 40.26  ? 59  PHE D CD2 1 
ATOM   8127  C  CE1 . PHE D  1 59  ? -35.429 -38.447 114.399 1.00 41.51  ? 59  PHE D CE1 1 
ATOM   8128  C  CE2 . PHE D  1 59  ? -36.299 -38.628 112.179 1.00 43.70  ? 59  PHE D CE2 1 
ATOM   8129  C  CZ  . PHE D  1 59  ? -36.094 -39.175 113.427 1.00 39.66  ? 59  PHE D CZ  1 
ATOM   8130  N  N   . GLY D  1 60  ? -35.036 -31.753 112.921 1.00 32.25  ? 60  GLY D N   1 
ATOM   8131  C  CA  . GLY D  1 60  ? -34.328 -30.486 113.237 1.00 30.46  ? 60  GLY D CA  1 
ATOM   8132  C  C   . GLY D  1 60  ? -33.309 -30.030 112.190 1.00 32.97  ? 60  GLY D C   1 
ATOM   8133  O  O   . GLY D  1 60  ? -32.528 -29.121 112.440 1.00 37.39  ? 60  GLY D O   1 
ATOM   8134  N  N   . VAL D  1 61  ? -33.316 -30.660 111.030 1.00 31.26  ? 61  VAL D N   1 
ATOM   8135  C  CA  . VAL D  1 61  ? -32.418 -30.240 109.942 1.00 29.96  ? 61  VAL D CA  1 
ATOM   8136  C  C   . VAL D  1 61  ? -32.896 -28.931 109.359 1.00 30.20  ? 61  VAL D C   1 
ATOM   8137  O  O   . VAL D  1 61  ? -34.055 -28.820 108.910 1.00 30.50  ? 61  VAL D O   1 
ATOM   8138  C  CB  . VAL D  1 61  ? -32.338 -31.285 108.820 1.00 28.38  ? 61  VAL D CB  1 
ATOM   8139  C  CG1 . VAL D  1 61  ? -31.446 -30.766 107.669 1.00 25.44  ? 61  VAL D CG1 1 
ATOM   8140  C  CG2 . VAL D  1 61  ? -31.818 -32.617 109.360 1.00 26.56  ? 61  VAL D CG2 1 
ATOM   8141  N  N   . LYS D  1 62  ? -32.025 -27.934 109.352 1.00 29.16  ? 62  LYS D N   1 
ATOM   8142  C  CA  . LYS D  1 62  ? -32.406 -26.598 108.869 1.00 33.63  ? 62  LYS D CA  1 
ATOM   8143  C  C   . LYS D  1 62  ? -31.922 -26.339 107.431 1.00 35.49  ? 62  LYS D C   1 
ATOM   8144  O  O   . LYS D  1 62  ? -32.611 -25.634 106.634 1.00 41.58  ? 62  LYS D O   1 
ATOM   8145  C  CB  . LYS D  1 62  ? -31.874 -25.527 109.806 1.00 36.42  ? 62  LYS D CB  1 
ATOM   8146  C  CG  . LYS D  1 62  ? -32.309 -24.116 109.454 1.00 43.17  ? 62  LYS D CG  1 
ATOM   8147  C  CD  . LYS D  1 62  ? -31.818 -23.111 110.510 1.00 45.70  ? 62  LYS D CD  1 
ATOM   8148  C  CE  . LYS D  1 62  ? -32.151 -21.691 110.121 1.00 45.42  ? 62  LYS D CE  1 
ATOM   8149  N  NZ  . LYS D  1 62  ? -31.523 -20.706 111.050 1.00 45.19  ? 62  LYS D NZ  1 
ATOM   8150  N  N   . THR D  1 63  ? -30.750 -26.905 107.085 1.00 31.63  ? 63  THR D N   1 
ATOM   8151  C  CA  . THR D  1 63  ? -30.140 -26.665 105.785 1.00 29.27  ? 63  THR D CA  1 
ATOM   8152  C  C   . THR D  1 63  ? -29.591 -27.945 105.166 1.00 29.43  ? 63  THR D C   1 
ATOM   8153  O  O   . THR D  1 63  ? -28.960 -28.774 105.852 1.00 27.18  ? 63  THR D O   1 
ATOM   8154  C  CB  . THR D  1 63  ? -28.995 -25.632 105.890 1.00 27.41  ? 63  THR D CB  1 
ATOM   8155  O  OG1 . THR D  1 63  ? -29.494 -24.427 106.450 1.00 27.72  ? 63  THR D OG1 1 
ATOM   8156  C  CG2 . THR D  1 63  ? -28.398 -25.343 104.521 1.00 25.82  ? 63  THR D CG2 1 
ATOM   8157  N  N   . ILE D  1 64  ? -29.823 -28.105 103.888 1.00 31.90  ? 64  ILE D N   1 
ATOM   8158  C  CA  . ILE D  1 64  ? -29.314 -29.242 103.153 1.00 28.03  ? 64  ILE D CA  1 
ATOM   8159  C  C   . ILE D  1 64  ? -28.485 -28.777 101.997 1.00 28.80  ? 64  ILE D C   1 
ATOM   8160  O  O   . ILE D  1 64  ? -28.903 -27.874 101.222 1.00 26.56  ? 64  ILE D O   1 
ATOM   8161  C  CB  . ILE D  1 64  ? -30.465 -30.136 102.625 1.00 29.71  ? 64  ILE D CB  1 
ATOM   8162  C  CG1 . ILE D  1 64  ? -31.235 -30.755 103.792 1.00 27.90  ? 64  ILE D CG1 1 
ATOM   8163  C  CG2 . ILE D  1 64  ? -29.920 -31.221 101.690 1.00 27.98  ? 64  ILE D CG2 1 
ATOM   8164  C  CD1 . ILE D  1 64  ? -32.499 -31.493 103.374 1.00 28.59  ? 64  ILE D CD1 1 
ATOM   8165  N  N   . VAL D  1 65  ? -27.313 -29.357 101.857 1.00 26.29  ? 65  VAL D N   1 
ATOM   8166  C  CA  . VAL D  1 65  ? -26.463 -29.048 100.788 1.00 24.72  ? 65  VAL D CA  1 
ATOM   8167  C  C   . VAL D  1 65  ? -26.523 -30.190 99.769  1.00 26.72  ? 65  VAL D C   1 
ATOM   8168  O  O   . VAL D  1 65  ? -26.277 -31.369 100.113 1.00 26.15  ? 65  VAL D O   1 
ATOM   8169  C  CB  . VAL D  1 65  ? -25.004 -28.838 101.271 1.00 25.94  ? 65  VAL D CB  1 
ATOM   8170  C  CG1 . VAL D  1 65  ? -24.092 -28.537 100.103 1.00 22.63  ? 65  VAL D CG1 1 
ATOM   8171  C  CG2 . VAL D  1 65  ? -24.948 -27.718 102.308 1.00 24.12  ? 65  VAL D CG2 1 
ATOM   8172  N  N   . ASP D  1 66  ? -26.853 -29.854 98.540  1.00 25.47  ? 66  ASP D N   1 
ATOM   8173  C  CA  . ASP D  1 66  ? -27.088 -30.851 97.509  1.00 26.39  ? 66  ASP D CA  1 
ATOM   8174  C  C   . ASP D  1 66  ? -26.098 -30.717 96.371  1.00 26.21  ? 66  ASP D C   1 
ATOM   8175  O  O   . ASP D  1 66  ? -26.254 -29.842 95.506  1.00 27.12  ? 66  ASP D O   1 
ATOM   8176  C  CB  . ASP D  1 66  ? -28.533 -30.724 96.977  1.00 29.09  ? 66  ASP D CB  1 
ATOM   8177  C  CG  . ASP D  1 66  ? -28.836 -31.713 95.848  1.00 34.41  ? 66  ASP D CG  1 
ATOM   8178  O  OD1 . ASP D  1 66  ? -27.867 -32.248 95.235  1.00 33.93  ? 66  ASP D OD1 1 
ATOM   8179  O  OD2 . ASP D  1 66  ? -30.045 -31.953 95.568  1.00 36.40  ? 66  ASP D OD2 1 
ATOM   8180  N  N   . PRO D  1 67  ? -25.046 -31.614 96.350  1.00 23.19  ? 67  PRO D N   1 
ATOM   8181  C  CA  . PRO D  1 67  ? -24.001 -31.553 95.380  1.00 24.93  ? 67  PRO D CA  1 
ATOM   8182  C  C   . PRO D  1 67  ? -24.364 -32.241 94.048  1.00 24.60  ? 67  PRO D C   1 
ATOM   8183  O  O   . PRO D  1 67  ? -23.483 -32.868 93.404  1.00 23.09  ? 67  PRO D O   1 
ATOM   8184  C  CB  . PRO D  1 67  ? -22.822 -32.322 96.076  1.00 23.80  ? 67  PRO D CB  1 
ATOM   8185  C  CG  . PRO D  1 67  ? -23.416 -32.858 97.369  1.00 26.51  ? 67  PRO D CG  1 
ATOM   8186  C  CD  . PRO D  1 67  ? -24.879 -32.735 97.255  1.00 23.72  ? 67  PRO D CD  1 
ATOM   8187  N  N   . THR D  1 68  ? -25.627 -32.142 93.644  1.00 23.83  ? 68  THR D N   1 
ATOM   8188  C  CA  . THR D  1 68  ? -26.033 -32.601 92.359  1.00 23.01  ? 68  THR D CA  1 
ATOM   8189  C  C   . THR D  1 68  ? -25.614 -31.550 91.303  1.00 24.09  ? 68  THR D C   1 
ATOM   8190  O  O   . THR D  1 68  ? -26.142 -30.407 91.290  1.00 24.87  ? 68  THR D O   1 
ATOM   8191  C  CB  . THR D  1 68  ? -27.576 -32.819 92.281  1.00 23.91  ? 68  THR D CB  1 
ATOM   8192  O  OG1 . THR D  1 68  ? -28.009 -33.636 93.377  1.00 23.37  ? 68  THR D OG1 1 
ATOM   8193  C  CG2 . THR D  1 68  ? -27.961 -33.498 90.963  1.00 23.39  ? 68  THR D CG2 1 
ATOM   8194  N  N   . VAL D  1 69  ? -24.671 -31.930 90.435  1.00 23.16  ? 69  VAL D N   1 
ATOM   8195  C  CA  . VAL D  1 69  ? -24.131 -31.011 89.395  1.00 25.20  ? 69  VAL D CA  1 
ATOM   8196  C  C   . VAL D  1 69  ? -24.154 -31.685 88.003  1.00 27.03  ? 69  VAL D C   1 
ATOM   8197  O  O   . VAL D  1 69  ? -24.741 -32.738 87.839  1.00 29.43  ? 69  VAL D O   1 
ATOM   8198  C  CB  . VAL D  1 69  ? -22.699 -30.559 89.735  1.00 25.55  ? 69  VAL D CB  1 
ATOM   8199  C  CG1 . VAL D  1 69  ? -22.686 -29.756 91.046  1.00 22.74  ? 69  VAL D CG1 1 
ATOM   8200  C  CG2 . VAL D  1 69  ? -21.751 -31.775 89.828  1.00 21.85  ? 69  VAL D CG2 1 
ATOM   8201  N  N   . MET D  1 70  ? -23.504 -31.048 87.000  1.00 27.01  ? 70  MET D N   1 
ATOM   8202  C  CA  . MET D  1 70  ? -23.427 -31.658 85.624  1.00 25.71  ? 70  MET D CA  1 
ATOM   8203  C  C   . MET D  1 70  ? -22.942 -33.058 85.721  1.00 25.86  ? 70  MET D C   1 
ATOM   8204  O  O   . MET D  1 70  ? -21.868 -33.326 86.332  1.00 23.41  ? 70  MET D O   1 
ATOM   8205  C  CB  . MET D  1 70  ? -22.493 -30.871 84.718  1.00 26.86  ? 70  MET D CB  1 
ATOM   8206  C  CG  . MET D  1 70  ? -22.632 -31.250 83.199  1.00 25.60  ? 70  MET D CG  1 
ATOM   8207  S  SD  . MET D  1 70  ? -21.034 -31.531 82.355  1.00 31.06  ? 70  MET D SD  1 
ATOM   8208  C  CE  . MET D  1 70  ? -20.674 -33.246 82.884  1.00 26.49  ? 70  MET D CE  1 
ATOM   8209  N  N   . GLY D  1 71  ? -23.685 -33.979 85.135  1.00 22.68  ? 71  GLY D N   1 
ATOM   8210  C  CA  . GLY D  1 71  ? -23.321 -35.366 85.176  1.00 23.42  ? 71  GLY D CA  1 
ATOM   8211  C  C   . GLY D  1 71  ? -24.139 -36.155 86.172  1.00 23.82  ? 71  GLY D C   1 
ATOM   8212  O  O   . GLY D  1 71  ? -24.154 -37.379 86.136  1.00 24.04  ? 71  GLY D O   1 
ATOM   8213  N  N   . LEU D  1 72  ? -24.826 -35.442 87.081  1.00 23.68  ? 72  LEU D N   1 
ATOM   8214  C  CA  . LEU D  1 72  ? -25.727 -36.100 88.072  1.00 24.32  ? 72  LEU D CA  1 
ATOM   8215  C  C   . LEU D  1 72  ? -27.113 -35.637 87.898  1.00 23.58  ? 72  LEU D C   1 
ATOM   8216  O  O   . LEU D  1 72  ? -28.020 -36.009 88.682  1.00 24.63  ? 72  LEU D O   1 
ATOM   8217  C  CB  . LEU D  1 72  ? -25.254 -35.833 89.517  1.00 23.71  ? 72  LEU D CB  1 
ATOM   8218  C  CG  . LEU D  1 72  ? -23.926 -36.410 89.921  1.00 23.74  ? 72  LEU D CG  1 
ATOM   8219  C  CD1 . LEU D  1 72  ? -23.602 -36.016 91.363  1.00 25.07  ? 72  LEU D CD1 1 
ATOM   8220  C  CD2 . LEU D  1 72  ? -23.914 -37.947 89.757  1.00 21.75  ? 72  LEU D CD2 1 
ATOM   8221  N  N   . GLY D  1 73  ? -27.327 -34.808 86.885  1.00 24.92  ? 73  GLY D N   1 
ATOM   8222  C  CA  . GLY D  1 73  ? -28.693 -34.364 86.520  1.00 23.63  ? 73  GLY D CA  1 
ATOM   8223  C  C   . GLY D  1 73  ? -29.235 -33.186 87.337  1.00 25.51  ? 73  GLY D C   1 
ATOM   8224  O  O   . GLY D  1 73  ? -30.420 -33.149 87.669  1.00 24.54  ? 73  GLY D O   1 
ATOM   8225  N  N   . ARG D  1 74  ? -28.364 -32.220 87.658  1.00 22.69  ? 74  ARG D N   1 
ATOM   8226  C  CA  . ARG D  1 74  ? -28.810 -30.982 88.362  1.00 26.06  ? 74  ARG D CA  1 
ATOM   8227  C  C   . ARG D  1 74  ? -30.011 -30.346 87.643  1.00 28.10  ? 74  ARG D C   1 
ATOM   8228  O  O   . ARG D  1 74  ? -29.992 -30.172 86.451  1.00 27.85  ? 74  ARG D O   1 
ATOM   8229  C  CB  . ARG D  1 74  ? -27.682 -29.976 88.458  1.00 27.49  ? 74  ARG D CB  1 
ATOM   8230  C  CG  . ARG D  1 74  ? -28.080 -28.670 89.156  1.00 28.20  ? 74  ARG D CG  1 
ATOM   8231  C  CD  . ARG D  1 74  ? -26.937 -27.663 89.164  1.00 27.29  ? 74  ARG D CD  1 
ATOM   8232  N  NE  . ARG D  1 74  ? -26.620 -27.187 87.830  1.00 27.36  ? 74  ARG D NE  1 
ATOM   8233  C  CZ  . ARG D  1 74  ? -25.704 -26.246 87.562  1.00 25.78  ? 74  ARG D CZ  1 
ATOM   8234  N  NH1 . ARG D  1 74  ? -25.005 -25.674 88.562  1.00 21.47  ? 74  ARG D NH1 1 
ATOM   8235  N  NH2 . ARG D  1 74  ? -25.484 -25.870 86.294  1.00 25.53  ? 74  ARG D NH2 1 
ATOM   8236  N  N   . ASP D  1 75  ? -31.038 -30.011 88.402  1.00 29.01  ? 75  ASP D N   1 
ATOM   8237  C  CA  . ASP D  1 75  ? -32.229 -29.369 87.854  1.00 30.82  ? 75  ASP D CA  1 
ATOM   8238  C  C   . ASP D  1 75  ? -32.757 -28.345 88.864  1.00 31.59  ? 75  ASP D C   1 
ATOM   8239  O  O   . ASP D  1 75  ? -33.527 -28.699 89.808  1.00 28.96  ? 75  ASP D O   1 
ATOM   8240  C  CB  . ASP D  1 75  ? -33.289 -30.410 87.540  1.00 33.99  ? 75  ASP D CB  1 
ATOM   8241  C  CG  . ASP D  1 75  ? -34.546 -29.803 86.897  1.00 37.72  ? 75  ASP D CG  1 
ATOM   8242  O  OD1 . ASP D  1 75  ? -35.367 -30.561 86.404  1.00 45.23  ? 75  ASP D OD1 1 
ATOM   8243  O  OD2 . ASP D  1 75  ? -34.686 -28.583 86.903  1.00 46.07  ? 75  ASP D OD2 1 
ATOM   8244  N  N   . ILE D  1 76  ? -32.349 -27.079 88.685  1.00 27.64  ? 76  ILE D N   1 
ATOM   8245  C  CA  . ILE D  1 76  ? -32.638 -26.042 89.648  1.00 30.40  ? 76  ILE D CA  1 
ATOM   8246  C  C   . ILE D  1 76  ? -34.140 -25.833 89.851  1.00 33.62  ? 76  ILE D C   1 
ATOM   8247  O  O   . ILE D  1 76  ? -34.583 -25.517 90.948  1.00 32.86  ? 76  ILE D O   1 
ATOM   8248  C  CB  . ILE D  1 76  ? -31.976 -24.688 89.251  1.00 30.28  ? 76  ILE D CB  1 
ATOM   8249  C  CG1 . ILE D  1 76  ? -31.906 -23.750 90.467  1.00 31.93  ? 76  ILE D CG1 1 
ATOM   8250  C  CG2 . ILE D  1 76  ? -32.717 -24.050 88.122  1.00 30.43  ? 76  ILE D CG2 1 
ATOM   8251  C  CD1 . ILE D  1 76  ? -31.070 -24.308 91.624  1.00 29.66  ? 76  ILE D CD1 1 
ATOM   8252  N  N   . ARG D  1 77  ? -34.915 -26.016 88.784  1.00 32.31  ? 77  ARG D N   1 
ATOM   8253  C  CA  . ARG D  1 77  ? -36.338 -25.810 88.853  1.00 33.47  ? 77  ARG D CA  1 
ATOM   8254  C  C   . ARG D  1 77  ? -37.015 -26.898 89.660  1.00 31.71  ? 77  ARG D C   1 
ATOM   8255  O  O   . ARG D  1 77  ? -37.956 -26.631 90.407  1.00 36.61  ? 77  ARG D O   1 
ATOM   8256  C  CB  . ARG D  1 77  ? -36.939 -25.702 87.438  1.00 36.85  ? 77  ARG D CB  1 
ATOM   8257  C  CG  . ARG D  1 77  ? -36.595 -24.375 86.747  1.00 36.65  ? 77  ARG D CG  1 
ATOM   8258  C  CD  . ARG D  1 77  ? -36.916 -24.395 85.266  1.00 37.82  ? 77  ARG D CD  1 
ATOM   8259  N  NE  . ARG D  1 77  ? -36.497 -23.149 84.614  1.00 39.30  ? 77  ARG D NE  1 
ATOM   8260  C  CZ  . ARG D  1 77  ? -35.248 -22.906 84.182  1.00 39.65  ? 77  ARG D CZ  1 
ATOM   8261  N  NH1 . ARG D  1 77  ? -34.299 -23.826 84.334  1.00 35.44  ? 77  ARG D NH1 1 
ATOM   8262  N  NH2 . ARG D  1 77  ? -34.951 -21.738 83.599  1.00 35.60  ? 77  ARG D NH2 1 
ATOM   8263  N  N   . PHE D  1 78  ? -36.537 -28.121 89.523  1.00 29.93  ? 78  PHE D N   1 
ATOM   8264  C  CA  . PHE D  1 78  ? -37.025 -29.198 90.337  1.00 31.16  ? 78  PHE D CA  1 
ATOM   8265  C  C   . PHE D  1 78  ? -36.711 -28.887 91.821  1.00 31.04  ? 78  PHE D C   1 
ATOM   8266  O  O   . PHE D  1 78  ? -37.565 -29.050 92.701  1.00 31.86  ? 78  PHE D O   1 
ATOM   8267  C  CB  . PHE D  1 78  ? -36.391 -30.536 89.912  1.00 30.11  ? 78  PHE D CB  1 
ATOM   8268  C  CG  . PHE D  1 78  ? -36.766 -31.724 90.826  1.00 30.48  ? 78  PHE D CG  1 
ATOM   8269  C  CD1 . PHE D  1 78  ? -35.889 -32.159 91.833  1.00 29.41  ? 78  PHE D CD1 1 
ATOM   8270  C  CD2 . PHE D  1 78  ? -38.000 -32.400 90.665  1.00 30.58  ? 78  PHE D CD2 1 
ATOM   8271  C  CE1 . PHE D  1 78  ? -36.228 -33.236 92.661  1.00 30.81  ? 78  PHE D CE1 1 
ATOM   8272  C  CE2 . PHE D  1 78  ? -38.339 -33.475 91.490  1.00 29.38  ? 78  PHE D CE2 1 
ATOM   8273  C  CZ  . PHE D  1 78  ? -37.457 -33.894 92.487  1.00 29.69  ? 78  PHE D CZ  1 
ATOM   8274  N  N   . MET D  1 79  ? -35.497 -28.434 92.071  1.00 29.33  ? 79  MET D N   1 
ATOM   8275  C  CA  . MET D  1 79  ? -35.093 -28.053 93.384  1.00 32.88  ? 79  MET D CA  1 
ATOM   8276  C  C   . MET D  1 79  ? -36.022 -26.914 93.972  1.00 36.82  ? 79  MET D C   1 
ATOM   8277  O  O   . MET D  1 79  ? -36.411 -26.959 95.159  1.00 37.90  ? 79  MET D O   1 
ATOM   8278  C  CB  . MET D  1 79  ? -33.632 -27.609 93.385  1.00 28.63  ? 79  MET D CB  1 
ATOM   8279  C  CG  . MET D  1 79  ? -32.647 -28.731 93.079  1.00 34.21  ? 79  MET D CG  1 
ATOM   8280  S  SD  . MET D  1 79  ? -30.920 -28.148 92.945  1.00 37.50  ? 79  MET D SD  1 
ATOM   8281  C  CE  . MET D  1 79  ? -30.032 -29.678 93.213  1.00 44.94  ? 79  MET D CE  1 
ATOM   8282  N  N   . GLU D  1 80  ? -36.359 -25.910 93.126  1.00 38.20  ? 80  GLU D N   1 
ATOM   8283  C  CA  . GLU D  1 80  ? -37.292 -24.781 93.558  1.00 38.77  ? 80  GLU D CA  1 
ATOM   8284  C  C   . GLU D  1 80  ? -38.576 -25.315 94.031  1.00 39.47  ? 80  GLU D C   1 
ATOM   8285  O  O   . GLU D  1 80  ? -39.061 -24.939 95.088  1.00 41.01  ? 80  GLU D O   1 
ATOM   8286  C  CB  . GLU D  1 80  ? -37.543 -23.814 92.408  1.00 41.58  ? 80  GLU D CB  1 
ATOM   8287  C  CG  . GLU D  1 80  ? -36.421 -22.857 92.133  1.00 45.24  ? 80  GLU D CG  1 
ATOM   8288  C  CD  . GLU D  1 80  ? -36.663 -22.020 90.858  1.00 49.46  ? 80  GLU D CD  1 
ATOM   8289  O  OE1 . GLU D  1 80  ? -37.242 -22.569 89.882  1.00 48.19  ? 80  GLU D OE1 1 
ATOM   8290  O  OE2 . GLU D  1 80  ? -36.272 -20.818 90.838  1.00 46.99  ? 80  GLU D OE2 1 
ATOM   8291  N  N   . LYS D  1 81  ? -39.157 -26.206 93.248  1.00 42.04  ? 81  LYS D N   1 
ATOM   8292  C  CA  . LYS D  1 81  ? -40.423 -26.803 93.593  1.00 41.38  ? 81  LYS D CA  1 
ATOM   8293  C  C   . LYS D  1 81  ? -40.356 -27.517 94.968  1.00 40.96  ? 81  LYS D C   1 
ATOM   8294  O  O   . LYS D  1 81  ? -41.279 -27.433 95.756  1.00 43.54  ? 81  LYS D O   1 
ATOM   8295  C  CB  . LYS D  1 81  ? -40.870 -27.779 92.502  1.00 45.52  ? 81  LYS D CB  1 
ATOM   8296  C  CG  . LYS D  1 81  ? -41.011 -27.139 91.119  1.00 54.79  ? 81  LYS D CG  1 
ATOM   8297  C  CD  . LYS D  1 81  ? -41.476 -28.155 90.069  1.00 63.12  ? 81  LYS D CD  1 
ATOM   8298  C  CE  . LYS D  1 81  ? -42.881 -28.667 90.373  1.00 77.84  ? 81  LYS D CE  1 
ATOM   8299  N  NZ  . LYS D  1 81  ? -43.381 -29.595 89.310  1.00 81.65  ? 81  LYS D NZ  1 
ATOM   8300  N  N   . VAL D  1 82  ? -39.245 -28.211 95.229  1.00 35.60  ? 82  VAL D N   1 
ATOM   8301  C  CA  . VAL D  1 82  ? -39.069 -28.911 96.515  1.00 35.24  ? 82  VAL D CA  1 
ATOM   8302  C  C   . VAL D  1 82  ? -38.965 -27.924 97.691  1.00 33.65  ? 82  VAL D C   1 
ATOM   8303  O  O   . VAL D  1 82  ? -39.477 -28.171 98.741  1.00 33.73  ? 82  VAL D O   1 
ATOM   8304  C  CB  . VAL D  1 82  ? -37.842 -29.839 96.501  1.00 34.92  ? 82  VAL D CB  1 
ATOM   8305  C  CG1 . VAL D  1 82  ? -37.531 -30.328 97.906  1.00 29.73  ? 82  VAL D CG1 1 
ATOM   8306  C  CG2 . VAL D  1 82  ? -38.080 -31.019 95.552  1.00 29.43  ? 82  VAL D CG2 1 
ATOM   8307  N  N   . VAL D  1 83  ? -38.292 -26.811 97.468  1.00 34.79  ? 83  VAL D N   1 
ATOM   8308  C  CA  . VAL D  1 83  ? -38.173 -25.805 98.467  1.00 36.66  ? 83  VAL D CA  1 
ATOM   8309  C  C   . VAL D  1 83  ? -39.569 -25.200 98.821  1.00 38.42  ? 83  VAL D C   1 
ATOM   8310  O  O   . VAL D  1 83  ? -39.925 -25.081 99.988  1.00 37.70  ? 83  VAL D O   1 
ATOM   8311  C  CB  . VAL D  1 83  ? -37.215 -24.676 98.029  1.00 34.77  ? 83  VAL D CB  1 
ATOM   8312  C  CG1 . VAL D  1 83  ? -37.346 -23.476 98.957  1.00 33.11  ? 83  VAL D CG1 1 
ATOM   8313  C  CG2 . VAL D  1 83  ? -35.776 -25.181 97.993  1.00 30.88  ? 83  VAL D CG2 1 
ATOM   8314  N  N   . LYS D  1 84  ? -40.324 -24.840 97.807  1.00 41.47  ? 84  LYS D N   1 
ATOM   8315  C  CA  . LYS D  1 84  ? -41.645 -24.236 98.023  1.00 46.89  ? 84  LYS D CA  1 
ATOM   8316  C  C   . LYS D  1 84  ? -42.630 -25.205 98.680  1.00 45.08  ? 84  LYS D C   1 
ATOM   8317  O  O   . LYS D  1 84  ? -43.581 -24.785 99.320  1.00 44.57  ? 84  LYS D O   1 
ATOM   8318  C  CB  . LYS D  1 84  ? -42.221 -23.679 96.704  1.00 50.11  ? 84  LYS D CB  1 
ATOM   8319  C  CG  . LYS D  1 84  ? -41.831 -22.233 96.435  1.00 56.57  ? 84  LYS D CG  1 
ATOM   8320  C  CD  . LYS D  1 84  ? -42.228 -21.792 95.050  1.00 63.07  ? 84  LYS D CD  1 
ATOM   8321  C  CE  . LYS D  1 84  ? -41.287 -22.353 94.007  1.00 64.08  ? 84  LYS D CE  1 
ATOM   8322  N  NZ  . LYS D  1 84  ? -41.548 -21.777 92.669  1.00 69.69  ? 84  LYS D NZ  1 
ATOM   8323  N  N   . ALA D  1 85  ? -42.387 -26.493 98.519  1.00 41.82  ? 85  ALA D N   1 
ATOM   8324  C  CA  . ALA D  1 85  ? -43.244 -27.495 99.106  1.00 43.15  ? 85  ALA D CA  1 
ATOM   8325  C  C   . ALA D  1 85  ? -42.781 -27.896 100.554 1.00 42.19  ? 85  ALA D C   1 
ATOM   8326  O  O   . ALA D  1 85  ? -43.483 -28.618 101.258 1.00 44.47  ? 85  ALA D O   1 
ATOM   8327  C  CB  . ALA D  1 85  ? -43.318 -28.720 98.213  1.00 37.06  ? 85  ALA D CB  1 
ATOM   8328  N  N   . THR D  1 86  ? -41.612 -27.411 100.964 1.00 35.18  ? 86  THR D N   1 
ATOM   8329  C  CA  . THR D  1 86  ? -41.024 -27.825 102.262 1.00 35.05  ? 86  THR D CA  1 
ATOM   8330  C  C   . THR D  1 86  ? -40.571 -26.649 103.131 1.00 35.61  ? 86  THR D C   1 
ATOM   8331  O  O   . THR D  1 86  ? -40.743 -26.668 104.331 1.00 37.62  ? 86  THR D O   1 
ATOM   8332  C  CB  . THR D  1 86  ? -39.834 -28.762 102.054 1.00 36.34  ? 86  THR D CB  1 
ATOM   8333  O  OG1 . THR D  1 86  ? -38.790 -28.069 101.315 1.00 32.76  ? 86  THR D OG1 1 
ATOM   8334  C  CG2 . THR D  1 86  ? -40.265 -30.017 101.281 1.00 33.54  ? 86  THR D CG2 1 
ATOM   8335  N  N   . GLY D  1 87  ? -39.979 -25.627 102.497 1.00 36.99  ? 87  GLY D N   1 
ATOM   8336  C  CA  . GLY D  1 87  ? -39.442 -24.448 103.244 1.00 36.23  ? 87  GLY D CA  1 
ATOM   8337  C  C   . GLY D  1 87  ? -38.000 -24.683 103.740 1.00 38.55  ? 87  GLY D C   1 
ATOM   8338  O  O   . GLY D  1 87  ? -37.448 -23.876 104.474 1.00 40.22  ? 87  GLY D O   1 
ATOM   8339  N  N   . ILE D  1 88  ? -37.413 -25.797 103.323 1.00 36.04  ? 88  ILE D N   1 
ATOM   8340  C  CA  . ILE D  1 88  ? -36.061 -26.123 103.683 1.00 31.31  ? 88  ILE D CA  1 
ATOM   8341  C  C   . ILE D  1 88  ? -35.082 -25.109 103.093 1.00 30.69  ? 88  ILE D C   1 
ATOM   8342  O  O   . ILE D  1 88  ? -35.320 -24.562 102.046 1.00 32.56  ? 88  ILE D O   1 
ATOM   8343  C  CB  . ILE D  1 88  ? -35.680 -27.519 103.163 1.00 33.98  ? 88  ILE D CB  1 
ATOM   8344  C  CG1 . ILE D  1 88  ? -34.280 -27.921 103.649 1.00 30.82  ? 88  ILE D CG1 1 
ATOM   8345  C  CG2 . ILE D  1 88  ? -35.746 -27.556 101.629 1.00 34.40  ? 88  ILE D CG2 1 
ATOM   8346  C  CD1 . ILE D  1 88  ? -34.215 -28.261 105.113 1.00 33.64  ? 88  ILE D CD1 1 
ATOM   8347  N  N   . ASN D  1 89  ? -33.979 -24.862 103.802 1.00 31.54  ? 89  ASN D N   1 
ATOM   8348  C  CA  . ASN D  1 89  ? -32.865 -24.142 103.228 1.00 29.88  ? 89  ASN D CA  1 
ATOM   8349  C  C   . ASN D  1 89  ? -32.129 -25.069 102.378 1.00 30.99  ? 89  ASN D C   1 
ATOM   8350  O  O   . ASN D  1 89  ? -31.610 -26.079 102.860 1.00 32.13  ? 89  ASN D O   1 
ATOM   8351  C  CB  . ASN D  1 89  ? -31.923 -23.614 104.331 1.00 33.20  ? 89  ASN D CB  1 
ATOM   8352  C  CG  . ASN D  1 89  ? -32.511 -22.446 105.101 1.00 35.44  ? 89  ASN D CG  1 
ATOM   8353  O  OD1 . ASN D  1 89  ? -33.493 -21.839 104.684 1.00 33.64  ? 89  ASN D OD1 1 
ATOM   8354  N  ND2 . ASN D  1 89  ? -31.904 -22.127 106.228 1.00 35.63  ? 89  ASN D ND2 1 
ATOM   8355  N  N   . LEU D  1 90  ? -32.066 -24.775 101.096 1.00 32.51  ? 90  LEU D N   1 
ATOM   8356  C  CA  . LEU D  1 90  ? -31.372 -25.661 100.144 1.00 31.45  ? 90  LEU D CA  1 
ATOM   8357  C  C   . LEU D  1 90  ? -30.263 -24.937 99.412  1.00 31.17  ? 90  LEU D C   1 
ATOM   8358  O  O   . LEU D  1 90  ? -30.502 -23.928 98.728  1.00 31.84  ? 90  LEU D O   1 
ATOM   8359  C  CB  . LEU D  1 90  ? -32.364 -26.254 99.142  1.00 28.82  ? 90  LEU D CB  1 
ATOM   8360  C  CG  . LEU D  1 90  ? -31.792 -27.250 98.110  1.00 32.34  ? 90  LEU D CG  1 
ATOM   8361  C  CD1 . LEU D  1 90  ? -31.299 -28.551 98.790  1.00 28.17  ? 90  LEU D CD1 1 
ATOM   8362  C  CD2 . LEU D  1 90  ? -32.816 -27.557 97.026  1.00 30.67  ? 90  LEU D CD2 1 
ATOM   8363  N  N   . VAL D  1 91  ? -29.062 -25.434 99.549  1.00 30.34  ? 91  VAL D N   1 
ATOM   8364  C  CA  . VAL D  1 91  ? -27.936 -24.873 98.848  1.00 29.47  ? 91  VAL D CA  1 
ATOM   8365  C  C   . VAL D  1 91  ? -27.596 -25.717 97.638  1.00 31.31  ? 91  VAL D C   1 
ATOM   8366  O  O   . VAL D  1 91  ? -27.233 -26.901 97.772  1.00 28.29  ? 91  VAL D O   1 
ATOM   8367  C  CB  . VAL D  1 91  ? -26.703 -24.794 99.741  1.00 30.48  ? 91  VAL D CB  1 
ATOM   8368  C  CG1 . VAL D  1 91  ? -25.574 -24.045 99.020  1.00 25.93  ? 91  VAL D CG1 1 
ATOM   8369  C  CG2 . VAL D  1 91  ? -27.050 -24.114 101.085 1.00 30.70  ? 91  VAL D CG2 1 
ATOM   8370  N  N   . ALA D  1 92  ? -27.715 -25.122 96.449  1.00 31.83  ? 92  ALA D N   1 
ATOM   8371  C  CA  . ALA D  1 92  ? -27.324 -25.811 95.187  1.00 32.74  ? 92  ALA D CA  1 
ATOM   8372  C  C   . ALA D  1 92  ? -25.941 -25.422 94.816  1.00 27.90  ? 92  ALA D C   1 
ATOM   8373  O  O   . ALA D  1 92  ? -25.467 -24.400 95.222  1.00 34.15  ? 92  ALA D O   1 
ATOM   8374  C  CB  . ALA D  1 92  ? -28.295 -25.467 94.066  1.00 31.53  ? 92  ALA D CB  1 
ATOM   8375  N  N   . GLY D  1 93  ? -25.282 -26.253 94.036  1.00 28.37  ? 93  GLY D N   1 
ATOM   8376  C  CA  . GLY D  1 93  ? -23.892 -25.985 93.647  1.00 27.01  ? 93  GLY D CA  1 
ATOM   8377  C  C   . GLY D  1 93  ? -23.646 -26.024 92.149  1.00 25.73  ? 93  GLY D C   1 
ATOM   8378  O  O   . GLY D  1 93  ? -24.583 -26.187 91.350  1.00 23.58  ? 93  GLY D O   1 
ATOM   8379  N  N   . THR D  1 94  ? -22.391 -25.865 91.770  1.00 24.79  ? 94  THR D N   1 
ATOM   8380  C  CA  . THR D  1 94  ? -21.990 -25.991 90.418  1.00 27.36  ? 94  THR D CA  1 
ATOM   8381  C  C   . THR D  1 94  ? -20.781 -26.889 90.359  1.00 29.39  ? 94  THR D C   1 
ATOM   8382  O  O   . THR D  1 94  ? -20.204 -27.244 91.408  1.00 29.11  ? 94  THR D O   1 
ATOM   8383  C  CB  . THR D  1 94  ? -21.644 -24.582 89.766  1.00 28.06  ? 94  THR D CB  1 
ATOM   8384  O  OG1 . THR D  1 94  ? -21.371 -24.746 88.370  1.00 31.29  ? 94  THR D OG1 1 
ATOM   8385  C  CG2 . THR D  1 94  ? -20.430 -23.945 90.447  1.00 27.75  ? 94  THR D CG2 1 
ATOM   8386  N  N   . GLY D  1 95  ? -20.382 -27.272 89.151  1.00 27.28  ? 95  GLY D N   1 
ATOM   8387  C  CA  . GLY D  1 95  ? -19.246 -28.139 88.975  1.00 24.63  ? 95  GLY D CA  1 
ATOM   8388  C  C   . GLY D  1 95  ? -19.495 -29.215 87.938  1.00 26.81  ? 95  GLY D C   1 
ATOM   8389  O  O   . GLY D  1 95  ? -20.515 -29.188 87.217  1.00 27.40  ? 95  GLY D O   1 
ATOM   8390  N  N   . ILE D  1 96  ? -18.578 -30.162 87.851  1.00 25.25  ? 96  ILE D N   1 
ATOM   8391  C  CA  . ILE D  1 96  ? -18.698 -31.246 86.912  1.00 25.75  ? 96  ILE D CA  1 
ATOM   8392  C  C   . ILE D  1 96  ? -18.350 -32.542 87.561  1.00 27.34  ? 96  ILE D C   1 
ATOM   8393  O  O   . ILE D  1 96  ? -17.274 -32.671 88.234  1.00 26.65  ? 96  ILE D O   1 
ATOM   8394  C  CB  . ILE D  1 96  ? -17.780 -31.038 85.682  1.00 28.49  ? 96  ILE D CB  1 
ATOM   8395  C  CG1 . ILE D  1 96  ? -18.200 -29.798 84.906  1.00 29.93  ? 96  ILE D CG1 1 
ATOM   8396  C  CG2 . ILE D  1 96  ? -17.805 -32.271 84.773  1.00 27.89  ? 96  ILE D CG2 1 
ATOM   8397  C  CD1 . ILE D  1 96  ? -17.228 -29.417 83.789  1.00 33.28  ? 96  ILE D CD1 1 
ATOM   8398  N  N   . TYR D  1 97  ? -19.211 -33.522 87.382  1.00 26.16  ? 97  TYR D N   1 
ATOM   8399  C  CA  . TYR D  1 97  ? -19.013 -34.828 87.947  1.00 26.91  ? 97  TYR D CA  1 
ATOM   8400  C  C   . TYR D  1 97  ? -18.571 -35.868 86.825  1.00 26.56  ? 97  TYR D C   1 
ATOM   8401  O  O   . TYR D  1 97  ? -19.389 -36.354 86.077  1.00 25.08  ? 97  TYR D O   1 
ATOM   8402  C  CB  . TYR D  1 97  ? -20.301 -35.281 88.628  1.00 28.94  ? 97  TYR D CB  1 
ATOM   8403  C  CG  . TYR D  1 97  ? -20.235 -36.613 89.370  1.00 29.38  ? 97  TYR D CG  1 
ATOM   8404  C  CD1 . TYR D  1 97  ? -20.212 -37.816 88.678  1.00 30.46  ? 97  TYR D CD1 1 
ATOM   8405  C  CD2 . TYR D  1 97  ? -20.242 -36.656 90.799  1.00 31.11  ? 97  TYR D CD2 1 
ATOM   8406  C  CE1 . TYR D  1 97  ? -20.171 -39.029 89.348  1.00 33.02  ? 97  TYR D CE1 1 
ATOM   8407  C  CE2 . TYR D  1 97  ? -20.203 -37.863 91.484  1.00 31.38  ? 97  TYR D CE2 1 
ATOM   8408  C  CZ  . TYR D  1 97  ? -20.169 -39.047 90.773  1.00 37.40  ? 97  TYR D CZ  1 
ATOM   8409  O  OH  . TYR D  1 97  ? -20.132 -40.247 91.444  1.00 36.42  ? 97  TYR D OH  1 
ATOM   8410  N  N   . ILE D  1 98  ? -17.251 -36.155 86.753  1.00 26.59  ? 98  ILE D N   1 
ATOM   8411  C  CA  . ILE D  1 98  ? -16.721 -37.174 85.804  1.00 26.53  ? 98  ILE D CA  1 
ATOM   8412  C  C   . ILE D  1 98  ? -15.698 -38.077 86.464  1.00 29.09  ? 98  ILE D C   1 
ATOM   8413  O  O   . ILE D  1 98  ? -15.040 -37.683 87.411  1.00 31.42  ? 98  ILE D O   1 
ATOM   8414  C  CB  . ILE D  1 98  ? -16.063 -36.522 84.562  1.00 29.89  ? 98  ILE D CB  1 
ATOM   8415  C  CG1 . ILE D  1 98  ? -14.881 -35.606 84.990  1.00 29.61  ? 98  ILE D CG1 1 
ATOM   8416  C  CG2 . ILE D  1 98  ? -17.115 -35.760 83.715  1.00 26.91  ? 98  ILE D CG2 1 
ATOM   8417  C  CD1 . ILE D  1 98  ? -13.944 -35.224 83.849  1.00 29.97  ? 98  ILE D CD1 1 
ATOM   8418  N  N   . TYR D  1 99  ? -15.564 -39.304 85.946  1.00 28.84  ? 99  TYR D N   1 
ATOM   8419  C  CA  . TYR D  1 99  ? -14.547 -40.209 86.411  1.00 27.93  ? 99  TYR D CA  1 
ATOM   8420  C  C   . TYR D  1 99  ? -13.371 -40.266 85.452  1.00 28.78  ? 99  TYR D C   1 
ATOM   8421  O  O   . TYR D  1 99  ? -12.243 -40.442 85.862  1.00 33.01  ? 99  TYR D O   1 
ATOM   8422  C  CB  . TYR D  1 99  ? -15.115 -41.639 86.599  1.00 32.81  ? 99  TYR D CB  1 
ATOM   8423  C  CG  . TYR D  1 99  ? -16.089 -41.793 87.756  1.00 36.53  ? 99  TYR D CG  1 
ATOM   8424  C  CD1 . TYR D  1 99  ? -16.337 -40.733 88.640  1.00 34.04  ? 99  TYR D CD1 1 
ATOM   8425  C  CD2 . TYR D  1 99  ? -16.743 -43.018 87.986  1.00 33.22  ? 99  TYR D CD2 1 
ATOM   8426  C  CE1 . TYR D  1 99  ? -17.217 -40.876 89.697  1.00 36.01  ? 99  TYR D CE1 1 
ATOM   8427  C  CE2 . TYR D  1 99  ? -17.622 -43.173 89.037  1.00 36.83  ? 99  TYR D CE2 1 
ATOM   8428  C  CZ  . TYR D  1 99  ? -17.862 -42.104 89.896  1.00 35.45  ? 99  TYR D CZ  1 
ATOM   8429  O  OH  . TYR D  1 99  ? -18.719 -42.254 90.925  1.00 32.98  ? 99  TYR D OH  1 
ATOM   8430  N  N   . ILE D  1 100 ? -13.643 -40.128 84.184  1.00 30.67  ? 100 ILE D N   1 
ATOM   8431  C  CA  . ILE D  1 100 ? -12.595 -40.308 83.169  1.00 32.18  ? 100 ILE D CA  1 
ATOM   8432  C  C   . ILE D  1 100 ? -12.409 -39.082 82.281  1.00 33.55  ? 100 ILE D C   1 
ATOM   8433  O  O   . ILE D  1 100 ? -11.458 -38.285 82.480  1.00 31.69  ? 100 ILE D O   1 
ATOM   8434  C  CB  . ILE D  1 100 ? -12.863 -41.560 82.294  1.00 34.05  ? 100 ILE D CB  1 
ATOM   8435  C  CG1 . ILE D  1 100 ? -13.101 -42.803 83.193  1.00 31.53  ? 100 ILE D CG1 1 
ATOM   8436  C  CG2 . ILE D  1 100 ? -11.706 -41.794 81.321  1.00 31.56  ? 100 ILE D CG2 1 
ATOM   8437  C  CD1 . ILE D  1 100 ? -13.274 -44.085 82.434  1.00 31.32  ? 100 ILE D CD1 1 
ATOM   8438  N  N   . ASP D  1 101 ? -13.292 -38.920 81.306  1.00 31.03  ? 101 ASP D N   1 
ATOM   8439  C  CA  . ASP D  1 101 ? -13.174 -37.820 80.364  1.00 33.95  ? 101 ASP D CA  1 
ATOM   8440  C  C   . ASP D  1 101 ? -14.333 -36.872 80.441  1.00 31.23  ? 101 ASP D C   1 
ATOM   8441  O  O   . ASP D  1 101 ? -15.413 -37.228 80.911  1.00 32.03  ? 101 ASP D O   1 
ATOM   8442  C  CB  . ASP D  1 101 ? -13.017 -38.357 78.909  1.00 36.19  ? 101 ASP D CB  1 
ATOM   8443  C  CG  . ASP D  1 101 ? -11.586 -38.922 78.629  1.00 47.78  ? 101 ASP D CG  1 
ATOM   8444  O  OD1 . ASP D  1 101 ? -10.728 -38.862 79.540  1.00 49.94  ? 101 ASP D OD1 1 
ATOM   8445  O  OD2 . ASP D  1 101 ? -11.346 -39.416 77.497  1.00 54.34  ? 101 ASP D OD2 1 
ATOM   8446  N  N   . LEU D  1 102 ? -14.103 -35.651 79.988  1.00 28.75  ? 102 LEU D N   1 
ATOM   8447  C  CA  . LEU D  1 102 ? -15.132 -34.669 79.877  1.00 29.37  ? 102 LEU D CA  1 
ATOM   8448  C  C   . LEU D  1 102 ? -15.971 -34.960 78.651  1.00 29.04  ? 102 LEU D C   1 
ATOM   8449  O  O   . LEU D  1 102 ? -15.541 -35.667 77.772  1.00 30.00  ? 102 LEU D O   1 
ATOM   8450  C  CB  . LEU D  1 102 ? -14.504 -33.255 79.748  1.00 26.96  ? 102 LEU D CB  1 
ATOM   8451  C  CG  . LEU D  1 102 ? -13.934 -32.618 80.999  1.00 28.18  ? 102 LEU D CG  1 
ATOM   8452  C  CD1 . LEU D  1 102 ? -12.861 -31.559 80.644  1.00 27.25  ? 102 LEU D CD1 1 
ATOM   8453  C  CD2 . LEU D  1 102 ? -15.047 -31.993 81.814  1.00 25.50  ? 102 LEU D CD2 1 
ATOM   8454  N  N   . PRO D  1 103 ? -17.189 -34.412 78.604  1.00 27.39  ? 103 PRO D N   1 
ATOM   8455  C  CA  . PRO D  1 103 ? -18.002 -34.488 77.400  1.00 29.64  ? 103 PRO D CA  1 
ATOM   8456  C  C   . PRO D  1 103 ? -17.255 -33.816 76.196  1.00 31.64  ? 103 PRO D C   1 
ATOM   8457  O  O   . PRO D  1 103 ? -16.479 -32.862 76.392  1.00 30.04  ? 103 PRO D O   1 
ATOM   8458  C  CB  . PRO D  1 103 ? -19.270 -33.678 77.777  1.00 29.31  ? 103 PRO D CB  1 
ATOM   8459  C  CG  . PRO D  1 103 ? -19.334 -33.750 79.275  1.00 25.47  ? 103 PRO D CG  1 
ATOM   8460  C  CD  . PRO D  1 103 ? -17.900 -33.733 79.724  1.00 28.67  ? 103 PRO D CD  1 
ATOM   8461  N  N   A PHE D  1 104 ? -17.496 -34.316 74.995  0.50 33.53  ? 104 PHE D N   1 
ATOM   8462  N  N   B PHE D  1 104 ? -17.502 -34.316 74.975  0.50 33.90  ? 104 PHE D N   1 
ATOM   8463  C  CA  A PHE D  1 104 ? -16.762 -33.839 73.788  0.50 34.55  ? 104 PHE D CA  1 
ATOM   8464  C  CA  B PHE D  1 104 ? -16.760 -33.816 73.765  0.50 35.02  ? 104 PHE D CA  1 
ATOM   8465  C  C   A PHE D  1 104 ? -16.806 -32.296 73.621  0.50 33.22  ? 104 PHE D C   1 
ATOM   8466  C  C   B PHE D  1 104 ? -16.815 -32.290 73.604  0.50 33.45  ? 104 PHE D C   1 
ATOM   8467  O  O   A PHE D  1 104 ? -15.967 -31.720 72.949  0.50 35.71  ? 104 PHE D O   1 
ATOM   8468  O  O   B PHE D  1 104 ? -15.991 -31.708 72.918  0.50 35.91  ? 104 PHE D O   1 
ATOM   8469  C  CB  A PHE D  1 104 ? -17.276 -34.539 72.531  0.50 34.81  ? 104 PHE D CB  1 
ATOM   8470  C  CB  B PHE D  1 104 ? -17.235 -34.535 72.461  0.50 35.77  ? 104 PHE D CB  1 
ATOM   8471  C  CG  A PHE D  1 104 ? -17.268 -36.053 72.632  0.50 32.97  ? 104 PHE D CG  1 
ATOM   8472  C  CG  B PHE D  1 104 ? -18.680 -34.260 72.095  0.50 34.99  ? 104 PHE D CG  1 
ATOM   8473  C  CD1 A PHE D  1 104 ? -16.078 -36.750 72.674  0.50 32.89  ? 104 PHE D CD1 1 
ATOM   8474  C  CD1 B PHE D  1 104 ? -19.093 -32.981 71.740  0.50 34.89  ? 104 PHE D CD1 1 
ATOM   8475  C  CD2 A PHE D  1 104 ? -18.450 -36.762 72.683  0.50 32.68  ? 104 PHE D CD2 1 
ATOM   8476  C  CD2 B PHE D  1 104 ? -19.622 -35.295 72.085  0.50 33.68  ? 104 PHE D CD2 1 
ATOM   8477  C  CE1 A PHE D  1 104 ? -16.069 -38.124 72.767  0.50 32.87  ? 104 PHE D CE1 1 
ATOM   8478  C  CE1 B PHE D  1 104 ? -20.405 -32.735 71.401  0.50 33.42  ? 104 PHE D CE1 1 
ATOM   8479  C  CE2 A PHE D  1 104 ? -18.443 -38.143 72.776  0.50 31.68  ? 104 PHE D CE2 1 
ATOM   8480  C  CE2 B PHE D  1 104 ? -20.939 -35.047 71.741  0.50 30.34  ? 104 PHE D CE2 1 
ATOM   8481  C  CZ  A PHE D  1 104 ? -17.260 -38.818 72.818  0.50 32.44  ? 104 PHE D CZ  1 
ATOM   8482  C  CZ  B PHE D  1 104 ? -21.332 -33.776 71.401  0.50 32.47  ? 104 PHE D CZ  1 
ATOM   8483  N  N   . TYR D  1 105 ? -17.780 -31.662 74.242  1.00 31.87  ? 105 TYR D N   1 
ATOM   8484  C  CA  . TYR D  1 105 ? -17.888 -30.209 74.196  1.00 34.56  ? 105 TYR D CA  1 
ATOM   8485  C  C   . TYR D  1 105 ? -16.574 -29.539 74.627  1.00 33.77  ? 105 TYR D C   1 
ATOM   8486  O  O   . TYR D  1 105 ? -16.176 -28.542 74.068  1.00 32.83  ? 105 TYR D O   1 
ATOM   8487  C  CB  . TYR D  1 105 ? -18.995 -29.716 75.076  1.00 35.38  ? 105 TYR D CB  1 
ATOM   8488  C  CG  . TYR D  1 105 ? -18.951 -28.211 75.275  1.00 36.18  ? 105 TYR D CG  1 
ATOM   8489  C  CD1 . TYR D  1 105 ? -19.606 -27.342 74.374  1.00 37.23  ? 105 TYR D CD1 1 
ATOM   8490  C  CD2 . TYR D  1 105 ? -18.238 -27.641 76.352  1.00 35.36  ? 105 TYR D CD2 1 
ATOM   8491  C  CE1 . TYR D  1 105 ? -19.563 -25.959 74.541  1.00 35.89  ? 105 TYR D CE1 1 
ATOM   8492  C  CE2 . TYR D  1 105 ? -18.188 -26.260 76.532  1.00 37.15  ? 105 TYR D CE2 1 
ATOM   8493  C  CZ  . TYR D  1 105 ? -18.856 -25.414 75.617  1.00 38.78  ? 105 TYR D CZ  1 
ATOM   8494  O  OH  . TYR D  1 105 ? -18.813 -24.039 75.783  1.00 35.24  ? 105 TYR D OH  1 
ATOM   8495  N  N   . PHE D  1 106 ? -15.918 -30.114 75.637  1.00 32.92  ? 106 PHE D N   1 
ATOM   8496  C  CA  . PHE D  1 106 ? -14.675 -29.482 76.235  1.00 34.51  ? 106 PHE D CA  1 
ATOM   8497  C  C   . PHE D  1 106 ? -13.429 -29.794 75.493  1.00 35.00  ? 106 PHE D C   1 
ATOM   8498  O  O   . PHE D  1 106 ? -12.358 -29.342 75.866  1.00 40.85  ? 106 PHE D O   1 
ATOM   8499  C  CB  . PHE D  1 106 ? -14.525 -29.873 77.746  1.00 31.41  ? 106 PHE D CB  1 
ATOM   8500  C  CG  . PHE D  1 106 ? -15.657 -29.416 78.592  1.00 29.77  ? 106 PHE D CG  1 
ATOM   8501  C  CD1 . PHE D  1 106 ? -16.768 -30.220 78.777  1.00 28.98  ? 106 PHE D CD1 1 
ATOM   8502  C  CD2 . PHE D  1 106 ? -15.628 -28.183 79.193  1.00 32.00  ? 106 PHE D CD2 1 
ATOM   8503  C  CE1 . PHE D  1 106 ? -17.819 -29.799 79.551  1.00 32.89  ? 106 PHE D CE1 1 
ATOM   8504  C  CE2 . PHE D  1 106 ? -16.682 -27.753 79.973  1.00 33.70  ? 106 PHE D CE2 1 
ATOM   8505  C  CZ  . PHE D  1 106 ? -17.777 -28.562 80.151  1.00 32.51  ? 106 PHE D CZ  1 
ATOM   8506  N  N   . LEU D  1 107 ? -13.546 -30.568 74.433  1.00 37.93  ? 107 LEU D N   1 
ATOM   8507  C  CA  . LEU D  1 107 ? -12.397 -30.905 73.643  1.00 45.84  ? 107 LEU D CA  1 
ATOM   8508  C  C   . LEU D  1 107 ? -11.677 -29.597 73.213  1.00 46.61  ? 107 LEU D C   1 
ATOM   8509  O  O   . LEU D  1 107 ? -12.282 -28.723 72.617  1.00 44.34  ? 107 LEU D O   1 
ATOM   8510  C  CB  . LEU D  1 107 ? -12.807 -31.723 72.415  1.00 49.82  ? 107 LEU D CB  1 
ATOM   8511  C  CG  . LEU D  1 107 ? -11.856 -32.862 71.984  1.00 53.19  ? 107 LEU D CG  1 
ATOM   8512  C  CD1 . LEU D  1 107 ? -10.453 -32.341 71.710  1.00 52.74  ? 107 LEU D CD1 1 
ATOM   8513  C  CD2 . LEU D  1 107 ? -11.827 -33.976 73.041  1.00 48.13  ? 107 LEU D CD2 1 
ATOM   8514  N  N   . ASN D  1 108 ? -10.386 -29.489 73.545  1.00 53.35  ? 108 ASN D N   1 
ATOM   8515  C  CA  . ASN D  1 108 ? -9.601  -28.258 73.243  1.00 58.46  ? 108 ASN D CA  1 
ATOM   8516  C  C   . ASN D  1 108 ? -9.767  -27.170 74.293  1.00 63.07  ? 108 ASN D C   1 
ATOM   8517  O  O   . ASN D  1 108 ? -8.791  -26.554 74.720  1.00 83.77  ? 108 ASN D O   1 
ATOM   8518  C  CB  . ASN D  1 108 ? -9.969  -27.702 71.877  1.00 64.76  ? 108 ASN D CB  1 
ATOM   8519  C  CG  . ASN D  1 108 ? -9.285  -28.415 70.764  1.00 73.59  ? 108 ASN D CG  1 
ATOM   8520  O  OD1 . ASN D  1 108 ? -8.997  -29.607 70.856  1.00 81.94  ? 108 ASN D OD1 1 
ATOM   8521  N  ND2 . ASN D  1 108 ? -9.013  -27.697 69.689  1.00 82.58  ? 108 ASN D ND2 1 
ATOM   8522  N  N   . ARG D  1 109 ? -11.012 -26.935 74.707  1.00 52.95  ? 109 ARG D N   1 
ATOM   8523  C  CA  . ARG D  1 109 ? -11.328 -25.836 75.642  1.00 45.26  ? 109 ARG D CA  1 
ATOM   8524  C  C   . ARG D  1 109 ? -10.376 -25.777 76.897  1.00 42.48  ? 109 ARG D C   1 
ATOM   8525  O  O   . ARG D  1 109 ? -9.867  -26.799 77.357  1.00 41.08  ? 109 ARG D O   1 
ATOM   8526  C  CB  . ARG D  1 109 ? -12.807 -25.875 76.052  1.00 43.42  ? 109 ARG D CB  1 
ATOM   8527  C  CG  . ARG D  1 109 ? -13.748 -25.723 74.869  1.00 42.13  ? 109 ARG D CG  1 
ATOM   8528  C  CD  . ARG D  1 109 ? -15.072 -25.144 75.265  1.00 49.72  ? 109 ARG D CD  1 
ATOM   8529  N  NE  . ARG D  1 109 ? -15.703 -24.438 74.136  1.00 55.37  ? 109 ARG D NE  1 
ATOM   8530  C  CZ  . ARG D  1 109 ? -16.432 -25.023 73.218  1.00 53.90  ? 109 ARG D CZ  1 
ATOM   8531  N  NH1 . ARG D  1 109 ? -16.640 -26.313 73.275  1.00 61.40  ? 109 ARG D NH1 1 
ATOM   8532  N  NH2 . ARG D  1 109 ? -16.959 -24.314 72.233  1.00 49.69  ? 109 ARG D NH2 1 
ATOM   8533  N  N   . SER D  1 110 ? -10.162 -24.580 77.404  1.00 40.78  ? 110 SER D N   1 
ATOM   8534  C  CA  . SER D  1 110 ? -9.207  -24.368 78.451  1.00 40.77  ? 110 SER D CA  1 
ATOM   8535  C  C   . SER D  1 110 ? -9.824  -24.509 79.821  1.00 40.27  ? 110 SER D C   1 
ATOM   8536  O  O   . SER D  1 110 ? -11.064 -24.541 79.969  1.00 38.19  ? 110 SER D O   1 
ATOM   8537  C  CB  . SER D  1 110 ? -8.558  -22.969 78.309  1.00 42.55  ? 110 SER D CB  1 
ATOM   8538  O  OG  . SER D  1 110 ? -9.503  -21.936 78.571  1.00 45.88  ? 110 SER D OG  1 
ATOM   8539  N  N   . ILE D  1 111 ? -8.968  -24.595 80.832  1.00 39.41  ? 111 ILE D N   1 
ATOM   8540  C  CA  . ILE D  1 111 ? -9.401  -24.670 82.158  1.00 39.82  ? 111 ILE D CA  1 
ATOM   8541  C  C   . ILE D  1 111 ? -10.185 -23.398 82.524  1.00 41.26  ? 111 ILE D C   1 
ATOM   8542  O  O   . ILE D  1 111 ? -11.183 -23.457 83.279  1.00 36.39  ? 111 ILE D O   1 
ATOM   8543  C  CB  . ILE D  1 111 ? -8.208  -24.859 83.128  1.00 43.26  ? 111 ILE D CB  1 
ATOM   8544  C  CG1 . ILE D  1 111 ? -7.470  -26.170 82.807  1.00 41.75  ? 111 ILE D CG1 1 
ATOM   8545  C  CG2 . ILE D  1 111 ? -8.684  -24.859 84.570  1.00 41.67  ? 111 ILE D CG2 1 
ATOM   8546  C  CD1 . ILE D  1 111 ? -6.213  -26.384 83.625  1.00 40.21  ? 111 ILE D CD1 1 
ATOM   8547  N  N   . ASP D  1 112 ? -9.739  -22.241 81.973  1.00 39.16  ? 112 ASP D N   1 
ATOM   8548  C  CA  . ASP D  1 112 ? -10.438 -20.947 82.190  1.00 39.21  ? 112 ASP D CA  1 
ATOM   8549  C  C   . ASP D  1 112 ? -11.866 -20.983 81.679  1.00 37.93  ? 112 ASP D C   1 
ATOM   8550  O  O   . ASP D  1 112 ? -12.765 -20.442 82.304  1.00 38.83  ? 112 ASP D O   1 
ATOM   8551  C  CB  . ASP D  1 112 ? -9.665  -19.784 81.524  1.00 45.60  ? 112 ASP D CB  1 
ATOM   8552  C  CG  . ASP D  1 112 ? -8.479  -19.282 82.389  1.00 51.64  ? 112 ASP D CG  1 
ATOM   8553  O  OD1 . ASP D  1 112 ? -8.002  -18.169 82.141  1.00 60.70  ? 112 ASP D OD1 1 
ATOM   8554  O  OD2 . ASP D  1 112 ? -8.050  -20.016 83.309  1.00 54.85  ? 112 ASP D OD2 1 
ATOM   8555  N  N   . GLU D  1 113 ? -12.067 -21.617 80.534  1.00 36.32  ? 113 GLU D N   1 
ATOM   8556  C  CA  . GLU D  1 113 ? -13.406 -21.760 79.962  1.00 40.52  ? 113 GLU D CA  1 
ATOM   8557  C  C   . GLU D  1 113 ? -14.325 -22.578 80.894  1.00 36.43  ? 113 GLU D C   1 
ATOM   8558  O  O   . GLU D  1 113 ? -15.509 -22.236 81.083  1.00 36.41  ? 113 GLU D O   1 
ATOM   8559  C  CB  . GLU D  1 113 ? -13.337 -22.411 78.590  1.00 42.23  ? 113 GLU D CB  1 
ATOM   8560  C  CG  . GLU D  1 113 ? -13.059 -21.451 77.460  1.00 51.33  ? 113 GLU D CG  1 
ATOM   8561  C  CD  . GLU D  1 113 ? -12.838 -22.163 76.139  1.00 56.48  ? 113 GLU D CD  1 
ATOM   8562  O  OE1 . GLU D  1 113 ? -11.678 -22.566 75.859  1.00 58.27  ? 113 GLU D OE1 1 
ATOM   8563  O  OE2 . GLU D  1 113 ? -13.812 -22.318 75.378  1.00 52.10  ? 113 GLU D OE2 1 
ATOM   8564  N  N   . ILE D  1 114 ? -13.781 -23.648 81.464  1.00 33.86  ? 114 ILE D N   1 
ATOM   8565  C  CA  . ILE D  1 114 ? -14.518 -24.458 82.404  1.00 35.31  ? 114 ILE D CA  1 
ATOM   8566  C  C   . ILE D  1 114 ? -14.865 -23.628 83.682  1.00 35.05  ? 114 ILE D C   1 
ATOM   8567  O  O   . ILE D  1 114 ? -16.034 -23.588 84.123  1.00 35.03  ? 114 ILE D O   1 
ATOM   8568  C  CB  . ILE D  1 114 ? -13.731 -25.726 82.803  1.00 36.23  ? 114 ILE D CB  1 
ATOM   8569  C  CG1 . ILE D  1 114 ? -13.305 -26.507 81.560  1.00 35.42  ? 114 ILE D CG1 1 
ATOM   8570  C  CG2 . ILE D  1 114 ? -14.562 -26.607 83.720  1.00 33.63  ? 114 ILE D CG2 1 
ATOM   8571  C  CD1 . ILE D  1 114 ? -12.624 -27.822 81.876  1.00 35.42  ? 114 ILE D CD1 1 
ATOM   8572  N  N   . ALA D  1 115 ? -13.850 -22.972 84.252  1.00 31.35  ? 115 ALA D N   1 
ATOM   8573  C  CA  . ALA D  1 115 ? -14.032 -22.170 85.469  1.00 29.10  ? 115 ALA D CA  1 
ATOM   8574  C  C   . ALA D  1 115 ? -15.077 -21.123 85.270  1.00 31.37  ? 115 ALA D C   1 
ATOM   8575  O  O   . ALA D  1 115 ? -15.858 -20.813 86.207  1.00 31.45  ? 115 ALA D O   1 
ATOM   8576  C  CB  . ALA D  1 115 ? -12.710 -21.532 85.890  1.00 28.05  ? 115 ALA D CB  1 
ATOM   8577  N  N   . ASP D  1 116 ? -15.121 -20.538 84.024  1.00 32.33  ? 116 ASP D N   1 
ATOM   8578  C  CA  . ASP D  1 116 ? -16.141 -19.505 83.669  1.00 34.60  ? 116 ASP D CA  1 
ATOM   8579  C  C   . ASP D  1 116 ? -17.539 -20.044 83.786  1.00 31.16  ? 116 ASP D C   1 
ATOM   8580  O  O   . ASP D  1 116 ? -18.468 -19.310 84.133  1.00 34.95  ? 116 ASP D O   1 
ATOM   8581  C  CB  . ASP D  1 116 ? -15.894 -18.952 82.239  1.00 36.10  ? 116 ASP D CB  1 
ATOM   8582  C  CG  . ASP D  1 116 ? -14.645 -18.074 82.159  1.00 43.03  ? 116 ASP D CG  1 
ATOM   8583  O  OD1 . ASP D  1 116 ? -14.099 -17.921 81.055  1.00 46.06  ? 116 ASP D OD1 1 
ATOM   8584  O  OD2 . ASP D  1 116 ? -14.206 -17.536 83.235  1.00 41.74  ? 116 ASP D OD2 1 
ATOM   8585  N  N   . LEU D  1 117 ? -17.705 -21.341 83.493  1.00 29.52  ? 117 LEU D N   1 
ATOM   8586  C  CA  . LEU D  1 117 ? -19.018 -22.006 83.659  1.00 29.99  ? 117 LEU D CA  1 
ATOM   8587  C  C   . LEU D  1 117 ? -19.421 -22.011 85.118  1.00 28.44  ? 117 LEU D C   1 
ATOM   8588  O  O   . LEU D  1 117 ? -20.553 -21.764 85.446  1.00 28.08  ? 117 LEU D O   1 
ATOM   8589  C  CB  . LEU D  1 117 ? -18.978 -23.438 83.122  1.00 29.38  ? 117 LEU D CB  1 
ATOM   8590  C  CG  . LEU D  1 117 ? -18.684 -23.626 81.630  1.00 31.56  ? 117 LEU D CG  1 
ATOM   8591  C  CD1 . LEU D  1 117 ? -18.710 -25.097 81.277  1.00 27.83  ? 117 LEU D CD1 1 
ATOM   8592  C  CD2 . LEU D  1 117 ? -19.679 -22.849 80.777  1.00 31.69  ? 117 LEU D CD2 1 
ATOM   8593  N  N   . PHE D  1 118 ? -18.448 -22.302 86.005  1.00 31.28  ? 118 PHE D N   1 
ATOM   8594  C  CA  . PHE D  1 118 ? -18.712 -22.316 87.435  1.00 32.66  ? 118 PHE D CA  1 
ATOM   8595  C  C   . PHE D  1 118 ? -19.001 -20.886 87.945  1.00 33.95  ? 118 PHE D C   1 
ATOM   8596  O  O   . PHE D  1 118 ? -19.972 -20.657 88.674  1.00 33.96  ? 118 PHE D O   1 
ATOM   8597  C  CB  . PHE D  1 118 ? -17.524 -22.942 88.218  1.00 30.66  ? 118 PHE D CB  1 
ATOM   8598  C  CG  . PHE D  1 118 ? -17.134 -24.354 87.739  1.00 28.22  ? 118 PHE D CG  1 
ATOM   8599  C  CD1 . PHE D  1 118 ? -18.060 -25.164 87.042  1.00 28.09  ? 118 PHE D CD1 1 
ATOM   8600  C  CD2 . PHE D  1 118 ? -15.856 -24.874 88.006  1.00 25.49  ? 118 PHE D CD2 1 
ATOM   8601  C  CE1 . PHE D  1 118 ? -17.702 -26.448 86.610  1.00 28.38  ? 118 PHE D CE1 1 
ATOM   8602  C  CE2 . PHE D  1 118 ? -15.495 -26.175 87.571  1.00 26.15  ? 118 PHE D CE2 1 
ATOM   8603  C  CZ  . PHE D  1 118 ? -16.405 -26.951 86.883  1.00 27.42  ? 118 PHE D CZ  1 
ATOM   8604  N  N   . ILE D  1 119 ? -18.146 -19.933 87.540  1.00 32.93  ? 119 ILE D N   1 
ATOM   8605  C  CA  . ILE D  1 119 ? -18.316 -18.540 87.905  1.00 30.84  ? 119 ILE D CA  1 
ATOM   8606  C  C   . ILE D  1 119 ? -19.707 -17.984 87.426  1.00 32.43  ? 119 ILE D C   1 
ATOM   8607  O  O   . ILE D  1 119 ? -20.332 -17.199 88.110  1.00 34.94  ? 119 ILE D O   1 
ATOM   8608  C  CB  . ILE D  1 119 ? -17.162 -17.674 87.357  1.00 35.97  ? 119 ILE D CB  1 
ATOM   8609  C  CG1 . ILE D  1 119 ? -15.835 -18.035 88.087  1.00 36.36  ? 119 ILE D CG1 1 
ATOM   8610  C  CG2 . ILE D  1 119 ? -17.478 -16.183 87.503  1.00 35.48  ? 119 ILE D CG2 1 
ATOM   8611  C  CD1 . ILE D  1 119 ? -14.605 -17.524 87.412  1.00 36.72  ? 119 ILE D CD1 1 
ATOM   8612  N  N   . HIS D  1 120 ? -20.151 -18.424 86.265  1.00 31.40  ? 120 HIS D N   1 
ATOM   8613  C  CA  . HIS D  1 120 ? -21.439 -18.040 85.768  1.00 30.92  ? 120 HIS D CA  1 
ATOM   8614  C  C   . HIS D  1 120 ? -22.562 -18.469 86.730  1.00 32.33  ? 120 HIS D C   1 
ATOM   8615  O  O   . HIS D  1 120 ? -23.433 -17.647 87.109  1.00 30.59  ? 120 HIS D O   1 
ATOM   8616  C  CB  . HIS D  1 120 ? -21.681 -18.635 84.358  1.00 31.82  ? 120 HIS D CB  1 
ATOM   8617  C  CG  . HIS D  1 120 ? -23.066 -18.435 83.853  1.00 32.31  ? 120 HIS D CG  1 
ATOM   8618  N  ND1 . HIS D  1 120 ? -23.403 -17.419 82.992  1.00 35.77  ? 120 HIS D ND1 1 
ATOM   8619  C  CD2 . HIS D  1 120 ? -24.268 -19.155 84.105  1.00 31.31  ? 120 HIS D CD2 1 
ATOM   8620  C  CE1 . HIS D  1 120 ? -24.730 -17.489 82.712  1.00 31.69  ? 120 HIS D CE1 1 
ATOM   8621  N  NE2 . HIS D  1 120 ? -25.258 -18.548 83.392  1.00 34.24  ? 120 HIS D NE2 1 
ATOM   8622  N  N   . ASP D  1 121 ? -22.550 -19.762 87.128  1.00 31.35  ? 121 ASP D N   1 
ATOM   8623  C  CA  . ASP D  1 121 ? -23.564 -20.296 88.043  1.00 30.35  ? 121 ASP D CA  1 
ATOM   8624  C  C   . ASP D  1 121 ? -23.508 -19.599 89.403  1.00 30.99  ? 121 ASP D C   1 
ATOM   8625  O  O   . ASP D  1 121 ? -24.534 -19.363 90.028  1.00 26.39  ? 121 ASP D O   1 
ATOM   8626  C  CB  . ASP D  1 121 ? -23.385 -21.817 88.229  1.00 32.13  ? 121 ASP D CB  1 
ATOM   8627  C  CG  . ASP D  1 121 ? -23.766 -22.636 86.944  1.00 35.38  ? 121 ASP D CG  1 
ATOM   8628  O  OD1 . ASP D  1 121 ? -24.456 -22.068 86.039  1.00 35.49  ? 121 ASP D OD1 1 
ATOM   8629  O  OD2 . ASP D  1 121 ? -23.368 -23.854 86.860  1.00 34.04  ? 121 ASP D OD2 1 
ATOM   8630  N  N   . ILE D  1 122 ? -22.285 -19.281 89.856  1.00 29.17  ? 122 ILE D N   1 
ATOM   8631  C  CA  . ILE D  1 122 ? -22.091 -18.656 91.132  1.00 33.73  ? 122 ILE D CA  1 
ATOM   8632  C  C   . ILE D  1 122 ? -22.542 -17.160 91.124  1.00 39.37  ? 122 ILE D C   1 
ATOM   8633  O  O   . ILE D  1 122 ? -23.279 -16.723 92.003  1.00 42.49  ? 122 ILE D O   1 
ATOM   8634  C  CB  . ILE D  1 122 ? -20.618 -18.737 91.582  1.00 36.61  ? 122 ILE D CB  1 
ATOM   8635  C  CG1 . ILE D  1 122 ? -20.185 -20.216 91.763  1.00 32.38  ? 122 ILE D CG1 1 
ATOM   8636  C  CG2 . ILE D  1 122 ? -20.405 -17.934 92.873  1.00 33.90  ? 122 ILE D CG2 1 
ATOM   8637  C  CD1 . ILE D  1 122 ? -18.675 -20.415 91.853  1.00 33.95  ? 122 ILE D CD1 1 
ATOM   8638  N  N   . LYS D  1 123 ? -22.091 -16.408 90.116  1.00 39.23  ? 123 LYS D N   1 
ATOM   8639  C  CA  . LYS D  1 123 ? -22.365 -14.947 90.051  1.00 42.96  ? 123 LYS D CA  1 
ATOM   8640  C  C   . LYS D  1 123 ? -23.695 -14.596 89.334  1.00 45.06  ? 123 LYS D C   1 
ATOM   8641  O  O   . LYS D  1 123 ? -24.447 -13.750 89.797  1.00 41.17  ? 123 LYS D O   1 
ATOM   8642  C  CB  . LYS D  1 123 ? -21.208 -14.214 89.385  1.00 44.02  ? 123 LYS D CB  1 
ATOM   8643  C  CG  . LYS D  1 123 ? -19.909 -14.265 90.164  1.00 50.07  ? 123 LYS D CG  1 
ATOM   8644  C  CD  . LYS D  1 123 ? -18.855 -13.357 89.529  1.00 61.07  ? 123 LYS D CD  1 
ATOM   8645  C  CE  . LYS D  1 123 ? -17.584 -13.302 90.369  1.00 65.12  ? 123 LYS D CE  1 
ATOM   8646  N  NZ  . LYS D  1 123 ? -16.556 -12.411 89.754  1.00 67.53  ? 123 LYS D NZ  1 
ATOM   8647  N  N   . GLU D  1 124 ? -23.957 -15.251 88.212  1.00 42.93  ? 124 GLU D N   1 
ATOM   8648  C  CA  . GLU D  1 124 ? -25.149 -14.928 87.392  1.00 42.38  ? 124 GLU D CA  1 
ATOM   8649  C  C   . GLU D  1 124 ? -26.378 -15.707 87.817  1.00 43.06  ? 124 GLU D C   1 
ATOM   8650  O  O   . GLU D  1 124 ? -27.403 -15.127 88.136  1.00 41.82  ? 124 GLU D O   1 
ATOM   8651  C  CB  . GLU D  1 124 ? -24.860 -15.166 85.895  1.00 45.04  ? 124 GLU D CB  1 
ATOM   8652  C  CG  . GLU D  1 124 ? -23.610 -14.462 85.385  1.00 49.44  ? 124 GLU D CG  1 
ATOM   8653  C  CD  . GLU D  1 124 ? -23.678 -12.949 85.548  1.00 57.48  ? 124 GLU D CD  1 
ATOM   8654  O  OE1 . GLU D  1 124 ? -24.805 -12.396 85.565  1.00 63.94  ? 124 GLU D OE1 1 
ATOM   8655  O  OE2 . GLU D  1 124 ? -22.608 -12.313 85.657  1.00 61.10  ? 124 GLU D OE2 1 
ATOM   8656  N  N   . GLY D  1 125 ? -26.269 -17.033 87.816  1.00 40.10  ? 125 GLY D N   1 
ATOM   8657  C  CA  . GLY D  1 125 ? -27.395 -17.886 88.157  1.00 35.90  ? 125 GLY D CA  1 
ATOM   8658  C  C   . GLY D  1 125 ? -27.308 -19.258 87.492  1.00 35.95  ? 125 GLY D C   1 
ATOM   8659  O  O   . GLY D  1 125 ? -26.445 -19.499 86.651  1.00 33.93  ? 125 GLY D O   1 
ATOM   8660  N  N   . ILE D  1 126 ? -28.199 -20.139 87.868  1.00 34.83  ? 126 ILE D N   1 
ATOM   8661  C  CA  . ILE D  1 126 ? -28.165 -21.512 87.385  1.00 33.79  ? 126 ILE D CA  1 
ATOM   8662  C  C   . ILE D  1 126 ? -29.254 -21.791 86.377  1.00 31.39  ? 126 ILE D C   1 
ATOM   8663  O  O   . ILE D  1 126 ? -30.432 -21.520 86.625  1.00 33.88  ? 126 ILE D O   1 
ATOM   8664  C  CB  . ILE D  1 126 ? -28.268 -22.548 88.583  1.00 28.95  ? 126 ILE D CB  1 
ATOM   8665  C  CG1 . ILE D  1 126 ? -27.029 -22.458 89.476  1.00 26.14  ? 126 ILE D CG1 1 
ATOM   8666  C  CG2 . ILE D  1 126 ? -28.453 -23.968 88.059  1.00 28.34  ? 126 ILE D CG2 1 
ATOM   8667  C  CD1 . ILE D  1 126 ? -27.159 -23.208 90.787  1.00 23.79  ? 126 ILE D CD1 1 
ATOM   8668  N  N   . GLN D  1 127 ? -28.855 -22.332 85.226  1.00 32.48  ? 127 GLN D N   1 
ATOM   8669  C  CA  . GLN D  1 127 ? -29.805 -22.754 84.180  1.00 32.67  ? 127 GLN D CA  1 
ATOM   8670  C  C   . GLN D  1 127 ? -30.844 -21.680 83.838  1.00 35.68  ? 127 GLN D C   1 
ATOM   8671  O  O   . GLN D  1 127 ? -32.096 -21.981 83.722  1.00 35.59  ? 127 GLN D O   1 
ATOM   8672  C  CB  . GLN D  1 127 ? -30.492 -24.069 84.582  1.00 34.10  ? 127 GLN D CB  1 
ATOM   8673  C  CG  . GLN D  1 127 ? -29.533 -25.256 84.667  1.00 34.27  ? 127 GLN D CG  1 
ATOM   8674  C  CD  . GLN D  1 127 ? -30.203 -26.516 85.154  1.00 36.83  ? 127 GLN D CD  1 
ATOM   8675  O  OE1 . GLN D  1 127 ? -30.094 -27.573 84.527  1.00 40.96  ? 127 GLN D OE1 1 
ATOM   8676  N  NE2 . GLN D  1 127 ? -30.904 -26.419 86.271  1.00 29.15  ? 127 GLN D NE2 1 
ATOM   8677  N  N   . GLY D  1 128 ? -30.372 -20.444 83.668  1.00 38.72  ? 128 GLY D N   1 
ATOM   8678  C  CA  . GLY D  1 128 ? -31.225 -19.350 83.243  1.00 40.84  ? 128 GLY D CA  1 
ATOM   8679  C  C   . GLY D  1 128 ? -32.093 -18.763 84.344  1.00 45.44  ? 128 GLY D C   1 
ATOM   8680  O  O   . GLY D  1 128 ? -32.989 -17.972 84.072  1.00 46.63  ? 128 GLY D O   1 
ATOM   8681  N  N   . THR D  1 129 ? -31.826 -19.156 85.599  1.00 41.38  ? 129 THR D N   1 
ATOM   8682  C  CA  . THR D  1 129 ? -32.578 -18.607 86.750  1.00 41.61  ? 129 THR D CA  1 
ATOM   8683  C  C   . THR D  1 129 ? -31.699 -17.725 87.564  1.00 41.98  ? 129 THR D C   1 
ATOM   8684  O  O   . THR D  1 129 ? -30.505 -17.572 87.263  1.00 37.76  ? 129 THR D O   1 
ATOM   8685  C  CB  . THR D  1 129 ? -33.147 -19.725 87.654  1.00 42.94  ? 129 THR D CB  1 
ATOM   8686  O  OG1 . THR D  1 129 ? -32.096 -20.269 88.483  1.00 46.18  ? 129 THR D OG1 1 
ATOM   8687  C  CG2 . THR D  1 129 ? -33.780 -20.849 86.803  1.00 38.43  ? 129 THR D CG2 1 
ATOM   8688  N  N   . LEU D  1 130 ? -32.264 -17.128 88.612  1.00 39.00  ? 130 LEU D N   1 
ATOM   8689  C  CA  . LEU D  1 130 ? -31.496 -16.271 89.490  1.00 40.03  ? 130 LEU D CA  1 
ATOM   8690  C  C   . LEU D  1 130 ? -31.019 -17.014 90.768  1.00 37.80  ? 130 LEU D C   1 
ATOM   8691  O  O   . LEU D  1 130 ? -30.335 -16.436 91.611  1.00 39.15  ? 130 LEU D O   1 
ATOM   8692  C  CB  . LEU D  1 130 ? -32.289 -14.997 89.850  1.00 41.90  ? 130 LEU D CB  1 
ATOM   8693  C  CG  . LEU D  1 130 ? -32.615 -14.069 88.635  1.00 44.77  ? 130 LEU D CG  1 
ATOM   8694  C  CD1 . LEU D  1 130 ? -33.350 -12.821 89.082  1.00 43.27  ? 130 LEU D CD1 1 
ATOM   8695  C  CD2 . LEU D  1 130 ? -31.346 -13.703 87.870  1.00 43.18  ? 130 LEU D CD2 1 
ATOM   8696  N  N   . ASN D  1 131 ? -31.394 -18.297 90.890  1.00 34.98  ? 131 ASN D N   1 
ATOM   8697  C  CA  . ASN D  1 131 ? -30.848 -19.148 91.940  1.00 31.17  ? 131 ASN D CA  1 
ATOM   8698  C  C   . ASN D  1 131 ? -29.367 -19.324 91.686  1.00 28.97  ? 131 ASN D C   1 
ATOM   8699  O  O   . ASN D  1 131 ? -28.980 -19.726 90.635  1.00 31.76  ? 131 ASN D O   1 
ATOM   8700  C  CB  . ASN D  1 131 ? -31.530 -20.487 91.939  1.00 29.46  ? 131 ASN D CB  1 
ATOM   8701  C  CG  . ASN D  1 131 ? -33.069 -20.376 92.103  1.00 31.91  ? 131 ASN D CG  1 
ATOM   8702  O  OD1 . ASN D  1 131 ? -33.848 -20.779 91.194  1.00 32.72  ? 131 ASN D OD1 1 
ATOM   8703  N  ND2 . ASN D  1 131 ? -33.506 -19.842 93.231  1.00 30.21  ? 131 ASN D ND2 1 
ATOM   8704  N  N   . LYS D  1 132 ? -28.559 -19.009 92.654  1.00 28.65  ? 132 LYS D N   1 
ATOM   8705  C  CA  . LYS D  1 132 ? -27.070 -19.053 92.455  1.00 29.34  ? 132 LYS D CA  1 
ATOM   8706  C  C   . LYS D  1 132 ? -26.415 -20.241 93.136  1.00 29.95  ? 132 LYS D C   1 
ATOM   8707  O  O   . LYS D  1 132 ? -26.970 -20.815 94.064  1.00 27.84  ? 132 LYS D O   1 
ATOM   8708  C  CB  . LYS D  1 132 ? -26.436 -17.755 92.919  1.00 32.14  ? 132 LYS D CB  1 
ATOM   8709  C  CG  . LYS D  1 132 ? -26.886 -16.550 92.114  1.00 38.11  ? 132 LYS D CG  1 
ATOM   8710  C  CD  . LYS D  1 132 ? -26.352 -15.278 92.679  1.00 44.00  ? 132 LYS D CD  1 
ATOM   8711  C  CE  . LYS D  1 132 ? -26.731 -14.098 91.794  1.00 49.30  ? 132 LYS D CE  1 
ATOM   8712  N  NZ  . LYS D  1 132 ? -28.183 -14.128 91.437  1.00 51.68  ? 132 LYS D NZ  1 
ATOM   8713  N  N   . ALA D  1 133 ? -25.193 -20.612 92.644  1.00 27.39  ? 133 ALA D N   1 
ATOM   8714  C  CA  . ALA D  1 133 ? -24.435 -21.717 93.199  1.00 27.97  ? 133 ALA D CA  1 
ATOM   8715  C  C   . ALA D  1 133 ? -23.706 -21.288 94.416  1.00 28.60  ? 133 ALA D C   1 
ATOM   8716  O  O   . ALA D  1 133 ? -23.146 -20.220 94.451  1.00 32.66  ? 133 ALA D O   1 
ATOM   8717  C  CB  . ALA D  1 133 ? -23.437 -22.268 92.146  1.00 24.12  ? 133 ALA D CB  1 
ATOM   8718  N  N   . GLY D  1 134 ? -23.702 -22.153 95.448  1.00 30.44  ? 134 GLY D N   1 
ATOM   8719  C  CA  . GLY D  1 134 ? -23.038 -21.832 96.726  1.00 27.44  ? 134 GLY D CA  1 
ATOM   8720  C  C   . GLY D  1 134 ? -21.693 -22.559 96.921  1.00 28.03  ? 134 GLY D C   1 
ATOM   8721  O  O   . GLY D  1 134 ? -21.003 -22.344 97.908  1.00 29.13  ? 134 GLY D O   1 
ATOM   8722  N  N   . PHE D  1 135 ? -21.340 -23.409 95.974  1.00 28.39  ? 135 PHE D N   1 
ATOM   8723  C  CA  . PHE D  1 135 ? -20.099 -24.215 96.071  1.00 25.04  ? 135 PHE D CA  1 
ATOM   8724  C  C   . PHE D  1 135 ? -19.815 -24.868 94.782  1.00 25.69  ? 135 PHE D C   1 
ATOM   8725  O  O   . PHE D  1 135 ? -20.663 -24.851 93.858  1.00 22.78  ? 135 PHE D O   1 
ATOM   8726  C  CB  . PHE D  1 135 ? -20.237 -25.284 97.171  1.00 24.92  ? 135 PHE D CB  1 
ATOM   8727  C  CG  . PHE D  1 135 ? -21.322 -26.273 96.910  1.00 23.66  ? 135 PHE D CG  1 
ATOM   8728  C  CD1 . PHE D  1 135 ? -21.039 -27.492 96.303  1.00 22.42  ? 135 PHE D CD1 1 
ATOM   8729  C  CD2 . PHE D  1 135 ? -22.649 -25.986 97.258  1.00 25.18  ? 135 PHE D CD2 1 
ATOM   8730  C  CE1 . PHE D  1 135 ? -22.052 -28.412 96.050  1.00 24.10  ? 135 PHE D CE1 1 
ATOM   8731  C  CE2 . PHE D  1 135 ? -23.667 -26.906 97.006  1.00 24.75  ? 135 PHE D CE2 1 
ATOM   8732  C  CZ  . PHE D  1 135 ? -23.368 -28.119 96.403  1.00 25.42  ? 135 PHE D CZ  1 
ATOM   8733  N  N   . VAL D  1 136 ? -18.608 -25.459 94.669  1.00 25.24  ? 136 VAL D N   1 
ATOM   8734  C  CA  . VAL D  1 136 ? -18.230 -26.210 93.499  1.00 26.11  ? 136 VAL D CA  1 
ATOM   8735  C  C   . VAL D  1 136 ? -18.030 -27.724 93.858  1.00 29.04  ? 136 VAL D C   1 
ATOM   8736  O  O   . VAL D  1 136 ? -17.363 -28.071 94.897  1.00 26.60  ? 136 VAL D O   1 
ATOM   8737  C  CB  . VAL D  1 136 ? -16.938 -25.673 92.875  1.00 28.52  ? 136 VAL D CB  1 
ATOM   8738  C  CG1 . VAL D  1 136 ? -16.615 -26.434 91.587  1.00 26.15  ? 136 VAL D CG1 1 
ATOM   8739  C  CG2 . VAL D  1 136 ? -17.061 -24.195 92.598  1.00 28.48  ? 136 VAL D CG2 1 
HETATM 8740  N  N   . KCX D  1 137 ? -18.591 -28.604 93.032  1.00 27.00  ? 137 KCX D N   1 
HETATM 8741  C  CA  . KCX D  1 137 ? -18.462 -30.040 93.242  1.00 26.35  ? 137 KCX D CA  1 
HETATM 8742  C  CB  . KCX D  1 137 ? -19.865 -30.696 93.245  1.00 24.49  ? 137 KCX D CB  1 
HETATM 8743  C  CG  . KCX D  1 137 ? -19.788 -32.220 93.105  1.00 24.94  ? 137 KCX D CG  1 
HETATM 8744  C  CD  . KCX D  1 137 ? -19.470 -32.902 94.446  1.00 23.16  ? 137 KCX D CD  1 
HETATM 8745  C  CE  . KCX D  1 137 ? -19.476 -34.446 94.299  1.00 25.63  ? 137 KCX D CE  1 
HETATM 8746  N  NZ  . KCX D  1 137 ? -20.864 -34.995 94.278  1.00 23.89  ? 137 KCX D NZ  1 
HETATM 8747  C  C   . KCX D  1 137 ? -17.630 -30.623 92.155  1.00 27.04  ? 137 KCX D C   1 
HETATM 8748  O  O   . KCX D  1 137 ? -17.876 -30.375 90.953  1.00 27.00  ? 137 KCX D O   1 
HETATM 8749  C  CX  . KCX D  1 137 ? -21.183 -36.250 94.771  1.00 24.73  ? 137 KCX D CX  1 
HETATM 8750  O  OQ1 . KCX D  1 137 ? -22.446 -36.649 94.710  1.00 25.05  ? 137 KCX D OQ1 1 
HETATM 8751  O  OQ2 . KCX D  1 137 ? -20.315 -37.056 95.287  1.00 22.22  ? 137 KCX D OQ2 1 
ATOM   8752  N  N   . ILE D  1 138 ? -16.631 -31.391 92.539  1.00 23.42  ? 138 ILE D N   1 
ATOM   8753  C  CA  . ILE D  1 138 ? -15.794 -32.070 91.592  1.00 25.84  ? 138 ILE D CA  1 
ATOM   8754  C  C   . ILE D  1 138 ? -15.646 -33.530 91.992  1.00 23.95  ? 138 ILE D C   1 
ATOM   8755  O  O   . ILE D  1 138 ? -15.906 -33.893 93.136  1.00 22.18  ? 138 ILE D O   1 
ATOM   8756  C  CB  . ILE D  1 138 ? -14.372 -31.370 91.443  1.00 29.35  ? 138 ILE D CB  1 
ATOM   8757  C  CG1 . ILE D  1 138 ? -13.551 -31.492 92.736  1.00 30.39  ? 138 ILE D CG1 1 
ATOM   8758  C  CG2 . ILE D  1 138 ? -14.533 -29.920 91.043  1.00 29.99  ? 138 ILE D CG2 1 
ATOM   8759  C  CD1 . ILE D  1 138 ? -12.911 -32.860 92.929  1.00 35.72  ? 138 ILE D CD1 1 
ATOM   8760  N  N   . ALA D  1 139 ? -15.238 -34.362 91.060  1.00 25.80  ? 139 ALA D N   1 
ATOM   8761  C  CA  . ALA D  1 139 ? -15.179 -35.809 91.324  1.00 26.18  ? 139 ALA D CA  1 
ATOM   8762  C  C   . ALA D  1 139 ? -13.925 -36.473 90.836  1.00 25.94  ? 139 ALA D C   1 
ATOM   8763  O  O   . ALA D  1 139 ? -13.234 -35.968 89.966  1.00 26.45  ? 139 ALA D O   1 
ATOM   8764  C  CB  . ALA D  1 139 ? -16.432 -36.521 90.730  1.00 21.70  ? 139 ALA D CB  1 
ATOM   8765  N  N   . ALA D  1 140 ? -13.642 -37.621 91.423  1.00 28.25  ? 140 ALA D N   1 
ATOM   8766  C  CA  . ALA D  1 140 ? -12.628 -38.497 90.979  1.00 26.86  ? 140 ALA D CA  1 
ATOM   8767  C  C   . ALA D  1 140 ? -12.931 -39.841 91.611  1.00 30.49  ? 140 ALA D C   1 
ATOM   8768  O  O   . ALA D  1 140 ? -13.447 -39.900 92.728  1.00 30.47  ? 140 ALA D O   1 
ATOM   8769  C  CB  . ALA D  1 140 ? -11.276 -38.002 91.412  1.00 33.43  ? 140 ALA D CB  1 
ATOM   8770  N  N   . ASP D  1 141 ? -12.636 -40.909 90.921  1.00 31.76  ? 141 ASP D N   1 
ATOM   8771  C  CA  . ASP D  1 141 ? -12.946 -42.231 91.453  1.00 30.74  ? 141 ASP D CA  1 
ATOM   8772  C  C   . ASP D  1 141 ? -11.858 -43.272 91.139  1.00 32.96  ? 141 ASP D C   1 
ATOM   8773  O  O   . ASP D  1 141 ? -10.643 -42.967 91.196  1.00 30.05  ? 141 ASP D O   1 
ATOM   8774  C  CB  . ASP D  1 141 ? -14.317 -42.704 90.959  1.00 33.26  ? 141 ASP D CB  1 
ATOM   8775  C  CG  . ASP D  1 141 ? -14.950 -43.752 91.892  1.00 39.65  ? 141 ASP D CG  1 
ATOM   8776  O  OD1 . ASP D  1 141 ? -14.571 -44.926 91.801  1.00 39.52  ? 141 ASP D OD1 1 
ATOM   8777  O  OD2 . ASP D  1 141 ? -15.852 -43.369 92.728  1.00 34.32  ? 141 ASP D OD2 1 
ATOM   8778  N  N   . GLU D  1 142 ? -12.280 -44.481 90.816  1.00 32.01  ? 142 GLU D N   1 
ATOM   8779  C  CA  . GLU D  1 142 ? -11.340 -45.596 90.629  1.00 35.67  ? 142 GLU D CA  1 
ATOM   8780  C  C   . GLU D  1 142 ? -10.240 -45.312 89.550  1.00 35.81  ? 142 GLU D C   1 
ATOM   8781  O  O   . GLU D  1 142 ? -9.068  -45.638 89.757  1.00 33.53  ? 142 GLU D O   1 
ATOM   8782  C  CB  . GLU D  1 142 ? -12.082 -46.887 90.312  1.00 41.37  ? 142 GLU D CB  1 
ATOM   8783  C  CG  . GLU D  1 142 ? -11.166 -48.081 90.115  1.00 57.24  ? 142 GLU D CG  1 
ATOM   8784  C  CD  . GLU D  1 142 ? -11.919 -49.386 90.040  1.00 77.08  ? 142 GLU D CD  1 
ATOM   8785  O  OE1 . GLU D  1 142 ? -11.329 -50.392 89.570  1.00 90.73  ? 142 GLU D OE1 1 
ATOM   8786  O  OE2 . GLU D  1 142 ? -13.107 -49.416 90.449  1.00 85.56  ? 142 GLU D OE2 1 
ATOM   8787  N  N   . PRO D  1 143 ? -10.641 -44.703 88.394  1.00 33.85  ? 143 PRO D N   1 
ATOM   8788  C  CA  . PRO D  1 143 ? -9.661  -44.398 87.311  1.00 35.56  ? 143 PRO D CA  1 
ATOM   8789  C  C   . PRO D  1 143 ? -8.571  -43.366 87.739  1.00 35.78  ? 143 PRO D C   1 
ATOM   8790  O  O   . PRO D  1 143 ? -7.713  -43.049 86.974  1.00 37.49  ? 143 PRO D O   1 
ATOM   8791  C  CB  . PRO D  1 143 ? -10.550 -43.816 86.180  1.00 31.61  ? 143 PRO D CB  1 
ATOM   8792  C  CG  . PRO D  1 143 ? -11.935 -44.299 86.501  1.00 32.96  ? 143 PRO D CG  1 
ATOM   8793  C  CD  . PRO D  1 143 ? -12.011 -44.350 88.009  1.00 34.22  ? 143 PRO D CD  1 
ATOM   8794  N  N   . GLY D  1 144 ? -8.658  -42.875 88.969  1.00 36.13  ? 144 GLY D N   1 
ATOM   8795  C  CA  . GLY D  1 144 ? -7.642  -41.923 89.501  1.00 33.16  ? 144 GLY D CA  1 
ATOM   8796  C  C   . GLY D  1 144 ? -7.802  -40.490 88.960  1.00 33.08  ? 144 GLY D C   1 
ATOM   8797  O  O   . GLY D  1 144 ? -8.877  -40.100 88.510  1.00 29.06  ? 144 GLY D O   1 
ATOM   8798  N  N   . ILE D  1 145 ? -6.729  -39.727 89.015  1.00 30.61  ? 145 ILE D N   1 
ATOM   8799  C  CA  . ILE D  1 145 ? -6.745  -38.356 88.555  1.00 33.26  ? 145 ILE D CA  1 
ATOM   8800  C  C   . ILE D  1 145 ? -6.354  -38.268 87.105  1.00 33.28  ? 145 ILE D C   1 
ATOM   8801  O  O   . ILE D  1 145 ? -5.216  -38.042 86.791  1.00 37.58  ? 145 ILE D O   1 
ATOM   8802  C  CB  . ILE D  1 145 ? -5.770  -37.451 89.404  1.00 32.71  ? 145 ILE D CB  1 
ATOM   8803  C  CG1 . ILE D  1 145 ? -6.097  -37.556 90.885  1.00 31.14  ? 145 ILE D CG1 1 
ATOM   8804  C  CG2 . ILE D  1 145 ? -5.829  -35.993 88.930  1.00 33.13  ? 145 ILE D CG2 1 
ATOM   8805  C  CD1 . ILE D  1 145 ? -7.543  -37.167 91.230  1.00 30.77  ? 145 ILE D CD1 1 
ATOM   8806  N  N   . THR D  1 146 ? -7.337  -38.459 86.207  1.00 36.21  ? 146 THR D N   1 
ATOM   8807  C  CA  . THR D  1 146 ? -7.095  -38.353 84.752  1.00 34.08  ? 146 THR D CA  1 
ATOM   8808  C  C   . THR D  1 146 ? -6.817  -36.926 84.375  1.00 35.66  ? 146 THR D C   1 
ATOM   8809  O  O   . THR D  1 146 ? -7.028  -35.996 85.191  1.00 35.27  ? 146 THR D O   1 
ATOM   8810  C  CB  . THR D  1 146 ? -8.327  -38.854 83.921  1.00 33.20  ? 146 THR D CB  1 
ATOM   8811  O  OG1 . THR D  1 146 ? -9.421  -37.960 84.102  1.00 34.12  ? 146 THR D OG1 1 
ATOM   8812  C  CG2 . THR D  1 146 ? -8.738  -40.241 84.351  1.00 31.11  ? 146 THR D CG2 1 
ATOM   8813  N  N   . LYS D  1 147 ? -6.348  -36.718 83.142  1.00 37.33  ? 147 LYS D N   1 
ATOM   8814  C  CA  . LYS D  1 147 ? -6.074  -35.382 82.654  1.00 37.28  ? 147 LYS D CA  1 
ATOM   8815  C  C   . LYS D  1 147 ? -7.311  -34.496 82.755  1.00 35.43  ? 147 LYS D C   1 
ATOM   8816  O  O   . LYS D  1 147 ? -7.227  -33.347 83.185  1.00 31.12  ? 147 LYS D O   1 
ATOM   8817  C  CB  . LYS D  1 147 ? -5.579  -35.426 81.208  1.00 42.85  ? 147 LYS D CB  1 
ATOM   8818  C  CG  . LYS D  1 147 ? -4.177  -35.953 81.051  1.00 49.77  ? 147 LYS D CG  1 
ATOM   8819  C  CD  . LYS D  1 147 ? -3.748  -35.933 79.593  1.00 58.32  ? 147 LYS D CD  1 
ATOM   8820  C  CE  . LYS D  1 147 ? -2.298  -36.335 79.436  1.00 61.64  ? 147 LYS D CE  1 
ATOM   8821  N  NZ  . LYS D  1 147 ? -1.862  -36.251 78.018  1.00 61.60  ? 147 LYS D NZ  1 
ATOM   8822  N  N   . ASP D  1 148 ? -8.475  -35.046 82.351  1.00 35.88  ? 148 ASP D N   1 
ATOM   8823  C  CA  . ASP D  1 148 ? -9.747  -34.282 82.396  1.00 35.75  ? 148 ASP D CA  1 
ATOM   8824  C  C   . ASP D  1 148 ? -10.237 -34.068 83.815  1.00 34.13  ? 148 ASP D C   1 
ATOM   8825  O  O   . ASP D  1 148 ? -10.820 -33.023 84.128  1.00 33.49  ? 148 ASP D O   1 
ATOM   8826  C  CB  . ASP D  1 148 ? -10.833 -34.958 81.536  1.00 36.81  ? 148 ASP D CB  1 
ATOM   8827  C  CG  . ASP D  1 148 ? -10.639 -34.690 80.021  1.00 45.42  ? 148 ASP D CG  1 
ATOM   8828  O  OD1 . ASP D  1 148 ? -11.490 -35.149 79.206  1.00 43.89  ? 148 ASP D OD1 1 
ATOM   8829  O  OD2 . ASP D  1 148 ? -9.642  -34.020 79.660  1.00 48.27  ? 148 ASP D OD2 1 
ATOM   8830  N  N   . VAL D  1 149 ? -10.005 -35.044 84.677  1.00 31.88  ? 149 VAL D N   1 
ATOM   8831  C  CA  . VAL D  1 149 ? -10.348 -34.892 86.062  1.00 32.41  ? 149 VAL D CA  1 
ATOM   8832  C  C   . VAL D  1 149 ? -9.530  -33.730 86.664  1.00 32.59  ? 149 VAL D C   1 
ATOM   8833  O  O   . VAL D  1 149 ? -10.066 -32.887 87.412  1.00 32.04  ? 149 VAL D O   1 
ATOM   8834  C  CB  . VAL D  1 149 ? -10.110 -36.217 86.876  1.00 32.20  ? 149 VAL D CB  1 
ATOM   8835  C  CG1 . VAL D  1 149 ? -10.176 -35.953 88.346  1.00 28.43  ? 149 VAL D CG1 1 
ATOM   8836  C  CG2 . VAL D  1 149 ? -11.141 -37.294 86.466  1.00 29.52  ? 149 VAL D CG2 1 
ATOM   8837  N  N   . GLU D  1 150 ? -8.243  -33.678 86.316  1.00 34.05  ? 150 GLU D N   1 
ATOM   8838  C  CA  . GLU D  1 150 ? -7.347  -32.617 86.806  1.00 37.01  ? 150 GLU D CA  1 
ATOM   8839  C  C   . GLU D  1 150 ? -7.798  -31.187 86.339  1.00 36.51  ? 150 GLU D C   1 
ATOM   8840  O  O   . GLU D  1 150 ? -7.750  -30.216 87.130  1.00 37.09  ? 150 GLU D O   1 
ATOM   8841  C  CB  . GLU D  1 150 ? -5.918  -32.879 86.385  1.00 39.51  ? 150 GLU D CB  1 
ATOM   8842  C  CG  . GLU D  1 150 ? -4.915  -31.922 87.005  1.00 45.45  ? 150 GLU D CG  1 
ATOM   8843  C  CD  . GLU D  1 150 ? -3.511  -32.139 86.500  1.00 54.41  ? 150 GLU D CD  1 
ATOM   8844  O  OE1 . GLU D  1 150 ? -2.606  -31.396 86.928  1.00 59.63  ? 150 GLU D OE1 1 
ATOM   8845  O  OE2 . GLU D  1 150 ? -3.306  -33.056 85.665  1.00 58.78  ? 150 GLU D OE2 1 
ATOM   8846  N  N   . LYS D  1 151 ? -8.226  -31.073 85.062  1.00 34.73  ? 151 LYS D N   1 
ATOM   8847  C  CA  . LYS D  1 151 ? -8.726  -29.791 84.532  1.00 32.26  ? 151 LYS D CA  1 
ATOM   8848  C  C   . LYS D  1 151 ? -9.855  -29.294 85.367  1.00 34.69  ? 151 LYS D C   1 
ATOM   8849  O  O   . LYS D  1 151 ? -9.924  -28.083 85.707  1.00 34.49  ? 151 LYS D O   1 
ATOM   8850  C  CB  . LYS D  1 151 ? -9.206  -29.949 83.103  1.00 35.34  ? 151 LYS D CB  1 
ATOM   8851  C  CG  . LYS D  1 151 ? -8.149  -30.319 82.119  1.00 42.90  ? 151 LYS D CG  1 
ATOM   8852  C  CD  . LYS D  1 151 ? -8.735  -30.366 80.706  1.00 41.76  ? 151 LYS D CD  1 
ATOM   8853  C  CE  . LYS D  1 151 ? -7.855  -31.120 79.775  1.00 46.03  ? 151 LYS D CE  1 
ATOM   8854  N  NZ  . LYS D  1 151 ? -8.494  -31.286 78.449  1.00 54.98  ? 151 LYS D NZ  1 
ATOM   8855  N  N   . VAL D  1 152 ? -10.771 -30.200 85.710  1.00 28.97  ? 152 VAL D N   1 
ATOM   8856  C  CA  . VAL D  1 152 ? -11.916 -29.847 86.492  1.00 30.49  ? 152 VAL D CA  1 
ATOM   8857  C  C   . VAL D  1 152 ? -11.488 -29.367 87.888  1.00 27.46  ? 152 VAL D C   1 
ATOM   8858  O  O   . VAL D  1 152 ? -11.953 -28.339 88.371  1.00 30.67  ? 152 VAL D O   1 
ATOM   8859  C  CB  . VAL D  1 152 ? -12.920 -31.052 86.621  1.00 32.96  ? 152 VAL D CB  1 
ATOM   8860  C  CG1 . VAL D  1 152 ? -14.116 -30.663 87.464  1.00 31.67  ? 152 VAL D CG1 1 
ATOM   8861  C  CG2 . VAL D  1 152 ? -13.365 -31.524 85.241  1.00 30.91  ? 152 VAL D CG2 1 
ATOM   8862  N  N   . ILE D  1 153 ? -10.615 -30.102 88.505  1.00 26.66  ? 153 ILE D N   1 
ATOM   8863  C  CA  . ILE D  1 153 ? -10.098 -29.726 89.805  1.00 31.70  ? 153 ILE D CA  1 
ATOM   8864  C  C   . ILE D  1 153 ? -9.461  -28.285 89.782  1.00 32.13  ? 153 ILE D C   1 
ATOM   8865  O  O   . ILE D  1 153 ? -9.705  -27.461 90.694  1.00 32.25  ? 153 ILE D O   1 
ATOM   8866  C  CB  . ILE D  1 153 ? -9.070  -30.725 90.307  1.00 32.17  ? 153 ILE D CB  1 
ATOM   8867  C  CG1 . ILE D  1 153 ? -9.718  -32.135 90.459  1.00 30.21  ? 153 ILE D CG1 1 
ATOM   8868  C  CG2 . ILE D  1 153 ? -8.482  -30.257 91.627  1.00 30.44  ? 153 ILE D CG2 1 
ATOM   8869  C  CD1 . ILE D  1 153 ? -8.733  -33.232 90.860  1.00 29.07  ? 153 ILE D CD1 1 
ATOM   8870  N  N   . ARG D  1 154 ? -8.676  -28.004 88.759  1.00 33.57  ? 154 ARG D N   1 
ATOM   8871  C  CA  . ARG D  1 154 ? -8.023  -26.684 88.640  1.00 35.51  ? 154 ARG D CA  1 
ATOM   8872  C  C   . ARG D  1 154 ? -9.036  -25.592 88.367  1.00 36.12  ? 154 ARG D C   1 
ATOM   8873  O  O   . ARG D  1 154 ? -8.898  -24.461 88.860  1.00 37.46  ? 154 ARG D O   1 
ATOM   8874  C  CB  . ARG D  1 154 ? -6.946  -26.709 87.566  1.00 39.07  ? 154 ARG D CB  1 
ATOM   8875  C  CG  . ARG D  1 154 ? -5.898  -27.796 87.801  1.00 43.68  ? 154 ARG D CG  1 
ATOM   8876  C  CD  . ARG D  1 154 ? -4.620  -27.545 87.042  1.00 43.51  ? 154 ARG D CD  1 
ATOM   8877  N  NE  . ARG D  1 154 ? -3.599  -28.550 87.386  1.00 52.14  ? 154 ARG D NE  1 
ATOM   8878  C  CZ  . ARG D  1 154 ? -2.685  -28.405 88.376  1.00 54.03  ? 154 ARG D CZ  1 
ATOM   8879  N  NH1 . ARG D  1 154 ? -1.807  -29.374 88.616  1.00 47.50  ? 154 ARG D NH1 1 
ATOM   8880  N  NH2 . ARG D  1 154 ? -2.659  -27.285 89.118  1.00 46.40  ? 154 ARG D NH2 1 
ATOM   8881  N  N   . ALA D  1 155 ? -10.065 -25.922 87.593  1.00 32.32  ? 155 ALA D N   1 
ATOM   8882  C  CA  . ALA D  1 155 ? -11.110 -24.972 87.282  1.00 31.60  ? 155 ALA D CA  1 
ATOM   8883  C  C   . ALA D  1 155 ? -11.901 -24.624 88.529  1.00 34.29  ? 155 ALA D C   1 
ATOM   8884  O  O   . ALA D  1 155 ? -12.330 -23.479 88.708  1.00 35.16  ? 155 ALA D O   1 
ATOM   8885  C  CB  . ALA D  1 155 ? -12.030 -25.529 86.202  1.00 32.74  ? 155 ALA D CB  1 
ATOM   8886  N  N   . ALA D  1 156 ? -12.095 -25.619 89.401  1.00 35.27  ? 156 ALA D N   1 
ATOM   8887  C  CA  . ALA D  1 156 ? -12.794 -25.401 90.671  1.00 33.58  ? 156 ALA D CA  1 
ATOM   8888  C  C   . ALA D  1 156 ? -12.004 -24.458 91.557  1.00 29.82  ? 156 ALA D C   1 
ATOM   8889  O  O   . ALA D  1 156 ? -12.588 -23.628 92.295  1.00 30.37  ? 156 ALA D O   1 
ATOM   8890  C  CB  . ALA D  1 156 ? -13.046 -26.744 91.393  1.00 34.48  ? 156 ALA D CB  1 
ATOM   8891  N  N   . ALA D  1 157 ? -10.675 -24.569 91.496  1.00 27.29  ? 157 ALA D N   1 
ATOM   8892  C  CA  . ALA D  1 157 ? -9.771  -23.664 92.276  1.00 31.14  ? 157 ALA D CA  1 
ATOM   8893  C  C   . ALA D  1 157 ? -9.943  -22.220 91.844  1.00 31.44  ? 157 ALA D C   1 
ATOM   8894  O  O   . ALA D  1 157 ? -10.040 -21.301 92.691  1.00 33.74  ? 157 ALA D O   1 
ATOM   8895  C  CB  . ALA D  1 157 ? -8.332  -24.093 92.123  1.00 27.60  ? 157 ALA D CB  1 
ATOM   8896  N  N   . ILE D  1 158 ? -9.986  -22.009 90.539  1.00 32.24  ? 158 ILE D N   1 
ATOM   8897  C  CA  . ILE D  1 158 ? -10.150 -20.700 89.986  1.00 30.58  ? 158 ILE D CA  1 
ATOM   8898  C  C   . ILE D  1 158 ? -11.508 -20.096 90.414  1.00 35.38  ? 158 ILE D C   1 
ATOM   8899  O  O   . ILE D  1 158 ? -11.599 -18.884 90.752  1.00 37.50  ? 158 ILE D O   1 
ATOM   8900  C  CB  . ILE D  1 158 ? -10.051 -20.735 88.459  1.00 29.95  ? 158 ILE D CB  1 
ATOM   8901  C  CG1 . ILE D  1 158 ? -8.654  -21.237 88.030  1.00 30.64  ? 158 ILE D CG1 1 
ATOM   8902  C  CG2 . ILE D  1 158 ? -10.352 -19.346 87.858  1.00 30.67  ? 158 ILE D CG2 1 
ATOM   8903  C  CD1 . ILE D  1 158 ? -8.501  -21.444 86.518  1.00 29.23  ? 158 ILE D CD1 1 
ATOM   8904  N  N   . ALA D  1 159 ? -12.554 -20.935 90.415  1.00 32.09  ? 159 ALA D N   1 
ATOM   8905  C  CA  . ALA D  1 159 ? -13.905 -20.492 90.823  1.00 32.84  ? 159 ALA D CA  1 
ATOM   8906  C  C   . ALA D  1 159 ? -13.944 -20.099 92.298  1.00 33.85  ? 159 ALA D C   1 
ATOM   8907  O  O   . ALA D  1 159 ? -14.675 -19.157 92.695  1.00 36.05  ? 159 ALA D O   1 
ATOM   8908  C  CB  . ALA D  1 159 ? -14.934 -21.579 90.532  1.00 27.82  ? 159 ALA D CB  1 
ATOM   8909  N  N   . ASN D  1 160 ? -13.170 -20.809 93.115  1.00 37.03  ? 160 ASN D N   1 
ATOM   8910  C  CA  . ASN D  1 160 ? -13.101 -20.522 94.547  1.00 38.50  ? 160 ASN D CA  1 
ATOM   8911  C  C   . ASN D  1 160 ? -12.363 -19.206 94.836  1.00 39.44  ? 160 ASN D C   1 
ATOM   8912  O  O   . ASN D  1 160 ? -12.809 -18.396 95.678  1.00 38.16  ? 160 ASN D O   1 
ATOM   8913  C  CB  . ASN D  1 160 ? -12.437 -21.659 95.286  1.00 39.33  ? 160 ASN D CB  1 
ATOM   8914  C  CG  . ASN D  1 160 ? -12.102 -21.301 96.715  1.00 42.33  ? 160 ASN D CG  1 
ATOM   8915  O  OD1 . ASN D  1 160 ? -10.919 -21.029 97.050  1.00 34.70  ? 160 ASN D OD1 1 
ATOM   8916  N  ND2 . ASN D  1 160 ? -13.141 -21.274 97.596  1.00 41.39  ? 160 ASN D ND2 1 
ATOM   8917  N  N   . LYS D  1 161 ? -11.237 -18.992 94.146  1.00 38.60  ? 161 LYS D N   1 
ATOM   8918  C  CA  . LYS D  1 161 ? -10.468 -17.750 94.313  1.00 43.28  ? 161 LYS D CA  1 
ATOM   8919  C  C   . LYS D  1 161 ? -11.299 -16.564 93.953  1.00 42.36  ? 161 LYS D C   1 
ATOM   8920  O  O   . LYS D  1 161 ? -11.274 -15.563 94.628  1.00 46.63  ? 161 LYS D O   1 
ATOM   8921  C  CB  . LYS D  1 161 ? -9.219  -17.762 93.457  1.00 42.46  ? 161 LYS D CB  1 
ATOM   8922  C  CG  . LYS D  1 161 ? -8.182  -18.755 93.867  1.00 48.44  ? 161 LYS D CG  1 
ATOM   8923  C  CD  . LYS D  1 161 ? -6.804  -18.337 93.324  1.00 53.11  ? 161 LYS D CD  1 
ATOM   8924  C  CE  . LYS D  1 161 ? -5.909  -19.504 93.153  1.00 54.86  ? 161 LYS D CE  1 
ATOM   8925  N  NZ  . LYS D  1 161 ? -6.447  -20.459 92.130  1.00 64.92  ? 161 LYS D NZ  1 
ATOM   8926  N  N   . GLU D  1 162 ? -12.044 -16.683 92.874  1.00 43.47  ? 162 GLU D N   1 
ATOM   8927  C  CA  . GLU D  1 162 ? -12.839 -15.586 92.381  1.00 45.00  ? 162 GLU D CA  1 
ATOM   8928  C  C   . GLU D  1 162 ? -14.058 -15.294 93.253  1.00 41.22  ? 162 GLU D C   1 
ATOM   8929  O  O   . GLU D  1 162 ? -14.400 -14.171 93.453  1.00 47.59  ? 162 GLU D O   1 
ATOM   8930  C  CB  . GLU D  1 162 ? -13.286 -15.849 90.921  1.00 50.47  ? 162 GLU D CB  1 
ATOM   8931  C  CG  . GLU D  1 162 ? -12.169 -15.720 89.899  1.00 64.90  ? 162 GLU D CG  1 
ATOM   8932  C  CD  . GLU D  1 162 ? -11.617 -14.284 89.801  1.00 68.37  ? 162 GLU D CD  1 
ATOM   8933  O  OE1 . GLU D  1 162 ? -12.383 -13.322 90.083  1.00 66.20  ? 162 GLU D OE1 1 
ATOM   8934  O  OE2 . GLU D  1 162 ? -10.433 -14.126 89.444  1.00 72.95  ? 162 GLU D OE2 1 
ATOM   8935  N  N   . THR D  1 163 ? -14.698 -16.338 93.764  1.00 37.32  ? 163 THR D N   1 
ATOM   8936  C  CA  . THR D  1 163 ? -16.010 -16.159 94.490  1.00 35.06  ? 163 THR D CA  1 
ATOM   8937  C  C   . THR D  1 163 ? -15.972 -16.567 95.948  1.00 34.65  ? 163 THR D C   1 
ATOM   8938  O  O   . THR D  1 163 ? -16.900 -16.292 96.691  1.00 36.04  ? 163 THR D O   1 
ATOM   8939  C  CB  . THR D  1 163 ? -17.116 -16.909 93.808  1.00 37.29  ? 163 THR D CB  1 
ATOM   8940  O  OG1 . THR D  1 163 ? -16.852 -18.334 93.883  1.00 37.21  ? 163 THR D OG1 1 
ATOM   8941  C  CG2 . THR D  1 163 ? -17.223 -16.480 92.334  1.00 35.56  ? 163 THR D CG2 1 
ATOM   8942  N  N   . LYS D  1 164 ? -14.916 -17.222 96.351  1.00 35.02  ? 164 LYS D N   1 
ATOM   8943  C  CA  . LYS D  1 164 ? -14.761 -17.663 97.802  1.00 39.18  ? 164 LYS D CA  1 
ATOM   8944  C  C   . LYS D  1 164 ? -15.729 -18.790 98.238  1.00 39.49  ? 164 LYS D C   1 
ATOM   8945  O  O   . LYS D  1 164 ? -15.750 -19.164 99.389  1.00 43.06  ? 164 LYS D O   1 
ATOM   8946  C  CB  . LYS D  1 164 ? -14.874 -16.461 98.770  1.00 45.44  ? 164 LYS D CB  1 
ATOM   8947  C  CG  . LYS D  1 164 ? -13.619 -15.575 98.830  1.00 44.75  ? 164 LYS D CG  1 
ATOM   8948  C  CD  . LYS D  1 164 ? -13.358 -14.924 97.517  1.00 54.57  ? 164 LYS D CD  1 
ATOM   8949  C  CE  . LYS D  1 164 ? -12.160 -14.014 97.579  1.00 57.98  ? 164 LYS D CE  1 
ATOM   8950  N  NZ  . LYS D  1 164 ? -11.993 -13.262 96.300  1.00 61.65  ? 164 LYS D NZ  1 
ATOM   8951  N  N   . VAL D  1 165 ? -16.528 -19.317 97.295  1.00 36.06  ? 165 VAL D N   1 
ATOM   8952  C  CA  . VAL D  1 165 ? -17.385 -20.468 97.609  1.00 33.17  ? 165 VAL D CA  1 
ATOM   8953  C  C   . VAL D  1 165 ? -16.507 -21.719 97.883  1.00 32.80  ? 165 VAL D C   1 
ATOM   8954  O  O   . VAL D  1 165 ? -15.466 -21.903 97.245  1.00 33.39  ? 165 VAL D O   1 
ATOM   8955  C  CB  . VAL D  1 165 ? -18.428 -20.774 96.475  1.00 30.60  ? 165 VAL D CB  1 
ATOM   8956  C  CG1 . VAL D  1 165 ? -19.265 -19.527 96.161  1.00 30.84  ? 165 VAL D CG1 1 
ATOM   8957  C  CG2 . VAL D  1 165 ? -17.736 -21.298 95.225  1.00 27.78  ? 165 VAL D CG2 1 
ATOM   8958  N  N   . PRO D  1 166 ? -16.929 -22.564 98.845  1.00 29.59  ? 166 PRO D N   1 
ATOM   8959  C  CA  . PRO D  1 166 ? -16.177 -23.760 99.188  1.00 31.36  ? 166 PRO D CA  1 
ATOM   8960  C  C   . PRO D  1 166 ? -16.273 -24.862 98.097  1.00 30.24  ? 166 PRO D C   1 
ATOM   8961  O  O   . PRO D  1 166 ? -17.098 -24.755 97.141  1.00 26.73  ? 166 PRO D O   1 
ATOM   8962  C  CB  . PRO D  1 166 ? -16.851 -24.236 100.474 1.00 29.46  ? 166 PRO D CB  1 
ATOM   8963  C  CG  . PRO D  1 166 ? -18.216 -23.715 100.389 1.00 32.04  ? 166 PRO D CG  1 
ATOM   8964  C  CD  . PRO D  1 166 ? -18.121 -22.406 99.673  1.00 28.65  ? 166 PRO D CD  1 
ATOM   8965  N  N   . ILE D  1 167 ? -15.467 -25.884 98.236  1.00 33.04  ? 167 ILE D N   1 
ATOM   8966  C  CA  . ILE D  1 167 ? -15.450 -26.963 97.293  1.00 29.10  ? 167 ILE D CA  1 
ATOM   8967  C  C   . ILE D  1 167 ? -15.740 -28.309 97.967  1.00 28.83  ? 167 ILE D C   1 
ATOM   8968  O  O   . ILE D  1 167 ? -15.076 -28.691 98.929  1.00 28.13  ? 167 ILE D O   1 
ATOM   8969  C  CB  . ILE D  1 167 ? -14.103 -27.042 96.570  1.00 27.10  ? 167 ILE D CB  1 
ATOM   8970  C  CG1 . ILE D  1 167 ? -13.838 -25.731 95.792  1.00 26.57  ? 167 ILE D CG1 1 
ATOM   8971  C  CG2 . ILE D  1 167 ? -14.061 -28.270 95.640  1.00 26.06  ? 167 ILE D CG2 1 
ATOM   8972  C  CD1 . ILE D  1 167 ? -12.464 -25.652 95.167  1.00 25.10  ? 167 ILE D CD1 1 
ATOM   8973  N  N   . ILE D  1 168 ? -16.734 -29.011 97.450  1.00 27.13  ? 168 ILE D N   1 
ATOM   8974  C  CA  . ILE D  1 168 ? -17.074 -30.329 97.924  1.00 25.58  ? 168 ILE D CA  1 
ATOM   8975  C  C   . ILE D  1 168 ? -16.620 -31.358 96.891  1.00 28.27  ? 168 ILE D C   1 
ATOM   8976  O  O   . ILE D  1 168 ? -16.855 -31.189 95.730  1.00 28.78  ? 168 ILE D O   1 
ATOM   8977  C  CB  . ILE D  1 168 ? -18.579 -30.464 98.120  1.00 23.26  ? 168 ILE D CB  1 
ATOM   8978  C  CG1 . ILE D  1 168 ? -19.076 -29.472 99.204  1.00 22.59  ? 168 ILE D CG1 1 
ATOM   8979  C  CG2 . ILE D  1 168 ? -18.960 -31.938 98.460  1.00 23.05  ? 168 ILE D CG2 1 
ATOM   8980  C  CD1 . ILE D  1 168 ? -20.600 -29.420 99.343  1.00 25.40  ? 168 ILE D CD1 1 
ATOM   8981  N  N   . THR D  1 169 ? -15.966 -32.436 97.343  1.00 28.18  ? 169 THR D N   1 
ATOM   8982  C  CA  . THR D  1 169 ? -15.448 -33.454 96.384  1.00 28.42  ? 169 THR D CA  1 
ATOM   8983  C  C   . THR D  1 169 ? -16.038 -34.829 96.564  1.00 25.89  ? 169 THR D C   1 
ATOM   8984  O  O   . THR D  1 169 ? -16.502 -35.191 97.634  1.00 24.33  ? 169 THR D O   1 
ATOM   8985  C  CB  . THR D  1 169 ? -13.914 -33.597 96.455  1.00 27.41  ? 169 THR D CB  1 
ATOM   8986  O  OG1 . THR D  1 169 ? -13.574 -34.618 97.392  1.00 30.24  ? 169 THR D OG1 1 
ATOM   8987  C  CG2 . THR D  1 169 ? -13.260 -32.283 96.852  1.00 29.47  ? 169 THR D CG2 1 
ATOM   8988  N  N   . HIS D  1 170 ? -16.007 -35.580 95.498  1.00 25.44  ? 170 HIS D N   1 
ATOM   8989  C  CA  . HIS D  1 170 ? -16.303 -36.923 95.508  1.00 24.26  ? 170 HIS D CA  1 
ATOM   8990  C  C   . HIS D  1 170 ? -15.009 -37.630 95.291  1.00 23.62  ? 170 HIS D C   1 
ATOM   8991  O  O   . HIS D  1 170 ? -14.239 -37.254 94.416  1.00 22.58  ? 170 HIS D O   1 
ATOM   8992  C  CB  . HIS D  1 170 ? -17.254 -37.235 94.369  1.00 23.26  ? 170 HIS D CB  1 
ATOM   8993  C  CG  . HIS D  1 170 ? -17.439 -38.706 94.106  1.00 23.77  ? 170 HIS D CG  1 
ATOM   8994  N  ND1 . HIS D  1 170 ? -18.609 -39.366 94.381  1.00 24.56  ? 170 HIS D ND1 1 
ATOM   8995  C  CD2 . HIS D  1 170 ? -16.567 -39.670 93.552  1.00 27.24  ? 170 HIS D CD2 1 
ATOM   8996  C  CE1 . HIS D  1 170 ? -18.482 -40.679 94.024  1.00 24.00  ? 170 HIS D CE1 1 
ATOM   8997  N  NE2 . HIS D  1 170 ? -17.248 -40.866 93.523  1.00 29.88  ? 170 HIS D NE2 1 
ATOM   8998  N  N   . SER D  1 171 ? -14.736 -38.647 96.088  1.00 22.23  ? 171 SER D N   1 
ATOM   8999  C  CA  . SER D  1 171 ? -13.511 -39.408 95.917  1.00 24.45  ? 171 SER D CA  1 
ATOM   9000  C  C   . SER D  1 171 ? -13.714 -40.856 96.211  1.00 24.03  ? 171 SER D C   1 
ATOM   9001  O  O   . SER D  1 171 ? -14.769 -41.262 96.700  1.00 26.35  ? 171 SER D O   1 
ATOM   9002  C  CB  . SER D  1 171 ? -12.341 -38.819 96.820  1.00 24.42  ? 171 SER D CB  1 
ATOM   9003  O  OG  . SER D  1 171 ? -12.426 -39.302 98.187  1.00 26.55  ? 171 SER D OG  1 
ATOM   9004  N  N   . ASN D  1 172 ? -12.717 -41.639 95.899  1.00 27.58  ? 172 ASN D N   1 
ATOM   9005  C  CA  . ASN D  1 172 ? -12.699 -43.010 96.222  1.00 26.78  ? 172 ASN D CA  1 
ATOM   9006  C  C   . ASN D  1 172 ? -11.771 -43.220 97.401  1.00 28.38  ? 172 ASN D C   1 
ATOM   9007  O  O   . ASN D  1 172 ? -10.580 -42.893 97.337  1.00 28.96  ? 172 ASN D O   1 
ATOM   9008  C  CB  . ASN D  1 172 ? -12.224 -43.834 95.010  1.00 29.81  ? 172 ASN D CB  1 
ATOM   9009  C  CG  . ASN D  1 172 ? -12.197 -45.300 95.286  1.00 28.73  ? 172 ASN D CG  1 
ATOM   9010  O  OD1 . ASN D  1 172 ? -11.497 -45.758 96.176  1.00 31.87  ? 172 ASN D OD1 1 
ATOM   9011  N  ND2 . ASN D  1 172 ? -12.951 -46.050 94.525  1.00 27.96  ? 172 ASN D ND2 1 
ATOM   9012  N  N   . ALA D  1 173 ? -12.307 -43.750 98.470  1.00 29.96  ? 173 ALA D N   1 
ATOM   9013  C  CA  . ALA D  1 173 ? -11.574 -43.854 99.735  1.00 31.62  ? 173 ALA D CA  1 
ATOM   9014  C  C   . ALA D  1 173 ? -10.376 -44.835 99.695  1.00 32.98  ? 173 ALA D C   1 
ATOM   9015  O  O   . ALA D  1 173 ? -9.574  -44.844 100.589 1.00 31.62  ? 173 ALA D O   1 
ATOM   9016  C  CB  . ALA D  1 173 ? -12.522 -44.232 100.862 1.00 28.85  ? 173 ALA D CB  1 
ATOM   9017  N  N   . HIS D  1 174 ? -10.284 -45.642 98.637  1.00 34.65  ? 174 HIS D N   1 
ATOM   9018  C  CA  . HIS D  1 174 ? -9.270  -46.745 98.598  1.00 35.67  ? 174 HIS D CA  1 
ATOM   9019  C  C   . HIS D  1 174 ? -8.104  -46.534 97.622  1.00 37.81  ? 174 HIS D C   1 
ATOM   9020  O  O   . HIS D  1 174 ? -7.229  -47.369 97.533  1.00 42.44  ? 174 HIS D O   1 
ATOM   9021  C  CB  . HIS D  1 174 ? -9.944  -48.091 98.308  1.00 35.30  ? 174 HIS D CB  1 
ATOM   9022  C  CG  . HIS D  1 174 ? -11.082 -48.400 99.208  1.00 36.31  ? 174 HIS D CG  1 
ATOM   9023  N  ND1 . HIS D  1 174 ? -10.918 -48.699 100.522 1.00 39.23  ? 174 HIS D ND1 1 
ATOM   9024  C  CD2 . HIS D  1 174 ? -12.448 -48.467 98.964  1.00 38.78  ? 174 HIS D CD2 1 
ATOM   9025  C  CE1 . HIS D  1 174 ? -12.122 -48.936 101.081 1.00 39.74  ? 174 HIS D CE1 1 
ATOM   9026  N  NE2 . HIS D  1 174 ? -13.053 -48.797 100.142 1.00 43.26  ? 174 HIS D NE2 1 
ATOM   9027  N  N   . ASN D  1 175 ? -8.096  -45.416 96.897  1.00 34.83  ? 175 ASN D N   1 
ATOM   9028  C  CA  . ASN D  1 175 ? -7.017  -45.191 95.860  1.00 37.72  ? 175 ASN D CA  1 
ATOM   9029  C  C   . ASN D  1 175 ? -6.296  -43.837 95.939  1.00 42.97  ? 175 ASN D C   1 
ATOM   9030  O  O   . ASN D  1 175 ? -5.606  -43.452 95.012  1.00 45.66  ? 175 ASN D O   1 
ATOM   9031  C  CB  . ASN D  1 175 ? -7.559  -45.416 94.455  1.00 32.95  ? 175 ASN D CB  1 
ATOM   9032  C  CG  . ASN D  1 175 ? -8.479  -44.308 94.003  1.00 33.17  ? 175 ASN D CG  1 
ATOM   9033  O  OD1 . ASN D  1 175 ? -8.808  -43.380 94.782  1.00 33.25  ? 175 ASN D OD1 1 
ATOM   9034  N  ND2 . ASN D  1 175 ? -8.907  -44.375 92.754  1.00 31.92  ? 175 ASN D ND2 1 
ATOM   9035  N  N   . ASN D  1 176 ? -6.472  -43.129 97.034  1.00 42.70  ? 176 ASN D N   1 
ATOM   9036  C  CA  . ASN D  1 176 ? -5.693  -41.925 97.272  1.00 42.92  ? 176 ASN D CA  1 
ATOM   9037  C  C   . ASN D  1 176 ? -6.183  -40.645 96.482  1.00 37.89  ? 176 ASN D C   1 
ATOM   9038  O  O   . ASN D  1 176 ? -5.535  -39.586 96.537  1.00 32.50  ? 176 ASN D O   1 
ATOM   9039  C  CB  . ASN D  1 176 ? -4.207  -42.197 96.956  1.00 52.66  ? 176 ASN D CB  1 
ATOM   9040  C  CG  . ASN D  1 176 ? -3.311  -41.112 97.431  1.00 60.75  ? 176 ASN D CG  1 
ATOM   9041  O  OD1 . ASN D  1 176 ? -3.330  -40.742 98.611  1.00 74.89  ? 176 ASN D OD1 1 
ATOM   9042  N  ND2 . ASN D  1 176 ? -2.483  -40.577 96.516  1.00 66.10  ? 176 ASN D ND2 1 
ATOM   9043  N  N   . THR D  1 177 ? -7.310  -40.764 95.765  1.00 32.19  ? 177 THR D N   1 
ATOM   9044  C  CA  . THR D  1 177 ? -7.820  -39.622 94.952  1.00 30.96  ? 177 THR D CA  1 
ATOM   9045  C  C   . THR D  1 177 ? -8.170  -38.390 95.829  1.00 32.36  ? 177 THR D C   1 
ATOM   9046  O  O   . THR D  1 177 ? -7.954  -37.218 95.413  1.00 30.15  ? 177 THR D O   1 
ATOM   9047  C  CB  . THR D  1 177 ? -9.046  -40.018 94.086  1.00 30.62  ? 177 THR D CB  1 
ATOM   9048  O  OG1 . THR D  1 177 ? -10.024 -40.683 94.903  1.00 33.69  ? 177 THR D OG1 1 
ATOM   9049  C  CG2 . THR D  1 177 ? -8.623  -40.937 92.954  1.00 27.67  ? 177 THR D CG2 1 
ATOM   9050  N  N   . GLY D  1 178 ? -8.706  -38.648 97.026  1.00 30.13  ? 178 GLY D N   1 
ATOM   9051  C  CA  . GLY D  1 178 ? -9.044  -37.600 97.928  1.00 28.65  ? 178 GLY D CA  1 
ATOM   9052  C  C   . GLY D  1 178 ? -7.814  -36.758 98.332  1.00 30.22  ? 178 GLY D C   1 
ATOM   9053  O  O   . GLY D  1 178 ? -7.864  -35.524 98.330  1.00 27.93  ? 178 GLY D O   1 
ATOM   9054  N  N   . LEU D  1 179 ? -6.723  -37.434 98.671  1.00 33.90  ? 179 LEU D N   1 
ATOM   9055  C  CA  . LEU D  1 179 ? -5.501  -36.752 99.069  1.00 35.31  ? 179 LEU D CA  1 
ATOM   9056  C  C   . LEU D  1 179 ? -4.952  -35.881 97.913  1.00 35.58  ? 179 LEU D C   1 
ATOM   9057  O  O   . LEU D  1 179 ? -4.429  -34.788 98.139  1.00 35.68  ? 179 LEU D O   1 
ATOM   9058  C  CB  . LEU D  1 179 ? -4.434  -37.770 99.534  1.00 36.58  ? 179 LEU D CB  1 
ATOM   9059  C  CG  . LEU D  1 179 ? -3.133  -37.188 100.176 1.00 40.56  ? 179 LEU D CG  1 
ATOM   9060  C  CD1 . LEU D  1 179 ? -3.441  -36.485 101.498 1.00 37.87  ? 179 LEU D CD1 1 
ATOM   9061  C  CD2 . LEU D  1 179 ? -2.090  -38.276 100.373 1.00 38.92  ? 179 LEU D CD2 1 
ATOM   9062  N  N   . GLU D  1 180 ? -5.084  -36.382 96.684  1.00 37.69  ? 180 GLU D N   1 
ATOM   9063  C  CA  . GLU D  1 180 ? -4.600  -35.643 95.469  1.00 35.23  ? 180 GLU D CA  1 
ATOM   9064  C  C   . GLU D  1 180 ? -5.464  -34.415 95.165  1.00 35.21  ? 180 GLU D C   1 
ATOM   9065  O  O   . GLU D  1 180 ? -4.946  -33.357 94.777  1.00 30.25  ? 180 GLU D O   1 
ATOM   9066  C  CB  . GLU D  1 180 ? -4.554  -36.547 94.288  1.00 33.40  ? 180 GLU D CB  1 
ATOM   9067  C  CG  . GLU D  1 180 ? -3.351  -37.488 94.271  1.00 41.93  ? 180 GLU D CG  1 
ATOM   9068  C  CD  . GLU D  1 180 ? -2.015  -36.734 94.224  1.00 41.89  ? 180 GLU D CD  1 
ATOM   9069  O  OE1 . GLU D  1 180 ? -1.415  -36.668 93.145  1.00 48.01  ? 180 GLU D OE1 1 
ATOM   9070  O  OE2 . GLU D  1 180 ? -1.587  -36.203 95.272  1.00 43.54  ? 180 GLU D OE2 1 
ATOM   9071  N  N   . GLN D  1 181 ? -6.777  -34.558 95.338  1.00 29.12  ? 181 GLN D N   1 
ATOM   9072  C  CA  . GLN D  1 181 ? -7.672  -33.467 95.140  1.00 32.30  ? 181 GLN D CA  1 
ATOM   9073  C  C   . GLN D  1 181 ? -7.290  -32.343 96.035  1.00 31.31  ? 181 GLN D C   1 
ATOM   9074  O  O   . GLN D  1 181 ? -7.232  -31.178 95.608  1.00 33.85  ? 181 GLN D O   1 
ATOM   9075  C  CB  . GLN D  1 181 ? -9.135  -33.899 95.435  1.00 29.09  ? 181 GLN D CB  1 
ATOM   9076  C  CG  . GLN D  1 181 ? -9.757  -34.793 94.373  1.00 29.65  ? 181 GLN D CG  1 
ATOM   9077  C  CD  . GLN D  1 181 ? -11.102 -35.415 94.835  1.00 31.54  ? 181 GLN D CD  1 
ATOM   9078  O  OE1 . GLN D  1 181 ? -11.397 -35.469 96.035  1.00 30.41  ? 181 GLN D OE1 1 
ATOM   9079  N  NE2 . GLN D  1 181 ? -11.891 -35.878 93.890  1.00 29.90  ? 181 GLN D NE2 1 
ATOM   9080  N  N   . GLN D  1 182 ? -7.022  -32.671 97.296  1.00 32.15  ? 182 GLN D N   1 
ATOM   9081  C  CA  . GLN D  1 182 ? -6.617  -31.682 98.282  1.00 34.17  ? 182 GLN D CA  1 
ATOM   9082  C  C   . GLN D  1 182 ? -5.294  -31.023 97.898  1.00 33.16  ? 182 GLN D C   1 
ATOM   9083  O  O   . GLN D  1 182 ? -5.167  -29.823 97.946  1.00 41.14  ? 182 GLN D O   1 
ATOM   9084  C  CB  . GLN D  1 182 ? -6.502  -32.329 99.691  1.00 33.50  ? 182 GLN D CB  1 
ATOM   9085  C  CG  . GLN D  1 182 ? -6.099  -31.345 100.806 1.00 34.24  ? 182 GLN D CG  1 
ATOM   9086  C  CD  . GLN D  1 182 ? -5.886  -32.040 102.154 1.00 40.68  ? 182 GLN D CD  1 
ATOM   9087  O  OE1 . GLN D  1 182 ? -5.092  -33.003 102.262 1.00 38.03  ? 182 GLN D OE1 1 
ATOM   9088  N  NE2 . GLN D  1 182 ? -6.595  -31.556 103.201 1.00 36.86  ? 182 GLN D NE2 1 
ATOM   9089  N  N   . ARG D  1 183 ? -4.325  -31.828 97.523  1.00 29.64  ? 183 ARG D N   1 
ATOM   9090  C  CA  . ARG D  1 183 ? -3.026  -31.308 97.136  1.00 33.18  ? 183 ARG D CA  1 
ATOM   9091  C  C   . ARG D  1 183 ? -3.154  -30.292 95.997  1.00 33.19  ? 183 ARG D C   1 
ATOM   9092  O  O   . ARG D  1 183 ? -2.675  -29.158 96.101  1.00 31.90  ? 183 ARG D O   1 
ATOM   9093  C  CB  . ARG D  1 183 ? -2.084  -32.446 96.716  1.00 32.90  ? 183 ARG D CB  1 
ATOM   9094  C  CG  . ARG D  1 183 ? -0.696  -31.952 96.253  1.00 35.81  ? 183 ARG D CG  1 
ATOM   9095  C  CD  . ARG D  1 183 ? 0.181   -33.095 95.753  1.00 37.28  ? 183 ARG D CD  1 
ATOM   9096  N  NE  . ARG D  1 183 ? -0.381  -33.750 94.579  1.00 41.14  ? 183 ARG D NE  1 
ATOM   9097  C  CZ  . ARG D  1 183 ? -0.375  -33.225 93.347  1.00 42.79  ? 183 ARG D CZ  1 
ATOM   9098  N  NH1 . ARG D  1 183 ? -0.911  -33.903 92.325  1.00 41.48  ? 183 ARG D NH1 1 
ATOM   9099  N  NH2 . ARG D  1 183 ? 0.156   -32.032 93.137  1.00 48.88  ? 183 ARG D NH2 1 
ATOM   9100  N  N   . ILE D  1 184 ? -3.801  -30.703 94.922  1.00 31.74  ? 184 ILE D N   1 
ATOM   9101  C  CA  . ILE D  1 184 ? -3.921  -29.874 93.761  1.00 33.07  ? 184 ILE D CA  1 
ATOM   9102  C  C   . ILE D  1 184 ? -4.710  -28.576 94.066  1.00 35.37  ? 184 ILE D C   1 
ATOM   9103  O  O   . ILE D  1 184 ? -4.315  -27.493 93.653  1.00 39.41  ? 184 ILE D O   1 
ATOM   9104  C  CB  . ILE D  1 184 ? -4.558  -30.639 92.590  1.00 37.05  ? 184 ILE D CB  1 
ATOM   9105  C  CG1 . ILE D  1 184 ? -3.585  -31.729 92.085  1.00 32.67  ? 184 ILE D CG1 1 
ATOM   9106  C  CG2 . ILE D  1 184 ? -4.957  -29.665 91.447  1.00 36.37  ? 184 ILE D CG2 1 
ATOM   9107  C  CD1 . ILE D  1 184 ? -4.154  -32.620 91.036  1.00 34.00  ? 184 ILE D CD1 1 
ATOM   9108  N  N   . LEU D  1 185 ? -5.798  -28.706 94.795  1.00 32.93  ? 185 LEU D N   1 
ATOM   9109  C  CA  . LEU D  1 185 ? -6.607  -27.541 95.163  1.00 32.81  ? 185 LEU D CA  1 
ATOM   9110  C  C   . LEU D  1 185 ? -5.797  -26.513 96.019  1.00 32.86  ? 185 LEU D C   1 
ATOM   9111  O  O   . LEU D  1 185 ? -5.858  -25.304 95.778  1.00 35.63  ? 185 LEU D O   1 
ATOM   9112  C  CB  . LEU D  1 185 ? -7.856  -27.971 95.895  1.00 30.34  ? 185 LEU D CB  1 
ATOM   9113  C  CG  . LEU D  1 185 ? -8.890  -28.695 95.054  1.00 30.81  ? 185 LEU D CG  1 
ATOM   9114  C  CD1 . LEU D  1 185 ? -9.945  -29.347 95.938  1.00 29.20  ? 185 LEU D CD1 1 
ATOM   9115  C  CD2 . LEU D  1 185 ? -9.535  -27.732 94.034  1.00 29.28  ? 185 LEU D CD2 1 
ATOM   9116  N  N   . THR D  1 186 ? -5.058  -27.013 96.999  1.00 34.99  ? 186 THR D N   1 
ATOM   9117  C  CA  . THR D  1 186 ? -4.265  -26.149 97.865  1.00 37.73  ? 186 THR D CA  1 
ATOM   9118  C  C   . THR D  1 186 ? -3.101  -25.494 97.080  1.00 38.74  ? 186 THR D C   1 
ATOM   9119  O  O   . THR D  1 186 ? -2.819  -24.317 97.252  1.00 40.90  ? 186 THR D O   1 
ATOM   9120  C  CB  . THR D  1 186 ? -3.718  -26.909 99.092  1.00 38.01  ? 186 THR D CB  1 
ATOM   9121  O  OG1 . THR D  1 186 ? -2.916  -28.010 98.657  1.00 43.05  ? 186 THR D OG1 1 
ATOM   9122  C  CG2 . THR D  1 186 ? -4.868  -27.434 99.949  1.00 36.69  ? 186 THR D CG2 1 
ATOM   9123  N  N   . GLU D  1 187 ? -2.441  -26.286 96.208  1.00 37.23  ? 187 GLU D N   1 
ATOM   9124  C  CA  . GLU D  1 187 ? -1.371  -25.758 95.354  1.00 38.21  ? 187 GLU D CA  1 
ATOM   9125  C  C   . GLU D  1 187 ? -1.891  -24.632 94.462  1.00 38.53  ? 187 GLU D C   1 
ATOM   9126  O  O   . GLU D  1 187 ? -1.197  -23.663 94.216  1.00 38.09  ? 187 GLU D O   1 
ATOM   9127  C  CB  . GLU D  1 187 ? -0.748  -26.874 94.497  1.00 36.09  ? 187 GLU D CB  1 
ATOM   9128  C  CG  . GLU D  1 187 ? 0.120   -27.854 95.289  1.00 39.55  ? 187 GLU D CG  1 
ATOM   9129  C  CD  . GLU D  1 187 ? 0.852   -28.867 94.384  1.00 41.54  ? 187 GLU D CD  1 
ATOM   9130  O  OE1 . GLU D  1 187 ? 1.489   -29.800 94.927  1.00 45.80  ? 187 GLU D OE1 1 
ATOM   9131  O  OE2 . GLU D  1 187 ? 0.784   -28.719 93.127  1.00 41.19  ? 187 GLU D OE2 1 
ATOM   9132  N  N   . GLU D  1 188 ? -3.124  -24.779 93.983  1.00 33.66  ? 188 GLU D N   1 
ATOM   9133  C  CA  . GLU D  1 188 ? -3.751  -23.755 93.176  1.00 36.45  ? 188 GLU D CA  1 
ATOM   9134  C  C   . GLU D  1 188 ? -4.215  -22.519 94.048  1.00 41.04  ? 188 GLU D C   1 
ATOM   9135  O  O   . GLU D  1 188 ? -4.789  -21.589 93.538  1.00 40.20  ? 188 GLU D O   1 
ATOM   9136  C  CB  . GLU D  1 188 ? -4.928  -24.324 92.404  1.00 34.97  ? 188 GLU D CB  1 
ATOM   9137  C  CG  . GLU D  1 188 ? -4.532  -25.221 91.219  1.00 36.74  ? 188 GLU D CG  1 
ATOM   9138  C  CD  . GLU D  1 188 ? -3.939  -24.423 90.038  1.00 42.30  ? 188 GLU D CD  1 
ATOM   9139  O  OE1 . GLU D  1 188 ? -3.808  -23.168 90.153  1.00 45.81  ? 188 GLU D OE1 1 
ATOM   9140  O  OE2 . GLU D  1 188 ? -3.612  -25.039 89.016  1.00 49.00  ? 188 GLU D OE2 1 
ATOM   9141  N  N   . GLY D  1 189 ? -3.945  -22.572 95.364  1.00 37.35  ? 189 GLY D N   1 
ATOM   9142  C  CA  . GLY D  1 189 ? -4.229  -21.425 96.249  1.00 39.88  ? 189 GLY D CA  1 
ATOM   9143  C  C   . GLY D  1 189 ? -5.563  -21.507 97.030  1.00 40.54  ? 189 GLY D C   1 
ATOM   9144  O  O   . GLY D  1 189 ? -5.992  -20.519 97.660  1.00 37.58  ? 189 GLY D O   1 
ATOM   9145  N  N   . VAL D  1 190 ? -6.205  -22.653 96.992  1.00 39.36  ? 190 VAL D N   1 
ATOM   9146  C  CA  . VAL D  1 190 ? -7.414  -22.845 97.760  1.00 37.20  ? 190 VAL D CA  1 
ATOM   9147  C  C   . VAL D  1 190 ? -7.098  -23.033 99.252  1.00 37.45  ? 190 VAL D C   1 
ATOM   9148  O  O   . VAL D  1 190 ? -6.166  -23.837 99.633  1.00 32.96  ? 190 VAL D O   1 
ATOM   9149  C  CB  . VAL D  1 190 ? -8.228  -24.057 97.262  1.00 35.16  ? 190 VAL D CB  1 
ATOM   9150  C  CG1 . VAL D  1 190 ? -9.363  -24.364 98.230  1.00 30.40  ? 190 VAL D CG1 1 
ATOM   9151  C  CG2 . VAL D  1 190 ? -8.766  -23.801 95.859  1.00 31.54  ? 190 VAL D CG2 1 
ATOM   9152  N  N   . ASP D  1 191 ? -7.841  -22.309 100.106 1.00 37.02  ? 191 ASP D N   1 
ATOM   9153  C  CA  . ASP D  1 191 ? -7.749  -22.477 101.539 1.00 36.54  ? 191 ASP D CA  1 
ATOM   9154  C  C   . ASP D  1 191 ? -8.260  -23.919 101.941 1.00 39.20  ? 191 ASP D C   1 
ATOM   9155  O  O   . ASP D  1 191 ? -9.418  -24.274 101.664 1.00 40.32  ? 191 ASP D O   1 
ATOM   9156  C  CB  . ASP D  1 191 ? -8.572  -21.397 102.247 1.00 40.19  ? 191 ASP D CB  1 
ATOM   9157  C  CG  . ASP D  1 191 ? -8.634  -21.595 103.809 1.00 44.29  ? 191 ASP D CG  1 
ATOM   9158  O  OD1 . ASP D  1 191 ? -8.377  -22.728 104.298 1.00 42.86  ? 191 ASP D OD1 1 
ATOM   9159  O  OD2 . ASP D  1 191 ? -8.947  -20.612 104.512 1.00 52.22  ? 191 ASP D OD2 1 
ATOM   9160  N  N   . PRO D  1 192 ? -7.379  -24.726 102.589 1.00 44.16  ? 192 PRO D N   1 
ATOM   9161  C  CA  . PRO D  1 192 ? -7.736  -26.103 103.007 1.00 41.12  ? 192 PRO D CA  1 
ATOM   9162  C  C   . PRO D  1 192 ? -9.082  -26.147 103.730 1.00 39.90  ? 192 PRO D C   1 
ATOM   9163  O  O   . PRO D  1 192 ? -9.842  -27.114 103.574 1.00 36.64  ? 192 PRO D O   1 
ATOM   9164  C  CB  . PRO D  1 192 ? -6.607  -26.479 103.966 1.00 41.93  ? 192 PRO D CB  1 
ATOM   9165  C  CG  . PRO D  1 192 ? -5.428  -25.671 103.501 1.00 45.11  ? 192 PRO D CG  1 
ATOM   9166  C  CD  . PRO D  1 192 ? -5.997  -24.360 103.000 1.00 44.31  ? 192 PRO D CD  1 
ATOM   9167  N  N   . GLY D  1 193 ? -9.374  -25.099 104.513 1.00 34.48  ? 193 GLY D N   1 
ATOM   9168  C  CA  . GLY D  1 193 ? -10.626 -25.025 105.283 1.00 32.33  ? 193 GLY D CA  1 
ATOM   9169  C  C   . GLY D  1 193 ? -11.837 -24.813 104.416 1.00 31.79  ? 193 GLY D C   1 
ATOM   9170  O  O   . GLY D  1 193 ? -12.954 -24.865 104.887 1.00 34.38  ? 193 GLY D O   1 
ATOM   9171  N  N   . LYS D  1 194 ? -11.610 -24.573 103.143 1.00 33.65  ? 194 LYS D N   1 
ATOM   9172  C  CA  . LYS D  1 194 ? -12.700 -24.387 102.197 1.00 32.52  ? 194 LYS D CA  1 
ATOM   9173  C  C   . LYS D  1 194 ? -12.926 -25.652 101.346 1.00 32.47  ? 194 LYS D C   1 
ATOM   9174  O  O   . LYS D  1 194 ? -13.654 -25.618 100.313 1.00 34.00  ? 194 LYS D O   1 
ATOM   9175  C  CB  . LYS D  1 194 ? -12.429 -23.183 101.305 1.00 36.73  ? 194 LYS D CB  1 
ATOM   9176  C  CG  . LYS D  1 194 ? -12.829 -21.852 101.927 1.00 36.56  ? 194 LYS D CG  1 
ATOM   9177  C  CD  . LYS D  1 194 ? -14.328 -21.649 101.823 1.00 43.66  ? 194 LYS D CD  1 
ATOM   9178  C  CE  . LYS D  1 194 ? -14.762 -20.348 102.423 1.00 41.46  ? 194 LYS D CE  1 
ATOM   9179  N  NZ  . LYS D  1 194 ? -16.245 -20.124 102.230 1.00 46.33  ? 194 LYS D NZ  1 
ATOM   9180  N  N   . ILE D  1 195 ? -12.321 -26.761 101.771 1.00 31.61  ? 195 ILE D N   1 
ATOM   9181  C  CA  . ILE D  1 195 ? -12.420 -28.013 101.041 1.00 31.43  ? 195 ILE D CA  1 
ATOM   9182  C  C   . ILE D  1 195 ? -13.007 -29.168 101.901 1.00 31.28  ? 195 ILE D C   1 
ATOM   9183  O  O   . ILE D  1 195 ? -12.532 -29.439 103.027 1.00 29.49  ? 195 ILE D O   1 
ATOM   9184  C  CB  . ILE D  1 195 ? -11.061 -28.467 100.529 1.00 30.40  ? 195 ILE D CB  1 
ATOM   9185  C  CG1 . ILE D  1 195 ? -10.412 -27.380 99.714  1.00 31.47  ? 195 ILE D CG1 1 
ATOM   9186  C  CG2 . ILE D  1 195 ? -11.203 -29.768 99.702  1.00 29.87  ? 195 ILE D CG2 1 
ATOM   9187  C  CD1 . ILE D  1 195 ? -8.953  -27.641 99.423  1.00 26.98  ? 195 ILE D CD1 1 
ATOM   9188  N  N   . LEU D  1 196 ? -14.018 -29.836 101.360 1.00 29.64  ? 196 LEU D N   1 
ATOM   9189  C  CA  . LEU D  1 196 ? -14.519 -31.051 101.928 1.00 26.50  ? 196 LEU D CA  1 
ATOM   9190  C  C   . LEU D  1 196 ? -14.145 -32.215 101.039 1.00 25.90  ? 196 LEU D C   1 
ATOM   9191  O  O   . LEU D  1 196 ? -14.651 -32.335 99.900  1.00 26.25  ? 196 LEU D O   1 
ATOM   9192  C  CB  . LEU D  1 196 ? -16.064 -30.989 102.090 1.00 25.72  ? 196 LEU D CB  1 
ATOM   9193  C  CG  . LEU D  1 196 ? -16.767 -32.344 102.483 1.00 27.08  ? 196 LEU D CG  1 
ATOM   9194  C  CD1 . LEU D  1 196 ? -16.118 -32.961 103.732 1.00 26.33  ? 196 LEU D CD1 1 
ATOM   9195  C  CD2 . LEU D  1 196 ? -18.219 -32.138 102.699 1.00 25.27  ? 196 LEU D CD2 1 
ATOM   9196  N  N   . ILE D  1 197 ? -13.253 -33.076 101.528 1.00 24.24  ? 197 ILE D N   1 
ATOM   9197  C  CA  . ILE D  1 197 ? -12.879 -34.288 100.785 1.00 23.80  ? 197 ILE D CA  1 
ATOM   9198  C  C   . ILE D  1 197 ? -13.923 -35.441 101.076 1.00 25.79  ? 197 ILE D C   1 
ATOM   9199  O  O   . ILE D  1 197 ? -13.978 -35.988 102.196 1.00 23.28  ? 197 ILE D O   1 
ATOM   9200  C  CB  . ILE D  1 197 ? -11.499 -34.747 101.129 1.00 23.19  ? 197 ILE D CB  1 
ATOM   9201  C  CG1 . ILE D  1 197 ? -10.443 -33.623 100.782 1.00 22.08  ? 197 ILE D CG1 1 
ATOM   9202  C  CG2 . ILE D  1 197 ? -11.173 -36.048 100.400 1.00 21.23  ? 197 ILE D CG2 1 
ATOM   9203  C  CD1 . ILE D  1 197 ? -10.389 -33.254 99.266  1.00 22.13  ? 197 ILE D CD1 1 
ATOM   9204  N  N   . GLY D  1 198 ? -14.722 -35.778 100.067 1.00 27.04  ? 198 GLY D N   1 
ATOM   9205  C  CA  . GLY D  1 198 ? -15.884 -36.667 100.265 1.00 23.43  ? 198 GLY D CA  1 
ATOM   9206  C  C   . GLY D  1 198 ? -15.615 -38.192 100.252 1.00 23.01  ? 198 GLY D C   1 
ATOM   9207  O  O   . GLY D  1 198 ? -14.640 -38.672 99.655  1.00 21.07  ? 198 GLY D O   1 
ATOM   9208  N  N   . HIS D  1 199 ? -16.493 -38.924 100.931 1.00 24.61  ? 199 HIS D N   1 
ATOM   9209  C  CA  . HIS D  1 199 ? -16.521 -40.403 100.896 1.00 22.66  ? 199 HIS D CA  1 
ATOM   9210  C  C   . HIS D  1 199 ? -15.377 -41.070 101.611 1.00 24.62  ? 199 HIS D C   1 
ATOM   9211  O  O   . HIS D  1 199 ? -15.106 -42.274 101.403 1.00 24.82  ? 199 HIS D O   1 
ATOM   9212  C  CB  . HIS D  1 199 ? -16.656 -40.905 99.461  1.00 21.84  ? 199 HIS D CB  1 
ATOM   9213  C  CG  . HIS D  1 199 ? -17.779 -40.218 98.679  1.00 22.19  ? 199 HIS D CG  1 
ATOM   9214  N  ND1 . HIS D  1 199 ? -18.931 -39.762 99.283  1.00 23.39  ? 199 HIS D ND1 1 
ATOM   9215  C  CD2 . HIS D  1 199 ? -17.911 -39.919 97.306  1.00 21.36  ? 199 HIS D CD2 1 
ATOM   9216  C  CE1 . HIS D  1 199 ? -19.748 -39.195 98.339  1.00 21.89  ? 199 HIS D CE1 1 
ATOM   9217  N  NE2 . HIS D  1 199 ? -19.139 -39.289 97.139  1.00 23.25  ? 199 HIS D NE2 1 
ATOM   9218  N  N   . LEU D  1 200 ? -14.714 -40.334 102.459 1.00 25.75  ? 200 LEU D N   1 
ATOM   9219  C  CA  . LEU D  1 200 ? -13.676 -40.901 103.272 1.00 27.43  ? 200 LEU D CA  1 
ATOM   9220  C  C   . LEU D  1 200 ? -14.272 -41.916 104.287 1.00 27.25  ? 200 LEU D C   1 
ATOM   9221  O  O   . LEU D  1 200 ? -13.577 -42.783 104.784 1.00 31.27  ? 200 LEU D O   1 
ATOM   9222  C  CB  . LEU D  1 200 ? -12.890 -39.796 103.998 1.00 27.44  ? 200 LEU D CB  1 
ATOM   9223  C  CG  . LEU D  1 200 ? -12.093 -38.868 103.077 1.00 29.13  ? 200 LEU D CG  1 
ATOM   9224  C  CD1 . LEU D  1 200 ? -11.329 -37.814 103.881 1.00 29.57  ? 200 LEU D CD1 1 
ATOM   9225  C  CD2 . LEU D  1 200 ? -11.140 -39.676 102.206 1.00 25.27  ? 200 LEU D CD2 1 
ATOM   9226  N  N   . GLY D  1 201 ? -15.580 -41.780 104.562 1.00 29.40  ? 201 GLY D N   1 
ATOM   9227  C  CA  . GLY D  1 201 ? -16.291 -42.711 105.482 1.00 25.07  ? 201 GLY D CA  1 
ATOM   9228  C  C   . GLY D  1 201 ? -16.456 -44.106 104.897 1.00 28.00  ? 201 GLY D C   1 
ATOM   9229  O  O   . GLY D  1 201 ? -16.933 -45.042 105.592 1.00 26.61  ? 201 GLY D O   1 
ATOM   9230  N  N   . ASP D  1 202 ? -16.068 -44.266 103.619 1.00 28.22  ? 202 ASP D N   1 
ATOM   9231  C  CA  . ASP D  1 202 ? -16.143 -45.584 102.935 1.00 27.90  ? 202 ASP D CA  1 
ATOM   9232  C  C   . ASP D  1 202 ? -15.007 -46.537 103.392 1.00 30.57  ? 202 ASP D C   1 
ATOM   9233  O  O   . ASP D  1 202 ? -15.015 -47.712 103.069 1.00 28.87  ? 202 ASP D O   1 
ATOM   9234  C  CB  . ASP D  1 202 ? -16.096 -45.415 101.419 1.00 27.74  ? 202 ASP D CB  1 
ATOM   9235  C  CG  . ASP D  1 202 ? -17.344 -44.710 100.859 1.00 32.29  ? 202 ASP D CG  1 
ATOM   9236  O  OD1 . ASP D  1 202 ? -18.325 -44.502 101.630 1.00 29.07  ? 202 ASP D OD1 1 
ATOM   9237  O  OD2 . ASP D  1 202 ? -17.340 -44.364 99.638  1.00 32.00  ? 202 ASP D OD2 1 
ATOM   9238  N  N   . THR D  1 203 ? -14.045 -46.003 104.136 1.00 29.48  ? 203 THR D N   1 
ATOM   9239  C  CA  . THR D  1 203 ? -12.919 -46.804 104.609 1.00 30.75  ? 203 THR D CA  1 
ATOM   9240  C  C   . THR D  1 203 ? -12.760 -46.719 106.145 1.00 35.00  ? 203 THR D C   1 
ATOM   9241  O  O   . THR D  1 203 ? -13.186 -45.711 106.789 1.00 32.11  ? 203 THR D O   1 
ATOM   9242  C  CB  . THR D  1 203 ? -11.605 -46.364 103.952 1.00 30.89  ? 203 THR D CB  1 
ATOM   9243  O  OG1 . THR D  1 203 ? -10.556 -47.231 104.357 1.00 35.39  ? 203 THR D OG1 1 
ATOM   9244  C  CG2 . THR D  1 203 ? -11.249 -44.899 104.360 1.00 29.43  ? 203 THR D CG2 1 
ATOM   9245  N  N   . ASP D  1 204 ? -12.158 -47.764 106.738 1.00 34.56  ? 204 ASP D N   1 
ATOM   9246  C  CA  . ASP D  1 204 ? -11.829 -47.742 108.150 1.00 37.49  ? 204 ASP D CA  1 
ATOM   9247  C  C   . ASP D  1 204 ? -10.310 -47.529 108.341 1.00 38.37  ? 204 ASP D C   1 
ATOM   9248  O  O   . ASP D  1 204 ? -9.792  -47.658 109.435 1.00 38.98  ? 204 ASP D O   1 
ATOM   9249  C  CB  . ASP D  1 204 ? -12.307 -49.030 108.863 1.00 35.94  ? 204 ASP D CB  1 
ATOM   9250  C  CG  . ASP D  1 204 ? -11.751 -50.249 108.261 1.00 39.11  ? 204 ASP D CG  1 
ATOM   9251  O  OD1 . ASP D  1 204 ? -12.093 -51.348 108.727 1.00 44.26  ? 204 ASP D OD1 1 
ATOM   9252  O  OD2 . ASP D  1 204 ? -10.965 -50.133 107.312 1.00 42.01  ? 204 ASP D OD2 1 
ATOM   9253  N  N   . ASN D  1 205 ? -9.619  -47.206 107.241 1.00 37.80  ? 205 ASN D N   1 
ATOM   9254  C  CA  . ASN D  1 205 ? -8.220  -46.815 107.306 1.00 36.45  ? 205 ASN D CA  1 
ATOM   9255  C  C   . ASN D  1 205 ? -8.125  -45.429 107.894 1.00 37.98  ? 205 ASN D C   1 
ATOM   9256  O  O   . ASN D  1 205 ? -8.031  -44.412 107.158 1.00 37.62  ? 205 ASN D O   1 
ATOM   9257  C  CB  . ASN D  1 205 ? -7.583  -46.853 105.917 1.00 37.61  ? 205 ASN D CB  1 
ATOM   9258  C  CG  . ASN D  1 205 ? -6.089  -46.456 105.935 1.00 43.25  ? 205 ASN D CG  1 
ATOM   9259  O  OD1 . ASN D  1 205 ? -5.544  -46.060 106.979 1.00 42.64  ? 205 ASN D OD1 1 
ATOM   9260  N  ND2 . ASN D  1 205 ? -5.435  -46.560 104.778 1.00 44.81  ? 205 ASN D ND2 1 
ATOM   9261  N  N   . ILE D  1 206 ? -8.161  -45.368 109.201 1.00 38.16  ? 206 ILE D N   1 
ATOM   9262  C  CA  . ILE D  1 206 ? -8.203  -44.143 109.904 1.00 36.31  ? 206 ILE D CA  1 
ATOM   9263  C  C   . ILE D  1 206 ? -6.929  -43.263 109.644 1.00 36.46  ? 206 ILE D C   1 
ATOM   9264  O  O   . ILE D  1 206 ? -6.997  -42.030 109.671 1.00 36.32  ? 206 ILE D O   1 
ATOM   9265  C  CB  . ILE D  1 206 ? -8.408  -44.390 111.470 1.00 40.59  ? 206 ILE D CB  1 
ATOM   9266  C  CG1 . ILE D  1 206 ? -8.735  -43.117 112.170 1.00 44.74  ? 206 ILE D CG1 1 
ATOM   9267  C  CG2 . ILE D  1 206 ? -7.180  -45.086 112.083 1.00 42.60  ? 206 ILE D CG2 1 
ATOM   9268  C  CD1 . ILE D  1 206 ? -10.120 -42.619 111.884 1.00 55.87  ? 206 ILE D CD1 1 
ATOM   9269  N  N   . ASP D  1 207 ? -5.803  -43.915 109.388 1.00 35.58  ? 207 ASP D N   1 
ATOM   9270  C  CA  . ASP D  1 207 ? -4.550  -43.205 109.116 1.00 35.82  ? 207 ASP D CA  1 
ATOM   9271  C  C   . ASP D  1 207 ? -4.653  -42.348 107.850 1.00 34.86  ? 207 ASP D C   1 
ATOM   9272  O  O   . ASP D  1 207 ? -4.253  -41.195 107.844 1.00 35.76  ? 207 ASP D O   1 
ATOM   9273  C  CB  . ASP D  1 207 ? -3.383  -44.190 109.008 1.00 37.08  ? 207 ASP D CB  1 
ATOM   9274  C  CG  . ASP D  1 207 ? -3.022  -44.827 110.365 1.00 44.45  ? 207 ASP D CG  1 
ATOM   9275  O  OD1 . ASP D  1 207 ? -3.447  -44.281 111.413 1.00 45.06  ? 207 ASP D OD1 1 
ATOM   9276  O  OD2 . ASP D  1 207 ? -2.314  -45.869 110.375 1.00 48.84  ? 207 ASP D OD2 1 
ATOM   9277  N  N   . TYR D  1 208 ? -5.199  -42.922 106.791 1.00 34.13  ? 208 TYR D N   1 
ATOM   9278  C  CA  . TYR D  1 208 ? -5.415  -42.162 105.537 1.00 33.14  ? 208 TYR D CA  1 
ATOM   9279  C  C   . TYR D  1 208 ? -6.356  -40.967 105.764 1.00 30.85  ? 208 TYR D C   1 
ATOM   9280  O  O   . TYR D  1 208 ? -6.109  -39.857 105.260 1.00 30.33  ? 208 TYR D O   1 
ATOM   9281  C  CB  . TYR D  1 208 ? -5.963  -43.061 104.445 1.00 33.13  ? 208 TYR D CB  1 
ATOM   9282  C  CG  . TYR D  1 208 ? -6.334  -42.318 103.188 1.00 34.68  ? 208 TYR D CG  1 
ATOM   9283  C  CD1 . TYR D  1 208 ? -5.345  -41.715 102.387 1.00 34.19  ? 208 TYR D CD1 1 
ATOM   9284  C  CD2 . TYR D  1 208 ? -7.679  -42.207 102.782 1.00 34.98  ? 208 TYR D CD2 1 
ATOM   9285  C  CE1 . TYR D  1 208 ? -5.679  -41.021 101.222 1.00 36.50  ? 208 TYR D CE1 1 
ATOM   9286  C  CE2 . TYR D  1 208 ? -8.028  -41.515 101.615 1.00 34.64  ? 208 TYR D CE2 1 
ATOM   9287  C  CZ  . TYR D  1 208 ? -7.018  -40.921 100.836 1.00 35.87  ? 208 TYR D CZ  1 
ATOM   9288  O  OH  . TYR D  1 208 ? -7.343  -40.246 99.697  1.00 36.10  ? 208 TYR D OH  1 
ATOM   9289  N  N   . ILE D  1 209 ? -7.425  -41.194 106.525 1.00 29.15  ? 209 ILE D N   1 
ATOM   9290  C  CA  . ILE D  1 209 ? -8.413  -40.133 106.800 1.00 28.73  ? 209 ILE D CA  1 
ATOM   9291  C  C   . ILE D  1 209 ? -7.798  -38.964 107.562 1.00 30.43  ? 209 ILE D C   1 
ATOM   9292  O  O   . ILE D  1 209 ? -8.021  -37.779 107.210 1.00 29.94  ? 209 ILE D O   1 
ATOM   9293  C  CB  . ILE D  1 209 ? -9.611  -40.669 107.593 1.00 27.33  ? 209 ILE D CB  1 
ATOM   9294  C  CG1 . ILE D  1 209 ? -10.306 -41.802 106.814 1.00 23.35  ? 209 ILE D CG1 1 
ATOM   9295  C  CG2 . ILE D  1 209 ? -10.584 -39.539 107.910 1.00 24.18  ? 209 ILE D CG2 1 
ATOM   9296  C  CD1 . ILE D  1 209 ? -11.546 -42.348 107.502 1.00 24.62  ? 209 ILE D CD1 1 
ATOM   9297  N  N   . LYS D  1 210 ? -7.036  -39.274 108.602 1.00 31.29  ? 210 LYS D N   1 
ATOM   9298  C  CA  . LYS D  1 210 ? -6.371  -38.222 109.422 1.00 32.51  ? 210 LYS D CA  1 
ATOM   9299  C  C   . LYS D  1 210 ? -5.373  -37.409 108.590 1.00 34.09  ? 210 LYS D C   1 
ATOM   9300  O  O   . LYS D  1 210 ? -5.202  -36.162 108.803 1.00 32.88  ? 210 LYS D O   1 
ATOM   9301  C  CB  . LYS D  1 210 ? -5.670  -38.836 110.588 1.00 34.49  ? 210 LYS D CB  1 
ATOM   9302  C  CG  . LYS D  1 210 ? -6.586  -39.462 111.614 1.00 30.26  ? 210 LYS D CG  1 
ATOM   9303  C  CD  . LYS D  1 210 ? -5.764  -40.110 112.732 1.00 33.42  ? 210 LYS D CD  1 
ATOM   9304  C  CE  . LYS D  1 210 ? -6.615  -40.533 113.862 1.00 33.30  ? 210 LYS D CE  1 
ATOM   9305  N  NZ  . LYS D  1 210 ? -5.831  -41.269 114.849 1.00 32.34  ? 210 LYS D NZ  1 
ATOM   9306  N  N   . LYS D  1 211 ? -4.714  -38.082 107.660 1.00 34.89  ? 211 LYS D N   1 
ATOM   9307  C  CA  . LYS D  1 211 ? -3.730  -37.455 106.804 1.00 36.85  ? 211 LYS D CA  1 
ATOM   9308  C  C   . LYS D  1 211 ? -4.338  -36.243 106.111 1.00 36.88  ? 211 LYS D C   1 
ATOM   9309  O  O   . LYS D  1 211 ? -3.718  -35.194 106.017 1.00 37.60  ? 211 LYS D O   1 
ATOM   9310  C  CB  . LYS D  1 211 ? -3.231  -38.458 105.774 1.00 39.71  ? 211 LYS D CB  1 
ATOM   9311  C  CG  . LYS D  1 211 ? -1.811  -38.250 105.328 1.00 47.20  ? 211 LYS D CG  1 
ATOM   9312  C  CD  . LYS D  1 211 ? -1.234  -39.543 104.743 1.00 46.99  ? 211 LYS D CD  1 
ATOM   9313  C  CE  . LYS D  1 211 ? 0.209   -39.381 104.374 1.00 56.89  ? 211 LYS D CE  1 
ATOM   9314  N  NZ  . LYS D  1 211 ? 0.379   -38.457 103.234 1.00 70.46  ? 211 LYS D NZ  1 
ATOM   9315  N  N   . ILE D  1 212 ? -5.554  -36.398 105.649 1.00 33.85  ? 212 ILE D N   1 
ATOM   9316  C  CA  . ILE D  1 212 ? -6.247  -35.344 104.958 1.00 30.86  ? 212 ILE D CA  1 
ATOM   9317  C  C   . ILE D  1 212 ? -6.725  -34.213 105.937 1.00 32.45  ? 212 ILE D C   1 
ATOM   9318  O  O   . ILE D  1 212 ? -6.605  -33.012 105.630 1.00 32.50  ? 212 ILE D O   1 
ATOM   9319  C  CB  . ILE D  1 212 ? -7.430  -35.897 104.187 1.00 34.78  ? 212 ILE D CB  1 
ATOM   9320  C  CG1 . ILE D  1 212 ? -6.926  -36.742 102.989 1.00 35.26  ? 212 ILE D CG1 1 
ATOM   9321  C  CG2 . ILE D  1 212 ? -8.353  -34.759 103.722 1.00 33.61  ? 212 ILE D CG2 1 
ATOM   9322  C  CD1 . ILE D  1 212 ? -7.910  -37.742 102.490 1.00 39.37  ? 212 ILE D CD1 1 
ATOM   9323  N  N   . ALA D  1 213 ? -7.249  -34.611 107.092 1.00 30.41  ? 213 ALA D N   1 
ATOM   9324  C  CA  . ALA D  1 213 ? -7.696  -33.665 108.079 1.00 28.80  ? 213 ALA D CA  1 
ATOM   9325  C  C   . ALA D  1 213 ? -6.514  -32.859 108.635 1.00 30.56  ? 213 ALA D C   1 
ATOM   9326  O  O   . ALA D  1 213 ? -6.647  -31.639 108.943 1.00 30.93  ? 213 ALA D O   1 
ATOM   9327  C  CB  . ALA D  1 213 ? -8.440  -34.381 109.208 1.00 30.74  ? 213 ALA D CB  1 
ATOM   9328  N  N   . ASP D  1 214 ? -5.366  -33.515 108.766 1.00 30.71  ? 214 ASP D N   1 
ATOM   9329  C  CA  . ASP D  1 214 ? -4.160  -32.850 109.272 1.00 32.73  ? 214 ASP D CA  1 
ATOM   9330  C  C   . ASP D  1 214 ? -3.703  -31.760 108.340 1.00 36.56  ? 214 ASP D C   1 
ATOM   9331  O  O   . ASP D  1 214 ? -3.013  -30.824 108.756 1.00 38.50  ? 214 ASP D O   1 
ATOM   9332  C  CB  . ASP D  1 214 ? -3.031  -33.864 109.498 1.00 32.29  ? 214 ASP D CB  1 
ATOM   9333  C  CG  . ASP D  1 214 ? -3.297  -34.787 110.708 1.00 35.59  ? 214 ASP D CG  1 
ATOM   9334  O  OD1 . ASP D  1 214 ? -4.140  -34.414 111.583 1.00 35.58  ? 214 ASP D OD1 1 
ATOM   9335  O  OD2 . ASP D  1 214 ? -2.679  -35.857 110.782 1.00 39.29  ? 214 ASP D OD2 1 
ATOM   9336  N  N   . LYS D  1 215 ? -4.079  -31.867 107.075 1.00 35.31  ? 215 LYS D N   1 
ATOM   9337  C  CA  . LYS D  1 215 ? -3.708  -30.840 106.086 1.00 37.14  ? 215 LYS D CA  1 
ATOM   9338  C  C   . LYS D  1 215 ? -4.748  -29.684 106.017 1.00 34.68  ? 215 LYS D C   1 
ATOM   9339  O  O   . LYS D  1 215 ? -4.650  -28.820 105.197 1.00 38.71  ? 215 LYS D O   1 
ATOM   9340  C  CB  . LYS D  1 215 ? -3.466  -31.453 104.738 1.00 37.36  ? 215 LYS D CB  1 
ATOM   9341  C  CG  . LYS D  1 215 ? -2.104  -32.092 104.627 1.00 43.98  ? 215 LYS D CG  1 
ATOM   9342  C  CD  . LYS D  1 215 ? -2.082  -33.205 103.630 1.00 50.78  ? 215 LYS D CD  1 
ATOM   9343  C  CE  . LYS D  1 215 ? -0.739  -33.938 103.670 1.00 57.66  ? 215 LYS D CE  1 
ATOM   9344  N  NZ  . LYS D  1 215 ? -0.733  -35.159 102.820 1.00 62.85  ? 215 LYS D NZ  1 
ATOM   9345  N  N   . GLY D  1 216 ? -5.731  -29.723 106.912 1.00 34.72  ? 216 GLY D N   1 
ATOM   9346  C  CA  . GLY D  1 216 ? -6.643  -28.570 107.116 1.00 33.29  ? 216 GLY D CA  1 
ATOM   9347  C  C   . GLY D  1 216 ? -8.013  -28.669 106.486 1.00 32.80  ? 216 GLY D C   1 
ATOM   9348  O  O   . GLY D  1 216 ? -8.790  -27.760 106.588 1.00 34.96  ? 216 GLY D O   1 
ATOM   9349  N  N   . SER D  1 217 ? -8.307  -29.788 105.835 1.00 30.52  ? 217 SER D N   1 
ATOM   9350  C  CA  . SER D  1 217 ? -9.635  -29.934 105.126 1.00 29.52  ? 217 SER D CA  1 
ATOM   9351  C  C   . SER D  1 217 ? -10.655 -30.788 105.896 1.00 27.79  ? 217 SER D C   1 
ATOM   9352  O  O   . SER D  1 217 ? -10.294 -31.636 106.677 1.00 28.47  ? 217 SER D O   1 
ATOM   9353  C  CB  . SER D  1 217 ? -9.437  -30.487 103.701 1.00 29.71  ? 217 SER D CB  1 
ATOM   9354  O  OG  . SER D  1 217 ? -8.643  -29.601 102.919 1.00 30.00  ? 217 SER D OG  1 
ATOM   9355  N  N   . PHE D  1 218 ? -11.935 -30.533 105.651 1.00 27.75  ? 218 PHE D N   1 
ATOM   9356  C  CA  . PHE D  1 218 ? -12.977 -31.333 106.231 1.00 25.58  ? 218 PHE D CA  1 
ATOM   9357  C  C   . PHE D  1 218 ? -13.001 -32.717 105.581 1.00 26.02  ? 218 PHE D C   1 
ATOM   9358  O  O   . PHE D  1 218 ? -12.711 -32.864 104.380 1.00 24.48  ? 218 PHE D O   1 
ATOM   9359  C  CB  . PHE D  1 218 ? -14.327 -30.641 106.095 1.00 25.04  ? 218 PHE D CB  1 
ATOM   9360  C  CG  . PHE D  1 218 ? -14.431 -29.369 106.887 1.00 26.21  ? 218 PHE D CG  1 
ATOM   9361  C  CD1 . PHE D  1 218 ? -14.232 -28.115 106.270 1.00 27.13  ? 218 PHE D CD1 1 
ATOM   9362  C  CD2 . PHE D  1 218 ? -14.708 -29.405 108.262 1.00 27.21  ? 218 PHE D CD2 1 
ATOM   9363  C  CE1 . PHE D  1 218 ? -14.319 -26.936 107.009 1.00 25.89  ? 218 PHE D CE1 1 
ATOM   9364  C  CE2 . PHE D  1 218 ? -14.794 -28.219 109.008 1.00 29.05  ? 218 PHE D CE2 1 
ATOM   9365  C  CZ  . PHE D  1 218 ? -14.603 -26.989 108.385 1.00 26.52  ? 218 PHE D CZ  1 
ATOM   9366  N  N   . ILE D  1 219 ? -13.325 -33.723 106.376 1.00 23.75  ? 219 ILE D N   1 
ATOM   9367  C  CA  . ILE D  1 219 ? -13.332 -35.109 105.911 1.00 25.20  ? 219 ILE D CA  1 
ATOM   9368  C  C   . ILE D  1 219 ? -14.738 -35.617 105.884 1.00 27.14  ? 219 ILE D C   1 
ATOM   9369  O  O   . ILE D  1 219 ? -15.496 -35.463 106.873 1.00 25.26  ? 219 ILE D O   1 
ATOM   9370  C  CB  . ILE D  1 219 ? -12.468 -36.007 106.813 1.00 26.89  ? 219 ILE D CB  1 
ATOM   9371  C  CG1 . ILE D  1 219 ? -12.895 -35.866 108.269 1.00 27.34  ? 219 ILE D CG1 1 
ATOM   9372  C  CG2 . ILE D  1 219 ? -10.955 -35.654 106.656 1.00 24.25  ? 219 ILE D CG2 1 
ATOM   9373  C  CD1 . ILE D  1 219 ? -12.062 -36.706 109.240 1.00 27.58  ? 219 ILE D CD1 1 
ATOM   9374  N  N   . GLY D  1 220 ? -15.120 -36.219 104.766 1.00 24.95  ? 220 GLY D N   1 
ATOM   9375  C  CA  . GLY D  1 220 ? -16.475 -36.578 104.544 1.00 24.88  ? 220 GLY D CA  1 
ATOM   9376  C  C   . GLY D  1 220 ? -16.835 -37.961 104.974 1.00 24.04  ? 220 GLY D C   1 
ATOM   9377  O  O   . GLY D  1 220 ? -16.602 -38.925 104.248 1.00 23.18  ? 220 GLY D O   1 
ATOM   9378  N  N   . LEU D  1 221 ? -17.404 -38.071 106.175 1.00 22.75  ? 221 LEU D N   1 
ATOM   9379  C  CA  . LEU D  1 221 ? -18.014 -39.340 106.643 1.00 25.14  ? 221 LEU D CA  1 
ATOM   9380  C  C   . LEU D  1 221 ? -19.432 -39.260 106.241 1.00 23.42  ? 221 LEU D C   1 
ATOM   9381  O  O   . LEU D  1 221 ? -20.333 -39.135 107.080 1.00 24.00  ? 221 LEU D O   1 
ATOM   9382  C  CB  . LEU D  1 221 ? -17.886 -39.457 108.140 1.00 22.54  ? 221 LEU D CB  1 
ATOM   9383  C  CG  . LEU D  1 221 ? -16.469 -39.164 108.676 1.00 24.69  ? 221 LEU D CG  1 
ATOM   9384  C  CD1 . LEU D  1 221 ? -16.371 -39.451 110.174 1.00 24.60  ? 221 LEU D CD1 1 
ATOM   9385  C  CD2 . LEU D  1 221 ? -15.427 -39.958 107.909 1.00 22.61  ? 221 LEU D CD2 1 
ATOM   9386  N  N   . ASP D  1 222 ? -19.655 -39.334 104.936 1.00 24.81  ? 222 ASP D N   1 
ATOM   9387  C  CA  . ASP D  1 222 ? -20.871 -38.764 104.321 1.00 25.63  ? 222 ASP D CA  1 
ATOM   9388  C  C   . ASP D  1 222 ? -21.727 -39.748 103.577 1.00 25.84  ? 222 ASP D C   1 
ATOM   9389  O  O   . ASP D  1 222 ? -22.584 -39.341 102.762 1.00 26.36  ? 222 ASP D O   1 
ATOM   9390  C  CB  . ASP D  1 222 ? -20.458 -37.666 103.373 1.00 25.54  ? 222 ASP D CB  1 
ATOM   9391  C  CG  . ASP D  1 222 ? -19.336 -38.146 102.334 1.00 29.81  ? 222 ASP D CG  1 
ATOM   9392  O  OD1 . ASP D  1 222 ? -18.600 -37.278 101.799 1.00 25.99  ? 222 ASP D OD1 1 
ATOM   9393  O  OD2 . ASP D  1 222 ? -19.222 -39.417 102.088 1.00 27.47  ? 222 ASP D OD2 1 
ATOM   9394  N  N   . ARG D  1 223 ? -21.527 -41.038 103.823 1.00 22.71  ? 223 ARG D N   1 
ATOM   9395  C  CA  . ARG D  1 223 ? -22.307 -42.069 103.119 1.00 23.93  ? 223 ARG D CA  1 
ATOM   9396  C  C   . ARG D  1 223 ? -22.966 -43.080 104.081 1.00 24.15  ? 223 ARG D C   1 
ATOM   9397  O  O   . ARG D  1 223 ? -23.095 -44.245 103.767 1.00 22.79  ? 223 ARG D O   1 
ATOM   9398  C  CB  . ARG D  1 223 ? -21.432 -42.798 102.059 1.00 24.46  ? 223 ARG D CB  1 
ATOM   9399  C  CG  . ARG D  1 223 ? -21.412 -42.104 100.682 1.00 23.23  ? 223 ARG D CG  1 
ATOM   9400  C  CD  . ARG D  1 223 ? -20.439 -42.766 99.736  1.00 24.77  ? 223 ARG D CD  1 
ATOM   9401  N  NE  . ARG D  1 223 ? -20.732 -42.437 98.319  1.00 26.54  ? 223 ARG D NE  1 
ATOM   9402  C  CZ  . ARG D  1 223 ? -19.993 -42.853 97.284  1.00 27.31  ? 223 ARG D CZ  1 
ATOM   9403  N  NH1 . ARG D  1 223 ? -18.919 -43.599 97.495  1.00 21.98  ? 223 ARG D NH1 1 
ATOM   9404  N  NH2 . ARG D  1 223 ? -20.334 -42.513 96.030  1.00 26.49  ? 223 ARG D NH2 1 
ATOM   9405  N  N   . TYR D  1 224 ? -23.371 -42.603 105.233 1.00 25.26  ? 224 TYR D N   1 
ATOM   9406  C  CA  . TYR D  1 224 ? -24.032 -43.433 106.199 1.00 27.67  ? 224 TYR D CA  1 
ATOM   9407  C  C   . TYR D  1 224 ? -25.279 -44.075 105.601 1.00 30.53  ? 224 TYR D C   1 
ATOM   9408  O  O   . TYR D  1 224 ? -26.146 -43.383 105.044 1.00 28.51  ? 224 TYR D O   1 
ATOM   9409  C  CB  . TYR D  1 224 ? -24.397 -42.627 107.424 1.00 28.00  ? 224 TYR D CB  1 
ATOM   9410  C  CG  . TYR D  1 224 ? -23.370 -42.676 108.508 1.00 26.60  ? 224 TYR D CG  1 
ATOM   9411  C  CD1 . TYR D  1 224 ? -22.462 -41.640 108.685 1.00 24.48  ? 224 TYR D CD1 1 
ATOM   9412  C  CD2 . TYR D  1 224 ? -23.302 -43.779 109.384 1.00 26.79  ? 224 TYR D CD2 1 
ATOM   9413  C  CE1 . TYR D  1 224 ? -21.505 -41.689 109.702 1.00 24.59  ? 224 TYR D CE1 1 
ATOM   9414  C  CE2 . TYR D  1 224 ? -22.362 -43.838 110.390 1.00 26.40  ? 224 TYR D CE2 1 
ATOM   9415  C  CZ  . TYR D  1 224 ? -21.463 -42.796 110.553 1.00 27.03  ? 224 TYR D CZ  1 
ATOM   9416  O  OH  . TYR D  1 224 ? -20.515 -42.860 111.576 1.00 28.38  ? 224 TYR D OH  1 
ATOM   9417  N  N   . GLY D  1 225 ? -25.367 -45.405 105.711 1.00 31.82  ? 225 GLY D N   1 
ATOM   9418  C  CA  . GLY D  1 225 ? -26.491 -46.135 105.181 1.00 34.99  ? 225 GLY D CA  1 
ATOM   9419  C  C   . GLY D  1 225 ? -26.125 -46.973 103.962 1.00 41.16  ? 225 GLY D C   1 
ATOM   9420  O  O   . GLY D  1 225 ? -26.771 -47.960 103.673 1.00 41.72  ? 225 GLY D O   1 
ATOM   9421  N  N   . LEU D  1 226 ? -25.079 -46.556 103.242 1.00 38.78  ? 226 LEU D N   1 
ATOM   9422  C  CA  . LEU D  1 226 ? -24.603 -47.321 102.062 1.00 39.92  ? 226 LEU D CA  1 
ATOM   9423  C  C   . LEU D  1 226 ? -23.650 -48.429 102.489 1.00 38.20  ? 226 LEU D C   1 
ATOM   9424  O  O   . LEU D  1 226 ? -22.403 -48.276 102.407 1.00 35.21  ? 226 LEU D O   1 
ATOM   9425  C  CB  . LEU D  1 226 ? -23.938 -46.396 101.054 1.00 36.28  ? 226 LEU D CB  1 
ATOM   9426  C  CG  . LEU D  1 226 ? -24.889 -45.454 100.298 1.00 42.59  ? 226 LEU D CG  1 
ATOM   9427  C  CD1 . LEU D  1 226 ? -24.116 -44.437 99.486  1.00 44.52  ? 226 LEU D CD1 1 
ATOM   9428  C  CD2 . LEU D  1 226 ? -25.835 -46.249 99.405  1.00 47.96  ? 226 LEU D CD2 1 
ATOM   9429  N  N   . ASP D  1 227 ? -24.226 -49.553 102.949 1.00 41.15  ? 227 ASP D N   1 
ATOM   9430  C  CA  . ASP D  1 227 ? -23.421 -50.699 103.502 1.00 43.60  ? 227 ASP D CA  1 
ATOM   9431  C  C   . ASP D  1 227 ? -22.459 -51.298 102.497 1.00 43.62  ? 227 ASP D C   1 
ATOM   9432  O  O   . ASP D  1 227 ? -21.359 -51.743 102.866 1.00 49.13  ? 227 ASP D O   1 
ATOM   9433  C  CB  . ASP D  1 227 ? -24.349 -51.797 104.072 1.00 49.05  ? 227 ASP D CB  1 
ATOM   9434  C  CG  . ASP D  1 227 ? -25.074 -51.351 105.381 1.00 57.87  ? 227 ASP D CG  1 
ATOM   9435  O  OD1 . ASP D  1 227 ? -24.540 -50.453 106.097 1.00 60.25  ? 227 ASP D OD1 1 
ATOM   9436  O  OD2 . ASP D  1 227 ? -26.148 -51.897 105.676 1.00 60.47  ? 227 ASP D OD2 1 
ATOM   9437  N  N   . LEU D  1 228 ? -22.854 -51.314 101.222 1.00 41.21  ? 228 LEU D N   1 
ATOM   9438  C  CA  . LEU D  1 228 ? -22.008 -51.899 100.174 1.00 44.07  ? 228 LEU D CA  1 
ATOM   9439  C  C   . LEU D  1 228 ? -20.604 -51.246 100.138 1.00 41.05  ? 228 LEU D C   1 
ATOM   9440  O  O   . LEU D  1 228 ? -19.652 -51.866 99.756  1.00 44.15  ? 228 LEU D O   1 
ATOM   9441  C  CB  . LEU D  1 228 ? -22.686 -51.815 98.786  1.00 39.02  ? 228 LEU D CB  1 
ATOM   9442  C  CG  . LEU D  1 228 ? -22.763 -50.448 98.124  1.00 47.03  ? 228 LEU D CG  1 
ATOM   9443  C  CD1 . LEU D  1 228 ? -22.865 -50.583 96.588  1.00 39.80  ? 228 LEU D CD1 1 
ATOM   9444  C  CD2 . LEU D  1 228 ? -23.931 -49.617 98.696  1.00 45.06  ? 228 LEU D CD2 1 
ATOM   9445  N  N   . PHE D  1 229 ? -20.523 -49.991 100.543 1.00 39.89  ? 229 PHE D N   1 
ATOM   9446  C  CA  . PHE D  1 229 ? -19.237 -49.315 100.642 1.00 40.18  ? 229 PHE D CA  1 
ATOM   9447  C  C   . PHE D  1 229 ? -18.595 -49.575 102.025 1.00 42.65  ? 229 PHE D C   1 
ATOM   9448  O  O   . PHE D  1 229 ? -17.408 -49.864 102.121 1.00 41.59  ? 229 PHE D O   1 
ATOM   9449  C  CB  . PHE D  1 229 ? -19.385 -47.814 100.383 1.00 41.21  ? 229 PHE D CB  1 
ATOM   9450  C  CG  . PHE D  1 229 ? -19.859 -47.472 98.955  1.00 44.94  ? 229 PHE D CG  1 
ATOM   9451  C  CD1 . PHE D  1 229 ? -19.092 -47.831 97.843  1.00 47.42  ? 229 PHE D CD1 1 
ATOM   9452  C  CD2 . PHE D  1 229 ? -21.064 -46.785 98.744  1.00 46.09  ? 229 PHE D CD2 1 
ATOM   9453  C  CE1 . PHE D  1 229 ? -19.523 -47.518 96.541  1.00 45.35  ? 229 PHE D CE1 1 
ATOM   9454  C  CE2 . PHE D  1 229 ? -21.492 -46.475 97.452  1.00 43.54  ? 229 PHE D CE2 1 
ATOM   9455  C  CZ  . PHE D  1 229 ? -20.715 -46.845 96.351  1.00 47.55  ? 229 PHE D CZ  1 
ATOM   9456  N  N   . LEU D  1 230 ? -19.405 -49.466 103.082 1.00 38.03  ? 230 LEU D N   1 
ATOM   9457  C  CA  . LEU D  1 230 ? -18.958 -49.801 104.434 1.00 34.69  ? 230 LEU D CA  1 
ATOM   9458  C  C   . LEU D  1 230 ? -20.134 -49.887 105.353 1.00 34.09  ? 230 LEU D C   1 
ATOM   9459  O  O   . LEU D  1 230 ? -20.959 -48.996 105.380 1.00 37.61  ? 230 LEU D O   1 
ATOM   9460  C  CB  . LEU D  1 230 ? -17.947 -48.762 104.958 1.00 32.68  ? 230 LEU D CB  1 
ATOM   9461  C  CG  . LEU D  1 230 ? -17.088 -49.243 106.158 1.00 33.68  ? 230 LEU D CG  1 
ATOM   9462  C  CD1 . LEU D  1 230 ? -16.116 -50.353 105.722 1.00 28.83  ? 230 LEU D CD1 1 
ATOM   9463  C  CD2 . LEU D  1 230 ? -16.340 -48.086 106.824 1.00 32.28  ? 230 LEU D CD2 1 
ATOM   9464  N  N   . PRO D  1 231 ? -20.230 -50.996 106.125 1.00 36.27  ? 231 PRO D N   1 
ATOM   9465  C  CA  . PRO D  1 231 ? -21.354 -51.190 107.067 1.00 36.20  ? 231 PRO D CA  1 
ATOM   9466  C  C   . PRO D  1 231 ? -21.474 -50.013 108.091 1.00 36.47  ? 231 PRO D C   1 
ATOM   9467  O  O   . PRO D  1 231 ? -20.473 -49.394 108.444 1.00 34.52  ? 231 PRO D O   1 
ATOM   9468  C  CB  . PRO D  1 231 ? -20.991 -52.502 107.786 1.00 32.17  ? 231 PRO D CB  1 
ATOM   9469  C  CG  . PRO D  1 231 ? -20.084 -53.223 106.825 1.00 36.27  ? 231 PRO D CG  1 
ATOM   9470  C  CD  . PRO D  1 231 ? -19.293 -52.147 106.131 1.00 34.67  ? 231 PRO D CD  1 
ATOM   9471  N  N   . VAL D  1 232 ? -22.698 -49.742 108.542 1.00 34.15  ? 232 VAL D N   1 
ATOM   9472  C  CA  . VAL D  1 232 ? -22.959 -48.636 109.467 1.00 34.89  ? 232 VAL D CA  1 
ATOM   9473  C  C   . VAL D  1 232 ? -22.176 -48.749 110.777 1.00 34.34  ? 232 VAL D C   1 
ATOM   9474  O  O   . VAL D  1 232 ? -21.721 -47.737 111.329 1.00 34.40  ? 232 VAL D O   1 
ATOM   9475  C  CB  . VAL D  1 232 ? -24.484 -48.511 109.793 1.00 35.26  ? 232 VAL D CB  1 
ATOM   9476  C  CG1 . VAL D  1 232 ? -24.697 -47.576 110.956 1.00 33.63  ? 232 VAL D CG1 1 
ATOM   9477  C  CG2 . VAL D  1 232 ? -25.243 -48.030 108.578 1.00 32.26  ? 232 VAL D CG2 1 
ATOM   9478  N  N   . ASP D  1 233 ? -22.024 -49.974 111.279 1.00 34.08  ? 233 ASP D N   1 
ATOM   9479  C  CA  . ASP D  1 233 ? -21.336 -50.186 112.558 1.00 40.30  ? 233 ASP D CA  1 
ATOM   9480  C  C   . ASP D  1 233 ? -19.821 -49.900 112.463 1.00 35.87  ? 233 ASP D C   1 
ATOM   9481  O  O   . ASP D  1 233 ? -19.233 -49.374 113.394 1.00 36.27  ? 233 ASP D O   1 
ATOM   9482  C  CB  . ASP D  1 233 ? -21.603 -51.609 113.111 1.00 49.07  ? 233 ASP D CB  1 
ATOM   9483  C  CG  . ASP D  1 233 ? -21.340 -52.671 112.111 1.00 62.23  ? 233 ASP D CG  1 
ATOM   9484  O  OD1 . ASP D  1 233 ? -20.941 -52.336 110.964 1.00 70.53  ? 233 ASP D OD1 1 
ATOM   9485  O  OD2 . ASP D  1 233 ? -21.527 -53.860 112.447 1.00 78.84  ? 233 ASP D OD2 1 
ATOM   9486  N  N   . LYS D  1 234 ? -19.205 -50.258 111.310 1.00 34.97  ? 234 LYS D N   1 
ATOM   9487  C  CA  . LYS D  1 234 ? -17.762 -49.911 111.047 1.00 35.58  ? 234 LYS D CA  1 
ATOM   9488  C  C   . LYS D  1 234 ? -17.589 -48.401 110.858 1.00 32.73  ? 234 LYS D C   1 
ATOM   9489  O  O   . LYS D  1 234 ? -16.567 -47.818 111.274 1.00 32.98  ? 234 LYS D O   1 
ATOM   9490  C  CB  . LYS D  1 234 ? -17.235 -50.649 109.835 1.00 38.95  ? 234 LYS D CB  1 
ATOM   9491  C  CG  . LYS D  1 234 ? -16.645 -52.007 110.128 1.00 44.12  ? 234 LYS D CG  1 
ATOM   9492  C  CD  . LYS D  1 234 ? -15.876 -52.550 108.882 1.00 52.68  ? 234 LYS D CD  1 
ATOM   9493  C  CE  . LYS D  1 234 ? -15.001 -53.765 109.232 1.00 59.38  ? 234 LYS D CE  1 
ATOM   9494  N  NZ  . LYS D  1 234 ? -15.809 -54.984 109.501 1.00 64.72  ? 234 LYS D NZ  1 
ATOM   9495  N  N   . ARG D  1 235 ? -18.588 -47.763 110.220 1.00 32.38  ? 235 ARG D N   1 
ATOM   9496  C  CA  . ARG D  1 235 ? -18.589 -46.312 110.074 1.00 29.70  ? 235 ARG D CA  1 
ATOM   9497  C  C   . ARG D  1 235 ? -18.645 -45.662 111.441 1.00 27.83  ? 235 ARG D C   1 
ATOM   9498  O  O   . ARG D  1 235 ? -17.833 -44.795 111.757 1.00 25.83  ? 235 ARG D O   1 
ATOM   9499  C  CB  . ARG D  1 235 ? -19.753 -45.862 109.231 1.00 26.47  ? 235 ARG D CB  1 
ATOM   9500  C  CG  . ARG D  1 235 ? -19.607 -46.202 107.762 1.00 30.02  ? 235 ARG D CG  1 
ATOM   9501  C  CD  . ARG D  1 235 ? -20.806 -45.722 106.940 1.00 27.46  ? 235 ARG D CD  1 
ATOM   9502  N  NE  . ARG D  1 235 ? -20.683 -46.136 105.537 1.00 29.41  ? 235 ARG D NE  1 
ATOM   9503  C  CZ  . ARG D  1 235 ? -20.177 -45.369 104.567 1.00 28.07  ? 235 ARG D CZ  1 
ATOM   9504  N  NH1 . ARG D  1 235 ? -20.102 -45.824 103.354 1.00 27.69  ? 235 ARG D NH1 1 
ATOM   9505  N  NH2 . ARG D  1 235 ? -19.751 -44.129 104.840 1.00 30.02  ? 235 ARG D NH2 1 
ATOM   9506  N  N   . ASN D  1 236 ? -19.606 -46.098 112.268 1.00 23.95  ? 236 ASN D N   1 
ATOM   9507  C  CA  . ASN D  1 236 ? -19.735 -45.565 113.666 1.00 27.86  ? 236 ASN D CA  1 
ATOM   9508  C  C   . ASN D  1 236 ? -18.465 -45.705 114.435 1.00 27.92  ? 236 ASN D C   1 
ATOM   9509  O  O   . ASN D  1 236 ? -18.039 -44.776 115.119 1.00 31.96  ? 236 ASN D O   1 
ATOM   9510  C  CB  . ASN D  1 236 ? -20.879 -46.258 114.413 1.00 28.24  ? 236 ASN D CB  1 
ATOM   9511  C  CG  . ASN D  1 236 ? -22.233 -45.796 113.954 1.00 29.53  ? 236 ASN D CG  1 
ATOM   9512  O  OD1 . ASN D  1 236 ? -22.357 -44.778 113.249 1.00 33.74  ? 236 ASN D OD1 1 
ATOM   9513  N  ND2 . ASN D  1 236 ? -23.265 -46.525 114.344 1.00 30.14  ? 236 ASN D ND2 1 
ATOM   9514  N  N   . GLU D  1 237 ? -17.837 -46.878 114.326 1.00 28.62  ? 237 GLU D N   1 
ATOM   9515  C  CA  . GLU D  1 237 ? -16.588 -47.151 115.036 1.00 30.43  ? 237 GLU D CA  1 
ATOM   9516  C  C   . GLU D  1 237 ? -15.508 -46.210 114.597 1.00 26.78  ? 237 GLU D C   1 
ATOM   9517  O  O   . GLU D  1 237 ? -14.741 -45.698 115.416 1.00 28.53  ? 237 GLU D O   1 
ATOM   9518  C  CB  . GLU D  1 237 ? -16.147 -48.607 114.804 1.00 34.82  ? 237 GLU D CB  1 
ATOM   9519  C  CG  . GLU D  1 237 ? -14.735 -48.924 115.308 1.00 47.13  ? 237 GLU D CG  1 
ATOM   9520  C  CD  . GLU D  1 237 ? -14.245 -50.340 114.872 1.00 61.73  ? 237 GLU D CD  1 
ATOM   9521  O  OE1 . GLU D  1 237 ? -13.032 -50.616 114.993 1.00 69.08  ? 237 GLU D OE1 1 
ATOM   9522  O  OE2 . GLU D  1 237 ? -15.090 -51.158 114.408 1.00 68.83  ? 237 GLU D OE2 1 
ATOM   9523  N  N   . THR D  1 238 ? -15.441 -45.973 113.302 1.00 27.01  ? 238 THR D N   1 
ATOM   9524  C  CA  . THR D  1 238 ? -14.452 -45.090 112.734 1.00 24.73  ? 238 THR D CA  1 
ATOM   9525  C  C   . THR D  1 238 ? -14.680 -43.652 113.192 1.00 24.95  ? 238 THR D C   1 
ATOM   9526  O  O   . THR D  1 238 ? -13.743 -42.968 113.622 1.00 23.14  ? 238 THR D O   1 
ATOM   9527  C  CB  . THR D  1 238 ? -14.473 -45.153 111.182 1.00 25.01  ? 238 THR D CB  1 
ATOM   9528  O  OG1 . THR D  1 238 ? -14.187 -46.484 110.756 1.00 27.50  ? 238 THR D OG1 1 
ATOM   9529  C  CG2 . THR D  1 238 ? -13.439 -44.198 110.584 1.00 23.80  ? 238 THR D CG2 1 
ATOM   9530  N  N   . THR D  1 239 ? -15.928 -43.203 113.104 1.00 23.74  ? 239 THR D N   1 
ATOM   9531  C  CA  . THR D  1 239 ? -16.299 -41.878 113.521 1.00 26.60  ? 239 THR D CA  1 
ATOM   9532  C  C   . THR D  1 239 ? -15.984 -41.646 115.001 1.00 27.83  ? 239 THR D C   1 
ATOM   9533  O  O   . THR D  1 239 ? -15.403 -40.615 115.371 1.00 27.89  ? 239 THR D O   1 
ATOM   9534  C  CB  . THR D  1 239 ? -17.795 -41.629 113.312 1.00 26.88  ? 239 THR D CB  1 
ATOM   9535  O  OG1 . THR D  1 239 ? -18.143 -41.910 111.963 1.00 28.23  ? 239 THR D OG1 1 
ATOM   9536  C  CG2 . THR D  1 239 ? -18.136 -40.191 113.630 1.00 25.00  ? 239 THR D CG2 1 
ATOM   9537  N  N   . LEU D  1 240 ? -16.378 -42.592 115.841 1.00 25.29  ? 240 LEU D N   1 
ATOM   9538  C  CA  . LEU D  1 240 ? -16.126 -42.490 117.260 1.00 25.45  ? 240 LEU D CA  1 
ATOM   9539  C  C   . LEU D  1 240 ? -14.649 -42.380 117.516 1.00 25.31  ? 240 LEU D C   1 
ATOM   9540  O  O   . LEU D  1 240 ? -14.204 -41.541 118.290 1.00 27.11  ? 240 LEU D O   1 
ATOM   9541  C  CB  . LEU D  1 240 ? -16.714 -43.718 118.010 1.00 24.15  ? 240 LEU D CB  1 
ATOM   9542  C  CG  . LEU D  1 240 ? -16.504 -43.760 119.523 1.00 26.04  ? 240 LEU D CG  1 
ATOM   9543  C  CD1 . LEU D  1 240 ? -17.198 -42.572 120.211 1.00 26.41  ? 240 LEU D CD1 1 
ATOM   9544  C  CD2 . LEU D  1 240 ? -16.986 -45.105 120.113 1.00 25.45  ? 240 LEU D CD2 1 
ATOM   9545  N  N   . ARG D  1 241 ? -13.892 -43.215 116.865 1.00 26.16  ? 241 ARG D N   1 
ATOM   9546  C  CA  . ARG D  1 241 ? -12.442 -43.205 117.011 1.00 29.62  ? 241 ARG D CA  1 
ATOM   9547  C  C   . ARG D  1 241 ? -11.837 -41.813 116.630 1.00 28.05  ? 241 ARG D C   1 
ATOM   9548  O  O   . ARG D  1 241 ? -10.979 -41.273 117.350 1.00 28.83  ? 241 ARG D O   1 
ATOM   9549  C  CB  . ARG D  1 241 ? -11.816 -44.313 116.160 1.00 34.02  ? 241 ARG D CB  1 
ATOM   9550  C  CG  . ARG D  1 241 ? -10.315 -44.316 116.149 1.00 40.98  ? 241 ARG D CG  1 
ATOM   9551  C  CD  . ARG D  1 241 ? -9.753  -44.887 117.428 1.00 52.15  ? 241 ARG D CD  1 
ATOM   9552  N  NE  . ARG D  1 241 ? -8.299  -45.002 117.371 1.00 60.79  ? 241 ARG D NE  1 
ATOM   9553  C  CZ  . ARG D  1 241 ? -7.649  -45.942 116.681 1.00 64.80  ? 241 ARG D CZ  1 
ATOM   9554  N  NH1 . ARG D  1 241 ? -8.332  -46.853 115.979 1.00 61.97  ? 241 ARG D NH1 1 
ATOM   9555  N  NH2 . ARG D  1 241 ? -6.322  -45.972 116.685 1.00 69.12  ? 241 ARG D NH2 1 
ATOM   9556  N  N   . LEU D  1 242 ? -12.295 -41.254 115.503 1.00 25.85  ? 242 LEU D N   1 
ATOM   9557  C  CA  . LEU D  1 242 ? -11.822 -39.932 115.048 1.00 24.26  ? 242 LEU D CA  1 
ATOM   9558  C  C   . LEU D  1 242 ? -12.169 -38.866 116.043 1.00 25.31  ? 242 LEU D C   1 
ATOM   9559  O  O   . LEU D  1 242 ? -11.355 -38.018 116.356 1.00 24.96  ? 242 LEU D O   1 
ATOM   9560  C  CB  . LEU D  1 242 ? -12.412 -39.593 113.677 1.00 25.48  ? 242 LEU D CB  1 
ATOM   9561  C  CG  . LEU D  1 242 ? -11.807 -40.361 112.501 1.00 27.84  ? 242 LEU D CG  1 
ATOM   9562  C  CD1 . LEU D  1 242 ? -12.671 -40.240 111.258 1.00 24.40  ? 242 LEU D CD1 1 
ATOM   9563  C  CD2 . LEU D  1 242 ? -10.350 -39.878 112.223 1.00 25.73  ? 242 LEU D CD2 1 
ATOM   9564  N  N   . ILE D  1 243 ? -13.397 -38.910 116.545 1.00 26.37  ? 243 ILE D N   1 
ATOM   9565  C  CA  . ILE D  1 243 ? -13.829 -37.980 117.540 1.00 27.02  ? 243 ILE D CA  1 
ATOM   9566  C  C   . ILE D  1 243 ? -12.934 -38.081 118.821 1.00 28.50  ? 243 ILE D C   1 
ATOM   9567  O  O   . ILE D  1 243 ? -12.488 -37.057 119.364 1.00 28.13  ? 243 ILE D O   1 
ATOM   9568  C  CB  . ILE D  1 243 ? -15.306 -38.198 117.908 1.00 26.64  ? 243 ILE D CB  1 
ATOM   9569  C  CG1 . ILE D  1 243 ? -16.210 -37.760 116.741 1.00 24.78  ? 243 ILE D CG1 1 
ATOM   9570  C  CG2 . ILE D  1 243 ? -15.664 -37.441 119.211 1.00 25.95  ? 243 ILE D CG2 1 
ATOM   9571  C  CD1 . ILE D  1 243 ? -17.678 -38.078 116.942 1.00 23.54  ? 243 ILE D CD1 1 
ATOM   9572  N  N   . LYS D  1 244 ? -12.675 -39.314 119.274 1.00 28.17  ? 244 LYS D N   1 
ATOM   9573  C  CA  . LYS D  1 244 ? -11.825 -39.533 120.481 1.00 29.66  ? 244 LYS D CA  1 
ATOM   9574  C  C   . LYS D  1 244 ? -10.390 -39.082 120.266 1.00 31.72  ? 244 LYS D C   1 
ATOM   9575  O  O   . LYS D  1 244 ? -9.700  -38.764 121.203 1.00 33.11  ? 244 LYS D O   1 
ATOM   9576  C  CB  . LYS D  1 244 ? -11.866 -41.002 120.923 1.00 31.80  ? 244 LYS D CB  1 
ATOM   9577  C  CG  . LYS D  1 244 ? -13.126 -41.372 121.686 1.00 38.55  ? 244 LYS D CG  1 
ATOM   9578  C  CD  . LYS D  1 244 ? -13.127 -42.836 122.089 1.00 46.25  ? 244 LYS D CD  1 
ATOM   9579  C  CE  . LYS D  1 244 ? -14.387 -43.185 122.870 1.00 55.58  ? 244 LYS D CE  1 
ATOM   9580  N  NZ  . LYS D  1 244 ? -14.505 -44.635 123.106 1.00 65.65  ? 244 LYS D NZ  1 
ATOM   9581  N  N   . ASP D  1 245 ? -9.955  -39.059 119.013 1.00 30.91  ? 245 ASP D N   1 
ATOM   9582  C  CA  . ASP D  1 245 ? -8.603  -38.614 118.690 1.00 31.56  ? 245 ASP D CA  1 
ATOM   9583  C  C   . ASP D  1 245 ? -8.532  -37.073 118.473 1.00 30.91  ? 245 ASP D C   1 
ATOM   9584  O  O   . ASP D  1 245 ? -7.482  -36.535 118.229 1.00 32.92  ? 245 ASP D O   1 
ATOM   9585  C  CB  . ASP D  1 245 ? -8.062  -39.360 117.485 1.00 32.11  ? 245 ASP D CB  1 
ATOM   9586  C  CG  . ASP D  1 245 ? -7.700  -40.818 117.812 1.00 39.00  ? 245 ASP D CG  1 
ATOM   9587  O  OD1 . ASP D  1 245 ? -7.431  -41.587 116.880 1.00 36.47  ? 245 ASP D OD1 1 
ATOM   9588  O  OD2 . ASP D  1 245 ? -7.694  -41.181 119.033 1.00 39.87  ? 245 ASP D OD2 1 
ATOM   9589  N  N   . GLY D  1 246 ? -9.686  -36.405 118.573 1.00 31.58  ? 246 GLY D N   1 
ATOM   9590  C  CA  . GLY D  1 246 ? -9.741  -34.909 118.516 1.00 31.30  ? 246 GLY D CA  1 
ATOM   9591  C  C   . GLY D  1 246 ? -10.018 -34.328 117.134 1.00 31.97  ? 246 GLY D C   1 
ATOM   9592  O  O   . GLY D  1 246 ? -9.706  -33.164 116.866 1.00 31.78  ? 246 GLY D O   1 
ATOM   9593  N  N   . TYR D  1 247 ? -10.617 -35.118 116.269 1.00 31.28  ? 247 TYR D N   1 
ATOM   9594  C  CA  . TYR D  1 247 ? -10.875 -34.669 114.863 1.00 29.12  ? 247 TYR D CA  1 
ATOM   9595  C  C   . TYR D  1 247 ? -12.292 -34.105 114.622 1.00 29.75  ? 247 TYR D C   1 
ATOM   9596  O  O   . TYR D  1 247 ? -12.696 -33.876 113.461 1.00 32.38  ? 247 TYR D O   1 
ATOM   9597  C  CB  . TYR D  1 247 ? -10.554 -35.779 113.884 1.00 29.04  ? 247 TYR D CB  1 
ATOM   9598  C  CG  . TYR D  1 247 ? -9.078  -35.997 113.733 1.00 29.90  ? 247 TYR D CG  1 
ATOM   9599  C  CD1 . TYR D  1 247 ? -8.369  -36.789 114.649 1.00 28.68  ? 247 TYR D CD1 1 
ATOM   9600  C  CD2 . TYR D  1 247 ? -8.372  -35.397 112.700 1.00 29.01  ? 247 TYR D CD2 1 
ATOM   9601  C  CE1 . TYR D  1 247 ? -7.013  -36.984 114.522 1.00 29.80  ? 247 TYR D CE1 1 
ATOM   9602  C  CE2 . TYR D  1 247 ? -7.007  -35.584 112.562 1.00 31.06  ? 247 TYR D CE2 1 
ATOM   9603  C  CZ  . TYR D  1 247 ? -6.330  -36.380 113.475 1.00 29.68  ? 247 TYR D CZ  1 
ATOM   9604  O  OH  . TYR D  1 247 ? -4.986  -36.572 113.344 1.00 32.41  ? 247 TYR D OH  1 
ATOM   9605  N  N   . SER D  1 248 ? -13.029 -33.871 115.702 1.00 26.79  ? 248 SER D N   1 
ATOM   9606  C  CA  . SER D  1 248 ? -14.430 -33.349 115.596 1.00 30.61  ? 248 SER D CA  1 
ATOM   9607  C  C   . SER D  1 248 ? -14.532 -32.090 114.746 1.00 29.63  ? 248 SER D C   1 
ATOM   9608  O  O   . SER D  1 248 ? -15.476 -31.927 113.991 1.00 29.16  ? 248 SER D O   1 
ATOM   9609  C  CB  . SER D  1 248 ? -15.014 -33.083 116.985 1.00 31.51  ? 248 SER D CB  1 
ATOM   9610  O  OG  . SER D  1 248 ? -15.204 -34.286 117.683 1.00 44.87  ? 248 SER D OG  1 
ATOM   9611  N  N   . ASP D  1 249 ? -13.557 -31.198 114.880 1.00 28.80  ? 249 ASP D N   1 
ATOM   9612  C  CA  . ASP D  1 249 ? -13.615 -29.907 114.165 1.00 34.48  ? 249 ASP D CA  1 
ATOM   9613  C  C   . ASP D  1 249 ? -13.341 -30.047 112.637 1.00 32.56  ? 249 ASP D C   1 
ATOM   9614  O  O   . ASP D  1 249 ? -13.321 -29.081 111.930 1.00 35.22  ? 249 ASP D O   1 
ATOM   9615  C  CB  . ASP D  1 249 ? -12.664 -28.863 114.806 1.00 36.06  ? 249 ASP D CB  1 
ATOM   9616  C  CG  . ASP D  1 249 ? -11.243 -29.230 114.669 1.00 39.37  ? 249 ASP D CG  1 
ATOM   9617  O  OD1 . ASP D  1 249 ? -10.960 -30.294 114.120 1.00 43.62  ? 249 ASP D OD1 1 
ATOM   9618  O  OD2 . ASP D  1 249 ? -10.383 -28.447 115.115 1.00 49.76  ? 249 ASP D OD2 1 
ATOM   9619  N  N   . LYS D  1 250 ? -13.148 -31.271 112.176 1.00 31.86  ? 250 LYS D N   1 
ATOM   9620  C  CA  . LYS D  1 250 ? -12.935 -31.516 110.710 1.00 33.87  ? 250 LYS D CA  1 
ATOM   9621  C  C   . LYS D  1 250 ? -13.843 -32.568 110.139 1.00 32.01  ? 250 LYS D C   1 
ATOM   9622  O  O   . LYS D  1 250 ? -13.785 -32.872 108.948 1.00 32.94  ? 250 LYS D O   1 
ATOM   9623  C  CB  . LYS D  1 250 ? -11.476 -31.816 110.421 1.00 34.28  ? 250 LYS D CB  1 
ATOM   9624  C  CG  . LYS D  1 250 ? -10.657 -30.533 110.211 1.00 38.84  ? 250 LYS D CG  1 
ATOM   9625  C  CD  . LYS D  1 250 ? -9.241  -30.750 110.381 1.00 41.23  ? 250 LYS D CD  1 
ATOM   9626  C  CE  . LYS D  1 250 ? -8.500  -29.423 110.390 1.00 41.99  ? 250 LYS D CE  1 
ATOM   9627  N  NZ  . LYS D  1 250 ? -7.051  -29.598 110.743 1.00 52.18  ? 250 LYS D NZ  1 
ATOM   9628  N  N   . ILE D  1 251 ? -14.700 -33.117 110.981 1.00 29.60  ? 251 ILE D N   1 
ATOM   9629  C  CA  . ILE D  1 251 ? -15.629 -34.145 110.563 1.00 25.37  ? 251 ILE D CA  1 
ATOM   9630  C  C   . ILE D  1 251 ? -16.946 -33.557 110.061 1.00 22.96  ? 251 ILE D C   1 
ATOM   9631  O  O   . ILE D  1 251 ? -17.509 -32.697 110.673 1.00 21.51  ? 251 ILE D O   1 
ATOM   9632  C  CB  . ILE D  1 251 ? -15.952 -35.113 111.727 1.00 24.58  ? 251 ILE D CB  1 
ATOM   9633  C  CG1 . ILE D  1 251 ? -14.751 -36.011 112.029 1.00 22.76  ? 251 ILE D CG1 1 
ATOM   9634  C  CG2 . ILE D  1 251 ? -17.192 -35.943 111.402 1.00 21.35  ? 251 ILE D CG2 1 
ATOM   9635  C  CD1 . ILE D  1 251 ? -14.878 -36.795 113.355 1.00 21.94  ? 251 ILE D CD1 1 
ATOM   9636  N  N   . MET D  1 252 ? -17.404 -34.039 108.949 1.00 24.43  ? 252 MET D N   1 
ATOM   9637  C  CA  . MET D  1 252 ? -18.760 -33.760 108.521 1.00 27.05  ? 252 MET D CA  1 
ATOM   9638  C  C   . MET D  1 252 ? -19.476 -35.069 108.156 1.00 26.57  ? 252 MET D C   1 
ATOM   9639  O  O   . MET D  1 252 ? -18.881 -35.976 107.587 1.00 25.25  ? 252 MET D O   1 
ATOM   9640  C  CB  . MET D  1 252 ? -18.789 -32.724 107.378 1.00 31.20  ? 252 MET D CB  1 
ATOM   9641  C  CG  . MET D  1 252 ? -18.349 -31.301 107.866 1.00 34.14  ? 252 MET D CG  1 
ATOM   9642  S  SD  . MET D  1 252 ? -18.628 -29.987 106.742 1.00 50.46  ? 252 MET D SD  1 
ATOM   9643  C  CE  . MET D  1 252 ? -17.629 -30.504 105.386 1.00 36.90  ? 252 MET D CE  1 
ATOM   9644  N  N   . ILE D  1 253 ? -20.726 -35.155 108.517 1.00 26.52  ? 253 ILE D N   1 
ATOM   9645  C  CA  . ILE D  1 253 ? -21.465 -36.368 108.392 1.00 26.42  ? 253 ILE D CA  1 
ATOM   9646  C  C   . ILE D  1 253 ? -22.692 -36.159 107.567 1.00 26.76  ? 253 ILE D C   1 
ATOM   9647  O  O   . ILE D  1 253 ? -23.327 -35.129 107.648 1.00 25.85  ? 253 ILE D O   1 
ATOM   9648  C  CB  . ILE D  1 253 ? -21.871 -36.938 109.830 1.00 25.61  ? 253 ILE D CB  1 
ATOM   9649  C  CG1 . ILE D  1 253 ? -20.626 -37.365 110.602 1.00 24.59  ? 253 ILE D CG1 1 
ATOM   9650  C  CG2 . ILE D  1 253 ? -22.865 -38.101 109.703 1.00 25.04  ? 253 ILE D CG2 1 
ATOM   9651  C  CD1 . ILE D  1 253 ? -20.909 -37.868 112.004 1.00 28.32  ? 253 ILE D CD1 1 
ATOM   9652  N  N   . SER D  1 254 ? -23.026 -37.154 106.757 1.00 27.47  ? 254 SER D N   1 
ATOM   9653  C  CA  . SER D  1 254 ? -24.176 -37.079 105.895 1.00 25.50  ? 254 SER D CA  1 
ATOM   9654  C  C   . SER D  1 254 ? -24.473 -38.479 105.345 1.00 25.64  ? 254 SER D C   1 
ATOM   9655  O  O   . SER D  1 254 ? -23.784 -39.456 105.706 1.00 25.25  ? 254 SER D O   1 
ATOM   9656  C  CB  . SER D  1 254 ? -23.920 -36.090 104.760 1.00 27.69  ? 254 SER D CB  1 
ATOM   9657  O  OG  . SER D  1 254 ? -25.076 -35.300 104.495 1.00 29.81  ? 254 SER D OG  1 
ATOM   9658  N  N   . HIS D  1 255 ? -25.498 -38.590 104.465 1.00 25.74  ? 255 HIS D N   1 
ATOM   9659  C  CA  . HIS D  1 255 ? -25.942 -39.929 103.949 1.00 24.98  ? 255 HIS D CA  1 
ATOM   9660  C  C   . HIS D  1 255 ? -25.687 -40.136 102.466 1.00 26.69  ? 255 HIS D C   1 
ATOM   9661  O  O   . HIS D  1 255 ? -25.703 -41.279 101.984 1.00 24.00  ? 255 HIS D O   1 
ATOM   9662  C  CB  . HIS D  1 255 ? -27.428 -40.147 104.215 1.00 26.71  ? 255 HIS D CB  1 
ATOM   9663  C  CG  . HIS D  1 255 ? -27.864 -39.805 105.626 1.00 27.74  ? 255 HIS D CG  1 
ATOM   9664  N  ND1 . HIS D  1 255 ? -28.289 -38.577 105.978 1.00 28.40  ? 255 HIS D ND1 1 
ATOM   9665  C  CD2 . HIS D  1 255 ? -27.951 -40.583 106.768 1.00 23.56  ? 255 HIS D CD2 1 
ATOM   9666  C  CE1 . HIS D  1 255 ? -28.616 -38.578 107.268 1.00 25.48  ? 255 HIS D CE1 1 
ATOM   9667  N  NE2 . HIS D  1 255 ? -28.411 -39.798 107.750 1.00 25.18  ? 255 HIS D NE2 1 
ATOM   9668  N  N   . ASP D  1 256 ? -25.476 -39.030 101.720 1.00 23.21  ? 256 ASP D N   1 
ATOM   9669  C  CA  . ASP D  1 256 ? -25.373 -39.107 100.246 1.00 24.36  ? 256 ASP D CA  1 
ATOM   9670  C  C   . ASP D  1 256 ? -26.647 -39.769 99.696  1.00 29.01  ? 256 ASP D C   1 
ATOM   9671  O  O   . ASP D  1 256 ? -26.643 -40.369 98.603  1.00 30.59  ? 256 ASP D O   1 
ATOM   9672  C  CB  . ASP D  1 256 ? -24.160 -39.900 99.847  1.00 24.15  ? 256 ASP D CB  1 
ATOM   9673  C  CG  . ASP D  1 256 ? -23.742 -39.669 98.345  1.00 25.62  ? 256 ASP D CG  1 
ATOM   9674  O  OD1 . ASP D  1 256 ? -24.156 -38.580 97.709  1.00 23.70  ? 256 ASP D OD1 1 
ATOM   9675  O  OD2 . ASP D  1 256 ? -23.005 -40.537 97.803  1.00 28.31  ? 256 ASP D OD2 1 
ATOM   9676  N  N   . TYR D  1 257 ? -27.730 -39.659 100.449 1.00 30.64  ? 257 TYR D N   1 
ATOM   9677  C  CA  . TYR D  1 257 ? -28.966 -40.281 100.063 1.00 33.02  ? 257 TYR D CA  1 
ATOM   9678  C  C   . TYR D  1 257 ? -29.549 -39.668 98.813  1.00 40.57  ? 257 TYR D C   1 
ATOM   9679  O  O   . TYR D  1 257 ? -29.533 -38.441 98.638  1.00 39.50  ? 257 TYR D O   1 
ATOM   9680  C  CB  . TYR D  1 257 ? -30.000 -40.228 101.204 1.00 32.49  ? 257 TYR D CB  1 
ATOM   9681  C  CG  . TYR D  1 257 ? -31.258 -40.996 100.883 1.00 36.47  ? 257 TYR D CG  1 
ATOM   9682  C  CD1 . TYR D  1 257 ? -32.457 -40.333 100.620 1.00 34.10  ? 257 TYR D CD1 1 
ATOM   9683  C  CD2 . TYR D  1 257 ? -31.246 -42.415 100.817 1.00 34.95  ? 257 TYR D CD2 1 
ATOM   9684  C  CE1 . TYR D  1 257 ? -33.612 -41.035 100.317 1.00 39.98  ? 257 TYR D CE1 1 
ATOM   9685  C  CE2 . TYR D  1 257 ? -32.388 -43.125 100.514 1.00 37.82  ? 257 TYR D CE2 1 
ATOM   9686  C  CZ  . TYR D  1 257 ? -33.576 -42.441 100.263 1.00 40.01  ? 257 TYR D CZ  1 
ATOM   9687  O  OH  . TYR D  1 257 ? -34.696 -43.131 99.966  1.00 45.03  ? 257 TYR D OH  1 
ATOM   9688  N  N   . CYS D  1 258 ? -30.065 -40.529 97.935  1.00 43.65  ? 258 CYS D N   1 
ATOM   9689  C  CA  . CYS D  1 258 ? -30.723 -40.103 96.745  1.00 46.41  ? 258 CYS D CA  1 
ATOM   9690  C  C   . CYS D  1 258 ? -32.146 -40.466 96.834  1.00 54.95  ? 258 CYS D C   1 
ATOM   9691  O  O   . CYS D  1 258 ? -32.512 -41.631 96.648  1.00 57.05  ? 258 CYS D O   1 
ATOM   9692  C  CB  . CYS D  1 258 ? -30.099 -40.783 95.510  1.00 44.49  ? 258 CYS D CB  1 
ATOM   9693  S  SG  . CYS D  1 258 ? -28.321 -40.652 95.405  1.00 50.45  ? 258 CYS D SG  1 
ATOM   9694  N  N   . CYS D  1 259 ? -32.977 -39.496 97.126  1.00 61.04  ? 259 CYS D N   1 
ATOM   9695  C  CA  . CYS D  1 259 ? -34.382 -39.721 97.204  1.00 64.81  ? 259 CYS D CA  1 
ATOM   9696  C  C   . CYS D  1 259 ? -34.836 -40.475 95.950  1.00 70.55  ? 259 CYS D C   1 
ATOM   9697  O  O   . CYS D  1 259 ? -35.803 -41.228 95.980  1.00 64.17  ? 259 CYS D O   1 
ATOM   9698  C  CB  . CYS D  1 259 ? -35.107 -38.411 97.327  1.00 58.17  ? 259 CYS D CB  1 
ATOM   9699  S  SG  . CYS D  1 259 ? -34.403 -37.312 98.587  1.00 62.44  ? 259 CYS D SG  1 
ATOM   9700  N  N   . THR D  1 260 ? -34.110 -40.258 94.851  1.00 72.05  ? 260 THR D N   1 
ATOM   9701  C  CA  . THR D  1 260 ? -34.337 -40.981 93.615  1.00 65.91  ? 260 THR D CA  1 
ATOM   9702  C  C   . THR D  1 260 ? -33.050 -41.049 92.815  1.00 64.22  ? 260 THR D C   1 
ATOM   9703  O  O   . THR D  1 260 ? -32.424 -40.022 92.539  1.00 58.20  ? 260 THR D O   1 
ATOM   9704  C  CB  . THR D  1 260 ? -35.420 -40.324 92.764  1.00 60.20  ? 260 THR D CB  1 
ATOM   9705  O  OG1 . THR D  1 260 ? -36.640 -40.285 93.491  1.00 53.55  ? 260 THR D OG1 1 
ATOM   9706  C  CG2 . THR D  1 260 ? -35.632 -41.124 91.434  1.00 61.21  ? 260 THR D CG2 1 
ATOM   9707  N  N   . ILE D  1 261 ? -32.655 -42.256 92.445  1.00 65.57  ? 261 ILE D N   1 
ATOM   9708  C  CA  . ILE D  1 261 ? -31.445 -42.461 91.687  1.00 64.58  ? 261 ILE D CA  1 
ATOM   9709  C  C   . ILE D  1 261 ? -31.685 -43.506 90.560  1.00 70.99  ? 261 ILE D C   1 
ATOM   9710  O  O   . ILE D  1 261 ? -32.397 -44.509 90.767  1.00 64.24  ? 261 ILE D O   1 
ATOM   9711  C  CB  . ILE D  1 261 ? -30.267 -42.905 92.606  1.00 64.31  ? 261 ILE D CB  1 
ATOM   9712  C  CG1 . ILE D  1 261 ? -28.954 -42.970 91.816  1.00 62.54  ? 261 ILE D CG1 1 
ATOM   9713  C  CG2 . ILE D  1 261 ? -30.587 -44.246 93.299  1.00 55.97  ? 261 ILE D CG2 1 
ATOM   9714  C  CD1 . ILE D  1 261 ? -27.722 -43.122 92.693  1.00 67.29  ? 261 ILE D CD1 1 
ATOM   9715  N  N   . ASP D  1 262 ? -31.090 -43.263 89.371  1.00 66.04  ? 262 ASP D N   1 
ATOM   9716  C  CA  . ASP D  1 262 ? -31.389 -44.100 88.180  1.00 60.00  ? 262 ASP D CA  1 
ATOM   9717  C  C   . ASP D  1 262 ? -30.368 -45.284 87.892  1.00 57.25  ? 262 ASP D C   1 
ATOM   9718  O  O   . ASP D  1 262 ? -30.622 -46.117 87.047  1.00 58.46  ? 262 ASP D O   1 
ATOM   9719  C  CB  . ASP D  1 262 ? -31.615 -43.206 86.887  1.00 53.27  ? 262 ASP D CB  1 
ATOM   9720  C  CG  . ASP D  1 262 ? -30.299 -42.576 86.349  1.00 51.37  ? 262 ASP D CG  1 
ATOM   9721  O  OD1 . ASP D  1 262 ? -29.249 -42.657 87.056  1.00 57.72  ? 262 ASP D OD1 1 
ATOM   9722  O  OD2 . ASP D  1 262 ? -30.330 -41.996 85.204  1.00 35.51  ? 262 ASP D OD2 1 
ATOM   9723  N  N   . MET D  1 263 ? -29.234 -45.316 88.623  1.00 66.99  ? 263 MET D N   1 
ATOM   9724  C  CA  . MET D  1 263 ? -28.245 -46.451 88.466  1.00 70.54  ? 263 MET D CA  1 
ATOM   9725  C  C   . MET D  1 263 ? -28.928 -47.802 88.570  1.00 76.56  ? 263 MET D C   1 
ATOM   9726  O  O   . MET D  1 263 ? -29.830 -47.996 89.410  1.00 65.59  ? 263 MET D O   1 
ATOM   9727  C  CB  . MET D  1 263 ? -27.100 -46.360 89.504  1.00 80.47  ? 263 MET D CB  1 
ATOM   9728  C  CG  . MET D  1 263 ? -25.913 -45.497 89.072  1.00 87.39  ? 263 MET D CG  1 
ATOM   9729  S  SD  . MET D  1 263 ? -25.930 -43.853 89.779  1.00 108.70 ? 263 MET D SD  1 
ATOM   9730  C  CE  . MET D  1 263 ? -25.473 -44.217 91.482  1.00 99.63  ? 263 MET D CE  1 
ATOM   9731  N  N   . GLY D  1 264 ? -28.504 -48.753 87.715  1.00 76.82  ? 264 GLY D N   1 
ATOM   9732  C  CA  . GLY D  1 264 ? -29.049 -50.124 87.750  1.00 77.66  ? 264 GLY D CA  1 
ATOM   9733  C  C   . GLY D  1 264 ? -28.767 -50.797 89.080  1.00 76.59  ? 264 GLY D C   1 
ATOM   9734  O  O   . GLY D  1 264 ? -29.501 -51.718 89.502  1.00 61.44  ? 264 GLY D O   1 
ATOM   9735  N  N   . THR D  1 265 ? -27.695 -50.337 89.756  1.00 82.38  ? 265 THR D N   1 
ATOM   9736  C  CA  . THR D  1 265 ? -27.313 -50.866 91.054  1.00 89.74  ? 265 THR D CA  1 
ATOM   9737  C  C   . THR D  1 265 ? -28.312 -50.438 92.160  1.00 91.85  ? 265 THR D C   1 
ATOM   9738  O  O   . THR D  1 265 ? -28.278 -50.963 93.278  1.00 89.08  ? 265 THR D O   1 
ATOM   9739  C  CB  . THR D  1 265 ? -25.878 -50.429 91.450  1.00 88.61  ? 265 THR D CB  1 
ATOM   9740  O  OG1 . THR D  1 265 ? -25.558 -50.942 92.755  1.00 88.99  ? 265 THR D OG1 1 
ATOM   9741  C  CG2 . THR D  1 265 ? -25.763 -48.914 91.461  1.00 79.76  ? 265 THR D CG2 1 
ATOM   9742  N  N   . ALA D  1 266 ? -29.193 -49.479 91.828  1.00 92.40  ? 266 ALA D N   1 
ATOM   9743  C  CA  . ALA D  1 266 ? -30.243 -49.059 92.740  1.00 90.38  ? 266 ALA D CA  1 
ATOM   9744  C  C   . ALA D  1 266 ? -31.334 -50.151 92.827  1.00 106.06 ? 266 ALA D C   1 
ATOM   9745  O  O   . ALA D  1 266 ? -31.161 -51.153 93.512  1.00 124.71 ? 266 ALA D O   1 
ATOM   9746  C  CB  . ALA D  1 266 ? -30.839 -47.743 92.295  1.00 82.72  ? 266 ALA D CB  1 
ATOM   9747  N  N   . LYS D  1 267 ? -32.450 -49.938 92.117  1.00 102.94 ? 267 LYS D N   1 
ATOM   9748  C  CA  . LYS D  1 267 ? -33.556 -50.933 92.076  1.00 100.64 ? 267 LYS D CA  1 
ATOM   9749  C  C   . LYS D  1 267 ? -33.942 -51.460 93.498  1.00 105.70 ? 267 LYS D C   1 
ATOM   9750  O  O   . LYS D  1 267 ? -33.103 -51.502 94.399  1.00 98.49  ? 267 LYS D O   1 
ATOM   9751  C  CB  . LYS D  1 267 ? -33.197 -52.104 91.148  1.00 91.46  ? 267 LYS D CB  1 
ATOM   9752  C  CG  . LYS D  1 267 ? -32.924 -51.695 89.697  1.00 85.05  ? 267 LYS D CG  1 
ATOM   9753  C  CD  . LYS D  1 267 ? -32.590 -52.908 88.830  1.00 88.81  ? 267 LYS D CD  1 
ATOM   9754  C  CE  . LYS D  1 267 ? -32.328 -52.502 87.385  1.00 94.08  ? 267 LYS D CE  1 
ATOM   9755  N  NZ  . LYS D  1 267 ? -32.032 -53.677 86.512  1.00 91.56  ? 267 LYS D NZ  1 
ATOM   9756  N  N   . PRO D  1 268 ? -35.235 -51.861 93.676  1.00 110.40 ? 268 PRO D N   1 
ATOM   9757  C  CA  . PRO D  1 268 ? -35.754 -52.359 94.967  1.00 105.49 ? 268 PRO D CA  1 
ATOM   9758  C  C   . PRO D  1 268 ? -35.113 -53.729 95.432  1.00 96.47  ? 268 PRO D C   1 
ATOM   9759  O  O   . PRO D  1 268 ? -34.892 -53.930 96.625  1.00 80.45  ? 268 PRO D O   1 
ATOM   9760  C  CB  . PRO D  1 268 ? -37.266 -52.537 94.695  1.00 110.39 ? 268 PRO D CB  1 
ATOM   9761  C  CG  . PRO D  1 268 ? -37.534 -51.719 93.461  1.00 111.62 ? 268 PRO D CG  1 
ATOM   9762  C  CD  . PRO D  1 268 ? -36.289 -51.787 92.654  1.00 113.25 ? 268 PRO D CD  1 
ATOM   9763  N  N   . GLU D  1 269 ? -34.833 -54.631 94.475  1.00 101.09 ? 269 GLU D N   1 
ATOM   9764  C  CA  . GLU D  1 269 ? -34.271 -55.981 94.816  1.00 103.50 ? 269 GLU D CA  1 
ATOM   9765  C  C   . GLU D  1 269 ? -32.772 -55.933 95.213  1.00 102.18 ? 269 GLU D C   1 
ATOM   9766  O  O   . GLU D  1 269 ? -32.160 -56.968 95.480  1.00 107.22 ? 269 GLU D O   1 
ATOM   9767  C  CB  . GLU D  1 269 ? -34.502 -56.999 93.661  1.00 105.73 ? 269 GLU D CB  1 
ATOM   9768  C  CG  . GLU D  1 269 ? -33.703 -56.712 92.386  1.00 108.00 ? 269 GLU D CG  1 
ATOM   9769  C  CD  . GLU D  1 269 ? -34.312 -55.598 91.542  1.00 107.71 ? 269 GLU D CD  1 
ATOM   9770  O  OE1 . GLU D  1 269 ? -35.423 -55.131 91.877  1.00 103.63 ? 269 GLU D OE1 1 
ATOM   9771  O  OE2 . GLU D  1 269 ? -33.681 -55.198 90.547  1.00 112.92 ? 269 GLU D OE2 1 
ATOM   9772  N  N   . TYR D  1 270 ? -32.205 -54.727 95.246  1.00 100.06 ? 270 TYR D N   1 
ATOM   9773  C  CA  . TYR D  1 270 ? -30.800 -54.537 95.647  1.00 90.83  ? 270 TYR D CA  1 
ATOM   9774  C  C   . TYR D  1 270 ? -30.695 -53.744 96.969  1.00 85.71  ? 270 TYR D C   1 
ATOM   9775  O  O   . TYR D  1 270 ? -29.622 -53.652 97.567  1.00 84.86  ? 270 TYR D O   1 
ATOM   9776  C  CB  . TYR D  1 270 ? -30.012 -53.821 94.541  1.00 98.57  ? 270 TYR D CB  1 
ATOM   9777  C  CG  . TYR D  1 270 ? -29.688 -54.700 93.317  1.00 109.32 ? 270 TYR D CG  1 
ATOM   9778  C  CD1 . TYR D  1 270 ? -30.692 -55.080 92.416  1.00 113.99 ? 270 TYR D CD1 1 
ATOM   9779  C  CD2 . TYR D  1 270 ? -28.378 -55.130 93.066  1.00 109.06 ? 270 TYR D CD2 1 
ATOM   9780  C  CE1 . TYR D  1 270 ? -30.402 -55.872 91.306  1.00 107.22 ? 270 TYR D CE1 1 
ATOM   9781  C  CE2 . TYR D  1 270 ? -28.077 -55.919 91.960  1.00 109.84 ? 270 TYR D CE2 1 
ATOM   9782  C  CZ  . TYR D  1 270 ? -29.093 -56.289 91.082  1.00 108.79 ? 270 TYR D CZ  1 
ATOM   9783  O  OH  . TYR D  1 270 ? -28.802 -57.068 89.989  1.00 102.00 ? 270 TYR D OH  1 
ATOM   9784  N  N   . LYS D  1 271 ? -31.824 -53.181 97.408  1.00 85.52  ? 271 LYS D N   1 
ATOM   9785  C  CA  . LYS D  1 271 ? -31.864 -52.338 98.617  1.00 86.01  ? 271 LYS D CA  1 
ATOM   9786  C  C   . LYS D  1 271 ? -31.408 -53.108 99.916  1.00 90.37  ? 271 LYS D C   1 
ATOM   9787  O  O   . LYS D  1 271 ? -30.462 -52.687 100.593 1.00 79.36  ? 271 LYS D O   1 
ATOM   9788  C  CB  . LYS D  1 271 ? -33.268 -51.745 98.813  1.00 86.39  ? 271 LYS D CB  1 
ATOM   9789  C  CG  . LYS D  1 271 ? -33.316 -50.535 99.731  1.00 85.50  ? 271 LYS D CG  1 
ATOM   9790  C  CD  . LYS D  1 271 ? -32.660 -49.319 99.079  1.00 87.77  ? 271 LYS D CD  1 
ATOM   9791  C  CE  . LYS D  1 271 ? -32.822 -48.075 99.939  1.00 89.36  ? 271 LYS D CE  1 
ATOM   9792  N  NZ  . LYS D  1 271 ? -32.261 -46.871 99.277  1.00 86.44  ? 271 LYS D NZ  1 
ATOM   9793  N  N   . PRO D  1 272 ? -32.105 -54.244 100.243 1.00 96.07  ? 272 PRO D N   1 
ATOM   9794  C  CA  . PRO D  1 272 ? -31.835 -55.019 101.483 1.00 97.62  ? 272 PRO D CA  1 
ATOM   9795  C  C   . PRO D  1 272 ? -30.393 -55.553 101.564 1.00 96.52  ? 272 PRO D C   1 
ATOM   9796  O  O   . PRO D  1 272 ? -29.830 -55.663 102.660 1.00 92.97  ? 272 PRO D O   1 
ATOM   9797  C  CB  . PRO D  1 272 ? -32.834 -56.192 101.387 1.00 97.25  ? 272 PRO D CB  1 
ATOM   9798  C  CG  . PRO D  1 272 ? -33.193 -56.271 99.926  1.00 92.22  ? 272 PRO D CG  1 
ATOM   9799  C  CD  . PRO D  1 272 ? -33.164 -54.869 99.426  1.00 91.31  ? 272 PRO D CD  1 
ATOM   9800  N  N   . LYS D  1 273 ? -29.816 -55.872 100.423 1.00 95.00  ? 273 LYS D N   1 
ATOM   9801  C  CA  . LYS D  1 273 ? -28.494 -56.472 100.374 1.00 97.13  ? 273 LYS D CA  1 
ATOM   9802  C  C   . LYS D  1 273 ? -27.343 -55.417 100.356 1.00 96.09  ? 273 LYS D C   1 
ATOM   9803  O  O   . LYS D  1 273 ? -26.203 -55.726 100.714 1.00 101.59 ? 273 LYS D O   1 
ATOM   9804  C  CB  . LYS D  1 273 ? -28.380 -57.413 99.149  1.00 97.30  ? 273 LYS D CB  1 
ATOM   9805  C  CG  . LYS D  1 273 ? -27.007 -58.049 98.958  1.00 95.05  ? 273 LYS D CG  1 
ATOM   9806  C  CD  . LYS D  1 273 ? -27.001 -58.992 97.743  1.00 97.50  ? 273 LYS D CD  1 
ATOM   9807  C  CE  . LYS D  1 273 ? -25.615 -59.569 97.487  1.00 91.74  ? 273 LYS D CE  1 
ATOM   9808  N  NZ  . LYS D  1 273 ? -24.627 -58.509 97.128  1.00 92.52  ? 273 LYS D NZ  1 
ATOM   9809  N  N   . LEU D  1 274 ? -27.664 -54.181 99.943  1.00 90.58  ? 274 LEU D N   1 
ATOM   9810  C  CA  . LEU D  1 274 ? -26.619 -53.137 99.753  1.00 77.97  ? 274 LEU D CA  1 
ATOM   9811  C  C   . LEU D  1 274 ? -26.814 -51.855 100.644 1.00 72.70  ? 274 LEU D C   1 
ATOM   9812  O  O   . LEU D  1 274 ? -25.832 -51.198 101.026 1.00 69.69  ? 274 LEU D O   1 
ATOM   9813  C  CB  . LEU D  1 274 ? -26.515 -52.744 98.267  1.00 78.92  ? 274 LEU D CB  1 
ATOM   9814  C  CG  . LEU D  1 274 ? -26.279 -53.900 97.261  1.00 79.91  ? 274 LEU D CG  1 
ATOM   9815  C  CD1 . LEU D  1 274 ? -26.313 -53.388 95.822  1.00 71.29  ? 274 LEU D CD1 1 
ATOM   9816  C  CD2 . LEU D  1 274 ? -24.966 -54.631 97.552  1.00 72.59  ? 274 LEU D CD2 1 
ATOM   9817  N  N   . ALA D  1 275 ? -28.073 -51.524 100.954 1.00 71.07  ? 275 ALA D N   1 
ATOM   9818  C  CA  . ALA D  1 275 ? -28.388 -50.297 101.759 1.00 59.45  ? 275 ALA D CA  1 
ATOM   9819  C  C   . ALA D  1 275 ? -29.721 -50.440 102.519 1.00 62.80  ? 275 ALA D C   1 
ATOM   9820  O  O   . ALA D  1 275 ? -30.656 -49.625 102.324 1.00 59.94  ? 275 ALA D O   1 
ATOM   9821  C  CB  . ALA D  1 275 ? -28.412 -49.080 100.870 1.00 59.88  ? 275 ALA D CB  1 
ATOM   9822  N  N   . PRO D  1 276 ? -29.814 -51.478 103.400 1.00 66.31  ? 276 PRO D N   1 
ATOM   9823  C  CA  . PRO D  1 276 ? -31.040 -51.841 104.153 1.00 63.90  ? 276 PRO D CA  1 
ATOM   9824  C  C   . PRO D  1 276 ? -31.848 -50.611 104.759 1.00 61.83  ? 276 PRO D C   1 
ATOM   9825  O  O   . PRO D  1 276 ? -32.997 -50.391 104.388 1.00 59.65  ? 276 PRO D O   1 
ATOM   9826  C  CB  . PRO D  1 276 ? -30.506 -52.764 105.285 1.00 66.36  ? 276 PRO D CB  1 
ATOM   9827  C  CG  . PRO D  1 276 ? -28.982 -52.828 105.073 1.00 62.25  ? 276 PRO D CG  1 
ATOM   9828  C  CD  . PRO D  1 276 ? -28.716 -52.401 103.679 1.00 61.52  ? 276 PRO D CD  1 
ATOM   9829  N  N   A ARG D  1 277 ? -31.215 -49.858 105.675 0.50 58.49  ? 277 ARG D N   1 
ATOM   9830  N  N   B ARG D  1 277 ? -31.213 -49.851 105.679 0.50 59.82  ? 277 ARG D N   1 
ATOM   9831  C  CA  A ARG D  1 277 ? -31.892 -48.700 106.338 0.50 56.70  ? 277 ARG D CA  1 
ATOM   9832  C  CA  B ARG D  1 277 ? -31.903 -48.689 106.349 0.50 58.67  ? 277 ARG D CA  1 
ATOM   9833  C  C   A ARG D  1 277 ? -31.356 -47.333 105.843 0.50 52.44  ? 277 ARG D C   1 
ATOM   9834  C  C   B ARG D  1 277 ? -31.399 -47.316 105.834 0.50 53.10  ? 277 ARG D C   1 
ATOM   9835  O  O   A ARG D  1 277 ? -31.250 -46.374 106.618 0.50 50.35  ? 277 ARG D O   1 
ATOM   9836  O  O   B ARG D  1 277 ? -31.352 -46.335 106.587 0.50 49.55  ? 277 ARG D O   1 
ATOM   9837  C  CB  A ARG D  1 277 ? -31.783 -48.806 107.864 0.50 56.61  ? 277 ARG D CB  1 
ATOM   9838  C  CB  B ARG D  1 277 ? -31.759 -48.772 107.873 0.50 61.27  ? 277 ARG D CB  1 
ATOM   9839  C  CG  A ARG D  1 277 ? -30.396 -49.206 108.373 0.50 56.06  ? 277 ARG D CG  1 
ATOM   9840  C  CG  B ARG D  1 277 ? -32.251 -50.086 108.479 0.50 64.93  ? 277 ARG D CG  1 
ATOM   9841  C  CD  A ARG D  1 277 ? -30.378 -49.296 109.907 0.50 57.56  ? 277 ARG D CD  1 
ATOM   9842  C  CD  B ARG D  1 277 ? -31.295 -51.227 108.167 0.50 67.71  ? 277 ARG D CD  1 
ATOM   9843  N  NE  A ARG D  1 277 ? -29.128 -49.871 110.419 0.50 55.03  ? 277 ARG D NE  1 
ATOM   9844  N  NE  B ARG D  1 277 ? -30.037 -51.103 108.904 0.50 65.45  ? 277 ARG D NE  1 
ATOM   9845  C  CZ  A ARG D  1 277 ? -28.168 -50.383 109.651 0.50 51.97  ? 277 ARG D CZ  1 
ATOM   9846  C  CZ  B ARG D  1 277 ? -29.852 -50.280 109.934 0.50 66.05  ? 277 ARG D CZ  1 
ATOM   9847  N  NH1 A ARG D  1 277 ? -28.305 -50.398 108.339 0.50 49.16  ? 277 ARG D NH1 1 
ATOM   9848  N  NH1 B ARG D  1 277 ? -30.847 -49.511 110.357 0.50 63.12  ? 277 ARG D NH1 1 
ATOM   9849  N  NH2 A ARG D  1 277 ? -27.073 -50.882 110.203 0.50 51.65  ? 277 ARG D NH2 1 
ATOM   9850  N  NH2 B ARG D  1 277 ? -28.674 -50.231 110.544 0.50 66.71  ? 277 ARG D NH2 1 
ATOM   9851  N  N   . TRP D  1 278 ? -31.036 -47.267 104.554 1.00 49.69  ? 278 TRP D N   1 
ATOM   9852  C  CA  . TRP D  1 278 ? -30.509 -46.043 103.938 1.00 45.43  ? 278 TRP D CA  1 
ATOM   9853  C  C   . TRP D  1 278 ? -31.598 -44.975 103.732 1.00 40.95  ? 278 TRP D C   1 
ATOM   9854  O  O   . TRP D  1 278 ? -32.539 -45.178 102.976 1.00 39.73  ? 278 TRP D O   1 
ATOM   9855  C  CB  . TRP D  1 278 ? -29.831 -46.395 102.593 1.00 44.43  ? 278 TRP D CB  1 
ATOM   9856  C  CG  . TRP D  1 278 ? -29.033 -45.273 101.961 1.00 47.30  ? 278 TRP D CG  1 
ATOM   9857  C  CD1 . TRP D  1 278 ? -28.208 -44.350 102.614 1.00 46.27  ? 278 TRP D CD1 1 
ATOM   9858  C  CD2 . TRP D  1 278 ? -28.937 -44.958 100.523 1.00 49.20  ? 278 TRP D CD2 1 
ATOM   9859  N  NE1 . TRP D  1 278 ? -27.622 -43.472 101.678 1.00 45.06  ? 278 TRP D NE1 1 
ATOM   9860  C  CE2 . TRP D  1 278 ? -28.045 -43.816 100.395 1.00 47.60  ? 278 TRP D CE2 1 
ATOM   9861  C  CE3 . TRP D  1 278 ? -29.517 -45.513 99.347  1.00 46.78  ? 278 TRP D CE3 1 
ATOM   9862  C  CZ2 . TRP D  1 278 ? -27.731 -43.239 99.144  1.00 46.88  ? 278 TRP D CZ2 1 
ATOM   9863  C  CZ3 . TRP D  1 278 ? -29.198 -44.927 98.084  1.00 45.09  ? 278 TRP D CZ3 1 
ATOM   9864  C  CH2 . TRP D  1 278 ? -28.324 -43.814 97.992  1.00 44.87  ? 278 TRP D CH2 1 
ATOM   9865  N  N   . SER D  1 279 ? -31.454 -43.830 104.429 1.00 37.64  ? 279 SER D N   1 
ATOM   9866  C  CA  . SER D  1 279 ? -32.403 -42.665 104.260 1.00 36.68  ? 279 SER D CA  1 
ATOM   9867  C  C   . SER D  1 279 ? -31.730 -41.397 104.652 1.00 38.61  ? 279 SER D C   1 
ATOM   9868  O  O   . SER D  1 279 ? -30.576 -41.407 105.092 1.00 35.84  ? 279 SER D O   1 
ATOM   9869  C  CB  . SER D  1 279 ? -33.660 -42.855 105.092 1.00 36.17  ? 279 SER D CB  1 
ATOM   9870  O  OG  . SER D  1 279 ? -33.484 -42.338 106.403 1.00 36.77  ? 279 SER D OG  1 
ATOM   9871  N  N   . ILE D  1 280 ? -32.441 -40.280 104.509 1.00 38.04  ? 280 ILE D N   1 
ATOM   9872  C  CA  . ILE D  1 280 ? -31.879 -38.986 104.829 1.00 34.07  ? 280 ILE D CA  1 
ATOM   9873  C  C   . ILE D  1 280 ? -31.911 -38.690 106.373 1.00 33.92  ? 280 ILE D C   1 
ATOM   9874  O  O   . ILE D  1 280 ? -31.404 -37.677 106.819 1.00 32.12  ? 280 ILE D O   1 
ATOM   9875  C  CB  . ILE D  1 280 ? -32.596 -37.845 104.059 1.00 38.14  ? 280 ILE D CB  1 
ATOM   9876  C  CG1 . ILE D  1 280 ? -31.705 -36.603 103.982 1.00 36.22  ? 280 ILE D CG1 1 
ATOM   9877  C  CG2 . ILE D  1 280 ? -33.949 -37.522 104.702 1.00 32.46  ? 280 ILE D CG2 1 
ATOM   9878  C  CD1 . ILE D  1 280 ? -32.294 -35.484 103.163 1.00 38.10  ? 280 ILE D CD1 1 
ATOM   9879  N  N   . THR D  1 281 ? -32.522 -39.612 107.160 1.00 33.16  ? 281 THR D N   1 
ATOM   9880  C  CA  . THR D  1 281 ? -32.616 -39.427 108.649 1.00 31.31  ? 281 THR D CA  1 
ATOM   9881  C  C   . THR D  1 281 ? -31.931 -40.574 109.450 1.00 30.25  ? 281 THR D C   1 
ATOM   9882  O  O   . THR D  1 281 ? -32.103 -40.680 110.685 1.00 29.99  ? 281 THR D O   1 
ATOM   9883  C  CB  . THR D  1 281 ? -34.075 -39.284 109.121 1.00 30.81  ? 281 THR D CB  1 
ATOM   9884  O  OG1 . THR D  1 281 ? -34.794 -40.473 108.815 1.00 33.38  ? 281 THR D OG1 1 
ATOM   9885  C  CG2 . THR D  1 281 ? -34.755 -38.078 108.440 1.00 28.56  ? 281 THR D CG2 1 
ATOM   9886  N  N   . LEU D  1 282 ? -31.167 -41.402 108.761 1.00 28.09  ? 282 LEU D N   1 
ATOM   9887  C  CA  . LEU D  1 282 ? -30.513 -42.541 109.403 1.00 29.57  ? 282 LEU D CA  1 
ATOM   9888  C  C   . LEU D  1 282 ? -29.617 -42.133 110.627 1.00 30.65  ? 282 LEU D C   1 
ATOM   9889  O  O   . LEU D  1 282 ? -29.619 -42.798 111.630 1.00 30.20  ? 282 LEU D O   1 
ATOM   9890  C  CB  . LEU D  1 282 ? -29.685 -43.340 108.405 1.00 30.80  ? 282 LEU D CB  1 
ATOM   9891  C  CG  . LEU D  1 282 ? -28.883 -44.512 109.077 1.00 36.52  ? 282 LEU D CG  1 
ATOM   9892  C  CD1 . LEU D  1 282 ? -29.839 -45.553 109.689 1.00 33.54  ? 282 LEU D CD1 1 
ATOM   9893  C  CD2 . LEU D  1 282 ? -27.899 -45.164 108.116 1.00 32.81  ? 282 LEU D CD2 1 
ATOM   9894  N  N   . ILE D  1 283 ? -28.858 -41.028 110.493 1.00 30.02  ? 283 ILE D N   1 
ATOM   9895  C  CA  . ILE D  1 283 ? -27.935 -40.602 111.594 1.00 32.62  ? 283 ILE D CA  1 
ATOM   9896  C  C   . ILE D  1 283 ? -28.681 -40.251 112.863 1.00 32.93  ? 283 ILE D C   1 
ATOM   9897  O  O   . ILE D  1 283 ? -28.127 -40.321 113.948 1.00 31.43  ? 283 ILE D O   1 
ATOM   9898  C  CB  . ILE D  1 283 ? -27.031 -39.414 111.185 1.00 36.18  ? 283 ILE D CB  1 
ATOM   9899  C  CG1 . ILE D  1 283 ? -27.881 -38.174 110.851 1.00 36.12  ? 283 ILE D CG1 1 
ATOM   9900  C  CG2 . ILE D  1 283 ? -26.101 -39.814 110.017 1.00 28.73  ? 283 ILE D CG2 1 
ATOM   9901  C  CD1 . ILE D  1 283 ? -27.075 -36.913 110.682 1.00 35.87  ? 283 ILE D CD1 1 
ATOM   9902  N  N   . PHE D  1 284 ? -29.958 -39.866 112.719 1.00 30.60  ? 284 PHE D N   1 
ATOM   9903  C  CA  . PHE D  1 284 ? -30.771 -39.505 113.867 1.00 33.79  ? 284 PHE D CA  1 
ATOM   9904  C  C   . PHE D  1 284 ? -31.265 -40.738 114.579 1.00 33.23  ? 284 PHE D C   1 
ATOM   9905  O  O   . PHE D  1 284 ? -31.445 -40.731 115.767 1.00 32.65  ? 284 PHE D O   1 
ATOM   9906  C  CB  . PHE D  1 284 ? -31.965 -38.635 113.437 1.00 33.90  ? 284 PHE D CB  1 
ATOM   9907  C  CG  . PHE D  1 284 ? -31.577 -37.366 112.807 1.00 34.13  ? 284 PHE D CG  1 
ATOM   9908  C  CD1 . PHE D  1 284 ? -31.762 -37.165 111.448 1.00 33.97  ? 284 PHE D CD1 1 
ATOM   9909  C  CD2 . PHE D  1 284 ? -31.008 -36.338 113.567 1.00 33.44  ? 284 PHE D CD2 1 
ATOM   9910  C  CE1 . PHE D  1 284 ? -31.393 -35.968 110.855 1.00 35.72  ? 284 PHE D CE1 1 
ATOM   9911  C  CE2 . PHE D  1 284 ? -30.641 -35.149 112.981 1.00 32.69  ? 284 PHE D CE2 1 
ATOM   9912  C  CZ  . PHE D  1 284 ? -30.829 -34.959 111.626 1.00 34.86  ? 284 PHE D CZ  1 
ATOM   9913  N  N   . GLU D  1 285 ? -31.475 -41.802 113.823 1.00 33.63  ? 285 GLU D N   1 
ATOM   9914  C  CA  . GLU D  1 285 ? -32.007 -43.049 114.368 1.00 38.39  ? 285 GLU D CA  1 
ATOM   9915  C  C   . GLU D  1 285 ? -30.908 -43.943 114.860 1.00 37.52  ? 285 GLU D C   1 
ATOM   9916  O  O   . GLU D  1 285 ? -31.121 -44.767 115.699 1.00 43.59  ? 285 GLU D O   1 
ATOM   9917  C  CB  . GLU D  1 285 ? -32.822 -43.791 113.295 1.00 36.20  ? 285 GLU D CB  1 
ATOM   9918  C  CG  . GLU D  1 285 ? -33.808 -42.901 112.515 1.00 41.04  ? 285 GLU D CG  1 
ATOM   9919  C  CD  . GLU D  1 285 ? -34.144 -43.473 111.100 1.00 45.04  ? 285 GLU D CD  1 
ATOM   9920  O  OE1 . GLU D  1 285 ? -33.711 -44.625 110.793 1.00 42.57  ? 285 GLU D OE1 1 
ATOM   9921  O  OE2 . GLU D  1 285 ? -34.834 -42.762 110.305 1.00 42.93  ? 285 GLU D OE2 1 
ATOM   9922  N  N   . ASP D  1 286 ? -29.720 -43.767 114.318 1.00 36.57  ? 286 ASP D N   1 
ATOM   9923  C  CA  . ASP D  1 286 ? -28.630 -44.670 114.606 1.00 36.51  ? 286 ASP D CA  1 
ATOM   9924  C  C   . ASP D  1 286 ? -27.321 -43.961 115.108 1.00 34.42  ? 286 ASP D C   1 
ATOM   9925  O  O   . ASP D  1 286 ? -26.930 -44.102 116.277 1.00 37.33  ? 286 ASP D O   1 
ATOM   9926  C  CB  . ASP D  1 286 ? -28.321 -45.533 113.379 1.00 37.35  ? 286 ASP D CB  1 
ATOM   9927  C  CG  . ASP D  1 286 ? -27.179 -46.524 113.629 1.00 46.20  ? 286 ASP D CG  1 
ATOM   9928  O  OD1 . ASP D  1 286 ? -26.284 -46.214 114.449 1.00 42.84  ? 286 ASP D OD1 1 
ATOM   9929  O  OD2 . ASP D  1 286 ? -27.181 -47.604 113.002 1.00 53.54  ? 286 ASP D OD2 1 
ATOM   9930  N  N   . THR D  1 287 ? -26.684 -43.229 114.227 1.00 33.09  ? 287 THR D N   1 
ATOM   9931  C  CA  . THR D  1 287 ? -25.317 -42.661 114.502 1.00 29.79  ? 287 THR D CA  1 
ATOM   9932  C  C   . THR D  1 287 ? -25.265 -41.748 115.726 1.00 28.42  ? 287 THR D C   1 
ATOM   9933  O  O   . THR D  1 287 ? -24.468 -41.978 116.656 1.00 27.00  ? 287 THR D O   1 
ATOM   9934  C  CB  . THR D  1 287 ? -24.765 -41.918 113.287 1.00 29.88  ? 287 THR D CB  1 
ATOM   9935  O  OG1 . THR D  1 287 ? -24.812 -42.771 112.152 1.00 31.36  ? 287 THR D OG1 1 
ATOM   9936  C  CG2 . THR D  1 287 ? -23.302 -41.479 113.537 1.00 29.41  ? 287 THR D CG2 1 
ATOM   9937  N  N   . ILE D  1 288 ? -26.089 -40.727 115.736 1.00 26.12  ? 288 ILE D N   1 
ATOM   9938  C  CA  . ILE D  1 288 ? -26.073 -39.761 116.844 1.00 27.23  ? 288 ILE D CA  1 
ATOM   9939  C  C   . ILE D  1 288 ? -26.363 -40.431 118.236 1.00 26.48  ? 288 ILE D C   1 
ATOM   9940  O  O   . ILE D  1 288 ? -25.590 -40.234 119.212 1.00 28.10  ? 288 ILE D O   1 
ATOM   9941  C  CB  . ILE D  1 288 ? -27.020 -38.547 116.583 1.00 28.34  ? 288 ILE D CB  1 
ATOM   9942  C  CG1 . ILE D  1 288 ? -26.448 -37.671 115.455 1.00 27.72  ? 288 ILE D CG1 1 
ATOM   9943  C  CG2 . ILE D  1 288 ? -27.205 -37.732 117.848 1.00 29.51  ? 288 ILE D CG2 1 
ATOM   9944  C  CD1 . ILE D  1 288 ? -27.292 -36.461 115.114 1.00 29.16  ? 288 ILE D CD1 1 
ATOM   9945  N  N   . PRO D  1 289 ? -27.442 -41.208 118.325 1.00 26.67  ? 289 PRO D N   1 
ATOM   9946  C  CA  . PRO D  1 289 ? -27.704 -41.949 119.595 1.00 27.57  ? 289 PRO D CA  1 
ATOM   9947  C  C   . PRO D  1 289 ? -26.508 -42.846 119.987 1.00 27.34  ? 289 PRO D C   1 
ATOM   9948  O  O   . PRO D  1 289 ? -26.152 -42.928 121.170 1.00 27.71  ? 289 PRO D O   1 
ATOM   9949  C  CB  . PRO D  1 289 ? -28.910 -42.796 119.260 1.00 26.61  ? 289 PRO D CB  1 
ATOM   9950  C  CG  . PRO D  1 289 ? -29.611 -42.040 118.166 1.00 28.55  ? 289 PRO D CG  1 
ATOM   9951  C  CD  . PRO D  1 289 ? -28.517 -41.389 117.349 1.00 25.70  ? 289 PRO D CD  1 
ATOM   9952  N  N   . PHE D  1 290 ? -25.895 -43.511 118.985 1.00 26.20  ? 290 PHE D N   1 
ATOM   9953  C  CA  . PHE D  1 290 ? -24.714 -44.355 119.233 1.00 26.95  ? 290 PHE D CA  1 
ATOM   9954  C  C   . PHE D  1 290 ? -23.593 -43.550 119.853 1.00 24.86  ? 290 PHE D C   1 
ATOM   9955  O  O   . PHE D  1 290 ? -23.021 -43.941 120.858 1.00 25.03  ? 290 PHE D O   1 
ATOM   9956  C  CB  . PHE D  1 290 ? -24.224 -45.026 117.919 1.00 26.18  ? 290 PHE D CB  1 
ATOM   9957  C  CG  . PHE D  1 290 ? -22.839 -45.636 118.026 1.00 28.01  ? 290 PHE D CG  1 
ATOM   9958  C  CD1 . PHE D  1 290 ? -22.656 -46.898 118.598 1.00 27.90  ? 290 PHE D CD1 1 
ATOM   9959  C  CD2 . PHE D  1 290 ? -21.716 -44.945 117.561 1.00 26.11  ? 290 PHE D CD2 1 
ATOM   9960  C  CE1 . PHE D  1 290 ? -21.384 -47.451 118.698 1.00 29.51  ? 290 PHE D CE1 1 
ATOM   9961  C  CE2 . PHE D  1 290 ? -20.455 -45.496 117.661 1.00 26.56  ? 290 PHE D CE2 1 
ATOM   9962  C  CZ  . PHE D  1 290 ? -20.286 -46.750 118.229 1.00 26.57  ? 290 PHE D CZ  1 
ATOM   9963  N  N   . LEU D  1 291 ? -23.285 -42.421 119.246 1.00 25.11  ? 291 LEU D N   1 
ATOM   9964  C  CA  . LEU D  1 291 ? -22.233 -41.585 119.717 1.00 25.23  ? 291 LEU D CA  1 
ATOM   9965  C  C   . LEU D  1 291 ? -22.500 -41.093 121.174 1.00 25.32  ? 291 LEU D C   1 
ATOM   9966  O  O   . LEU D  1 291 ? -21.602 -41.103 122.017 1.00 23.96  ? 291 LEU D O   1 
ATOM   9967  C  CB  . LEU D  1 291 ? -22.021 -40.370 118.758 1.00 23.60  ? 291 LEU D CB  1 
ATOM   9968  C  CG  . LEU D  1 291 ? -21.424 -40.679 117.365 1.00 22.92  ? 291 LEU D CG  1 
ATOM   9969  C  CD1 . LEU D  1 291 ? -21.425 -39.418 116.484 1.00 23.17  ? 291 LEU D CD1 1 
ATOM   9970  C  CD2 . LEU D  1 291 ? -20.032 -41.243 117.490 1.00 22.49  ? 291 LEU D CD2 1 
ATOM   9971  N  N   . LYS D  1 292 ? -23.725 -40.682 121.444 1.00 24.42  ? 292 LYS D N   1 
ATOM   9972  C  CA  . LYS D  1 292 ? -24.071 -40.155 122.785 1.00 28.26  ? 292 LYS D CA  1 
ATOM   9973  C  C   . LYS D  1 292 ? -24.010 -41.249 123.935 1.00 30.59  ? 292 LYS D C   1 
ATOM   9974  O  O   . LYS D  1 292 ? -23.679 -40.937 125.068 1.00 28.09  ? 292 LYS D O   1 
ATOM   9975  C  CB  . LYS D  1 292 ? -25.426 -39.426 122.763 1.00 33.43  ? 292 LYS D CB  1 
ATOM   9976  C  CG  . LYS D  1 292 ? -25.379 -38.075 121.970 1.00 37.11  ? 292 LYS D CG  1 
ATOM   9977  C  CD  . LYS D  1 292 ? -26.571 -37.178 122.283 1.00 46.95  ? 292 LYS D CD  1 
ATOM   9978  C  CE  . LYS D  1 292 ? -27.814 -37.617 121.543 1.00 48.63  ? 292 LYS D CE  1 
ATOM   9979  N  NZ  . LYS D  1 292 ? -28.865 -36.527 121.538 1.00 50.46  ? 292 LYS D NZ  1 
ATOM   9980  N  N   . ARG D  1 293 ? -24.328 -42.518 123.592 1.00 26.28  ? 293 ARG D N   1 
ATOM   9981  C  CA  . ARG D  1 293 ? -24.230 -43.616 124.573 1.00 26.87  ? 293 ARG D CA  1 
ATOM   9982  C  C   . ARG D  1 293 ? -22.772 -44.083 124.702 1.00 26.40  ? 293 ARG D C   1 
ATOM   9983  O  O   . ARG D  1 293 ? -22.457 -44.934 125.513 1.00 24.73  ? 293 ARG D O   1 
ATOM   9984  C  CB  . ARG D  1 293 ? -25.142 -44.798 124.184 1.00 27.73  ? 293 ARG D CB  1 
ATOM   9985  C  CG  . ARG D  1 293 ? -24.473 -45.823 123.271 1.00 29.87  ? 293 ARG D CG  1 
ATOM   9986  C  CD  . ARG D  1 293 ? -25.335 -47.087 123.111 1.00 34.50  ? 293 ARG D CD  1 
ATOM   9987  N  NE  . ARG D  1 293 ? -26.538 -46.791 122.466 1.00 39.14  ? 293 ARG D NE  1 
ATOM   9988  C  CZ  . ARG D  1 293 ? -26.807 -47.097 121.220 1.00 33.85  ? 293 ARG D CZ  1 
ATOM   9989  N  NH1 . ARG D  1 293 ? -25.925 -47.757 120.486 1.00 31.34  ? 293 ARG D NH1 1 
ATOM   9990  N  NH2 . ARG D  1 293 ? -27.962 -46.760 120.708 1.00 35.91  ? 293 ARG D NH2 1 
ATOM   9991  N  N   . ASN D  1 294 ? -21.895 -43.509 123.878 1.00 28.72  ? 294 ASN D N   1 
ATOM   9992  C  CA  . ASN D  1 294 ? -20.449 -43.813 123.958 1.00 27.14  ? 294 ASN D CA  1 
ATOM   9993  C  C   . ASN D  1 294 ? -19.625 -42.611 124.406 1.00 29.97  ? 294 ASN D C   1 
ATOM   9994  O  O   . ASN D  1 294 ? -18.495 -42.429 123.978 1.00 30.52  ? 294 ASN D O   1 
ATOM   9995  C  CB  . ASN D  1 294 ? -19.917 -44.380 122.620 1.00 29.47  ? 294 ASN D CB  1 
ATOM   9996  C  CG  . ASN D  1 294 ? -20.405 -45.818 122.351 1.00 30.14  ? 294 ASN D CG  1 
ATOM   9997  O  OD1 . ASN D  1 294 ? -21.482 -46.032 121.756 1.00 30.70  ? 294 ASN D OD1 1 
ATOM   9998  N  ND2 . ASN D  1 294 ? -19.638 -46.777 122.775 1.00 26.30  ? 294 ASN D ND2 1 
ATOM   9999  N  N   . GLY D  1 295 ? -20.222 -41.784 125.276 1.00 29.75  ? 295 GLY D N   1 
ATOM   10000 C  CA  . GLY D  1 295 ? -19.503 -40.705 125.933 1.00 33.29  ? 295 GLY D CA  1 
ATOM   10001 C  C   . GLY D  1 295 ? -19.168 -39.515 125.059 1.00 35.29  ? 295 GLY D C   1 
ATOM   10002 O  O   . GLY D  1 295 ? -18.295 -38.752 125.379 1.00 39.25  ? 295 GLY D O   1 
ATOM   10003 N  N   . VAL D  1 296 ? -19.870 -39.367 123.951 1.00 32.03  ? 296 VAL D N   1 
ATOM   10004 C  CA  . VAL D  1 296 ? -19.666 -38.193 123.087 1.00 29.03  ? 296 VAL D CA  1 
ATOM   10005 C  C   . VAL D  1 296 ? -20.569 -37.059 123.527 1.00 29.52  ? 296 VAL D C   1 
ATOM   10006 O  O   . VAL D  1 296 ? -21.782 -37.166 123.465 1.00 27.90  ? 296 VAL D O   1 
ATOM   10007 C  CB  . VAL D  1 296 ? -19.908 -38.520 121.596 1.00 28.76  ? 296 VAL D CB  1 
ATOM   10008 C  CG1 . VAL D  1 296 ? -20.010 -37.231 120.773 1.00 23.43  ? 296 VAL D CG1 1 
ATOM   10009 C  CG2 . VAL D  1 296 ? -18.802 -39.418 121.064 1.00 24.81  ? 296 VAL D CG2 1 
ATOM   10010 N  N   . ASN D  1 297 ? -19.958 -35.970 123.981 1.00 30.30  ? 297 ASN D N   1 
ATOM   10011 C  CA  . ASN D  1 297 ? -20.701 -34.819 124.499 1.00 31.80  ? 297 ASN D CA  1 
ATOM   10012 C  C   . ASN D  1 297 ? -21.526 -34.086 123.414 1.00 31.34  ? 297 ASN D C   1 
ATOM   10013 O  O   . ASN D  1 297 ? -21.104 -33.988 122.252 1.00 31.87  ? 297 ASN D O   1 
ATOM   10014 C  CB  . ASN D  1 297 ? -19.747 -33.843 125.187 1.00 30.92  ? 297 ASN D CB  1 
ATOM   10015 C  CG  . ASN D  1 297 ? -20.480 -32.768 125.982 1.00 33.25  ? 297 ASN D CG  1 
ATOM   10016 O  OD1 . ASN D  1 297 ? -20.947 -31.784 125.426 1.00 30.36  ? 297 ASN D OD1 1 
ATOM   10017 N  ND2 . ASN D  1 297 ? -20.569 -32.962 127.306 1.00 30.85  ? 297 ASN D ND2 1 
ATOM   10018 N  N   . GLU D  1 298 ? -22.695 -33.584 123.804 1.00 31.81  ? 298 GLU D N   1 
ATOM   10019 C  CA  . GLU D  1 298 ? -23.565 -32.836 122.884 1.00 36.42  ? 298 GLU D CA  1 
ATOM   10020 C  C   . GLU D  1 298 ? -22.785 -31.702 122.139 1.00 32.47  ? 298 GLU D C   1 
ATOM   10021 O  O   . GLU D  1 298 ? -23.121 -31.340 121.023 1.00 33.44  ? 298 GLU D O   1 
ATOM   10022 C  CB  . GLU D  1 298 ? -24.760 -32.249 123.631 1.00 38.73  ? 298 GLU D CB  1 
ATOM   10023 C  CG  . GLU D  1 298 ? -25.685 -31.381 122.757 1.00 47.97  ? 298 GLU D CG  1 
ATOM   10024 C  CD  . GLU D  1 298 ? -26.408 -32.202 121.640 1.00 61.80  ? 298 GLU D CD  1 
ATOM   10025 O  OE1 . GLU D  1 298 ? -26.773 -33.396 121.900 1.00 64.20  ? 298 GLU D OE1 1 
ATOM   10026 O  OE2 . GLU D  1 298 ? -26.611 -31.648 120.514 1.00 61.47  ? 298 GLU D OE2 1 
ATOM   10027 N  N   . GLU D  1 299 ? -21.767 -31.174 122.781 1.00 31.02  ? 299 GLU D N   1 
ATOM   10028 C  CA  . GLU D  1 299 ? -20.969 -30.131 122.193 1.00 32.21  ? 299 GLU D CA  1 
ATOM   10029 C  C   . GLU D  1 299 ? -20.348 -30.603 120.878 1.00 30.68  ? 299 GLU D C   1 
ATOM   10030 O  O   . GLU D  1 299 ? -20.209 -29.815 119.916 1.00 32.18  ? 299 GLU D O   1 
ATOM   10031 C  CB  . GLU D  1 299 ? -19.865 -29.674 123.174 1.00 34.86  ? 299 GLU D CB  1 
ATOM   10032 C  CG  . GLU D  1 299 ? -18.979 -28.509 122.642 1.00 39.17  ? 299 GLU D CG  1 
ATOM   10033 C  CD  . GLU D  1 299 ? -19.763 -27.145 122.524 1.00 41.20  ? 299 GLU D CD  1 
ATOM   10034 O  OE1 . GLU D  1 299 ? -20.937 -27.078 122.978 1.00 44.33  ? 299 GLU D OE1 1 
ATOM   10035 O  OE2 . GLU D  1 299 ? -19.188 -26.168 121.982 1.00 43.52  ? 299 GLU D OE2 1 
ATOM   10036 N  N   . VAL D  1 300 ? -19.977 -31.880 120.827 1.00 27.65  ? 300 VAL D N   1 
ATOM   10037 C  CA  . VAL D  1 300 ? -19.362 -32.470 119.595 1.00 26.62  ? 300 VAL D CA  1 
ATOM   10038 C  C   . VAL D  1 300 ? -20.370 -32.581 118.464 1.00 24.98  ? 300 VAL D C   1 
ATOM   10039 O  O   . VAL D  1 300 ? -20.043 -32.342 117.307 1.00 25.79  ? 300 VAL D O   1 
ATOM   10040 C  CB  . VAL D  1 300 ? -18.735 -33.847 119.878 1.00 24.87  ? 300 VAL D CB  1 
ATOM   10041 C  CG1 . VAL D  1 300 ? -18.313 -34.518 118.580 1.00 23.68  ? 300 VAL D CG1 1 
ATOM   10042 C  CG2 . VAL D  1 300 ? -17.564 -33.697 120.800 1.00 25.64  ? 300 VAL D CG2 1 
ATOM   10043 N  N   . ILE D  1 301 ? -21.578 -32.939 118.798 1.00 27.18  ? 301 ILE D N   1 
ATOM   10044 C  CA  . ILE D  1 301 ? -22.665 -33.012 117.797 1.00 29.19  ? 301 ILE D CA  1 
ATOM   10045 C  C   . ILE D  1 301 ? -22.887 -31.656 117.163 1.00 29.54  ? 301 ILE D C   1 
ATOM   10046 O  O   . ILE D  1 301 ? -23.079 -31.553 115.964 1.00 33.07  ? 301 ILE D O   1 
ATOM   10047 C  CB  . ILE D  1 301 ? -23.972 -33.492 118.425 1.00 29.10  ? 301 ILE D CB  1 
ATOM   10048 C  CG1 . ILE D  1 301 ? -23.766 -34.860 119.125 1.00 33.77  ? 301 ILE D CG1 1 
ATOM   10049 C  CG2 . ILE D  1 301 ? -25.081 -33.562 117.374 1.00 29.45  ? 301 ILE D CG2 1 
ATOM   10050 C  CD1 . ILE D  1 301 ? -23.161 -35.939 118.221 1.00 38.36  ? 301 ILE D CD1 1 
ATOM   10051 N  N   . ALA D  1 302 ? -22.854 -30.600 117.999 1.00 28.67  ? 302 ALA D N   1 
ATOM   10052 C  CA  . ALA D  1 302 ? -23.026 -29.219 117.526 1.00 28.36  ? 302 ALA D CA  1 
ATOM   10053 C  C   . ALA D  1 302 ? -21.896 -28.803 116.592 1.00 29.77  ? 302 ALA D C   1 
ATOM   10054 O  O   . ALA D  1 302 ? -22.130 -28.137 115.571 1.00 31.66  ? 302 ALA D O   1 
ATOM   10055 C  CB  . ALA D  1 302 ? -23.123 -28.251 118.718 1.00 24.68  ? 302 ALA D CB  1 
ATOM   10056 N  N   . THR D  1 303 ? -20.655 -29.190 116.944 1.00 25.73  ? 303 THR D N   1 
ATOM   10057 C  CA  . THR D  1 303 ? -19.497 -28.882 116.118 1.00 28.23  ? 303 THR D CA  1 
ATOM   10058 C  C   . THR D  1 303 ? -19.664 -29.461 114.723 1.00 29.64  ? 303 THR D C   1 
ATOM   10059 O  O   . THR D  1 303 ? -19.551 -28.755 113.726 1.00 29.86  ? 303 THR D O   1 
ATOM   10060 C  CB  . THR D  1 303 ? -18.203 -29.457 116.731 1.00 27.47  ? 303 THR D CB  1 
ATOM   10061 O  OG1 . THR D  1 303 ? -17.955 -28.840 117.961 1.00 29.39  ? 303 THR D OG1 1 
ATOM   10062 C  CG2 . THR D  1 303 ? -17.001 -29.218 115.792 1.00 25.38  ? 303 THR D CG2 1 
ATOM   10063 N  N   . ILE D  1 304 ? -19.933 -30.739 114.668 1.00 28.70  ? 304 ILE D N   1 
ATOM   10064 C  CA  . ILE D  1 304 ? -20.022 -31.445 113.428 1.00 26.42  ? 304 ILE D CA  1 
ATOM   10065 C  C   . ILE D  1 304 ? -21.145 -30.917 112.515 1.00 23.79  ? 304 ILE D C   1 
ATOM   10066 O  O   . ILE D  1 304 ? -20.932 -30.698 111.309 1.00 24.03  ? 304 ILE D O   1 
ATOM   10067 C  CB  . ILE D  1 304 ? -20.232 -32.981 113.669 1.00 22.73  ? 304 ILE D CB  1 
ATOM   10068 C  CG1 . ILE D  1 304 ? -19.000 -33.584 114.327 1.00 22.89  ? 304 ILE D CG1 1 
ATOM   10069 C  CG2 . ILE D  1 304 ? -20.546 -33.685 112.369 1.00 21.86  ? 304 ILE D CG2 1 
ATOM   10070 C  CD1 . ILE D  1 304 ? -19.172 -35.039 114.752 1.00 21.92  ? 304 ILE D CD1 1 
ATOM   10071 N  N   . PHE D  1 305 ? -22.331 -30.713 113.090 1.00 24.55  ? 305 PHE D N   1 
ATOM   10072 C  CA  . PHE D  1 305 ? -23.543 -30.407 112.283 1.00 27.09  ? 305 PHE D CA  1 
ATOM   10073 C  C   . PHE D  1 305 ? -23.896 -28.879 112.184 1.00 30.75  ? 305 PHE D C   1 
ATOM   10074 O  O   . PHE D  1 305 ? -24.715 -28.477 111.346 1.00 29.20  ? 305 PHE D O   1 
ATOM   10075 C  CB  . PHE D  1 305 ? -24.733 -31.196 112.798 1.00 28.58  ? 305 PHE D CB  1 
ATOM   10076 C  CG  . PHE D  1 305 ? -24.603 -32.704 112.596 1.00 29.76  ? 305 PHE D CG  1 
ATOM   10077 C  CD1 . PHE D  1 305 ? -24.278 -33.549 113.674 1.00 26.05  ? 305 PHE D CD1 1 
ATOM   10078 C  CD2 . PHE D  1 305 ? -24.797 -33.282 111.311 1.00 26.90  ? 305 PHE D CD2 1 
ATOM   10079 C  CE1 . PHE D  1 305 ? -24.157 -34.926 113.488 1.00 27.01  ? 305 PHE D CE1 1 
ATOM   10080 C  CE2 . PHE D  1 305 ? -24.674 -34.670 111.122 1.00 25.19  ? 305 PHE D CE2 1 
ATOM   10081 C  CZ  . PHE D  1 305 ? -24.355 -35.491 112.199 1.00 25.20  ? 305 PHE D CZ  1 
ATOM   10082 N  N   . LYS D  1 306 ? -23.284 -28.068 113.025 1.00 30.69  ? 306 LYS D N   1 
ATOM   10083 C  CA  . LYS D  1 306 ? -23.535 -26.610 112.993 1.00 31.23  ? 306 LYS D CA  1 
ATOM   10084 C  C   . LYS D  1 306 ? -22.253 -25.801 112.772 1.00 32.56  ? 306 LYS D C   1 
ATOM   10085 O  O   . LYS D  1 306 ? -22.156 -25.026 111.825 1.00 33.20  ? 306 LYS D O   1 
ATOM   10086 C  CB  . LYS D  1 306 ? -24.242 -26.153 114.265 1.00 29.87  ? 306 LYS D CB  1 
ATOM   10087 C  CG  . LYS D  1 306 ? -25.645 -26.716 114.422 1.00 36.25  ? 306 LYS D CG  1 
ATOM   10088 C  CD  . LYS D  1 306 ? -26.284 -26.275 115.735 1.00 39.80  ? 306 LYS D CD  1 
ATOM   10089 C  CE  . LYS D  1 306 ? -27.646 -26.942 115.933 1.00 46.09  ? 306 LYS D CE  1 
ATOM   10090 N  NZ  . LYS D  1 306 ? -28.360 -26.420 117.128 1.00 53.62  ? 306 LYS D NZ  1 
ATOM   10091 N  N   . GLU D  1 307 ? -21.287 -25.990 113.641 1.00 32.29  ? 307 GLU D N   1 
ATOM   10092 C  CA  . GLU D  1 307 ? -20.068 -25.208 113.595 1.00 33.46  ? 307 GLU D CA  1 
ATOM   10093 C  C   . GLU D  1 307 ? -19.261 -25.493 112.336 1.00 32.46  ? 307 GLU D C   1 
ATOM   10094 O  O   . GLU D  1 307 ? -18.845 -24.568 111.631 1.00 32.94  ? 307 GLU D O   1 
ATOM   10095 C  CB  . GLU D  1 307 ? -19.214 -25.464 114.842 1.00 36.95  ? 307 GLU D CB  1 
ATOM   10096 C  CG  . GLU D  1 307 ? -18.340 -24.329 115.202 1.00 49.68  ? 307 GLU D CG  1 
ATOM   10097 C  CD  . GLU D  1 307 ? -19.140 -23.039 115.483 1.00 55.38  ? 307 GLU D CD  1 
ATOM   10098 O  OE1 . GLU D  1 307 ? -20.341 -23.144 115.901 1.00 58.29  ? 307 GLU D OE1 1 
ATOM   10099 O  OE2 . GLU D  1 307 ? -18.581 -21.936 115.291 1.00 65.27  ? 307 GLU D OE2 1 
ATOM   10100 N  N   . ASN D  1 308 ? -19.038 -26.770 112.052 1.00 31.81  ? 308 ASN D N   1 
ATOM   10101 C  CA  . ASN D  1 308 ? -18.252 -27.155 110.886 1.00 30.25  ? 308 ASN D CA  1 
ATOM   10102 C  C   . ASN D  1 308 ? -18.839 -26.604 109.529 1.00 27.89  ? 308 ASN D C   1 
ATOM   10103 O  O   . ASN D  1 308 ? -18.160 -25.966 108.803 1.00 27.98  ? 308 ASN D O   1 
ATOM   10104 C  CB  . ASN D  1 308 ? -18.033 -28.690 110.839 1.00 29.21  ? 308 ASN D CB  1 
ATOM   10105 C  CG  . ASN D  1 308 ? -16.945 -29.169 111.850 1.00 31.64  ? 308 ASN D CG  1 
ATOM   10106 O  OD1 . ASN D  1 308 ? -16.384 -28.371 112.593 1.00 33.26  ? 308 ASN D OD1 1 
ATOM   10107 N  ND2 . ASN D  1 308 ? -16.661 -30.491 111.856 1.00 28.90  ? 308 ASN D ND2 1 
ATOM   10108 N  N   . PRO D  1 309 ? -20.128 -26.884 109.253 1.00 27.92  ? 309 PRO D N   1 
ATOM   10109 C  CA  . PRO D  1 309 ? -20.764 -26.320 108.032 1.00 27.52  ? 309 PRO D CA  1 
ATOM   10110 C  C   . PRO D  1 309 ? -20.699 -24.777 108.022 1.00 32.18  ? 309 PRO D C   1 
ATOM   10111 O  O   . PRO D  1 309 ? -20.514 -24.170 106.967 1.00 30.80  ? 309 PRO D O   1 
ATOM   10112 C  CB  . PRO D  1 309 ? -22.207 -26.786 108.144 1.00 27.65  ? 309 PRO D CB  1 
ATOM   10113 C  CG  . PRO D  1 309 ? -22.140 -28.025 109.003 1.00 28.77  ? 309 PRO D CG  1 
ATOM   10114 C  CD  . PRO D  1 309 ? -21.043 -27.756 110.000 1.00 27.62  ? 309 PRO D CD  1 
ATOM   10115 N  N   . LYS D  1 310 ? -20.845 -24.164 109.202 1.00 30.83  ? 310 LYS D N   1 
ATOM   10116 C  CA  . LYS D  1 310 ? -20.791 -22.725 109.315 1.00 35.05  ? 310 LYS D CA  1 
ATOM   10117 C  C   . LYS D  1 310 ? -19.416 -22.217 108.894 1.00 33.33  ? 310 LYS D C   1 
ATOM   10118 O  O   . LYS D  1 310 ? -19.302 -21.287 108.095 1.00 30.33  ? 310 LYS D O   1 
ATOM   10119 C  CB  . LYS D  1 310 ? -21.099 -22.283 110.746 1.00 36.72  ? 310 LYS D CB  1 
ATOM   10120 C  CG  . LYS D  1 310 ? -21.515 -20.833 110.861 1.00 45.57  ? 310 LYS D CG  1 
ATOM   10121 C  CD  . LYS D  1 310 ? -21.435 -20.327 112.304 1.00 48.57  ? 310 LYS D CD  1 
ATOM   10122 C  CE  . LYS D  1 310 ? -20.004 -20.023 112.699 1.00 57.53  ? 310 LYS D CE  1 
ATOM   10123 N  NZ  . LYS D  1 310 ? -19.921 -19.354 114.028 1.00 66.93  ? 310 LYS D NZ  1 
ATOM   10124 N  N   . LYS D  1 311 ? -18.377 -22.841 109.433 1.00 33.28  ? 311 LYS D N   1 
ATOM   10125 C  CA  . LYS D  1 311 ? -17.024 -22.490 109.103 1.00 33.72  ? 311 LYS D CA  1 
ATOM   10126 C  C   . LYS D  1 311 ? -16.753 -22.737 107.616 1.00 35.99  ? 311 LYS D C   1 
ATOM   10127 O  O   . LYS D  1 311 ? -16.118 -21.934 106.952 1.00 40.28  ? 311 LYS D O   1 
ATOM   10128 C  CB  . LYS D  1 311 ? -16.052 -23.296 109.958 1.00 39.35  ? 311 LYS D CB  1 
ATOM   10129 C  CG  . LYS D  1 311 ? -14.601 -23.038 109.663 1.00 49.38  ? 311 LYS D CG  1 
ATOM   10130 C  CD  . LYS D  1 311 ? -13.706 -23.624 110.758 1.00 57.92  ? 311 LYS D CD  1 
ATOM   10131 C  CE  . LYS D  1 311 ? -12.219 -23.452 110.422 1.00 68.75  ? 311 LYS D CE  1 
ATOM   10132 N  NZ  . LYS D  1 311 ? -11.812 -24.287 109.244 1.00 70.85  ? 311 LYS D NZ  1 
ATOM   10133 N  N   . PHE D  1 312 ? -17.256 -23.858 107.112 1.00 34.18  ? 312 PHE D N   1 
ATOM   10134 C  CA  . PHE D  1 312 ? -17.089 -24.232 105.717 1.00 31.40  ? 312 PHE D CA  1 
ATOM   10135 C  C   . PHE D  1 312 ? -17.603 -23.124 104.753 1.00 31.96  ? 312 PHE D C   1 
ATOM   10136 O  O   . PHE D  1 312 ? -16.948 -22.798 103.748 1.00 27.79  ? 312 PHE D O   1 
ATOM   10137 C  CB  . PHE D  1 312 ? -17.827 -25.561 105.445 1.00 28.86  ? 312 PHE D CB  1 
ATOM   10138 C  CG  . PHE D  1 312 ? -17.485 -26.200 104.115 1.00 28.52  ? 312 PHE D CG  1 
ATOM   10139 C  CD1 . PHE D  1 312 ? -18.479 -26.450 103.170 1.00 29.39  ? 312 PHE D CD1 1 
ATOM   10140 C  CD2 . PHE D  1 312 ? -16.156 -26.568 103.810 1.00 27.51  ? 312 PHE D CD2 1 
ATOM   10141 C  CE1 . PHE D  1 312 ? -18.165 -27.050 101.948 1.00 29.64  ? 312 PHE D CE1 1 
ATOM   10142 C  CE2 . PHE D  1 312 ? -15.848 -27.153 102.612 1.00 25.48  ? 312 PHE D CE2 1 
ATOM   10143 C  CZ  . PHE D  1 312 ? -16.858 -27.400 101.668 1.00 26.29  ? 312 PHE D CZ  1 
ATOM   10144 N  N   . PHE D  1 313 ? -18.773 -22.558 105.074 1.00 32.73  ? 313 PHE D N   1 
ATOM   10145 C  CA  . PHE D  1 313 ? -19.405 -21.560 104.216 1.00 35.58  ? 313 PHE D CA  1 
ATOM   10146 C  C   . PHE D  1 313 ? -19.027 -20.101 104.580 1.00 37.74  ? 313 PHE D C   1 
ATOM   10147 O  O   . PHE D  1 313 ? -19.631 -19.163 104.087 1.00 42.95  ? 313 PHE D O   1 
ATOM   10148 C  CB  . PHE D  1 313 ? -20.934 -21.730 104.222 1.00 32.34  ? 313 PHE D CB  1 
ATOM   10149 C  CG  . PHE D  1 313 ? -21.419 -22.858 103.366 1.00 33.47  ? 313 PHE D CG  1 
ATOM   10150 C  CD1 . PHE D  1 313 ? -21.786 -24.073 103.932 1.00 31.23  ? 313 PHE D CD1 1 
ATOM   10151 C  CD2 . PHE D  1 313 ? -21.510 -22.708 101.954 1.00 30.62  ? 313 PHE D CD2 1 
ATOM   10152 C  CE1 . PHE D  1 313 ? -22.237 -25.124 103.134 1.00 30.50  ? 313 PHE D CE1 1 
ATOM   10153 C  CE2 . PHE D  1 313 ? -21.955 -23.740 101.168 1.00 32.45  ? 313 PHE D CE2 1 
ATOM   10154 C  CZ  . PHE D  1 313 ? -22.323 -24.964 101.757 1.00 31.59  ? 313 PHE D CZ  1 
ATOM   10155 N  N   . SER D  1 314 ? -18.036 -19.941 105.428 1.00 43.21  ? 314 SER D N   1 
ATOM   10156 C  CA  . SER D  1 314 ? -17.578 -18.596 105.824 1.00 49.99  ? 314 SER D CA  1 
ATOM   10157 C  C   . SER D  1 314 ? -16.338 -18.203 105.051 1.00 58.69  ? 314 SER D C   1 
ATOM   10158 O  O   . SER D  1 314 ? -15.389 -18.987 104.929 1.00 62.74  ? 314 SER D O   1 
ATOM   10159 C  CB  . SER D  1 314 ? -17.307 -18.544 107.298 1.00 45.33  ? 314 SER D CB  1 
ATOM   10160 O  OG  . SER D  1 314 ? -18.470 -18.878 108.035 1.00 48.85  ? 314 SER D OG  1 
ATOM   10161 O  OXT . SER D  1 314 ? -16.249 -17.099 104.524 1.00 72.98  ? 314 SER D OXT 1 
HETATM 10162 FE FE  . FE2 E  2 .   ? -20.364 -15.552 24.029  1.00 18.86  ? 401 FE2 A FE  1 
HETATM 10163 CO CO  . CO  F  3 .   ? -18.402 -12.774 23.549  1.00 21.73  ? 402 CO  A CO  1 
HETATM 10164 C  C1  . EDO G  4 .   ? -10.584 -10.326 25.194  1.00 47.63  ? 403 EDO A C1  1 
HETATM 10165 O  O1  . EDO G  4 .   ? -9.334  -10.982 24.902  1.00 53.45  ? 403 EDO A O1  1 
HETATM 10166 C  C2  . EDO G  4 .   ? -10.479 -9.609  26.541  1.00 43.88  ? 403 EDO A C2  1 
HETATM 10167 O  O2  . EDO G  4 .   ? -11.794 -9.232  26.985  1.00 38.65  ? 403 EDO A O2  1 
HETATM 10168 C  C1  . EDO H  4 .   ? -16.414 -9.428  10.740  1.00 52.25  ? 404 EDO A C1  1 
HETATM 10169 O  O1  . EDO H  4 .   ? -15.735 -8.186  10.725  1.00 61.02  ? 404 EDO A O1  1 
HETATM 10170 C  C2  . EDO H  4 .   ? -15.518 -10.481 11.373  1.00 61.15  ? 404 EDO A C2  1 
HETATM 10171 O  O2  . EDO H  4 .   ? -15.738 -10.503 12.793  1.00 57.23  ? 404 EDO A O2  1 
HETATM 10172 C  C1  . GOL I  5 .   ? -36.192 0.799   27.564  1.00 32.75  ? 405 GOL A C1  1 
HETATM 10173 O  O1  . GOL I  5 .   ? -35.624 -0.486  27.421  1.00 35.90  ? 405 GOL A O1  1 
HETATM 10174 C  C2  . GOL I  5 .   ? -35.326 1.806   26.876  1.00 36.10  ? 405 GOL A C2  1 
HETATM 10175 O  O2  . GOL I  5 .   ? -33.927 1.693   27.363  1.00 29.16  ? 405 GOL A O2  1 
HETATM 10176 C  C3  . GOL I  5 .   ? -35.854 3.190   27.150  1.00 35.09  ? 405 GOL A C3  1 
HETATM 10177 O  O3  . GOL I  5 .   ? -34.758 4.098   27.217  1.00 41.12  ? 405 GOL A O3  1 
HETATM 10178 C  C1  . GOL J  5 .   ? -42.151 -14.190 10.218  1.00 52.07  ? 406 GOL A C1  1 
HETATM 10179 O  O1  . GOL J  5 .   ? -41.472 -14.191 8.924   1.00 47.65  ? 406 GOL A O1  1 
HETATM 10180 C  C2  . GOL J  5 .   ? -42.853 -15.549 10.445  1.00 51.01  ? 406 GOL A C2  1 
HETATM 10181 O  O2  . GOL J  5 .   ? -44.159 -15.332 10.972  1.00 60.96  ? 406 GOL A O2  1 
HETATM 10182 C  C3  . GOL J  5 .   ? -42.056 -16.374 11.433  1.00 49.09  ? 406 GOL A C3  1 
HETATM 10183 O  O3  . GOL J  5 .   ? -40.936 -15.621 11.894  1.00 38.70  ? 406 GOL A O3  1 
HETATM 10184 C  C1  . EDO K  4 .   ? -27.281 -35.263 40.409  1.00 53.20  ? 401 EDO B C1  1 
HETATM 10185 O  O1  . EDO K  4 .   ? -28.155 -34.806 41.489  1.00 46.25  ? 401 EDO B O1  1 
HETATM 10186 C  C2  . EDO K  4 .   ? -25.813 -35.313 40.905  1.00 48.61  ? 401 EDO B C2  1 
HETATM 10187 O  O2  . EDO K  4 .   ? -24.994 -36.009 39.938  1.00 49.39  ? 401 EDO B O2  1 
HETATM 10188 FE FE  . FE2 L  2 .   ? -21.337 -38.496 62.541  1.00 21.58  ? 402 FE2 B FE  1 
HETATM 10189 CO CO  . CO  M  3 .   ? -18.861 -40.602 63.574  1.00 24.97  ? 403 CO  B CO  1 
HETATM 10190 C  C1  . GOL N  5 .   ? -31.278 -58.163 58.978  1.00 44.68  ? 404 GOL B C1  1 
HETATM 10191 O  O1  . GOL N  5 .   ? -32.325 -57.394 59.534  1.00 47.86  ? 404 GOL B O1  1 
HETATM 10192 C  C2  . GOL N  5 .   ? -30.703 -59.058 60.031  1.00 41.53  ? 404 GOL B C2  1 
HETATM 10193 O  O2  . GOL N  5 .   ? -29.237 -58.974 59.997  1.00 35.30  ? 404 GOL B O2  1 
HETATM 10194 C  C3  . GOL N  5 .   ? -31.131 -60.468 59.761  1.00 42.16  ? 404 GOL B C3  1 
HETATM 10195 O  O3  . GOL N  5 .   ? -30.069 -61.353 60.110  1.00 42.93  ? 404 GOL B O3  1 
HETATM 10196 FE FE  . FE2 O  2 .   ? -18.051 -12.564 -9.538  1.00 22.67  ? 401 FE2 C FE  1 
HETATM 10197 CO CO  . CO  P  3 .   ? -15.451 -10.650 -8.245  1.00 30.67  ? 402 CO  C CO  1 
HETATM 10198 C  C1  . GOL Q  5 .   ? -0.807  -27.268 -13.256 1.00 52.90  ? 403 GOL C C1  1 
HETATM 10199 O  O1  . GOL Q  5 .   ? -2.251  -27.317 -13.174 1.00 55.77  ? 403 GOL C O1  1 
HETATM 10200 C  C2  . GOL Q  5 .   ? -0.244  -26.609 -11.998 1.00 52.24  ? 403 GOL C C2  1 
HETATM 10201 O  O2  . GOL Q  5 .   ? 0.207   -25.301 -12.311 1.00 52.40  ? 403 GOL C O2  1 
HETATM 10202 C  C3  . GOL Q  5 .   ? 0.933   -27.439 -11.451 1.00 52.58  ? 403 GOL C C3  1 
HETATM 10203 O  O3  . GOL Q  5 .   ? 1.936   -27.574 -12.458 1.00 45.82  ? 403 GOL C O3  1 
HETATM 10204 FE FE  . FE2 R  2 .   ? -23.253 -37.524 96.288  1.00 23.55  ? 401 FE2 D FE  1 
HETATM 10205 CO CO  . CO  S  3 .   ? -20.120 -38.843 95.514  1.00 24.58  ? 402 CO  D CO  1 
HETATM 10206 C  C1  . EDO T  4 .   ? -16.209 -46.291 96.837  1.00 43.56  ? 403 EDO D C1  1 
HETATM 10207 O  O1  . EDO T  4 .   ? -16.259 -47.648 96.381  1.00 61.12  ? 403 EDO D O1  1 
HETATM 10208 C  C2  . EDO T  4 .   ? -15.096 -46.151 97.908  1.00 39.01  ? 403 EDO D C2  1 
HETATM 10209 O  O2  . EDO T  4 .   ? -14.990 -44.757 98.314  1.00 31.71  ? 403 EDO D O2  1 
HETATM 10210 C  C1  . EDO U  4 .   ? -16.818 -40.515 82.603  1.00 52.53  ? 404 EDO D C1  1 
HETATM 10211 O  O1  . EDO U  4 .   ? -16.012 -39.348 82.448  1.00 39.44  ? 404 EDO D O1  1 
HETATM 10212 C  C2  . EDO U  4 .   ? -17.902 -40.251 83.654  1.00 54.47  ? 404 EDO D C2  1 
HETATM 10213 O  O2  . EDO U  4 .   ? -17.822 -41.249 84.680  1.00 61.83  ? 404 EDO D O2  1 
HETATM 10214 C  C1  . GOL V  5 .   ? -10.872 -18.492 99.713  1.00 47.87  ? 405 GOL D C1  1 
HETATM 10215 O  O1  . GOL V  5 .   ? -12.232 -18.950 99.560  1.00 48.47  ? 405 GOL D O1  1 
HETATM 10216 C  C2  . GOL V  5 .   ? -9.985  -19.225 98.734  1.00 48.89  ? 405 GOL D C2  1 
HETATM 10217 O  O2  . GOL V  5 .   ? -9.634  -20.513 99.276  1.00 47.13  ? 405 GOL D O2  1 
HETATM 10218 C  C3  . GOL V  5 .   ? -8.720  -18.413 98.487  1.00 49.36  ? 405 GOL D C3  1 
HETATM 10219 O  O3  . GOL V  5 .   ? -7.680  -18.897 99.323  1.00 45.03  ? 405 GOL D O3  1 
HETATM 10220 C  C1  . GOL W  5 .   ? -28.524 -16.678 82.788  1.00 54.95  ? 406 GOL D C1  1 
HETATM 10221 O  O1  . GOL W  5 .   ? -27.546 -16.397 81.767  1.00 59.55  ? 406 GOL D O1  1 
HETATM 10222 C  C2  . GOL W  5 .   ? -28.682 -15.459 83.703  1.00 55.41  ? 406 GOL D C2  1 
HETATM 10223 O  O2  . GOL W  5 .   ? -29.819 -14.701 83.289  1.00 56.14  ? 406 GOL D O2  1 
HETATM 10224 C  C3  . GOL W  5 .   ? -28.900 -15.931 85.105  1.00 57.24  ? 406 GOL D C3  1 
HETATM 10225 O  O3  . GOL W  5 .   ? -29.706 -17.122 85.078  1.00 53.15  ? 406 GOL D O3  1 
HETATM 10226 O  O   . HOH X  6 .   ? -26.322 -21.634 20.629  1.00 20.38  ? 501 HOH A O   1 
HETATM 10227 O  O   . HOH X  6 .   ? -37.180 -22.438 26.934  1.00 22.98  ? 502 HOH A O   1 
HETATM 10228 O  O   . HOH X  6 .   ? -15.273 -12.186 31.360  1.00 23.30  ? 503 HOH A O   1 
HETATM 10229 O  O   . HOH X  6 .   ? -29.742 -16.502 20.519  1.00 25.68  ? 504 HOH A O   1 
HETATM 10230 O  O   . HOH X  6 .   ? -21.974 -10.889 28.066  1.00 26.31  ? 505 HOH A O   1 
HETATM 10231 O  O   . HOH X  6 .   ? -21.341 -6.614  16.524  1.00 25.83  ? 506 HOH A O   1 
HETATM 10232 O  O   . HOH X  6 .   ? -25.741 -15.460 35.262  1.00 19.24  ? 507 HOH A O   1 
HETATM 10233 O  O   . HOH X  6 .   ? -25.607 -13.196 36.708  1.00 23.12  ? 508 HOH A O   1 
HETATM 10234 O  O   . HOH X  6 .   ? -14.167 -3.270  27.323  1.00 25.86  ? 509 HOH A O   1 
HETATM 10235 O  O   . HOH X  6 .   ? -11.844 -10.665 36.694  1.00 26.35  ? 510 HOH A O   1 
HETATM 10236 O  O   . HOH X  6 .   ? -42.128 -17.454 24.497  1.00 24.26  ? 511 HOH A O   1 
HETATM 10237 O  O   . HOH X  6 .   ? -23.122 -28.202 20.942  1.00 34.38  ? 512 HOH A O   1 
HETATM 10238 O  O   . HOH X  6 .   ? -14.071 -4.559  17.029  1.00 23.86  ? 513 HOH A O   1 
HETATM 10239 O  O   . HOH X  6 .   ? -14.180 -11.797 37.462  1.00 28.13  ? 514 HOH A O   1 
HETATM 10240 O  O   . HOH X  6 .   ? -28.210 -21.882 18.224  1.00 33.65  ? 515 HOH A O   1 
HETATM 10241 O  O   . HOH X  6 .   ? -21.714 -6.111  46.900  1.00 26.82  ? 516 HOH A O   1 
HETATM 10242 O  O   . HOH X  6 .   ? -40.953 -17.363 22.133  1.00 28.56  ? 517 HOH A O   1 
HETATM 10243 O  O   . HOH X  6 .   ? -29.149 -12.580 14.726  1.00 28.62  ? 518 HOH A O   1 
HETATM 10244 O  O   . HOH X  6 .   ? -21.621 -3.854  17.139  1.00 30.70  ? 519 HOH A O   1 
HETATM 10245 O  O   . HOH X  6 .   ? -41.208 -21.664 31.881  1.00 30.79  ? 520 HOH A O   1 
HETATM 10246 O  O   . HOH X  6 .   ? -14.107 1.794   10.296  1.00 35.53  ? 521 HOH A O   1 
HETATM 10247 O  O   . HOH X  6 .   ? -35.248 -14.341 11.531  1.00 20.73  ? 522 HOH A O   1 
HETATM 10248 O  O   . HOH X  6 .   ? -36.275 -16.342 23.615  1.00 18.18  ? 523 HOH A O   1 
HETATM 10249 O  O   . HOH X  6 .   ? -11.222 -18.776 34.160  1.00 39.90  ? 524 HOH A O   1 
HETATM 10250 O  O   . HOH X  6 .   ? -42.167 -9.489  33.519  1.00 43.24  ? 525 HOH A O   1 
HETATM 10251 O  O   . HOH X  6 .   ? -14.925 -13.484 35.473  1.00 30.47  ? 526 HOH A O   1 
HETATM 10252 O  O   . HOH X  6 .   ? -36.345 -24.559 33.688  1.00 28.12  ? 527 HOH A O   1 
HETATM 10253 O  O   . HOH X  6 .   ? -19.756 4.600   29.045  1.00 30.17  ? 528 HOH A O   1 
HETATM 10254 O  O   . HOH X  6 .   ? -37.490 -17.613 21.453  1.00 40.31  ? 529 HOH A O   1 
HETATM 10255 O  O   . HOH X  6 .   ? -12.979 -10.389 24.053  1.00 33.44  ? 530 HOH A O   1 
HETATM 10256 O  O   . HOH X  6 .   ? -18.760 -30.849 2.665   1.00 26.02  ? 531 HOH A O   1 
HETATM 10257 O  O   . HOH X  6 .   ? -10.187 -1.357  28.775  1.00 29.70  ? 532 HOH A O   1 
HETATM 10258 O  O   . HOH X  6 .   ? -42.202 -10.175 36.949  1.00 32.46  ? 533 HOH A O   1 
HETATM 10259 O  O   . HOH X  6 .   ? -16.424 -0.834  9.285   1.00 34.34  ? 534 HOH A O   1 
HETATM 10260 O  O   . HOH X  6 .   ? -34.323 -20.481 40.769  1.00 26.73  ? 535 HOH A O   1 
HETATM 10261 O  O   . HOH X  6 .   ? -13.078 -13.236 22.044  1.00 41.99  ? 536 HOH A O   1 
HETATM 10262 O  O   . HOH X  6 .   ? -27.540 -24.952 11.035  1.00 41.65  ? 537 HOH A O   1 
HETATM 10263 O  O   . HOH X  6 .   ? -19.462 -17.578 8.364   1.00 33.00  ? 538 HOH A O   1 
HETATM 10264 O  O   . HOH X  6 .   ? -38.723 -15.242 8.427   1.00 39.09  ? 539 HOH A O   1 
HETATM 10265 O  O   . HOH X  6 .   ? -38.831 -5.333  11.347  1.00 26.82  ? 540 HOH A O   1 
HETATM 10266 O  O   . HOH X  6 .   ? -27.748 4.722   8.423   1.00 36.94  ? 541 HOH A O   1 
HETATM 10267 O  O   . HOH X  6 .   ? -11.627 -30.957 5.119   1.00 40.02  ? 542 HOH A O   1 
HETATM 10268 O  O   . HOH X  6 .   ? -36.828 -28.124 16.307  1.00 37.46  ? 543 HOH A O   1 
HETATM 10269 O  O   . HOH X  6 .   ? -10.309 -10.129 46.392  1.00 40.38  ? 544 HOH A O   1 
HETATM 10270 O  O   . HOH X  6 .   ? -9.021  -14.543 49.177  1.00 60.86  ? 545 HOH A O   1 
HETATM 10271 O  O   . HOH X  6 .   ? -36.929 -14.269 38.738  1.00 47.50  ? 546 HOH A O   1 
HETATM 10272 O  O   . HOH X  6 .   ? -28.982 -3.005  38.768  1.00 48.48  ? 547 HOH A O   1 
HETATM 10273 O  O   . HOH X  6 .   ? -21.905 -24.820 44.769  1.00 40.09  ? 548 HOH A O   1 
HETATM 10274 O  O   . HOH X  6 .   ? -44.545 -16.248 34.183  1.00 35.84  ? 549 HOH A O   1 
HETATM 10275 O  O   . HOH X  6 .   ? -37.066 -9.701  26.885  1.00 33.16  ? 550 HOH A O   1 
HETATM 10276 O  O   . HOH X  6 .   ? -12.830 -26.380 43.494  1.00 47.66  ? 551 HOH A O   1 
HETATM 10277 O  O   . HOH X  6 .   ? -22.366 -11.196 51.999  1.00 51.61  ? 552 HOH A O   1 
HETATM 10278 O  O   . HOH X  6 .   ? -43.101 -21.594 15.328  1.00 42.18  ? 553 HOH A O   1 
HETATM 10279 O  O   . HOH X  6 .   ? -25.191 -30.998 10.570  1.00 41.74  ? 554 HOH A O   1 
HETATM 10280 O  O   . HOH X  6 .   ? -30.611 -31.399 41.161  1.00 46.73  ? 555 HOH A O   1 
HETATM 10281 O  O   . HOH X  6 .   ? -31.117 -32.120 34.697  1.00 39.41  ? 556 HOH A O   1 
HETATM 10282 O  O   . HOH X  6 .   ? -20.617 0.303   46.169  1.00 38.40  ? 557 HOH A O   1 
HETATM 10283 O  O   . HOH X  6 .   ? -36.260 -2.721  6.530   1.00 33.05  ? 558 HOH A O   1 
HETATM 10284 O  O   . HOH X  6 .   ? -43.194 -21.019 29.811  1.00 34.19  ? 559 HOH A O   1 
HETATM 10285 O  O   . HOH X  6 .   ? -14.849 -7.649  8.271   1.00 48.49  ? 560 HOH A O   1 
HETATM 10286 O  O   . HOH X  6 .   ? -39.393 -9.188  25.670  1.00 35.91  ? 561 HOH A O   1 
HETATM 10287 O  O   . HOH X  6 .   ? -33.171 -31.489 32.364  1.00 50.55  ? 562 HOH A O   1 
HETATM 10288 O  O   . HOH X  6 .   ? -37.142 -6.216  38.498  1.00 55.46  ? 563 HOH A O   1 
HETATM 10289 O  O   . HOH X  6 .   ? -12.026 3.545   23.658  1.00 56.94  ? 564 HOH A O   1 
HETATM 10290 O  O   . HOH X  6 .   ? -17.179 -10.892 52.226  1.00 53.46  ? 565 HOH A O   1 
HETATM 10291 O  O   . HOH X  6 .   ? -33.238 -22.996 12.426  1.00 40.64  ? 566 HOH A O   1 
HETATM 10292 O  O   . HOH X  6 .   ? -45.296 -20.016 31.163  1.00 39.38  ? 567 HOH A O   1 
HETATM 10293 O  O   . HOH X  6 .   ? -19.487 -30.155 15.185  1.00 38.58  ? 568 HOH A O   1 
HETATM 10294 O  O   . HOH X  6 .   ? -41.488 -24.638 32.199  1.00 35.26  ? 569 HOH A O   1 
HETATM 10295 O  O   . HOH X  6 .   ? -17.925 -5.093  52.545  1.00 46.66  ? 570 HOH A O   1 
HETATM 10296 O  O   . HOH X  6 .   ? -32.538 -4.786  4.731   1.00 44.95  ? 571 HOH A O   1 
HETATM 10297 O  O   . HOH X  6 .   ? -18.684 -14.908 12.372  1.00 48.55  ? 572 HOH A O   1 
HETATM 10298 O  O   . HOH X  6 .   ? -37.145 -7.450  28.690  1.00 41.71  ? 573 HOH A O   1 
HETATM 10299 O  O   . HOH X  6 .   ? -47.246 -15.390 35.424  1.00 48.96  ? 574 HOH A O   1 
HETATM 10300 O  O   . HOH X  6 .   ? -20.665 4.010   11.869  1.00 28.93  ? 575 HOH A O   1 
HETATM 10301 O  O   . HOH X  6 .   ? -44.973 -18.844 38.638  1.00 43.47  ? 576 HOH A O   1 
HETATM 10302 O  O   . HOH X  6 .   ? -35.341 -24.634 38.777  1.00 51.73  ? 577 HOH A O   1 
HETATM 10303 O  O   . HOH X  6 .   ? -34.484 -4.821  7.227   1.00 32.03  ? 578 HOH A O   1 
HETATM 10304 O  O   . HOH X  6 .   ? -23.870 -33.432 10.962  1.00 50.00  ? 579 HOH A O   1 
HETATM 10305 O  O   . HOH X  6 .   ? -18.534 -14.708 24.052  1.00 22.24  ? 580 HOH A O   1 
HETATM 10306 O  O   . HOH X  6 .   ? -36.605 -14.116 41.251  1.00 44.92  ? 581 HOH A O   1 
HETATM 10307 O  O   . HOH X  6 .   ? -9.863  -19.053 43.447  1.00 41.89  ? 582 HOH A O   1 
HETATM 10308 O  O   . HOH X  6 .   ? -10.223 -23.523 33.627  1.00 38.06  ? 583 HOH A O   1 
HETATM 10309 O  O   . HOH X  6 .   ? -38.643 -15.006 11.108  1.00 36.73  ? 584 HOH A O   1 
HETATM 10310 O  O   . HOH X  6 .   ? -26.141 -23.163 16.787  1.00 50.25  ? 585 HOH A O   1 
HETATM 10311 O  O   . HOH X  6 .   ? -34.191 -14.402 37.799  1.00 49.50  ? 586 HOH A O   1 
HETATM 10312 O  O   . HOH X  6 .   ? -18.925 -12.271 11.969  1.00 34.77  ? 587 HOH A O   1 
HETATM 10313 O  O   . HOH X  6 .   ? -30.393 -33.787 16.192  1.00 43.10  ? 588 HOH A O   1 
HETATM 10314 O  O   . HOH Y  6 .   ? -29.188 -33.832 64.366  1.00 26.86  ? 501 HOH B O   1 
HETATM 10315 O  O   . HOH Y  6 .   ? -31.225 -39.700 64.571  1.00 32.88  ? 502 HOH B O   1 
HETATM 10316 O  O   . HOH Y  6 .   ? -21.170 -43.881 58.939  1.00 23.66  ? 503 HOH B O   1 
HETATM 10317 O  O   . HOH Y  6 .   ? -14.577 -41.045 56.459  1.00 26.80  ? 504 HOH B O   1 
HETATM 10318 O  O   . HOH Y  6 .   ? -21.254 -46.544 71.016  1.00 20.34  ? 505 HOH B O   1 
HETATM 10319 O  O   . HOH Y  6 .   ? -38.756 -36.424 56.786  1.00 27.90  ? 506 HOH B O   1 
HETATM 10320 O  O   . HOH Y  6 .   ? -12.018 -48.779 61.672  1.00 27.79  ? 507 HOH B O   1 
HETATM 10321 O  O   . HOH Y  6 .   ? -11.721 -33.963 53.553  1.00 32.50  ? 508 HOH B O   1 
HETATM 10322 O  O   . HOH Y  6 .   ? -14.053 -40.139 52.105  1.00 30.64  ? 509 HOH B O   1 
HETATM 10323 O  O   . HOH Y  6 .   ? -13.695 -46.749 71.607  1.00 26.01  ? 510 HOH B O   1 
HETATM 10324 O  O   . HOH Y  6 .   ? -24.910 -41.020 50.898  1.00 25.21  ? 511 HOH B O   1 
HETATM 10325 O  O   . HOH Y  6 .   ? -10.303 -41.964 51.811  1.00 32.15  ? 512 HOH B O   1 
HETATM 10326 O  O   . HOH Y  6 .   ? -23.748 -43.213 49.824  1.00 26.10  ? 513 HOH B O   1 
HETATM 10327 O  O   . HOH Y  6 .   ? -20.699 -49.180 70.784  1.00 33.48  ? 514 HOH B O   1 
HETATM 10328 O  O   . HOH Y  6 .   ? -12.244 -29.179 53.591  1.00 34.50  ? 515 HOH B O   1 
HETATM 10329 O  O   . HOH Y  6 .   ? -12.596 -41.825 50.545  1.00 27.72  ? 516 HOH B O   1 
HETATM 10330 O  O   . HOH Y  6 .   ? -16.804 -50.101 41.126  1.00 30.19  ? 517 HOH B O   1 
HETATM 10331 O  O   . HOH Y  6 .   ? -31.062 -34.102 66.586  1.00 41.62  ? 518 HOH B O   1 
HETATM 10332 O  O   . HOH Y  6 .   ? -30.399 -42.621 71.096  1.00 28.55  ? 519 HOH B O   1 
HETATM 10333 O  O   . HOH Y  6 .   ? -29.739 -32.116 68.114  1.00 39.51  ? 520 HOH B O   1 
HETATM 10334 O  O   . HOH Y  6 .   ? -14.939 -58.203 60.159  1.00 28.92  ? 521 HOH B O   1 
HETATM 10335 O  O   . HOH Y  6 .   ? -26.573 -21.217 81.620  1.00 28.91  ? 522 HOH B O   1 
HETATM 10336 O  O   . HOH Y  6 .   ? -36.903 -41.788 61.042  1.00 24.63  ? 523 HOH B O   1 
HETATM 10337 O  O   . HOH Y  6 .   ? -7.374  -49.910 61.009  1.00 32.86  ? 524 HOH B O   1 
HETATM 10338 O  O   . HOH Y  6 .   ? -39.164 -50.490 48.334  1.00 34.38  ? 525 HOH B O   1 
HETATM 10339 O  O   . HOH Y  6 .   ? -42.754 -42.436 59.585  1.00 36.87  ? 526 HOH B O   1 
HETATM 10340 O  O   . HOH Y  6 .   ? -16.166 -49.991 79.350  1.00 28.26  ? 527 HOH B O   1 
HETATM 10341 O  O   . HOH Y  6 .   ? -33.353 -38.867 43.824  1.00 32.44  ? 528 HOH B O   1 
HETATM 10342 O  O   . HOH Y  6 .   ? -23.202 -34.581 77.765  1.00 36.82  ? 529 HOH B O   1 
HETATM 10343 O  O   . HOH Y  6 .   ? -41.560 -38.446 51.632  1.00 37.56  ? 530 HOH B O   1 
HETATM 10344 O  O   . HOH Y  6 .   ? -43.612 -39.651 53.256  1.00 34.97  ? 531 HOH B O   1 
HETATM 10345 O  O   . HOH Y  6 .   ? -41.807 -42.002 61.842  1.00 33.20  ? 532 HOH B O   1 
HETATM 10346 O  O   . HOH Y  6 .   ? -35.548 -48.717 58.360  1.00 29.07  ? 533 HOH B O   1 
HETATM 10347 O  O   . HOH Y  6 .   ? -42.793 -44.898 49.294  1.00 37.44  ? 534 HOH B O   1 
HETATM 10348 O  O   . HOH Y  6 .   ? -38.769 -40.417 62.707  1.00 43.74  ? 535 HOH B O   1 
HETATM 10349 O  O   . HOH Y  6 .   ? -35.884 -47.446 43.220  1.00 44.23  ? 536 HOH B O   1 
HETATM 10350 O  O   . HOH Y  6 .   ? -14.529 -58.868 47.005  1.00 37.72  ? 537 HOH B O   1 
HETATM 10351 O  O   . HOH Y  6 .   ? -33.950 -26.112 48.200  1.00 38.84  ? 538 HOH B O   1 
HETATM 10352 O  O   . HOH Y  6 .   ? -37.014 -34.762 49.974  1.00 32.82  ? 539 HOH B O   1 
HETATM 10353 O  O   . HOH Y  6 .   ? -24.154 -62.573 73.051  1.00 45.77  ? 540 HOH B O   1 
HETATM 10354 O  O   . HOH Y  6 .   ? -32.510 -27.845 41.734  1.00 39.95  ? 541 HOH B O   1 
HETATM 10355 O  O   . HOH Y  6 .   ? -37.005 -42.187 73.251  1.00 27.45  ? 542 HOH B O   1 
HETATM 10356 O  O   . HOH Y  6 .   ? -7.532  -31.863 49.001  1.00 46.96  ? 543 HOH B O   1 
HETATM 10357 O  O   . HOH Y  6 .   ? -12.784 -41.513 64.058  1.00 32.91  ? 544 HOH B O   1 
HETATM 10358 O  O   . HOH Y  6 .   ? -25.424 -55.385 45.292  1.00 46.27  ? 545 HOH B O   1 
HETATM 10359 O  O   . HOH Y  6 .   ? -33.432 -51.080 42.649  1.00 52.87  ? 546 HOH B O   1 
HETATM 10360 O  O   . HOH Y  6 .   ? -18.988 -48.306 83.188  1.00 43.77  ? 547 HOH B O   1 
HETATM 10361 O  O   . HOH Y  6 .   ? -17.029 -42.888 80.235  1.00 60.14  ? 548 HOH B O   1 
HETATM 10362 O  O   . HOH Y  6 .   ? -30.675 -26.455 77.990  1.00 35.14  ? 549 HOH B O   1 
HETATM 10363 O  O   . HOH Y  6 .   ? -26.496 -61.506 74.815  1.00 55.52  ? 550 HOH B O   1 
HETATM 10364 O  O   . HOH Y  6 .   ? -6.159  -47.024 69.118  1.00 40.67  ? 551 HOH B O   1 
HETATM 10365 O  O   . HOH Y  6 .   ? -27.620 -21.477 44.472  1.00 45.31  ? 552 HOH B O   1 
HETATM 10366 O  O   . HOH Y  6 .   ? -41.321 -41.521 75.783  1.00 33.90  ? 553 HOH B O   1 
HETATM 10367 O  O   . HOH Y  6 .   ? -33.697 -17.156 63.164  1.00 57.48  ? 554 HOH B O   1 
HETATM 10368 O  O   . HOH Y  6 .   ? -26.325 -64.165 69.150  1.00 39.43  ? 555 HOH B O   1 
HETATM 10369 O  O   . HOH Y  6 .   ? -13.478 -46.034 35.174  1.00 52.19  ? 556 HOH B O   1 
HETATM 10370 O  O   . HOH Y  6 .   ? -9.465  -53.073 74.194  1.00 66.41  ? 557 HOH B O   1 
HETATM 10371 O  O   . HOH Y  6 .   ? -33.426 -49.829 81.294  1.00 36.28  ? 558 HOH B O   1 
HETATM 10372 O  O   . HOH Y  6 .   ? -44.411 -34.597 67.648  1.00 55.40  ? 559 HOH B O   1 
HETATM 10373 O  O   . HOH Y  6 .   ? -17.445 -63.241 54.027  1.00 48.02  ? 560 HOH B O   1 
HETATM 10374 O  O   . HOH Y  6 .   ? -33.913 -25.035 42.598  1.00 45.17  ? 561 HOH B O   1 
HETATM 10375 O  O   . HOH Y  6 .   ? -5.004  -51.149 60.074  1.00 53.84  ? 562 HOH B O   1 
HETATM 10376 O  O   . HOH Y  6 .   ? -37.918 -49.552 59.235  1.00 38.49  ? 563 HOH B O   1 
HETATM 10377 O  O   . HOH Y  6 .   ? -22.017 -40.889 32.531  1.00 48.68  ? 564 HOH B O   1 
HETATM 10378 O  O   . HOH Y  6 .   ? -40.628 -42.524 72.956  1.00 40.26  ? 565 HOH B O   1 
HETATM 10379 O  O   . HOH Y  6 .   ? -13.213 -51.935 78.875  1.00 35.11  ? 566 HOH B O   1 
HETATM 10380 O  O   . HOH Y  6 .   ? -9.101  -34.370 44.119  1.00 50.50  ? 567 HOH B O   1 
HETATM 10381 O  O   . HOH Y  6 .   ? -23.446 -58.872 51.840  1.00 47.10  ? 568 HOH B O   1 
HETATM 10382 O  O   . HOH Y  6 .   ? -41.902 -39.751 77.487  1.00 46.15  ? 569 HOH B O   1 
HETATM 10383 O  O   . HOH Y  6 .   ? -35.820 -53.255 79.432  1.00 34.88  ? 570 HOH B O   1 
HETATM 10384 O  O   . HOH Y  6 .   ? -28.514 -59.394 78.498  1.00 45.51  ? 571 HOH B O   1 
HETATM 10385 O  O   . HOH Y  6 .   ? -25.650 -22.860 69.661  1.00 35.39  ? 572 HOH B O   1 
HETATM 10386 O  O   . HOH Y  6 .   ? -34.920 -50.879 56.793  1.00 40.06  ? 573 HOH B O   1 
HETATM 10387 O  O   . HOH Y  6 .   ? -32.691 -58.011 56.672  1.00 48.71  ? 574 HOH B O   1 
HETATM 10388 O  O   . HOH Y  6 .   ? -12.390 -48.706 36.036  1.00 62.38  ? 575 HOH B O   1 
HETATM 10389 O  O   . HOH Y  6 .   ? -38.405 -52.058 74.123  1.00 36.76  ? 576 HOH B O   1 
HETATM 10390 O  O   . HOH Y  6 .   ? -34.342 -50.840 78.884  1.00 45.31  ? 577 HOH B O   1 
HETATM 10391 O  O   . HOH Y  6 .   ? -37.241 -33.762 71.536  1.00 46.88  ? 578 HOH B O   1 
HETATM 10392 O  O   . HOH Y  6 .   ? -20.509 -35.221 74.899  1.00 53.47  ? 579 HOH B O   1 
HETATM 10393 O  O   . HOH Y  6 .   ? -21.570 -32.503 40.820  1.00 43.40  ? 580 HOH B O   1 
HETATM 10394 O  O   . HOH Y  6 .   ? -31.046 -20.769 72.721  1.00 41.60  ? 581 HOH B O   1 
HETATM 10395 O  O   . HOH Y  6 .   ? -19.628 -38.641 62.791  1.00 25.73  ? 582 HOH B O   1 
HETATM 10396 O  O   . HOH Y  6 .   ? -17.666 -42.651 76.813  1.00 28.77  ? 583 HOH B O   1 
HETATM 10397 O  O   . HOH Y  6 .   ? -10.680 -42.074 61.840  1.00 41.04  ? 584 HOH B O   1 
HETATM 10398 O  O   . HOH Y  6 .   ? -25.840 -58.422 79.769  1.00 38.97  ? 585 HOH B O   1 
HETATM 10399 O  O   . HOH Y  6 .   ? -43.279 -42.339 71.918  1.00 41.37  ? 586 HOH B O   1 
HETATM 10400 O  O   . HOH Z  6 .   ? -8.581  -7.502  0.185   1.00 27.95  ? 501 HOH C O   1 
HETATM 10401 O  O   . HOH Z  6 .   ? -24.065 -28.782 -16.203 1.00 20.42  ? 502 HOH C O   1 
HETATM 10402 O  O   . HOH Z  6 .   ? -16.041 -16.066 -21.294 1.00 26.74  ? 503 HOH C O   1 
HETATM 10403 O  O   . HOH Z  6 .   ? -13.854 -6.307  -15.267 1.00 31.63  ? 504 HOH C O   1 
HETATM 10404 O  O   . HOH Z  6 .   ? -12.688 -13.461 -13.139 1.00 29.92  ? 505 HOH C O   1 
HETATM 10405 O  O   . HOH Z  6 .   ? -16.438 -22.661 -1.461  1.00 29.68  ? 506 HOH C O   1 
HETATM 10406 O  O   . HOH Z  6 .   ? -19.422 -22.402 -7.774  1.00 23.77  ? 507 HOH C O   1 
HETATM 10407 O  O   . HOH Z  6 .   ? -11.458 -2.063  -19.483 1.00 34.65  ? 508 HOH C O   1 
HETATM 10408 O  O   . HOH Z  6 .   ? -19.488 -33.935 -14.019 1.00 21.18  ? 509 HOH C O   1 
HETATM 10409 O  O   . HOH Z  6 .   ? -24.874 -21.149 -6.195  1.00 35.24  ? 510 HOH C O   1 
HETATM 10410 O  O   . HOH Z  6 .   ? -12.392 -4.221  -20.896 1.00 38.50  ? 511 HOH C O   1 
HETATM 10411 O  O   . HOH Z  6 .   ? -13.666 -15.596 -22.639 1.00 30.05  ? 512 HOH C O   1 
HETATM 10412 O  O   . HOH Z  6 .   ? -14.500 -5.398  -19.482 1.00 30.88  ? 513 HOH C O   1 
HETATM 10413 O  O   . HOH Z  6 .   ? -19.891 -1.638  -17.852 1.00 39.24  ? 514 HOH C O   1 
HETATM 10414 O  O   . HOH Z  6 .   ? -24.491 -19.101 -8.145  1.00 29.96  ? 515 HOH C O   1 
HETATM 10415 O  O   . HOH Z  6 .   ? -7.760  -14.875 -1.132  1.00 42.29  ? 516 HOH C O   1 
HETATM 10416 O  O   . HOH Z  6 .   ? -22.379 -31.550 -22.002 1.00 24.50  ? 517 HOH C O   1 
HETATM 10417 O  O   . HOH Z  6 .   ? -31.169 -15.845 -9.015  1.00 34.64  ? 518 HOH C O   1 
HETATM 10418 O  O   . HOH Z  6 .   ? -4.819  -10.120 -30.133 1.00 29.05  ? 519 HOH C O   1 
HETATM 10419 O  O   . HOH Z  6 .   ? -24.973 -1.164  -18.120 1.00 42.81  ? 520 HOH C O   1 
HETATM 10420 O  O   . HOH Z  6 .   ? -36.459 -14.222 9.096   1.00 23.30  ? 521 HOH C O   1 
HETATM 10421 O  O   . HOH Z  6 .   ? -10.563 -14.659 -0.772  1.00 36.99  ? 522 HOH C O   1 
HETATM 10422 O  O   . HOH Z  6 .   ? -20.582 -6.060  -35.819 1.00 32.83  ? 523 HOH C O   1 
HETATM 10423 O  O   . HOH Z  6 .   ? -19.027 -32.652 0.095   1.00 31.74  ? 524 HOH C O   1 
HETATM 10424 O  O   . HOH Z  6 .   ? -5.684  -5.860  -9.768  1.00 35.93  ? 525 HOH C O   1 
HETATM 10425 O  O   . HOH Z  6 .   ? -17.217 -35.722 -27.446 1.00 30.13  ? 526 HOH C O   1 
HETATM 10426 O  O   . HOH Z  6 .   ? -26.735 -27.224 -1.462  1.00 30.68  ? 527 HOH C O   1 
HETATM 10427 O  O   . HOH Z  6 .   ? -22.348 -9.919  -33.498 1.00 36.36  ? 528 HOH C O   1 
HETATM 10428 O  O   . HOH Z  6 .   ? -35.007 -27.841 -12.065 1.00 34.92  ? 529 HOH C O   1 
HETATM 10429 O  O   . HOH Z  6 .   ? -34.415 -13.240 -3.038  1.00 35.44  ? 530 HOH C O   1 
HETATM 10430 O  O   . HOH Z  6 .   ? -7.887  -28.352 -15.399 1.00 42.97  ? 531 HOH C O   1 
HETATM 10431 O  O   . HOH Z  6 .   ? -20.053 -23.434 -29.146 1.00 34.48  ? 532 HOH C O   1 
HETATM 10432 O  O   . HOH Z  6 .   ? 2.791   -21.155 0.533   1.00 52.25  ? 533 HOH C O   1 
HETATM 10433 O  O   . HOH Z  6 .   ? -35.879 -17.794 2.238   1.00 44.54  ? 534 HOH C O   1 
HETATM 10434 O  O   . HOH Z  6 .   ? -13.100 -5.333  -7.478  1.00 42.85  ? 535 HOH C O   1 
HETATM 10435 O  O   . HOH Z  6 .   ? -18.559 -29.263 0.373   1.00 20.53  ? 536 HOH C O   1 
HETATM 10436 O  O   . HOH Z  6 .   ? -18.514 -28.437 -11.793 1.00 19.76  ? 537 HOH C O   1 
HETATM 10437 O  O   . HOH Z  6 .   ? -34.570 -13.140 -21.317 1.00 44.28  ? 538 HOH C O   1 
HETATM 10438 O  O   . HOH Z  6 .   ? -16.773 -12.950 2.829   1.00 35.03  ? 539 HOH C O   1 
HETATM 10439 O  O   . HOH Z  6 .   ? -32.037 -19.385 5.301   1.00 27.25  ? 540 HOH C O   1 
HETATM 10440 O  O   . HOH Z  6 .   ? -3.684  -1.401  -10.141 1.00 48.70  ? 541 HOH C O   1 
HETATM 10441 O  O   . HOH Z  6 .   ? 0.174   -13.112 -25.258 1.00 56.81  ? 542 HOH C O   1 
HETATM 10442 O  O   . HOH Z  6 .   ? -37.468 -26.955 -9.799  1.00 45.39  ? 543 HOH C O   1 
HETATM 10443 O  O   . HOH Z  6 .   ? -36.337 -6.769  7.594   1.00 33.70  ? 544 HOH C O   1 
HETATM 10444 O  O   . HOH Z  6 .   ? -24.997 -26.366 -22.900 1.00 41.56  ? 545 HOH C O   1 
HETATM 10445 O  O   . HOH Z  6 .   ? -8.922  -32.826 -10.323 1.00 42.51  ? 546 HOH C O   1 
HETATM 10446 O  O   . HOH Z  6 .   ? -7.720  -30.914 7.079   1.00 37.37  ? 547 HOH C O   1 
HETATM 10447 O  O   . HOH Z  6 .   ? -10.055 -32.226 -24.043 1.00 48.59  ? 548 HOH C O   1 
HETATM 10448 O  O   . HOH Z  6 .   ? -19.605 -13.092 2.493   1.00 36.98  ? 549 HOH C O   1 
HETATM 10449 O  O   . HOH Z  6 .   ? -5.979  -10.843 7.832   1.00 32.37  ? 550 HOH C O   1 
HETATM 10450 O  O   . HOH Z  6 .   ? -24.447 -35.804 -19.151 1.00 43.45  ? 551 HOH C O   1 
HETATM 10451 O  O   . HOH Z  6 .   ? -25.718 -29.435 -24.827 1.00 58.89  ? 552 HOH C O   1 
HETATM 10452 O  O   . HOH Z  6 .   ? -31.902 -22.078 -2.096  1.00 47.17  ? 553 HOH C O   1 
HETATM 10453 O  O   . HOH Z  6 .   ? -9.871  -16.551 11.541  1.00 51.20  ? 554 HOH C O   1 
HETATM 10454 O  O   . HOH Z  6 .   ? -2.866  -13.262 -28.955 1.00 39.86  ? 555 HOH C O   1 
HETATM 10455 O  O   . HOH Z  6 .   ? -18.312 -6.160  -2.771  1.00 57.42  ? 556 HOH C O   1 
HETATM 10456 O  O   . HOH Z  6 .   ? -9.399  -9.846  -36.385 1.00 39.84  ? 557 HOH C O   1 
HETATM 10457 O  O   . HOH Z  6 .   ? -28.277 -33.375 -10.385 1.00 40.73  ? 558 HOH C O   1 
HETATM 10458 O  O   . HOH Z  6 .   ? -12.403 5.961   -16.332 1.00 49.91  ? 559 HOH C O   1 
HETATM 10459 O  O   . HOH Z  6 .   ? -19.428 -33.148 -11.272 1.00 34.35  ? 560 HOH C O   1 
HETATM 10460 O  O   . HOH Z  6 .   ? -20.412 -32.985 2.960   1.00 37.19  ? 561 HOH C O   1 
HETATM 10461 O  O   . HOH Z  6 .   ? -15.792 -30.443 -29.620 1.00 38.62  ? 562 HOH C O   1 
HETATM 10462 O  O   . HOH Z  6 .   ? -13.198 -9.734  8.214   1.00 52.62  ? 563 HOH C O   1 
HETATM 10463 O  O   . HOH Z  6 .   ? -7.804  -16.867 10.329  1.00 46.12  ? 564 HOH C O   1 
HETATM 10464 O  O   . HOH Z  6 .   ? -28.033 -6.405  -21.196 1.00 47.40  ? 565 HOH C O   1 
HETATM 10465 O  O   . HOH Z  6 .   ? -20.062 -30.217 -10.418 1.00 46.10  ? 566 HOH C O   1 
HETATM 10466 O  O   . HOH Z  6 .   ? -0.403  -22.383 7.985   1.00 47.88  ? 567 HOH C O   1 
HETATM 10467 O  O   . HOH Z  6 .   ? -21.061 3.156   -22.092 1.00 43.82  ? 568 HOH C O   1 
HETATM 10468 O  O   . HOH Z  6 .   ? -14.870 -13.398 7.197   1.00 44.03  ? 569 HOH C O   1 
HETATM 10469 O  O   . HOH Z  6 .   ? -32.682 -20.102 8.394   1.00 45.12  ? 570 HOH C O   1 
HETATM 10470 O  O   . HOH Z  6 .   ? -0.635  3.565   -17.487 1.00 53.86  ? 571 HOH C O   1 
HETATM 10471 O  O   . HOH Z  6 .   ? -31.799 -9.882  -25.450 1.00 54.31  ? 572 HOH C O   1 
HETATM 10472 O  O   . HOH Z  6 .   ? -17.211 -10.929 -8.831  1.00 28.49  ? 573 HOH C O   1 
HETATM 10473 O  O   . HOH Z  6 .   ? -26.594 -19.717 -4.583  1.00 39.87  ? 574 HOH C O   1 
HETATM 10474 O  O   . HOH AA 6 .   ? -19.478 -19.727 79.942  1.00 33.42  ? 501 HOH D O   1 
HETATM 10475 O  O   . HOH AA 6 .   ? -11.531 -40.659 88.374  1.00 19.61  ? 502 HOH D O   1 
HETATM 10476 O  O   . HOH AA 6 .   ? -18.496 -41.846 103.099 1.00 21.38  ? 503 HOH D O   1 
HETATM 10477 O  O   . HOH AA 6 .   ? -21.707 -32.431 109.156 1.00 28.13  ? 504 HOH D O   1 
HETATM 10478 O  O   . HOH AA 6 .   ? -17.180 -42.999 109.220 1.00 25.00  ? 505 HOH D O   1 
HETATM 10479 O  O   . HOH AA 6 .   ? -15.122 -34.178 88.343  1.00 28.61  ? 506 HOH D O   1 
HETATM 10480 O  O   . HOH AA 6 .   ? -23.758 -32.582 107.554 1.00 29.65  ? 507 HOH D O   1 
HETATM 10481 O  O   . HOH AA 6 .   ? -30.580 -33.103 93.315  1.00 31.74  ? 508 HOH D O   1 
HETATM 10482 O  O   . HOH AA 6 .   ? -18.798 -35.058 100.160 1.00 30.99  ? 509 HOH D O   1 
HETATM 10483 O  O   . HOH AA 6 .   ? -19.398 -42.634 107.439 1.00 29.29  ? 510 HOH D O   1 
HETATM 10484 O  O   . HOH AA 6 .   ? -34.088 -22.946 100.210 1.00 31.63  ? 511 HOH D O   1 
HETATM 10485 O  O   . HOH AA 6 .   ? -26.768 -28.525 93.270  1.00 36.12  ? 512 HOH D O   1 
HETATM 10486 O  O   . HOH AA 6 .   ? -8.982  -37.319 80.844  1.00 36.51  ? 513 HOH D O   1 
HETATM 10487 O  O   . HOH AA 6 .   ? -31.351 -31.252 91.058  1.00 40.53  ? 514 HOH D O   1 
HETATM 10488 O  O   . HOH AA 6 .   ? -23.519 -47.746 105.905 1.00 32.42  ? 515 HOH D O   1 
HETATM 10489 O  O   . HOH AA 6 .   ? -15.640 -45.033 108.167 1.00 30.26  ? 516 HOH D O   1 
HETATM 10490 O  O   . HOH AA 6 .   ? -23.000 -28.140 87.368  1.00 41.05  ? 517 HOH D O   1 
HETATM 10491 O  O   . HOH AA 6 .   ? -27.914 -49.615 105.566 1.00 42.39  ? 518 HOH D O   1 
HETATM 10492 O  O   . HOH AA 6 .   ? -25.658 -39.295 80.763  1.00 40.43  ? 519 HOH D O   1 
HETATM 10493 O  O   . HOH AA 6 .   ? -9.905  -40.791 98.798  1.00 34.55  ? 520 HOH D O   1 
HETATM 10494 O  O   . HOH AA 6 .   ? -30.148 -16.863 97.534  1.00 33.78  ? 521 HOH D O   1 
HETATM 10495 O  O   . HOH AA 6 .   ? -12.687 -33.564 88.622  1.00 36.88  ? 522 HOH D O   1 
HETATM 10496 O  O   . HOH AA 6 .   ? -24.055 -34.055 126.127 1.00 32.83  ? 523 HOH D O   1 
HETATM 10497 O  O   . HOH AA 6 .   ? -38.674 -42.448 75.515  1.00 28.54  ? 524 HOH D O   1 
HETATM 10498 O  O   . HOH AA 6 .   ? -38.984 -21.740 85.743  1.00 53.41  ? 525 HOH D O   1 
HETATM 10499 O  O   . HOH AA 6 .   ? -12.767 -34.596 118.677 1.00 28.58  ? 526 HOH D O   1 
HETATM 10500 O  O   . HOH AA 6 .   ? -41.508 -31.147 108.234 1.00 47.53  ? 527 HOH D O   1 
HETATM 10501 O  O   . HOH AA 6 .   ? -16.484 -43.531 95.678  1.00 29.31  ? 528 HOH D O   1 
HETATM 10502 O  O   . HOH AA 6 .   ? -11.544 -31.204 117.038 1.00 40.20  ? 529 HOH D O   1 
HETATM 10503 O  O   . HOH AA 6 .   ? -36.448 -37.665 93.777  1.00 51.97  ? 530 HOH D O   1 
HETATM 10504 O  O   . HOH AA 6 .   ? -13.874 -26.261 112.485 1.00 54.05  ? 531 HOH D O   1 
HETATM 10505 O  O   . HOH AA 6 .   ? -26.360 -22.639 84.312  1.00 25.70  ? 532 HOH D O   1 
HETATM 10506 O  O   . HOH AA 6 .   ? -21.720 -20.063 99.381  1.00 27.91  ? 533 HOH D O   1 
HETATM 10507 O  O   . HOH AA 6 .   ? -29.877 -17.610 95.085  1.00 39.43  ? 534 HOH D O   1 
HETATM 10508 O  O   . HOH AA 6 .   ? -21.800 -42.506 127.472 1.00 45.76  ? 535 HOH D O   1 
HETATM 10509 O  O   . HOH AA 6 .   ? -28.147 -42.591 122.862 1.00 27.22  ? 536 HOH D O   1 
HETATM 10510 O  O   . HOH AA 6 .   ? -33.820 -18.760 105.044 1.00 35.51  ? 537 HOH D O   1 
HETATM 10511 O  O   . HOH AA 6 .   ? -24.116 -40.938 128.659 1.00 53.71  ? 538 HOH D O   1 
HETATM 10512 O  O   . HOH AA 6 .   ? -35.967 -15.946 101.720 1.00 63.99  ? 539 HOH D O   1 
HETATM 10513 O  O   . HOH AA 6 .   ? -23.075 -48.999 115.430 1.00 31.78  ? 540 HOH D O   1 
HETATM 10514 O  O   . HOH AA 6 .   ? -28.621 -14.586 107.386 1.00 41.08  ? 541 HOH D O   1 
HETATM 10515 O  O   . HOH AA 6 .   ? -38.064 -41.695 87.907  1.00 31.85  ? 542 HOH D O   1 
HETATM 10516 O  O   . HOH AA 6 .   ? -27.831 -22.254 96.381  1.00 29.91  ? 543 HOH D O   1 
HETATM 10517 O  O   . HOH AA 6 .   ? -6.722  -44.068 100.012 1.00 45.11  ? 544 HOH D O   1 
HETATM 10518 O  O   . HOH AA 6 .   ? -12.372 -17.892 102.328 1.00 49.15  ? 545 HOH D O   1 
HETATM 10519 O  O   . HOH AA 6 .   ? -20.879 -49.806 116.172 1.00 44.28  ? 546 HOH D O   1 
HETATM 10520 O  O   . HOH AA 6 .   ? -24.570 -37.022 81.797  1.00 40.90  ? 547 HOH D O   1 
HETATM 10521 O  O   . HOH AA 6 .   ? -16.961 -34.579 127.718 1.00 32.34  ? 548 HOH D O   1 
HETATM 10522 O  O   . HOH AA 6 .   ? -15.339 -18.649 78.836  1.00 43.20  ? 549 HOH D O   1 
HETATM 10523 O  O   . HOH AA 6 .   ? -19.382 -44.054 93.797  1.00 41.03  ? 550 HOH D O   1 
HETATM 10524 O  O   . HOH AA 6 .   ? -22.379 -15.573 109.433 1.00 47.61  ? 551 HOH D O   1 
HETATM 10525 O  O   . HOH AA 6 .   ? -3.531  -24.932 85.876  1.00 56.63  ? 552 HOH D O   1 
HETATM 10526 O  O   . HOH AA 6 .   ? -15.175 -40.655 79.870  1.00 44.20  ? 553 HOH D O   1 
HETATM 10527 O  O   . HOH AA 6 .   ? -30.877 -50.468 96.096  1.00 50.46  ? 554 HOH D O   1 
HETATM 10528 O  O   . HOH AA 6 .   ? -3.435  -45.826 95.519  1.00 50.75  ? 555 HOH D O   1 
HETATM 10529 O  O   . HOH AA 6 .   ? -36.795 -43.315 103.373 1.00 39.29  ? 556 HOH D O   1 
HETATM 10530 O  O   . HOH AA 6 .   ? -0.680  -20.950 94.648  1.00 39.12  ? 557 HOH D O   1 
HETATM 10531 O  O   . HOH AA 6 .   ? -29.841 -38.852 119.905 1.00 42.25  ? 558 HOH D O   1 
HETATM 10532 O  O   . HOH AA 6 .   ? -33.491 -16.748 103.282 1.00 38.89  ? 559 HOH D O   1 
HETATM 10533 O  O   . HOH AA 6 .   ? -3.449  -33.308 100.385 1.00 34.95  ? 560 HOH D O   1 
HETATM 10534 O  O   . HOH AA 6 .   ? -34.833 -17.105 88.937  1.00 54.14  ? 561 HOH D O   1 
HETATM 10535 O  O   . HOH AA 6 .   ? -20.400 -37.943 84.174  1.00 29.68  ? 562 HOH D O   1 
HETATM 10536 O  O   . HOH AA 6 .   ? -23.764 -52.192 110.176 1.00 44.81  ? 563 HOH D O   1 
HETATM 10537 O  O   . HOH AA 6 .   ? -21.315 -17.546 98.814  1.00 31.10  ? 564 HOH D O   1 
HETATM 10538 O  O   . HOH AA 6 .   ? -32.402 -14.175 104.552 1.00 45.99  ? 565 HOH D O   1 
HETATM 10539 O  O   . HOH AA 6 .   ? -31.376 -15.051 106.921 1.00 50.62  ? 566 HOH D O   1 
HETATM 10540 O  O   . HOH AA 6 .   ? -19.721 -35.809 128.094 1.00 48.70  ? 567 HOH D O   1 
HETATM 10541 O  O   . HOH AA 6 .   ? -3.821  -43.380 99.507  1.00 45.40  ? 568 HOH D O   1 
HETATM 10542 O  O   . HOH AA 6 .   ? -17.927 -16.614 83.876  1.00 43.88  ? 569 HOH D O   1 
HETATM 10543 O  O   . HOH AA 6 .   ? -15.900 -49.144 99.931  1.00 38.49  ? 570 HOH D O   1 
HETATM 10544 O  O   . HOH AA 6 .   ? -30.577 -25.589 113.503 1.00 36.85  ? 571 HOH D O   1 
HETATM 10545 O  O   . HOH AA 6 .   ? -29.374 -53.654 108.081 1.00 58.31  ? 572 HOH D O   1 
HETATM 10546 O  O   . HOH AA 6 .   ? -36.533 -42.352 98.791  1.00 40.21  ? 573 HOH D O   1 
HETATM 10547 O  O   . HOH AA 6 .   ? -39.684 -38.461 81.879  1.00 43.39  ? 574 HOH D O   1 
HETATM 10548 O  O   . HOH AA 6 .   ? -40.785 -45.234 85.813  1.00 55.57  ? 575 HOH D O   1 
HETATM 10549 O  O   . HOH AA 6 .   ? -4.680  -43.538 113.764 1.00 47.26  ? 576 HOH D O   1 
HETATM 10550 O  O   . HOH AA 6 .   ? -7.302  -36.026 121.716 1.00 52.92  ? 577 HOH D O   1 
HETATM 10551 O  O   . HOH AA 6 .   ? -4.281  -40.882 94.024  1.00 61.22  ? 578 HOH D O   1 
HETATM 10552 O  O   . HOH AA 6 .   ? -28.511 -34.274 119.635 1.00 57.44  ? 579 HOH D O   1 
HETATM 10553 O  O   . HOH AA 6 .   ? -18.711 -17.218 98.850  1.00 33.65  ? 580 HOH D O   1 
HETATM 10554 O  O   . HOH AA 6 .   ? -22.043 -38.965 96.116  1.00 19.79  ? 581 HOH D O   1 
HETATM 10555 O  O   . HOH AA 6 .   ? -32.728 -33.327 89.495  1.00 35.89  ? 582 HOH D O   1 
HETATM 10556 O  O   . HOH AA 6 .   ? -29.734 -21.435 94.683  1.00 52.53  ? 583 HOH D O   1 
HETATM 10557 O  O   . HOH AA 6 .   ? -11.553 -15.734 85.753  1.00 47.94  ? 584 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1     N  N   A MET A 1   ? 0.6059 0.8211 0.6514 0.0125  0.0186  -0.0347 1   MET A N   
2     N  N   B MET A 1   ? 0.5682 0.7602 0.6040 -0.0007 0.0203  -0.0321 1   MET A N   
3     C  CA  A MET A 1   ? 0.6206 0.8265 0.6607 0.0150  0.0214  -0.0356 1   MET A CA  
4     C  CA  B MET A 1   ? 0.5777 0.7828 0.6180 0.0108  0.0208  -0.0347 1   MET A CA  
5     C  C   A MET A 1   ? 0.6361 0.8214 0.6706 0.0241  0.0196  -0.0352 1   MET A C   
6     C  C   B MET A 1   ? 0.5858 0.7730 0.6214 0.0209  0.0192  -0.0346 1   MET A C   
7     O  O   A MET A 1   ? 0.7326 0.9205 0.7671 0.0348  0.0198  -0.0372 1   MET A O   
8     O  O   B MET A 1   ? 0.6614 0.8539 0.6981 0.0314  0.0195  -0.0367 1   MET A O   
9     C  CB  A MET A 1   ? 0.6324 0.8293 0.6676 0.0034  0.0229  -0.0339 1   MET A CB  
10    C  CB  B MET A 1   ? 0.5919 0.8136 0.6341 0.0112  0.0251  -0.0372 1   MET A CB  
11    C  CG  A MET A 1   ? 0.6349 0.8508 0.6735 -0.0060 0.0256  -0.0345 1   MET A CG  
12    C  CG  B MET A 1   ? 0.6311 0.8724 0.6779 0.0006  0.0270  -0.0372 1   MET A CG  
13    S  SD  A MET A 1   ? 0.7186 0.9571 0.7611 0.0000  0.0303  -0.0381 1   MET A SD  
14    S  SD  B MET A 1   ? 0.6519 0.8776 0.6927 -0.0147 0.0259  -0.0339 1   MET A SD  
15    C  CE  A MET A 1   ? 0.6797 0.9359 0.7243 -0.0150 0.0333  -0.0375 1   MET A CE  
16    C  CE  B MET A 1   ? 0.6633 0.9144 0.7085 -0.0264 0.0289  -0.0345 1   MET A CE  
17    N  N   A ARG A 2   ? 0.5749 0.7397 0.6043 0.0197  0.0177  -0.0326 2   ARG A N   
18    N  N   B ARG A 2   ? 0.5310 0.6968 0.5611 0.0177  0.0175  -0.0322 2   ARG A N   
19    C  CA  A ARG A 2   ? 0.4881 0.6335 0.5120 0.0264  0.0160  -0.0319 2   ARG A CA  
20    C  CA  B ARG A 2   ? 0.4729 0.6206 0.4978 0.0253  0.0159  -0.0317 2   ARG A CA  
21    C  C   A ARG A 2   ? 0.4080 0.5357 0.4291 0.0213  0.0133  -0.0285 2   ARG A C   
22    C  C   B ARG A 2   ? 0.4021 0.5314 0.4238 0.0207  0.0133  -0.0285 2   ARG A C   
23    O  O   A ARG A 2   ? 0.3983 0.5171 0.4184 0.0261  0.0110  -0.0275 2   ARG A O   
24    O  O   B ARG A 2   ? 0.3924 0.5139 0.4136 0.0255  0.0109  -0.0275 2   ARG A O   
25    C  CB  A ARG A 2   ? 0.5619 0.6994 0.5798 0.0284  0.0181  -0.0332 2   ARG A CB  
26    C  CB  B ARG A 2   ? 0.5436 0.6847 0.5631 0.0275  0.0181  -0.0332 2   ARG A CB  
27    C  CG  A ARG A 2   ? 0.5864 0.7103 0.5990 0.0384  0.0168  -0.0340 2   ARG A CG  
28    C  CG  B ARG A 2   ? 0.5659 0.6952 0.5806 0.0379  0.0170  -0.0342 2   ARG A CG  
29    C  CD  A ARG A 2   ? 0.5739 0.6794 0.5835 0.0376  0.0136  -0.0311 2   ARG A CD  
30    C  CD  B ARG A 2   ? 0.5480 0.6896 0.5667 0.0478  0.0165  -0.0361 2   ARG A CD  
31    N  NE  A ARG A 2   ? 0.5819 0.6731 0.5852 0.0458  0.0122  -0.0316 2   ARG A NE  
32    N  NE  B ARG A 2   ? 0.5380 0.6699 0.5505 0.0583  0.0164  -0.0380 2   ARG A NE  
33    C  CZ  A ARG A 2   ? 0.5607 0.6511 0.5638 0.0542  0.0104  -0.0320 2   ARG A CZ  
34    C  CZ  B ARG A 2   ? 0.5503 0.6895 0.5611 0.0643  0.0193  -0.0412 2   ARG A CZ  
35    N  NH1 A ARG A 2   ? 0.5552 0.6303 0.5508 0.0607  0.0092  -0.0324 2   ARG A NH1 
36    N  NH1 B ARG A 2   ? 0.5672 0.7252 0.5827 0.0603  0.0227  -0.0428 2   ARG A NH1 
37    N  NH2 A ARG A 2   ? 0.5556 0.6599 0.5652 0.0556  0.0096  -0.0319 2   ARG A NH2 
38    N  NH2 B ARG A 2   ? 0.5725 0.6997 0.5759 0.0741  0.0189  -0.0429 2   ARG A NH2 
39    N  N   . ILE A 3   ? 0.3516 0.4746 0.3711 0.0119  0.0140  -0.0269 3   ILE A N   
40    C  CA  . ILE A 3   ? 0.3330 0.4400 0.3499 0.0076  0.0120  -0.0238 3   ILE A CA  
41    C  C   . ILE A 3   ? 0.3137 0.4258 0.3330 0.0007  0.0112  -0.0227 3   ILE A C   
42    O  O   . ILE A 3   ? 0.2810 0.3993 0.3002 -0.0069 0.0126  -0.0227 3   ILE A O   
43    C  CB  . ILE A 3   ? 0.3786 0.4728 0.3905 0.0030  0.0125  -0.0223 3   ILE A CB  
44    C  CG1 . ILE A 3   ? 0.3952 0.4842 0.4034 0.0087  0.0132  -0.0237 3   ILE A CG1 
45    C  CG2 . ILE A 3   ? 0.3333 0.4124 0.3434 0.0006  0.0104  -0.0192 3   ILE A CG2 
46    C  CD1 . ILE A 3   ? 0.4720 0.5544 0.4795 0.0173  0.0114  -0.0240 3   ILE A CD1 
47    N  N   . PRO A 4   ? 0.2970 0.4053 0.3173 0.0031  0.0090  -0.0216 4   PRO A N   
48    C  CA  . PRO A 4   ? 0.2915 0.4030 0.3127 -0.0029 0.0081  -0.0209 4   PRO A CA  
49    C  C   . PRO A 4   ? 0.2837 0.3823 0.3006 -0.0101 0.0083  -0.0188 4   PRO A C   
50    O  O   . PRO A 4   ? 0.2798 0.3649 0.2940 -0.0087 0.0082  -0.0171 4   PRO A O   
51    C  CB  . PRO A 4   ? 0.2926 0.4002 0.3145 0.0030  0.0058  -0.0202 4   PRO A CB  
52    C  CG  . PRO A 4   ? 0.2653 0.3604 0.2847 0.0094  0.0055  -0.0194 4   PRO A CG  
53    C  CD  . PRO A 4   ? 0.2600 0.3593 0.2793 0.0112  0.0073  -0.0211 4   PRO A CD  
54    N  N   . LEU A 5   ? 0.2703 0.3731 0.2864 -0.0180 0.0085  -0.0187 5   LEU A N   
55    C  CA  . LEU A 5   ? 0.2797 0.3695 0.2905 -0.0246 0.0086  -0.0167 5   LEU A CA  
56    C  C   . LEU A 5   ? 0.3080 0.3950 0.3168 -0.0283 0.0073  -0.0163 5   LEU A C   
57    O  O   . LEU A 5   ? 0.3298 0.4289 0.3410 -0.0300 0.0066  -0.0178 5   LEU A O   
58    C  CB  . LEU A 5   ? 0.2501 0.3441 0.2584 -0.0321 0.0104  -0.0170 5   LEU A CB  
59    C  CG  . LEU A 5   ? 0.2529 0.3477 0.2610 -0.0300 0.0121  -0.0173 5   LEU A CG  
60    C  CD1 . LEU A 5   ? 0.2388 0.3376 0.2434 -0.0386 0.0139  -0.0173 5   LEU A CD1 
61    C  CD2 . LEU A 5   ? 0.2486 0.3271 0.2540 -0.0261 0.0111  -0.0153 5   LEU A CD2 
62    N  N   . VAL A 6   ? 0.2659 0.3376 0.2701 -0.0294 0.0068  -0.0144 6   VAL A N   
63    C  CA  . VAL A 6   ? 0.2636 0.3303 0.2642 -0.0331 0.0058  -0.0142 6   VAL A CA  
64    C  C   . VAL A 6   ? 0.3110 0.3817 0.3078 -0.0428 0.0061  -0.0149 6   VAL A C   
65    O  O   . VAL A 6   ? 0.3199 0.3851 0.3127 -0.0476 0.0071  -0.0140 6   VAL A O   
66    C  CB  . VAL A 6   ? 0.2271 0.2760 0.2231 -0.0316 0.0056  -0.0120 6   VAL A CB  
67    C  CG1 . VAL A 6   ? 0.2224 0.2650 0.2131 -0.0350 0.0048  -0.0122 6   VAL A CG1 
68    C  CG2 . VAL A 6   ? 0.1971 0.2427 0.1968 -0.0233 0.0054  -0.0110 6   VAL A CG2 
69    N  N   . GLY A 7   ? 0.3006 0.3807 0.2980 -0.0462 0.0049  -0.0164 7   GLY A N   
70    C  CA  . GLY A 7   ? 0.2954 0.3789 0.2883 -0.0568 0.0049  -0.0170 7   GLY A CA  
71    C  C   . GLY A 7   ? 0.2923 0.3901 0.2883 -0.0615 0.0066  -0.0178 7   GLY A C   
72    O  O   . GLY A 7   ? 0.3237 0.4221 0.3149 -0.0712 0.0070  -0.0177 7   GLY A O   
73    N  N   . LYS A 8   ? 0.2904 0.3989 0.2935 -0.0547 0.0077  -0.0185 8   LYS A N   
74    C  CA  . LYS A 8   ? 0.2851 0.4092 0.2916 -0.0580 0.0099  -0.0196 8   LYS A CA  
75    C  C   . LYS A 8   ? 0.2809 0.4225 0.2963 -0.0498 0.0102  -0.0215 8   LYS A C   
76    O  O   . LYS A 8   ? 0.2546 0.3937 0.2729 -0.0410 0.0087  -0.0216 8   LYS A O   
77    C  CB  . LYS A 8   ? 0.2813 0.3947 0.2837 -0.0585 0.0117  -0.0182 8   LYS A CB  
78    C  CG  . LYS A 8   ? 0.3170 0.4120 0.3097 -0.0657 0.0114  -0.0160 8   LYS A CG  
79    C  CD  . LYS A 8   ? 0.3468 0.4343 0.3360 -0.0660 0.0130  -0.0146 8   LYS A CD  
80    C  CE  . LYS A 8   ? 0.3475 0.4159 0.3265 -0.0720 0.0124  -0.0122 8   LYS A CE  
81    N  NZ  . LYS A 8   ? 0.3616 0.4237 0.3369 -0.0723 0.0136  -0.0107 8   LYS A NZ  
82    N  N   . ASP A 9   ? 0.2664 0.4259 0.2859 -0.0524 0.0122  -0.0229 9   ASP A N   
83    C  CA  . ASP A 9   ? 0.3050 0.4810 0.3324 -0.0434 0.0130  -0.0249 9   ASP A CA  
84    C  C   . ASP A 9   ? 0.3047 0.4693 0.3306 -0.0354 0.0140  -0.0245 9   ASP A C   
85    O  O   . ASP A 9   ? 0.3106 0.4611 0.3306 -0.0387 0.0150  -0.0231 9   ASP A O   
86    C  CB  . ASP A 9   ? 0.3436 0.5418 0.3752 -0.0484 0.0157  -0.0265 9   ASP A CB  
87    C  CG  . ASP A 9   ? 0.4342 0.6473 0.4683 -0.0573 0.0145  -0.0270 9   ASP A CG  
88    O  OD1 . ASP A 9   ? 0.5920 0.8198 0.6274 -0.0654 0.0167  -0.0275 9   ASP A OD1 
89    O  OD2 . ASP A 9   ? 0.4703 0.6807 0.5046 -0.0567 0.0113  -0.0268 9   ASP A OD2 
90    N  N   . SER A 10  ? 0.2826 0.4520 0.3129 -0.0247 0.0135  -0.0258 10  SER A N   
91    C  CA  . SER A 10  ? 0.2773 0.4355 0.3055 -0.0170 0.0141  -0.0257 10  SER A CA  
92    C  C   . SER A 10  ? 0.2965 0.4604 0.3235 -0.0188 0.0175  -0.0268 10  SER A C   
93    O  O   . SER A 10  ? 0.2570 0.4387 0.2872 -0.0232 0.0196  -0.0282 10  SER A O   
94    C  CB  . SER A 10  ? 0.2991 0.4613 0.3310 -0.0056 0.0128  -0.0269 10  SER A CB  
95    O  OG  . SER A 10  ? 0.3391 0.5229 0.3770 -0.0022 0.0140  -0.0293 10  SER A OG  
96    N  N   . ILE A 11  ? 0.2828 0.4324 0.3052 -0.0157 0.0181  -0.0262 11  ILE A N   
97    C  CA  . ILE A 11  ? 0.2963 0.4482 0.3157 -0.0175 0.0211  -0.0270 11  ILE A CA  
98    C  C   . ILE A 11  ? 0.3229 0.4711 0.3412 -0.0077 0.0217  -0.0287 11  ILE A C   
99    O  O   . ILE A 11  ? 0.3342 0.4711 0.3516 -0.0011 0.0194  -0.0281 11  ILE A O   
100   C  CB  . ILE A 11  ? 0.3082 0.4441 0.3205 -0.0253 0.0210  -0.0245 11  ILE A CB  
101   C  CG1 . ILE A 11  ? 0.2840 0.3998 0.2934 -0.0214 0.0181  -0.0224 11  ILE A CG1 
102   C  CG2 . ILE A 11  ? 0.2999 0.4383 0.3111 -0.0359 0.0209  -0.0231 11  ILE A CG2 
103   C  CD1 . ILE A 11  ? 0.3134 0.4136 0.3161 -0.0267 0.0178  -0.0199 11  ILE A CD1 
104   N  N   . GLU A 12  ? 0.3315 0.4883 0.3487 -0.0070 0.0249  -0.0307 12  GLU A N   
105   C  CA  . GLU A 12  ? 0.3463 0.4964 0.3597 0.0014  0.0256  -0.0323 12  GLU A CA  
106   C  C   . GLU A 12  ? 0.3250 0.4534 0.3309 -0.0016 0.0241  -0.0301 12  GLU A C   
107   O  O   . GLU A 12  ? 0.2840 0.4071 0.2873 -0.0100 0.0240  -0.0279 12  GLU A O   
108   C  CB  . GLU A 12  ? 0.3270 0.4922 0.3405 0.0027  0.0298  -0.0352 12  GLU A CB  
109   C  CG  . GLU A 12  ? 0.4013 0.5918 0.4235 0.0054  0.0315  -0.0374 12  GLU A CG  
110   C  CD  . GLU A 12  ? 0.4414 0.6487 0.4642 0.0082  0.0362  -0.0406 12  GLU A CD  
111   O  OE1 . GLU A 12  ? 0.4778 0.7049 0.5054 0.0018  0.0388  -0.0410 12  GLU A OE1 
112   O  OE2 . GLU A 12  ? 0.5133 0.7135 0.5311 0.0165  0.0374  -0.0426 12  GLU A OE2 
113   N  N   . SER A 13  ? 0.3616 0.4777 0.3639 0.0057  0.0228  -0.0306 13  SER A N   
114   C  CA  . SER A 13  ? 0.3966 0.4930 0.3925 0.0032  0.0208  -0.0284 13  SER A CA  
115   C  C   . SER A 13  ? 0.3882 0.4826 0.3784 -0.0036 0.0226  -0.0280 13  SER A C   
116   O  O   . SER A 13  ? 0.3669 0.4484 0.3531 -0.0083 0.0207  -0.0254 13  SER A O   
117   C  CB  . SER A 13  ? 0.4269 0.5120 0.4187 0.0115  0.0194  -0.0295 13  SER A CB  
118   O  OG  . SER A 13  ? 0.4075 0.4982 0.3958 0.0165  0.0222  -0.0330 13  SER A OG  
119   N  N   . LYS A 14  ? 0.4021 0.5100 0.3921 -0.0038 0.0262  -0.0305 14  LYS A N   
120   C  CA  . LYS A 14  ? 0.4045 0.5114 0.3883 -0.0100 0.0283  -0.0303 14  LYS A CA  
121   C  C   . LYS A 14  ? 0.3844 0.4905 0.3680 -0.0207 0.0278  -0.0271 14  LYS A C   
122   O  O   . LYS A 14  ? 0.3825 0.4831 0.3598 -0.0267 0.0284  -0.0258 14  LYS A O   
123   C  CB  . LYS A 14  ? 0.3823 0.5062 0.3664 -0.0077 0.0330  -0.0339 14  LYS A CB  
124   C  CG  . LYS A 14  ? 0.4043 0.5491 0.3955 -0.0128 0.0355  -0.0341 14  LYS A CG  
125   C  CD  . LYS A 14  ? 0.3912 0.5564 0.3855 -0.0072 0.0400  -0.0381 14  LYS A CD  
126   C  CE  . LYS A 14  ? 0.3551 0.5412 0.3540 -0.0157 0.0433  -0.0381 14  LYS A CE  
127   N  NZ  . LYS A 14  ? 0.3606 0.5507 0.3656 -0.0217 0.0408  -0.0358 14  LYS A NZ  
128   N  N   . ASP A 15  ? 0.3534 0.4640 0.3430 -0.0226 0.0265  -0.0259 15  ASP A N   
129   C  CA  . ASP A 15  ? 0.3532 0.4621 0.3416 -0.0324 0.0260  -0.0232 15  ASP A CA  
130   C  C   . ASP A 15  ? 0.3227 0.4141 0.3096 -0.0335 0.0221  -0.0199 15  ASP A C   
131   O  O   . ASP A 15  ? 0.3115 0.3990 0.2969 -0.0402 0.0213  -0.0177 15  ASP A O   
132   C  CB  . ASP A 15  ? 0.3984 0.5246 0.3933 -0.0354 0.0274  -0.0242 15  ASP A CB  
133   C  CG  . ASP A 15  ? 0.4293 0.5753 0.4258 -0.0367 0.0318  -0.0269 15  ASP A CG  
134   O  OD1 . ASP A 15  ? 0.4278 0.5732 0.4183 -0.0427 0.0340  -0.0265 15  ASP A OD1 
135   O  OD2 . ASP A 15  ? 0.4601 0.6226 0.4639 -0.0315 0.0329  -0.0294 15  ASP A OD2 
136   N  N   . ILE A 16  ? 0.3109 0.3921 0.2979 -0.0268 0.0199  -0.0197 16  ILE A N   
137   C  CA  . ILE A 16  ? 0.3237 0.3901 0.3103 -0.0272 0.0165  -0.0165 16  ILE A CA  
138   C  C   . ILE A 16  ? 0.2969 0.3528 0.2769 -0.0335 0.0156  -0.0138 16  ILE A C   
139   O  O   . ILE A 16  ? 0.2923 0.3412 0.2715 -0.0372 0.0140  -0.0112 16  ILE A O   
140   C  CB  . ILE A 16  ? 0.4028 0.4609 0.3902 -0.0198 0.0144  -0.0167 16  ILE A CB  
141   C  CG1 . ILE A 16  ? 0.5435 0.6106 0.5356 -0.0128 0.0152  -0.0194 16  ILE A CG1 
142   C  CG2 . ILE A 16  ? 0.3527 0.3994 0.3413 -0.0201 0.0115  -0.0135 16  ILE A CG2 
143   C  CD1 . ILE A 16  ? 0.5668 0.6398 0.5645 -0.0127 0.0146  -0.0190 16  ILE A CD1 
144   N  N   . GLY A 17  ? 0.2657 0.3200 0.2402 -0.0345 0.0165  -0.0143 17  GLY A N   
145   C  CA  . GLY A 17  ? 0.2685 0.3130 0.2359 -0.0402 0.0155  -0.0117 17  GLY A CA  
146   C  C   . GLY A 17  ? 0.2906 0.3211 0.2574 -0.0382 0.0116  -0.0088 17  GLY A C   
147   O  O   . GLY A 17  ? 0.2685 0.2968 0.2395 -0.0323 0.0101  -0.0093 17  GLY A O   
148   N  N   . PHE A 18  ? 0.2779 0.2992 0.2394 -0.0429 0.0099  -0.0056 18  PHE A N   
149   C  CA  . PHE A 18  ? 0.3053 0.3154 0.2668 -0.0409 0.0062  -0.0027 18  PHE A CA  
150   C  C   . PHE A 18  ? 0.3052 0.3145 0.2737 -0.0374 0.0052  -0.0020 18  PHE A C   
151   O  O   . PHE A 18  ? 0.3108 0.3203 0.2800 -0.0398 0.0058  -0.0013 18  PHE A O   
152   C  CB  . PHE A 18  ? 0.2841 0.2849 0.2383 -0.0461 0.0045  0.0007  18  PHE A CB  
153   C  CG  . PHE A 18  ? 0.2719 0.2631 0.2257 -0.0437 0.0005  0.0036  18  PHE A CG  
154   C  CD1 . PHE A 18  ? 0.3044 0.2908 0.2520 -0.0451 -0.0013 0.0047  18  PHE A CD1 
155   C  CD2 . PHE A 18  ? 0.2756 0.2634 0.2352 -0.0401 -0.0014 0.0054  18  PHE A CD2 
156   C  CE1 . PHE A 18  ? 0.2861 0.2652 0.2340 -0.0432 -0.0055 0.0076  18  PHE A CE1 
157   C  CE2 . PHE A 18  ? 0.2791 0.2602 0.2395 -0.0379 -0.0051 0.0083  18  PHE A CE2 
158   C  CZ  . PHE A 18  ? 0.2893 0.2667 0.2442 -0.0396 -0.0073 0.0094  18  PHE A CZ  
159   N  N   . THR A 19  ? 0.2668 0.2745 0.2397 -0.0322 0.0036  -0.0021 19  THR A N   
160   C  CA  . THR A 19  ? 0.2690 0.2772 0.2484 -0.0285 0.0032  -0.0019 19  THR A CA  
161   C  C   . THR A 19  ? 0.2790 0.2794 0.2606 -0.0264 0.0002  0.0012  19  THR A C   
162   O  O   . THR A 19  ? 0.2855 0.2819 0.2655 -0.0259 -0.0018 0.0022  19  THR A O   
163   C  CB  . THR A 19  ? 0.2861 0.3008 0.2692 -0.0236 0.0043  -0.0049 19  THR A CB  
164   O  OG1 . THR A 19  ? 0.3256 0.3500 0.3080 -0.0246 0.0071  -0.0078 19  THR A OG1 
165   C  CG2 . THR A 19  ? 0.3038 0.3188 0.2927 -0.0200 0.0039  -0.0044 19  THR A CG2 
166   N  N   . LEU A 20  ? 0.2572 0.2557 0.2420 -0.0254 0.0001  0.0027  20  LEU A N   
167   C  CA  . LEU A 20  ? 0.2544 0.2487 0.2433 -0.0222 -0.0019 0.0051  20  LEU A CA  
168   C  C   . LEU A 20  ? 0.2542 0.2525 0.2482 -0.0184 -0.0009 0.0036  20  LEU A C   
169   O  O   . LEU A 20  ? 0.2612 0.2623 0.2569 -0.0177 0.0007  0.0026  20  LEU A O   
170   C  CB  . LEU A 20  ? 0.2457 0.2349 0.2340 -0.0227 -0.0024 0.0076  20  LEU A CB  
171   C  CG  . LEU A 20  ? 0.2661 0.2490 0.2481 -0.0260 -0.0038 0.0097  20  LEU A CG  
172   C  CD1 . LEU A 20  ? 0.2655 0.2417 0.2463 -0.0250 -0.0044 0.0121  20  LEU A CD1 
173   C  CD2 . LEU A 20  ? 0.2788 0.2601 0.2604 -0.0257 -0.0066 0.0114  20  LEU A CD2 
174   N  N   . ILE A 21  ? 0.2518 0.2497 0.2474 -0.0163 -0.0021 0.0035  21  ILE A N   
175   C  CA  . ILE A 21  ? 0.2522 0.2525 0.2507 -0.0127 -0.0013 0.0019  21  ILE A CA  
176   C  C   . ILE A 21  ? 0.2622 0.2615 0.2655 -0.0104 -0.0013 0.0037  21  ILE A C   
177   O  O   . ILE A 21  ? 0.2835 0.2846 0.2884 -0.0077 -0.0005 0.0026  21  ILE A O   
178   C  CB  . ILE A 21  ? 0.2725 0.2703 0.2690 -0.0116 -0.0027 0.0011  21  ILE A CB  
179   C  CG1 . ILE A 21  ? 0.2825 0.2821 0.2794 -0.0077 -0.0016 -0.0013 21  ILE A CG1 
180   C  CG2 . ILE A 21  ? 0.2918 0.2849 0.2901 -0.0124 -0.0052 0.0042  21  ILE A CG2 
181   C  CD1 . ILE A 21  ? 0.2499 0.2557 0.2447 -0.0065 0.0005  -0.0048 21  ILE A CD1 
182   N  N   . HIS A 22  ? 0.2443 0.2409 0.2492 -0.0110 -0.0022 0.0065  22  HIS A N   
183   C  CA  . HIS A 22  ? 0.2305 0.2268 0.2397 -0.0086 -0.0018 0.0082  22  HIS A CA  
184   C  C   . HIS A 22  ? 0.2371 0.2311 0.2467 -0.0087 -0.0016 0.0103  22  HIS A C   
185   O  O   . HIS A 22  ? 0.2228 0.2154 0.2342 -0.0086 -0.0033 0.0130  22  HIS A O   
186   C  CB  . HIS A 22  ? 0.2088 0.2043 0.2210 -0.0079 -0.0034 0.0101  22  HIS A CB  
187   C  CG  . HIS A 22  ? 0.2203 0.2167 0.2368 -0.0056 -0.0023 0.0117  22  HIS A CG  
188   N  ND1 . HIS A 22  ? 0.2215 0.2175 0.2389 -0.0048 -0.0024 0.0118  22  HIS A ND1 
189   C  CD2 . HIS A 22  ? 0.2215 0.2187 0.2407 -0.0039 -0.0009 0.0131  22  HIS A CD2 
190   C  CE1 . HIS A 22  ? 0.2499 0.2472 0.2707 -0.0032 -0.0010 0.0135  22  HIS A CE1 
191   N  NE2 . HIS A 22  ? 0.2646 0.2629 0.2867 -0.0023 0.0001  0.0142  22  HIS A NE2 
192   N  N   . GLU A 23  ? 0.2186 0.2122 0.2262 -0.0087 0.0001  0.0091  23  GLU A N   
193   C  CA  . GLU A 23  ? 0.2518 0.2412 0.2582 -0.0081 0.0005  0.0106  23  GLU A CA  
194   C  C   . GLU A 23  ? 0.2647 0.2541 0.2709 -0.0065 0.0026  0.0094  23  GLU A C   
195   O  O   . GLU A 23  ? 0.3026 0.2955 0.3083 -0.0071 0.0034  0.0070  23  GLU A O   
196   C  CB  . GLU A 23  ? 0.2436 0.2287 0.2438 -0.0116 0.0000  0.0105  23  GLU A CB  
197   C  CG  . GLU A 23  ? 0.2907 0.2759 0.2892 -0.0140 -0.0020 0.0112  23  GLU A CG  
198   C  CD  . GLU A 23  ? 0.3304 0.3138 0.3316 -0.0121 -0.0043 0.0144  23  GLU A CD  
199   O  OE1 . GLU A 23  ? 0.3107 0.2952 0.3116 -0.0137 -0.0062 0.0149  23  GLU A OE1 
200   O  OE2 . GLU A 23  ? 0.3167 0.2981 0.3202 -0.0089 -0.0042 0.0164  23  GLU A OE2 
201   N  N   . HIS A 24  ? 0.2606 0.2461 0.2668 -0.0040 0.0033  0.0109  24  HIS A N   
202   C  CA  . HIS A 24  ? 0.2575 0.2416 0.2620 -0.0025 0.0053  0.0096  24  HIS A CA  
203   C  C   . HIS A 24  ? 0.2907 0.2671 0.2885 -0.0037 0.0057  0.0092  24  HIS A C   
204   O  O   . HIS A 24  ? 0.2856 0.2566 0.2818 -0.0020 0.0053  0.0112  24  HIS A O   
205   C  CB  . HIS A 24  ? 0.2349 0.2204 0.2440 0.0017  0.0065  0.0113  24  HIS A CB  
206   C  CG  . HIS A 24  ? 0.2371 0.2284 0.2517 0.0022  0.0059  0.0121  24  HIS A CG  
207   N  ND1 . HIS A 24  ? 0.2080 0.2020 0.2230 0.0024  0.0066  0.0106  24  HIS A ND1 
208   C  CD2 . HIS A 24  ? 0.2051 0.1990 0.2242 0.0022  0.0044  0.0143  24  HIS A CD2 
209   C  CE1 . HIS A 24  ? 0.1973 0.1941 0.2160 0.0025  0.0057  0.0119  24  HIS A CE1 
210   N  NE2 . HIS A 24  ? 0.2145 0.2115 0.2358 0.0020  0.0044  0.0140  24  HIS A NE2 
211   N  N   . LEU A 25  ? 0.2991 0.2748 0.2923 -0.0066 0.0064  0.0068  25  LEU A N   
212   C  CA  . LEU A 25  ? 0.3200 0.2868 0.3052 -0.0084 0.0068  0.0062  25  LEU A CA  
213   C  C   . LEU A 25  ? 0.3223 0.2834 0.3062 -0.0036 0.0083  0.0068  25  LEU A C   
214   O  O   . LEU A 25  ? 0.3358 0.2874 0.3140 -0.0024 0.0085  0.0076  25  LEU A O   
215   C  CB  . LEU A 25  ? 0.2906 0.2596 0.2717 -0.0134 0.0071  0.0033  25  LEU A CB  
216   C  CG  . LEU A 25  ? 0.3269 0.3022 0.3084 -0.0184 0.0062  0.0023  25  LEU A CG  
217   C  CD1 . LEU A 25  ? 0.3361 0.3153 0.3142 -0.0232 0.0064  -0.0004 25  LEU A CD1 
218   C  CD2 . LEU A 25  ? 0.3021 0.2709 0.2792 -0.0210 0.0052  0.0039  25  LEU A CD2 
219   N  N   . ARG A 26  ? 0.3246 0.2914 0.3134 -0.0006 0.0096  0.0065  26  ARG A N   
220   C  CA  . ARG A 26  ? 0.3515 0.3144 0.3394 0.0042  0.0116  0.0071  26  ARG A CA  
221   C  C   . ARG A 26  ? 0.3701 0.3410 0.3647 0.0069  0.0127  0.0076  26  ARG A C   
222   O  O   . ARG A 26  ? 0.3557 0.3323 0.3522 0.0050  0.0122  0.0064  26  ARG A O   
223   C  CB  . ARG A 26  ? 0.3448 0.2998 0.3234 0.0026  0.0125  0.0047  26  ARG A CB  
224   C  CG  . ARG A 26  ? 0.3293 0.2794 0.3054 0.0077  0.0149  0.0048  26  ARG A CG  
225   C  CD  . ARG A 26  ? 0.3379 0.2792 0.3036 0.0055  0.0155  0.0021  26  ARG A CD  
226   N  NE  . ARG A 26  ? 0.3793 0.3270 0.3451 0.0015  0.0147  0.0000  26  ARG A NE  
227   C  CZ  . ARG A 26  ? 0.3502 0.2930 0.3079 -0.0014 0.0147  -0.0024 26  ARG A CZ  
228   N  NH1 . ARG A 26  ? 0.3346 0.2853 0.2937 -0.0045 0.0135  -0.0040 26  ARG A NH1 
229   N  NH2 . ARG A 26  ? 0.3628 0.2922 0.3102 -0.0012 0.0155  -0.0034 26  ARG A NH2 
230   N  N   . VAL A 27  ? 0.3479 0.3193 0.3460 0.0116  0.0143  0.0096  27  VAL A N   
231   C  CA  . VAL A 27  ? 0.3560 0.3340 0.3594 0.0137  0.0157  0.0105  27  VAL A CA  
232   C  C   . VAL A 27  ? 0.3384 0.3137 0.3396 0.0180  0.0189  0.0107  27  VAL A C   
233   O  O   . VAL A 27  ? 0.3021 0.2731 0.3018 0.0214  0.0200  0.0115  27  VAL A O   
234   C  CB  . VAL A 27  ? 0.3447 0.3296 0.3566 0.0142  0.0148  0.0133  27  VAL A CB  
235   C  CG1 . VAL A 27  ? 0.3576 0.3480 0.3739 0.0160  0.0166  0.0147  27  VAL A CG1 
236   C  CG2 . VAL A 27  ? 0.3211 0.3086 0.3344 0.0102  0.0120  0.0128  27  VAL A CG2 
237   N  N   . PHE A 28  ? 0.3157 0.2931 0.3159 0.0183  0.0204  0.0099  28  PHE A N   
238   C  CA  . PHE A 28  ? 0.3159 0.2915 0.3138 0.0224  0.0239  0.0101  28  PHE A CA  
239   C  C   . PHE A 28  ? 0.3181 0.2985 0.3173 0.0220  0.0250  0.0104  28  PHE A C   
240   O  O   . PHE A 28  ? 0.3019 0.2845 0.3013 0.0189  0.0228  0.0096  28  PHE A O   
241   C  CB  . PHE A 28  ? 0.2732 0.2386 0.2606 0.0229  0.0247  0.0073  28  PHE A CB  
242   C  CG  . PHE A 28  ? 0.3045 0.2679 0.2860 0.0184  0.0229  0.0046  28  PHE A CG  
243   C  CD1 . PHE A 28  ? 0.2693 0.2342 0.2481 0.0186  0.0240  0.0037  28  PHE A CD1 
244   C  CD2 . PHE A 28  ? 0.2752 0.2361 0.2539 0.0138  0.0201  0.0031  28  PHE A CD2 
245   C  CE1 . PHE A 28  ? 0.2832 0.2478 0.2572 0.0147  0.0219  0.0013  28  PHE A CE1 
246   C  CE2 . PHE A 28  ? 0.2829 0.2445 0.2573 0.0096  0.0184  0.0007  28  PHE A CE2 
247   C  CZ  . PHE A 28  ? 0.2941 0.2579 0.2665 0.0103  0.0191  -0.0002 28  PHE A CZ  
248   N  N   . SER A 29  ? 0.3013 0.2832 0.3010 0.0255  0.0285  0.0116  29  SER A N   
249   C  CA  . SER A 29  ? 0.3451 0.3298 0.3439 0.0252  0.0299  0.0121  29  SER A CA  
250   C  C   . SER A 29  ? 0.3499 0.3280 0.3389 0.0247  0.0301  0.0091  29  SER A C   
251   O  O   . SER A 29  ? 0.3638 0.3358 0.3465 0.0271  0.0321  0.0076  29  SER A O   
252   C  CB  . SER A 29  ? 0.3548 0.3442 0.3572 0.0285  0.0340  0.0145  29  SER A CB  
253   O  OG  . SER A 29  ? 0.4226 0.4190 0.4344 0.0290  0.0337  0.0172  29  SER A OG  
254   N  N   . GLU A 30  ? 0.3219 0.3010 0.3091 0.0219  0.0277  0.0082  30  GLU A N   
255   C  CA  . GLU A 30  ? 0.3311 0.3054 0.3093 0.0208  0.0269  0.0054  30  GLU A CA  
256   C  C   . GLU A 30  ? 0.3297 0.2999 0.3013 0.0237  0.0305  0.0051  30