data_4KGC
# 
_entry.id   4KGC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4KGC         
NDB   NA2460       
RCSB  RCSB079303   
WWPDB D_1000079303 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4KGC 
_pdbx_database_status.recvd_initial_deposition_date   2013-04-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Adhireksan, Z.' 1 
'Davey, C.A.'    2 
# 
_citation.id                        primary 
_citation.title                     
'Ligand substitutions between ruthenium-cymene compounds can control protein versus DNA targeting and anticancer activity' 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_volume            5 
_citation.page_first                3462 
_citation.page_last                 3462 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24637564 
_citation.pdbx_database_id_DOI      10.1038/ncomms4462 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Adhireksan, Z.'    1  
primary 'Davey, G.E.'       2  
primary 'Campomanes, P.'    3  
primary 'Groessl, M.'       4  
primary 'Clavel, C.M.'      5  
primary 'Yu, H.'            6  
primary 'Nazarov, A.A.'     7  
primary 'Yeo, C.H.'         8  
primary 'Ang, W.H.'         9  
primary 'Droge, P.'         10 
primary 'Rothlisberger, U.' 11 
primary 'Dyson, P.J.'       12 
primary 'Davey, C.A.'       13 
# 
_cell.entry_id           4KGC 
_cell.length_a           106.620 
_cell.length_b           109.710 
_cell.length_c           181.940 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4KGC 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3.2' 15421.101 2 ? ? ? ? 
2 polymer     man 'Histone H4' 11394.426 2 ? ? ? ? 
3 polymer     man 'Histone H2A' 14109.436 2 ? ? ? ? 
4 polymer     man 'Histone H2B 1.1' 13979.291 2 ? ? ? ? 
5 polymer     syn 'DNA (145-mer)' 44749.664 1 ? ? ? ? 
6 polymer     syn 'DNA (145-mer)' 44740.648 1 ? ? ? ? 
7 non-polymer syn 
"(ethane-1,2-diamine-kappa~2~N,N')[(1,2,3,4,5,6-eta)-1-methyl-4-(propan-2-yl)cyclohexane-1,2,3,4,5,6-hexayl]ruthenium" 295.386   4 
? ? ? ? 
8 non-polymer syn 'SULFATE ION' 96.063    3 ? ? ? ? 
9 non-polymer syn 'MAGNESIUM ION' 24.305    1 ? ? ? ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
C,G ? 
4 'polypeptide(L)'        no no 
;MPEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;MPEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DA)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGAATCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGATTCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ARG n 
1 4   THR n 
1 5   LYS n 
1 6   GLN n 
1 7   THR n 
1 8   ALA n 
1 9   ARG n 
1 10  LYS n 
1 11  SER n 
1 12  THR n 
1 13  GLY n 
1 14  GLY n 
1 15  LYS n 
1 16  ALA n 
1 17  PRO n 
1 18  ARG n 
1 19  LYS n 
1 20  GLN n 
1 21  LEU n 
1 22  ALA n 
1 23  THR n 
1 24  LYS n 
1 25  ALA n 
1 26  ALA n 
1 27  ARG n 
1 28  LYS n 
1 29  SER n 
1 30  ALA n 
1 31  PRO n 
1 32  ALA n 
1 33  THR n 
1 34  GLY n 
1 35  GLY n 
1 36  VAL n 
1 37  LYS n 
1 38  LYS n 
1 39  PRO n 
1 40  HIS n 
1 41  ARG n 
1 42  TYR n 
1 43  ARG n 
1 44  PRO n 
1 45  GLY n 
1 46  THR n 
1 47  VAL n 
1 48  ALA n 
1 49  LEU n 
1 50  ARG n 
1 51  GLU n 
1 52  ILE n 
1 53  ARG n 
1 54  ARG n 
1 55  TYR n 
1 56  GLN n 
1 57  LYS n 
1 58  SER n 
1 59  THR n 
1 60  GLU n 
1 61  LEU n 
1 62  LEU n 
1 63  ILE n 
1 64  ARG n 
1 65  LYS n 
1 66  LEU n 
1 67  PRO n 
1 68  PHE n 
1 69  GLN n 
1 70  ARG n 
1 71  LEU n 
1 72  VAL n 
1 73  ARG n 
1 74  GLU n 
1 75  ILE n 
1 76  ALA n 
1 77  GLN n 
1 78  ASP n 
1 79  PHE n 
1 80  LYS n 
1 81  THR n 
1 82  ASP n 
1 83  LEU n 
1 84  ARG n 
1 85  PHE n 
1 86  GLN n 
1 87  SER n 
1 88  SER n 
1 89  ALA n 
1 90  VAL n 
1 91  MET n 
1 92  ALA n 
1 93  LEU n 
1 94  GLN n 
1 95  GLU n 
1 96  ALA n 
1 97  SER n 
1 98  GLU n 
1 99  ALA n 
1 100 TYR n 
1 101 LEU n 
1 102 VAL n 
1 103 GLY n 
1 104 LEU n 
1 105 PHE n 
1 106 GLU n 
1 107 ASP n 
1 108 THR n 
1 109 ASN n 
1 110 LEU n 
1 111 CYS n 
1 112 ALA n 
1 113 ILE n 
1 114 HIS n 
1 115 ALA n 
1 116 LYS n 
1 117 ARG n 
1 118 VAL n 
1 119 THR n 
1 120 ILE n 
1 121 MET n 
1 122 PRO n 
1 123 LYS n 
1 124 ASP n 
1 125 ILE n 
1 126 GLN n 
1 127 LEU n 
1 128 ALA n 
1 129 ARG n 
1 130 ARG n 
1 131 ILE n 
1 132 ARG n 
1 133 GLY n 
1 134 GLU n 
1 135 ARG n 
1 136 ALA n 
2 1   MET n 
2 2   SER n 
2 3   GLY n 
2 4   ARG n 
2 5   GLY n 
2 6   LYS n 
2 7   GLY n 
2 8   GLY n 
2 9   LYS n 
2 10  GLY n 
2 11  LEU n 
2 12  GLY n 
2 13  LYS n 
2 14  GLY n 
2 15  GLY n 
2 16  ALA n 
2 17  LYS n 
2 18  ARG n 
2 19  HIS n 
2 20  ARG n 
2 21  LYS n 
2 22  VAL n 
2 23  LEU n 
2 24  ARG n 
2 25  ASP n 
2 26  ASN n 
2 27  ILE n 
2 28  GLN n 
2 29  GLY n 
2 30  ILE n 
2 31  THR n 
2 32  LYS n 
2 33  PRO n 
2 34  ALA n 
2 35  ILE n 
2 36  ARG n 
2 37  ARG n 
2 38  LEU n 
2 39  ALA n 
2 40  ARG n 
2 41  ARG n 
2 42  GLY n 
2 43  GLY n 
2 44  VAL n 
2 45  LYS n 
2 46  ARG n 
2 47  ILE n 
2 48  SER n 
2 49  GLY n 
2 50  LEU n 
2 51  ILE n 
2 52  TYR n 
2 53  GLU n 
2 54  GLU n 
2 55  THR n 
2 56  ARG n 
2 57  GLY n 
2 58  VAL n 
2 59  LEU n 
2 60  LYS n 
2 61  VAL n 
2 62  PHE n 
2 63  LEU n 
2 64  GLU n 
2 65  ASN n 
2 66  VAL n 
2 67  ILE n 
2 68  ARG n 
2 69  ASP n 
2 70  ALA n 
2 71  VAL n 
2 72  THR n 
2 73  TYR n 
2 74  THR n 
2 75  GLU n 
2 76  HIS n 
2 77  ALA n 
2 78  LYS n 
2 79  ARG n 
2 80  LYS n 
2 81  THR n 
2 82  VAL n 
2 83  THR n 
2 84  ALA n 
2 85  MET n 
2 86  ASP n 
2 87  VAL n 
2 88  VAL n 
2 89  TYR n 
2 90  ALA n 
2 91  LEU n 
2 92  LYS n 
2 93  ARG n 
2 94  GLN n 
2 95  GLY n 
2 96  ARG n 
2 97  THR n 
2 98  LEU n 
2 99  TYR n 
2 100 GLY n 
2 101 PHE n 
2 102 GLY n 
2 103 GLY n 
3 1   MET n 
3 2   SER n 
3 3   GLY n 
3 4   ARG n 
3 5   GLY n 
3 6   LYS n 
3 7   GLN n 
3 8   GLY n 
3 9   GLY n 
3 10  LYS n 
3 11  THR n 
3 12  ARG n 
3 13  ALA n 
3 14  LYS n 
3 15  ALA n 
3 16  LYS n 
3 17  THR n 
3 18  ARG n 
3 19  SER n 
3 20  SER n 
3 21  ARG n 
3 22  ALA n 
3 23  GLY n 
3 24  LEU n 
3 25  GLN n 
3 26  PHE n 
3 27  PRO n 
3 28  VAL n 
3 29  GLY n 
3 30  ARG n 
3 31  VAL n 
3 32  HIS n 
3 33  ARG n 
3 34  LEU n 
3 35  LEU n 
3 36  ARG n 
3 37  LYS n 
3 38  GLY n 
3 39  ASN n 
3 40  TYR n 
3 41  ALA n 
3 42  GLU n 
3 43  ARG n 
3 44  VAL n 
3 45  GLY n 
3 46  ALA n 
3 47  GLY n 
3 48  ALA n 
3 49  PRO n 
3 50  VAL n 
3 51  TYR n 
3 52  LEU n 
3 53  ALA n 
3 54  ALA n 
3 55  VAL n 
3 56  LEU n 
3 57  GLU n 
3 58  TYR n 
3 59  LEU n 
3 60  THR n 
3 61  ALA n 
3 62  GLU n 
3 63  ILE n 
3 64  LEU n 
3 65  GLU n 
3 66  LEU n 
3 67  ALA n 
3 68  GLY n 
3 69  ASN n 
3 70  ALA n 
3 71  ALA n 
3 72  ARG n 
3 73  ASP n 
3 74  ASN n 
3 75  LYS n 
3 76  LYS n 
3 77  THR n 
3 78  ARG n 
3 79  ILE n 
3 80  ILE n 
3 81  PRO n 
3 82  ARG n 
3 83  HIS n 
3 84  LEU n 
3 85  GLN n 
3 86  LEU n 
3 87  ALA n 
3 88  VAL n 
3 89  ARG n 
3 90  ASN n 
3 91  ASP n 
3 92  GLU n 
3 93  GLU n 
3 94  LEU n 
3 95  ASN n 
3 96  LYS n 
3 97  LEU n 
3 98  LEU n 
3 99  GLY n 
3 100 ARG n 
3 101 VAL n 
3 102 THR n 
3 103 ILE n 
3 104 ALA n 
3 105 GLN n 
3 106 GLY n 
3 107 GLY n 
3 108 VAL n 
3 109 LEU n 
3 110 PRO n 
3 111 ASN n 
3 112 ILE n 
3 113 GLN n 
3 114 SER n 
3 115 VAL n 
3 116 LEU n 
3 117 LEU n 
3 118 PRO n 
3 119 LYS n 
3 120 LYS n 
3 121 THR n 
3 122 GLU n 
3 123 SER n 
3 124 SER n 
3 125 LYS n 
3 126 SER n 
3 127 ALA n 
3 128 LYS n 
3 129 SER n 
3 130 LYS n 
4 1   MET n 
4 2   PRO n 
4 3   GLU n 
4 4   PRO n 
4 5   ALA n 
4 6   LYS n 
4 7   SER n 
4 8   ALA n 
4 9   PRO n 
4 10  ALA n 
4 11  PRO n 
4 12  LYS n 
4 13  LYS n 
4 14  GLY n 
4 15  SER n 
4 16  LYS n 
4 17  LYS n 
4 18  ALA n 
4 19  VAL n 
4 20  THR n 
4 21  LYS n 
4 22  THR n 
4 23  GLN n 
4 24  LYS n 
4 25  LYS n 
4 26  ASP n 
4 27  GLY n 
4 28  LYS n 
4 29  LYS n 
4 30  ARG n 
4 31  ARG n 
4 32  LYS n 
4 33  THR n 
4 34  ARG n 
4 35  LYS n 
4 36  GLU n 
4 37  SER n 
4 38  TYR n 
4 39  ALA n 
4 40  ILE n 
4 41  TYR n 
4 42  VAL n 
4 43  TYR n 
4 44  LYS n 
4 45  VAL n 
4 46  LEU n 
4 47  LYS n 
4 48  GLN n 
4 49  VAL n 
4 50  HIS n 
4 51  PRO n 
4 52  ASP n 
4 53  THR n 
4 54  GLY n 
4 55  ILE n 
4 56  SER n 
4 57  SER n 
4 58  LYS n 
4 59  ALA n 
4 60  MET n 
4 61  SER n 
4 62  ILE n 
4 63  MET n 
4 64  ASN n 
4 65  SER n 
4 66  PHE n 
4 67  VAL n 
4 68  ASN n 
4 69  ASP n 
4 70  VAL n 
4 71  PHE n 
4 72  GLU n 
4 73  ARG n 
4 74  ILE n 
4 75  ALA n 
4 76  GLY n 
4 77  GLU n 
4 78  ALA n 
4 79  SER n 
4 80  ARG n 
4 81  LEU n 
4 82  ALA n 
4 83  HIS n 
4 84  TYR n 
4 85  ASN n 
4 86  LYS n 
4 87  ARG n 
4 88  SER n 
4 89  THR n 
4 90  ILE n 
4 91  THR n 
4 92  SER n 
4 93  ARG n 
4 94  GLU n 
4 95  ILE n 
4 96  GLN n 
4 97  THR n 
4 98  ALA n 
4 99  VAL n 
4 100 ARG n 
4 101 LEU n 
4 102 LEU n 
4 103 LEU n 
4 104 PRO n 
4 105 GLY n 
4 106 GLU n 
4 107 LEU n 
4 108 ALA n 
4 109 LYS n 
4 110 HIS n 
4 111 ALA n 
4 112 VAL n 
4 113 SER n 
4 114 GLU n 
4 115 GLY n 
4 116 THR n 
4 117 LYS n 
4 118 ALA n 
4 119 VAL n 
4 120 THR n 
4 121 LYS n 
4 122 TYR n 
4 123 THR n 
4 124 SER n 
4 125 ALA n 
4 126 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DA  n 
5 5   DA  n 
5 6   DT  n 
5 7   DA  n 
5 8   DT  n 
5 9   DC  n 
5 10  DC  n 
5 11  DA  n 
5 12  DC  n 
5 13  DC  n 
5 14  DT  n 
5 15  DG  n 
5 16  DC  n 
5 17  DA  n 
5 18  DG  n 
5 19  DA  n 
5 20  DT  n 
5 21  DA  n 
5 22  DC  n 
5 23  DT  n 
5 24  DA  n 
5 25  DC  n 
5 26  DC  n 
5 27  DA  n 
5 28  DA  n 
5 29  DA  n 
5 30  DA  n 
5 31  DG  n 
5 32  DT  n 
5 33  DG  n 
5 34  DT  n 
5 35  DA  n 
5 36  DT  n 
5 37  DT  n 
5 38  DT  n 
5 39  DG  n 
5 40  DG  n 
5 41  DA  n 
5 42  DA  n 
5 43  DA  n 
5 44  DC  n 
5 45  DT  n 
5 46  DG  n 
5 47  DC  n 
5 48  DT  n 
5 49  DC  n 
5 50  DC  n 
5 51  DA  n 
5 52  DT  n 
5 53  DC  n 
5 54  DA  n 
5 55  DA  n 
5 56  DA  n 
5 57  DA  n 
5 58  DG  n 
5 59  DG  n 
5 60  DC  n 
5 61  DA  n 
5 62  DT  n 
5 63  DG  n 
5 64  DT  n 
5 65  DT  n 
5 66  DC  n 
5 67  DA  n 
5 68  DG  n 
5 69  DC  n 
5 70  DT  n 
5 71  DG  n 
5 72  DA  n 
5 73  DA  n 
5 74  DT  n 
5 75  DC  n 
5 76  DA  n 
5 77  DG  n 
5 78  DC  n 
5 79  DT  n 
5 80  DG  n 
5 81  DA  n 
5 82  DA  n 
5 83  DC  n 
5 84  DA  n 
5 85  DT  n 
5 86  DG  n 
5 87  DC  n 
5 88  DC  n 
5 89  DT  n 
5 90  DT  n 
5 91  DT  n 
5 92  DT  n 
5 93  DG  n 
5 94  DA  n 
5 95  DT  n 
5 96  DG  n 
5 97  DG  n 
5 98  DA  n 
5 99  DG  n 
5 100 DC  n 
5 101 DA  n 
5 102 DG  n 
5 103 DT  n 
5 104 DT  n 
5 105 DT  n 
5 106 DC  n 
5 107 DC  n 
5 108 DA  n 
5 109 DA  n 
5 110 DA  n 
5 111 DT  n 
5 112 DA  n 
5 113 DC  n 
5 114 DA  n 
5 115 DC  n 
5 116 DT  n 
5 117 DT  n 
5 118 DT  n 
5 119 DT  n 
5 120 DG  n 
5 121 DG  n 
5 122 DT  n 
5 123 DA  n 
5 124 DG  n 
5 125 DT  n 
5 126 DA  n 
5 127 DT  n 
5 128 DC  n 
5 129 DT  n 
5 130 DG  n 
5 131 DC  n 
5 132 DA  n 
5 133 DG  n 
5 134 DG  n 
5 135 DT  n 
5 136 DG  n 
5 137 DG  n 
5 138 DA  n 
5 139 DT  n 
5 140 DA  n 
5 141 DT  n 
5 142 DT  n 
5 143 DG  n 
5 144 DA  n 
5 145 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DA  n 
6 5   DA  n 
6 6   DT  n 
6 7   DA  n 
6 8   DT  n 
6 9   DC  n 
6 10  DC  n 
6 11  DA  n 
6 12  DC  n 
6 13  DC  n 
6 14  DT  n 
6 15  DG  n 
6 16  DC  n 
6 17  DA  n 
6 18  DG  n 
6 19  DA  n 
6 20  DT  n 
6 21  DA  n 
6 22  DC  n 
6 23  DT  n 
6 24  DA  n 
6 25  DC  n 
6 26  DC  n 
6 27  DA  n 
6 28  DA  n 
6 29  DA  n 
6 30  DA  n 
6 31  DG  n 
6 32  DT  n 
6 33  DG  n 
6 34  DT  n 
6 35  DA  n 
6 36  DT  n 
6 37  DT  n 
6 38  DT  n 
6 39  DG  n 
6 40  DG  n 
6 41  DA  n 
6 42  DA  n 
6 43  DA  n 
6 44  DC  n 
6 45  DT  n 
6 46  DG  n 
6 47  DC  n 
6 48  DT  n 
6 49  DC  n 
6 50  DC  n 
6 51  DA  n 
6 52  DT  n 
6 53  DC  n 
6 54  DA  n 
6 55  DA  n 
6 56  DA  n 
6 57  DA  n 
6 58  DG  n 
6 59  DG  n 
6 60  DC  n 
6 61  DA  n 
6 62  DT  n 
6 63  DG  n 
6 64  DT  n 
6 65  DT  n 
6 66  DC  n 
6 67  DA  n 
6 68  DG  n 
6 69  DC  n 
6 70  DT  n 
6 71  DG  n 
6 72  DA  n 
6 73  DT  n 
6 74  DT  n 
6 75  DC  n 
6 76  DA  n 
6 77  DG  n 
6 78  DC  n 
6 79  DT  n 
6 80  DG  n 
6 81  DA  n 
6 82  DA  n 
6 83  DC  n 
6 84  DA  n 
6 85  DT  n 
6 86  DG  n 
6 87  DC  n 
6 88  DC  n 
6 89  DT  n 
6 90  DT  n 
6 91  DT  n 
6 92  DT  n 
6 93  DG  n 
6 94  DA  n 
6 95  DT  n 
6 96  DG  n 
6 97  DG  n 
6 98  DA  n 
6 99  DG  n 
6 100 DC  n 
6 101 DA  n 
6 102 DG  n 
6 103 DT  n 
6 104 DT  n 
6 105 DT  n 
6 106 DC  n 
6 107 DC  n 
6 108 DA  n 
6 109 DA  n 
6 110 DA  n 
6 111 DT  n 
6 112 DA  n 
6 113 DC  n 
6 114 DA  n 
6 115 DC  n 
6 116 DT  n 
6 117 DT  n 
6 118 DT  n 
6 119 DT  n 
6 120 DG  n 
6 121 DG  n 
6 122 DT  n 
6 123 DA  n 
6 124 DG  n 
6 125 DT  n 
6 126 DA  n 
6 127 DT  n 
6 128 DC  n 
6 129 DT  n 
6 130 DG  n 
6 131 DC  n 
6 132 DA  n 
6 133 DG  n 
6 134 DG  n 
6 135 DT  n 
6 136 DG  n 
6 137 DG  n 
6 138 DA  n 
6 139 DT  n 
6 140 DA  n 
6 141 DT  n 
6 142 DT  n 
6 143 DG  n 
6 144 DA  n 
6 145 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? 'hist1h2aj, LOC494591' ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample ? ? 'synthetic construct' ? 32630 ? 
6 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP H32_XENLA    P84233 1 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
1 ? 
2 UNP H4_XENLA     P62799 2 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
1 ? 
3 UNP Q6AZJ8_XENLA Q6AZJ8 3 
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
1 ? 
4 UNP H2B11_XENLA  P02281 4 
;MPEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
1 ? 
5 PDB 4KGC         4KGC   5 ? ? ? 
6 PDB 4KGC         4KGC   6 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4KGC A 1 ? 136 ? P84233 1   ? 136 ? 0   135 
2  2 4KGC B 1 ? 103 ? P62799 1   ? 103 ? 0   102 
3  3 4KGC C 1 ? 130 ? Q6AZJ8 1   ? 130 ? 0   129 
4  4 4KGC D 1 ? 126 ? P02281 1   ? 126 ? -3  122 
5  1 4KGC E 1 ? 136 ? P84233 1   ? 136 ? 0   135 
6  2 4KGC F 1 ? 103 ? P62799 1   ? 103 ? 0   102 
7  3 4KGC G 1 ? 130 ? Q6AZJ8 1   ? 130 ? 0   129 
8  4 4KGC H 1 ? 126 ? P02281 1   ? 126 ? -3  122 
9  5 4KGC I 1 ? 145 ? 4KGC   -72 ? 72  ? -72 72  
10 6 4KGC J 1 ? 145 ? 4KGC   -72 ? 72  ? -72 72  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
4 4KGC THR D 33 ? UNP P02281 SER 33 'SEE REMARK 999' 29 1 
8 4KGC THR H 33 ? UNP P02281 SER 33 'SEE REMARK 999' 29 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'  156.162 
HRU non-polymer         . 
"(ethane-1,2-diamine-kappa~2~N,N')[(1,2,3,4,5,6-eta)-1-methyl-4-(propan-2-yl)cyclohexane-1,2,3,4,5,6-hexayl]ruthenium" ? 
'C12 H22 N2 Ru'   295.386 
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION' ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4KGC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.67 
_exptl_crystal.density_percent_sol   53.93 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'40 mM MnCl2, 30 mM KCl, 20 mM K-Cacodylate , pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-07-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Bartels Monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.50 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.50 
# 
_reflns.entry_id                     4KGC 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             60.6 
_reflns.d_resolution_high            2.69 
_reflns.number_obs                   55781 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.69 
_reflns_shell.d_res_low                   2.84 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4KGC 
_refine.ls_number_reflns_obs                     54577 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             60.6 
_refine.ls_d_res_high                            2.69 
_refine.ls_percent_reflns_obs                    92.89 
_refine.ls_R_factor_obs                          0.24835 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.24764 
_refine.ls_R_factor_R_free                       0.28234 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.1 
_refine.ls_number_reflns_R_free                  1143 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.930 
_refine.correlation_coeff_Fo_to_Fc_free          0.900 
_refine.B_iso_mean                               84.444 
_refine.aniso_B[1][1]                            1.04 
_refine.aniso_B[2][2]                            -3.86 
_refine.aniso_B[3][3]                            2.82 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.960 
_refine.pdbx_overall_ESU_R_Free                  0.369 
_refine.overall_SU_ML                            0.295 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             13.757 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6076 
_refine_hist.pdbx_number_atoms_nucleic_acid   5939 
_refine_hist.pdbx_number_atoms_ligand         76 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               12091 
_refine_hist.d_res_high                       2.69 
_refine_hist.d_res_low                        60.6 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       0.009  0.021  ? 12917 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    1.432  2.548  ? 18762 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 4.716  5.000  ? 757   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 32.371 21.338 ? 269   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 17.347 15.000 ? 1181  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 21.424 15.000 ? 84    ? 'X-RAY DIFFRACTION' 
r_chiral_restr         0.070  0.200  ? 2125  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   0.004  0.020  ? 7705  ? 'X-RAY DIFFRACTION' 
r_mcbond_it            0.659  1.500  ? 3797  ? 'X-RAY DIFFRACTION' 
r_mcangle_it           1.270  2.000  ? 6110  ? 'X-RAY DIFFRACTION' 
r_scbond_it            1.328  3.000  ? 9120  ? 'X-RAY DIFFRACTION' 
r_scangle_it           2.198  4.500  ? 12556 ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.690 
_refine_ls_shell.d_res_low                        2.760 
_refine_ls_shell.number_reflns_R_work             2646 
_refine_ls_shell.R_factor_R_work                  0.331 
_refine_ls_shell.percent_reflns_obs               61.26 
_refine_ls_shell.R_factor_R_free                  0.363 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             41 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  4KGC 
_struct.title                     'Nucleosome Core Particle Containing (ETA6-P-CYMENE)-(1, 2-ETHYLENEDIAMINE)-RUTHENIUM' 
_struct.pdbx_descriptor           'Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4KGC 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            'DNA-protein complex, nucleosome, Ruthenium agents, STRUCTURAL PROTEIN-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 8 ? 
M N N 9 ? 
N N N 7 ? 
O N N 8 ? 
P N N 8 ? 
Q N N 7 ? 
R N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 45  ? SER A 58  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  2  ARG A 64  ? ASP A 78  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  3  GLN A 86  ? ALA A 115 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  4  MET A 121 ? ARG A 132 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  5  ASP B 25  ? ILE B 30  ? ASP B 24  ILE B 29  5 ? 6  
HELX_P HELX_P6  6  THR B 31  ? GLY B 42  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  7  LEU B 50  ? ALA B 77  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  8  THR B 83  ? GLN B 94  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  9  THR C 17  ? GLY C 23  ? THR C 16  GLY C 22  1 ? 7  
HELX_P HELX_P10 10 PRO C 27  ? GLY C 38  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 11 GLY C 47  ? ASN C 74  ? GLY C 46  ASN C 73  1 ? 28 
HELX_P HELX_P12 12 ILE C 80  ? ASP C 91  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P13 13 ASP C 91  ? LEU C 98  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 14 GLN C 113 ? LEU C 117 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 15 TYR D 38  ? HIS D 50  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 16 SER D 56  ? ASN D 85  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 17 THR D 91  ? LEU D 103 ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 18 PRO D 104 ? LYS D 126 ? PRO D 100 LYS D 122 1 ? 23 
HELX_P HELX_P19 19 GLY E 45  ? SER E 58  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 20 ARG E 64  ? LYS E 80  ? ARG E 63  LYS E 79  1 ? 17 
HELX_P HELX_P21 21 GLN E 86  ? ALA E 115 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 22 MET E 121 ? ARG E 132 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 23 ASP F 25  ? ILE F 30  ? ASP F 24  ILE F 29  5 ? 6  
HELX_P HELX_P24 24 THR F 31  ? GLY F 42  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 25 LEU F 50  ? ALA F 77  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 26 THR F 83  ? GLN F 94  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 27 THR G 17  ? GLY G 23  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 28 PRO G 27  ? LYS G 37  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P29 29 GLY G 47  ? ASN G 74  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P30 30 ILE G 80  ? ASN G 90  ? ILE G 79  ASN G 89  1 ? 11 
HELX_P HELX_P31 31 ASP G 91  ? LEU G 98  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 32 GLN G 113 ? LEU G 117 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 33 TYR H 38  ? HIS H 50  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 34 SER H 56  ? ASN H 85  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 35 THR H 91  ? LEU H 103 ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 36 PRO H 104 ? SER H 124 ? PRO H 100 SER H 120 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? E ASP 78  OD1 ? ? ? 1_555 M MG  .   MG  ? ? E ASP 77  E MG  201 1_555 ? ? ? ? ? ? ?               2.313 ? 
metalc2   metalc ? ? G GLU 65  OE2 ? ? ? 1_555 N HRU .   RU1 ? ? G GLU 64  G HRU 201 1_555 ? ? ? ? ? ? ?               2.619 ? 
metalc3   metalc ? ? J DG  58  N7  ? ? ? 1_555 R HRU .   RU1 ? ? J DG  -15 J HRU 101 1_555 ? ? ? ? ? ? ?               2.624 ? 
hydrog1   hydrog ? ? I DA  1   N1  ? ? ? 1_555 J DT  145 N3  ? ? I DA  -72 J DT  72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? I DA  1   N6  ? ? ? 1_555 J DT  145 O4  ? ? I DA  -72 J DT  72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? I DT  2   N3  ? ? ? 1_555 J DA  144 N1  ? ? I DT  -71 J DA  71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? I DT  2   O4  ? ? ? 1_555 J DA  144 N6  ? ? I DT  -71 J DA  71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? I DC  3   N3  ? ? ? 1_555 J DG  143 N1  ? ? I DC  -70 J DG  70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? I DC  3   N4  ? ? ? 1_555 J DG  143 O6  ? ? I DC  -70 J DG  70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? I DC  3   O2  ? ? ? 1_555 J DG  143 N2  ? ? I DC  -70 J DG  70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? I DA  4   N1  ? ? ? 1_555 J DT  142 N3  ? ? I DA  -69 J DT  69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? I DA  4   N6  ? ? ? 1_555 J DT  142 O4  ? ? I DA  -69 J DT  69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? I DA  5   N1  ? ? ? 1_555 J DT  141 N3  ? ? I DA  -68 J DT  68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? I DA  5   N6  ? ? ? 1_555 J DT  141 O4  ? ? I DA  -68 J DT  68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? I DT  6   N3  ? ? ? 1_555 J DA  140 N1  ? ? I DT  -67 J DA  67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? I DT  6   O4  ? ? ? 1_555 J DA  140 N6  ? ? I DT  -67 J DA  67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? I DA  7   N1  ? ? ? 1_555 J DT  139 N3  ? ? I DA  -66 J DT  66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? I DA  7   N6  ? ? ? 1_555 J DT  139 O4  ? ? I DA  -66 J DT  66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? I DT  8   N3  ? ? ? 1_555 J DA  138 N1  ? ? I DT  -65 J DA  65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? I DT  8   O4  ? ? ? 1_555 J DA  138 N6  ? ? I DT  -65 J DA  65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? I DC  9   N3  ? ? ? 1_555 J DG  137 N1  ? ? I DC  -64 J DG  64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? I DC  9   N4  ? ? ? 1_555 J DG  137 O6  ? ? I DC  -64 J DG  64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? I DC  9   O2  ? ? ? 1_555 J DG  137 N2  ? ? I DC  -64 J DG  64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? I DC  10  N3  ? ? ? 1_555 J DG  136 N1  ? ? I DC  -63 J DG  63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? I DC  10  N4  ? ? ? 1_555 J DG  136 O6  ? ? I DC  -63 J DG  63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? I DC  10  O2  ? ? ? 1_555 J DG  136 N2  ? ? I DC  -63 J DG  63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? I DA  11  N1  ? ? ? 1_555 J DT  135 N3  ? ? I DA  -62 J DT  62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? I DA  11  N6  ? ? ? 1_555 J DT  135 O4  ? ? I DA  -62 J DT  62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? I DC  12  N3  ? ? ? 1_555 J DG  134 N1  ? ? I DC  -61 J DG  61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? I DC  12  N4  ? ? ? 1_555 J DG  134 O6  ? ? I DC  -61 J DG  61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? I DC  12  O2  ? ? ? 1_555 J DG  134 N2  ? ? I DC  -61 J DG  61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? I DC  13  N3  ? ? ? 1_555 J DG  133 N1  ? ? I DC  -60 J DG  60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? I DC  13  N4  ? ? ? 1_555 J DG  133 O6  ? ? I DC  -60 J DG  60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? I DC  13  O2  ? ? ? 1_555 J DG  133 N2  ? ? I DC  -60 J DG  60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? I DT  14  N3  ? ? ? 1_555 J DA  132 N1  ? ? I DT  -59 J DA  59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? I DT  14  O4  ? ? ? 1_555 J DA  132 N6  ? ? I DT  -59 J DA  59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? I DG  15  N1  ? ? ? 1_555 J DC  131 N3  ? ? I DG  -58 J DC  58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? I DG  15  N2  ? ? ? 1_555 J DC  131 O2  ? ? I DG  -58 J DC  58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? I DG  15  O6  ? ? ? 1_555 J DC  131 N4  ? ? I DG  -58 J DC  58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? I DC  16  N3  ? ? ? 1_555 J DG  130 N1  ? ? I DC  -57 J DG  57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? I DC  16  N4  ? ? ? 1_555 J DG  130 O6  ? ? I DC  -57 J DG  57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? I DC  16  O2  ? ? ? 1_555 J DG  130 N2  ? ? I DC  -57 J DG  57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? I DA  17  N1  ? ? ? 1_555 J DT  129 N3  ? ? I DA  -56 J DT  56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? I DA  17  N6  ? ? ? 1_555 J DT  129 O4  ? ? I DA  -56 J DT  56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? I DG  18  N1  ? ? ? 1_555 J DC  128 N3  ? ? I DG  -55 J DC  55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? I DG  18  N2  ? ? ? 1_555 J DC  128 O2  ? ? I DG  -55 J DC  55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? I DG  18  O6  ? ? ? 1_555 J DC  128 N4  ? ? I DG  -55 J DC  55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? I DA  19  N1  ? ? ? 1_555 J DT  127 N3  ? ? I DA  -54 J DT  54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? I DA  19  N6  ? ? ? 1_555 J DT  127 O4  ? ? I DA  -54 J DT  54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? I DT  20  N3  ? ? ? 1_555 J DA  126 N1  ? ? I DT  -53 J DA  53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? I DT  20  O4  ? ? ? 1_555 J DA  126 N6  ? ? I DT  -53 J DA  53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? I DA  21  N1  ? ? ? 1_555 J DT  125 N3  ? ? I DA  -52 J DT  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? I DA  21  N6  ? ? ? 1_555 J DT  125 O4  ? ? I DA  -52 J DT  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? I DC  22  N4  ? ? ? 1_555 J DG  124 O6  ? ? I DC  -51 J DG  51  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog52  hydrog ? ? I DT  23  N3  ? ? ? 1_555 J DA  123 N1  ? ? I DT  -50 J DA  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? I DT  23  O4  ? ? ? 1_555 J DA  123 N6  ? ? I DT  -50 J DA  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? I DA  24  N1  ? ? ? 1_555 J DT  122 N3  ? ? I DA  -49 J DT  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? I DA  24  N6  ? ? ? 1_555 J DT  122 O4  ? ? I DA  -49 J DT  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? I DC  25  N4  ? ? ? 1_555 J DG  120 O6  ? ? I DC  -48 J DG  47  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog57  hydrog ? ? I DC  25  N3  ? ? ? 1_555 J DG  121 N1  ? ? I DC  -48 J DG  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? I DC  25  N4  ? ? ? 1_555 J DG  121 O6  ? ? I DC  -48 J DG  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? I DC  25  O2  ? ? ? 1_555 J DG  121 N2  ? ? I DC  -48 J DG  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? I DC  26  N3  ? ? ? 1_555 J DG  120 N1  ? ? I DC  -47 J DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? I DC  26  N4  ? ? ? 1_555 J DG  120 O6  ? ? I DC  -47 J DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? I DC  26  O2  ? ? ? 1_555 J DG  120 N2  ? ? I DC  -47 J DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? I DA  27  N1  ? ? ? 1_555 J DT  119 N3  ? ? I DA  -46 J DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? I DA  27  N6  ? ? ? 1_555 J DT  119 O4  ? ? I DA  -46 J DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? I DA  28  N1  ? ? ? 1_555 J DT  118 N3  ? ? I DA  -45 J DT  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? I DA  28  N6  ? ? ? 1_555 J DT  118 O4  ? ? I DA  -45 J DT  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? I DA  29  N1  ? ? ? 1_555 J DT  117 N3  ? ? I DA  -44 J DT  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? I DA  29  N6  ? ? ? 1_555 J DT  117 O4  ? ? I DA  -44 J DT  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? I DA  30  N1  ? ? ? 1_555 J DT  116 N3  ? ? I DA  -43 J DT  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? I DA  30  N6  ? ? ? 1_555 J DT  116 O4  ? ? I DA  -43 J DT  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? I DG  31  N1  ? ? ? 1_555 J DC  115 N3  ? ? I DG  -42 J DC  42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? I DG  31  N2  ? ? ? 1_555 J DC  115 O2  ? ? I DG  -42 J DC  42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? I DG  31  O6  ? ? ? 1_555 J DC  115 N4  ? ? I DG  -42 J DC  42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? I DT  32  N3  ? ? ? 1_555 J DA  114 N1  ? ? I DT  -41 J DA  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? I DT  32  O4  ? ? ? 1_555 J DA  114 N6  ? ? I DT  -41 J DA  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? I DG  33  N1  ? ? ? 1_555 J DC  113 N3  ? ? I DG  -40 J DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? I DG  33  N2  ? ? ? 1_555 J DC  113 O2  ? ? I DG  -40 J DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? I DG  33  O6  ? ? ? 1_555 J DC  113 N4  ? ? I DG  -40 J DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? I DT  34  N3  ? ? ? 1_555 J DA  112 N1  ? ? I DT  -39 J DA  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? I DT  34  O4  ? ? ? 1_555 J DA  112 N6  ? ? I DT  -39 J DA  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? I DA  35  N1  ? ? ? 1_555 J DT  111 N3  ? ? I DA  -38 J DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? I DA  35  N6  ? ? ? 1_555 J DT  111 O4  ? ? I DA  -38 J DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? I DT  36  N3  ? ? ? 1_555 J DA  110 N1  ? ? I DT  -37 J DA  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? I DT  36  O4  ? ? ? 1_555 J DA  110 N6  ? ? I DT  -37 J DA  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? I DT  37  O4  ? ? ? 1_555 J DA  108 N6  ? ? I DT  -36 J DA  35  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog86  hydrog ? ? I DT  37  N3  ? ? ? 1_555 J DA  109 N1  ? ? I DT  -36 J DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? I DT  37  O4  ? ? ? 1_555 J DA  109 N6  ? ? I DT  -36 J DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? I DT  38  O4  ? ? ? 1_555 J DC  107 N4  ? ? I DT  -35 J DC  34  1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog89  hydrog ? ? I DT  38  N3  ? ? ? 1_555 J DA  108 N1  ? ? I DT  -35 J DA  35  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog90  hydrog ? ? I DG  39  N1  ? ? ? 1_555 J DC  107 N3  ? ? I DG  -34 J DC  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? I DG  39  N2  ? ? ? 1_555 J DC  107 O2  ? ? I DG  -34 J DC  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I DG  39  O6  ? ? ? 1_555 J DC  107 N4  ? ? I DG  -34 J DC  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? I DG  40  N1  ? ? ? 1_555 J DC  106 O2  ? ? I DG  -33 J DC  33  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog94  hydrog ? ? I DA  41  N1  ? ? ? 1_555 J DT  105 N3  ? ? I DA  -32 J DT  32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I DA  41  N6  ? ? ? 1_555 J DT  105 O4  ? ? I DA  -32 J DT  32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? I DA  42  N1  ? ? ? 1_555 J DT  104 N3  ? ? I DA  -31 J DT  31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? I DA  42  N6  ? ? ? 1_555 J DT  104 O4  ? ? I DA  -31 J DT  31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? I DA  43  N1  ? ? ? 1_555 J DT  103 N3  ? ? I DA  -30 J DT  30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? I DA  43  N6  ? ? ? 1_555 J DT  103 O4  ? ? I DA  -30 J DT  30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? I DC  44  N3  ? ? ? 1_555 J DA  101 N6  ? ? I DC  -29 J DA  28  1_555 ? ? ? ? ? ? 'DC-DA MISPAIR' ?     ? 
hydrog101 hydrog ? ? I DC  44  O2  ? ? ? 1_555 J DG  102 N1  ? ? I DC  -29 J DG  29  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog102 hydrog ? ? I DT  45  N3  ? ? ? 1_555 J DA  101 N1  ? ? I DT  -28 J DA  28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? I DT  45  O4  ? ? ? 1_555 J DA  101 N6  ? ? I DT  -28 J DA  28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? I DG  46  N1  ? ? ? 1_555 J DC  100 N3  ? ? I DG  -27 J DC  27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? I DG  46  N2  ? ? ? 1_555 J DC  100 O2  ? ? I DG  -27 J DC  27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? I DG  46  O6  ? ? ? 1_555 J DC  100 N4  ? ? I DG  -27 J DC  27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I DC  47  N3  ? ? ? 1_555 J DG  99  N1  ? ? I DC  -26 J DG  26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? I DC  47  N4  ? ? ? 1_555 J DG  99  O6  ? ? I DC  -26 J DG  26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? I DC  47  O2  ? ? ? 1_555 J DG  99  N2  ? ? I DC  -26 J DG  26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? I DT  48  N3  ? ? ? 1_555 J DA  98  N1  ? ? I DT  -25 J DA  25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? I DT  48  O4  ? ? ? 1_555 J DA  98  N6  ? ? I DT  -25 J DA  25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? I DC  49  N3  ? ? ? 1_555 J DG  97  N1  ? ? I DC  -24 J DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? I DC  49  N4  ? ? ? 1_555 J DG  97  O6  ? ? I DC  -24 J DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I DC  49  O2  ? ? ? 1_555 J DG  97  N2  ? ? I DC  -24 J DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? I DC  50  N3  ? ? ? 1_555 J DG  96  N2  ? ? I DC  -23 J DG  23  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog116 hydrog ? ? I DA  51  N1  ? ? ? 1_555 J DT  95  N3  ? ? I DA  -22 J DT  22  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog117 hydrog ? ? I DT  52  O4  ? ? ? 1_555 J DG  93  N1  ? ? I DT  -21 J DG  20  1_555 ? ? ? ? ? ? 'DT-DG MISPAIR' ?     ? 
hydrog118 hydrog ? ? I DT  52  N3  ? ? ? 1_555 J DA  94  N1  ? ? I DT  -21 J DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? I DT  52  O4  ? ? ? 1_555 J DA  94  N6  ? ? I DT  -21 J DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? I DC  53  O2  ? ? ? 1_555 J DG  93  N2  ? ? I DC  -20 J DG  20  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog121 hydrog ? ? I DA  54  N6  ? ? ? 1_555 J DT  91  O4  ? ? I DA  -19 J DT  18  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog122 hydrog ? ? I DA  54  N1  ? ? ? 1_555 J DT  92  N3  ? ? I DA  -19 J DT  19  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog123 hydrog ? ? I DA  55  N6  ? ? ? 1_555 J DT  90  O4  ? ? I DA  -18 J DT  17  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog124 hydrog ? ? I DA  55  N1  ? ? ? 1_555 J DT  91  N3  ? ? I DA  -18 J DT  18  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog125 hydrog ? ? I DA  56  N6  ? ? ? 1_555 J DT  89  O4  ? ? I DA  -17 J DT  16  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog126 hydrog ? ? I DA  56  N1  ? ? ? 1_555 J DT  90  N3  ? ? I DA  -17 J DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? I DA  56  N6  ? ? ? 1_555 J DT  90  O4  ? ? I DA  -17 J DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? I DA  57  N1  ? ? ? 1_555 J DT  89  N3  ? ? I DA  -16 J DT  16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? I DA  57  N6  ? ? ? 1_555 J DT  89  O4  ? ? I DA  -16 J DT  16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? I DG  58  N1  ? ? ? 1_555 J DC  88  N3  ? ? I DG  -15 J DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? I DG  58  N2  ? ? ? 1_555 J DC  88  O2  ? ? I DG  -15 J DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? I DG  58  O6  ? ? ? 1_555 J DC  88  N4  ? ? I DG  -15 J DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? I DG  59  N1  ? ? ? 1_555 J DC  87  N3  ? ? I DG  -14 J DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? I DG  59  N2  ? ? ? 1_555 J DC  87  O2  ? ? I DG  -14 J DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? I DG  59  O6  ? ? ? 1_555 J DC  87  N4  ? ? I DG  -14 J DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? I DC  60  N3  ? ? ? 1_555 J DG  86  N1  ? ? I DC  -13 J DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? I DC  60  N4  ? ? ? 1_555 J DG  86  O6  ? ? I DC  -13 J DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? I DC  60  O2  ? ? ? 1_555 J DG  86  N2  ? ? I DC  -13 J DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? I DA  61  N1  ? ? ? 1_555 J DT  85  N3  ? ? I DA  -12 J DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? I DA  61  N6  ? ? ? 1_555 J DT  85  O4  ? ? I DA  -12 J DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? I DT  62  N3  ? ? ? 1_555 J DA  84  N1  ? ? I DT  -11 J DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? I DT  62  O4  ? ? ? 1_555 J DA  84  N6  ? ? I DT  -11 J DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? I DG  63  N1  ? ? ? 1_555 J DC  83  N3  ? ? I DG  -10 J DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? I DG  63  N2  ? ? ? 1_555 J DC  83  O2  ? ? I DG  -10 J DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? I DG  63  O6  ? ? ? 1_555 J DC  83  N4  ? ? I DG  -10 J DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? I DT  64  N3  ? ? ? 1_555 J DA  82  N1  ? ? I DT  -9  J DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? I DT  64  O4  ? ? ? 1_555 J DA  82  N6  ? ? I DT  -9  J DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? I DT  65  N3  ? ? ? 1_555 J DA  81  N1  ? ? I DT  -8  J DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? I DT  65  O4  ? ? ? 1_555 J DA  81  N6  ? ? I DT  -8  J DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? I DC  66  N3  ? ? ? 1_555 J DG  80  N1  ? ? I DC  -7  J DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? I DC  66  N4  ? ? ? 1_555 J DG  80  O6  ? ? I DC  -7  J DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? I DC  66  O2  ? ? ? 1_555 J DG  80  N2  ? ? I DC  -7  J DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? I DA  67  N1  ? ? ? 1_555 J DT  79  N3  ? ? I DA  -6  J DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? I DA  67  N6  ? ? ? 1_555 J DT  79  O4  ? ? I DA  -6  J DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? I DG  68  N1  ? ? ? 1_555 J DC  78  N3  ? ? I DG  -5  J DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? I DG  68  N2  ? ? ? 1_555 J DC  78  O2  ? ? I DG  -5  J DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? I DG  68  O6  ? ? ? 1_555 J DC  78  N4  ? ? I DG  -5  J DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? I DC  69  N3  ? ? ? 1_555 J DG  77  N1  ? ? I DC  -4  J DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? I DC  69  N4  ? ? ? 1_555 J DG  77  O6  ? ? I DC  -4  J DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? I DC  69  O2  ? ? ? 1_555 J DG  77  N2  ? ? I DC  -4  J DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? I DT  70  N3  ? ? ? 1_555 J DA  76  N1  ? ? I DT  -3  J DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? I DT  70  O4  ? ? ? 1_555 J DA  76  N6  ? ? I DT  -3  J DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? I DG  71  N1  ? ? ? 1_555 J DC  75  N3  ? ? I DG  -2  J DC  2   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog164 hydrog ? ? I DA  72  N1  ? ? ? 1_555 J DT  74  N3  ? ? I DA  -1  J DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? I DA  72  N6  ? ? ? 1_555 J DT  74  O4  ? ? I DA  -1  J DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? I DA  73  N1  ? ? ? 1_555 J DT  73  N3  ? ? I DA  0   J DT  0   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? I DA  73  N6  ? ? ? 1_555 J DT  73  O4  ? ? I DA  0   J DT  0   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? I DT  74  N3  ? ? ? 1_555 J DA  72  N1  ? ? I DT  1   J DA  -1  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? I DT  74  O4  ? ? ? 1_555 J DA  72  N6  ? ? I DT  1   J DA  -1  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? I DC  75  N3  ? ? ? 1_555 J DG  71  N1  ? ? I DC  2   J DG  -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? I DC  75  N4  ? ? ? 1_555 J DG  71  O6  ? ? I DC  2   J DG  -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? I DC  75  O2  ? ? ? 1_555 J DG  71  N2  ? ? I DC  2   J DG  -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? I DA  76  N1  ? ? ? 1_555 J DT  70  N3  ? ? I DA  3   J DT  -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? I DA  76  N6  ? ? ? 1_555 J DT  70  O4  ? ? I DA  3   J DT  -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? I DG  77  N1  ? ? ? 1_555 J DC  69  N3  ? ? I DG  4   J DC  -4  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog176 hydrog ? ? I DC  78  N3  ? ? ? 1_555 J DG  68  N1  ? ? I DC  5   J DG  -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? I DC  78  N4  ? ? ? 1_555 J DG  68  O6  ? ? I DC  5   J DG  -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? I DC  78  O2  ? ? ? 1_555 J DG  68  N2  ? ? I DC  5   J DG  -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? I DT  79  N3  ? ? ? 1_555 J DA  67  N1  ? ? I DT  6   J DA  -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? I DT  79  O4  ? ? ? 1_555 J DA  67  N6  ? ? I DT  6   J DA  -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? I DG  80  N1  ? ? ? 1_555 J DC  66  N3  ? ? I DG  7   J DC  -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? I DG  80  N2  ? ? ? 1_555 J DC  66  O2  ? ? I DG  7   J DC  -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? I DG  80  O6  ? ? ? 1_555 J DC  66  N4  ? ? I DG  7   J DC  -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? I DA  81  N1  ? ? ? 1_555 J DT  65  N3  ? ? I DA  8   J DT  -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? I DA  81  N6  ? ? ? 1_555 J DT  65  O4  ? ? I DA  8   J DT  -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? I DA  82  N1  ? ? ? 1_555 J DT  64  N3  ? ? I DA  9   J DT  -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? I DA  82  N6  ? ? ? 1_555 J DT  64  O4  ? ? I DA  9   J DT  -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? I DC  83  N3  ? ? ? 1_555 J DG  63  N1  ? ? I DC  10  J DG  -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? I DC  83  N4  ? ? ? 1_555 J DG  63  O6  ? ? I DC  10  J DG  -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? I DC  83  O2  ? ? ? 1_555 J DG  63  N2  ? ? I DC  10  J DG  -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? I DA  84  N1  ? ? ? 1_555 J DT  62  N3  ? ? I DA  11  J DT  -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? I DA  84  N6  ? ? ? 1_555 J DT  62  O4  ? ? I DA  11  J DT  -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? I DT  85  N3  ? ? ? 1_555 J DA  61  N1  ? ? I DT  12  J DA  -12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? I DT  85  O4  ? ? ? 1_555 J DA  61  N6  ? ? I DT  12  J DA  -12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? I DG  86  N1  ? ? ? 1_555 J DC  60  N3  ? ? I DG  13  J DC  -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? I DG  86  N2  ? ? ? 1_555 J DC  60  O2  ? ? I DG  13  J DC  -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? I DG  86  O6  ? ? ? 1_555 J DC  60  N4  ? ? I DG  13  J DC  -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? I DC  87  N3  ? ? ? 1_555 J DG  59  N1  ? ? I DC  14  J DG  -14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? I DC  87  N4  ? ? ? 1_555 J DG  59  O6  ? ? I DC  14  J DG  -14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? I DC  87  O2  ? ? ? 1_555 J DG  59  N2  ? ? I DC  14  J DG  -14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? I DC  88  N3  ? ? ? 1_555 J DG  58  N1  ? ? I DC  15  J DG  -15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? I DC  88  N4  ? ? ? 1_555 J DG  58  O6  ? ? I DC  15  J DG  -15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? I DC  88  O2  ? ? ? 1_555 J DG  58  N2  ? ? I DC  15  J DG  -15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? I DT  89  O4  ? ? ? 1_555 J DA  56  N6  ? ? I DT  16  J DA  -17 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog205 hydrog ? ? I DT  89  N3  ? ? ? 1_555 J DA  57  N1  ? ? I DT  16  J DA  -16 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? I DT  89  O4  ? ? ? 1_555 J DA  57  N6  ? ? I DT  16  J DA  -16 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? I DT  90  N3  ? ? ? 1_555 J DA  56  N1  ? ? I DT  17  J DA  -17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? I DT  90  O4  ? ? ? 1_555 J DA  56  N6  ? ? I DT  17  J DA  -17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? I DT  91  N3  ? ? ? 1_555 J DA  55  N1  ? ? I DT  18  J DA  -18 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog210 hydrog ? ? I DT  92  N3  ? ? ? 1_555 J DA  54  N1  ? ? I DT  19  J DA  -19 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog211 hydrog ? ? I DG  93  N1  ? ? ? 1_555 J DC  53  N3  ? ? I DG  20  J DC  -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? I DG  93  N2  ? ? ? 1_555 J DC  53  O2  ? ? I DG  20  J DC  -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? I DG  93  O6  ? ? ? 1_555 J DC  53  N4  ? ? I DG  20  J DC  -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? I DA  94  N1  ? ? ? 1_555 J DT  52  N3  ? ? I DA  21  J DT  -21 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog215 hydrog ? ? I DT  95  N3  ? ? ? 1_555 J DA  51  N1  ? ? I DT  22  J DA  -22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? I DT  95  O4  ? ? ? 1_555 J DA  51  N6  ? ? I DT  22  J DA  -22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? I DG  96  N1  ? ? ? 1_555 J DC  50  N3  ? ? I DG  23  J DC  -23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? I DG  96  N2  ? ? ? 1_555 J DC  50  O2  ? ? I DG  23  J DC  -23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? I DG  96  O6  ? ? ? 1_555 J DC  50  N4  ? ? I DG  23  J DC  -23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? I DG  97  N1  ? ? ? 1_555 J DC  49  N3  ? ? I DG  24  J DC  -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? I DG  97  N2  ? ? ? 1_555 J DC  49  O2  ? ? I DG  24  J DC  -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? I DG  97  O6  ? ? ? 1_555 J DC  49  N4  ? ? I DG  24  J DC  -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? I DA  98  N1  ? ? ? 1_555 J DT  48  N3  ? ? I DA  25  J DT  -25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? I DA  98  N6  ? ? ? 1_555 J DT  48  O4  ? ? I DA  25  J DT  -25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? I DG  99  N1  ? ? ? 1_555 J DC  47  N3  ? ? I DG  26  J DC  -26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? I DG  99  N2  ? ? ? 1_555 J DC  47  O2  ? ? I DG  26  J DC  -26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? I DG  99  O6  ? ? ? 1_555 J DC  47  N4  ? ? I DG  26  J DC  -26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? I DC  100 N3  ? ? ? 1_555 J DG  46  N1  ? ? I DC  27  J DG  -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? I DC  100 N4  ? ? ? 1_555 J DG  46  O6  ? ? I DC  27  J DG  -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? I DC  100 O2  ? ? ? 1_555 J DG  46  N2  ? ? I DC  27  J DG  -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? I DG  102 N1  ? ? ? 1_555 J DC  44  N3  ? ? I DG  29  J DC  -29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? I DG  102 N2  ? ? ? 1_555 J DC  44  O2  ? ? I DG  29  J DC  -29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? I DG  102 O6  ? ? ? 1_555 J DC  44  N4  ? ? I DG  29  J DC  -29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? I DT  103 N3  ? ? ? 1_555 J DA  43  N1  ? ? I DT  30  J DA  -30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? I DT  103 O4  ? ? ? 1_555 J DA  43  N6  ? ? I DT  30  J DA  -30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? I DT  105 N3  ? ? ? 1_555 J DA  41  N1  ? ? I DT  32  J DA  -32 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog237 hydrog ? ? I DC  106 N4  ? ? ? 1_555 J DG  40  O6  ? ? I DC  33  J DG  -33 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog238 hydrog ? ? I DC  107 O2  ? ? ? 1_555 J DG  39  N2  ? ? I DC  34  J DG  -34 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog239 hydrog ? ? I DA  108 N1  ? ? ? 1_555 J DT  38  N3  ? ? I DA  35  J DT  -35 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? I DA  108 N6  ? ? ? 1_555 J DT  38  O4  ? ? I DA  35  J DT  -35 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? I DA  109 N1  ? ? ? 1_555 J DT  37  N3  ? ? I DA  36  J DT  -36 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog242 hydrog ? ? I DA  110 N1  ? ? ? 1_555 J DT  36  N3  ? ? I DA  37  J DT  -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? I DA  110 N6  ? ? ? 1_555 J DT  36  O4  ? ? I DA  37  J DT  -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? I DT  111 N3  ? ? ? 1_555 J DA  35  N1  ? ? I DT  38  J DA  -38 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? I DT  111 O4  ? ? ? 1_555 J DA  35  N6  ? ? I DT  38  J DA  -38 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? I DA  112 N1  ? ? ? 1_555 J DT  34  N3  ? ? I DA  39  J DT  -39 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? I DA  112 N6  ? ? ? 1_555 J DT  34  O4  ? ? I DA  39  J DT  -39 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? I DC  113 N3  ? ? ? 1_555 J DG  33  N1  ? ? I DC  40  J DG  -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? I DC  113 N4  ? ? ? 1_555 J DG  33  O6  ? ? I DC  40  J DG  -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? I DC  113 O2  ? ? ? 1_555 J DG  33  N2  ? ? I DC  40  J DG  -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? I DA  114 N1  ? ? ? 1_555 J DT  32  N3  ? ? I DA  41  J DT  -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ? ? I DA  114 N6  ? ? ? 1_555 J DT  32  O4  ? ? I DA  41  J DT  -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ? ? I DC  115 N3  ? ? ? 1_555 J DG  31  N1  ? ? I DC  42  J DG  -42 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ? ? I DC  115 N4  ? ? ? 1_555 J DG  31  O6  ? ? I DC  42  J DG  -42 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ? ? I DC  115 O2  ? ? ? 1_555 J DG  31  N2  ? ? I DC  42  J DG  -42 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog256 hydrog ? ? I DT  116 N3  ? ? ? 1_555 J DA  30  N1  ? ? I DT  43  J DA  -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog257 hydrog ? ? I DT  116 O4  ? ? ? 1_555 J DA  30  N6  ? ? I DT  43  J DA  -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ? ? I DT  117 N3  ? ? ? 1_555 J DA  29  N1  ? ? I DT  44  J DA  -44 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog259 hydrog ? ? I DT  118 N3  ? ? ? 1_555 J DA  28  N1  ? ? I DT  45  J DA  -45 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog260 hydrog ? ? I DT  118 O4  ? ? ? 1_555 J DA  28  N6  ? ? I DT  45  J DA  -45 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog261 hydrog ? ? I DT  119 N3  ? ? ? 1_555 J DA  27  N1  ? ? I DT  46  J DA  -46 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog262 hydrog ? ? I DG  120 N1  ? ? ? 1_555 J DC  26  N3  ? ? I DG  47  J DC  -47 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog263 hydrog ? ? I DG  120 N2  ? ? ? 1_555 J DC  26  O2  ? ? I DG  47  J DC  -47 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? I DG  120 O6  ? ? ? 1_555 J DC  26  N4  ? ? I DG  47  J DC  -47 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? I DG  121 N1  ? ? ? 1_555 J DC  25  N3  ? ? I DG  48  J DC  -48 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog266 hydrog ? ? I DT  122 N3  ? ? ? 1_555 J DA  24  N1  ? ? I DT  49  J DA  -49 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog267 hydrog ? ? I DA  123 N1  ? ? ? 1_555 J DT  23  N3  ? ? I DA  50  J DT  -50 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog268 hydrog ? ? I DG  124 N1  ? ? ? 1_555 J DC  22  N3  ? ? I DG  51  J DC  -51 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? I DG  124 N2  ? ? ? 1_555 J DC  22  O2  ? ? I DG  51  J DC  -51 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? I DG  124 O6  ? ? ? 1_555 J DC  22  N4  ? ? I DG  51  J DC  -51 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? I DT  125 N3  ? ? ? 1_555 J DA  21  N1  ? ? I DT  52  J DA  -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? I DT  125 O4  ? ? ? 1_555 J DA  21  N6  ? ? I DT  52  J DA  -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? I DA  126 N1  ? ? ? 1_555 J DT  20  N3  ? ? I DA  53  J DT  -53 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog274 hydrog ? ? I DA  126 N6  ? ? ? 1_555 J DT  20  O4  ? ? I DA  53  J DT  -53 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? I DT  127 N3  ? ? ? 1_555 J DA  19  N1  ? ? I DT  54  J DA  -54 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog276 hydrog ? ? I DC  128 N3  ? ? ? 1_555 J DG  18  N1  ? ? I DC  55  J DG  -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog277 hydrog ? ? I DC  128 N4  ? ? ? 1_555 J DG  18  O6  ? ? I DC  55  J DG  -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog278 hydrog ? ? I DC  128 O2  ? ? ? 1_555 J DG  18  N2  ? ? I DC  55  J DG  -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? I DT  129 N3  ? ? ? 1_555 J DA  17  N1  ? ? I DT  56  J DA  -56 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ? ? I DT  129 O4  ? ? ? 1_555 J DA  17  N6  ? ? I DT  56  J DA  -56 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ? ? I DG  130 N1  ? ? ? 1_555 J DC  16  N3  ? ? I DG  57  J DC  -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ? ? I DG  130 N2  ? ? ? 1_555 J DC  16  O2  ? ? I DG  57  J DC  -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog283 hydrog ? ? I DG  130 O6  ? ? ? 1_555 J DC  16  N4  ? ? I DG  57  J DC  -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? I DC  131 N3  ? ? ? 1_555 J DG  15  N1  ? ? I DC  58  J DG  -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ? ? I DC  131 N4  ? ? ? 1_555 J DG  15  O6  ? ? I DC  58  J DG  -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? I DC  131 O2  ? ? ? 1_555 J DG  15  N2  ? ? I DC  58  J DG  -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? I DA  132 N1  ? ? ? 1_555 J DT  14  N3  ? ? I DA  59  J DT  -59 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog288 hydrog ? ? I DG  133 N1  ? ? ? 1_555 J DC  13  N3  ? ? I DG  60  J DC  -60 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog289 hydrog ? ? I DG  133 N2  ? ? ? 1_555 J DC  13  O2  ? ? I DG  60  J DC  -60 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog290 hydrog ? ? I DG  133 O6  ? ? ? 1_555 J DC  13  N4  ? ? I DG  60  J DC  -60 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog291 hydrog ? ? I DG  134 N1  ? ? ? 1_555 J DC  12  N3  ? ? I DG  61  J DC  -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog292 hydrog ? ? I DG  134 N2  ? ? ? 1_555 J DC  12  O2  ? ? I DG  61  J DC  -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog293 hydrog ? ? I DG  134 O6  ? ? ? 1_555 J DC  12  N4  ? ? I DG  61  J DC  -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog294 hydrog ? ? I DT  135 N3  ? ? ? 1_555 J DA  11  N1  ? ? I DT  62  J DA  -62 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog295 hydrog ? ? I DT  135 O4  ? ? ? 1_555 J DA  11  N6  ? ? I DT  62  J DA  -62 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog296 hydrog ? ? I DG  136 N1  ? ? ? 1_555 J DC  10  N3  ? ? I DG  63  J DC  -63 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog297 hydrog ? ? I DG  136 N2  ? ? ? 1_555 J DC  10  O2  ? ? I DG  63  J DC  -63 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog298 hydrog ? ? I DG  136 O6  ? ? ? 1_555 J DC  10  N4  ? ? I DG  63  J DC  -63 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog299 hydrog ? ? I DG  137 N1  ? ? ? 1_555 J DC  9   N3  ? ? I DG  64  J DC  -64 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog300 hydrog ? ? I DA  138 N1  ? ? ? 1_555 J DT  8   N3  ? ? I DA  65  J DT  -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog301 hydrog ? ? I DA  138 N6  ? ? ? 1_555 J DT  8   O4  ? ? I DA  65  J DT  -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog302 hydrog ? ? I DT  139 N3  ? ? ? 1_555 J DA  7   N1  ? ? I DT  66  J DA  -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog303 hydrog ? ? I DT  139 O4  ? ? ? 1_555 J DA  7   N6  ? ? I DT  66  J DA  -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog304 hydrog ? ? I DA  140 N1  ? ? ? 1_555 J DT  6   N3  ? ? I DA  67  J DT  -67 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog305 hydrog ? ? I DA  140 N6  ? ? ? 1_555 J DT  6   O4  ? ? I DA  67  J DT  -67 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog306 hydrog ? ? I DT  141 N3  ? ? ? 1_555 J DA  5   N1  ? ? I DT  68  J DA  -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog307 hydrog ? ? I DT  141 O4  ? ? ? 1_555 J DA  5   N6  ? ? I DT  68  J DA  -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog308 hydrog ? ? I DT  142 N3  ? ? ? 1_555 J DA  4   N1  ? ? I DT  69  J DA  -69 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog309 hydrog ? ? I DT  142 O4  ? ? ? 1_555 J DA  4   N6  ? ? I DT  69  J DA  -69 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog310 hydrog ? ? I DG  143 N1  ? ? ? 1_555 J DC  3   N3  ? ? I DG  70  J DC  -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog311 hydrog ? ? I DG  143 N2  ? ? ? 1_555 J DC  3   O2  ? ? I DG  70  J DC  -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog312 hydrog ? ? I DG  143 O6  ? ? ? 1_555 J DC  3   N4  ? ? I DG  70  J DC  -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog313 hydrog ? ? I DA  144 N1  ? ? ? 1_555 J DT  2   N3  ? ? I DA  71  J DT  -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog314 hydrog ? ? I DA  144 N6  ? ? ? 1_555 J DT  2   O4  ? ? I DA  71  J DT  -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog315 hydrog ? ? I DT  145 N3  ? ? ? 1_555 J DA  1   N1  ? ? I DT  72  J DA  -72 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog316 hydrog ? ? I DT  145 O4  ? ? ? 1_555 J DA  1   N6  ? ? I DT  72  J DA  -72 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 84  ? PHE A 85  ? ARG A 83  PHE A 84  
A 2 THR B 81  ? VAL B 82  ? THR B 80  VAL B 81  
B 1 THR A 119 ? ILE A 120 ? THR A 118 ILE A 119 
B 2 ARG B 46  ? ILE B 47  ? ARG B 45  ILE B 46  
C 1 THR B 97  ? TYR B 99  ? THR B 96  TYR B 98  
C 2 VAL G 101 ? ILE G 103 ? VAL G 100 ILE G 102 
D 1 ARG C 43  ? VAL C 44  ? ARG C 42  VAL C 43  
D 2 THR D 89  ? ILE D 90  ? THR D 85  ILE D 86  
E 1 ARG C 78  ? ILE C 79  ? ARG C 77  ILE C 78  
E 2 GLY D 54  ? ILE D 55  ? GLY D 50  ILE D 51  
F 1 VAL C 101 ? ILE C 103 ? VAL C 100 ILE C 102 
F 2 THR F 97  ? TYR F 99  ? THR F 96  TYR F 98  
G 1 ARG E 84  ? PHE E 85  ? ARG E 83  PHE E 84  
G 2 THR F 81  ? VAL F 82  ? THR F 80  VAL F 81  
H 1 THR E 119 ? ILE E 120 ? THR E 118 ILE E 119 
H 2 ARG F 46  ? ILE F 47  ? ARG F 45  ILE F 46  
I 1 ARG G 43  ? VAL G 44  ? ARG G 42  VAL G 43  
I 2 THR H 89  ? ILE H 90  ? THR H 85  ILE H 86  
J 1 ARG G 78  ? ILE G 79  ? ARG G 77  ILE G 78  
J 2 GLY H 54  ? ILE H 55  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 84  ? N ARG A 83  O VAL B 82  ? O VAL B 81  
B 1 2 N ILE A 120 ? N ILE A 119 O ARG B 46  ? O ARG B 45  
C 1 2 N TYR B 99  ? N TYR B 98  O THR G 102 ? O THR G 101 
D 1 2 N ARG C 43  ? N ARG C 42  O ILE D 90  ? O ILE D 86  
E 1 2 N ILE C 79  ? N ILE C 78  O GLY D 54  ? O GLY D 50  
F 1 2 N THR C 102 ? N THR C 101 O TYR F 99  ? O TYR F 98  
G 1 2 N ARG E 84  ? N ARG E 83  O VAL F 82  ? O VAL F 81  
H 1 2 N ILE E 120 ? N ILE E 119 O ARG F 46  ? O ARG F 45  
I 1 2 N ARG G 43  ? N ARG G 42  O ILE H 90  ? O ILE H 86  
J 1 2 N ILE G 79  ? N ILE G 78  O GLY H 54  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE HRU C 201' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 D 201' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG E 201'  
AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE HRU G 201' 
AC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 H 201' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 H 202' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE HRU I 101' 
AC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE HRU J 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ASN C 39  ? ASN C 38  . ? 1_555 ? 
2  AC1 5 GLU C 42  ? GLU C 41  . ? 1_555 ? 
3  AC1 5 ASN G 39  ? ASN G 38  . ? 1_555 ? 
4  AC1 5 GLU G 42  ? GLU G 41  . ? 1_555 ? 
5  AC1 5 DC  I 113 ? DC  I 40  . ? 1_555 ? 
6  AC2 6 ALA C 46  ? ALA C 45  . ? 1_555 ? 
7  AC2 6 GLY C 47  ? GLY C 46  . ? 1_555 ? 
8  AC2 6 ALA C 48  ? ALA C 47  . ? 1_555 ? 
9  AC2 6 THR D 91  ? THR D 87  . ? 1_555 ? 
10 AC2 6 SER D 92  ? SER D 88  . ? 1_555 ? 
11 AC2 6 DT  J 111 ? DT  J 38  . ? 1_555 ? 
12 AC3 2 VAL D 49  ? VAL D 45  . ? 3_545 ? 
13 AC3 2 ASP E 78  ? ASP E 77  . ? 1_555 ? 
14 AC4 2 GLU G 62  ? GLU G 61  . ? 1_555 ? 
15 AC4 2 GLU G 65  ? GLU G 64  . ? 1_555 ? 
16 AC5 7 GLY G 45  ? GLY G 44  . ? 1_555 ? 
17 AC5 7 ALA G 46  ? ALA G 45  . ? 1_555 ? 
18 AC5 7 GLY G 47  ? GLY G 46  . ? 1_555 ? 
19 AC5 7 ALA G 48  ? ALA G 47  . ? 1_555 ? 
20 AC5 7 THR H 91  ? THR H 87  . ? 1_555 ? 
21 AC5 7 SER H 92  ? SER H 88  . ? 1_555 ? 
22 AC5 7 DT  I 111 ? DT  I 38  . ? 1_555 ? 
23 AC6 4 HIS H 50  ? HIS H 46  . ? 1_555 ? 
24 AC6 4 PRO H 51  ? PRO H 47  . ? 1_555 ? 
25 AC6 4 ASP H 52  ? ASP H 48  . ? 1_555 ? 
26 AC6 4 THR H 53  ? THR H 49  . ? 1_555 ? 
27 AC7 4 DG  I 59  ? DG  I -14 . ? 1_555 ? 
28 AC7 4 DG  I 58  ? DG  I -15 . ? 1_555 ? 
29 AC7 4 DG  J 86  ? DG  J 13  . ? 1_555 ? 
30 AC7 4 DC  J 87  ? DC  J 14  . ? 1_555 ? 
31 AC8 2 DG  J 59  ? DG  J -14 . ? 1_555 ? 
32 AC8 2 DG  J 58  ? DG  J -15 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4KGC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4KGC 
_atom_sites.fract_transf_matrix[1][1]   0.009379 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009115 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005496 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
RU 
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . PRO A 1 39  ? -60.512 -29.785 80.315 1.00 96.42  ? 38  PRO A N     1 
ATOM   2     C  CA    . PRO A 1 39  ? -59.432 -28.848 79.980 1.00 96.26  ? 38  PRO A CA    1 
ATOM   3     C  C     . PRO A 1 39  ? -58.068 -29.545 79.872 1.00 95.94  ? 38  PRO A C     1 
ATOM   4     O  O     . PRO A 1 39  ? -57.314 -29.617 80.856 1.00 95.97  ? 38  PRO A O     1 
ATOM   5     C  CB    . PRO A 1 39  ? -59.454 -27.846 81.145 1.00 96.39  ? 38  PRO A CB    1 
ATOM   6     C  CG    . PRO A 1 39  ? -60.186 -28.565 82.290 1.00 96.69  ? 38  PRO A CG    1 
ATOM   7     C  CD    . PRO A 1 39  ? -60.749 -29.870 81.770 1.00 96.46  ? 38  PRO A CD    1 
ATOM   8     N  N     . HIS A 1 40  ? -57.774 -30.056 78.672 1.00 95.43  ? 39  HIS A N     1 
ATOM   9     C  CA    . HIS A 1 40  ? -56.544 -30.804 78.397 1.00 94.53  ? 39  HIS A CA    1 
ATOM   10    C  C     . HIS A 1 40  ? -55.484 -29.889 77.790 1.00 93.23  ? 39  HIS A C     1 
ATOM   11    O  O     . HIS A 1 40  ? -55.773 -29.095 76.886 1.00 92.99  ? 39  HIS A O     1 
ATOM   12    C  CB    . HIS A 1 40  ? -56.837 -31.973 77.449 1.00 95.13  ? 39  HIS A CB    1 
ATOM   13    C  CG    . HIS A 1 40  ? -55.892 -33.129 77.591 1.00 96.53  ? 39  HIS A CG    1 
ATOM   14    N  ND1   . HIS A 1 40  ? -55.129 -33.601 76.541 1.00 97.82  ? 39  HIS A ND1   1 
ATOM   15    C  CD2   . HIS A 1 40  ? -55.599 -33.917 78.655 1.00 97.12  ? 39  HIS A CD2   1 
ATOM   16    C  CE1   . HIS A 1 40  ? -54.405 -34.627 76.955 1.00 98.66  ? 39  HIS A CE1   1 
ATOM   17    N  NE2   . HIS A 1 40  ? -54.671 -34.839 78.234 1.00 98.21  ? 39  HIS A NE2   1 
ATOM   18    N  N     . ARG A 1 41  ? -54.259 -30.015 78.291 1.00 91.53  ? 40  ARG A N     1 
ATOM   19    C  CA    . ARG A 1 41  ? -53.174 -29.125 77.895 1.00 89.80  ? 40  ARG A CA    1 
ATOM   20    C  C     . ARG A 1 41  ? -51.913 -29.899 77.497 1.00 88.46  ? 40  ARG A C     1 
ATOM   21    O  O     . ARG A 1 41  ? -51.480 -30.813 78.216 1.00 88.47  ? 40  ARG A O     1 
ATOM   22    C  CB    . ARG A 1 41  ? -52.876 -28.137 79.027 1.00 89.85  ? 40  ARG A CB    1 
ATOM   23    C  CG    . ARG A 1 41  ? -52.124 -26.904 78.592 1.00 89.43  ? 40  ARG A CG    1 
ATOM   24    C  CD    . ARG A 1 41  ? -52.072 -25.868 79.695 1.00 88.34  ? 40  ARG A CD    1 
ATOM   25    N  NE    . ARG A 1 41  ? -51.107 -24.813 79.394 1.00 87.96  ? 40  ARG A NE    1 
ATOM   26    C  CZ    . ARG A 1 41  ? -51.361 -23.741 78.645 1.00 87.94  ? 40  ARG A CZ    1 
ATOM   27    N  NH1   . ARG A 1 41  ? -52.562 -23.554 78.106 1.00 88.49  ? 40  ARG A NH1   1 
ATOM   28    N  NH2   . ARG A 1 41  ? -50.406 -22.847 78.436 1.00 87.32  ? 40  ARG A NH2   1 
ATOM   29    N  N     . TYR A 1 42  ? -51.338 -29.526 76.349 1.00 86.61  ? 41  TYR A N     1 
ATOM   30    C  CA    . TYR A 1 42  ? -50.138 -30.183 75.816 1.00 84.69  ? 41  TYR A CA    1 
ATOM   31    C  C     . TYR A 1 42  ? -48.856 -29.579 76.390 1.00 83.46  ? 41  TYR A C     1 
ATOM   32    O  O     . TYR A 1 42  ? -48.741 -28.362 76.514 1.00 83.31  ? 41  TYR A O     1 
ATOM   33    C  CB    . TYR A 1 42  ? -50.118 -30.131 74.278 1.00 84.54  ? 41  TYR A CB    1 
ATOM   34    C  CG    . TYR A 1 42  ? -51.087 -31.081 73.586 1.00 83.54  ? 41  TYR A CG    1 
ATOM   35    C  CD1   . TYR A 1 42  ? -52.070 -30.596 72.716 1.00 83.03  ? 41  TYR A CD1   1 
ATOM   36    C  CD2   . TYR A 1 42  ? -51.011 -32.460 73.788 1.00 82.87  ? 41  TYR A CD2   1 
ATOM   37    C  CE1   . TYR A 1 42  ? -52.961 -31.454 72.075 1.00 82.23  ? 41  TYR A CE1   1 
ATOM   38    C  CE2   . TYR A 1 42  ? -51.896 -33.328 73.151 1.00 82.71  ? 41  TYR A CE2   1 
ATOM   39    C  CZ    . TYR A 1 42  ? -52.866 -32.815 72.296 1.00 82.77  ? 41  TYR A CZ    1 
ATOM   40    O  OH    . TYR A 1 42  ? -53.739 -33.671 71.665 1.00 83.86  ? 41  TYR A OH    1 
ATOM   41    N  N     . ARG A 1 43  ? -47.903 -30.439 76.743 1.00 82.14  ? 42  ARG A N     1 
ATOM   42    C  CA    . ARG A 1 43  ? -46.609 -30.016 77.291 1.00 81.09  ? 42  ARG A CA    1 
ATOM   43    C  C     . ARG A 1 43  ? -45.825 -29.150 76.292 1.00 80.10  ? 42  ARG A C     1 
ATOM   44    O  O     . ARG A 1 43  ? -45.870 -29.408 75.085 1.00 80.33  ? 42  ARG A O     1 
ATOM   45    C  CB    . ARG A 1 43  ? -45.757 -31.236 77.672 1.00 81.12  ? 42  ARG A CB    1 
ATOM   46    C  CG    . ARG A 1 43  ? -46.476 -32.323 78.461 1.00 82.25  ? 42  ARG A CG    1 
ATOM   47    C  CD    . ARG A 1 43  ? -46.623 -31.975 79.928 1.00 84.21  ? 42  ARG A CD    1 
ATOM   48    N  NE    . ARG A 1 43  ? -45.439 -32.353 80.692 1.00 86.40  ? 42  ARG A NE    1 
ATOM   49    C  CZ    . ARG A 1 43  ? -45.230 -33.559 81.216 1.00 88.07  ? 42  ARG A CZ    1 
ATOM   50    N  NH1   . ARG A 1 43  ? -46.128 -34.526 81.059 1.00 89.34  ? 42  ARG A NH1   1 
ATOM   51    N  NH2   . ARG A 1 43  ? -44.119 -33.803 81.902 1.00 88.88  ? 42  ARG A NH2   1 
ATOM   52    N  N     . PRO A 1 44  ? -45.086 -28.134 76.788 1.00 78.82  ? 43  PRO A N     1 
ATOM   53    C  CA    . PRO A 1 44  ? -44.262 -27.329 75.895 1.00 77.76  ? 43  PRO A CA    1 
ATOM   54    C  C     . PRO A 1 44  ? -43.379 -28.224 75.048 1.00 76.65  ? 43  PRO A C     1 
ATOM   55    O  O     . PRO A 1 44  ? -42.693 -29.103 75.587 1.00 76.26  ? 43  PRO A O     1 
ATOM   56    C  CB    . PRO A 1 44  ? -43.389 -26.519 76.858 1.00 77.72  ? 43  PRO A CB    1 
ATOM   57    C  CG    . PRO A 1 44  ? -44.157 -26.457 78.099 1.00 78.17  ? 43  PRO A CG    1 
ATOM   58    C  CD    . PRO A 1 44  ? -44.874 -27.763 78.197 1.00 78.88  ? 43  PRO A CD    1 
ATOM   59    N  N     . GLY A 1 45  ? -43.424 -28.023 73.734 1.00 75.34  ? 44  GLY A N     1 
ATOM   60    C  CA    . GLY A 1 45  ? -42.575 -28.788 72.827 1.00 74.17  ? 44  GLY A CA    1 
ATOM   61    C  C     . GLY A 1 45  ? -43.264 -29.945 72.138 1.00 73.33  ? 44  GLY A C     1 
ATOM   62    O  O     . GLY A 1 45  ? -42.766 -30.451 71.138 1.00 73.78  ? 44  GLY A O     1 
ATOM   63    N  N     . THR A 1 46  ? -44.405 -30.376 72.670 1.00 72.40  ? 45  THR A N     1 
ATOM   64    C  CA    . THR A 1 46  ? -45.154 -31.469 72.065 1.00 71.18  ? 45  THR A CA    1 
ATOM   65    C  C     . THR A 1 46  ? -45.774 -30.993 70.757 1.00 70.28  ? 45  THR A C     1 
ATOM   66    O  O     . THR A 1 46  ? -45.642 -31.654 69.730 1.00 70.17  ? 45  THR A O     1 
ATOM   67    C  CB    . THR A 1 46  ? -46.200 -32.048 73.045 1.00 71.31  ? 45  THR A CB    1 
ATOM   68    O  OG1   . THR A 1 46  ? -45.507 -32.695 74.121 1.00 71.79  ? 45  THR A OG1   1 
ATOM   69    C  CG2   . THR A 1 46  ? -47.099 -33.086 72.364 1.00 71.03  ? 45  THR A CG2   1 
ATOM   70    N  N     . VAL A 1 47  ? -46.420 -29.834 70.795 1.00 69.13  ? 46  VAL A N     1 
ATOM   71    C  CA    . VAL A 1 47  ? -46.991 -29.244 69.592 1.00 68.45  ? 46  VAL A CA    1 
ATOM   72    C  C     . VAL A 1 47  ? -45.890 -28.798 68.626 1.00 68.03  ? 46  VAL A C     1 
ATOM   73    O  O     . VAL A 1 47  ? -46.075 -28.835 67.406 1.00 68.16  ? 46  VAL A O     1 
ATOM   74    C  CB    . VAL A 1 47  ? -47.885 -28.034 69.919 1.00 68.50  ? 46  VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1 47  ? -48.659 -27.575 68.678 1.00 67.82  ? 46  VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1 47  ? -48.823 -28.370 71.062 1.00 68.41  ? 46  VAL A CG2   1 
ATOM   77    N  N     . ALA A 1 48  ? -44.753 -28.377 69.170 1.00 67.05  ? 47  ALA A N     1 
ATOM   78    C  CA    . ALA A 1 48  ? -43.625 -28.005 68.339 1.00 66.45  ? 47  ALA A CA    1 
ATOM   79    C  C     . ALA A 1 48  ? -43.207 -29.196 67.473 1.00 66.06  ? 47  ALA A C     1 
ATOM   80    O  O     . ALA A 1 48  ? -43.212 -29.100 66.246 1.00 66.24  ? 47  ALA A O     1 
ATOM   81    C  CB    . ALA A 1 48  ? -42.480 -27.518 69.185 1.00 66.51  ? 47  ALA A CB    1 
ATOM   82    N  N     . LEU A 1 49  ? -42.880 -30.318 68.112 1.00 65.27  ? 48  LEU A N     1 
ATOM   83    C  CA    . LEU A 1 49  ? -42.569 -31.566 67.417 1.00 64.73  ? 48  LEU A CA    1 
ATOM   84    C  C     . LEU A 1 49  ? -43.616 -31.965 66.368 1.00 64.59  ? 48  LEU A C     1 
ATOM   85    O  O     . LEU A 1 49  ? -43.282 -32.516 65.311 1.00 64.54  ? 48  LEU A O     1 
ATOM   86    C  CB    . LEU A 1 49  ? -42.429 -32.686 68.436 1.00 64.63  ? 48  LEU A CB    1 
ATOM   87    C  CG    . LEU A 1 49  ? -41.055 -33.106 68.969 1.00 65.22  ? 48  LEU A CG    1 
ATOM   88    C  CD1   . LEU A 1 49  ? -39.938 -32.111 68.662 1.00 65.97  ? 48  LEU A CD1   1 
ATOM   89    C  CD2   . LEU A 1 49  ? -41.158 -33.351 70.460 1.00 65.25  ? 48  LEU A CD2   1 
ATOM   90    N  N     . ARG A 1 50  ? -44.880 -31.683 66.671 1.00 63.99  ? 49  ARG A N     1 
ATOM   91    C  CA    . ARG A 1 50  ? -45.991 -32.063 65.813 1.00 63.43  ? 49  ARG A CA    1 
ATOM   92    C  C     . ARG A 1 50  ? -45.970 -31.219 64.554 1.00 62.80  ? 49  ARG A C     1 
ATOM   93    O  O     . ARG A 1 50  ? -46.285 -31.691 63.459 1.00 62.62  ? 49  ARG A O     1 
ATOM   94    C  CB    . ARG A 1 50  ? -47.298 -31.840 66.568 1.00 63.77  ? 49  ARG A CB    1 
ATOM   95    C  CG    . ARG A 1 50  ? -48.536 -32.456 65.931 1.00 64.73  ? 49  ARG A CG    1 
ATOM   96    C  CD    . ARG A 1 50  ? -49.505 -32.933 67.017 1.00 66.40  ? 49  ARG A CD    1 
ATOM   97    N  NE    . ARG A 1 50  ? -50.361 -31.868 67.538 1.00 66.21  ? 49  ARG A NE    1 
ATOM   98    C  CZ    . ARG A 1 50  ? -50.639 -31.703 68.834 1.00 66.03  ? 49  ARG A CZ    1 
ATOM   99    N  NH1   . ARG A 1 50  ? -50.110 -32.520 69.746 1.00 64.42  ? 49  ARG A NH1   1 
ATOM   100   N  NH2   . ARG A 1 50  ? -51.425 -30.703 69.222 1.00 64.88  ? 49  ARG A NH2   1 
ATOM   101   N  N     . GLU A 1 51  ? -45.612 -29.954 64.731 1.00 61.99  ? 50  GLU A N     1 
ATOM   102   C  CA    . GLU A 1 51  ? -45.526 -29.031 63.630 1.00 61.12  ? 50  GLU A CA    1 
ATOM   103   C  C     . GLU A 1 51  ? -44.319 -29.370 62.772 1.00 60.36  ? 50  GLU A C     1 
ATOM   104   O  O     . GLU A 1 51  ? -44.363 -29.214 61.553 1.00 60.52  ? 50  GLU A O     1 
ATOM   105   C  CB    . GLU A 1 51  ? -45.456 -27.601 64.142 1.00 61.35  ? 50  GLU A CB    1 
ATOM   106   C  CG    . GLU A 1 51  ? -46.766 -27.056 64.656 1.00 62.78  ? 50  GLU A CG    1 
ATOM   107   C  CD    . GLU A 1 51  ? -46.647 -25.641 65.216 1.00 65.71  ? 50  GLU A CD    1 
ATOM   108   O  OE1   . GLU A 1 51  ? -45.707 -24.903 64.845 1.00 66.77  ? 50  GLU A OE1   1 
ATOM   109   O  OE2   . GLU A 1 51  ? -47.507 -25.249 66.033 1.00 67.89  ? 50  GLU A OE2   1 
ATOM   110   N  N     . ILE A 1 52  ? -43.245 -29.856 63.385 1.00 59.51  ? 51  ILE A N     1 
ATOM   111   C  CA    . ILE A 1 52  ? -42.078 -30.261 62.590 1.00 58.89  ? 51  ILE A CA    1 
ATOM   112   C  C     . ILE A 1 52  ? -42.485 -31.359 61.613 1.00 58.69  ? 51  ILE A C     1 
ATOM   113   O  O     . ILE A 1 52  ? -42.270 -31.236 60.414 1.00 58.38  ? 51  ILE A O     1 
ATOM   114   C  CB    . ILE A 1 52  ? -40.881 -30.703 63.454 1.00 58.68  ? 51  ILE A CB    1 
ATOM   115   C  CG1   . ILE A 1 52  ? -40.265 -29.494 64.160 1.00 58.64  ? 51  ILE A CG1   1 
ATOM   116   C  CG2   . ILE A 1 52  ? -39.832 -31.382 62.601 1.00 57.69  ? 51  ILE A CG2   1 
ATOM   117   C  CD1   . ILE A 1 52  ? -39.464 -29.840 65.418 1.00 57.25  ? 51  ILE A CD1   1 
ATOM   118   N  N     . ARG A 1 53  ? -43.113 -32.406 62.135 1.00 58.73  ? 52  ARG A N     1 
ATOM   119   C  CA    . ARG A 1 53  ? -43.579 -33.518 61.321 1.00 58.97  ? 52  ARG A CA    1 
ATOM   120   C  C     . ARG A 1 53  ? -44.539 -33.049 60.226 1.00 58.93  ? 52  ARG A C     1 
ATOM   121   O  O     . ARG A 1 53  ? -44.392 -33.420 59.058 1.00 58.74  ? 52  ARG A O     1 
ATOM   122   C  CB    . ARG A 1 53  ? -44.182 -34.615 62.210 1.00 59.01  ? 52  ARG A CB    1 
ATOM   123   C  CG    . ARG A 1 53  ? -43.149 -35.137 63.223 1.00 61.10  ? 52  ARG A CG    1 
ATOM   124   C  CD    . ARG A 1 53  ? -43.470 -36.498 63.827 1.00 65.01  ? 52  ARG A CD    1 
ATOM   125   N  NE    . ARG A 1 53  ? -42.335 -36.992 64.630 1.00 68.04  ? 52  ARG A NE    1 
ATOM   126   C  CZ    . ARG A 1 53  ? -42.238 -36.908 65.964 1.00 68.09  ? 52  ARG A CZ    1 
ATOM   127   N  NH1   . ARG A 1 53  ? -43.215 -36.363 66.688 1.00 65.62  ? 52  ARG A NH1   1 
ATOM   128   N  NH2   . ARG A 1 53  ? -41.154 -37.382 66.577 1.00 68.08  ? 52  ARG A NH2   1 
ATOM   129   N  N     . ARG A 1 54  ? -45.490 -32.203 60.599 1.00 59.03  ? 53  ARG A N     1 
ATOM   130   C  CA    . ARG A 1 54  ? -46.454 -31.684 59.653 1.00 59.48  ? 53  ARG A CA    1 
ATOM   131   C  C     . ARG A 1 54  ? -45.784 -30.922 58.509 1.00 59.52  ? 53  ARG A C     1 
ATOM   132   O  O     . ARG A 1 54  ? -46.037 -31.196 57.334 1.00 59.59  ? 53  ARG A O     1 
ATOM   133   C  CB    . ARG A 1 54  ? -47.444 -30.771 60.364 1.00 59.97  ? 53  ARG A CB    1 
ATOM   134   C  CG    . ARG A 1 54  ? -48.441 -30.136 59.424 1.00 62.05  ? 53  ARG A CG    1 
ATOM   135   C  CD    . ARG A 1 54  ? -49.194 -29.012 60.081 1.00 67.29  ? 53  ARG A CD    1 
ATOM   136   N  NE    . ARG A 1 54  ? -50.087 -28.378 59.113 1.00 71.65  ? 53  ARG A NE    1 
ATOM   137   C  CZ    . ARG A 1 54  ? -50.837 -27.303 59.353 1.00 73.79  ? 53  ARG A CZ    1 
ATOM   138   N  NH1   . ARG A 1 54  ? -50.813 -26.708 60.544 1.00 75.31  ? 53  ARG A NH1   1 
ATOM   139   N  NH2   . ARG A 1 54  ? -51.619 -26.820 58.394 1.00 73.80  ? 53  ARG A NH2   1 
ATOM   140   N  N     . TYR A 1 55  ? -44.930 -29.963 58.851 1.00 59.18  ? 54  TYR A N     1 
ATOM   141   C  CA    . TYR A 1 55  ? -44.319 -29.126 57.834 1.00 58.66  ? 54  TYR A CA    1 
ATOM   142   C  C     . TYR A 1 55  ? -43.196 -29.789 57.042 1.00 58.55  ? 54  TYR A C     1 
ATOM   143   O  O     . TYR A 1 55  ? -42.970 -29.424 55.885 1.00 58.70  ? 54  TYR A O     1 
ATOM   144   C  CB    . TYR A 1 55  ? -43.898 -27.788 58.419 1.00 58.54  ? 54  TYR A CB    1 
ATOM   145   C  CG    . TYR A 1 55  ? -45.090 -26.978 58.836 1.00 58.24  ? 54  TYR A CG    1 
ATOM   146   C  CD1   . TYR A 1 55  ? -45.360 -26.741 60.178 1.00 59.27  ? 54  TYR A CD1   1 
ATOM   147   C  CD2   . TYR A 1 55  ? -45.976 -26.479 57.889 1.00 58.69  ? 54  TYR A CD2   1 
ATOM   148   C  CE1   . TYR A 1 55  ? -46.471 -26.002 60.569 1.00 60.02  ? 54  TYR A CE1   1 
ATOM   149   C  CE2   . TYR A 1 55  ? -47.092 -25.744 58.267 1.00 59.19  ? 54  TYR A CE2   1 
ATOM   150   C  CZ    . TYR A 1 55  ? -47.334 -25.513 59.607 1.00 59.64  ? 54  TYR A CZ    1 
ATOM   151   O  OH    . TYR A 1 55  ? -48.438 -24.788 59.985 1.00 61.15  ? 54  TYR A OH    1 
ATOM   152   N  N     . GLN A 1 56  ? -42.516 -30.769 57.634 1.00 58.29  ? 55  GLN A N     1 
ATOM   153   C  CA    . GLN A 1 56  ? -41.505 -31.514 56.893 1.00 58.45  ? 55  GLN A CA    1 
ATOM   154   C  C     . GLN A 1 56  ? -42.168 -32.442 55.892 1.00 59.21  ? 55  GLN A C     1 
ATOM   155   O  O     . GLN A 1 56  ? -41.546 -32.867 54.925 1.00 59.86  ? 55  GLN A O     1 
ATOM   156   C  CB    . GLN A 1 56  ? -40.549 -32.269 57.821 1.00 58.09  ? 55  GLN A CB    1 
ATOM   157   C  CG    . GLN A 1 56  ? -39.520 -31.347 58.508 1.00 56.89  ? 55  GLN A CG    1 
ATOM   158   C  CD    . GLN A 1 56  ? -38.418 -32.081 59.284 1.00 56.79  ? 55  GLN A CD    1 
ATOM   159   O  OE1   . GLN A 1 56  ? -38.499 -33.284 59.564 1.00 56.15  ? 55  GLN A OE1   1 
ATOM   160   N  NE2   . GLN A 1 56  ? -37.384 -31.339 59.648 1.00 56.66  ? 55  GLN A NE2   1 
ATOM   161   N  N     . LYS A 1 57  ? -43.447 -32.724 56.115 1.00 59.81  ? 56  LYS A N     1 
ATOM   162   C  CA    . LYS A 1 57  ? -44.197 -33.637 55.277 1.00 60.28  ? 56  LYS A CA    1 
ATOM   163   C  C     . LYS A 1 57  ? -44.689 -32.938 54.017 1.00 60.24  ? 56  LYS A C     1 
ATOM   164   O  O     . LYS A 1 57  ? -44.744 -33.555 52.953 1.00 60.66  ? 56  LYS A O     1 
ATOM   165   C  CB    . LYS A 1 57  ? -45.398 -34.195 56.046 1.00 60.75  ? 56  LYS A CB    1 
ATOM   166   C  CG    . LYS A 1 57  ? -45.609 -35.700 55.897 1.00 62.91  ? 56  LYS A CG    1 
ATOM   167   C  CD    . LYS A 1 57  ? -45.178 -36.438 57.194 1.00 66.88  ? 56  LYS A CD    1 
ATOM   168   C  CE    . LYS A 1 57  ? -44.330 -37.695 56.861 1.00 69.88  ? 56  LYS A CE    1 
ATOM   169   N  NZ    . LYS A 1 57  ? -43.303 -38.036 57.923 1.00 71.16  ? 56  LYS A NZ    1 
ATOM   170   N  N     . SER A 1 58  ? -45.058 -31.665 54.135 1.00 59.87  ? 57  SER A N     1 
ATOM   171   C  CA    . SER A 1 58  ? -45.658 -30.943 53.023 1.00 59.83  ? 57  SER A CA    1 
ATOM   172   C  C     . SER A 1 58  ? -44.674 -30.061 52.246 1.00 59.98  ? 57  SER A C     1 
ATOM   173   O  O     . SER A 1 58  ? -43.481 -29.994 52.559 1.00 60.37  ? 57  SER A O     1 
ATOM   174   C  CB    . SER A 1 58  ? -46.831 -30.111 53.525 1.00 59.88  ? 57  SER A CB    1 
ATOM   175   O  OG    . SER A 1 58  ? -46.404 -29.148 54.461 1.00 60.86  ? 57  SER A OG    1 
ATOM   176   N  N     . THR A 1 59  ? -45.186 -29.374 51.229 1.00 59.80  ? 58  THR A N     1 
ATOM   177   C  CA    . THR A 1 59  ? -44.357 -28.520 50.390 1.00 59.33  ? 58  THR A CA    1 
ATOM   178   C  C     . THR A 1 59  ? -44.914 -27.101 50.177 1.00 59.35  ? 58  THR A C     1 
ATOM   179   O  O     . THR A 1 59  ? -44.238 -26.269 49.581 1.00 59.44  ? 58  THR A O     1 
ATOM   180   C  CB    . THR A 1 59  ? -44.079 -29.184 49.031 1.00 59.00  ? 58  THR A CB    1 
ATOM   181   O  OG1   . THR A 1 59  ? -45.315 -29.447 48.375 1.00 59.41  ? 58  THR A OG1   1 
ATOM   182   C  CG2   . THR A 1 59  ? -43.362 -30.494 49.214 1.00 58.79  ? 58  THR A CG2   1 
ATOM   183   N  N     . GLU A 1 60  ? -46.125 -26.808 50.657 1.00 59.46  ? 59  GLU A N     1 
ATOM   184   C  CA    . GLU A 1 60  ? -46.660 -25.451 50.458 1.00 59.86  ? 59  GLU A CA    1 
ATOM   185   C  C     . GLU A 1 60  ? -45.708 -24.387 50.974 1.00 59.49  ? 59  GLU A C     1 
ATOM   186   O  O     . GLU A 1 60  ? -44.950 -24.610 51.930 1.00 58.78  ? 59  GLU A O     1 
ATOM   187   C  CB    . GLU A 1 60  ? -48.090 -25.195 51.004 1.00 59.93  ? 59  GLU A CB    1 
ATOM   188   C  CG    . GLU A 1 60  ? -48.733 -26.187 51.963 1.00 62.82  ? 59  GLU A CG    1 
ATOM   189   C  CD    . GLU A 1 60  ? -48.032 -26.310 53.300 1.00 66.85  ? 59  GLU A CD    1 
ATOM   190   O  OE1   . GLU A 1 60  ? -48.623 -25.921 54.336 1.00 66.78  ? 59  GLU A OE1   1 
ATOM   191   O  OE2   . GLU A 1 60  ? -46.891 -26.827 53.316 1.00 69.76  ? 59  GLU A OE2   1 
ATOM   192   N  N     . LEU A 1 61  ? -45.755 -23.237 50.308 1.00 59.24  ? 60  LEU A N     1 
ATOM   193   C  CA    . LEU A 1 61  ? -45.063 -22.065 50.782 1.00 59.25  ? 60  LEU A CA    1 
ATOM   194   C  C     . LEU A 1 61  ? -45.698 -21.623 52.095 1.00 59.50  ? 60  LEU A C     1 
ATOM   195   O  O     . LEU A 1 61  ? -46.900 -21.822 52.318 1.00 59.55  ? 60  LEU A O     1 
ATOM   196   C  CB    . LEU A 1 61  ? -45.073 -20.963 49.725 1.00 59.01  ? 60  LEU A CB    1 
ATOM   197   C  CG    . LEU A 1 61  ? -44.283 -21.317 48.451 1.00 59.54  ? 60  LEU A CG    1 
ATOM   198   C  CD1   . LEU A 1 61  ? -44.647 -20.403 47.300 1.00 59.97  ? 60  LEU A CD1   1 
ATOM   199   C  CD2   . LEU A 1 61  ? -42.747 -21.353 48.666 1.00 58.68  ? 60  LEU A CD2   1 
ATOM   200   N  N     . LEU A 1 62  ? -44.877 -21.042 52.965 1.00 59.61  ? 61  LEU A N     1 
ATOM   201   C  CA    . LEU A 1 62  ? -45.248 -20.856 54.356 1.00 59.76  ? 61  LEU A CA    1 
ATOM   202   C  C     . LEU A 1 62  ? -45.360 -19.389 54.757 1.00 60.27  ? 61  LEU A C     1 
ATOM   203   O  O     . LEU A 1 62  ? -45.676 -19.076 55.906 1.00 60.91  ? 61  LEU A O     1 
ATOM   204   C  CB    . LEU A 1 62  ? -44.267 -21.617 55.259 1.00 59.42  ? 61  LEU A CB    1 
ATOM   205   C  CG    . LEU A 1 62  ? -44.189 -23.140 55.051 1.00 58.54  ? 61  LEU A CG    1 
ATOM   206   C  CD1   . LEU A 1 62  ? -43.050 -23.758 55.833 1.00 56.97  ? 61  LEU A CD1   1 
ATOM   207   C  CD2   . LEU A 1 62  ? -45.497 -23.831 55.404 1.00 56.99  ? 61  LEU A CD2   1 
ATOM   208   N  N     . ILE A 1 63  ? -45.099 -18.500 53.802 1.00 60.57  ? 62  ILE A N     1 
ATOM   209   C  CA    . ILE A 1 63  ? -45.286 -17.055 53.968 1.00 60.59  ? 62  ILE A CA    1 
ATOM   210   C  C     . ILE A 1 63  ? -46.479 -16.668 53.092 1.00 60.88  ? 62  ILE A C     1 
ATOM   211   O  O     . ILE A 1 63  ? -46.591 -17.160 51.964 1.00 60.87  ? 62  ILE A O     1 
ATOM   212   C  CB    . ILE A 1 63  ? -44.001 -16.286 53.536 1.00 60.59  ? 62  ILE A CB    1 
ATOM   213   C  CG1   . ILE A 1 63  ? -42.835 -16.643 54.458 1.00 59.82  ? 62  ILE A CG1   1 
ATOM   214   C  CG2   . ILE A 1 63  ? -44.214 -14.763 53.494 1.00 60.22  ? 62  ILE A CG2   1 
ATOM   215   C  CD1   . ILE A 1 63  ? -41.490 -16.133 53.982 1.00 59.78  ? 62  ILE A CD1   1 
ATOM   216   N  N     . ARG A 1 64  ? -47.379 -15.823 53.600 1.00 61.23  ? 63  ARG A N     1 
ATOM   217   C  CA    . ARG A 1 64  ? -48.558 -15.436 52.813 1.00 61.85  ? 63  ARG A CA    1 
ATOM   218   C  C     . ARG A 1 64  ? -48.127 -14.644 51.579 1.00 61.77  ? 63  ARG A C     1 
ATOM   219   O  O     . ARG A 1 64  ? -47.265 -13.766 51.669 1.00 61.61  ? 63  ARG A O     1 
ATOM   220   C  CB    . ARG A 1 64  ? -49.594 -14.641 53.632 1.00 62.33  ? 63  ARG A CB    1 
ATOM   221   C  CG    . ARG A 1 64  ? -49.986 -15.148 55.046 1.00 63.64  ? 63  ARG A CG    1 
ATOM   222   C  CD    . ARG A 1 64  ? -50.414 -16.616 55.164 1.00 68.01  ? 63  ARG A CD    1 
ATOM   223   N  NE    . ARG A 1 64  ? -50.736 -17.286 53.900 1.00 72.79  ? 63  ARG A NE    1 
ATOM   224   C  CZ    . ARG A 1 64  ? -51.964 -17.604 53.486 1.00 76.30  ? 63  ARG A CZ    1 
ATOM   225   N  NH1   . ARG A 1 64  ? -53.040 -17.305 54.224 1.00 77.74  ? 63  ARG A NH1   1 
ATOM   226   N  NH2   . ARG A 1 64  ? -52.120 -18.223 52.315 1.00 76.90  ? 63  ARG A NH2   1 
ATOM   227   N  N     . LYS A 1 65  ? -48.721 -14.961 50.432 1.00 61.83  ? 64  LYS A N     1 
ATOM   228   C  CA    . LYS A 1 65  ? -48.269 -14.408 49.158 1.00 62.16  ? 64  LYS A CA    1 
ATOM   229   C  C     . LYS A 1 65  ? -48.200 -12.895 49.146 1.00 61.84  ? 64  LYS A C     1 
ATOM   230   O  O     . LYS A 1 65  ? -47.189 -12.324 48.732 1.00 62.15  ? 64  LYS A O     1 
ATOM   231   C  CB    . LYS A 1 65  ? -49.136 -14.895 47.995 1.00 62.55  ? 64  LYS A CB    1 
ATOM   232   C  CG    . LYS A 1 65  ? -48.976 -16.385 47.686 1.00 65.23  ? 64  LYS A CG    1 
ATOM   233   C  CD    . LYS A 1 65  ? -49.356 -16.699 46.236 1.00 68.56  ? 64  LYS A CD    1 
ATOM   234   C  CE    . LYS A 1 65  ? -49.274 -18.200 45.958 1.00 70.33  ? 64  LYS A CE    1 
ATOM   235   N  NZ    . LYS A 1 65  ? -49.431 -18.476 44.495 1.00 72.08  ? 64  LYS A NZ    1 
ATOM   236   N  N     . LEU A 1 66  ? -49.258 -12.241 49.609 1.00 61.47  ? 65  LEU A N     1 
ATOM   237   C  CA    . LEU A 1 66  ? -49.367 -10.799 49.426 1.00 61.17  ? 65  LEU A CA    1 
ATOM   238   C  C     . LEU A 1 66  ? -48.272 -10.004 50.141 1.00 60.87  ? 65  LEU A C     1 
ATOM   239   O  O     . LEU A 1 66  ? -47.587 -9.204  49.496 1.00 60.70  ? 65  LEU A O     1 
ATOM   240   C  CB    . LEU A 1 66  ? -50.766 -10.282 49.788 1.00 61.36  ? 65  LEU A CB    1 
ATOM   241   C  CG    . LEU A 1 66  ? -51.050 -8.817  49.430 1.00 61.01  ? 65  LEU A CG    1 
ATOM   242   C  CD1   . LEU A 1 66  ? -51.253 -8.634  47.931 1.00 61.50  ? 65  LEU A CD1   1 
ATOM   243   C  CD2   . LEU A 1 66  ? -52.255 -8.312  50.194 1.00 61.61  ? 65  LEU A CD2   1 
ATOM   244   N  N     . PRO A 1 67  ? -48.105 -10.215 51.466 1.00 60.62  ? 66  PRO A N     1 
ATOM   245   C  CA    . PRO A 1 67  ? -47.052 -9.524  52.211 1.00 60.49  ? 66  PRO A CA    1 
ATOM   246   C  C     . PRO A 1 67  ? -45.670 -9.737  51.610 1.00 60.82  ? 66  PRO A C     1 
ATOM   247   O  O     . PRO A 1 67  ? -44.842 -8.819  51.626 1.00 61.02  ? 66  PRO A O     1 
ATOM   248   C  CB    . PRO A 1 67  ? -47.104 -10.164 53.605 1.00 60.39  ? 66  PRO A CB    1 
ATOM   249   C  CG    . PRO A 1 67  ? -48.117 -11.226 53.555 1.00 60.79  ? 66  PRO A CG    1 
ATOM   250   C  CD    . PRO A 1 67  ? -48.972 -11.005 52.356 1.00 60.71  ? 66  PRO A CD    1 
ATOM   251   N  N     . PHE A 1 68  ? -45.426 -10.941 51.086 1.00 60.81  ? 67  PHE A N     1 
ATOM   252   C  CA    . PHE A 1 68  ? -44.189 -11.230 50.378 1.00 60.29  ? 67  PHE A CA    1 
ATOM   253   C  C     . PHE A 1 68  ? -44.090 -10.395 49.116 1.00 60.26  ? 67  PHE A C     1 
ATOM   254   O  O     . PHE A 1 68  ? -43.025 -9.884  48.800 1.00 60.75  ? 67  PHE A O     1 
ATOM   255   C  CB    . PHE A 1 68  ? -44.057 -12.715 50.048 1.00 60.09  ? 67  PHE A CB    1 
ATOM   256   C  CG    . PHE A 1 68  ? -42.713 -13.087 49.492 1.00 59.49  ? 67  PHE A CG    1 
ATOM   257   C  CD1   . PHE A 1 68  ? -41.644 -13.319 50.340 1.00 57.59  ? 67  PHE A CD1   1 
ATOM   258   C  CD2   . PHE A 1 68  ? -42.512 -13.183 48.112 1.00 59.80  ? 67  PHE A CD2   1 
ATOM   259   C  CE1   . PHE A 1 68  ? -40.405 -13.643 49.837 1.00 57.11  ? 67  PHE A CE1   1 
ATOM   260   C  CE2   . PHE A 1 68  ? -41.266 -13.514 47.596 1.00 58.16  ? 67  PHE A CE2   1 
ATOM   261   C  CZ    . PHE A 1 68  ? -40.212 -13.740 48.459 1.00 57.72  ? 67  PHE A CZ    1 
ATOM   262   N  N     . GLN A 1 69  ? -45.197 -10.240 48.404 1.00 60.22  ? 68  GLN A N     1 
ATOM   263   C  CA    . GLN A 1 69  ? -45.181 -9.469  47.164 1.00 60.34  ? 68  GLN A CA    1 
ATOM   264   C  C     . GLN A 1 69  ? -44.831 -7.995  47.442 1.00 60.01  ? 68  GLN A C     1 
ATOM   265   O  O     . GLN A 1 69  ? -44.009 -7.379  46.733 1.00 59.79  ? 68  GLN A O     1 
ATOM   266   C  CB    . GLN A 1 69  ? -46.512 -9.606  46.422 1.00 60.46  ? 68  GLN A CB    1 
ATOM   267   C  CG    . GLN A 1 69  ? -46.367 -9.421  44.918 1.00 63.36  ? 68  GLN A CG    1 
ATOM   268   C  CD    . GLN A 1 69  ? -47.628 -9.762  44.121 1.00 66.97  ? 68  GLN A CD    1 
ATOM   269   O  OE1   . GLN A 1 69  ? -48.753 -9.628  44.623 1.00 68.51  ? 68  GLN A OE1   1 
ATOM   270   N  NE2   . GLN A 1 69  ? -47.444 -10.184 42.860 1.00 66.45  ? 68  GLN A NE2   1 
ATOM   271   N  N     . ARG A 1 70  ? -45.428 -7.441  48.493 1.00 59.19  ? 69  ARG A N     1 
ATOM   272   C  CA    . ARG A 1 70  ? -45.159 -6.055  48.849 1.00 58.80  ? 69  ARG A CA    1 
ATOM   273   C  C     . ARG A 1 70  ? -43.683 -5.841  49.152 1.00 58.16  ? 69  ARG A C     1 
ATOM   274   O  O     . ARG A 1 70  ? -43.067 -4.880  48.684 1.00 57.69  ? 69  ARG A O     1 
ATOM   275   C  CB    . ARG A 1 70  ? -46.011 -5.615  50.039 1.00 59.00  ? 69  ARG A CB    1 
ATOM   276   C  CG    . ARG A 1 70  ? -47.502 -5.477  49.722 1.00 59.99  ? 69  ARG A CG    1 
ATOM   277   C  CD    . ARG A 1 70  ? -48.225 -4.623  50.754 1.00 61.08  ? 69  ARG A CD    1 
ATOM   278   N  NE    . ARG A 1 70  ? -48.143 -5.149  52.116 1.00 61.96  ? 69  ARG A NE    1 
ATOM   279   C  CZ    . ARG A 1 70  ? -49.054 -5.950  52.662 1.00 63.45  ? 69  ARG A CZ    1 
ATOM   280   N  NH1   . ARG A 1 70  ? -50.114 -6.323  51.951 1.00 63.27  ? 69  ARG A NH1   1 
ATOM   281   N  NH2   . ARG A 1 70  ? -48.904 -6.385  53.915 1.00 63.36  ? 69  ARG A NH2   1 
ATOM   282   N  N     . LEU A 1 71  ? -43.123 -6.761  49.932 1.00 57.65  ? 70  LEU A N     1 
ATOM   283   C  CA    . LEU A 1 71  ? -41.727 -6.691  50.334 1.00 56.67  ? 70  LEU A CA    1 
ATOM   284   C  C     . LEU A 1 71  ? -40.803 -6.789  49.124 1.00 55.92  ? 70  LEU A C     1 
ATOM   285   O  O     . LEU A 1 71  ? -39.846 -6.023  49.014 1.00 55.66  ? 70  LEU A O     1 
ATOM   286   C  CB    . LEU A 1 71  ? -41.426 -7.774  51.350 1.00 56.65  ? 70  LEU A CB    1 
ATOM   287   C  CG    . LEU A 1 71  ? -40.051 -7.737  51.996 1.00 57.31  ? 70  LEU A CG    1 
ATOM   288   C  CD1   . LEU A 1 71  ? -39.912 -6.562  52.938 1.00 57.83  ? 70  LEU A CD1   1 
ATOM   289   C  CD2   . LEU A 1 71  ? -39.819 -9.049  52.733 1.00 58.18  ? 70  LEU A CD2   1 
ATOM   290   N  N     . VAL A 1 72  ? -41.109 -7.701  48.206 1.00 54.91  ? 71  VAL A N     1 
ATOM   291   C  CA    . VAL A 1 72  ? -40.384 -7.764  46.939 1.00 54.72  ? 71  VAL A CA    1 
ATOM   292   C  C     . VAL A 1 72  ? -40.405 -6.414  46.201 1.00 54.77  ? 71  VAL A C     1 
ATOM   293   O  O     . VAL A 1 72  ? -39.360 -5.834  45.946 1.00 54.45  ? 71  VAL A O     1 
ATOM   294   C  CB    . VAL A 1 72  ? -40.930 -8.887  46.035 1.00 54.66  ? 71  VAL A CB    1 
ATOM   295   C  CG1   . VAL A 1 72  ? -40.416 -8.738  44.626 1.00 54.41  ? 71  VAL A CG1   1 
ATOM   296   C  CG2   . VAL A 1 72  ? -40.538 -10.234 46.579 1.00 53.99  ? 71  VAL A CG2   1 
ATOM   297   N  N     . ARG A 1 73  ? -41.603 -5.910  45.903 1.00 55.27  ? 72  ARG A N     1 
ATOM   298   C  CA    . ARG A 1 73  ? -41.790 -4.636  45.206 1.00 55.57  ? 72  ARG A CA    1 
ATOM   299   C  C     . ARG A 1 73  ? -41.140 -3.452  45.906 1.00 55.87  ? 72  ARG A C     1 
ATOM   300   O  O     . ARG A 1 73  ? -40.524 -2.611  45.254 1.00 55.95  ? 72  ARG A O     1 
ATOM   301   C  CB    . ARG A 1 73  ? -43.269 -4.365  44.990 1.00 55.64  ? 72  ARG A CB    1 
ATOM   302   C  CG    . ARG A 1 73  ? -43.932 -5.354  44.041 1.00 57.15  ? 72  ARG A CG    1 
ATOM   303   C  CD    . ARG A 1 73  ? -45.417 -5.085  43.942 1.00 57.87  ? 72  ARG A CD    1 
ATOM   304   N  NE    . ARG A 1 73  ? -46.148 -6.188  43.325 1.00 58.68  ? 72  ARG A NE    1 
ATOM   305   C  CZ    . ARG A 1 73  ? -46.242 -6.396  42.010 1.00 58.51  ? 72  ARG A CZ    1 
ATOM   306   N  NH1   . ARG A 1 73  ? -45.638 -5.586  41.150 1.00 57.80  ? 72  ARG A NH1   1 
ATOM   307   N  NH2   . ARG A 1 73  ? -46.948 -7.421  41.556 1.00 57.60  ? 72  ARG A NH2   1 
ATOM   308   N  N     . GLU A 1 74  ? -41.266 -3.393  47.227 1.00 56.43  ? 73  GLU A N     1 
ATOM   309   C  CA    . GLU A 1 74  ? -40.627 -2.350  48.018 1.00 57.29  ? 73  GLU A CA    1 
ATOM   310   C  C     . GLU A 1 74  ? -39.130 -2.311  47.754 1.00 57.64  ? 73  GLU A C     1 
ATOM   311   O  O     . GLU A 1 74  ? -38.575 -1.258  47.419 1.00 57.96  ? 73  GLU A O     1 
ATOM   312   C  CB    . GLU A 1 74  ? -40.887 -2.577  49.506 1.00 57.43  ? 73  GLU A CB    1 
ATOM   313   C  CG    . GLU A 1 74  ? -40.166 -1.586  50.405 1.00 60.67  ? 73  GLU A CG    1 
ATOM   314   C  CD    . GLU A 1 74  ? -40.520 -1.742  51.877 1.00 64.89  ? 73  GLU A CD    1 
ATOM   315   O  OE1   . GLU A 1 74  ? -41.719 -1.817  52.208 1.00 66.26  ? 73  GLU A OE1   1 
ATOM   316   O  OE2   . GLU A 1 74  ? -39.593 -1.773  52.714 1.00 67.31  ? 73  GLU A OE2   1 
ATOM   317   N  N     . ILE A 1 75  ? -38.488 -3.470  47.909 1.00 58.17  ? 74  ILE A N     1 
ATOM   318   C  CA    . ILE A 1 75  ? -37.049 -3.622  47.716 1.00 58.24  ? 74  ILE A CA    1 
ATOM   319   C  C     . ILE A 1 75  ? -36.648 -3.311  46.271 1.00 58.74  ? 74  ILE A C     1 
ATOM   320   O  O     . ILE A 1 75  ? -35.632 -2.650  46.039 1.00 58.85  ? 74  ILE A O     1 
ATOM   321   C  CB    . ILE A 1 75  ? -36.576 -5.034  48.151 1.00 58.09  ? 74  ILE A CB    1 
ATOM   322   C  CG1   . ILE A 1 75  ? -36.676 -5.175  49.674 1.00 57.50  ? 74  ILE A CG1   1 
ATOM   323   C  CG2   . ILE A 1 75  ? -35.149 -5.295  47.717 1.00 58.10  ? 74  ILE A CG2   1 
ATOM   324   C  CD1   . ILE A 1 75  ? -36.533 -6.586  50.208 1.00 54.92  ? 74  ILE A CD1   1 
ATOM   325   N  N     . ALA A 1 76  ? -37.452 -3.761  45.310 1.00 59.12  ? 75  ALA A N     1 
ATOM   326   C  CA    . ALA A 1 76  ? -37.159 -3.515  43.899 1.00 60.32  ? 75  ALA A CA    1 
ATOM   327   C  C     . ALA A 1 76  ? -37.144 -2.012  43.596 1.00 61.53  ? 75  ALA A C     1 
ATOM   328   O  O     . ALA A 1 76  ? -36.324 -1.527  42.787 1.00 61.15  ? 75  ALA A O     1 
ATOM   329   C  CB    . ALA A 1 76  ? -38.165 -4.226  43.023 1.00 59.66  ? 75  ALA A CB    1 
ATOM   330   N  N     . GLN A 1 77  ? -38.040 -1.294  44.288 1.00 62.69  ? 76  GLN A N     1 
ATOM   331   C  CA    . GLN A 1 77  ? -38.292 0.114   44.050 1.00 64.18  ? 76  GLN A CA    1 
ATOM   332   C  C     . GLN A 1 77  ? -37.035 0.965   44.241 1.00 64.76  ? 76  GLN A C     1 
ATOM   333   O  O     . GLN A 1 77  ? -36.844 1.934   43.498 1.00 65.08  ? 76  GLN A O     1 
ATOM   334   C  CB    . GLN A 1 77  ? -39.458 0.595   44.926 1.00 64.66  ? 76  GLN A CB    1 
ATOM   335   C  CG    . GLN A 1 77  ? -39.873 2.072   44.776 1.00 67.19  ? 76  GLN A CG    1 
ATOM   336   C  CD    . GLN A 1 77  ? -40.655 2.388   43.485 1.00 71.37  ? 76  GLN A CD    1 
ATOM   337   O  OE1   . GLN A 1 77  ? -40.923 1.508   42.649 1.00 73.57  ? 76  GLN A OE1   1 
ATOM   338   N  NE2   . GLN A 1 77  ? -41.010 3.662   43.321 1.00 71.66  ? 76  GLN A NE2   1 
ATOM   339   N  N     . ASP A 1 78  ? -36.175 0.592   45.197 1.00 65.23  ? 77  ASP A N     1 
ATOM   340   C  CA    . ASP A 1 78  ? -34.888 1.278   45.387 1.00 65.84  ? 77  ASP A CA    1 
ATOM   341   C  C     . ASP A 1 78  ? -33.904 1.048   44.235 1.00 65.94  ? 77  ASP A C     1 
ATOM   342   O  O     . ASP A 1 78  ? -32.929 1.788   44.110 1.00 66.15  ? 77  ASP A O     1 
ATOM   343   C  CB    . ASP A 1 78  ? -34.206 0.895   46.712 1.00 66.15  ? 77  ASP A CB    1 
ATOM   344   C  CG    . ASP A 1 78  ? -34.971 1.376   47.950 1.00 68.39  ? 77  ASP A CG    1 
ATOM   345   O  OD1   . ASP A 1 78  ? -35.303 0.512   48.793 1.00 69.68  ? 77  ASP A OD1   1 
ATOM   346   O  OD2   . ASP A 1 78  ? -35.233 2.603   48.101 1.00 70.96  ? 77  ASP A OD2   1 
ATOM   347   N  N     . PHE A 1 79  ? -34.122 0.028   43.404 1.00 65.91  ? 78  PHE A N     1 
ATOM   348   C  CA    . PHE A 1 79  ? -33.190 -0.198  42.294 1.00 66.09  ? 78  PHE A CA    1 
ATOM   349   C  C     . PHE A 1 79  ? -33.725 0.411   41.003 1.00 66.47  ? 78  PHE A C     1 
ATOM   350   O  O     . PHE A 1 79  ? -32.960 0.939   40.188 1.00 66.12  ? 78  PHE A O     1 
ATOM   351   C  CB    . PHE A 1 79  ? -32.823 -1.693  42.116 1.00 66.08  ? 78  PHE A CB    1 
ATOM   352   C  CG    . PHE A 1 79  ? -32.340 -2.366  43.381 1.00 65.24  ? 78  PHE A CG    1 
ATOM   353   C  CD1   . PHE A 1 79  ? -33.010 -3.481  43.889 1.00 64.00  ? 78  PHE A CD1   1 
ATOM   354   C  CD2   . PHE A 1 79  ? -31.228 -1.874  44.078 1.00 64.80  ? 78  PHE A CD2   1 
ATOM   355   C  CE1   . PHE A 1 79  ? -32.583 -4.102  45.068 1.00 62.87  ? 78  PHE A CE1   1 
ATOM   356   C  CE2   . PHE A 1 79  ? -30.788 -2.486  45.261 1.00 63.82  ? 78  PHE A CE2   1 
ATOM   357   C  CZ    . PHE A 1 79  ? -31.471 -3.598  45.758 1.00 63.62  ? 78  PHE A CZ    1 
ATOM   358   N  N     . LYS A 1 80  ? -35.039 0.321   40.821 1.00 67.27  ? 79  LYS A N     1 
ATOM   359   C  CA    . LYS A 1 80  ? -35.714 0.930   39.681 1.00 68.40  ? 79  LYS A CA    1 
ATOM   360   C  C     . LYS A 1 80  ? -37.160 1.193   40.011 1.00 68.92  ? 79  LYS A C     1 
ATOM   361   O  O     . LYS A 1 80  ? -37.853 0.324   40.553 1.00 69.41  ? 79  LYS A O     1 
ATOM   362   C  CB    . LYS A 1 80  ? -35.646 0.058   38.431 1.00 68.41  ? 79  LYS A CB    1 
ATOM   363   C  CG    . LYS A 1 80  ? -35.889 0.852   37.162 1.00 70.14  ? 79  LYS A CG    1 
ATOM   364   C  CD    . LYS A 1 80  ? -36.130 -0.035  35.961 1.00 72.92  ? 79  LYS A CD    1 
ATOM   365   C  CE    . LYS A 1 80  ? -36.355 0.802   34.700 1.00 75.42  ? 79  LYS A CE    1 
ATOM   366   N  NZ    . LYS A 1 80  ? -36.534 -0.084  33.497 1.00 77.50  ? 79  LYS A NZ    1 
ATOM   367   N  N     . THR A 1 81  ? -37.615 2.394   39.667 1.00 69.52  ? 80  THR A N     1 
ATOM   368   C  CA    . THR A 1 81  ? -38.981 2.818   39.969 1.00 69.93  ? 80  THR A CA    1 
ATOM   369   C  C     . THR A 1 81  ? -39.951 2.408   38.860 1.00 70.00  ? 80  THR A C     1 
ATOM   370   O  O     . THR A 1 81  ? -39.553 2.230   37.703 1.00 69.70  ? 80  THR A O     1 
ATOM   371   C  CB    . THR A 1 81  ? -39.069 4.342   40.190 1.00 70.00  ? 80  THR A CB    1 
ATOM   372   O  OG1   . THR A 1 81  ? -38.777 5.020   38.962 1.00 70.06  ? 80  THR A OG1   1 
ATOM   373   C  CG2   . THR A 1 81  ? -38.087 4.803   41.294 1.00 69.59  ? 80  THR A CG2   1 
ATOM   374   N  N     . ASP A 1 82  ? -41.220 2.248   39.245 1.00 70.17  ? 81  ASP A N     1 
ATOM   375   C  CA    . ASP A 1 82  ? -42.310 1.896   38.328 1.00 70.35  ? 81  ASP A CA    1 
ATOM   376   C  C     . ASP A 1 82  ? -42.055 0.542   37.665 1.00 70.09  ? 81  ASP A C     1 
ATOM   377   O  O     . ASP A 1 82  ? -41.993 0.422   36.424 1.00 70.21  ? 81  ASP A O     1 
ATOM   378   C  CB    . ASP A 1 82  ? -42.539 3.016   37.296 1.00 70.65  ? 81  ASP A CB    1 
ATOM   379   C  CG    . ASP A 1 82  ? -43.879 2.903   36.587 1.00 72.42  ? 81  ASP A CG    1 
ATOM   380   O  OD1   . ASP A 1 82  ? -44.918 2.618   37.248 1.00 73.32  ? 81  ASP A OD1   1 
ATOM   381   O  OD2   . ASP A 1 82  ? -43.878 3.104   35.348 1.00 75.17  ? 81  ASP A OD2   1 
ATOM   382   N  N     . LEU A 1 83  ? -41.898 -0.478  38.513 1.00 69.41  ? 82  LEU A N     1 
ATOM   383   C  CA    . LEU A 1 83  ? -41.561 -1.805  38.028 1.00 68.58  ? 82  LEU A CA    1 
ATOM   384   C  C     . LEU A 1 83  ? -42.773 -2.700  38.038 1.00 67.98  ? 82  LEU A C     1 
ATOM   385   O  O     . LEU A 1 83  ? -43.650 -2.548  38.873 1.00 68.03  ? 82  LEU A O     1 
ATOM   386   C  CB    . LEU A 1 83  ? -40.420 -2.416  38.845 1.00 68.37  ? 82  LEU A CB    1 
ATOM   387   C  CG    . LEU A 1 83  ? -39.000 -2.149  38.329 1.00 67.54  ? 82  LEU A CG    1 
ATOM   388   C  CD1   . LEU A 1 83  ? -38.003 -2.821  39.242 1.00 67.04  ? 82  LEU A CD1   1 
ATOM   389   C  CD2   . LEU A 1 83  ? -38.802 -2.637  36.898 1.00 66.88  ? 82  LEU A CD2   1 
ATOM   390   N  N     . ARG A 1 84  ? -42.831 -3.619  37.086 1.00 67.21  ? 83  ARG A N     1 
ATOM   391   C  CA    . ARG A 1 84  ? -43.877 -4.630  37.096 1.00 66.70  ? 83  ARG A CA    1 
ATOM   392   C  C     . ARG A 1 84  ? -43.199 -5.996  37.198 1.00 66.02  ? 83  ARG A C     1 
ATOM   393   O  O     . ARG A 1 84  ? -42.010 -6.145  36.866 1.00 66.14  ? 83  ARG A O     1 
ATOM   394   C  CB    . ARG A 1 84  ? -44.757 -4.524  35.849 1.00 66.93  ? 83  ARG A CB    1 
ATOM   395   C  CG    . ARG A 1 84  ? -45.090 -3.074  35.459 1.00 68.60  ? 83  ARG A CG    1 
ATOM   396   C  CD    . ARG A 1 84  ? -46.112 -2.990  34.360 1.00 70.03  ? 83  ARG A CD    1 
ATOM   397   N  NE    . ARG A 1 84  ? -47.467 -2.991  34.897 1.00 72.90  ? 83  ARG A NE    1 
ATOM   398   C  CZ    . ARG A 1 84  ? -48.553 -3.306  34.195 1.00 74.40  ? 83  ARG A CZ    1 
ATOM   399   N  NH1   . ARG A 1 84  ? -48.443 -3.655  32.915 1.00 75.80  ? 83  ARG A NH1   1 
ATOM   400   N  NH2   . ARG A 1 84  ? -49.751 -3.274  34.771 1.00 74.86  ? 83  ARG A NH2   1 
ATOM   401   N  N     . PHE A 1 85  ? -43.953 -6.982  37.669 1.00 64.63  ? 84  PHE A N     1 
ATOM   402   C  CA    . PHE A 1 85  ? -43.415 -8.291  37.982 1.00 63.29  ? 84  PHE A CA    1 
ATOM   403   C  C     . PHE A 1 85  ? -44.295 -9.336  37.364 1.00 62.56  ? 84  PHE A C     1 
ATOM   404   O  O     . PHE A 1 85  ? -45.498 -9.322  37.605 1.00 62.83  ? 84  PHE A O     1 
ATOM   405   C  CB    . PHE A 1 85  ? -43.433 -8.501  39.497 1.00 63.07  ? 84  PHE A CB    1 
ATOM   406   C  CG    . PHE A 1 85  ? -42.211 -7.999  40.199 1.00 62.30  ? 84  PHE A CG    1 
ATOM   407   C  CD1   . PHE A 1 85  ? -42.138 -6.679  40.640 1.00 61.44  ? 84  PHE A CD1   1 
ATOM   408   C  CD2   . PHE A 1 85  ? -41.136 -8.855  40.441 1.00 61.09  ? 84  PHE A CD2   1 
ATOM   409   C  CE1   . PHE A 1 85  ? -41.000 -6.212  41.301 1.00 61.23  ? 84  PHE A CE1   1 
ATOM   410   C  CE2   . PHE A 1 85  ? -39.995 -8.407  41.100 1.00 60.59  ? 84  PHE A CE2   1 
ATOM   411   C  CZ    . PHE A 1 85  ? -39.921 -7.079  41.527 1.00 61.57  ? 84  PHE A CZ    1 
ATOM   412   N  N     . GLN A 1 86  ? -43.720 -10.258 36.592 1.00 61.56  ? 85  GLN A N     1 
ATOM   413   C  CA    . GLN A 1 86  ? -44.484 -11.439 36.184 1.00 60.75  ? 85  GLN A CA    1 
ATOM   414   C  C     . GLN A 1 86  ? -44.908 -12.158 37.456 1.00 60.42  ? 85  GLN A C     1 
ATOM   415   O  O     . GLN A 1 86  ? -44.186 -12.120 38.451 1.00 60.23  ? 85  GLN A O     1 
ATOM   416   C  CB    . GLN A 1 86  ? -43.663 -12.384 35.317 1.00 60.44  ? 85  GLN A CB    1 
ATOM   417   C  CG    . GLN A 1 86  ? -43.400 -11.891 33.922 1.00 60.04  ? 85  GLN A CG    1 
ATOM   418   C  CD    . GLN A 1 86  ? -42.762 -12.941 33.046 1.00 60.38  ? 85  GLN A CD    1 
ATOM   419   O  OE1   . GLN A 1 86  ? -42.229 -13.940 33.527 1.00 61.14  ? 85  GLN A OE1   1 
ATOM   420   N  NE2   . GLN A 1 86  ? -42.809 -12.721 31.748 1.00 61.57  ? 85  GLN A NE2   1 
ATOM   421   N  N     . SER A 1 87  ? -46.075 -12.795 37.430 1.00 59.95  ? 86  SER A N     1 
ATOM   422   C  CA    . SER A 1 87  ? -46.543 -13.564 38.575 1.00 59.58  ? 86  SER A CA    1 
ATOM   423   C  C     . SER A 1 87  ? -45.532 -14.639 38.952 1.00 59.08  ? 86  SER A C     1 
ATOM   424   O  O     . SER A 1 87  ? -45.262 -14.848 40.138 1.00 58.98  ? 86  SER A O     1 
ATOM   425   C  CB    . SER A 1 87  ? -47.884 -14.225 38.281 1.00 59.81  ? 86  SER A CB    1 
ATOM   426   O  OG    . SER A 1 87  ? -48.377 -14.850 39.459 1.00 61.02  ? 86  SER A OG    1 
ATOM   427   N  N     . SER A 1 88  ? -44.977 -15.311 37.944 1.00 58.19  ? 87  SER A N     1 
ATOM   428   C  CA    . SER A 1 88  ? -44.032 -16.391 38.183 1.00 57.89  ? 87  SER A CA    1 
ATOM   429   C  C     . SER A 1 88  ? -42.704 -15.884 38.762 1.00 57.50  ? 87  SER A C     1 
ATOM   430   O  O     . SER A 1 88  ? -42.022 -16.612 39.472 1.00 57.27  ? 87  SER A O     1 
ATOM   431   C  CB    . SER A 1 88  ? -43.806 -17.209 36.908 1.00 57.88  ? 87  SER A CB    1 
ATOM   432   O  OG    . SER A 1 88  ? -43.305 -16.396 35.862 1.00 58.26  ? 87  SER A OG    1 
ATOM   433   N  N     . ALA A 1 89  ? -42.351 -14.636 38.460 1.00 57.10  ? 88  ALA A N     1 
ATOM   434   C  CA    . ALA A 1 89  ? -41.151 -14.011 39.023 1.00 56.67  ? 88  ALA A CA    1 
ATOM   435   C  C     . ALA A 1 89  ? -41.254 -13.896 40.542 1.00 56.14  ? 88  ALA A C     1 
ATOM   436   O  O     . ALA A 1 89  ? -40.319 -14.218 41.264 1.00 56.27  ? 88  ALA A O     1 
ATOM   437   C  CB    . ALA A 1 89  ? -40.904 -12.635 38.391 1.00 56.34  ? 88  ALA A CB    1 
ATOM   438   N  N     . VAL A 1 90  ? -42.402 -13.449 41.023 1.00 55.75  ? 89  VAL A N     1 
ATOM   439   C  CA    . VAL A 1 90  ? -42.610 -13.352 42.447 1.00 55.69  ? 89  VAL A CA    1 
ATOM   440   C  C     . VAL A 1 90  ? -42.493 -14.758 43.036 1.00 56.02  ? 89  VAL A C     1 
ATOM   441   O  O     . VAL A 1 90  ? -41.725 -14.973 43.979 1.00 56.07  ? 89  VAL A O     1 
ATOM   442   C  CB    . VAL A 1 90  ? -43.964 -12.671 42.810 1.00 55.70  ? 89  VAL A CB    1 
ATOM   443   C  CG1   . VAL A 1 90  ? -44.029 -12.383 44.312 1.00 54.68  ? 89  VAL A CG1   1 
ATOM   444   C  CG2   . VAL A 1 90  ? -44.151 -11.366 42.023 1.00 54.61  ? 89  VAL A CG2   1 
ATOM   445   N  N     . MET A 1 91  ? -43.228 -15.706 42.452 1.00 56.11  ? 90  MET A N     1 
ATOM   446   C  CA    . MET A 1 91  ? -43.198 -17.111 42.876 1.00 56.42  ? 90  MET A CA    1 
ATOM   447   C  C     . MET A 1 91  ? -41.787 -17.690 42.936 1.00 55.52  ? 90  MET A C     1 
ATOM   448   O  O     . MET A 1 91  ? -41.390 -18.246 43.953 1.00 55.83  ? 90  MET A O     1 
ATOM   449   C  CB    . MET A 1 91  ? -44.081 -17.977 41.973 1.00 57.38  ? 90  MET A CB    1 
ATOM   450   C  CG    . MET A 1 91  ? -45.578 -17.697 42.098 1.00 60.83  ? 90  MET A CG    1 
ATOM   451   S  SD    . MET A 1 91  ? -46.068 -17.429 43.824 1.00 69.93  ? 90  MET A SD    1 
ATOM   452   C  CE    . MET A 1 91  ? -46.126 -19.119 44.405 1.00 67.40  ? 90  MET A CE    1 
ATOM   453   N  N     . ALA A 1 92  ? -41.030 -17.553 41.854 1.00 54.50  ? 91  ALA A N     1 
ATOM   454   C  CA    . ALA A 1 92  ? -39.637 -17.962 41.853 1.00 53.52  ? 91  ALA A CA    1 
ATOM   455   C  C     . ALA A 1 92  ? -38.916 -17.377 43.076 1.00 53.44  ? 91  ALA A C     1 
ATOM   456   O  O     . ALA A 1 92  ? -38.262 -18.115 43.828 1.00 53.32  ? 91  ALA A O     1 
ATOM   457   C  CB    . ALA A 1 92  ? -38.958 -17.549 40.568 1.00 53.03  ? 91  ALA A CB    1 
ATOM   458   N  N     . LEU A 1 93  ? -39.070 -16.069 43.296 1.00 52.65  ? 92  LEU A N     1 
ATOM   459   C  CA    . LEU A 1 93  ? -38.429 -15.416 44.436 1.00 52.29  ? 92  LEU A CA    1 
ATOM   460   C  C     . LEU A 1 93  ? -38.845 -16.028 45.757 1.00 51.74  ? 92  LEU A C     1 
ATOM   461   O  O     . LEU A 1 93  ? -38.018 -16.175 46.658 1.00 51.66  ? 92  LEU A O     1 
ATOM   462   C  CB    . LEU A 1 93  ? -38.734 -13.916 44.475 1.00 52.29  ? 92  LEU A CB    1 
ATOM   463   C  CG    . LEU A 1 93  ? -37.903 -13.004 43.583 1.00 52.31  ? 92  LEU A CG    1 
ATOM   464   C  CD1   . LEU A 1 93  ? -38.562 -11.654 43.527 1.00 51.03  ? 92  LEU A CD1   1 
ATOM   465   C  CD2   . LEU A 1 93  ? -36.454 -12.899 44.072 1.00 51.95  ? 92  LEU A CD2   1 
ATOM   466   N  N     . GLN A 1 94  ? -40.119 -16.388 45.879 1.00 51.16  ? 93  GLN A N     1 
ATOM   467   C  CA    . GLN A 1 94  ? -40.591 -16.958 47.138 1.00 50.83  ? 93  GLN A CA    1 
ATOM   468   C  C     . GLN A 1 94  ? -40.036 -18.359 47.361 1.00 50.50  ? 93  GLN A C     1 
ATOM   469   O  O     . GLN A 1 94  ? -39.585 -18.694 48.465 1.00 50.14  ? 93  GLN A O     1 
ATOM   470   C  CB    . GLN A 1 94  ? -42.111 -16.945 47.245 1.00 50.92  ? 93  GLN A CB    1 
ATOM   471   C  CG    . GLN A 1 94  ? -42.588 -16.817 48.697 1.00 51.28  ? 93  GLN A CG    1 
ATOM   472   C  CD    . GLN A 1 94  ? -44.094 -16.795 48.828 1.00 50.80  ? 93  GLN A CD    1 
ATOM   473   O  OE1   . GLN A 1 94  ? -44.780 -16.173 48.030 1.00 53.02  ? 93  GLN A OE1   1 
ATOM   474   N  NE2   . GLN A 1 94  ? -44.614 -17.475 49.840 1.00 50.18  ? 93  GLN A NE2   1 
ATOM   475   N  N     . GLU A 1 95  ? -40.047 -19.160 46.305 1.00 49.84  ? 94  GLU A N     1 
ATOM   476   C  CA    . GLU A 1 95  ? -39.544 -20.497 46.399 1.00 49.81  ? 94  GLU A CA    1 
ATOM   477   C  C     . GLU A 1 95  ? -38.105 -20.425 46.865 1.00 49.47  ? 94  GLU A C     1 
ATOM   478   O  O     . GLU A 1 95  ? -37.728 -21.077 47.844 1.00 49.41  ? 94  GLU A O     1 
ATOM   479   C  CB    . GLU A 1 95  ? -39.634 -21.186 45.045 1.00 50.66  ? 94  GLU A CB    1 
ATOM   480   C  CG    . GLU A 1 95  ? -41.053 -21.552 44.612 1.00 52.01  ? 94  GLU A CG    1 
ATOM   481   C  CD    . GLU A 1 95  ? -41.608 -22.757 45.340 1.00 54.67  ? 94  GLU A CD    1 
ATOM   482   O  OE1   . GLU A 1 95  ? -42.851 -22.881 45.359 1.00 56.94  ? 94  GLU A OE1   1 
ATOM   483   O  OE2   . GLU A 1 95  ? -40.820 -23.575 45.883 1.00 54.59  ? 94  GLU A OE2   1 
ATOM   484   N  N     . ALA A 1 96  ? -37.311 -19.595 46.186 1.00 48.68  ? 95  ALA A N     1 
ATOM   485   C  CA    . ALA A 1 96  ? -35.902 -19.489 46.499 1.00 47.36  ? 95  ALA A CA    1 
ATOM   486   C  C     . ALA A 1 96  ? -35.713 -18.985 47.911 1.00 47.27  ? 95  ALA A C     1 
ATOM   487   O  O     . ALA A 1 96  ? -34.939 -19.575 48.664 1.00 47.37  ? 95  ALA A O     1 
ATOM   488   C  CB    . ALA A 1 96  ? -35.203 -18.618 45.523 1.00 47.18  ? 95  ALA A CB    1 
ATOM   489   N  N     . SER A 1 97  ? -36.440 -17.931 48.292 1.00 46.55  ? 96  SER A N     1 
ATOM   490   C  CA    . SER A 1 97  ? -36.279 -17.378 49.638 1.00 46.36  ? 96  SER A CA    1 
ATOM   491   C  C     . SER A 1 97  ? -36.605 -18.379 50.745 1.00 46.28  ? 96  SER A C     1 
ATOM   492   O  O     . SER A 1 97  ? -35.893 -18.466 51.755 1.00 46.59  ? 96  SER A O     1 
ATOM   493   C  CB    . SER A 1 97  ? -37.137 -16.134 49.824 1.00 46.10  ? 96  SER A CB    1 
ATOM   494   O  OG    . SER A 1 97  ? -36.742 -15.139 48.922 1.00 46.60  ? 96  SER A OG    1 
ATOM   495   N  N     . GLU A 1 98  ? -37.700 -19.111 50.568 1.00 45.87  ? 97  GLU A N     1 
ATOM   496   C  CA    . GLU A 1 98  ? -38.164 -20.022 51.597 1.00 45.36  ? 97  GLU A CA    1 
ATOM   497   C  C     . GLU A 1 98  ? -37.237 -21.234 51.688 1.00 44.58  ? 97  GLU A C     1 
ATOM   498   O  O     . GLU A 1 98  ? -36.920 -21.692 52.770 1.00 44.66  ? 97  GLU A O     1 
ATOM   499   C  CB    . GLU A 1 98  ? -39.621 -20.431 51.349 1.00 45.69  ? 97  GLU A CB    1 
ATOM   500   C  CG    . GLU A 1 98  ? -40.637 -19.290 51.514 1.00 46.80  ? 97  GLU A CG    1 
ATOM   501   C  CD    . GLU A 1 98  ? -42.058 -19.786 51.810 1.00 48.89  ? 97  GLU A CD    1 
ATOM   502   O  OE1   . GLU A 1 98  ? -42.235 -20.995 52.062 1.00 49.60  ? 97  GLU A OE1   1 
ATOM   503   O  OE2   . GLU A 1 98  ? -43.006 -18.964 51.798 1.00 50.47  ? 97  GLU A OE2   1 
ATOM   504   N  N     . ALA A 1 99  ? -36.776 -21.738 50.552 1.00 43.65  ? 98  ALA A N     1 
ATOM   505   C  CA    . ALA A 1 99  ? -35.785 -22.807 50.561 1.00 42.60  ? 98  ALA A CA    1 
ATOM   506   C  C     . ALA A 1 99  ? -34.502 -22.340 51.233 1.00 42.56  ? 98  ALA A C     1 
ATOM   507   O  O     . ALA A 1 99  ? -33.906 -23.087 51.991 1.00 42.76  ? 98  ALA A O     1 
ATOM   508   C  CB    . ALA A 1 99  ? -35.498 -23.265 49.165 1.00 42.23  ? 98  ALA A CB    1 
ATOM   509   N  N     . TYR A 1 100 ? -34.087 -21.102 50.958 1.00 42.55  ? 99  TYR A N     1 
ATOM   510   C  CA    . TYR A 1 100 ? -32.922 -20.520 51.601 1.00 42.33  ? 99  TYR A CA    1 
ATOM   511   C  C     . TYR A 1 100 ? -33.111 -20.488 53.115 1.00 42.62  ? 99  TYR A C     1 
ATOM   512   O  O     . TYR A 1 100 ? -32.219 -20.885 53.861 1.00 43.48  ? 99  TYR A O     1 
ATOM   513   C  CB    . TYR A 1 100 ? -32.619 -19.119 51.051 1.00 42.02  ? 99  TYR A CB    1 
ATOM   514   C  CG    . TYR A 1 100 ? -31.605 -18.345 51.863 1.00 42.37  ? 99  TYR A CG    1 
ATOM   515   C  CD1   . TYR A 1 100 ? -30.231 -18.544 51.702 1.00 42.95  ? 99  TYR A CD1   1 
ATOM   516   C  CD2   . TYR A 1 100 ? -32.023 -17.424 52.811 1.00 43.94  ? 99  TYR A CD2   1 
ATOM   517   C  CE1   . TYR A 1 100 ? -29.297 -17.827 52.480 1.00 43.68  ? 99  TYR A CE1   1 
ATOM   518   C  CE2   . TYR A 1 100 ? -31.112 -16.715 53.592 1.00 45.37  ? 99  TYR A CE2   1 
ATOM   519   C  CZ    . TYR A 1 100 ? -29.758 -16.916 53.428 1.00 45.51  ? 99  TYR A CZ    1 
ATOM   520   O  OH    . TYR A 1 100 ? -28.888 -16.185 54.219 1.00 47.05  ? 99  TYR A OH    1 
ATOM   521   N  N     . LEU A 1 101 ? -34.262 -20.021 53.571 1.00 42.30  ? 100 LEU A N     1 
ATOM   522   C  CA    . LEU A 1 101 ? -34.422 -19.771 54.982 1.00 42.18  ? 100 LEU A CA    1 
ATOM   523   C  C     . LEU A 1 101 ? -34.574 -21.072 55.737 1.00 43.08  ? 100 LEU A C     1 
ATOM   524   O  O     . LEU A 1 101 ? -34.048 -21.206 56.853 1.00 43.56  ? 100 LEU A O     1 
ATOM   525   C  CB    . LEU A 1 101 ? -35.610 -18.849 55.252 1.00 41.60  ? 100 LEU A CB    1 
ATOM   526   C  CG    . LEU A 1 101 ? -35.513 -17.359 54.935 1.00 39.94  ? 100 LEU A CG    1 
ATOM   527   C  CD1   . LEU A 1 101 ? -36.827 -16.701 55.316 1.00 37.61  ? 100 LEU A CD1   1 
ATOM   528   C  CD2   . LEU A 1 101 ? -34.352 -16.683 55.651 1.00 36.90  ? 100 LEU A CD2   1 
ATOM   529   N  N     . VAL A 1 102 ? -35.281 -22.034 55.132 1.00 43.25  ? 101 VAL A N     1 
ATOM   530   C  CA    . VAL A 1 102 ? -35.405 -23.363 55.733 1.00 43.15  ? 101 VAL A CA    1 
ATOM   531   C  C     . VAL A 1 102 ? -34.021 -23.995 55.947 1.00 43.14  ? 101 VAL A C     1 
ATOM   532   O  O     . VAL A 1 102 ? -33.719 -24.485 57.048 1.00 43.53  ? 101 VAL A O     1 
ATOM   533   C  CB    . VAL A 1 102 ? -36.275 -24.327 54.909 1.00 43.40  ? 101 VAL A CB    1 
ATOM   534   C  CG1   . VAL A 1 102 ? -36.097 -25.746 55.427 1.00 42.00  ? 101 VAL A CG1   1 
ATOM   535   C  CG2   . VAL A 1 102 ? -37.761 -23.914 54.947 1.00 42.20  ? 101 VAL A CG2   1 
ATOM   536   N  N     . GLY A 1 103 ? -33.170 -23.960 54.921 1.00 42.46  ? 102 GLY A N     1 
ATOM   537   C  CA    . GLY A 1 103 ? -31.842 -24.563 55.067 1.00 41.88  ? 102 GLY A CA    1 
ATOM   538   C  C     . GLY A 1 103 ? -31.044 -23.813 56.133 1.00 42.03  ? 102 GLY A C     1 
ATOM   539   O  O     . GLY A 1 103 ? -30.326 -24.429 56.923 1.00 42.49  ? 102 GLY A O     1 
ATOM   540   N  N     . LEU A 1 104 ? -31.207 -22.499 56.199 1.00 41.88  ? 103 LEU A N     1 
ATOM   541   C  CA    . LEU A 1 104 ? -30.464 -21.728 57.182 1.00 42.45  ? 103 LEU A CA    1 
ATOM   542   C  C     . LEU A 1 104 ? -30.903 -22.079 58.620 1.00 42.86  ? 103 LEU A C     1 
ATOM   543   O  O     . LEU A 1 104 ? -30.096 -22.113 59.545 1.00 42.36  ? 103 LEU A O     1 
ATOM   544   C  CB    . LEU A 1 104 ? -30.595 -20.230 56.908 1.00 42.55  ? 103 LEU A CB    1 
ATOM   545   C  CG    . LEU A 1 104 ? -29.938 -19.278 57.914 1.00 41.48  ? 103 LEU A CG    1 
ATOM   546   C  CD1   . LEU A 1 104 ? -28.449 -19.372 57.818 1.00 39.66  ? 103 LEU A CD1   1 
ATOM   547   C  CD2   . LEU A 1 104 ? -30.410 -17.848 57.683 1.00 40.33  ? 103 LEU A CD2   1 
ATOM   548   N  N     . PHE A 1 105 ? -32.188 -22.357 58.784 1.00 43.28  ? 104 PHE A N     1 
ATOM   549   C  CA    . PHE A 1 105 ? -32.686 -22.883 60.031 1.00 43.65  ? 104 PHE A CA    1 
ATOM   550   C  C     . PHE A 1 105 ? -32.131 -24.276 60.350 1.00 44.43  ? 104 PHE A C     1 
ATOM   551   O  O     . PHE A 1 105 ? -31.975 -24.626 61.508 1.00 44.68  ? 104 PHE A O     1 
ATOM   552   C  CB    . PHE A 1 105 ? -34.210 -22.870 60.038 1.00 43.54  ? 104 PHE A CB    1 
ATOM   553   C  CG    . PHE A 1 105 ? -34.803 -21.514 60.315 1.00 43.09  ? 104 PHE A CG    1 
ATOM   554   C  CD1   . PHE A 1 105 ? -35.698 -20.931 59.428 1.00 41.63  ? 104 PHE A CD1   1 
ATOM   555   C  CD2   . PHE A 1 105 ? -34.462 -20.821 61.476 1.00 42.97  ? 104 PHE A CD2   1 
ATOM   556   C  CE1   . PHE A 1 105 ? -36.240 -19.687 59.701 1.00 42.34  ? 104 PHE A CE1   1 
ATOM   557   C  CE2   . PHE A 1 105 ? -34.999 -19.587 61.752 1.00 41.92  ? 104 PHE A CE2   1 
ATOM   558   C  CZ    . PHE A 1 105 ? -35.888 -19.016 60.869 1.00 42.69  ? 104 PHE A CZ    1 
ATOM   559   N  N     . GLU A 1 106 ? -31.807 -25.079 59.349 1.00 45.12  ? 105 GLU A N     1 
ATOM   560   C  CA    . GLU A 1 106 ? -31.210 -26.364 59.674 1.00 45.95  ? 105 GLU A CA    1 
ATOM   561   C  C     . GLU A 1 106 ? -29.837 -26.116 60.285 1.00 45.66  ? 105 GLU A C     1 
ATOM   562   O  O     . GLU A 1 106 ? -29.532 -26.651 61.349 1.00 46.42  ? 105 GLU A O     1 
ATOM   563   C  CB    . GLU A 1 106 ? -31.125 -27.296 58.457 1.00 46.36  ? 105 GLU A CB    1 
ATOM   564   C  CG    . GLU A 1 106 ? -32.472 -27.665 57.833 1.00 49.80  ? 105 GLU A CG    1 
ATOM   565   C  CD    . GLU A 1 106 ? -32.365 -28.284 56.412 1.00 54.75  ? 105 GLU A CD    1 
ATOM   566   O  OE1   . GLU A 1 106 ? -31.297 -28.887 56.102 1.00 56.25  ? 105 GLU A OE1   1 
ATOM   567   O  OE2   . GLU A 1 106 ? -33.354 -28.174 55.616 1.00 52.92  ? 105 GLU A OE2   1 
ATOM   568   N  N     . ASP A 1 107 ? -29.027 -25.279 59.634 1.00 45.28  ? 106 ASP A N     1 
ATOM   569   C  CA    . ASP A 1 107 ? -27.658 -24.986 60.092 1.00 44.66  ? 106 ASP A CA    1 
ATOM   570   C  C     . ASP A 1 107 ? -27.681 -24.259 61.422 1.00 44.40  ? 106 ASP A C     1 
ATOM   571   O  O     . ASP A 1 107 ? -26.879 -24.534 62.318 1.00 43.53  ? 106 ASP A O     1 
ATOM   572   C  CB    . ASP A 1 107 ? -26.921 -24.122 59.087 1.00 44.43  ? 106 ASP A CB    1 
ATOM   573   C  CG    . ASP A 1 107 ? -26.824 -24.755 57.715 1.00 46.81  ? 106 ASP A CG    1 
ATOM   574   O  OD1   . ASP A 1 107 ? -27.402 -25.840 57.487 1.00 48.86  ? 106 ASP A OD1   1 
ATOM   575   O  OD2   . ASP A 1 107 ? -26.162 -24.150 56.833 1.00 50.67  ? 106 ASP A OD2   1 
ATOM   576   N  N     . THR A 1 108 ? -28.609 -23.318 61.534 1.00 44.57  ? 107 THR A N     1 
ATOM   577   C  CA    . THR A 1 108 ? -28.825 -22.601 62.766 1.00 45.08  ? 107 THR A CA    1 
ATOM   578   C  C     . THR A 1 108 ? -29.077 -23.594 63.900 1.00 45.61  ? 107 THR A C     1 
ATOM   579   O  O     . THR A 1 108 ? -28.440 -23.518 64.966 1.00 45.41  ? 107 THR A O     1 
ATOM   580   C  CB    . THR A 1 108 ? -29.999 -21.629 62.635 1.00 45.16  ? 107 THR A CB    1 
ATOM   581   O  OG1   . THR A 1 108 ? -29.691 -20.660 61.620 1.00 45.26  ? 107 THR A OG1   1 
ATOM   582   C  CG2   . THR A 1 108 ? -30.226 -20.901 63.943 1.00 44.95  ? 107 THR A CG2   1 
ATOM   583   N  N     . ASN A 1 109 ? -29.976 -24.542 63.641 1.00 45.71  ? 108 ASN A N     1 
ATOM   584   C  CA    . ASN A 1 109 ? -30.335 -25.552 64.615 1.00 45.95  ? 108 ASN A CA    1 
ATOM   585   C  C     . ASN A 1 109 ? -29.116 -26.358 65.009 1.00 45.65  ? 108 ASN A C     1 
ATOM   586   O  O     . ASN A 1 109 ? -28.859 -26.548 66.199 1.00 45.42  ? 108 ASN A O     1 
ATOM   587   C  CB    . ASN A 1 109 ? -31.445 -26.460 64.075 1.00 46.44  ? 108 ASN A CB    1 
ATOM   588   C  CG    . ASN A 1 109 ? -32.276 -27.092 65.178 1.00 48.22  ? 108 ASN A CG    1 
ATOM   589   O  OD1   . ASN A 1 109 ? -32.548 -26.478 66.215 1.00 52.52  ? 108 ASN A OD1   1 
ATOM   590   N  ND2   . ASN A 1 109 ? -32.683 -28.319 64.962 1.00 48.74  ? 108 ASN A ND2   1 
ATOM   591   N  N     . LEU A 1 110 ? -28.338 -26.798 64.023 1.00 45.20  ? 109 LEU A N     1 
ATOM   592   C  CA    . LEU A 1 110 ? -27.104 -27.497 64.348 1.00 45.26  ? 109 LEU A CA    1 
ATOM   593   C  C     . LEU A 1 110 ? -26.158 -26.663 65.222 1.00 45.45  ? 109 LEU A C     1 
ATOM   594   O  O     . LEU A 1 110 ? -25.468 -27.212 66.077 1.00 46.53  ? 109 LEU A O     1 
ATOM   595   C  CB    . LEU A 1 110 ? -26.392 -27.972 63.098 1.00 44.79  ? 109 LEU A CB    1 
ATOM   596   C  CG    . LEU A 1 110 ? -27.130 -28.990 62.244 1.00 44.72  ? 109 LEU A CG    1 
ATOM   597   C  CD1   . LEU A 1 110 ? -26.329 -29.190 60.992 1.00 44.53  ? 109 LEU A CD1   1 
ATOM   598   C  CD2   . LEU A 1 110 ? -27.313 -30.317 62.962 1.00 43.44  ? 109 LEU A CD2   1 
ATOM   599   N  N     . CYS A 1 111 ? -26.137 -25.351 65.033 1.00 45.03  ? 110 CYS A N     1 
ATOM   600   C  CA    . CYS A 1 111 ? -25.255 -24.520 65.830 1.00 45.29  ? 110 CYS A CA    1 
ATOM   601   C  C     . CYS A 1 111 ? -25.727 -24.447 67.291 1.00 45.40  ? 110 CYS A C     1 
ATOM   602   O  O     . CYS A 1 111 ? -24.918 -24.539 68.221 1.00 44.85  ? 110 CYS A O     1 
ATOM   603   C  CB    . CYS A 1 111 ? -25.104 -23.125 65.211 1.00 45.29  ? 110 CYS A CB    1 
ATOM   604   S  SG    . CYS A 1 111 ? -24.254 -23.110 63.601 1.00 46.19  ? 110 CYS A SG    1 
ATOM   605   N  N     . ALA A 1 112 ? -27.038 -24.298 67.479 1.00 45.69  ? 111 ALA A N     1 
ATOM   606   C  CA    . ALA A 1 112 ? -27.639 -24.314 68.806 1.00 45.70  ? 111 ALA A CA    1 
ATOM   607   C  C     . ALA A 1 112 ? -27.355 -25.624 69.506 1.00 45.89  ? 111 ALA A C     1 
ATOM   608   O  O     . ALA A 1 112 ? -26.970 -25.631 70.662 1.00 46.40  ? 111 ALA A O     1 
ATOM   609   C  CB    . ALA A 1 112 ? -29.124 -24.071 68.732 1.00 45.73  ? 111 ALA A CB    1 
ATOM   610   N  N     . ILE A 1 113 ? -27.521 -26.735 68.805 1.00 46.28  ? 112 ILE A N     1 
ATOM   611   C  CA    . ILE A 1 113 ? -27.218 -28.039 69.391 1.00 46.76  ? 112 ILE A CA    1 
ATOM   612   C  C     . ILE A 1 113 ? -25.722 -28.156 69.709 1.00 47.60  ? 112 ILE A C     1 
ATOM   613   O  O     . ILE A 1 113 ? -25.329 -28.814 70.677 1.00 48.04  ? 112 ILE A O     1 
ATOM   614   C  CB    . ILE A 1 113 ? -27.704 -29.193 68.489 1.00 46.56  ? 112 ILE A CB    1 
ATOM   615   C  CG1   . ILE A 1 113 ? -29.230 -29.216 68.446 1.00 46.17  ? 112 ILE A CG1   1 
ATOM   616   C  CG2   . ILE A 1 113 ? -27.215 -30.537 68.979 1.00 45.37  ? 112 ILE A CG2   1 
ATOM   617   C  CD1   . ILE A 1 113 ? -29.769 -30.019 67.282 1.00 45.50  ? 112 ILE A CD1   1 
ATOM   618   N  N     . HIS A 1 114 ? -24.890 -27.491 68.917 1.00 48.07  ? 113 HIS A N     1 
ATOM   619   C  CA    . HIS A 1 114 ? -23.458 -27.505 69.177 1.00 48.31  ? 113 HIS A CA    1 
ATOM   620   C  C     . HIS A 1 114 ? -23.113 -26.871 70.519 1.00 49.04  ? 113 HIS A C     1 
ATOM   621   O  O     . HIS A 1 114 ? -22.136 -27.265 71.161 1.00 49.50  ? 113 HIS A O     1 
ATOM   622   C  CB    . HIS A 1 114 ? -22.699 -26.790 68.068 1.00 47.79  ? 113 HIS A CB    1 
ATOM   623   C  CG    . HIS A 1 114 ? -21.215 -26.961 68.155 1.00 47.10  ? 113 HIS A CG    1 
ATOM   624   N  ND1   . HIS A 1 114 ? -20.582 -28.134 67.807 1.00 45.96  ? 113 HIS A ND1   1 
ATOM   625   C  CD2   . HIS A 1 114 ? -20.240 -26.111 68.558 1.00 46.05  ? 113 HIS A CD2   1 
ATOM   626   C  CE1   . HIS A 1 114 ? -19.279 -27.996 67.982 1.00 45.56  ? 113 HIS A CE1   1 
ATOM   627   N  NE2   . HIS A 1 114 ? -19.046 -26.778 68.438 1.00 44.74  ? 113 HIS A NE2   1 
ATOM   628   N  N     . ALA A 1 115 ? -23.904 -25.876 70.921 1.00 49.69  ? 114 ALA A N     1 
ATOM   629   C  CA    . ALA A 1 115 ? -23.686 -25.151 72.166 1.00 50.13  ? 114 ALA A CA    1 
ATOM   630   C  C     . ALA A 1 115 ? -24.573 -25.783 73.243 1.00 51.19  ? 114 ALA A C     1 
ATOM   631   O  O     . ALA A 1 115 ? -24.875 -25.168 74.271 1.00 51.61  ? 114 ALA A O     1 
ATOM   632   C  CB    . ALA A 1 115 ? -24.006 -23.698 71.985 1.00 49.54  ? 114 ALA A CB    1 
ATOM   633   N  N     . LYS A 1 116 ? -24.993 -27.021 72.977 1.00 51.78  ? 115 LYS A N     1 
ATOM   634   C  CA    . LYS A 1 116 ? -25.742 -27.834 73.924 1.00 52.32  ? 115 LYS A CA    1 
ATOM   635   C  C     . LYS A 1 116 ? -27.074 -27.230 74.307 1.00 51.76  ? 115 LYS A C     1 
ATOM   636   O  O     . LYS A 1 116 ? -27.524 -27.397 75.444 1.00 51.83  ? 115 LYS A O     1 
ATOM   637   C  CB    . LYS A 1 116 ? -24.905 -28.125 75.166 1.00 52.88  ? 115 LYS A CB    1 
ATOM   638   C  CG    . LYS A 1 116 ? -23.679 -28.955 74.860 1.00 55.50  ? 115 LYS A CG    1 
ATOM   639   C  CD    . LYS A 1 116 ? -22.739 -28.992 76.043 1.00 60.32  ? 115 LYS A CD    1 
ATOM   640   C  CE    . LYS A 1 116 ? -21.557 -29.901 75.734 1.00 64.26  ? 115 LYS A CE    1 
ATOM   641   N  NZ    . LYS A 1 116 ? -20.647 -30.106 76.913 1.00 67.95  ? 115 LYS A NZ    1 
ATOM   642   N  N     . ARG A 1 117 ? -27.698 -26.546 73.349 1.00 50.86  ? 116 ARG A N     1 
ATOM   643   C  CA    . ARG A 1 117 ? -29.025 -25.978 73.528 1.00 50.08  ? 116 ARG A CA    1 
ATOM   644   C  C     . ARG A 1 117 ? -30.041 -26.635 72.592 1.00 49.77  ? 116 ARG A C     1 
ATOM   645   O  O     . ARG A 1 117 ? -29.694 -27.491 71.785 1.00 50.31  ? 116 ARG A O     1 
ATOM   646   C  CB    . ARG A 1 117 ? -28.976 -24.461 73.303 1.00 50.47  ? 116 ARG A CB    1 
ATOM   647   C  CG    . ARG A 1 117 ? -28.206 -23.660 74.382 1.00 49.70  ? 116 ARG A CG    1 
ATOM   648   C  CD    . ARG A 1 117 ? -28.322 -22.136 74.165 1.00 48.83  ? 116 ARG A CD    1 
ATOM   649   N  NE    . ARG A 1 117 ? -27.332 -21.593 73.215 1.00 47.98  ? 116 ARG A NE    1 
ATOM   650   C  CZ    . ARG A 1 117 ? -27.545 -21.399 71.910 1.00 45.32  ? 116 ARG A CZ    1 
ATOM   651   N  NH1   . ARG A 1 117 ? -28.702 -21.699 71.364 1.00 44.19  ? 116 ARG A NH1   1 
ATOM   652   N  NH2   . ARG A 1 117 ? -26.597 -20.902 71.141 1.00 46.08  ? 116 ARG A NH2   1 
ATOM   653   N  N     . VAL A 1 118 ? -31.302 -26.241 72.716 1.00 49.41  ? 117 VAL A N     1 
ATOM   654   C  CA    . VAL A 1 118 ? -32.378 -26.726 71.854 1.00 48.69  ? 117 VAL A CA    1 
ATOM   655   C  C     . VAL A 1 118 ? -33.169 -25.522 71.389 1.00 49.03  ? 117 VAL A C     1 
ATOM   656   O  O     . VAL A 1 118 ? -34.231 -25.657 70.784 1.00 49.55  ? 117 VAL A O     1 
ATOM   657   C  CB    . VAL A 1 118 ? -33.342 -27.724 72.589 1.00 48.52  ? 117 VAL A CB    1 
ATOM   658   C  CG1   . VAL A 1 118 ? -32.637 -29.043 72.920 1.00 48.09  ? 117 VAL A CG1   1 
ATOM   659   C  CG2   . VAL A 1 118 ? -33.922 -27.112 73.848 1.00 47.04  ? 117 VAL A CG2   1 
ATOM   660   N  N     . THR A 1 119 ? -32.652 -24.338 71.700 1.00 49.10  ? 118 THR A N     1 
ATOM   661   C  CA    . THR A 1 119 ? -33.313 -23.081 71.371 1.00 49.34  ? 118 THR A CA    1 
ATOM   662   C  C     . THR A 1 119 ? -32.451 -22.267 70.426 1.00 49.46  ? 118 THR A C     1 
ATOM   663   O  O     . THR A 1 119 ? -31.363 -21.859 70.792 1.00 49.61  ? 118 THR A O     1 
ATOM   664   C  CB    . THR A 1 119 ? -33.518 -22.221 72.632 1.00 49.19  ? 118 THR A CB    1 
ATOM   665   O  OG1   . THR A 1 119 ? -33.955 -23.052 73.719 1.00 49.95  ? 118 THR A OG1   1 
ATOM   666   C  CG2   . THR A 1 119 ? -34.540 -21.132 72.367 1.00 48.87  ? 118 THR A CG2   1 
ATOM   667   N  N     . ILE A 1 120 ? -32.923 -22.014 69.213 1.00 49.89  ? 119 ILE A N     1 
ATOM   668   C  CA    . ILE A 1 120 ? -32.117 -21.213 68.291 1.00 49.66  ? 119 ILE A CA    1 
ATOM   669   C  C     . ILE A 1 120 ? -32.098 -19.749 68.731 1.00 50.12  ? 119 ILE A C     1 
ATOM   670   O  O     . ILE A 1 120 ? -33.098 -19.226 69.223 1.00 50.28  ? 119 ILE A O     1 
ATOM   671   C  CB    . ILE A 1 120 ? -32.548 -21.360 66.826 1.00 48.97  ? 119 ILE A CB    1 
ATOM   672   C  CG1   . ILE A 1 120 ? -33.979 -20.889 66.632 1.00 48.49  ? 119 ILE A CG1   1 
ATOM   673   C  CG2   . ILE A 1 120 ? -32.400 -22.792 66.387 1.00 48.94  ? 119 ILE A CG2   1 
ATOM   674   C  CD1   . ILE A 1 120 ? -34.283 -20.449 65.215 1.00 46.89  ? 119 ILE A CD1   1 
ATOM   675   N  N     . MET A 1 121 ? -30.936 -19.123 68.581 1.00 50.25  ? 120 MET A N     1 
ATOM   676   C  CA    . MET A 1 121 ? -30.711 -17.759 68.998 1.00 50.61  ? 120 MET A CA    1 
ATOM   677   C  C     . MET A 1 121 ? -30.030 -17.009 67.867 1.00 50.66  ? 120 MET A C     1 
ATOM   678   O  O     . MET A 1 121 ? -29.528 -17.624 66.935 1.00 50.64  ? 120 MET A O     1 
ATOM   679   C  CB    . MET A 1 121 ? -29.853 -17.741 70.251 1.00 50.85  ? 120 MET A CB    1 
ATOM   680   C  CG    . MET A 1 121 ? -30.587 -18.250 71.462 1.00 52.40  ? 120 MET A CG    1 
ATOM   681   S  SD    . MET A 1 121 ? -29.592 -18.316 72.951 1.00 57.29  ? 120 MET A SD    1 
ATOM   682   C  CE    . MET A 1 121 ? -30.744 -19.235 73.994 1.00 56.57  ? 120 MET A CE    1 
ATOM   683   N  N     . PRO A 1 122 ? -30.046 -15.670 67.915 1.00 50.74  ? 121 PRO A N     1 
ATOM   684   C  CA    . PRO A 1 122 ? -29.377 -14.944 66.849 1.00 50.60  ? 121 PRO A CA    1 
ATOM   685   C  C     . PRO A 1 122 ? -27.917 -15.356 66.657 1.00 50.49  ? 121 PRO A C     1 
ATOM   686   O  O     . PRO A 1 122 ? -27.394 -15.321 65.535 1.00 50.60  ? 121 PRO A O     1 
ATOM   687   C  CB    . PRO A 1 122 ? -29.484 -13.493 67.319 1.00 50.45  ? 121 PRO A CB    1 
ATOM   688   C  CG    . PRO A 1 122 ? -30.832 -13.455 67.952 1.00 50.54  ? 121 PRO A CG    1 
ATOM   689   C  CD    . PRO A 1 122 ? -30.954 -14.789 68.679 1.00 50.79  ? 121 PRO A CD    1 
ATOM   690   N  N     . LYS A 1 123 ? -27.254 -15.758 67.729 1.00 49.91  ? 122 LYS A N     1 
ATOM   691   C  CA    . LYS A 1 123 ? -25.837 -16.023 67.588 1.00 49.50  ? 122 LYS A CA    1 
ATOM   692   C  C     . LYS A 1 123 ? -25.618 -17.265 66.765 1.00 48.72  ? 122 LYS A C     1 
ATOM   693   O  O     . LYS A 1 123 ? -24.626 -17.362 66.053 1.00 48.69  ? 122 LYS A O     1 
ATOM   694   C  CB    . LYS A 1 123 ? -25.113 -16.076 68.932 1.00 49.53  ? 122 LYS A CB    1 
ATOM   695   C  CG    . LYS A 1 123 ? -25.744 -16.946 69.971 1.00 51.74  ? 122 LYS A CG    1 
ATOM   696   C  CD    . LYS A 1 123 ? -24.820 -17.059 71.163 1.00 55.68  ? 122 LYS A CD    1 
ATOM   697   C  CE    . LYS A 1 123 ? -25.606 -17.343 72.428 1.00 58.72  ? 122 LYS A CE    1 
ATOM   698   N  NZ    . LYS A 1 123 ? -24.708 -17.311 73.617 1.00 60.71  ? 122 LYS A NZ    1 
ATOM   699   N  N     . ASP A 1 124 ? -26.574 -18.189 66.853 1.00 48.01  ? 123 ASP A N     1 
ATOM   700   C  CA    . ASP A 1 124 ? -26.620 -19.380 66.019 1.00 46.96  ? 123 ASP A CA    1 
ATOM   701   C  C     . ASP A 1 124 ? -26.790 -19.038 64.540 1.00 46.50  ? 123 ASP A C     1 
ATOM   702   O  O     . ASP A 1 124 ? -26.084 -19.568 63.709 1.00 46.40  ? 123 ASP A O     1 
ATOM   703   C  CB    . ASP A 1 124 ? -27.763 -20.275 66.462 1.00 47.04  ? 123 ASP A CB    1 
ATOM   704   C  CG    . ASP A 1 124 ? -27.651 -20.703 67.917 1.00 46.96  ? 123 ASP A CG    1 
ATOM   705   O  OD1   . ASP A 1 124 ? -26.533 -20.988 68.393 1.00 47.20  ? 123 ASP A OD1   1 
ATOM   706   O  OD2   . ASP A 1 124 ? -28.699 -20.775 68.585 1.00 46.90  ? 123 ASP A OD2   1 
ATOM   707   N  N     . ILE A 1 125 ? -27.721 -18.155 64.211 1.00 46.23  ? 124 ILE A N     1 
ATOM   708   C  CA    . ILE A 1 125 ? -27.859 -17.684 62.833 1.00 46.59  ? 124 ILE A CA    1 
ATOM   709   C  C     . ILE A 1 125 ? -26.582 -17.007 62.350 1.00 46.89  ? 124 ILE A C     1 
ATOM   710   O  O     . ILE A 1 125 ? -26.118 -17.238 61.224 1.00 47.14  ? 124 ILE A O     1 
ATOM   711   C  CB    . ILE A 1 125 ? -29.031 -16.688 62.652 1.00 46.43  ? 124 ILE A CB    1 
ATOM   712   C  CG1   . ILE A 1 125 ? -30.361 -17.346 63.027 1.00 46.54  ? 124 ILE A CG1   1 
ATOM   713   C  CG2   . ILE A 1 125 ? -29.113 -16.210 61.195 1.00 45.75  ? 124 ILE A CG2   1 
ATOM   714   C  CD1   . ILE A 1 125 ? -31.586 -16.480 62.781 1.00 45.29  ? 124 ILE A CD1   1 
ATOM   715   N  N     . GLN A 1 126 ? -26.025 -16.173 63.215 1.00 47.07  ? 125 GLN A N     1 
ATOM   716   C  CA    . GLN A 1 126 ? -24.834 -15.409 62.895 1.00 47.34  ? 125 GLN A CA    1 
ATOM   717   C  C     . GLN A 1 126 ? -23.684 -16.349 62.643 1.00 46.48  ? 125 GLN A C     1 
ATOM   718   O  O     . GLN A 1 126 ? -22.967 -16.207 61.665 1.00 47.13  ? 125 GLN A O     1 
ATOM   719   C  CB    . GLN A 1 126 ? -24.502 -14.423 64.020 1.00 47.82  ? 125 GLN A CB    1 
ATOM   720   C  CG    . GLN A 1 126 ? -25.406 -13.194 64.035 1.00 49.97  ? 125 GLN A CG    1 
ATOM   721   C  CD    . GLN A 1 126 ? -25.527 -12.543 65.417 1.00 55.35  ? 125 GLN A CD    1 
ATOM   722   O  OE1   . GLN A 1 126 ? -24.688 -12.759 66.310 1.00 56.51  ? 125 GLN A OE1   1 
ATOM   723   N  NE2   . GLN A 1 126 ? -26.580 -11.728 65.597 1.00 55.99  ? 125 GLN A NE2   1 
ATOM   724   N  N     . LEU A 1 127 ? -23.528 -17.340 63.500 1.00 45.38  ? 126 LEU A N     1 
ATOM   725   C  CA    . LEU A 1 127 ? -22.469 -18.305 63.288 1.00 44.76  ? 126 LEU A CA    1 
ATOM   726   C  C     . LEU A 1 127 ? -22.651 -19.063 61.944 1.00 44.62  ? 126 LEU A C     1 
ATOM   727   O  O     . LEU A 1 127 ? -21.697 -19.217 61.179 1.00 44.30  ? 126 LEU A O     1 
ATOM   728   C  CB    . LEU A 1 127 ? -22.383 -19.259 64.474 1.00 43.94  ? 126 LEU A CB    1 
ATOM   729   C  CG    . LEU A 1 127 ? -21.263 -20.269 64.358 1.00 44.55  ? 126 LEU A CG    1 
ATOM   730   C  CD1   . LEU A 1 127 ? -19.916 -19.562 64.422 1.00 44.74  ? 126 LEU A CD1   1 
ATOM   731   C  CD2   . LEU A 1 127 ? -21.397 -21.335 65.426 1.00 44.66  ? 126 LEU A CD2   1 
ATOM   732   N  N     . ALA A 1 128 ? -23.868 -19.517 61.662 1.00 44.19  ? 127 ALA A N     1 
ATOM   733   C  CA    . ALA A 1 128 ? -24.119 -20.252 60.445 1.00 44.74  ? 127 ALA A CA    1 
ATOM   734   C  C     . ALA A 1 128 ? -23.773 -19.401 59.224 1.00 45.17  ? 127 ALA A C     1 
ATOM   735   O  O     . ALA A 1 128 ? -23.060 -19.851 58.333 1.00 45.37  ? 127 ALA A O     1 
ATOM   736   C  CB    . ALA A 1 128 ? -25.553 -20.744 60.388 1.00 44.59  ? 127 ALA A CB    1 
ATOM   737   N  N     . ARG A 1 129 ? -24.228 -18.153 59.209 1.00 45.56  ? 128 ARG A N     1 
ATOM   738   C  CA    . ARG A 1 129 ? -23.910 -17.263 58.103 1.00 45.71  ? 128 ARG A CA    1 
ATOM   739   C  C     . ARG A 1 129 ? -22.433 -16.924 57.984 1.00 45.89  ? 128 ARG A C     1 
ATOM   740   O  O     . ARG A 1 129 ? -21.938 -16.763 56.882 1.00 46.16  ? 128 ARG A O     1 
ATOM   741   C  CB    . ARG A 1 129 ? -24.759 -16.012 58.163 1.00 45.58  ? 128 ARG A CB    1 
ATOM   742   C  CG    . ARG A 1 129 ? -26.199 -16.314 57.928 1.00 45.98  ? 128 ARG A CG    1 
ATOM   743   C  CD    . ARG A 1 129 ? -27.010 -15.055 57.852 1.00 48.59  ? 128 ARG A CD    1 
ATOM   744   N  NE    . ARG A 1 129 ? -26.773 -14.311 56.618 1.00 50.03  ? 128 ARG A NE    1 
ATOM   745   C  CZ    . ARG A 1 129 ? -26.373 -13.040 56.566 1.00 49.10  ? 128 ARG A CZ    1 
ATOM   746   N  NH1   . ARG A 1 129 ? -26.168 -12.361 57.675 1.00 47.16  ? 128 ARG A NH1   1 
ATOM   747   N  NH2   . ARG A 1 129 ? -26.188 -12.444 55.396 1.00 50.10  ? 128 ARG A NH2   1 
ATOM   748   N  N     . ARG A 1 130 ? -21.725 -16.826 59.102 1.00 46.27  ? 129 ARG A N     1 
ATOM   749   C  CA    . ARG A 1 130 ? -20.289 -16.547 59.043 1.00 47.11  ? 129 ARG A CA    1 
ATOM   750   C  C     . ARG A 1 130 ? -19.501 -17.716 58.415 1.00 47.49  ? 129 ARG A C     1 
ATOM   751   O  O     . ARG A 1 130 ? -18.655 -17.507 57.557 1.00 47.20  ? 129 ARG A O     1 
ATOM   752   C  CB    . ARG A 1 130 ? -19.751 -16.114 60.417 1.00 46.63  ? 129 ARG A CB    1 
ATOM   753   C  CG    . ARG A 1 130 ? -18.244 -16.163 60.612 1.00 47.67  ? 129 ARG A CG    1 
ATOM   754   C  CD    . ARG A 1 130 ? -17.437 -15.397 59.578 1.00 49.92  ? 129 ARG A CD    1 
ATOM   755   N  NE    . ARG A 1 130 ? -16.000 -15.669 59.685 1.00 53.82  ? 129 ARG A NE    1 
ATOM   756   C  CZ    . ARG A 1 130 ? -15.402 -16.799 59.285 1.00 55.38  ? 129 ARG A CZ    1 
ATOM   757   N  NH1   . ARG A 1 130 ? -16.111 -17.791 58.752 1.00 55.85  ? 129 ARG A NH1   1 
ATOM   758   N  NH2   . ARG A 1 130 ? -14.090 -16.946 59.424 1.00 54.26  ? 129 ARG A NH2   1 
ATOM   759   N  N     . ILE A 1 131 ? -19.822 -18.940 58.819 1.00 48.35  ? 130 ILE A N     1 
ATOM   760   C  CA    . ILE A 1 131 ? -19.153 -20.135 58.309 1.00 49.10  ? 130 ILE A CA    1 
ATOM   761   C  C     . ILE A 1 131 ? -19.527 -20.400 56.847 1.00 49.50  ? 130 ILE A C     1 
ATOM   762   O  O     . ILE A 1 131 ? -18.720 -20.901 56.068 1.00 49.70  ? 130 ILE A O     1 
ATOM   763   C  CB    . ILE A 1 131 ? -19.461 -21.340 59.201 1.00 49.04  ? 130 ILE A CB    1 
ATOM   764   C  CG1   . ILE A 1 131 ? -18.924 -21.074 60.593 1.00 49.22  ? 130 ILE A CG1   1 
ATOM   765   C  CG2   . ILE A 1 131 ? -18.842 -22.613 58.666 1.00 49.34  ? 130 ILE A CG2   1 
ATOM   766   C  CD1   . ILE A 1 131 ? -19.443 -22.049 61.595 1.00 52.74  ? 130 ILE A CD1   1 
ATOM   767   N  N     . ARG A 1 132 ? -20.745 -20.029 56.480 1.00 50.17  ? 131 ARG A N     1 
ATOM   768   C  CA    . ARG A 1 132 ? -21.185 -20.109 55.094 1.00 50.88  ? 131 ARG A CA    1 
ATOM   769   C  C     . ARG A 1 132 ? -20.455 -19.131 54.161 1.00 51.82  ? 131 ARG A C     1 
ATOM   770   O  O     . ARG A 1 132 ? -20.547 -19.253 52.953 1.00 51.49  ? 131 ARG A O     1 
ATOM   771   C  CB    . ARG A 1 132 ? -22.678 -19.848 55.018 1.00 50.26  ? 131 ARG A CB    1 
ATOM   772   C  CG    . ARG A 1 132 ? -23.562 -21.021 55.349 1.00 49.22  ? 131 ARG A CG    1 
ATOM   773   C  CD    . ARG A 1 132 ? -24.992 -20.505 55.413 1.00 49.79  ? 131 ARG A CD    1 
ATOM   774   N  NE    . ARG A 1 132 ? -26.008 -21.543 55.513 1.00 48.08  ? 131 ARG A NE    1 
ATOM   775   C  CZ    . ARG A 1 132 ? -27.128 -21.556 54.789 1.00 48.46  ? 131 ARG A CZ    1 
ATOM   776   N  NH1   . ARG A 1 132 ? -27.364 -20.594 53.897 1.00 46.65  ? 131 ARG A NH1   1 
ATOM   777   N  NH2   . ARG A 1 132 ? -28.007 -22.547 54.935 1.00 47.99  ? 131 ARG A NH2   1 
ATOM   778   N  N     . GLY A 1 133 ? -19.747 -18.156 54.723 1.00 53.13  ? 132 GLY A N     1 
ATOM   779   C  CA    . GLY A 1 133 ? -19.152 -17.101 53.915 1.00 54.96  ? 132 GLY A CA    1 
ATOM   780   C  C     . GLY A 1 133 ? -20.116 -15.986 53.531 1.00 56.42  ? 132 GLY A C     1 
ATOM   781   O  O     . GLY A 1 133 ? -19.813 -15.167 52.662 1.00 57.15  ? 132 GLY A O     1 
ATOM   782   N  N     . GLU A 1 134 ? -21.273 -15.928 54.176 1.00 57.43  ? 133 GLU A N     1 
ATOM   783   C  CA    . GLU A 1 134 ? -22.217 -14.860 53.892 1.00 58.74  ? 133 GLU A CA    1 
ATOM   784   C  C     . GLU A 1 134 ? -21.839 -13.568 54.610 1.00 60.11  ? 133 GLU A C     1 
ATOM   785   O  O     . GLU A 1 134 ? -22.202 -12.473 54.161 1.00 60.62  ? 133 GLU A O     1 
ATOM   786   C  CB    . GLU A 1 134 ? -23.655 -15.295 54.204 1.00 58.35  ? 133 GLU A CB    1 
ATOM   787   C  CG    . GLU A 1 134 ? -24.251 -16.218 53.140 1.00 57.31  ? 133 GLU A CG    1 
ATOM   788   C  CD    . GLU A 1 134 ? -25.560 -16.900 53.564 1.00 56.79  ? 133 GLU A CD    1 
ATOM   789   O  OE1   . GLU A 1 134 ? -26.421 -16.253 54.212 1.00 56.46  ? 133 GLU A OE1   1 
ATOM   790   O  OE2   . GLU A 1 134 ? -25.731 -18.089 53.223 1.00 55.08  ? 133 GLU A OE2   1 
ATOM   791   N  N     . ARG A 1 135 ? -21.115 -13.709 55.723 1.00 61.77  ? 134 ARG A N     1 
ATOM   792   C  CA    . ARG A 1 135 ? -20.605 -12.574 56.514 1.00 62.93  ? 134 ARG A CA    1 
ATOM   793   C  C     . ARG A 1 135 ? -19.186 -12.182 56.060 1.00 63.56  ? 134 ARG A C     1 
ATOM   794   O  O     . ARG A 1 135 ? -18.446 -11.478 56.772 1.00 64.46  ? 134 ARG A O     1 
ATOM   795   C  CB    . ARG A 1 135 ? -20.644 -12.885 58.027 1.00 62.77  ? 134 ARG A CB    1 
ATOM   796   C  CG    . ARG A 1 135 ? -21.987 -12.543 58.701 1.00 63.37  ? 134 ARG A CG    1 
ATOM   797   C  CD    . ARG A 1 135 ? -22.128 -13.152 60.115 1.00 62.08  ? 134 ARG A CD    1 
ATOM   798   N  N     . VAL B 2 22  ? -53.317 2.389   61.149 1.00 95.62  ? 21  VAL B N     1 
ATOM   799   C  CA    . VAL B 2 22  ? -52.487 1.161   61.378 1.00 95.65  ? 21  VAL B CA    1 
ATOM   800   C  C     . VAL B 2 22  ? -51.485 0.998   60.226 1.00 95.42  ? 21  VAL B C     1 
ATOM   801   O  O     . VAL B 2 22  ? -51.753 0.265   59.270 1.00 95.52  ? 21  VAL B O     1 
ATOM   802   C  CB    . VAL B 2 22  ? -53.368 -0.137  61.504 1.00 95.72  ? 21  VAL B CB    1 
ATOM   803   C  CG1   . VAL B 2 22  ? -52.689 -1.175  62.407 1.00 95.44  ? 21  VAL B CG1   1 
ATOM   804   C  CG2   . VAL B 2 22  ? -54.784 0.181   62.016 1.00 95.79  ? 21  VAL B CG2   1 
ATOM   805   N  N     . LEU B 2 23  ? -50.343 1.687   60.315 1.00 95.06  ? 22  LEU B N     1 
ATOM   806   C  CA    . LEU B 2 23  ? -49.330 1.654   59.240 1.00 94.63  ? 22  LEU B CA    1 
ATOM   807   C  C     . LEU B 2 23  ? -48.578 0.306   59.140 1.00 93.90  ? 22  LEU B C     1 
ATOM   808   O  O     . LEU B 2 23  ? -49.053 -0.607  58.452 1.00 94.03  ? 22  LEU B O     1 
ATOM   809   C  CB    . LEU B 2 23  ? -48.387 2.883   59.288 1.00 94.93  ? 22  LEU B CB    1 
ATOM   810   C  CG    . LEU B 2 23  ? -47.865 3.494   60.603 1.00 95.56  ? 22  LEU B CG    1 
ATOM   811   C  CD1   . LEU B 2 23  ? -46.395 3.138   60.863 1.00 96.19  ? 22  LEU B CD1   1 
ATOM   812   C  CD2   . LEU B 2 23  ? -48.030 5.015   60.578 1.00 96.50  ? 22  LEU B CD2   1 
ATOM   813   N  N     . ARG B 2 24  ? -47.433 0.187   59.822 1.00 92.80  ? 23  ARG B N     1 
ATOM   814   C  CA    . ARG B 2 24  ? -46.626 -1.051  59.871 1.00 91.67  ? 23  ARG B CA    1 
ATOM   815   C  C     . ARG B 2 24  ? -45.915 -1.363  58.552 1.00 90.18  ? 23  ARG B C     1 
ATOM   816   O  O     . ARG B 2 24  ? -46.556 -1.624  57.528 1.00 89.85  ? 23  ARG B O     1 
ATOM   817   C  CB    . ARG B 2 24  ? -47.465 -2.257  60.327 1.00 92.15  ? 23  ARG B CB    1 
ATOM   818   C  CG    . ARG B 2 24  ? -46.794 -3.143  61.378 1.00 93.51  ? 23  ARG B CG    1 
ATOM   819   C  CD    . ARG B 2 24  ? -47.858 -3.943  62.155 1.00 95.96  ? 23  ARG B CD    1 
ATOM   820   N  NE    . ARG B 2 24  ? -47.831 -5.396  61.932 1.00 96.96  ? 23  ARG B NE    1 
ATOM   821   C  CZ    . ARG B 2 24  ? -48.123 -6.017  60.781 1.00 97.54  ? 23  ARG B CZ    1 
ATOM   822   N  NH1   . ARG B 2 24  ? -48.449 -5.323  59.685 1.00 97.78  ? 23  ARG B NH1   1 
ATOM   823   N  NH2   . ARG B 2 24  ? -48.074 -7.347  60.722 1.00 96.91  ? 23  ARG B NH2   1 
ATOM   824   N  N     . ASP B 2 25  ? -44.583 -1.344  58.607 1.00 88.47  ? 24  ASP B N     1 
ATOM   825   C  CA    . ASP B 2 25  ? -43.726 -1.539  57.440 1.00 86.63  ? 24  ASP B CA    1 
ATOM   826   C  C     . ASP B 2 25  ? -43.907 -2.938  56.832 1.00 84.86  ? 24  ASP B C     1 
ATOM   827   O  O     . ASP B 2 25  ? -44.294 -3.887  57.529 1.00 84.59  ? 24  ASP B O     1 
ATOM   828   C  CB    . ASP B 2 25  ? -42.262 -1.287  57.830 1.00 87.06  ? 24  ASP B CB    1 
ATOM   829   C  CG    . ASP B 2 25  ? -41.370 -0.979  56.628 1.00 88.25  ? 24  ASP B CG    1 
ATOM   830   O  OD1   . ASP B 2 25  ? -41.888 -0.529  55.575 1.00 89.18  ? 24  ASP B OD1   1 
ATOM   831   O  OD2   . ASP B 2 25  ? -40.139 -1.187  56.749 1.00 89.43  ? 24  ASP B OD2   1 
ATOM   832   N  N     . ASN B 2 26  ? -43.638 -3.048  55.531 1.00 82.58  ? 25  ASN B N     1 
ATOM   833   C  CA    . ASN B 2 26  ? -43.846 -4.292  54.784 1.00 80.25  ? 25  ASN B CA    1 
ATOM   834   C  C     . ASN B 2 26  ? -43.070 -5.507  55.315 1.00 79.00  ? 25  ASN B C     1 
ATOM   835   O  O     . ASN B 2 26  ? -43.593 -6.630  55.304 1.00 79.01  ? 25  ASN B O     1 
ATOM   836   C  CB    . ASN B 2 26  ? -43.554 -4.077  53.298 1.00 80.08  ? 25  ASN B CB    1 
ATOM   837   C  CG    . ASN B 2 26  ? -44.631 -3.260  52.598 1.00 79.14  ? 25  ASN B CG    1 
ATOM   838   O  OD1   . ASN B 2 26  ? -45.818 -3.554  52.706 1.00 79.49  ? 25  ASN B OD1   1 
ATOM   839   N  ND2   . ASN B 2 26  ? -44.217 -2.248  51.857 1.00 76.68  ? 25  ASN B ND2   1 
ATOM   840   N  N     . ILE B 2 27  ? -41.838 -5.280  55.782 1.00 77.08  ? 26  ILE B N     1 
ATOM   841   C  CA    . ILE B 2 27  ? -41.019 -6.344  56.380 1.00 75.19  ? 26  ILE B CA    1 
ATOM   842   C  C     . ILE B 2 27  ? -41.738 -7.068  57.518 1.00 73.93  ? 26  ILE B C     1 
ATOM   843   O  O     . ILE B 2 27  ? -41.602 -8.280  57.684 1.00 73.91  ? 26  ILE B O     1 
ATOM   844   C  CB    . ILE B 2 27  ? -39.608 -5.840  56.838 1.00 75.22  ? 26  ILE B CB    1 
ATOM   845   C  CG1   . ILE B 2 27  ? -38.703 -7.011  57.226 1.00 75.09  ? 26  ILE B CG1   1 
ATOM   846   C  CG2   . ILE B 2 27  ? -39.696 -4.862  57.994 1.00 74.88  ? 26  ILE B CG2   1 
ATOM   847   C  CD1   . ILE B 2 27  ? -38.327 -7.913  56.066 1.00 74.87  ? 26  ILE B CD1   1 
ATOM   848   N  N     . GLN B 2 28  ? -42.528 -6.321  58.278 1.00 72.30  ? 27  GLN B N     1 
ATOM   849   C  CA    . GLN B 2 28  ? -43.221 -6.875  59.427 1.00 70.69  ? 27  GLN B CA    1 
ATOM   850   C  C     . GLN B 2 28  ? -44.368 -7.763  58.989 1.00 69.52  ? 27  GLN B C     1 
ATOM   851   O  O     . GLN B 2 28  ? -44.934 -8.502  59.802 1.00 69.20  ? 27  GLN B O     1 
ATOM   852   C  CB    . GLN B 2 28  ? -43.708 -5.759  60.339 1.00 70.66  ? 27  GLN B CB    1 
ATOM   853   C  CG    . GLN B 2 28  ? -42.578 -5.023  61.023 1.00 70.85  ? 27  GLN B CG    1 
ATOM   854   C  CD    . GLN B 2 28  ? -41.767 -5.914  61.952 1.00 71.28  ? 27  GLN B CD    1 
ATOM   855   O  OE1   . GLN B 2 28  ? -42.318 -6.742  62.685 1.00 71.32  ? 27  GLN B OE1   1 
ATOM   856   N  NE2   . GLN B 2 28  ? -40.448 -5.741  61.931 1.00 71.18  ? 27  GLN B NE2   1 
ATOM   857   N  N     . GLY B 2 29  ? -44.679 -7.703  57.695 1.00 68.12  ? 28  GLY B N     1 
ATOM   858   C  CA    . GLY B 2 29  ? -45.690 -8.562  57.086 1.00 66.80  ? 28  GLY B CA    1 
ATOM   859   C  C     . GLY B 2 29  ? -45.252 -10.012 57.096 1.00 65.90  ? 28  GLY B C     1 
ATOM   860   O  O     . GLY B 2 29  ? -46.082 -10.931 57.063 1.00 66.19  ? 28  GLY B O     1 
ATOM   861   N  N     . ILE B 2 30  ? -43.936 -10.211 57.132 1.00 64.34  ? 29  ILE B N     1 
ATOM   862   C  CA    . ILE B 2 30  ? -43.361 -11.514 57.350 1.00 62.49  ? 29  ILE B CA    1 
ATOM   863   C  C     . ILE B 2 30  ? -43.529 -11.779 58.843 1.00 61.87  ? 29  ILE B C     1 
ATOM   864   O  O     . ILE B 2 30  ? -42.719 -11.354 59.666 1.00 61.33  ? 29  ILE B O     1 
ATOM   865   C  CB    . ILE B 2 30  ? -41.873 -11.549 56.902 1.00 62.52  ? 29  ILE B CB    1 
ATOM   866   C  CG1   . ILE B 2 30  ? -41.702 -10.942 55.502 1.00 61.13  ? 29  ILE B CG1   1 
ATOM   867   C  CG2   . ILE B 2 30  ? -41.291 -12.976 56.981 1.00 61.67  ? 29  ILE B CG2   1 
ATOM   868   C  CD1   . ILE B 2 30  ? -42.361 -11.717 54.374 1.00 59.01  ? 29  ILE B CD1   1 
ATOM   869   N  N     . THR B 2 31  ? -44.609 -12.465 59.186 1.00 61.20  ? 30  THR B N     1 
ATOM   870   C  CA    . THR B 2 31  ? -45.058 -12.509 60.576 1.00 61.05  ? 30  THR B CA    1 
ATOM   871   C  C     . THR B 2 31  ? -44.342 -13.548 61.406 1.00 60.62  ? 30  THR B C     1 
ATOM   872   O  O     . THR B 2 31  ? -43.751 -14.485 60.875 1.00 60.95  ? 30  THR B O     1 
ATOM   873   C  CB    . THR B 2 31  ? -46.577 -12.767 60.676 1.00 61.09  ? 30  THR B CB    1 
ATOM   874   O  OG1   . THR B 2 31  ? -46.882 -14.070 60.152 1.00 62.28  ? 30  THR B OG1   1 
ATOM   875   C  CG2   . THR B 2 31  ? -47.361 -11.710 59.918 1.00 60.44  ? 30  THR B CG2   1 
ATOM   876   N  N     . LYS B 2 32  ? -44.419 -13.380 62.718 1.00 60.25  ? 31  LYS B N     1 
ATOM   877   C  CA    . LYS B 2 32  ? -43.935 -14.376 63.665 1.00 60.06  ? 31  LYS B CA    1 
ATOM   878   C  C     . LYS B 2 32  ? -44.342 -15.823 63.312 1.00 59.96  ? 31  LYS B C     1 
ATOM   879   O  O     . LYS B 2 32  ? -43.482 -16.685 63.232 1.00 60.20  ? 31  LYS B O     1 
ATOM   880   C  CB    . LYS B 2 32  ? -44.339 -14.001 65.103 1.00 59.83  ? 31  LYS B CB    1 
ATOM   881   C  CG    . LYS B 2 32  ? -44.326 -15.178 66.078 1.00 60.58  ? 31  LYS B CG    1 
ATOM   882   C  CD    . LYS B 2 32  ? -44.200 -14.767 67.536 1.00 60.66  ? 31  LYS B CD    1 
ATOM   883   C  CE    . LYS B 2 32  ? -44.003 -16.003 68.411 1.00 61.44  ? 31  LYS B CE    1 
ATOM   884   N  NZ    . LYS B 2 32  ? -43.637 -15.681 69.820 1.00 62.81  ? 31  LYS B NZ    1 
ATOM   885   N  N     . PRO B 2 33  ? -45.644 -16.098 63.088 1.00 60.04  ? 32  PRO B N     1 
ATOM   886   C  CA    . PRO B 2 33  ? -46.027 -17.493 62.827 1.00 59.88  ? 32  PRO B CA    1 
ATOM   887   C  C     . PRO B 2 33  ? -45.452 -18.073 61.541 1.00 59.84  ? 32  PRO B C     1 
ATOM   888   O  O     . PRO B 2 33  ? -45.132 -19.259 61.506 1.00 59.95  ? 32  PRO B O     1 
ATOM   889   C  CB    . PRO B 2 33  ? -47.545 -17.425 62.702 1.00 59.96  ? 32  PRO B CB    1 
ATOM   890   C  CG    . PRO B 2 33  ? -47.929 -16.131 63.337 1.00 60.63  ? 32  PRO B CG    1 
ATOM   891   C  CD    . PRO B 2 33  ? -46.817 -15.207 63.055 1.00 60.01  ? 32  PRO B CD    1 
ATOM   892   N  N     . ALA B 2 34  ? -45.345 -17.257 60.490 1.00 59.72  ? 33  ALA B N     1 
ATOM   893   C  CA    . ALA B 2 34  ? -44.753 -17.706 59.223 1.00 59.23  ? 33  ALA B CA    1 
ATOM   894   C  C     . ALA B 2 34  ? -43.262 -18.032 59.396 1.00 59.01  ? 33  ALA B C     1 
ATOM   895   O  O     . ALA B 2 34  ? -42.774 -19.059 58.902 1.00 59.08  ? 33  ALA B O     1 
ATOM   896   C  CB    . ALA B 2 34  ? -44.949 -16.675 58.154 1.00 59.31  ? 33  ALA B CB    1 
ATOM   897   N  N     . ILE B 2 35  ? -42.544 -17.165 60.108 1.00 58.17  ? 34  ILE B N     1 
ATOM   898   C  CA    . ILE B 2 35  ? -41.155 -17.450 60.447 1.00 57.46  ? 34  ILE B CA    1 
ATOM   899   C  C     . ILE B 2 35  ? -41.084 -18.709 61.315 1.00 57.24  ? 34  ILE B C     1 
ATOM   900   O  O     . ILE B 2 35  ? -40.201 -19.552 61.149 1.00 57.43  ? 34  ILE B O     1 
ATOM   901   C  CB    . ILE B 2 35  ? -40.472 -16.257 61.134 1.00 57.38  ? 34  ILE B CB    1 
ATOM   902   C  CG1   . ILE B 2 35  ? -40.447 -15.048 60.202 1.00 55.82  ? 34  ILE B CG1   1 
ATOM   903   C  CG2   . ILE B 2 35  ? -39.046 -16.610 61.536 1.00 58.05  ? 34  ILE B CG2   1 
ATOM   904   C  CD1   . ILE B 2 35  ? -40.104 -13.775 60.903 1.00 54.87  ? 34  ILE B CD1   1 
ATOM   905   N  N     . ARG B 2 36  ? -42.044 -18.855 62.213 1.00 57.00  ? 35  ARG B N     1 
ATOM   906   C  CA    . ARG B 2 36  ? -42.134 -20.054 63.028 1.00 56.88  ? 35  ARG B CA    1 
ATOM   907   C  C     . ARG B 2 36  ? -42.298 -21.285 62.151 1.00 56.26  ? 35  ARG B C     1 
ATOM   908   O  O     . ARG B 2 36  ? -41.646 -22.305 62.386 1.00 56.65  ? 35  ARG B O     1 
ATOM   909   C  CB    . ARG B 2 36  ? -43.276 -19.922 64.016 1.00 57.07  ? 35  ARG B CB    1 
ATOM   910   C  CG    . ARG B 2 36  ? -43.530 -21.131 64.874 1.00 59.14  ? 35  ARG B CG    1 
ATOM   911   C  CD    . ARG B 2 36  ? -44.373 -20.708 66.073 1.00 61.11  ? 35  ARG B CD    1 
ATOM   912   N  NE    . ARG B 2 36  ? -43.557 -19.908 66.977 1.00 60.33  ? 35  ARG B NE    1 
ATOM   913   C  CZ    . ARG B 2 36  ? -43.264 -20.263 68.220 1.00 60.53  ? 35  ARG B CZ    1 
ATOM   914   N  NH1   . ARG B 2 36  ? -43.747 -21.381 68.735 1.00 61.09  ? 35  ARG B NH1   1 
ATOM   915   N  NH2   . ARG B 2 36  ? -42.500 -19.484 68.960 1.00 62.46  ? 35  ARG B NH2   1 
ATOM   916   N  N     . ARG B 2 37  ? -43.137 -21.181 61.120 1.00 55.56  ? 36  ARG B N     1 
ATOM   917   C  CA    . ARG B 2 37  ? -43.394 -22.321 60.225 1.00 54.38  ? 36  ARG B CA    1 
ATOM   918   C  C     . ARG B 2 37  ? -42.146 -22.765 59.477 1.00 53.41  ? 36  ARG B C     1 
ATOM   919   O  O     . ARG B 2 37  ? -41.835 -23.961 59.437 1.00 53.05  ? 36  ARG B O     1 
ATOM   920   C  CB    . ARG B 2 37  ? -44.537 -22.025 59.257 1.00 54.45  ? 36  ARG B CB    1 
ATOM   921   C  CG    . ARG B 2 37  ? -45.899 -22.007 59.931 1.00 55.50  ? 36  ARG B CG    1 
ATOM   922   C  CD    . ARG B 2 37  ? -47.035 -22.048 58.929 1.00 55.92  ? 36  ARG B CD    1 
ATOM   923   N  NE    . ARG B 2 37  ? -47.151 -20.812 58.162 1.00 56.93  ? 36  ARG B NE    1 
ATOM   924   C  CZ    . ARG B 2 37  ? -47.890 -19.765 58.520 1.00 57.82  ? 36  ARG B CZ    1 
ATOM   925   N  NH1   . ARG B 2 37  ? -48.581 -19.777 59.648 1.00 58.73  ? 36  ARG B NH1   1 
ATOM   926   N  NH2   . ARG B 2 37  ? -47.934 -18.696 57.744 1.00 58.76  ? 36  ARG B NH2   1 
ATOM   927   N  N     . LEU B 2 38  ? -41.431 -21.792 58.907 1.00 52.24  ? 37  LEU B N     1 
ATOM   928   C  CA    . LEU B 2 38  ? -40.170 -22.044 58.230 1.00 50.97  ? 37  LEU B CA    1 
ATOM   929   C  C     . LEU B 2 38  ? -39.196 -22.753 59.143 1.00 50.38  ? 37  LEU B C     1 
ATOM   930   O  O     . LEU B 2 38  ? -38.618 -23.764 58.778 1.00 50.49  ? 37  LEU B O     1 
ATOM   931   C  CB    . LEU B 2 38  ? -39.570 -20.742 57.743 1.00 50.82  ? 37  LEU B CB    1 
ATOM   932   C  CG    . LEU B 2 38  ? -40.345 -20.113 56.590 1.00 51.44  ? 37  LEU B CG    1 
ATOM   933   C  CD1   . LEU B 2 38  ? -40.107 -18.605 56.592 1.00 51.11  ? 37  LEU B CD1   1 
ATOM   934   C  CD2   . LEU B 2 38  ? -40.020 -20.757 55.236 1.00 48.67  ? 37  LEU B CD2   1 
ATOM   935   N  N     . ALA B 2 39  ? -39.038 -22.240 60.350 1.00 50.17  ? 38  ALA B N     1 
ATOM   936   C  CA    . ALA B 2 39  ? -38.175 -22.885 61.331 1.00 49.95  ? 38  ALA B CA    1 
ATOM   937   C  C     . ALA B 2 39  ? -38.560 -24.354 61.481 1.00 49.99  ? 38  ALA B C     1 
ATOM   938   O  O     . ALA B 2 39  ? -37.700 -25.228 61.533 1.00 50.02  ? 38  ALA B O     1 
ATOM   939   C  CB    . ALA B 2 39  ? -38.269 -22.167 62.649 1.00 49.21  ? 38  ALA B CB    1 
ATOM   940   N  N     . ARG B 2 40  ? -39.866 -24.610 61.518 1.00 50.11  ? 39  ARG B N     1 
ATOM   941   C  CA    . ARG B 2 40  ? -40.394 -25.947 61.725 1.00 50.22  ? 39  ARG B CA    1 
ATOM   942   C  C     . ARG B 2 40  ? -39.994 -26.870 60.592 1.00 49.99  ? 39  ARG B C     1 
ATOM   943   O  O     . ARG B 2 40  ? -39.525 -27.990 60.828 1.00 50.16  ? 39  ARG B O     1 
ATOM   944   C  CB    . ARG B 2 40  ? -41.914 -25.905 61.890 1.00 50.31  ? 39  ARG B CB    1 
ATOM   945   C  CG    . ARG B 2 40  ? -42.376 -25.242 63.190 1.00 51.76  ? 39  ARG B CG    1 
ATOM   946   C  CD    . ARG B 2 40  ? -42.049 -26.125 64.420 1.00 54.42  ? 39  ARG B CD    1 
ATOM   947   N  NE    . ARG B 2 40  ? -42.638 -25.603 65.653 1.00 56.63  ? 39  ARG B NE    1 
ATOM   948   C  CZ    . ARG B 2 40  ? -41.986 -24.860 66.544 1.00 58.64  ? 39  ARG B CZ    1 
ATOM   949   N  NH1   . ARG B 2 40  ? -40.708 -24.544 66.349 1.00 58.42  ? 39  ARG B NH1   1 
ATOM   950   N  NH2   . ARG B 2 40  ? -42.611 -24.427 67.634 1.00 59.43  ? 39  ARG B NH2   1 
ATOM   951   N  N     . ARG B 2 41  ? -40.149 -26.397 59.361 1.00 49.42  ? 40  ARG B N     1 
ATOM   952   C  CA    . ARG B 2 41  ? -39.735 -27.192 58.224 1.00 48.96  ? 40  ARG B CA    1 
ATOM   953   C  C     . ARG B 2 41  ? -38.238 -27.466 58.296 1.00 48.76  ? 40  ARG B C     1 
ATOM   954   O  O     . ARG B 2 41  ? -37.765 -28.503 57.827 1.00 49.07  ? 40  ARG B O     1 
ATOM   955   C  CB    . ARG B 2 41  ? -40.110 -26.510 56.916 1.00 49.13  ? 40  ARG B CB    1 
ATOM   956   C  CG    . ARG B 2 41  ? -39.870 -27.355 55.669 1.00 49.20  ? 40  ARG B CG    1 
ATOM   957   C  CD    . ARG B 2 41  ? -40.550 -26.747 54.474 1.00 49.52  ? 40  ARG B CD    1 
ATOM   958   N  NE    . ARG B 2 41  ? -41.954 -27.122 54.411 1.00 51.86  ? 40  ARG B NE    1 
ATOM   959   C  CZ    . ARG B 2 41  ? -42.851 -26.541 53.620 1.00 53.39  ? 40  ARG B CZ    1 
ATOM   960   N  NH1   . ARG B 2 41  ? -42.496 -25.526 52.843 1.00 52.92  ? 40  ARG B NH1   1 
ATOM   961   N  NH2   . ARG B 2 41  ? -44.110 -26.966 53.625 1.00 53.47  ? 40  ARG B NH2   1 
ATOM   962   N  N     . GLY B 2 42  ? -37.497 -26.542 58.906 1.00 48.50  ? 41  GLY B N     1 
ATOM   963   C  CA    . GLY B 2 42  ? -36.053 -26.716 59.115 1.00 47.68  ? 41  GLY B CA    1 
ATOM   964   C  C     . GLY B 2 42  ? -35.733 -27.536 60.346 1.00 47.28  ? 41  GLY B C     1 
ATOM   965   O  O     . GLY B 2 42  ? -34.579 -27.620 60.748 1.00 46.71  ? 41  GLY B O     1 
ATOM   966   N  N     . GLY B 2 43  ? -36.767 -28.130 60.943 1.00 47.25  ? 42  GLY B N     1 
ATOM   967   C  CA    . GLY B 2 43  ? -36.623 -28.996 62.112 1.00 47.66  ? 42  GLY B CA    1 
ATOM   968   C  C     . GLY B 2 43  ? -36.321 -28.315 63.440 1.00 48.14  ? 42  GLY B C     1 
ATOM   969   O  O     . GLY B 2 43  ? -35.710 -28.922 64.308 1.00 47.82  ? 42  GLY B O     1 
ATOM   970   N  N     . VAL B 2 44  ? -36.761 -27.067 63.599 1.00 48.87  ? 43  VAL B N     1 
ATOM   971   C  CA    . VAL B 2 44  ? -36.518 -26.297 64.821 1.00 49.97  ? 43  VAL B CA    1 
ATOM   972   C  C     . VAL B 2 44  ? -37.636 -26.418 65.871 1.00 50.67  ? 43  VAL B C     1 
ATOM   973   O  O     . VAL B 2 44  ? -38.798 -26.142 65.586 1.00 50.71  ? 43  VAL B O     1 
ATOM   974   C  CB    . VAL B 2 44  ? -36.290 -24.804 64.515 1.00 49.92  ? 43  VAL B CB    1 
ATOM   975   C  CG1   . VAL B 2 44  ? -35.996 -24.051 65.789 1.00 49.74  ? 43  VAL B CG1   1 
ATOM   976   C  CG2   . VAL B 2 44  ? -35.136 -24.624 63.527 1.00 50.68  ? 43  VAL B CG2   1 
ATOM   977   N  N     . LYS B 2 45  ? -37.249 -26.800 67.089 1.00 51.71  ? 44  LYS B N     1 
ATOM   978   C  CA    . LYS B 2 45  ? -38.168 -27.089 68.194 1.00 52.66  ? 44  LYS B CA    1 
ATOM   979   C  C     . LYS B 2 45  ? -38.513 -25.868 69.036 1.00 53.16  ? 44  LYS B C     1 
ATOM   980   O  O     . LYS B 2 45  ? -39.673 -25.649 69.377 1.00 53.92  ? 44  LYS B O     1 
ATOM   981   C  CB    . LYS B 2 45  ? -37.559 -28.158 69.106 1.00 52.77  ? 44  LYS B CB    1 
ATOM   982   C  CG    . LYS B 2 45  ? -38.483 -28.628 70.207 1.00 53.82  ? 44  LYS B CG    1 
ATOM   983   C  CD    . LYS B 2 45  ? -37.934 -29.858 70.875 1.00 55.79  ? 44  LYS B CD    1 
ATOM   984   C  CE    . LYS B 2 45  ? -38.869 -30.355 71.972 1.00 57.52  ? 44  LYS B CE    1 
ATOM   985   N  NZ    . LYS B 2 45  ? -38.232 -31.485 72.707 1.00 59.19  ? 44  LYS B NZ    1 
ATOM   986   N  N     . ARG B 2 46  ? -37.501 -25.076 69.367 1.00 53.65  ? 45  ARG B N     1 
ATOM   987   C  CA    . ARG B 2 46  ? -37.663 -23.969 70.285 1.00 54.10  ? 45  ARG B CA    1 
ATOM   988   C  C     . ARG B 2 46  ? -36.953 -22.739 69.745 1.00 54.24  ? 45  ARG B C     1 
ATOM   989   O  O     . ARG B 2 46  ? -35.798 -22.816 69.304 1.00 54.04  ? 45  ARG B O     1 
ATOM   990   C  CB    . ARG B 2 46  ? -37.104 -24.355 71.653 1.00 54.54  ? 45  ARG B CB    1 
ATOM   991   C  CG    . ARG B 2 46  ? -37.633 -23.540 72.816 1.00 55.17  ? 45  ARG B CG    1 
ATOM   992   C  CD    . ARG B 2 46  ? -37.241 -24.195 74.141 1.00 57.49  ? 45  ARG B CD    1 
ATOM   993   N  NE    . ARG B 2 46  ? -37.785 -23.455 75.275 1.00 59.86  ? 45  ARG B NE    1 
ATOM   994   C  CZ    . ARG B 2 46  ? -37.170 -22.439 75.889 1.00 62.21  ? 45  ARG B CZ    1 
ATOM   995   N  NH1   . ARG B 2 46  ? -35.967 -22.025 75.503 1.00 61.73  ? 45  ARG B NH1   1 
ATOM   996   N  NH2   . ARG B 2 46  ? -37.763 -21.829 76.908 1.00 63.84  ? 45  ARG B NH2   1 
ATOM   997   N  N     . ILE B 2 47  ? -37.650 -21.603 69.816 1.00 54.25  ? 46  ILE B N     1 
ATOM   998   C  CA    . ILE B 2 47  ? -37.250 -20.389 69.129 1.00 53.91  ? 46  ILE B CA    1 
ATOM   999   C  C     . ILE B 2 47  ? -37.214 -19.190 70.078 1.00 54.21  ? 46  ILE B C     1 
ATOM   1000  O  O     . ILE B 2 47  ? -38.215 -18.837 70.670 1.00 54.72  ? 46  ILE B O     1 
ATOM   1001  C  CB    . ILE B 2 47  ? -38.200 -20.111 67.922 1.00 53.43  ? 46  ILE B CB    1 
ATOM   1002  C  CG1   . ILE B 2 47  ? -38.207 -21.308 66.962 1.00 52.60  ? 46  ILE B CG1   1 
ATOM   1003  C  CG2   . ILE B 2 47  ? -37.785 -18.846 67.192 1.00 52.54  ? 46  ILE B CG2   1 
ATOM   1004  C  CD1   . ILE B 2 47  ? -39.311 -21.289 65.919 1.00 51.70  ? 46  ILE B CD1   1 
ATOM   1005  N  N     . SER B 2 48  ? -36.054 -18.562 70.204 1.00 54.64  ? 47  SER B N     1 
ATOM   1006  C  CA    . SER B 2 48  ? -35.905 -17.328 70.967 1.00 54.92  ? 47  SER B CA    1 
ATOM   1007  C  C     . SER B 2 48  ? -36.667 -16.173 70.335 1.00 55.17  ? 47  SER B C     1 
ATOM   1008  O  O     . SER B 2 48  ? -36.704 -16.048 69.111 1.00 55.46  ? 47  SER B O     1 
ATOM   1009  C  CB    . SER B 2 48  ? -34.429 -16.951 71.071 1.00 54.91  ? 47  SER B CB    1 
ATOM   1010  O  OG    . SER B 2 48  ? -34.260 -15.544 70.951 1.00 56.19  ? 47  SER B OG    1 
ATOM   1011  N  N     . GLY B 2 49  ? -37.224 -15.300 71.178 1.00 55.38  ? 48  GLY B N     1 
ATOM   1012  C  CA    . GLY B 2 49  ? -38.000 -14.136 70.726 1.00 55.05  ? 48  GLY B CA    1 
ATOM   1013  C  C     . GLY B 2 49  ? -37.252 -13.193 69.799 1.00 55.38  ? 48  GLY B C     1 
ATOM   1014  O  O     . GLY B 2 49  ? -37.874 -12.495 68.989 1.00 55.57  ? 48  GLY B O     1 
ATOM   1015  N  N     . LEU B 2 50  ? -35.919 -13.176 69.895 1.00 55.18  ? 49  LEU B N     1 
ATOM   1016  C  CA    . LEU B 2 50  ? -35.109 -12.295 69.045 1.00 55.02  ? 49  LEU B CA    1 
ATOM   1017  C  C     . LEU B 2 50  ? -34.959 -12.799 67.603 1.00 54.90  ? 49  LEU B C     1 
ATOM   1018  O  O     . LEU B 2 50  ? -34.546 -12.044 66.710 1.00 55.08  ? 49  LEU B O     1 
ATOM   1019  C  CB    . LEU B 2 50  ? -33.735 -12.039 69.670 1.00 55.02  ? 49  LEU B CB    1 
ATOM   1020  C  CG    . LEU B 2 50  ? -33.739 -11.361 71.052 1.00 55.34  ? 49  LEU B CG    1 
ATOM   1021  C  CD1   . LEU B 2 50  ? -32.373 -11.447 71.693 1.00 55.34  ? 49  LEU B CD1   1 
ATOM   1022  C  CD2   . LEU B 2 50  ? -34.191 -9.916  70.953 1.00 54.62  ? 49  LEU B CD2   1 
ATOM   1023  N  N     . ILE B 2 51  ? -35.323 -14.059 67.369 1.00 54.23  ? 50  ILE B N     1 
ATOM   1024  C  CA    . ILE B 2 51  ? -35.088 -14.682 66.072 1.00 53.65  ? 50  ILE B CA    1 
ATOM   1025  C  C     . ILE B 2 51  ? -35.865 -13.999 64.968 1.00 53.47  ? 50  ILE B C     1 
ATOM   1026  O  O     . ILE B 2 51  ? -35.394 -13.923 63.834 1.00 53.89  ? 50  ILE B O     1 
ATOM   1027  C  CB    . ILE B 2 51  ? -35.412 -16.200 66.093 1.00 53.86  ? 50  ILE B CB    1 
ATOM   1028  C  CG1   . ILE B 2 51  ? -34.396 -16.970 66.948 1.00 53.11  ? 50  ILE B CG1   1 
ATOM   1029  C  CG2   . ILE B 2 51  ? -35.513 -16.779 64.677 1.00 52.46  ? 50  ILE B CG2   1 
ATOM   1030  C  CD1   . ILE B 2 51  ? -33.007 -17.028 66.354 1.00 56.16  ? 50  ILE B CD1   1 
ATOM   1031  N  N     . TYR B 2 52  ? -37.042 -13.487 65.303 1.00 53.13  ? 51  TYR B N     1 
ATOM   1032  C  CA    . TYR B 2 52  ? -37.967 -12.993 64.291 1.00 52.84  ? 51  TYR B CA    1 
ATOM   1033  C  C     . TYR B 2 52  ? -37.394 -11.784 63.602 1.00 53.03  ? 51  TYR B C     1 
ATOM   1034  O  O     . TYR B 2 52  ? -37.360 -11.724 62.371 1.00 53.04  ? 51  TYR B O     1 
ATOM   1035  C  CB    . TYR B 2 52  ? -39.361 -12.762 64.882 1.00 52.54  ? 51  TYR B CB    1 
ATOM   1036  C  CG    . TYR B 2 52  ? -39.832 -13.999 65.590 1.00 52.44  ? 51  TYR B CG    1 
ATOM   1037  C  CD1   . TYR B 2 52  ? -40.174 -15.141 64.864 1.00 53.33  ? 51  TYR B CD1   1 
ATOM   1038  C  CD2   . TYR B 2 52  ? -39.861 -14.064 66.981 1.00 51.50  ? 51  TYR B CD2   1 
ATOM   1039  C  CE1   . TYR B 2 52  ? -40.569 -16.317 65.505 1.00 53.63  ? 51  TYR B CE1   1 
ATOM   1040  C  CE2   . TYR B 2 52  ? -40.257 -15.237 67.642 1.00 52.44  ? 51  TYR B CE2   1 
ATOM   1041  C  CZ    . TYR B 2 52  ? -40.609 -16.363 66.894 1.00 53.57  ? 51  TYR B CZ    1 
ATOM   1042  O  OH    . TYR B 2 52  ? -40.995 -17.539 67.517 1.00 52.83  ? 51  TYR B OH    1 
ATOM   1043  N  N     . GLU B 2 53  ? -36.890 -10.845 64.392 1.00 53.47  ? 52  GLU B N     1 
ATOM   1044  C  CA    . GLU B 2 53  ? -36.243 -9.683  63.818 1.00 54.14  ? 52  GLU B CA    1 
ATOM   1045  C  C     . GLU B 2 53  ? -35.011 -10.116 63.032 1.00 53.67  ? 52  GLU B C     1 
ATOM   1046  O  O     . GLU B 2 53  ? -34.851 -9.737  61.862 1.00 53.63  ? 52  GLU B O     1 
ATOM   1047  C  CB    . GLU B 2 53  ? -35.910 -8.629  64.881 1.00 54.79  ? 52  GLU B CB    1 
ATOM   1048  C  CG    . GLU B 2 53  ? -37.102 -7.755  65.287 1.00 57.39  ? 52  GLU B CG    1 
ATOM   1049  C  CD    . GLU B 2 53  ? -37.715 -7.013  64.105 1.00 61.15  ? 52  GLU B CD    1 
ATOM   1050  O  OE1   . GLU B 2 53  ? -37.041 -6.103  63.566 1.00 62.64  ? 52  GLU B OE1   1 
ATOM   1051  O  OE2   . GLU B 2 53  ? -38.862 -7.347  63.709 1.00 62.04  ? 52  GLU B OE2   1 
ATOM   1052  N  N     . GLU B 2 54  ? -34.170 -10.939 63.655 1.00 53.01  ? 53  GLU B N     1 
ATOM   1053  C  CA    . GLU B 2 54  ? -32.964 -11.439 62.984 1.00 52.66  ? 53  GLU B CA    1 
ATOM   1054  C  C     . GLU B 2 54  ? -33.282 -12.018 61.591 1.00 51.63  ? 53  GLU B C     1 
ATOM   1055  O  O     . GLU B 2 54  ? -32.663 -11.633 60.601 1.00 50.80  ? 53  GLU B O     1 
ATOM   1056  C  CB    . GLU B 2 54  ? -32.235 -12.460 63.864 1.00 52.72  ? 53  GLU B CB    1 
ATOM   1057  C  CG    . GLU B 2 54  ? -30.768 -12.680 63.500 1.00 55.00  ? 53  GLU B CG    1 
ATOM   1058  C  CD    . GLU B 2 54  ? -29.859 -11.488 63.839 1.00 59.03  ? 53  GLU B CD    1 
ATOM   1059  O  OE1   . GLU B 2 54  ? -30.197 -10.694 64.758 1.00 58.41  ? 53  GLU B OE1   1 
ATOM   1060  O  OE2   . GLU B 2 54  ? -28.791 -11.356 63.177 1.00 60.65  ? 53  GLU B OE2   1 
ATOM   1061  N  N     . THR B 2 55  ? -34.274 -12.906 61.532 1.00 50.82  ? 54  THR B N     1 
ATOM   1062  C  CA    . THR B 2 55  ? -34.699 -13.538 60.285 1.00 50.55  ? 54  THR B CA    1 
ATOM   1063  C  C     . THR B 2 55  ? -35.141 -12.542 59.221 1.00 50.48  ? 54  THR B C     1 
ATOM   1064  O  O     . THR B 2 55  ? -34.791 -12.682 58.039 1.00 50.38  ? 54  THR B O     1 
ATOM   1065  C  CB    . THR B 2 55  ? -35.862 -14.529 60.511 1.00 50.81  ? 54  THR B CB    1 
ATOM   1066  O  OG1   . THR B 2 55  ? -35.525 -15.452 61.552 1.00 50.31  ? 54  THR B OG1   1 
ATOM   1067  C  CG2   . THR B 2 55  ? -36.174 -15.312 59.229 1.00 50.50  ? 54  THR B CG2   1 
ATOM   1068  N  N     . ARG B 2 56  ? -35.925 -11.549 59.635 1.00 50.59  ? 55  ARG B N     1 
ATOM   1069  C  CA    . ARG B 2 56  ? -36.367 -10.496 58.723 1.00 50.24  ? 55  ARG B CA    1 
ATOM   1070  C  C     . ARG B 2 56  ? -35.168 -9.804  58.109 1.00 49.41  ? 55  ARG B C     1 
ATOM   1071  O  O     . ARG B 2 56  ? -35.130 -9.588  56.905 1.00 49.03  ? 55  ARG B O     1 
ATOM   1072  C  CB    . ARG B 2 56  ? -37.280 -9.497  59.434 1.00 50.77  ? 55  ARG B CB    1 
ATOM   1073  C  CG    . ARG B 2 56  ? -38.652 -10.078 59.773 1.00 52.47  ? 55  ARG B CG    1 
ATOM   1074  C  CD    . ARG B 2 56  ? -39.643 -9.021  60.285 1.00 54.32  ? 55  ARG B CD    1 
ATOM   1075  N  NE    . ARG B 2 56  ? -40.841 -9.678  60.800 1.00 54.83  ? 55  ARG B NE    1 
ATOM   1076  C  CZ    . ARG B 2 56  ? -41.075 -9.928  62.087 1.00 54.88  ? 55  ARG B CZ    1 
ATOM   1077  N  NH1   . ARG B 2 56  ? -40.212 -9.536  63.022 1.00 53.44  ? 55  ARG B NH1   1 
ATOM   1078  N  NH2   . ARG B 2 56  ? -42.190 -10.565 62.439 1.00 55.54  ? 55  ARG B NH2   1 
ATOM   1079  N  N     . GLY B 2 57  ? -34.176 -9.496  58.939 1.00 48.96  ? 56  GLY B N     1 
ATOM   1080  C  CA    . GLY B 2 57  ? -32.942 -8.877  58.473 1.00 48.70  ? 56  GLY B CA    1 
ATOM   1081  C  C     . GLY B 2 57  ? -32.248 -9.712  57.412 1.00 48.78  ? 56  GLY B C     1 
ATOM   1082  O  O     . GLY B 2 57  ? -31.847 -9.198  56.358 1.00 49.75  ? 56  GLY B O     1 
ATOM   1083  N  N     . VAL B 2 58  ? -32.123 -11.005 57.676 1.00 47.94  ? 57  VAL B N     1 
ATOM   1084  C  CA    . VAL B 2 58  ? -31.468 -11.925 56.752 1.00 47.47  ? 57  VAL B CA    1 
ATOM   1085  C  C     . VAL B 2 58  ? -32.244 -12.045 55.438 1.00 47.47  ? 57  VAL B C     1 
ATOM   1086  O  O     . VAL B 2 58  ? -31.658 -12.023 54.349 1.00 47.37  ? 57  VAL B O     1 
ATOM   1087  C  CB    . VAL B 2 58  ? -31.303 -13.322 57.394 1.00 47.36  ? 57  VAL B CB    1 
ATOM   1088  C  CG1   . VAL B 2 58  ? -31.005 -14.362 56.350 1.00 47.99  ? 57  VAL B CG1   1 
ATOM   1089  C  CG2   . VAL B 2 58  ? -30.221 -13.305 58.459 1.00 46.19  ? 57  VAL B CG2   1 
ATOM   1090  N  N     . LEU B 2 59  ? -33.562 -12.176 55.542 1.00 47.19  ? 58  LEU B N     1 
ATOM   1091  C  CA    . LEU B 2 59  ? -34.397 -12.247 54.360 1.00 47.20  ? 58  LEU B CA    1 
ATOM   1092  C  C     . LEU B 2 59  ? -34.267 -11.001 53.499 1.00 47.68  ? 58  LEU B C     1 
ATOM   1093  O  O     . LEU B 2 59  ? -34.299 -11.074 52.261 1.00 48.19  ? 58  LEU B O     1 
ATOM   1094  C  CB    . LEU B 2 59  ? -35.846 -12.447 54.767 1.00 46.98  ? 58  LEU B CB    1 
ATOM   1095  C  CG    . LEU B 2 59  ? -36.881 -12.414 53.650 1.00 46.52  ? 58  LEU B CG    1 
ATOM   1096  C  CD1   . LEU B 2 59  ? -36.509 -13.364 52.511 1.00 45.42  ? 58  LEU B CD1   1 
ATOM   1097  C  CD2   . LEU B 2 59  ? -38.240 -12.749 54.237 1.00 44.66  ? 58  LEU B CD2   1 
ATOM   1098  N  N     . LYS B 2 60  ? -34.131 -9.852  54.151 1.00 47.90  ? 59  LYS B N     1 
ATOM   1099  C  CA    . LYS B 2 60  ? -34.024 -8.594  53.431 1.00 48.00  ? 59  LYS B CA    1 
ATOM   1100  C  C     . LYS B 2 60  ? -32.713 -8.559  52.663 1.00 47.69  ? 59  LYS B C     1 
ATOM   1101  O  O     . LYS B 2 60  ? -32.699 -8.186  51.490 1.00 48.27  ? 59  LYS B O     1 
ATOM   1102  C  CB    . LYS B 2 60  ? -34.143 -7.404  54.391 1.00 48.46  ? 59  LYS B CB    1 
ATOM   1103  C  CG    . LYS B 2 60  ? -34.287 -6.037  53.733 1.00 49.39  ? 59  LYS B CG    1 
ATOM   1104  C  CD    . LYS B 2 60  ? -34.636 -4.974  54.783 1.00 52.40  ? 59  LYS B CD    1 
ATOM   1105  C  CE    . LYS B 2 60  ? -34.321 -3.552  54.295 1.00 54.40  ? 59  LYS B CE    1 
ATOM   1106  N  NZ    . LYS B 2 60  ? -32.857 -3.242  54.340 1.00 53.13  ? 59  LYS B NZ    1 
ATOM   1107  N  N     . VAL B 2 61  ? -31.618 -8.953  53.308 1.00 46.92  ? 60  VAL B N     1 
ATOM   1108  C  CA    . VAL B 2 61  ? -30.334 -8.999  52.619 1.00 46.54  ? 60  VAL B CA    1 
ATOM   1109  C  C     . VAL B 2 61  ? -30.400 -9.980  51.445 1.00 46.26  ? 60  VAL B C     1 
ATOM   1110  O  O     . VAL B 2 61  ? -29.857 -9.703  50.371 1.00 46.49  ? 60  VAL B O     1 
ATOM   1111  C  CB    . VAL B 2 61  ? -29.172 -9.371  53.557 1.00 46.63  ? 60  VAL B CB    1 
ATOM   1112  C  CG1   . VAL B 2 61  ? -27.938 -9.672  52.757 1.00 47.95  ? 60  VAL B CG1   1 
ATOM   1113  C  CG2   . VAL B 2 61  ? -28.853 -8.246  54.513 1.00 46.91  ? 60  VAL B CG2   1 
ATOM   1114  N  N     . PHE B 2 62  ? -31.069 -11.114 51.647 1.00 45.91  ? 61  PHE B N     1 
ATOM   1115  C  CA    . PHE B 2 62  ? -31.207 -12.124 50.604 1.00 45.72  ? 61  PHE B CA    1 
ATOM   1116  C  C     . PHE B 2 62  ? -31.927 -11.531 49.420 1.00 46.06  ? 61  PHE B C     1 
ATOM   1117  O  O     . PHE B 2 62  ? -31.444 -11.571 48.290 1.00 46.23  ? 61  PHE B O     1 
ATOM   1118  C  CB    . PHE B 2 62  ? -31.980 -13.350 51.103 1.00 45.33  ? 61  PHE B CB    1 
ATOM   1119  C  CG    . PHE B 2 62  ? -32.075 -14.453 50.080 1.00 45.54  ? 61  PHE B CG    1 
ATOM   1120  C  CD1   . PHE B 2 62  ? -30.999 -15.332 49.861 1.00 44.55  ? 61  PHE B CD1   1 
ATOM   1121  C  CD2   . PHE B 2 62  ? -33.226 -14.614 49.317 1.00 45.65  ? 61  PHE B CD2   1 
ATOM   1122  C  CE1   . PHE B 2 62  ? -31.081 -16.346 48.900 1.00 41.80  ? 61  PHE B CE1   1 
ATOM   1123  C  CE2   . PHE B 2 62  ? -33.308 -15.634 48.354 1.00 44.67  ? 61  PHE B CE2   1 
ATOM   1124  C  CZ    . PHE B 2 62  ? -32.231 -16.493 48.153 1.00 42.97  ? 61  PHE B CZ    1 
ATOM   1125  N  N     . LEU B 2 63  ? -33.099 -10.973 49.690 1.00 46.56  ? 62  LEU B N     1 
ATOM   1126  C  CA    . LEU B 2 63  ? -33.914 -10.397 48.644 1.00 46.61  ? 62  LEU B CA    1 
ATOM   1127  C  C     . LEU B 2 63  ? -33.210 -9.244  47.915 1.00 46.76  ? 62  LEU B C     1 
ATOM   1128  O  O     . LEU B 2 63  ? -33.261 -9.182  46.680 1.00 46.93  ? 62  LEU B O     1 
ATOM   1129  C  CB    . LEU B 2 63  ? -35.267 -9.988  49.209 1.00 46.44  ? 62  LEU B CB    1 
ATOM   1130  C  CG    . LEU B 2 63  ? -36.234 -11.157 49.411 1.00 46.60  ? 62  LEU B CG    1 
ATOM   1131  C  CD1   . LEU B 2 63  ? -37.558 -10.638 49.920 1.00 47.78  ? 62  LEU B CD1   1 
ATOM   1132  C  CD2   . LEU B 2 63  ? -36.460 -11.947 48.115 1.00 46.07  ? 62  LEU B CD2   1 
ATOM   1133  N  N     . GLU B 2 64  ? -32.542 -8.358  48.665 1.00 46.30  ? 63  GLU B N     1 
ATOM   1134  C  CA    . GLU B 2 64  ? -31.761 -7.281  48.055 1.00 46.36  ? 63  GLU B CA    1 
ATOM   1135  C  C     . GLU B 2 64  ? -30.791 -7.822  47.032 1.00 45.84  ? 63  GLU B C     1 
ATOM   1136  O  O     . GLU B 2 64  ? -30.862 -7.443  45.863 1.00 45.62  ? 63  GLU B O     1 
ATOM   1137  C  CB    . GLU B 2 64  ? -31.026 -6.434  49.096 1.00 46.63  ? 63  GLU B CB    1 
ATOM   1138  C  CG    . GLU B 2 64  ? -31.928 -5.423  49.782 1.00 49.64  ? 63  GLU B CG    1 
ATOM   1139  C  CD    . GLU B 2 64  ? -31.342 -4.837  51.061 1.00 53.98  ? 63  GLU B CD    1 
ATOM   1140  O  OE1   . GLU B 2 64  ? -30.269 -5.301  51.512 1.00 56.02  ? 63  GLU B OE1   1 
ATOM   1141  O  OE2   . GLU B 2 64  ? -31.970 -3.913  51.625 1.00 55.76  ? 63  GLU B OE2   1 
ATOM   1142  N  N     . ASN B 2 65  ? -29.910 -8.732  47.453 1.00 45.70  ? 64  ASN B N     1 
ATOM   1143  C  CA    . ASN B 2 65  ? -28.881 -9.237  46.551 1.00 45.78  ? 64  ASN B CA    1 
ATOM   1144  C  C     . ASN B 2 65  ? -29.461 -9.831  45.271 1.00 45.91  ? 64  ASN B C     1 
ATOM   1145  O  O     . ASN B 2 65  ? -28.987 -9.533  44.184 1.00 45.91  ? 64  ASN B O     1 
ATOM   1146  C  CB    . ASN B 2 65  ? -27.979 -10.249 47.242 1.00 46.08  ? 64  ASN B CB    1 
ATOM   1147  C  CG    . ASN B 2 65  ? -27.105 -9.631  48.310 1.00 47.70  ? 64  ASN B CG    1 
ATOM   1148  O  OD1   . ASN B 2 65  ? -26.961 -8.418  48.397 1.00 51.92  ? 64  ASN B OD1   1 
ATOM   1149  N  ND2   . ASN B 2 65  ? -26.510 -10.470 49.131 1.00 49.47  ? 64  ASN B ND2   1 
ATOM   1150  N  N     . VAL B 2 66  ? -30.494 -10.656 45.406 1.00 45.96  ? 65  VAL B N     1 
ATOM   1151  C  CA    . VAL B 2 66  ? -31.084 -11.324 44.267 1.00 46.76  ? 65  VAL B CA    1 
ATOM   1152  C  C     . VAL B 2 66  ? -31.856 -10.363 43.364 1.00 47.35  ? 65  VAL B C     1 
ATOM   1153  O  O     . VAL B 2 66  ? -31.659 -10.378 42.135 1.00 46.74  ? 65  VAL B O     1 
ATOM   1154  C  CB    . VAL B 2 66  ? -31.996 -12.468 44.706 1.00 46.73  ? 65  VAL B CB    1 
ATOM   1155  C  CG1   . VAL B 2 66  ? -32.505 -13.207 43.504 1.00 47.36  ? 65  VAL B CG1   1 
ATOM   1156  C  CG2   . VAL B 2 66  ? -31.227 -13.424 45.584 1.00 48.46  ? 65  VAL B CG2   1 
ATOM   1157  N  N     . ILE B 2 67  ? -32.726 -9.538  43.976 1.00 47.97  ? 66  ILE B N     1 
ATOM   1158  C  CA    . ILE B 2 67  ? -33.533 -8.563  43.248 1.00 48.48  ? 66  ILE B CA    1 
ATOM   1159  C  C     . ILE B 2 67  ? -32.633 -7.594  42.484 1.00 48.81  ? 66  ILE B C     1 
ATOM   1160  O  O     . ILE B 2 67  ? -32.853 -7.345  41.290 1.00 48.81  ? 66  ILE B O     1 
ATOM   1161  C  CB    . ILE B 2 67  ? -34.495 -7.801  44.170 1.00 48.99  ? 66  ILE B CB    1 
ATOM   1162  C  CG1   . ILE B 2 67  ? -35.665 -8.699  44.569 1.00 49.88  ? 66  ILE B CG1   1 
ATOM   1163  C  CG2   . ILE B 2 67  ? -35.041 -6.529  43.477 1.00 48.95  ? 66  ILE B CG2   1 
ATOM   1164  C  CD1   . ILE B 2 67  ? -36.430 -8.200  45.781 1.00 50.20  ? 66  ILE B CD1   1 
ATOM   1165  N  N     . ARG B 2 68  ? -31.602 -7.077  43.151 1.00 48.67  ? 67  ARG B N     1 
ATOM   1166  C  CA    . ARG B 2 68  ? -30.663 -6.206  42.461 1.00 49.29  ? 67  ARG B CA    1 
ATOM   1167  C  C     . ARG B 2 68  ? -30.228 -6.822  41.133 1.00 48.96  ? 67  ARG B C     1 
ATOM   1168  O  O     . ARG B 2 68  ? -30.377 -6.192  40.099 1.00 49.18  ? 67  ARG B O     1 
ATOM   1169  C  CB    . ARG B 2 68  ? -29.459 -5.857  43.344 1.00 49.60  ? 67  ARG B CB    1 
ATOM   1170  C  CG    . ARG B 2 68  ? -28.482 -4.842  42.732 1.00 51.91  ? 67  ARG B CG    1 
ATOM   1171  C  CD    . ARG B 2 68  ? -27.142 -4.791  43.507 1.00 57.91  ? 67  ARG B CD    1 
ATOM   1172  N  NE    . ARG B 2 68  ? -27.248 -4.131  44.821 1.00 62.08  ? 67  ARG B NE    1 
ATOM   1173  C  CZ    . ARG B 2 68  ? -27.252 -4.755  46.001 1.00 64.75  ? 67  ARG B CZ    1 
ATOM   1174  N  NH1   . ARG B 2 68  ? -27.157 -6.080  46.075 1.00 66.79  ? 67  ARG B NH1   1 
ATOM   1175  N  NH2   . ARG B 2 68  ? -27.347 -4.051  47.122 1.00 66.13  ? 67  ARG B NH2   1 
ATOM   1176  N  N     . ASP B 2 69  ? -29.725 -8.054  41.161 1.00 48.91  ? 68  ASP B N     1 
ATOM   1177  C  CA    . ASP B 2 69  ? -29.225 -8.708  39.947 1.00 49.04  ? 68  ASP B CA    1 
ATOM   1178  C  C     . ASP B 2 69  ? -30.364 -8.931  38.940 1.00 49.05  ? 68  ASP B C     1 
ATOM   1179  O  O     . ASP B 2 69  ? -30.178 -8.721  37.752 1.00 48.96  ? 68  ASP B O     1 
ATOM   1180  C  CB    . ASP B 2 69  ? -28.517 -10.043 40.261 1.00 48.93  ? 68  ASP B CB    1 
ATOM   1181  C  CG    . ASP B 2 69  ? -27.143 -9.874  40.914 1.00 49.42  ? 68  ASP B CG    1 
ATOM   1182  O  OD1   . ASP B 2 69  ? -26.701 -8.751  41.239 1.00 51.72  ? 68  ASP B OD1   1 
ATOM   1183  O  OD2   . ASP B 2 69  ? -26.475 -10.901 41.123 1.00 50.40  ? 68  ASP B OD2   1 
ATOM   1184  N  N     . ALA B 2 70  ? -31.535 -9.349  39.421 1.00 49.07  ? 69  ALA B N     1 
ATOM   1185  C  CA    . ALA B 2 70  ? -32.718 -9.525  38.566 1.00 49.33  ? 69  ALA B CA    1 
ATOM   1186  C  C     . ALA B 2 70  ? -33.042 -8.240  37.804 1.00 49.46  ? 69  ALA B C     1 
ATOM   1187  O  O     . ALA B 2 70  ? -33.060 -8.224  36.580 1.00 49.23  ? 69  ALA B O     1 
ATOM   1188  C  CB    . ALA B 2 70  ? -33.921 -9.964  39.403 1.00 49.41  ? 69  ALA B CB    1 
ATOM   1189  N  N     . VAL B 2 71  ? -33.257 -7.155  38.545 1.00 49.98  ? 70  VAL B N     1 
ATOM   1190  C  CA    . VAL B 2 71  ? -33.510 -5.835  37.962 1.00 50.40  ? 70  VAL B CA    1 
ATOM   1191  C  C     . VAL B 2 71  ? -32.407 -5.398  36.980 1.00 50.88  ? 70  VAL B C     1 
ATOM   1192  O  O     . VAL B 2 71  ? -32.705 -4.855  35.922 1.00 51.58  ? 70  VAL B O     1 
ATOM   1193  C  CB    . VAL B 2 71  ? -33.766 -4.773  39.051 1.00 50.07  ? 70  VAL B CB    1 
ATOM   1194  C  CG1   . VAL B 2 71  ? -33.937 -3.414  38.441 1.00 51.04  ? 70  VAL B CG1   1 
ATOM   1195  C  CG2   . VAL B 2 71  ? -35.010 -5.125  39.851 1.00 49.68  ? 70  VAL B CG2   1 
ATOM   1196  N  N     . THR B 2 72  ? -31.147 -5.653  37.307 1.00 51.18  ? 71  THR B N     1 
ATOM   1197  C  CA    . THR B 2 72  ? -30.060 -5.397  36.371 1.00 51.86  ? 71  THR B CA    1 
ATOM   1198  C  C     . THR B 2 72  ? -30.285 -6.130  35.043 1.00 52.85  ? 71  THR B C     1 
ATOM   1199  O  O     . THR B 2 72  ? -29.972 -5.605  33.985 1.00 53.35  ? 71  THR B O     1 
ATOM   1200  C  CB    . THR B 2 72  ? -28.714 -5.796  36.977 1.00 51.69  ? 71  THR B CB    1 
ATOM   1201  O  OG1   . THR B 2 72  ? -28.567 -5.153  38.248 1.00 52.05  ? 71  THR B OG1   1 
ATOM   1202  C  CG2   . THR B 2 72  ? -27.555 -5.384  36.080 1.00 51.07  ? 71  THR B CG2   1 
ATOM   1203  N  N     . TYR B 2 73  ? -30.835 -7.338  35.103 1.00 53.83  ? 72  TYR B N     1 
ATOM   1204  C  CA    . TYR B 2 73  ? -31.189 -8.074  33.895 1.00 54.60  ? 72  TYR B CA    1 
ATOM   1205  C  C     . TYR B 2 73  ? -32.335 -7.397  33.135 1.00 55.88  ? 72  TYR B C     1 
ATOM   1206  O  O     . TYR B 2 73  ? -32.294 -7.281  31.905 1.00 55.75  ? 72  TYR B O     1 
ATOM   1207  C  CB    . TYR B 2 73  ? -31.550 -9.511  34.246 1.00 53.91  ? 72  TYR B CB    1 
ATOM   1208  C  CG    . TYR B 2 73  ? -30.334 -10.394 34.433 1.00 52.27  ? 72  TYR B CG    1 
ATOM   1209  C  CD1   . TYR B 2 73  ? -30.080 -11.009 35.646 1.00 49.20  ? 72  TYR B CD1   1 
ATOM   1210  C  CD2   . TYR B 2 73  ? -29.432 -10.612 33.379 1.00 50.48  ? 72  TYR B CD2   1 
ATOM   1211  C  CE1   . TYR B 2 73  ? -28.964 -11.830 35.811 1.00 48.60  ? 72  TYR B CE1   1 
ATOM   1212  C  CE2   . TYR B 2 73  ? -28.318 -11.429 33.539 1.00 48.80  ? 72  TYR B CE2   1 
ATOM   1213  C  CZ    . TYR B 2 73  ? -28.092 -12.034 34.755 1.00 47.55  ? 72  TYR B CZ    1 
ATOM   1214  O  OH    . TYR B 2 73  ? -26.989 -12.826 34.909 1.00 46.14  ? 72  TYR B OH    1 
ATOM   1215  N  N     . THR B 2 74  ? -33.338 -6.945  33.891 1.00 57.08  ? 73  THR B N     1 
ATOM   1216  C  CA    . THR B 2 74  ? -34.490 -6.243  33.345 1.00 58.03  ? 73  THR B CA    1 
ATOM   1217  C  C     . THR B 2 74  ? -34.061 -4.983  32.600 1.00 59.32  ? 73  THR B C     1 
ATOM   1218  O  O     . THR B 2 74  ? -34.406 -4.804  31.419 1.00 59.63  ? 73  THR B O     1 
ATOM   1219  C  CB    . THR B 2 74  ? -35.458 -5.849  34.449 1.00 57.59  ? 73  THR B CB    1 
ATOM   1220  O  OG1   . THR B 2 74  ? -35.852 -7.023  35.167 1.00 57.30  ? 73  THR B OG1   1 
ATOM   1221  C  CG2   . THR B 2 74  ? -36.691 -5.173  33.858 1.00 57.29  ? 73  THR B CG2   1 
ATOM   1222  N  N     . GLU B 2 75  ? -33.309 -4.127  33.297 1.00 60.38  ? 74  GLU B N     1 
ATOM   1223  C  CA    . GLU B 2 75  ? -32.802 -2.884  32.733 1.00 61.72  ? 74  GLU B CA    1 
ATOM   1224  C  C     . GLU B 2 75  ? -32.045 -3.174  31.460 1.00 61.77  ? 74  GLU B C     1 
ATOM   1225  O  O     . GLU B 2 75  ? -32.203 -2.459  30.474 1.00 62.13  ? 74  GLU B O     1 
ATOM   1226  C  CB    . GLU B 2 75  ? -31.890 -2.128  33.720 1.00 62.25  ? 74  GLU B CB    1 
ATOM   1227  C  CG    . GLU B 2 75  ? -32.640 -1.316  34.791 1.00 66.37  ? 74  GLU B CG    1 
ATOM   1228  C  CD    . GLU B 2 75  ? -31.724 -0.461  35.678 1.00 71.78  ? 74  GLU B CD    1 
ATOM   1229  O  OE1   . GLU B 2 75  ? -32.033 0.740   35.873 1.00 73.77  ? 74  GLU B OE1   1 
ATOM   1230  O  OE2   . GLU B 2 75  ? -30.701 -0.983  36.191 1.00 74.47  ? 74  GLU B OE2   1 
ATOM   1231  N  N     . HIS B 2 76  ? -31.237 -4.233  31.470 1.00 61.87  ? 75  HIS B N     1 
ATOM   1232  C  CA    . HIS B 2 76  ? -30.425 -4.543  30.301 1.00 61.79  ? 75  HIS B CA    1 
ATOM   1233  C  C     . HIS B 2 76  ? -31.303 -4.882  29.105 1.00 62.11  ? 75  HIS B C     1 
ATOM   1234  O  O     . HIS B 2 76  ? -31.010 -4.483  27.985 1.00 62.04  ? 75  HIS B O     1 
ATOM   1235  C  CB    . HIS B 2 76  ? -29.423 -5.667  30.575 1.00 61.32  ? 75  HIS B CB    1 
ATOM   1236  C  CG    . HIS B 2 76  ? -28.459 -5.879  29.452 1.00 60.05  ? 75  HIS B CG    1 
ATOM   1237  N  ND1   . HIS B 2 76  ? -27.296 -5.154  29.325 1.00 57.64  ? 75  HIS B ND1   1 
ATOM   1238  C  CD2   . HIS B 2 76  ? -28.513 -6.699  28.375 1.00 59.47  ? 75  HIS B CD2   1 
ATOM   1239  C  CE1   . HIS B 2 76  ? -26.657 -5.538  28.235 1.00 58.31  ? 75  HIS B CE1   1 
ATOM   1240  N  NE2   . HIS B 2 76  ? -27.377 -6.471  27.635 1.00 58.56  ? 75  HIS B NE2   1 
ATOM   1241  N  N     . ALA B 2 77  ? -32.379 -5.619  29.365 1.00 62.78  ? 76  ALA B N     1 
ATOM   1242  C  CA    . ALA B 2 77  ? -33.324 -6.027  28.338 1.00 63.52  ? 76  ALA B CA    1 
ATOM   1243  C  C     . ALA B 2 77  ? -34.247 -4.858  27.933 1.00 64.18  ? 76  ALA B C     1 
ATOM   1244  O  O     . ALA B 2 77  ? -35.087 -4.998  27.040 1.00 64.57  ? 76  ALA B O     1 
ATOM   1245  C  CB    . ALA B 2 77  ? -34.132 -7.209  28.826 1.00 63.18  ? 76  ALA B CB    1 
ATOM   1246  N  N     . LYS B 2 78  ? -34.065 -3.708  28.580 1.00 64.46  ? 77  LYS B N     1 
ATOM   1247  C  CA    . LYS B 2 78  ? -34.877 -2.511  28.334 1.00 64.97  ? 77  LYS B CA    1 
ATOM   1248  C  C     . LYS B 2 78  ? -36.363 -2.747  28.647 1.00 64.79  ? 77  LYS B C     1 
ATOM   1249  O  O     . LYS B 2 78  ? -37.251 -2.253  27.948 1.00 64.86  ? 77  LYS B O     1 
ATOM   1250  C  CB    . LYS B 2 78  ? -34.692 -2.009  26.898 1.00 65.21  ? 77  LYS B CB    1 
ATOM   1251  C  CG    . LYS B 2 78  ? -33.268 -1.666  26.523 1.00 66.83  ? 77  LYS B CG    1 
ATOM   1252  C  CD    . LYS B 2 78  ? -33.119 -1.680  25.002 1.00 69.36  ? 77  LYS B CD    1 
ATOM   1253  C  CE    . LYS B 2 78  ? -31.650 -1.639  24.589 1.00 70.69  ? 77  LYS B CE    1 
ATOM   1254  N  NZ    . LYS B 2 78  ? -31.542 -1.181  23.164 1.00 72.80  ? 77  LYS B NZ    1 
ATOM   1255  N  N     . ARG B 2 79  ? -36.628 -3.507  29.701 1.00 64.51  ? 78  ARG B N     1 
ATOM   1256  C  CA    . ARG B 2 79  ? -37.994 -3.846  30.054 1.00 64.27  ? 78  ARG B CA    1 
ATOM   1257  C  C     . ARG B 2 79  ? -38.412 -3.087  31.301 1.00 64.26  ? 78  ARG B C     1 
ATOM   1258  O  O     . ARG B 2 79  ? -37.590 -2.466  31.964 1.00 64.36  ? 78  ARG B O     1 
ATOM   1259  C  CB    . ARG B 2 79  ? -38.146 -5.362  30.252 1.00 64.49  ? 78  ARG B CB    1 
ATOM   1260  C  CG    . ARG B 2 79  ? -38.046 -6.194  28.977 1.00 63.81  ? 78  ARG B CG    1 
ATOM   1261  C  CD    . ARG B 2 79  ? -38.387 -7.667  29.239 1.00 64.00  ? 78  ARG B CD    1 
ATOM   1262  N  NE    . ARG B 2 79  ? -37.210 -8.508  29.503 1.00 63.71  ? 78  ARG B NE    1 
ATOM   1263  C  CZ    . ARG B 2 79  ? -36.790 -8.868  30.719 1.00 62.92  ? 78  ARG B CZ    1 
ATOM   1264  N  NH1   . ARG B 2 79  ? -37.440 -8.460  31.807 1.00 62.22  ? 78  ARG B NH1   1 
ATOM   1265  N  NH2   . ARG B 2 79  ? -35.715 -9.636  30.851 1.00 60.76  ? 78  ARG B NH2   1 
ATOM   1266  N  N     . LYS B 2 80  ? -39.704 -3.121  31.597 1.00 64.44  ? 79  LYS B N     1 
ATOM   1267  C  CA    . LYS B 2 80  ? -40.267 -2.475  32.773 1.00 64.62  ? 79  LYS B CA    1 
ATOM   1268  C  C     . LYS B 2 80  ? -40.913 -3.546  33.657 1.00 64.30  ? 79  LYS B C     1 
ATOM   1269  O  O     . LYS B 2 80  ? -41.479 -3.244  34.726 1.00 64.58  ? 79  LYS B O     1 
ATOM   1270  C  CB    . LYS B 2 80  ? -41.309 -1.437  32.348 1.00 65.13  ? 79  LYS B CB    1 
ATOM   1271  C  CG    . LYS B 2 80  ? -40.733 -0.157  31.732 1.00 67.21  ? 79  LYS B CG    1 
ATOM   1272  C  CD    . LYS B 2 80  ? -41.807 0.927   31.709 1.00 71.00  ? 79  LYS B CD    1 
ATOM   1273  C  CE    . LYS B 2 80  ? -41.296 2.230   32.303 1.00 73.11  ? 79  LYS B CE    1 
ATOM   1274  N  NZ    . LYS B 2 80  ? -42.447 3.086   32.733 1.00 75.84  ? 79  LYS B NZ    1 
ATOM   1275  N  N     . THR B 2 81  ? -40.824 -4.793  33.192 1.00 63.50  ? 80  THR B N     1 
ATOM   1276  C  CA    . THR B 2 81  ? -41.335 -5.958  33.902 1.00 62.89  ? 80  THR B CA    1 
ATOM   1277  C  C     . THR B 2 81  ? -40.195 -6.921  34.193 1.00 62.02  ? 80  THR B C     1 
ATOM   1278  O  O     . THR B 2 81  ? -39.439 -7.307  33.290 1.00 62.17  ? 80  THR B O     1 
ATOM   1279  C  CB    . THR B 2 81  ? -42.368 -6.716  33.053 1.00 63.34  ? 80  THR B CB    1 
ATOM   1280  O  OG1   . THR B 2 81  ? -43.298 -5.787  32.472 1.00 65.11  ? 80  THR B OG1   1 
ATOM   1281  C  CG2   . THR B 2 81  ? -43.113 -7.754  33.895 1.00 62.83  ? 80  THR B CG2   1 
ATOM   1282  N  N     . VAL B 2 82  ? -40.075 -7.311  35.456 1.00 60.95  ? 81  VAL B N     1 
ATOM   1283  C  CA    . VAL B 2 82  ? -39.138 -8.358  35.854 1.00 59.55  ? 81  VAL B CA    1 
ATOM   1284  C  C     . VAL B 2 82  ? -39.770 -9.692  35.490 1.00 58.80  ? 81  VAL B C     1 
ATOM   1285  O  O     . VAL B 2 82  ? -40.883 -9.999  35.934 1.00 58.65  ? 81  VAL B O     1 
ATOM   1286  C  CB    . VAL B 2 82  ? -38.853 -8.306  37.362 1.00 59.47  ? 81  VAL B CB    1 
ATOM   1287  C  CG1   . VAL B 2 82  ? -37.985 -9.486  37.798 1.00 59.66  ? 81  VAL B CG1   1 
ATOM   1288  C  CG2   . VAL B 2 82  ? -38.193 -6.985  37.727 1.00 59.06  ? 81  VAL B CG2   1 
ATOM   1289  N  N     . THR B 2 83  ? -39.079 -10.472 34.662 1.00 58.00  ? 82  THR B N     1 
ATOM   1290  C  CA    . THR B 2 83  ? -39.573 -11.798 34.294 1.00 57.10  ? 82  THR B CA    1 
ATOM   1291  C  C     . THR B 2 83  ? -39.070 -12.842 35.267 1.00 56.44  ? 82  THR B C     1 
ATOM   1292  O  O     . THR B 2 83  ? -38.091 -12.628 35.978 1.00 56.62  ? 82  THR B O     1 
ATOM   1293  C  CB    . THR B 2 83  ? -39.134 -12.213 32.885 1.00 57.06  ? 82  THR B CB    1 
ATOM   1294  O  OG1   . THR B 2 83  ? -37.709 -12.157 32.796 1.00 57.02  ? 82  THR B OG1   1 
ATOM   1295  C  CG2   . THR B 2 83  ? -39.726 -11.288 31.842 1.00 57.69  ? 82  THR B CG2   1 
ATOM   1296  N  N     . ALA B 2 84  ? -39.756 -13.977 35.291 1.00 55.84  ? 83  ALA B N     1 
ATOM   1297  C  CA    . ALA B 2 84  ? -39.264 -15.176 35.958 1.00 54.84  ? 83  ALA B CA    1 
ATOM   1298  C  C     . ALA B 2 84  ? -37.816 -15.452 35.592 1.00 53.96  ? 83  ALA B C     1 
ATOM   1299  O  O     . ALA B 2 84  ? -37.030 -15.802 36.464 1.00 54.08  ? 83  ALA B O     1 
ATOM   1300  C  CB    . ALA B 2 84  ? -40.121 -16.365 35.593 1.00 54.86  ? 83  ALA B CB    1 
ATOM   1301  N  N     . MET B 2 85  ? -37.469 -15.291 34.314 1.00 53.00  ? 84  MET B N     1 
ATOM   1302  C  CA    . MET B 2 85  ? -36.122 -15.613 33.841 1.00 52.52  ? 84  MET B CA    1 
ATOM   1303  C  C     . MET B 2 85  ? -35.078 -14.664 34.400 1.00 52.26  ? 84  MET B C     1 
ATOM   1304  O  O     . MET B 2 85  ? -33.931 -15.068 34.643 1.00 52.24  ? 84  MET B O     1 
ATOM   1305  C  CB    . MET B 2 85  ? -36.034 -15.647 32.315 1.00 52.35  ? 84  MET B CB    1 
ATOM   1306  C  CG    . MET B 2 85  ? -36.714 -16.840 31.678 1.00 53.04  ? 84  MET B CG    1 
ATOM   1307  S  SD    . MET B 2 85  ? -36.204 -18.442 32.325 1.00 56.94  ? 84  MET B SD    1 
ATOM   1308  C  CE    . MET B 2 85  ? -34.493 -18.511 31.775 1.00 55.89  ? 84  MET B CE    1 
ATOM   1309  N  N     . ASP B 2 86  ? -35.465 -13.413 34.613 1.00 51.53  ? 85  ASP B N     1 
ATOM   1310  C  CA    . ASP B 2 86  ? -34.549 -12.468 35.221 1.00 51.73  ? 85  ASP B CA    1 
ATOM   1311  C  C     . ASP B 2 86  ? -34.151 -13.021 36.576 1.00 51.27  ? 85  ASP B C     1 
ATOM   1312  O  O     . ASP B 2 86  ? -32.967 -13.013 36.938 1.00 51.15  ? 85  ASP B O     1 
ATOM   1313  C  CB    . ASP B 2 86  ? -35.199 -11.090 35.418 1.00 52.34  ? 85  ASP B CB    1 
ATOM   1314  C  CG    . ASP B 2 86  ? -35.404 -10.338 34.119 1.00 53.74  ? 85  ASP B CG    1 
ATOM   1315  O  OD1   . ASP B 2 86  ? -34.641 -10.578 33.147 1.00 55.89  ? 85  ASP B OD1   1 
ATOM   1316  O  OD2   . ASP B 2 86  ? -36.335 -9.500  34.086 1.00 54.33  ? 85  ASP B OD2   1 
ATOM   1317  N  N     . VAL B 2 87  ? -35.157 -13.499 37.312 1.00 50.34  ? 86  VAL B N     1 
ATOM   1318  C  CA    . VAL B 2 87  ? -34.969 -14.009 38.652 1.00 49.82  ? 86  VAL B CA    1 
ATOM   1319  C  C     . VAL B 2 87  ? -34.131 -15.283 38.611 1.00 50.00  ? 86  VAL B C     1 
ATOM   1320  O  O     . VAL B 2 87  ? -33.171 -15.419 39.382 1.00 50.31  ? 86  VAL B O     1 
ATOM   1321  C  CB    . VAL B 2 87  ? -36.308 -14.292 39.339 1.00 49.78  ? 86  VAL B CB    1 
ATOM   1322  C  CG1   . VAL B 2 87  ? -36.094 -15.023 40.644 1.00 49.22  ? 86  VAL B CG1   1 
ATOM   1323  C  CG2   . VAL B 2 87  ? -37.074 -12.994 39.573 1.00 49.96  ? 86  VAL B CG2   1 
ATOM   1324  N  N     . VAL B 2 88  ? -34.477 -16.189 37.696 1.00 49.26  ? 87  VAL B N     1 
ATOM   1325  C  CA    . VAL B 2 88  ? -33.803 -17.470 37.585 1.00 49.19  ? 87  VAL B CA    1 
ATOM   1326  C  C     . VAL B 2 88  ? -32.310 -17.284 37.325 1.00 49.30  ? 87  VAL B C     1 
ATOM   1327  O  O     . VAL B 2 88  ? -31.475 -17.896 37.993 1.00 49.37  ? 87  VAL B O     1 
ATOM   1328  C  CB    . VAL B 2 88  ? -34.460 -18.351 36.493 1.00 49.41  ? 87  VAL B CB    1 
ATOM   1329  C  CG1   . VAL B 2 88  ? -33.556 -19.531 36.083 1.00 48.12  ? 87  VAL B CG1   1 
ATOM   1330  C  CG2   . VAL B 2 88  ? -35.800 -18.852 36.970 1.00 49.80  ? 87  VAL B CG2   1 
ATOM   1331  N  N     . TYR B 2 89  ? -31.988 -16.425 36.366 1.00 49.41  ? 88  TYR B N     1 
ATOM   1332  C  CA    . TYR B 2 89  ? -30.617 -16.074 36.075 1.00 49.61  ? 88  TYR B CA    1 
ATOM   1333  C  C     . TYR B 2 89  ? -29.918 -15.412 37.268 1.00 49.05  ? 88  TYR B C     1 
ATOM   1334  O  O     . TYR B 2 89  ? -28.722 -15.637 37.494 1.00 48.90  ? 88  TYR B O     1 
ATOM   1335  C  CB    . TYR B 2 89  ? -30.570 -15.136 34.881 1.00 50.38  ? 88  TYR B CB    1 
ATOM   1336  C  CG    . TYR B 2 89  ? -31.039 -15.736 33.577 1.00 53.38  ? 88  TYR B CG    1 
ATOM   1337  C  CD1   . TYR B 2 89  ? -31.850 -15.009 32.717 1.00 55.76  ? 88  TYR B CD1   1 
ATOM   1338  C  CD2   . TYR B 2 89  ? -30.657 -17.017 33.192 1.00 56.45  ? 88  TYR B CD2   1 
ATOM   1339  C  CE1   . TYR B 2 89  ? -32.281 -15.528 31.516 1.00 57.79  ? 88  TYR B CE1   1 
ATOM   1340  C  CE2   . TYR B 2 89  ? -31.082 -17.553 31.983 1.00 59.21  ? 88  TYR B CE2   1 
ATOM   1341  C  CZ    . TYR B 2 89  ? -31.894 -16.789 31.147 1.00 60.37  ? 88  TYR B CZ    1 
ATOM   1342  O  OH    . TYR B 2 89  ? -32.328 -17.296 29.939 1.00 63.22  ? 88  TYR B OH    1 
ATOM   1343  N  N     . ALA B 2 90  ? -30.651 -14.596 38.024 1.00 48.18  ? 89  ALA B N     1 
ATOM   1344  C  CA    . ALA B 2 90  ? -30.061 -13.932 39.190 1.00 47.95  ? 89  ALA B CA    1 
ATOM   1345  C  C     . ALA B 2 90  ? -29.682 -14.961 40.247 1.00 47.63  ? 89  ALA B C     1 
ATOM   1346  O  O     . ALA B 2 90  ? -28.602 -14.893 40.834 1.00 47.25  ? 89  ALA B O     1 
ATOM   1347  C  CB    . ALA B 2 90  ? -31.010 -12.904 39.775 1.00 47.82  ? 89  ALA B CB    1 
ATOM   1348  N  N     . LEU B 2 91  ? -30.581 -15.915 40.468 1.00 47.15  ? 90  LEU B N     1 
ATOM   1349  C  CA    . LEU B 2 91  ? -30.367 -16.962 41.443 1.00 46.93  ? 90  LEU B CA    1 
ATOM   1350  C  C     . LEU B 2 91  ? -29.200 -17.845 41.015 1.00 47.73  ? 90  LEU B C     1 
ATOM   1351  O  O     . LEU B 2 91  ? -28.374 -18.245 41.853 1.00 47.72  ? 90  LEU B O     1 
ATOM   1352  C  CB    . LEU B 2 91  ? -31.631 -17.799 41.624 1.00 46.33  ? 90  LEU B CB    1 
ATOM   1353  C  CG    . LEU B 2 91  ? -32.800 -17.158 42.383 1.00 45.20  ? 90  LEU B CG    1 
ATOM   1354  C  CD1   . LEU B 2 91  ? -34.079 -17.835 41.996 1.00 43.69  ? 90  LEU B CD1   1 
ATOM   1355  C  CD2   . LEU B 2 91  ? -32.629 -17.171 43.902 1.00 43.22  ? 90  LEU B CD2   1 
ATOM   1356  N  N     . LYS B 2 92  ? -29.118 -18.135 39.716 1.00 47.98  ? 91  LYS B N     1 
ATOM   1357  C  CA    . LYS B 2 92  ? -28.029 -18.958 39.240 1.00 48.60  ? 91  LYS B CA    1 
ATOM   1358  C  C     . LYS B 2 92  ? -26.709 -18.303 39.604 1.00 48.73  ? 91  LYS B C     1 
ATOM   1359  O  O     . LYS B 2 92  ? -25.871 -18.920 40.279 1.00 48.99  ? 91  LYS B O     1 
ATOM   1360  C  CB    . LYS B 2 92  ? -28.106 -19.242 37.744 1.00 48.45  ? 91  LYS B CB    1 
ATOM   1361  C  CG    . LYS B 2 92  ? -26.945 -20.128 37.267 1.00 50.60  ? 91  LYS B CG    1 
ATOM   1362  C  CD    . LYS B 2 92  ? -27.373 -21.298 36.360 1.00 52.90  ? 91  LYS B CD    1 
ATOM   1363  C  CE    . LYS B 2 92  ? -28.069 -20.798 35.078 1.00 57.01  ? 91  LYS B CE    1 
ATOM   1364  N  NZ    . LYS B 2 92  ? -28.290 -21.874 34.057 1.00 58.89  ? 91  LYS B NZ    1 
ATOM   1365  N  N     . ARG B 2 93  ? -26.529 -17.052 39.198 1.00 48.54  ? 92  ARG B N     1 
ATOM   1366  C  CA    . ARG B 2 93  ? -25.242 -16.406 39.426 1.00 48.43  ? 92  ARG B CA    1 
ATOM   1367  C  C     . ARG B 2 93  ? -24.954 -16.167 40.910 1.00 48.35  ? 92  ARG B C     1 
ATOM   1368  O  O     . ARG B 2 93  ? -23.795 -16.003 41.292 1.00 48.30  ? 92  ARG B O     1 
ATOM   1369  C  CB    . ARG B 2 93  ? -25.078 -15.133 38.592 1.00 48.44  ? 92  ARG B CB    1 
ATOM   1370  C  CG    . ARG B 2 93  ? -25.911 -13.935 39.027 1.00 48.59  ? 92  ARG B CG    1 
ATOM   1371  C  CD    . ARG B 2 93  ? -25.439 -12.706 38.254 1.00 48.82  ? 92  ARG B CD    1 
ATOM   1372  N  NE    . ARG B 2 93  ? -23.993 -12.579 38.380 1.00 48.66  ? 92  ARG B NE    1 
ATOM   1373  C  CZ    . ARG B 2 93  ? -23.379 -12.066 39.441 1.00 49.17  ? 92  ARG B CZ    1 
ATOM   1374  N  NH1   . ARG B 2 93  ? -24.089 -11.608 40.475 1.00 48.64  ? 92  ARG B NH1   1 
ATOM   1375  N  NH2   . ARG B 2 93  ? -22.054 -12.022 39.477 1.00 49.17  ? 92  ARG B NH2   1 
ATOM   1376  N  N     . GLN B 2 94  ? -25.997 -16.181 41.740 1.00 48.12  ? 93  GLN B N     1 
ATOM   1377  C  CA    . GLN B 2 94  ? -25.818 -16.090 43.189 1.00 48.37  ? 93  GLN B CA    1 
ATOM   1378  C  C     . GLN B 2 94  ? -25.554 -17.453 43.854 1.00 48.42  ? 93  GLN B C     1 
ATOM   1379  O  O     . GLN B 2 94  ? -25.544 -17.564 45.087 1.00 48.50  ? 93  GLN B O     1 
ATOM   1380  C  CB    . GLN B 2 94  ? -27.023 -15.409 43.853 1.00 48.57  ? 93  GLN B CB    1 
ATOM   1381  C  CG    . GLN B 2 94  ? -27.222 -13.945 43.489 1.00 49.74  ? 93  GLN B CG    1 
ATOM   1382  C  CD    . GLN B 2 94  ? -26.257 -13.017 44.194 1.00 53.42  ? 93  GLN B CD    1 
ATOM   1383  O  OE1   . GLN B 2 94  ? -25.915 -13.224 45.355 1.00 56.92  ? 93  GLN B OE1   1 
ATOM   1384  N  NE2   . GLN B 2 94  ? -25.823 -11.974 43.501 1.00 54.15  ? 93  GLN B NE2   1 
ATOM   1385  N  N     . GLY B 2 95  ? -25.345 -18.484 43.035 1.00 48.42  ? 94  GLY B N     1 
ATOM   1386  C  CA    . GLY B 2 95  ? -25.100 -19.836 43.507 1.00 47.53  ? 94  GLY B CA    1 
ATOM   1387  C  C     . GLY B 2 95  ? -26.313 -20.492 44.133 1.00 47.46  ? 94  GLY B C     1 
ATOM   1388  O  O     . GLY B 2 95  ? -26.176 -21.342 45.008 1.00 47.51  ? 94  GLY B O     1 
ATOM   1389  N  N     . ARG B 2 96  ? -27.502 -20.100 43.689 1.00 47.41  ? 95  ARG B N     1 
ATOM   1390  C  CA    . ARG B 2 96  ? -28.752 -20.613 44.250 1.00 47.19  ? 95  ARG B CA    1 
ATOM   1391  C  C     . ARG B 2 96  ? -29.677 -21.117 43.155 1.00 46.43  ? 95  ARG B C     1 
ATOM   1392  O  O     . ARG B 2 96  ? -30.857 -20.802 43.186 1.00 46.53  ? 95  ARG B O     1 
ATOM   1393  C  CB    . ARG B 2 96  ? -29.510 -19.514 45.015 1.00 47.53  ? 95  ARG B CB    1 
ATOM   1394  C  CG    . ARG B 2 96  ? -28.712 -18.667 46.005 1.00 49.77  ? 95  ARG B CG    1 
ATOM   1395  C  CD    . ARG B 2 96  ? -28.582 -19.276 47.385 1.00 52.37  ? 95  ARG B CD    1 
ATOM   1396  N  NE    . ARG B 2 96  ? -29.706 -20.151 47.715 1.00 56.43  ? 95  ARG B NE    1 
ATOM   1397  C  CZ    . ARG B 2 96  ? -29.705 -21.036 48.713 1.00 57.28  ? 95  ARG B CZ    1 
ATOM   1398  N  NH1   . ARG B 2 96  ? -28.635 -21.165 49.500 1.00 58.26  ? 95  ARG B NH1   1 
ATOM   1399  N  NH2   . ARG B 2 96  ? -30.774 -21.793 48.925 1.00 56.60  ? 95  ARG B NH2   1 
ATOM   1400  N  N     . THR B 2 97  ? -29.148 -21.881 42.197 1.00 45.90  ? 96  THR B N     1 
ATOM   1401  C  CA    . THR B 2 97  ? -29.914 -22.378 41.041 1.00 45.01  ? 96  THR B CA    1 
ATOM   1402  C  C     . THR B 2 97  ? -31.291 -22.874 41.442 1.00 45.15  ? 96  THR B C     1 
ATOM   1403  O  O     . THR B 2 97  ? -31.412 -23.719 42.330 1.00 45.71  ? 96  THR B O     1 
ATOM   1404  C  CB    . THR B 2 97  ? -29.153 -23.507 40.326 1.00 44.62  ? 96  THR B CB    1 
ATOM   1405  O  OG1   . THR B 2 97  ? -28.007 -22.958 39.683 1.00 45.74  ? 96  THR B OG1   1 
ATOM   1406  C  CG2   . THR B 2 97  ? -29.992 -24.182 39.265 1.00 43.96  ? 96  THR B CG2   1 
ATOM   1407  N  N     . LEU B 2 98  ? -32.322 -22.340 40.795 1.00 44.96  ? 97  LEU B N     1 
ATOM   1408  C  CA    . LEU B 2 98  ? -33.689 -22.767 41.038 1.00 45.40  ? 97  LEU B CA    1 
ATOM   1409  C  C     . LEU B 2 98  ? -34.226 -23.535 39.827 1.00 46.24  ? 97  LEU B C     1 
ATOM   1410  O  O     . LEU B 2 98  ? -33.984 -23.147 38.690 1.00 46.89  ? 97  LEU B O     1 
ATOM   1411  C  CB    . LEU B 2 98  ? -34.562 -21.548 41.338 1.00 44.98  ? 97  LEU B CB    1 
ATOM   1412  C  CG    . LEU B 2 98  ? -36.067 -21.726 41.539 1.00 44.15  ? 97  LEU B CG    1 
ATOM   1413  C  CD1   . LEU B 2 98  ? -36.417 -22.412 42.853 1.00 44.94  ? 97  LEU B CD1   1 
ATOM   1414  C  CD2   . LEU B 2 98  ? -36.730 -20.393 41.483 1.00 43.05  ? 97  LEU B CD2   1 
ATOM   1415  N  N     . TYR B 2 99  ? -34.935 -24.631 40.068 1.00 46.85  ? 98  TYR B N     1 
ATOM   1416  C  CA    . TYR B 2 99  ? -35.499 -25.423 38.985 1.00 47.54  ? 98  TYR B CA    1 
ATOM   1417  C  C     . TYR B 2 99  ? -36.994 -25.280 39.027 1.00 48.64  ? 98  TYR B C     1 
ATOM   1418  O  O     . TYR B 2 99  ? -37.586 -25.248 40.112 1.00 48.76  ? 98  TYR B O     1 
ATOM   1419  C  CB    . TYR B 2 99  ? -35.192 -26.905 39.168 1.00 47.25  ? 98  TYR B CB    1 
ATOM   1420  C  CG    . TYR B 2 99  ? -33.836 -27.418 38.719 1.00 45.44  ? 98  TYR B CG    1 
ATOM   1421  C  CD1   . TYR B 2 99  ? -32.844 -26.571 38.209 1.00 43.55  ? 98  TYR B CD1   1 
ATOM   1422  C  CD2   . TYR B 2 99  ? -33.538 -28.759 38.867 1.00 43.31  ? 98  TYR B CD2   1 
ATOM   1423  C  CE1   . TYR B 2 99  ? -31.606 -27.072 37.814 1.00 41.58  ? 98  TYR B CE1   1 
ATOM   1424  C  CE2   . TYR B 2 99  ? -32.315 -29.260 38.502 1.00 43.66  ? 98  TYR B CE2   1 
ATOM   1425  C  CZ    . TYR B 2 99  ? -31.353 -28.426 37.970 1.00 42.94  ? 98  TYR B CZ    1 
ATOM   1426  O  OH    . TYR B 2 99  ? -30.151 -28.997 37.621 1.00 41.31  ? 98  TYR B OH    1 
ATOM   1427  N  N     . GLY B 2 100 ? -37.601 -25.205 37.844 1.00 49.59  ? 99  GLY B N     1 
ATOM   1428  C  CA    . GLY B 2 100 ? -39.052 -25.216 37.713 1.00 50.55  ? 99  GLY B CA    1 
ATOM   1429  C  C     . GLY B 2 100 ? -39.696 -23.928 37.273 1.00 51.37  ? 99  GLY B C     1 
ATOM   1430  O  O     . GLY B 2 100 ? -40.908 -23.802 37.334 1.00 52.21  ? 99  GLY B O     1 
ATOM   1431  N  N     . PHE B 2 101 ? -38.909 -22.966 36.815 1.00 52.14  ? 100 PHE B N     1 
ATOM   1432  C  CA    . PHE B 2 101 ? -39.482 -21.702 36.384 1.00 52.78  ? 100 PHE B CA    1 
ATOM   1433  C  C     . PHE B 2 101 ? -38.906 -21.230 35.052 1.00 54.01  ? 100 PHE B C     1 
ATOM   1434  O  O     . PHE B 2 101 ? -38.819 -20.026 34.790 1.00 54.13  ? 100 PHE B O     1 
ATOM   1435  C  CB    . PHE B 2 101 ? -39.273 -20.642 37.456 1.00 52.36  ? 100 PHE B CB    1 
ATOM   1436  C  CG    . PHE B 2 101 ? -40.146 -20.813 38.661 1.00 51.38  ? 100 PHE B CG    1 
ATOM   1437  C  CD1   . PHE B 2 101 ? -39.702 -21.543 39.770 1.00 49.66  ? 100 PHE B CD1   1 
ATOM   1438  C  CD2   . PHE B 2 101 ? -41.406 -20.218 38.708 1.00 50.02  ? 100 PHE B CD2   1 
ATOM   1439  C  CE1   . PHE B 2 101 ? -40.513 -21.678 40.910 1.00 49.47  ? 100 PHE B CE1   1 
ATOM   1440  C  CE2   . PHE B 2 101 ? -42.227 -20.347 39.838 1.00 49.55  ? 100 PHE B CE2   1 
ATOM   1441  C  CZ    . PHE B 2 101 ? -41.787 -21.081 40.939 1.00 48.45  ? 100 PHE B CZ    1 
ATOM   1442  N  N     . GLY B 2 102 ? -38.521 -22.178 34.204 1.00 55.10  ? 101 GLY B N     1 
ATOM   1443  C  CA    . GLY B 2 102 ? -37.945 -21.837 32.906 1.00 56.20  ? 101 GLY B CA    1 
ATOM   1444  C  C     . GLY B 2 102 ? -36.437 -21.948 32.961 1.00 56.96  ? 101 GLY B C     1 
ATOM   1445  O  O     . GLY B 2 102 ? -35.870 -22.198 34.022 1.00 57.39  ? 101 GLY B O     1 
ATOM   1446  N  N     . GLY B 2 103 ? -35.785 -21.777 31.815 1.00 57.48  ? 102 GLY B N     1 
ATOM   1447  C  CA    . GLY B 2 103 ? -34.333 -21.922 31.734 1.00 57.44  ? 102 GLY B CA    1 
ATOM   1448  C  C     . GLY B 2 103 ? -33.925 -23.377 31.771 1.00 57.58  ? 102 GLY B C     1 
ATOM   1449  O  O     . GLY B 2 103 ? -32.747 -23.676 31.947 1.00 57.65  ? 102 GLY B O     1 
ATOM   1450  O  OXT   . GLY B 2 103 ? -34.758 -24.278 31.614 1.00 57.64  ? 102 GLY B OXT   1 
ATOM   1451  N  N     . ALA C 3 15  ? -0.342  6.382   12.547 1.00 78.89  ? 14  ALA C N     1 
ATOM   1452  C  CA    . ALA C 3 15  ? -0.132  5.046   13.180 1.00 79.03  ? 14  ALA C CA    1 
ATOM   1453  C  C     . ALA C 3 15  ? -0.303  5.109   14.711 1.00 78.73  ? 14  ALA C C     1 
ATOM   1454  O  O     . ALA C 3 15  ? 0.681   5.118   15.464 1.00 78.89  ? 14  ALA C O     1 
ATOM   1455  C  CB    . ALA C 3 15  ? 1.244   4.482   12.796 1.00 79.28  ? 14  ALA C CB    1 
ATOM   1456  N  N     . LYS C 3 16  ? -1.562  5.161   15.148 1.00 77.87  ? 15  LYS C N     1 
ATOM   1457  C  CA    . LYS C 3 16  ? -1.915  5.245   16.567 1.00 76.95  ? 15  LYS C CA    1 
ATOM   1458  C  C     . LYS C 3 16  ? -2.508  3.950   17.122 1.00 75.84  ? 15  LYS C C     1 
ATOM   1459  O  O     . LYS C 3 16  ? -3.319  3.290   16.466 1.00 75.62  ? 15  LYS C O     1 
ATOM   1460  C  CB    . LYS C 3 16  ? -2.921  6.374   16.805 1.00 77.20  ? 15  LYS C CB    1 
ATOM   1461  C  CG    . LYS C 3 16  ? -2.309  7.755   16.864 1.00 77.98  ? 15  LYS C CG    1 
ATOM   1462  C  CD    . LYS C 3 16  ? -2.825  8.505   18.087 1.00 79.18  ? 15  LYS C CD    1 
ATOM   1463  C  CE    . LYS C 3 16  ? -1.710  9.349   18.712 1.00 79.69  ? 15  LYS C CE    1 
ATOM   1464  N  NZ    . LYS C 3 16  ? -1.843  9.451   20.205 1.00 79.12  ? 15  LYS C NZ    1 
ATOM   1465  N  N     . THR C 3 17  ? -2.113  3.611   18.346 1.00 74.47  ? 16  THR C N     1 
ATOM   1466  C  CA    . THR C 3 17  ? -2.757  2.534   19.090 1.00 72.95  ? 16  THR C CA    1 
ATOM   1467  C  C     . THR C 3 17  ? -4.133  3.002   19.560 1.00 71.88  ? 16  THR C C     1 
ATOM   1468  O  O     . THR C 3 17  ? -4.339  4.185   19.849 1.00 71.27  ? 16  THR C O     1 
ATOM   1469  C  CB    . THR C 3 17  ? -1.933  2.090   20.320 1.00 72.90  ? 16  THR C CB    1 
ATOM   1470  O  OG1   . THR C 3 17  ? -1.936  3.129   21.305 1.00 73.33  ? 16  THR C OG1   1 
ATOM   1471  C  CG2   . THR C 3 17  ? -0.491  1.738   19.941 1.00 72.79  ? 16  THR C CG2   1 
ATOM   1472  N  N     . ARG C 3 18  ? -5.071  2.061   19.625 1.00 70.87  ? 17  ARG C N     1 
ATOM   1473  C  CA    . ARG C 3 18  ? -6.402  2.314   20.184 1.00 69.89  ? 17  ARG C CA    1 
ATOM   1474  C  C     . ARG C 3 18  ? -6.327  2.637   21.683 1.00 69.30  ? 17  ARG C C     1 
ATOM   1475  O  O     . ARG C 3 18  ? -7.150  3.380   22.218 1.00 68.71  ? 17  ARG C O     1 
ATOM   1476  C  CB    . ARG C 3 18  ? -7.305  1.108   19.938 1.00 69.67  ? 17  ARG C CB    1 
ATOM   1477  C  CG    . ARG C 3 18  ? -7.371  0.697   18.477 1.00 69.14  ? 17  ARG C CG    1 
ATOM   1478  C  CD    . ARG C 3 18  ? -8.565  -0.184  18.205 1.00 68.18  ? 17  ARG C CD    1 
ATOM   1479  N  NE    . ARG C 3 18  ? -8.196  -1.589  18.309 1.00 67.42  ? 17  ARG C NE    1 
ATOM   1480  C  CZ    . ARG C 3 18  ? -9.041  -2.570  18.605 1.00 66.94  ? 17  ARG C CZ    1 
ATOM   1481  N  NH1   . ARG C 3 18  ? -10.319 -2.306  18.841 1.00 67.08  ? 17  ARG C NH1   1 
ATOM   1482  N  NH2   . ARG C 3 18  ? -8.595  -3.816  18.673 1.00 67.06  ? 17  ARG C NH2   1 
ATOM   1483  N  N     . SER C 3 19  ? -5.325  2.068   22.350 1.00 68.97  ? 18  SER C N     1 
ATOM   1484  C  CA    . SER C 3 19  ? -5.030  2.396   23.740 1.00 68.68  ? 18  SER C CA    1 
ATOM   1485  C  C     . SER C 3 19  ? -4.874  3.904   23.902 1.00 68.55  ? 18  SER C C     1 
ATOM   1486  O  O     . SER C 3 19  ? -5.657  4.529   24.622 1.00 68.52  ? 18  SER C O     1 
ATOM   1487  C  CB    . SER C 3 19  ? -3.773  1.663   24.221 1.00 68.42  ? 18  SER C CB    1 
ATOM   1488  O  OG    . SER C 3 19  ? -4.038  0.295   24.444 1.00 68.16  ? 18  SER C OG    1 
ATOM   1489  N  N     . SER C 3 20  ? -3.880  4.481   23.220 1.00 68.32  ? 19  SER C N     1 
ATOM   1490  C  CA    . SER C 3 20  ? -3.629  5.930   23.284 1.00 68.17  ? 19  SER C CA    1 
ATOM   1491  C  C     . SER C 3 20  ? -4.832  6.746   22.814 1.00 67.50  ? 19  SER C C     1 
ATOM   1492  O  O     . SER C 3 20  ? -5.125  7.792   23.386 1.00 67.57  ? 19  SER C O     1 
ATOM   1493  C  CB    . SER C 3 20  ? -2.357  6.330   22.525 1.00 68.13  ? 19  SER C CB    1 
ATOM   1494  O  OG    . SER C 3 20  ? -2.429  5.940   21.160 1.00 69.69  ? 19  SER C OG    1 
ATOM   1495  N  N     . ARG C 3 21  ? -5.541  6.258   21.802 1.00 66.95  ? 20  ARG C N     1 
ATOM   1496  C  CA    . ARG C 3 21  ? -6.812  6.864   21.417 1.00 66.76  ? 20  ARG C CA    1 
ATOM   1497  C  C     . ARG C 3 21  ? -7.801  6.905   22.580 1.00 66.24  ? 20  ARG C C     1 
ATOM   1498  O  O     . ARG C 3 21  ? -8.538  7.882   22.722 1.00 66.71  ? 20  ARG C O     1 
ATOM   1499  C  CB    . ARG C 3 21  ? -7.471  6.124   20.245 1.00 67.28  ? 20  ARG C CB    1 
ATOM   1500  C  CG    . ARG C 3 21  ? -6.919  6.395   18.856 1.00 68.77  ? 20  ARG C CG    1 
ATOM   1501  C  CD    . ARG C 3 21  ? -7.901  5.883   17.805 1.00 72.58  ? 20  ARG C CD    1 
ATOM   1502  N  NE    . ARG C 3 21  ? -7.222  5.312   16.636 1.00 77.40  ? 20  ARG C NE    1 
ATOM   1503  C  CZ    . ARG C 3 21  ? -6.956  5.969   15.497 1.00 79.48  ? 20  ARG C CZ    1 
ATOM   1504  N  NH1   . ARG C 3 21  ? -7.304  7.246   15.342 1.00 79.33  ? 20  ARG C NH1   1 
ATOM   1505  N  NH2   . ARG C 3 21  ? -6.334  5.344   14.498 1.00 80.21  ? 20  ARG C NH2   1 
ATOM   1506  N  N     . ALA C 3 22  ? -7.841  5.853   23.402 1.00 65.54  ? 21  ALA C N     1 
ATOM   1507  C  CA    . ALA C 3 22  ? -8.815  5.798   24.517 1.00 64.77  ? 21  ALA C CA    1 
ATOM   1508  C  C     . ALA C 3 22  ? -8.321  6.423   25.825 1.00 64.17  ? 21  ALA C C     1 
ATOM   1509  O  O     . ALA C 3 22  ? -9.110  6.677   26.734 1.00 64.49  ? 21  ALA C O     1 
ATOM   1510  C  CB    . ALA C 3 22  ? -9.286  4.380   24.755 1.00 65.01  ? 21  ALA C CB    1 
ATOM   1511  N  N     . GLY C 3 23  ? -7.021  6.684   25.912 1.00 63.29  ? 22  GLY C N     1 
ATOM   1512  C  CA    . GLY C 3 23  ? -6.431  7.280   27.101 1.00 62.18  ? 22  GLY C CA    1 
ATOM   1513  C  C     . GLY C 3 23  ? -6.087  6.228   28.133 1.00 61.71  ? 22  GLY C C     1 
ATOM   1514  O  O     . GLY C 3 23  ? -6.199  6.469   29.346 1.00 61.52  ? 22  GLY C O     1 
ATOM   1515  N  N     . LEU C 3 24  ? -5.638  5.070   27.642 1.00 60.77  ? 23  LEU C N     1 
ATOM   1516  C  CA    . LEU C 3 24  ? -5.456  3.899   28.470 1.00 59.62  ? 23  LEU C CA    1 
ATOM   1517  C  C     . LEU C 3 24  ? -4.044  3.343   28.390 1.00 59.80  ? 23  LEU C C     1 
ATOM   1518  O  O     . LEU C 3 24  ? -3.409  3.376   27.342 1.00 59.84  ? 23  LEU C O     1 
ATOM   1519  C  CB    . LEU C 3 24  ? -6.487  2.822   28.101 1.00 59.16  ? 23  LEU C CB    1 
ATOM   1520  C  CG    . LEU C 3 24  ? -7.996  3.113   28.231 1.00 57.29  ? 23  LEU C CG    1 
ATOM   1521  C  CD1   . LEU C 3 24  ? -8.832  1.908   27.813 1.00 55.89  ? 23  LEU C CD1   1 
ATOM   1522  C  CD2   . LEU C 3 24  ? -8.393  3.526   29.625 1.00 56.28  ? 23  LEU C CD2   1 
ATOM   1523  N  N     . GLN C 3 25  ? -3.555  2.837   29.518 1.00 60.11  ? 24  GLN C N     1 
ATOM   1524  C  CA    . GLN C 3 25  ? -2.271  2.151   29.577 1.00 60.03  ? 24  GLN C CA    1 
ATOM   1525  C  C     . GLN C 3 25  ? -2.433  0.681   29.195 1.00 60.22  ? 24  GLN C C     1 
ATOM   1526  O  O     . GLN C 3 25  ? -1.528  0.091   28.608 1.00 60.67  ? 24  GLN C O     1 
ATOM   1527  C  CB    . GLN C 3 25  ? -1.700  2.257   30.983 1.00 60.28  ? 24  GLN C CB    1 
ATOM   1528  C  CG    . GLN C 3 25  ? -1.664  3.665   31.543 1.00 59.60  ? 24  GLN C CG    1 
ATOM   1529  C  CD    . GLN C 3 25  ? -0.678  4.536   30.808 1.00 59.04  ? 24  GLN C CD    1 
ATOM   1530  O  OE1   . GLN C 3 25  ? 0.469   4.148   30.569 1.00 59.43  ? 24  GLN C OE1   1 
ATOM   1531  N  NE2   . GLN C 3 25  ? -1.116  5.721   30.441 1.00 58.94  ? 24  GLN C NE2   1 
ATOM   1532  N  N     . PHE C 3 26  ? -3.586  0.098   29.527 1.00 60.01  ? 25  PHE C N     1 
ATOM   1533  C  CA    . PHE C 3 26  ? -3.884  -1.301  29.208 1.00 59.88  ? 25  PHE C CA    1 
ATOM   1534  C  C     . PHE C 3 26  ? -4.154  -1.493  27.717 1.00 60.10  ? 25  PHE C C     1 
ATOM   1535  O  O     . PHE C 3 26  ? -4.731  -0.615  27.080 1.00 60.33  ? 25  PHE C O     1 
ATOM   1536  C  CB    . PHE C 3 26  ? -5.058  -1.807  30.053 1.00 59.73  ? 25  PHE C CB    1 
ATOM   1537  C  CG    . PHE C 3 26  ? -4.640  -2.516  31.317 1.00 58.72  ? 25  PHE C CG    1 
ATOM   1538  C  CD1   . PHE C 3 26  ? -3.821  -1.890  32.253 1.00 56.55  ? 25  PHE C CD1   1 
ATOM   1539  C  CD2   . PHE C 3 26  ? -5.077  -3.821  31.576 1.00 57.88  ? 25  PHE C CD2   1 
ATOM   1540  C  CE1   . PHE C 3 26  ? -3.440  -2.554  33.421 1.00 56.22  ? 25  PHE C CE1   1 
ATOM   1541  C  CE2   . PHE C 3 26  ? -4.709  -4.485  32.744 1.00 55.73  ? 25  PHE C CE2   1 
ATOM   1542  C  CZ    . PHE C 3 26  ? -3.888  -3.848  33.666 1.00 55.07  ? 25  PHE C CZ    1 
ATOM   1543  N  N     . PRO C 3 27  ? -3.745  -2.649  27.159 1.00 60.25  ? 26  PRO C N     1 
ATOM   1544  C  CA    . PRO C 3 27  ? -3.660  -2.840  25.726 1.00 60.04  ? 26  PRO C CA    1 
ATOM   1545  C  C     . PRO C 3 27  ? -4.987  -3.250  25.134 1.00 60.06  ? 26  PRO C C     1 
ATOM   1546  O  O     . PRO C 3 27  ? -5.403  -4.397  25.300 1.00 60.35  ? 26  PRO C O     1 
ATOM   1547  C  CB    . PRO C 3 27  ? -2.641  -3.968  25.605 1.00 59.96  ? 26  PRO C CB    1 
ATOM   1548  C  CG    . PRO C 3 27  ? -2.850  -4.774  26.785 1.00 59.75  ? 26  PRO C CG    1 
ATOM   1549  C  CD    . PRO C 3 27  ? -3.305  -3.858  27.878 1.00 60.70  ? 26  PRO C CD    1 
ATOM   1550  N  N     . VAL C 3 28  ? -5.638  -2.316  24.448 1.00 60.00  ? 27  VAL C N     1 
ATOM   1551  C  CA    . VAL C 3 28  ? -6.946  -2.556  23.834 1.00 60.18  ? 27  VAL C CA    1 
ATOM   1552  C  C     . VAL C 3 28  ? -6.889  -3.608  22.722 1.00 60.60  ? 27  VAL C C     1 
ATOM   1553  O  O     . VAL C 3 28  ? -7.764  -4.474  22.639 1.00 60.65  ? 27  VAL C O     1 
ATOM   1554  C  CB    . VAL C 3 28  ? -7.553  -1.256  23.272 1.00 60.12  ? 27  VAL C CB    1 
ATOM   1555  C  CG1   . VAL C 3 28  ? -8.855  -1.544  22.536 1.00 59.87  ? 27  VAL C CG1   1 
ATOM   1556  C  CG2   . VAL C 3 28  ? -7.770  -0.248  24.385 1.00 58.92  ? 27  VAL C CG2   1 
ATOM   1557  N  N     . GLY C 3 29  ? -5.864  -3.522  21.873 1.00 61.10  ? 28  GLY C N     1 
ATOM   1558  C  CA    . GLY C 3 29  ? -5.664  -4.500  20.812 1.00 61.50  ? 28  GLY C CA    1 
ATOM   1559  C  C     . GLY C 3 29  ? -5.695  -5.891  21.406 1.00 61.86  ? 28  GLY C C     1 
ATOM   1560  O  O     . GLY C 3 29  ? -6.520  -6.722  21.025 1.00 62.24  ? 28  GLY C O     1 
ATOM   1561  N  N     . ARG C 3 30  ? -4.806  -6.118  22.368 1.00 62.24  ? 29  ARG C N     1 
ATOM   1562  C  CA    . ARG C 3 30  ? -4.728  -7.369  23.126 1.00 62.50  ? 29  ARG C CA    1 
ATOM   1563  C  C     . ARG C 3 30  ? -6.090  -7.821  23.646 1.00 62.68  ? 29  ARG C C     1 
ATOM   1564  O  O     . ARG C 3 30  ? -6.503  -8.959  23.410 1.00 62.83  ? 29  ARG C O     1 
ATOM   1565  C  CB    . ARG C 3 30  ? -3.761  -7.205  24.301 1.00 62.32  ? 29  ARG C CB    1 
ATOM   1566  C  CG    . ARG C 3 30  ? -3.521  -8.473  25.091 1.00 62.48  ? 29  ARG C CG    1 
ATOM   1567  C  CD    . ARG C 3 30  ? -2.191  -9.047  24.746 1.00 62.80  ? 29  ARG C CD    1 
ATOM   1568  N  NE    . ARG C 3 30  ? -1.255  -8.835  25.829 1.00 63.49  ? 29  ARG C NE    1 
ATOM   1569  C  CZ    . ARG C 3 30  ? 0.065   -8.834  25.693 1.00 65.74  ? 29  ARG C CZ    1 
ATOM   1570  N  NH1   . ARG C 3 30  ? 0.637   -9.003  24.504 1.00 66.77  ? 29  ARG C NH1   1 
ATOM   1571  N  NH2   . ARG C 3 30  ? 0.820   -8.656  26.763 1.00 67.89  ? 29  ARG C NH2   1 
ATOM   1572  N  N     . VAL C 3 31  ? -6.786  -6.928  24.342 1.00 62.85  ? 30  VAL C N     1 
ATOM   1573  C  CA    . VAL C 3 31  ? -8.071  -7.271  24.932 1.00 63.40  ? 30  VAL C CA    1 
ATOM   1574  C  C     . VAL C 3 31  ? -9.097  -7.683  23.870 1.00 63.95  ? 30  VAL C C     1 
ATOM   1575  O  O     . VAL C 3 31  ? -9.813  -8.668  24.059 1.00 64.43  ? 30  VAL C O     1 
ATOM   1576  C  CB    . VAL C 3 31  ? -8.606  -6.155  25.859 1.00 63.32  ? 30  VAL C CB    1 
ATOM   1577  C  CG1   . VAL C 3 31  ? -9.997  -6.491  26.372 1.00 63.22  ? 30  VAL C CG1   1 
ATOM   1578  C  CG2   . VAL C 3 31  ? -7.665  -5.949  27.029 1.00 62.56  ? 30  VAL C CG2   1 
ATOM   1579  N  N     . HIS C 3 32  ? -9.144  -6.956  22.754 1.00 64.56  ? 31  HIS C N     1 
ATOM   1580  C  CA    . HIS C 3 32  ? -10.019 -7.317  21.629 1.00 64.95  ? 31  HIS C CA    1 
ATOM   1581  C  C     . HIS C 3 32  ? -9.732  -8.731  21.153 1.00 64.70  ? 31  HIS C C     1 
ATOM   1582  O  O     . HIS C 3 32  ? -10.652 -9.513  20.916 1.00 64.81  ? 31  HIS C O     1 
ATOM   1583  C  CB    . HIS C 3 32  ? -9.833  -6.357  20.449 1.00 65.42  ? 31  HIS C CB    1 
ATOM   1584  C  CG    . HIS C 3 32  ? -11.054 -6.208  19.588 1.00 66.62  ? 31  HIS C CG    1 
ATOM   1585  N  ND1   . HIS C 3 32  ? -12.035 -7.176  19.506 1.00 67.99  ? 31  HIS C ND1   1 
ATOM   1586  C  CD2   . HIS C 3 32  ? -11.445 -5.206  18.764 1.00 66.94  ? 31  HIS C CD2   1 
ATOM   1587  C  CE1   . HIS C 3 32  ? -12.987 -6.767  18.684 1.00 68.00  ? 31  HIS C CE1   1 
ATOM   1588  N  NE2   . HIS C 3 32  ? -12.651 -5.577  18.217 1.00 67.79  ? 31  HIS C NE2   1 
ATOM   1589  N  N     . ARG C 3 33  ? -8.445  -9.043  21.025 1.00 64.32  ? 32  ARG C N     1 
ATOM   1590  C  CA    . ARG C 3 33  ? -7.992  -10.341 20.555 1.00 64.40  ? 32  ARG C CA    1 
ATOM   1591  C  C     . ARG C 3 33  ? -8.411  -11.471 21.500 1.00 64.58  ? 32  ARG C C     1 
ATOM   1592  O  O     . ARG C 3 33  ? -8.968  -12.476 21.056 1.00 65.19  ? 32  ARG C O     1 
ATOM   1593  C  CB    . ARG C 3 33  ? -6.478  -10.327 20.371 1.00 64.06  ? 32  ARG C CB    1 
ATOM   1594  C  CG    . ARG C 3 33  ? -5.926  -11.554 19.668 1.00 64.89  ? 32  ARG C CG    1 
ATOM   1595  C  CD    . ARG C 3 33  ? -4.426  -11.658 19.866 1.00 65.43  ? 32  ARG C CD    1 
ATOM   1596  N  NE    . ARG C 3 33  ? -4.148  -12.055 21.236 1.00 67.22  ? 32  ARG C NE    1 
ATOM   1597  C  CZ    . ARG C 3 33  ? -3.076  -11.707 21.940 1.00 67.55  ? 32  ARG C CZ    1 
ATOM   1598  N  NH1   . ARG C 3 33  ? -2.132  -10.949 21.422 1.00 67.45  ? 32  ARG C NH1   1 
ATOM   1599  N  NH2   . ARG C 3 33  ? -2.958  -12.124 23.188 1.00 69.59  ? 32  ARG C NH2   1 
ATOM   1600  N  N     . LEU C 3 34  ? -8.149  -11.296 22.797 1.00 64.31  ? 33  LEU C N     1 
ATOM   1601  C  CA    . LEU C 3 34  ? -8.497  -12.287 23.796 1.00 63.69  ? 33  LEU C CA    1 
ATOM   1602  C  C     . LEU C 3 34  ? -10.000 -12.509 23.876 1.00 64.35  ? 33  LEU C C     1 
ATOM   1603  O  O     . LEU C 3 34  ? -10.431 -13.636 24.119 1.00 64.69  ? 33  LEU C O     1 
ATOM   1604  C  CB    . LEU C 3 34  ? -7.934  -11.899 25.154 1.00 63.06  ? 33  LEU C CB    1 
ATOM   1605  C  CG    . LEU C 3 34  ? -6.414  -11.796 25.274 1.00 62.04  ? 33  LEU C CG    1 
ATOM   1606  C  CD1   . LEU C 3 34  ? -6.043  -11.131 26.580 1.00 61.15  ? 33  LEU C CD1   1 
ATOM   1607  C  CD2   . LEU C 3 34  ? -5.704  -13.134 25.159 1.00 60.10  ? 33  LEU C CD2   1 
ATOM   1608  N  N     . LEU C 3 35  ? -10.794 -11.452 23.665 1.00 64.87  ? 34  LEU C N     1 
ATOM   1609  C  CA    . LEU C 3 35  ? -12.258 -11.592 23.589 1.00 65.56  ? 34  LEU C CA    1 
ATOM   1610  C  C     . LEU C 3 35  ? -12.698 -12.481 22.419 1.00 66.19  ? 34  LEU C C     1 
ATOM   1611  O  O     . LEU C 3 35  ? -13.668 -13.230 22.526 1.00 65.65  ? 34  LEU C O     1 
ATOM   1612  C  CB    . LEU C 3 35  ? -12.950 -10.228 23.488 1.00 65.34  ? 34  LEU C CB    1 
ATOM   1613  C  CG    . LEU C 3 35  ? -13.186 -9.359  24.734 1.00 65.24  ? 34  LEU C CG    1 
ATOM   1614  C  CD1   . LEU C 3 35  ? -13.642 -7.963  24.327 1.00 64.43  ? 34  LEU C CD1   1 
ATOM   1615  C  CD2   . LEU C 3 35  ? -14.204 -9.963  25.688 1.00 63.95  ? 34  LEU C CD2   1 
ATOM   1616  N  N     . ARG C 3 36  ? -11.975 -12.381 21.303 1.00 67.39  ? 35  ARG C N     1 
ATOM   1617  C  CA    . ARG C 3 36  ? -12.243 -13.205 20.128 1.00 68.51  ? 35  ARG C CA    1 
ATOM   1618  C  C     . ARG C 3 36  ? -11.930 -14.672 20.392 1.00 68.49  ? 35  ARG C C     1 
ATOM   1619  O  O     . ARG C 3 36  ? -12.761 -15.535 20.120 1.00 68.71  ? 35  ARG C O     1 
ATOM   1620  C  CB    . ARG C 3 36  ? -11.436 -12.736 18.916 1.00 68.89  ? 35  ARG C CB    1 
ATOM   1621  C  CG    . ARG C 3 36  ? -11.753 -11.346 18.410 1.00 71.12  ? 35  ARG C CG    1 
ATOM   1622  C  CD    . ARG C 3 36  ? -11.190 -11.165 16.997 1.00 74.46  ? 35  ARG C CD    1 
ATOM   1623  N  NE    . ARG C 3 36  ? -10.975 -9.765  16.631 1.00 77.45  ? 35  ARG C NE    1 
ATOM   1624  C  CZ    . ARG C 3 36  ? -11.945 -8.881  16.376 1.00 78.94  ? 35  ARG C CZ    1 
ATOM   1625  N  NH1   . ARG C 3 36  ? -13.233 -9.224  16.468 1.00 77.59  ? 35  ARG C NH1   1 
ATOM   1626  N  NH2   . ARG C 3 36  ? -11.621 -7.634  16.038 1.00 79.77  ? 35  ARG C NH2   1 
ATOM   1627  N  N     . LYS C 3 37  ? -10.737 -14.943 20.918 1.00 68.52  ? 36  LYS C N     1 
ATOM   1628  C  CA    . LYS C 3 37  ? -10.268 -16.315 21.109 1.00 69.12  ? 36  LYS C CA    1 
ATOM   1629  C  C     . LYS C 3 37  ? -11.014 -17.054 22.246 1.00 68.71  ? 36  LYS C C     1 
ATOM   1630  O  O     . LYS C 3 37  ? -11.004 -18.284 22.315 1.00 69.04  ? 36  LYS C O     1 
ATOM   1631  C  CB    . LYS C 3 37  ? -8.740  -16.347 21.316 1.00 69.30  ? 36  LYS C CB    1 
ATOM   1632  C  CG    . LYS C 3 37  ? -8.279  -16.807 22.713 1.00 71.62  ? 36  LYS C CG    1 
ATOM   1633  C  CD    . LYS C 3 37  ? -6.889  -16.274 23.098 1.00 74.42  ? 36  LYS C CD    1 
ATOM   1634  C  CE    . LYS C 3 37  ? -5.783  -16.903 22.265 1.00 76.43  ? 36  LYS C CE    1 
ATOM   1635  N  NZ    . LYS C 3 37  ? -4.677  -15.920 22.020 1.00 77.34  ? 36  LYS C NZ    1 
ATOM   1636  N  N     . GLY C 3 38  ? -11.662 -16.301 23.124 1.00 68.20  ? 37  GLY C N     1 
ATOM   1637  C  CA    . GLY C 3 38  ? -12.374 -16.883 24.247 1.00 67.59  ? 37  GLY C CA    1 
ATOM   1638  C  C     . GLY C 3 38  ? -13.762 -17.363 23.882 1.00 67.47  ? 37  GLY C C     1 
ATOM   1639  O  O     . GLY C 3 38  ? -14.434 -18.000 24.706 1.00 67.62  ? 37  GLY C O     1 
ATOM   1640  N  N     . ASN C 3 39  ? -14.187 -17.075 22.648 1.00 66.93  ? 38  ASN C N     1 
ATOM   1641  C  CA    . ASN C 3 39  ? -15.501 -17.483 22.154 1.00 66.62  ? 38  ASN C CA    1 
ATOM   1642  C  C     . ASN C 3 39  ? -16.593 -17.130 23.135 1.00 66.09  ? 38  ASN C C     1 
ATOM   1643  O  O     . ASN C 3 39  ? -17.320 -18.003 23.616 1.00 66.29  ? 38  ASN C O     1 
ATOM   1644  C  CB    . ASN C 3 39  ? -15.547 -18.984 21.886 1.00 67.13  ? 38  ASN C CB    1 
ATOM   1645  C  CG    . ASN C 3 39  ? -14.770 -19.375 20.663 1.00 68.84  ? 38  ASN C CG    1 
ATOM   1646  O  OD1   . ASN C 3 39  ? -13.814 -20.158 20.747 1.00 71.15  ? 38  ASN C OD1   1 
ATOM   1647  N  ND2   . ASN C 3 39  ? -15.174 -18.838 19.506 1.00 69.96  ? 38  ASN C ND2   1 
ATOM   1648  N  N     . TYR C 3 40  ? -16.698 -15.849 23.447 1.00 65.14  ? 39  TYR C N     1 
ATOM   1649  C  CA    . TYR C 3 40  ? -17.721 -15.394 24.362 1.00 64.27  ? 39  TYR C CA    1 
ATOM   1650  C  C     . TYR C 3 40  ? -19.002 -15.054 23.596 1.00 64.47  ? 39  TYR C C     1 
ATOM   1651  O  O     . TYR C 3 40  ? -20.101 -15.112 24.139 1.00 64.40  ? 39  TYR C O     1 
ATOM   1652  C  CB    . TYR C 3 40  ? -17.188 -14.225 25.180 1.00 63.68  ? 39  TYR C CB    1 
ATOM   1653  C  CG    . TYR C 3 40  ? -15.981 -14.586 26.033 1.00 61.48  ? 39  TYR C CG    1 
ATOM   1654  C  CD1   . TYR C 3 40  ? -14.687 -14.284 25.619 1.00 58.84  ? 39  TYR C CD1   1 
ATOM   1655  C  CD2   . TYR C 3 40  ? -16.140 -15.232 27.256 1.00 59.29  ? 39  TYR C CD2   1 
ATOM   1656  C  CE1   . TYR C 3 40  ? -13.588 -14.610 26.401 1.00 57.79  ? 39  TYR C CE1   1 
ATOM   1657  C  CE2   . TYR C 3 40  ? -15.052 -15.563 28.037 1.00 57.43  ? 39  TYR C CE2   1 
ATOM   1658  C  CZ    . TYR C 3 40  ? -13.780 -15.252 27.606 1.00 58.05  ? 39  TYR C CZ    1 
ATOM   1659  O  OH    . TYR C 3 40  ? -12.696 -15.579 28.393 1.00 58.23  ? 39  TYR C OH    1 
ATOM   1660  N  N     . ALA C 3 41  ? -18.850 -14.723 22.321 1.00 64.79  ? 40  ALA C N     1 
ATOM   1661  C  CA    . ALA C 3 41  ? -19.986 -14.535 21.424 1.00 65.43  ? 40  ALA C CA    1 
ATOM   1662  C  C     . ALA C 3 41  ? -19.509 -14.627 19.986 1.00 65.87  ? 40  ALA C C     1 
ATOM   1663  O  O     . ALA C 3 41  ? -18.310 -14.750 19.723 1.00 65.77  ? 40  ALA C O     1 
ATOM   1664  C  CB    . ALA C 3 41  ? -20.674 -13.194 21.678 1.00 65.07  ? 40  ALA C CB    1 
ATOM   1665  N  N     . GLU C 3 42  ? -20.452 -14.585 19.054 1.00 66.64  ? 41  GLU C N     1 
ATOM   1666  C  CA    . GLU C 3 42  ? -20.111 -14.544 17.634 1.00 67.58  ? 41  GLU C CA    1 
ATOM   1667  C  C     . GLU C 3 42  ? -19.330 -13.270 17.300 1.00 67.30  ? 41  GLU C C     1 
ATOM   1668  O  O     . GLU C 3 42  ? -18.232 -13.331 16.743 1.00 67.15  ? 41  GLU C O     1 
ATOM   1669  C  CB    . GLU C 3 42  ? -21.380 -14.656 16.779 1.00 68.00  ? 41  GLU C CB    1 
ATOM   1670  C  CG    . GLU C 3 42  ? -21.994 -16.049 16.788 1.00 70.75  ? 41  GLU C CG    1 
ATOM   1671  C  CD    . GLU C 3 42  ? -21.226 -17.015 15.903 1.00 74.44  ? 41  GLU C CD    1 
ATOM   1672  O  OE1   . GLU C 3 42  ? -21.276 -16.830 14.664 1.00 75.94  ? 41  GLU C OE1   1 
ATOM   1673  O  OE2   . GLU C 3 42  ? -20.585 -17.953 16.439 1.00 75.41  ? 41  GLU C OE2   1 
ATOM   1674  N  N     . ARG C 3 43  ? -19.890 -12.124 17.679 1.00 67.07  ? 42  ARG C N     1 
ATOM   1675  C  CA    . ARG C 3 43  ? -19.304 -10.841 17.341 1.00 67.10  ? 42  ARG C CA    1 
ATOM   1676  C  C     . ARG C 3 43  ? -18.882 -10.067 18.570 1.00 66.83  ? 42  ARG C C     1 
ATOM   1677  O  O     . ARG C 3 43  ? -19.573 -10.083 19.596 1.00 66.96  ? 42  ARG C O     1 
ATOM   1678  C  CB    . ARG C 3 43  ? -20.305 -9.984  16.568 1.00 67.57  ? 42  ARG C CB    1 
ATOM   1679  C  CG    . ARG C 3 43  ? -20.981 -10.689 15.417 1.00 68.36  ? 42  ARG C CG    1 
ATOM   1680  C  CD    . ARG C 3 43  ? -21.911 -9.754  14.693 1.00 69.29  ? 42  ARG C CD    1 
ATOM   1681  N  NE    . ARG C 3 43  ? -21.902 -10.114 13.285 1.00 70.56  ? 42  ARG C NE    1 
ATOM   1682  C  CZ    . ARG C 3 43  ? -21.989 -9.257  12.280 1.00 71.11  ? 42  ARG C CZ    1 
ATOM   1683  N  NH1   . ARG C 3 43  ? -22.106 -7.949  12.506 1.00 72.49  ? 42  ARG C NH1   1 
ATOM   1684  N  NH2   . ARG C 3 43  ? -21.950 -9.721  11.044 1.00 70.80  ? 42  ARG C NH2   1 
ATOM   1685  N  N     . VAL C 3 44  ? -17.766 -9.355  18.434 1.00 66.10  ? 43  VAL C N     1 
ATOM   1686  C  CA    . VAL C 3 44  ? -17.289 -8.438  19.451 1.00 65.52  ? 43  VAL C CA    1 
ATOM   1687  C  C     . VAL C 3 44  ? -17.322 -6.996  18.953 1.00 65.09  ? 43  VAL C C     1 
ATOM   1688  O  O     . VAL C 3 44  ? -16.604 -6.638  18.029 1.00 65.21  ? 43  VAL C O     1 
ATOM   1689  C  CB    . VAL C 3 44  ? -15.862 -8.785  19.873 1.00 65.60  ? 43  VAL C CB    1 
ATOM   1690  C  CG1   . VAL C 3 44  ? -15.393 -7.855  21.000 1.00 64.90  ? 43  VAL C CG1   1 
ATOM   1691  C  CG2   . VAL C 3 44  ? -15.794 -10.246 20.296 1.00 65.54  ? 43  VAL C CG2   1 
ATOM   1692  N  N     . GLY C 3 45  ? -18.150 -6.172  19.583 1.00 64.45  ? 44  GLY C N     1 
ATOM   1693  C  CA    . GLY C 3 45  ? -18.221 -4.753  19.262 1.00 63.68  ? 44  GLY C CA    1 
ATOM   1694  C  C     . GLY C 3 45  ? -16.939 -4.008  19.578 1.00 63.21  ? 44  GLY C C     1 
ATOM   1695  O  O     . GLY C 3 45  ? -16.179 -4.402  20.463 1.00 63.35  ? 44  GLY C O     1 
ATOM   1696  N  N     . ALA C 3 46  ? -16.720 -2.912  18.860 1.00 62.62  ? 45  ALA C N     1 
ATOM   1697  C  CA    . ALA C 3 46  ? -15.467 -2.163  18.906 1.00 61.81  ? 45  ALA C CA    1 
ATOM   1698  C  C     . ALA C 3 46  ? -15.194 -1.470  20.238 1.00 61.16  ? 45  ALA C C     1 
ATOM   1699  O  O     . ALA C 3 46  ? -14.041 -1.254  20.598 1.00 61.28  ? 45  ALA C O     1 
ATOM   1700  C  CB    . ALA C 3 46  ? -15.432 -1.147  17.773 1.00 62.09  ? 45  ALA C CB    1 
ATOM   1701  N  N     . GLY C 3 47  ? -16.248 -1.103  20.951 1.00 60.12  ? 46  GLY C N     1 
ATOM   1702  C  CA    . GLY C 3 47  ? -16.094 -0.462  22.250 1.00 59.37  ? 46  GLY C CA    1 
ATOM   1703  C  C     . GLY C 3 47  ? -15.965 -1.434  23.417 1.00 58.64  ? 46  GLY C C     1 
ATOM   1704  O  O     . GLY C 3 47  ? -15.524 -1.043  24.506 1.00 58.75  ? 46  GLY C O     1 
ATOM   1705  N  N     . ALA C 3 48  ? -16.343 -2.693  23.194 1.00 57.49  ? 47  ALA C N     1 
ATOM   1706  C  CA    . ALA C 3 48  ? -16.221 -3.724  24.225 1.00 56.41  ? 47  ALA C CA    1 
ATOM   1707  C  C     . ALA C 3 48  ? -14.804 -3.795  24.813 1.00 55.39  ? 47  ALA C C     1 
ATOM   1708  O  O     . ALA C 3 48  ? -14.638 -3.590  26.013 1.00 54.82  ? 47  ALA C O     1 
ATOM   1709  C  CB    . ALA C 3 48  ? -16.681 -5.084  23.707 1.00 56.36  ? 47  ALA C CB    1 
ATOM   1710  N  N     . PRO C 3 49  ? -13.779 -4.020  23.969 1.00 54.80  ? 48  PRO C N     1 
ATOM   1711  C  CA    . PRO C 3 49  ? -12.419 -4.163  24.513 1.00 54.62  ? 48  PRO C CA    1 
ATOM   1712  C  C     . PRO C 3 49  ? -11.872 -2.889  25.128 1.00 54.80  ? 48  PRO C C     1 
ATOM   1713  O  O     . PRO C 3 49  ? -10.953 -2.946  25.954 1.00 55.33  ? 48  PRO C O     1 
ATOM   1714  C  CB    . PRO C 3 49  ? -11.575 -4.526  23.293 1.00 54.70  ? 48  PRO C CB    1 
ATOM   1715  C  CG    . PRO C 3 49  ? -12.362 -4.078  22.111 1.00 54.71  ? 48  PRO C CG    1 
ATOM   1716  C  CD    . PRO C 3 49  ? -13.807 -4.110  22.497 1.00 54.69  ? 48  PRO C CD    1 
ATOM   1717  N  N     . VAL C 3 50  ? -12.426 -1.750  24.716 1.00 54.27  ? 49  VAL C N     1 
ATOM   1718  C  CA    . VAL C 3 50  ? -12.018 -0.452  25.230 1.00 53.36  ? 49  VAL C CA    1 
ATOM   1719  C  C     . VAL C 3 50  ? -12.563 -0.315  26.637 1.00 53.03  ? 49  VAL C C     1 
ATOM   1720  O  O     . VAL C 3 50  ? -11.846 0.088   27.552 1.00 53.37  ? 49  VAL C O     1 
ATOM   1721  C  CB    . VAL C 3 50  ? -12.530 0.717   24.301 1.00 53.58  ? 49  VAL C CB    1 
ATOM   1722  C  CG1   . VAL C 3 50  ? -12.351 2.083   24.942 1.00 52.82  ? 49  VAL C CG1   1 
ATOM   1723  C  CG2   . VAL C 3 50  ? -11.820 0.695   22.948 1.00 52.76  ? 49  VAL C CG2   1 
ATOM   1724  N  N     . TYR C 3 51  ? -13.838 -0.649  26.812 1.00 52.39  ? 50  TYR C N     1 
ATOM   1725  C  CA    . TYR C 3 51  ? -14.479 -0.550  28.124 1.00 51.97  ? 50  TYR C CA    1 
ATOM   1726  C  C     . TYR C 3 51  ? -13.853 -1.542  29.112 1.00 51.89  ? 50  TYR C C     1 
ATOM   1727  O  O     . TYR C 3 51  ? -13.524 -1.178  30.245 1.00 52.30  ? 50  TYR C O     1 
ATOM   1728  C  CB    . TYR C 3 51  ? -15.957 -0.832  27.984 1.00 51.71  ? 50  TYR C CB    1 
ATOM   1729  C  CG    . TYR C 3 51  ? -16.846 -0.373  29.116 1.00 51.47  ? 50  TYR C CG    1 
ATOM   1730  C  CD1   . TYR C 3 51  ? -17.836 0.582   28.893 1.00 51.22  ? 50  TYR C CD1   1 
ATOM   1731  C  CD2   . TYR C 3 51  ? -16.751 -0.935  30.388 1.00 51.44  ? 50  TYR C CD2   1 
ATOM   1732  C  CE1   . TYR C 3 51  ? -18.695 0.985   29.900 1.00 51.43  ? 50  TYR C CE1   1 
ATOM   1733  C  CE2   . TYR C 3 51  ? -17.611 -0.538  31.415 1.00 51.77  ? 50  TYR C CE2   1 
ATOM   1734  C  CZ    . TYR C 3 51  ? -18.583 0.420   31.163 1.00 53.42  ? 50  TYR C CZ    1 
ATOM   1735  O  OH    . TYR C 3 51  ? -19.440 0.823   32.176 1.00 55.14  ? 50  TYR C OH    1 
ATOM   1736  N  N     . LEU C 3 52  ? -13.668 -2.781  28.666 1.00 51.01  ? 51  LEU C N     1 
ATOM   1737  C  CA    . LEU C 3 52  ? -13.076 -3.809  29.489 1.00 50.25  ? 51  LEU C CA    1 
ATOM   1738  C  C     . LEU C 3 52  ? -11.629 -3.474  29.871 1.00 50.32  ? 51  LEU C C     1 
ATOM   1739  O  O     . LEU C 3 52  ? -11.220 -3.696  31.022 1.00 50.19  ? 51  LEU C O     1 
ATOM   1740  C  CB    . LEU C 3 52  ? -13.141 -5.157  28.766 1.00 50.23  ? 51  LEU C CB    1 
ATOM   1741  C  CG    . LEU C 3 52  ? -12.567 -6.397  29.464 1.00 49.42  ? 51  LEU C CG    1 
ATOM   1742  C  CD1   . LEU C 3 52  ? -13.208 -6.655  30.820 1.00 48.02  ? 51  LEU C CD1   1 
ATOM   1743  C  CD2   . LEU C 3 52  ? -12.775 -7.576  28.547 1.00 49.56  ? 51  LEU C CD2   1 
ATOM   1744  N  N     . ALA C 3 53  ? -10.851 -2.948  28.920 1.00 49.60  ? 52  ALA C N     1 
ATOM   1745  C  CA    . ALA C 3 53  ? -9.472  -2.578  29.244 1.00 49.17  ? 52  ALA C CA    1 
ATOM   1746  C  C     . ALA C 3 53  ? -9.466  -1.465  30.287 1.00 48.93  ? 52  ALA C C     1 
ATOM   1747  O  O     . ALA C 3 53  ? -8.590  -1.423  31.164 1.00 49.28  ? 52  ALA C O     1 
ATOM   1748  C  CB    . ALA C 3 53  ? -8.708  -2.157  28.018 1.00 48.98  ? 52  ALA C CB    1 
ATOM   1749  N  N     . ALA C 3 54  ? -10.449 -0.574  30.213 1.00 47.72  ? 53  ALA C N     1 
ATOM   1750  C  CA    . ALA C 3 54  ? -10.513 0.491   31.194 1.00 47.50  ? 53  ALA C CA    1 
ATOM   1751  C  C     . ALA C 3 54  ? -10.868 -0.059  32.590 1.00 47.07  ? 53  ALA C C     1 
ATOM   1752  O  O     . ALA C 3 54  ? -10.294 0.355   33.603 1.00 47.29  ? 53  ALA C O     1 
ATOM   1753  C  CB    . ALA C 3 54  ? -11.496 1.565   30.761 1.00 47.32  ? 53  ALA C CB    1 
ATOM   1754  N  N     . VAL C 3 55  ? -11.814 -0.992  32.635 1.00 46.13  ? 54  VAL C N     1 
ATOM   1755  C  CA    . VAL C 3 55  ? -12.184 -1.620  33.892 1.00 45.07  ? 54  VAL C CA    1 
ATOM   1756  C  C     . VAL C 3 55  ? -10.990 -2.358  34.503 1.00 44.88  ? 54  VAL C C     1 
ATOM   1757  O  O     . VAL C 3 55  ? -10.692 -2.200  35.696 1.00 44.41  ? 54  VAL C O     1 
ATOM   1758  C  CB    . VAL C 3 55  ? -13.398 -2.536  33.719 1.00 44.91  ? 54  VAL C CB    1 
ATOM   1759  C  CG1   . VAL C 3 55  ? -13.634 -3.369  34.987 1.00 44.16  ? 54  VAL C CG1   1 
ATOM   1760  C  CG2   . VAL C 3 55  ? -14.608 -1.706  33.394 1.00 42.52  ? 54  VAL C CG2   1 
ATOM   1761  N  N     . LEU C 3 56  ? -10.299 -3.134  33.672 1.00 44.73  ? 55  LEU C N     1 
ATOM   1762  C  CA    . LEU C 3 56  ? -9.146  -3.879  34.135 1.00 45.14  ? 55  LEU C CA    1 
ATOM   1763  C  C     . LEU C 3 56  ? -8.107  -2.947  34.694 1.00 45.27  ? 55  LEU C C     1 
ATOM   1764  O  O     . LEU C 3 56  ? -7.551  -3.215  35.744 1.00 45.59  ? 55  LEU C O     1 
ATOM   1765  C  CB    . LEU C 3 56  ? -8.564  -4.747  33.029 1.00 45.12  ? 55  LEU C CB    1 
ATOM   1766  C  CG    . LEU C 3 56  ? -9.507  -5.879  32.588 1.00 46.13  ? 55  LEU C CG    1 
ATOM   1767  C  CD1   . LEU C 3 56  ? -8.950  -6.610  31.363 1.00 48.70  ? 55  LEU C CD1   1 
ATOM   1768  C  CD2   . LEU C 3 56  ? -9.803  -6.860  33.694 1.00 44.91  ? 55  LEU C CD2   1 
ATOM   1769  N  N     . GLU C 3 57  ? -7.894  -1.825  34.018 1.00 45.69  ? 56  GLU C N     1 
ATOM   1770  C  CA    . GLU C 3 57  ? -6.872  -0.871  34.415 1.00 45.84  ? 56  GLU C CA    1 
ATOM   1771  C  C     . GLU C 3 57  ? -7.269  -0.171  35.708 1.00 45.16  ? 56  GLU C C     1 
ATOM   1772  O  O     . GLU C 3 57  ? -6.445  0.039   36.600 1.00 44.75  ? 56  GLU C O     1 
ATOM   1773  C  CB    . GLU C 3 57  ? -6.667  0.136   33.295 1.00 46.26  ? 56  GLU C CB    1 
ATOM   1774  C  CG    . GLU C 3 57  ? -5.492  1.088   33.462 1.00 48.32  ? 56  GLU C CG    1 
ATOM   1775  C  CD    . GLU C 3 57  ? -5.501  2.185   32.398 1.00 53.11  ? 56  GLU C CD    1 
ATOM   1776  O  OE1   . GLU C 3 57  ? -5.509  1.863   31.181 1.00 52.56  ? 56  GLU C OE1   1 
ATOM   1777  O  OE2   . GLU C 3 57  ? -5.514  3.373   32.782 1.00 56.71  ? 56  GLU C OE2   1 
ATOM   1778  N  N     . TYR C 3 58  ? -8.540  0.177   35.805 1.00 45.02  ? 57  TYR C N     1 
ATOM   1779  C  CA    . TYR C 3 58  ? -9.061  0.799   37.011 1.00 45.75  ? 57  TYR C CA    1 
ATOM   1780  C  C     . TYR C 3 58  ? -8.796  -0.101  38.227 1.00 46.05  ? 57  TYR C C     1 
ATOM   1781  O  O     . TYR C 3 58  ? -8.165  0.331   39.208 1.00 46.53  ? 57  TYR C O     1 
ATOM   1782  C  CB    . TYR C 3 58  ? -10.565 1.101   36.871 1.00 45.54  ? 57  TYR C CB    1 
ATOM   1783  C  CG    . TYR C 3 58  ? -11.229 1.366   38.205 1.00 47.75  ? 57  TYR C CG    1 
ATOM   1784  C  CD1   . TYR C 3 58  ? -10.947 2.522   38.941 1.00 50.16  ? 57  TYR C CD1   1 
ATOM   1785  C  CD2   . TYR C 3 58  ? -12.123 0.440   38.754 1.00 50.52  ? 57  TYR C CD2   1 
ATOM   1786  C  CE1   . TYR C 3 58  ? -11.551 2.749   40.187 1.00 51.25  ? 57  TYR C CE1   1 
ATOM   1787  C  CE2   . TYR C 3 58  ? -12.735 0.652   39.994 1.00 49.38  ? 57  TYR C CE2   1 
ATOM   1788  C  CZ    . TYR C 3 58  ? -12.439 1.797   40.710 1.00 51.93  ? 57  TYR C CZ    1 
ATOM   1789  O  OH    . TYR C 3 58  ? -13.046 2.006   41.942 1.00 53.51  ? 57  TYR C OH    1 
ATOM   1790  N  N     . LEU C 3 59  ? -9.251  -1.357  38.131 1.00 45.67  ? 58  LEU C N     1 
ATOM   1791  C  CA    . LEU C 3 59  ? -9.077  -2.344  39.187 1.00 45.09  ? 58  LEU C CA    1 
ATOM   1792  C  C     . LEU C 3 59  ? -7.639  -2.541  39.584 1.00 44.90  ? 58  LEU C C     1 
ATOM   1793  O  O     . LEU C 3 59  ? -7.336  -2.606  40.785 1.00 45.49  ? 58  LEU C O     1 
ATOM   1794  C  CB    . LEU C 3 59  ? -9.697  -3.686  38.795 1.00 45.00  ? 58  LEU C CB    1 
ATOM   1795  C  CG    . LEU C 3 59  ? -11.223 -3.624  38.774 1.00 44.69  ? 58  LEU C CG    1 
ATOM   1796  C  CD1   . LEU C 3 59  ? -11.868 -4.961  38.350 1.00 43.68  ? 58  LEU C CD1   1 
ATOM   1797  C  CD2   . LEU C 3 59  ? -11.747 -3.158  40.122 1.00 43.47  ? 58  LEU C CD2   1 
ATOM   1798  N  N     . THR C 3 60  ? -6.738  -2.635  38.613 1.00 44.17  ? 59  THR C N     1 
ATOM   1799  C  CA    . THR C 3 60  ? -5.360  -2.880  39.007 1.00 44.14  ? 59  THR C CA    1 
ATOM   1800  C  C     . THR C 3 60  ? -4.728  -1.642  39.652 1.00 44.26  ? 59  THR C C     1 
ATOM   1801  O  O     . THR C 3 60  ? -3.818  -1.778  40.478 1.00 44.68  ? 59  THR C O     1 
ATOM   1802  C  CB    . THR C 3 60  ? -4.460  -3.494  37.898 1.00 44.05  ? 59  THR C CB    1 
ATOM   1803  O  OG1   . THR C 3 60  ? -3.464  -2.548  37.473 1.00 44.41  ? 59  THR C OG1   1 
ATOM   1804  C  CG2   . THR C 3 60  ? -5.277  -4.005  36.739 1.00 42.74  ? 59  THR C CG2   1 
ATOM   1805  N  N     . ALA C 3 61  ? -5.224  -0.453  39.303 1.00 43.58  ? 60  ALA C N     1 
ATOM   1806  C  CA    . ALA C 3 61  ? -4.734  0.780   39.925 1.00 43.56  ? 60  ALA C CA    1 
ATOM   1807  C  C     . ALA C 3 61  ? -5.149  0.841   41.389 1.00 43.64  ? 60  ALA C C     1 
ATOM   1808  O  O     . ALA C 3 61  ? -4.366  1.224   42.270 1.00 42.76  ? 60  ALA C O     1 
ATOM   1809  C  CB    . ALA C 3 61  ? -5.252  1.993   39.187 1.00 43.75  ? 60  ALA C CB    1 
ATOM   1810  N  N     . GLU C 3 62  ? -6.393  0.438   41.635 1.00 43.71  ? 61  GLU C N     1 
ATOM   1811  C  CA    . GLU C 3 62  ? -6.949  0.411   42.973 1.00 44.15  ? 61  GLU C CA    1 
ATOM   1812  C  C     . GLU C 3 62  ? -6.205  -0.596  43.880 1.00 43.77  ? 61  GLU C C     1 
ATOM   1813  O  O     . GLU C 3 62  ? -5.961  -0.341  45.066 1.00 43.17  ? 61  GLU C O     1 
ATOM   1814  C  CB    . GLU C 3 62  ? -8.427  0.087   42.871 1.00 44.38  ? 61  GLU C CB    1 
ATOM   1815  C  CG    . GLU C 3 62  ? -9.176  0.213   44.156 1.00 48.70  ? 61  GLU C CG    1 
ATOM   1816  C  CD    . GLU C 3 62  ? -9.496  1.665   44.563 1.00 55.79  ? 61  GLU C CD    1 
ATOM   1817  O  OE1   . GLU C 3 62  ? -9.609  2.586   43.690 1.00 54.00  ? 61  GLU C OE1   1 
ATOM   1818  O  OE2   . GLU C 3 62  ? -9.670  1.857   45.801 1.00 59.99  ? 61  GLU C OE2   1 
ATOM   1819  N  N     . ILE C 3 63  ? -5.813  -1.729  43.328 1.00 43.29  ? 62  ILE C N     1 
ATOM   1820  C  CA    . ILE C 3 63  ? -5.125  -2.684  44.167 1.00 43.76  ? 62  ILE C CA    1 
ATOM   1821  C  C     . ILE C 3 63  ? -3.678  -2.253  44.384 1.00 43.06  ? 62  ILE C C     1 
ATOM   1822  O  O     . ILE C 3 63  ? -3.162  -2.313  45.508 1.00 43.51  ? 62  ILE C O     1 
ATOM   1823  C  CB    . ILE C 3 63  ? -5.281  -4.135  43.655 1.00 43.73  ? 62  ILE C CB    1 
ATOM   1824  C  CG1   . ILE C 3 63  ? -4.454  -5.093  44.489 1.00 44.76  ? 62  ILE C CG1   1 
ATOM   1825  C  CG2   . ILE C 3 63  ? -4.841  -4.247  42.208 1.00 45.78  ? 62  ILE C CG2   1 
ATOM   1826  C  CD1   . ILE C 3 63  ? -4.916  -6.548  44.328 1.00 50.99  ? 62  ILE C CD1   1 
ATOM   1827  N  N     . LEU C 3 64  ? -3.049  -1.773  43.323 1.00 42.66  ? 63  LEU C N     1 
ATOM   1828  C  CA    . LEU C 3 64  ? -1.682  -1.267  43.400 1.00 42.87  ? 63  LEU C CA    1 
ATOM   1829  C  C     . LEU C 3 64  ? -1.490  -0.087  44.363 1.00 42.90  ? 63  LEU C C     1 
ATOM   1830  O  O     . LEU C 3 64  ? -0.450  0.045   44.994 1.00 42.26  ? 63  LEU C O     1 
ATOM   1831  C  CB    . LEU C 3 64  ? -1.169  -0.946  41.999 1.00 42.85  ? 63  LEU C CB    1 
ATOM   1832  C  CG    . LEU C 3 64  ? -0.840  -2.247  41.239 1.00 43.63  ? 63  LEU C CG    1 
ATOM   1833  C  CD1   . LEU C 3 64  ? -0.274  -1.939  39.896 1.00 43.09  ? 63  LEU C CD1   1 
ATOM   1834  C  CD2   . LEU C 3 64  ? 0.120   -3.169  42.048 1.00 42.59  ? 63  LEU C CD2   1 
ATOM   1835  N  N     . GLU C 3 65  ? -2.519  0.740   44.489 1.00 43.77  ? 64  GLU C N     1 
ATOM   1836  C  CA    . GLU C 3 65  ? -2.490  1.889   45.361 1.00 45.00  ? 64  GLU C CA    1 
ATOM   1837  C  C     . GLU C 3 65  ? -2.381  1.432   46.791 1.00 45.54  ? 64  GLU C C     1 
ATOM   1838  O  O     . GLU C 3 65  ? -1.445  1.800   47.514 1.00 45.69  ? 64  GLU C O     1 
ATOM   1839  C  CB    . GLU C 3 65  ? -3.752  2.730   45.166 1.00 45.27  ? 64  GLU C CB    1 
ATOM   1840  C  CG    . GLU C 3 65  ? -3.957  3.849   46.208 1.00 47.22  ? 64  GLU C CG    1 
ATOM   1841  C  CD    . GLU C 3 65  ? -2.975  5.026   46.097 1.00 49.44  ? 64  GLU C CD    1 
ATOM   1842  O  OE1   . GLU C 3 65  ? -3.057  5.937   46.940 1.00 53.96  ? 64  GLU C OE1   1 
ATOM   1843  O  OE2   . GLU C 3 65  ? -2.127  5.066   45.196 1.00 49.34  ? 64  GLU C OE2   1 
ATOM   1844  N  N     . LEU C 3 66  ? -3.345  0.600   47.180 1.00 46.33  ? 65  LEU C N     1 
ATOM   1845  C  CA    . LEU C 3 66  ? -3.452  0.075   48.536 1.00 45.84  ? 65  LEU C CA    1 
ATOM   1846  C  C     . LEU C 3 66  ? -2.288  -0.848  48.867 1.00 46.31  ? 65  LEU C C     1 
ATOM   1847  O  O     . LEU C 3 66  ? -1.833  -0.889  50.013 1.00 46.86  ? 65  LEU C O     1 
ATOM   1848  C  CB    . LEU C 3 66  ? -4.746  -0.698  48.685 1.00 45.25  ? 65  LEU C CB    1 
ATOM   1849  C  CG    . LEU C 3 66  ? -6.060  0.057   48.614 1.00 44.87  ? 65  LEU C CG    1 
ATOM   1850  C  CD1   . LEU C 3 66  ? -7.215  -0.959  48.501 1.00 43.33  ? 65  LEU C CD1   1 
ATOM   1851  C  CD2   . LEU C 3 66  ? -6.240  0.979   49.828 1.00 42.25  ? 65  LEU C CD2   1 
ATOM   1852  N  N     . ALA C 3 67  ? -1.823  -1.600  47.873 1.00 46.37  ? 66  ALA C N     1 
ATOM   1853  C  CA    . ALA C 3 67  ? -0.693  -2.515  48.068 1.00 46.44  ? 66  ALA C CA    1 
ATOM   1854  C  C     . ALA C 3 67  ? 0.583   -1.722  48.339 1.00 46.72  ? 66  ALA C C     1 
ATOM   1855  O  O     . ALA C 3 67  ? 1.337   -2.043  49.253 1.00 46.52  ? 66  ALA C O     1 
ATOM   1856  C  CB    . ALA C 3 67  ? -0.529  -3.426  46.846 1.00 45.82  ? 66  ALA C CB    1 
ATOM   1857  N  N     . GLY C 3 68  ? 0.796   -0.666  47.551 1.00 47.24  ? 67  GLY C N     1 
ATOM   1858  C  CA    . GLY C 3 68  ? 1.947   0.214   47.714 1.00 47.88  ? 67  GLY C CA    1 
ATOM   1859  C  C     . GLY C 3 68  ? 1.934   0.867   49.078 1.00 48.32  ? 67  GLY C C     1 
ATOM   1860  O  O     . GLY C 3 68  ? 2.979   1.108   49.688 1.00 48.19  ? 67  GLY C O     1 
ATOM   1861  N  N     . ASN C 3 69  ? 0.736   1.158   49.560 1.00 48.81  ? 68  ASN C N     1 
ATOM   1862  C  CA    . ASN C 3 69  ? 0.599   1.701   50.883 1.00 49.49  ? 68  ASN C CA    1 
ATOM   1863  C  C     . ASN C 3 69  ? 0.977   0.683   51.930 1.00 50.00  ? 68  ASN C C     1 
ATOM   1864  O  O     . ASN C 3 69  ? 1.579   1.026   52.946 1.00 50.29  ? 68  ASN C O     1 
ATOM   1865  C  CB    . ASN C 3 69  ? -0.808  2.217   51.103 1.00 49.53  ? 68  ASN C CB    1 
ATOM   1866  C  CG    . ASN C 3 69  ? -1.071  3.472   50.331 1.00 51.21  ? 68  ASN C CG    1 
ATOM   1867  O  OD1   . ASN C 3 69  ? -0.138  4.095   49.799 1.00 54.56  ? 68  ASN C OD1   1 
ATOM   1868  N  ND2   . ASN C 3 69  ? -2.335  3.867   50.256 1.00 51.09  ? 68  ASN C ND2   1 
ATOM   1869  N  N     . ALA C 3 70  ? 0.657   -0.580  51.677 1.00 50.72  ? 69  ALA C N     1 
ATOM   1870  C  CA    . ALA C 3 70  ? 0.984   -1.615  52.646 1.00 51.75  ? 69  ALA C CA    1 
ATOM   1871  C  C     . ALA C 3 70  ? 2.493   -1.836  52.674 1.00 52.69  ? 69  ALA C C     1 
ATOM   1872  O  O     . ALA C 3 70  ? 3.092   -1.916  53.747 1.00 52.67  ? 69  ALA C O     1 
ATOM   1873  C  CB    . ALA C 3 70  ? 0.261   -2.868  52.354 1.00 51.43  ? 69  ALA C CB    1 
ATOM   1874  N  N     . ALA C 3 71  ? 3.102   -1.881  51.491 1.00 53.80  ? 70  ALA C N     1 
ATOM   1875  C  CA    . ALA C 3 71  ? 4.555   -1.843  51.365 1.00 54.98  ? 70  ALA C CA    1 
ATOM   1876  C  C     . ALA C 3 71  ? 5.129   -0.737  52.243 1.00 55.91  ? 70  ALA C C     1 
ATOM   1877  O  O     . ALA C 3 71  ? 6.033   -0.971  53.048 1.00 56.06  ? 70  ALA C O     1 
ATOM   1878  C  CB    . ALA C 3 71  ? 4.951   -1.617  49.918 1.00 54.55  ? 70  ALA C CB    1 
ATOM   1879  N  N     . ARG C 3 72  ? 4.579   0.464   52.102 1.00 57.11  ? 71  ARG C N     1 
ATOM   1880  C  CA    . ARG C 3 72  ? 5.120   1.612   52.796 1.00 58.64  ? 71  ARG C CA    1 
ATOM   1881  C  C     . ARG C 3 72  ? 4.976   1.462   54.295 1.00 59.05  ? 71  ARG C C     1 
ATOM   1882  O  O     . ARG C 3 72  ? 5.929   1.719   55.012 1.00 59.34  ? 71  ARG C O     1 
ATOM   1883  C  CB    . ARG C 3 72  ? 4.475   2.908   52.323 1.00 58.93  ? 71  ARG C CB    1 
ATOM   1884  C  CG    . ARG C 3 72  ? 5.293   4.161   52.661 1.00 60.87  ? 71  ARG C CG    1 
ATOM   1885  C  CD    . ARG C 3 72  ? 4.443   5.225   53.374 1.00 64.58  ? 71  ARG C CD    1 
ATOM   1886  N  NE    . ARG C 3 72  ? 3.014   5.126   53.042 1.00 69.08  ? 71  ARG C NE    1 
ATOM   1887  C  CZ    . ARG C 3 72  ? 2.029   4.918   53.923 1.00 71.63  ? 71  ARG C CZ    1 
ATOM   1888  N  NH1   . ARG C 3 72  ? 2.288   4.806   55.233 1.00 71.65  ? 71  ARG C NH1   1 
ATOM   1889  N  NH2   . ARG C 3 72  ? 0.771   4.841   53.491 1.00 71.89  ? 71  ARG C NH2   1 
ATOM   1890  N  N     . ASP C 3 73  ? 3.804   1.030   54.764 1.00 59.93  ? 72  ASP C N     1 
ATOM   1891  C  CA    . ASP C 3 73  ? 3.581   0.799   56.196 1.00 60.79  ? 72  ASP C CA    1 
ATOM   1892  C  C     . ASP C 3 73  ? 4.541   -0.254  56.770 1.00 61.66  ? 72  ASP C C     1 
ATOM   1893  O  O     . ASP C 3 73  ? 4.698   -0.350  57.989 1.00 62.02  ? 72  ASP C O     1 
ATOM   1894  C  CB    . ASP C 3 73  ? 2.150   0.333   56.478 1.00 60.73  ? 72  ASP C CB    1 
ATOM   1895  C  CG    . ASP C 3 73  ? 1.095   1.354   56.102 1.00 61.31  ? 72  ASP C CG    1 
ATOM   1896  O  OD1   . ASP C 3 73  ? 1.303   2.581   56.266 1.00 60.65  ? 72  ASP C OD1   1 
ATOM   1897  O  OD2   . ASP C 3 73  ? 0.016   0.907   55.658 1.00 62.31  ? 72  ASP C OD2   1 
ATOM   1898  N  N     . ASN C 3 74  ? 5.161   -1.052  55.899 1.00 62.29  ? 73  ASN C N     1 
ATOM   1899  C  CA    . ASN C 3 74  ? 6.128   -2.062  56.329 1.00 63.07  ? 73  ASN C CA    1 
ATOM   1900  C  C     . ASN C 3 74  ? 7.575   -1.699  55.956 1.00 62.92  ? 73  ASN C C     1 
ATOM   1901  O  O     . ASN C 3 74  ? 8.458   -2.560  55.956 1.00 63.16  ? 73  ASN C O     1 
ATOM   1902  C  CB    . ASN C 3 74  ? 5.742   -3.447  55.786 1.00 63.78  ? 73  ASN C CB    1 
ATOM   1903  C  CG    . ASN C 3 74  ? 4.399   -3.950  56.344 1.00 66.48  ? 73  ASN C CG    1 
ATOM   1904  O  OD1   . ASN C 3 74  ? 4.346   -4.539  57.430 1.00 69.82  ? 73  ASN C OD1   1 
ATOM   1905  N  ND2   . ASN C 3 74  ? 3.312   -3.714  55.602 1.00 67.62  ? 73  ASN C ND2   1 
ATOM   1906  N  N     . LYS C 3 75  ? 7.810   -0.418  55.661 1.00 62.46  ? 74  LYS C N     1 
ATOM   1907  C  CA    . LYS C 3 75  ? 9.137   0.100   55.295 1.00 61.94  ? 74  LYS C CA    1 
ATOM   1908  C  C     . LYS C 3 75  ? 9.784   -0.594  54.087 1.00 60.85  ? 74  LYS C C     1 
ATOM   1909  O  O     . LYS C 3 75  ? 10.983  -0.893  54.107 1.00 61.13  ? 74  LYS C O     1 
ATOM   1910  C  CB    . LYS C 3 75  ? 10.082  0.072   56.505 1.00 62.60  ? 74  LYS C CB    1 
ATOM   1911  C  CG    . LYS C 3 75  ? 9.988   1.299   57.436 1.00 65.15  ? 74  LYS C CG    1 
ATOM   1912  C  CD    . LYS C 3 75  ? 8.983   1.103   58.579 1.00 68.65  ? 74  LYS C CD    1 
ATOM   1913  C  CE    . LYS C 3 75  ? 8.390   2.455   59.026 1.00 70.95  ? 74  LYS C CE    1 
ATOM   1914  N  NZ    . LYS C 3 75  ? 7.076   2.310   59.751 1.00 70.90  ? 74  LYS C NZ    1 
ATOM   1915  N  N     . LYS C 3 76  ? 8.997   -0.840  53.039 1.00 59.32  ? 75  LYS C N     1 
ATOM   1916  C  CA    . LYS C 3 76  ? 9.491   -1.542  51.849 1.00 58.19  ? 75  LYS C CA    1 
ATOM   1917  C  C     . LYS C 3 76  ? 9.237   -0.752  50.578 1.00 57.32  ? 75  LYS C C     1 
ATOM   1918  O  O     . LYS C 3 76  ? 8.313   0.061   50.510 1.00 57.49  ? 75  LYS C O     1 
ATOM   1919  C  CB    . LYS C 3 76  ? 8.840   -2.924  51.713 1.00 58.25  ? 75  LYS C CB    1 
ATOM   1920  C  CG    . LYS C 3 76  ? 9.023   -3.838  52.891 1.00 57.78  ? 75  LYS C CG    1 
ATOM   1921  C  CD    . LYS C 3 76  ? 10.405  -4.463  52.911 1.00 59.00  ? 75  LYS C CD    1 
ATOM   1922  C  CE    . LYS C 3 76  ? 10.522  -5.505  54.029 1.00 59.82  ? 75  LYS C CE    1 
ATOM   1923  N  NZ    . LYS C 3 76  ? 10.288  -4.936  55.392 1.00 59.13  ? 75  LYS C NZ    1 
ATOM   1924  N  N     . THR C 3 77  ? 10.052  -1.026  49.573 1.00 56.04  ? 76  THR C N     1 
ATOM   1925  C  CA    . THR C 3 77  ? 10.033  -0.320  48.310 1.00 55.23  ? 76  THR C CA    1 
ATOM   1926  C  C     . THR C 3 77  ? 9.379   -1.217  47.276 1.00 54.71  ? 76  THR C C     1 
ATOM   1927  O  O     . THR C 3 77  ? 8.797   -0.757  46.282 1.00 54.45  ? 76  THR C O     1 
ATOM   1928  C  CB    . THR C 3 77  ? 11.480  -0.022  47.903 1.00 55.43  ? 76  THR C CB    1 
ATOM   1929  O  OG1   . THR C 3 77  ? 11.970  1.022   48.755 1.00 55.88  ? 76  THR C OG1   1 
ATOM   1930  C  CG2   . THR C 3 77  ? 11.607  0.376   46.411 1.00 54.96  ? 76  THR C CG2   1 
ATOM   1931  N  N     . ARG C 3 78  ? 9.485   -2.513  47.532 1.00 53.85  ? 77  ARG C N     1 
ATOM   1932  C  CA    . ARG C 3 78  ? 9.005   -3.520  46.617 1.00 52.78  ? 77  ARG C CA    1 
ATOM   1933  C  C     . ARG C 3 78  ? 7.769   -4.204  47.180 1.00 51.07  ? 77  ARG C C     1 
ATOM   1934  O  O     . ARG C 3 78  ? 7.833   -4.806  48.248 1.00 51.36  ? 77  ARG C O     1 
ATOM   1935  C  CB    . ARG C 3 78  ? 10.110  -4.535  46.405 1.00 53.34  ? 77  ARG C CB    1 
ATOM   1936  C  CG    . ARG C 3 78  ? 9.871   -5.471  45.255 1.00 55.84  ? 77  ARG C CG    1 
ATOM   1937  C  CD    . ARG C 3 78  ? 11.054  -6.362  45.133 1.00 59.24  ? 77  ARG C CD    1 
ATOM   1938  N  NE    . ARG C 3 78  ? 12.196  -5.618  44.620 1.00 63.15  ? 77  ARG C NE    1 
ATOM   1939  C  CZ    . ARG C 3 78  ? 13.451  -5.795  45.027 1.00 65.27  ? 77  ARG C CZ    1 
ATOM   1940  N  NH1   . ARG C 3 78  ? 13.720  -6.676  45.989 1.00 65.12  ? 77  ARG C NH1   1 
ATOM   1941  N  NH2   . ARG C 3 78  ? 14.433  -5.076  44.480 1.00 65.02  ? 77  ARG C NH2   1 
ATOM   1942  N  N     . ILE C 3 79  ? 6.649   -4.076  46.475 1.00 49.06  ? 78  ILE C N     1 
ATOM   1943  C  CA    . ILE C 3 79  ? 5.418   -4.807  46.791 1.00 47.13  ? 78  ILE C CA    1 
ATOM   1944  C  C     . ILE C 3 79  ? 5.658   -6.315  46.664 1.00 46.32  ? 78  ILE C C     1 
ATOM   1945  O  O     . ILE C 3 79  ? 6.129   -6.792  45.605 1.00 46.95  ? 78  ILE C O     1 
ATOM   1946  C  CB    . ILE C 3 79  ? 4.270   -4.416  45.828 1.00 46.74  ? 78  ILE C CB    1 
ATOM   1947  C  CG1   . ILE C 3 79  ? 3.711   -3.029  46.174 1.00 45.55  ? 78  ILE C CG1   1 
ATOM   1948  C  CG2   . ILE C 3 79  ? 3.169   -5.446  45.867 1.00 46.53  ? 78  ILE C CG2   1 
ATOM   1949  C  CD1   . ILE C 3 79  ? 2.852   -2.421  45.104 1.00 40.69  ? 78  ILE C CD1   1 
ATOM   1950  N  N     . ILE C 3 80  ? 5.360   -7.059  47.728 1.00 44.18  ? 79  ILE C N     1 
ATOM   1951  C  CA    . ILE C 3 80  ? 5.361   -8.521  47.647 1.00 42.90  ? 79  ILE C CA    1 
ATOM   1952  C  C     . ILE C 3 80  ? 3.932   -9.076  47.821 1.00 42.89  ? 79  ILE C C     1 
ATOM   1953  O  O     . ILE C 3 80  ? 2.991   -8.302  48.079 1.00 43.49  ? 79  ILE C O     1 
ATOM   1954  C  CB    . ILE C 3 80  ? 6.368   -9.165  48.647 1.00 42.45  ? 79  ILE C CB    1 
ATOM   1955  C  CG1   . ILE C 3 80  ? 5.919   -8.952  50.109 1.00 39.91  ? 79  ILE C CG1   1 
ATOM   1956  C  CG2   . ILE C 3 80  ? 7.780   -8.663  48.350 1.00 41.59  ? 79  ILE C CG2   1 
ATOM   1957  C  CD1   . ILE C 3 80  ? 6.822   -9.566  51.141 1.00 32.52  ? 79  ILE C CD1   1 
ATOM   1958  N  N     . PRO C 3 81  ? 3.749   -10.406 47.677 1.00 41.99  ? 80  PRO C N     1 
ATOM   1959  C  CA    . PRO C 3 81  ? 2.391   -10.933 47.849 1.00 41.38  ? 80  PRO C CA    1 
ATOM   1960  C  C     . PRO C 3 81  ? 1.720   -10.595 49.164 1.00 40.68  ? 80  PRO C C     1 
ATOM   1961  O  O     . PRO C 3 81  ? 0.526   -10.349 49.144 1.00 41.29  ? 80  PRO C O     1 
ATOM   1962  C  CB    . PRO C 3 81  ? 2.579   -12.442 47.684 1.00 41.03  ? 80  PRO C CB    1 
ATOM   1963  C  CG    . PRO C 3 81  ? 3.668   -12.519 46.680 1.00 40.95  ? 80  PRO C CG    1 
ATOM   1964  C  CD    . PRO C 3 81  ? 4.632   -11.413 47.064 1.00 41.70  ? 80  PRO C CD    1 
ATOM   1965  N  N     . ARG C 3 82  ? 2.454   -10.545 50.277 1.00 40.17  ? 81  ARG C N     1 
ATOM   1966  C  CA    . ARG C 3 82  ? 1.838   -10.174 51.579 1.00 40.10  ? 81  ARG C CA    1 
ATOM   1967  C  C     . ARG C 3 82  ? 1.181   -8.809  51.509 1.00 40.00  ? 81  ARG C C     1 
ATOM   1968  O  O     . ARG C 3 82  ? 0.140   -8.585  52.136 1.00 39.67  ? 81  ARG C O     1 
ATOM   1969  C  CB    . ARG C 3 82  ? 2.838   -10.210 52.746 1.00 39.77  ? 81  ARG C CB    1 
ATOM   1970  C  CG    . ARG C 3 82  ? 2.490   -9.249  53.876 1.00 41.08  ? 81  ARG C CG    1 
ATOM   1971  C  CD    . ARG C 3 82  ? 2.124   -9.831  55.266 1.00 42.64  ? 81  ARG C CD    1 
ATOM   1972  N  NE    . ARG C 3 82  ? 0.973   -10.727 55.258 1.00 44.88  ? 81  ARG C NE    1 
ATOM   1973  C  CZ    . ARG C 3 82  ? 0.270   -11.119 56.335 1.00 45.15  ? 81  ARG C CZ    1 
ATOM   1974  N  NH1   . ARG C 3 82  ? 0.529   -10.697 57.578 1.00 40.41  ? 81  ARG C NH1   1 
ATOM   1975  N  NH2   . ARG C 3 82  ? -0.735  -11.956 56.148 1.00 45.63  ? 81  ARG C NH2   1 
ATOM   1976  N  N     . HIS C 3 83  ? 1.791   -7.900  50.738 1.00 40.35  ? 82  HIS C N     1 
ATOM   1977  C  CA    . HIS C 3 83  ? 1.273   -6.533  50.587 1.00 39.94  ? 82  HIS C CA    1 
ATOM   1978  C  C     . HIS C 3 83  ? -0.001  -6.550  49.807 1.00 40.20  ? 82  HIS C C     1 
ATOM   1979  O  O     . HIS C 3 83  ? -0.932  -5.825  50.169 1.00 40.56  ? 82  HIS C O     1 
ATOM   1980  C  CB    . HIS C 3 83  ? 2.277   -5.582  49.959 1.00 39.40  ? 82  HIS C CB    1 
ATOM   1981  C  CG    . HIS C 3 83  ? 3.550   -5.479  50.729 1.00 38.26  ? 82  HIS C CG    1 
ATOM   1982  N  ND1   . HIS C 3 83  ? 4.780   -5.370  50.122 1.00 37.88  ? 82  HIS C ND1   1 
ATOM   1983  C  CD2   . HIS C 3 83  ? 3.790   -5.524  52.059 1.00 37.94  ? 82  HIS C CD2   1 
ATOM   1984  C  CE1   . HIS C 3 83  ? 5.721   -5.340  51.045 1.00 37.85  ? 82  HIS C CE1   1 
ATOM   1985  N  NE2   . HIS C 3 83  ? 5.147   -5.423  52.231 1.00 37.64  ? 82  HIS C NE2   1 
ATOM   1986  N  N     . LEU C 3 84  ? -0.061  -7.400  48.777 1.00 40.14  ? 83  LEU C N     1 
ATOM   1987  C  CA    . LEU C 3 84  ? -1.291  -7.559  47.976 1.00 40.29  ? 83  LEU C CA    1 
ATOM   1988  C  C     . LEU C 3 84  ? -2.395  -8.170  48.832 1.00 40.47  ? 83  LEU C C     1 
ATOM   1989  O  O     . LEU C 3 84  ? -3.576  -7.802  48.742 1.00 40.48  ? 83  LEU C O     1 
ATOM   1990  C  CB    . LEU C 3 84  ? -1.053  -8.422  46.741 1.00 39.73  ? 83  LEU C CB    1 
ATOM   1991  C  CG    . LEU C 3 84  ? -0.124  -7.855  45.664 1.00 39.79  ? 83  LEU C CG    1 
ATOM   1992  C  CD1   . LEU C 3 84  ? 0.240   -8.898  44.614 1.00 38.69  ? 83  LEU C CD1   1 
ATOM   1993  C  CD2   . LEU C 3 84  ? -0.768  -6.680  44.992 1.00 39.71  ? 83  LEU C CD2   1 
ATOM   1994  N  N     . GLN C 3 85  ? -2.005  -9.084  49.697 1.00 40.11  ? 84  GLN C N     1 
ATOM   1995  C  CA    . GLN C 3 85  ? -2.993  -9.682  50.561 1.00 40.37  ? 84  GLN C CA    1 
ATOM   1996  C  C     . GLN C 3 85  ? -3.535  -8.693  51.611 1.00 40.46  ? 84  GLN C C     1 
ATOM   1997  O  O     . GLN C 3 85  ? -4.744  -8.660  51.866 1.00 40.42  ? 84  GLN C O     1 
ATOM   1998  C  CB    . GLN C 3 85  ? -2.432  -10.936 51.192 1.00 39.64  ? 84  GLN C CB    1 
ATOM   1999  C  CG    . GLN C 3 85  ? -3.257  -11.454 52.326 1.00 41.00  ? 84  GLN C CG    1 
ATOM   2000  C  CD    . GLN C 3 85  ? -4.440  -12.343 51.906 1.00 39.90  ? 84  GLN C CD    1 
ATOM   2001  O  OE1   . GLN C 3 85  ? -5.006  -12.222 50.818 1.00 39.98  ? 84  GLN C OE1   1 
ATOM   2002  N  NE2   . GLN C 3 85  ? -4.819  -13.222 52.804 1.00 36.96  ? 84  GLN C NE2   1 
ATOM   2003  N  N     . LEU C 3 86  ? -2.659  -7.884  52.205 1.00 40.43  ? 85  LEU C N     1 
ATOM   2004  C  CA    . LEU C 3 86  ? -3.111  -6.884  53.152 1.00 40.96  ? 85  LEU C CA    1 
ATOM   2005  C  C     . LEU C 3 86  ? -4.072  -5.898  52.487 1.00 41.03  ? 85  LEU C C     1 
ATOM   2006  O  O     . LEU C 3 86  ? -5.128  -5.574  53.035 1.00 40.72  ? 85  LEU C O     1 
ATOM   2007  C  CB    . LEU C 3 86  ? -1.921  -6.141  53.752 1.00 41.93  ? 85  LEU C CB    1 
ATOM   2008  C  CG    . LEU C 3 86  ? -1.078  -6.907  54.784 1.00 42.65  ? 85  LEU C CG    1 
ATOM   2009  C  CD1   . LEU C 3 86  ? 0.234   -6.202  55.064 1.00 40.40  ? 85  LEU C CD1   1 
ATOM   2010  C  CD2   . LEU C 3 86  ? -1.860  -7.089  56.055 1.00 43.57  ? 85  LEU C CD2   1 
ATOM   2011  N  N     . ALA C 3 87  ? -3.717  -5.451  51.287 1.00 40.85  ? 86  ALA C N     1 
ATOM   2012  C  CA    . ALA C 3 87  ? -4.556  -4.544  50.530 1.00 40.41  ? 86  ALA C CA    1 
ATOM   2013  C  C     . ALA C 3 87  ? -5.946  -5.118  50.328 1.00 40.62  ? 86  ALA C C     1 
ATOM   2014  O  O     . ALA C 3 87  ? -6.931  -4.467  50.602 1.00 41.25  ? 86  ALA C O     1 
ATOM   2015  C  CB    . ALA C 3 87  ? -3.911  -4.223  49.207 1.00 40.64  ? 86  ALA C CB    1 
ATOM   2016  N  N     . VAL C 3 88  ? -6.026  -6.357  49.868 1.00 41.13  ? 87  VAL C N     1 
ATOM   2017  C  CA    . VAL C 3 88  ? -7.304  -6.957  49.513 1.00 40.96  ? 87  VAL C CA    1 
ATOM   2018  C  C     . VAL C 3 88  ? -8.167  -7.205  50.738 1.00 41.20  ? 87  VAL C C     1 
ATOM   2019  O  O     . VAL C 3 88  ? -9.333  -6.823  50.782 1.00 41.38  ? 87  VAL C O     1 
ATOM   2020  C  CB    . VAL C 3 88  ? -7.090  -8.251  48.695 1.00 40.90  ? 87  VAL C CB    1 
ATOM   2021  C  CG1   . VAL C 3 88  ? -8.379  -9.007  48.488 1.00 40.12  ? 87  VAL C CG1   1 
ATOM   2022  C  CG2   . VAL C 3 88  ? -6.472  -7.907  47.351 1.00 41.01  ? 87  VAL C CG2   1 
ATOM   2023  N  N     . ARG C 3 89  ? -7.577  -7.839  51.739 1.00 41.54  ? 88  ARG C N     1 
ATOM   2024  C  CA    . ARG C 3 89  ? -8.328  -8.266  52.895 1.00 41.61  ? 88  ARG C CA    1 
ATOM   2025  C  C     . ARG C 3 89  ? -8.743  -7.104  53.783 1.00 42.30  ? 88  ARG C C     1 
ATOM   2026  O  O     . ARG C 3 89  ? -9.755  -7.183  54.456 1.00 42.68  ? 88  ARG C O     1 
ATOM   2027  C  CB    . ARG C 3 89  ? -7.551  -9.338  53.673 1.00 41.35  ? 88  ARG C CB    1 
ATOM   2028  C  CG    . ARG C 3 89  ? -7.244  -10.643 52.878 1.00 40.57  ? 88  ARG C CG    1 
ATOM   2029  C  CD    . ARG C 3 89  ? -8.464  -11.234 52.104 1.00 36.59  ? 88  ARG C CD    1 
ATOM   2030  N  NE    . ARG C 3 89  ? -8.064  -12.005 50.924 1.00 34.08  ? 88  ARG C NE    1 
ATOM   2031  C  CZ    . ARG C 3 89  ? -8.900  -12.398 49.961 1.00 33.72  ? 88  ARG C CZ    1 
ATOM   2032  N  NH1   . ARG C 3 89  ? -10.187 -12.091 50.014 1.00 36.09  ? 88  ARG C NH1   1 
ATOM   2033  N  NH2   . ARG C 3 89  ? -8.462  -13.102 48.937 1.00 31.90  ? 88  ARG C NH2   1 
ATOM   2034  N  N     . ASN C 3 90  ? -7.982  -6.012  53.775 1.00 43.33  ? 89  ASN C N     1 
ATOM   2035  C  CA    . ASN C 3 90  ? -8.366  -4.831  54.557 1.00 43.76  ? 89  ASN C CA    1 
ATOM   2036  C  C     . ASN C 3 90  ? -9.423  -3.949  53.905 1.00 44.43  ? 89  ASN C C     1 
ATOM   2037  O  O     . ASN C 3 90  ? -9.959  -3.052  54.555 1.00 44.71  ? 89  ASN C O     1 
ATOM   2038  C  CB    . ASN C 3 90  ? -7.150  -4.031  54.962 1.00 43.52  ? 89  ASN C CB    1 
ATOM   2039  C  CG    . ASN C 3 90  ? -6.445  -4.645  56.137 1.00 43.92  ? 89  ASN C CG    1 
ATOM   2040  O  OD1   . ASN C 3 90  ? -7.086  -5.019  57.113 1.00 46.44  ? 89  ASN C OD1   1 
ATOM   2041  N  ND2   . ASN C 3 90  ? -5.129  -4.765  56.059 1.00 43.72  ? 89  ASN C ND2   1 
ATOM   2042  N  N     . ASP C 3 91  ? -9.751  -4.244  52.645 1.00 44.95  ? 90  ASP C N     1 
ATOM   2043  C  CA    . ASP C 3 91  ? -10.688 -3.454  51.875 1.00 45.59  ? 90  ASP C CA    1 
ATOM   2044  C  C     . ASP C 3 91  ? -11.960 -4.214  51.597 1.00 46.34  ? 90  ASP C C     1 
ATOM   2045  O  O     . ASP C 3 91  ? -11.962 -5.149  50.802 1.00 46.87  ? 90  ASP C O     1 
ATOM   2046  C  CB    . ASP C 3 91  ? -10.065 -3.061  50.545 1.00 45.76  ? 90  ASP C CB    1 
ATOM   2047  C  CG    . ASP C 3 91  ? -10.946 -2.133  49.762 1.00 47.09  ? 90  ASP C CG    1 
ATOM   2048  O  OD1   . ASP C 3 91  ? -10.971 -0.940  50.104 1.00 49.21  ? 90  ASP C OD1   1 
ATOM   2049  O  OD2   . ASP C 3 91  ? -11.638 -2.590  48.826 1.00 49.49  ? 90  ASP C OD2   1 
ATOM   2050  N  N     . GLU C 3 92  ? -13.059 -3.792  52.209 1.00 47.24  ? 91  GLU C N     1 
ATOM   2051  C  CA    . GLU C 3 92  ? -14.324 -4.515  52.087 1.00 48.09  ? 91  GLU C CA    1 
ATOM   2052  C  C     . GLU C 3 92  ? -14.619 -5.050  50.685 1.00 47.26  ? 91  GLU C C     1 
ATOM   2053  O  O     . GLU C 3 92  ? -14.941 -6.221  50.524 1.00 47.26  ? 91  GLU C O     1 
ATOM   2054  C  CB    . GLU C 3 92  ? -15.484 -3.640  52.548 1.00 49.00  ? 91  GLU C CB    1 
ATOM   2055  C  CG    . GLU C 3 92  ? -15.939 -3.861  53.977 1.00 53.44  ? 91  GLU C CG    1 
ATOM   2056  C  CD    . GLU C 3 92  ? -17.306 -3.222  54.238 1.00 59.54  ? 91  GLU C CD    1 
ATOM   2057  O  OE1   . GLU C 3 92  ? -18.131 -3.184  53.296 1.00 59.75  ? 91  GLU C OE1   1 
ATOM   2058  O  OE2   . GLU C 3 92  ? -17.554 -2.756  55.383 1.00 63.48  ? 91  GLU C OE2   1 
ATOM   2059  N  N     . GLU C 3 93  ? -14.508 -4.188  49.681 1.00 46.94  ? 92  GLU C N     1 
ATOM   2060  C  CA    . GLU C 3 93  ? -15.023 -4.502  48.345 1.00 46.48  ? 92  GLU C CA    1 
ATOM   2061  C  C     . GLU C 3 93  ? -14.066 -5.374  47.556 1.00 45.64  ? 92  GLU C C     1 
ATOM   2062  O  O     . GLU C 3 93  ? -14.485 -6.264  46.823 1.00 45.34  ? 92  GLU C O     1 
ATOM   2063  C  CB    . GLU C 3 93  ? -15.412 -3.230  47.588 1.00 46.29  ? 92  GLU C CB    1 
ATOM   2064  C  CG    . GLU C 3 93  ? -16.594 -2.541  48.247 1.00 48.96  ? 92  GLU C CG    1 
ATOM   2065  C  CD    . GLU C 3 93  ? -17.300 -1.539  47.368 1.00 52.14  ? 92  GLU C CD    1 
ATOM   2066  O  OE1   . GLU C 3 93  ? -16.748 -1.181  46.304 1.00 53.16  ? 92  GLU C OE1   1 
ATOM   2067  O  OE2   . GLU C 3 93  ? -18.418 -1.114  47.754 1.00 54.64  ? 92  GLU C OE2   1 
ATOM   2068  N  N     . LEU C 3 94  ? -12.777 -5.133  47.730 1.00 44.77  ? 93  LEU C N     1 
ATOM   2069  C  CA    . LEU C 3 94  ? -11.800 -5.988  47.106 1.00 44.11  ? 93  LEU C CA    1 
ATOM   2070  C  C     . LEU C 3 94  ? -11.822 -7.356  47.756 1.00 44.08  ? 93  LEU C C     1 
ATOM   2071  O  O     . LEU C 3 94  ? -11.704 -8.370  47.064 1.00 43.99  ? 93  LEU C O     1 
ATOM   2072  C  CB    . LEU C 3 94  ? -10.399 -5.379  47.170 1.00 44.05  ? 93  LEU C CB    1 
ATOM   2073  C  CG    . LEU C 3 94  ? -10.028 -4.366  46.070 1.00 42.41  ? 93  LEU C CG    1 
ATOM   2074  C  CD1   . LEU C 3 94  ? -8.584  -3.908  46.280 1.00 41.69  ? 93  LEU C CD1   1 
ATOM   2075  C  CD2   . LEU C 3 94  ? -10.221 -4.908  44.650 1.00 38.01  ? 93  LEU C CD2   1 
ATOM   2076  N  N     . ASN C 3 95  ? -11.985 -7.379  49.083 1.00 43.83  ? 94  ASN C N     1 
ATOM   2077  C  CA    . ASN C 3 95  ? -12.202 -8.624  49.816 1.00 43.20  ? 94  ASN C CA    1 
ATOM   2078  C  C     . ASN C 3 95  ? -13.352 -9.487  49.281 1.00 43.20  ? 94  ASN C C     1 
ATOM   2079  O  O     . ASN C 3 95  ? -13.197 -10.691 49.158 1.00 43.67  ? 94  ASN C O     1 
ATOM   2080  C  CB    . ASN C 3 95  ? -12.415 -8.373  51.305 1.00 42.85  ? 94  ASN C CB    1 
ATOM   2081  C  CG    . ASN C 3 95  ? -12.445 -9.670  52.111 1.00 41.74  ? 94  ASN C CG    1 
ATOM   2082  O  OD1   . ASN C 3 95  ? -11.553 -10.505 51.989 1.00 41.13  ? 94  ASN C OD1   1 
ATOM   2083  N  ND2   . ASN C 3 95  ? -13.471 -9.842  52.917 1.00 39.14  ? 94  ASN C ND2   1 
ATOM   2084  N  N     . LYS C 3 96  ? -14.498 -8.887  48.999 1.00 42.79  ? 95  LYS C N     1 
ATOM   2085  C  CA    . LYS C 3 96  ? -15.624 -9.619  48.440 1.00 43.39  ? 95  LYS C CA    1 
ATOM   2086  C  C     . LYS C 3 96  ? -15.344 -10.056 46.993 1.00 43.34  ? 95  LYS C C     1 
ATOM   2087  O  O     . LYS C 3 96  ? -15.646 -11.179 46.597 1.00 43.47  ? 95  LYS C O     1 
ATOM   2088  C  CB    . LYS C 3 96  ? -16.879 -8.752  48.487 1.00 43.74  ? 95  LYS C CB    1 
ATOM   2089  C  CG    . LYS C 3 96  ? -18.153 -9.467  48.142 1.00 46.10  ? 95  LYS C CG    1 
ATOM   2090  C  CD    . LYS C 3 96  ? -19.341 -8.702  48.755 1.00 54.14  ? 95  LYS C CD    1 
ATOM   2091  C  CE    . LYS C 3 96  ? -20.625 -9.579  48.855 1.00 58.18  ? 95  LYS C CE    1 
ATOM   2092  N  NZ    . LYS C 3 96  ? -21.722 -8.932  49.668 1.00 60.22  ? 95  LYS C NZ    1 
ATOM   2093  N  N     . LEU C 3 97  ? -14.777 -9.161  46.199 1.00 42.70  ? 96  LEU C N     1 
ATOM   2094  C  CA    . LEU C 3 97  ? -14.527 -9.469  44.815 1.00 42.23  ? 96  LEU C CA    1 
ATOM   2095  C  C     . LEU C 3 97  ? -13.631 -10.689 44.717 1.00 42.31  ? 96  LEU C C     1 
ATOM   2096  O  O     . LEU C 3 97  ? -13.734 -11.484 43.764 1.00 42.69  ? 96  LEU C O     1 
ATOM   2097  C  CB    . LEU C 3 97  ? -13.872 -8.276  44.115 1.00 42.03  ? 96  LEU C CB    1 
ATOM   2098  C  CG    . LEU C 3 97  ? -13.495 -8.469  42.653 1.00 41.63  ? 96  LEU C CG    1 
ATOM   2099  C  CD1   . LEU C 3 97  ? -14.717 -8.740  41.782 1.00 40.71  ? 96  LEU C CD1   1 
ATOM   2100  C  CD2   . LEU C 3 97  ? -12.776 -7.259  42.185 1.00 42.49  ? 96  LEU C CD2   1 
ATOM   2101  N  N     . LEU C 3 98  ? -12.760 -10.826 45.711 1.00 41.69  ? 97  LEU C N     1 
ATOM   2102  C  CA    . LEU C 3 98  ? -11.774 -11.880 45.745 1.00 41.54  ? 97  LEU C CA    1 
ATOM   2103  C  C     . LEU C 3 98  ? -12.041 -12.791 46.961 1.00 41.85  ? 97  LEU C C     1 
ATOM   2104  O  O     . LEU C 3 98  ? -11.112 -13.368 47.573 1.00 41.24  ? 97  LEU C O     1 
ATOM   2105  C  CB    . LEU C 3 98  ? -10.368 -11.275 45.800 1.00 41.42  ? 97  LEU C CB    1 
ATOM   2106  C  CG    . LEU C 3 98  ? -9.892  -10.359 44.665 1.00 42.01  ? 97  LEU C CG    1 
ATOM   2107  C  CD1   . LEU C 3 98  ? -8.426  -9.980  44.819 1.00 40.48  ? 97  LEU C CD1   1 
ATOM   2108  C  CD2   . LEU C 3 98  ? -10.123 -11.008 43.303 1.00 42.06  ? 97  LEU C CD2   1 
ATOM   2109  N  N     . GLY C 3 99  ? -13.321 -12.909 47.306 1.00 41.81  ? 98  GLY C N     1 
ATOM   2110  C  CA    . GLY C 3 99  ? -13.737 -13.684 48.470 1.00 42.27  ? 98  GLY C CA    1 
ATOM   2111  C  C     . GLY C 3 99  ? -13.417 -15.166 48.358 1.00 42.51  ? 98  GLY C C     1 
ATOM   2112  O  O     . GLY C 3 99  ? -13.288 -15.862 49.364 1.00 42.72  ? 98  GLY C O     1 
ATOM   2113  N  N     . ARG C 3 100 ? -13.278 -15.644 47.132 1.00 42.21  ? 99  ARG C N     1 
ATOM   2114  C  CA    . ARG C 3 100 ? -13.072 -17.042 46.899 1.00 42.43  ? 99  ARG C CA    1 
ATOM   2115  C  C     . ARG C 3 100 ? -11.785 -17.291 46.131 1.00 41.75  ? 99  ARG C C     1 
ATOM   2116  O  O     . ARG C 3 100 ? -11.721 -18.159 45.260 1.00 42.32  ? 99  ARG C O     1 
ATOM   2117  C  CB    . ARG C 3 100 ? -14.311 -17.621 46.226 1.00 42.62  ? 99  ARG C CB    1 
ATOM   2118  C  CG    . ARG C 3 100 ? -15.264 -18.046 47.309 1.00 48.14  ? 99  ARG C CG    1 
ATOM   2119  C  CD    . ARG C 3 100 ? -16.711 -18.035 46.915 1.00 57.71  ? 99  ARG C CD    1 
ATOM   2120  N  NE    . ARG C 3 100 ? -17.528 -18.392 48.088 1.00 63.15  ? 99  ARG C NE    1 
ATOM   2121  C  CZ    . ARG C 3 100 ? -18.745 -17.912 48.354 1.00 64.96  ? 99  ARG C CZ    1 
ATOM   2122  N  NH1   . ARG C 3 100 ? -19.330 -17.034 47.536 1.00 65.25  ? 99  ARG C NH1   1 
ATOM   2123  N  NH2   . ARG C 3 100 ? -19.375 -18.308 49.454 1.00 65.71  ? 99  ARG C NH2   1 
ATOM   2124  N  N     . VAL C 3 101 ? -10.760 -16.501 46.457 1.00 40.48  ? 100 VAL C N     1 
ATOM   2125  C  CA    . VAL C 3 101 ? -9.484  -16.548 45.770 1.00 38.84  ? 100 VAL C CA    1 
ATOM   2126  C  C     . VAL C 3 101 ? -8.406  -16.618 46.834 1.00 38.89  ? 100 VAL C C     1 
ATOM   2127  O  O     . VAL C 3 101 ? -8.526  -16.020 47.901 1.00 38.29  ? 100 VAL C O     1 
ATOM   2128  C  CB    . VAL C 3 101 ? -9.275  -15.286 44.922 1.00 38.94  ? 100 VAL C CB    1 
ATOM   2129  C  CG1   . VAL C 3 101 ? -7.806  -15.115 44.518 1.00 37.91  ? 100 VAL C CG1   1 
ATOM   2130  C  CG2   . VAL C 3 101 ? -10.175 -15.303 43.710 1.00 37.50  ? 100 VAL C CG2   1 
ATOM   2131  N  N     . THR C 3 102 ? -7.359  -17.374 46.536 1.00 38.82  ? 101 THR C N     1 
ATOM   2132  C  CA    . THR C 3 102 ? -6.215  -17.497 47.404 1.00 38.70  ? 101 THR C CA    1 
ATOM   2133  C  C     . THR C 3 102 ? -5.033  -16.826 46.733 1.00 39.26  ? 101 THR C C     1 
ATOM   2134  O  O     . THR C 3 102 ? -4.731  -17.103 45.561 1.00 39.92  ? 101 THR C O     1 
ATOM   2135  C  CB    . THR C 3 102 ? -5.915  -18.982 47.677 1.00 39.23  ? 101 THR C CB    1 
ATOM   2136  O  OG1   . THR C 3 102 ? -7.048  -19.583 48.351 1.00 39.67  ? 101 THR C OG1   1 
ATOM   2137  C  CG2   . THR C 3 102 ? -4.645  -19.146 48.508 1.00 37.51  ? 101 THR C CG2   1 
ATOM   2138  N  N     . ILE C 3 103 ? -4.404  -15.908 47.464 1.00 39.08  ? 102 ILE C N     1 
ATOM   2139  C  CA    . ILE C 3 103 ? -3.178  -15.254 47.055 1.00 38.45  ? 102 ILE C CA    1 
ATOM   2140  C  C     . ILE C 3 103 ? -2.020  -16.015 47.697 1.00 39.28  ? 102 ILE C C     1 
ATOM   2141  O  O     . ILE C 3 103 ? -1.800  -15.977 48.928 1.00 39.47  ? 102 ILE C O     1 
ATOM   2142  C  CB    . ILE C 3 103 ? -3.157  -13.756 47.501 1.00 38.86  ? 102 ILE C CB    1 
ATOM   2143  C  CG1   . ILE C 3 103 ? -4.200  -12.934 46.719 1.00 38.32  ? 102 ILE C CG1   1 
ATOM   2144  C  CG2   . ILE C 3 103 ? -1.754  -13.153 47.384 1.00 36.42  ? 102 ILE C CG2   1 
ATOM   2145  C  CD1   . ILE C 3 103 ? -4.674  -11.702 47.463 1.00 37.74  ? 102 ILE C CD1   1 
ATOM   2146  N  N     . ALA C 3 104 ? -1.287  -16.734 46.864 1.00 39.57  ? 103 ALA C N     1 
ATOM   2147  C  CA    . ALA C 3 104 ? -0.153  -17.491 47.333 1.00 40.32  ? 103 ALA C CA    1 
ATOM   2148  C  C     . ALA C 3 104 ? 0.771   -16.572 48.118 1.00 41.04  ? 103 ALA C C     1 
ATOM   2149  O  O     . ALA C 3 104 ? 0.983   -15.433 47.723 1.00 41.96  ? 103 ALA C O     1 
ATOM   2150  C  CB    . ALA C 3 104 ? 0.580   -18.102 46.161 1.00 40.36  ? 103 ALA C CB    1 
ATOM   2151  N  N     . GLN C 3 105 ? 1.315   -17.065 49.230 1.00 41.17  ? 104 GLN C N     1 
ATOM   2152  C  CA    . GLN C 3 105 ? 2.286   -16.312 50.031 1.00 41.09  ? 104 GLN C CA    1 
ATOM   2153  C  C     . GLN C 3 105 ? 1.744   -15.002 50.632 1.00 40.07  ? 104 GLN C C     1 
ATOM   2154  O  O     . GLN C 3 105 ? 2.515   -14.139 51.036 1.00 39.79  ? 104 GLN C O     1 
ATOM   2155  C  CB    . GLN C 3 105 ? 3.601   -16.114 49.255 1.00 41.44  ? 104 GLN C CB    1 
ATOM   2156  C  CG    . GLN C 3 105 ? 4.501   -17.362 49.255 1.00 45.39  ? 104 GLN C CG    1 
ATOM   2157  C  CD    . GLN C 3 105 ? 4.949   -17.768 50.688 1.00 51.35  ? 104 GLN C CD    1 
ATOM   2158  O  OE1   . GLN C 3 105 ? 5.586   -16.976 51.402 1.00 53.18  ? 104 GLN C OE1   1 
ATOM   2159  N  NE2   . GLN C 3 105 ? 4.592   -18.991 51.111 1.00 50.74  ? 104 GLN C NE2   1 
ATOM   2160  N  N     . GLY C 3 106 ? 0.418   -14.889 50.709 1.00 39.08  ? 105 GLY C N     1 
ATOM   2161  C  CA    . GLY C 3 106 ? -0.248  -13.758 51.351 1.00 38.74  ? 105 GLY C CA    1 
ATOM   2162  C  C     . GLY C 3 106 ? -0.426  -13.801 52.869 1.00 39.06  ? 105 GLY C C     1 
ATOM   2163  O  O     . GLY C 3 106 ? -0.608  -12.746 53.523 1.00 39.04  ? 105 GLY C O     1 
ATOM   2164  N  N     . GLY C 3 107 ? -0.352  -15.002 53.448 1.00 38.88  ? 106 GLY C N     1 
ATOM   2165  C  CA    . GLY C 3 107 ? -0.632  -15.186 54.863 1.00 38.76  ? 106 GLY C CA    1 
ATOM   2166  C  C     . GLY C 3 107 ? -2.061  -14.800 55.149 1.00 39.31  ? 106 GLY C C     1 
ATOM   2167  O  O     . GLY C 3 107 ? -2.917  -14.851 54.261 1.00 39.99  ? 106 GLY C O     1 
ATOM   2168  N  N     . VAL C 3 108 ? -2.320  -14.392 56.385 1.00 39.91  ? 107 VAL C N     1 
ATOM   2169  C  CA    . VAL C 3 108 ? -3.645  -13.929 56.808 1.00 39.68  ? 107 VAL C CA    1 
ATOM   2170  C  C     . VAL C 3 108 ? -3.573  -12.589 57.559 1.00 40.07  ? 107 VAL C C     1 
ATOM   2171  O  O     . VAL C 3 108 ? -2.494  -12.135 57.903 1.00 40.27  ? 107 VAL C O     1 
ATOM   2172  C  CB    . VAL C 3 108 ? -4.341  -15.004 57.708 1.00 40.21  ? 107 VAL C CB    1 
ATOM   2173  C  CG1   . VAL C 3 108 ? -4.484  -16.338 56.956 1.00 37.72  ? 107 VAL C CG1   1 
ATOM   2174  C  CG2   . VAL C 3 108 ? -3.626  -15.162 59.075 1.00 38.46  ? 107 VAL C CG2   1 
ATOM   2175  N  N     . LEU C 3 109 ? -4.710  -11.954 57.811 1.00 40.90  ? 108 LEU C N     1 
ATOM   2176  C  CA    . LEU C 3 109 ? -4.734  -10.766 58.682 1.00 42.44  ? 108 LEU C CA    1 
ATOM   2177  C  C     . LEU C 3 109 ? -4.510  -11.124 60.161 1.00 43.32  ? 108 LEU C C     1 
ATOM   2178  O  O     . LEU C 3 109 ? -5.116  -12.061 60.663 1.00 43.53  ? 108 LEU C O     1 
ATOM   2179  C  CB    . LEU C 3 109 ? -6.065  -10.007 58.542 1.00 42.04  ? 108 LEU C CB    1 
ATOM   2180  C  CG    . LEU C 3 109 ? -6.387  -9.372  57.192 1.00 41.02  ? 108 LEU C CG    1 
ATOM   2181  C  CD1   . LEU C 3 109 ? -7.656  -8.589  57.268 1.00 39.60  ? 108 LEU C CD1   1 
ATOM   2182  C  CD2   . LEU C 3 109 ? -5.265  -8.490  56.738 1.00 42.08  ? 108 LEU C CD2   1 
ATOM   2183  N  N     . PRO C 3 110 ? -3.641  -10.385 60.868 1.00 44.89  ? 109 PRO C N     1 
ATOM   2184  C  CA    . PRO C 3 110 ? -3.572  -10.643 62.320 1.00 45.77  ? 109 PRO C CA    1 
ATOM   2185  C  C     . PRO C 3 110 ? -4.938  -10.448 62.957 1.00 47.04  ? 109 PRO C C     1 
ATOM   2186  O  O     . PRO C 3 110 ? -5.552  -9.399  62.799 1.00 47.30  ? 109 PRO C O     1 
ATOM   2187  C  CB    . PRO C 3 110 ? -2.598  -9.582  62.817 1.00 45.50  ? 109 PRO C CB    1 
ATOM   2188  C  CG    . PRO C 3 110 ? -1.695  -9.325  61.632 1.00 45.30  ? 109 PRO C CG    1 
ATOM   2189  C  CD    . PRO C 3 110 ? -2.616  -9.412  60.429 1.00 44.90  ? 109 PRO C CD    1 
ATOM   2190  N  N     . ASN C 3 111 ? -5.432  -11.479 63.625 1.00 48.63  ? 110 ASN C N     1 
ATOM   2191  C  CA    . ASN C 3 111 ? -6.751  -11.432 64.214 1.00 50.17  ? 110 ASN C CA    1 
ATOM   2192  C  C     . ASN C 3 111 ? -6.894  -12.547 65.230 1.00 51.00  ? 110 ASN C C     1 
ATOM   2193  O  O     . ASN C 3 111 ? -6.927  -13.743 64.884 1.00 51.55  ? 110 ASN C O     1 
ATOM   2194  C  CB    . ASN C 3 111 ? -7.831  -11.524 63.135 1.00 50.53  ? 110 ASN C CB    1 
ATOM   2195  C  CG    . ASN C 3 111 ? -9.219  -11.386 63.689 1.00 52.62  ? 110 ASN C CG    1 
ATOM   2196  O  OD1   . ASN C 3 111 ? -9.411  -10.887 64.805 1.00 56.91  ? 110 ASN C OD1   1 
ATOM   2197  N  ND2   . ASN C 3 111 ? -10.210 -11.830 62.918 1.00 53.85  ? 110 ASN C ND2   1 
ATOM   2198  N  N     . ILE C 3 112 ? -6.952  -12.124 66.490 1.00 51.56  ? 111 ILE C N     1 
ATOM   2199  C  CA    . ILE C 3 112 ? -7.134  -12.981 67.662 1.00 51.47  ? 111 ILE C CA    1 
ATOM   2200  C  C     . ILE C 3 112 ? -8.473  -12.654 68.318 1.00 51.64  ? 111 ILE C C     1 
ATOM   2201  O  O     . ILE C 3 112 ? -8.762  -11.502 68.595 1.00 51.89  ? 111 ILE C O     1 
ATOM   2202  C  CB    . ILE C 3 112 ? -6.070  -12.687 68.694 1.00 50.84  ? 111 ILE C CB    1 
ATOM   2203  C  CG1   . ILE C 3 112 ? -4.686  -12.825 68.082 1.00 50.55  ? 111 ILE C CG1   1 
ATOM   2204  C  CG2   . ILE C 3 112 ? -6.262  -13.584 69.898 1.00 52.34  ? 111 ILE C CG2   1 
ATOM   2205  C  CD1   . ILE C 3 112 ? -3.541  -12.502 69.046 1.00 49.70  ? 111 ILE C CD1   1 
ATOM   2206  N  N     . GLN C 3 113 ? -9.280  -13.671 68.564 1.00 52.34  ? 112 GLN C N     1 
ATOM   2207  C  CA    . GLN C 3 113 ? -10.590 -13.500 69.152 1.00 52.98  ? 112 GLN C CA    1 
ATOM   2208  C  C     . GLN C 3 113 ? -10.473 -13.063 70.609 1.00 54.05  ? 112 GLN C C     1 
ATOM   2209  O  O     . GLN C 3 113 ? -9.648  -13.597 71.360 1.00 53.89  ? 112 GLN C O     1 
ATOM   2210  C  CB    . GLN C 3 113 ? -11.359 -14.819 69.068 1.00 53.20  ? 112 GLN C CB    1 
ATOM   2211  C  CG    . GLN C 3 113 ? -11.601 -15.313 67.644 1.00 52.71  ? 112 GLN C CG    1 
ATOM   2212  C  CD    . GLN C 3 113 ? -12.525 -14.402 66.864 1.00 52.38  ? 112 GLN C CD    1 
ATOM   2213  O  OE1   . GLN C 3 113 ? -13.632 -14.076 67.319 1.00 52.37  ? 112 GLN C OE1   1 
ATOM   2214  N  NE2   . GLN C 3 113 ? -12.078 -13.980 65.682 1.00 50.35  ? 112 GLN C NE2   1 
ATOM   2215  N  N     . SER C 3 114 ? -11.322 -12.106 70.992 1.00 54.90  ? 113 SER C N     1 
ATOM   2216  C  CA    . SER C 3 114 ? -11.361 -11.525 72.341 1.00 55.94  ? 113 SER C CA    1 
ATOM   2217  C  C     . SER C 3 114 ? -11.165 -12.486 73.502 1.00 56.67  ? 113 SER C C     1 
ATOM   2218  O  O     . SER C 3 114 ? -10.279 -12.262 74.318 1.00 57.07  ? 113 SER C O     1 
ATOM   2219  C  CB    . SER C 3 114 ? -12.674 -10.760 72.578 1.00 55.80  ? 113 SER C CB    1 
ATOM   2220  O  OG    . SER C 3 114 ? -12.678 -9.537  71.887 1.00 54.89  ? 113 SER C OG    1 
ATOM   2221  N  N     . VAL C 3 115 ? -11.995 -13.527 73.595 1.00 57.53  ? 114 VAL C N     1 
ATOM   2222  C  CA    . VAL C 3 115 ? -11.970 -14.430 74.759 1.00 58.78  ? 114 VAL C CA    1 
ATOM   2223  C  C     . VAL C 3 115 ? -10.631 -15.114 74.937 1.00 59.82  ? 114 VAL C C     1 
ATOM   2224  O  O     . VAL C 3 115 ? -10.352 -15.653 76.008 1.00 60.88  ? 114 VAL C O     1 
ATOM   2225  C  CB    . VAL C 3 115 ? -13.069 -15.551 74.743 1.00 58.36  ? 114 VAL C CB    1 
ATOM   2226  C  CG1   . VAL C 3 115 ? -14.455 -14.961 74.807 1.00 59.53  ? 114 VAL C CG1   1 
ATOM   2227  C  CG2   . VAL C 3 115 ? -12.919 -16.470 73.528 1.00 58.35  ? 114 VAL C CG2   1 
ATOM   2228  N  N     . LEU C 3 116 ? -9.811  -15.109 73.895 1.00 60.60  ? 115 LEU C N     1 
ATOM   2229  C  CA    . LEU C 3 116 ? -8.550  -15.821 73.948 1.00 61.69  ? 115 LEU C CA    1 
ATOM   2230  C  C     . LEU C 3 116 ? -7.482  -15.021 74.649 1.00 63.01  ? 115 LEU C C     1 
ATOM   2231  O  O     . LEU C 3 116 ? -6.436  -15.564 74.991 1.00 63.35  ? 115 LEU C O     1 
ATOM   2232  C  CB    . LEU C 3 116 ? -8.077  -16.234 72.544 1.00 61.45  ? 115 LEU C CB    1 
ATOM   2233  C  CG    . LEU C 3 116 ? -8.986  -17.144 71.712 1.00 59.37  ? 115 LEU C CG    1 
ATOM   2234  C  CD1   . LEU C 3 116 ? -8.291  -17.491 70.445 1.00 57.13  ? 115 LEU C CD1   1 
ATOM   2235  C  CD2   . LEU C 3 116 ? -9.400  -18.403 72.469 1.00 57.15  ? 115 LEU C CD2   1 
ATOM   2236  N  N     . LEU C 3 117 ? -7.743  -13.736 74.862 1.00 64.72  ? 116 LEU C N     1 
ATOM   2237  C  CA    . LEU C 3 117 ? -6.806  -12.884 75.577 1.00 66.94  ? 116 LEU C CA    1 
ATOM   2238  C  C     . LEU C 3 117 ? -6.909  -13.094 77.090 1.00 68.92  ? 116 LEU C C     1 
ATOM   2239  O  O     . LEU C 3 117 ? -7.991  -13.389 77.610 1.00 68.95  ? 116 LEU C O     1 
ATOM   2240  C  CB    . LEU C 3 117 ? -7.015  -11.415 75.212 1.00 66.71  ? 116 LEU C CB    1 
ATOM   2241  C  CG    . LEU C 3 117 ? -6.886  -11.002 73.741 1.00 66.69  ? 116 LEU C CG    1 
ATOM   2242  C  CD1   . LEU C 3 117 ? -7.190  -9.521  73.577 1.00 65.90  ? 116 LEU C CD1   1 
ATOM   2243  C  CD2   . LEU C 3 117 ? -5.548  -11.350 73.126 1.00 65.22  ? 116 LEU C CD2   1 
ATOM   2244  N  N     . PRO C 3 118 ? -5.780  -12.941 77.805 1.00 70.94  ? 117 PRO C N     1 
ATOM   2245  C  CA    . PRO C 3 118 ? -5.730  -13.203 79.255 1.00 72.93  ? 117 PRO C CA    1 
ATOM   2246  C  C     . PRO C 3 118 ? -6.430  -12.164 80.154 1.00 74.91  ? 117 PRO C C     1 
ATOM   2247  O  O     . PRO C 3 118 ? -6.962  -11.165 79.653 1.00 74.89  ? 117 PRO C O     1 
ATOM   2248  C  CB    . PRO C 3 118 ? -4.228  -13.261 79.556 1.00 72.74  ? 117 PRO C CB    1 
ATOM   2249  C  CG    . PRO C 3 118 ? -3.578  -12.513 78.443 1.00 71.96  ? 117 PRO C CG    1 
ATOM   2250  C  CD    . PRO C 3 118 ? -4.466  -12.567 77.252 1.00 70.83  ? 117 PRO C CD    1 
ATOM   2251  N  N     . LYS C 3 119 ? -6.404  -12.423 81.470 1.00 77.46  ? 118 LYS C N     1 
ATOM   2252  C  CA    . LYS C 3 119 ? -7.070  -11.615 82.516 1.00 79.61  ? 118 LYS C CA    1 
ATOM   2253  C  C     . LYS C 3 119 ? -8.595  -11.725 82.414 1.00 81.02  ? 118 LYS C C     1 
ATOM   2254  O  O     . LYS C 3 119 ? -9.124  -12.763 81.981 1.00 81.23  ? 118 LYS C O     1 
ATOM   2255  C  CB    . LYS C 3 119 ? -6.640  -10.135 82.476 1.00 79.68  ? 118 LYS C CB    1 
ATOM   2256  C  CG    . LYS C 3 119 ? -5.341  -9.806  83.201 1.00 80.69  ? 118 LYS C CG    1 
ATOM   2257  C  CD    . LYS C 3 119 ? -5.258  -8.309  83.548 1.00 82.21  ? 118 LYS C CD    1 
ATOM   2258  C  CE    . LYS C 3 119 ? -5.135  -7.437  82.289 1.00 83.46  ? 118 LYS C CE    1 
ATOM   2259  N  NZ    . LYS C 3 119 ? -4.817  -6.008  82.600 1.00 83.51  ? 118 LYS C NZ    1 
ATOM   2260  N  N     . LYS C 3 120 ? -9.292  -10.657 82.824 1.00 82.52  ? 119 LYS C N     1 
ATOM   2261  C  CA    . LYS C 3 120 ? -10.740 -10.542 82.602 1.00 83.74  ? 119 LYS C CA    1 
ATOM   2262  C  C     . LYS C 3 120 ? -11.092 -9.411  81.615 1.00 83.93  ? 119 LYS C C     1 
ATOM   2263  O  O     . LYS C 3 120 ? -10.577 -8.291  81.710 1.00 84.17  ? 119 LYS C O     1 
ATOM   2264  C  CB    . LYS C 3 120 ? -11.516 -10.393 83.927 1.00 84.10  ? 119 LYS C CB    1 
ATOM   2265  C  CG    . LYS C 3 120 ? -11.314 -9.065  84.677 1.00 85.64  ? 119 LYS C CG    1 
ATOM   2266  C  CD    . LYS C 3 120 ? -10.595 -9.267  86.010 1.00 88.06  ? 119 LYS C CD    1 
ATOM   2267  C  CE    . LYS C 3 120 ? -10.864 -8.088  86.957 1.00 88.69  ? 119 LYS C CE    1 
ATOM   2268  N  NZ    . LYS C 3 120 ? -10.687 -8.472  88.392 1.00 88.70  ? 119 LYS C NZ    1 
ATOM   2269  N  N     . LYS D 4 32  ? 12.743  -19.828 23.411 1.00 96.64  ? 28  LYS D N     1 
ATOM   2270  C  CA    . LYS D 4 32  ? 12.120  -19.203 22.199 1.00 96.53  ? 28  LYS D CA    1 
ATOM   2271  C  C     . LYS D 4 32  ? 10.594  -19.159 22.334 1.00 96.11  ? 28  LYS D C     1 
ATOM   2272  O  O     . LYS D 4 32  ? 9.944   -18.266 21.782 1.00 96.05  ? 28  LYS D O     1 
ATOM   2273  C  CB    . LYS D 4 32  ? 12.501  -19.952 20.903 1.00 96.79  ? 28  LYS D CB    1 
ATOM   2274  C  CG    . LYS D 4 32  ? 13.685  -20.925 21.006 1.00 97.55  ? 28  LYS D CG    1 
ATOM   2275  C  CD    . LYS D 4 32  ? 13.199  -22.350 21.304 1.00 98.48  ? 28  LYS D CD    1 
ATOM   2276  C  CE    . LYS D 4 32  ? 14.360  -23.259 21.704 1.00 98.75  ? 28  LYS D CE    1 
ATOM   2277  N  NZ    . LYS D 4 32  ? 15.306  -23.488 20.562 1.00 99.00  ? 28  LYS D NZ    1 
ATOM   2278  N  N     . THR D 4 33  ? 10.036  -20.133 23.056 1.00 95.46  ? 29  THR D N     1 
ATOM   2279  C  CA    . THR D 4 33  ? 8.591   -20.209 23.323 1.00 94.82  ? 29  THR D CA    1 
ATOM   2280  C  C     . THR D 4 33  ? 8.026   -18.877 23.862 1.00 93.88  ? 29  THR D C     1 
ATOM   2281  O  O     . THR D 4 33  ? 8.636   -18.240 24.742 1.00 94.01  ? 29  THR D O     1 
ATOM   2282  C  CB    . THR D 4 33  ? 8.254   -21.379 24.290 1.00 95.06  ? 29  THR D CB    1 
ATOM   2283  O  OG1   . THR D 4 33  ? 6.828   -21.481 24.439 1.00 95.85  ? 29  THR D OG1   1 
ATOM   2284  C  CG2   . THR D 4 33  ? 8.922   -21.202 25.680 1.00 95.56  ? 29  THR D CG2   1 
ATOM   2285  N  N     . ARG D 4 34  ? 6.875   -18.454 23.331 1.00 92.34  ? 30  ARG D N     1 
ATOM   2286  C  CA    . ARG D 4 34  ? 6.350   -17.117 23.643 1.00 90.75  ? 30  ARG D CA    1 
ATOM   2287  C  C     . ARG D 4 34  ? 5.161   -17.128 24.618 1.00 89.28  ? 30  ARG D C     1 
ATOM   2288  O  O     . ARG D 4 34  ? 4.254   -17.972 24.510 1.00 89.46  ? 30  ARG D O     1 
ATOM   2289  C  CB    . ARG D 4 34  ? 6.012   -16.347 22.357 1.00 90.89  ? 30  ARG D CB    1 
ATOM   2290  C  CG    . ARG D 4 34  ? 4.577   -16.543 21.849 1.00 91.93  ? 30  ARG D CG    1 
ATOM   2291  C  CD    . ARG D 4 34  ? 4.082   -15.334 21.048 1.00 93.59  ? 30  ARG D CD    1 
ATOM   2292  N  NE    . ARG D 4 34  ? 4.785   -14.085 21.367 1.00 93.99  ? 30  ARG D NE    1 
ATOM   2293  C  CZ    . ARG D 4 34  ? 4.218   -12.879 21.385 1.00 94.55  ? 30  ARG D CZ    1 
ATOM   2294  N  NH1   . ARG D 4 34  ? 2.920   -12.744 21.134 1.00 94.70  ? 30  ARG D NH1   1 
ATOM   2295  N  NH2   . ARG D 4 34  ? 4.944   -11.802 21.670 1.00 94.26  ? 30  ARG D NH2   1 
ATOM   2296  N  N     . LYS D 4 35  ? 5.182   -16.199 25.577 1.00 86.89  ? 31  LYS D N     1 
ATOM   2297  C  CA    . LYS D 4 35  ? 4.105   -16.086 26.568 1.00 84.76  ? 31  LYS D CA    1 
ATOM   2298  C  C     . LYS D 4 35  ? 3.812   -14.647 26.956 1.00 82.81  ? 31  LYS D C     1 
ATOM   2299  O  O     . LYS D 4 35  ? 4.662   -13.949 27.509 1.00 82.74  ? 31  LYS D O     1 
ATOM   2300  C  CB    . LYS D 4 35  ? 4.380   -16.933 27.823 1.00 84.83  ? 31  LYS D CB    1 
ATOM   2301  C  CG    . LYS D 4 35  ? 5.816   -17.377 27.965 1.00 85.84  ? 31  LYS D CG    1 
ATOM   2302  C  CD    . LYS D 4 35  ? 6.184   -17.746 29.395 1.00 87.14  ? 31  LYS D CD    1 
ATOM   2303  C  CE    . LYS D 4 35  ? 7.618   -18.293 29.428 1.00 87.41  ? 31  LYS D CE    1 
ATOM   2304  N  NZ    . LYS D 4 35  ? 8.233   -18.232 30.787 1.00 86.99  ? 31  LYS D NZ    1 
ATOM   2305  N  N     . GLU D 4 36  ? 2.591   -14.220 26.662 1.00 80.23  ? 32  GLU D N     1 
ATOM   2306  C  CA    . GLU D 4 36  ? 2.131   -12.882 26.988 1.00 77.75  ? 32  GLU D CA    1 
ATOM   2307  C  C     . GLU D 4 36  ? 1.680   -12.760 28.434 1.00 75.34  ? 32  GLU D C     1 
ATOM   2308  O  O     . GLU D 4 36  ? 1.118   -13.693 29.001 1.00 75.22  ? 32  GLU D O     1 
ATOM   2309  C  CB    . GLU D 4 36  ? 0.946   -12.512 26.106 1.00 78.13  ? 32  GLU D CB    1 
ATOM   2310  C  CG    . GLU D 4 36  ? 1.243   -12.417 24.623 1.00 79.69  ? 32  GLU D CG    1 
ATOM   2311  C  CD    . GLU D 4 36  ? -0.005  -12.064 23.846 1.00 81.69  ? 32  GLU D CD    1 
ATOM   2312  O  OE1   . GLU D 4 36  ? -1.103  -12.269 24.411 1.00 81.62  ? 32  GLU D OE1   1 
ATOM   2313  O  OE2   . GLU D 4 36  ? 0.103   -11.579 22.692 1.00 82.56  ? 32  GLU D OE2   1 
ATOM   2314  N  N     . SER D 4 37  ? 1.911   -11.589 29.018 1.00 72.50  ? 33  SER D N     1 
ATOM   2315  C  CA    . SER D 4 37  ? 1.281   -11.218 30.281 1.00 69.28  ? 33  SER D CA    1 
ATOM   2316  C  C     . SER D 4 37  ? 0.935   -9.746  30.281 1.00 67.05  ? 33  SER D C     1 
ATOM   2317  O  O     . SER D 4 37  ? 1.322   -9.014  29.385 1.00 66.48  ? 33  SER D O     1 
ATOM   2318  C  CB    . SER D 4 37  ? 2.154   -11.591 31.486 1.00 69.38  ? 33  SER D CB    1 
ATOM   2319  O  OG    . SER D 4 37  ? 3.218   -10.689 31.674 1.00 69.04  ? 33  SER D OG    1 
ATOM   2320  N  N     . TYR D 4 38  ? 0.187   -9.329  31.291 1.00 64.65  ? 34  TYR D N     1 
ATOM   2321  C  CA    . TYR D 4 38  ? -0.173  -7.934  31.487 1.00 62.31  ? 34  TYR D CA    1 
ATOM   2322  C  C     . TYR D 4 38  ? 0.857   -7.146  32.300 1.00 61.08  ? 34  TYR D C     1 
ATOM   2323  O  O     . TYR D 4 38  ? 0.588   -6.027  32.727 1.00 60.45  ? 34  TYR D O     1 
ATOM   2324  C  CB    . TYR D 4 38  ? -1.492  -7.860  32.218 1.00 61.97  ? 34  TYR D CB    1 
ATOM   2325  C  CG    . TYR D 4 38  ? -2.683  -8.336  31.445 1.00 61.68  ? 34  TYR D CG    1 
ATOM   2326  C  CD1   . TYR D 4 38  ? -3.108  -9.659  31.524 1.00 61.53  ? 34  TYR D CD1   1 
ATOM   2327  C  CD2   . TYR D 4 38  ? -3.425  -7.452  30.668 1.00 60.80  ? 34  TYR D CD2   1 
ATOM   2328  C  CE1   . TYR D 4 38  ? -4.234  -10.088 30.833 1.00 60.93  ? 34  TYR D CE1   1 
ATOM   2329  C  CE2   . TYR D 4 38  ? -4.547  -7.879  29.970 1.00 59.86  ? 34  TYR D CE2   1 
ATOM   2330  C  CZ    . TYR D 4 38  ? -4.943  -9.186  30.063 1.00 59.45  ? 34  TYR D CZ    1 
ATOM   2331  O  OH    . TYR D 4 38  ? -6.052  -9.594  29.371 1.00 60.77  ? 34  TYR D OH    1 
ATOM   2332  N  N     . ALA D 4 39  ? 2.033   -7.727  32.495 1.00 59.96  ? 35  ALA D N     1 
ATOM   2333  C  CA    . ALA D 4 39  ? 3.029   -7.183  33.398 1.00 59.21  ? 35  ALA D CA    1 
ATOM   2334  C  C     . ALA D 4 39  ? 3.478   -5.769  33.072 1.00 58.71  ? 35  ALA D C     1 
ATOM   2335  O  O     . ALA D 4 39  ? 3.614   -4.940  33.976 1.00 58.44  ? 35  ALA D O     1 
ATOM   2336  C  CB    . ALA D 4 39  ? 4.230   -8.117  33.495 1.00 59.48  ? 35  ALA D CB    1 
ATOM   2337  N  N     . ILE D 4 40  ? 3.706   -5.474  31.795 1.00 58.23  ? 36  ILE D N     1 
ATOM   2338  C  CA    . ILE D 4 40  ? 4.247   -4.159  31.450 1.00 57.71  ? 36  ILE D CA    1 
ATOM   2339  C  C     . ILE D 4 40  ? 3.202   -3.098  31.718 1.00 56.80  ? 36  ILE D C     1 
ATOM   2340  O  O     . ILE D 4 40  ? 3.517   -1.992  32.161 1.00 56.66  ? 36  ILE D O     1 
ATOM   2341  C  CB    . ILE D 4 40  ? 4.848   -4.078  30.011 1.00 58.27  ? 36  ILE D CB    1 
ATOM   2342  C  CG1   . ILE D 4 40  ? 3.788   -4.317  28.933 1.00 59.65  ? 36  ILE D CG1   1 
ATOM   2343  C  CG2   . ILE D 4 40  ? 6.032   -5.071  29.850 1.00 58.87  ? 36  ILE D CG2   1 
ATOM   2344  C  CD1   . ILE D 4 40  ? 4.348   -4.235  27.521 1.00 60.21  ? 36  ILE D CD1   1 
ATOM   2345  N  N     . TYR D 4 41  ? 1.950   -3.459  31.492 1.00 55.95  ? 37  TYR D N     1 
ATOM   2346  C  CA    . TYR D 4 41  ? 0.838   -2.574  31.810 1.00 55.51  ? 37  TYR D CA    1 
ATOM   2347  C  C     . TYR D 4 41  ? 0.663   -2.378  33.300 1.00 54.49  ? 37  TYR D C     1 
ATOM   2348  O  O     . TYR D 4 41  ? 0.403   -1.265  33.739 1.00 54.91  ? 37  TYR D O     1 
ATOM   2349  C  CB    . TYR D 4 41  ? -0.443  -3.115  31.203 1.00 55.82  ? 37  TYR D CB    1 
ATOM   2350  C  CG    . TYR D 4 41  ? -0.207  -3.563  29.803 1.00 58.31  ? 37  TYR D CG    1 
ATOM   2351  C  CD1   . TYR D 4 41  ? -0.227  -4.921  29.478 1.00 60.37  ? 37  TYR D CD1   1 
ATOM   2352  C  CD2   . TYR D 4 41  ? 0.108   -2.634  28.803 1.00 60.23  ? 37  TYR D CD2   1 
ATOM   2353  C  CE1   . TYR D 4 41  ? 0.024   -5.349  28.179 1.00 63.01  ? 37  TYR D CE1   1 
ATOM   2354  C  CE2   . TYR D 4 41  ? 0.358   -3.041  27.505 1.00 62.97  ? 37  TYR D CE2   1 
ATOM   2355  C  CZ    . TYR D 4 41  ? 0.312   -4.399  27.197 1.00 64.36  ? 37  TYR D CZ    1 
ATOM   2356  O  OH    . TYR D 4 41  ? 0.550   -4.812  25.909 1.00 67.33  ? 37  TYR D OH    1 
ATOM   2357  N  N     . VAL D 4 42  ? 0.797   -3.453  34.074 1.00 53.19  ? 38  VAL D N     1 
ATOM   2358  C  CA    . VAL D 4 42  ? 0.674   -3.379  35.531 1.00 51.81  ? 38  VAL D CA    1 
ATOM   2359  C  C     . VAL D 4 42  ? 1.774   -2.469  36.047 1.00 51.76  ? 38  VAL D C     1 
ATOM   2360  O  O     . VAL D 4 42  ? 1.533   -1.582  36.871 1.00 51.08  ? 38  VAL D O     1 
ATOM   2361  C  CB    . VAL D 4 42  ? 0.756   -4.782  36.197 1.00 51.51  ? 38  VAL D CB    1 
ATOM   2362  C  CG1   . VAL D 4 42  ? 0.940   -4.661  37.687 1.00 50.46  ? 38  VAL D CG1   1 
ATOM   2363  C  CG2   . VAL D 4 42  ? -0.481  -5.607  35.871 1.00 50.32  ? 38  VAL D CG2   1 
ATOM   2364  N  N     . TYR D 4 43  ? 2.977   -2.677  35.526 1.00 51.76  ? 39  TYR D N     1 
ATOM   2365  C  CA    . TYR D 4 43  ? 4.117   -1.845  35.875 1.00 52.45  ? 39  TYR D CA    1 
ATOM   2366  C  C     . TYR D 4 43  ? 3.940   -0.342  35.534 1.00 52.73  ? 39  TYR D C     1 
ATOM   2367  O  O     . TYR D 4 43  ? 4.328   0.530   36.332 1.00 52.77  ? 39  TYR D O     1 
ATOM   2368  C  CB    . TYR D 4 43  ? 5.378   -2.404  35.234 1.00 52.77  ? 39  TYR D CB    1 
ATOM   2369  C  CG    . TYR D 4 43  ? 6.624   -1.784  35.778 1.00 55.67  ? 39  TYR D CG    1 
ATOM   2370  C  CD1   . TYR D 4 43  ? 7.036   -2.035  37.092 1.00 58.37  ? 39  TYR D CD1   1 
ATOM   2371  C  CD2   . TYR D 4 43  ? 7.392   -0.925  34.989 1.00 58.97  ? 39  TYR D CD2   1 
ATOM   2372  C  CE1   . TYR D 4 43  ? 8.181   -1.442  37.613 1.00 60.55  ? 39  TYR D CE1   1 
ATOM   2373  C  CE2   . TYR D 4 43  ? 8.545   -0.328  35.488 1.00 61.26  ? 39  TYR D CE2   1 
ATOM   2374  C  CZ    . TYR D 4 43  ? 8.937   -0.589  36.803 1.00 62.37  ? 39  TYR D CZ    1 
ATOM   2375  O  OH    . TYR D 4 43  ? 10.081  0.009   37.299 1.00 64.25  ? 39  TYR D OH    1 
ATOM   2376  N  N     . LYS D 4 44  ? 3.351   -0.029  34.373 1.00 52.57  ? 40  LYS D N     1 
ATOM   2377  C  CA    . LYS D 4 44  ? 3.065   1.369   34.035 1.00 52.61  ? 40  LYS D CA    1 
ATOM   2378  C  C     . LYS D 4 44  ? 2.133   1.958   35.074 1.00 52.33  ? 40  LYS D C     1 
ATOM   2379  O  O     . LYS D 4 44  ? 2.365   3.059   35.583 1.00 52.50  ? 40  LYS D O     1 
ATOM   2380  C  CB    . LYS D 4 44  ? 2.436   1.511   32.649 1.00 52.72  ? 40  LYS D CB    1 
ATOM   2381  C  CG    . LYS D 4 44  ? 3.439   1.433   31.505 1.00 54.93  ? 40  LYS D CG    1 
ATOM   2382  C  CD    . LYS D 4 44  ? 2.759   1.112   30.179 1.00 58.33  ? 40  LYS D CD    1 
ATOM   2383  C  CE    . LYS D 4 44  ? 3.782   0.957   29.056 1.00 61.82  ? 40  LYS D CE    1 
ATOM   2384  N  NZ    . LYS D 4 44  ? 3.164   0.487   27.761 1.00 63.75  ? 40  LYS D NZ    1 
ATOM   2385  N  N     . VAL D 4 45  ? 1.079   1.208   35.384 1.00 51.69  ? 41  VAL D N     1 
ATOM   2386  C  CA    . VAL D 4 45  ? 0.039   1.671   36.296 1.00 50.91  ? 41  VAL D CA    1 
ATOM   2387  C  C     . VAL D 4 45  ? 0.643   1.842   37.702 1.00 51.12  ? 41  VAL D C     1 
ATOM   2388  O  O     . VAL D 4 45  ? 0.388   2.837   38.406 1.00 50.85  ? 41  VAL D O     1 
ATOM   2389  C  CB    . VAL D 4 45  ? -1.162  0.699   36.287 1.00 50.78  ? 41  VAL D CB    1 
ATOM   2390  C  CG1   . VAL D 4 45  ? -2.214  1.129   37.280 1.00 50.03  ? 41  VAL D CG1   1 
ATOM   2391  C  CG2   . VAL D 4 45  ? -1.755  0.577   34.868 1.00 48.83  ? 41  VAL D CG2   1 
ATOM   2392  N  N     . LEU D 4 46  ? 1.476   0.883   38.087 1.00 50.72  ? 42  LEU D N     1 
ATOM   2393  C  CA    . LEU D 4 46  ? 2.222   0.993   39.322 1.00 50.45  ? 42  LEU D CA    1 
ATOM   2394  C  C     . LEU D 4 46  ? 3.020   2.299   39.348 1.00 50.87  ? 42  LEU D C     1 
ATOM   2395  O  O     . LEU D 4 46  ? 3.027   3.033   40.363 1.00 50.87  ? 42  LEU D O     1 
ATOM   2396  C  CB    . LEU D 4 46  ? 3.158   -0.196  39.469 1.00 49.84  ? 42  LEU D CB    1 
ATOM   2397  C  CG    . LEU D 4 46  ? 4.029   -0.207  40.725 1.00 49.70  ? 42  LEU D CG    1 
ATOM   2398  C  CD1   . LEU D 4 46  ? 3.184   -0.178  42.044 1.00 48.06  ? 42  LEU D CD1   1 
ATOM   2399  C  CD2   . LEU D 4 46  ? 5.004   -1.411  40.673 1.00 47.88  ? 42  LEU D CD2   1 
ATOM   2400  N  N     . LYS D 4 47  ? 3.671   2.597   38.223 1.00 50.94  ? 43  LYS D N     1 
ATOM   2401  C  CA    . LYS D 4 47  ? 4.514   3.779   38.147 1.00 51.05  ? 43  LYS D CA    1 
ATOM   2402  C  C     . LYS D 4 47  ? 3.711   5.043   38.278 1.00 50.65  ? 43  LYS D C     1 
ATOM   2403  O  O     . LYS D 4 47  ? 4.193   6.013   38.862 1.00 51.29  ? 43  LYS D O     1 
ATOM   2404  C  CB    . LYS D 4 47  ? 5.393   3.767   36.893 1.00 51.74  ? 43  LYS D CB    1 
ATOM   2405  C  CG    . LYS D 4 47  ? 6.672   2.921   37.106 1.00 52.61  ? 43  LYS D CG    1 
ATOM   2406  C  CD    . LYS D 4 47  ? 7.086   3.021   38.587 1.00 54.22  ? 43  LYS D CD    1 
ATOM   2407  C  CE    . LYS D 4 47  ? 8.269   2.138   38.918 1.00 57.61  ? 43  LYS D CE    1 
ATOM   2408  N  NZ    . LYS D 4 47  ? 8.766   2.368   40.305 1.00 58.89  ? 43  LYS D NZ    1 
ATOM   2409  N  N     . GLN D 4 48  ? 2.464   5.002   37.806 1.00 49.84  ? 44  GLN D N     1 
ATOM   2410  C  CA    . GLN D 4 48  ? 1.558   6.134   37.931 1.00 49.12  ? 44  GLN D CA    1 
ATOM   2411  C  C     . GLN D 4 48  ? 1.152   6.439   39.382 1.00 49.06  ? 44  GLN D C     1 
ATOM   2412  O  O     . GLN D 4 48  ? 1.085   7.609   39.767 1.00 48.71  ? 44  GLN D O     1 
ATOM   2413  C  CB    . GLN D 4 48  ? 0.313   5.940   37.076 1.00 48.91  ? 44  GLN D CB    1 
ATOM   2414  C  CG    . GLN D 4 48  ? 0.546   5.903   35.572 1.00 50.00  ? 44  GLN D CG    1 
ATOM   2415  C  CD    . GLN D 4 48  ? -0.763  5.885   34.791 1.00 53.14  ? 44  GLN D CD    1 
ATOM   2416  O  OE1   . GLN D 4 48  ? -1.751  5.260   35.216 1.00 55.08  ? 44  GLN D OE1   1 
ATOM   2417  N  NE2   . GLN D 4 48  ? -0.784  6.569   33.645 1.00 52.56  ? 44  GLN D NE2   1 
ATOM   2418  N  N     . VAL D 4 49  ? 0.900   5.397   40.183 1.00 49.12  ? 45  VAL D N     1 
ATOM   2419  C  CA    . VAL D 4 49  ? 0.327   5.567   41.529 1.00 48.78  ? 45  VAL D CA    1 
ATOM   2420  C  C     . VAL D 4 49  ? 1.380   5.589   42.633 1.00 48.88  ? 45  VAL D C     1 
ATOM   2421  O  O     . VAL D 4 49  ? 1.192   6.194   43.684 1.00 48.47  ? 45  VAL D O     1 
ATOM   2422  C  CB    . VAL D 4 49  ? -0.774  4.521   41.852 1.00 48.93  ? 45  VAL D CB    1 
ATOM   2423  C  CG1   . VAL D 4 49  ? -1.899  4.583   40.817 1.00 49.15  ? 45  VAL D CG1   1 
ATOM   2424  C  CG2   . VAL D 4 49  ? -0.196  3.110   41.938 1.00 48.77  ? 45  VAL D CG2   1 
ATOM   2425  N  N     . HIS D 4 50  ? 2.499   4.936   42.395 1.00 49.56  ? 46  HIS D N     1 
ATOM   2426  C  CA    . HIS D 4 50  ? 3.572   4.952   43.379 1.00 50.19  ? 46  HIS D CA    1 
ATOM   2427  C  C     . HIS D 4 50  ? 4.893   4.978   42.627 1.00 50.90  ? 46  HIS D C     1 
ATOM   2428  O  O     . HIS D 4 50  ? 5.465   3.919   42.354 1.00 50.72  ? 46  HIS D O     1 
ATOM   2429  C  CB    . HIS D 4 50  ? 3.494   3.747   44.302 1.00 49.19  ? 46  HIS D CB    1 
ATOM   2430  C  CG    . HIS D 4 50  ? 2.338   3.789   45.247 1.00 49.12  ? 46  HIS D CG    1 
ATOM   2431  N  ND1   . HIS D 4 50  ? 2.350   4.532   46.407 1.00 48.61  ? 46  HIS D ND1   1 
ATOM   2432  C  CD2   . HIS D 4 50  ? 1.134   3.167   45.214 1.00 50.19  ? 46  HIS D CD2   1 
ATOM   2433  C  CE1   . HIS D 4 50  ? 1.206   4.368   47.049 1.00 47.02  ? 46  HIS D CE1   1 
ATOM   2434  N  NE2   . HIS D 4 50  ? 0.448   3.547   46.345 1.00 48.89  ? 46  HIS D NE2   1 
ATOM   2435  N  N     . PRO D 4 51  ? 5.361   6.196   42.281 1.00 51.52  ? 47  PRO D N     1 
ATOM   2436  C  CA    . PRO D 4 51  ? 6.478   6.407   41.348 1.00 51.94  ? 47  PRO D CA    1 
ATOM   2437  C  C     . PRO D 4 51  ? 7.781   5.728   41.796 1.00 52.56  ? 47  PRO D C     1 
ATOM   2438  O  O     . PRO D 4 51  ? 8.555   5.273   40.945 1.00 52.49  ? 47  PRO D O     1 
ATOM   2439  C  CB    . PRO D 4 51  ? 6.635   7.939   41.324 1.00 52.01  ? 47  PRO D CB    1 
ATOM   2440  C  CG    . PRO D 4 51  ? 5.299   8.486   41.768 1.00 50.88  ? 47  PRO D CG    1 
ATOM   2441  C  CD    . PRO D 4 51  ? 4.817   7.476   42.789 1.00 51.45  ? 47  PRO D CD    1 
ATOM   2442  N  N     . ASP D 4 52  ? 8.007   5.630   43.105 1.00 53.02  ? 48  ASP D N     1 
ATOM   2443  C  CA    . ASP D 4 52  ? 9.253   5.028   43.606 1.00 54.30  ? 48  ASP D CA    1 
ATOM   2444  C  C     . ASP D 4 52  ? 9.069   3.651   44.239 1.00 54.08  ? 48  ASP D C     1 
ATOM   2445  O  O     . ASP D 4 52  ? 9.866   3.230   45.082 1.00 54.45  ? 48  ASP D O     1 
ATOM   2446  C  CB    . ASP D 4 52  ? 9.968   5.959   44.597 1.00 55.05  ? 48  ASP D CB    1 
ATOM   2447  C  CG    . ASP D 4 52  ? 10.182  7.356   44.039 1.00 57.71  ? 48  ASP D CG    1 
ATOM   2448  O  OD1   . ASP D 4 52  ? 10.516  7.480   42.823 1.00 59.92  ? 48  ASP D OD1   1 
ATOM   2449  O  OD2   . ASP D 4 52  ? 10.000  8.323   44.826 1.00 59.68  ? 48  ASP D OD2   1 
ATOM   2450  N  N     . THR D 4 53  ? 8.029   2.948   43.806 1.00 53.66  ? 49  THR D N     1 
ATOM   2451  C  CA    . THR D 4 53  ? 7.700   1.641   44.334 1.00 52.66  ? 49  THR D CA    1 
ATOM   2452  C  C     . THR D 4 53  ? 7.819   0.578   43.239 1.00 52.26  ? 49  THR D C     1 
ATOM   2453  O  O     . THR D 4 53  ? 7.326   0.752   42.117 1.00 51.69  ? 49  THR D O     1 
ATOM   2454  C  CB    . THR D 4 53  ? 6.301   1.677   44.922 1.00 52.56  ? 49  THR D CB    1 
ATOM   2455  O  OG1   . THR D 4 53  ? 6.266   2.694   45.922 1.00 53.27  ? 49  THR D OG1   1 
ATOM   2456  C  CG2   . THR D 4 53  ? 5.913   0.354   45.556 1.00 52.95  ? 49  THR D CG2   1 
ATOM   2457  N  N     . GLY D 4 54  ? 8.509   -0.506  43.580 1.00 51.66  ? 50  GLY D N     1 
ATOM   2458  C  CA    . GLY D 4 54  ? 8.610   -1.665  42.716 1.00 51.18  ? 50  GLY D CA    1 
ATOM   2459  C  C     . GLY D 4 54  ? 7.709   -2.818  43.149 1.00 50.96  ? 50  GLY D C     1 
ATOM   2460  O  O     . GLY D 4 54  ? 6.891   -2.701  44.051 1.00 50.63  ? 50  GLY D O     1 
ATOM   2461  N  N     . ILE D 4 55  ? 7.875   -3.948  42.484 1.00 50.79  ? 51  ILE D N     1 
ATOM   2462  C  CA    . ILE D 4 55  ? 7.007   -5.075  42.666 1.00 50.57  ? 51  ILE D CA    1 
ATOM   2463  C  C     . ILE D 4 55  ? 7.836   -6.338  42.409 1.00 51.08  ? 51  ILE D C     1 
ATOM   2464  O  O     . ILE D 4 55  ? 8.592   -6.402  41.432 1.00 51.42  ? 51  ILE D O     1 
ATOM   2465  C  CB    . ILE D 4 55  ? 5.790   -4.977  41.716 1.00 50.30  ? 51  ILE D CB    1 
ATOM   2466  C  CG1   . ILE D 4 55  ? 4.797   -6.117  41.985 1.00 49.78  ? 51  ILE D CG1   1 
ATOM   2467  C  CG2   . ILE D 4 55  ? 6.242   -4.925  40.262 1.00 49.01  ? 51  ILE D CG2   1 
ATOM   2468  C  CD1   . ILE D 4 55  ? 3.359   -5.862  41.526 1.00 46.24  ? 51  ILE D CD1   1 
ATOM   2469  N  N     . SER D 4 56  ? 7.711   -7.323  43.298 1.00 50.94  ? 52  SER D N     1 
ATOM   2470  C  CA    . SER D 4 56  ? 8.449   -8.579  43.158 1.00 50.78  ? 52  SER D CA    1 
ATOM   2471  C  C     . SER D 4 56  ? 7.817   -9.368  42.021 1.00 50.42  ? 52  SER D C     1 
ATOM   2472  O  O     . SER D 4 56  ? 6.692   -9.062  41.610 1.00 50.39  ? 52  SER D O     1 
ATOM   2473  C  CB    . SER D 4 56  ? 8.373   -9.393  44.441 1.00 50.66  ? 52  SER D CB    1 
ATOM   2474  O  OG    . SER D 4 56  ? 7.152   -10.118 44.462 1.00 51.02  ? 52  SER D OG    1 
ATOM   2475  N  N     . SER D 4 57  ? 8.521   -10.378 41.517 1.00 49.81  ? 53  SER D N     1 
ATOM   2476  C  CA    . SER D 4 57  ? 8.012   -11.107 40.371 1.00 50.02  ? 53  SER D CA    1 
ATOM   2477  C  C     . SER D 4 57  ? 6.824   -11.971 40.777 1.00 49.89  ? 53  SER D C     1 
ATOM   2478  O  O     . SER D 4 57  ? 5.897   -12.168 39.989 1.00 49.91  ? 53  SER D O     1 
ATOM   2479  C  CB    . SER D 4 57  ? 9.113   -11.932 39.692 1.00 50.18  ? 53  SER D CB    1 
ATOM   2480  O  OG    . SER D 4 57  ? 9.354   -13.133 40.391 1.00 51.34  ? 53  SER D OG    1 
ATOM   2481  N  N     . LYS D 4 58  ? 6.848   -12.482 42.007 1.00 49.85  ? 54  LYS D N     1 
ATOM   2482  C  CA    . LYS D 4 58  ? 5.715   -13.248 42.515 1.00 49.58  ? 54  LYS D CA    1 
ATOM   2483  C  C     . LYS D 4 58  ? 4.497   -12.360 42.708 1.00 48.68  ? 54  LYS D C     1 
ATOM   2484  O  O     . LYS D 4 58  ? 3.395   -12.761 42.337 1.00 48.66  ? 54  LYS D O     1 
ATOM   2485  C  CB    . LYS D 4 58  ? 6.061   -13.981 43.802 1.00 50.43  ? 54  LYS D CB    1 
ATOM   2486  C  CG    . LYS D 4 58  ? 6.963   -15.188 43.616 1.00 53.35  ? 54  LYS D CG    1 
ATOM   2487  C  CD    . LYS D 4 58  ? 7.548   -15.602 44.980 1.00 59.90  ? 54  LYS D CD    1 
ATOM   2488  C  CE    . LYS D 4 58  ? 8.677   -16.654 44.852 1.00 61.80  ? 54  LYS D CE    1 
ATOM   2489  N  NZ    . LYS D 4 58  ? 9.153   -17.037 46.226 1.00 63.33  ? 54  LYS D NZ    1 
ATOM   2490  N  N     . ALA D 4 59  ? 4.690   -11.150 43.256 1.00 47.59  ? 55  ALA D N     1 
ATOM   2491  C  CA    . ALA D 4 59  ? 3.597   -10.164 43.311 1.00 46.09  ? 55  ALA D CA    1 
ATOM   2492  C  C     . ALA D 4 59  ? 3.069   -9.847  41.918 1.00 45.32  ? 55  ALA D C     1 
ATOM   2493  O  O     . ALA D 4 59  ? 1.860   -9.716  41.723 1.00 45.26  ? 55  ALA D O     1 
ATOM   2494  C  CB    . ALA D 4 59  ? 4.010   -8.912  44.033 1.00 45.94  ? 55  ALA D CB    1 
ATOM   2495  N  N     . MET D 4 60  ? 3.957   -9.776  40.935 1.00 44.70  ? 56  MET D N     1 
ATOM   2496  C  CA    . MET D 4 60  ? 3.516   -9.510  39.564 1.00 44.83  ? 56  MET D CA    1 
ATOM   2497  C  C     . MET D 4 60  ? 2.735   -10.693 39.024 1.00 44.22  ? 56  MET D C     1 
ATOM   2498  O  O     . MET D 4 60  ? 1.769   -10.538 38.263 1.00 44.44  ? 56  MET D O     1 
ATOM   2499  C  CB    . MET D 4 60  ? 4.688   -9.175  38.640 1.00 44.98  ? 56  MET D CB    1 
ATOM   2500  C  CG    . MET D 4 60  ? 4.274   -8.857  37.202 1.00 46.20  ? 56  MET D CG    1 
ATOM   2501  S  SD    . MET D 4 60  ? 3.255   -7.369  37.107 1.00 51.47  ? 56  MET D SD    1 
ATOM   2502  C  CE    . MET D 4 60  ? 4.484   -6.045  37.260 1.00 48.89  ? 56  MET D CE    1 
ATOM   2503  N  N     . SER D 4 61  ? 3.128   -11.879 39.447 1.00 43.37  ? 57  SER D N     1 
ATOM   2504  C  CA    . SER D 4 61  ? 2.440   -13.063 38.971 1.00 43.39  ? 57  SER D CA    1 
ATOM   2505  C  C     . SER D 4 61  ? 1.005   -13.132 39.489 1.00 42.81  ? 57  SER D C     1 
ATOM   2506  O  O     . SER D 4 61  ? 0.082   -13.510 38.765 1.00 42.78  ? 57  SER D O     1 
ATOM   2507  C  CB    . SER D 4 61  ? 3.209   -14.302 39.349 1.00 43.45  ? 57  SER D CB    1 
ATOM   2508  O  OG    . SER D 4 61  ? 2.616   -15.389 38.686 1.00 46.02  ? 57  SER D OG    1 
ATOM   2509  N  N     . ILE D 4 62  ? 0.825   -12.743 40.744 1.00 42.27  ? 58  ILE D N     1 
ATOM   2510  C  CA    . ILE D 4 62  ? -0.502  -12.549 41.318 1.00 41.53  ? 58  ILE D CA    1 
ATOM   2511  C  C     . ILE D 4 62  ? -1.299  -11.443 40.588 1.00 41.72  ? 58  ILE D C     1 
ATOM   2512  O  O     . ILE D 4 62  ? -2.509  -11.594 40.332 1.00 40.86  ? 58  ILE D O     1 
ATOM   2513  C  CB    . ILE D 4 62  ? -0.366  -12.255 42.810 1.00 41.39  ? 58  ILE D CB    1 
ATOM   2514  C  CG1   . ILE D 4 62  ? 0.101   -13.538 43.513 1.00 40.86  ? 58  ILE D CG1   1 
ATOM   2515  C  CG2   . ILE D 4 62  ? -1.653  -11.659 43.387 1.00 39.71  ? 58  ILE D CG2   1 
ATOM   2516  C  CD1   . ILE D 4 62  ? 0.745   -13.308 44.827 1.00 41.34  ? 58  ILE D CD1   1 
ATOM   2517  N  N     . MET D 4 63  ? -0.622  -10.348 40.235 1.00 41.42  ? 59  MET D N     1 
ATOM   2518  C  CA    . MET D 4 63  ? -1.308  -9.285  39.493 1.00 41.90  ? 59  MET D CA    1 
ATOM   2519  C  C     . MET D 4 63  ? -1.736  -9.776  38.120 1.00 41.48  ? 59  MET D C     1 
ATOM   2520  O  O     . MET D 4 63  ? -2.832  -9.466  37.648 1.00 40.77  ? 59  MET D O     1 
ATOM   2521  C  CB    . MET D 4 63  ? -0.453  -8.015  39.356 1.00 42.07  ? 59  MET D CB    1 
ATOM   2522  C  CG    . MET D 4 63  ? -0.304  -7.184  40.630 1.00 42.02  ? 59  MET D CG    1 
ATOM   2523  S  SD    . MET D 4 63  ? -1.838  -6.789  41.471 1.00 44.20  ? 59  MET D SD    1 
ATOM   2524  C  CE    . MET D 4 63  ? -2.860  -6.175  40.135 1.00 43.15  ? 59  MET D CE    1 
ATOM   2525  N  N     . ASN D 4 64  ? -0.884  -10.576 37.497 1.00 41.26  ? 60  ASN D N     1 
ATOM   2526  C  CA    . ASN D 4 64  ? -1.280  -11.146 36.239 1.00 41.78  ? 60  ASN D CA    1 
ATOM   2527  C  C     . ASN D 4 64  ? -2.468  -12.096 36.328 1.00 41.76  ? 60  ASN D C     1 
ATOM   2528  O  O     . ASN D 4 64  ? -3.329  -12.105 35.434 1.00 41.35  ? 60  ASN D O     1 
ATOM   2529  C  CB    . ASN D 4 64  ? -0.130  -11.829 35.545 1.00 42.25  ? 60  ASN D CB    1 
ATOM   2530  C  CG    . ASN D 4 64  ? -0.411  -12.001 34.099 1.00 42.45  ? 60  ASN D CG    1 
ATOM   2531  O  OD1   . ASN D 4 64  ? -0.715  -11.040 33.429 1.00 45.41  ? 60  ASN D OD1   1 
ATOM   2532  N  ND2   . ASN D 4 64  ? -0.366  -13.225 33.612 1.00 44.31  ? 60  ASN D ND2   1 
ATOM   2533  N  N     . SER D 4 65  ? -2.486  -12.899 37.398 1.00 41.60  ? 61  SER D N     1 
ATOM   2534  C  CA    . SER D 4 65  ? -3.573  -13.816 37.665 1.00 41.77  ? 61  SER D CA    1 
ATOM   2535  C  C     . SER D 4 65  ? -4.862  -13.024 37.849 1.00 41.85  ? 61  SER D C     1 
ATOM   2536  O  O     . SER D 4 65  ? -5.887  -13.314 37.218 1.00 42.05  ? 61  SER D O     1 
ATOM   2537  C  CB    . SER D 4 65  ? -3.282  -14.620 38.933 1.00 42.20  ? 61  SER D CB    1 
ATOM   2538  O  OG    . SER D 4 65  ? -2.236  -15.564 38.747 1.00 43.41  ? 61  SER D OG    1 
ATOM   2539  N  N     . PHE D 4 66  ? -4.797  -12.013 38.710 1.00 41.64  ? 62  PHE D N     1 
ATOM   2540  C  CA    . PHE D 4 66  ? -5.945  -11.178 39.008 1.00 41.33  ? 62  PHE D CA    1 
ATOM   2541  C  C     . PHE D 4 66  ? -6.593  -10.636 37.748 1.00 42.13  ? 62  PHE D C     1 
ATOM   2542  O  O     . PHE D 4 66  ? -7.818  -10.735 37.609 1.00 42.24  ? 62  PHE D O     1 
ATOM   2543  C  CB    . PHE D 4 66  ? -5.534  -10.044 39.936 1.00 40.79  ? 62  PHE D CB    1 
ATOM   2544  C  CG    . PHE D 4 66  ? -6.567  -9.007  40.120 1.00 39.53  ? 62  PHE D CG    1 
ATOM   2545  C  CD1   . PHE D 4 66  ? -7.740  -9.292  40.771 1.00 40.22  ? 62  PHE D CD1   1 
ATOM   2546  C  CD2   . PHE D 4 66  ? -6.352  -7.712  39.669 1.00 41.77  ? 62  PHE D CD2   1 
ATOM   2547  C  CE1   . PHE D 4 66  ? -8.711  -8.309  40.967 1.00 40.37  ? 62  PHE D CE1   1 
ATOM   2548  C  CE2   . PHE D 4 66  ? -7.318  -6.719  39.851 1.00 40.95  ? 62  PHE D CE2   1 
ATOM   2549  C  CZ    . PHE D 4 66  ? -8.496  -7.028  40.502 1.00 41.26  ? 62  PHE D CZ    1 
ATOM   2550  N  N     . VAL D 4 67  ? -5.787  -10.073 36.832 1.00 42.77  ? 63  VAL D N     1 
ATOM   2551  C  CA    . VAL D 4 67  ? -6.327  -9.457  35.607 1.00 43.18  ? 63  VAL D CA    1 
ATOM   2552  C  C     . VAL D 4 67  ? -6.992  -10.514 34.735 1.00 43.72  ? 63  VAL D C     1 
ATOM   2553  O  O     . VAL D 4 67  ? -8.116  -10.331 34.278 1.00 43.89  ? 63  VAL D O     1 
ATOM   2554  C  CB    . VAL D 4 67  ? -5.256  -8.698  34.770 1.00 43.61  ? 63  VAL D CB    1 
ATOM   2555  C  CG1   . VAL D 4 67  ? -5.872  -8.138  33.486 1.00 42.89  ? 63  VAL D CG1   1 
ATOM   2556  C  CG2   . VAL D 4 67  ? -4.607  -7.583  35.575 1.00 42.34  ? 63  VAL D CG2   1 
ATOM   2557  N  N     . ASN D 4 68  ? -6.304  -11.629 34.525 1.00 44.17  ? 64  ASN D N     1 
ATOM   2558  C  CA    . ASN D 4 68  ? -6.887  -12.734 33.797 1.00 44.78  ? 64  ASN D CA    1 
ATOM   2559  C  C     . ASN D 4 68  ? -8.178  -13.202 34.436 1.00 44.85  ? 64  ASN D C     1 
ATOM   2560  O  O     . ASN D 4 68  ? -9.162  -13.481 33.748 1.00 44.73  ? 64  ASN D O     1 
ATOM   2561  C  CB    . ASN D 4 68  ? -5.894  -13.875 33.718 1.00 45.05  ? 64  ASN D CB    1 
ATOM   2562  C  CG    . ASN D 4 68  ? -4.783  -13.593 32.751 1.00 47.22  ? 64  ASN D CG    1 
ATOM   2563  O  OD1   . ASN D 4 68  ? -5.033  -13.289 31.584 1.00 51.11  ? 64  ASN D OD1   1 
ATOM   2564  N  ND2   . ASN D 4 68  ? -3.544  -13.664 33.225 1.00 48.43  ? 64  ASN D ND2   1 
ATOM   2565  N  N     . ASP D 4 69  ? -8.171  -13.279 35.759 1.00 45.11  ? 65  ASP D N     1 
ATOM   2566  C  CA    . ASP D 4 69  ? -9.335  -13.736 36.479 1.00 45.65  ? 65  ASP D CA    1 
ATOM   2567  C  C     . ASP D 4 69  ? -10.529 -12.815 36.252 1.00 46.14  ? 65  ASP D C     1 
ATOM   2568  O  O     . ASP D 4 69  ? -11.580 -13.263 35.800 1.00 47.17  ? 65  ASP D O     1 
ATOM   2569  C  CB    . ASP D 4 69  ? -9.022  -13.873 37.958 1.00 45.63  ? 65  ASP D CB    1 
ATOM   2570  C  CG    . ASP D 4 69  ? -10.171 -14.443 38.736 1.00 46.68  ? 65  ASP D CG    1 
ATOM   2571  O  OD1   . ASP D 4 69  ? -10.969 -15.222 38.165 1.00 48.26  ? 65  ASP D OD1   1 
ATOM   2572  O  OD2   . ASP D 4 69  ? -10.281 -14.108 39.931 1.00 49.02  ? 65  ASP D OD2   1 
ATOM   2573  N  N     . VAL D 4 70  ? -10.363 -11.525 36.528 1.00 46.10  ? 66  VAL D N     1 
ATOM   2574  C  CA    . VAL D 4 70  ? -11.437 -10.568 36.292 1.00 46.01  ? 66  VAL D CA    1 
ATOM   2575  C  C     . VAL D 4 70  ? -11.826 -10.472 34.804 1.00 46.21  ? 66  VAL D C     1 
ATOM   2576  O  O     . VAL D 4 70  ? -13.005 -10.300 34.484 1.00 46.16  ? 66  VAL D O     1 
ATOM   2577  C  CB    . VAL D 4 70  ? -11.101 -9.191  36.883 1.00 46.12  ? 66  VAL D CB    1 
ATOM   2578  C  CG1   . VAL D 4 70  ? -12.296 -8.290  36.822 1.00 46.16  ? 66  VAL D CG1   1 
ATOM   2579  C  CG2   . VAL D 4 70  ? -10.671 -9.330  38.336 1.00 46.13  ? 66  VAL D CG2   1 
ATOM   2580  N  N     . PHE D 4 71  ? -10.857 -10.605 33.900 1.00 46.45  ? 67  PHE D N     1 
ATOM   2581  C  CA    . PHE D 4 71  ? -11.169 -10.643 32.471 1.00 47.08  ? 67  PHE D CA    1 
ATOM   2582  C  C     . PHE D 4 71  ? -12.180 -11.740 32.158 1.00 47.41  ? 67  PHE D C     1 
ATOM   2583  O  O     . PHE D 4 71  ? -13.164 -11.487 31.473 1.00 47.44  ? 67  PHE D O     1 
ATOM   2584  C  CB    . PHE D 4 71  ? -9.908  -10.817 31.614 1.00 47.39  ? 67  PHE D CB    1 
ATOM   2585  C  CG    . PHE D 4 71  ? -10.185 -10.941 30.120 1.00 48.68  ? 67  PHE D CG    1 
ATOM   2586  C  CD1   . PHE D 4 71  ? -10.019 -9.847  29.271 1.00 48.79  ? 67  PHE D CD1   1 
ATOM   2587  C  CD2   . PHE D 4 71  ? -10.592 -12.157 29.562 1.00 48.78  ? 67  PHE D CD2   1 
ATOM   2588  C  CE1   . PHE D 4 71  ? -10.259 -9.962  27.900 1.00 48.56  ? 67  PHE D CE1   1 
ATOM   2589  C  CE2   . PHE D 4 71  ? -10.841 -12.275 28.193 1.00 49.22  ? 67  PHE D CE2   1 
ATOM   2590  C  CZ    . PHE D 4 71  ? -10.676 -11.174 27.363 1.00 49.10  ? 67  PHE D CZ    1 
ATOM   2591  N  N     . GLU D 4 72  ? -11.953 -12.952 32.667 1.00 48.02  ? 68  GLU D N     1 
ATOM   2592  C  CA    . GLU D 4 72  ? -12.822 -14.092 32.327 1.00 48.72  ? 68  GLU D CA    1 
ATOM   2593  C  C     . GLU D 4 72  ? -14.177 -13.980 32.987 1.00 47.82  ? 68  GLU D C     1 
ATOM   2594  O  O     . GLU D 4 72  ? -15.189 -14.311 32.390 1.00 47.72  ? 68  GLU D O     1 
ATOM   2595  C  CB    . GLU D 4 72  ? -12.184 -15.426 32.703 1.00 49.71  ? 68  GLU D CB    1 
ATOM   2596  C  CG    . GLU D 4 72  ? -10.904 -15.777 31.921 1.00 54.49  ? 68  GLU D CG    1 
ATOM   2597  C  CD    . GLU D 4 72  ? -9.996  -16.755 32.689 1.00 60.47  ? 68  GLU D CD    1 
ATOM   2598  O  OE1   . GLU D 4 72  ? -9.590  -17.781 32.101 1.00 63.31  ? 68  GLU D OE1   1 
ATOM   2599  O  OE2   . GLU D 4 72  ? -9.688  -16.506 33.882 1.00 63.15  ? 68  GLU D OE2   1 
ATOM   2600  N  N     . ARG D 4 73  ? -14.201 -13.497 34.218 1.00 47.21  ? 69  ARG D N     1 
ATOM   2601  C  CA    . ARG D 4 73  ? -15.466 -13.280 34.882 1.00 47.17  ? 69  ARG D CA    1 
ATOM   2602  C  C     . ARG D 4 73  ? -16.360 -12.263 34.160 1.00 47.60  ? 69  ARG D C     1 
ATOM   2603  O  O     . ARG D 4 73  ? -17.551 -12.533 33.945 1.00 48.25  ? 69  ARG D O     1 
ATOM   2604  C  CB    . ARG D 4 73  ? -15.239 -12.871 36.315 1.00 47.06  ? 69  ARG D CB    1 
ATOM   2605  C  CG    . ARG D 4 73  ? -14.394 -13.865 37.109 1.00 46.89  ? 69  ARG D CG    1 
ATOM   2606  C  CD    . ARG D 4 73  ? -14.818 -13.820 38.568 1.00 45.90  ? 69  ARG D CD    1 
ATOM   2607  N  NE    . ARG D 4 73  ? -13.671 -13.612 39.418 1.00 42.74  ? 69  ARG D NE    1 
ATOM   2608  C  CZ    . ARG D 4 73  ? -13.742 -13.188 40.667 1.00 41.68  ? 69  ARG D CZ    1 
ATOM   2609  N  NH1   . ARG D 4 73  ? -14.912 -12.920 41.215 1.00 40.30  ? 69  ARG D NH1   1 
ATOM   2610  N  NH2   . ARG D 4 73  ? -12.625 -13.017 41.358 1.00 42.45  ? 69  ARG D NH2   1 
ATOM   2611  N  N     . ILE D 4 74  ? -15.794 -11.123 33.750 1.00 47.43  ? 70  ILE D N     1 
ATOM   2612  C  CA    . ILE D 4 74  ? -16.572 -10.095 33.033 1.00 47.12  ? 70  ILE D CA    1 
ATOM   2613  C  C     . ILE D 4 74  ? -17.013 -10.599 31.665 1.00 47.48  ? 70  ILE D C     1 
ATOM   2614  O  O     . ILE D 4 74  ? -18.198 -10.508 31.300 1.00 47.20  ? 70  ILE D O     1 
ATOM   2615  C  CB    . ILE D 4 74  ? -15.803 -8.749  32.894 1.00 47.12  ? 70  ILE D CB    1 
ATOM   2616  C  CG1   . ILE D 4 74  ? -15.739 -8.033  34.251 1.00 45.94  ? 70  ILE D CG1   1 
ATOM   2617  C  CG2   . ILE D 4 74  ? -16.474 -7.843  31.861 1.00 45.78  ? 70  ILE D CG2   1 
ATOM   2618  C  CD1   . ILE D 4 74  ? -14.636 -7.024  34.361 1.00 44.37  ? 70  ILE D CD1   1 
ATOM   2619  N  N     . ALA D 4 75  ? -16.060 -11.144 30.917 1.00 47.65  ? 71  ALA D N     1 
ATOM   2620  C  CA    . ALA D 4 75  ? -16.364 -11.704 29.610 1.00 48.04  ? 71  ALA D CA    1 
ATOM   2621  C  C     . ALA D 4 75  ? -17.372 -12.851 29.715 1.00 48.55  ? 71  ALA D C     1 
ATOM   2622  O  O     . ALA D 4 75  ? -18.215 -13.010 28.833 1.00 48.85  ? 71  ALA D O     1 
ATOM   2623  C  CB    . ALA D 4 75  ? -15.100 -12.154 28.926 1.00 47.85  ? 71  ALA D CB    1 
ATOM   2624  N  N     . GLY D 4 76  ? -17.294 -13.634 30.795 1.00 48.83  ? 72  GLY D N     1 
ATOM   2625  C  CA    . GLY D 4 76  ? -18.207 -14.753 30.999 1.00 49.27  ? 72  GLY D CA    1 
ATOM   2626  C  C     . GLY D 4 76  ? -19.620 -14.254 31.214 1.00 49.99  ? 72  GLY D C     1 
ATOM   2627  O  O     . GLY D 4 76  ? -20.549 -14.708 30.560 1.00 49.48  ? 72  GLY D O     1 
ATOM   2628  N  N     . GLU D 4 77  ? -19.773 -13.309 32.138 1.00 50.98  ? 73  GLU D N     1 
ATOM   2629  C  CA    . GLU D 4 77  ? -21.059 -12.691 32.403 1.00 52.18  ? 73  GLU D CA    1 
ATOM   2630  C  C     . GLU D 4 77  ? -21.608 -12.031 31.146 1.00 52.83  ? 73  GLU D C     1 
ATOM   2631  O  O     . GLU D 4 77  ? -22.791 -12.196 30.838 1.00 53.51  ? 73  GLU D O     1 
ATOM   2632  C  CB    . GLU D 4 77  ? -20.938 -11.641 33.504 1.00 52.29  ? 73  GLU D CB    1 
ATOM   2633  C  CG    . GLU D 4 77  ? -20.792 -12.180 34.907 1.00 54.51  ? 73  GLU D CG    1 
ATOM   2634  C  CD    . GLU D 4 77  ? -22.118 -12.618 35.538 1.00 56.95  ? 73  GLU D CD    1 
ATOM   2635  O  OE1   . GLU D 4 77  ? -23.183 -12.597 34.862 1.00 57.25  ? 73  GLU D OE1   1 
ATOM   2636  O  OE2   . GLU D 4 77  ? -22.074 -12.989 36.731 1.00 58.65  ? 73  GLU D OE2   1 
ATOM   2637  N  N     . ALA D 4 78  ? -20.761 -11.287 30.423 1.00 53.16  ? 74  ALA D N     1 
ATOM   2638  C  CA    . ALA D 4 78  ? -21.182 -10.662 29.161 1.00 53.55  ? 74  ALA D CA    1 
ATOM   2639  C  C     . ALA D 4 78  ? -21.683 -11.710 28.178 1.00 53.87  ? 74  ALA D C     1 
ATOM   2640  O  O     . ALA D 4 78  ? -22.703 -11.505 27.522 1.00 53.85  ? 74  ALA D O     1 
ATOM   2641  C  CB    . ALA D 4 78  ? -20.063 -9.852  28.544 1.00 53.46  ? 74  ALA D CB    1 
ATOM   2642  N  N     . SER D 4 79  ? -20.971 -12.837 28.108 1.00 54.16  ? 75  SER D N     1 
ATOM   2643  C  CA    . SER D 4 79  ? -21.335 -13.949 27.242 1.00 54.51  ? 75  SER D CA    1 
ATOM   2644  C  C     . SER D 4 79  ? -22.729 -14.440 27.528 1.00 54.99  ? 75  SER D C     1 
ATOM   2645  O  O     . SER D 4 79  ? -23.556 -14.541 26.613 1.00 55.36  ? 75  SER D O     1 
ATOM   2646  C  CB    . SER D 4 79  ? -20.363 -15.103 27.413 1.00 54.42  ? 75  SER D CB    1 
ATOM   2647  O  OG    . SER D 4 79  ? -20.717 -16.153 26.534 1.00 54.89  ? 75  SER D OG    1 
ATOM   2648  N  N     . ARG D 4 80  ? -22.973 -14.750 28.802 1.00 55.61  ? 76  ARG D N     1 
ATOM   2649  C  CA    . ARG D 4 80  ? -24.273 -15.207 29.283 1.00 56.10  ? 76  ARG D CA    1 
ATOM   2650  C  C     . ARG D 4 80  ? -25.332 -14.167 28.983 1.00 56.65  ? 76  ARG D C     1 
ATOM   2651  O  O     . ARG D 4 80  ? -26.400 -14.480 28.465 1.00 56.91  ? 76  ARG D O     1 
ATOM   2652  C  CB    . ARG D 4 80  ? -24.224 -15.475 30.793 1.00 55.95  ? 76  ARG D CB    1 
ATOM   2653  C  CG    . ARG D 4 80  ? -24.201 -16.942 31.187 1.00 55.21  ? 76  ARG D CG    1 
ATOM   2654  C  CD    . ARG D 4 80  ? -23.617 -17.153 32.578 1.00 53.77  ? 76  ARG D CD    1 
ATOM   2655  N  NE    . ARG D 4 80  ? -22.195 -17.452 32.472 1.00 54.57  ? 76  ARG D NE    1 
ATOM   2656  C  CZ    . ARG D 4 80  ? -21.245 -16.920 33.237 1.00 54.47  ? 76  ARG D CZ    1 
ATOM   2657  N  NH1   . ARG D 4 80  ? -21.555 -16.042 34.189 1.00 53.91  ? 76  ARG D NH1   1 
ATOM   2658  N  NH2   . ARG D 4 80  ? -19.977 -17.253 33.028 1.00 53.30  ? 76  ARG D NH2   1 
ATOM   2659  N  N     . LEU D 4 81  ? -25.019 -12.922 29.300 1.00 57.46  ? 77  LEU D N     1 
ATOM   2660  C  CA    . LEU D 4 81  ? -25.968 -11.833 29.128 1.00 58.78  ? 77  LEU D CA    1 
ATOM   2661  C  C     . LEU D 4 81  ? -26.457 -11.708 27.669 1.00 59.52  ? 77  LEU D C     1 
ATOM   2662  O  O     . LEU D 4 81  ? -27.657 -11.559 27.415 1.00 59.31  ? 77  LEU D O     1 
ATOM   2663  C  CB    . LEU D 4 81  ? -25.336 -10.541 29.630 1.00 58.42  ? 77  LEU D CB    1 
ATOM   2664  C  CG    . LEU D 4 81  ? -26.165 -9.273  29.742 1.00 58.54  ? 77  LEU D CG    1 
ATOM   2665  C  CD1   . LEU D 4 81  ? -27.167 -9.361  30.855 1.00 57.57  ? 77  LEU D CD1   1 
ATOM   2666  C  CD2   . LEU D 4 81  ? -25.202 -8.139  29.992 1.00 60.32  ? 77  LEU D CD2   1 
ATOM   2667  N  N     . ALA D 4 82  ? -25.520 -11.797 26.728 1.00 60.72  ? 78  ALA D N     1 
ATOM   2668  C  CA    . ALA D 4 82  ? -25.839 -11.800 25.310 1.00 62.23  ? 78  ALA D CA    1 
ATOM   2669  C  C     . ALA D 4 82  ? -26.772 -12.952 24.977 1.00 63.45  ? 78  ALA D C     1 
ATOM   2670  O  O     . ALA D 4 82  ? -27.864 -12.751 24.423 1.00 63.74  ? 78  ALA D O     1 
ATOM   2671  C  CB    . ALA D 4 82  ? -24.577 -11.898 24.493 1.00 62.22  ? 78  ALA D CB    1 
ATOM   2672  N  N     . HIS D 4 83  ? -26.348 -14.158 25.338 1.00 64.88  ? 79  HIS D N     1 
ATOM   2673  C  CA    . HIS D 4 83  ? -27.136 -15.336 25.065 1.00 66.26  ? 79  HIS D CA    1 
ATOM   2674  C  C     . HIS D 4 83  ? -28.547 -15.108 25.574 1.00 66.50  ? 79  HIS D C     1 
ATOM   2675  O  O     . HIS D 4 83  ? -29.492 -15.181 24.812 1.00 66.64  ? 79  HIS D O     1 
ATOM   2676  C  CB    . HIS D 4 83  ? -26.490 -16.582 25.668 1.00 66.83  ? 79  HIS D CB    1 
ATOM   2677  C  CG    . HIS D 4 83  ? -25.295 -17.083 24.899 1.00 70.26  ? 79  HIS D CG    1 
ATOM   2678  N  ND1   . HIS D 4 83  ? -25.364 -17.463 23.571 1.00 73.33  ? 79  HIS D ND1   1 
ATOM   2679  C  CD2   . HIS D 4 83  ? -24.008 -17.294 25.281 1.00 72.33  ? 79  HIS D CD2   1 
ATOM   2680  C  CE1   . HIS D 4 83  ? -24.170 -17.869 23.165 1.00 73.77  ? 79  HIS D CE1   1 
ATOM   2681  N  NE2   . HIS D 4 83  ? -23.329 -17.775 24.183 1.00 73.42  ? 79  HIS D NE2   1 
ATOM   2682  N  N     . TYR D 4 84  ? -28.686 -14.748 26.842 1.00 67.33  ? 80  TYR D N     1 
ATOM   2683  C  CA    . TYR D 4 84  ? -30.008 -14.561 27.426 1.00 68.14  ? 80  TYR D CA    1 
ATOM   2684  C  C     . TYR D 4 84  ? -30.922 -13.662 26.587 1.00 68.29  ? 80  TYR D C     1 
ATOM   2685  O  O     . TYR D 4 84  ? -32.143 -13.833 26.602 1.00 68.29  ? 80  TYR D O     1 
ATOM   2686  C  CB    . TYR D 4 84  ? -29.914 -14.026 28.857 1.00 68.35  ? 80  TYR D CB    1 
ATOM   2687  C  CG    . TYR D 4 84  ? -29.167 -14.921 29.826 1.00 69.93  ? 80  TYR D CG    1 
ATOM   2688  C  CD1   . TYR D 4 84  ? -28.670 -14.409 31.029 1.00 71.01  ? 80  TYR D CD1   1 
ATOM   2689  C  CD2   . TYR D 4 84  ? -28.938 -16.274 29.542 1.00 71.20  ? 80  TYR D CD2   1 
ATOM   2690  C  CE1   . TYR D 4 84  ? -27.971 -15.218 31.930 1.00 71.26  ? 80  TYR D CE1   1 
ATOM   2691  C  CE2   . TYR D 4 84  ? -28.232 -17.095 30.436 1.00 71.59  ? 80  TYR D CE2   1 
ATOM   2692  C  CZ    . TYR D 4 84  ? -27.755 -16.557 31.629 1.00 72.17  ? 80  TYR D CZ    1 
ATOM   2693  O  OH    . TYR D 4 84  ? -27.072 -17.360 32.524 1.00 72.71  ? 80  TYR D OH    1 
ATOM   2694  N  N     . ASN D 4 85  ? -30.330 -12.729 25.844 1.00 68.48  ? 81  ASN D N     1 
ATOM   2695  C  CA    . ASN D 4 85  ? -31.104 -11.749 25.079 1.00 68.57  ? 81  ASN D CA    1 
ATOM   2696  C  C     . ASN D 4 85  ? -31.116 -12.001 23.574 1.00 68.85  ? 81  ASN D C     1 
ATOM   2697  O  O     . ASN D 4 85  ? -31.473 -11.116 22.786 1.00 69.03  ? 81  ASN D O     1 
ATOM   2698  C  CB    . ASN D 4 85  ? -30.592 -10.346 25.377 1.00 68.54  ? 81  ASN D CB    1 
ATOM   2699  C  CG    . ASN D 4 85  ? -30.936 -9.901  26.765 1.00 68.10  ? 81  ASN D CG    1 
ATOM   2700  O  OD1   . ASN D 4 85  ? -32.067 -9.497  27.031 1.00 68.40  ? 81  ASN D OD1   1 
ATOM   2701  N  ND2   . ASN D 4 85  ? -29.966 -9.984  27.674 1.00 67.04  ? 81  ASN D ND2   1 
ATOM   2702  N  N     . LYS D 4 86  ? -30.720 -13.211 23.183 1.00 69.04  ? 82  LYS D N     1 
ATOM   2703  C  CA    . LYS D 4 86  ? -30.657 -13.629 21.769 1.00 69.10  ? 82  LYS D CA    1 
ATOM   2704  C  C     . LYS D 4 86  ? -29.862 -12.655 20.889 1.00 68.37  ? 82  LYS D C     1 
ATOM   2705  O  O     . LYS D 4 86  ? -30.152 -12.501 19.712 1.00 68.51  ? 82  LYS D O     1 
ATOM   2706  C  CB    . LYS D 4 86  ? -32.061 -13.889 21.194 1.00 69.34  ? 82  LYS D CB    1 
ATOM   2707  C  CG    . LYS D 4 86  ? -32.985 -14.686 22.117 1.00 71.61  ? 82  LYS D CG    1 
ATOM   2708  C  CD    . LYS D 4 86  ? -34.356 -14.942 21.473 1.00 75.70  ? 82  LYS D CD    1 
ATOM   2709  C  CE    . LYS D 4 86  ? -35.533 -14.532 22.391 1.00 78.14  ? 82  LYS D CE    1 
ATOM   2710  N  NZ    . LYS D 4 86  ? -35.309 -14.818 23.859 1.00 79.83  ? 82  LYS D NZ    1 
ATOM   2711  N  N     . ARG D 4 87  ? -28.865 -12.002 21.479 1.00 67.81  ? 83  ARG D N     1 
ATOM   2712  C  CA    . ARG D 4 87  ? -27.896 -11.197 20.741 1.00 67.38  ? 83  ARG D CA    1 
ATOM   2713  C  C     . ARG D 4 87  ? -26.712 -12.070 20.396 1.00 66.69  ? 83  ARG D C     1 
ATOM   2714  O  O     . ARG D 4 87  ? -26.413 -13.034 21.107 1.00 66.72  ? 83  ARG D O     1 
ATOM   2715  C  CB    . ARG D 4 87  ? -27.375 -10.034 21.587 1.00 67.49  ? 83  ARG D CB    1 
ATOM   2716  C  CG    . ARG D 4 87  ? -28.410 -9.024  22.011 1.00 69.33  ? 83  ARG D CG    1 
ATOM   2717  C  CD    . ARG D 4 87  ? -28.587 -7.934  20.977 1.00 72.30  ? 83  ARG D CD    1 
ATOM   2718  N  NE    . ARG D 4 87  ? -29.796 -7.154  21.234 1.00 73.83  ? 83  ARG D NE    1 
ATOM   2719  C  CZ    . ARG D 4 87  ? -31.031 -7.551  20.925 1.00 74.15  ? 83  ARG D CZ    1 
ATOM   2720  N  NH1   . ARG D 4 87  ? -31.241 -8.725  20.344 1.00 74.79  ? 83  ARG D NH1   1 
ATOM   2721  N  NH2   . ARG D 4 87  ? -32.066 -6.771  21.203 1.00 74.86  ? 83  ARG D NH2   1 
ATOM   2722  N  N     . SER D 4 88  ? -26.019 -11.717 19.321 1.00 65.79  ? 84  SER D N     1 
ATOM   2723  C  CA    . SER D 4 88  ? -24.814 -12.421 18.941 1.00 64.91  ? 84  SER D CA    1 
ATOM   2724  C  C     . SER D 4 88  ? -23.610 -11.506 19.066 1.00 64.16  ? 84  SER D C     1 
ATOM   2725  O  O     . SER D 4 88  ? -22.489 -11.890 18.735 1.00 64.04  ? 84  SER D O     1 
ATOM   2726  C  CB    . SER D 4 88  ? -24.954 -12.958 17.523 1.00 65.04  ? 84  SER D CB    1 
ATOM   2727  O  OG    . SER D 4 88  ? -25.361 -11.921 16.646 1.00 66.10  ? 84  SER D OG    1 
ATOM   2728  N  N     . THR D 4 89  ? -23.834 -10.291 19.553 1.00 63.58  ? 85  THR D N     1 
ATOM   2729  C  CA    . THR D 4 89  ? -22.726 -9.349  19.723 1.00 63.41  ? 85  THR D CA    1 
ATOM   2730  C  C     . THR D 4 89  ? -22.515 -8.978  21.183 1.00 62.80  ? 85  THR D C     1 
ATOM   2731  O  O     . THR D 4 89  ? -23.472 -8.677  21.892 1.00 62.82  ? 85  THR D O     1 
ATOM   2732  C  CB    . THR D 4 89  ? -22.915 -8.027  18.922 1.00 63.27  ? 85  THR D CB    1 
ATOM   2733  O  OG1   . THR D 4 89  ? -23.363 -8.311  17.598 1.00 63.62  ? 85  THR D OG1   1 
ATOM   2734  C  CG2   . THR D 4 89  ? -21.602 -7.276  18.835 1.00 63.54  ? 85  THR D CG2   1 
ATOM   2735  N  N     . ILE D 4 90  ? -21.258 -8.991  21.617 1.00 61.99  ? 86  ILE D N     1 
ATOM   2736  C  CA    . ILE D 4 90  ? -20.893 -8.421  22.914 1.00 61.41  ? 86  ILE D CA    1 
ATOM   2737  C  C     . ILE D 4 90  ? -20.403 -6.999  22.718 1.00 60.83  ? 86  ILE D C     1 
ATOM   2738  O  O     . ILE D 4 90  ? -19.295 -6.767  22.230 1.00 61.00  ? 86  ILE D O     1 
ATOM   2739  C  CB    . ILE D 4 90  ? -19.830 -9.271  23.668 1.00 61.34  ? 86  ILE D CB    1 
ATOM   2740  C  CG1   . ILE D 4 90  ? -20.491 -10.508 24.277 1.00 61.55  ? 86  ILE D CG1   1 
ATOM   2741  C  CG2   . ILE D 4 90  ? -19.171 -8.464  24.778 1.00 60.74  ? 86  ILE D CG2   1 
ATOM   2742  C  CD1   . ILE D 4 90  ? -19.508 -11.561 24.730 1.00 62.17  ? 86  ILE D CD1   1 
ATOM   2743  N  N     . THR D 4 91  ? -21.246 -6.054  23.093 1.00 60.12  ? 87  THR D N     1 
ATOM   2744  C  CA    . THR D 4 91  ? -20.912 -4.650  22.992 1.00 59.89  ? 87  THR D CA    1 
ATOM   2745  C  C     . THR D 4 91  ? -20.556 -4.096  24.371 1.00 60.10  ? 87  THR D C     1 
ATOM   2746  O  O     . THR D 4 91  ? -20.710 -4.782  25.395 1.00 60.75  ? 87  THR D O     1 
ATOM   2747  C  CB    . THR D 4 91  ? -22.078 -3.831  22.390 1.00 59.77  ? 87  THR D CB    1 
ATOM   2748  O  OG1   . THR D 4 91  ? -23.043 -3.533  23.408 1.00 59.30  ? 87  THR D OG1   1 
ATOM   2749  C  CG2   . THR D 4 91  ? -22.749 -4.595  21.244 1.00 59.83  ? 87  THR D CG2   1 
ATOM   2750  N  N     . SER D 4 92  ? -20.103 -2.847  24.397 1.00 59.50  ? 88  SER D N     1 
ATOM   2751  C  CA    . SER D 4 92  ? -19.661 -2.204  25.615 1.00 59.15  ? 88  SER D CA    1 
ATOM   2752  C  C     . SER D 4 92  ? -20.793 -2.143  26.624 1.00 58.70  ? 88  SER D C     1 
ATOM   2753  O  O     . SER D 4 92  ? -20.552 -2.048  27.821 1.00 58.79  ? 88  SER D O     1 
ATOM   2754  C  CB    . SER D 4 92  ? -19.146 -0.798  25.310 1.00 59.50  ? 88  SER D CB    1 
ATOM   2755  O  OG    . SER D 4 92  ? -20.226 0.119   25.204 1.00 59.98  ? 88  SER D OG    1 
ATOM   2756  N  N     . ARG D 4 93  ? -22.025 -2.204  26.131 1.00 58.34  ? 89  ARG D N     1 
ATOM   2757  C  CA    . ARG D 4 93  ? -23.205 -2.279  26.993 1.00 57.99  ? 89  ARG D CA    1 
ATOM   2758  C  C     . ARG D 4 93  ? -23.301 -3.622  27.749 1.00 57.55  ? 89  ARG D C     1 
ATOM   2759  O  O     . ARG D 4 93  ? -23.728 -3.671  28.893 1.00 57.44  ? 89  ARG D O     1 
ATOM   2760  C  CB    . ARG D 4 93  ? -24.471 -2.007  26.185 1.00 57.82  ? 89  ARG D CB    1 
ATOM   2761  C  CG    . ARG D 4 93  ? -25.663 -1.678  27.044 1.00 58.36  ? 89  ARG D CG    1 
ATOM   2762  C  CD    . ARG D 4 93  ? -26.870 -1.284  26.214 1.00 60.65  ? 89  ARG D CD    1 
ATOM   2763  N  NE    . ARG D 4 93  ? -28.042 -1.110  27.069 1.00 61.76  ? 89  ARG D NE    1 
ATOM   2764  C  CZ    . ARG D 4 93  ? -28.939 -2.060  27.307 1.00 62.19  ? 89  ARG D CZ    1 
ATOM   2765  N  NH1   . ARG D 4 93  ? -28.812 -3.263  26.746 1.00 61.52  ? 89  ARG D NH1   1 
ATOM   2766  N  NH2   . ARG D 4 93  ? -29.967 -1.800  28.105 1.00 63.07  ? 89  ARG D NH2   1 
ATOM   2767  N  N     . GLU D 4 94  ? -22.900 -4.711  27.102 1.00 57.31  ? 90  GLU D N     1 
ATOM   2768  C  CA    . GLU D 4 94  ? -22.828 -6.011  27.774 1.00 56.37  ? 90  GLU D CA    1 
ATOM   2769  C  C     . GLU D 4 94  ? -21.737 -6.007  28.847 1.00 55.56  ? 90  GLU D C     1 
ATOM   2770  O  O     . GLU D 4 94  ? -21.962 -6.454  29.971 1.00 55.54  ? 90  GLU D O     1 
ATOM   2771  C  CB    . GLU D 4 94  ? -22.605 -7.136  26.763 1.00 56.23  ? 90  GLU D CB    1 
ATOM   2772  C  CG    . GLU D 4 94  ? -23.882 -7.597  26.054 1.00 57.76  ? 90  GLU D CG    1 
ATOM   2773  C  CD    . GLU D 4 94  ? -24.492 -6.524  25.150 1.00 58.80  ? 90  GLU D CD    1 
ATOM   2774  O  OE1   . GLU D 4 94  ? -25.710 -6.259  25.243 1.00 59.12  ? 90  GLU D OE1   1 
ATOM   2775  O  OE2   . GLU D 4 94  ? -23.743 -5.936  24.358 1.00 59.21  ? 90  GLU D OE2   1 
ATOM   2776  N  N     . ILE D 4 95  ? -20.561 -5.495  28.502 1.00 54.47  ? 91  ILE D N     1 
ATOM   2777  C  CA    . ILE D 4 95  ? -19.480 -5.369  29.469 1.00 53.49  ? 91  ILE D CA    1 
ATOM   2778  C  C     . ILE D 4 95  ? -19.956 -4.518  30.641 1.00 53.23  ? 91  ILE D C     1 
ATOM   2779  O  O     . ILE D 4 95  ? -19.689 -4.829  31.815 1.00 53.34  ? 91  ILE D O     1 
ATOM   2780  C  CB    . ILE D 4 95  ? -18.251 -4.712  28.834 1.00 53.49  ? 91  ILE D CB    1 
ATOM   2781  C  CG1   . ILE D 4 95  ? -17.885 -5.401  27.496 1.00 53.71  ? 91  ILE D CG1   1 
ATOM   2782  C  CG2   . ILE D 4 95  ? -17.094 -4.660  29.820 1.00 52.25  ? 91  ILE D CG2   1 
ATOM   2783  C  CD1   . ILE D 4 95  ? -17.271 -6.791  27.613 1.00 55.31  ? 91  ILE D CD1   1 
ATOM   2784  N  N     . GLN D 4 96  ? -20.693 -3.460  30.315 1.00 52.56  ? 92  GLN D N     1 
ATOM   2785  C  CA    . GLN D 4 96  ? -21.203 -2.550  31.329 1.00 51.84  ? 92  GLN D CA    1 
ATOM   2786  C  C     . GLN D 4 96  ? -22.106 -3.261  32.315 1.00 50.55  ? 92  GLN D C     1 
ATOM   2787  O  O     . GLN D 4 96  ? -21.901 -3.166  33.515 1.00 50.59  ? 92  GLN D O     1 
ATOM   2788  C  CB    . GLN D 4 96  ? -21.931 -1.351  30.714 1.00 52.04  ? 92  GLN D CB    1 
ATOM   2789  C  CG    . GLN D 4 96  ? -22.528 -0.444  31.791 1.00 54.80  ? 92  GLN D CG    1 
ATOM   2790  C  CD    . GLN D 4 96  ? -22.668 0.996   31.365 1.00 57.42  ? 92  GLN D CD    1 
ATOM   2791  O  OE1   . GLN D 4 96  ? -23.782 1.472   31.146 1.00 59.12  ? 92  GLN D OE1   1 
ATOM   2792  N  NE2   . GLN D 4 96  ? -21.543 1.705   31.253 1.00 56.36  ? 92  GLN D NE2   1 
ATOM   2793  N  N     . THR D 4 97  ? -23.094 -3.976  31.813 1.00 49.36  ? 93  THR D N     1 
ATOM   2794  C  CA    . THR D 4 97  ? -23.950 -4.737  32.680 1.00 49.43  ? 93  THR D CA    1 
ATOM   2795  C  C     . THR D 4 97  ? -23.176 -5.818  33.468 1.00 49.12  ? 93  THR D C     1 
ATOM   2796  O  O     . THR D 4 97  ? -23.413 -6.003  34.666 1.00 48.59  ? 93  THR D O     1 
ATOM   2797  C  CB    . THR D 4 97  ? -25.086 -5.337  31.891 1.00 49.67  ? 93  THR D CB    1 
ATOM   2798  O  OG1   . THR D 4 97  ? -25.801 -4.265  31.256 1.00 51.18  ? 93  THR D OG1   1 
ATOM   2799  C  CG2   . THR D 4 97  ? -26.032 -6.138  32.813 1.00 49.15  ? 93  THR D CG2   1 
ATOM   2800  N  N     . ALA D 4 98  ? -22.235 -6.488  32.802 1.00 48.69  ? 94  ALA D N     1 
ATOM   2801  C  CA    . ALA D 4 98  ? -21.425 -7.533  33.427 1.00 48.64  ? 94  ALA D CA    1 
ATOM   2802  C  C     . ALA D 4 98  ? -20.680 -6.973  34.620 1.00 48.91  ? 94  ALA D C     1 
ATOM   2803  O  O     . ALA D 4 98  ? -20.531 -7.638  35.644 1.00 48.76  ? 94  ALA D O     1 
ATOM   2804  C  CB    . ALA D 4 98  ? -20.446 -8.108  32.431 1.00 48.50  ? 94  ALA D CB    1 
ATOM   2805  N  N     . VAL D 4 99  ? -20.219 -5.738  34.478 1.00 49.05  ? 95  VAL D N     1 
ATOM   2806  C  CA    . VAL D 4 99  ? -19.467 -5.080  35.529 1.00 49.32  ? 95  VAL D CA    1 
ATOM   2807  C  C     . VAL D 4 99  ? -20.372 -4.788  36.731 1.00 49.70  ? 95  VAL D C     1 
ATOM   2808  O  O     . VAL D 4 99  ? -19.964 -4.954  37.887 1.00 49.20  ? 95  VAL D O     1 
ATOM   2809  C  CB    . VAL D 4 99  ? -18.792 -3.799  34.975 1.00 49.71  ? 95  VAL D CB    1 
ATOM   2810  C  CG1   . VAL D 4 99  ? -18.218 -2.945  36.091 1.00 48.10  ? 95  VAL D CG1   1 
ATOM   2811  C  CG2   . VAL D 4 99  ? -17.710 -4.174  33.925 1.00 48.63  ? 95  VAL D CG2   1 
ATOM   2812  N  N     . ARG D 4 100 ? -21.609 -4.390  36.442 1.00 50.12  ? 96  ARG D N     1 
ATOM   2813  C  CA    . ARG D 4 100 ? -22.584 -4.081  37.486 1.00 50.83  ? 96  ARG D CA    1 
ATOM   2814  C  C     . ARG D 4 100 ? -23.010 -5.348  38.204 1.00 50.26  ? 96  ARG D C     1 
ATOM   2815  O  O     . ARG D 4 100 ? -23.263 -5.326  39.411 1.00 50.81  ? 96  ARG D O     1 
ATOM   2816  C  CB    . ARG D 4 100 ? -23.812 -3.370  36.905 1.00 51.54  ? 96  ARG D CB    1 
ATOM   2817  C  CG    . ARG D 4 100 ? -23.528 -1.970  36.372 1.00 54.89  ? 96  ARG D CG    1 
ATOM   2818  C  CD    . ARG D 4 100 ? -24.809 -1.140  36.258 1.00 62.22  ? 96  ARG D CD    1 
ATOM   2819  N  NE    . ARG D 4 100 ? -24.526 0.303   36.274 1.00 68.32  ? 96  ARG D NE    1 
ATOM   2820  C  CZ    . ARG D 4 100 ? -24.828 1.160   35.283 1.00 71.07  ? 96  ARG D CZ    1 
ATOM   2821  N  NH1   . ARG D 4 100 ? -25.441 0.748   34.162 1.00 71.07  ? 96  ARG D NH1   1 
ATOM   2822  N  NH2   . ARG D 4 100 ? -24.514 2.446   35.424 1.00 73.06  ? 96  ARG D NH2   1 
ATOM   2823  N  N     . LEU D 4 101 ? -23.077 -6.447  37.460 1.00 49.40  ? 97  LEU D N     1 
ATOM   2824  C  CA    . LEU D 4 101 ? -23.408 -7.732  38.036 1.00 49.01  ? 97  LEU D CA    1 
ATOM   2825  C  C     . LEU D 4 101 ? -22.252 -8.257  38.863 1.00 49.36  ? 97  LEU D C     1 
ATOM   2826  O  O     . LEU D 4 101 ? -22.443 -8.729  39.980 1.00 49.88  ? 97  LEU D O     1 
ATOM   2827  C  CB    . LEU D 4 101 ? -23.764 -8.734  36.951 1.00 48.27  ? 97  LEU D CB    1 
ATOM   2828  C  CG    . LEU D 4 101 ? -25.133 -8.506  36.324 1.00 47.34  ? 97  LEU D CG    1 
ATOM   2829  C  CD1   . LEU D 4 101 ? -25.238 -9.282  35.026 1.00 45.87  ? 97  LEU D CD1   1 
ATOM   2830  C  CD2   . LEU D 4 101 ? -26.254 -8.884  37.287 1.00 46.62  ? 97  LEU D CD2   1 
ATOM   2831  N  N     . LEU D 4 102 ? -21.047 -8.134  38.330 1.00 49.50  ? 98  LEU D N     1 
ATOM   2832  C  CA    . LEU D 4 102 ? -19.888 -8.738  38.949 1.00 49.62  ? 98  LEU D CA    1 
ATOM   2833  C  C     . LEU D 4 102 ? -19.313 -7.976  40.146 1.00 49.44  ? 98  LEU D C     1 
ATOM   2834  O  O     . LEU D 4 102 ? -18.998 -8.577  41.169 1.00 49.73  ? 98  LEU D O     1 
ATOM   2835  C  CB    . LEU D 4 102 ? -18.808 -8.966  37.901 1.00 49.61  ? 98  LEU D CB    1 
ATOM   2836  C  CG    . LEU D 4 102 ? -17.652 -9.859  38.342 1.00 51.78  ? 98  LEU D CG    1 
ATOM   2837  C  CD1   . LEU D 4 102 ? -18.062 -11.337 38.319 1.00 53.55  ? 98  LEU D CD1   1 
ATOM   2838  C  CD2   . LEU D 4 102 ? -16.428 -9.615  37.456 1.00 53.47  ? 98  LEU D CD2   1 
ATOM   2839  N  N     . LEU D 4 103 ? -19.167 -6.664  40.024 1.00 49.29  ? 99  LEU D N     1 
ATOM   2840  C  CA    . LEU D 4 103 ? -18.410 -5.913  41.017 1.00 49.08  ? 99  LEU D CA    1 
ATOM   2841  C  C     . LEU D 4 103 ? -19.306 -5.436  42.147 1.00 49.04  ? 99  LEU D C     1 
ATOM   2842  O  O     . LEU D 4 103 ? -20.501 -5.260  41.944 1.00 49.27  ? 99  LEU D O     1 
ATOM   2843  C  CB    . LEU D 4 103 ? -17.677 -4.742  40.354 1.00 49.17  ? 99  LEU D CB    1 
ATOM   2844  C  CG    . LEU D 4 103 ? -16.597 -5.104  39.336 1.00 49.19  ? 99  LEU D CG    1 
ATOM   2845  C  CD1   . LEU D 4 103 ? -15.972 -3.873  38.759 1.00 51.29  ? 99  LEU D CD1   1 
ATOM   2846  C  CD2   . LEU D 4 103 ? -15.539 -5.869  40.019 1.00 51.33  ? 99  LEU D CD2   1 
ATOM   2847  N  N     . PRO D 4 104 ? -18.737 -5.256  43.351 1.00 49.19  ? 100 PRO D N     1 
ATOM   2848  C  CA    . PRO D 4 104 ? -19.523 -4.716  44.453 1.00 49.43  ? 100 PRO D CA    1 
ATOM   2849  C  C     . PRO D 4 104 ? -19.676 -3.206  44.402 1.00 50.37  ? 100 PRO D C     1 
ATOM   2850  O  O     . PRO D 4 104 ? -18.730 -2.483  44.051 1.00 50.54  ? 100 PRO D O     1 
ATOM   2851  C  CB    . PRO D 4 104 ? -18.729 -5.123  45.697 1.00 49.19  ? 100 PRO D CB    1 
ATOM   2852  C  CG    . PRO D 4 104 ? -17.350 -5.365  45.234 1.00 48.74  ? 100 PRO D CG    1 
ATOM   2853  C  CD    . PRO D 4 104 ? -17.443 -5.808  43.806 1.00 49.27  ? 100 PRO D CD    1 
ATOM   2854  N  N     . GLY D 4 105 ? -20.880 -2.762  44.767 1.00 51.20  ? 101 GLY D N     1 
ATOM   2855  C  CA    . GLY D 4 105 ? -21.257 -1.361  44.900 1.00 51.53  ? 101 GLY D CA    1 
ATOM   2856  C  C     . GLY D 4 105 ? -20.317 -0.301  44.396 1.00 51.97  ? 101 GLY D C     1 
ATOM   2857  O  O     . GLY D 4 105 ? -20.431 0.141   43.251 1.00 52.33  ? 101 GLY D O     1 
ATOM   2858  N  N     . GLU D 4 106 ? -19.388 0.116   45.244 1.00 52.18  ? 102 GLU D N     1 
ATOM   2859  C  CA    . GLU D 4 106 ? -18.593 1.291   44.943 1.00 52.71  ? 102 GLU D CA    1 
ATOM   2860  C  C     . GLU D 4 106 ? -17.575 1.050   43.845 1.00 52.65  ? 102 GLU D C     1 
ATOM   2861  O  O     . GLU D 4 106 ? -17.280 1.962   43.083 1.00 53.37  ? 102 GLU D O     1 
ATOM   2862  C  CB    . GLU D 4 106 ? -17.931 1.823   46.207 1.00 52.92  ? 102 GLU D CB    1 
ATOM   2863  C  CG    . GLU D 4 106 ? -17.434 3.274   46.123 1.00 56.78  ? 102 GLU D CG    1 
ATOM   2864  C  CD    . GLU D 4 106 ? -18.555 4.318   45.967 1.00 61.21  ? 102 GLU D CD    1 
ATOM   2865  O  OE1   . GLU D 4 106 ? -19.759 3.995   46.135 1.00 61.14  ? 102 GLU D OE1   1 
ATOM   2866  O  OE2   . GLU D 4 106 ? -18.209 5.485   45.672 1.00 64.08  ? 102 GLU D OE2   1 
ATOM   2867  N  N     . LEU D 4 107 ? -17.027 -0.161  43.752 1.00 52.64  ? 103 LEU D N     1 
ATOM   2868  C  CA    . LEU D 4 107 ? -16.085 -0.459  42.675 1.00 52.50  ? 103 LEU D CA    1 
ATOM   2869  C  C     . LEU D 4 107 ? -16.823 -0.466  41.336 1.00 52.76  ? 103 LEU D C     1 
ATOM   2870  O  O     . LEU D 4 107 ? -16.304 0.011   40.334 1.00 52.32  ? 103 LEU D O     1 
ATOM   2871  C  CB    . LEU D 4 107 ? -15.362 -1.795  42.893 1.00 52.25  ? 103 LEU D CB    1 
ATOM   2872  C  CG    . LEU D 4 107 ? -14.234 -1.968  43.923 1.00 51.32  ? 103 LEU D CG    1 
ATOM   2873  C  CD1   . LEU D 4 107 ? -13.936 -3.460  44.154 1.00 49.70  ? 103 LEU D CD1   1 
ATOM   2874  C  CD2   . LEU D 4 107 ? -12.966 -1.248  43.532 1.00 48.65  ? 103 LEU D CD2   1 
ATOM   2875  N  N     . ALA D 4 108 ? -18.038 -1.009  41.338 1.00 53.25  ? 104 ALA D N     1 
ATOM   2876  C  CA    . ALA D 4 108 ? -18.872 -1.053  40.151 1.00 54.08  ? 104 ALA D CA    1 
ATOM   2877  C  C     . ALA D 4 108 ? -19.091 0.365   39.611 1.00 55.15  ? 104 ALA D C     1 
ATOM   2878  O  O     . ALA D 4 108 ? -18.842 0.641   38.423 1.00 55.41  ? 104 ALA D O     1 
ATOM   2879  C  CB    . ALA D 4 108 ? -20.183 -1.708  40.475 1.00 53.68  ? 104 ALA D CB    1 
ATOM   2880  N  N     . LYS D 4 109 ? -19.516 1.264   40.504 1.00 56.00  ? 105 LYS D N     1 
ATOM   2881  C  CA    . LYS D 4 109 ? -19.791 2.655   40.169 1.00 56.58  ? 105 LYS D CA    1 
ATOM   2882  C  C     . LYS D 4 109 ? -18.598 3.298   39.482 1.00 56.27  ? 105 LYS D C     1 
ATOM   2883  O  O     . LYS D 4 109 ? -18.726 3.863   38.392 1.00 56.87  ? 105 LYS D O     1 
ATOM   2884  C  CB    . LYS D 4 109 ? -20.161 3.429   41.427 1.00 56.67  ? 105 LYS D CB    1 
ATOM   2885  C  CG    . LYS D 4 109 ? -20.694 4.837   41.173 1.00 59.95  ? 105 LYS D CG    1 
ATOM   2886  C  CD    . LYS D 4 109 ? -21.179 5.516   42.468 1.00 64.43  ? 105 LYS D CD    1 
ATOM   2887  C  CE    . LYS D 4 109 ? -22.380 4.774   43.094 1.00 67.27  ? 105 LYS D CE    1 
ATOM   2888  N  NZ    . LYS D 4 109 ? -22.744 5.309   44.458 1.00 68.23  ? 105 LYS D NZ    1 
ATOM   2889  N  N     . HIS D 4 110 ? -17.437 3.185   40.098 1.00 55.81  ? 106 HIS D N     1 
ATOM   2890  C  CA    . HIS D 4 110 ? -16.254 3.813   39.550 1.00 56.04  ? 106 HIS D CA    1 
ATOM   2891  C  C     . HIS D 4 110 ? -15.714 3.168   38.296 1.00 55.38  ? 106 HIS D C     1 
ATOM   2892  O  O     . HIS D 4 110 ? -15.143 3.865   37.466 1.00 56.13  ? 106 HIS D O     1 
ATOM   2893  C  CB    . HIS D 4 110 ? -15.150 3.858   40.577 1.00 56.53  ? 106 HIS D CB    1 
ATOM   2894  C  CG    . HIS D 4 110 ? -15.380 4.856   41.661 1.00 60.09  ? 106 HIS D CG    1 
ATOM   2895  N  ND1   . HIS D 4 110 ? -15.749 4.491   42.940 1.00 63.05  ? 106 HIS D ND1   1 
ATOM   2896  C  CD2   . HIS D 4 110 ? -15.282 6.207   41.662 1.00 62.68  ? 106 HIS D CD2   1 
ATOM   2897  C  CE1   . HIS D 4 110 ? -15.861 5.575   43.686 1.00 63.84  ? 106 HIS D CE1   1 
ATOM   2898  N  NE2   . HIS D 4 110 ? -15.583 6.629   42.935 1.00 65.06  ? 106 HIS D NE2   1 
ATOM   2899  N  N     . ALA D 4 111 ? -15.862 1.853   38.157 1.00 54.67  ? 107 ALA D N     1 
ATOM   2900  C  CA    . ALA D 4 111 ? -15.389 1.159   36.954 1.00 53.84  ? 107 ALA D CA    1 
ATOM   2901  C  C     . ALA D 4 111 ? -16.261 1.548   35.779 1.00 53.46  ? 107 ALA D C     1 
ATOM   2902  O  O     . ALA D 4 111 ? -15.758 1.726   34.683 1.00 52.94  ? 107 ALA D O     1 
ATOM   2903  C  CB    . ALA D 4 111 ? -15.370 -0.359  37.147 1.00 53.46  ? 107 ALA D CB    1 
ATOM   2904  N  N     . VAL D 4 112 ? -17.562 1.695   36.030 1.00 53.45  ? 108 VAL D N     1 
ATOM   2905  C  CA    . VAL D 4 112 ? -18.516 2.148   35.018 1.00 54.09  ? 108 VAL D CA    1 
ATOM   2906  C  C     . VAL D 4 112 ? -18.146 3.539   34.462 1.00 54.99  ? 108 VAL D C     1 
ATOM   2907  O  O     . VAL D 4 112 ? -18.153 3.745   33.239 1.00 55.09  ? 108 VAL D O     1 
ATOM   2908  C  CB    . VAL D 4 112 ? -19.969 2.107   35.552 1.00 53.95  ? 108 VAL D CB    1 
ATOM   2909  C  CG1   . VAL D 4 112 ? -20.913 2.923   34.694 1.00 52.48  ? 108 VAL D CG1   1 
ATOM   2910  C  CG2   . VAL D 4 112 ? -20.452 0.665   35.655 1.00 53.84  ? 108 VAL D CG2   1 
ATOM   2911  N  N     . SER D 4 113 ? -17.801 4.473   35.349 1.00 55.64  ? 109 SER D N     1 
ATOM   2912  C  CA    . SER D 4 113 ? -17.270 5.784   34.925 1.00 56.70  ? 109 SER D CA    1 
ATOM   2913  C  C     . SER D 4 113 ? -16.117 5.648   33.951 1.00 56.89  ? 109 SER D C     1 
ATOM   2914  O  O     . SER D 4 113 ? -16.192 6.133   32.819 1.00 57.48  ? 109 SER D O     1 
ATOM   2915  C  CB    . SER D 4 113 ? -16.783 6.613   36.116 1.00 56.32  ? 109 SER D CB    1 
ATOM   2916  O  OG    . SER D 4 113 ? -17.877 7.064   36.869 1.00 57.57  ? 109 SER D OG    1 
ATOM   2917  N  N     . GLU D 4 114 ? -15.058 4.987   34.409 1.00 57.23  ? 110 GLU D N     1 
ATOM   2918  C  CA    . GLU D 4 114 ? -13.820 4.841   33.641 1.00 57.81  ? 110 GLU D CA    1 
ATOM   2919  C  C     . GLU D 4 114 ? -14.045 4.129   32.304 1.00 57.76  ? 110 GLU D C     1 
ATOM   2920  O  O     . GLU D 4 114 ? -13.400 4.439   31.317 1.00 57.58  ? 110 GLU D O     1 
ATOM   2921  C  CB    . GLU D 4 114 ? -12.778 4.098   34.471 1.00 57.69  ? 110 GLU D CB    1 
ATOM   2922  C  CG    . GLU D 4 114 ? -12.407 4.784   35.763 1.00 59.60  ? 110 GLU D CG    1 
ATOM   2923  C  CD    . GLU D 4 114 ? -11.070 5.505   35.682 1.00 63.91  ? 110 GLU D CD    1 
ATOM   2924  O  OE1   . GLU D 4 114 ? -10.983 6.574   35.028 1.00 65.29  ? 110 GLU D OE1   1 
ATOM   2925  O  OE2   . GLU D 4 114 ? -10.095 5.004   36.294 1.00 66.06  ? 110 GLU D OE2   1 
ATOM   2926  N  N     . GLY D 4 115 ? -14.974 3.184   32.283 1.00 58.18  ? 111 GLY D N     1 
ATOM   2927  C  CA    . GLY D 4 115 ? -15.301 2.478   31.060 1.00 59.14  ? 111 GLY D CA    1 
ATOM   2928  C  C     . GLY D 4 115 ? -16.046 3.383   30.097 1.00 59.62  ? 111 GLY D C     1 
ATOM   2929  O  O     . GLY D 4 115 ? -15.697 3.469   28.926 1.00 59.00  ? 111 GLY D O     1 
ATOM   2930  N  N     . THR D 4 116 ? -17.077 4.050   30.612 1.00 60.39  ? 112 THR D N     1 
ATOM   2931  C  CA    . THR D 4 116 ? -17.881 4.985   29.843 1.00 61.47  ? 112 THR D CA    1 
ATOM   2932  C  C     . THR D 4 116 ? -16.974 6.065   29.279 1.00 62.18  ? 112 THR D C     1 
ATOM   2933  O  O     . THR D 4 116 ? -16.891 6.268   28.059 1.00 62.10  ? 112 THR D O     1 
ATOM   2934  C  CB    . THR D 4 116 ? -18.939 5.646   30.732 1.00 61.19  ? 112 THR D CB    1 
ATOM   2935  O  OG1   . THR D 4 116 ? -19.814 4.638   31.257 1.00 62.41  ? 112 THR D OG1   1 
ATOM   2936  C  CG2   . THR D 4 116 ? -19.760 6.636   29.931 1.00 61.60  ? 112 THR D CG2   1 
ATOM   2937  N  N     . LYS D 4 117 ? -16.283 6.728   30.199 1.00 62.84  ? 113 LYS D N     1 
ATOM   2938  C  CA    . LYS D 4 117 ? -15.274 7.717   29.885 1.00 63.78  ? 113 LYS D CA    1 
ATOM   2939  C  C     . LYS D 4 117 ? -14.372 7.274   28.744 1.00 63.86  ? 113 LYS D C     1 
ATOM   2940  O  O     . LYS D 4 117 ? -14.270 7.974   27.760 1.00 64.29  ? 113 LYS D O     1 
ATOM   2941  C  CB    . LYS D 4 117 ? -14.455 8.004   31.142 1.00 64.10  ? 113 LYS D CB    1 
ATOM   2942  C  CG    . LYS D 4 117 ? -13.417 9.082   31.032 1.00 64.65  ? 113 LYS D CG    1 
ATOM   2943  C  CD    . LYS D 4 117 ? -12.836 9.287   32.411 1.00 66.97  ? 113 LYS D CD    1 
ATOM   2944  C  CE    . LYS D 4 117 ? -12.168 10.634  32.519 1.00 70.11  ? 113 LYS D CE    1 
ATOM   2945  N  NZ    . LYS D 4 117 ? -10.920 10.660  31.696 1.00 72.43  ? 113 LYS D NZ    1 
ATOM   2946  N  N     . ALA D 4 118 ? -13.737 6.114   28.865 1.00 64.39  ? 114 ALA D N     1 
ATOM   2947  C  CA    . ALA D 4 118 ? -12.810 5.649   27.832 1.00 65.07  ? 114 ALA D CA    1 
ATOM   2948  C  C     . ALA D 4 118 ? -13.501 5.444   26.478 1.00 65.38  ? 114 ALA D C     1 
ATOM   2949  O  O     . ALA D 4 118 ? -12.977 5.846   25.439 1.00 65.20  ? 114 ALA D O     1 
ATOM   2950  C  CB    . ALA D 4 118 ? -12.087 4.385   28.272 1.00 64.75  ? 114 ALA D CB    1 
ATOM   2951  N  N     . VAL D 4 119 ? -14.679 4.831   26.503 1.00 66.15  ? 115 VAL D N     1 
ATOM   2952  C  CA    . VAL D 4 119 ? -15.441 4.570   25.284 1.00 67.13  ? 115 VAL D CA    1 
ATOM   2953  C  C     . VAL D 4 119 ? -15.758 5.883   24.566 1.00 67.98  ? 115 VAL D C     1 
ATOM   2954  O  O     . VAL D 4 119 ? -15.413 6.060   23.397 1.00 68.09  ? 115 VAL D O     1 
ATOM   2955  C  CB    . VAL D 4 119 ? -16.728 3.782   25.583 1.00 67.06  ? 115 VAL D CB    1 
ATOM   2956  C  CG1   . VAL D 4 119 ? -17.673 3.783   24.369 1.00 66.44  ? 115 VAL D CG1   1 
ATOM   2957  C  CG2   . VAL D 4 119 ? -16.373 2.354   26.009 1.00 66.78  ? 115 VAL D CG2   1 
ATOM   2958  N  N     . THR D 4 120 ? -16.394 6.795   25.290 1.00 69.03  ? 116 THR D N     1 
ATOM   2959  C  CA    . THR D 4 120 ? -16.640 8.154   24.824 1.00 70.21  ? 116 THR D CA    1 
ATOM   2960  C  C     . THR D 4 120 ? -15.395 8.826   24.234 1.00 71.06  ? 116 THR D C     1 
ATOM   2961  O  O     . THR D 4 120 ? -15.460 9.380   23.140 1.00 71.67  ? 116 THR D O     1 
ATOM   2962  C  CB    . THR D 4 120 ? -17.208 9.023   25.951 1.00 69.99  ? 116 THR D CB    1 
ATOM   2963  O  OG1   . THR D 4 120 ? -18.460 8.470   26.389 1.00 70.28  ? 116 THR D OG1   1 
ATOM   2964  C  CG2   . THR D 4 120 ? -17.471 10.397  25.446 1.00 70.65  ? 116 THR D CG2   1 
ATOM   2965  N  N     . LYS D 4 121 ? -14.270 8.779   24.942 1.00 72.03  ? 117 LYS D N     1 
ATOM   2966  C  CA    . LYS D 4 121 ? -13.045 9.373   24.419 1.00 72.96  ? 117 LYS D CA    1 
ATOM   2967  C  C     . LYS D 4 121 ? -12.621 8.658   23.146 1.00 74.10  ? 117 LYS D C     1 
ATOM   2968  O  O     . LYS D 4 121 ? -12.174 9.294   22.205 1.00 74.55  ? 117 LYS D O     1 
ATOM   2969  C  CB    . LYS D 4 121 ? -11.909 9.396   25.460 1.00 72.63  ? 117 LYS D CB    1 
ATOM   2970  C  CG    . LYS D 4 121 ? -10.495 9.500   24.854 1.00 72.08  ? 117 LYS D CG    1 
ATOM   2971  C  CD    . LYS D 4 121 ? -9.503  10.323  25.694 1.00 71.28  ? 117 LYS D CD    1 
ATOM   2972  C  CE    . LYS D 4 121 ? -8.131  10.403  24.969 1.00 71.53  ? 117 LYS D CE    1 
ATOM   2973  N  NZ    . LYS D 4 121 ? -7.232  11.541  25.387 1.00 69.42  ? 117 LYS D NZ    1 
ATOM   2974  N  N     . TYR D 4 122 ? -12.787 7.340   23.108 1.00 75.53  ? 118 TYR D N     1 
ATOM   2975  C  CA    . TYR D 4 122 ? -12.320 6.551   21.972 1.00 76.70  ? 118 TYR D CA    1 
ATOM   2976  C  C     . TYR D 4 122 ? -13.101 6.888   20.710 1.00 78.07  ? 118 TYR D C     1 
ATOM   2977  O  O     . TYR D 4 122 ? -12.544 6.870   19.611 1.00 78.05  ? 118 TYR D O     1 
ATOM   2978  C  CB    . TYR D 4 122 ? -12.413 5.060   22.280 1.00 76.13  ? 118 TYR D CB    1 
ATOM   2979  C  CG    . TYR D 4 122 ? -12.150 4.148   21.091 1.00 75.41  ? 118 TYR D CG    1 
ATOM   2980  C  CD1   . TYR D 4 122 ? -10.854 3.736   20.776 1.00 74.07  ? 118 TYR D CD1   1 
ATOM   2981  C  CD2   . TYR D 4 122 ? -13.203 3.680   20.297 1.00 73.52  ? 118 TYR D CD2   1 
ATOM   2982  C  CE1   . TYR D 4 122 ? -10.611 2.888   19.694 1.00 74.05  ? 118 TYR D CE1   1 
ATOM   2983  C  CE2   . TYR D 4 122 ? -12.970 2.840   19.224 1.00 72.99  ? 118 TYR D CE2   1 
ATOM   2984  C  CZ    . TYR D 4 122 ? -11.673 2.448   18.927 1.00 73.85  ? 118 TYR D CZ    1 
ATOM   2985  O  OH    . TYR D 4 122 ? -11.432 1.613   17.859 1.00 75.70  ? 118 TYR D OH    1 
ATOM   2986  N  N     . THR D 4 123 ? -14.385 7.190   20.888 1.00 79.97  ? 119 THR D N     1 
ATOM   2987  C  CA    . THR D 4 123 ? -15.283 7.518   19.791 1.00 82.09  ? 119 THR D CA    1 
ATOM   2988  C  C     . THR D 4 123 ? -14.936 8.880   19.199 1.00 83.50  ? 119 THR D C     1 
ATOM   2989  O  O     . THR D 4 123 ? -14.795 9.011   17.980 1.00 83.96  ? 119 THR D O     1 
ATOM   2990  C  CB    . THR D 4 123 ? -16.759 7.518   20.251 1.00 82.09  ? 119 THR D CB    1 
ATOM   2991  O  OG1   . THR D 4 123 ? -17.015 6.349   21.035 1.00 82.33  ? 119 THR D OG1   1 
ATOM   2992  C  CG2   . THR D 4 123 ? -17.701 7.525   19.048 1.00 82.51  ? 119 THR D CG2   1 
ATOM   2993  N  N     . SER D 4 124 ? -14.787 9.882   20.062 1.00 85.14  ? 120 SER D N     1 
ATOM   2994  C  CA    . SER D 4 124 ? -14.492 11.245  19.620 1.00 86.92  ? 120 SER D CA    1 
ATOM   2995  C  C     . SER D 4 124 ? -13.026 11.432  19.217 1.00 87.98  ? 120 SER D C     1 
ATOM   2996  O  O     . SER D 4 124 ? -12.705 12.343  18.446 1.00 88.11  ? 120 SER D O     1 
ATOM   2997  C  CB    . SER D 4 124 ? -14.865 12.264  20.701 1.00 86.87  ? 120 SER D CB    1 
ATOM   2998  O  OG    . SER D 4 124 ? -13.739 12.555  21.526 1.00 87.50  ? 120 SER D OG    1 
ATOM   2999  N  N     . ALA D 4 125 ? -12.143 10.588  19.752 1.00 89.31  ? 121 ALA D N     1 
ATOM   3000  C  CA    . ALA D 4 125 ? -10.722 10.650  19.405 1.00 90.83  ? 121 ALA D CA    1 
ATOM   3001  C  C     . ALA D 4 125 ? -10.459 10.135  17.989 1.00 91.91  ? 121 ALA D C     1 
ATOM   3002  O  O     . ALA D 4 125 ? -9.538  10.618  17.313 1.00 92.43  ? 121 ALA D O     1 
ATOM   3003  C  CB    . ALA D 4 125 ? -9.866  9.901   20.421 1.00 90.65  ? 121 ALA D CB    1 
ATOM   3004  N  N     . LYS D 4 126 ? -11.274 9.175   17.542 1.00 92.87  ? 122 LYS D N     1 
ATOM   3005  C  CA    . LYS D 4 126 ? -11.132 8.595   16.203 1.00 93.87  ? 122 LYS D CA    1 
ATOM   3006  C  C     . LYS D 4 126 ? -11.679 9.526   15.117 1.00 94.38  ? 122 LYS D C     1 
ATOM   3007  O  O     . LYS D 4 126 ? -11.003 9.805   14.109 1.00 94.64  ? 122 LYS D O     1 
ATOM   3008  C  CB    . LYS D 4 126 ? -11.824 7.229   16.116 1.00 94.07  ? 122 LYS D CB    1 
ATOM   3009  C  CG    . LYS D 4 126 ? -11.241 6.340   15.027 1.00 94.80  ? 122 LYS D CG    1 
ATOM   3010  C  CD    . LYS D 4 126 ? -12.069 5.096   14.768 1.00 95.31  ? 122 LYS D CD    1 
ATOM   3011  C  CE    . LYS D 4 126 ? -11.375 4.227   13.716 1.00 95.47  ? 122 LYS D CE    1 
ATOM   3012  N  NZ    . LYS D 4 126 ? -12.306 3.242   13.111 1.00 95.66  ? 122 LYS D NZ    1 
ATOM   3013  O  OXT   . LYS D 4 126 ? -12.815 10.016  15.226 1.00 94.77  ? 122 LYS D OXT   1 
ATOM   3014  N  N     . PRO E 1 39  ? 14.227  -22.064 87.688 1.00 86.41  ? 38  PRO E N     1 
ATOM   3015  C  CA    . PRO E 1 39  ? 13.990  -21.820 86.261 1.00 86.17  ? 38  PRO E CA    1 
ATOM   3016  C  C     . PRO E 1 39  ? 12.681  -21.071 86.022 1.00 85.77  ? 38  PRO E C     1 
ATOM   3017  O  O     . PRO E 1 39  ? 11.791  -21.090 86.877 1.00 85.99  ? 38  PRO E O     1 
ATOM   3018  C  CB    . PRO E 1 39  ? 13.914  -23.232 85.657 1.00 86.11  ? 38  PRO E CB    1 
ATOM   3019  C  CG    . PRO E 1 39  ? 13.860  -24.200 86.839 1.00 86.53  ? 38  PRO E CG    1 
ATOM   3020  C  CD    . PRO E 1 39  ? 13.750  -23.393 88.107 1.00 86.55  ? 38  PRO E CD    1 
ATOM   3021  N  N     . HIS E 1 40  ? 12.584  -20.413 84.867 1.00 85.04  ? 39  HIS E N     1 
ATOM   3022  C  CA    . HIS E 1 40  ? 11.416  -19.607 84.505 1.00 84.11  ? 39  HIS E CA    1 
ATOM   3023  C  C     . HIS E 1 40  ? 10.478  -20.409 83.601 1.00 82.72  ? 39  HIS E C     1 
ATOM   3024  O  O     . HIS E 1 40  ? 10.938  -21.155 82.715 1.00 82.62  ? 39  HIS E O     1 
ATOM   3025  C  CB    . HIS E 1 40  ? 11.878  -18.335 83.787 1.00 84.84  ? 39  HIS E CB    1 
ATOM   3026  C  CG    . HIS E 1 40  ? 10.865  -17.230 83.776 1.00 86.79  ? 39  HIS E CG    1 
ATOM   3027  N  ND1   . HIS E 1 40  ? 10.276  -16.775 82.612 1.00 88.50  ? 39  HIS E ND1   1 
ATOM   3028  C  CD2   . HIS E 1 40  ? 10.353  -16.476 84.783 1.00 88.39  ? 39  HIS E CD2   1 
ATOM   3029  C  CE1   . HIS E 1 40  ? 9.442   -15.789 82.902 1.00 89.28  ? 39  HIS E CE1   1 
ATOM   3030  N  NE2   . HIS E 1 40  ? 9.467   -15.590 84.213 1.00 89.67  ? 39  HIS E NE2   1 
ATOM   3031  N  N     . ARG E 1 41  ? 9.169   -20.267 83.835 1.00 80.56  ? 40  ARG E N     1 
ATOM   3032  C  CA    . ARG E 1 41  ? 8.150   -20.949 83.021 1.00 78.23  ? 40  ARG E CA    1 
ATOM   3033  C  C     . ARG E 1 41  ? 7.001   -20.024 82.673 1.00 76.37  ? 40  ARG E C     1 
ATOM   3034  O  O     . ARG E 1 41  ? 6.453   -19.349 83.547 1.00 76.47  ? 40  ARG E O     1 
ATOM   3035  C  CB    . ARG E 1 41  ? 7.598   -22.195 83.729 1.00 78.49  ? 40  ARG E CB    1 
ATOM   3036  C  CG    . ARG E 1 41  ? 8.579   -23.353 83.808 1.00 78.88  ? 40  ARG E CG    1 
ATOM   3037  C  CD    . ARG E 1 41  ? 7.947   -24.608 84.378 1.00 79.38  ? 40  ARG E CD    1 
ATOM   3038  N  NE    . ARG E 1 41  ? 7.706   -25.617 83.346 1.00 80.16  ? 40  ARG E NE    1 
ATOM   3039  C  CZ    . ARG E 1 41  ? 6.502   -26.015 82.951 1.00 79.92  ? 40  ARG E CZ    1 
ATOM   3040  N  NH1   . ARG E 1 41  ? 5.411   -25.499 83.507 1.00 80.52  ? 40  ARG E NH1   1 
ATOM   3041  N  NH2   . ARG E 1 41  ? 6.392   -26.936 82.005 1.00 78.36  ? 40  ARG E NH2   1 
ATOM   3042  N  N     . TYR E 1 42  ? 6.631   -19.994 81.397 1.00 73.75  ? 41  TYR E N     1 
ATOM   3043  C  CA    . TYR E 1 42  ? 5.451   -19.241 81.001 1.00 71.13  ? 41  TYR E CA    1 
ATOM   3044  C  C     . TYR E 1 42  ? 4.203   -20.048 81.334 1.00 69.86  ? 41  TYR E C     1 
ATOM   3045  O  O     . TYR E 1 42  ? 4.230   -21.277 81.341 1.00 69.40  ? 41  TYR E O     1 
ATOM   3046  C  CB    . TYR E 1 42  ? 5.518   -18.837 79.525 1.00 70.67  ? 41  TYR E CB    1 
ATOM   3047  C  CG    . TYR E 1 42  ? 6.577   -17.794 79.269 1.00 68.92  ? 41  TYR E CG    1 
ATOM   3048  C  CD1   . TYR E 1 42  ? 7.806   -18.142 78.731 1.00 68.23  ? 41  TYR E CD1   1 
ATOM   3049  C  CD2   . TYR E 1 42  ? 6.362   -16.461 79.605 1.00 68.24  ? 41  TYR E CD2   1 
ATOM   3050  C  CE1   . TYR E 1 42  ? 8.786   -17.189 78.509 1.00 68.24  ? 41  TYR E CE1   1 
ATOM   3051  C  CE2   . TYR E 1 42  ? 7.332   -15.502 79.387 1.00 68.07  ? 41  TYR E CE2   1 
ATOM   3052  C  CZ    . TYR E 1 42  ? 8.542   -15.872 78.839 1.00 68.29  ? 41  TYR E CZ    1 
ATOM   3053  O  OH    . TYR E 1 42  ? 9.513   -14.920 78.623 1.00 70.53  ? 41  TYR E OH    1 
ATOM   3054  N  N     . ARG E 1 43  ? 3.125   -19.344 81.652 1.00 68.40  ? 42  ARG E N     1 
ATOM   3055  C  CA    . ARG E 1 43  ? 1.857   -19.975 81.985 1.00 67.21  ? 42  ARG E CA    1 
ATOM   3056  C  C     . ARG E 1 43  ? 1.160   -20.502 80.720 1.00 65.92  ? 42  ARG E C     1 
ATOM   3057  O  O     . ARG E 1 43  ? 1.322   -19.932 79.642 1.00 66.18  ? 42  ARG E O     1 
ATOM   3058  C  CB    . ARG E 1 43  ? 0.986   -18.999 82.787 1.00 67.49  ? 42  ARG E CB    1 
ATOM   3059  C  CG    . ARG E 1 43  ? 1.501   -18.814 84.221 1.00 69.09  ? 42  ARG E CG    1 
ATOM   3060  C  CD    . ARG E 1 43  ? 1.035   -17.536 84.879 1.00 72.61  ? 42  ARG E CD    1 
ATOM   3061  N  NE    . ARG E 1 43  ? -0.317  -17.645 85.428 1.00 76.54  ? 42  ARG E NE    1 
ATOM   3062  C  CZ    . ARG E 1 43  ? -1.327  -16.834 85.099 1.00 78.13  ? 42  ARG E CZ    1 
ATOM   3063  N  NH1   . ARG E 1 43  ? -1.136  -15.839 84.234 1.00 79.06  ? 42  ARG E NH1   1 
ATOM   3064  N  NH2   . ARG E 1 43  ? -2.529  -17.006 85.643 1.00 78.51  ? 42  ARG E NH2   1 
ATOM   3065  N  N     . PRO E 1 44  ? 0.403   -21.606 80.840 1.00 64.53  ? 43  PRO E N     1 
ATOM   3066  C  CA    . PRO E 1 44  ? -0.244  -22.237 79.698 1.00 63.41  ? 43  PRO E CA    1 
ATOM   3067  C  C     . PRO E 1 44  ? -1.148  -21.277 78.929 1.00 62.36  ? 43  PRO E C     1 
ATOM   3068  O  O     . PRO E 1 44  ? -2.126  -20.755 79.483 1.00 62.34  ? 43  PRO E O     1 
ATOM   3069  C  CB    . PRO E 1 44  ? -1.090  -23.333 80.350 1.00 63.50  ? 43  PRO E CB    1 
ATOM   3070  C  CG    . PRO E 1 44  ? -0.402  -23.643 81.595 1.00 63.34  ? 43  PRO E CG    1 
ATOM   3071  C  CD    . PRO E 1 44  ? 0.062   -22.310 82.088 1.00 64.64  ? 43  PRO E CD    1 
ATOM   3072  N  N     . GLY E 1 45  ? -0.818  -21.049 77.661 1.00 60.97  ? 44  GLY E N     1 
ATOM   3073  C  CA    . GLY E 1 45  ? -1.575  -20.122 76.841 1.00 59.04  ? 44  GLY E CA    1 
ATOM   3074  C  C     . GLY E 1 45  ? -0.760  -18.914 76.444 1.00 57.83  ? 44  GLY E C     1 
ATOM   3075  O  O     . GLY E 1 45  ? -1.026  -18.298 75.419 1.00 58.16  ? 44  GLY E O     1 
ATOM   3076  N  N     . THR E 1 46  ? 0.229   -18.564 77.259 1.00 56.27  ? 45  THR E N     1 
ATOM   3077  C  CA    . THR E 1 46  ? 1.076   -17.419 76.970 1.00 54.64  ? 45  THR E CA    1 
ATOM   3078  C  C     . THR E 1 46  ? 1.898   -17.688 75.723 1.00 53.74  ? 45  THR E C     1 
ATOM   3079  O  O     . THR E 1 46  ? 1.971   -16.839 74.841 1.00 54.30  ? 45  THR E O     1 
ATOM   3080  C  CB    . THR E 1 46  ? 2.013   -17.080 78.164 1.00 54.70  ? 45  THR E CB    1 
ATOM   3081  O  OG1   . THR E 1 46  ? 1.224   -16.796 79.321 1.00 55.16  ? 45  THR E OG1   1 
ATOM   3082  C  CG2   . THR E 1 46  ? 2.893   -15.887 77.867 1.00 53.18  ? 45  THR E CG2   1 
ATOM   3083  N  N     . VAL E 1 47  ? 2.525   -18.858 75.654 1.00 52.56  ? 46  VAL E N     1 
ATOM   3084  C  CA    . VAL E 1 47  ? 3.373   -19.190 74.511 1.00 51.67  ? 46  VAL E CA    1 
ATOM   3085  C  C     . VAL E 1 47  ? 2.503   -19.405 73.281 1.00 51.17  ? 46  VAL E C     1 
ATOM   3086  O  O     . VAL E 1 47  ? 2.885   -19.019 72.161 1.00 50.71  ? 46  VAL E O     1 
ATOM   3087  C  CB    . VAL E 1 47  ? 4.285   -20.419 74.776 1.00 51.57  ? 46  VAL E CB    1 
ATOM   3088  C  CG1   . VAL E 1 47  ? 5.215   -20.693 73.595 1.00 50.22  ? 46  VAL E CG1   1 
ATOM   3089  C  CG2   . VAL E 1 47  ? 5.113   -20.181 76.009 1.00 52.09  ? 46  VAL E CG2   1 
ATOM   3090  N  N     . ALA E 1 48  ? 1.329   -20.001 73.502 1.00 50.31  ? 47  ALA E N     1 
ATOM   3091  C  CA    . ALA E 1 48  ? 0.367   -20.203 72.426 1.00 49.98  ? 47  ALA E CA    1 
ATOM   3092  C  C     . ALA E 1 48  ? -0.025  -18.871 71.741 1.00 49.58  ? 47  ALA E C     1 
ATOM   3093  O  O     . ALA E 1 48  ? 0.006   -18.773 70.504 1.00 49.54  ? 47  ALA E O     1 
ATOM   3094  C  CB    . ALA E 1 48  ? -0.848  -20.980 72.914 1.00 49.56  ? 47  ALA E CB    1 
ATOM   3095  N  N     . LEU E 1 49  ? -0.340  -17.850 72.537 1.00 48.93  ? 48  LEU E N     1 
ATOM   3096  C  CA    . LEU E 1 49  ? -0.657  -16.518 71.997 1.00 49.09  ? 48  LEU E CA    1 
ATOM   3097  C  C     . LEU E 1 49  ? 0.533   -15.917 71.255 1.00 49.06  ? 48  LEU E C     1 
ATOM   3098  O  O     . LEU E 1 49  ? 0.366   -15.265 70.223 1.00 49.55  ? 48  LEU E O     1 
ATOM   3099  C  CB    . LEU E 1 49  ? -1.133  -15.569 73.091 1.00 48.63  ? 48  LEU E CB    1 
ATOM   3100  C  CG    . LEU E 1 49  ? -2.529  -15.835 73.649 1.00 50.23  ? 48  LEU E CG    1 
ATOM   3101  C  CD1   . LEU E 1 49  ? -2.766  -15.085 74.958 1.00 50.19  ? 48  LEU E CD1   1 
ATOM   3102  C  CD2   . LEU E 1 49  ? -3.609  -15.470 72.637 1.00 52.86  ? 48  LEU E CD2   1 
ATOM   3103  N  N     . ARG E 1 50  ? 1.731   -16.151 71.770 1.00 48.73  ? 49  ARG E N     1 
ATOM   3104  C  CA    . ARG E 1 50  ? 2.940   -15.726 71.095 1.00 49.24  ? 49  ARG E CA    1 
ATOM   3105  C  C     . ARG E 1 50  ? 3.021   -16.343 69.687 1.00 49.18  ? 49  ARG E C     1 
ATOM   3106  O  O     . ARG E 1 50  ? 3.349   -15.671 68.697 1.00 49.29  ? 49  ARG E O     1 
ATOM   3107  C  CB    . ARG E 1 50  ? 4.146   -16.149 71.926 1.00 49.77  ? 49  ARG E CB    1 
ATOM   3108  C  CG    . ARG E 1 50  ? 5.394   -15.316 71.711 1.00 50.97  ? 49  ARG E CG    1 
ATOM   3109  C  CD    . ARG E 1 50  ? 6.700   -16.097 71.994 1.00 53.71  ? 49  ARG E CD    1 
ATOM   3110  N  NE    . ARG E 1 50  ? 6.973   -16.473 73.387 1.00 55.47  ? 49  ARG E NE    1 
ATOM   3111  C  CZ    . ARG E 1 50  ? 6.474   -15.891 74.479 1.00 58.43  ? 49  ARG E CZ    1 
ATOM   3112  N  NH1   . ARG E 1 50  ? 5.647   -14.840 74.397 1.00 58.67  ? 49  ARG E NH1   1 
ATOM   3113  N  NH2   . ARG E 1 50  ? 6.829   -16.365 75.676 1.00 58.19  ? 49  ARG E NH2   1 
ATOM   3114  N  N     . GLU E 1 51  ? 2.691   -17.623 69.600 1.00 48.97  ? 50  GLU E N     1 
ATOM   3115  C  CA    . GLU E 1 51  ? 2.800   -18.342 68.345 1.00 48.96  ? 50  GLU E CA    1 
ATOM   3116  C  C     . GLU E 1 51  ? 1.743   -17.843 67.365 1.00 47.92  ? 50  GLU E C     1 
ATOM   3117  O  O     . GLU E 1 51  ? 2.009   -17.728 66.163 1.00 47.56  ? 50  GLU E O     1 
ATOM   3118  C  CB    . GLU E 1 51  ? 2.686   -19.852 68.577 1.00 49.75  ? 50  GLU E CB    1 
ATOM   3119  C  CG    . GLU E 1 51  ? 3.917   -20.505 69.200 1.00 51.61  ? 50  GLU E CG    1 
ATOM   3120  C  CD    . GLU E 1 51  ? 3.681   -21.981 69.496 1.00 56.49  ? 50  GLU E CD    1 
ATOM   3121  O  OE1   . GLU E 1 51  ? 4.338   -22.537 70.413 1.00 58.45  ? 50  GLU E OE1   1 
ATOM   3122  O  OE2   . GLU E 1 51  ? 2.822   -22.593 68.815 1.00 59.24  ? 50  GLU E OE2   1 
ATOM   3123  N  N     . ILE E 1 52  ? 0.559   -17.516 67.881 1.00 46.64  ? 51  ILE E N     1 
ATOM   3124  C  CA    . ILE E 1 52  ? -0.470  -16.911 67.042 1.00 45.82  ? 51  ILE E CA    1 
ATOM   3125  C  C     . ILE E 1 52  ? 0.047   -15.633 66.359 1.00 45.95  ? 51  ILE E C     1 
ATOM   3126  O  O     . ILE E 1 52  ? 0.065   -15.566 65.125 1.00 45.99  ? 51  ILE E O     1 
ATOM   3127  C  CB    . ILE E 1 52  ? -1.780  -16.663 67.802 1.00 45.57  ? 51  ILE E CB    1 
ATOM   3128  C  CG1   . ILE E 1 52  ? -2.373  -18.007 68.256 1.00 43.96  ? 51  ILE E CG1   1 
ATOM   3129  C  CG2   . ILE E 1 52  ? -2.767  -15.864 66.923 1.00 45.12  ? 51  ILE E CG2   1 
ATOM   3130  C  CD1   . ILE E 1 52  ? -3.647  -17.916 69.020 1.00 40.17  ? 51  ILE E CD1   1 
ATOM   3131  N  N     . ARG E 1 53  ? 0.518   -14.661 67.144 1.00 45.43  ? 52  ARG E N     1 
ATOM   3132  C  CA    . ARG E 1 53  ? 1.054   -13.408 66.584 1.00 45.69  ? 52  ARG E CA    1 
ATOM   3133  C  C     . ARG E 1 53  ? 2.145   -13.652 65.546 1.00 45.41  ? 52  ARG E C     1 
ATOM   3134  O  O     . ARG E 1 53  ? 2.159   -13.023 64.506 1.00 45.36  ? 52  ARG E O     1 
ATOM   3135  C  CB    . ARG E 1 53  ? 1.559   -12.469 67.699 1.00 45.77  ? 52  ARG E CB    1 
ATOM   3136  C  CG    . ARG E 1 53  ? 0.458   -12.060 68.702 1.00 47.78  ? 52  ARG E CG    1 
ATOM   3137  C  CD    . ARG E 1 53  ? 0.934   -11.184 69.843 1.00 52.17  ? 52  ARG E CD    1 
ATOM   3138  N  NE    . ARG E 1 53  ? 0.141   -11.421 71.060 1.00 55.83  ? 52  ARG E NE    1 
ATOM   3139  C  CZ    . ARG E 1 53  ? -1.012  -10.807 71.341 1.00 58.75  ? 52  ARG E CZ    1 
ATOM   3140  N  NH1   . ARG E 1 53  ? -1.530  -9.899  70.496 1.00 59.76  ? 52  ARG E NH1   1 
ATOM   3141  N  NH2   . ARG E 1 53  ? -1.659  -11.101 72.465 1.00 57.90  ? 52  ARG E NH2   1 
ATOM   3142  N  N     . ARG E 1 54  ? 3.043   -14.584 65.843 1.00 45.65  ? 53  ARG E N     1 
ATOM   3143  C  CA    . ARG E 1 54  ? 4.189   -14.867 65.012 1.00 45.84  ? 53  ARG E CA    1 
ATOM   3144  C  C     . ARG E 1 54  ? 3.748   -15.420 63.671 1.00 45.84  ? 53  ARG E C     1 
ATOM   3145  O  O     . ARG E 1 54  ? 4.168   -14.937 62.624 1.00 46.10  ? 53  ARG E O     1 
ATOM   3146  C  CB    . ARG E 1 54  ? 5.093   -15.891 65.700 1.00 46.14  ? 53  ARG E CB    1 
ATOM   3147  C  CG    . ARG E 1 54  ? 6.255   -16.315 64.818 1.00 48.26  ? 53  ARG E CG    1 
ATOM   3148  C  CD    . ARG E 1 54  ? 6.996   -17.539 65.309 1.00 52.71  ? 53  ARG E CD    1 
ATOM   3149  N  NE    . ARG E 1 54  ? 7.958   -17.956 64.279 1.00 56.93  ? 53  ARG E NE    1 
ATOM   3150  C  CZ    . ARG E 1 54  ? 8.871   -18.922 64.405 1.00 57.70  ? 53  ARG E CZ    1 
ATOM   3151  N  NH1   . ARG E 1 54  ? 8.990   -19.623 65.538 1.00 57.18  ? 53  ARG E NH1   1 
ATOM   3152  N  NH2   . ARG E 1 54  ? 9.676   -19.180 63.380 1.00 57.34  ? 53  ARG E NH2   1 
ATOM   3153  N  N     . TYR E 1 55  ? 2.892   -16.436 63.708 1.00 45.45  ? 54  TYR E N     1 
ATOM   3154  C  CA    . TYR E 1 55  ? 2.484   -17.094 62.482 1.00 44.94  ? 54  TYR E CA    1 
ATOM   3155  C  C     . TYR E 1 55  ? 1.487   -16.284 61.660 1.00 44.97  ? 54  TYR E C     1 
ATOM   3156  O  O     . TYR E 1 55  ? 1.445   -16.447 60.433 1.00 45.29  ? 54  TYR E O     1 
ATOM   3157  C  CB    . TYR E 1 55  ? 2.006   -18.535 62.753 1.00 44.53  ? 54  TYR E CB    1 
ATOM   3158  C  CG    . TYR E 1 55  ? 3.154   -19.417 63.141 1.00 42.97  ? 54  TYR E CG    1 
ATOM   3159  C  CD1   . TYR E 1 55  ? 3.218   -20.007 64.399 1.00 42.59  ? 54  TYR E CD1   1 
ATOM   3160  C  CD2   . TYR E 1 55  ? 4.207   -19.617 62.273 1.00 42.70  ? 54  TYR E CD2   1 
ATOM   3161  C  CE1   . TYR E 1 55  ? 4.292   -20.791 64.770 1.00 42.12  ? 54  TYR E CE1   1 
ATOM   3162  C  CE2   . TYR E 1 55  ? 5.288   -20.396 62.634 1.00 44.56  ? 54  TYR E CE2   1 
ATOM   3163  C  CZ    . TYR E 1 55  ? 5.328   -20.978 63.879 1.00 43.96  ? 54  TYR E CZ    1 
ATOM   3164  O  OH    . TYR E 1 55  ? 6.422   -21.746 64.202 1.00 46.11  ? 54  TYR E OH    1 
ATOM   3165  N  N     . GLN E 1 56  ? 0.701   -15.437 62.334 1.00 44.62  ? 55  GLN E N     1 
ATOM   3166  C  CA    . GLN E 1 56  ? -0.223  -14.510 61.672 1.00 44.96  ? 55  GLN E CA    1 
ATOM   3167  C  C     . GLN E 1 56  ? 0.505   -13.350 61.007 1.00 45.89  ? 55  GLN E C     1 
ATOM   3168  O  O     . GLN E 1 56  ? -0.035  -12.695 60.120 1.00 46.79  ? 55  GLN E O     1 
ATOM   3169  C  CB    . GLN E 1 56  ? -1.292  -14.002 62.633 1.00 43.74  ? 55  GLN E CB    1 
ATOM   3170  C  CG    . GLN E 1 56  ? -2.408  -15.016 62.786 1.00 43.82  ? 55  GLN E CG    1 
ATOM   3171  C  CD    . GLN E 1 56  ? -3.563  -14.524 63.602 1.00 41.60  ? 55  GLN E CD    1 
ATOM   3172  O  OE1   . GLN E 1 56  ? -3.505  -13.446 64.172 1.00 43.59  ? 55  GLN E OE1   1 
ATOM   3173  N  NE2   . GLN E 1 56  ? -4.630  -15.309 63.660 1.00 39.17  ? 55  GLN E NE2   1 
ATOM   3174  N  N     . LYS E 1 57  ? 1.743   -13.131 61.429 1.00 46.42  ? 56  LYS E N     1 
ATOM   3175  C  CA    . LYS E 1 57  ? 2.599   -12.097 60.920 1.00 47.25  ? 56  LYS E CA    1 
ATOM   3176  C  C     . LYS E 1 57  ? 3.346   -12.569 59.684 1.00 47.03  ? 56  LYS E C     1 
ATOM   3177  O  O     . LYS E 1 57  ? 3.753   -11.751 58.868 1.00 47.59  ? 56  LYS E O     1 
ATOM   3178  C  CB    . LYS E 1 57  ? 3.618   -11.790 62.010 1.00 48.18  ? 56  LYS E CB    1 
ATOM   3179  C  CG    . LYS E 1 57  ? 4.314   -10.451 61.954 1.00 52.06  ? 56  LYS E CG    1 
ATOM   3180  C  CD    . LYS E 1 57  ? 5.153   -10.289 63.234 1.00 57.21  ? 56  LYS E CD    1 
ATOM   3181  C  CE    . LYS E 1 57  ? 5.740   -8.875  63.365 1.00 62.50  ? 56  LYS E CE    1 
ATOM   3182  N  NZ    . LYS E 1 57  ? 5.961   -8.499  64.821 1.00 65.57  ? 56  LYS E NZ    1 
ATOM   3183  N  N     . SER E 1 58  ? 3.571   -13.873 59.549 1.00 46.39  ? 57  SER E N     1 
ATOM   3184  C  CA    . SER E 1 58  ? 4.427   -14.355 58.475 1.00 46.11  ? 57  SER E CA    1 
ATOM   3185  C  C     . SER E 1 58  ? 3.629   -15.085 57.417 1.00 46.24  ? 57  SER E C     1 
ATOM   3186  O  O     . SER E 1 58  ? 2.416   -15.332 57.582 1.00 46.41  ? 57  SER E O     1 
ATOM   3187  C  CB    . SER E 1 58  ? 5.520   -15.259 59.028 1.00 45.98  ? 57  SER E CB    1 
ATOM   3188  O  OG    . SER E 1 58  ? 4.939   -16.290 59.799 1.00 47.35  ? 57  SER E OG    1 
ATOM   3189  N  N     . THR E 1 59  ? 4.311   -15.453 56.336 1.00 45.81  ? 58  THR E N     1 
ATOM   3190  C  CA    . THR E 1 59  ? 3.630   -16.050 55.195 1.00 45.38  ? 58  THR E CA    1 
ATOM   3191  C  C     . THR E 1 59  ? 4.255   -17.349 54.653 1.00 45.92  ? 58  THR E C     1 
ATOM   3192  O  O     . THR E 1 59  ? 3.748   -17.912 53.670 1.00 46.06  ? 58  THR E O     1 
ATOM   3193  C  CB    . THR E 1 59  ? 3.549   -15.048 54.021 1.00 45.25  ? 58  THR E CB    1 
ATOM   3194  O  OG1   . THR E 1 59  ? 4.861   -14.843 53.495 1.00 44.06  ? 58  THR E OG1   1 
ATOM   3195  C  CG2   . THR E 1 59  ? 2.956   -13.712 54.455 1.00 43.66  ? 58  THR E CG2   1 
ATOM   3196  N  N     . GLU E 1 60  ? 5.348   -17.819 55.254 1.00 45.99  ? 59  GLU E N     1 
ATOM   3197  C  CA    . GLU E 1 60  ? 5.945   -19.077 54.810 1.00 46.77  ? 59  GLU E CA    1 
ATOM   3198  C  C     . GLU E 1 60  ? 5.052   -20.281 55.085 1.00 46.60  ? 59  GLU E C     1 
ATOM   3199  O  O     . GLU E 1 60  ? 4.225   -20.268 56.010 1.00 46.26  ? 59  GLU E O     1 
ATOM   3200  C  CB    . GLU E 1 60  ? 7.321   -19.293 55.403 1.00 46.66  ? 59  GLU E CB    1 
ATOM   3201  C  CG    . GLU E 1 60  ? 7.580   -18.486 56.638 1.00 52.14  ? 59  GLU E CG    1 
ATOM   3202  C  CD    . GLU E 1 60  ? 7.222   -19.207 57.916 1.00 56.64  ? 59  GLU E CD    1 
ATOM   3203  O  OE1   . GLU E 1 60  ? 7.414   -20.434 57.960 1.00 60.84  ? 59  GLU E OE1   1 
ATOM   3204  O  OE2   . GLU E 1 60  ? 6.775   -18.551 58.884 1.00 57.50  ? 59  GLU E OE2   1 
ATOM   3205  N  N     . LEU E 1 61  ? 5.203   -21.304 54.241 1.00 46.54  ? 60  LEU E N     1 
ATOM   3206  C  CA    . LEU E 1 61  ? 4.491   -22.559 54.422 1.00 46.44  ? 60  LEU E CA    1 
ATOM   3207  C  C     . LEU E 1 61  ? 4.887   -23.222 55.737 1.00 46.71  ? 60  LEU E C     1 
ATOM   3208  O  O     . LEU E 1 61  ? 6.050   -23.150 56.166 1.00 47.06  ? 60  LEU E O     1 
ATOM   3209  C  CB    . LEU E 1 61  ? 4.734   -23.485 53.244 1.00 46.20  ? 60  LEU E CB    1 
ATOM   3210  C  CG    . LEU E 1 61  ? 4.211   -22.853 51.967 1.00 45.72  ? 60  LEU E CG    1 
ATOM   3211  C  CD1   . LEU E 1 61  ? 4.676   -23.652 50.800 1.00 44.10  ? 60  LEU E CD1   1 
ATOM   3212  C  CD2   . LEU E 1 61  ? 2.669   -22.699 52.000 1.00 44.92  ? 60  LEU E CD2   1 
ATOM   3213  N  N     . LEU E 1 62  ? 3.909   -23.834 56.384 1.00 46.44  ? 61  LEU E N     1 
ATOM   3214  C  CA    . LEU E 1 62  ? 4.097   -24.327 57.741 1.00 46.87  ? 61  LEU E CA    1 
ATOM   3215  C  C     . LEU E 1 62  ? 4.343   -25.842 57.797 1.00 47.07  ? 61  LEU E C     1 
ATOM   3216  O  O     . LEU E 1 62  ? 4.834   -26.362 58.800 1.00 47.43  ? 61  LEU E O     1 
ATOM   3217  C  CB    . LEU E 1 62  ? 2.919   -23.887 58.609 1.00 46.41  ? 61  LEU E CB    1 
ATOM   3218  C  CG    . LEU E 1 62  ? 2.823   -22.355 58.685 1.00 46.22  ? 61  LEU E CG    1 
ATOM   3219  C  CD1   . LEU E 1 62  ? 1.515   -21.886 59.343 1.00 44.21  ? 61  LEU E CD1   1 
ATOM   3220  C  CD2   . LEU E 1 62  ? 4.076   -21.734 59.387 1.00 44.31  ? 61  LEU E CD2   1 
ATOM   3221  N  N     . ILE E 1 63  ? 4.007   -26.519 56.698 1.00 46.85  ? 62  ILE E N     1 
ATOM   3222  C  CA    . ILE E 1 63  ? 4.317   -27.921 56.476 1.00 46.72  ? 62  ILE E CA    1 
ATOM   3223  C  C     . ILE E 1 63  ? 5.641   -28.078 55.713 1.00 46.92  ? 62  ILE E C     1 
ATOM   3224  O  O     . ILE E 1 63  ? 5.919   -27.314 54.799 1.00 47.21  ? 62  ILE E O     1 
ATOM   3225  C  CB    . ILE E 1 63  ? 3.191   -28.609 55.653 1.00 46.63  ? 62  ILE E CB    1 
ATOM   3226  C  CG1   . ILE E 1 63  ? 1.827   -28.368 56.307 1.00 45.88  ? 62  ILE E CG1   1 
ATOM   3227  C  CG2   . ILE E 1 63  ? 3.463   -30.118 55.471 1.00 46.17  ? 62  ILE E CG2   1 
ATOM   3228  C  CD1   . ILE E 1 63  ? 0.699   -29.114 55.669 1.00 41.68  ? 62  ILE E CD1   1 
ATOM   3229  N  N     . ARG E 1 64  ? 6.428   -29.099 56.082 1.00 47.08  ? 63  ARG E N     1 
ATOM   3230  C  CA    . ARG E 1 64  ? 7.736   -29.375 55.483 1.00 46.98  ? 63  ARG E CA    1 
ATOM   3231  C  C     . ARG E 1 64  ? 7.657   -29.768 54.011 1.00 46.54  ? 63  ARG E C     1 
ATOM   3232  O  O     . ARG E 1 64  ? 6.833   -30.580 53.619 1.00 46.38  ? 63  ARG E O     1 
ATOM   3233  C  CB    . ARG E 1 64  ? 8.408   -30.515 56.243 1.00 47.83  ? 63  ARG E CB    1 
ATOM   3234  C  CG    . ARG E 1 64  ? 8.678   -30.312 57.731 1.00 48.52  ? 63  ARG E CG    1 
ATOM   3235  C  CD    . ARG E 1 64  ? 9.871   -29.414 57.918 1.00 52.27  ? 63  ARG E CD    1 
ATOM   3236  N  NE    . ARG E 1 64  ? 9.393   -28.049 57.753 1.00 58.43  ? 63  ARG E NE    1 
ATOM   3237  C  CZ    . ARG E 1 64  ? 10.129  -26.951 57.817 1.00 59.34  ? 63  ARG E CZ    1 
ATOM   3238  N  NH1   . ARG E 1 64  ? 11.441  -27.042 58.033 1.00 62.85  ? 63  ARG E NH1   1 
ATOM   3239  N  NH2   . ARG E 1 64  ? 9.536   -25.769 57.663 1.00 57.35  ? 63  ARG E NH2   1 
ATOM   3240  N  N     . LYS E 1 65  ? 8.550   -29.215 53.203 1.00 46.53  ? 64  LYS E N     1 
ATOM   3241  C  CA    . LYS E 1 65  ? 8.445   -29.353 51.755 1.00 46.81  ? 64  LYS E CA    1 
ATOM   3242  C  C     . LYS E 1 65  ? 8.350   -30.828 51.326 1.00 45.59  ? 64  LYS E C     1 
ATOM   3243  O  O     . LYS E 1 65  ? 7.396   -31.204 50.658 1.00 45.49  ? 64  LYS E O     1 
ATOM   3244  C  CB    . LYS E 1 65  ? 9.573   -28.578 51.046 1.00 47.19  ? 64  LYS E CB    1 
ATOM   3245  C  CG    . LYS E 1 65  ? 9.544   -28.683 49.520 1.00 51.29  ? 64  LYS E CG    1 
ATOM   3246  C  CD    . LYS E 1 65  ? 10.860  -28.163 48.905 1.00 57.26  ? 64  LYS E CD    1 
ATOM   3247  C  CE    . LYS E 1 65  ? 10.763  -27.998 47.376 1.00 59.85  ? 64  LYS E CE    1 
ATOM   3248  N  NZ    . LYS E 1 65  ? 10.375  -29.266 46.689 1.00 62.07  ? 64  LYS E NZ    1 
ATOM   3249  N  N     . LEU E 1 66  ? 9.296   -31.651 51.773 1.00 44.78  ? 65  LEU E N     1 
ATOM   3250  C  CA    . LEU E 1 66  ? 9.405   -33.052 51.356 1.00 44.12  ? 65  LEU E CA    1 
ATOM   3251  C  C     . LEU E 1 66  ? 8.271   -33.977 51.848 1.00 43.62  ? 65  LEU E C     1 
ATOM   3252  O  O     . LEU E 1 66  ? 7.676   -34.702 51.056 1.00 43.61  ? 65  LEU E O     1 
ATOM   3253  C  CB    . LEU E 1 66  ? 10.787  -33.611 51.731 1.00 44.25  ? 65  LEU E CB    1 
ATOM   3254  C  CG    . LEU E 1 66  ? 11.154  -35.067 51.407 1.00 44.82  ? 65  LEU E CG    1 
ATOM   3255  C  CD1   . LEU E 1 66  ? 11.080  -35.346 49.917 1.00 45.43  ? 65  LEU E CD1   1 
ATOM   3256  C  CD2   . LEU E 1 66  ? 12.555  -35.350 51.919 1.00 46.44  ? 65  LEU E CD2   1 
ATOM   3257  N  N     . PRO E 1 67  ? 7.981   -33.985 53.155 1.00 43.21  ? 66  PRO E N     1 
ATOM   3258  C  CA    . PRO E 1 67  ? 6.865   -34.822 53.554 1.00 43.14  ? 66  PRO E CA    1 
ATOM   3259  C  C     . PRO E 1 67  ? 5.606   -34.544 52.735 1.00 43.24  ? 66  PRO E C     1 
ATOM   3260  O  O     . PRO E 1 67  ? 4.949   -35.484 52.303 1.00 43.38  ? 66  PRO E O     1 
ATOM   3261  C  CB    . PRO E 1 67  ? 6.630   -34.432 55.014 1.00 43.30  ? 66  PRO E CB    1 
ATOM   3262  C  CG    . PRO E 1 67  ? 7.887   -33.852 55.470 1.00 43.57  ? 66  PRO E CG    1 
ATOM   3263  C  CD    . PRO E 1 67  ? 8.626   -33.320 54.298 1.00 43.07  ? 66  PRO E CD    1 
ATOM   3264  N  N     . PHE E 1 68  ? 5.276   -33.266 52.523 1.00 43.43  ? 67  PHE E N     1 
ATOM   3265  C  CA    . PHE E 1 68  ? 4.098   -32.895 51.729 1.00 43.25  ? 67  PHE E CA    1 
ATOM   3266  C  C     . PHE E 1 68  ? 4.217   -33.432 50.302 1.00 43.31  ? 67  PHE E C     1 
ATOM   3267  O  O     . PHE E 1 68  ? 3.248   -33.904 49.738 1.00 43.62  ? 67  PHE E O     1 
ATOM   3268  C  CB    . PHE E 1 68  ? 3.843   -31.377 51.723 1.00 42.43  ? 67  PHE E CB    1 
ATOM   3269  C  CG    . PHE E 1 68  ? 2.594   -30.978 50.978 1.00 40.51  ? 67  PHE E CG    1 
ATOM   3270  C  CD1   . PHE E 1 68  ? 1.372   -30.916 51.630 1.00 40.72  ? 67  PHE E CD1   1 
ATOM   3271  C  CD2   . PHE E 1 68  ? 2.634   -30.686 49.620 1.00 37.69  ? 67  PHE E CD2   1 
ATOM   3272  C  CE1   . PHE E 1 68  ? 0.206   -30.559 50.936 1.00 40.05  ? 67  PHE E CE1   1 
ATOM   3273  C  CE2   . PHE E 1 68  ? 1.494   -30.337 48.930 1.00 36.62  ? 67  PHE E CE2   1 
ATOM   3274  C  CZ    . PHE E 1 68  ? 0.274   -30.275 49.585 1.00 38.14  ? 67  PHE E CZ    1 
ATOM   3275  N  N     . GLN E 1 69  ? 5.405   -33.355 49.735 1.00 43.80  ? 68  GLN E N     1 
ATOM   3276  C  CA    . GLN E 1 69  ? 5.662   -33.896 48.409 1.00 45.53  ? 68  GLN E CA    1 
ATOM   3277  C  C     . GLN E 1 69  ? 5.321   -35.398 48.333 1.00 45.09  ? 68  GLN E C     1 
ATOM   3278  O  O     . GLN E 1 69  ? 4.614   -35.843 47.424 1.00 45.00  ? 68  GLN E O     1 
ATOM   3279  C  CB    . GLN E 1 69  ? 7.118   -33.648 48.022 1.00 45.83  ? 68  GLN E CB    1 
ATOM   3280  C  CG    . GLN E 1 69  ? 7.293   -33.252 46.558 1.00 52.11  ? 68  GLN E CG    1 
ATOM   3281  C  CD    . GLN E 1 69  ? 8.754   -33.379 46.062 1.00 59.43  ? 68  GLN E CD    1 
ATOM   3282  O  OE1   . GLN E 1 69  ? 9.672   -33.747 46.822 1.00 62.64  ? 68  GLN E OE1   1 
ATOM   3283  N  NE2   . GLN E 1 69  ? 8.962   -33.087 44.782 1.00 60.39  ? 68  GLN E NE2   1 
ATOM   3284  N  N     . ARG E 1 70  ? 5.793   -36.159 49.318 1.00 45.10  ? 69  ARG E N     1 
ATOM   3285  C  CA    . ARG E 1 70  ? 5.537   -37.596 49.395 1.00 45.04  ? 69  ARG E CA    1 
ATOM   3286  C  C     . ARG E 1 70  ? 4.064   -37.921 49.422 1.00 44.85  ? 69  ARG E C     1 
ATOM   3287  O  O     . ARG E 1 70  ? 3.600   -38.790 48.680 1.00 45.34  ? 69  ARG E O     1 
ATOM   3288  C  CB    . ARG E 1 70  ? 6.146   -38.164 50.655 1.00 45.36  ? 69  ARG E CB    1 
ATOM   3289  C  CG    . ARG E 1 70  ? 7.565   -38.615 50.538 1.00 44.53  ? 69  ARG E CG    1 
ATOM   3290  C  CD    . ARG E 1 70  ? 7.895   -39.319 51.828 1.00 43.70  ? 69  ARG E CD    1 
ATOM   3291  N  NE    . ARG E 1 70  ? 9.122   -38.782 52.365 1.00 45.52  ? 69  ARG E NE    1 
ATOM   3292  C  CZ    . ARG E 1 70  ? 9.275   -38.296 53.586 1.00 44.53  ? 69  ARG E CZ    1 
ATOM   3293  N  NH1   . ARG E 1 70  ? 8.287   -38.293 54.470 1.00 42.45  ? 69  ARG E NH1   1 
ATOM   3294  N  NH2   . ARG E 1 70  ? 10.458  -37.830 53.911 1.00 46.28  ? 69  ARG E NH2   1 
ATOM   3295  N  N     . LEU E 1 71  ? 3.343   -37.228 50.296 1.00 44.36  ? 70  LEU E N     1 
ATOM   3296  C  CA    . LEU E 1 71  ? 1.892   -37.330 50.376 1.00 44.01  ? 70  LEU E CA    1 
ATOM   3297  C  C     . LEU E 1 71  ? 1.233   -37.077 49.021 1.00 44.08  ? 70  LEU E C     1 
ATOM   3298  O  O     . LEU E 1 71  ? 0.325   -37.813 48.630 1.00 44.40  ? 70  LEU E O     1 
ATOM   3299  C  CB    . LEU E 1 71  ? 1.337   -36.392 51.457 1.00 43.64  ? 70  LEU E CB    1 
ATOM   3300  C  CG    . LEU E 1 71  ? -0.161  -36.493 51.755 1.00 43.14  ? 70  LEU E CG    1 
ATOM   3301  C  CD1   . LEU E 1 71  ? -0.555  -37.923 52.141 1.00 44.12  ? 70  LEU E CD1   1 
ATOM   3302  C  CD2   . LEU E 1 71  ? -0.556  -35.501 52.831 1.00 41.00  ? 70  LEU E CD2   1 
ATOM   3303  N  N     . VAL E 1 72  ? 1.706   -36.070 48.289 1.00 43.93  ? 71  VAL E N     1 
ATOM   3304  C  CA    . VAL E 1 72  ? 1.126   -35.770 46.976 1.00 44.12  ? 71  VAL E CA    1 
ATOM   3305  C  C     . VAL E 1 72  ? 1.345   -36.952 46.045 1.00 44.13  ? 71  VAL E C     1 
ATOM   3306  O  O     . VAL E 1 72  ? 0.402   -37.478 45.461 1.00 44.44  ? 71  VAL E O     1 
ATOM   3307  C  CB    . VAL E 1 72  ? 1.666   -34.437 46.376 1.00 44.23  ? 71  VAL E CB    1 
ATOM   3308  C  CG1   . VAL E 1 72  ? 1.289   -34.291 44.909 1.00 43.81  ? 71  VAL E CG1   1 
ATOM   3309  C  CG2   . VAL E 1 72  ? 1.134   -33.246 47.165 1.00 43.59  ? 71  VAL E CG2   1 
ATOM   3310  N  N     . ARG E 1 73  ? 2.591   -37.394 45.956 1.00 44.38  ? 72  ARG E N     1 
ATOM   3311  C  CA    . ARG E 1 73  ? 2.963   -38.517 45.096 1.00 44.53  ? 72  ARG E CA    1 
ATOM   3312  C  C     . ARG E 1 73  ? 2.249   -39.828 45.410 1.00 44.51  ? 72  ARG E C     1 
ATOM   3313  O  O     . ARG E 1 73  ? 1.839   -40.542 44.494 1.00 44.39  ? 72  ARG E O     1 
ATOM   3314  C  CB    . ARG E 1 73  ? 4.464   -38.701 45.108 1.00 44.63  ? 72  ARG E CB    1 
ATOM   3315  C  CG    . ARG E 1 73  ? 5.173   -37.532 44.473 1.00 44.85  ? 72  ARG E CG    1 
ATOM   3316  C  CD    . ARG E 1 73  ? 6.638   -37.758 44.432 1.00 47.88  ? 72  ARG E CD    1 
ATOM   3317  N  NE    . ARG E 1 73  ? 7.338   -36.591 43.916 1.00 51.67  ? 72  ARG E NE    1 
ATOM   3318  C  CZ    . ARG E 1 73  ? 7.363   -36.233 42.634 1.00 53.31  ? 72  ARG E CZ    1 
ATOM   3319  N  NH1   . ARG E 1 73  ? 6.716   -36.946 41.710 1.00 54.10  ? 72  ARG E NH1   1 
ATOM   3320  N  NH2   . ARG E 1 73  ? 8.037   -35.150 42.276 1.00 53.28  ? 72  ARG E NH2   1 
ATOM   3321  N  N     . GLU E 1 74  ? 2.078   -40.115 46.699 1.00 44.37  ? 73  GLU E N     1 
ATOM   3322  C  CA    . GLU E 1 74  ? 1.364   -41.289 47.142 1.00 44.25  ? 73  GLU E CA    1 
ATOM   3323  C  C     . GLU E 1 74  ? -0.093  -41.231 46.728 1.00 44.98  ? 73  GLU E C     1 
ATOM   3324  O  O     . GLU E 1 74  ? -0.600  -42.152 46.099 1.00 45.49  ? 73  GLU E O     1 
ATOM   3325  C  CB    . GLU E 1 74  ? 1.474   -41.430 48.655 1.00 43.90  ? 73  GLU E CB    1 
ATOM   3326  C  CG    . GLU E 1 74  ? 0.817   -42.680 49.198 1.00 42.70  ? 73  GLU E CG    1 
ATOM   3327  C  CD    . GLU E 1 74  ? 0.642   -42.667 50.709 1.00 42.42  ? 73  GLU E CD    1 
ATOM   3328  O  OE1   . GLU E 1 74  ? 1.656   -42.617 51.440 1.00 41.93  ? 73  GLU E OE1   1 
ATOM   3329  O  OE2   . GLU E 1 74  ? -0.525  -42.737 51.165 1.00 42.99  ? 73  GLU E OE2   1 
ATOM   3330  N  N     . ILE E 1 75  ? -0.774  -40.142 47.079 1.00 45.94  ? 74  ILE E N     1 
ATOM   3331  C  CA    . ILE E 1 75  ? -2.186  -39.981 46.729 1.00 45.97  ? 74  ILE E CA    1 
ATOM   3332  C  C     . ILE E 1 75  ? -2.361  -40.082 45.221 1.00 46.52  ? 74  ILE E C     1 
ATOM   3333  O  O     . ILE E 1 75  ? -3.211  -40.826 44.746 1.00 46.27  ? 74  ILE E O     1 
ATOM   3334  C  CB    . ILE E 1 75  ? -2.759  -38.674 47.271 1.00 45.62  ? 74  ILE E CB    1 
ATOM   3335  C  CG1   . ILE E 1 75  ? -2.898  -38.769 48.780 1.00 45.30  ? 74  ILE E CG1   1 
ATOM   3336  C  CG2   . ILE E 1 75  ? -4.117  -38.368 46.669 1.00 45.33  ? 74  ILE E CG2   1 
ATOM   3337  C  CD1   . ILE E 1 75  ? -2.978  -37.394 49.488 1.00 44.16  ? 74  ILE E CD1   1 
ATOM   3338  N  N     . ALA E 1 76  ? -1.536  -39.351 44.477 1.00 47.40  ? 75  ALA E N     1 
ATOM   3339  C  CA    . ALA E 1 76  ? -1.627  -39.354 43.007 1.00 48.70  ? 75  ALA E CA    1 
ATOM   3340  C  C     . ALA E 1 76  ? -1.351  -40.724 42.414 1.00 49.44  ? 75  ALA E C     1 
ATOM   3341  O  O     . ALA E 1 76  ? -1.987  -41.117 41.434 1.00 49.50  ? 75  ALA E O     1 
ATOM   3342  C  CB    . ALA E 1 76  ? -0.676  -38.337 42.408 1.00 48.30  ? 75  ALA E CB    1 
ATOM   3343  N  N     . GLN E 1 77  ? -0.400  -41.445 43.015 1.00 50.24  ? 76  GLN E N     1 
ATOM   3344  C  CA    . GLN E 1 77  ? 0.004   -42.739 42.498 1.00 51.21  ? 76  GLN E CA    1 
ATOM   3345  C  C     . GLN E 1 77  ? -1.154  -43.697 42.552 1.00 51.89  ? 76  GLN E C     1 
ATOM   3346  O  O     . GLN E 1 77  ? -1.398  -44.436 41.601 1.00 52.56  ? 76  GLN E O     1 
ATOM   3347  C  CB    . GLN E 1 77  ? 1.139   -43.299 43.303 1.00 51.20  ? 76  GLN E CB    1 
ATOM   3348  C  CG    . GLN E 1 77  ? 1.973   -44.295 42.564 1.00 52.27  ? 76  GLN E CG    1 
ATOM   3349  C  CD    . GLN E 1 77  ? 3.033   -44.837 43.455 1.00 54.51  ? 76  GLN E CD    1 
ATOM   3350  O  OE1   . GLN E 1 77  ? 2.832   -44.966 44.671 1.00 55.93  ? 76  GLN E OE1   1 
ATOM   3351  N  NE2   . GLN E 1 77  ? 4.186   -45.136 42.881 1.00 56.89  ? 76  GLN E NE2   1 
ATOM   3352  N  N     . ASP E 1 78  ? -1.870  -43.666 43.669 1.00 52.44  ? 77  ASP E N     1 
ATOM   3353  C  CA    . ASP E 1 78  ? -3.103  -44.408 43.808 1.00 53.26  ? 77  ASP E CA    1 
ATOM   3354  C  C     . ASP E 1 78  ? -4.174  -44.098 42.738 1.00 54.48  ? 77  ASP E C     1 
ATOM   3355  O  O     . ASP E 1 78  ? -5.032  -44.935 42.506 1.00 54.98  ? 77  ASP E O     1 
ATOM   3356  C  CB    . ASP E 1 78  ? -3.644  -44.268 45.231 1.00 52.59  ? 77  ASP E CB    1 
ATOM   3357  C  CG    . ASP E 1 78  ? -2.778  -44.991 46.259 1.00 52.98  ? 77  ASP E CG    1 
ATOM   3358  O  OD1   . ASP E 1 78  ? -2.017  -45.907 45.896 1.00 53.97  ? 77  ASP E OD1   1 
ATOM   3359  O  OD2   . ASP E 1 78  ? -2.844  -44.660 47.456 1.00 54.30  ? 77  ASP E OD2   1 
ATOM   3360  N  N     . PHE E 1 79  ? -4.127  -42.926 42.090 1.00 55.84  ? 78  PHE E N     1 
ATOM   3361  C  CA    . PHE E 1 79  ? -5.005  -42.644 40.943 1.00 57.44  ? 78  PHE E CA    1 
ATOM   3362  C  C     . PHE E 1 79  ? -4.405  -43.108 39.623 1.00 58.52  ? 78  PHE E C     1 
ATOM   3363  O  O     . PHE E 1 79  ? -5.132  -43.534 38.730 1.00 58.60  ? 78  PHE E O     1 
ATOM   3364  C  CB    . PHE E 1 79  ? -5.313  -41.149 40.798 1.00 57.52  ? 78  PHE E CB    1 
ATOM   3365  C  CG    . PHE E 1 79  ? -6.244  -40.622 41.832 1.00 58.27  ? 78  PHE E CG    1 
ATOM   3366  C  CD1   . PHE E 1 79  ? -5.809  -39.657 42.741 1.00 58.42  ? 78  PHE E CD1   1 
ATOM   3367  C  CD2   . PHE E 1 79  ? -7.554  -41.084 41.914 1.00 57.69  ? 78  PHE E CD2   1 
ATOM   3368  C  CE1   . PHE E 1 79  ? -6.664  -39.161 43.728 1.00 57.65  ? 78  PHE E CE1   1 
ATOM   3369  C  CE2   . PHE E 1 79  ? -8.419  -40.587 42.898 1.00 58.23  ? 78  PHE E CE2   1 
ATOM   3370  C  CZ    . PHE E 1 79  ? -7.966  -39.619 43.804 1.00 57.96  ? 78  PHE E CZ    1 
ATOM   3371  N  N     . LYS E 1 80  ? -3.085  -42.986 39.500 1.00 59.81  ? 79  LYS E N     1 
ATOM   3372  C  CA    . LYS E 1 80  ? -2.388  -43.236 38.253 1.00 61.30  ? 79  LYS E CA    1 
ATOM   3373  C  C     . LYS E 1 80  ? -0.895  -43.438 38.526 1.00 61.97  ? 79  LYS E C     1 
ATOM   3374  O  O     . LYS E 1 80  ? -0.236  -42.601 39.169 1.00 62.48  ? 79  LYS E O     1 
ATOM   3375  C  CB    . LYS E 1 80  ? -2.593  -42.050 37.308 1.00 61.45  ? 79  LYS E CB    1 
ATOM   3376  C  CG    . LYS E 1 80  ? -2.935  -42.422 35.884 1.00 62.77  ? 79  LYS E CG    1 
ATOM   3377  C  CD    . LYS E 1 80  ? -1.700  -42.463 35.026 1.00 65.18  ? 79  LYS E CD    1 
ATOM   3378  C  CE    . LYS E 1 80  ? -1.934  -43.290 33.775 1.00 66.79  ? 79  LYS E CE    1 
ATOM   3379  N  NZ    . LYS E 1 80  ? -0.705  -44.104 33.518 1.00 68.28  ? 79  LYS E NZ    1 
ATOM   3380  N  N     . THR E 1 81  ? -0.364  -44.556 38.044 1.00 62.50  ? 80  THR E N     1 
ATOM   3381  C  CA    . THR E 1 81  ? 1.067   -44.845 38.176 1.00 62.97  ? 80  THR E CA    1 
ATOM   3382  C  C     . THR E 1 81  ? 1.851   -44.062 37.151 1.00 63.19  ? 80  THR E C     1 
ATOM   3383  O  O     . THR E 1 81  ? 1.280   -43.550 36.184 1.00 63.63  ? 80  THR E O     1 
ATOM   3384  C  CB    . THR E 1 81  ? 1.377   -46.313 37.937 1.00 62.77  ? 80  THR E CB    1 
ATOM   3385  O  OG1   . THR E 1 81  ? 0.977   -46.670 36.599 1.00 63.24  ? 80  THR E OG1   1 
ATOM   3386  C  CG2   . THR E 1 81  ? 0.650   -47.159 38.947 1.00 62.81  ? 80  THR E CG2   1 
ATOM   3387  N  N     . ASP E 1 82  ? 3.161   -43.984 37.366 1.00 63.43  ? 81  ASP E N     1 
ATOM   3388  C  CA    . ASP E 1 82  ? 4.060   -43.322 36.428 1.00 64.09  ? 81  ASP E CA    1 
ATOM   3389  C  C     . ASP E 1 82  ? 3.723   -41.861 36.159 1.00 63.18  ? 81  ASP E C     1 
ATOM   3390  O  O     . ASP E 1 82  ? 3.745   -41.420 35.005 1.00 63.84  ? 81  ASP E O     1 
ATOM   3391  C  CB    . ASP E 1 82  ? 4.105   -44.096 35.103 1.00 65.09  ? 81  ASP E CB    1 
ATOM   3392  C  CG    . ASP E 1 82  ? 5.271   -45.074 35.036 1.00 68.69  ? 81  ASP E CG    1 
ATOM   3393  O  OD1   . ASP E 1 82  ? 5.496   -45.626 33.932 1.00 72.84  ? 81  ASP E OD1   1 
ATOM   3394  O  OD2   . ASP E 1 82  ? 5.966   -45.281 36.073 1.00 71.56  ? 81  ASP E OD2   1 
ATOM   3395  N  N     . LEU E 1 83  ? 3.403   -41.119 37.219 1.00 62.06  ? 82  LEU E N     1 
ATOM   3396  C  CA    . LEU E 1 83  ? 3.226   -39.675 37.109 1.00 60.46  ? 82  LEU E CA    1 
ATOM   3397  C  C     . LEU E 1 83  ? 4.464   -38.928 37.557 1.00 59.70  ? 82  LEU E C     1 
ATOM   3398  O  O     . LEU E 1 83  ? 5.154   -39.323 38.495 1.00 59.23  ? 82  LEU E O     1 
ATOM   3399  C  CB    . LEU E 1 83  ? 2.009   -39.194 37.902 1.00 60.12  ? 82  LEU E CB    1 
ATOM   3400  C  CG    . LEU E 1 83  ? 0.631   -39.525 37.324 1.00 59.31  ? 82  LEU E CG    1 
ATOM   3401  C  CD1   . LEU E 1 83  ? -0.455  -39.040 38.279 1.00 56.85  ? 82  LEU E CD1   1 
ATOM   3402  C  CD2   . LEU E 1 83  ? 0.434   -38.951 35.900 1.00 57.74  ? 82  LEU E CD2   1 
ATOM   3403  N  N     . ARG E 1 84  ? 4.731   -37.843 36.856 1.00 59.04  ? 83  ARG E N     1 
ATOM   3404  C  CA    . ARG E 1 84  ? 5.722   -36.875 37.275 1.00 58.56  ? 83  ARG E CA    1 
ATOM   3405  C  C     . ARG E 1 84  ? 5.002   -35.586 37.693 1.00 57.39  ? 83  ARG E C     1 
ATOM   3406  O  O     . ARG E 1 84  ? 3.841   -35.371 37.359 1.00 56.75  ? 83  ARG E O     1 
ATOM   3407  C  CB    . ARG E 1 84  ? 6.698   -36.600 36.126 1.00 59.10  ? 83  ARG E CB    1 
ATOM   3408  C  CG    . ARG E 1 84  ? 7.668   -37.733 35.861 1.00 61.42  ? 83  ARG E CG    1 
ATOM   3409  C  CD    . ARG E 1 84  ? 8.192   -37.721 34.429 1.00 65.89  ? 83  ARG E CD    1 
ATOM   3410  N  NE    . ARG E 1 84  ? 9.632   -37.987 34.392 1.00 70.62  ? 83  ARG E NE    1 
ATOM   3411  C  CZ    . ARG E 1 84  ? 10.552  -37.113 33.975 1.00 73.57  ? 83  ARG E CZ    1 
ATOM   3412  N  NH1   . ARG E 1 84  ? 10.193  -35.912 33.522 1.00 74.04  ? 83  ARG E NH1   1 
ATOM   3413  N  NH2   . ARG E 1 84  ? 11.840  -37.445 33.990 1.00 75.18  ? 83  ARG E NH2   1 
ATOM   3414  N  N     . PHE E 1 85  ? 5.710   -34.729 38.419 1.00 56.42  ? 84  PHE E N     1 
ATOM   3415  C  CA    . PHE E 1 85  ? 5.165   -33.462 38.877 1.00 55.08  ? 84  PHE E CA    1 
ATOM   3416  C  C     . PHE E 1 85  ? 6.130   -32.341 38.625 1.00 54.13  ? 84  PHE E C     1 
ATOM   3417  O  O     . PHE E 1 85  ? 7.277   -32.421 39.047 1.00 54.28  ? 84  PHE E O     1 
ATOM   3418  C  CB    . PHE E 1 85  ? 4.890   -33.519 40.375 1.00 55.01  ? 84  PHE E CB    1 
ATOM   3419  C  CG    . PHE E 1 85  ? 3.596   -34.188 40.728 1.00 55.46  ? 84  PHE E CG    1 
ATOM   3420  C  CD1   . PHE E 1 85  ? 3.529   -35.570 40.882 1.00 54.98  ? 84  PHE E CD1   1 
ATOM   3421  C  CD2   . PHE E 1 85  ? 2.437   -33.432 40.924 1.00 55.38  ? 84  PHE E CD2   1 
ATOM   3422  C  CE1   . PHE E 1 85  ? 2.326   -36.192 41.225 1.00 54.52  ? 84  PHE E CE1   1 
ATOM   3423  C  CE2   . PHE E 1 85  ? 1.232   -34.047 41.265 1.00 54.83  ? 84  PHE E CE2   1 
ATOM   3424  C  CZ    . PHE E 1 85  ? 1.177   -35.429 41.408 1.00 54.22  ? 84  PHE E CZ    1 
ATOM   3425  N  N     . GLN E 1 86  ? 5.667   -31.295 37.943 1.00 53.10  ? 85  GLN E N     1 
ATOM   3426  C  CA    . GLN E 1 86  ? 6.372   -30.016 37.937 1.00 52.19  ? 85  GLN E CA    1 
ATOM   3427  C  C     . GLN E 1 86  ? 6.477   -29.557 39.379 1.00 51.62  ? 85  GLN E C     1 
ATOM   3428  O  O     . GLN E 1 86  ? 5.514   -29.640 40.127 1.00 51.97  ? 85  GLN E O     1 
ATOM   3429  C  CB    . GLN E 1 86  ? 5.607   -28.988 37.122 1.00 52.20  ? 85  GLN E CB    1 
ATOM   3430  C  CG    . GLN E 1 86  ? 5.601   -29.252 35.631 1.00 52.94  ? 85  GLN E CG    1 
ATOM   3431  C  CD    . GLN E 1 86  ? 5.007   -28.103 34.830 1.00 55.86  ? 85  GLN E CD    1 
ATOM   3432  O  OE1   . GLN E 1 86  ? 4.472   -27.135 35.389 1.00 56.17  ? 85  GLN E OE1   1 
ATOM   3433  N  NE2   . GLN E 1 86  ? 5.080   -28.214 33.503 1.00 57.67  ? 85  GLN E NE2   1 
ATOM   3434  N  N     . SER E 1 87  ? 7.643   -29.111 39.804 1.00 51.03  ? 86  SER E N     1 
ATOM   3435  C  CA    . SER E 1 87  ? 7.805   -28.816 41.224 1.00 50.86  ? 86  SER E CA    1 
ATOM   3436  C  C     . SER E 1 87  ? 6.834   -27.744 41.650 1.00 50.54  ? 86  SER E C     1 
ATOM   3437  O  O     . SER E 1 87  ? 6.441   -27.702 42.805 1.00 51.55  ? 86  SER E O     1 
ATOM   3438  C  CB    . SER E 1 87  ? 9.233   -28.409 41.569 1.00 50.47  ? 86  SER E CB    1 
ATOM   3439  O  OG    . SER E 1 87  ? 9.625   -27.325 40.763 1.00 52.21  ? 86  SER E OG    1 
ATOM   3440  N  N     . SER E 1 88  ? 6.433   -26.893 40.713 1.00 49.88  ? 87  SER E N     1 
ATOM   3441  C  CA    . SER E 1 88  ? 5.515   -25.812 41.017 1.00 49.11  ? 87  SER E CA    1 
ATOM   3442  C  C     . SER E 1 88  ? 4.092   -26.324 41.093 1.00 48.56  ? 87  SER E C     1 
ATOM   3443  O  O     . SER E 1 88  ? 3.239   -25.658 41.655 1.00 49.22  ? 87  SER E O     1 
ATOM   3444  C  CB    . SER E 1 88  ? 5.627   -24.668 40.009 1.00 48.66  ? 87  SER E CB    1 
ATOM   3445  O  OG    . SER E 1 88  ? 5.051   -25.032 38.766 1.00 50.34  ? 87  SER E OG    1 
ATOM   3446  N  N     . ALA E 1 89  ? 3.824   -27.504 40.549 1.00 47.87  ? 88  ALA E N     1 
ATOM   3447  C  CA    . ALA E 1 89  ? 2.510   -28.129 40.753 1.00 46.73  ? 88  ALA E CA    1 
ATOM   3448  C  C     . ALA E 1 89  ? 2.413   -28.567 42.198 1.00 46.24  ? 88  ALA E C     1 
ATOM   3449  O  O     . ALA E 1 89  ? 1.371   -28.443 42.835 1.00 46.71  ? 88  ALA E O     1 
ATOM   3450  C  CB    . ALA E 1 89  ? 2.302   -29.291 39.840 1.00 46.07  ? 88  ALA E CB    1 
ATOM   3451  N  N     . VAL E 1 90  ? 3.512   -29.046 42.741 1.00 45.54  ? 89  VAL E N     1 
ATOM   3452  C  CA    . VAL E 1 90  ? 3.483   -29.485 44.127 1.00 45.18  ? 89  VAL E CA    1 
ATOM   3453  C  C     . VAL E 1 90  ? 3.331   -28.275 45.043 1.00 45.31  ? 89  VAL E C     1 
ATOM   3454  O  O     . VAL E 1 90  ? 2.580   -28.309 46.016 1.00 45.41  ? 89  VAL E O     1 
ATOM   3455  C  CB    . VAL E 1 90  ? 4.713   -30.340 44.480 1.00 44.51  ? 89  VAL E CB    1 
ATOM   3456  C  CG1   . VAL E 1 90  ? 4.679   -30.777 45.936 1.00 43.92  ? 89  VAL E CG1   1 
ATOM   3457  C  CG2   . VAL E 1 90  ? 4.742   -31.555 43.581 1.00 44.47  ? 89  VAL E CG2   1 
ATOM   3458  N  N     . MET E 1 91  ? 4.036   -27.204 44.701 1.00 45.49  ? 90  MET E N     1 
ATOM   3459  C  CA    . MET E 1 91  ? 4.017   -25.981 45.471 1.00 45.26  ? 90  MET E CA    1 
ATOM   3460  C  C     . MET E 1 91  ? 2.630   -25.334 45.441 1.00 44.85  ? 90  MET E C     1 
ATOM   3461  O  O     . MET E 1 91  ? 2.145   -24.862 46.476 1.00 44.54  ? 90  MET E O     1 
ATOM   3462  C  CB    . MET E 1 91  ? 5.087   -25.041 44.954 1.00 45.59  ? 90  MET E CB    1 
ATOM   3463  C  CG    . MET E 1 91  ? 6.490   -25.527 45.251 1.00 47.84  ? 90  MET E CG    1 
ATOM   3464  S  SD    . MET E 1 91  ? 6.736   -25.977 47.002 1.00 55.35  ? 90  MET E SD    1 
ATOM   3465  C  CE    . MET E 1 91  ? 6.524   -24.392 47.818 1.00 51.99  ? 90  MET E CE    1 
ATOM   3466  N  N     . ALA E 1 92  ? 1.983   -25.355 44.273 1.00 43.72  ? 91  ALA E N     1 
ATOM   3467  C  CA    . ALA E 1 92  ? 0.628   -24.845 44.157 1.00 43.01  ? 91  ALA E CA    1 
ATOM   3468  C  C     . ALA E 1 92  ? -0.328  -25.645 45.044 1.00 43.06  ? 91  ALA E C     1 
ATOM   3469  O  O     . ALA E 1 92  ? -1.199  -25.058 45.699 1.00 43.59  ? 91  ALA E O     1 
ATOM   3470  C  CB    . ALA E 1 92  ? 0.165   -24.855 42.723 1.00 42.45  ? 91  ALA E CB    1 
ATOM   3471  N  N     . LEU E 1 93  ? -0.173  -26.973 45.075 1.00 42.12  ? 92  LEU E N     1 
ATOM   3472  C  CA    . LEU E 1 93  ? -0.990  -27.798 45.967 1.00 41.21  ? 92  LEU E CA    1 
ATOM   3473  C  C     . LEU E 1 93  ? -0.732  -27.436 47.423 1.00 40.63  ? 92  LEU E C     1 
ATOM   3474  O  O     . LEU E 1 93  ? -1.655  -27.440 48.239 1.00 40.79  ? 92  LEU E O     1 
ATOM   3475  C  CB    . LEU E 1 93  ? -0.746  -29.294 45.747 1.00 41.25  ? 92  LEU E CB    1 
ATOM   3476  C  CG    . LEU E 1 93  ? -1.305  -29.905 44.451 1.00 42.11  ? 92  LEU E CG    1 
ATOM   3477  C  CD1   . LEU E 1 93  ? -0.535  -31.166 44.017 1.00 40.14  ? 92  LEU E CD1   1 
ATOM   3478  C  CD2   . LEU E 1 93  ? -2.805  -30.167 44.553 1.00 39.79  ? 92  LEU E CD2   1 
ATOM   3479  N  N     . GLN E 1 94  ? 0.511   -27.104 47.757 1.00 39.45  ? 93  GLN E N     1 
ATOM   3480  C  CA    . GLN E 1 94  ? 0.829   -26.828 49.147 1.00 38.56  ? 93  GLN E CA    1 
ATOM   3481  C  C     . GLN E 1 94  ? 0.221   -25.513 49.600 1.00 38.37  ? 93  GLN E C     1 
ATOM   3482  O  O     . GLN E 1 94  ? -0.280  -25.410 50.719 1.00 38.23  ? 93  GLN E O     1 
ATOM   3483  C  CB    . GLN E 1 94  ? 2.341   -26.860 49.426 1.00 38.13  ? 93  GLN E CB    1 
ATOM   3484  C  CG    . GLN E 1 94  ? 2.610   -27.037 50.919 1.00 37.44  ? 93  GLN E CG    1 
ATOM   3485  C  CD    . GLN E 1 94  ? 4.042   -27.321 51.273 1.00 38.38  ? 93  GLN E CD    1 
ATOM   3486  O  OE1   . GLN E 1 94  ? 4.863   -27.659 50.427 1.00 37.35  ? 93  GLN E OE1   1 
ATOM   3487  N  NE2   . GLN E 1 94  ? 4.356   -27.194 52.558 1.00 41.11  ? 93  GLN E NE2   1 
ATOM   3488  N  N     . GLU E 1 95  ? 0.272   -24.513 48.721 1.00 37.84  ? 94  GLU E N     1 
ATOM   3489  C  CA    . GLU E 1 95  ? -0.259  -23.204 49.010 1.00 37.08  ? 94  GLU E CA    1 
ATOM   3490  C  C     . GLU E 1 95  ? -1.767  -23.350 49.147 1.00 37.20  ? 94  GLU E C     1 
ATOM   3491  O  O     . GLU E 1 95  ? -2.367  -22.849 50.096 1.00 37.25  ? 94  GLU E O     1 
ATOM   3492  C  CB    . GLU E 1 95  ? 0.086   -22.230 47.887 1.00 37.39  ? 94  GLU E CB    1 
ATOM   3493  C  CG    . GLU E 1 95  ? 1.545   -21.766 47.821 1.00 38.43  ? 94  GLU E CG    1 
ATOM   3494  C  CD    . GLU E 1 95  ? 1.919   -20.696 48.859 1.00 42.15  ? 94  GLU E CD    1 
ATOM   3495  O  OE1   . GLU E 1 95  ? 1.029   -20.127 49.546 1.00 41.92  ? 94  GLU E OE1   1 
ATOM   3496  O  OE2   . GLU E 1 95  ? 3.133   -20.421 48.982 1.00 44.16  ? 94  GLU E OE2   1 
ATOM   3497  N  N     . ALA E 1 96  ? -2.387  -24.073 48.218 1.00 36.58  ? 95  ALA E N     1 
ATOM   3498  C  CA    . ALA E 1 96  ? -3.816  -24.289 48.301 1.00 35.95  ? 95  ALA E CA    1 
ATOM   3499  C  C     . ALA E 1 96  ? -4.200  -25.022 49.579 1.00 36.25  ? 95  ALA E C     1 
ATOM   3500  O  O     . ALA E 1 96  ? -5.124  -24.606 50.254 1.00 36.70  ? 95  ALA E O     1 
ATOM   3501  C  CB    . ALA E 1 96  ? -4.316  -25.021 47.094 1.00 34.88  ? 95  ALA E CB    1 
ATOM   3502  N  N     . SER E 1 97  ? -3.484  -26.101 49.902 1.00 36.50  ? 96  SER E N     1 
ATOM   3503  C  CA    . SER E 1 97  ? -3.778  -26.952 51.052 1.00 36.77  ? 96  SER E CA    1 
ATOM   3504  C  C     . SER E 1 97  ? -3.661  -26.224 52.372 1.00 36.80  ? 96  SER E C     1 
ATOM   3505  O  O     . SER E 1 97  ? -4.541  -26.349 53.224 1.00 36.54  ? 96  SER E O     1 
ATOM   3506  C  CB    . SER E 1 97  ? -2.829  -28.157 51.083 1.00 37.27  ? 96  SER E CB    1 
ATOM   3507  O  OG    . SER E 1 97  ? -2.960  -28.962 49.923 1.00 39.27  ? 96  SER E OG    1 
ATOM   3508  N  N     . GLU E 1 98  ? -2.569  -25.474 52.543 1.00 37.36  ? 97  GLU E N     1 
ATOM   3509  C  CA    . GLU E 1 98  ? -2.349  -24.671 53.760 1.00 37.77  ? 97  GLU E CA    1 
ATOM   3510  C  C     . GLU E 1 98  ? -3.364  -23.533 53.898 1.00 37.29  ? 97  GLU E C     1 
ATOM   3511  O  O     . GLU E 1 98  ? -3.840  -23.236 54.993 1.00 38.24  ? 97  GLU E O     1 
ATOM   3512  C  CB    . GLU E 1 98  ? -0.897  -24.182 53.870 1.00 37.83  ? 97  GLU E CB    1 
ATOM   3513  C  CG    . GLU E 1 98  ? 0.164   -25.312 53.804 1.00 40.98  ? 97  GLU E CG    1 
ATOM   3514  C  CD    . GLU E 1 98  ? 1.503   -24.966 54.486 1.00 46.31  ? 97  GLU E CD    1 
ATOM   3515  O  OE1   . GLU E 1 98  ? 1.584   -23.939 55.197 1.00 50.07  ? 97  GLU E OE1   1 
ATOM   3516  O  OE2   . GLU E 1 98  ? 2.492   -25.722 54.317 1.00 47.50  ? 97  GLU E OE2   1 
ATOM   3517  N  N     . ALA E 1 99  ? -3.742  -22.916 52.793 1.00 36.62  ? 98  ALA E N     1 
ATOM   3518  C  CA    . ALA E 1 99  ? -4.755  -21.871 52.860 1.00 35.93  ? 98  ALA E CA    1 
ATOM   3519  C  C     . ALA E 1 99  ? -6.110  -22.450 53.221 1.00 36.34  ? 98  ALA E C     1 
ATOM   3520  O  O     . ALA E 1 99  ? -6.882  -21.805 53.935 1.00 37.90  ? 98  ALA E O     1 
ATOM   3521  C  CB    . ALA E 1 99  ? -4.828  -21.102 51.595 1.00 34.59  ? 98  ALA E CB    1 
ATOM   3522  N  N     . TYR E 1 100 ? -6.400  -23.668 52.769 1.00 35.89  ? 99  TYR E N     1 
ATOM   3523  C  CA    . TYR E 1 100 ? -7.650  -24.306 53.120 1.00 35.34  ? 99  TYR E CA    1 
ATOM   3524  C  C     . TYR E 1 100 ? -7.610  -24.618 54.626 1.00 35.88  ? 99  TYR E C     1 
ATOM   3525  O  O     . TYR E 1 100 ? -8.574  -24.349 55.354 1.00 36.37  ? 99  TYR E O     1 
ATOM   3526  C  CB    . TYR E 1 100 ? -7.891  -25.547 52.256 1.00 34.96  ? 99  TYR E CB    1 
ATOM   3527  C  CG    . TYR E 1 100 ? -9.021  -26.436 52.717 1.00 35.54  ? 99  TYR E CG    1 
ATOM   3528  C  CD1   . TYR E 1 100 ? -10.328 -26.225 52.287 1.00 36.86  ? 99  TYR E CD1   1 
ATOM   3529  C  CD2   . TYR E 1 100 ? -8.783  -27.493 53.579 1.00 35.86  ? 99  TYR E CD2   1 
ATOM   3530  C  CE1   . TYR E 1 100 ? -11.371 -27.044 52.722 1.00 35.78  ? 99  TYR E CE1   1 
ATOM   3531  C  CE2   . TYR E 1 100 ? -9.801  -28.310 54.019 1.00 36.45  ? 99  TYR E CE2   1 
ATOM   3532  C  CZ    . TYR E 1 100 ? -11.095 -28.089 53.598 1.00 37.66  ? 99  TYR E CZ    1 
ATOM   3533  O  OH    . TYR E 1 100 ? -12.108 -28.934 54.060 1.00 38.11  ? 99  TYR E OH    1 
ATOM   3534  N  N     . LEU E 1 101 ? -6.486  -25.125 55.114 1.00 35.39  ? 100 LEU E N     1 
ATOM   3535  C  CA    . LEU E 1 101 ? -6.478  -25.621 56.473 1.00 35.30  ? 100 LEU E CA    1 
ATOM   3536  C  C     . LEU E 1 101 ? -6.520  -24.512 57.522 1.00 35.87  ? 100 LEU E C     1 
ATOM   3537  O  O     . LEU E 1 101 ? -7.264  -24.613 58.519 1.00 35.75  ? 100 LEU E O     1 
ATOM   3538  C  CB    . LEU E 1 101 ? -5.310  -26.568 56.707 1.00 35.19  ? 100 LEU E CB    1 
ATOM   3539  C  CG    . LEU E 1 101 ? -5.367  -27.983 56.083 1.00 35.11  ? 100 LEU E CG    1 
ATOM   3540  C  CD1   . LEU E 1 101 ? -4.034  -28.699 56.378 1.00 30.67  ? 100 LEU E CD1   1 
ATOM   3541  C  CD2   . LEU E 1 101 ? -6.606  -28.834 56.548 1.00 30.90  ? 100 LEU E CD2   1 
ATOM   3542  N  N     . VAL E 1 102 ? -5.743  -23.447 57.286 1.00 35.85  ? 101 VAL E N     1 
ATOM   3543  C  CA    . VAL E 1 102 ? -5.772  -22.247 58.126 1.00 35.05  ? 101 VAL E CA    1 
ATOM   3544  C  C     . VAL E 1 102 ? -7.186  -21.648 58.185 1.00 34.93  ? 101 VAL E C     1 
ATOM   3545  O  O     . VAL E 1 102 ? -7.661  -21.312 59.268 1.00 35.09  ? 101 VAL E O     1 
ATOM   3546  C  CB    . VAL E 1 102 ? -4.731  -21.192 57.656 1.00 35.78  ? 101 VAL E CB    1 
ATOM   3547  C  CG1   . VAL E 1 102 ? -4.910  -19.869 58.390 1.00 34.67  ? 101 VAL E CG1   1 
ATOM   3548  C  CG2   . VAL E 1 102 ? -3.281  -21.720 57.822 1.00 33.72  ? 101 VAL E CG2   1 
ATOM   3549  N  N     . GLY E 1 103 ? -7.875  -21.553 57.045 1.00 34.44  ? 102 GLY E N     1 
ATOM   3550  C  CA    . GLY E 1 103 ? -9.239  -21.009 57.043 1.00 34.56  ? 102 GLY E CA    1 
ATOM   3551  C  C     . GLY E 1 103 ? -10.234 -21.958 57.738 1.00 35.46  ? 102 GLY E C     1 
ATOM   3552  O  O     . GLY E 1 103 ? -11.226 -21.512 58.340 1.00 36.12  ? 102 GLY E O     1 
ATOM   3553  N  N     . LEU E 1 104 ? -9.968  -23.262 57.670 1.00 36.30  ? 103 LEU E N     1 
ATOM   3554  C  CA    . LEU E 1 104 ? -10.833 -24.231 58.340 1.00 36.77  ? 103 LEU E CA    1 
ATOM   3555  C  C     . LEU E 1 104 ? -10.662 -24.110 59.845 1.00 37.96  ? 103 LEU E C     1 
ATOM   3556  O  O     . LEU E 1 104 ? -11.639 -24.166 60.601 1.00 38.40  ? 103 LEU E O     1 
ATOM   3557  C  CB    . LEU E 1 104 ? -10.540 -25.642 57.876 1.00 36.20  ? 103 LEU E CB    1 
ATOM   3558  C  CG    . LEU E 1 104 ? -11.345 -26.762 58.535 1.00 36.13  ? 103 LEU E CG    1 
ATOM   3559  C  CD1   . LEU E 1 104 ? -12.851 -26.660 58.354 1.00 33.44  ? 103 LEU E CD1   1 
ATOM   3560  C  CD2   . LEU E 1 104 ? -10.839 -28.079 58.020 1.00 33.99  ? 103 LEU E CD2   1 
ATOM   3561  N  N     . PHE E 1 105 ? -9.424  -23.903 60.283 1.00 39.01  ? 104 PHE E N     1 
ATOM   3562  C  CA    . PHE E 1 105 ? -9.168  -23.679 61.709 1.00 39.49  ? 104 PHE E CA    1 
ATOM   3563  C  C     . PHE E 1 105 ? -9.798  -22.391 62.240 1.00 40.62  ? 104 PHE E C     1 
ATOM   3564  O  O     . PHE E 1 105 ? -10.247 -22.348 63.373 1.00 41.06  ? 104 PHE E O     1 
ATOM   3565  C  CB    . PHE E 1 105 ? -7.685  -23.714 62.005 1.00 38.78  ? 104 PHE E CB    1 
ATOM   3566  C  CG    . PHE E 1 105 ? -7.104  -25.098 62.042 1.00 38.30  ? 104 PHE E CG    1 
ATOM   3567  C  CD1   . PHE E 1 105 ? -6.038  -25.431 61.242 1.00 37.92  ? 104 PHE E CD1   1 
ATOM   3568  C  CD2   . PHE E 1 105 ? -7.601  -26.058 62.923 1.00 39.03  ? 104 PHE E CD2   1 
ATOM   3569  C  CE1   . PHE E 1 105 ? -5.489  -26.703 61.303 1.00 39.87  ? 104 PHE E CE1   1 
ATOM   3570  C  CE2   . PHE E 1 105 ? -7.059  -27.326 62.989 1.00 37.95  ? 104 PHE E CE2   1 
ATOM   3571  C  CZ    . PHE E 1 105 ? -6.001  -27.651 62.179 1.00 38.82  ? 104 PHE E CZ    1 
ATOM   3572  N  N     . GLU E 1 106 ? -9.861  -21.340 61.430 1.00 41.88  ? 105 GLU E N     1 
ATOM   3573  C  CA    . GLU E 1 106 ? -10.554 -20.130 61.884 1.00 42.73  ? 105 GLU E CA    1 
ATOM   3574  C  C     . GLU E 1 106 ? -12.004 -20.504 62.126 1.00 42.88  ? 105 GLU E C     1 
ATOM   3575  O  O     . GLU E 1 106 ? -12.558 -20.193 63.174 1.00 43.27  ? 105 GLU E O     1 
ATOM   3576  C  CB    . GLU E 1 106 ? -10.466 -18.978 60.863 1.00 42.87  ? 105 GLU E CB    1 
ATOM   3577  C  CG    . GLU E 1 106 ? -9.044  -18.532 60.541 1.00 45.07  ? 105 GLU E CG    1 
ATOM   3578  C  CD    . GLU E 1 106 ? -8.925  -17.673 59.277 1.00 48.42  ? 105 GLU E CD    1 
ATOM   3579  O  OE1   . GLU E 1 106 ? -9.970  -17.245 58.732 1.00 50.36  ? 105 GLU E OE1   1 
ATOM   3580  O  OE2   . GLU E 1 106 ? -7.772  -17.424 58.832 1.00 48.82  ? 105 GLU E OE2   1 
ATOM   3581  N  N     . ASP E 1 107 ? -12.615 -21.196 61.164 1.00 42.94  ? 106 ASP E N     1 
ATOM   3582  C  CA    . ASP E 1 107 ? -14.017 -21.570 61.301 1.00 42.89  ? 106 ASP E CA    1 
ATOM   3583  C  C     . ASP E 1 107 ? -14.216 -22.480 62.501 1.00 43.07  ? 106 ASP E C     1 
ATOM   3584  O  O     . ASP E 1 107 ? -15.186 -22.348 63.246 1.00 43.02  ? 106 ASP E O     1 
ATOM   3585  C  CB    . ASP E 1 107 ? -14.506 -22.222 60.023 1.00 42.65  ? 106 ASP E CB    1 
ATOM   3586  C  CG    . ASP E 1 107 ? -14.669 -21.227 58.909 1.00 43.44  ? 106 ASP E CG    1 
ATOM   3587  O  OD1   . ASP E 1 107 ? -14.451 -20.030 59.171 1.00 46.53  ? 106 ASP E OD1   1 
ATOM   3588  O  OD2   . ASP E 1 107 ? -15.022 -21.613 57.776 1.00 45.12  ? 106 ASP E OD2   1 
ATOM   3589  N  N     . THR E 1 108 ? -13.259 -23.383 62.695 1.00 42.96  ? 107 THR E N     1 
ATOM   3590  C  CA    . THR E 1 108 ? -13.311 -24.367 63.760 1.00 42.63  ? 107 THR E CA    1 
ATOM   3591  C  C     . THR E 1 108 ? -13.243 -23.669 65.111 1.00 43.17  ? 107 THR E C     1 
ATOM   3592  O  O     . THR E 1 108 ? -14.068 -23.938 65.991 1.00 43.30  ? 107 THR E O     1 
ATOM   3593  C  CB    . THR E 1 108 ? -12.164 -25.336 63.590 1.00 42.36  ? 107 THR E CB    1 
ATOM   3594  O  OG1   . THR E 1 108 ? -12.337 -26.021 62.346 1.00 42.47  ? 107 THR E OG1   1 
ATOM   3595  C  CG2   . THR E 1 108 ? -12.107 -26.333 64.711 1.00 41.59  ? 107 THR E CG2   1 
ATOM   3596  N  N     . ASN E 1 109 ? -12.267 -22.767 65.247 1.00 43.26  ? 108 ASN E N     1 
ATOM   3597  C  CA    . ASN E 1 109 ? -12.109 -21.908 66.407 1.00 43.33  ? 108 ASN E CA    1 
ATOM   3598  C  C     . ASN E 1 109 ? -13.391 -21.180 66.740 1.00 43.61  ? 108 ASN E C     1 
ATOM   3599  O  O     . ASN E 1 109 ? -13.793 -21.135 67.904 1.00 44.14  ? 108 ASN E O     1 
ATOM   3600  C  CB    . ASN E 1 109 ? -11.030 -20.883 66.139 1.00 43.58  ? 108 ASN E CB    1 
ATOM   3601  C  CG    . ASN E 1 109 ? -10.315 -20.449 67.389 1.00 44.50  ? 108 ASN E CG    1 
ATOM   3602  O  OD1   . ASN E 1 109 ? -10.350 -21.127 68.417 1.00 46.78  ? 108 ASN E OD1   1 
ATOM   3603  N  ND2   . ASN E 1 109 ? -9.631  -19.330 67.303 1.00 44.08  ? 108 ASN E ND2   1 
ATOM   3604  N  N     . LEU E 1 110 ? -14.055 -20.630 65.719 1.00 43.52  ? 109 LEU E N     1 
ATOM   3605  C  CA    . LEU E 1 110 ? -15.329 -19.952 65.939 1.00 43.11  ? 109 LEU E CA    1 
ATOM   3606  C  C     . LEU E 1 110 ? -16.359 -20.898 66.529 1.00 43.21  ? 109 LEU E C     1 
ATOM   3607  O  O     . LEU E 1 110 ? -17.138 -20.494 67.383 1.00 43.90  ? 109 LEU E O     1 
ATOM   3608  C  CB    . LEU E 1 110 ? -15.859 -19.317 64.658 1.00 42.46  ? 109 LEU E CB    1 
ATOM   3609  C  CG    . LEU E 1 110 ? -15.171 -18.042 64.169 1.00 41.93  ? 109 LEU E CG    1 
ATOM   3610  C  CD1   . LEU E 1 110 ? -15.841 -17.593 62.866 1.00 41.79  ? 109 LEU E CD1   1 
ATOM   3611  C  CD2   . LEU E 1 110 ? -15.156 -16.890 65.184 1.00 39.54  ? 109 LEU E CD2   1 
ATOM   3612  N  N     . CYS E 1 111 ? -16.341 -22.155 66.093 1.00 43.22  ? 110 CYS E N     1 
ATOM   3613  C  CA    . CYS E 1 111 ? -17.277 -23.161 66.600 1.00 43.29  ? 110 CYS E CA    1 
ATOM   3614  C  C     . CYS E 1 111 ? -16.989 -23.569 68.054 1.00 43.53  ? 110 CYS E C     1 
ATOM   3615  O  O     . CYS E 1 111 ? -17.905 -23.765 68.840 1.00 43.21  ? 110 CYS E O     1 
ATOM   3616  C  CB    . CYS E 1 111 ? -17.300 -24.380 65.673 1.00 43.02  ? 110 CYS E CB    1 
ATOM   3617  S  SG    . CYS E 1 111 ? -18.048 -24.045 64.043 1.00 42.37  ? 110 CYS E SG    1 
ATOM   3618  N  N     . ALA E 1 112 ? -15.714 -23.697 68.402 1.00 43.93  ? 111 ALA E N     1 
ATOM   3619  C  CA    . ALA E 1 112 ? -15.334 -23.959 69.774 1.00 44.51  ? 111 ALA E CA    1 
ATOM   3620  C  C     . ALA E 1 112 ? -15.814 -22.821 70.673 1.00 45.13  ? 111 ALA E C     1 
ATOM   3621  O  O     . ALA E 1 112 ? -16.469 -23.058 71.688 1.00 45.73  ? 111 ALA E O     1 
ATOM   3622  C  CB    . ALA E 1 112 ? -13.841 -24.152 69.890 1.00 44.34  ? 111 ALA E CB    1 
ATOM   3623  N  N     . ILE E 1 113 ? -15.514 -21.583 70.290 1.00 45.48  ? 112 ILE E N     1 
ATOM   3624  C  CA    . ILE E 1 113 ? -15.930 -20.413 71.070 1.00 45.32  ? 112 ILE E CA    1 
ATOM   3625  C  C     . ILE E 1 113 ? -17.450 -20.319 71.159 1.00 46.25  ? 112 ILE E C     1 
ATOM   3626  O  O     . ILE E 1 113 ? -17.993 -19.858 72.160 1.00 46.82  ? 112 ILE E O     1 
ATOM   3627  C  CB    . ILE E 1 113 ? -15.352 -19.114 70.479 1.00 45.08  ? 112 ILE E CB    1 
ATOM   3628  C  CG1   . ILE E 1 113 ? -13.835 -19.092 70.621 1.00 44.66  ? 112 ILE E CG1   1 
ATOM   3629  C  CG2   . ILE E 1 113 ? -15.964 -17.890 71.120 1.00 43.27  ? 112 ILE E CG2   1 
ATOM   3630  C  CD1   . ILE E 1 113 ? -13.163 -18.220 69.591 1.00 44.91  ? 112 ILE E CD1   1 
ATOM   3631  N  N     . HIS E 1 114 ? -18.152 -20.760 70.121 1.00 47.00  ? 113 HIS E N     1 
ATOM   3632  C  CA    . HIS E 1 114 ? -19.614 -20.803 70.192 1.00 47.76  ? 113 HIS E CA    1 
ATOM   3633  C  C     . HIS E 1 114 ? -20.081 -21.710 71.331 1.00 48.67  ? 113 HIS E C     1 
ATOM   3634  O  O     . HIS E 1 114 ? -21.090 -21.431 71.992 1.00 49.21  ? 113 HIS E O     1 
ATOM   3635  C  CB    . HIS E 1 114 ? -20.194 -21.315 68.898 1.00 47.39  ? 113 HIS E CB    1 
ATOM   3636  C  CG    . HIS E 1 114 ? -21.676 -21.177 68.817 1.00 47.91  ? 113 HIS E CG    1 
ATOM   3637  N  ND1   . HIS E 1 114 ? -22.296 -19.970 68.579 1.00 47.65  ? 113 HIS E ND1   1 
ATOM   3638  C  CD2   . HIS E 1 114 ? -22.665 -22.098 68.917 1.00 49.23  ? 113 HIS E CD2   1 
ATOM   3639  C  CE1   . HIS E 1 114 ? -23.605 -20.147 68.552 1.00 48.06  ? 113 HIS E CE1   1 
ATOM   3640  N  NE2   . HIS E 1 114 ? -23.857 -21.431 68.751 1.00 49.21  ? 113 HIS E NE2   1 
ATOM   3641  N  N     . ALA E 1 115 ? -19.328 -22.787 71.559 1.00 48.97  ? 114 ALA E N     1 
ATOM   3642  C  CA    . ALA E 1 115 ? -19.665 -23.776 72.557 1.00 49.13  ? 114 ALA E CA    1 
ATOM   3643  C  C     . ALA E 1 115 ? -19.128 -23.348 73.901 1.00 49.81  ? 114 ALA E C     1 
ATOM   3644  O  O     . ALA E 1 115 ? -19.106 -24.134 74.844 1.00 49.95  ? 114 ALA E O     1 
ATOM   3645  C  CB    . ALA E 1 115 ? -19.086 -25.094 72.170 1.00 49.36  ? 114 ALA E CB    1 
ATOM   3646  N  N     . LYS E 1 116 ? -18.687 -22.094 73.982 1.00 50.43  ? 115 LYS E N     1 
ATOM   3647  C  CA    . LYS E 1 116 ? -18.072 -21.546 75.200 1.00 50.36  ? 115 LYS E CA    1 
ATOM   3648  C  C     . LYS E 1 116 ? -16.824 -22.322 75.638 1.00 49.63  ? 115 LYS E C     1 
ATOM   3649  O  O     . LYS E 1 116 ? -16.560 -22.476 76.821 1.00 49.82  ? 115 LYS E O     1 
ATOM   3650  C  CB    . LYS E 1 116 ? -19.111 -21.425 76.318 1.00 50.76  ? 115 LYS E CB    1 
ATOM   3651  C  CG    . LYS E 1 116 ? -20.198 -20.425 75.974 1.00 52.74  ? 115 LYS E CG    1 
ATOM   3652  C  CD    . LYS E 1 116 ? -21.423 -20.530 76.859 1.00 55.78  ? 115 LYS E CD    1 
ATOM   3653  C  CE    . LYS E 1 116 ? -22.405 -19.441 76.457 1.00 58.11  ? 115 LYS E CE    1 
ATOM   3654  N  NZ    . LYS E 1 116 ? -23.257 -18.962 77.590 1.00 61.99  ? 115 LYS E NZ    1 
ATOM   3655  N  N     . ARG E 1 117 ? -16.049 -22.782 74.660 1.00 48.98  ? 116 ARG E N     1 
ATOM   3656  C  CA    . ARG E 1 117 ? -14.736 -23.375 74.903 1.00 48.24  ? 116 ARG E CA    1 
ATOM   3657  C  C     . ARG E 1 117 ? -13.628 -22.513 74.280 1.00 48.07  ? 116 ARG E C     1 
ATOM   3658  O  O     . ARG E 1 117 ? -13.894 -21.566 73.547 1.00 48.17  ? 116 ARG E O     1 
ATOM   3659  C  CB    . ARG E 1 117 ? -14.687 -24.806 74.345 1.00 48.38  ? 116 ARG E CB    1 
ATOM   3660  C  CG    . ARG E 1 117 ? -15.649 -25.792 75.029 1.00 47.67  ? 116 ARG E CG    1 
ATOM   3661  C  CD    . ARG E 1 117 ? -15.529 -27.194 74.462 1.00 46.98  ? 116 ARG E CD    1 
ATOM   3662  N  NE    . ARG E 1 117 ? -16.405 -27.412 73.304 1.00 47.40  ? 116 ARG E NE    1 
ATOM   3663  C  CZ    . ARG E 1 117 ? -16.035 -27.366 72.023 1.00 45.07  ? 116 ARG E CZ    1 
ATOM   3664  N  NH1   . ARG E 1 117 ? -14.788 -27.105 71.669 1.00 46.06  ? 116 ARG E NH1   1 
ATOM   3665  N  NH2   . ARG E 1 117 ? -16.927 -27.587 71.086 1.00 43.78  ? 116 ARG E NH2   1 
ATOM   3666  N  N     . VAL E 1 118 ? -12.382 -22.837 74.590 1.00 47.89  ? 117 VAL E N     1 
ATOM   3667  C  CA    . VAL E 1 118 ? -11.234 -22.204 73.947 1.00 47.38  ? 117 VAL E CA    1 
ATOM   3668  C  C     . VAL E 1 118 ? -10.378 -23.296 73.297 1.00 47.40  ? 117 VAL E C     1 
ATOM   3669  O  O     . VAL E 1 118 ? -9.320  -23.021 72.730 1.00 47.74  ? 117 VAL E O     1 
ATOM   3670  C  CB    . VAL E 1 118 ? -10.395 -21.352 74.962 1.00 47.20  ? 117 VAL E CB    1 
ATOM   3671  C  CG1   . VAL E 1 118 ? -11.217 -20.206 75.505 1.00 46.63  ? 117 VAL E CG1   1 
ATOM   3672  C  CG2   . VAL E 1 118 ? -9.894  -22.208 76.112 1.00 47.08  ? 117 VAL E CG2   1 
ATOM   3673  N  N     . THR E 1 119 ? -10.846 -24.539 73.402 1.00 47.33  ? 118 THR E N     1 
ATOM   3674  C  CA    . THR E 1 119 ? -10.170 -25.706 72.823 1.00 47.05  ? 118 THR E CA    1 
ATOM   3675  C  C     . THR E 1 119 ? -10.941 -26.244 71.623 1.00 46.59  ? 118 THR E C     1 
ATOM   3676  O  O     . THR E 1 119 ? -12.109 -26.628 71.741 1.00 46.51  ? 118 THR E O     1 
ATOM   3677  C  CB    . THR E 1 119 ? -10.054 -26.847 73.862 1.00 47.11  ? 118 THR E CB    1 
ATOM   3678  O  OG1   . THR E 1 119 ? -9.705  -26.290 75.130 1.00 47.53  ? 118 THR E OG1   1 
ATOM   3679  C  CG2   . THR E 1 119 ? -9.007  -27.896 73.446 1.00 46.90  ? 118 THR E CG2   1 
ATOM   3680  N  N     . ILE E 1 120 ? -10.289 -26.276 70.471 1.00 46.02  ? 119 ILE E N     1 
ATOM   3681  C  CA    . ILE E 1 120 ? -10.896 -26.877 69.278 1.00 45.31  ? 119 ILE E CA    1 
ATOM   3682  C  C     . ILE E 1 120 ? -10.909 -28.415 69.367 1.00 45.25  ? 119 ILE E C     1 
ATOM   3683  O  O     . ILE E 1 120 ? -9.920  -29.050 69.756 1.00 44.85  ? 119 ILE E O     1 
ATOM   3684  C  CB    . ILE E 1 120 ? -10.225 -26.390 67.955 1.00 44.80  ? 119 ILE E CB    1 
ATOM   3685  C  CG1   . ILE E 1 120 ? -8.753  -26.802 67.875 1.00 43.77  ? 119 ILE E CG1   1 
ATOM   3686  C  CG2   . ILE E 1 120 ? -10.289 -24.915 67.861 1.00 45.29  ? 119 ILE E CG2   1 
ATOM   3687  C  CD1   . ILE E 1 120 ? -8.211  -26.826 66.488 1.00 42.75  ? 119 ILE E CD1   1 
ATOM   3688  N  N     . MET E 1 121 ? -12.039 -28.999 68.994 1.00 45.25  ? 120 MET E N     1 
ATOM   3689  C  CA    . MET E 1 121 ? -12.225 -30.445 69.036 1.00 45.65  ? 120 MET E CA    1 
ATOM   3690  C  C     . MET E 1 121 ? -12.666 -30.964 67.667 1.00 45.10  ? 120 MET E C     1 
ATOM   3691  O  O     . MET E 1 121 ? -13.095 -30.185 66.820 1.00 45.50  ? 120 MET E O     1 
ATOM   3692  C  CB    . MET E 1 121 ? -13.255 -30.792 70.117 1.00 45.77  ? 120 MET E CB    1 
ATOM   3693  C  CG    . MET E 1 121 ? -12.917 -30.153 71.443 1.00 48.77  ? 120 MET E CG    1 
ATOM   3694  S  SD    . MET E 1 121 ? -13.808 -30.698 72.909 1.00 55.11  ? 120 MET E SD    1 
ATOM   3695  C  CE    . MET E 1 121 ? -15.473 -30.978 72.332 1.00 58.28  ? 120 MET E CE    1 
ATOM   3696  N  N     . PRO E 1 122 ? -12.566 -32.279 67.431 1.00 44.85  ? 121 PRO E N     1 
ATOM   3697  C  CA    . PRO E 1 122 ? -13.061 -32.768 66.140 1.00 44.42  ? 121 PRO E CA    1 
ATOM   3698  C  C     . PRO E 1 122 ? -14.521 -32.381 65.827 1.00 44.23  ? 121 PRO E C     1 
ATOM   3699  O  O     . PRO E 1 122 ? -14.866 -32.152 64.654 1.00 44.37  ? 121 PRO E O     1 
ATOM   3700  C  CB    . PRO E 1 122 ? -12.885 -34.280 66.261 1.00 43.88  ? 121 PRO E CB    1 
ATOM   3701  C  CG    . PRO E 1 122 ? -11.631 -34.396 67.063 1.00 44.70  ? 121 PRO E CG    1 
ATOM   3702  C  CD    . PRO E 1 122 ? -11.805 -33.325 68.144 1.00 44.89  ? 121 PRO E CD    1 
ATOM   3703  N  N     . LYS E 1 123 ? -15.359 -32.282 66.851 1.00 43.75  ? 122 LYS E N     1 
ATOM   3704  C  CA    . LYS E 1 123 ? -16.757 -31.917 66.625 1.00 43.77  ? 122 LYS E CA    1 
ATOM   3705  C  C     . LYS E 1 123 ? -16.876 -30.481 66.090 1.00 43.10  ? 122 LYS E C     1 
ATOM   3706  O  O     . LYS E 1 123 ? -17.813 -30.155 65.362 1.00 42.37  ? 122 LYS E O     1 
ATOM   3707  C  CB    . LYS E 1 123 ? -17.630 -32.151 67.886 1.00 43.73  ? 122 LYS E CB    1 
ATOM   3708  C  CG    . LYS E 1 123 ? -17.266 -31.280 69.095 1.00 46.01  ? 122 LYS E CG    1 
ATOM   3709  C  CD    . LYS E 1 123 ? -18.105 -31.572 70.337 1.00 49.87  ? 122 LYS E CD    1 
ATOM   3710  C  CE    . LYS E 1 123 ? -19.495 -30.971 70.190 1.00 55.88  ? 122 LYS E CE    1 
ATOM   3711  N  NZ    . LYS E 1 123 ? -20.178 -30.644 71.504 1.00 58.60  ? 122 LYS E NZ    1 
ATOM   3712  N  N     . ASP E 1 124 ? -15.910 -29.638 66.449 1.00 42.96  ? 123 ASP E N     1 
ATOM   3713  C  CA    . ASP E 1 124 ? -15.828 -28.279 65.906 1.00 42.82  ? 123 ASP E CA    1 
ATOM   3714  C  C     . ASP E 1 124 ? -15.474 -28.295 64.416 1.00 42.62  ? 123 ASP E C     1 
ATOM   3715  O  O     . ASP E 1 124 ? -16.095 -27.600 63.625 1.00 43.03  ? 123 ASP E O     1 
ATOM   3716  C  CB    . ASP E 1 124 ? -14.817 -27.441 66.684 1.00 42.61  ? 123 ASP E CB    1 
ATOM   3717  C  CG    . ASP E 1 124 ? -15.134 -27.355 68.168 1.00 42.83  ? 123 ASP E CG    1 
ATOM   3718  O  OD1   . ASP E 1 124 ? -16.298 -27.139 68.535 1.00 44.07  ? 123 ASP E OD1   1 
ATOM   3719  O  OD2   . ASP E 1 124 ? -14.213 -27.493 68.981 1.00 43.22  ? 123 ASP E OD2   1 
ATOM   3720  N  N     . ILE E 1 125 ? -14.491 -29.099 64.031 1.00 42.50  ? 124 ILE E N     1 
ATOM   3721  C  CA    . ILE E 1 125 ? -14.112 -29.204 62.622 1.00 42.56  ? 124 ILE E CA    1 
ATOM   3722  C  C     . ILE E 1 125 ? -15.295 -29.711 61.808 1.00 43.13  ? 124 ILE E C     1 
ATOM   3723  O  O     . ILE E 1 125 ? -15.629 -29.144 60.760 1.00 43.18  ? 124 ILE E O     1 
ATOM   3724  C  CB    . ILE E 1 125 ? -12.903 -30.152 62.421 1.00 42.50  ? 124 ILE E CB    1 
ATOM   3725  C  CG1   . ILE E 1 125 ? -11.638 -29.581 63.076 1.00 41.83  ? 124 ILE E CG1   1 
ATOM   3726  C  CG2   . ILE E 1 125 ? -12.657 -30.400 60.956 1.00 41.28  ? 124 ILE E CG2   1 
ATOM   3727  C  CD1   . ILE E 1 125 ? -10.392 -30.455 62.895 1.00 39.45  ? 124 ILE E CD1   1 
ATOM   3728  N  N     . GLN E 1 126 ? -15.924 -30.772 62.315 1.00 43.46  ? 125 GLN E N     1 
ATOM   3729  C  CA    . GLN E 1 126 ? -17.080 -31.399 61.682 1.00 43.61  ? 125 GLN E CA    1 
ATOM   3730  C  C     . GLN E 1 126 ? -18.256 -30.446 61.532 1.00 43.28  ? 125 GLN E C     1 
ATOM   3731  O  O     . GLN E 1 126 ? -18.966 -30.507 60.537 1.00 44.34  ? 125 GLN E O     1 
ATOM   3732  C  CB    . GLN E 1 126 ? -17.490 -32.662 62.453 1.00 44.03  ? 125 GLN E CB    1 
ATOM   3733  C  CG    . GLN E 1 126 ? -16.448 -33.790 62.350 1.00 46.05  ? 125 GLN E CG    1 
ATOM   3734  C  CD    . GLN E 1 126 ? -16.466 -34.767 63.519 1.00 50.35  ? 125 GLN E CD    1 
ATOM   3735  O  OE1   . GLN E 1 126 ? -17.364 -34.750 64.374 1.00 53.05  ? 125 GLN E OE1   1 
ATOM   3736  N  NE2   . GLN E 1 126 ? -15.457 -35.630 63.567 1.00 51.84  ? 125 GLN E NE2   1 
ATOM   3737  N  N     . LEU E 1 127 ? -18.469 -29.551 62.490 1.00 42.73  ? 126 LEU E N     1 
ATOM   3738  C  CA    . LEU E 1 127 ? -19.592 -28.642 62.366 1.00 42.14  ? 126 LEU E CA    1 
ATOM   3739  C  C     . LEU E 1 127 ? -19.263 -27.611 61.293 1.00 42.34  ? 126 LEU E C     1 
ATOM   3740  O  O     . LEU E 1 127 ? -20.100 -27.321 60.435 1.00 42.32  ? 126 LEU E O     1 
ATOM   3741  C  CB    . LEU E 1 127 ? -19.966 -27.995 63.702 1.00 41.91  ? 126 LEU E CB    1 
ATOM   3742  C  CG    . LEU E 1 127 ? -21.063 -26.925 63.606 1.00 41.99  ? 126 LEU E CG    1 
ATOM   3743  C  CD1   . LEU E 1 127 ? -22.409 -27.532 63.297 1.00 40.70  ? 126 LEU E CD1   1 
ATOM   3744  C  CD2   . LEU E 1 127 ? -21.137 -26.069 64.863 1.00 41.77  ? 126 LEU E CD2   1 
ATOM   3745  N  N     . ALA E 1 128 ? -18.039 -27.086 61.317 1.00 42.11  ? 127 ALA E N     1 
ATOM   3746  C  CA    . ALA E 1 128 ? -17.593 -26.180 60.261 1.00 42.28  ? 127 ALA E CA    1 
ATOM   3747  C  C     . ALA E 1 128 ? -17.822 -26.800 58.884 1.00 42.64  ? 127 ALA E C     1 
ATOM   3748  O  O     . ALA E 1 128 ? -18.446 -26.201 58.003 1.00 42.25  ? 127 ALA E O     1 
ATOM   3749  C  CB    . ALA E 1 128 ? -16.140 -25.814 60.439 1.00 41.80  ? 127 ALA E CB    1 
ATOM   3750  N  N     . ARG E 1 129 ? -17.343 -28.024 58.712 1.00 43.22  ? 128 ARG E N     1 
ATOM   3751  C  CA    . ARG E 1 129 ? -17.379 -28.637 57.408 1.00 43.30  ? 128 ARG E CA    1 
ATOM   3752  C  C     . ARG E 1 129 ? -18.805 -28.927 56.990 1.00 44.06  ? 128 ARG E C     1 
ATOM   3753  O  O     . ARG E 1 129 ? -19.117 -28.865 55.810 1.00 44.32  ? 128 ARG E O     1 
ATOM   3754  C  CB    . ARG E 1 129 ? -16.522 -29.880 57.380 1.00 42.65  ? 128 ARG E CB    1 
ATOM   3755  C  CG    . ARG E 1 129 ? -15.060 -29.626 57.650 1.00 42.33  ? 128 ARG E CG    1 
ATOM   3756  C  CD    . ARG E 1 129 ? -14.196 -30.418 56.684 1.00 44.83  ? 128 ARG E CD    1 
ATOM   3757  N  NE    . ARG E 1 129 ? -14.538 -31.829 56.748 1.00 48.82  ? 128 ARG E NE    1 
ATOM   3758  C  CZ    . ARG E 1 129 ? -14.659 -32.638 55.705 1.00 49.60  ? 128 ARG E CZ    1 
ATOM   3759  N  NH1   . ARG E 1 129 ? -14.452 -32.206 54.465 1.00 48.75  ? 128 ARG E NH1   1 
ATOM   3760  N  NH2   . ARG E 1 129 ? -14.996 -33.897 55.927 1.00 51.16  ? 128 ARG E NH2   1 
ATOM   3761  N  N     . ARG E 1 130 ? -19.681 -29.219 57.946 1.00 45.14  ? 129 ARG E N     1 
ATOM   3762  C  CA    . ARG E 1 130 ? -21.085 -29.437 57.606 1.00 46.64  ? 129 ARG E CA    1 
ATOM   3763  C  C     . ARG E 1 130 ? -21.755 -28.150 57.139 1.00 46.73  ? 129 ARG E C     1 
ATOM   3764  O  O     . ARG E 1 130 ? -22.453 -28.135 56.135 1.00 46.64  ? 129 ARG E O     1 
ATOM   3765  C  CB    . ARG E 1 130 ? -21.878 -30.064 58.756 1.00 46.86  ? 129 ARG E CB    1 
ATOM   3766  C  CG    . ARG E 1 130 ? -23.353 -30.331 58.391 1.00 49.73  ? 129 ARG E CG    1 
ATOM   3767  C  CD    . ARG E 1 130 ? -23.923 -31.379 59.321 1.00 57.18  ? 129 ARG E CD    1 
ATOM   3768  N  NE    . ARG E 1 130 ? -25.285 -31.815 58.984 1.00 61.69  ? 129 ARG E NE    1 
ATOM   3769  C  CZ    . ARG E 1 130 ? -26.051 -32.564 59.789 1.00 63.28  ? 129 ARG E CZ    1 
ATOM   3770  N  NH1   . ARG E 1 130 ? -25.604 -32.946 60.988 1.00 62.80  ? 129 ARG E NH1   1 
ATOM   3771  N  NH2   . ARG E 1 130 ? -27.274 -32.918 59.405 1.00 63.90  ? 129 ARG E NH2   1 
ATOM   3772  N  N     . ILE E 1 131 ? -21.532 -27.071 57.867 1.00 47.48  ? 130 ILE E N     1 
ATOM   3773  C  CA    . ILE E 1 131 ? -22.143 -25.814 57.503 1.00 48.44  ? 130 ILE E CA    1 
ATOM   3774  C  C     . ILE E 1 131 ? -21.558 -25.276 56.206 1.00 49.00  ? 130 ILE E C     1 
ATOM   3775  O  O     . ILE E 1 131 ? -22.281 -24.696 55.410 1.00 49.61  ? 130 ILE E O     1 
ATOM   3776  C  CB    . ILE E 1 131 ? -22.081 -24.822 58.640 1.00 48.45  ? 130 ILE E CB    1 
ATOM   3777  C  CG1   . ILE E 1 131 ? -22.833 -25.406 59.832 1.00 49.37  ? 130 ILE E CG1   1 
ATOM   3778  C  CG2   . ILE E 1 131 ? -22.673 -23.497 58.238 1.00 47.70  ? 130 ILE E CG2   1 
ATOM   3779  C  CD1   . ILE E 1 131 ? -22.683 -24.570 61.095 1.00 52.24  ? 130 ILE E CD1   1 
ATOM   3780  N  N     . ARG E 1 132 ? -20.272 -25.508 55.972 1.00 49.78  ? 131 ARG E N     1 
ATOM   3781  C  CA    . ARG E 1 132 ? -19.646 -25.162 54.681 1.00 50.33  ? 131 ARG E CA    1 
ATOM   3782  C  C     . ARG E 1 132 ? -20.188 -25.961 53.487 1.00 51.56  ? 131 ARG E C     1 
ATOM   3783  O  O     . ARG E 1 132 ? -19.880 -25.639 52.343 1.00 51.88  ? 131 ARG E O     1 
ATOM   3784  C  CB    . ARG E 1 132 ? -18.143 -25.382 54.735 1.00 49.68  ? 131 ARG E CB    1 
ATOM   3785  C  CG    . ARG E 1 132 ? -17.345 -24.356 55.451 1.00 47.13  ? 131 ARG E CG    1 
ATOM   3786  C  CD    . ARG E 1 132 ? -15.941 -24.902 55.567 1.00 45.49  ? 131 ARG E CD    1 
ATOM   3787  N  NE    . ARG E 1 132 ? -14.979 -23.889 55.957 1.00 44.00  ? 131 ARG E NE    1 
ATOM   3788  C  CZ    . ARG E 1 132 ? -13.721 -23.847 55.532 1.00 45.36  ? 131 ARG E CZ    1 
ATOM   3789  N  NH1   . ARG E 1 132 ? -13.252 -24.768 54.694 1.00 43.08  ? 131 ARG E NH1   1 
ATOM   3790  N  NH2   . ARG E 1 132 ? -12.924 -22.863 55.940 1.00 46.91  ? 131 ARG E NH2   1 
ATOM   3791  N  N     . GLY E 1 133 ? -20.965 -27.008 53.740 1.00 52.71  ? 132 GLY E N     1 
ATOM   3792  C  CA    . GLY E 1 133 ? -21.436 -27.860 52.656 1.00 54.81  ? 132 GLY E CA    1 
ATOM   3793  C  C     . GLY E 1 133 ? -20.378 -28.829 52.165 1.00 56.72  ? 132 GLY E C     1 
ATOM   3794  O  O     . GLY E 1 133 ? -20.416 -29.249 51.022 1.00 57.26  ? 132 GLY E O     1 
ATOM   3795  N  N     . GLU E 1 134 ? -19.433 -29.191 53.032 1.00 58.46  ? 133 GLU E N     1 
ATOM   3796  C  CA    . GLU E 1 134 ? -18.387 -30.156 52.700 1.00 59.97  ? 133 GLU E CA    1 
ATOM   3797  C  C     . GLU E 1 134 ? -18.745 -31.553 53.201 1.00 61.87  ? 133 GLU E C     1 
ATOM   3798  O  O     . GLU E 1 134 ? -18.134 -32.548 52.796 1.00 62.87  ? 133 GLU E O     1 
ATOM   3799  C  CB    . GLU E 1 134 ? -17.040 -29.716 53.288 1.00 59.49  ? 133 GLU E CB    1 
ATOM   3800  C  CG    . GLU E 1 134 ? -16.392 -28.548 52.562 1.00 58.30  ? 133 GLU E CG    1 
ATOM   3801  C  CD    . GLU E 1 134 ? -15.127 -28.035 53.235 1.00 56.66  ? 133 GLU E CD    1 
ATOM   3802  O  OE1   . GLU E 1 134 ? -14.320 -28.848 53.743 1.00 54.57  ? 133 GLU E OE1   1 
ATOM   3803  O  OE2   . GLU E 1 134 ? -14.940 -26.797 53.246 1.00 57.31  ? 133 GLU E OE2   1 
ATOM   3804  N  N     . ARG E 1 135 ? -19.717 -31.630 54.108 1.00 63.70  ? 134 ARG E N     1 
ATOM   3805  C  CA    . ARG E 1 135 ? -20.230 -32.916 54.589 1.00 64.95  ? 134 ARG E CA    1 
ATOM   3806  C  C     . ARG E 1 135 ? -21.722 -32.789 54.941 1.00 65.80  ? 134 ARG E C     1 
ATOM   3807  O  O     . ARG E 1 135 ? -22.602 -33.143 54.144 1.00 66.78  ? 134 ARG E O     1 
ATOM   3808  C  CB    . ARG E 1 135 ? -19.426 -33.426 55.796 1.00 64.90  ? 134 ARG E CB    1 
ATOM   3809  C  CG    . ARG E 1 135 ? -19.837 -32.805 57.142 1.00 65.84  ? 134 ARG E CG    1 
ATOM   3810  C  CD    . ARG E 1 135 ? -19.094 -33.409 58.347 1.00 65.27  ? 134 ARG E CD    1 
ATOM   3811  N  N     . LYS F 2 17  ? 16.666  -46.539 35.880 1.00 106.04 ? 16  LYS F N     1 
ATOM   3812  C  CA    . LYS F 2 17  ? 16.033  -46.875 37.195 1.00 105.89 ? 16  LYS F CA    1 
ATOM   3813  C  C     . LYS F 2 17  ? 16.380  -48.295 37.670 1.00 105.62 ? 16  LYS F C     1 
ATOM   3814  O  O     . LYS F 2 17  ? 16.038  -49.294 37.017 1.00 105.73 ? 16  LYS F O     1 
ATOM   3815  C  CB    . LYS F 2 17  ? 14.506  -46.669 37.153 1.00 106.01 ? 16  LYS F CB    1 
ATOM   3816  C  CG    . LYS F 2 17  ? 13.779  -47.522 36.110 1.00 106.43 ? 16  LYS F CG    1 
ATOM   3817  C  CD    . LYS F 2 17  ? 12.347  -47.841 36.523 1.00 107.07 ? 16  LYS F CD    1 
ATOM   3818  C  CE    . LYS F 2 17  ? 11.822  -49.055 35.755 1.00 107.08 ? 16  LYS F CE    1 
ATOM   3819  N  NZ    . LYS F 2 17  ? 10.335  -49.059 35.673 1.00 107.33 ? 16  LYS F NZ    1 
ATOM   3820  N  N     . ARG F 2 18  ? 17.089  -48.368 38.797 1.00 104.95 ? 17  ARG F N     1 
ATOM   3821  C  CA    . ARG F 2 18  ? 17.239  -49.616 39.536 1.00 104.07 ? 17  ARG F CA    1 
ATOM   3822  C  C     . ARG F 2 18  ? 16.163  -49.636 40.622 1.00 103.01 ? 17  ARG F C     1 
ATOM   3823  O  O     . ARG F 2 18  ? 16.380  -49.104 41.728 1.00 103.16 ? 17  ARG F O     1 
ATOM   3824  C  CB    . ARG F 2 18  ? 18.653  -49.744 40.142 1.00 104.41 ? 17  ARG F CB    1 
ATOM   3825  C  CG    . ARG F 2 18  ? 19.583  -50.744 39.424 1.00 105.32 ? 17  ARG F CG    1 
ATOM   3826  C  CD    . ARG F 2 18  ? 19.175  -52.203 39.700 1.00 106.83 ? 17  ARG F CD    1 
ATOM   3827  N  NE    . ARG F 2 18  ? 19.673  -53.139 38.687 1.00 108.07 ? 17  ARG F NE    1 
ATOM   3828  C  CZ    . ARG F 2 18  ? 19.285  -54.412 38.562 1.00 109.02 ? 17  ARG F CZ    1 
ATOM   3829  N  NH1   . ARG F 2 18  ? 18.377  -54.943 39.386 1.00 109.03 ? 17  ARG F NH1   1 
ATOM   3830  N  NH2   . ARG F 2 18  ? 19.811  -55.166 37.602 1.00 109.23 ? 17  ARG F NH2   1 
ATOM   3831  N  N     . HIS F 2 19  ? 15.005  -50.229 40.279 1.00 101.35 ? 18  HIS F N     1 
ATOM   3832  C  CA    . HIS F 2 19  ? 13.827  -50.380 41.178 1.00 99.58  ? 18  HIS F CA    1 
ATOM   3833  C  C     . HIS F 2 19  ? 12.810  -49.225 41.092 1.00 97.48  ? 18  HIS F C     1 
ATOM   3834  O  O     . HIS F 2 19  ? 12.657  -48.611 40.030 1.00 97.43  ? 18  HIS F O     1 
ATOM   3835  C  CB    . HIS F 2 19  ? 14.241  -50.661 42.644 1.00 100.13 ? 18  HIS F CB    1 
ATOM   3836  C  CG    . HIS F 2 19  ? 13.779  -51.989 43.168 1.00 101.99 ? 18  HIS F CG    1 
ATOM   3837  N  ND1   . HIS F 2 19  ? 12.929  -52.106 44.251 1.00 103.31 ? 18  HIS F ND1   1 
ATOM   3838  C  CD2   . HIS F 2 19  ? 14.041  -53.255 42.758 1.00 103.51 ? 18  HIS F CD2   1 
ATOM   3839  C  CE1   . HIS F 2 19  ? 12.691  -53.386 44.487 1.00 103.96 ? 18  HIS F CE1   1 
ATOM   3840  N  NE2   . HIS F 2 19  ? 13.353  -54.104 43.595 1.00 104.18 ? 18  HIS F NE2   1 
ATOM   3841  N  N     . ARG F 2 20  ? 12.110  -48.980 42.209 1.00 94.74  ? 19  ARG F N     1 
ATOM   3842  C  CA    . ARG F 2 20  ? 11.151  -47.875 42.408 1.00 91.96  ? 19  ARG F CA    1 
ATOM   3843  C  C     . ARG F 2 20  ? 10.580  -47.957 43.842 1.00 89.40  ? 19  ARG F C     1 
ATOM   3844  O  O     . ARG F 2 20  ? 10.116  -49.018 44.276 1.00 89.48  ? 19  ARG F O     1 
ATOM   3845  C  CB    . ARG F 2 20  ? 10.014  -47.916 41.373 1.00 92.38  ? 19  ARG F CB    1 
ATOM   3846  C  CG    . ARG F 2 20  ? 9.516   -46.540 40.919 1.00 94.16  ? 19  ARG F CG    1 
ATOM   3847  C  CD    . ARG F 2 20  ? 8.686   -45.846 42.009 1.00 97.84  ? 19  ARG F CD    1 
ATOM   3848  N  NE    . ARG F 2 20  ? 8.529   -44.402 41.796 1.00 99.44  ? 19  ARG F NE    1 
ATOM   3849  C  CZ    . ARG F 2 20  ? 8.126   -43.539 42.735 1.00 100.69 ? 19  ARG F CZ    1 
ATOM   3850  N  NH1   . ARG F 2 20  ? 7.843   -43.963 43.969 1.00 100.80 ? 19  ARG F NH1   1 
ATOM   3851  N  NH2   . ARG F 2 20  ? 8.009   -42.243 42.444 1.00 101.04 ? 19  ARG F NH2   1 
ATOM   3852  N  N     . LYS F 2 21  ? 10.609  -46.839 44.567 1.00 85.72  ? 20  LYS F N     1 
ATOM   3853  C  CA    . LYS F 2 21  ? 10.277  -46.822 46.002 1.00 82.02  ? 20  LYS F CA    1 
ATOM   3854  C  C     . LYS F 2 21  ? 8.770   -46.928 46.322 1.00 79.04  ? 20  LYS F C     1 
ATOM   3855  O  O     . LYS F 2 21  ? 7.935   -46.387 45.597 1.00 79.03  ? 20  LYS F O     1 
ATOM   3856  C  CB    . LYS F 2 21  ? 10.891  -45.579 46.665 1.00 82.41  ? 20  LYS F CB    1 
ATOM   3857  C  CG    . LYS F 2 21  ? 11.032  -45.643 48.202 1.00 82.82  ? 20  LYS F CG    1 
ATOM   3858  C  CD    . LYS F 2 21  ? 11.902  -46.831 48.690 1.00 83.25  ? 20  LYS F CD    1 
ATOM   3859  C  CE    . LYS F 2 21  ? 11.091  -48.118 48.904 1.00 82.67  ? 20  LYS F CE    1 
ATOM   3860  N  NZ    . LYS F 2 21  ? 10.146  -47.972 50.054 1.00 82.67  ? 20  LYS F NZ    1 
ATOM   3861  N  N     . VAL F 2 22  ? 8.433   -47.631 47.405 1.00 74.84  ? 21  VAL F N     1 
ATOM   3862  C  CA    . VAL F 2 22  ? 7.041   -47.843 47.790 1.00 70.96  ? 21  VAL F CA    1 
ATOM   3863  C  C     . VAL F 2 22  ? 6.637   -46.790 48.803 1.00 68.71  ? 21  VAL F C     1 
ATOM   3864  O  O     . VAL F 2 22  ? 7.248   -46.669 49.870 1.00 68.62  ? 21  VAL F O     1 
ATOM   3865  C  CB    . VAL F 2 22  ? 6.776   -49.272 48.365 1.00 70.88  ? 21  VAL F CB    1 
ATOM   3866  C  CG1   . VAL F 2 22  ? 5.441   -49.341 49.075 1.00 69.81  ? 21  VAL F CG1   1 
ATOM   3867  C  CG2   . VAL F 2 22  ? 6.797   -50.292 47.269 1.00 70.91  ? 21  VAL F CG2   1 
ATOM   3868  N  N     . LEU F 2 23  ? 5.592   -46.046 48.450 1.00 65.36  ? 22  LEU F N     1 
ATOM   3869  C  CA    . LEU F 2 23  ? 5.079   -44.970 49.253 1.00 62.07  ? 22  LEU F CA    1 
ATOM   3870  C  C     . LEU F 2 23  ? 3.941   -45.469 50.146 1.00 60.74  ? 22  LEU F C     1 
ATOM   3871  O  O     . LEU F 2 23  ? 2.916   -45.948 49.661 1.00 60.36  ? 22  LEU F O     1 
ATOM   3872  C  CB    . LEU F 2 23  ? 4.616   -43.824 48.348 1.00 61.70  ? 22  LEU F CB    1 
ATOM   3873  C  CG    . LEU F 2 23  ? 5.660   -43.207 47.397 1.00 60.84  ? 22  LEU F CG    1 
ATOM   3874  C  CD1   . LEU F 2 23  ? 5.047   -42.190 46.468 1.00 59.67  ? 22  LEU F CD1   1 
ATOM   3875  C  CD2   . LEU F 2 23  ? 6.842   -42.592 48.135 1.00 59.83  ? 22  LEU F CD2   1 
ATOM   3876  N  N     . ARG F 2 24  ? 4.135   -45.362 51.457 1.00 58.77  ? 23  ARG F N     1 
ATOM   3877  C  CA    . ARG F 2 24  ? 3.106   -45.750 52.415 1.00 57.04  ? 23  ARG F CA    1 
ATOM   3878  C  C     . ARG F 2 24  ? 3.123   -44.872 53.658 1.00 56.08  ? 23  ARG F C     1 
ATOM   3879  O  O     . ARG F 2 24  ? 4.182   -44.521 54.161 1.00 55.72  ? 23  ARG F O     1 
ATOM   3880  C  CB    . ARG F 2 24  ? 3.231   -47.232 52.794 1.00 56.80  ? 23  ARG F CB    1 
ATOM   3881  C  CG    . ARG F 2 24  ? 4.660   -47.748 52.839 1.00 56.68  ? 23  ARG F CG    1 
ATOM   3882  C  CD    . ARG F 2 24  ? 4.716   -49.253 52.835 1.00 53.49  ? 23  ARG F CD    1 
ATOM   3883  N  NE    . ARG F 2 24  ? 4.158   -49.768 54.071 1.00 53.51  ? 23  ARG F NE    1 
ATOM   3884  C  CZ    . ARG F 2 24  ? 4.877   -50.128 55.136 1.00 52.70  ? 23  ARG F CZ    1 
ATOM   3885  N  NH1   . ARG F 2 24  ? 6.214   -50.067 55.133 1.00 48.66  ? 23  ARG F NH1   1 
ATOM   3886  N  NH2   . ARG F 2 24  ? 4.239   -50.569 56.206 1.00 50.63  ? 23  ARG F NH2   1 
ATOM   3887  N  N     . ASP F 2 25  ? 1.934   -44.496 54.128 1.00 55.16  ? 24  ASP F N     1 
ATOM   3888  C  CA    . ASP F 2 25  ? 1.771   -43.774 55.397 1.00 54.12  ? 24  ASP F CA    1 
ATOM   3889  C  C     . ASP F 2 25  ? 2.355   -42.356 55.427 1.00 53.21  ? 24  ASP F C     1 
ATOM   3890  O  O     . ASP F 2 25  ? 2.600   -41.796 56.495 1.00 52.87  ? 24  ASP F O     1 
ATOM   3891  C  CB    . ASP F 2 25  ? 2.372   -44.585 56.544 1.00 54.29  ? 24  ASP F CB    1 
ATOM   3892  C  CG    . ASP F 2 25  ? 1.640   -44.383 57.824 1.00 54.97  ? 24  ASP F CG    1 
ATOM   3893  O  OD1   . ASP F 2 25  ? 0.430   -44.085 57.733 1.00 56.90  ? 24  ASP F OD1   1 
ATOM   3894  O  OD2   . ASP F 2 25  ? 2.255   -44.542 58.906 1.00 54.83  ? 24  ASP F OD2   1 
ATOM   3895  N  N     . ASN F 2 26  ? 2.564   -41.770 54.262 1.00 52.29  ? 25  ASN F N     1 
ATOM   3896  C  CA    . ASN F 2 26  ? 3.103   -40.422 54.182 1.00 51.39  ? 25  ASN F CA    1 
ATOM   3897  C  C     . ASN F 2 26  ? 2.250   -39.313 54.813 1.00 51.01  ? 25  ASN F C     1 
ATOM   3898  O  O     . ASN F 2 26  ? 2.753   -38.216 55.026 1.00 50.93  ? 25  ASN F O     1 
ATOM   3899  C  CB    . ASN F 2 26  ? 3.425   -40.091 52.745 1.00 51.15  ? 25  ASN F CB    1 
ATOM   3900  C  CG    . ASN F 2 26  ? 4.583   -40.867 52.253 1.00 51.45  ? 25  ASN F CG    1 
ATOM   3901  O  OD1   . ASN F 2 26  ? 5.711   -40.605 52.644 1.00 52.21  ? 25  ASN F OD1   1 
ATOM   3902  N  ND2   . ASN F 2 26  ? 4.326   -41.858 51.411 1.00 51.82  ? 25  ASN F ND2   1 
ATOM   3903  N  N     . ILE F 2 27  ? 0.985   -39.607 55.123 1.00 50.37  ? 26  ILE F N     1 
ATOM   3904  C  CA    . ILE F 2 27  ? 0.142   -38.682 55.858 1.00 50.00  ? 26  ILE F CA    1 
ATOM   3905  C  C     . ILE F 2 27  ? 0.721   -38.404 57.235 1.00 50.28  ? 26  ILE F C     1 
ATOM   3906  O  O     . ILE F 2 27  ? 0.462   -37.359 57.809 1.00 51.02  ? 26  ILE F O     1 
ATOM   3907  C  CB    . ILE F 2 27  ? -1.346  -39.147 55.998 1.00 49.71  ? 26  ILE F CB    1 
ATOM   3908  C  CG1   . ILE F 2 27  ? -2.236  -38.035 56.573 1.00 49.71  ? 26  ILE F CG1   1 
ATOM   3909  C  CG2   . ILE F 2 27  ? -1.476  -40.323 56.928 1.00 48.78  ? 26  ILE F CG2   1 
ATOM   3910  C  CD1   . ILE F 2 27  ? -2.308  -36.746 55.758 1.00 50.09  ? 26  ILE F CD1   1 
ATOM   3911  N  N     . GLN F 2 28  ? 1.502   -39.327 57.772 1.00 50.09  ? 27  GLN F N     1 
ATOM   3912  C  CA    . GLN F 2 28  ? 2.072   -39.116 59.102 1.00 49.86  ? 27  GLN F CA    1 
ATOM   3913  C  C     . GLN F 2 28  ? 3.255   -38.153 58.993 1.00 49.59  ? 27  GLN F C     1 
ATOM   3914  O  O     . GLN F 2 28  ? 3.832   -37.715 60.003 1.00 49.67  ? 27  GLN F O     1 
ATOM   3915  C  CB    . GLN F 2 28  ? 2.466   -40.446 59.771 1.00 49.63  ? 27  GLN F CB    1 
ATOM   3916  C  CG    . GLN F 2 28  ? 1.272   -41.330 60.148 1.00 49.94  ? 27  GLN F CG    1 
ATOM   3917  C  CD    . GLN F 2 28  ? 0.385   -40.712 61.218 1.00 51.09  ? 27  GLN F CD    1 
ATOM   3918  O  OE1   . GLN F 2 28  ? 0.852   -39.902 62.012 1.00 53.80  ? 27  GLN F OE1   1 
ATOM   3919  N  NE2   . GLN F 2 28  ? -0.900  -41.093 61.250 1.00 51.50  ? 27  GLN F NE2   1 
ATOM   3920  N  N     . GLY F 2 29  ? 3.593   -37.804 57.757 1.00 48.89  ? 28  GLY F N     1 
ATOM   3921  C  CA    . GLY F 2 29  ? 4.640   -36.829 57.517 1.00 48.74  ? 28  GLY F CA    1 
ATOM   3922  C  C     . GLY F 2 29  ? 4.115   -35.442 57.858 1.00 48.75  ? 28  GLY F C     1 
ATOM   3923  O  O     . GLY F 2 29  ? 4.886   -34.482 57.978 1.00 49.17  ? 28  GLY F O     1 
ATOM   3924  N  N     . ILE F 2 30  ? 2.794   -35.339 57.992 1.00 47.78  ? 29  ILE F N     1 
ATOM   3925  C  CA    . ILE F 2 30  ? 2.158   -34.126 58.463 1.00 47.14  ? 29  ILE F CA    1 
ATOM   3926  C  C     . ILE F 2 30  ? 2.138   -34.155 59.982 1.00 46.88  ? 29  ILE F C     1 
ATOM   3927  O  O     . ILE F 2 30  ? 1.191   -34.667 60.623 1.00 46.21  ? 29  ILE F O     1 
ATOM   3928  C  CB    . ILE F 2 30  ? 0.726   -34.000 57.930 1.00 47.43  ? 29  ILE F CB    1 
ATOM   3929  C  CG1   . ILE F 2 30  ? 0.669   -34.217 56.405 1.00 48.16  ? 29  ILE F CG1   1 
ATOM   3930  C  CG2   . ILE F 2 30  ? 0.137   -32.663 58.313 1.00 47.54  ? 29  ILE F CG2   1 
ATOM   3931  C  CD1   . ILE F 2 30  ? 1.710   -33.458 55.596 1.00 46.73  ? 29  ILE F CD1   1 
ATOM   3932  N  N     . THR F 2 31  ? 3.204   -33.622 60.559 1.00 46.33  ? 30  THR F N     1 
ATOM   3933  C  CA    . THR F 2 31  ? 3.430   -33.784 61.977 1.00 46.40  ? 30  THR F CA    1 
ATOM   3934  C  C     . THR F 2 31  ? 2.499   -32.932 62.829 1.00 46.39  ? 30  THR F C     1 
ATOM   3935  O  O     . THR F 2 31  ? 1.964   -31.929 62.373 1.00 46.32  ? 30  THR F O     1 
ATOM   3936  C  CB    . THR F 2 31  ? 4.906   -33.541 62.324 1.00 46.39  ? 30  THR F CB    1 
ATOM   3937  O  OG1   . THR F 2 31  ? 5.227   -32.167 62.094 1.00 48.16  ? 30  THR F OG1   1 
ATOM   3938  C  CG2   . THR F 2 31  ? 5.814   -34.420 61.441 1.00 45.57  ? 30  THR F CG2   1 
ATOM   3939  N  N     . LYS F 2 32  ? 2.290   -33.368 64.065 1.00 46.67  ? 31  LYS F N     1 
ATOM   3940  C  CA    . LYS F 2 32  ? 1.646   -32.566 65.103 1.00 46.72  ? 31  LYS F CA    1 
ATOM   3941  C  C     . LYS F 2 32  ? 2.173   -31.103 65.209 1.00 46.44  ? 31  LYS F C     1 
ATOM   3942  O  O     . LYS F 2 32  ? 1.373   -30.166 65.290 1.00 46.62  ? 31  LYS F O     1 
ATOM   3943  C  CB    . LYS F 2 32  ? 1.767   -33.296 66.438 1.00 46.83  ? 31  LYS F CB    1 
ATOM   3944  C  CG    . LYS F 2 32  ? 1.328   -32.511 67.632 1.00 50.21  ? 31  LYS F CG    1 
ATOM   3945  C  CD    . LYS F 2 32  ? 1.671   -33.205 68.939 1.00 54.71  ? 31  LYS F CD    1 
ATOM   3946  C  CE    . LYS F 2 32  ? 1.232   -32.315 70.109 1.00 56.05  ? 31  LYS F CE    1 
ATOM   3947  N  NZ    . LYS F 2 32  ? 1.015   -33.119 71.371 1.00 61.86  ? 31  LYS F NZ    1 
ATOM   3948  N  N     . PRO F 2 33  ? 3.506   -30.891 65.209 1.00 45.97  ? 32  PRO F N     1 
ATOM   3949  C  CA    . PRO F 2 33  ? 3.900   -29.473 65.265 1.00 45.77  ? 32  PRO F CA    1 
ATOM   3950  C  C     . PRO F 2 33  ? 3.515   -28.656 64.030 1.00 45.68  ? 32  PRO F C     1 
ATOM   3951  O  O     . PRO F 2 33  ? 3.129   -27.493 64.179 1.00 46.24  ? 32  PRO F O     1 
ATOM   3952  C  CB    . PRO F 2 33  ? 5.427   -29.523 65.406 1.00 45.75  ? 32  PRO F CB    1 
ATOM   3953  C  CG    . PRO F 2 33  ? 5.735   -30.914 65.855 1.00 46.00  ? 32  PRO F CG    1 
ATOM   3954  C  CD    . PRO F 2 33  ? 4.669   -31.794 65.310 1.00 45.45  ? 32  PRO F CD    1 
ATOM   3955  N  N     . ALA F 2 34  ? 3.624   -29.237 62.832 1.00 44.90  ? 33  ALA F N     1 
ATOM   3956  C  CA    . ALA F 2 34  ? 3.214   -28.531 61.615 1.00 44.13  ? 33  ALA F CA    1 
ATOM   3957  C  C     . ALA F 2 34  ? 1.721   -28.166 61.674 1.00 44.02  ? 33  ALA F C     1 
ATOM   3958  O  O     . ALA F 2 34  ? 1.324   -27.070 61.282 1.00 44.08  ? 33  ALA F O     1 
ATOM   3959  C  CB    . ALA F 2 34  ? 3.520   -29.351 60.390 1.00 43.26  ? 33  ALA F CB    1 
ATOM   3960  N  N     . ILE F 2 35  ? 0.907   -29.089 62.181 1.00 43.88  ? 34  ILE F N     1 
ATOM   3961  C  CA    . ILE F 2 35  ? -0.537  -28.904 62.275 1.00 43.85  ? 34  ILE F CA    1 
ATOM   3962  C  C     . ILE F 2 35  ? -0.820  -27.838 63.316 1.00 44.34  ? 34  ILE F C     1 
ATOM   3963  O  O     . ILE F 2 35  ? -1.691  -26.986 63.138 1.00 44.77  ? 34  ILE F O     1 
ATOM   3964  C  CB    . ILE F 2 35  ? -1.258  -30.206 62.691 1.00 43.53  ? 34  ILE F CB    1 
ATOM   3965  C  CG1   . ILE F 2 35  ? -1.187  -31.247 61.567 1.00 43.27  ? 34  ILE F CG1   1 
ATOM   3966  C  CG2   . ILE F 2 35  ? -2.713  -29.907 63.119 1.00 42.53  ? 34  ILE F CG2   1 
ATOM   3967  C  CD1   . ILE F 2 35  ? -1.596  -32.673 62.001 1.00 41.73  ? 34  ILE F CD1   1 
ATOM   3968  N  N     . ARG F 2 36  ? -0.077  -27.886 64.409 1.00 44.58  ? 35  ARG F N     1 
ATOM   3969  C  CA    . ARG F 2 36  ? -0.150  -26.828 65.401 1.00 45.05  ? 35  ARG F CA    1 
ATOM   3970  C  C     . ARG F 2 36  ? 0.180   -25.443 64.804 1.00 43.98  ? 35  ARG F C     1 
ATOM   3971  O  O     . ARG F 2 36  ? -0.539  -24.468 65.045 1.00 44.18  ? 35  ARG F O     1 
ATOM   3972  C  CB    . ARG F 2 36  ? 0.732   -27.136 66.595 1.00 45.04  ? 35  ARG F CB    1 
ATOM   3973  C  CG    . ARG F 2 36  ? 0.469   -26.176 67.709 1.00 50.49  ? 35  ARG F CG    1 
ATOM   3974  C  CD    . ARG F 2 36  ? 1.569   -26.193 68.758 1.00 57.30  ? 35  ARG F CD    1 
ATOM   3975  N  NE    . ARG F 2 36  ? 1.770   -27.552 69.233 1.00 60.42  ? 35  ARG F NE    1 
ATOM   3976  C  CZ    . ARG F 2 36  ? 1.008   -28.170 70.127 1.00 61.94  ? 35  ARG F CZ    1 
ATOM   3977  N  NH1   . ARG F 2 36  ? -0.042  -27.582 70.692 1.00 58.63  ? 35  ARG F NH1   1 
ATOM   3978  N  NH2   . ARG F 2 36  ? 1.336   -29.404 70.471 1.00 67.26  ? 35  ARG F NH2   1 
ATOM   3979  N  N     . ARG F 2 37  ? 1.225   -25.348 64.002 1.00 42.75  ? 36  ARG F N     1 
ATOM   3980  C  CA    . ARG F 2 37  ? 1.504   -24.066 63.383 1.00 42.49  ? 36  ARG F CA    1 
ATOM   3981  C  C     . ARG F 2 37  ? 0.307   -23.546 62.562 1.00 41.93  ? 36  ARG F C     1 
ATOM   3982  O  O     . ARG F 2 37  ? -0.039  -22.382 62.670 1.00 42.19  ? 36  ARG F O     1 
ATOM   3983  C  CB    . ARG F 2 37  ? 2.796   -24.084 62.554 1.00 42.57  ? 36  ARG F CB    1 
ATOM   3984  C  CG    . ARG F 2 37  ? 4.065   -24.351 63.358 1.00 42.58  ? 36  ARG F CG    1 
ATOM   3985  C  CD    . ARG F 2 37  ? 5.326   -24.204 62.491 1.00 43.26  ? 36  ARG F CD    1 
ATOM   3986  N  NE    . ARG F 2 37  ? 5.560   -25.303 61.542 1.00 42.46  ? 36  ARG F NE    1 
ATOM   3987  C  CZ    . ARG F 2 37  ? 6.239   -26.427 61.819 1.00 43.19  ? 36  ARG F CZ    1 
ATOM   3988  N  NH1   . ARG F 2 37  ? 6.760   -26.626 63.035 1.00 41.74  ? 36  ARG F NH1   1 
ATOM   3989  N  NH2   . ARG F 2 37  ? 6.404   -27.365 60.873 1.00 40.95  ? 36  ARG F NH2   1 
ATOM   3990  N  N     . LEU F 2 38  ? -0.328  -24.407 61.766 1.00 41.29  ? 37  LEU F N     1 
ATOM   3991  C  CA    . LEU F 2 38  ? -1.445  -23.992 60.901 1.00 40.55  ? 37  LEU F CA    1 
ATOM   3992  C  C     . LEU F 2 38  ? -2.627  -23.484 61.728 1.00 40.37  ? 37  LEU F C     1 
ATOM   3993  O  O     . LEU F 2 38  ? -3.247  -22.463 61.405 1.00 40.29  ? 37  LEU F O     1 
ATOM   3994  C  CB    . LEU F 2 38  ? -1.891  -25.140 59.983 1.00 40.53  ? 37  LEU F CB    1 
ATOM   3995  C  CG    . LEU F 2 38  ? -0.893  -25.660 58.949 1.00 39.90  ? 37  LEU F CG    1 
ATOM   3996  C  CD1   . LEU F 2 38  ? -1.247  -27.038 58.485 1.00 40.72  ? 37  LEU F CD1   1 
ATOM   3997  C  CD2   . LEU F 2 38  ? -0.828  -24.752 57.769 1.00 40.79  ? 37  LEU F CD2   1 
ATOM   3998  N  N     . ALA F 2 39  ? -2.930  -24.203 62.802 1.00 39.81  ? 38  ALA F N     1 
ATOM   3999  C  CA    . ALA F 2 39  ? -3.899  -23.757 63.792 1.00 39.11  ? 38  ALA F CA    1 
ATOM   4000  C  C     . ALA F 2 39  ? -3.562  -22.358 64.341 1.00 38.97  ? 38  ALA F C     1 
ATOM   4001  O  O     . ALA F 2 39  ? -4.451  -21.525 64.569 1.00 38.27  ? 38  ALA F O     1 
ATOM   4002  C  CB    . ALA F 2 39  ? -3.942  -24.761 64.926 1.00 38.89  ? 38  ALA F CB    1 
ATOM   4003  N  N     . ARG F 2 40  ? -2.273  -22.129 64.589 1.00 39.11  ? 39  ARG F N     1 
ATOM   4004  C  CA    . ARG F 2 40  ? -1.796  -20.879 65.158 1.00 39.32  ? 39  ARG F CA    1 
ATOM   4005  C  C     . ARG F 2 40  ? -2.081  -19.767 64.180 1.00 39.01  ? 39  ARG F C     1 
ATOM   4006  O  O     . ARG F 2 40  ? -2.655  -18.737 64.549 1.00 39.32  ? 39  ARG F O     1 
ATOM   4007  C  CB    . ARG F 2 40  ? -0.291  -20.948 65.462 1.00 39.40  ? 39  ARG F CB    1 
ATOM   4008  C  CG    . ARG F 2 40  ? 0.053   -21.818 66.667 1.00 41.04  ? 39  ARG F CG    1 
ATOM   4009  C  CD    . ARG F 2 40  ? -0.650  -21.398 67.960 1.00 42.39  ? 39  ARG F CD    1 
ATOM   4010  N  NE    . ARG F 2 40  ? -0.143  -22.218 69.054 1.00 45.60  ? 39  ARG F NE    1 
ATOM   4011  C  CZ    . ARG F 2 40  ? -0.884  -23.019 69.814 1.00 46.14  ? 39  ARG F CZ    1 
ATOM   4012  N  NH1   . ARG F 2 40  ? -2.191  -23.080 69.663 1.00 46.80  ? 39  ARG F NH1   1 
ATOM   4013  N  NH2   . ARG F 2 40  ? -0.314  -23.738 70.757 1.00 48.04  ? 39  ARG F NH2   1 
ATOM   4014  N  N     . ARG F 2 41  ? -1.704  -19.991 62.925 1.00 38.01  ? 40  ARG F N     1 
ATOM   4015  C  CA    . ARG F 2 41  ? -2.020  -19.049 61.895 1.00 37.50  ? 40  ARG F CA    1 
ATOM   4016  C  C     . ARG F 2 41  ? -3.528  -18.847 61.838 1.00 37.16  ? 40  ARG F C     1 
ATOM   4017  O  O     . ARG F 2 41  ? -4.000  -17.760 61.555 1.00 38.24  ? 40  ARG F O     1 
ATOM   4018  C  CB    . ARG F 2 41  ? -1.448  -19.493 60.541 1.00 37.53  ? 40  ARG F CB    1 
ATOM   4019  C  CG    . ARG F 2 41  ? -1.601  -18.425 59.434 1.00 36.50  ? 40  ARG F CG    1 
ATOM   4020  C  CD    . ARG F 2 41  ? -0.633  -18.654 58.273 1.00 36.03  ? 40  ARG F CD    1 
ATOM   4021  N  NE    . ARG F 2 41  ? 0.753   -18.320 58.581 1.00 36.42  ? 40  ARG F NE    1 
ATOM   4022  C  CZ    . ARG F 2 41  ? 1.801   -18.677 57.829 1.00 39.47  ? 40  ARG F CZ    1 
ATOM   4023  N  NH1   . ARG F 2 41  ? 1.636   -19.406 56.722 1.00 36.41  ? 40  ARG F NH1   1 
ATOM   4024  N  NH2   . ARG F 2 41  ? 3.041   -18.314 58.197 1.00 39.67  ? 40  ARG F NH2   1 
ATOM   4025  N  N     . GLY F 2 42  ? -4.284  -19.893 62.121 1.00 36.71  ? 41  GLY F N     1 
ATOM   4026  C  CA    . GLY F 2 42  ? -5.738  -19.816 62.097 1.00 36.36  ? 41  GLY F CA    1 
ATOM   4027  C  C     . GLY F 2 42  ? -6.279  -19.226 63.375 1.00 36.39  ? 41  GLY F C     1 
ATOM   4028  O  O     . GLY F 2 42  ? -7.484  -19.144 63.555 1.00 36.09  ? 41  GLY F O     1 
ATOM   4029  N  N     . GLY F 2 43  ? -5.382  -18.835 64.275 1.00 37.02  ? 42  GLY F N     1 
ATOM   4030  C  CA    . GLY F 2 43  ? -5.753  -18.096 65.491 1.00 38.12  ? 42  GLY F CA    1 
ATOM   4031  C  C     . GLY F 2 43  ? -6.200  -18.958 66.658 1.00 39.39  ? 42  GLY F C     1 
ATOM   4032  O  O     . GLY F 2 43  ? -6.935  -18.501 67.534 1.00 39.41  ? 42  GLY F O     1 
ATOM   4033  N  N     . VAL F 2 44  ? -5.743  -20.210 66.669 1.00 40.24  ? 43  VAL F N     1 
ATOM   4034  C  CA    . VAL F 2 44  ? -6.190  -21.203 67.631 1.00 40.57  ? 43  VAL F CA    1 
ATOM   4035  C  C     . VAL F 2 44  ? -5.233  -21.241 68.787 1.00 41.38  ? 43  VAL F C     1 
ATOM   4036  O  O     . VAL F 2 44  ? -4.035  -21.362 68.592 1.00 41.35  ? 43  VAL F O     1 
ATOM   4037  C  CB    . VAL F 2 44  ? -6.283  -22.601 66.997 1.00 40.16  ? 43  VAL F CB    1 
ATOM   4038  C  CG1   . VAL F 2 44  ? -6.586  -23.626 68.037 1.00 39.82  ? 43  VAL F CG1   1 
ATOM   4039  C  CG2   . VAL F 2 44  ? -7.345  -22.604 65.924 1.00 40.64  ? 43  VAL F CG2   1 
ATOM   4040  N  N     . LYS F 2 45  ? -5.780  -21.153 69.995 1.00 43.05  ? 44  LYS F N     1 
ATOM   4041  C  CA    . LYS F 2 45  ? -4.979  -21.070 71.201 1.00 44.56  ? 44  LYS F CA    1 
ATOM   4042  C  C     . LYS F 2 45  ? -4.772  -22.425 71.861 1.00 45.24  ? 44  LYS F C     1 
ATOM   4043  O  O     . LYS F 2 45  ? -3.692  -22.687 72.378 1.00 46.70  ? 44  LYS F O     1 
ATOM   4044  C  CB    . LYS F 2 45  ? -5.627  -20.101 72.193 1.00 44.87  ? 44  LYS F CB    1 
ATOM   4045  C  CG    . LYS F 2 45  ? -4.776  -19.788 73.431 1.00 46.54  ? 44  LYS F CG    1 
ATOM   4046  C  CD    . LYS F 2 45  ? -5.602  -19.048 74.471 1.00 48.41  ? 44  LYS F CD    1 
ATOM   4047  C  CE    . LYS F 2 45  ? -4.742  -18.498 75.572 1.00 49.64  ? 44  LYS F CE    1 
ATOM   4048  N  NZ    . LYS F 2 45  ? -5.640  -18.036 76.664 1.00 52.83  ? 44  LYS F NZ    1 
ATOM   4049  N  N     . ARG F 2 46  ? -5.795  -23.277 71.858 1.00 45.48  ? 45  ARG F N     1 
ATOM   4050  C  CA    . ARG F 2 46  ? -5.739  -24.543 72.574 1.00 45.57  ? 45  ARG F CA    1 
ATOM   4051  C  C     . ARG F 2 46  ? -6.286  -25.687 71.724 1.00 45.33  ? 45  ARG F C     1 
ATOM   4052  O  O     . ARG F 2 46  ? -7.334  -25.549 71.114 1.00 45.21  ? 45  ARG F O     1 
ATOM   4053  C  CB    . ARG F 2 46  ? -6.518  -24.421 73.882 1.00 46.05  ? 45  ARG F CB    1 
ATOM   4054  C  CG    . ARG F 2 46  ? -6.130  -25.438 74.956 1.00 46.60  ? 45  ARG F CG    1 
ATOM   4055  C  CD    . ARG F 2 46  ? -6.831  -25.129 76.275 1.00 49.94  ? 45  ARG F CD    1 
ATOM   4056  N  NE    . ARG F 2 46  ? -6.427  -26.040 77.352 1.00 52.94  ? 45  ARG F NE    1 
ATOM   4057  C  CZ    . ARG F 2 46  ? -7.001  -27.223 77.596 1.00 54.17  ? 45  ARG F CZ    1 
ATOM   4058  N  NH1   . ARG F 2 46  ? -8.009  -27.654 76.848 1.00 54.47  ? 45  ARG F NH1   1 
ATOM   4059  N  NH2   . ARG F 2 46  ? -6.562  -27.987 78.585 1.00 54.28  ? 45  ARG F NH2   1 
ATOM   4060  N  N     . ILE F 2 47  ? -5.578  -26.816 71.708 1.00 45.21  ? 46  ILE F N     1 
ATOM   4061  C  CA    . ILE F 2 47  ? -5.842  -27.897 70.750 1.00 45.42  ? 46  ILE F CA    1 
ATOM   4062  C  C     . ILE F 2 47  ? -5.955  -29.275 71.403 1.00 46.06  ? 46  ILE F C     1 
ATOM   4063  O  O     . ILE F 2 47  ? -4.996  -29.788 71.991 1.00 46.78  ? 46  ILE F O     1 
ATOM   4064  C  CB    . ILE F 2 47  ? -4.731  -27.999 69.683 1.00 45.20  ? 46  ILE F CB    1 
ATOM   4065  C  CG1   . ILE F 2 47  ? -4.501  -26.660 68.980 1.00 44.64  ? 46  ILE F CG1   1 
ATOM   4066  C  CG2   . ILE F 2 47  ? -5.070  -29.077 68.680 1.00 44.92  ? 46  ILE F CG2   1 
ATOM   4067  C  CD1   . ILE F 2 47  ? -3.176  -26.569 68.277 1.00 42.66  ? 46  ILE F CD1   1 
ATOM   4068  N  N     . SER F 2 48  ? -7.128  -29.881 71.272 1.00 46.26  ? 47  SER F N     1 
ATOM   4069  C  CA    . SER F 2 48  ? -7.389  -31.214 71.801 1.00 46.12  ? 47  SER F CA    1 
ATOM   4070  C  C     . SER F 2 48  ? -6.544  -32.303 71.114 1.00 46.38  ? 47  SER F C     1 
ATOM   4071  O  O     . SER F 2 48  ? -6.234  -32.215 69.920 1.00 46.88  ? 47  SER F O     1 
ATOM   4072  C  CB    . SER F 2 48  ? -8.888  -31.494 71.677 1.00 45.91  ? 47  SER F CB    1 
ATOM   4073  O  OG    . SER F 2 48  ? -9.125  -32.791 71.202 1.00 46.74  ? 47  SER F OG    1 
ATOM   4074  N  N     . GLY F 2 49  ? -6.171  -33.333 71.863 1.00 46.35  ? 48  GLY F N     1 
ATOM   4075  C  CA    . GLY F 2 49  ? -5.297  -34.383 71.329 1.00 46.54  ? 48  GLY F CA    1 
ATOM   4076  C  C     . GLY F 2 49  ? -5.781  -35.079 70.058 1.00 46.89  ? 48  GLY F C     1 
ATOM   4077  O  O     . GLY F 2 49  ? -4.968  -35.604 69.279 1.00 47.29  ? 48  GLY F O     1 
ATOM   4078  N  N     . LEU F 2 50  ? -7.095  -35.081 69.838 1.00 46.17  ? 49  LEU F N     1 
ATOM   4079  C  CA    . LEU F 2 50  ? -7.665  -35.767 68.682 1.00 46.13  ? 49  LEU F CA    1 
ATOM   4080  C  C     . LEU F 2 50  ? -7.625  -34.976 67.367 1.00 45.67  ? 49  LEU F C     1 
ATOM   4081  O  O     . LEU F 2 50  ? -7.939  -35.519 66.301 1.00 45.75  ? 49  LEU F O     1 
ATOM   4082  C  CB    . LEU F 2 50  ? -9.099  -36.210 68.978 1.00 46.10  ? 49  LEU F CB    1 
ATOM   4083  C  CG    . LEU F 2 50  ? -9.213  -37.263 70.079 1.00 46.83  ? 49  LEU F CG    1 
ATOM   4084  C  CD1   . LEU F 2 50  ? -10.618 -37.245 70.658 1.00 47.42  ? 49  LEU F CD1   1 
ATOM   4085  C  CD2   . LEU F 2 50  ? -8.791  -38.653 69.591 1.00 45.21  ? 49  LEU F CD2   1 
ATOM   4086  N  N     . ILE F 2 51  ? -7.228  -33.706 67.445 1.00 44.70  ? 50  ILE F N     1 
ATOM   4087  C  CA    . ILE F 2 51  ? -7.314  -32.805 66.309 1.00 43.53  ? 50  ILE F CA    1 
ATOM   4088  C  C     . ILE F 2 51  ? -6.395  -33.289 65.208 1.00 42.95  ? 50  ILE F C     1 
ATOM   4089  O  O     . ILE F 2 51  ? -6.756  -33.264 64.025 1.00 43.08  ? 50  ILE F O     1 
ATOM   4090  C  CB    . ILE F 2 51  ? -7.038  -31.325 66.737 1.00 43.60  ? 50  ILE F CB    1 
ATOM   4091  C  CG1   . ILE F 2 51  ? -8.279  -30.716 67.377 1.00 43.42  ? 50  ILE F CG1   1 
ATOM   4092  C  CG2   . ILE F 2 51  ? -6.561  -30.452 65.577 1.00 42.33  ? 50  ILE F CG2   1 
ATOM   4093  C  CD1   . ILE F 2 51  ? -9.429  -30.476 66.398 1.00 43.76  ? 50  ILE F CD1   1 
ATOM   4094  N  N     . TYR F 2 52  ? -5.225  -33.767 65.599 1.00 42.19  ? 51  TYR F N     1 
ATOM   4095  C  CA    . TYR F 2 52  ? -4.209  -34.127 64.623 1.00 42.42  ? 51  TYR F CA    1 
ATOM   4096  C  C     . TYR F 2 52  ? -4.664  -35.206 63.651 1.00 42.70  ? 51  TYR F C     1 
ATOM   4097  O  O     . TYR F 2 52  ? -4.530  -35.020 62.439 1.00 43.08  ? 51  TYR F O     1 
ATOM   4098  C  CB    . TYR F 2 52  ? -2.881  -34.429 65.289 1.00 41.97  ? 51  TYR F CB    1 
ATOM   4099  C  CG    . TYR F 2 52  ? -2.554  -33.399 66.326 1.00 42.86  ? 51  TYR F CG    1 
ATOM   4100  C  CD1   . TYR F 2 52  ? -2.727  -33.673 67.687 1.00 44.12  ? 51  TYR F CD1   1 
ATOM   4101  C  CD2   . TYR F 2 52  ? -2.112  -32.127 65.955 1.00 43.69  ? 51  TYR F CD2   1 
ATOM   4102  C  CE1   . TYR F 2 52  ? -2.445  -32.706 68.658 1.00 45.78  ? 51  TYR F CE1   1 
ATOM   4103  C  CE2   . TYR F 2 52  ? -1.826  -31.154 66.912 1.00 45.38  ? 51  TYR F CE2   1 
ATOM   4104  C  CZ    . TYR F 2 52  ? -2.000  -31.451 68.263 1.00 46.93  ? 51  TYR F CZ    1 
ATOM   4105  O  OH    . TYR F 2 52  ? -1.723  -30.501 69.223 1.00 49.80  ? 51  TYR F OH    1 
ATOM   4106  N  N     . GLU F 2 53  ? -5.247  -36.297 64.146 1.00 42.96  ? 52  GLU F N     1 
ATOM   4107  C  CA    . GLU F 2 53  ? -5.774  -37.309 63.221 1.00 43.23  ? 52  GLU F CA    1 
ATOM   4108  C  C     . GLU F 2 53  ? -6.956  -36.775 62.396 1.00 42.30  ? 52  GLU F C     1 
ATOM   4109  O  O     . GLU F 2 53  ? -7.080  -37.081 61.204 1.00 42.11  ? 52  GLU F O     1 
ATOM   4110  C  CB    . GLU F 2 53  ? -6.116  -38.640 63.914 1.00 43.69  ? 52  GLU F CB    1 
ATOM   4111  C  CG    . GLU F 2 53  ? -4.910  -39.596 64.153 1.00 47.22  ? 52  GLU F CG    1 
ATOM   4112  C  CD    . GLU F 2 53  ? -4.034  -39.848 62.908 1.00 52.10  ? 52  GLU F CD    1 
ATOM   4113  O  OE1   . GLU F 2 53  ? -4.598  -40.114 61.814 1.00 55.32  ? 52  GLU F OE1   1 
ATOM   4114  O  OE2   . GLU F 2 53  ? -2.779  -39.804 63.021 1.00 52.22  ? 52  GLU F OE2   1 
ATOM   4115  N  N     . GLU F 2 54  ? -7.793  -35.952 63.010 1.00 41.31  ? 53  GLU F N     1 
ATOM   4116  C  CA    . GLU F 2 54  ? -8.940  -35.388 62.297 1.00 41.18  ? 53  GLU F CA    1 
ATOM   4117  C  C     . GLU F 2 54  ? -8.490  -34.511 61.129 1.00 40.78  ? 53  GLU F C     1 
ATOM   4118  O  O     . GLU F 2 54  ? -9.032  -34.596 60.035 1.00 40.48  ? 53  GLU F O     1 
ATOM   4119  C  CB    . GLU F 2 54  ? -9.805  -34.578 63.250 1.00 41.21  ? 53  GLU F CB    1 
ATOM   4120  C  CG    . GLU F 2 54  ? -11.174 -34.220 62.691 1.00 43.38  ? 53  GLU F CG    1 
ATOM   4121  C  CD    . GLU F 2 54  ? -12.214 -35.327 62.806 1.00 45.07  ? 53  GLU F CD    1 
ATOM   4122  O  OE1   . GLU F 2 54  ? -11.936 -36.388 63.400 1.00 47.50  ? 53  GLU F OE1   1 
ATOM   4123  O  OE2   . GLU F 2 54  ? -13.331 -35.123 62.297 1.00 45.71  ? 53  GLU F OE2   1 
ATOM   4124  N  N     . THR F 2 55  ? -7.477  -33.686 61.374 1.00 40.43  ? 54  THR F N     1 
ATOM   4125  C  CA    . THR F 2 55  ? -6.929  -32.811 60.366 1.00 39.71  ? 54  THR F CA    1 
ATOM   4126  C  C     . THR F 2 55  ? -6.260  -33.612 59.252 1.00 39.98  ? 54  THR F C     1 
ATOM   4127  O  O     . THR F 2 55  ? -6.431  -33.301 58.062 1.00 39.65  ? 54  THR F O     1 
ATOM   4128  C  CB    . THR F 2 55  ? -5.887  -31.866 60.979 1.00 39.90  ? 54  THR F CB    1 
ATOM   4129  O  OG1   . THR F 2 55  ? -6.443  -31.207 62.123 1.00 39.02  ? 54  THR F OG1   1 
ATOM   4130  C  CG2   . THR F 2 55  ? -5.444  -30.836 59.949 1.00 38.76  ? 54  THR F CG2   1 
ATOM   4131  N  N     . ARG F 2 56  ? -5.478  -34.624 59.631 1.00 39.94  ? 55  ARG F N     1 
ATOM   4132  C  CA    . ARG F 2 56  ? -4.847  -35.480 58.633 1.00 39.98  ? 55  ARG F CA    1 
ATOM   4133  C  C     . ARG F 2 56  ? -5.926  -36.018 57.690 1.00 39.96  ? 55  ARG F C     1 
ATOM   4134  O  O     . ARG F 2 56  ? -5.782  -35.937 56.477 1.00 39.53  ? 55  ARG F O     1 
ATOM   4135  C  CB    . ARG F 2 56  ? -4.035  -36.606 59.292 1.00 40.15  ? 55  ARG F CB    1 
ATOM   4136  C  CG    . ARG F 2 56  ? -2.753  -36.094 59.917 1.00 40.41  ? 55  ARG F CG    1 
ATOM   4137  C  CD    . ARG F 2 56  ? -1.750  -37.170 60.316 1.00 40.26  ? 55  ARG F CD    1 
ATOM   4138  N  NE    . ARG F 2 56  ? -0.708  -36.565 61.153 1.00 41.05  ? 55  ARG F NE    1 
ATOM   4139  C  CZ    . ARG F 2 56  ? -0.693  -36.586 62.483 1.00 40.30  ? 55  ARG F CZ    1 
ATOM   4140  N  NH1   . ARG F 2 56  ? -1.633  -37.210 63.167 1.00 39.40  ? 55  ARG F NH1   1 
ATOM   4141  N  NH2   . ARG F 2 56  ? 0.272   -35.969 63.132 1.00 43.97  ? 55  ARG F NH2   1 
ATOM   4142  N  N     . GLY F 2 57  ? -7.028  -36.516 58.251 1.00 39.53  ? 56  GLY F N     1 
ATOM   4143  C  CA    . GLY F 2 57  ? -8.085  -37.060 57.428 1.00 39.39  ? 56  GLY F CA    1 
ATOM   4144  C  C     . GLY F 2 57  ? -8.718  -36.018 56.519 1.00 39.99  ? 56  GLY F C     1 
ATOM   4145  O  O     . GLY F 2 57  ? -8.960  -36.298 55.326 1.00 40.75  ? 56  GLY F O     1 
ATOM   4146  N  N     . VAL F 2 58  ? -8.993  -34.828 57.072 1.00 38.78  ? 57  VAL F N     1 
ATOM   4147  C  CA    . VAL F 2 58  ? -9.522  -33.705 56.295 1.00 38.01  ? 57  VAL F CA    1 
ATOM   4148  C  C     . VAL F 2 58  ? -8.568  -33.272 55.176 1.00 38.04  ? 57  VAL F C     1 
ATOM   4149  O  O     . VAL F 2 58  ? -9.007  -32.969 54.072 1.00 38.09  ? 57  VAL F O     1 
ATOM   4150  C  CB    . VAL F 2 58  ? -9.925  -32.508 57.220 1.00 38.13  ? 57  VAL F CB    1 
ATOM   4151  C  CG1   . VAL F 2 58  ? -9.996  -31.205 56.460 1.00 38.41  ? 57  VAL F CG1   1 
ATOM   4152  C  CG2   . VAL F 2 58  ? -11.248 -32.785 57.916 1.00 36.24  ? 57  VAL F CG2   1 
ATOM   4153  N  N     . LEU F 2 59  ? -7.271  -33.245 55.451 1.00 38.27  ? 58  LEU F N     1 
ATOM   4154  C  CA    . LEU F 2 59  ? -6.305  -32.885 54.420 1.00 38.92  ? 58  LEU F CA    1 
ATOM   4155  C  C     . LEU F 2 59  ? -6.279  -33.929 53.319 1.00 39.51  ? 58  LEU F C     1 
ATOM   4156  O  O     . LEU F 2 59  ? -6.215  -33.602 52.137 1.00 39.83  ? 58  LEU F O     1 
ATOM   4157  C  CB    . LEU F 2 59  ? -4.897  -32.699 55.013 1.00 38.78  ? 58  LEU F CB    1 
ATOM   4158  C  CG    . LEU F 2 59  ? -3.704  -32.602 54.051 1.00 38.47  ? 58  LEU F CG    1 
ATOM   4159  C  CD1   . LEU F 2 59  ? -3.929  -31.548 52.938 1.00 39.34  ? 58  LEU F CD1   1 
ATOM   4160  C  CD2   . LEU F 2 59  ? -2.425  -32.326 54.826 1.00 37.73  ? 58  LEU F CD2   1 
ATOM   4161  N  N     . LYS F 2 60  ? -6.324  -35.193 53.708 1.00 40.41  ? 59  LYS F N     1 
ATOM   4162  C  CA    . LYS F 2 60  ? -6.303  -36.288 52.739 1.00 41.40  ? 59  LYS F CA    1 
ATOM   4163  C  C     . LYS F 2 60  ? -7.467  -36.200 51.731 1.00 41.22  ? 59  LYS F C     1 
ATOM   4164  O  O     . LYS F 2 60  ? -7.267  -36.364 50.527 1.00 41.33  ? 59  LYS F O     1 
ATOM   4165  C  CB    . LYS F 2 60  ? -6.282  -37.622 53.476 1.00 41.86  ? 59  LYS F CB    1 
ATOM   4166  C  CG    . LYS F 2 60  ? -6.141  -38.814 52.596 1.00 45.24  ? 59  LYS F CG    1 
ATOM   4167  C  CD    . LYS F 2 60  ? -5.368  -39.904 53.303 1.00 51.91  ? 59  LYS F CD    1 
ATOM   4168  C  CE    . LYS F 2 60  ? -5.529  -41.239 52.560 1.00 55.97  ? 59  LYS F CE    1 
ATOM   4169  N  NZ    . LYS F 2 60  ? -7.007  -41.603 52.379 1.00 58.33  ? 59  LYS F NZ    1 
ATOM   4170  N  N     . VAL F 2 61  ? -8.666  -35.909 52.225 1.00 40.69  ? 60  VAL F N     1 
ATOM   4171  C  CA    . VAL F 2 61  ? -9.823  -35.731 51.364 1.00 40.41  ? 60  VAL F CA    1 
ATOM   4172  C  C     . VAL F 2 61  ? -9.608  -34.535 50.451 1.00 40.40  ? 60  VAL F C     1 
ATOM   4173  O  O     . VAL F 2 61  ? -9.918  -34.583 49.260 1.00 40.85  ? 60  VAL F O     1 
ATOM   4174  C  CB    . VAL F 2 61  ? -11.116 -35.522 52.195 1.00 40.67  ? 60  VAL F CB    1 
ATOM   4175  C  CG1   . VAL F 2 61  ? -12.236 -34.938 51.350 1.00 40.65  ? 60  VAL F CG1   1 
ATOM   4176  C  CG2   . VAL F 2 61  ? -11.578 -36.823 52.831 1.00 40.96  ? 60  VAL F CG2   1 
ATOM   4177  N  N     . PHE F 2 62  ? -9.085  -33.449 51.009 1.00 39.77  ? 61  PHE F N     1 
ATOM   4178  C  CA    . PHE F 2 62  ? -8.899  -32.253 50.230 1.00 38.59  ? 61  PHE F CA    1 
ATOM   4179  C  C     . PHE F 2 62  ? -7.996  -32.578 49.048 1.00 38.74  ? 61  PHE F C     1 
ATOM   4180  O  O     . PHE F 2 62  ? -8.355  -32.336 47.899 1.00 38.93  ? 61  PHE F O     1 
ATOM   4181  C  CB    . PHE F 2 62  ? -8.325  -31.137 51.086 1.00 37.54  ? 61  PHE F CB    1 
ATOM   4182  C  CG    . PHE F 2 62  ? -8.062  -29.869 50.327 1.00 37.05  ? 61  PHE F CG    1 
ATOM   4183  C  CD1   . PHE F 2 62  ? -9.075  -28.925 50.142 1.00 35.08  ? 61  PHE F CD1   1 
ATOM   4184  C  CD2   . PHE F 2 62  ? -6.800  -29.608 49.784 1.00 35.22  ? 61  PHE F CD2   1 
ATOM   4185  C  CE1   . PHE F 2 62  ? -8.825  -27.748 49.435 1.00 32.68  ? 61  PHE F CE1   1 
ATOM   4186  C  CE2   . PHE F 2 62  ? -6.561  -28.437 49.068 1.00 33.88  ? 61  PHE F CE2   1 
ATOM   4187  C  CZ    . PHE F 2 62  ? -7.575  -27.512 48.902 1.00 32.59  ? 61  PHE F CZ    1 
ATOM   4188  N  N     . LEU F 2 63  ? -6.834  -33.145 49.339 1.00 39.09  ? 62  LEU F N     1 
ATOM   4189  C  CA    . LEU F 2 63  ? -5.864  -33.500 48.320 1.00 39.67  ? 62  LEU F CA    1 
ATOM   4190  C  C     . LEU F 2 63  ? -6.384  -34.511 47.313 1.00 40.11  ? 62  LEU F C     1 
ATOM   4191  O  O     . LEU F 2 63  ? -6.138  -34.379 46.116 1.00 40.23  ? 62  LEU F O     1 
ATOM   4192  C  CB    . LEU F 2 63  ? -4.580  -34.008 48.956 1.00 39.54  ? 62  LEU F CB    1 
ATOM   4193  C  CG    . LEU F 2 63  ? -3.639  -32.919 49.445 1.00 39.51  ? 62  LEU F CG    1 
ATOM   4194  C  CD1   . LEU F 2 63  ? -2.451  -33.529 50.180 1.00 38.28  ? 62  LEU F CD1   1 
ATOM   4195  C  CD2   . LEU F 2 63  ? -3.175  -32.026 48.268 1.00 39.37  ? 62  LEU F CD2   1 
ATOM   4196  N  N     . GLU F 2 64  ? -7.120  -35.511 47.786 1.00 40.96  ? 63  GLU F N     1 
ATOM   4197  C  CA    . GLU F 2 64  ? -7.679  -36.491 46.873 1.00 41.92  ? 63  GLU F CA    1 
ATOM   4198  C  C     . GLU F 2 64  ? -8.512  -35.808 45.813 1.00 42.56  ? 63  GLU F C     1 
ATOM   4199  O  O     . GLU F 2 64  ? -8.327  -36.072 44.622 1.00 42.67  ? 63  GLU F O     1 
ATOM   4200  C  CB    . GLU F 2 64  ? -8.496  -37.536 47.605 1.00 42.25  ? 63  GLU F CB    1 
ATOM   4201  C  CG    . GLU F 2 64  ? -7.652  -38.693 48.165 1.00 45.19  ? 63  GLU F CG    1 
ATOM   4202  C  CD    . GLU F 2 64  ? -8.395  -39.518 49.219 1.00 47.24  ? 63  GLU F CD    1 
ATOM   4203  O  OE1   . GLU F 2 64  ? -9.605  -39.258 49.430 1.00 46.59  ? 63  GLU F OE1   1 
ATOM   4204  O  OE2   . GLU F 2 64  ? -7.759  -40.416 49.830 1.00 48.59  ? 63  GLU F OE2   1 
ATOM   4205  N  N     . ASN F 2 65  ? -9.413  -34.915 46.245 1.00 43.14  ? 64  ASN F N     1 
ATOM   4206  C  CA    . ASN F 2 65  ? -10.329 -34.247 45.336 1.00 43.35  ? 64  ASN F CA    1 
ATOM   4207  C  C     . ASN F 2 65  ? -9.605  -33.405 44.321 1.00 43.46  ? 64  ASN F C     1 
ATOM   4208  O  O     . ASN F 2 65  ? -9.941  -33.438 43.130 1.00 43.30  ? 64  ASN F O     1 
ATOM   4209  C  CB    . ASN F 2 65  ? -11.346 -33.413 46.087 1.00 43.70  ? 64  ASN F CB    1 
ATOM   4210  C  CG    . ASN F 2 65  ? -12.361 -34.266 46.816 1.00 46.74  ? 64  ASN F CG    1 
ATOM   4211  O  OD1   . ASN F 2 65  ? -12.705 -35.355 46.375 1.00 50.00  ? 64  ASN F OD1   1 
ATOM   4212  N  ND2   . ASN F 2 65  ? -12.846 -33.774 47.946 1.00 51.46  ? 64  ASN F ND2   1 
ATOM   4213  N  N     . VAL F 2 66  ? -8.599  -32.667 44.784 1.00 43.30  ? 65  VAL F N     1 
ATOM   4214  C  CA    . VAL F 2 66  ? -7.903  -31.745 43.900 1.00 43.10  ? 65  VAL F CA    1 
ATOM   4215  C  C     . VAL F 2 66  ? -6.965  -32.494 42.971 1.00 42.87  ? 65  VAL F C     1 
ATOM   4216  O  O     . VAL F 2 66  ? -6.950  -32.222 41.787 1.00 43.04  ? 65  VAL F O     1 
ATOM   4217  C  CB    . VAL F 2 66  ? -7.105  -30.645 44.649 1.00 43.38  ? 65  VAL F CB    1 
ATOM   4218  C  CG1   . VAL F 2 66  ? -6.382  -29.762 43.641 1.00 42.40  ? 65  VAL F CG1   1 
ATOM   4219  C  CG2   . VAL F 2 66  ? -8.021  -29.789 45.508 1.00 43.33  ? 65  VAL F CG2   1 
ATOM   4220  N  N     . ILE F 2 67  ? -6.182  -33.420 43.511 1.00 42.71  ? 66  ILE F N     1 
ATOM   4221  C  CA    . ILE F 2 67  ? -5.286  -34.227 42.705 1.00 42.86  ? 66  ILE F CA    1 
ATOM   4222  C  C     . ILE F 2 67  ? -6.056  -35.031 41.642 1.00 43.55  ? 66  ILE F C     1 
ATOM   4223  O  O     . ILE F 2 67  ? -5.631  -35.108 40.501 1.00 43.52  ? 66  ILE F O     1 
ATOM   4224  C  CB    . ILE F 2 67  ? -4.445  -35.164 43.588 1.00 42.91  ? 66  ILE F CB    1 
ATOM   4225  C  CG1   . ILE F 2 67  ? -3.366  -34.371 44.317 1.00 42.24  ? 66  ILE F CG1   1 
ATOM   4226  C  CG2   . ILE F 2 67  ? -3.807  -36.251 42.749 1.00 42.56  ? 66  ILE F CG2   1 
ATOM   4227  C  CD1   . ILE F 2 67  ? -2.852  -35.020 45.560 1.00 43.25  ? 66  ILE F CD1   1 
ATOM   4228  N  N     . ARG F 2 68  ? -7.202  -35.601 42.007 1.00 44.20  ? 67  ARG F N     1 
ATOM   4229  C  CA    . ARG F 2 68  ? -8.021  -36.342 41.057 1.00 45.04  ? 67  ARG F CA    1 
ATOM   4230  C  C     . ARG F 2 68  ? -8.369  -35.464 39.860 1.00 45.14  ? 67  ARG F C     1 
ATOM   4231  O  O     . ARG F 2 68  ? -8.228  -35.897 38.732 1.00 45.83  ? 67  ARG F O     1 
ATOM   4232  C  CB    . ARG F 2 68  ? -9.290  -36.885 41.732 1.00 45.55  ? 67  ARG F CB    1 
ATOM   4233  C  CG    . ARG F 2 68  ? -10.296 -37.593 40.803 1.00 47.69  ? 67  ARG F CG    1 
ATOM   4234  C  CD    . ARG F 2 68  ? -11.644 -37.934 41.514 1.00 53.56  ? 67  ARG F CD    1 
ATOM   4235  N  NE    . ARG F 2 68  ? -11.452 -38.704 42.764 1.00 59.11  ? 67  ARG F NE    1 
ATOM   4236  C  CZ    . ARG F 2 68  ? -11.823 -38.308 43.992 1.00 60.63  ? 67  ARG F CZ    1 
ATOM   4237  N  NH1   . ARG F 2 68  ? -12.457 -37.147 44.186 1.00 60.44  ? 67  ARG F NH1   1 
ATOM   4238  N  NH2   . ARG F 2 68  ? -11.583 -39.095 45.036 1.00 61.27  ? 67  ARG F NH2   1 
ATOM   4239  N  N     . ASP F 2 69  ? -8.824  -34.235 40.094 1.00 44.87  ? 68  ASP F N     1 
ATOM   4240  C  CA    . ASP F 2 69  ? -9.144  -33.345 38.982 1.00 44.76  ? 68  ASP F CA    1 
ATOM   4241  C  C     . ASP F 2 69  ? -7.884  -32.921 38.218 1.00 44.42  ? 68  ASP F C     1 
ATOM   4242  O  O     . ASP F 2 69  ? -7.904  -32.829 36.992 1.00 44.38  ? 68  ASP F O     1 
ATOM   4243  C  CB    . ASP F 2 69  ? -9.919  -32.111 39.448 1.00 44.80  ? 68  ASP F CB    1 
ATOM   4244  C  CG    . ASP F 2 69  ? -11.385 -32.402 39.753 1.00 46.01  ? 68  ASP F CG    1 
ATOM   4245  O  OD1   . ASP F 2 69  ? -11.849 -33.567 39.660 1.00 46.80  ? 68  ASP F OD1   1 
ATOM   4246  O  OD2   . ASP F 2 69  ? -12.083 -31.429 40.104 1.00 47.86  ? 68  ASP F OD2   1 
ATOM   4247  N  N     . ALA F 2 70  ? -6.797  -32.660 38.941 1.00 43.59  ? 69  ALA F N     1 
ATOM   4248  C  CA    . ALA F 2 70  ? -5.554  -32.249 38.310 1.00 43.05  ? 69  ALA F CA    1 
ATOM   4249  C  C     . ALA F 2 70  ? -5.088  -33.330 37.346 1.00 43.14  ? 69  ALA F C     1 
ATOM   4250  O  O     . ALA F 2 70  ? -4.789  -33.039 36.189 1.00 42.43  ? 69  ALA F O     1 
ATOM   4251  C  CB    . ALA F 2 70  ? -4.475  -31.939 39.358 1.00 42.30  ? 69  ALA F CB    1 
ATOM   4252  N  N     . VAL F 2 71  ? -5.061  -34.572 37.848 1.00 43.40  ? 70  VAL F N     1 
ATOM   4253  C  CA    . VAL F 2 71  ? -4.657  -35.763 37.097 1.00 43.21  ? 70  VAL F CA    1 
ATOM   4254  C  C     . VAL F 2 71  ? -5.579  -36.037 35.893 1.00 43.55  ? 70  VAL F C     1 
ATOM   4255  O  O     . VAL F 2 71  ? -5.111  -36.485 34.841 1.00 43.50  ? 70  VAL F O     1 
ATOM   4256  C  CB    . VAL F 2 71  ? -4.555  -36.994 38.017 1.00 42.74  ? 70  VAL F CB    1 
ATOM   4257  C  CG1   . VAL F 2 71  ? -4.339  -38.242 37.216 1.00 42.39  ? 70  VAL F CG1   1 
ATOM   4258  C  CG2   . VAL F 2 71  ? -3.402  -36.808 39.007 1.00 42.21  ? 70  VAL F CG2   1 
ATOM   4259  N  N     . THR F 2 72  ? -6.866  -35.748 36.041 1.00 43.56  ? 71  THR F N     1 
ATOM   4260  C  CA    . THR F 2 72  ? -7.785  -35.874 34.926 1.00 44.49  ? 71  THR F CA    1 
ATOM   4261  C  C     . THR F 2 72  ? -7.415  -34.922 33.779 1.00 46.01  ? 71  THR F C     1 
ATOM   4262  O  O     . THR F 2 72  ? -7.435  -35.312 32.613 1.00 46.70  ? 71  THR F O     1 
ATOM   4263  C  CB    . THR F 2 72  ? -9.223  -35.664 35.373 1.00 44.12  ? 71  THR F CB    1 
ATOM   4264  O  OG1   . THR F 2 72  ? -9.520  -36.600 36.419 1.00 43.65  ? 71  THR F OG1   1 
ATOM   4265  C  CG2   . THR F 2 72  ? -10.184 -35.871 34.222 1.00 41.87  ? 71  THR F CG2   1 
ATOM   4266  N  N     . TYR F 2 73  ? -7.063  -33.682 34.115 1.00 47.25  ? 72  TYR F N     1 
ATOM   4267  C  CA    . TYR F 2 73  ? -6.556  -32.729 33.130 1.00 48.23  ? 72  TYR F CA    1 
ATOM   4268  C  C     . TYR F 2 73  ? -5.235  -33.202 32.484 1.00 49.26  ? 72  TYR F C     1 
ATOM   4269  O  O     . TYR F 2 73  ? -5.034  -33.074 31.267 1.00 49.30  ? 72  TYR F O     1 
ATOM   4270  C  CB    . TYR F 2 73  ? -6.362  -31.348 33.766 1.00 48.00  ? 72  TYR F CB    1 
ATOM   4271  C  CG    . TYR F 2 73  ? -7.637  -30.573 34.038 1.00 47.54  ? 72  TYR F CG    1 
ATOM   4272  C  CD1   . TYR F 2 73  ? -7.933  -30.101 35.322 1.00 48.17  ? 72  TYR F CD1   1 
ATOM   4273  C  CD2   . TYR F 2 73  ? -8.535  -30.286 33.015 1.00 46.91  ? 72  TYR F CD2   1 
ATOM   4274  C  CE1   . TYR F 2 73  ? -9.105  -29.385 35.577 1.00 47.72  ? 72  TYR F CE1   1 
ATOM   4275  C  CE2   . TYR F 2 73  ? -9.694  -29.571 33.257 1.00 47.27  ? 72  TYR F CE2   1 
ATOM   4276  C  CZ    . TYR F 2 73  ? -9.976  -29.127 34.533 1.00 47.86  ? 72  TYR F CZ    1 
ATOM   4277  O  OH    . TYR F 2 73  ? -11.132 -28.424 34.741 1.00 48.31  ? 72  TYR F OH    1 
ATOM   4278  N  N     . THR F 2 74  ? -4.336  -33.738 33.306 1.00 50.23  ? 73  THR F N     1 
ATOM   4279  C  CA    . THR F 2 74  ? -3.086  -34.295 32.812 1.00 51.41  ? 73  THR F CA    1 
ATOM   4280  C  C     . THR F 2 74  ? -3.337  -35.365 31.758 1.00 52.49  ? 73  THR F C     1 
ATOM   4281  O  O     . THR F 2 74  ? -2.744  -35.326 30.696 1.00 52.28  ? 73  THR F O     1 
ATOM   4282  C  CB    . THR F 2 74  ? -2.289  -34.929 33.939 1.00 50.98  ? 73  THR F CB    1 
ATOM   4283  O  OG1   . THR F 2 74  ? -2.109  -33.967 34.976 1.00 51.69  ? 73  THR F OG1   1 
ATOM   4284  C  CG2   . THR F 2 74  ? -0.931  -35.360 33.434 1.00 50.96  ? 73  THR F CG2   1 
ATOM   4285  N  N     . GLU F 2 75  ? -4.221  -36.312 32.073 1.00 53.98  ? 74  GLU F N     1 
ATOM   4286  C  CA    . GLU F 2 75  ? -4.539  -37.419 31.187 1.00 55.50  ? 74  GLU F CA    1 
ATOM   4287  C  C     . GLU F 2 75  ? -5.254  -36.929 29.940 1.00 55.81  ? 74  GLU F C     1 
ATOM   4288  O  O     . GLU F 2 75  ? -5.016  -37.431 28.842 1.00 55.87  ? 74  GLU F O     1 
ATOM   4289  C  CB    . GLU F 2 75  ? -5.418  -38.437 31.897 1.00 56.05  ? 74  GLU F CB    1 
ATOM   4290  C  CG    . GLU F 2 75  ? -4.748  -39.117 33.087 1.00 60.53  ? 74  GLU F CG    1 
ATOM   4291  C  CD    . GLU F 2 75  ? -5.585  -40.264 33.661 1.00 66.23  ? 74  GLU F CD    1 
ATOM   4292  O  OE1   . GLU F 2 75  ? -6.784  -40.053 33.989 1.00 67.88  ? 74  GLU F OE1   1 
ATOM   4293  O  OE2   . GLU F 2 75  ? -5.034  -41.385 33.772 1.00 69.46  ? 74  GLU F OE2   1 
ATOM   4294  N  N     . HIS F 2 76  ? -6.132  -35.944 30.097 1.00 56.21  ? 75  HIS F N     1 
ATOM   4295  C  CA    . HIS F 2 76  ? -6.871  -35.490 28.945 1.00 56.49  ? 75  HIS F CA    1 
ATOM   4296  C  C     . HIS F 2 76  ? -5.924  -34.896 27.911 1.00 56.89  ? 75  HIS F C     1 
ATOM   4297  O  O     . HIS F 2 76  ? -6.148  -35.021 26.705 1.00 56.91  ? 75  HIS F O     1 
ATOM   4298  C  CB    . HIS F 2 76  ? -7.937  -34.482 29.286 1.00 56.36  ? 75  HIS F CB    1 
ATOM   4299  C  CG    . HIS F 2 76  ? -8.684  -34.025 28.079 1.00 56.17  ? 75  HIS F CG    1 
ATOM   4300  N  ND1   . HIS F 2 76  ? -9.860  -34.614 27.668 1.00 56.01  ? 75  HIS F ND1   1 
ATOM   4301  C  CD2   . HIS F 2 76  ? -8.380  -33.095 27.144 1.00 56.05  ? 75  HIS F CD2   1 
ATOM   4302  C  CE1   . HIS F 2 76  ? -10.269 -34.042 26.549 1.00 56.86  ? 75  HIS F CE1   1 
ATOM   4303  N  NE2   . HIS F 2 76  ? -9.388  -33.116 26.208 1.00 56.88  ? 75  HIS F NE2   1 
ATOM   4304  N  N     . ALA F 2 77  ? -4.870  -34.254 28.403 1.00 57.08  ? 76  ALA F N     1 
ATOM   4305  C  CA    . ALA F 2 77  ? -3.846  -33.680 27.558 1.00 57.33  ? 76  ALA F CA    1 
ATOM   4306  C  C     . ALA F 2 77  ? -2.845  -34.739 27.099 1.00 57.84  ? 76  ALA F C     1 
ATOM   4307  O  O     . ALA F 2 77  ? -1.901  -34.410 26.395 1.00 58.19  ? 76  ALA F O     1 
ATOM   4308  C  CB    . ALA F 2 77  ? -3.133  -32.580 28.292 1.00 56.97  ? 76  ALA F CB    1 
ATOM   4309  N  N     . LYS F 2 78  ? -3.042  -35.996 27.498 1.00 58.27  ? 77  LYS F N     1 
ATOM   4310  C  CA    . LYS F 2 78  ? -2.110  -37.094 27.146 1.00 59.16  ? 77  LYS F CA    1 
ATOM   4311  C  C     . LYS F 2 78  ? -0.671  -36.859 27.633 1.00 58.63  ? 77  LYS F C     1 
ATOM   4312  O  O     . LYS F 2 78  ? 0.307   -37.237 26.960 1.00 58.93  ? 77  LYS F O     1 
ATOM   4313  C  CB    . LYS F 2 78  ? -2.123  -37.374 25.631 1.00 59.33  ? 77  LYS F CB    1 
ATOM   4314  C  CG    . LYS F 2 78  ? -3.382  -38.063 25.150 1.00 62.07  ? 77  LYS F CG    1 
ATOM   4315  C  CD    . LYS F 2 78  ? -3.571  -37.849 23.656 1.00 66.45  ? 77  LYS F CD    1 
ATOM   4316  C  CE    . LYS F 2 78  ? -4.838  -38.543 23.149 1.00 69.53  ? 77  LYS F CE    1 
ATOM   4317  N  NZ    . LYS F 2 78  ? -5.273  -38.001 21.807 1.00 72.63  ? 77  LYS F NZ    1 
ATOM   4318  N  N     . ARG F 2 79  ? -0.550  -36.232 28.797 1.00 57.59  ? 78  ARG F N     1 
ATOM   4319  C  CA    . ARG F 2 79  ? 0.744   -36.051 29.424 1.00 56.72  ? 78  ARG F CA    1 
ATOM   4320  C  C     . ARG F 2 79  ? 0.962   -37.069 30.530 1.00 56.53  ? 78  ARG F C     1 
ATOM   4321  O  O     . ARG F 2 79  ? 0.048   -37.811 30.893 1.00 56.17  ? 78  ARG F O     1 
ATOM   4322  C  CB    . ARG F 2 79  ? 0.877   -34.638 29.977 1.00 56.52  ? 78  ARG F CB    1 
ATOM   4323  C  CG    . ARG F 2 79  ? 1.270   -33.638 28.950 1.00 55.31  ? 78  ARG F CG    1 
ATOM   4324  C  CD    . ARG F 2 79  ? 1.404   -32.296 29.572 1.00 55.32  ? 78  ARG F CD    1 
ATOM   4325  N  NE    . ARG F 2 79  ? 0.120   -31.596 29.709 1.00 54.55  ? 78  ARG F NE    1 
ATOM   4326  C  CZ    . ARG F 2 79  ? -0.582  -31.484 30.841 1.00 52.65  ? 78  ARG F CZ    1 
ATOM   4327  N  NH1   . ARG F 2 79  ? -0.161  -32.043 31.974 1.00 49.39  ? 78  ARG F NH1   1 
ATOM   4328  N  NH2   . ARG F 2 79  ? -1.714  -30.791 30.831 1.00 51.63  ? 78  ARG F NH2   1 
ATOM   4329  N  N     . LYS F 2 80  ? 2.186   -37.099 31.050 1.00 56.46  ? 79  LYS F N     1 
ATOM   4330  C  CA    . LYS F 2 80  ? 2.553   -37.954 32.170 1.00 56.49  ? 79  LYS F CA    1 
ATOM   4331  C  C     . LYS F 2 80  ? 3.011   -37.073 33.326 1.00 55.57  ? 79  LYS F C     1 
ATOM   4332  O  O     . LYS F 2 80  ? 3.233   -37.555 34.453 1.00 55.87  ? 79  LYS F O     1 
ATOM   4333  C  CB    . LYS F 2 80  ? 3.655   -38.941 31.748 1.00 57.09  ? 79  LYS F CB    1 
ATOM   4334  C  CG    . LYS F 2 80  ? 3.417   -39.553 30.365 1.00 60.13  ? 79  LYS F CG    1 
ATOM   4335  C  CD    . LYS F 2 80  ? 3.793   -41.037 30.300 1.00 66.23  ? 79  LYS F CD    1 
ATOM   4336  C  CE    . LYS F 2 80  ? 3.519   -41.579 28.884 1.00 69.06  ? 79  LYS F CE    1 
ATOM   4337  N  NZ    . LYS F 2 80  ? 3.828   -43.041 28.753 1.00 69.85  ? 79  LYS F NZ    1 
ATOM   4338  N  N     . THR F 2 81  ? 3.148   -35.781 33.029 1.00 54.28  ? 80  THR F N     1 
ATOM   4339  C  CA    . THR F 2 81  ? 3.555   -34.774 34.000 1.00 53.37  ? 80  THR F CA    1 
ATOM   4340  C  C     . THR F 2 81  ? 2.358   -33.922 34.426 1.00 52.38  ? 80  THR F C     1 
ATOM   4341  O  O     . THR F 2 81  ? 1.656   -33.352 33.594 1.00 52.50  ? 80  THR F O     1 
ATOM   4342  C  CB    . THR F 2 81  ? 4.639   -33.869 33.400 1.00 53.57  ? 80  THR F CB    1 
ATOM   4343  O  OG1   . THR F 2 81  ? 5.560   -34.682 32.669 1.00 53.91  ? 80  THR F OG1   1 
ATOM   4344  C  CG2   . THR F 2 81  ? 5.392   -33.084 34.496 1.00 53.78  ? 80  THR F CG2   1 
ATOM   4345  N  N     . VAL F 2 82  ? 2.119   -33.860 35.728 1.00 51.38  ? 81  VAL F N     1 
ATOM   4346  C  CA    . VAL F 2 82  ? 1.117   -32.961 36.288 1.00 50.19  ? 81  VAL F CA    1 
ATOM   4347  C  C     . VAL F 2 82  ? 1.739   -31.566 36.320 1.00 49.77  ? 81  VAL F C     1 
ATOM   4348  O  O     . VAL F 2 82  ? 2.769   -31.358 36.972 1.00 49.43  ? 81  VAL F O     1 
ATOM   4349  C  CB    . VAL F 2 82  ? 0.742   -33.367 37.721 1.00 50.32  ? 81  VAL F CB    1 
ATOM   4350  C  CG1   . VAL F 2 82  ? -0.268  -32.373 38.312 1.00 50.26  ? 81  VAL F CG1   1 
ATOM   4351  C  CG2   . VAL F 2 82  ? 0.222   -34.822 37.775 1.00 48.64  ? 81  VAL F CG2   1 
ATOM   4352  N  N     . THR F 2 83  ? 1.137   -30.625 35.595 1.00 48.94  ? 82  THR F N     1 
ATOM   4353  C  CA    . THR F 2 83  ? 1.652   -29.264 35.538 1.00 48.45  ? 82  THR F CA    1 
ATOM   4354  C  C     . THR F 2 83  ? 0.983   -28.392 36.599 1.00 47.98  ? 82  THR F C     1 
ATOM   4355  O  O     . THR F 2 83  ? -0.136  -28.679 37.030 1.00 48.13  ? 82  THR F O     1 
ATOM   4356  C  CB    . THR F 2 83  ? 1.412   -28.624 34.152 1.00 48.48  ? 82  THR F CB    1 
ATOM   4357  O  OG1   . THR F 2 83  ? 0.006   -28.605 33.875 1.00 47.96  ? 82  THR F OG1   1 
ATOM   4358  C  CG2   . THR F 2 83  ? 2.138   -29.398 33.058 1.00 48.58  ? 82  THR F CG2   1 
ATOM   4359  N  N     . ALA F 2 84  ? 1.658   -27.320 37.006 1.00 47.19  ? 83  ALA F N     1 
ATOM   4360  C  CA    . ALA F 2 84  ? 1.020   -26.280 37.818 1.00 46.16  ? 83  ALA F CA    1 
ATOM   4361  C  C     . ALA F 2 84  ? -0.348  -25.926 37.250 1.00 45.88  ? 83  ALA F C     1 
ATOM   4362  O  O     . ALA F 2 84  ? -1.304  -25.757 38.012 1.00 46.75  ? 83  ALA F O     1 
ATOM   4363  C  CB    . ALA F 2 84  ? 1.878   -25.060 37.891 1.00 45.95  ? 83  ALA F CB    1 
ATOM   4364  N  N     . MET F 2 85  ? -0.457  -25.841 35.925 1.00 44.77  ? 84  MET F N     1 
ATOM   4365  C  CA    . MET F 2 85  ? -1.711  -25.474 35.300 1.00 44.16  ? 84  MET F CA    1 
ATOM   4366  C  C     . MET F 2 85  ? -2.804  -26.500 35.562 1.00 43.65  ? 84  MET F C     1 
ATOM   4367  O  O     . MET F 2 85  ? -3.967  -26.135 35.791 1.00 43.47  ? 84  MET F O     1 
ATOM   4368  C  CB    . MET F 2 85  ? -1.556  -25.178 33.792 1.00 44.10  ? 84  MET F CB    1 
ATOM   4369  C  CG    . MET F 2 85  ? -0.945  -23.790 33.485 1.00 45.84  ? 84  MET F CG    1 
ATOM   4370  S  SD    . MET F 2 85  ? -1.415  -22.409 34.607 1.00 51.74  ? 84  MET F SD    1 
ATOM   4371  C  CE    . MET F 2 85  ? -3.098  -22.083 34.067 1.00 49.08  ? 84  MET F CE    1 
ATOM   4372  N  N     . ASP F 2 86  ? -2.446  -27.778 35.545 1.00 42.81  ? 85  ASP F N     1 
ATOM   4373  C  CA    . ASP F 2 86  ? -3.435  -28.810 35.853 1.00 42.22  ? 85  ASP F CA    1 
ATOM   4374  C  C     . ASP F 2 86  ? -4.009  -28.559 37.246 1.00 41.39  ? 85  ASP F C     1 
ATOM   4375  O  O     . ASP F 2 86  ? -5.212  -28.655 37.458 1.00 40.25  ? 85  ASP F O     1 
ATOM   4376  C  CB    . ASP F 2 86  ? -2.815  -30.216 35.794 1.00 42.81  ? 85  ASP F CB    1 
ATOM   4377  C  CG    . ASP F 2 86  ? -2.318  -30.596 34.405 1.00 43.59  ? 85  ASP F CG    1 
ATOM   4378  O  OD1   . ASP F 2 86  ? -2.955  -30.235 33.391 1.00 43.25  ? 85  ASP F OD1   1 
ATOM   4379  O  OD2   . ASP F 2 86  ? -1.286  -31.288 34.340 1.00 45.75  ? 85  ASP F OD2   1 
ATOM   4380  N  N     . VAL F 2 87  ? -3.129  -28.220 38.187 1.00 41.28  ? 86  VAL F N     1 
ATOM   4381  C  CA    . VAL F 2 87  ? -3.525  -27.971 39.569 1.00 41.53  ? 86  VAL F CA    1 
ATOM   4382  C  C     . VAL F 2 87  ? -4.350  -26.700 39.701 1.00 42.22  ? 86  VAL F C     1 
ATOM   4383  O  O     . VAL F 2 87  ? -5.367  -26.706 40.395 1.00 42.68  ? 86  VAL F O     1 
ATOM   4384  C  CB    . VAL F 2 87  ? -2.325  -27.886 40.499 1.00 41.27  ? 86  VAL F CB    1 
ATOM   4385  C  CG1   . VAL F 2 87  ? -2.774  -27.458 41.882 1.00 40.63  ? 86  VAL F CG1   1 
ATOM   4386  C  CG2   . VAL F 2 87  ? -1.605  -29.235 40.552 1.00 40.30  ? 86  VAL F CG2   1 
ATOM   4387  N  N     . VAL F 2 88  ? -3.921  -25.632 39.022 1.00 42.11  ? 87  VAL F N     1 
ATOM   4388  C  CA    . VAL F 2 88  ? -4.642  -24.360 39.015 1.00 42.35  ? 87  VAL F CA    1 
ATOM   4389  C  C     . VAL F 2 88  ? -6.057  -24.537 38.460 1.00 43.23  ? 87  VAL F C     1 
ATOM   4390  O  O     . VAL F 2 88  ? -7.015  -24.113 39.085 1.00 44.16  ? 87  VAL F O     1 
ATOM   4391  C  CB    . VAL F 2 88  ? -3.840  -23.256 38.255 1.00 42.64  ? 87  VAL F CB    1 
ATOM   4392  C  CG1   . VAL F 2 88  ? -4.679  -22.030 37.981 1.00 39.97  ? 87  VAL F CG1   1 
ATOM   4393  C  CG2   . VAL F 2 88  ? -2.549  -22.886 39.036 1.00 41.98  ? 87  VAL F CG2   1 
ATOM   4394  N  N     . TYR F 2 89  ? -6.198  -25.202 37.317 1.00 44.15  ? 88  TYR F N     1 
ATOM   4395  C  CA    . TYR F 2 89  ? -7.523  -25.502 36.763 1.00 44.65  ? 88  TYR F CA    1 
ATOM   4396  C  C     . TYR F 2 89  ? -8.335  -26.395 37.661 1.00 44.21  ? 88  TYR F C     1 
ATOM   4397  O  O     . TYR F 2 89  ? -9.562  -26.319 37.669 1.00 44.77  ? 88  TYR F O     1 
ATOM   4398  C  CB    . TYR F 2 89  ? -7.432  -26.159 35.391 1.00 45.07  ? 88  TYR F CB    1 
ATOM   4399  C  CG    . TYR F 2 89  ? -6.777  -25.316 34.343 1.00 48.68  ? 88  TYR F CG    1 
ATOM   4400  C  CD1   . TYR F 2 89  ? -5.882  -25.879 33.453 1.00 51.40  ? 88  TYR F CD1   1 
ATOM   4401  C  CD2   . TYR F 2 89  ? -7.029  -23.944 34.249 1.00 53.51  ? 88  TYR F CD2   1 
ATOM   4402  C  CE1   . TYR F 2 89  ? -5.264  -25.129 32.479 1.00 53.51  ? 88  TYR F CE1   1 
ATOM   4403  C  CE2   . TYR F 2 89  ? -6.408  -23.170 33.263 1.00 56.02  ? 88  TYR F CE2   1 
ATOM   4404  C  CZ    . TYR F 2 89  ? -5.528  -23.794 32.379 1.00 56.10  ? 88  TYR F CZ    1 
ATOM   4405  O  OH    . TYR F 2 89  ? -4.888  -23.094 31.395 1.00 59.40  ? 88  TYR F OH    1 
ATOM   4406  N  N     . ALA F 2 90  ? -7.663  -27.267 38.400 1.00 43.92  ? 89  ALA F N     1 
ATOM   4407  C  CA    . ALA F 2 90  ? -8.378  -28.180 39.269 1.00 43.54  ? 89  ALA F CA    1 
ATOM   4408  C  C     . ALA F 2 90  ? -8.952  -27.363 40.391 1.00 43.42  ? 89  ALA F C     1 
ATOM   4409  O  O     . ALA F 2 90  ? -10.131 -27.495 40.712 1.00 43.54  ? 89  ALA F O     1 
ATOM   4410  C  CB    . ALA F 2 90  ? -7.453  -29.236 39.806 1.00 43.55  ? 89  ALA F CB    1 
ATOM   4411  N  N     . LEU F 2 91  ? -8.099  -26.504 40.960 1.00 43.11  ? 90  LEU F N     1 
ATOM   4412  C  CA    . LEU F 2 91  ? -8.449  -25.643 42.060 1.00 42.70  ? 90  LEU F CA    1 
ATOM   4413  C  C     . LEU F 2 91  ? -9.597  -24.702 41.688 1.00 43.75  ? 90  LEU F C     1 
ATOM   4414  O  O     . LEU F 2 91  ? -10.518 -24.463 42.485 1.00 43.65  ? 90  LEU F O     1 
ATOM   4415  C  CB    . LEU F 2 91  ? -7.216  -24.870 42.494 1.00 41.87  ? 90  LEU F CB    1 
ATOM   4416  C  CG    . LEU F 2 91  ? -6.205  -25.617 43.385 1.00 40.22  ? 90  LEU F CG    1 
ATOM   4417  C  CD1   . LEU F 2 91  ? -4.943  -24.779 43.530 1.00 36.76  ? 90  LEU F CD1   1 
ATOM   4418  C  CD2   . LEU F 2 91  ? -6.761  -26.037 44.764 1.00 34.17  ? 90  LEU F CD2   1 
ATOM   4419  N  N     . LYS F 2 92  ? -9.553  -24.195 40.462 1.00 44.87  ? 91  LYS F N     1 
ATOM   4420  C  CA    . LYS F 2 92  ? -10.579 -23.298 39.979 1.00 46.35  ? 91  LYS F CA    1 
ATOM   4421  C  C     . LYS F 2 92  ? -11.943 -23.979 39.940 1.00 46.44  ? 91  LYS F C     1 
ATOM   4422  O  O     . LYS F 2 92  ? -12.929 -23.405 40.389 1.00 46.51  ? 91  LYS F O     1 
ATOM   4423  C  CB    . LYS F 2 92  ? -10.194 -22.735 38.617 1.00 46.86  ? 91  LYS F CB    1 
ATOM   4424  C  CG    . LYS F 2 92  ? -11.204 -21.726 38.049 1.00 50.16  ? 91  LYS F CG    1 
ATOM   4425  C  CD    . LYS F 2 92  ? -10.586 -20.810 37.008 1.00 54.06  ? 91  LYS F CD    1 
ATOM   4426  C  CE    . LYS F 2 92  ? -10.393 -19.438 37.609 1.00 59.98  ? 91  LYS F CE    1 
ATOM   4427  N  NZ    . LYS F 2 92  ? -9.496  -18.498 36.838 1.00 63.02  ? 91  LYS F NZ    1 
ATOM   4428  N  N     . ARG F 2 93  ? -11.984 -25.204 39.425 1.00 47.09  ? 92  ARG F N     1 
ATOM   4429  C  CA    . ARG F 2 93  ? -13.219 -26.010 39.325 1.00 47.68  ? 92  ARG F CA    1 
ATOM   4430  C  C     . ARG F 2 93  ? -13.885 -26.193 40.671 1.00 47.81  ? 92  ARG F C     1 
ATOM   4431  O  O     . ARG F 2 93  ? -15.098 -26.259 40.774 1.00 48.38  ? 92  ARG F O     1 
ATOM   4432  C  CB    . ARG F 2 93  ? -12.888 -27.424 38.871 1.00 47.68  ? 92  ARG F CB    1 
ATOM   4433  C  CG    . ARG F 2 93  ? -12.922 -27.670 37.425 1.00 49.22  ? 92  ARG F CG    1 
ATOM   4434  C  CD    . ARG F 2 93  ? -13.079 -29.170 37.194 1.00 49.83  ? 92  ARG F CD    1 
ATOM   4435  N  NE    . ARG F 2 93  ? -14.490 -29.519 37.194 1.00 49.42  ? 92  ARG F NE    1 
ATOM   4436  C  CZ    . ARG F 2 93  ? -15.136 -30.052 38.223 1.00 48.84  ? 92  ARG F CZ    1 
ATOM   4437  N  NH1   . ARG F 2 93  ? -14.502 -30.336 39.342 1.00 48.88  ? 92  ARG F NH1   1 
ATOM   4438  N  NH2   . ARG F 2 93  ? -16.425 -30.317 38.119 1.00 50.68  ? 92  ARG F NH2   1 
ATOM   4439  N  N     . GLN F 2 94  ? -13.067 -26.344 41.695 1.00 47.68  ? 93  GLN F N     1 
ATOM   4440  C  CA    . GLN F 2 94  ? -13.554 -26.584 43.022 1.00 47.92  ? 93  GLN F CA    1 
ATOM   4441  C  C     . GLN F 2 94  ? -13.810 -25.334 43.837 1.00 46.82  ? 93  GLN F C     1 
ATOM   4442  O  O     . GLN F 2 94  ? -13.959 -25.435 45.046 1.00 46.44  ? 93  GLN F O     1 
ATOM   4443  C  CB    . GLN F 2 94  ? -12.553 -27.463 43.746 1.00 48.91  ? 93  GLN F CB    1 
ATOM   4444  C  CG    . GLN F 2 94  ? -12.920 -28.930 43.611 1.00 53.09  ? 93  GLN F CG    1 
ATOM   4445  C  CD    . GLN F 2 94  ? -11.721 -29.780 43.556 1.00 58.12  ? 93  GLN F CD    1 
ATOM   4446  O  OE1   . GLN F 2 94  ? -10.819 -29.648 44.399 1.00 61.31  ? 93  GLN F OE1   1 
ATOM   4447  N  NE2   . GLN F 2 94  ? -11.664 -30.663 42.550 1.00 58.72  ? 93  GLN F NE2   1 
ATOM   4448  N  N     . GLY F 2 95  ? -13.861 -24.167 43.180 1.00 45.70  ? 94  GLY F N     1 
ATOM   4449  C  CA    . GLY F 2 95  ? -14.137 -22.902 43.861 1.00 44.21  ? 94  GLY F CA    1 
ATOM   4450  C  C     . GLY F 2 95  ? -13.066 -22.509 44.873 1.00 43.66  ? 94  GLY F C     1 
ATOM   4451  O  O     . GLY F 2 95  ? -13.362 -21.845 45.876 1.00 43.06  ? 94  GLY F O     1 
ATOM   4452  N  N     . ARG F 2 96  ? -11.827 -22.923 44.588 1.00 42.74  ? 95  ARG F N     1 
ATOM   4453  C  CA    . ARG F 2 96  ? -10.650 -22.600 45.379 1.00 41.79  ? 95  ARG F CA    1 
ATOM   4454  C  C     . ARG F 2 96  ? -9.565  -22.009 44.467 1.00 40.97  ? 95  ARG F C     1 
ATOM   4455  O  O     . ARG F 2 96  ? -8.409  -22.468 44.483 1.00 40.92  ? 95  ARG F O     1 
ATOM   4456  C  CB    . ARG F 2 96  ? -10.072 -23.855 46.050 1.00 42.01  ? 95  ARG F CB    1 
ATOM   4457  C  CG    . ARG F 2 96  ? -11.042 -24.773 46.740 1.00 43.89  ? 95  ARG F CG    1 
ATOM   4458  C  CD    . ARG F 2 96  ? -11.344 -24.368 48.152 1.00 48.52  ? 95  ARG F CD    1 
ATOM   4459  N  NE    . ARG F 2 96  ? -10.197 -23.728 48.809 1.00 52.18  ? 95  ARG F NE    1 
ATOM   4460  C  CZ    . ARG F 2 96  ? -10.259 -23.018 49.938 1.00 50.38  ? 95  ARG F CZ    1 
ATOM   4461  N  NH1   . ARG F 2 96  ? -11.412 -22.867 50.584 1.00 48.13  ? 95  ARG F NH1   1 
ATOM   4462  N  NH2   . ARG F 2 96  ? -9.149  -22.476 50.425 1.00 49.62  ? 95  ARG F NH2   1 
ATOM   4463  N  N     . THR F 2 97  ? -9.936  -21.018 43.660 1.00 39.94  ? 96  THR F N     1 
ATOM   4464  C  CA    . THR F 2 97  ? -9.011  -20.299 42.766 1.00 38.64  ? 96  THR F CA    1 
ATOM   4465  C  C     . THR F 2 97  ? -7.748  -19.860 43.459 1.00 38.44  ? 96  THR F C     1 
ATOM   4466  O  O     . THR F 2 97  ? -7.779  -19.289 44.543 1.00 39.19  ? 96  THR F O     1 
ATOM   4467  C  CB    . THR F 2 97  ? -9.666  -19.044 42.250 1.00 38.37  ? 96  THR F CB    1 
ATOM   4468  O  OG1   . THR F 2 97  ? -10.832 -19.407 41.512 1.00 39.32  ? 96  THR F OG1   1 
ATOM   4469  C  CG2   . THR F 2 97  ? -8.723  -18.264 41.390 1.00 36.54  ? 96  THR F CG2   1 
ATOM   4470  N  N     . LEU F 2 98  ? -6.630  -20.136 42.825 1.00 38.62  ? 97  LEU F N     1 
ATOM   4471  C  CA    . LEU F 2 98  ? -5.326  -19.789 43.359 1.00 38.62  ? 97  LEU F CA    1 
ATOM   4472  C  C     . LEU F 2 98  ? -4.662  -18.795 42.410 1.00 39.20  ? 97  LEU F C     1 
ATOM   4473  O  O     . LEU F 2 98  ? -4.724  -18.965 41.186 1.00 38.79  ? 97  LEU F O     1 
ATOM   4474  C  CB    . LEU F 2 98  ? -4.460  -21.042 43.484 1.00 37.90  ? 97  LEU F CB    1 
ATOM   4475  C  CG    . LEU F 2 98  ? -3.013  -20.878 43.938 1.00 37.66  ? 97  LEU F CG    1 
ATOM   4476  C  CD1   . LEU F 2 98  ? -2.889  -20.462 45.399 1.00 37.49  ? 97  LEU F CD1   1 
ATOM   4477  C  CD2   . LEU F 2 98  ? -2.290  -22.164 43.713 1.00 38.42  ? 97  LEU F CD2   1 
ATOM   4478  N  N     . TYR F 2 99  ? -4.044  -17.760 42.981 1.00 39.66  ? 98  TYR F N     1 
ATOM   4479  C  CA    . TYR F 2 99  ? -3.260  -16.809 42.219 1.00 40.32  ? 98  TYR F CA    1 
ATOM   4480  C  C     . TYR F 2 99  ? -1.797  -17.047 42.500 1.00 40.90  ? 98  TYR F C     1 
ATOM   4481  O  O     . TYR F 2 99  ? -1.412  -17.320 43.648 1.00 41.08  ? 98  TYR F O     1 
ATOM   4482  C  CB    . TYR F 2 99  ? -3.579  -15.405 42.697 1.00 40.64  ? 98  TYR F CB    1 
ATOM   4483  C  CG    . TYR F 2 99  ? -4.871  -14.795 42.207 1.00 41.56  ? 98  TYR F CG    1 
ATOM   4484  C  CD1   . TYR F 2 99  ? -5.797  -15.525 41.449 1.00 43.01  ? 98  TYR F CD1   1 
ATOM   4485  C  CD2   . TYR F 2 99  ? -5.175  -13.475 42.533 1.00 41.83  ? 98  TYR F CD2   1 
ATOM   4486  C  CE1   . TYR F 2 99  ? -6.987  -14.931 41.031 1.00 44.64  ? 98  TYR F CE1   1 
ATOM   4487  C  CE2   . TYR F 2 99  ? -6.344  -12.885 42.136 1.00 42.03  ? 98  TYR F CE2   1 
ATOM   4488  C  CZ    . TYR F 2 99  ? -7.241  -13.601 41.390 1.00 44.60  ? 98  TYR F CZ    1 
ATOM   4489  O  OH    . TYR F 2 99  ? -8.390  -12.959 41.008 1.00 47.09  ? 98  TYR F OH    1 
ATOM   4490  N  N     . GLY F 2 100 ? -0.966  -16.948 41.474 1.00 41.47  ? 99  GLY F N     1 
ATOM   4491  C  CA    . GLY F 2 100 ? 0.485   -16.921 41.699 1.00 42.33  ? 99  GLY F CA    1 
ATOM   4492  C  C     . GLY F 2 100 ? 1.251   -18.007 40.997 1.00 43.45  ? 99  GLY F C     1 
ATOM   4493  O  O     . GLY F 2 100 ? 2.483   -18.065 41.084 1.00 43.97  ? 99  GLY F O     1 
ATOM   4494  N  N     . PHE F 2 101 ? 0.522   -18.872 40.288 1.00 44.36  ? 100 PHE F N     1 
ATOM   4495  C  CA    . PHE F 2 101 ? 1.114   -20.020 39.610 1.00 44.10  ? 100 PHE F CA    1 
ATOM   4496  C  C     . PHE F 2 101 ? 0.769   -20.139 38.135 1.00 44.82  ? 100 PHE F C     1 
ATOM   4497  O  O     . PHE F 2 101 ? 0.906   -21.202 37.580 1.00 45.19  ? 100 PHE F O     1 
ATOM   4498  C  CB    . PHE F 2 101 ? 0.708   -21.294 40.352 1.00 43.80  ? 100 PHE F CB    1 
ATOM   4499  C  CG    . PHE F 2 101 ? 1.418   -21.472 41.653 1.00 42.36  ? 100 PHE F CG    1 
ATOM   4500  C  CD1   . PHE F 2 101 ? 0.909   -20.935 42.824 1.00 40.60  ? 100 PHE F CD1   1 
ATOM   4501  C  CD2   . PHE F 2 101 ? 2.618   -22.166 41.706 1.00 41.40  ? 100 PHE F CD2   1 
ATOM   4502  C  CE1   . PHE F 2 101 ? 1.595   -21.092 44.040 1.00 40.39  ? 100 PHE F CE1   1 
ATOM   4503  C  CE2   . PHE F 2 101 ? 3.310   -22.322 42.919 1.00 40.44  ? 100 PHE F CE2   1 
ATOM   4504  C  CZ    . PHE F 2 101 ? 2.795   -21.784 44.081 1.00 38.84  ? 100 PHE F CZ    1 
ATOM   4505  N  N     . GLY F 2 102 ? 0.301   -19.068 37.501 1.00 46.17  ? 101 GLY F N     1 
ATOM   4506  C  CA    . GLY F 2 102 ? 0.011   -19.094 36.070 1.00 47.82  ? 101 GLY F CA    1 
ATOM   4507  C  C     . GLY F 2 102 ? -1.443  -18.936 35.679 1.00 49.19  ? 101 GLY F C     1 
ATOM   4508  O  O     . GLY F 2 102 ? -1.793  -18.953 34.495 1.00 49.51  ? 101 GLY F O     1 
ATOM   4509  N  N     . GLY F 2 103 ? -2.299  -18.775 36.670 1.00 50.63  ? 102 GLY F N     1 
ATOM   4510  C  CA    . GLY F 2 103 ? -3.705  -18.419 36.409 1.00 53.06  ? 102 GLY F CA    1 
ATOM   4511  C  C     . GLY F 2 103 ? -4.421  -18.081 37.717 1.00 54.00  ? 102 GLY F C     1 
ATOM   4512  O  O     . GLY F 2 103 ? -3.814  -17.431 38.572 1.00 54.54  ? 102 GLY F O     1 
ATOM   4513  O  OXT   . GLY F 2 103 ? -5.580  -18.467 37.985 1.00 54.64  ? 102 GLY F OXT   1 
ATOM   4514  N  N     . ALA G 3 15  ? -34.430 -41.540 4.970  1.00 95.35  ? 14  ALA G N     1 
ATOM   4515  C  CA    . ALA G 3 15  ? -34.572 -40.425 5.967  1.00 95.29  ? 14  ALA G CA    1 
ATOM   4516  C  C     . ALA G 3 15  ? -34.689 -40.966 7.402  1.00 95.12  ? 14  ALA G C     1 
ATOM   4517  O  O     . ALA G 3 15  ? -35.791 -41.272 7.880  1.00 95.16  ? 14  ALA G O     1 
ATOM   4518  C  CB    . ALA G 3 15  ? -35.780 -39.538 5.610  1.00 95.41  ? 14  ALA G CB    1 
ATOM   4519  N  N     . LYS G 3 16  ? -33.547 -41.085 8.079  1.00 94.66  ? 15  LYS G N     1 
ATOM   4520  C  CA    . LYS G 3 16  ? -33.496 -41.674 9.422  1.00 94.26  ? 15  LYS G CA    1 
ATOM   4521  C  C     . LYS G 3 16  ? -32.747 -40.774 10.426 1.00 93.58  ? 15  LYS G C     1 
ATOM   4522  O  O     . LYS G 3 16  ? -31.625 -40.327 10.150 1.00 93.70  ? 15  LYS G O     1 
ATOM   4523  C  CB    . LYS G 3 16  ? -32.878 -43.083 9.356  1.00 94.34  ? 15  LYS G CB    1 
ATOM   4524  C  CG    . LYS G 3 16  ? -33.039 -43.934 10.627 1.00 95.31  ? 15  LYS G CG    1 
ATOM   4525  C  CD    . LYS G 3 16  ? -34.371 -44.719 10.699 1.00 96.72  ? 15  LYS G CD    1 
ATOM   4526  C  CE    . LYS G 3 16  ? -35.602 -43.839 11.002 1.00 97.31  ? 15  LYS G CE    1 
ATOM   4527  N  NZ    . LYS G 3 16  ? -35.371 -42.769 12.040 1.00 97.20  ? 15  LYS G NZ    1 
ATOM   4528  N  N     . THR G 3 17  ? -33.370 -40.512 11.579 1.00 92.45  ? 16  THR G N     1 
ATOM   4529  C  CA    . THR G 3 17  ? -32.785 -39.612 12.590 1.00 91.32  ? 16  THR G CA    1 
ATOM   4530  C  C     . THR G 3 17  ? -31.520 -40.164 13.234 1.00 90.52  ? 16  THR G C     1 
ATOM   4531  O  O     . THR G 3 17  ? -31.377 -41.379 13.431 1.00 90.54  ? 16  THR G O     1 
ATOM   4532  C  CB    . THR G 3 17  ? -33.757 -39.261 13.748 1.00 91.40  ? 16  THR G CB    1 
ATOM   4533  O  OG1   . THR G 3 17  ? -34.013 -40.425 14.551 1.00 91.17  ? 16  THR G OG1   1 
ATOM   4534  C  CG2   . THR G 3 17  ? -35.061 -38.649 13.229 1.00 91.45  ? 16  THR G CG2   1 
ATOM   4535  N  N     . ARG G 3 18  ? -30.618 -39.249 13.576 1.00 89.24  ? 17  ARG G N     1 
ATOM   4536  C  CA    . ARG G 3 18  ? -29.400 -39.582 14.301 1.00 88.00  ? 17  ARG G CA    1 
ATOM   4537  C  C     . ARG G 3 18  ? -29.694 -40.183 15.676 1.00 87.20  ? 17  ARG G C     1 
ATOM   4538  O  O     . ARG G 3 18  ? -28.938 -41.022 16.164 1.00 87.04  ? 17  ARG G O     1 
ATOM   4539  C  CB    . ARG G 3 18  ? -28.506 -38.351 14.418 1.00 88.00  ? 17  ARG G CB    1 
ATOM   4540  C  CG    . ARG G 3 18  ? -27.898 -37.928 13.092 1.00 87.22  ? 17  ARG G CG    1 
ATOM   4541  C  CD    . ARG G 3 18  ? -26.673 -37.075 13.298 1.00 86.28  ? 17  ARG G CD    1 
ATOM   4542  N  NE    . ARG G 3 18  ? -27.013 -35.660 13.395 1.00 85.96  ? 17  ARG G NE    1 
ATOM   4543  C  CZ    . ARG G 3 18  ? -26.171 -34.712 13.799 1.00 85.47  ? 17  ARG G CZ    1 
ATOM   4544  N  NH1   . ARG G 3 18  ? -24.931 -35.033 14.165 1.00 83.91  ? 17  ARG G NH1   1 
ATOM   4545  N  NH2   . ARG G 3 18  ? -26.578 -33.444 13.845 1.00 84.99  ? 17  ARG G NH2   1 
ATOM   4546  N  N     . SER G 3 19  ? -30.802 -39.768 16.285 1.00 86.26  ? 18  SER G N     1 
ATOM   4547  C  CA    . SER G 3 19  ? -31.238 -40.334 17.557 1.00 85.30  ? 18  SER G CA    1 
ATOM   4548  C  C     . SER G 3 19  ? -31.572 -41.814 17.416 1.00 84.71  ? 18  SER G C     1 
ATOM   4549  O  O     . SER G 3 19  ? -31.149 -42.621 18.242 1.00 84.68  ? 18  SER G O     1 
ATOM   4550  C  CB    . SER G 3 19  ? -32.430 -39.560 18.111 1.00 85.36  ? 18  SER G CB    1 
ATOM   4551  O  OG    . SER G 3 19  ? -32.182 -38.167 18.054 1.00 85.49  ? 18  SER G OG    1 
ATOM   4552  N  N     . SER G 3 20  ? -32.311 -42.169 16.363 1.00 83.92  ? 19  SER G N     1 
ATOM   4553  C  CA    . SER G 3 20  ? -32.625 -43.576 16.083 1.00 83.08  ? 19  SER G CA    1 
ATOM   4554  C  C     . SER G 3 20  ? -31.374 -44.346 15.673 1.00 82.36  ? 19  SER G C     1 
ATOM   4555  O  O     . SER G 3 20  ? -31.209 -45.499 16.054 1.00 82.15  ? 19  SER G O     1 
ATOM   4556  C  CB    . SER G 3 20  ? -33.706 -43.705 15.010 1.00 83.14  ? 19  SER G CB    1 
ATOM   4557  O  OG    . SER G 3 20  ? -33.311 -43.056 13.809 1.00 83.77  ? 19  SER G OG    1 
ATOM   4558  N  N     . ARG G 3 21  ? -30.491 -43.703 14.910 1.00 81.61  ? 20  ARG G N     1 
ATOM   4559  C  CA    . ARG G 3 21  ? -29.203 -44.309 14.563 1.00 81.22  ? 20  ARG G CA    1 
ATOM   4560  C  C     . ARG G 3 21  ? -28.393 -44.638 15.817 1.00 80.54  ? 20  ARG G C     1 
ATOM   4561  O  O     . ARG G 3 21  ? -27.759 -45.690 15.897 1.00 80.63  ? 20  ARG G O     1 
ATOM   4562  C  CB    . ARG G 3 21  ? -28.373 -43.391 13.657 1.00 81.55  ? 20  ARG G CB    1 
ATOM   4563  C  CG    . ARG G 3 21  ? -28.839 -43.274 12.214 1.00 82.92  ? 20  ARG G CG    1 
ATOM   4564  C  CD    . ARG G 3 21  ? -27.826 -42.487 11.396 1.00 85.18  ? 20  ARG G CD    1 
ATOM   4565  N  NE    . ARG G 3 21  ? -28.445 -41.809 10.258 1.00 87.80  ? 20  ARG G NE    1 
ATOM   4566  C  CZ    . ARG G 3 21  ? -28.515 -42.307 9.022  1.00 89.16  ? 20  ARG G CZ    1 
ATOM   4567  N  NH1   . ARG G 3 21  ? -28.000 -43.501 8.738  1.00 89.83  ? 20  ARG G NH1   1 
ATOM   4568  N  NH2   . ARG G 3 21  ? -29.099 -41.602 8.063  1.00 89.55  ? 20  ARG G NH2   1 
ATOM   4569  N  N     . ALA G 3 22  ? -28.409 -43.725 16.789 1.00 79.63  ? 21  ALA G N     1 
ATOM   4570  C  CA    . ALA G 3 22  ? -27.646 -43.900 18.023 1.00 78.42  ? 21  ALA G CA    1 
ATOM   4571  C  C     . ALA G 3 22  ? -28.446 -44.679 19.070 1.00 77.42  ? 21  ALA G C     1 
ATOM   4572  O  O     . ALA G 3 22  ? -27.920 -45.072 20.111 1.00 76.98  ? 21  ALA G O     1 
ATOM   4573  C  CB    . ALA G 3 22  ? -27.196 -42.552 18.561 1.00 78.71  ? 21  ALA G CB    1 
ATOM   4574  N  N     . GLY G 3 23  ? -29.720 -44.906 18.770 1.00 76.54  ? 22  GLY G N     1 
ATOM   4575  C  CA    . GLY G 3 23  ? -30.583 -45.737 19.608 1.00 75.48  ? 22  GLY G CA    1 
ATOM   4576  C  C     . GLY G 3 23  ? -31.092 -44.969 20.800 1.00 74.51  ? 22  GLY G C     1 
ATOM   4577  O  O     . GLY G 3 23  ? -31.260 -45.530 21.880 1.00 74.35  ? 22  GLY G O     1 
ATOM   4578  N  N     . LEU G 3 24  ? -31.352 -43.682 20.579 1.00 73.55  ? 23  LEU G N     1 
ATOM   4579  C  CA    . LEU G 3 24  ? -31.644 -42.748 21.649 1.00 72.58  ? 23  LEU G CA    1 
ATOM   4580  C  C     . LEU G 3 24  ? -33.000 -42.090 21.501 1.00 72.15  ? 23  LEU G C     1 
ATOM   4581  O  O     . LEU G 3 24  ? -33.488 -41.867 20.385 1.00 72.01  ? 23  LEU G O     1 
ATOM   4582  C  CB    . LEU G 3 24  ? -30.557 -41.675 21.718 1.00 72.39  ? 23  LEU G CB    1 
ATOM   4583  C  CG    . LEU G 3 24  ? -29.141 -42.158 22.056 1.00 72.70  ? 23  LEU G CG    1 
ATOM   4584  C  CD1   . LEU G 3 24  ? -28.105 -41.035 21.908 1.00 71.92  ? 23  LEU G CD1   1 
ATOM   4585  C  CD2   . LEU G 3 24  ? -29.084 -42.780 23.464 1.00 72.49  ? 23  LEU G CD2   1 
ATOM   4586  N  N     . GLN G 3 25  ? -33.598 -41.786 22.648 1.00 71.50  ? 24  GLN G N     1 
ATOM   4587  C  CA    . GLN G 3 25  ? -34.821 -41.014 22.712 1.00 71.03  ? 24  GLN G CA    1 
ATOM   4588  C  C     . GLN G 3 25  ? -34.530 -39.523 22.645 1.00 70.42  ? 24  GLN G C     1 
ATOM   4589  O  O     . GLN G 3 25  ? -35.330 -38.764 22.114 1.00 70.92  ? 24  GLN G O     1 
ATOM   4590  C  CB    . GLN G 3 25  ? -35.579 -41.332 23.997 1.00 71.36  ? 24  GLN G CB    1 
ATOM   4591  C  CG    . GLN G 3 25  ? -35.904 -42.816 24.177 1.00 72.74  ? 24  GLN G CG    1 
ATOM   4592  C  CD    . GLN G 3 25  ? -36.729 -43.359 23.035 1.00 73.47  ? 24  GLN G CD    1 
ATOM   4593  O  OE1   . GLN G 3 25  ? -37.890 -42.988 22.857 1.00 73.76  ? 24  GLN G OE1   1 
ATOM   4594  N  NE2   . GLN G 3 25  ? -36.125 -44.230 22.239 1.00 74.47  ? 24  GLN G NE2   1 
ATOM   4595  N  N     . PHE G 3 26  ? -33.386 -39.106 23.179 1.00 69.40  ? 25  PHE G N     1 
ATOM   4596  C  CA    . PHE G 3 26  ? -33.041 -37.682 23.273 1.00 68.28  ? 25  PHE G CA    1 
ATOM   4597  C  C     . PHE G 3 26  ? -32.518 -37.137 21.933 1.00 67.82  ? 25  PHE G C     1 
ATOM   4598  O  O     . PHE G 3 26  ? -31.787 -37.833 21.229 1.00 68.05  ? 25  PHE G O     1 
ATOM   4599  C  CB    . PHE G 3 26  ? -32.023 -37.454 24.407 1.00 68.13  ? 25  PHE G CB    1 
ATOM   4600  C  CG    . PHE G 3 26  ? -32.648 -37.067 25.730 1.00 66.69  ? 25  PHE G CG    1 
ATOM   4601  C  CD1   . PHE G 3 26  ? -33.617 -37.868 26.329 1.00 65.80  ? 25  PHE G CD1   1 
ATOM   4602  C  CD2   . PHE G 3 26  ? -32.256 -35.903 26.377 1.00 65.47  ? 25  PHE G CD2   1 
ATOM   4603  C  CE1   . PHE G 3 26  ? -34.186 -37.516 27.540 1.00 64.82  ? 25  PHE G CE1   1 
ATOM   4604  C  CE2   . PHE G 3 26  ? -32.823 -35.537 27.584 1.00 65.45  ? 25  PHE G CE2   1 
ATOM   4605  C  CZ    . PHE G 3 26  ? -33.792 -36.351 28.171 1.00 65.56  ? 25  PHE G CZ    1 
ATOM   4606  N  N     . PRO G 3 27  ? -32.870 -35.882 21.587 1.00 67.08  ? 26  PRO G N     1 
ATOM   4607  C  CA    . PRO G 3 27  ? -32.652 -35.392 20.212 1.00 66.24  ? 26  PRO G CA    1 
ATOM   4608  C  C     . PRO G 3 27  ? -31.208 -35.023 19.889 1.00 65.40  ? 26  PRO G C     1 
ATOM   4609  O  O     . PRO G 3 27  ? -30.756 -33.918 20.208 1.00 65.65  ? 26  PRO G O     1 
ATOM   4610  C  CB    . PRO G 3 27  ? -33.558 -34.159 20.136 1.00 66.24  ? 26  PRO G CB    1 
ATOM   4611  C  CG    . PRO G 3 27  ? -33.598 -33.645 21.541 1.00 66.72  ? 26  PRO G CG    1 
ATOM   4612  C  CD    . PRO G 3 27  ? -33.421 -34.829 22.466 1.00 66.97  ? 26  PRO G CD    1 
ATOM   4613  N  N     . VAL G 3 28  ? -30.496 -35.935 19.240 1.00 64.27  ? 27  VAL G N     1 
ATOM   4614  C  CA    . VAL G 3 28  ? -29.115 -35.679 18.850 1.00 63.39  ? 27  VAL G CA    1 
ATOM   4615  C  C     . VAL G 3 28  ? -28.999 -34.447 17.963 1.00 63.38  ? 27  VAL G C     1 
ATOM   4616  O  O     . VAL G 3 28  ? -28.043 -33.685 18.083 1.00 63.90  ? 27  VAL G O     1 
ATOM   4617  C  CB    . VAL G 3 28  ? -28.503 -36.883 18.140 1.00 63.30  ? 27  VAL G CB    1 
ATOM   4618  C  CG1   . VAL G 3 28  ? -27.041 -36.633 17.834 1.00 62.78  ? 27  VAL G CG1   1 
ATOM   4619  C  CG2   . VAL G 3 28  ? -28.663 -38.139 18.997 1.00 62.84  ? 27  VAL G CG2   1 
ATOM   4620  N  N     . GLY G 3 29  ? -29.972 -34.255 17.073 1.00 63.31  ? 28  GLY G N     1 
ATOM   4621  C  CA    . GLY G 3 29  ? -30.012 -33.081 16.210 1.00 62.42  ? 28  GLY G CA    1 
ATOM   4622  C  C     . GLY G 3 29  ? -30.015 -31.790 17.006 1.00 61.92  ? 28  GLY G C     1 
ATOM   4623  O  O     . GLY G 3 29  ? -29.166 -30.928 16.802 1.00 62.03  ? 28  GLY G O     1 
ATOM   4624  N  N     . ARG G 3 30  ? -30.971 -31.666 17.920 1.00 61.48  ? 29  ARG G N     1 
ATOM   4625  C  CA    . ARG G 3 30  ? -31.114 -30.468 18.741 1.00 61.11  ? 29  ARG G CA    1 
ATOM   4626  C  C     . ARG G 3 30  ? -29.849 -30.194 19.555 1.00 60.88  ? 29  ARG G C     1 
ATOM   4627  O  O     . ARG G 3 30  ? -29.363 -29.064 19.603 1.00 60.41  ? 29  ARG G O     1 
ATOM   4628  C  CB    . ARG G 3 30  ? -32.323 -30.608 19.663 1.00 61.12  ? 29  ARG G CB    1 
ATOM   4629  C  CG    . ARG G 3 30  ? -32.693 -29.349 20.423 1.00 61.63  ? 29  ARG G CG    1 
ATOM   4630  C  CD    . ARG G 3 30  ? -33.978 -29.550 21.229 1.00 63.07  ? 29  ARG G CD    1 
ATOM   4631  N  NE    . ARG G 3 30  ? -35.176 -29.571 20.389 1.00 64.58  ? 29  ARG G NE    1 
ATOM   4632  C  CZ    . ARG G 3 30  ? -36.429 -29.582 20.845 1.00 66.31  ? 29  ARG G CZ    1 
ATOM   4633  N  NH1   . ARG G 3 30  ? -36.683 -29.581 22.150 1.00 66.56  ? 29  ARG G NH1   1 
ATOM   4634  N  NH2   . ARG G 3 30  ? -37.443 -29.595 19.988 1.00 67.58  ? 29  ARG G NH2   1 
ATOM   4635  N  N     . VAL G 3 31  ? -29.310 -31.240 20.170 1.00 60.77  ? 30  VAL G N     1 
ATOM   4636  C  CA    . VAL G 3 31  ? -28.130 -31.100 21.012 1.00 60.78  ? 30  VAL G CA    1 
ATOM   4637  C  C     . VAL G 3 31  ? -26.947 -30.573 20.200 1.00 61.26  ? 30  VAL G C     1 
ATOM   4638  O  O     . VAL G 3 31  ? -26.207 -29.703 20.672 1.00 61.42  ? 30  VAL G O     1 
ATOM   4639  C  CB    . VAL G 3 31  ? -27.789 -32.417 21.747 1.00 60.55  ? 30  VAL G CB    1 
ATOM   4640  C  CG1   . VAL G 3 31  ? -26.454 -32.319 22.447 1.00 59.70  ? 30  VAL G CG1   1 
ATOM   4641  C  CG2   . VAL G 3 31  ? -28.872 -32.743 22.754 1.00 60.71  ? 30  VAL G CG2   1 
ATOM   4642  N  N     . HIS G 3 32  ? -26.787 -31.077 18.976 1.00 61.61  ? 31  HIS G N     1 
ATOM   4643  C  CA    . HIS G 3 32  ? -25.744 -30.588 18.074 1.00 61.97  ? 31  HIS G CA    1 
ATOM   4644  C  C     . HIS G 3 32  ? -25.920 -29.083 17.841 1.00 62.08  ? 31  HIS G C     1 
ATOM   4645  O  O     . HIS G 3 32  ? -24.982 -28.293 17.991 1.00 61.60  ? 31  HIS G O     1 
ATOM   4646  C  CB    . HIS G 3 32  ? -25.807 -31.339 16.746 1.00 62.04  ? 31  HIS G CB    1 
ATOM   4647  C  CG    . HIS G 3 32  ? -24.534 -31.296 15.959 1.00 63.41  ? 31  HIS G CG    1 
ATOM   4648  N  ND1   . HIS G 3 32  ? -23.741 -30.168 15.877 1.00 65.05  ? 31  HIS G ND1   1 
ATOM   4649  C  CD2   . HIS G 3 32  ? -23.926 -32.240 15.196 1.00 64.23  ? 31  HIS G CD2   1 
ATOM   4650  C  CE1   . HIS G 3 32  ? -22.691 -30.426 15.115 1.00 65.52  ? 31  HIS G CE1   1 
ATOM   4651  N  NE2   . HIS G 3 32  ? -22.780 -31.676 14.687 1.00 64.30  ? 31  HIS G NE2   1 
ATOM   4652  N  N     . ARG G 3 33  ? -27.141 -28.698 17.489 1.00 62.42  ? 32  ARG G N     1 
ATOM   4653  C  CA    . ARG G 3 33  ? -27.471 -27.303 17.253 1.00 63.12  ? 32  ARG G CA    1 
ATOM   4654  C  C     . ARG G 3 33  ? -27.123 -26.479 18.488 1.00 63.48  ? 32  ARG G C     1 
ATOM   4655  O  O     . ARG G 3 33  ? -26.310 -25.547 18.421 1.00 63.79  ? 32  ARG G O     1 
ATOM   4656  C  CB    . ARG G 3 33  ? -28.959 -27.182 16.899 1.00 63.04  ? 32  ARG G CB    1 
ATOM   4657  C  CG    . ARG G 3 33  ? -29.445 -25.795 16.555 1.00 62.93  ? 32  ARG G CG    1 
ATOM   4658  C  CD    . ARG G 3 33  ? -30.955 -25.767 16.712 1.00 63.98  ? 32  ARG G CD    1 
ATOM   4659  N  NE    . ARG G 3 33  ? -31.354 -25.419 18.073 1.00 65.01  ? 32  ARG G NE    1 
ATOM   4660  C  CZ    . ARG G 3 33  ? -32.498 -25.777 18.657 1.00 65.75  ? 32  ARG G CZ    1 
ATOM   4661  N  NH1   . ARG G 3 33  ? -33.390 -26.517 18.018 1.00 66.21  ? 32  ARG G NH1   1 
ATOM   4662  N  NH2   . ARG G 3 33  ? -32.754 -25.395 19.901 1.00 66.59  ? 32  ARG G NH2   1 
ATOM   4663  N  N     . LEU G 3 34  ? -27.715 -26.859 19.619 1.00 63.93  ? 33  LEU G N     1 
ATOM   4664  C  CA    . LEU G 3 34  ? -27.493 -26.175 20.884 1.00 64.46  ? 33  LEU G CA    1 
ATOM   4665  C  C     . LEU G 3 34  ? -26.011 -26.037 21.233 1.00 65.13  ? 33  LEU G C     1 
ATOM   4666  O  O     . LEU G 3 34  ? -25.610 -25.023 21.791 1.00 65.67  ? 33  LEU G O     1 
ATOM   4667  C  CB    . LEU G 3 34  ? -28.261 -26.865 22.012 1.00 64.12  ? 33  LEU G CB    1 
ATOM   4668  C  CG    . LEU G 3 34  ? -29.794 -26.744 21.978 1.00 63.56  ? 33  LEU G CG    1 
ATOM   4669  C  CD1   . LEU G 3 34  ? -30.442 -27.712 22.956 1.00 61.99  ? 33  LEU G CD1   1 
ATOM   4670  C  CD2   . LEU G 3 34  ? -30.290 -25.315 22.230 1.00 62.28  ? 33  LEU G CD2   1 
ATOM   4671  N  N     . LEU G 3 35  ? -25.206 -27.040 20.889 1.00 65.73  ? 34  LEU G N     1 
ATOM   4672  C  CA    . LEU G 3 35  ? -23.757 -26.955 21.053 1.00 66.64  ? 34  LEU G CA    1 
ATOM   4673  C  C     . LEU G 3 35  ? -23.082 -25.929 20.146 1.00 67.76  ? 34  LEU G C     1 
ATOM   4674  O  O     . LEU G 3 35  ? -22.097 -25.312 20.548 1.00 68.16  ? 34  LEU G O     1 
ATOM   4675  C  CB    . LEU G 3 35  ? -23.090 -28.320 20.838 1.00 66.33  ? 34  LEU G CB    1 
ATOM   4676  C  CG    . LEU G 3 35  ? -23.030 -29.354 21.969 1.00 65.72  ? 34  LEU G CG    1 
ATOM   4677  C  CD1   . LEU G 3 35  ? -22.308 -30.591 21.485 1.00 63.41  ? 34  LEU G CD1   1 
ATOM   4678  C  CD2   . LEU G 3 35  ? -22.365 -28.810 23.249 1.00 64.96  ? 34  LEU G CD2   1 
ATOM   4679  N  N     . ARG G 3 36  ? -23.575 -25.773 18.918 1.00 69.18  ? 35  ARG G N     1 
ATOM   4680  C  CA    . ARG G 3 36  ? -22.994 -24.808 17.983 1.00 70.45  ? 35  ARG G CA    1 
ATOM   4681  C  C     . ARG G 3 36  ? -23.333 -23.413 18.437 1.00 70.69  ? 35  ARG G C     1 
ATOM   4682  O  O     . ARG G 3 36  ? -22.483 -22.523 18.478 1.00 70.68  ? 35  ARG G O     1 
ATOM   4683  C  CB    . ARG G 3 36  ? -23.575 -24.969 16.582 1.00 70.81  ? 35  ARG G CB    1 
ATOM   4684  C  CG    . ARG G 3 36  ? -23.495 -26.342 16.011 1.00 73.20  ? 35  ARG G CG    1 
ATOM   4685  C  CD    . ARG G 3 36  ? -23.906 -26.290 14.559 1.00 76.75  ? 35  ARG G CD    1 
ATOM   4686  N  NE    . ARG G 3 36  ? -23.281 -27.367 13.802 1.00 79.20  ? 35  ARG G NE    1 
ATOM   4687  C  CZ    . ARG G 3 36  ? -21.972 -27.470 13.585 1.00 80.24  ? 35  ARG G CZ    1 
ATOM   4688  N  NH1   . ARG G 3 36  ? -21.120 -26.571 14.077 1.00 80.02  ? 35  ARG G NH1   1 
ATOM   4689  N  NH2   . ARG G 3 36  ? -21.514 -28.489 12.874 1.00 81.64  ? 35  ARG G NH2   1 
ATOM   4690  N  N     . LYS G 3 37  ? -24.602 -23.231 18.771 1.00 71.29  ? 36  LYS G N     1 
ATOM   4691  C  CA    . LYS G 3 37  ? -25.115 -21.912 19.048 1.00 72.09  ? 36  LYS G CA    1 
ATOM   4692  C  C     . LYS G 3 37  ? -24.915 -21.558 20.511 1.00 71.88  ? 36  LYS G C     1 
ATOM   4693  O  O     . LYS G 3 37  ? -25.541 -20.625 21.023 1.00 72.28  ? 36  LYS G O     1 
ATOM   4694  C  CB    . LYS G 3 37  ? -26.580 -21.817 18.608 1.00 72.79  ? 36  LYS G CB    1 
ATOM   4695  C  CG    . LYS G 3 37  ? -26.735 -21.796 17.074 1.00 75.00  ? 36  LYS G CG    1 
ATOM   4696  C  CD    . LYS G 3 37  ? -28.186 -21.954 16.630 1.00 79.59  ? 36  LYS G CD    1 
ATOM   4697  C  CE    . LYS G 3 37  ? -28.291 -22.165 15.105 1.00 82.41  ? 36  LYS G CE    1 
ATOM   4698  N  NZ    . LYS G 3 37  ? -29.709 -22.387 14.648 1.00 83.66  ? 36  LYS G NZ    1 
ATOM   4699  N  N     . GLY G 3 38  ? -24.017 -22.303 21.162 1.00 71.37  ? 37  GLY G N     1 
ATOM   4700  C  CA    . GLY G 3 38  ? -23.644 -22.074 22.548 1.00 70.53  ? 37  GLY G CA    1 
ATOM   4701  C  C     . GLY G 3 38  ? -22.257 -21.467 22.686 1.00 70.29  ? 37  GLY G C     1 
ATOM   4702  O  O     . GLY G 3 38  ? -21.812 -21.178 23.800 1.00 70.01  ? 37  GLY G O     1 
ATOM   4703  N  N     . ASN G 3 39  ? -21.576 -21.267 21.557 1.00 69.95  ? 38  ASN G N     1 
ATOM   4704  C  CA    . ASN G 3 39  ? -20.232 -20.675 21.538 1.00 69.98  ? 38  ASN G CA    1 
ATOM   4705  C  C     . ASN G 3 39  ? -19.258 -21.404 22.451 1.00 69.36  ? 38  ASN G C     1 
ATOM   4706  O  O     . ASN G 3 39  ? -18.414 -20.784 23.090 1.00 69.84  ? 38  ASN G O     1 
ATOM   4707  C  CB    . ASN G 3 39  ? -20.262 -19.184 21.930 1.00 70.37  ? 38  ASN G CB    1 
ATOM   4708  C  CG    . ASN G 3 39  ? -20.846 -18.290 20.844 1.00 71.17  ? 38  ASN G CG    1 
ATOM   4709  O  OD1   . ASN G 3 39  ? -21.931 -17.715 21.007 1.00 72.17  ? 38  ASN G OD1   1 
ATOM   4710  N  ND2   . ASN G 3 39  ? -20.121 -18.150 19.740 1.00 71.67  ? 38  ASN G ND2   1 
ATOM   4711  N  N     . TYR G 3 40  ? -19.380 -22.720 22.522 1.00 68.61  ? 39  TYR G N     1 
ATOM   4712  C  CA    . TYR G 3 40  ? -18.535 -23.507 23.408 1.00 67.68  ? 39  TYR G CA    1 
ATOM   4713  C  C     . TYR G 3 40  ? -17.173 -23.772 22.772 1.00 68.04  ? 39  TYR G C     1 
ATOM   4714  O  O     . TYR G 3 40  ? -16.170 -23.876 23.466 1.00 68.01  ? 39  TYR G O     1 
ATOM   4715  C  CB    . TYR G 3 40  ? -19.242 -24.805 23.793 1.00 67.02  ? 39  TYR G CB    1 
ATOM   4716  C  CG    . TYR G 3 40  ? -20.530 -24.605 24.567 1.00 64.43  ? 39  TYR G CG    1 
ATOM   4717  C  CD1   . TYR G 3 40  ? -21.763 -24.866 23.988 1.00 61.88  ? 39  TYR G CD1   1 
ATOM   4718  C  CD2   . TYR G 3 40  ? -20.509 -24.161 25.886 1.00 62.96  ? 39  TYR G CD2   1 
ATOM   4719  C  CE1   . TYR G 3 40  ? -22.944 -24.691 24.707 1.00 60.82  ? 39  TYR G CE1   1 
ATOM   4720  C  CE2   . TYR G 3 40  ? -21.675 -23.979 26.606 1.00 60.83  ? 39  TYR G CE2   1 
ATOM   4721  C  CZ    . TYR G 3 40  ? -22.888 -24.244 26.015 1.00 60.79  ? 39  TYR G CZ    1 
ATOM   4722  O  OH    . TYR G 3 40  ? -24.044 -24.058 26.748 1.00 60.48  ? 39  TYR G OH    1 
ATOM   4723  N  N     . ALA G 3 41  ? -17.154 -23.878 21.448 1.00 68.74  ? 40  ALA G N     1 
ATOM   4724  C  CA    . ALA G 3 41  ? -15.919 -23.895 20.664 1.00 69.68  ? 40  ALA G CA    1 
ATOM   4725  C  C     . ALA G 3 41  ? -16.249 -23.591 19.212 1.00 70.45  ? 40  ALA G C     1 
ATOM   4726  O  O     . ALA G 3 41  ? -17.410 -23.700 18.804 1.00 70.38  ? 40  ALA G O     1 
ATOM   4727  C  CB    . ALA G 3 41  ? -15.213 -25.234 20.778 1.00 69.37  ? 40  ALA G CB    1 
ATOM   4728  N  N     . GLU G 3 42  ? -15.227 -23.206 18.447 1.00 71.62  ? 41  GLU G N     1 
ATOM   4729  C  CA    . GLU G 3 42  ? -15.351 -22.965 16.999 1.00 72.99  ? 41  GLU G CA    1 
ATOM   4730  C  C     . GLU G 3 42  ? -16.032 -24.116 16.247 1.00 73.02  ? 41  GLU G C     1 
ATOM   4731  O  O     . GLU G 3 42  ? -16.883 -23.881 15.390 1.00 73.07  ? 41  GLU G O     1 
ATOM   4732  C  CB    . GLU G 3 42  ? -13.976 -22.685 16.367 1.00 73.28  ? 41  GLU G CB    1 
ATOM   4733  C  CG    . GLU G 3 42  ? -13.371 -21.329 16.717 1.00 76.01  ? 41  GLU G CG    1 
ATOM   4734  C  CD    . GLU G 3 42  ? -13.855 -20.213 15.804 1.00 80.94  ? 41  GLU G CD    1 
ATOM   4735  O  OE1   . GLU G 3 42  ? -13.553 -20.266 14.580 1.00 83.91  ? 41  GLU G OE1   1 
ATOM   4736  O  OE2   . GLU G 3 42  ? -14.530 -19.276 16.304 1.00 82.58  ? 41  GLU G OE2   1 
ATOM   4737  N  N     . ARG G 3 43  ? -15.659 -25.351 16.583 1.00 73.19  ? 42  ARG G N     1 
ATOM   4738  C  CA    . ARG G 3 43  ? -16.122 -26.532 15.856 1.00 73.57  ? 42  ARG G CA    1 
ATOM   4739  C  C     . ARG G 3 43  ? -16.679 -27.600 16.785 1.00 73.16  ? 42  ARG G C     1 
ATOM   4740  O  O     . ARG G 3 43  ? -16.217 -27.741 17.905 1.00 73.53  ? 42  ARG G O     1 
ATOM   4741  C  CB    . ARG G 3 43  ? -14.966 -27.139 15.069 1.00 74.07  ? 42  ARG G CB    1 
ATOM   4742  C  CG    . ARG G 3 43  ? -14.208 -26.167 14.185 1.00 75.71  ? 42  ARG G CG    1 
ATOM   4743  C  CD    . ARG G 3 43  ? -13.149 -26.916 13.423 1.00 79.24  ? 42  ARG G CD    1 
ATOM   4744  N  NE    . ARG G 3 43  ? -13.234 -26.588 12.008 1.00 82.47  ? 42  ARG G NE    1 
ATOM   4745  C  CZ    . ARG G 3 43  ? -13.051 -27.460 11.024 1.00 84.24  ? 42  ARG G CZ    1 
ATOM   4746  N  NH1   . ARG G 3 43  ? -12.768 -28.731 11.293 1.00 84.79  ? 42  ARG G NH1   1 
ATOM   4747  N  NH2   . ARG G 3 43  ? -13.164 -27.056 9.764  1.00 86.18  ? 42  ARG G NH2   1 
ATOM   4748  N  N     . VAL G 3 44  ? -17.649 -28.368 16.302 1.00 72.59  ? 43  VAL G N     1 
ATOM   4749  C  CA    . VAL G 3 44  ? -18.260 -29.432 17.091 1.00 72.08  ? 43  VAL G CA    1 
ATOM   4750  C  C     . VAL G 3 44  ? -18.188 -30.754 16.338 1.00 71.77  ? 43  VAL G C     1 
ATOM   4751  O  O     . VAL G 3 44  ? -18.844 -30.920 15.307 1.00 72.05  ? 43  VAL G O     1 
ATOM   4752  C  CB    . VAL G 3 44  ? -19.747 -29.118 17.422 1.00 72.22  ? 43  VAL G CB    1 
ATOM   4753  C  CG1   . VAL G 3 44  ? -20.406 -30.280 18.180 1.00 71.99  ? 43  VAL G CG1   1 
ATOM   4754  C  CG2   . VAL G 3 44  ? -19.866 -27.830 18.220 1.00 72.07  ? 43  VAL G CG2   1 
ATOM   4755  N  N     . GLY G 3 45  ? -17.407 -31.696 16.864 1.00 71.08  ? 44  GLY G N     1 
ATOM   4756  C  CA    . GLY G 3 45  ? -17.270 -33.029 16.265 1.00 70.24  ? 44  GLY G CA    1 
ATOM   4757  C  C     . GLY G 3 45  ? -18.576 -33.803 16.187 1.00 69.59  ? 44  GLY G C     1 
ATOM   4758  O  O     . GLY G 3 45  ? -19.545 -33.464 16.864 1.00 69.24  ? 44  GLY G O     1 
ATOM   4759  N  N     . ALA G 3 46  ? -18.591 -34.853 15.370 1.00 69.10  ? 45  ALA G N     1 
ATOM   4760  C  CA    . ALA G 3 46  ? -19.817 -35.599 15.088 1.00 68.52  ? 45  ALA G CA    1 
ATOM   4761  C  C     . ALA G 3 46  ? -20.373 -36.358 16.300 1.00 68.06  ? 45  ALA G C     1 
ATOM   4762  O  O     . ALA G 3 46  ? -21.572 -36.308 16.566 1.00 68.32  ? 45  ALA G O     1 
ATOM   4763  C  CB    . ALA G 3 46  ? -19.608 -36.540 13.902 1.00 68.42  ? 45  ALA G CB    1 
ATOM   4764  N  N     . GLY G 3 47  ? -19.509 -37.053 17.031 1.00 67.36  ? 46  GLY G N     1 
ATOM   4765  C  CA    . GLY G 3 47  ? -19.947 -37.877 18.163 1.00 66.57  ? 46  GLY G CA    1 
ATOM   4766  C  C     . GLY G 3 47  ? -20.349 -37.124 19.420 1.00 66.07  ? 46  GLY G C     1 
ATOM   4767  O  O     . GLY G 3 47  ? -21.161 -37.617 20.209 1.00 66.28  ? 46  GLY G O     1 
ATOM   4768  N  N     . ALA G 3 48  ? -19.785 -35.930 19.609 1.00 65.29  ? 47  ALA G N     1 
ATOM   4769  C  CA    . ALA G 3 48  ? -20.072 -35.110 20.786 1.00 64.01  ? 47  ALA G CA    1 
ATOM   4770  C  C     . ALA G 3 48  ? -21.561 -35.024 21.089 1.00 63.26  ? 47  ALA G C     1 
ATOM   4771  O  O     . ALA G 3 48  ? -21.973 -35.351 22.199 1.00 63.37  ? 47  ALA G O     1 
ATOM   4772  C  CB    . ALA G 3 48  ? -19.465 -33.716 20.650 1.00 64.01  ? 47  ALA G CB    1 
ATOM   4773  N  N     . PRO G 3 49  ? -22.385 -34.605 20.110 1.00 62.54  ? 48  PRO G N     1 
ATOM   4774  C  CA    . PRO G 3 49  ? -23.808 -34.504 20.471 1.00 61.89  ? 48  PRO G CA    1 
ATOM   4775  C  C     . PRO G 3 49  ? -24.444 -35.854 20.740 1.00 61.24  ? 48  PRO G C     1 
ATOM   4776  O  O     . PRO G 3 49  ? -25.493 -35.917 21.375 1.00 61.55  ? 48  PRO G O     1 
ATOM   4777  C  CB    . PRO G 3 49  ? -24.451 -33.860 19.236 1.00 61.91  ? 48  PRO G CB    1 
ATOM   4778  C  CG    . PRO G 3 49  ? -23.457 -34.029 18.136 1.00 61.75  ? 48  PRO G CG    1 
ATOM   4779  C  CD    . PRO G 3 49  ? -22.117 -34.061 18.765 1.00 62.19  ? 48  PRO G CD    1 
ATOM   4780  N  N     . VAL G 3 50  ? -23.819 -36.923 20.258 1.00 60.44  ? 49  VAL G N     1 
ATOM   4781  C  CA    . VAL G 3 50  ? -24.368 -38.262 20.436 1.00 60.04  ? 49  VAL G CA    1 
ATOM   4782  C  C     . VAL G 3 50  ? -24.114 -38.620 21.880 1.00 59.52  ? 49  VAL G C     1 
ATOM   4783  O  O     . VAL G 3 50  ? -25.041 -38.926 22.650 1.00 59.20  ? 49  VAL G O     1 
ATOM   4784  C  CB    . VAL G 3 50  ? -23.699 -39.319 19.477 1.00 60.19  ? 49  VAL G CB    1 
ATOM   4785  C  CG1   . VAL G 3 50  ? -24.114 -40.732 19.839 1.00 60.02  ? 49  VAL G CG1   1 
ATOM   4786  C  CG2   . VAL G 3 50  ? -24.046 -39.039 18.012 1.00 60.30  ? 49  VAL G CG2   1 
ATOM   4787  N  N     . TYR G 3 51  ? -22.833 -38.555 22.228 1.00 58.73  ? 50  TYR G N     1 
ATOM   4788  C  CA    . TYR G 3 51  ? -22.365 -38.771 23.580 1.00 58.19  ? 50  TYR G CA    1 
ATOM   4789  C  C     . TYR G 3 51  ? -23.170 -37.921 24.572 1.00 57.71  ? 50  TYR G C     1 
ATOM   4790  O  O     . TYR G 3 51  ? -23.786 -38.445 25.512 1.00 57.78  ? 50  TYR G O     1 
ATOM   4791  C  CB    . TYR G 3 51  ? -20.889 -38.405 23.645 1.00 58.12  ? 50  TYR G CB    1 
ATOM   4792  C  CG    . TYR G 3 51  ? -20.121 -39.091 24.740 1.00 59.08  ? 50  TYR G CG    1 
ATOM   4793  C  CD1   . TYR G 3 51  ? -18.974 -39.822 24.451 1.00 59.24  ? 50  TYR G CD1   1 
ATOM   4794  C  CD2   . TYR G 3 51  ? -20.528 -38.994 26.073 1.00 60.42  ? 50  TYR G CD2   1 
ATOM   4795  C  CE1   . TYR G 3 51  ? -18.248 -40.439 25.453 1.00 59.87  ? 50  TYR G CE1   1 
ATOM   4796  C  CE2   . TYR G 3 51  ? -19.813 -39.619 27.088 1.00 61.35  ? 50  TYR G CE2   1 
ATOM   4797  C  CZ    . TYR G 3 51  ? -18.672 -40.341 26.766 1.00 61.07  ? 50  TYR G CZ    1 
ATOM   4798  O  OH    . TYR G 3 51  ? -17.957 -40.964 27.762 1.00 62.44  ? 50  TYR G OH    1 
ATOM   4799  N  N     . LEU G 3 52  ? -23.184 -36.611 24.348 1.00 56.86  ? 51  LEU G N     1 
ATOM   4800  C  CA    . LEU G 3 52  ? -23.850 -35.714 25.265 1.00 56.10  ? 51  LEU G CA    1 
ATOM   4801  C  C     . LEU G 3 52  ? -25.297 -36.110 25.431 1.00 55.77  ? 51  LEU G C     1 
ATOM   4802  O  O     . LEU G 3 52  ? -25.756 -36.272 26.572 1.00 56.45  ? 51  LEU G O     1 
ATOM   4803  C  CB    . LEU G 3 52  ? -23.724 -34.254 24.825 1.00 56.21  ? 51  LEU G CB    1 
ATOM   4804  C  CG    . LEU G 3 52  ? -24.339 -33.181 25.728 1.00 55.71  ? 51  LEU G CG    1 
ATOM   4805  C  CD1   . LEU G 3 52  ? -23.954 -33.362 27.202 1.00 55.52  ? 51  LEU G CD1   1 
ATOM   4806  C  CD2   . LEU G 3 52  ? -23.927 -31.830 25.219 1.00 54.68  ? 51  LEU G CD2   1 
ATOM   4807  N  N     . ALA G 3 53  ? -25.999 -36.312 24.313 1.00 54.63  ? 52  ALA G N     1 
ATOM   4808  C  CA    . ALA G 3 53  ? -27.412 -36.711 24.354 1.00 53.76  ? 52  ALA G CA    1 
ATOM   4809  C  C     . ALA G 3 53  ? -27.667 -37.975 25.175 1.00 53.22  ? 52  ALA G C     1 
ATOM   4810  O  O     . ALA G 3 53  ? -28.678 -38.076 25.858 1.00 52.82  ? 52  ALA G O     1 
ATOM   4811  C  CB    . ALA G 3 53  ? -27.947 -36.877 22.955 1.00 54.11  ? 52  ALA G CB    1 
ATOM   4812  N  N     . ALA G 3 54  ? -26.741 -38.930 25.099 1.00 53.05  ? 53  ALA G N     1 
ATOM   4813  C  CA    . ALA G 3 54  ? -26.862 -40.195 25.803 1.00 53.02  ? 53  ALA G CA    1 
ATOM   4814  C  C     . ALA G 3 54  ? -26.796 -39.944 27.291 1.00 53.72  ? 53  ALA G C     1 
ATOM   4815  O  O     . ALA G 3 54  ? -27.626 -40.441 28.061 1.00 53.57  ? 53  ALA G O     1 
ATOM   4816  C  CB    . ALA G 3 54  ? -25.748 -41.117 25.395 1.00 52.95  ? 53  ALA G CB    1 
ATOM   4817  N  N     . VAL G 3 55  ? -25.795 -39.157 27.684 1.00 54.25  ? 54  VAL G N     1 
ATOM   4818  C  CA    . VAL G 3 55  ? -25.580 -38.812 29.075 1.00 54.63  ? 54  VAL G CA    1 
ATOM   4819  C  C     . VAL G 3 55  ? -26.812 -38.115 29.661 1.00 54.63  ? 54  VAL G C     1 
ATOM   4820  O  O     . VAL G 3 55  ? -27.230 -38.414 30.791 1.00 54.70  ? 54  VAL G O     1 
ATOM   4821  C  CB    . VAL G 3 55  ? -24.337 -37.934 29.218 1.00 55.01  ? 54  VAL G CB    1 
ATOM   4822  C  CG1   . VAL G 3 55  ? -24.225 -37.353 30.638 1.00 55.18  ? 54  VAL G CG1   1 
ATOM   4823  C  CG2   . VAL G 3 55  ? -23.081 -38.736 28.827 1.00 55.53  ? 54  VAL G CG2   1 
ATOM   4824  N  N     . LEU G 3 56  ? -27.408 -37.214 28.886 1.00 54.33  ? 55  LEU G N     1 
ATOM   4825  C  CA    . LEU G 3 56  ? -28.592 -36.508 29.355 1.00 54.44  ? 55  LEU G CA    1 
ATOM   4826  C  C     . LEU G 3 56  ? -29.759 -37.477 29.515 1.00 54.72  ? 55  LEU G C     1 
ATOM   4827  O  O     . LEU G 3 56  ? -30.499 -37.429 30.498 1.00 54.51  ? 55  LEU G O     1 
ATOM   4828  C  CB    . LEU G 3 56  ? -28.938 -35.347 28.419 1.00 54.30  ? 55  LEU G CB    1 
ATOM   4829  C  CG    . LEU G 3 56  ? -27.933 -34.180 28.367 1.00 53.90  ? 55  LEU G CG    1 
ATOM   4830  C  CD1   . LEU G 3 56  ? -28.214 -33.257 27.204 1.00 53.83  ? 55  LEU G CD1   1 
ATOM   4831  C  CD2   . LEU G 3 56  ? -27.925 -33.374 29.670 1.00 53.41  ? 55  LEU G CD2   1 
ATOM   4832  N  N     . GLU G 3 57  ? -29.896 -38.385 28.555 1.00 55.24  ? 56  GLU G N     1 
ATOM   4833  C  CA    . GLU G 3 57  ? -30.961 -39.364 28.593 1.00 55.48  ? 56  GLU G CA    1 
ATOM   4834  C  C     . GLU G 3 57  ? -30.744 -40.241 29.808 1.00 54.98  ? 56  GLU G C     1 
ATOM   4835  O  O     . GLU G 3 57  ? -31.639 -40.430 30.644 1.00 54.78  ? 56  GLU G O     1 
ATOM   4836  C  CB    . GLU G 3 57  ? -30.942 -40.193 27.325 1.00 55.95  ? 56  GLU G CB    1 
ATOM   4837  C  CG    . GLU G 3 57  ? -32.149 -41.109 27.160 1.00 58.45  ? 56  GLU G CG    1 
ATOM   4838  C  CD    . GLU G 3 57  ? -32.154 -41.826 25.814 1.00 61.32  ? 56  GLU G CD    1 
ATOM   4839  O  OE1   . GLU G 3 57  ? -31.773 -41.202 24.791 1.00 61.87  ? 56  GLU G OE1   1 
ATOM   4840  O  OE2   . GLU G 3 57  ? -32.537 -43.015 25.783 1.00 62.69  ? 56  GLU G OE2   1 
ATOM   4841  N  N     . TYR G 3 58  ? -29.528 -40.744 29.926 1.00 54.56  ? 57  TYR G N     1 
ATOM   4842  C  CA    . TYR G 3 58  ? -29.200 -41.583 31.056 1.00 54.42  ? 57  TYR G CA    1 
ATOM   4843  C  C     . TYR G 3 58  ? -29.623 -40.956 32.407 1.00 54.12  ? 57  TYR G C     1 
ATOM   4844  O  O     . TYR G 3 58  ? -30.373 -41.571 33.179 1.00 54.42  ? 57  TYR G O     1 
ATOM   4845  C  CB    . TYR G 3 58  ? -27.711 -41.937 31.066 1.00 54.24  ? 57  TYR G CB    1 
ATOM   4846  C  CG    . TYR G 3 58  ? -27.328 -42.512 32.395 1.00 55.53  ? 57  TYR G CG    1 
ATOM   4847  C  CD1   . TYR G 3 58  ? -27.935 -43.684 32.859 1.00 55.05  ? 57  TYR G CD1   1 
ATOM   4848  C  CD2   . TYR G 3 58  ? -26.410 -41.861 33.224 1.00 56.45  ? 57  TYR G CD2   1 
ATOM   4849  C  CE1   . TYR G 3 58  ? -27.628 -44.198 34.090 1.00 56.30  ? 57  TYR G CE1   1 
ATOM   4850  C  CE2   . TYR G 3 58  ? -26.086 -42.384 34.471 1.00 56.47  ? 57  TYR G CE2   1 
ATOM   4851  C  CZ    . TYR G 3 58  ? -26.705 -43.547 34.889 1.00 57.45  ? 57  TYR G CZ    1 
ATOM   4852  O  OH    . TYR G 3 58  ? -26.406 -44.085 36.113 1.00 61.12  ? 57  TYR G OH    1 
ATOM   4853  N  N     . LEU G 3 59  ? -29.144 -39.741 32.677 1.00 53.27  ? 58  LEU G N     1 
ATOM   4854  C  CA    . LEU G 3 59  ? -29.395 -39.089 33.955 1.00 52.59  ? 58  LEU G CA    1 
ATOM   4855  C  C     . LEU G 3 59  ? -30.880 -38.880 34.179 1.00 52.79  ? 58  LEU G C     1 
ATOM   4856  O  O     . LEU G 3 59  ? -31.372 -39.047 35.294 1.00 52.41  ? 58  LEU G O     1 
ATOM   4857  C  CB    . LEU G 3 59  ? -28.613 -37.767 34.081 1.00 51.86  ? 58  LEU G CB    1 
ATOM   4858  C  CG    . LEU G 3 59  ? -27.088 -37.920 34.202 1.00 50.37  ? 58  LEU G CG    1 
ATOM   4859  C  CD1   . LEU G 3 59  ? -26.342 -36.636 33.863 1.00 48.83  ? 58  LEU G CD1   1 
ATOM   4860  C  CD2   . LEU G 3 59  ? -26.656 -38.457 35.567 1.00 47.24  ? 58  LEU G CD2   1 
ATOM   4861  N  N     . THR G 3 60  ? -31.589 -38.539 33.111 1.00 53.38  ? 59  THR G N     1 
ATOM   4862  C  CA    . THR G 3 60  ? -33.039 -38.391 33.163 1.00 54.16  ? 59  THR G CA    1 
ATOM   4863  C  C     . THR G 3 60  ? -33.707 -39.694 33.606 1.00 54.52  ? 59  THR G C     1 
ATOM   4864  O  O     . THR G 3 60  ? -34.632 -39.688 34.421 1.00 54.56  ? 59  THR G O     1 
ATOM   4865  C  CB    . THR G 3 60  ? -33.580 -37.963 31.790 1.00 54.52  ? 59  THR G CB    1 
ATOM   4866  O  OG1   . THR G 3 60  ? -33.012 -36.692 31.447 1.00 54.14  ? 59  THR G OG1   1 
ATOM   4867  C  CG2   . THR G 3 60  ? -35.107 -37.873 31.789 1.00 53.47  ? 59  THR G CG2   1 
ATOM   4868  N  N     . ALA G 3 61  ? -33.225 -40.810 33.074 1.00 54.86  ? 60  ALA G N     1 
ATOM   4869  C  CA    . ALA G 3 61  ? -33.810 -42.106 33.399 1.00 55.10  ? 60  ALA G CA    1 
ATOM   4870  C  C     . ALA G 3 61  ? -33.503 -42.449 34.846 1.00 55.23  ? 60  ALA G C     1 
ATOM   4871  O  O     . ALA G 3 61  ? -34.346 -42.996 35.574 1.00 55.01  ? 60  ALA G O     1 
ATOM   4872  C  CB    . ALA G 3 61  ? -33.289 -43.193 32.454 1.00 55.07  ? 60  ALA G CB    1 
ATOM   4873  N  N     . GLU G 3 62  ? -32.293 -42.117 35.272 1.00 55.29  ? 61  GLU G N     1 
ATOM   4874  C  CA    . GLU G 3 62  ? -31.928 -42.336 36.660 1.00 55.55  ? 61  GLU G CA    1 
ATOM   4875  C  C     . GLU G 3 62  ? -32.896 -41.621 37.603 1.00 55.05  ? 61  GLU G C     1 
ATOM   4876  O  O     . GLU G 3 62  ? -33.403 -42.216 38.541 1.00 55.64  ? 61  GLU G O     1 
ATOM   4877  C  CB    . GLU G 3 62  ? -30.496 -41.895 36.905 1.00 55.83  ? 61  GLU G CB    1 
ATOM   4878  C  CG    . GLU G 3 62  ? -29.899 -42.439 38.176 1.00 58.53  ? 61  GLU G CG    1 
ATOM   4879  C  CD    . GLU G 3 62  ? -29.582 -43.922 38.112 1.00 62.42  ? 61  GLU G CD    1 
ATOM   4880  O  OE1   . GLU G 3 62  ? -29.152 -44.416 37.035 1.00 63.29  ? 61  GLU G OE1   1 
ATOM   4881  O  OE2   . GLU G 3 62  ? -29.749 -44.589 39.162 1.00 64.96  ? 61  GLU G OE2   1 
ATOM   4882  N  N     . ILE G 3 63  ? -33.174 -40.354 37.340 1.00 54.68  ? 62  ILE G N     1 
ATOM   4883  C  CA    . ILE G 3 63  ? -34.028 -39.580 38.215 1.00 54.34  ? 62  ILE G CA    1 
ATOM   4884  C  C     . ILE G 3 63  ? -35.453 -40.034 38.090 1.00 54.47  ? 62  ILE G C     1 
ATOM   4885  O  O     . ILE G 3 63  ? -36.114 -40.260 39.101 1.00 54.41  ? 62  ILE G O     1 
ATOM   4886  C  CB    . ILE G 3 63  ? -33.896 -38.065 37.967 1.00 54.46  ? 62  ILE G CB    1 
ATOM   4887  C  CG1   . ILE G 3 63  ? -32.564 -37.587 38.526 1.00 55.02  ? 62  ILE G CG1   1 
ATOM   4888  C  CG2   . ILE G 3 63  ? -35.021 -37.284 38.644 1.00 53.84  ? 62  ILE G CG2   1 
ATOM   4889  C  CD1   . ILE G 3 63  ? -32.228 -36.178 38.181 1.00 57.20  ? 62  ILE G CD1   1 
ATOM   4890  N  N     . LEU G 3 64  ? -35.925 -40.197 36.858 1.00 55.04  ? 63  LEU G N     1 
ATOM   4891  C  CA    . LEU G 3 64  ? -37.303 -40.658 36.628 1.00 55.49  ? 63  LEU G CA    1 
ATOM   4892  C  C     . LEU G 3 64  ? -37.593 -42.009 37.284 1.00 56.02  ? 63  LEU G C     1 
ATOM   4893  O  O     . LEU G 3 64  ? -38.666 -42.201 37.854 1.00 55.43  ? 63  LEU G O     1 
ATOM   4894  C  CB    . LEU G 3 64  ? -37.643 -40.675 35.141 1.00 55.39  ? 63  LEU G CB    1 
ATOM   4895  C  CG    . LEU G 3 64  ? -37.825 -39.302 34.480 1.00 55.16  ? 63  LEU G CG    1 
ATOM   4896  C  CD1   . LEU G 3 64  ? -37.996 -39.487 33.003 1.00 53.90  ? 63  LEU G CD1   1 
ATOM   4897  C  CD2   . LEU G 3 64  ? -39.012 -38.527 35.063 1.00 54.46  ? 63  LEU G CD2   1 
ATOM   4898  N  N     . GLU G 3 65  ? -36.623 -42.919 37.244 1.00 57.29  ? 64  GLU G N     1 
ATOM   4899  C  CA    . GLU G 3 65  ? -36.745 -44.192 37.950 1.00 59.53  ? 64  GLU G CA    1 
ATOM   4900  C  C     . GLU G 3 65  ? -37.073 -43.995 39.425 1.00 60.30  ? 64  GLU G C     1 
ATOM   4901  O  O     . GLU G 3 65  ? -38.130 -44.430 39.914 1.00 60.81  ? 64  GLU G O     1 
ATOM   4902  C  CB    . GLU G 3 65  ? -35.459 -44.991 37.828 1.00 59.99  ? 64  GLU G CB    1 
ATOM   4903  C  CG    . GLU G 3 65  ? -35.328 -46.106 38.855 1.00 63.75  ? 64  GLU G CG    1 
ATOM   4904  C  CD    . GLU G 3 65  ? -35.410 -47.496 38.249 1.00 68.35  ? 64  GLU G CD    1 
ATOM   4905  O  OE1   . GLU G 3 65  ? -36.505 -47.917 37.787 1.00 70.06  ? 64  GLU G OE1   1 
ATOM   4906  O  OE2   . GLU G 3 65  ? -34.358 -48.171 38.265 1.00 69.85  ? 64  GLU G OE2   1 
ATOM   4907  N  N     . LEU G 3 66  ? -36.163 -43.323 40.128 1.00 60.79  ? 65  LEU G N     1 
ATOM   4908  C  CA    . LEU G 3 66  ? -36.274 -43.153 41.561 1.00 60.75  ? 65  LEU G CA    1 
ATOM   4909  C  C     . LEU G 3 66  ? -37.468 -42.296 41.890 1.00 61.26  ? 65  LEU G C     1 
ATOM   4910  O  O     . LEU G 3 66  ? -38.101 -42.491 42.919 1.00 61.62  ? 65  LEU G O     1 
ATOM   4911  C  CB    . LEU G 3 66  ? -35.001 -42.529 42.114 1.00 60.67  ? 65  LEU G CB    1 
ATOM   4912  C  CG    . LEU G 3 66  ? -33.689 -43.280 41.852 1.00 60.56  ? 65  LEU G CG    1 
ATOM   4913  C  CD1   . LEU G 3 66  ? -32.513 -42.343 42.023 1.00 60.44  ? 65  LEU G CD1   1 
ATOM   4914  C  CD2   . LEU G 3 66  ? -33.528 -44.511 42.733 1.00 57.87  ? 65  LEU G CD2   1 
ATOM   4915  N  N     . ALA G 3 67  ? -37.781 -41.352 41.005 1.00 62.00  ? 66  ALA G N     1 
ATOM   4916  C  CA    . ALA G 3 67  ? -38.916 -40.461 41.211 1.00 62.78  ? 66  ALA G CA    1 
ATOM   4917  C  C     . ALA G 3 67  ? -40.192 -41.262 41.091 1.00 63.61  ? 66  ALA G C     1 
ATOM   4918  O  O     . ALA G 3 67  ? -41.114 -41.081 41.893 1.00 64.11  ? 66  ALA G O     1 
ATOM   4919  C  CB    . ALA G 3 67  ? -38.904 -39.315 40.219 1.00 62.43  ? 66  ALA G CB    1 
ATOM   4920  N  N     . GLY G 3 68  ? -40.228 -42.159 40.099 1.00 64.37  ? 67  GLY G N     1 
ATOM   4921  C  CA    . GLY G 3 68  ? -41.358 -43.067 39.891 1.00 64.85  ? 67  GLY G CA    1 
ATOM   4922  C  C     . GLY G 3 68  ? -41.587 -43.907 41.127 1.00 65.25  ? 67  GLY G C     1 
ATOM   4923  O  O     . GLY G 3 68  ? -42.695 -43.954 41.659 1.00 65.14  ? 67  GLY G O     1 
ATOM   4924  N  N     . ASN G 3 69  ? -40.518 -44.548 41.592 1.00 65.84  ? 68  ASN G N     1 
ATOM   4925  C  CA    . ASN G 3 69  ? -40.548 -45.350 42.810 1.00 66.52  ? 68  ASN G CA    1 
ATOM   4926  C  C     . ASN G 3 69  ? -41.131 -44.588 43.989 1.00 66.99  ? 68  ASN G C     1 
ATOM   4927  O  O     . ASN G 3 69  ? -41.872 -45.148 44.798 1.00 66.79  ? 68  ASN G O     1 
ATOM   4928  C  CB    . ASN G 3 69  ? -39.137 -45.809 43.180 1.00 66.46  ? 68  ASN G CB    1 
ATOM   4929  C  CG    . ASN G 3 69  ? -38.539 -46.769 42.167 1.00 66.65  ? 68  ASN G CG    1 
ATOM   4930  O  OD1   . ASN G 3 69  ? -39.188 -47.165 41.187 1.00 66.69  ? 68  ASN G OD1   1 
ATOM   4931  N  ND2   . ASN G 3 69  ? -37.285 -47.158 42.406 1.00 65.21  ? 68  ASN G ND2   1 
ATOM   4932  N  N     . ALA G 3 70  ? -40.784 -43.308 44.078 1.00 67.70  ? 69  ALA G N     1 
ATOM   4933  C  CA    . ALA G 3 70  ? -41.218 -42.476 45.187 1.00 68.70  ? 69  ALA G CA    1 
ATOM   4934  C  C     . ALA G 3 70  ? -42.706 -42.212 45.105 1.00 69.37  ? 69  ALA G C     1 
ATOM   4935  O  O     . ALA G 3 70  ? -43.385 -42.163 46.125 1.00 69.53  ? 69  ALA G O     1 
ATOM   4936  C  CB    . ALA G 3 70  ? -40.451 -41.180 45.201 1.00 68.67  ? 69  ALA G CB    1 
ATOM   4937  N  N     . ALA G 3 71  ? -43.205 -42.044 43.886 1.00 70.43  ? 70  ALA G N     1 
ATOM   4938  C  CA    . ALA G 3 71  ? -44.627 -41.870 43.663 1.00 71.60  ? 70  ALA G CA    1 
ATOM   4939  C  C     . ALA G 3 71  ? -45.321 -43.140 44.102 1.00 72.56  ? 70  ALA G C     1 
ATOM   4940  O  O     . ALA G 3 71  ? -46.287 -43.100 44.865 1.00 72.72  ? 70  ALA G O     1 
ATOM   4941  C  CB    . ALA G 3 71  ? -44.907 -41.582 42.204 1.00 71.52  ? 70  ALA G CB    1 
ATOM   4942  N  N     . ARG G 3 72  ? -44.793 -44.268 43.635 1.00 73.99  ? 71  ARG G N     1 
ATOM   4943  C  CA    . ARG G 3 72  ? -45.292 -45.583 44.004 1.00 75.50  ? 71  ARG G CA    1 
ATOM   4944  C  C     . ARG G 3 72  ? -45.468 -45.722 45.520 1.00 76.00  ? 71  ARG G C     1 
ATOM   4945  O  O     . ARG G 3 72  ? -46.544 -46.089 45.988 1.00 76.14  ? 71  ARG G O     1 
ATOM   4946  C  CB    . ARG G 3 72  ? -44.355 -46.672 43.483 1.00 75.69  ? 71  ARG G CB    1 
ATOM   4947  C  CG    . ARG G 3 72  ? -44.923 -48.071 43.643 1.00 78.04  ? 71  ARG G CG    1 
ATOM   4948  C  CD    . ARG G 3 72  ? -43.847 -49.148 43.793 1.00 81.17  ? 71  ARG G CD    1 
ATOM   4949  N  NE    . ARG G 3 72  ? -44.474 -50.467 43.927 1.00 83.75  ? 71  ARG G NE    1 
ATOM   4950  C  CZ    . ARG G 3 72  ? -43.825 -51.629 44.006 1.00 85.63  ? 71  ARG G CZ    1 
ATOM   4951  N  NH1   . ARG G 3 72  ? -42.493 -51.674 43.967 1.00 85.87  ? 71  ARG G NH1   1 
ATOM   4952  N  NH2   . ARG G 3 72  ? -44.521 -52.758 44.129 1.00 86.60  ? 71  ARG G NH2   1 
ATOM   4953  N  N     . ASP G 3 73  ? -44.419 -45.409 46.276 1.00 76.76  ? 72  ASP G N     1 
ATOM   4954  C  CA    . ASP G 3 73  ? -44.438 -45.563 47.727 1.00 77.76  ? 72  ASP G CA    1 
ATOM   4955  C  C     . ASP G 3 73  ? -45.458 -44.659 48.383 1.00 78.11  ? 72  ASP G C     1 
ATOM   4956  O  O     . ASP G 3 73  ? -45.850 -44.885 49.525 1.00 78.25  ? 72  ASP G O     1 
ATOM   4957  C  CB    . ASP G 3 73  ? -43.058 -45.287 48.331 1.00 78.04  ? 72  ASP G CB    1 
ATOM   4958  C  CG    . ASP G 3 73  ? -41.965 -46.155 47.727 1.00 79.71  ? 72  ASP G CG    1 
ATOM   4959  O  OD1   . ASP G 3 73  ? -42.235 -47.340 47.393 1.00 82.35  ? 72  ASP G OD1   1 
ATOM   4960  O  OD2   . ASP G 3 73  ? -40.828 -45.648 47.575 1.00 81.44  ? 72  ASP G OD2   1 
ATOM   4961  N  N     . ASN G 3 74  ? -45.891 -43.631 47.669 1.00 78.66  ? 73  ASN G N     1 
ATOM   4962  C  CA    . ASN G 3 74  ? -46.837 -42.692 48.249 1.00 79.44  ? 73  ASN G CA    1 
ATOM   4963  C  C     . ASN G 3 74  ? -48.265 -42.896 47.742 1.00 79.42  ? 73  ASN G C     1 
ATOM   4964  O  O     . ASN G 3 74  ? -49.135 -42.042 47.950 1.00 79.76  ? 73  ASN G O     1 
ATOM   4965  C  CB    . ASN G 3 74  ? -46.352 -41.251 48.060 1.00 79.80  ? 73  ASN G CB    1 
ATOM   4966  C  CG    . ASN G 3 74  ? -45.113 -40.934 48.907 1.00 81.81  ? 73  ASN G CG    1 
ATOM   4967  O  OD1   . ASN G 3 74  ? -45.229 -40.370 50.004 1.00 84.13  ? 73  ASN G OD1   1 
ATOM   4968  N  ND2   . ASN G 3 74  ? -43.927 -41.315 48.412 1.00 81.94  ? 73  ASN G ND2   1 
ATOM   4969  N  N     . LYS G 3 75  ? -48.496 -44.049 47.107 1.00 79.00  ? 74  LYS G N     1 
ATOM   4970  C  CA    . LYS G 3 75  ? -49.802 -44.423 46.530 1.00 78.81  ? 74  LYS G CA    1 
ATOM   4971  C  C     . LYS G 3 75  ? -50.208 -43.485 45.395 1.00 77.99  ? 74  LYS G C     1 
ATOM   4972  O  O     . LYS G 3 75  ? -51.372 -43.072 45.307 1.00 78.15  ? 74  LYS G O     1 
ATOM   4973  C  CB    . LYS G 3 75  ? -50.933 -44.471 47.589 1.00 79.12  ? 74  LYS G CB    1 
ATOM   4974  C  CG    . LYS G 3 75  ? -50.614 -45.185 48.913 1.00 80.73  ? 74  LYS G CG    1 
ATOM   4975  C  CD    . LYS G 3 75  ? -50.599 -46.713 48.779 1.00 82.55  ? 74  LYS G CD    1 
ATOM   4976  C  CE    . LYS G 3 75  ? -50.015 -47.368 50.039 1.00 83.20  ? 74  LYS G CE    1 
ATOM   4977  N  NZ    . LYS G 3 75  ? -49.354 -48.668 49.724 1.00 83.31  ? 74  LYS G NZ    1 
ATOM   4978  N  N     . LYS G 3 76  ? -49.252 -43.146 44.533 1.00 76.76  ? 75  LYS G N     1 
ATOM   4979  C  CA    . LYS G 3 76  ? -49.516 -42.212 43.437 1.00 75.55  ? 75  LYS G CA    1 
ATOM   4980  C  C     . LYS G 3 76  ? -48.889 -42.635 42.118 1.00 74.38  ? 75  LYS G C     1 
ATOM   4981  O  O     . LYS G 3 76  ? -47.896 -43.368 42.090 1.00 74.31  ? 75  LYS G O     1 
ATOM   4982  C  CB    . LYS G 3 76  ? -49.115 -40.797 43.845 1.00 75.75  ? 75  LYS G CB    1 
ATOM   4983  C  CG    . LYS G 3 76  ? -50.294 -40.052 44.458 1.00 77.12  ? 75  LYS G CG    1 
ATOM   4984  C  CD    . LYS G 3 76  ? -49.952 -39.318 45.729 1.00 78.17  ? 75  LYS G CD    1 
ATOM   4985  C  CE    . LYS G 3 76  ? -51.199 -38.657 46.294 1.00 78.67  ? 75  LYS G CE    1 
ATOM   4986  N  NZ    . LYS G 3 76  ? -51.012 -38.245 47.723 1.00 80.00  ? 75  LYS G NZ    1 
ATOM   4987  N  N     . THR G 3 77  ? -49.491 -42.184 41.025 1.00 72.96  ? 76  THR G N     1 
ATOM   4988  C  CA    . THR G 3 77  ? -49.104 -42.643 39.687 1.00 71.71  ? 76  THR G CA    1 
ATOM   4989  C  C     . THR G 3 77  ? -48.562 -41.481 38.847 1.00 70.50  ? 76  THR G C     1 
ATOM   4990  O  O     . THR G 3 77  ? -47.949 -41.675 37.795 1.00 70.31  ? 76  THR G O     1 
ATOM   4991  C  CB    . THR G 3 77  ? -50.306 -43.313 38.963 1.00 71.98  ? 76  THR G CB    1 
ATOM   4992  O  OG1   . THR G 3 77  ? -51.339 -42.338 38.730 1.00 72.03  ? 76  THR G OG1   1 
ATOM   4993  C  CG2   . THR G 3 77  ? -50.881 -44.458 39.818 1.00 72.35  ? 76  THR G CG2   1 
ATOM   4994  N  N     . ARG G 3 78  ? -48.810 -40.266 39.323 1.00 68.85  ? 77  ARG G N     1 
ATOM   4995  C  CA    . ARG G 3 78  ? -48.315 -39.067 38.674 1.00 67.18  ? 77  ARG G CA    1 
ATOM   4996  C  C     . ARG G 3 78  ? -47.196 -38.475 39.522 1.00 65.12  ? 77  ARG G C     1 
ATOM   4997  O  O     . ARG G 3 78  ? -47.399 -38.194 40.701 1.00 64.67  ? 77  ARG G O     1 
ATOM   4998  C  CB    . ARG G 3 78  ? -49.456 -38.062 38.524 1.00 67.72  ? 77  ARG G CB    1 
ATOM   4999  C  CG    . ARG G 3 78  ? -49.138 -36.856 37.677 1.00 68.97  ? 77  ARG G CG    1 
ATOM   5000  C  CD    . ARG G 3 78  ? -50.305 -35.900 37.722 1.00 71.57  ? 77  ARG G CD    1 
ATOM   5001  N  NE    . ARG G 3 78  ? -51.408 -36.367 36.885 1.00 74.43  ? 77  ARG G NE    1 
ATOM   5002  C  CZ    . ARG G 3 78  ? -52.668 -35.961 37.018 1.00 76.27  ? 77  ARG G CZ    1 
ATOM   5003  N  NH1   . ARG G 3 78  ? -52.998 -35.080 37.963 1.00 76.50  ? 77  ARG G NH1   1 
ATOM   5004  N  NH2   . ARG G 3 78  ? -53.602 -36.441 36.207 1.00 76.78  ? 77  ARG G NH2   1 
ATOM   5005  N  N     . ILE G 3 79  ? -46.023 -38.316 38.911 1.00 62.86  ? 78  ILE G N     1 
ATOM   5006  C  CA    . ILE G 3 79  ? -44.855 -37.708 39.551 1.00 60.54  ? 78  ILE G CA    1 
ATOM   5007  C  C     . ILE G 3 79  ? -45.054 -36.205 39.710 1.00 59.58  ? 78  ILE G C     1 
ATOM   5008  O  O     . ILE G 3 79  ? -45.343 -35.500 38.734 1.00 59.16  ? 78  ILE G O     1 
ATOM   5009  C  CB    . ILE G 3 79  ? -43.573 -37.965 38.738 1.00 60.16  ? 78  ILE G CB    1 
ATOM   5010  C  CG1   . ILE G 3 79  ? -43.135 -39.421 38.897 1.00 60.08  ? 78  ILE G CG1   1 
ATOM   5011  C  CG2   . ILE G 3 79  ? -42.461 -37.018 39.175 1.00 59.56  ? 78  ILE G CG2   1 
ATOM   5012  C  CD1   . ILE G 3 79  ? -42.230 -39.950 37.786 1.00 58.91  ? 78  ILE G CD1   1 
ATOM   5013  N  N     . ILE G 3 80  ? -44.931 -35.732 40.950 1.00 58.22  ? 79  ILE G N     1 
ATOM   5014  C  CA    . ILE G 3 80  ? -44.905 -34.303 41.236 1.00 57.18  ? 79  ILE G CA    1 
ATOM   5015  C  C     . ILE G 3 80  ? -43.536 -33.881 41.797 1.00 56.37  ? 79  ILE G C     1 
ATOM   5016  O  O     . ILE G 3 80  ? -42.693 -34.731 42.089 1.00 56.19  ? 79  ILE G O     1 
ATOM   5017  C  CB    . ILE G 3 80  ? -46.049 -33.879 42.175 1.00 57.15  ? 79  ILE G CB    1 
ATOM   5018  C  CG1   . ILE G 3 80  ? -46.029 -34.705 43.474 1.00 57.92  ? 79  ILE G CG1   1 
ATOM   5019  C  CG2   . ILE G 3 80  ? -47.376 -33.978 41.451 1.00 57.60  ? 79  ILE G CG2   1 
ATOM   5020  C  CD1   . ILE G 3 80  ? -46.852 -34.101 44.632 1.00 56.39  ? 79  ILE G CD1   1 
ATOM   5021  N  N     . PRO G 3 81  ? -43.299 -32.563 41.930 1.00 55.80  ? 80  PRO G N     1 
ATOM   5022  C  CA    . PRO G 3 81  ? -42.013 -32.087 42.427 1.00 55.18  ? 80  PRO G CA    1 
ATOM   5023  C  C     . PRO G 3 81  ? -41.539 -32.767 43.704 1.00 54.73  ? 80  PRO G C     1 
ATOM   5024  O  O     . PRO G 3 81  ? -40.341 -33.032 43.842 1.00 54.95  ? 80  PRO G O     1 
ATOM   5025  C  CB    . PRO G 3 81  ? -42.279 -30.607 42.649 1.00 54.99  ? 80  PRO G CB    1 
ATOM   5026  C  CG    . PRO G 3 81  ? -43.142 -30.270 41.474 1.00 55.19  ? 80  PRO G CG    1 
ATOM   5027  C  CD    . PRO G 3 81  ? -44.106 -31.437 41.417 1.00 55.96  ? 80  PRO G CD    1 
ATOM   5028  N  N     . ARG G 3 82  ? -42.468 -33.081 44.605 1.00 53.75  ? 81  ARG G N     1 
ATOM   5029  C  CA    . ARG G 3 82  ? -42.126 -33.767 45.838 1.00 52.79  ? 81  ARG G CA    1 
ATOM   5030  C  C     . ARG G 3 82  ? -41.389 -35.060 45.571 1.00 52.42  ? 81  ARG G C     1 
ATOM   5031  O  O     . ARG G 3 82  ? -40.459 -35.400 46.294 1.00 52.74  ? 81  ARG G O     1 
ATOM   5032  C  CB    . ARG G 3 82  ? -43.375 -34.059 46.663 1.00 52.81  ? 81  ARG G CB    1 
ATOM   5033  C  CG    . ARG G 3 82  ? -43.121 -34.782 47.970 1.00 52.51  ? 81  ARG G CG    1 
ATOM   5034  C  CD    . ARG G 3 82  ? -42.150 -34.022 48.859 1.00 51.54  ? 81  ARG G CD    1 
ATOM   5035  N  NE    . ARG G 3 82  ? -42.139 -34.520 50.240 1.00 50.11  ? 81  ARG G NE    1 
ATOM   5036  C  CZ    . ARG G 3 82  ? -41.270 -34.115 51.169 1.00 48.19  ? 81  ARG G CZ    1 
ATOM   5037  N  NH1   . ARG G 3 82  ? -40.345 -33.205 50.861 1.00 46.01  ? 81  ARG G NH1   1 
ATOM   5038  N  NH2   . ARG G 3 82  ? -41.319 -34.616 52.402 1.00 45.26  ? 81  ARG G NH2   1 
ATOM   5039  N  N     . HIS G 3 83  ? -41.796 -35.781 44.535 1.00 51.65  ? 82  HIS G N     1 
ATOM   5040  C  CA    . HIS G 3 83  ? -41.209 -37.089 44.279 1.00 51.13  ? 82  HIS G CA    1 
ATOM   5041  C  C     . HIS G 3 83  ? -39.794 -36.942 43.771 1.00 50.87  ? 82  HIS G C     1 
ATOM   5042  O  O     . HIS G 3 83  ? -38.912 -37.736 44.125 1.00 50.68  ? 82  HIS G O     1 
ATOM   5043  C  CB    . HIS G 3 83  ? -42.077 -37.916 43.328 1.00 50.84  ? 82  HIS G CB    1 
ATOM   5044  C  CG    . HIS G 3 83  ? -43.477 -38.087 43.818 1.00 50.87  ? 82  HIS G CG    1 
ATOM   5045  N  ND1   . HIS G 3 83  ? -44.576 -37.918 43.006 1.00 50.92  ? 82  HIS G ND1   1 
ATOM   5046  C  CD2   . HIS G 3 83  ? -43.958 -38.351 45.057 1.00 50.78  ? 82  HIS G CD2   1 
ATOM   5047  C  CE1   . HIS G 3 83  ? -45.675 -38.103 43.715 1.00 51.20  ? 82  HIS G CE1   1 
ATOM   5048  N  NE2   . HIS G 3 83  ? -45.328 -38.361 44.965 1.00 51.38  ? 82  HIS G NE2   1 
ATOM   5049  N  N     . LEU G 3 84  ? -39.586 -35.904 42.961 1.00 50.44  ? 83  LEU G N     1 
ATOM   5050  C  CA    . LEU G 3 84  ? -38.266 -35.552 42.440 1.00 49.51  ? 83  LEU G CA    1 
ATOM   5051  C  C     . LEU G 3 84  ? -37.324 -35.150 43.570 1.00 48.96  ? 83  LEU G C     1 
ATOM   5052  O  O     . LEU G 3 84  ? -36.161 -35.569 43.581 1.00 48.43  ? 83  LEU G O     1 
ATOM   5053  C  CB    . LEU G 3 84  ? -38.390 -34.424 41.426 1.00 49.92  ? 83  LEU G CB    1 
ATOM   5054  C  CG    . LEU G 3 84  ? -39.108 -34.758 40.113 1.00 49.45  ? 83  LEU G CG    1 
ATOM   5055  C  CD1   . LEU G 3 84  ? -39.482 -33.476 39.400 1.00 49.45  ? 83  LEU G CD1   1 
ATOM   5056  C  CD2   . LEU G 3 84  ? -38.211 -35.611 39.237 1.00 48.87  ? 83  LEU G CD2   1 
ATOM   5057  N  N     . GLN G 3 85  ? -37.840 -34.378 44.529 1.00 48.23  ? 84  GLN G N     1 
ATOM   5058  C  CA    . GLN G 3 85  ? -37.093 -34.048 45.738 1.00 48.14  ? 84  GLN G CA    1 
ATOM   5059  C  C     . GLN G 3 85  ? -36.702 -35.286 46.544 1.00 48.75  ? 84  GLN G C     1 
ATOM   5060  O  O     . GLN G 3 85  ? -35.526 -35.452 46.886 1.00 49.67  ? 84  GLN G O     1 
ATOM   5061  C  CB    . GLN G 3 85  ? -37.851 -33.073 46.626 1.00 47.58  ? 84  GLN G CB    1 
ATOM   5062  C  CG    . GLN G 3 85  ? -37.114 -32.680 47.907 1.00 47.09  ? 84  GLN G CG    1 
ATOM   5063  C  CD    . GLN G 3 85  ? -35.954 -31.661 47.716 1.00 47.66  ? 84  GLN G CD    1 
ATOM   5064  O  OE1   . GLN G 3 85  ? -35.347 -31.542 46.634 1.00 48.08  ? 84  GLN G OE1   1 
ATOM   5065  N  NE2   . GLN G 3 85  ? -35.632 -30.951 48.791 1.00 44.43  ? 84  GLN G NE2   1 
ATOM   5066  N  N     . LEU G 3 86  ? -37.661 -36.161 46.838 1.00 48.50  ? 85  LEU G N     1 
ATOM   5067  C  CA    . LEU G 3 86  ? -37.362 -37.349 47.619 1.00 48.40  ? 85  LEU G CA    1 
ATOM   5068  C  C     . LEU G 3 86  ? -36.375 -38.248 46.883 1.00 48.67  ? 85  LEU G C     1 
ATOM   5069  O  O     . LEU G 3 86  ? -35.490 -38.850 47.497 1.00 48.91  ? 85  LEU G O     1 
ATOM   5070  C  CB    . LEU G 3 86  ? -38.630 -38.128 47.949 1.00 48.50  ? 85  LEU G CB    1 
ATOM   5071  C  CG    . LEU G 3 86  ? -39.696 -37.509 48.868 1.00 49.47  ? 85  LEU G CG    1 
ATOM   5072  C  CD1   . LEU G 3 86  ? -40.894 -38.452 48.982 1.00 48.81  ? 85  LEU G CD1   1 
ATOM   5073  C  CD2   . LEU G 3 86  ? -39.154 -37.175 50.250 1.00 50.19  ? 85  LEU G CD2   1 
ATOM   5074  N  N     . ALA G 3 87  ? -36.512 -38.336 45.563 1.00 48.67  ? 86  ALA G N     1 
ATOM   5075  C  CA    . ALA G 3 87  ? -35.622 -39.185 44.781 1.00 48.40  ? 86  ALA G CA    1 
ATOM   5076  C  C     . ALA G 3 87  ? -34.201 -38.666 44.894 1.00 48.44  ? 86  ALA G C     1 
ATOM   5077  O  O     . ALA G 3 87  ? -33.288 -39.438 45.126 1.00 48.01  ? 86  ALA G O     1 
ATOM   5078  C  CB    . ALA G 3 87  ? -36.056 -39.239 43.327 1.00 48.05  ? 86  ALA G CB    1 
ATOM   5079  N  N     . VAL G 3 88  ? -34.042 -37.346 44.751 1.00 48.79  ? 87  VAL G N     1 
ATOM   5080  C  CA    . VAL G 3 88  ? -32.728 -36.704 44.628 1.00 48.53  ? 87  VAL G CA    1 
ATOM   5081  C  C     . VAL G 3 88  ? -31.992 -36.669 45.961 1.00 48.94  ? 87  VAL G C     1 
ATOM   5082  O  O     . VAL G 3 88  ? -30.817 -37.024 46.045 1.00 49.16  ? 87  VAL G O     1 
ATOM   5083  C  CB    . VAL G 3 88  ? -32.843 -35.277 43.983 1.00 48.31  ? 87  VAL G CB    1 
ATOM   5084  C  CG1   . VAL G 3 88  ? -31.658 -34.396 44.321 1.00 47.38  ? 87  VAL G CG1   1 
ATOM   5085  C  CG2   . VAL G 3 88  ? -33.004 -35.377 42.476 1.00 47.49  ? 87  VAL G CG2   1 
ATOM   5086  N  N     . ARG G 3 89  ? -32.689 -36.262 47.008 1.00 49.33  ? 88  ARG G N     1 
ATOM   5087  C  CA    . ARG G 3 89  ? -32.047 -36.068 48.291 1.00 50.02  ? 88  ARG G CA    1 
ATOM   5088  C  C     . ARG G 3 89  ? -31.847 -37.381 49.071 1.00 50.17  ? 88  ARG G C     1 
ATOM   5089  O  O     . ARG G 3 89  ? -31.025 -37.455 49.975 1.00 50.43  ? 88  ARG G O     1 
ATOM   5090  C  CB    . ARG G 3 89  ? -32.834 -35.033 49.089 1.00 50.05  ? 88  ARG G CB    1 
ATOM   5091  C  CG    . ARG G 3 89  ? -33.433 -33.951 48.185 1.00 50.74  ? 88  ARG G CG    1 
ATOM   5092  C  CD    . ARG G 3 89  ? -32.731 -32.593 48.242 1.00 48.84  ? 88  ARG G CD    1 
ATOM   5093  N  NE    . ARG G 3 89  ? -31.401 -32.568 47.648 1.00 46.65  ? 88  ARG G NE    1 
ATOM   5094  C  CZ    . ARG G 3 89  ? -31.005 -31.753 46.670 1.00 44.92  ? 88  ARG G CZ    1 
ATOM   5095  N  NH1   . ARG G 3 89  ? -31.815 -30.858 46.119 1.00 41.55  ? 88  ARG G NH1   1 
ATOM   5096  N  NH2   . ARG G 3 89  ? -29.758 -31.836 46.242 1.00 47.96  ? 88  ARG G NH2   1 
ATOM   5097  N  N     . ASN G 3 90  ? -32.576 -38.423 48.705 1.00 50.50  ? 89  ASN G N     1 
ATOM   5098  C  CA    . ASN G 3 90  ? -32.316 -39.751 49.270 1.00 50.82  ? 89  ASN G CA    1 
ATOM   5099  C  C     . ASN G 3 90  ? -31.193 -40.533 48.607 1.00 51.04  ? 89  ASN G C     1 
ATOM   5100  O  O     . ASN G 3 90  ? -30.812 -41.587 49.101 1.00 51.39  ? 89  ASN G O     1 
ATOM   5101  C  CB    . ASN G 3 90  ? -33.584 -40.595 49.299 1.00 50.40  ? 89  ASN G CB    1 
ATOM   5102  C  CG    . ASN G 3 90  ? -34.487 -40.208 50.423 1.00 50.25  ? 89  ASN G CG    1 
ATOM   5103  O  OD1   . ASN G 3 90  ? -34.048 -40.081 51.567 1.00 50.93  ? 89  ASN G OD1   1 
ATOM   5104  N  ND2   . ASN G 3 90  ? -35.753 -39.982 50.111 1.00 50.04  ? 89  ASN G ND2   1 
ATOM   5105  N  N     . ASP G 3 91  ? -30.679 -40.029 47.491 1.00 51.37  ? 90  ASP G N     1 
ATOM   5106  C  CA    . ASP G 3 91  ? -29.597 -40.687 46.789 1.00 52.07  ? 90  ASP G CA    1 
ATOM   5107  C  C     . ASP G 3 91  ? -28.339 -39.848 46.900 1.00 52.74  ? 90  ASP G C     1 
ATOM   5108  O  O     . ASP G 3 91  ? -28.308 -38.707 46.452 1.00 52.61  ? 90  ASP G O     1 
ATOM   5109  C  CB    . ASP G 3 91  ? -29.943 -40.893 45.327 1.00 52.03  ? 90  ASP G CB    1 
ATOM   5110  C  CG    . ASP G 3 91  ? -28.838 -41.606 44.572 1.00 54.29  ? 90  ASP G CG    1 
ATOM   5111  O  OD1   . ASP G 3 91  ? -28.850 -42.860 44.529 1.00 57.98  ? 90  ASP G OD1   1 
ATOM   5112  O  OD2   . ASP G 3 91  ? -27.944 -40.925 44.025 1.00 55.63  ? 90  ASP G OD2   1 
ATOM   5113  N  N     . GLU G 3 92  ? -27.296 -40.429 47.482 1.00 53.65  ? 91  GLU G N     1 
ATOM   5114  C  CA    . GLU G 3 92  ? -26.075 -39.705 47.770 1.00 54.83  ? 91  GLU G CA    1 
ATOM   5115  C  C     . GLU G 3 92  ? -25.516 -38.996 46.545 1.00 54.69  ? 91  GLU G C     1 
ATOM   5116  O  O     . GLU G 3 92  ? -25.143 -37.827 46.619 1.00 55.16  ? 91  GLU G O     1 
ATOM   5117  C  CB    . GLU G 3 92  ? -25.023 -40.641 48.364 1.00 55.58  ? 91  GLU G CB    1 
ATOM   5118  C  CG    . GLU G 3 92  ? -23.942 -39.910 49.165 1.00 59.85  ? 91  GLU G CG    1 
ATOM   5119  C  CD    . GLU G 3 92  ? -22.725 -40.772 49.439 1.00 65.24  ? 91  GLU G CD    1 
ATOM   5120  O  OE1   . GLU G 3 92  ? -22.351 -41.564 48.541 1.00 68.10  ? 91  GLU G OE1   1 
ATOM   5121  O  OE2   . GLU G 3 92  ? -22.133 -40.649 50.542 1.00 67.59  ? 91  GLU G OE2   1 
ATOM   5122  N  N     . GLU G 3 93  ? -25.480 -39.697 45.412 1.00 54.57  ? 92  GLU G N     1 
ATOM   5123  C  CA    . GLU G 3 93  ? -24.853 -39.169 44.205 1.00 53.75  ? 92  GLU G CA    1 
ATOM   5124  C  C     . GLU G 3 93  ? -25.667 -38.054 43.536 1.00 52.77  ? 92  GLU G C     1 
ATOM   5125  O  O     . GLU G 3 93  ? -25.143 -36.980 43.241 1.00 52.31  ? 92  GLU G O     1 
ATOM   5126  C  CB    . GLU G 3 93  ? -24.520 -40.298 43.240 1.00 53.98  ? 92  GLU G CB    1 
ATOM   5127  C  CG    . GLU G 3 93  ? -23.425 -41.232 43.762 1.00 55.95  ? 92  GLU G CG    1 
ATOM   5128  C  CD    . GLU G 3 93  ? -22.588 -41.880 42.648 1.00 59.08  ? 92  GLU G CD    1 
ATOM   5129  O  OE1   . GLU G 3 93  ? -23.036 -41.913 41.475 1.00 58.87  ? 92  GLU G OE1   1 
ATOM   5130  O  OE2   . GLU G 3 93  ? -21.469 -42.359 42.956 1.00 61.00  ? 92  GLU G OE2   1 
ATOM   5131  N  N     . LEU G 3 94  ? -26.953 -38.296 43.317 1.00 51.82  ? 93  LEU G N     1 
ATOM   5132  C  CA    . LEU G 3 94  ? -27.811 -37.248 42.766 1.00 51.04  ? 93  LEU G CA    1 
ATOM   5133  C  C     . LEU G 3 94  ? -27.834 -36.013 43.665 1.00 50.69  ? 93  LEU G C     1 
ATOM   5134  O  O     . LEU G 3 94  ? -27.807 -34.880 43.171 1.00 50.73  ? 93  LEU G O     1 
ATOM   5135  C  CB    . LEU G 3 94  ? -29.230 -37.764 42.502 1.00 50.75  ? 93  LEU G CB    1 
ATOM   5136  C  CG    . LEU G 3 94  ? -29.370 -38.642 41.251 1.00 49.35  ? 93  LEU G CG    1 
ATOM   5137  C  CD1   . LEU G 3 94  ? -30.742 -39.274 41.193 1.00 48.95  ? 93  LEU G CD1   1 
ATOM   5138  C  CD2   . LEU G 3 94  ? -29.112 -37.840 39.995 1.00 48.12  ? 93  LEU G CD2   1 
ATOM   5139  N  N     . ASN G 3 95  ? -27.860 -36.250 44.977 1.00 49.81  ? 94  ASN G N     1 
ATOM   5140  C  CA    . ASN G 3 95  ? -27.835 -35.197 45.967 1.00 48.97  ? 94  ASN G CA    1 
ATOM   5141  C  C     . ASN G 3 95  ? -26.606 -34.313 45.869 1.00 49.08  ? 94  ASN G C     1 
ATOM   5142  O  O     . ASN G 3 95  ? -26.694 -33.104 46.082 1.00 49.02  ? 94  ASN G O     1 
ATOM   5143  C  CB    . ASN G 3 95  ? -27.901 -35.791 47.367 1.00 48.89  ? 94  ASN G CB    1 
ATOM   5144  C  CG    . ASN G 3 95  ? -28.015 -34.731 48.438 1.00 47.93  ? 94  ASN G CG    1 
ATOM   5145  O  OD1   . ASN G 3 95  ? -28.941 -33.911 48.424 1.00 48.40  ? 94  ASN G OD1   1 
ATOM   5146  N  ND2   . ASN G 3 95  ? -27.072 -34.726 49.360 1.00 44.38  ? 94  ASN G ND2   1 
ATOM   5147  N  N     . LYS G 3 96  ? -25.461 -34.918 45.575 1.00 49.03  ? 95  LYS G N     1 
ATOM   5148  C  CA    . LYS G 3 96  ? -24.225 -34.169 45.438 1.00 49.18  ? 95  LYS G CA    1 
ATOM   5149  C  C     . LYS G 3 96  ? -24.243 -33.392 44.128 1.00 49.04  ? 95  LYS G C     1 
ATOM   5150  O  O     . LYS G 3 96  ? -23.955 -32.186 44.114 1.00 48.79  ? 95  LYS G O     1 
ATOM   5151  C  CB    . LYS G 3 96  ? -23.032 -35.105 45.503 1.00 49.64  ? 95  LYS G CB    1 
ATOM   5152  C  CG    . LYS G 3 96  ? -21.661 -34.437 45.527 1.00 52.40  ? 95  LYS G CG    1 
ATOM   5153  C  CD    . LYS G 3 96  ? -20.605 -35.499 45.886 1.00 58.17  ? 95  LYS G CD    1 
ATOM   5154  C  CE    . LYS G 3 96  ? -19.186 -35.137 45.432 1.00 60.79  ? 95  LYS G CE    1 
ATOM   5155  N  NZ    . LYS G 3 96  ? -18.226 -36.251 45.745 1.00 61.94  ? 95  LYS G NZ    1 
ATOM   5156  N  N     . LEU G 3 97  ? -24.613 -34.075 43.039 1.00 48.70  ? 96  LEU G N     1 
ATOM   5157  C  CA    . LEU G 3 97  ? -24.737 -33.437 41.731 1.00 47.99  ? 96  LEU G CA    1 
ATOM   5158  C  C     . LEU G 3 97  ? -25.660 -32.256 41.827 1.00 47.81  ? 96  LEU G C     1 
ATOM   5159  O  O     . LEU G 3 97  ? -25.429 -31.242 41.179 1.00 49.02  ? 96  LEU G O     1 
ATOM   5160  C  CB    . LEU G 3 97  ? -25.284 -34.401 40.680 1.00 47.77  ? 96  LEU G CB    1 
ATOM   5161  C  CG    . LEU G 3 97  ? -25.465 -33.848 39.262 1.00 47.60  ? 96  LEU G CG    1 
ATOM   5162  C  CD1   . LEU G 3 97  ? -24.129 -33.494 38.589 1.00 47.04  ? 96  LEU G CD1   1 
ATOM   5163  C  CD2   . LEU G 3 97  ? -26.230 -34.832 38.419 1.00 48.07  ? 96  LEU G CD2   1 
ATOM   5164  N  N     . LEU G 3 98  ? -26.703 -32.379 42.637 1.00 47.12  ? 97  LEU G N     1 
ATOM   5165  C  CA    . LEU G 3 98  ? -27.707 -31.323 42.733 1.00 46.48  ? 97  LEU G CA    1 
ATOM   5166  C  C     . LEU G 3 98  ? -27.603 -30.559 44.049 1.00 46.57  ? 97  LEU G C     1 
ATOM   5167  O  O     . LEU G 3 98  ? -28.564 -29.912 44.472 1.00 46.39  ? 97  LEU G O     1 
ATOM   5168  C  CB    . LEU G 3 98  ? -29.121 -31.892 42.518 1.00 46.14  ? 97  LEU G CB    1 
ATOM   5169  C  CG    . LEU G 3 98  ? -29.385 -32.422 41.099 1.00 45.13  ? 97  LEU G CG    1 
ATOM   5170  C  CD1   . LEU G 3 98  ? -30.859 -32.565 40.832 1.00 43.11  ? 97  LEU G CD1   1 
ATOM   5171  C  CD2   . LEU G 3 98  ? -28.760 -31.506 40.049 1.00 43.45  ? 97  LEU G CD2   1 
ATOM   5172  N  N     . GLY G 3 99  ? -26.425 -30.622 44.670 1.00 46.37  ? 98  GLY G N     1 
ATOM   5173  C  CA    . GLY G 3 99  ? -26.194 -30.024 45.979 1.00 47.24  ? 98  GLY G CA    1 
ATOM   5174  C  C     . GLY G 3 99  ? -26.403 -28.526 46.103 1.00 47.65  ? 98  GLY G C     1 
ATOM   5175  O  O     . GLY G 3 99  ? -26.562 -28.005 47.202 1.00 47.56  ? 98  GLY G O     1 
ATOM   5176  N  N     . ARG G 3 100 ? -26.396 -27.825 44.976 1.00 47.99  ? 99  ARG G N     1 
ATOM   5177  C  CA    . ARG G 3 100 ? -26.598 -26.387 44.998 1.00 47.96  ? 99  ARG G CA    1 
ATOM   5178  C  C     . ARG G 3 100 ? -27.743 -25.997 44.088 1.00 46.72  ? 99  ARG G C     1 
ATOM   5179  O  O     . ARG G 3 100 ? -27.704 -24.970 43.424 1.00 46.86  ? 99  ARG G O     1 
ATOM   5180  C  CB    . ARG G 3 100 ? -25.284 -25.654 44.703 1.00 48.42  ? 99  ARG G CB    1 
ATOM   5181  C  CG    . ARG G 3 100 ? -24.469 -25.544 45.971 1.00 52.04  ? 99  ARG G CG    1 
ATOM   5182  C  CD    . ARG G 3 100 ? -22.985 -25.415 45.736 1.00 60.63  ? 99  ARG G CD    1 
ATOM   5183  N  NE    . ARG G 3 100 ? -22.286 -25.544 47.025 1.00 68.14  ? 99  ARG G NE    1 
ATOM   5184  C  CZ    . ARG G 3 100 ? -21.006 -25.902 47.187 1.00 70.86  ? 99  ARG G CZ    1 
ATOM   5185  N  NH1   . ARG G 3 100 ? -20.227 -26.171 46.132 1.00 70.96  ? 99  ARG G NH1   1 
ATOM   5186  N  NH2   . ARG G 3 100 ? -20.506 -25.986 48.421 1.00 71.42  ? 99  ARG G NH2   1 
ATOM   5187  N  N     . VAL G 3 101 ? -28.770 -26.843 44.095 1.00 45.42  ? 100 VAL G N     1 
ATOM   5188  C  CA    . VAL G 3 101 ? -29.956 -26.656 43.284 1.00 44.40  ? 100 VAL G CA    1 
ATOM   5189  C  C     . VAL G 3 101 ? -31.182 -26.699 44.185 1.00 44.49  ? 100 VAL G C     1 
ATOM   5190  O  O     . VAL G 3 101 ? -31.185 -27.377 45.205 1.00 44.51  ? 100 VAL G O     1 
ATOM   5191  C  CB    . VAL G 3 101 ? -30.027 -27.711 42.146 1.00 44.01  ? 100 VAL G CB    1 
ATOM   5192  C  CG1   . VAL G 3 101 ? -31.436 -27.790 41.514 1.00 43.57  ? 100 VAL G CG1   1 
ATOM   5193  C  CG2   . VAL G 3 101 ? -28.988 -27.404 41.094 1.00 41.91  ? 100 VAL G CG2   1 
ATOM   5194  N  N     . THR G 3 102 ? -32.202 -25.927 43.833 1.00 44.86  ? 101 THR G N     1 
ATOM   5195  C  CA    . THR G 3 102 ? -33.452 -25.939 44.562 1.00 45.09  ? 101 THR G CA    1 
ATOM   5196  C  C     . THR G 3 102 ? -34.553 -26.357 43.612 1.00 46.01  ? 101 THR G C     1 
ATOM   5197  O  O     . THR G 3 102 ? -34.738 -25.755 42.555 1.00 46.00  ? 101 THR G O     1 
ATOM   5198  C  CB    . THR G 3 102 ? -33.766 -24.584 45.206 1.00 45.15  ? 101 THR G CB    1 
ATOM   5199  O  OG1   . THR G 3 102 ? -32.790 -24.309 46.223 1.00 45.16  ? 101 THR G OG1   1 
ATOM   5200  C  CG2   . THR G 3 102 ? -35.161 -24.592 45.842 1.00 43.82  ? 101 THR G CG2   1 
ATOM   5201  N  N     . ILE G 3 103 ? -35.240 -27.430 43.998 1.00 46.59  ? 102 ILE G N     1 
ATOM   5202  C  CA    . ILE G 3 103 ? -36.338 -27.983 43.258 1.00 46.91  ? 102 ILE G CA    1 
ATOM   5203  C  C     . ILE G 3 103 ? -37.567 -27.354 43.845 1.00 47.68  ? 102 ILE G C     1 
ATOM   5204  O  O     . ILE G 3 103 ? -37.961 -27.674 44.969 1.00 48.21  ? 102 ILE G O     1 
ATOM   5205  C  CB    . ILE G 3 103 ? -36.410 -29.536 43.421 1.00 47.19  ? 102 ILE G CB    1 
ATOM   5206  C  CG1   . ILE G 3 103 ? -35.263 -30.207 42.660 1.00 47.12  ? 102 ILE G CG1   1 
ATOM   5207  C  CG2   . ILE G 3 103 ? -37.750 -30.092 42.939 1.00 45.70  ? 102 ILE G CG2   1 
ATOM   5208  C  CD1   . ILE G 3 103 ? -34.935 -31.603 43.132 1.00 48.55  ? 102 ILE G CD1   1 
ATOM   5209  N  N     . ALA G 3 104 ? -38.163 -26.441 43.091 1.00 48.45  ? 103 ALA G N     1 
ATOM   5210  C  CA    . ALA G 3 104 ? -39.411 -25.804 43.489 1.00 49.48  ? 103 ALA G CA    1 
ATOM   5211  C  C     . ALA G 3 104 ? -40.452 -26.833 43.946 1.00 50.16  ? 103 ALA G C     1 
ATOM   5212  O  O     . ALA G 3 104 ? -40.601 -27.894 43.332 1.00 50.21  ? 103 ALA G O     1 
ATOM   5213  C  CB    . ALA G 3 104 ? -39.954 -24.985 42.342 1.00 49.50  ? 103 ALA G CB    1 
ATOM   5214  N  N     . GLN G 3 105 ? -41.162 -26.507 45.027 1.00 50.71  ? 104 GLN G N     1 
ATOM   5215  C  CA    . GLN G 3 105 ? -42.242 -27.348 45.547 1.00 51.13  ? 104 GLN G CA    1 
ATOM   5216  C  C     . GLN G 3 105 ? -41.770 -28.735 45.966 1.00 50.76  ? 104 GLN G C     1 
ATOM   5217  O  O     . GLN G 3 105 ? -42.541 -29.693 45.953 1.00 51.58  ? 104 GLN G O     1 
ATOM   5218  C  CB    . GLN G 3 105 ? -43.397 -27.443 44.540 1.00 51.66  ? 104 GLN G CB    1 
ATOM   5219  C  CG    . GLN G 3 105 ? -44.275 -26.185 44.477 1.00 54.08  ? 104 GLN G CG    1 
ATOM   5220  C  CD    . GLN G 3 105 ? -45.022 -25.931 45.780 1.00 58.26  ? 104 GLN G CD    1 
ATOM   5221  O  OE1   . GLN G 3 105 ? -45.867 -26.738 46.205 1.00 60.32  ? 104 GLN G OE1   1 
ATOM   5222  N  NE2   . GLN G 3 105 ? -44.707 -24.812 46.430 1.00 58.78  ? 104 GLN G NE2   1 
ATOM   5223  N  N     . GLY G 3 106 ? -40.510 -28.841 46.358 1.00 50.02  ? 105 GLY G N     1 
ATOM   5224  C  CA    . GLY G 3 106 ? -39.967 -30.118 46.772 1.00 49.87  ? 105 GLY G CA    1 
ATOM   5225  C  C     . GLY G 3 106 ? -40.057 -30.413 48.257 1.00 49.78  ? 105 GLY G C     1 
ATOM   5226  O  O     . GLY G 3 106 ? -40.025 -31.571 48.661 1.00 50.30  ? 105 GLY G O     1 
ATOM   5227  N  N     . GLY G 3 107 ? -40.163 -29.373 49.076 1.00 49.45  ? 106 GLY G N     1 
ATOM   5228  C  CA    . GLY G 3 107 ? -40.070 -29.520 50.522 1.00 49.40  ? 106 GLY G CA    1 
ATOM   5229  C  C     . GLY G 3 107 ? -38.728 -30.071 50.971 1.00 50.09  ? 106 GLY G C     1 
ATOM   5230  O  O     . GLY G 3 107 ? -37.700 -29.902 50.296 1.00 50.25  ? 106 GLY G O     1 
ATOM   5231  N  N     . VAL G 3 108 ? -38.737 -30.732 52.123 1.00 50.54  ? 107 VAL G N     1 
ATOM   5232  C  CA    . VAL G 3 108 ? -37.526 -31.319 52.695 1.00 50.81  ? 107 VAL G CA    1 
ATOM   5233  C  C     . VAL G 3 108 ? -37.760 -32.749 53.192 1.00 51.52  ? 107 VAL G C     1 
ATOM   5234  O  O     . VAL G 3 108 ? -38.903 -33.164 53.392 1.00 51.98  ? 107 VAL G O     1 
ATOM   5235  C  CB    . VAL G 3 108 ? -36.961 -30.459 53.847 1.00 50.70  ? 107 VAL G CB    1 
ATOM   5236  C  CG1   . VAL G 3 108 ? -36.707 -29.012 53.388 1.00 49.25  ? 107 VAL G CG1   1 
ATOM   5237  C  CG2   . VAL G 3 108 ? -37.887 -30.504 55.058 1.00 50.65  ? 107 VAL G CG2   1 
ATOM   5238  N  N     . LEU G 3 109 ? -36.674 -33.497 53.375 1.00 52.17  ? 108 LEU G N     1 
ATOM   5239  C  CA    . LEU G 3 109 ? -36.731 -34.850 53.924 1.00 52.52  ? 108 LEU G CA    1 
ATOM   5240  C  C     . LEU G 3 109 ? -37.141 -34.797 55.379 1.00 53.65  ? 108 LEU G C     1 
ATOM   5241  O  O     . LEU G 3 109 ? -36.626 -33.978 56.128 1.00 53.92  ? 108 LEU G O     1 
ATOM   5242  C  CB    . LEU G 3 109 ? -35.359 -35.526 53.846 1.00 52.16  ? 108 LEU G CB    1 
ATOM   5243  C  CG    . LEU G 3 109 ? -34.712 -35.830 52.491 1.00 50.35  ? 108 LEU G CG    1 
ATOM   5244  C  CD1   . LEU G 3 109 ? -33.514 -36.717 52.685 1.00 48.05  ? 108 LEU G CD1   1 
ATOM   5245  C  CD2   . LEU G 3 109 ? -35.685 -36.459 51.524 1.00 49.89  ? 108 LEU G CD2   1 
ATOM   5246  N  N     . PRO G 3 110 ? -38.077 -35.668 55.797 1.00 54.96  ? 109 PRO G N     1 
ATOM   5247  C  CA    . PRO G 3 110 ? -38.391 -35.698 57.228 1.00 55.21  ? 109 PRO G CA    1 
ATOM   5248  C  C     . PRO G 3 110 ? -37.131 -36.033 57.997 1.00 55.80  ? 109 PRO G C     1 
ATOM   5249  O  O     . PRO G 3 110 ? -36.469 -37.012 57.678 1.00 55.97  ? 109 PRO G O     1 
ATOM   5250  C  CB    . PRO G 3 110 ? -39.417 -36.826 57.330 1.00 54.95  ? 109 PRO G CB    1 
ATOM   5251  C  CG    . PRO G 3 110 ? -40.125 -36.785 55.984 1.00 54.97  ? 109 PRO G CG    1 
ATOM   5252  C  CD    . PRO G 3 110 ? -38.983 -36.539 55.017 1.00 55.01  ? 109 PRO G CD    1 
ATOM   5253  N  N     . ASN G 3 111 ? -36.780 -35.186 58.957 1.00 56.81  ? 110 ASN G N     1 
ATOM   5254  C  CA    . ASN G 3 111 ? -35.560 -35.343 59.730 1.00 58.04  ? 110 ASN G CA    1 
ATOM   5255  C  C     . ASN G 3 111 ? -35.613 -34.485 60.993 1.00 58.55  ? 110 ASN G C     1 
ATOM   5256  O  O     . ASN G 3 111 ? -35.703 -33.252 60.926 1.00 58.94  ? 110 ASN G O     1 
ATOM   5257  C  CB    . ASN G 3 111 ? -34.336 -34.977 58.876 1.00 58.49  ? 110 ASN G CB    1 
ATOM   5258  C  CG    . ASN G 3 111 ? -33.009 -35.281 59.567 1.00 60.57  ? 110 ASN G CG    1 
ATOM   5259  O  OD1   . ASN G 3 111 ? -32.967 -35.695 60.733 1.00 63.77  ? 110 ASN G OD1   1 
ATOM   5260  N  ND2   . ASN G 3 111 ? -31.912 -35.077 58.844 1.00 62.11  ? 110 ASN G ND2   1 
ATOM   5261  N  N     . ILE G 3 112 ? -35.569 -35.146 62.145 1.00 58.73  ? 111 ILE G N     1 
ATOM   5262  C  CA    . ILE G 3 112 ? -35.521 -34.454 63.422 1.00 58.69  ? 111 ILE G CA    1 
ATOM   5263  C  C     . ILE G 3 112 ? -34.308 -34.938 64.183 1.00 59.27  ? 111 ILE G C     1 
ATOM   5264  O  O     . ILE G 3 112 ? -34.051 -36.137 64.255 1.00 59.31  ? 111 ILE G O     1 
ATOM   5265  C  CB    . ILE G 3 112 ? -36.784 -34.694 64.283 1.00 58.65  ? 111 ILE G CB    1 
ATOM   5266  C  CG1   . ILE G 3 112 ? -38.064 -34.613 63.434 1.00 57.56  ? 111 ILE G CG1   1 
ATOM   5267  C  CG2   . ILE G 3 112 ? -36.819 -33.693 65.448 1.00 58.38  ? 111 ILE G CG2   1 
ATOM   5268  C  CD1   . ILE G 3 112 ? -39.318 -35.094 64.123 1.00 55.33  ? 111 ILE G CD1   1 
ATOM   5269  N  N     . GLN G 3 113 ? -33.560 -33.992 64.740 1.00 60.21  ? 112 GLN G N     1 
ATOM   5270  C  CA    . GLN G 3 113 ? -32.341 -34.286 65.479 1.00 60.95  ? 112 GLN G CA    1 
ATOM   5271  C  C     . GLN G 3 113 ? -32.712 -34.992 66.757 1.00 61.90  ? 112 GLN G C     1 
ATOM   5272  O  O     . GLN G 3 113 ? -33.613 -34.545 67.471 1.00 62.27  ? 112 GLN G O     1 
ATOM   5273  C  CB    . GLN G 3 113 ? -31.600 -33.000 65.807 1.00 60.93  ? 112 GLN G CB    1 
ATOM   5274  C  CG    . GLN G 3 113 ? -31.220 -32.205 64.588 1.00 60.34  ? 112 GLN G CG    1 
ATOM   5275  C  CD    . GLN G 3 113 ? -30.220 -32.933 63.753 1.00 59.40  ? 112 GLN G CD    1 
ATOM   5276  O  OE1   . GLN G 3 113 ? -29.117 -33.247 64.218 1.00 59.96  ? 112 GLN G OE1   1 
ATOM   5277  N  NE2   . GLN G 3 113 ? -30.596 -33.232 62.516 1.00 58.03  ? 112 GLN G NE2   1 
ATOM   5278  N  N     . SER G 3 114 ? -32.010 -36.082 67.048 1.00 62.73  ? 113 SER G N     1 
ATOM   5279  C  CA    . SER G 3 114 ? -32.432 -36.999 68.098 1.00 63.74  ? 113 SER G CA    1 
ATOM   5280  C  C     . SER G 3 114 ? -32.496 -36.376 69.486 1.00 64.49  ? 113 SER G C     1 
ATOM   5281  O  O     . SER G 3 114 ? -33.336 -36.763 70.298 1.00 64.65  ? 113 SER G O     1 
ATOM   5282  C  CB    . SER G 3 114 ? -31.584 -38.274 68.102 1.00 63.66  ? 113 SER G CB    1 
ATOM   5283  O  OG    . SER G 3 114 ? -30.205 -37.977 68.121 1.00 63.58  ? 113 SER G OG    1 
ATOM   5284  N  N     . VAL G 3 115 ? -31.641 -35.388 69.742 1.00 65.38  ? 114 VAL G N     1 
ATOM   5285  C  CA    . VAL G 3 115 ? -31.677 -34.678 71.025 1.00 66.22  ? 114 VAL G CA    1 
ATOM   5286  C  C     . VAL G 3 115 ? -32.972 -33.880 71.231 1.00 66.90  ? 114 VAL G C     1 
ATOM   5287  O  O     . VAL G 3 115 ? -33.290 -33.487 72.351 1.00 66.82  ? 114 VAL G O     1 
ATOM   5288  C  CB    . VAL G 3 115 ? -30.438 -33.773 71.230 1.00 66.29  ? 114 VAL G CB    1 
ATOM   5289  C  CG1   . VAL G 3 115 ? -30.492 -32.548 70.318 1.00 65.98  ? 114 VAL G CG1   1 
ATOM   5290  C  CG2   . VAL G 3 115 ? -30.312 -33.360 72.700 1.00 65.39  ? 114 VAL G CG2   1 
ATOM   5291  N  N     . LEU G 3 116 ? -33.718 -33.661 70.153 1.00 68.09  ? 115 LEU G N     1 
ATOM   5292  C  CA    . LEU G 3 116 ? -34.968 -32.904 70.226 1.00 69.42  ? 115 LEU G CA    1 
ATOM   5293  C  C     . LEU G 3 116 ? -36.155 -33.804 70.561 1.00 70.88  ? 115 LEU G C     1 
ATOM   5294  O  O     . LEU G 3 116 ? -37.235 -33.317 70.909 1.00 70.63  ? 115 LEU G O     1 
ATOM   5295  C  CB    . LEU G 3 116 ? -35.217 -32.126 68.925 1.00 68.87  ? 115 LEU G CB    1 
ATOM   5296  C  CG    . LEU G 3 116 ? -34.185 -31.058 68.515 1.00 68.07  ? 115 LEU G CG    1 
ATOM   5297  C  CD1   . LEU G 3 116 ? -34.521 -30.425 67.167 1.00 66.27  ? 115 LEU G CD1   1 
ATOM   5298  C  CD2   . LEU G 3 116 ? -34.033 -29.978 69.580 1.00 66.21  ? 115 LEU G CD2   1 
ATOM   5299  N  N     . LEU G 3 117 ? -35.941 -35.117 70.458 1.00 72.98  ? 116 LEU G N     1 
ATOM   5300  C  CA    . LEU G 3 117 ? -36.965 -36.109 70.793 1.00 75.07  ? 116 LEU G CA    1 
ATOM   5301  C  C     . LEU G 3 117 ? -37.243 -36.121 72.297 1.00 76.96  ? 116 LEU G C     1 
ATOM   5302  O  O     . LEU G 3 117 ? -36.311 -35.973 73.101 1.00 76.87  ? 116 LEU G O     1 
ATOM   5303  C  CB    . LEU G 3 117 ? -36.554 -37.505 70.308 1.00 74.75  ? 116 LEU G CB    1 
ATOM   5304  C  CG    . LEU G 3 117 ? -36.461 -37.711 68.793 1.00 74.32  ? 116 LEU G CG    1 
ATOM   5305  C  CD1   . LEU G 3 117 ? -35.940 -39.101 68.450 1.00 73.52  ? 116 LEU G CD1   1 
ATOM   5306  C  CD2   . LEU G 3 117 ? -37.807 -37.461 68.131 1.00 73.69  ? 116 LEU G CD2   1 
ATOM   5307  N  N     . PRO G 3 118 ? -38.528 -36.283 72.685 1.00 78.97  ? 117 PRO G N     1 
ATOM   5308  C  CA    . PRO G 3 118 ? -38.888 -36.313 74.106 1.00 80.47  ? 117 PRO G CA    1 
ATOM   5309  C  C     . PRO G 3 118 ? -38.340 -37.580 74.743 1.00 82.07  ? 117 PRO G C     1 
ATOM   5310  O  O     . PRO G 3 118 ? -38.166 -38.585 74.046 1.00 82.31  ? 117 PRO G O     1 
ATOM   5311  C  CB    . PRO G 3 118 ? -40.422 -36.339 74.084 1.00 80.49  ? 117 PRO G CB    1 
ATOM   5312  C  CG    . PRO G 3 118 ? -40.786 -36.939 72.772 1.00 79.82  ? 117 PRO G CG    1 
ATOM   5313  C  CD    . PRO G 3 118 ? -39.697 -36.524 71.812 1.00 79.23  ? 117 PRO G CD    1 
ATOM   5314  N  N     . LYS G 3 119 ? -38.077 -37.537 76.047 1.00 84.00  ? 118 LYS G N     1 
ATOM   5315  C  CA    . LYS G 3 119 ? -37.392 -38.647 76.737 1.00 86.18  ? 118 LYS G CA    1 
ATOM   5316  C  C     . LYS G 3 119 ? -38.250 -39.923 76.947 1.00 87.02  ? 118 LYS G C     1 
ATOM   5317  O  O     . LYS G 3 119 ? -38.989 -40.042 77.931 1.00 87.29  ? 118 LYS G O     1 
ATOM   5318  C  CB    . LYS G 3 119 ? -36.744 -38.150 78.040 1.00 86.45  ? 118 LYS G CB    1 
ATOM   5319  C  CG    . LYS G 3 119 ? -35.681 -37.068 77.787 1.00 88.68  ? 118 LYS G CG    1 
ATOM   5320  C  CD    . LYS G 3 119 ? -35.417 -36.155 78.992 1.00 92.19  ? 118 LYS G CD    1 
ATOM   5321  C  CE    . LYS G 3 119 ? -34.566 -34.932 78.564 1.00 94.04  ? 118 LYS G CE    1 
ATOM   5322  N  NZ    . LYS G 3 119 ? -33.965 -34.172 79.714 1.00 95.08  ? 118 LYS G NZ    1 
ATOM   5323  N  N     . LYS G 3 120 ? -38.126 -40.862 76.003 1.00 88.00  ? 119 LYS G N     1 
ATOM   5324  C  CA    . LYS G 3 120 ? -38.844 -42.144 76.013 1.00 88.84  ? 119 LYS G CA    1 
ATOM   5325  C  C     . LYS G 3 120 ? -38.634 -42.932 77.310 1.00 89.18  ? 119 LYS G C     1 
ATOM   5326  O  O     . LYS G 3 120 ? -39.538 -43.628 77.784 1.00 89.53  ? 119 LYS G O     1 
ATOM   5327  C  CB    . LYS G 3 120 ? -38.406 -43.008 74.820 1.00 89.19  ? 119 LYS G CB    1 
ATOM   5328  C  CG    . LYS G 3 120 ? -39.122 -42.707 73.489 1.00 90.38  ? 119 LYS G CG    1 
ATOM   5329  C  CD    . LYS G 3 120 ? -38.986 -43.870 72.492 1.00 91.66  ? 119 LYS G CD    1 
ATOM   5330  C  CE    . LYS G 3 120 ? -39.459 -45.201 73.103 1.00 92.91  ? 119 LYS G CE    1 
ATOM   5331  N  NZ    . LYS G 3 120 ? -39.721 -46.272 72.090 1.00 94.16  ? 119 LYS G NZ    1 
ATOM   5332  N  N     . LYS H 4 32  ? -47.133 -17.071 19.961 1.00 95.78  ? 28  LYS H N     1 
ATOM   5333  C  CA    . LYS H 4 32  ? -47.018 -17.369 18.502 1.00 95.78  ? 28  LYS H CA    1 
ATOM   5334  C  C     . LYS H 4 32  ? -45.682 -18.041 18.212 1.00 95.39  ? 28  LYS H C     1 
ATOM   5335  O  O     . LYS H 4 32  ? -45.590 -18.915 17.343 1.00 95.37  ? 28  LYS H O     1 
ATOM   5336  C  CB    . LYS H 4 32  ? -47.166 -16.083 17.670 1.00 95.95  ? 28  LYS H CB    1 
ATOM   5337  C  CG    . LYS H 4 32  ? -47.091 -16.279 16.146 1.00 96.48  ? 28  LYS H CG    1 
ATOM   5338  C  CD    . LYS H 4 32  ? -47.561 -15.034 15.388 1.00 97.09  ? 28  LYS H CD    1 
ATOM   5339  C  CE    . LYS H 4 32  ? -49.084 -14.947 15.312 1.00 97.05  ? 28  LYS H CE    1 
ATOM   5340  N  NZ    . LYS H 4 32  ? -49.526 -13.616 14.821 1.00 96.98  ? 28  LYS H NZ    1 
ATOM   5341  N  N     . THR H 4 33  ? -44.650 -17.628 18.943 1.00 94.80  ? 29  THR H N     1 
ATOM   5342  C  CA    . THR H 4 33  ? -43.335 -18.209 18.760 1.00 94.43  ? 29  THR H CA    1 
ATOM   5343  C  C     . THR H 4 33  ? -43.273 -19.602 19.396 1.00 94.01  ? 29  THR H C     1 
ATOM   5344  O  O     . THR H 4 33  ? -43.969 -19.891 20.376 1.00 93.86  ? 29  THR H O     1 
ATOM   5345  C  CB    . THR H 4 33  ? -42.203 -17.280 19.271 1.00 94.49  ? 29  THR H CB    1 
ATOM   5346  O  OG1   . THR H 4 33  ? -41.030 -17.458 18.464 1.00 94.60  ? 29  THR H OG1   1 
ATOM   5347  C  CG2   . THR H 4 33  ? -41.870 -17.543 20.745 1.00 94.64  ? 29  THR H CG2   1 
ATOM   5348  N  N     . ARG H 4 34  ? -42.456 -20.465 18.801 1.00 93.37  ? 30  ARG H N     1 
ATOM   5349  C  CA    . ARG H 4 34  ? -42.290 -21.828 19.280 1.00 92.73  ? 30  ARG H CA    1 
ATOM   5350  C  C     . ARG H 4 34  ? -41.364 -21.837 20.488 1.00 91.76  ? 30  ARG H C     1 
ATOM   5351  O  O     . ARG H 4 34  ? -40.268 -21.267 20.446 1.00 91.96  ? 30  ARG H O     1 
ATOM   5352  C  CB    . ARG H 4 34  ? -41.701 -22.701 18.178 1.00 93.04  ? 30  ARG H CB    1 
ATOM   5353  C  CG    . ARG H 4 34  ? -42.650 -23.023 17.026 1.00 94.10  ? 30  ARG H CG    1 
ATOM   5354  C  CD    . ARG H 4 34  ? -41.849 -23.427 15.797 1.00 96.27  ? 30  ARG H CD    1 
ATOM   5355  N  NE    . ARG H 4 34  ? -40.509 -23.904 16.162 1.00 97.60  ? 30  ARG H NE    1 
ATOM   5356  C  CZ    . ARG H 4 34  ? -40.188 -25.176 16.399 1.00 98.13  ? 30  ARG H CZ    1 
ATOM   5357  N  NH1   . ARG H 4 34  ? -41.106 -26.138 16.307 1.00 98.36  ? 30  ARG H NH1   1 
ATOM   5358  N  NH2   . ARG H 4 34  ? -38.940 -25.486 16.729 1.00 97.88  ? 30  ARG H NH2   1 
ATOM   5359  N  N     . LYS H 4 35  ? -41.808 -22.489 21.559 1.00 90.19  ? 31  LYS H N     1 
ATOM   5360  C  CA    . LYS H 4 35  ? -41.039 -22.569 22.790 1.00 88.63  ? 31  LYS H CA    1 
ATOM   5361  C  C     . LYS H 4 35  ? -40.495 -23.995 22.937 1.00 87.24  ? 31  LYS H C     1 
ATOM   5362  O  O     . LYS H 4 35  ? -41.229 -24.921 23.282 1.00 87.32  ? 31  LYS H O     1 
ATOM   5363  C  CB    . LYS H 4 35  ? -41.933 -22.164 23.967 1.00 88.94  ? 31  LYS H CB    1 
ATOM   5364  C  CG    . LYS H 4 35  ? -41.233 -21.477 25.137 1.00 89.97  ? 31  LYS H CG    1 
ATOM   5365  C  CD    . LYS H 4 35  ? -40.956 -22.462 26.283 1.00 92.24  ? 31  LYS H CD    1 
ATOM   5366  C  CE    . LYS H 4 35  ? -41.205 -21.826 27.660 1.00 93.31  ? 31  LYS H CE    1 
ATOM   5367  N  NZ    . LYS H 4 35  ? -40.202 -20.777 28.038 1.00 93.30  ? 31  LYS H NZ    1 
ATOM   5368  N  N     . GLU H 4 36  ? -39.208 -24.168 22.655 1.00 85.36  ? 32  GLU H N     1 
ATOM   5369  C  CA    . GLU H 4 36  ? -38.577 -25.488 22.666 1.00 83.67  ? 32  GLU H CA    1 
ATOM   5370  C  C     . GLU H 4 36  ? -38.303 -26.035 24.068 1.00 81.98  ? 32  GLU H C     1 
ATOM   5371  O  O     . GLU H 4 36  ? -37.878 -25.308 24.959 1.00 82.15  ? 32  GLU H O     1 
ATOM   5372  C  CB    . GLU H 4 36  ? -37.281 -25.463 21.867 1.00 84.05  ? 32  GLU H CB    1 
ATOM   5373  C  CG    . GLU H 4 36  ? -37.481 -25.362 20.364 1.00 85.48  ? 32  GLU H CG    1 
ATOM   5374  C  CD    . GLU H 4 36  ? -36.244 -25.791 19.594 1.00 88.62  ? 32  GLU H CD    1 
ATOM   5375  O  OE1   . GLU H 4 36  ? -36.311 -25.871 18.345 1.00 90.14  ? 32  GLU H OE1   1 
ATOM   5376  O  OE2   . GLU H 4 36  ? -35.202 -26.055 20.238 1.00 89.38  ? 32  GLU H OE2   1 
ATOM   5377  N  N     . SER H 4 37  ? -38.526 -27.333 24.239 1.00 79.81  ? 33  SER H N     1 
ATOM   5378  C  CA    . SER H 4 37  ? -38.463 -27.974 25.541 1.00 77.45  ? 33  SER H CA    1 
ATOM   5379  C  C     . SER H 4 37  ? -38.059 -29.423 25.369 1.00 75.97  ? 33  SER H C     1 
ATOM   5380  O  O     . SER H 4 37  ? -38.325 -30.011 24.324 1.00 75.88  ? 33  SER H O     1 
ATOM   5381  C  CB    . SER H 4 37  ? -39.839 -27.912 26.195 1.00 77.55  ? 33  SER H CB    1 
ATOM   5382  O  OG    . SER H 4 37  ? -39.898 -28.739 27.335 1.00 76.94  ? 33  SER H OG    1 
ATOM   5383  N  N     . TYR H 4 38  ? -37.427 -29.999 26.392 1.00 73.98  ? 34  TYR H N     1 
ATOM   5384  C  CA    . TYR H 4 38  ? -37.043 -31.419 26.369 1.00 71.91  ? 34  TYR H CA    1 
ATOM   5385  C  C     . TYR H 4 38  ? -38.209 -32.331 26.746 1.00 71.23  ? 34  TYR H C     1 
ATOM   5386  O  O     . TYR H 4 38  ? -38.062 -33.547 26.773 1.00 71.04  ? 34  TYR H O     1 
ATOM   5387  C  CB    . TYR H 4 38  ? -35.863 -31.687 27.304 1.00 71.33  ? 34  TYR H CB    1 
ATOM   5388  C  CG    . TYR H 4 38  ? -34.522 -31.165 26.834 1.00 69.84  ? 34  TYR H CG    1 
ATOM   5389  C  CD1   . TYR H 4 38  ? -34.011 -29.957 27.315 1.00 68.10  ? 34  TYR H CD1   1 
ATOM   5390  C  CD2   . TYR H 4 38  ? -33.743 -31.895 25.929 1.00 68.27  ? 34  TYR H CD2   1 
ATOM   5391  C  CE1   . TYR H 4 38  ? -32.771 -29.484 26.892 1.00 66.35  ? 34  TYR H CE1   1 
ATOM   5392  C  CE2   . TYR H 4 38  ? -32.507 -31.427 25.501 1.00 65.99  ? 34  TYR H CE2   1 
ATOM   5393  C  CZ    . TYR H 4 38  ? -32.033 -30.226 25.986 1.00 66.15  ? 34  TYR H CZ    1 
ATOM   5394  O  OH    . TYR H 4 38  ? -30.814 -29.769 25.563 1.00 66.84  ? 34  TYR H OH    1 
ATOM   5395  N  N     . ALA H 4 39  ? -39.369 -31.736 27.011 1.00 70.77  ? 35  ALA H N     1 
ATOM   5396  C  CA    . ALA H 4 39  ? -40.523 -32.445 27.573 1.00 70.49  ? 35  ALA H CA    1 
ATOM   5397  C  C     . ALA H 4 39  ? -40.918 -33.749 26.867 1.00 70.53  ? 35  ALA H C     1 
ATOM   5398  O  O     . ALA H 4 39  ? -41.130 -34.764 27.531 1.00 70.70  ? 35  ALA H O     1 
ATOM   5399  C  CB    . ALA H 4 39  ? -41.724 -31.511 27.710 1.00 70.13  ? 35  ALA H CB    1 
ATOM   5400  N  N     . ILE H 4 40  ? -41.017 -33.750 25.540 1.00 70.41  ? 36  ILE H N     1 
ATOM   5401  C  CA    . ILE H 4 40  ? -41.391 -35.004 24.859 1.00 70.47  ? 36  ILE H CA    1 
ATOM   5402  C  C     . ILE H 4 40  ? -40.401 -36.143 25.146 1.00 69.73  ? 36  ILE H C     1 
ATOM   5403  O  O     . ILE H 4 40  ? -40.805 -37.267 25.452 1.00 69.46  ? 36  ILE H O     1 
ATOM   5404  C  CB    . ILE H 4 40  ? -41.626 -34.849 23.322 1.00 70.68  ? 36  ILE H CB    1 
ATOM   5405  C  CG1   . ILE H 4 40  ? -40.467 -34.117 22.648 1.00 71.79  ? 36  ILE H CG1   1 
ATOM   5406  C  CG2   . ILE H 4 40  ? -42.947 -34.127 23.050 1.00 71.25  ? 36  ILE H CG2   1 
ATOM   5407  C  CD1   . ILE H 4 40  ? -40.422 -34.330 21.152 1.00 72.69  ? 36  ILE H CD1   1 
ATOM   5408  N  N     . TYR H 4 41  ? -39.112 -35.830 25.073 1.00 69.01  ? 37  TYR H N     1 
ATOM   5409  C  CA    . TYR H 4 41  ? -38.065 -36.821 25.282 1.00 68.34  ? 37  TYR H CA    1 
ATOM   5410  C  C     . TYR H 4 41  ? -38.065 -37.300 26.713 1.00 67.63  ? 37  TYR H C     1 
ATOM   5411  O  O     . TYR H 4 41  ? -37.901 -38.492 26.970 1.00 67.29  ? 37  TYR H O     1 
ATOM   5412  C  CB    . TYR H 4 41  ? -36.719 -36.221 24.948 1.00 68.31  ? 37  TYR H CB    1 
ATOM   5413  C  CG    . TYR H 4 41  ? -36.793 -35.367 23.731 1.00 69.91  ? 37  TYR H CG    1 
ATOM   5414  C  CD1   . TYR H 4 41  ? -36.812 -33.984 23.833 1.00 71.42  ? 37  TYR H CD1   1 
ATOM   5415  C  CD2   . TYR H 4 41  ? -36.876 -35.943 22.464 1.00 71.48  ? 37  TYR H CD2   1 
ATOM   5416  C  CE1   . TYR H 4 41  ? -36.897 -33.190 22.699 1.00 73.24  ? 37  TYR H CE1   1 
ATOM   5417  C  CE2   . TYR H 4 41  ? -36.951 -35.166 21.326 1.00 71.93  ? 37  TYR H CE2   1 
ATOM   5418  C  CZ    . TYR H 4 41  ? -36.966 -33.793 21.445 1.00 72.90  ? 37  TYR H CZ    1 
ATOM   5419  O  OH    . TYR H 4 41  ? -37.045 -33.015 20.314 1.00 73.87  ? 37  TYR H OH    1 
ATOM   5420  N  N     . VAL H 4 42  ? -38.248 -36.367 27.642 1.00 66.69  ? 38  VAL H N     1 
ATOM   5421  C  CA    . VAL H 4 42  ? -38.374 -36.726 29.041 1.00 66.16  ? 38  VAL H CA    1 
ATOM   5422  C  C     . VAL H 4 42  ? -39.536 -37.713 29.161 1.00 66.25  ? 38  VAL H C     1 
ATOM   5423  O  O     . VAL H 4 42  ? -39.385 -38.783 29.747 1.00 65.95  ? 38  VAL H O     1 
ATOM   5424  C  CB    . VAL H 4 42  ? -38.565 -35.480 29.943 1.00 66.16  ? 38  VAL H CB    1 
ATOM   5425  C  CG1   . VAL H 4 42  ? -38.899 -35.879 31.361 1.00 65.07  ? 38  VAL H CG1   1 
ATOM   5426  C  CG2   . VAL H 4 42  ? -37.308 -34.597 29.915 1.00 65.67  ? 38  VAL H CG2   1 
ATOM   5427  N  N     . TYR H 4 43  ? -40.670 -37.366 28.552 1.00 66.58  ? 39  TYR H N     1 
ATOM   5428  C  CA    . TYR H 4 43  ? -41.871 -38.202 28.591 1.00 67.10  ? 39  TYR H CA    1 
ATOM   5429  C  C     . TYR H 4 43  ? -41.645 -39.597 27.987 1.00 66.96  ? 39  TYR H C     1 
ATOM   5430  O  O     . TYR H 4 43  ? -42.082 -40.597 28.558 1.00 66.93  ? 39  TYR H O     1 
ATOM   5431  C  CB    . TYR H 4 43  ? -43.069 -37.494 27.937 1.00 67.32  ? 39  TYR H CB    1 
ATOM   5432  C  CG    . TYR H 4 43  ? -44.406 -37.886 28.536 1.00 68.55  ? 39  TYR H CG    1 
ATOM   5433  C  CD1   . TYR H 4 43  ? -44.930 -37.202 29.635 1.00 70.10  ? 39  TYR H CD1   1 
ATOM   5434  C  CD2   . TYR H 4 43  ? -45.142 -38.946 28.011 1.00 70.98  ? 39  TYR H CD2   1 
ATOM   5435  C  CE1   . TYR H 4 43  ? -46.156 -37.564 30.206 1.00 71.53  ? 39  TYR H CE1   1 
ATOM   5436  C  CE2   . TYR H 4 43  ? -46.379 -39.317 28.559 1.00 72.37  ? 39  TYR H CE2   1 
ATOM   5437  C  CZ    . TYR H 4 43  ? -46.875 -38.624 29.663 1.00 73.43  ? 39  TYR H CZ    1 
ATOM   5438  O  OH    . TYR H 4 43  ? -48.090 -38.985 30.213 1.00 74.71  ? 39  TYR H OH    1 
ATOM   5439  N  N     . LYS H 4 44  ? -40.941 -39.669 26.861 1.00 66.87  ? 40  LYS H N     1 
ATOM   5440  C  CA    . LYS H 4 44  ? -40.612 -40.963 26.276 1.00 67.02  ? 40  LYS H CA    1 
ATOM   5441  C  C     . LYS H 4 44  ? -39.828 -41.796 27.278 1.00 67.01  ? 40  LYS H C     1 
ATOM   5442  O  O     . LYS H 4 44  ? -40.173 -42.943 27.554 1.00 67.37  ? 40  LYS H O     1 
ATOM   5443  C  CB    . LYS H 4 44  ? -39.834 -40.810 24.968 1.00 67.18  ? 40  LYS H CB    1 
ATOM   5444  C  CG    . LYS H 4 44  ? -40.657 -40.269 23.792 1.00 67.84  ? 40  LYS H CG    1 
ATOM   5445  C  CD    . LYS H 4 44  ? -39.802 -40.184 22.526 1.00 70.25  ? 40  LYS H CD    1 
ATOM   5446  C  CE    . LYS H 4 44  ? -40.549 -39.552 21.336 1.00 71.20  ? 40  LYS H CE    1 
ATOM   5447  N  NZ    . LYS H 4 44  ? -39.583 -38.933 20.351 1.00 72.47  ? 40  LYS H NZ    1 
ATOM   5448  N  N     . VAL H 4 45  ? -38.789 -41.203 27.848 1.00 67.26  ? 41  VAL H N     1 
ATOM   5449  C  CA    . VAL H 4 45  ? -37.940 -41.901 28.816 1.00 67.07  ? 41  VAL H CA    1 
ATOM   5450  C  C     . VAL H 4 45  ? -38.727 -42.340 30.058 1.00 67.30  ? 41  VAL H C     1 
ATOM   5451  O  O     . VAL H 4 45  ? -38.480 -43.413 30.608 1.00 67.02  ? 41  VAL H O     1 
ATOM   5452  C  CB    . VAL H 4 45  ? -36.701 -41.062 29.192 1.00 66.89  ? 41  VAL H CB    1 
ATOM   5453  C  CG1   . VAL H 4 45  ? -35.815 -41.827 30.148 1.00 66.98  ? 41  VAL H CG1   1 
ATOM   5454  C  CG2   . VAL H 4 45  ? -35.897 -40.703 27.941 1.00 66.35  ? 41  VAL H CG2   1 
ATOM   5455  N  N     . LEU H 4 46  ? -39.687 -41.521 30.483 1.00 67.77  ? 42  LEU H N     1 
ATOM   5456  C  CA    . LEU H 4 46  ? -40.572 -41.898 31.578 1.00 68.22  ? 42  LEU H CA    1 
ATOM   5457  C  C     . LEU H 4 46  ? -41.350 -43.160 31.226 1.00 69.25  ? 42  LEU H C     1 
ATOM   5458  O  O     . LEU H 4 46  ? -41.557 -44.038 32.073 1.00 69.45  ? 42  LEU H O     1 
ATOM   5459  C  CB    . LEU H 4 46  ? -41.542 -40.765 31.910 1.00 67.84  ? 42  LEU H CB    1 
ATOM   5460  C  CG    . LEU H 4 46  ? -42.645 -41.048 32.947 1.00 67.05  ? 42  LEU H CG    1 
ATOM   5461  C  CD1   . LEU H 4 46  ? -42.114 -41.546 34.282 1.00 65.69  ? 42  LEU H CD1   1 
ATOM   5462  C  CD2   . LEU H 4 46  ? -43.503 -39.822 33.163 1.00 67.01  ? 42  LEU H CD2   1 
ATOM   5463  N  N     . LYS H 4 47  ? -41.779 -43.256 29.973 1.00 70.18  ? 43  LYS H N     1 
ATOM   5464  C  CA    . LYS H 4 47  ? -42.580 -44.393 29.556 1.00 71.01  ? 43  LYS H CA    1 
ATOM   5465  C  C     . LYS H 4 47  ? -41.806 -45.709 29.601 1.00 71.49  ? 43  LYS H C     1 
ATOM   5466  O  O     . LYS H 4 47  ? -42.339 -46.716 30.072 1.00 72.06  ? 43  LYS H O     1 
ATOM   5467  C  CB    . LYS H 4 47  ? -43.235 -44.137 28.201 1.00 71.11  ? 43  LYS H CB    1 
ATOM   5468  C  CG    . LYS H 4 47  ? -44.373 -43.110 28.309 1.00 72.06  ? 43  LYS H CG    1 
ATOM   5469  C  CD    . LYS H 4 47  ? -45.406 -43.600 29.319 1.00 72.86  ? 43  LYS H CD    1 
ATOM   5470  C  CE    . LYS H 4 47  ? -45.930 -42.489 30.189 1.00 73.03  ? 43  LYS H CE    1 
ATOM   5471  N  NZ    . LYS H 4 47  ? -46.866 -43.040 31.213 1.00 73.24  ? 43  LYS H NZ    1 
ATOM   5472  N  N     . GLN H 4 48  ? -40.550 -45.698 29.162 1.00 71.57  ? 44  GLN H N     1 
ATOM   5473  C  CA    . GLN H 4 48  ? -39.720 -46.899 29.240 1.00 72.00  ? 44  GLN H CA    1 
ATOM   5474  C  C     . GLN H 4 48  ? -39.579 -47.344 30.687 1.00 72.13  ? 44  GLN H C     1 
ATOM   5475  O  O     . GLN H 4 48  ? -39.810 -48.507 31.033 1.00 72.49  ? 44  GLN H O     1 
ATOM   5476  C  CB    . GLN H 4 48  ? -38.314 -46.644 28.704 1.00 72.10  ? 44  GLN H CB    1 
ATOM   5477  C  CG    . GLN H 4 48  ? -38.194 -46.150 27.280 1.00 73.50  ? 44  GLN H CG    1 
ATOM   5478  C  CD    . GLN H 4 48  ? -36.744 -46.192 26.801 1.00 76.31  ? 44  GLN H CD    1 
ATOM   5479  O  OE1   . GLN H 4 48  ? -35.813 -45.959 27.576 1.00 77.89  ? 44  GLN H OE1   1 
ATOM   5480  N  NE2   . GLN H 4 48  ? -36.548 -46.501 25.524 1.00 76.89  ? 44  GLN H NE2   1 
ATOM   5481  N  N     . VAL H 4 49  ? -39.205 -46.385 31.524 1.00 72.17  ? 45  VAL H N     1 
ATOM   5482  C  CA    . VAL H 4 49  ? -38.799 -46.626 32.899 1.00 71.88  ? 45  VAL H CA    1 
ATOM   5483  C  C     . VAL H 4 49  ? -39.996 -46.946 33.796 1.00 71.70  ? 45  VAL H C     1 
ATOM   5484  O  O     . VAL H 4 49  ? -39.908 -47.794 34.678 1.00 71.44  ? 45  VAL H O     1 
ATOM   5485  C  CB    . VAL H 4 49  ? -37.992 -45.398 33.419 1.00 71.93  ? 45  VAL H CB    1 
ATOM   5486  C  CG1   . VAL H 4 49  ? -37.776 -45.462 34.903 1.00 71.89  ? 45  VAL H CG1   1 
ATOM   5487  C  CG2   . VAL H 4 49  ? -36.654 -45.323 32.711 1.00 71.69  ? 45  VAL H CG2   1 
ATOM   5488  N  N     . HIS H 4 50  ? -41.110 -46.264 33.558 1.00 71.88  ? 46  HIS H N     1 
ATOM   5489  C  CA    . HIS H 4 50  ? -42.317 -46.449 34.357 1.00 72.50  ? 46  HIS H CA    1 
ATOM   5490  C  C     . HIS H 4 50  ? -43.568 -46.308 33.476 1.00 72.79  ? 46  HIS H C     1 
ATOM   5491  O  O     . HIS H 4 50  ? -44.207 -45.242 33.473 1.00 72.97  ? 46  HIS H O     1 
ATOM   5492  C  CB    . HIS H 4 50  ? -42.355 -45.433 35.499 1.00 72.43  ? 46  HIS H CB    1 
ATOM   5493  C  CG    . HIS H 4 50  ? -41.498 -45.796 36.672 1.00 72.76  ? 46  HIS H CG    1 
ATOM   5494  N  ND1   . HIS H 4 50  ? -41.959 -46.553 37.727 1.00 72.30  ? 46  HIS H ND1   1 
ATOM   5495  C  CD2   . HIS H 4 50  ? -40.217 -45.476 36.973 1.00 72.64  ? 46  HIS H CD2   1 
ATOM   5496  C  CE1   . HIS H 4 50  ? -40.994 -46.700 38.616 1.00 72.40  ? 46  HIS H CE1   1 
ATOM   5497  N  NE2   . HIS H 4 50  ? -39.925 -46.057 38.181 1.00 72.36  ? 46  HIS H NE2   1 
ATOM   5498  N  N     . PRO H 4 51  ? -43.930 -47.387 32.738 1.00 72.81  ? 47  PRO H N     1 
ATOM   5499  C  CA    . PRO H 4 51  ? -44.912 -47.315 31.651 1.00 72.70  ? 47  PRO H CA    1 
ATOM   5500  C  C     . PRO H 4 51  ? -46.287 -46.787 32.049 1.00 72.63  ? 47  PRO H C     1 
ATOM   5501  O  O     . PRO H 4 51  ? -46.972 -46.218 31.202 1.00 72.85  ? 47  PRO H O     1 
ATOM   5502  C  CB    . PRO H 4 51  ? -45.010 -48.761 31.171 1.00 72.73  ? 47  PRO H CB    1 
ATOM   5503  C  CG    . PRO H 4 51  ? -43.719 -49.375 31.569 1.00 72.76  ? 47  PRO H CG    1 
ATOM   5504  C  CD    . PRO H 4 51  ? -43.402 -48.756 32.883 1.00 72.79  ? 47  PRO H CD    1 
ATOM   5505  N  N     . ASP H 4 52  ? -46.677 -46.959 33.309 1.00 72.28  ? 48  ASP H N     1 
ATOM   5506  C  CA    . ASP H 4 52  ? -47.993 -46.515 33.767 1.00 72.32  ? 48  ASP H CA    1 
ATOM   5507  C  C     . ASP H 4 52  ? -47.905 -45.295 34.675 1.00 71.86  ? 48  ASP H C     1 
ATOM   5508  O  O     . ASP H 4 52  ? -48.869 -44.953 35.363 1.00 71.72  ? 48  ASP H O     1 
ATOM   5509  C  CB    . ASP H 4 52  ? -48.736 -47.641 34.506 1.00 72.96  ? 48  ASP H CB    1 
ATOM   5510  C  CG    . ASP H 4 52  ? -48.879 -48.914 33.672 1.00 74.76  ? 48  ASP H CG    1 
ATOM   5511  O  OD1   . ASP H 4 52  ? -49.449 -48.853 32.554 1.00 76.44  ? 48  ASP H OD1   1 
ATOM   5512  O  OD2   . ASP H 4 52  ? -48.431 -49.985 34.148 1.00 76.83  ? 48  ASP H OD2   1 
ATOM   5513  N  N     . THR H 4 53  ? -46.745 -44.643 34.689 1.00 71.26  ? 49  THR H N     1 
ATOM   5514  C  CA    . THR H 4 53  ? -46.554 -43.444 35.508 1.00 69.95  ? 49  THR H CA    1 
ATOM   5515  C  C     . THR H 4 53  ? -46.580 -42.207 34.625 1.00 69.00  ? 49  THR H C     1 
ATOM   5516  O  O     . THR H 4 53  ? -45.967 -42.196 33.565 1.00 68.98  ? 49  THR H O     1 
ATOM   5517  C  CB    . THR H 4 53  ? -45.220 -43.500 36.262 1.00 70.11  ? 49  THR H CB    1 
ATOM   5518  O  OG1   . THR H 4 53  ? -45.135 -44.737 36.970 1.00 70.35  ? 49  THR H OG1   1 
ATOM   5519  C  CG2   . THR H 4 53  ? -45.080 -42.343 37.246 1.00 69.64  ? 49  THR H CG2   1 
ATOM   5520  N  N     . GLY H 4 54  ? -47.303 -41.181 35.064 1.00 67.99  ? 50  GLY H N     1 
ATOM   5521  C  CA    . GLY H 4 54  ? -47.310 -39.880 34.396 1.00 66.91  ? 50  GLY H CA    1 
ATOM   5522  C  C     . GLY H 4 54  ? -46.528 -38.848 35.199 1.00 66.26  ? 50  GLY H C     1 
ATOM   5523  O  O     . GLY H 4 54  ? -45.713 -39.197 36.063 1.00 66.30  ? 50  GLY H O     1 
ATOM   5524  N  N     . ILE H 4 55  ? -46.790 -37.574 34.934 1.00 65.17  ? 51  ILE H N     1 
ATOM   5525  C  CA    . ILE H 4 55  ? -45.996 -36.508 35.510 1.00 64.28  ? 51  ILE H CA    1 
ATOM   5526  C  C     . ILE H 4 55  ? -46.742 -35.189 35.449 1.00 63.77  ? 51  ILE H C     1 
ATOM   5527  O  O     . ILE H 4 55  ? -47.394 -34.890 34.449 1.00 64.05  ? 51  ILE H O     1 
ATOM   5528  C  CB    . ILE H 4 55  ? -44.610 -36.396 34.797 1.00 64.54  ? 51  ILE H CB    1 
ATOM   5529  C  CG1   . ILE H 4 55  ? -43.737 -35.313 35.449 1.00 63.79  ? 51  ILE H CG1   1 
ATOM   5530  C  CG2   . ILE H 4 55  ? -44.768 -36.178 33.273 1.00 64.50  ? 51  ILE H CG2   1 
ATOM   5531  C  CD1   . ILE H 4 55  ? -42.232 -35.557 35.288 1.00 62.71  ? 51  ILE H CD1   1 
ATOM   5532  N  N     . SER H 4 56  ? -46.646 -34.405 36.520 1.00 62.76  ? 52  SER H N     1 
ATOM   5533  C  CA    . SER H 4 56  ? -47.288 -33.093 36.566 1.00 61.67  ? 52  SER H CA    1 
ATOM   5534  C  C     . SER H 4 56  ? -46.521 -32.064 35.742 1.00 60.85  ? 52  SER H C     1 
ATOM   5535  O  O     . SER H 4 56  ? -45.356 -32.261 35.399 1.00 60.80  ? 52  SER H O     1 
ATOM   5536  C  CB    . SER H 4 56  ? -47.448 -32.608 38.012 1.00 61.90  ? 52  SER H CB    1 
ATOM   5537  O  OG    . SER H 4 56  ? -46.245 -32.040 38.505 1.00 61.76  ? 52  SER H OG    1 
ATOM   5538  N  N     . SER H 4 57  ? -47.199 -30.969 35.433 1.00 59.99  ? 53  SER H N     1 
ATOM   5539  C  CA    . SER H 4 57  ? -46.654 -29.886 34.642 1.00 59.61  ? 53  SER H CA    1 
ATOM   5540  C  C     . SER H 4 57  ? -45.357 -29.376 35.226 1.00 59.36  ? 53  SER H C     1 
ATOM   5541  O  O     . SER H 4 57  ? -44.331 -29.303 34.538 1.00 59.47  ? 53  SER H O     1 
ATOM   5542  C  CB    . SER H 4 57  ? -47.648 -28.736 34.637 1.00 59.56  ? 53  SER H CB    1 
ATOM   5543  O  OG    . SER H 4 57  ? -47.620 -28.094 33.376 1.00 60.69  ? 53  SER H OG    1 
ATOM   5544  N  N     . LYS H 4 58  ? -45.437 -29.027 36.510 1.00 58.88  ? 54  LYS H N     1 
ATOM   5545  C  CA    . LYS H 4 58  ? -44.335 -28.497 37.286 1.00 58.36  ? 54  LYS H CA    1 
ATOM   5546  C  C     . LYS H 4 58  ? -43.184 -29.486 37.353 1.00 57.52  ? 54  LYS H C     1 
ATOM   5547  O  O     . LYS H 4 58  ? -42.019 -29.113 37.143 1.00 57.61  ? 54  LYS H O     1 
ATOM   5548  C  CB    . LYS H 4 58  ? -44.832 -28.137 38.683 1.00 58.76  ? 54  LYS H CB    1 
ATOM   5549  C  CG    . LYS H 4 58  ? -45.989 -27.133 38.638 1.00 62.14  ? 54  LYS H CG    1 
ATOM   5550  C  CD    . LYS H 4 58  ? -46.435 -26.648 40.027 1.00 66.40  ? 54  LYS H CD    1 
ATOM   5551  C  CE    . LYS H 4 58  ? -47.468 -25.509 39.872 1.00 67.89  ? 54  LYS H CE    1 
ATOM   5552  N  NZ    . LYS H 4 58  ? -47.528 -24.704 41.126 1.00 70.51  ? 54  LYS H NZ    1 
ATOM   5553  N  N     . ALA H 4 59  ? -43.500 -30.752 37.619 1.00 56.12  ? 55  ALA H N     1 
ATOM   5554  C  CA    . ALA H 4 59  ? -42.461 -31.759 37.676 1.00 54.91  ? 55  ALA H CA    1 
ATOM   5555  C  C     . ALA H 4 59  ? -41.747 -31.852 36.331 1.00 54.06  ? 55  ALA H C     1 
ATOM   5556  O  O     . ALA H 4 59  ? -40.528 -32.061 36.274 1.00 53.96  ? 55  ALA H O     1 
ATOM   5557  C  CB    . ALA H 4 59  ? -43.023 -33.096 38.112 1.00 54.75  ? 55  ALA H CB    1 
ATOM   5558  N  N     . MET H 4 60  ? -42.491 -31.660 35.249 1.00 53.15  ? 56  MET H N     1 
ATOM   5559  C  CA    . MET H 4 60  ? -41.866 -31.665 33.925 1.00 52.84  ? 56  MET H CA    1 
ATOM   5560  C  C     . MET H 4 60  ? -40.932 -30.458 33.746 1.00 52.02  ? 56  MET H C     1 
ATOM   5561  O  O     . MET H 4 60  ? -39.812 -30.583 33.232 1.00 51.18  ? 56  MET H O     1 
ATOM   5562  C  CB    . MET H 4 60  ? -42.915 -31.704 32.817 1.00 52.97  ? 56  MET H CB    1 
ATOM   5563  C  CG    . MET H 4 60  ? -42.320 -31.642 31.434 1.00 53.55  ? 56  MET H CG    1 
ATOM   5564  S  SD    . MET H 4 60  ? -41.230 -33.027 31.112 1.00 57.23  ? 56  MET H SD    1 
ATOM   5565  C  CE    . MET H 4 60  ? -42.424 -34.288 30.645 1.00 59.22  ? 56  MET H CE    1 
ATOM   5566  N  N     . SER H 4 61  ? -41.410 -29.301 34.195 1.00 51.17  ? 57  SER H N     1 
ATOM   5567  C  CA    . SER H 4 61  ? -40.638 -28.076 34.148 1.00 50.81  ? 57  SER H CA    1 
ATOM   5568  C  C     . SER H 4 61  ? -39.288 -28.240 34.870 1.00 50.31  ? 57  SER H C     1 
ATOM   5569  O  O     . SER H 4 61  ? -38.231 -27.920 34.304 1.00 49.73  ? 57  SER H O     1 
ATOM   5570  C  CB    . SER H 4 61  ? -41.457 -26.937 34.729 1.00 50.79  ? 57  SER H CB    1 
ATOM   5571  O  OG    . SER H 4 61  ? -40.724 -25.734 34.698 1.00 52.47  ? 57  SER H OG    1 
ATOM   5572  N  N     . ILE H 4 62  ? -39.334 -28.783 36.089 1.00 49.47  ? 58  ILE H N     1 
ATOM   5573  C  CA    . ILE H 4 62  ? -38.132 -29.158 36.828 1.00 48.99  ? 58  ILE H CA    1 
ATOM   5574  C  C     . ILE H 4 62  ? -37.213 -30.081 36.031 1.00 49.37  ? 58  ILE H C     1 
ATOM   5575  O  O     . ILE H 4 62  ? -36.004 -29.847 35.958 1.00 49.41  ? 58  ILE H O     1 
ATOM   5576  C  CB    . ILE H 4 62  ? -38.495 -29.821 38.151 1.00 48.95  ? 58  ILE H CB    1 
ATOM   5577  C  CG1   . ILE H 4 62  ? -38.983 -28.752 39.126 1.00 49.69  ? 58  ILE H CG1   1 
ATOM   5578  C  CG2   . ILE H 4 62  ? -37.303 -30.548 38.734 1.00 48.08  ? 58  ILE H CG2   1 
ATOM   5579  C  CD1   . ILE H 4 62  ? -39.997 -29.241 40.096 1.00 51.20  ? 58  ILE H CD1   1 
ATOM   5580  N  N     . MET H 4 63  ? -37.776 -31.132 35.433 1.00 49.61  ? 59  MET H N     1 
ATOM   5581  C  CA    . MET H 4 63  ? -36.966 -32.051 34.636 1.00 49.57  ? 59  MET H CA    1 
ATOM   5582  C  C     . MET H 4 63  ? -36.316 -31.332 33.468 1.00 49.35  ? 59  MET H C     1 
ATOM   5583  O  O     . MET H 4 63  ? -35.169 -31.585 33.128 1.00 49.10  ? 59  MET H O     1 
ATOM   5584  C  CB    . MET H 4 63  ? -37.796 -33.235 34.149 1.00 49.83  ? 59  MET H CB    1 
ATOM   5585  C  CG    . MET H 4 63  ? -38.127 -34.246 35.247 1.00 50.44  ? 59  MET H CG    1 
ATOM   5586  S  SD    . MET H 4 63  ? -36.658 -34.955 36.030 1.00 53.02  ? 59  MET H SD    1 
ATOM   5587  C  CE    . MET H 4 63  ? -35.769 -35.586 34.615 1.00 48.84  ? 59  MET H CE    1 
ATOM   5588  N  N     . ASN H 4 64  ? -37.045 -30.409 32.871 1.00 49.48  ? 60  ASN H N     1 
ATOM   5589  C  CA    . ASN H 4 64  ? -36.494 -29.641 31.783 1.00 49.80  ? 60  ASN H CA    1 
ATOM   5590  C  C     . ASN H 4 64  ? -35.310 -28.781 32.251 1.00 50.01  ? 60  ASN H C     1 
ATOM   5591  O  O     . ASN H 4 64  ? -34.246 -28.785 31.613 1.00 50.11  ? 60  ASN H O     1 
ATOM   5592  C  CB    . ASN H 4 64  ? -37.594 -28.788 31.150 1.00 50.26  ? 60  ASN H CB    1 
ATOM   5593  C  CG    . ASN H 4 64  ? -37.201 -28.259 29.819 1.00 50.51  ? 60  ASN H CG    1 
ATOM   5594  O  OD1   . ASN H 4 64  ? -36.641 -28.990 29.003 1.00 52.03  ? 60  ASN H OD1   1 
ATOM   5595  N  ND2   . ASN H 4 64  ? -37.462 -26.974 29.584 1.00 50.26  ? 60  ASN H ND2   1 
ATOM   5596  N  N     . SER H 4 65  ? -35.493 -28.067 33.371 1.00 49.61  ? 61  SER H N     1 
ATOM   5597  C  CA    . SER H 4 65  ? -34.422 -27.288 33.985 1.00 49.29  ? 61  SER H CA    1 
ATOM   5598  C  C     . SER H 4 65  ? -33.228 -28.184 34.243 1.00 49.15  ? 61  SER H C     1 
ATOM   5599  O  O     . SER H 4 65  ? -32.093 -27.837 33.938 1.00 49.23  ? 61  SER H O     1 
ATOM   5600  C  CB    . SER H 4 65  ? -34.877 -26.673 35.307 1.00 49.42  ? 61  SER H CB    1 
ATOM   5601  O  OG    . SER H 4 65  ? -36.018 -25.852 35.132 1.00 50.37  ? 61  SER H OG    1 
ATOM   5602  N  N     . PHE H 4 66  ? -33.490 -29.356 34.794 1.00 49.15  ? 62  PHE H N     1 
ATOM   5603  C  CA    . PHE H 4 66  ? -32.419 -30.284 35.073 1.00 49.48  ? 62  PHE H CA    1 
ATOM   5604  C  C     . PHE H 4 66  ? -31.596 -30.648 33.834 1.00 49.54  ? 62  PHE H C     1 
ATOM   5605  O  O     . PHE H 4 66  ? -30.367 -30.624 33.882 1.00 50.17  ? 62  PHE H O     1 
ATOM   5606  C  CB    . PHE H 4 66  ? -32.964 -31.530 35.725 1.00 49.62  ? 62  PHE H CB    1 
ATOM   5607  C  CG    . PHE H 4 66  ? -31.973 -32.638 35.795 1.00 51.27  ? 62  PHE H CG    1 
ATOM   5608  C  CD1   . PHE H 4 66  ? -30.980 -32.632 36.771 1.00 52.09  ? 62  PHE H CD1   1 
ATOM   5609  C  CD2   . PHE H 4 66  ? -32.016 -33.683 34.878 1.00 51.88  ? 62  PHE H CD2   1 
ATOM   5610  C  CE1   . PHE H 4 66  ? -30.052 -33.653 36.842 1.00 52.87  ? 62  PHE H CE1   1 
ATOM   5611  C  CE2   . PHE H 4 66  ? -31.096 -34.713 34.942 1.00 52.43  ? 62  PHE H CE2   1 
ATOM   5612  C  CZ    . PHE H 4 66  ? -30.108 -34.700 35.922 1.00 53.40  ? 62  PHE H CZ    1 
ATOM   5613  N  N     . VAL H 4 67  ? -32.262 -30.965 32.726 1.00 49.17  ? 63  VAL H N     1 
ATOM   5614  C  CA    . VAL H 4 67  ? -31.550 -31.261 31.489 1.00 48.53  ? 63  VAL H CA    1 
ATOM   5615  C  C     . VAL H 4 67  ? -30.757 -30.045 31.004 1.00 48.63  ? 63  VAL H C     1 
ATOM   5616  O  O     . VAL H 4 67  ? -29.557 -30.154 30.707 1.00 48.05  ? 63  VAL H O     1 
ATOM   5617  C  CB    . VAL H 4 67  ? -32.491 -31.779 30.375 1.00 48.69  ? 63  VAL H CB    1 
ATOM   5618  C  CG1   . VAL H 4 67  ? -31.683 -32.190 29.161 1.00 47.70  ? 63  VAL H CG1   1 
ATOM   5619  C  CG2   . VAL H 4 67  ? -33.316 -32.958 30.868 1.00 47.47  ? 63  VAL H CG2   1 
ATOM   5620  N  N     . ASN H 4 68  ? -31.410 -28.883 30.953 1.00 48.72  ? 64  ASN H N     1 
ATOM   5621  C  CA    . ASN H 4 68  ? -30.703 -27.656 30.566 1.00 49.31  ? 64  ASN H CA    1 
ATOM   5622  C  C     . ASN H 4 68  ? -29.459 -27.335 31.417 1.00 48.93  ? 64  ASN H C     1 
ATOM   5623  O  O     . ASN H 4 68  ? -28.404 -26.993 30.874 1.00 49.27  ? 64  ASN H O     1 
ATOM   5624  C  CB    . ASN H 4 68  ? -31.650 -26.465 30.539 1.00 49.76  ? 64  ASN H CB    1 
ATOM   5625  C  CG    . ASN H 4 68  ? -32.492 -26.429 29.294 1.00 51.17  ? 64  ASN H CG    1 
ATOM   5626  O  OD1   . ASN H 4 68  ? -31.975 -26.521 28.181 1.00 53.50  ? 64  ASN H OD1   1 
ATOM   5627  N  ND2   . ASN H 4 68  ? -33.801 -26.301 29.469 1.00 53.11  ? 64  ASN H ND2   1 
ATOM   5628  N  N     . ASP H 4 69  ? -29.594 -27.465 32.733 1.00 48.16  ? 65  ASP H N     1 
ATOM   5629  C  CA    . ASP H 4 69  ? -28.513 -27.208 33.662 1.00 47.96  ? 65  ASP H CA    1 
ATOM   5630  C  C     . ASP H 4 69  ? -27.360 -28.133 33.342 1.00 47.97  ? 65  ASP H C     1 
ATOM   5631  O  O     . ASP H 4 69  ? -26.246 -27.691 33.070 1.00 47.65  ? 65  ASP H O     1 
ATOM   5632  C  CB    . ASP H 4 69  ? -29.027 -27.439 35.085 1.00 48.37  ? 65  ASP H CB    1 
ATOM   5633  C  CG    . ASP H 4 69  ? -28.001 -27.109 36.179 1.00 48.67  ? 65  ASP H CG    1 
ATOM   5634  O  OD1   . ASP H 4 69  ? -26.984 -26.449 35.910 1.00 50.44  ? 65  ASP H OD1   1 
ATOM   5635  O  OD2   . ASP H 4 69  ? -28.235 -27.513 37.344 1.00 47.94  ? 65  ASP H OD2   1 
ATOM   5636  N  N     . VAL H 4 70  ? -27.641 -29.430 33.332 1.00 48.33  ? 66  VAL H N     1 
ATOM   5637  C  CA    . VAL H 4 70  ? -26.601 -30.423 33.123 1.00 48.16  ? 66  VAL H CA    1 
ATOM   5638  C  C     . VAL H 4 70  ? -25.964 -30.258 31.775 1.00 48.28  ? 66  VAL H C     1 
ATOM   5639  O  O     . VAL H 4 70  ? -24.756 -30.426 31.663 1.00 48.65  ? 66  VAL H O     1 
ATOM   5640  C  CB    . VAL H 4 70  ? -27.126 -31.838 33.289 1.00 48.32  ? 66  VAL H CB    1 
ATOM   5641  C  CG1   . VAL H 4 70  ? -26.067 -32.848 32.891 1.00 48.88  ? 66  VAL H CG1   1 
ATOM   5642  C  CG2   . VAL H 4 70  ? -27.534 -32.074 34.741 1.00 48.73  ? 66  VAL H CG2   1 
ATOM   5643  N  N     . PHE H 4 71  ? -26.765 -29.923 30.758 1.00 48.51  ? 67  PHE H N     1 
ATOM   5644  C  CA    . PHE H 4 71  ? -26.230 -29.585 29.446 1.00 48.42  ? 67  PHE H CA    1 
ATOM   5645  C  C     . PHE H 4 71  ? -25.159 -28.518 29.609 1.00 48.70  ? 67  PHE H C     1 
ATOM   5646  O  O     . PHE H 4 71  ? -23.996 -28.744 29.268 1.00 48.53  ? 67  PHE H O     1 
ATOM   5647  C  CB    . PHE H 4 71  ? -27.327 -29.075 28.505 1.00 48.57  ? 67  PHE H CB    1 
ATOM   5648  C  CG    . PHE H 4 71  ? -26.827 -28.742 27.116 1.00 48.95  ? 67  PHE H CG    1 
ATOM   5649  C  CD1   . PHE H 4 71  ? -26.881 -29.692 26.089 1.00 50.17  ? 67  PHE H CD1   1 
ATOM   5650  C  CD2   . PHE H 4 71  ? -26.291 -27.489 26.837 1.00 49.65  ? 67  PHE H CD2   1 
ATOM   5651  C  CE1   . PHE H 4 71  ? -26.403 -29.402 24.791 1.00 49.38  ? 67  PHE H CE1   1 
ATOM   5652  C  CE2   . PHE H 4 71  ? -25.811 -27.182 25.550 1.00 51.53  ? 67  PHE H CE2   1 
ATOM   5653  C  CZ    . PHE H 4 71  ? -25.865 -28.158 24.522 1.00 50.67  ? 67  PHE H CZ    1 
ATOM   5654  N  N     . GLU H 4 72  ? -25.566 -27.370 30.159 1.00 48.92  ? 68  GLU H N     1 
ATOM   5655  C  CA    . GLU H 4 72  ? -24.687 -26.220 30.342 1.00 49.73  ? 68  GLU H CA    1 
ATOM   5656  C  C     . GLU H 4 72  ? -23.408 -26.525 31.114 1.00 48.98  ? 68  GLU H C     1 
ATOM   5657  O  O     . GLU H 4 72  ? -22.327 -26.073 30.726 1.00 48.57  ? 68  GLU H O     1 
ATOM   5658  C  CB    . GLU H 4 72  ? -25.437 -25.044 30.972 1.00 50.23  ? 68  GLU H CB    1 
ATOM   5659  C  CG    . GLU H 4 72  ? -26.274 -24.248 29.947 1.00 55.24  ? 68  GLU H CG    1 
ATOM   5660  C  CD    . GLU H 4 72  ? -27.350 -23.328 30.578 1.00 60.83  ? 68  GLU H CD    1 
ATOM   5661  O  OE1   . GLU H 4 72  ? -27.491 -23.296 31.838 1.00 62.39  ? 68  GLU H OE1   1 
ATOM   5662  O  OE2   . GLU H 4 72  ? -28.061 -22.633 29.797 1.00 62.32  ? 68  GLU H OE2   1 
ATOM   5663  N  N     . ARG H 4 73  ? -23.529 -27.301 32.186 1.00 48.40  ? 69  ARG H N     1 
ATOM   5664  C  CA    . ARG H 4 73  ? -22.363 -27.684 32.961 1.00 48.12  ? 69  ARG H CA    1 
ATOM   5665  C  C     . ARG H 4 73  ? -21.408 -28.553 32.163 1.00 48.15  ? 69  ARG H C     1 
ATOM   5666  O  O     . ARG H 4 73  ? -20.209 -28.284 32.111 1.00 47.90  ? 69  ARG H O     1 
ATOM   5667  C  CB    . ARG H 4 73  ? -22.765 -28.389 34.248 1.00 48.11  ? 69  ARG H CB    1 
ATOM   5668  C  CG    . ARG H 4 73  ? -23.692 -27.593 35.154 1.00 47.84  ? 69  ARG H CG    1 
ATOM   5669  C  CD    . ARG H 4 73  ? -23.547 -28.108 36.545 1.00 47.33  ? 69  ARG H CD    1 
ATOM   5670  N  NE    . ARG H 4 73  ? -24.820 -28.281 37.227 1.00 47.54  ? 69  ARG H NE    1 
ATOM   5671  C  CZ    . ARG H 4 73  ? -24.971 -29.031 38.321 1.00 47.32  ? 69  ARG H CZ    1 
ATOM   5672  N  NH1   . ARG H 4 73  ? -23.934 -29.691 38.839 1.00 44.26  ? 69  ARG H NH1   1 
ATOM   5673  N  NH2   . ARG H 4 73  ? -26.166 -29.130 38.892 1.00 46.65  ? 69  ARG H NH2   1 
ATOM   5674  N  N     . ILE H 4 74  ? -21.936 -29.594 31.529 1.00 48.59  ? 70  ILE H N     1 
ATOM   5675  C  CA    . ILE H 4 74  ? -21.082 -30.471 30.741 1.00 49.02  ? 70  ILE H CA    1 
ATOM   5676  C  C     . ILE H 4 74  ? -20.407 -29.698 29.602 1.00 49.34  ? 70  ILE H C     1 
ATOM   5677  O  O     . ILE H 4 74  ? -19.190 -29.723 29.496 1.00 49.56  ? 70  ILE H O     1 
ATOM   5678  C  CB    . ILE H 4 74  ? -21.819 -31.718 30.235 1.00 48.88  ? 70  ILE H CB    1 
ATOM   5679  C  CG1   . ILE H 4 74  ? -22.109 -32.659 31.390 1.00 48.57  ? 70  ILE H CG1   1 
ATOM   5680  C  CG2   . ILE H 4 74  ? -20.962 -32.468 29.242 1.00 49.38  ? 70  ILE H CG2   1 
ATOM   5681  C  CD1   . ILE H 4 74  ? -23.089 -33.737 31.054 1.00 47.36  ? 70  ILE H CD1   1 
ATOM   5682  N  N     . ALA H 4 75  ? -21.199 -29.006 28.784 1.00 49.47  ? 71  ALA H N     1 
ATOM   5683  C  CA    . ALA H 4 75  ? -20.683 -28.187 27.693 1.00 49.90  ? 71  ALA H CA    1 
ATOM   5684  C  C     . ALA H 4 75  ? -19.646 -27.166 28.158 1.00 50.26  ? 71  ALA H C     1 
ATOM   5685  O  O     . ALA H 4 75  ? -18.562 -27.066 27.578 1.00 50.47  ? 71  ALA H O     1 
ATOM   5686  C  CB    . ALA H 4 75  ? -21.833 -27.485 26.972 1.00 49.87  ? 71  ALA H CB    1 
ATOM   5687  N  N     . GLY H 4 76  ? -19.980 -26.410 29.203 1.00 50.63  ? 72  GLY H N     1 
ATOM   5688  C  CA    . GLY H 4 76  ? -19.075 -25.401 29.749 1.00 51.00  ? 72  GLY H CA    1 
ATOM   5689  C  C     . GLY H 4 76  ? -17.734 -25.989 30.151 1.00 51.55  ? 72  GLY H C     1 
ATOM   5690  O  O     . GLY H 4 76  ? -16.674 -25.403 29.886 1.00 51.69  ? 72  GLY H O     1 
ATOM   5691  N  N     . GLU H 4 77  ? -17.768 -27.156 30.784 1.00 51.74  ? 73  GLU H N     1 
ATOM   5692  C  CA    . GLU H 4 77  ? -16.527 -27.817 31.140 1.00 52.50  ? 73  GLU H CA    1 
ATOM   5693  C  C     . GLU H 4 77  ? -15.770 -28.308 29.909 1.00 52.23  ? 73  GLU H C     1 
ATOM   5694  O  O     . GLU H 4 77  ? -14.551 -28.128 29.830 1.00 52.58  ? 73  GLU H O     1 
ATOM   5695  C  CB    . GLU H 4 77  ? -16.760 -28.953 32.125 1.00 52.76  ? 73  GLU H CB    1 
ATOM   5696  C  CG    . GLU H 4 77  ? -15.471 -29.599 32.572 1.00 55.69  ? 73  GLU H CG    1 
ATOM   5697  C  CD    . GLU H 4 77  ? -14.607 -28.663 33.399 1.00 60.12  ? 73  GLU H CD    1 
ATOM   5698  O  OE1   . GLU H 4 77  ? -13.525 -28.246 32.886 1.00 60.21  ? 73  GLU H OE1   1 
ATOM   5699  O  OE2   . GLU H 4 77  ? -15.023 -28.358 34.557 1.00 61.23  ? 73  GLU H OE2   1 
ATOM   5700  N  N     . ALA H 4 78  ? -16.483 -28.913 28.955 1.00 51.86  ? 74  ALA H N     1 
ATOM   5701  C  CA    . ALA H 4 78  ? -15.870 -29.375 27.700 1.00 51.72  ? 74  ALA H CA    1 
ATOM   5702  C  C     . ALA H 4 78  ? -15.204 -28.206 26.988 1.00 51.67  ? 74  ALA H C     1 
ATOM   5703  O  O     . ALA H 4 78  ? -14.067 -28.319 26.532 1.00 51.35  ? 74  ALA H O     1 
ATOM   5704  C  CB    . ALA H 4 78  ? -16.891 -30.046 26.798 1.00 51.44  ? 74  ALA H CB    1 
ATOM   5705  N  N     . SER H 4 79  ? -15.914 -27.077 26.940 1.00 51.69  ? 75  SER H N     1 
ATOM   5706  C  CA    . SER H 4 79  ? -15.400 -25.830 26.381 1.00 52.09  ? 75  SER H CA    1 
ATOM   5707  C  C     . SER H 4 79  ? -14.046 -25.435 26.975 1.00 52.62  ? 75  SER H C     1 
ATOM   5708  O  O     . SER H 4 79  ? -13.081 -25.209 26.245 1.00 53.04  ? 75  SER H O     1 
ATOM   5709  C  CB    . SER H 4 79  ? -16.411 -24.703 26.592 1.00 51.86  ? 75  SER H CB    1 
ATOM   5710  O  OG    . SER H 4 79  ? -15.866 -23.473 26.150 1.00 51.71  ? 75  SER H OG    1 
ATOM   5711  N  N     . ARG H 4 80  ? -13.980 -25.359 28.301 1.00 53.01  ? 76  ARG H N     1 
ATOM   5712  C  CA    . ARG H 4 80  ? -12.730 -25.115 28.995 1.00 53.51  ? 76  ARG H CA    1 
ATOM   5713  C  C     . ARG H 4 80  ? -11.619 -26.100 28.621 1.00 53.61  ? 76  ARG H C     1 
ATOM   5714  O  O     . ARG H 4 80  ? -10.494 -25.690 28.344 1.00 53.29  ? 76  ARG H O     1 
ATOM   5715  C  CB    . ARG H 4 80  ? -12.962 -25.111 30.501 1.00 53.87  ? 76  ARG H CB    1 
ATOM   5716  C  CG    . ARG H 4 80  ? -13.606 -23.827 31.005 1.00 54.53  ? 76  ARG H CG    1 
ATOM   5717  C  CD    . ARG H 4 80  ? -14.205 -23.974 32.410 1.00 55.20  ? 76  ARG H CD    1 
ATOM   5718  N  NE    . ARG H 4 80  ? -15.568 -23.438 32.415 1.00 55.63  ? 76  ARG H NE    1 
ATOM   5719  C  CZ    . ARG H 4 80  ? -16.642 -24.080 32.872 1.00 56.37  ? 76  ARG H CZ    1 
ATOM   5720  N  NH1   . ARG H 4 80  ? -16.532 -25.290 33.420 1.00 56.34  ? 76  ARG H NH1   1 
ATOM   5721  N  NH2   . ARG H 4 80  ? -17.834 -23.493 32.803 1.00 55.83  ? 76  ARG H NH2   1 
ATOM   5722  N  N     . LEU H 4 81  ? -11.934 -27.391 28.601 1.00 54.19  ? 77  LEU H N     1 
ATOM   5723  C  CA    . LEU H 4 81  ? -10.944 -28.393 28.205 1.00 55.16  ? 77  LEU H CA    1 
ATOM   5724  C  C     . LEU H 4 81  ? -10.311 -28.069 26.850 1.00 55.82  ? 77  LEU H C     1 
ATOM   5725  O  O     . LEU H 4 81  ? -9.078  -28.035 26.734 1.00 55.80  ? 77  LEU H O     1 
ATOM   5726  C  CB    . LEU H 4 81  ? -11.540 -29.801 28.178 1.00 54.74  ? 77  LEU H CB    1 
ATOM   5727  C  CG    . LEU H 4 81  ? -11.682 -30.507 29.516 1.00 54.05  ? 77  LEU H CG    1 
ATOM   5728  C  CD1   . LEU H 4 81  ? -12.699 -31.615 29.377 1.00 52.98  ? 77  LEU H CD1   1 
ATOM   5729  C  CD2   . LEU H 4 81  ? -10.337 -31.034 29.989 1.00 53.55  ? 77  LEU H CD2   1 
ATOM   5730  N  N     . ALA H 4 82  ? -11.151 -27.820 25.843 1.00 56.54  ? 78  ALA H N     1 
ATOM   5731  C  CA    . ALA H 4 82  ? -10.658 -27.471 24.515 1.00 57.93  ? 78  ALA H CA    1 
ATOM   5732  C  C     . ALA H 4 82  ? -9.728  -26.257 24.571 1.00 59.16  ? 78  ALA H C     1 
ATOM   5733  O  O     . ALA H 4 82  ? -8.578  -26.334 24.128 1.00 59.58  ? 78  ALA H O     1 
ATOM   5734  C  CB    . ALA H 4 82  ? -11.796 -27.235 23.565 1.00 57.77  ? 78  ALA H CB    1 
ATOM   5735  N  N     . HIS H 4 83  ? -10.211 -25.157 25.147 1.00 60.39  ? 79  HIS H N     1 
ATOM   5736  C  CA    . HIS H 4 83  ? -9.382  -23.971 25.345 1.00 62.05  ? 79  HIS H CA    1 
ATOM   5737  C  C     . HIS H 4 83  ? -8.066  -24.260 26.081 1.00 62.51  ? 79  HIS H C     1 
ATOM   5738  O  O     . HIS H 4 83  ? -7.008  -23.837 25.623 1.00 62.80  ? 79  HIS H O     1 
ATOM   5739  C  CB    . HIS H 4 83  ? -10.169 -22.843 26.029 1.00 62.36  ? 79  HIS H CB    1 
ATOM   5740  C  CG    . HIS H 4 83  ? -11.267 -22.269 25.178 1.00 65.84  ? 79  HIS H CG    1 
ATOM   5741  N  ND1   . HIS H 4 83  ? -11.033 -21.687 23.944 1.00 67.85  ? 79  HIS H ND1   1 
ATOM   5742  C  CD2   . HIS H 4 83  ? -12.605 -22.179 25.388 1.00 67.89  ? 79  HIS H CD2   1 
ATOM   5743  C  CE1   . HIS H 4 83  ? -12.180 -21.271 23.433 1.00 69.19  ? 79  HIS H CE1   1 
ATOM   5744  N  NE2   . HIS H 4 83  ? -13.149 -21.562 24.286 1.00 69.44  ? 79  HIS H NE2   1 
ATOM   5745  N  N     . TYR H 4 84  ? -8.116  -24.994 27.194 1.00 63.20  ? 80  TYR H N     1 
ATOM   5746  C  CA    . TYR H 4 84  ? -6.891  -25.306 27.931 1.00 64.15  ? 80  TYR H CA    1 
ATOM   5747  C  C     . TYR H 4 84  ? -5.881  -25.994 27.047 1.00 64.44  ? 80  TYR H C     1 
ATOM   5748  O  O     . TYR H 4 84  ? -4.689  -25.747 27.168 1.00 64.37  ? 80  TYR H O     1 
ATOM   5749  C  CB    . TYR H 4 84  ? -7.150  -26.194 29.151 1.00 64.38  ? 80  TYR H CB    1 
ATOM   5750  C  CG    . TYR H 4 84  ? -8.041  -25.583 30.204 1.00 65.86  ? 80  TYR H CG    1 
ATOM   5751  C  CD1   . TYR H 4 84  ? -8.174  -24.196 30.327 1.00 66.40  ? 80  TYR H CD1   1 
ATOM   5752  C  CD2   . TYR H 4 84  ? -8.740  -26.393 31.094 1.00 66.58  ? 80  TYR H CD2   1 
ATOM   5753  C  CE1   . TYR H 4 84  ? -8.988  -23.647 31.283 1.00 66.52  ? 80  TYR H CE1   1 
ATOM   5754  C  CE2   . TYR H 4 84  ? -9.552  -25.842 32.059 1.00 67.06  ? 80  TYR H CE2   1 
ATOM   5755  C  CZ    . TYR H 4 84  ? -9.670  -24.473 32.146 1.00 66.88  ? 80  TYR H CZ    1 
ATOM   5756  O  OH    . TYR H 4 84  ? -10.488 -23.928 33.106 1.00 69.04  ? 80  TYR H OH    1 
ATOM   5757  N  N     . ASN H 4 85  ? -6.374  -26.848 26.155 1.00 65.13  ? 81  ASN H N     1 
ATOM   5758  C  CA    . ASN H 4 85  ? -5.516  -27.646 25.286 1.00 65.78  ? 81  ASN H CA    1 
ATOM   5759  C  C     . ASN H 4 85  ? -5.356  -27.128 23.854 1.00 66.52  ? 81  ASN H C     1 
ATOM   5760  O  O     . ASN H 4 85  ? -4.962  -27.886 22.957 1.00 66.42  ? 81  ASN H O     1 
ATOM   5761  C  CB    . ASN H 4 85  ? -5.992  -29.092 25.290 1.00 65.68  ? 81  ASN H CB    1 
ATOM   5762  C  CG    . ASN H 4 85  ? -5.792  -29.744 26.628 1.00 65.50  ? 81  ASN H CG    1 
ATOM   5763  O  OD1   . ASN H 4 85  ? -4.659  -30.033 27.017 1.00 65.24  ? 81  ASN H OD1   1 
ATOM   5764  N  ND2   . ASN H 4 85  ? -6.884  -29.954 27.361 1.00 64.22  ? 81  ASN H ND2   1 
ATOM   5765  N  N     . LYS H 4 86  ? -5.656  -25.842 23.652 1.00 67.27  ? 82  LYS H N     1 
ATOM   5766  C  CA    . LYS H 4 86  ? -5.419  -25.169 22.380 1.00 68.13  ? 82  LYS H CA    1 
ATOM   5767  C  C     . LYS H 4 86  ? -5.989  -25.965 21.202 1.00 68.17  ? 82  LYS H C     1 
ATOM   5768  O  O     . LYS H 4 86  ? -5.332  -26.122 20.175 1.00 68.28  ? 82  LYS H O     1 
ATOM   5769  C  CB    . LYS H 4 86  ? -3.915  -24.927 22.189 1.00 68.44  ? 82  LYS H CB    1 
ATOM   5770  C  CG    . LYS H 4 86  ? -3.359  -23.771 23.004 1.00 70.49  ? 82  LYS H CG    1 
ATOM   5771  C  CD    . LYS H 4 86  ? -1.834  -23.844 23.116 1.00 73.04  ? 82  LYS H CD    1 
ATOM   5772  C  CE    . LYS H 4 86  ? -1.402  -24.452 24.452 1.00 74.67  ? 82  LYS H CE    1 
ATOM   5773  N  NZ    . LYS H 4 86  ? -0.008  -25.003 24.396 1.00 75.74  ? 82  LYS H NZ    1 
ATOM   5774  N  N     . ARG H 4 87  ? -7.201  -26.483 21.378 1.00 68.21  ? 83  ARG H N     1 
ATOM   5775  C  CA    . ARG H 4 87  ? -7.928  -27.160 20.313 1.00 68.50  ? 83  ARG H CA    1 
ATOM   5776  C  C     . ARG H 4 87  ? -9.135  -26.326 19.885 1.00 68.28  ? 83  ARG H C     1 
ATOM   5777  O  O     . ARG H 4 87  ? -9.674  -25.552 20.675 1.00 68.37  ? 83  ARG H O     1 
ATOM   5778  C  CB    . ARG H 4 87  ? -8.399  -28.536 20.776 1.00 68.68  ? 83  ARG H CB    1 
ATOM   5779  C  CG    . ARG H 4 87  ? -7.289  -29.487 21.168 1.00 70.71  ? 83  ARG H CG    1 
ATOM   5780  C  CD    . ARG H 4 87  ? -6.748  -30.260 19.986 1.00 73.36  ? 83  ARG H CD    1 
ATOM   5781  N  NE    . ARG H 4 87  ? -5.824  -31.312 20.406 1.00 76.25  ? 83  ARG H NE    1 
ATOM   5782  C  CZ    . ARG H 4 87  ? -4.506  -31.157 20.546 1.00 77.00  ? 83  ARG H CZ    1 
ATOM   5783  N  NH1   . ARG H 4 87  ? -3.934  -29.984 20.299 1.00 76.93  ? 83  ARG H NH1   1 
ATOM   5784  N  NH2   . ARG H 4 87  ? -3.756  -32.184 20.930 1.00 77.34  ? 83  ARG H NH2   1 
ATOM   5785  N  N     . SER H 4 88  ? -9.566  -26.501 18.641 1.00 68.09  ? 84  SER H N     1 
ATOM   5786  C  CA    . SER H 4 88  ? -10.676 -25.740 18.095 1.00 68.07  ? 84  SER H CA    1 
ATOM   5787  C  C     . SER H 4 88  ? -11.993 -26.502 18.153 1.00 68.03  ? 84  SER H C     1 
ATOM   5788  O  O     . SER H 4 88  ? -13.055 -25.928 17.883 1.00 68.17  ? 84  SER H O     1 
ATOM   5789  C  CB    . SER H 4 88  ? -10.380 -25.349 16.647 1.00 68.38  ? 84  SER H CB    1 
ATOM   5790  O  OG    . SER H 4 88  ? -9.346  -24.380 16.565 1.00 69.39  ? 84  SER H OG    1 
ATOM   5791  N  N     . THR H 4 89  ? -11.928 -27.785 18.508 1.00 67.62  ? 85  THR H N     1 
ATOM   5792  C  CA    . THR H 4 89  ? -13.096 -28.660 18.453 1.00 67.25  ? 85  THR H CA    1 
ATOM   5793  C  C     . THR H 4 89  ? -13.491 -29.259 19.814 1.00 66.86  ? 85  THR H C     1 
ATOM   5794  O  O     . THR H 4 89  ? -12.635 -29.612 20.632 1.00 66.84  ? 85  THR H O     1 
ATOM   5795  C  CB    . THR H 4 89  ? -12.862 -29.816 17.446 1.00 67.34  ? 85  THR H CB    1 
ATOM   5796  O  OG1   . THR H 4 89  ? -12.207 -29.305 16.286 1.00 68.70  ? 85  THR H OG1   1 
ATOM   5797  C  CG2   . THR H 4 89  ? -14.172 -30.478 17.024 1.00 66.87  ? 85  THR H CG2   1 
ATOM   5798  N  N     . ILE H 4 90  ? -14.800 -29.373 20.033 1.00 66.22  ? 86  ILE H N     1 
ATOM   5799  C  CA    . ILE H 4 90  ? -15.344 -30.151 21.131 1.00 65.55  ? 86  ILE H CA    1 
ATOM   5800  C  C     . ILE H 4 90  ? -15.740 -31.523 20.598 1.00 65.37  ? 86  ILE H C     1 
ATOM   5801  O  O     . ILE H 4 90  ? -16.763 -31.681 19.925 1.00 65.18  ? 86  ILE H O     1 
ATOM   5802  C  CB    . ILE H 4 90  ? -16.546 -29.441 21.811 1.00 65.63  ? 86  ILE H CB    1 
ATOM   5803  C  CG1   . ILE H 4 90  ? -16.042 -28.286 22.691 1.00 65.63  ? 86  ILE H CG1   1 
ATOM   5804  C  CG2   . ILE H 4 90  ? -17.364 -30.429 22.649 1.00 64.94  ? 86  ILE H CG2   1 
ATOM   5805  C  CD1   . ILE H 4 90  ? -17.135 -27.416 23.294 1.00 64.96  ? 86  ILE H CD1   1 
ATOM   5806  N  N     . THR H 4 91  ? -14.902 -32.511 20.897 1.00 65.06  ? 87  THR H N     1 
ATOM   5807  C  CA    . THR H 4 91  ? -15.166 -33.891 20.512 1.00 64.42  ? 87  THR H CA    1 
ATOM   5808  C  C     . THR H 4 91  ? -15.705 -34.668 21.712 1.00 64.11  ? 87  THR H C     1 
ATOM   5809  O  O     . THR H 4 91  ? -15.676 -34.178 22.847 1.00 64.30  ? 87  THR H O     1 
ATOM   5810  C  CB    . THR H 4 91  ? -13.901 -34.604 19.976 1.00 63.95  ? 87  THR H CB    1 
ATOM   5811  O  OG1   . THR H 4 91  ? -13.183 -35.186 21.064 1.00 65.09  ? 87  THR H OG1   1 
ATOM   5812  C  CG2   . THR H 4 91  ? -12.999 -33.649 19.235 1.00 64.35  ? 87  THR H CG2   1 
ATOM   5813  N  N     . SER H 4 92  ? -16.170 -35.888 21.460 1.00 63.39  ? 88  SER H N     1 
ATOM   5814  C  CA    . SER H 4 92  ? -16.742 -36.720 22.500 1.00 63.04  ? 88  SER H CA    1 
ATOM   5815  C  C     . SER H 4 92  ? -15.724 -36.957 23.615 1.00 62.44  ? 88  SER H C     1 
ATOM   5816  O  O     . SER H 4 92  ? -16.075 -37.302 24.740 1.00 62.55  ? 88  SER H O     1 
ATOM   5817  C  CB    . SER H 4 92  ? -17.222 -38.044 21.909 1.00 63.12  ? 88  SER H CB    1 
ATOM   5818  O  OG    . SER H 4 92  ? -16.147 -38.711 21.278 1.00 64.00  ? 88  SER H OG    1 
ATOM   5819  N  N     . ARG H 4 93  ? -14.458 -36.746 23.301 1.00 61.57  ? 89  ARG H N     1 
ATOM   5820  C  CA    . ARG H 4 93  ? -13.424 -36.896 24.288 1.00 61.07  ? 89  ARG H CA    1 
ATOM   5821  C  C     . ARG H 4 93  ? -13.502 -35.792 25.352 1.00 60.34  ? 89  ARG H C     1 
ATOM   5822  O  O     . ARG H 4 93  ? -13.307 -36.039 26.546 1.00 59.98  ? 89  ARG H O     1 
ATOM   5823  C  CB    . ARG H 4 93  ? -12.068 -36.904 23.601 1.00 61.34  ? 89  ARG H CB    1 
ATOM   5824  C  CG    . ARG H 4 93  ? -11.057 -37.721 24.355 1.00 63.40  ? 89  ARG H CG    1 
ATOM   5825  C  CD    . ARG H 4 93  ? -9.734  -37.708 23.653 1.00 66.56  ? 89  ARG H CD    1 
ATOM   5826  N  NE    . ARG H 4 93  ? -8.684  -38.078 24.596 1.00 68.77  ? 89  ARG H NE    1 
ATOM   5827  C  CZ    . ARG H 4 93  ? -7.885  -37.207 25.194 1.00 69.80  ? 89  ARG H CZ    1 
ATOM   5828  N  NH1   . ARG H 4 93  ? -8.008  -35.910 24.942 1.00 69.93  ? 89  ARG H NH1   1 
ATOM   5829  N  NH2   . ARG H 4 93  ? -6.957  -37.637 26.036 1.00 72.16  ? 89  ARG H NH2   1 
ATOM   5830  N  N     . GLU H 4 94  ? -13.795 -34.573 24.907 1.00 59.64  ? 90  GLU H N     1 
ATOM   5831  C  CA    . GLU H 4 94  ? -14.017 -33.460 25.816 1.00 58.59  ? 90  GLU H CA    1 
ATOM   5832  C  C     . GLU H 4 94  ? -15.265 -33.703 26.644 1.00 57.77  ? 90  GLU H C     1 
ATOM   5833  O  O     . GLU H 4 94  ? -15.237 -33.508 27.863 1.00 57.93  ? 90  GLU H O     1 
ATOM   5834  C  CB    . GLU H 4 94  ? -14.122 -32.134 25.059 1.00 58.90  ? 90  GLU H CB    1 
ATOM   5835  C  CG    . GLU H 4 94  ? -12.784 -31.581 24.591 1.00 59.64  ? 90  GLU H CG    1 
ATOM   5836  C  CD    . GLU H 4 94  ? -12.074 -32.503 23.601 1.00 61.62  ? 90  GLU H CD    1 
ATOM   5837  O  OE1   . GLU H 4 94  ? -12.762 -33.059 22.701 1.00 60.00  ? 90  GLU H OE1   1 
ATOM   5838  O  OE2   . GLU H 4 94  ? -10.834 -32.672 23.739 1.00 61.44  ? 90  GLU H OE2   1 
ATOM   5839  N  N     . ILE H 4 95  ? -16.347 -34.139 25.996 1.00 56.39  ? 91  ILE H N     1 
ATOM   5840  C  CA    . ILE H 4 95  ? -17.577 -34.479 26.720 1.00 55.50  ? 91  ILE H CA    1 
ATOM   5841  C  C     . ILE H 4 95  ? -17.324 -35.535 27.785 1.00 54.96  ? 91  ILE H C     1 
ATOM   5842  O  O     . ILE H 4 95  ? -17.805 -35.405 28.914 1.00 55.27  ? 91  ILE H O     1 
ATOM   5843  C  CB    . ILE H 4 95  ? -18.703 -34.984 25.803 1.00 55.52  ? 91  ILE H CB    1 
ATOM   5844  C  CG1   . ILE H 4 95  ? -18.996 -33.990 24.672 1.00 55.48  ? 91  ILE H CG1   1 
ATOM   5845  C  CG2   . ILE H 4 95  ? -19.960 -35.291 26.611 1.00 54.62  ? 91  ILE H CG2   1 
ATOM   5846  C  CD1   . ILE H 4 95  ? -19.516 -32.629 25.106 1.00 55.27  ? 91  ILE H CD1   1 
ATOM   5847  N  N     . GLN H 4 96  ? -16.555 -36.562 27.427 1.00 54.04  ? 92  GLN H N     1 
ATOM   5848  C  CA    . GLN H 4 96  ? -16.196 -37.639 28.357 1.00 53.16  ? 92  GLN H CA    1 
ATOM   5849  C  C     . GLN H 4 96  ? -15.445 -37.106 29.589 1.00 52.39  ? 92  GLN H C     1 
ATOM   5850  O  O     . GLN H 4 96  ? -15.922 -37.243 30.711 1.00 51.78  ? 92  GLN H O     1 
ATOM   5851  C  CB    . GLN H 4 96  ? -15.399 -38.734 27.637 1.00 52.95  ? 92  GLN H CB    1 
ATOM   5852  C  CG    . GLN H 4 96  ? -14.908 -39.829 28.565 1.00 53.78  ? 92  GLN H CG    1 
ATOM   5853  C  CD    . GLN H 4 96  ? -14.700 -41.167 27.877 1.00 52.87  ? 92  GLN H CD    1 
ATOM   5854  O  OE1   . GLN H 4 96  ? -13.573 -41.623 27.742 1.00 53.31  ? 92  GLN H OE1   1 
ATOM   5855  N  NE2   . GLN H 4 96  ? -15.784 -41.802 27.455 1.00 51.47  ? 92  GLN H NE2   1 
ATOM   5856  N  N     . THR H 4 97  ? -14.298 -36.471 29.363 1.00 51.86  ? 93  THR H N     1 
ATOM   5857  C  CA    . THR H 4 97  ? -13.524 -35.871 30.437 1.00 51.78  ? 93  THR H CA    1 
ATOM   5858  C  C     . THR H 4 97  ? -14.390 -34.933 31.287 1.00 51.92  ? 93  THR H C     1 
ATOM   5859  O  O     . THR H 4 97  ? -14.313 -34.967 32.519 1.00 51.80  ? 93  THR H O     1 
ATOM   5860  C  CB    . THR H 4 97  ? -12.337 -35.105 29.885 1.00 51.63  ? 93  THR H CB    1 
ATOM   5861  O  OG1   . THR H 4 97  ? -11.577 -35.972 29.046 1.00 52.23  ? 93  THR H OG1   1 
ATOM   5862  C  CG2   . THR H 4 97  ? -11.448 -34.588 31.012 1.00 51.36  ? 93  THR H CG2   1 
ATOM   5863  N  N     . ALA H 4 98  ? -15.219 -34.127 30.618 1.00 51.76  ? 94  ALA H N     1 
ATOM   5864  C  CA    . ALA H 4 98  ? -16.175 -33.237 31.268 1.00 51.91  ? 94  ALA H CA    1 
ATOM   5865  C  C     . ALA H 4 98  ? -17.110 -33.987 32.216 1.00 52.31  ? 94  ALA H C     1 
ATOM   5866  O  O     . ALA H 4 98  ? -17.367 -33.518 33.345 1.00 52.30  ? 94  ALA H O     1 
ATOM   5867  C  CB    . ALA H 4 98  ? -16.994 -32.497 30.225 1.00 51.95  ? 94  ALA H CB    1 
ATOM   5868  N  N     . VAL H 4 99  ? -17.633 -35.133 31.752 1.00 51.98  ? 95  VAL H N     1 
ATOM   5869  C  CA    . VAL H 4 99  ? -18.541 -35.940 32.561 1.00 51.51  ? 95  VAL H CA    1 
ATOM   5870  C  C     . VAL H 4 99  ? -17.783 -36.449 33.791 1.00 51.87  ? 95  VAL H C     1 
ATOM   5871  O  O     . VAL H 4 99  ? -18.281 -36.375 34.915 1.00 51.73  ? 95  VAL H O     1 
ATOM   5872  C  CB    . VAL H 4 99  ? -19.168 -37.093 31.727 1.00 51.57  ? 95  VAL H CB    1 
ATOM   5873  C  CG1   . VAL H 4 99  ? -19.798 -38.171 32.613 1.00 50.25  ? 95  VAL H CG1   1 
ATOM   5874  C  CG2   . VAL H 4 99  ? -20.211 -36.538 30.755 1.00 51.21  ? 95  VAL H CG2   1 
ATOM   5875  N  N     . ARG H 4 100 ? -16.559 -36.924 33.575 1.00 52.03  ? 96  ARG H N     1 
ATOM   5876  C  CA    . ARG H 4 100 ? -15.757 -37.437 34.669 1.00 52.45  ? 96  ARG H CA    1 
ATOM   5877  C  C     . ARG H 4 100 ? -15.464 -36.353 35.693 1.00 52.06  ? 96  ARG H C     1 
ATOM   5878  O  O     . ARG H 4 100 ? -15.343 -36.648 36.878 1.00 52.61  ? 96  ARG H O     1 
ATOM   5879  C  CB    . ARG H 4 100 ? -14.447 -38.060 34.171 1.00 52.63  ? 96  ARG H CB    1 
ATOM   5880  C  CG    . ARG H 4 100 ? -14.609 -39.366 33.430 1.00 54.45  ? 96  ARG H CG    1 
ATOM   5881  C  CD    . ARG H 4 100 ? -13.313 -40.157 33.414 1.00 57.70  ? 96  ARG H CD    1 
ATOM   5882  N  NE    . ARG H 4 100 ? -13.499 -41.514 32.878 1.00 61.97  ? 96  ARG H NE    1 
ATOM   5883  C  CZ    . ARG H 4 100 ? -13.112 -41.919 31.655 1.00 63.12  ? 96  ARG H CZ    1 
ATOM   5884  N  NH1   . ARG H 4 100 ? -12.510 -41.074 30.811 1.00 61.38  ? 96  ARG H NH1   1 
ATOM   5885  N  NH2   . ARG H 4 100 ? -13.329 -43.180 31.271 1.00 61.63  ? 96  ARG H NH2   1 
ATOM   5886  N  N     . LEU H 4 101 ? -15.347 -35.110 35.235 1.00 51.16  ? 97  LEU H N     1 
ATOM   5887  C  CA    . LEU H 4 101 ? -15.027 -34.003 36.130 1.00 50.55  ? 97  LEU H CA    1 
ATOM   5888  C  C     . LEU H 4 101 ? -16.241 -33.548 36.946 1.00 50.68  ? 97  LEU H C     1 
ATOM   5889  O  O     . LEU H 4 101 ? -16.114 -33.103 38.070 1.00 50.46  ? 97  LEU H O     1 
ATOM   5890  C  CB    . LEU H 4 101 ? -14.414 -32.839 35.337 1.00 50.01  ? 97  LEU H CB    1 
ATOM   5891  C  CG    . LEU H 4 101 ? -12.973 -33.034 34.850 1.00 47.98  ? 97  LEU H CG    1 
ATOM   5892  C  CD1   . LEU H 4 101 ? -12.600 -31.960 33.879 1.00 47.33  ? 97  LEU H CD1   1 
ATOM   5893  C  CD2   . LEU H 4 101 ? -12.004 -33.049 36.010 1.00 47.10  ? 97  LEU H CD2   1 
ATOM   5894  N  N     . LEU H 4 102 ? -17.420 -33.708 36.373 1.00 51.46  ? 98  LEU H N     1 
ATOM   5895  C  CA    . LEU H 4 102 ? -18.632 -33.154 36.929 1.00 51.83  ? 98  LEU H CA    1 
ATOM   5896  C  C     . LEU H 4 102 ? -19.434 -34.133 37.723 1.00 51.84  ? 98  LEU H C     1 
ATOM   5897  O  O     . LEU H 4 102 ? -19.987 -33.783 38.757 1.00 52.15  ? 98  LEU H O     1 
ATOM   5898  C  CB    . LEU H 4 102 ? -19.510 -32.617 35.807 1.00 52.09  ? 98  LEU H CB    1 
ATOM   5899  C  CG    . LEU H 4 102 ? -19.110 -31.206 35.409 1.00 53.26  ? 98  LEU H CG    1 
ATOM   5900  C  CD1   . LEU H 4 102 ? -19.531 -30.974 33.989 1.00 54.25  ? 98  LEU H CD1   1 
ATOM   5901  C  CD2   . LEU H 4 102 ? -19.747 -30.182 36.362 1.00 54.05  ? 98  LEU H CD2   1 
ATOM   5902  N  N     . LEU H 4 103 ? -19.529 -35.358 37.229 1.00 52.24  ? 99  LEU H N     1 
ATOM   5903  C  CA    . LEU H 4 103 ? -20.398 -36.353 37.856 1.00 52.29  ? 99  LEU H CA    1 
ATOM   5904  C  C     . LEU H 4 103 ? -19.683 -37.091 38.992 1.00 52.98  ? 99  LEU H C     1 
ATOM   5905  O  O     . LEU H 4 103 ? -18.463 -37.316 38.925 1.00 53.46  ? 99  LEU H O     1 
ATOM   5906  C  CB    . LEU H 4 103 ? -20.989 -37.319 36.818 1.00 51.62  ? 99  LEU H CB    1 
ATOM   5907  C  CG    . LEU H 4 103 ? -21.784 -36.768 35.606 1.00 50.91  ? 99  LEU H CG    1 
ATOM   5908  C  CD1   . LEU H 4 103 ? -22.759 -37.818 35.083 1.00 51.02  ? 99  LEU H CD1   1 
ATOM   5909  C  CD2   . LEU H 4 103 ? -22.559 -35.493 35.878 1.00 48.89  ? 99  LEU H CD2   1 
ATOM   5910  N  N     . PRO H 4 104 ? -20.430 -37.411 40.065 1.00 53.38  ? 100 PRO H N     1 
ATOM   5911  C  CA    . PRO H 4 104 ? -19.949 -38.257 41.145 1.00 53.87  ? 100 PRO H CA    1 
ATOM   5912  C  C     . PRO H 4 104 ? -19.622 -39.668 40.654 1.00 55.03  ? 100 PRO H C     1 
ATOM   5913  O  O     . PRO H 4 104 ? -20.340 -40.206 39.801 1.00 55.15  ? 100 PRO H O     1 
ATOM   5914  C  CB    . PRO H 4 104 ? -21.133 -38.311 42.111 1.00 53.87  ? 100 PRO H CB    1 
ATOM   5915  C  CG    . PRO H 4 104 ? -21.967 -37.118 41.802 1.00 53.46  ? 100 PRO H CG    1 
ATOM   5916  C  CD    . PRO H 4 104 ? -21.747 -36.810 40.364 1.00 53.58  ? 100 PRO H CD    1 
ATOM   5917  N  N     . GLY H 4 105 ? -18.540 -40.238 41.204 1.00 56.05  ? 101 GLY H N     1 
ATOM   5918  C  CA    . GLY H 4 105 ? -18.056 -41.599 40.927 1.00 56.89  ? 101 GLY H CA    1 
ATOM   5919  C  C     . GLY H 4 105 ? -18.909 -42.564 40.106 1.00 57.82  ? 101 GLY H C     1 
ATOM   5920  O  O     . GLY H 4 105 ? -18.595 -42.851 38.946 1.00 57.83  ? 101 GLY H O     1 
ATOM   5921  N  N     . GLU H 4 106 ? -19.979 -43.077 40.703 1.00 58.25  ? 102 GLU H N     1 
ATOM   5922  C  CA    . GLU H 4 106 ? -20.735 -44.155 40.084 1.00 59.08  ? 102 GLU H CA    1 
ATOM   5923  C  C     . GLU H 4 106 ? -21.631 -43.652 38.966 1.00 59.17  ? 102 GLU H C     1 
ATOM   5924  O  O     . GLU H 4 106 ? -21.867 -44.357 37.987 1.00 59.17  ? 102 GLU H O     1 
ATOM   5925  C  CB    . GLU H 4 106 ? -21.549 -44.896 41.136 1.00 59.29  ? 102 GLU H CB    1 
ATOM   5926  C  CG    . GLU H 4 106 ? -22.014 -46.281 40.725 1.00 62.54  ? 102 GLU H CG    1 
ATOM   5927  C  CD    . GLU H 4 106 ? -20.922 -47.363 40.823 1.00 66.39  ? 102 GLU H CD    1 
ATOM   5928  O  OE1   . GLU H 4 106 ? -21.305 -48.554 40.709 1.00 68.14  ? 102 GLU H OE1   1 
ATOM   5929  O  OE2   . GLU H 4 106 ? -19.712 -47.042 41.002 1.00 65.62  ? 102 GLU H OE2   1 
ATOM   5930  N  N     . LEU H 4 107 ? -22.120 -42.425 39.120 1.00 59.50  ? 103 LEU H N     1 
ATOM   5931  C  CA    . LEU H 4 107 ? -22.928 -41.763 38.105 1.00 59.66  ? 103 LEU H CA    1 
ATOM   5932  C  C     . LEU H 4 107 ? -22.058 -41.469 36.881 1.00 60.25  ? 103 LEU H C     1 
ATOM   5933  O  O     . LEU H 4 107 ? -22.504 -41.597 35.740 1.00 60.63  ? 103 LEU H O     1 
ATOM   5934  C  CB    . LEU H 4 107 ? -23.488 -40.464 38.679 1.00 59.27  ? 103 LEU H CB    1 
ATOM   5935  C  CG    . LEU H 4 107 ? -24.966 -40.089 38.553 1.00 58.93  ? 103 LEU H CG    1 
ATOM   5936  C  CD1   . LEU H 4 107 ? -25.916 -41.275 38.538 1.00 58.35  ? 103 LEU H CD1   1 
ATOM   5937  C  CD2   . LEU H 4 107 ? -25.337 -39.163 39.694 1.00 59.26  ? 103 LEU H CD2   1 
ATOM   5938  N  N     . ALA H 4 108 ? -20.807 -41.094 37.118 1.00 60.77  ? 104 ALA H N     1 
ATOM   5939  C  CA    . ALA H 4 108 ? -19.883 -40.843 36.029 1.00 61.46  ? 104 ALA H CA    1 
ATOM   5940  C  C     . ALA H 4 108 ? -19.659 -42.122 35.238 1.00 62.17  ? 104 ALA H C     1 
ATOM   5941  O  O     . ALA H 4 108 ? -19.715 -42.108 34.009 1.00 62.55  ? 104 ALA H O     1 
ATOM   5942  C  CB    . ALA H 4 108 ? -18.566 -40.308 36.555 1.00 61.43  ? 104 ALA H CB    1 
ATOM   5943  N  N     . LYS H 4 109 ? -19.422 -43.226 35.944 1.00 62.61  ? 105 LYS H N     1 
ATOM   5944  C  CA    . LYS H 4 109 ? -19.070 -44.478 35.296 1.00 63.42  ? 105 LYS H CA    1 
ATOM   5945  C  C     . LYS H 4 109 ? -20.136 -44.886 34.271 1.00 63.32  ? 105 LYS H C     1 
ATOM   5946  O  O     . LYS H 4 109 ? -19.821 -45.146 33.102 1.00 62.73  ? 105 LYS H O     1 
ATOM   5947  C  CB    . LYS H 4 109 ? -18.879 -45.574 36.341 1.00 63.75  ? 105 LYS H CB    1 
ATOM   5948  C  CG    . LYS H 4 109 ? -18.330 -46.888 35.795 1.00 66.14  ? 105 LYS H CG    1 
ATOM   5949  C  CD    . LYS H 4 109 ? -17.820 -47.793 36.933 1.00 70.53  ? 105 LYS H CD    1 
ATOM   5950  C  CE    . LYS H 4 109 ? -18.942 -48.689 37.481 1.00 73.69  ? 105 LYS H CE    1 
ATOM   5951  N  NZ    . LYS H 4 109 ? -18.894 -48.786 38.981 1.00 75.61  ? 105 LYS H NZ    1 
ATOM   5952  N  N     . HIS H 4 110 ? -21.389 -44.917 34.723 1.00 63.47  ? 106 HIS H N     1 
ATOM   5953  C  CA    . HIS H 4 110 ? -22.501 -45.380 33.909 1.00 63.74  ? 106 HIS H CA    1 
ATOM   5954  C  C     . HIS H 4 110 ? -22.743 -44.428 32.750 1.00 63.78  ? 106 HIS H C     1 
ATOM   5955  O  O     . HIS H 4 110 ? -23.024 -44.868 31.626 1.00 64.09  ? 106 HIS H O     1 
ATOM   5956  C  CB    . HIS H 4 110 ? -23.769 -45.512 34.749 1.00 63.82  ? 106 HIS H CB    1 
ATOM   5957  C  CG    . HIS H 4 110 ? -23.760 -46.683 35.683 1.00 64.87  ? 106 HIS H CG    1 
ATOM   5958  N  ND1   . HIS H 4 110 ? -23.976 -47.976 35.261 1.00 65.96  ? 106 HIS H ND1   1 
ATOM   5959  C  CD2   . HIS H 4 110 ? -23.584 -46.754 37.023 1.00 66.22  ? 106 HIS H CD2   1 
ATOM   5960  C  CE1   . HIS H 4 110 ? -23.919 -48.794 36.296 1.00 66.38  ? 106 HIS H CE1   1 
ATOM   5961  N  NE2   . HIS H 4 110 ? -23.683 -48.077 37.378 1.00 66.45  ? 106 HIS H NE2   1 
ATOM   5962  N  N     . ALA H 4 111 ? -22.616 -43.125 33.025 1.00 63.35  ? 107 ALA H N     1 
ATOM   5963  C  CA    . ALA H 4 111 ? -22.841 -42.091 32.012 1.00 62.59  ? 107 ALA H CA    1 
ATOM   5964  C  C     . ALA H 4 111 ? -21.837 -42.227 30.889 1.00 62.07  ? 107 ALA H C     1 
ATOM   5965  O  O     . ALA H 4 111 ? -22.174 -42.047 29.729 1.00 61.57  ? 107 ALA H O     1 
ATOM   5966  C  CB    . ALA H 4 111 ? -22.759 -40.713 32.629 1.00 62.59  ? 107 ALA H CB    1 
ATOM   5967  N  N     . VAL H 4 112 ? -20.603 -42.550 31.262 1.00 62.04  ? 108 VAL H N     1 
ATOM   5968  C  CA    . VAL H 4 112 ? -19.509 -42.759 30.327 1.00 62.20  ? 108 VAL H CA    1 
ATOM   5969  C  C     . VAL H 4 112 ? -19.786 -43.972 29.441 1.00 62.89  ? 108 VAL H C     1 
ATOM   5970  O  O     . VAL H 4 112 ? -19.579 -43.933 28.223 1.00 62.89  ? 108 VAL H O     1 
ATOM   5971  C  CB    . VAL H 4 112 ? -18.176 -42.898 31.084 1.00 61.96  ? 108 VAL H CB    1 
ATOM   5972  C  CG1   . VAL H 4 112 ? -17.103 -43.544 30.229 1.00 60.97  ? 108 VAL H CG1   1 
ATOM   5973  C  CG2   . VAL H 4 112 ? -17.730 -41.532 31.579 1.00 61.45  ? 108 VAL H CG2   1 
ATOM   5974  N  N     . SER H 4 113 ? -20.286 -45.036 30.051 1.00 63.39  ? 109 SER H N     1 
ATOM   5975  C  CA    . SER H 4 113 ? -20.570 -46.236 29.301 1.00 64.28  ? 109 SER H CA    1 
ATOM   5976  C  C     . SER H 4 113 ? -21.767 -46.004 28.388 1.00 64.69  ? 109 SER H C     1 
ATOM   5977  O  O     . SER H 4 113 ? -21.739 -46.391 27.220 1.00 64.79  ? 109 SER H O     1 
ATOM   5978  C  CB    . SER H 4 113 ? -20.787 -47.420 30.232 1.00 64.25  ? 109 SER H CB    1 
ATOM   5979  O  OG    . SER H 4 113 ? -22.008 -47.307 30.929 1.00 65.75  ? 109 SER H OG    1 
ATOM   5980  N  N     . GLU H 4 114 ? -22.797 -45.332 28.897 1.00 65.19  ? 110 GLU H N     1 
ATOM   5981  C  CA    . GLU H 4 114 ? -23.938 -44.970 28.052 1.00 65.83  ? 110 GLU H CA    1 
ATOM   5982  C  C     . GLU H 4 114 ? -23.535 -44.102 26.871 1.00 66.06  ? 110 GLU H C     1 
ATOM   5983  O  O     . GLU H 4 114 ? -24.154 -44.166 25.814 1.00 66.19  ? 110 GLU H O     1 
ATOM   5984  C  CB    . GLU H 4 114 ? -25.025 -44.265 28.851 1.00 65.65  ? 110 GLU H CB    1 
ATOM   5985  C  CG    . GLU H 4 114 ? -25.737 -45.162 29.850 1.00 67.60  ? 110 GLU H CG    1 
ATOM   5986  C  CD    . GLU H 4 114 ? -26.562 -46.266 29.213 1.00 69.36  ? 110 GLU H CD    1 
ATOM   5987  O  OE1   . GLU H 4 114 ? -27.010 -46.099 28.054 1.00 72.47  ? 110 GLU H OE1   1 
ATOM   5988  O  OE2   . GLU H 4 114 ? -26.778 -47.303 29.881 1.00 69.63  ? 110 GLU H OE2   1 
ATOM   5989  N  N     . GLY H 4 115 ? -22.499 -43.293 27.059 1.00 66.45  ? 111 GLY H N     1 
ATOM   5990  C  CA    . GLY H 4 115 ? -22.081 -42.342 26.047 1.00 67.22  ? 111 GLY H CA    1 
ATOM   5991  C  C     . GLY H 4 115 ? -21.286 -43.041 24.976 1.00 67.85  ? 111 GLY H C     1 
ATOM   5992  O  O     . GLY H 4 115 ? -21.565 -42.890 23.794 1.00 67.65  ? 111 GLY H O     1 
ATOM   5993  N  N     . THR H 4 116 ? -20.304 -43.823 25.406 1.00 68.77  ? 112 THR H N     1 
ATOM   5994  C  CA    . THR H 4 116 ? -19.482 -44.623 24.509 1.00 69.86  ? 112 THR H CA    1 
ATOM   5995  C  C     . THR H 4 116 ? -20.339 -45.631 23.735 1.00 70.80  ? 112 THR H C     1 
ATOM   5996  O  O     . THR H 4 116 ? -20.114 -45.867 22.546 1.00 70.18  ? 112 THR H O     1 
ATOM   5997  C  CB    . THR H 4 116 ? -18.387 -45.341 25.296 1.00 69.74  ? 112 THR H CB    1 
ATOM   5998  O  OG1   . THR H 4 116 ? -17.595 -44.361 25.973 1.00 69.49  ? 112 THR H OG1   1 
ATOM   5999  C  CG2   . THR H 4 116 ? -17.486 -46.141 24.370 1.00 69.94  ? 112 THR H CG2   1 
ATOM   6000  N  N     . LYS H 4 117 ? -21.329 -46.200 24.423 1.00 72.18  ? 113 LYS H N     1 
ATOM   6001  C  CA    . LYS H 4 117 ? -22.271 -47.118 23.810 1.00 73.65  ? 113 LYS H CA    1 
ATOM   6002  C  C     . LYS H 4 117 ? -22.940 -46.401 22.653 1.00 74.45  ? 113 LYS H C     1 
ATOM   6003  O  O     . LYS H 4 117 ? -22.864 -46.853 21.503 1.00 75.01  ? 113 LYS H O     1 
ATOM   6004  C  CB    . LYS H 4 117 ? -23.321 -47.573 24.823 1.00 73.65  ? 113 LYS H CB    1 
ATOM   6005  C  CG    . LYS H 4 117 ? -23.885 -48.945 24.557 1.00 74.59  ? 113 LYS H CG    1 
ATOM   6006  C  CD    . LYS H 4 117 ? -24.920 -49.326 25.614 1.00 76.79  ? 113 LYS H CD    1 
ATOM   6007  C  CE    . LYS H 4 117 ? -26.342 -49.027 25.149 1.00 77.06  ? 113 LYS H CE    1 
ATOM   6008  N  NZ    . LYS H 4 117 ? -27.253 -48.803 26.310 1.00 79.29  ? 113 LYS H NZ    1 
ATOM   6009  N  N     . ALA H 4 118 ? -23.565 -45.266 22.958 1.00 75.15  ? 114 ALA H N     1 
ATOM   6010  C  CA    . ALA H 4 118 ? -24.293 -44.495 21.958 1.00 75.96  ? 114 ALA H CA    1 
ATOM   6011  C  C     . ALA H 4 118 ? -23.418 -44.122 20.754 1.00 76.56  ? 114 ALA H C     1 
ATOM   6012  O  O     . ALA H 4 118 ? -23.893 -44.116 19.617 1.00 76.66  ? 114 ALA H O     1 
ATOM   6013  C  CB    . ALA H 4 118 ? -24.901 -43.255 22.587 1.00 75.82  ? 114 ALA H CB    1 
ATOM   6014  N  N     . VAL H 4 119 ? -22.147 -43.823 21.011 1.00 77.16  ? 115 VAL H N     1 
ATOM   6015  C  CA    . VAL H 4 119 ? -21.220 -43.430 19.961 1.00 77.91  ? 115 VAL H CA    1 
ATOM   6016  C  C     . VAL H 4 119 ? -20.841 -44.642 19.121 1.00 78.76  ? 115 VAL H C     1 
ATOM   6017  O  O     . VAL H 4 119 ? -20.659 -44.531 17.910 1.00 79.09  ? 115 VAL H O     1 
ATOM   6018  C  CB    . VAL H 4 119 ? -19.957 -42.741 20.539 1.00 77.85  ? 115 VAL H CB    1 
ATOM   6019  C  CG1   . VAL H 4 119 ? -18.891 -42.526 19.459 1.00 78.02  ? 115 VAL H CG1   1 
ATOM   6020  C  CG2   . VAL H 4 119 ? -20.320 -41.418 21.169 1.00 77.32  ? 115 VAL H CG2   1 
ATOM   6021  N  N     . THR H 4 120 ? -20.744 -45.803 19.762 1.00 79.76  ? 116 THR H N     1 
ATOM   6022  C  CA    . THR H 4 120 ? -20.376 -47.030 19.062 1.00 80.54  ? 116 THR H CA    1 
ATOM   6023  C  C     . THR H 4 120 ? -21.507 -47.452 18.123 1.00 81.45  ? 116 THR H C     1 
ATOM   6024  O  O     . THR H 4 120 ? -21.295 -47.604 16.916 1.00 81.64  ? 116 THR H O     1 
ATOM   6025  C  CB    . THR H 4 120 ? -19.946 -48.135 20.052 1.00 80.24  ? 116 THR H CB    1 
ATOM   6026  O  OG1   . THR H 4 120 ? -18.585 -47.899 20.447 1.00 80.07  ? 116 THR H OG1   1 
ATOM   6027  C  CG2   . THR H 4 120 ? -20.026 -49.512 19.420 1.00 80.81  ? 116 THR H CG2   1 
ATOM   6028  N  N     . LYS H 4 121 ? -22.706 -47.596 18.677 1.00 82.41  ? 117 LYS H N     1 
ATOM   6029  C  CA    . LYS H 4 121 ? -23.899 -47.906 17.906 1.00 83.56  ? 117 LYS H CA    1 
ATOM   6030  C  C     . LYS H 4 121 ? -24.070 -46.969 16.708 1.00 84.23  ? 117 LYS H C     1 
ATOM   6031  O  O     . LYS H 4 121 ? -24.476 -47.404 15.628 1.00 84.49  ? 117 LYS H O     1 
ATOM   6032  C  CB    . LYS H 4 121 ? -25.127 -47.808 18.810 1.00 83.71  ? 117 LYS H CB    1 
ATOM   6033  C  CG    . LYS H 4 121 ? -26.174 -48.877 18.582 1.00 84.51  ? 117 LYS H CG    1 
ATOM   6034  C  CD    . LYS H 4 121 ? -27.069 -48.995 19.807 1.00 86.33  ? 117 LYS H CD    1 
ATOM   6035  C  CE    . LYS H 4 121 ? -27.634 -50.404 19.977 1.00 87.54  ? 117 LYS H CE    1 
ATOM   6036  N  NZ    . LYS H 4 121 ? -28.723 -50.717 19.003 1.00 87.22  ? 117 LYS H NZ    1 
ATOM   6037  N  N     . TYR H 4 122 ? -23.749 -45.692 16.898 1.00 84.92  ? 118 TYR H N     1 
ATOM   6038  C  CA    . TYR H 4 122 ? -23.959 -44.685 15.866 1.00 85.79  ? 118 TYR H CA    1 
ATOM   6039  C  C     . TYR H 4 122 ? -22.917 -44.754 14.747 1.00 86.92  ? 118 TYR H C     1 
ATOM   6040  O  O     . TYR H 4 122 ? -23.242 -44.475 13.585 1.00 87.08  ? 118 TYR H O     1 
ATOM   6041  C  CB    . TYR H 4 122 ? -24.003 -43.277 16.483 1.00 85.50  ? 118 TYR H CB    1 
ATOM   6042  C  CG    . TYR H 4 122 ? -24.016 -42.137 15.476 1.00 84.20  ? 118 TYR H CG    1 
ATOM   6043  C  CD1   . TYR H 4 122 ? -25.220 -41.663 14.944 1.00 83.34  ? 118 TYR H CD1   1 
ATOM   6044  C  CD2   . TYR H 4 122 ? -22.823 -41.532 15.059 1.00 82.74  ? 118 TYR H CD2   1 
ATOM   6045  C  CE1   . TYR H 4 122 ? -25.238 -40.614 14.015 1.00 83.06  ? 118 TYR H CE1   1 
ATOM   6046  C  CE2   . TYR H 4 122 ? -22.828 -40.488 14.135 1.00 82.86  ? 118 TYR H CE2   1 
ATOM   6047  C  CZ    . TYR H 4 122 ? -24.040 -40.033 13.616 1.00 83.13  ? 118 TYR H CZ    1 
ATOM   6048  O  OH    . TYR H 4 122 ? -24.058 -39.002 12.703 1.00 83.15  ? 118 TYR H OH    1 
ATOM   6049  N  N     . THR H 4 123 ? -21.674 -45.095 15.097 1.00 88.10  ? 119 THR H N     1 
ATOM   6050  C  CA    . THR H 4 123 ? -20.581 -45.174 14.118 1.00 89.27  ? 119 THR H CA    1 
ATOM   6051  C  C     . THR H 4 123 ? -20.767 -46.402 13.229 1.00 90.27  ? 119 THR H C     1 
ATOM   6052  O  O     . THR H 4 123 ? -20.804 -46.296 12.000 1.00 90.61  ? 119 THR H O     1 
ATOM   6053  C  CB    . THR H 4 123 ? -19.191 -45.177 14.802 1.00 89.23  ? 119 THR H CB    1 
ATOM   6054  O  OG1   . THR H 4 123 ? -18.949 -43.891 15.379 1.00 89.03  ? 119 THR H OG1   1 
ATOM   6055  C  CG2   . THR H 4 123 ? -18.070 -45.483 13.800 1.00 89.26  ? 119 THR H CG2   1 
ATOM   6056  N  N     . SER H 4 124 ? -20.901 -47.562 13.858 1.00 91.41  ? 120 SER H N     1 
ATOM   6057  C  CA    . SER H 4 124 ? -21.290 -48.769 13.150 1.00 92.58  ? 120 SER H CA    1 
ATOM   6058  C  C     . SER H 4 124 ? -22.788 -48.697 12.820 1.00 93.41  ? 120 SER H C     1 
ATOM   6059  O  O     . SER H 4 124 ? -23.609 -49.444 13.367 1.00 93.47  ? 120 SER H O     1 
ATOM   6060  C  CB    . SER H 4 124 ? -20.947 -50.000 13.984 1.00 92.52  ? 120 SER H CB    1 
ATOM   6061  O  OG    . SER H 4 124 ? -19.638 -49.878 14.514 1.00 92.90  ? 120 SER H OG    1 
ATOM   6062  N  N     . ALA H 4 125 ? -23.128 -47.755 11.940 1.00 94.47  ? 121 ALA H N     1 
ATOM   6063  C  CA    . ALA H 4 125 ? -24.484 -47.602 11.416 1.00 95.55  ? 121 ALA H CA    1 
ATOM   6064  C  C     . ALA H 4 125 ? -24.405 -47.187 9.948  1.00 96.29  ? 121 ALA H C     1 
ATOM   6065  O  O     . ALA H 4 125 ? -23.991 -46.065 9.615  1.00 96.32  ? 121 ALA H O     1 
ATOM   6066  C  CB    . ALA H 4 125 ? -25.284 -46.595 12.230 1.00 95.39  ? 121 ALA H CB    1 
ATOM   6067  N  N     . LYS H 4 126 ? -24.793 -48.128 9.088  1.00 97.09  ? 122 LYS H N     1 
ATOM   6068  C  CA    . LYS H 4 126 ? -24.674 -48.023 7.631  1.00 97.72  ? 122 LYS H CA    1 
ATOM   6069  C  C     . LYS H 4 126 ? -25.856 -47.262 7.011  1.00 97.85  ? 122 LYS H C     1 
ATOM   6070  O  O     . LYS H 4 126 ? -25.709 -46.130 6.535  1.00 97.86  ? 122 LYS H O     1 
ATOM   6071  C  CB    . LYS H 4 126 ? -24.543 -49.432 7.017  1.00 97.83  ? 122 LYS H CB    1 
ATOM   6072  C  CG    . LYS H 4 126 ? -25.164 -50.548 7.884  1.00 98.54  ? 122 LYS H CG    1 
ATOM   6073  C  CD    . LYS H 4 126 ? -25.818 -51.660 7.061  1.00 99.62  ? 122 LYS H CD    1 
ATOM   6074  C  CE    . LYS H 4 126 ? -26.855 -52.425 7.893  1.00 99.53  ? 122 LYS H CE    1 
ATOM   6075  N  NZ    . LYS H 4 126 ? -27.659 -53.382 7.078  1.00 99.51  ? 122 LYS H NZ    1 
ATOM   6076  O  OXT   . LYS H 4 126 ? -26.989 -47.752 6.973  1.00 97.96  ? 122 LYS H OXT   1 
ATOM   6077  O  "O5'" . DA  I 5 1   ? 3.689   0.056   91.429 1.00 138.39 ? -72 DA  I "O5'" 1 
ATOM   6078  C  "C5'" . DA  I 5 1   ? 4.301   0.823   92.462 1.00 138.71 ? -72 DA  I "C5'" 1 
ATOM   6079  C  "C4'" . DA  I 5 1   ? 4.991   -0.068  93.483 1.00 138.75 ? -72 DA  I "C4'" 1 
ATOM   6080  O  "O4'" . DA  I 5 1   ? 4.051   -1.035  94.018 1.00 138.76 ? -72 DA  I "O4'" 1 
ATOM   6081  C  "C3'" . DA  I 5 1   ? 6.144   -0.900  92.944 1.00 138.58 ? -72 DA  I "C3'" 1 
ATOM   6082  O  "O3'" . DA  I 5 1   ? 7.323   -0.079  92.880 1.00 138.44 ? -72 DA  I "O3'" 1 
ATOM   6083  C  "C2'" . DA  I 5 1   ? 6.202   -2.024  93.981 1.00 138.75 ? -72 DA  I "C2'" 1 
ATOM   6084  C  "C1'" . DA  I 5 1   ? 4.738   -2.218  94.392 1.00 138.91 ? -72 DA  I "C1'" 1 
ATOM   6085  N  N9    . DA  I 5 1   ? 4.056   -3.381  93.796 1.00 139.19 ? -72 DA  I N9    1 
ATOM   6086  C  C8    . DA  I 5 1   ? 2.884   -3.358  93.084 1.00 139.32 ? -72 DA  I C8    1 
ATOM   6087  N  N7    . DA  I 5 1   ? 2.478   -4.533  92.657 1.00 139.33 ? -72 DA  I N7    1 
ATOM   6088  C  C5    . DA  I 5 1   ? 3.447   -5.406  93.120 1.00 139.21 ? -72 DA  I C5    1 
ATOM   6089  C  C6    . DA  I 5 1   ? 3.594   -6.810  93.004 1.00 138.94 ? -72 DA  I C6    1 
ATOM   6090  N  N6    . DA  I 5 1   ? 2.728   -7.599  92.356 1.00 138.38 ? -72 DA  I N6    1 
ATOM   6091  N  N1    . DA  I 5 1   ? 4.677   -7.377  93.582 1.00 139.09 ? -72 DA  I N1    1 
ATOM   6092  C  C2    . DA  I 5 1   ? 5.547   -6.587  94.237 1.00 139.54 ? -72 DA  I C2    1 
ATOM   6093  N  N3    . DA  I 5 1   ? 5.513   -5.261  94.412 1.00 139.46 ? -72 DA  I N3    1 
ATOM   6094  C  C4    . DA  I 5 1   ? 4.426   -4.716  93.829 1.00 139.29 ? -72 DA  I C4    1 
ATOM   6095  P  P     . DT  I 5 2   ? 8.801   -0.653  92.610 1.00 138.87 ? -71 DT  I P     1 
ATOM   6096  O  OP1   . DT  I 5 2   ? 9.737   0.494   92.557 1.00 139.27 ? -71 DT  I OP1   1 
ATOM   6097  O  OP2   . DT  I 5 2   ? 8.755   -1.574  91.451 1.00 138.57 ? -71 DT  I OP2   1 
ATOM   6098  O  "O5'" . DT  I 5 2   ? 9.073   -1.485  93.955 1.00 138.37 ? -71 DT  I "O5'" 1 
ATOM   6099  C  "C5'" . DT  I 5 2   ? 10.357  -1.517  94.573 1.00 137.71 ? -71 DT  I "C5'" 1 
ATOM   6100  C  "C4'" . DT  I 5 2   ? 11.007  -2.851  94.269 1.00 137.15 ? -71 DT  I "C4'" 1 
ATOM   6101  O  "O4'" . DT  I 5 2   ? 9.950   -3.843  94.125 1.00 137.37 ? -71 DT  I "O4'" 1 
ATOM   6102  C  "C3'" . DT  I 5 2   ? 11.813  -2.856  92.968 1.00 136.57 ? -71 DT  I "C3'" 1 
ATOM   6103  O  "O3'" . DT  I 5 2   ? 13.232  -3.122  93.120 1.00 135.37 ? -71 DT  I "O3'" 1 
ATOM   6104  C  "C2'" . DT  I 5 2   ? 11.098  -3.856  92.060 1.00 137.11 ? -71 DT  I "C2'" 1 
ATOM   6105  C  "C1'" . DT  I 5 2   ? 10.245  -4.683  93.025 1.00 137.47 ? -71 DT  I "C1'" 1 
ATOM   6106  N  N1    . DT  I 5 2   ? 8.998   -5.279  92.387 1.00 137.67 ? -71 DT  I N1    1 
ATOM   6107  C  C2    . DT  I 5 2   ? 8.858   -6.658  92.325 1.00 137.84 ? -71 DT  I C2    1 
ATOM   6108  O  O2    . DT  I 5 2   ? 9.679   -7.445  92.777 1.00 138.25 ? -71 DT  I O2    1 
ATOM   6109  N  N3    . DT  I 5 2   ? 7.701   -7.096  91.713 1.00 137.55 ? -71 DT  I N3    1 
ATOM   6110  C  C4    . DT  I 5 2   ? 6.691   -6.323  91.159 1.00 137.42 ? -71 DT  I C4    1 
ATOM   6111  O  O4    . DT  I 5 2   ? 5.696   -6.823  90.636 1.00 137.12 ? -71 DT  I O4    1 
ATOM   6112  C  C5    . DT  I 5 2   ? 6.897   -4.893  91.250 1.00 137.52 ? -71 DT  I C5    1 
ATOM   6113  C  C7    . DT  I 5 2   ? 5.883   -3.936  90.689 1.00 137.34 ? -71 DT  I C7    1 
ATOM   6114  C  C6    . DT  I 5 2   ? 8.021   -4.453  91.846 1.00 137.62 ? -71 DT  I C6    1 
ATOM   6115  P  P     . DC  I 5 3   ? 13.935  -4.320  93.943 1.00 134.59 ? -70 DC  I P     1 
ATOM   6116  O  OP1   . DC  I 5 3   ? 13.633  -4.157  95.386 1.00 134.38 ? -70 DC  I OP1   1 
ATOM   6117  O  OP2   . DC  I 5 3   ? 15.344  -4.347  93.481 1.00 134.45 ? -70 DC  I OP2   1 
ATOM   6118  O  "O5'" . DC  I 5 3   ? 13.259  -5.682  93.439 1.00 133.38 ? -70 DC  I "O5'" 1 
ATOM   6119  C  "C5'" . DC  I 5 3   ? 13.738  -6.949  93.918 1.00 130.94 ? -70 DC  I "C5'" 1 
ATOM   6120  C  "C4'" . DC  I 5 3   ? 13.913  -7.950  92.783 1.00 128.76 ? -70 DC  I "C4'" 1 
ATOM   6121  O  "O4'" . DC  I 5 3   ? 12.705  -8.009  91.977 1.00 128.76 ? -70 DC  I "O4'" 1 
ATOM   6122  C  "C3'" . DC  I 5 3   ? 15.043  -7.670  91.794 1.00 126.94 ? -70 DC  I "C3'" 1 
ATOM   6123  O  "O3'" . DC  I 5 3   ? 15.637  -8.921  91.447 1.00 123.84 ? -70 DC  I "O3'" 1 
ATOM   6124  C  "C2'" . DC  I 5 3   ? 14.312  -7.027  90.610 1.00 127.35 ? -70 DC  I "C2'" 1 
ATOM   6125  C  "C1'" . DC  I 5 3   ? 13.044  -7.878  90.605 1.00 128.31 ? -70 DC  I "C1'" 1 
ATOM   6126  N  N1    . DC  I 5 3   ? 11.833  -7.343  89.873 1.00 128.21 ? -70 DC  I N1    1 
ATOM   6127  C  C2    . DC  I 5 3   ? 10.744  -8.204  89.623 1.00 127.98 ? -70 DC  I C2    1 
ATOM   6128  O  O2    . DC  I 5 3   ? 10.788  -9.388  89.992 1.00 127.55 ? -70 DC  I O2    1 
ATOM   6129  N  N3    . DC  I 5 3   ? 9.653   -7.712  88.972 1.00 127.83 ? -70 DC  I N3    1 
ATOM   6130  C  C4    . DC  I 5 3   ? 9.620   -6.435  88.579 1.00 127.82 ? -70 DC  I C4    1 
ATOM   6131  N  N4    . DC  I 5 3   ? 8.525   -6.008  87.944 1.00 127.60 ? -70 DC  I N4    1 
ATOM   6132  C  C5    . DC  I 5 3   ? 10.711  -5.543  88.822 1.00 128.04 ? -70 DC  I C5    1 
ATOM   6133  C  C6    . DC  I 5 3   ? 11.782  -6.035  89.464 1.00 128.21 ? -70 DC  I C6    1 
ATOM   6134  P  P     . DA  I 5 4   ? 16.919  -8.991  90.491 1.00 121.60 ? -69 DA  I P     1 
ATOM   6135  O  OP1   . DA  I 5 4   ? 18.046  -8.450  91.284 1.00 121.71 ? -69 DA  I OP1   1 
ATOM   6136  O  OP2   . DA  I 5 4   ? 16.584  -8.369  89.185 1.00 121.23 ? -69 DA  I OP2   1 
ATOM   6137  O  "O5'" . DA  I 5 4   ? 17.166  -10.561 90.258 1.00 118.87 ? -69 DA  I "O5'" 1 
ATOM   6138  C  "C5'" . DA  I 5 4   ? 16.112  -11.538 90.321 1.00 114.14 ? -69 DA  I "C5'" 1 
ATOM   6139  C  "C4'" . DA  I 5 4   ? 15.655  -12.022 88.946 1.00 110.33 ? -69 DA  I "C4'" 1 
ATOM   6140  O  "O4'" . DA  I 5 4   ? 14.523  -11.237 88.488 1.00 109.09 ? -69 DA  I "O4'" 1 
ATOM   6141  C  "C3'" . DA  I 5 4   ? 16.660  -11.960 87.798 1.00 108.61 ? -69 DA  I "C3'" 1 
ATOM   6142  O  "O3'" . DA  I 5 4   ? 16.454  -13.113 87.019 1.00 107.38 ? -69 DA  I "O3'" 1 
ATOM   6143  C  "C2'" . DA  I 5 4   ? 16.237  -10.726 87.007 1.00 108.05 ? -69 DA  I "C2'" 1 
ATOM   6144  C  "C1'" . DA  I 5 4   ? 14.730  -10.915 87.126 1.00 107.52 ? -69 DA  I "C1'" 1 
ATOM   6145  N  N9    . DA  I 5 4   ? 13.872  -9.783  86.789 1.00 105.94 ? -69 DA  I N9    1 
ATOM   6146  C  C8    . DA  I 5 4   ? 14.123  -8.445  86.922 1.00 105.35 ? -69 DA  I C8    1 
ATOM   6147  N  N7    . DA  I 5 4   ? 13.127  -7.681  86.536 1.00 104.79 ? -69 DA  I N7    1 
ATOM   6148  C  C5    . DA  I 5 4   ? 12.153  -8.582  86.127 1.00 104.75 ? -69 DA  I C5    1 
ATOM   6149  C  C6    . DA  I 5 4   ? 10.845  -8.422  85.605 1.00 104.20 ? -69 DA  I C6    1 
ATOM   6150  N  N6    . DA  I 5 4   ? 10.266  -7.234  85.395 1.00 103.03 ? -69 DA  I N6    1 
ATOM   6151  N  N1    . DA  I 5 4   ? 10.143  -9.541  85.306 1.00 104.25 ? -69 DA  I N1    1 
ATOM   6152  C  C2    . DA  I 5 4   ? 10.715  -10.739 85.513 1.00 104.62 ? -69 DA  I C2    1 
ATOM   6153  N  N3    . DA  I 5 4   ? 11.930  -11.013 85.993 1.00 104.50 ? -69 DA  I N3    1 
ATOM   6154  C  C4    . DA  I 5 4   ? 12.601  -9.883  86.281 1.00 104.95 ? -69 DA  I C4    1 
ATOM   6155  P  P     . DA  I 5 5   ? 17.632  -14.159 86.811 1.00 106.76 ? -68 DA  I P     1 
ATOM   6156  O  OP1   . DA  I 5 5   ? 17.713  -14.967 88.050 1.00 106.58 ? -68 DA  I OP1   1 
ATOM   6157  O  OP2   . DA  I 5 5   ? 18.800  -13.399 86.305 1.00 106.68 ? -68 DA  I OP2   1 
ATOM   6158  O  "O5'" . DA  I 5 5   ? 17.134  -15.101 85.611 1.00 107.03 ? -68 DA  I "O5'" 1 
ATOM   6159  C  "C5'" . DA  I 5 5   ? 16.037  -16.026 85.762 1.00 106.39 ? -68 DA  I "C5'" 1 
ATOM   6160  C  "C4'" . DA  I 5 5   ? 15.073  -15.971 84.577 1.00 105.50 ? -68 DA  I "C4'" 1 
ATOM   6161  O  "O4'" . DA  I 5 5   ? 14.381  -14.693 84.544 1.00 105.16 ? -68 DA  I "O4'" 1 
ATOM   6162  C  "C3'" . DA  I 5 5   ? 15.691  -16.157 83.190 1.00 104.64 ? -68 DA  I "C3'" 1 
ATOM   6163  O  "O3'" . DA  I 5 5   ? 14.893  -17.060 82.445 1.00 104.07 ? -68 DA  I "O3'" 1 
ATOM   6164  C  "C2'" . DA  I 5 5   ? 15.658  -14.760 82.577 1.00 104.17 ? -68 DA  I "C2'" 1 
ATOM   6165  C  "C1'" . DA  I 5 5   ? 14.392  -14.201 83.221 1.00 104.86 ? -68 DA  I "C1'" 1 
ATOM   6166  N  N9    . DA  I 5 5   ? 14.322  -12.744 83.271 1.00 105.00 ? -68 DA  I N9    1 
ATOM   6167  C  C8    . DA  I 5 5   ? 15.292  -11.894 83.729 1.00 105.51 ? -68 DA  I C8    1 
ATOM   6168  N  N7    . DA  I 5 5   ? 14.961  -10.625 83.651 1.00 105.84 ? -68 DA  I N7    1 
ATOM   6169  C  C5    . DA  I 5 5   ? 13.688  -10.637 83.108 1.00 105.02 ? -68 DA  I C5    1 
ATOM   6170  C  C6    . DA  I 5 5   ? 12.786  -9.603  82.775 1.00 104.56 ? -68 DA  I C6    1 
ATOM   6171  N  N6    . DA  I 5 5   ? 13.057  -8.310  82.959 1.00 104.19 ? -68 DA  I N6    1 
ATOM   6172  N  N1    . DA  I 5 5   ? 11.590  -9.951  82.247 1.00 104.53 ? -68 DA  I N1    1 
ATOM   6173  C  C2    . DA  I 5 5   ? 11.319  -11.254 82.065 1.00 104.53 ? -68 DA  I C2    1 
ATOM   6174  N  N3    . DA  I 5 5   ? 12.088  -12.314 82.340 1.00 104.47 ? -68 DA  I N3    1 
ATOM   6175  C  C4    . DA  I 5 5   ? 13.273  -11.939 82.865 1.00 104.98 ? -68 DA  I C4    1 
ATOM   6176  P  P     . DT  I 5 6   ? 15.533  -17.970 81.281 1.00 104.67 ? -67 DT  I P     1 
ATOM   6177  O  OP1   . DT  I 5 6   ? 15.412  -19.380 81.747 1.00 104.09 ? -67 DT  I OP1   1 
ATOM   6178  O  OP2   . DT  I 5 6   ? 16.850  -17.395 80.878 1.00 104.15 ? -67 DT  I OP2   1 
ATOM   6179  O  "O5'" . DT  I 5 6   ? 14.538  -17.790 80.028 1.00 102.58 ? -67 DT  I "O5'" 1 
ATOM   6180  C  "C5'" . DT  I 5 6   ? 13.194  -17.325 80.226 1.00 99.15  ? -67 DT  I "C5'" 1 
ATOM   6181  C  "C4'" . DT  I 5 6   ? 12.831  -16.245 79.219 1.00 96.77  ? -67 DT  I "C4'" 1 
ATOM   6182  O  "O4'" . DT  I 5 6   ? 13.079  -14.919 79.740 1.00 95.61  ? -67 DT  I "O4'" 1 
ATOM   6183  C  "C3'" . DT  I 5 6   ? 13.570  -16.323 77.886 1.00 95.83  ? -67 DT  I "C3'" 1 
ATOM   6184  O  "O3'" . DT  I 5 6   ? 12.616  -16.821 76.948 1.00 95.56  ? -67 DT  I "O3'" 1 
ATOM   6185  C  "C2'" . DT  I 5 6   ? 14.060  -14.896 77.616 1.00 94.89  ? -67 DT  I "C2'" 1 
ATOM   6186  C  "C1'" . DT  I 5 6   ? 13.269  -14.075 78.628 1.00 94.97  ? -67 DT  I "C1'" 1 
ATOM   6187  N  N1    . DT  I 5 6   ? 13.926  -12.820 79.105 1.00 94.23  ? -67 DT  I N1    1 
ATOM   6188  C  C2    . DT  I 5 6   ? 13.222  -11.632 79.045 1.00 94.05  ? -67 DT  I C2    1 
ATOM   6189  O  O2    . DT  I 5 6   ? 12.086  -11.539 78.619 1.00 94.19  ? -67 DT  I O2    1 
ATOM   6190  N  N3    . DT  I 5 6   ? 13.902  -10.535 79.510 1.00 93.84  ? -67 DT  I N3    1 
ATOM   6191  C  C4    . DT  I 5 6   ? 15.186  -10.510 80.020 1.00 93.57  ? -67 DT  I C4    1 
ATOM   6192  O  O4    . DT  I 5 6   ? 15.683  -9.460  80.403 1.00 93.41  ? -67 DT  I O4    1 
ATOM   6193  C  C5    . DT  I 5 6   ? 15.874  -11.787 80.058 1.00 93.63  ? -67 DT  I C5    1 
ATOM   6194  C  C7    . DT  I 5 6   ? 17.275  -11.916 80.582 1.00 93.20  ? -67 DT  I C7    1 
ATOM   6195  C  C6    . DT  I 5 6   ? 15.216  -12.864 79.605 1.00 93.96  ? -67 DT  I C6    1 
ATOM   6196  P  P     . DA  I 5 7   ? 12.772  -16.742 75.359 1.00 95.06  ? -66 DA  I P     1 
ATOM   6197  O  OP1   . DA  I 5 7   ? 12.065  -17.925 74.828 1.00 94.96  ? -66 DA  I OP1   1 
ATOM   6198  O  OP2   . DA  I 5 7   ? 14.187  -16.498 74.992 1.00 95.16  ? -66 DA  I OP2   1 
ATOM   6199  O  "O5'" . DA  I 5 7   ? 11.923  -15.440 75.006 1.00 93.98  ? -66 DA  I "O5'" 1 
ATOM   6200  C  "C5'" . DA  I 5 7   ? 10.565  -15.375 75.430 1.00 92.67  ? -66 DA  I "C5'" 1 
ATOM   6201  C  "C4'" . DA  I 5 7   ? 9.865   -14.164 74.838 1.00 91.65  ? -66 DA  I "C4'" 1 
ATOM   6202  O  "O4'" . DA  I 5 7   ? 10.385  -12.947 75.429 1.00 91.17  ? -66 DA  I "O4'" 1 
ATOM   6203  C  "C3'" . DA  I 5 7   ? 10.016  -13.996 73.333 1.00 91.50  ? -66 DA  I "C3'" 1 
ATOM   6204  O  "O3'" . DA  I 5 7   ? 8.826   -13.399 72.828 1.00 91.64  ? -66 DA  I "O3'" 1 
ATOM   6205  C  "C2'" . DA  I 5 7   ? 11.226  -13.073 73.225 1.00 91.45  ? -66 DA  I "C2'" 1 
ATOM   6206  C  "C1'" . DA  I 5 7   ? 11.041  -12.174 74.445 1.00 91.30  ? -66 DA  I "C1'" 1 
ATOM   6207  N  N9    . DA  I 5 7   ? 12.306  -11.676 74.987 1.00 91.31  ? -66 DA  I N9    1 
ATOM   6208  C  C8    . DA  I 5 7   ? 13.431  -12.405 75.270 1.00 91.01  ? -66 DA  I C8    1 
ATOM   6209  N  N7    . DA  I 5 7   ? 14.418  -11.682 75.739 1.00 91.27  ? -66 DA  I N7    1 
ATOM   6210  C  C5    . DA  I 5 7   ? 13.911  -10.394 75.764 1.00 91.18  ? -66 DA  I C5    1 
ATOM   6211  C  C6    . DA  I 5 7   ? 14.466  -9.156  76.160 1.00 91.26  ? -66 DA  I C6    1 
ATOM   6212  N  N6    . DA  I 5 7   ? 15.710  -9.039  76.629 1.00 90.58  ? -66 DA  I N6    1 
ATOM   6213  N  N1    . DA  I 5 7   ? 13.692  -8.048  76.058 1.00 91.18  ? -66 DA  I N1    1 
ATOM   6214  C  C2    . DA  I 5 7   ? 12.443  -8.179  75.585 1.00 91.15  ? -66 DA  I C2    1 
ATOM   6215  N  N3    . DA  I 5 7   ? 11.813  -9.288  75.185 1.00 90.75  ? -66 DA  I N3    1 
ATOM   6216  C  C4    . DA  I 5 7   ? 12.608  -10.369 75.301 1.00 90.96  ? -66 DA  I C4    1 
ATOM   6217  P  P     . DT  I 5 8   ? 8.664   -12.976 71.292 1.00 91.96  ? -65 DT  I P     1 
ATOM   6218  O  OP1   . DT  I 5 8   ? 7.217   -12.912 71.001 1.00 92.40  ? -65 DT  I OP1   1 
ATOM   6219  O  OP2   . DT  I 5 8   ? 9.588   -13.790 70.460 1.00 91.24  ? -65 DT  I OP2   1 
ATOM   6220  O  "O5'" . DT  I 5 8   ? 9.121   -11.461 71.313 1.00 92.73  ? -65 DT  I "O5'" 1 
ATOM   6221  C  "C5'" . DT  I 5 8   ? 8.327   -10.566 72.091 1.00 94.96  ? -65 DT  I "C5'" 1 
ATOM   6222  C  "C4'" . DT  I 5 8   ? 8.697   -9.139  71.757 1.00 96.20  ? -65 DT  I "C4'" 1 
ATOM   6223  O  "O4'" . DT  I 5 8   ? 9.946   -8.799  72.406 1.00 95.71  ? -65 DT  I "O4'" 1 
ATOM   6224  C  "C3'" . DT  I 5 8   ? 8.914   -8.916  70.267 1.00 97.50  ? -65 DT  I "C3'" 1 
ATOM   6225  O  "O3'" . DT  I 5 8   ? 8.259   -7.711  69.936 1.00 99.62  ? -65 DT  I "O3'" 1 
ATOM   6226  C  "C2'" . DT  I 5 8   ? 10.436  -8.856  70.110 1.00 96.39  ? -65 DT  I "C2'" 1 
ATOM   6227  C  "C1'" . DT  I 5 8   ? 10.828  -8.255  71.451 1.00 95.59  ? -65 DT  I "C1'" 1 
ATOM   6228  N  N1    . DT  I 5 8   ? 12.217  -8.528  71.899 1.00 94.68  ? -65 DT  I N1    1 
ATOM   6229  C  C2    . DT  I 5 8   ? 12.930  -7.474  72.448 1.00 94.44  ? -65 DT  I C2    1 
ATOM   6230  O  O2    . DT  I 5 8   ? 12.480  -6.337  72.587 1.00 93.53  ? -65 DT  I O2    1 
ATOM   6231  N  N3    . DT  I 5 8   ? 14.203  -7.816  72.842 1.00 94.07  ? -65 DT  I N3    1 
ATOM   6232  C  C4    . DT  I 5 8   ? 14.812  -9.057  72.738 1.00 93.99  ? -65 DT  I C4    1 
ATOM   6233  O  O4    . DT  I 5 8   ? 15.961  -9.240  73.126 1.00 93.71  ? -65 DT  I O4    1 
ATOM   6234  C  C5    . DT  I 5 8   ? 14.009  -10.109 72.151 1.00 94.45  ? -65 DT  I C5    1 
ATOM   6235  C  C7    . DT  I 5 8   ? 14.565  -11.501 71.988 1.00 94.60  ? -65 DT  I C7    1 
ATOM   6236  C  C6    . DT  I 5 8   ? 12.760  -9.798  71.766 1.00 94.17  ? -65 DT  I C6    1 
ATOM   6237  P  P     . DC  I 5 9   ? 8.080   -7.207  68.428 1.00 101.24 ? -64 DC  I P     1 
ATOM   6238  O  OP1   . DC  I 5 9   ? 6.672   -6.766  68.288 1.00 101.20 ? -64 DC  I OP1   1 
ATOM   6239  O  OP2   . DC  I 5 9   ? 8.691   -8.147  67.453 1.00 100.40 ? -64 DC  I OP2   1 
ATOM   6240  O  "O5'" . DC  I 5 9   ? 8.993   -5.906  68.508 1.00 103.44 ? -64 DC  I "O5'" 1 
ATOM   6241  C  "C5'" . DC  I 5 9   ? 8.776   -4.978  69.580 1.00 106.08 ? -64 DC  I "C5'" 1 
ATOM   6242  C  "C4'" . DC  I 5 9   ? 9.944   -4.021  69.618 1.00 107.59 ? -64 DC  I "C4'" 1 
ATOM   6243  O  "O4'" . DC  I 5 9   ? 11.083  -4.715  70.176 1.00 107.68 ? -64 DC  I "O4'" 1 
ATOM   6244  C  "C3'" . DC  I 5 9   ? 10.363  -3.610  68.216 1.00 108.65 ? -64 DC  I "C3'" 1 
ATOM   6245  O  "O3'" . DC  I 5 9   ? 9.726   -2.363  67.890 1.00 110.11 ? -64 DC  I "O3'" 1 
ATOM   6246  C  "C2'" . DC  I 5 9   ? 11.892  -3.544  68.264 1.00 108.18 ? -64 DC  I "C2'" 1 
ATOM   6247  C  "C1'" . DC  I 5 9   ? 12.263  -4.216  69.585 1.00 107.53 ? -64 DC  I "C1'" 1 
ATOM   6248  N  N1    . DC  I 5 9   ? 13.250  -5.336  69.473 1.00 107.03 ? -64 DC  I N1    1 
ATOM   6249  C  C2    . DC  I 5 9   ? 14.558  -5.115  69.927 1.00 107.26 ? -64 DC  I C2    1 
ATOM   6250  O  O2    . DC  I 5 9   ? 14.849  -4.003  70.393 1.00 107.18 ? -64 DC  I O2    1 
ATOM   6251  N  N3    . DC  I 5 9   ? 15.467  -6.127  69.834 1.00 107.13 ? -64 DC  I N3    1 
ATOM   6252  C  C4    . DC  I 5 9   ? 15.106  -7.311  69.318 1.00 106.78 ? -64 DC  I C4    1 
ATOM   6253  N  N4    . DC  I 5 9   ? 16.036  -8.273  69.249 1.00 106.38 ? -64 DC  I N4    1 
ATOM   6254  C  C5    . DC  I 5 9   ? 13.774  -7.551  68.850 1.00 106.43 ? -64 DC  I C5    1 
ATOM   6255  C  C6    . DC  I 5 9   ? 12.890  -6.548  68.946 1.00 106.44 ? -64 DC  I C6    1 
ATOM   6256  P  P     . DC  I 5 10  ? 9.401   -1.939  66.370 1.00 110.89 ? -63 DC  I P     1 
ATOM   6257  O  OP1   . DC  I 5 10  ? 8.058   -1.310  66.360 1.00 110.55 ? -63 DC  I OP1   1 
ATOM   6258  O  OP2   . DC  I 5 10  ? 9.716   -3.070  65.449 1.00 110.74 ? -63 DC  I OP2   1 
ATOM   6259  O  "O5'" . DC  I 5 10  ? 10.471  -0.781  66.128 1.00 110.12 ? -63 DC  I "O5'" 1 
ATOM   6260  C  "C5'" . DC  I 5 10  ? 11.064  -0.113  67.230 1.00 109.66 ? -63 DC  I "C5'" 1 
ATOM   6261  C  "C4'" . DC  I 5 10  ? 12.500  0.173   66.855 1.00 109.81 ? -63 DC  I "C4'" 1 
ATOM   6262  O  "O4'" . DC  I 5 10  ? 13.377  -0.901  67.268 1.00 109.48 ? -63 DC  I "O4'" 1 
ATOM   6263  C  "C3'" . DC  I 5 10  ? 12.691  0.357   65.357 1.00 109.75 ? -63 DC  I "C3'" 1 
ATOM   6264  O  "O3'" . DC  I 5 10  ? 12.899  1.757   65.146 1.00 109.98 ? -63 DC  I "O3'" 1 
ATOM   6265  C  "C2'" . DC  I 5 10  ? 13.861  -0.564  64.991 1.00 109.40 ? -63 DC  I "C2'" 1 
ATOM   6266  C  "C1'" . DC  I 5 10  ? 14.425  -1.019  66.334 1.00 109.11 ? -63 DC  I "C1'" 1 
ATOM   6267  N  N1    . DC  I 5 10  ? 14.902  -2.440  66.378 1.00 109.06 ? -63 DC  I N1    1 
ATOM   6268  C  C2    . DC  I 5 10  ? 16.076  -2.747  67.088 1.00 109.01 ? -63 DC  I C2    1 
ATOM   6269  O  O2    . DC  I 5 10  ? 16.691  -1.838  67.660 1.00 108.82 ? -63 DC  I O2    1 
ATOM   6270  N  N3    . DC  I 5 10  ? 16.509  -4.039  67.129 1.00 108.87 ? -63 DC  I N3    1 
ATOM   6271  C  C4    . DC  I 5 10  ? 15.817  -5.001  66.499 1.00 108.93 ? -63 DC  I C4    1 
ATOM   6272  N  N4    . DC  I 5 10  ? 16.282  -6.255  66.569 1.00 108.53 ? -63 DC  I N4    1 
ATOM   6273  C  C5    . DC  I 5 10  ? 14.616  -4.713  65.771 1.00 108.70 ? -63 DC  I C5    1 
ATOM   6274  C  C6    . DC  I 5 10  ? 14.203  -3.436  65.740 1.00 108.98 ? -63 DC  I C6    1 
ATOM   6275  P  P     . DA  I 5 11  ? 13.438  2.391   63.780 1.00 110.15 ? -62 DA  I P     1 
ATOM   6276  O  OP1   . DA  I 5 11  ? 13.335  3.856   63.964 1.00 110.38 ? -62 DA  I OP1   1 
ATOM   6277  O  OP2   . DA  I 5 11  ? 12.774  1.735   62.621 1.00 109.03 ? -62 DA  I OP2   1 
ATOM   6278  O  "O5'" . DA  I 5 11  ? 14.993  2.012   63.825 1.00 109.14 ? -62 DA  I "O5'" 1 
ATOM   6279  C  "C5'" . DA  I 5 11  ? 15.787  2.531   64.886 1.00 108.55 ? -62 DA  I "C5'" 1 
ATOM   6280  C  "C4'" . DA  I 5 11  ? 17.245  2.409   64.517 1.00 108.48 ? -62 DA  I "C4'" 1 
ATOM   6281  O  "O4'" . DA  I 5 11  ? 17.714  1.103   64.936 1.00 107.83 ? -62 DA  I "O4'" 1 
ATOM   6282  C  "C3'" . DA  I 5 11  ? 17.533  2.547   63.022 1.00 108.70 ? -62 DA  I "C3'" 1 
ATOM   6283  O  "O3'" . DA  I 5 11  ? 18.688  3.366   62.814 1.00 109.61 ? -62 DA  I "O3'" 1 
ATOM   6284  C  "C2'" . DA  I 5 11  ? 17.765  1.107   62.568 1.00 107.87 ? -62 DA  I "C2'" 1 
ATOM   6285  C  "C1'" . DA  I 5 11  ? 18.288  0.430   63.832 1.00 107.20 ? -62 DA  I "C1'" 1 
ATOM   6286  N  N9    . DA  I 5 11  ? 17.959  -0.999  63.824 1.00 105.71 ? -62 DA  I N9    1 
ATOM   6287  C  C8    . DA  I 5 11  ? 16.748  -1.552  63.504 1.00 104.83 ? -62 DA  I C8    1 
ATOM   6288  N  N7    . DA  I 5 11  ? 16.732  -2.859  63.553 1.00 103.96 ? -62 DA  I N7    1 
ATOM   6289  C  C5    . DA  I 5 11  ? 18.024  -3.186  63.922 1.00 103.88 ? -62 DA  I C5    1 
ATOM   6290  C  C6    . DA  I 5 11  ? 18.654  -4.427  64.144 1.00 104.07 ? -62 DA  I C6    1 
ATOM   6291  N  N6    . DA  I 5 11  ? 17.993  -5.584  64.009 1.00 103.47 ? -62 DA  I N6    1 
ATOM   6292  N  N1    . DA  I 5 11  ? 19.968  -4.426  64.505 1.00 104.00 ? -62 DA  I N1    1 
ATOM   6293  C  C2    . DA  I 5 11  ? 20.603  -3.249  64.637 1.00 103.73 ? -62 DA  I C2    1 
ATOM   6294  N  N3    . DA  I 5 11  ? 20.106  -2.023  64.444 1.00 103.86 ? -62 DA  I N3    1 
ATOM   6295  C  C4    . DA  I 5 11  ? 18.804  -2.058  64.088 1.00 104.31 ? -62 DA  I C4    1 
ATOM   6296  P  P     . DC  I 5 12  ? 19.246  3.760   61.357 1.00 110.08 ? -61 DC  I P     1 
ATOM   6297  O  OP1   . DC  I 5 12  ? 19.514  5.209   61.462 1.00 110.53 ? -61 DC  I OP1   1 
ATOM   6298  O  OP2   . DC  I 5 12  ? 18.304  3.288   60.310 1.00 109.17 ? -61 DC  I OP2   1 
ATOM   6299  O  "O5'" . DC  I 5 12  ? 20.637  2.944   61.200 1.00 110.54 ? -61 DC  I "O5'" 1 
ATOM   6300  C  "C5'" . DC  I 5 12  ? 21.662  2.913   62.217 1.00 111.37 ? -61 DC  I "C5'" 1 
ATOM   6301  C  "C4'" . DC  I 5 12  ? 22.622  1.735   62.031 1.00 112.89 ? -61 DC  I "C4'" 1 
ATOM   6302  O  "O4'" . DC  I 5 12  ? 21.929  0.475   62.261 1.00 113.42 ? -61 DC  I "O4'" 1 
ATOM   6303  C  "C3'" . DC  I 5 12  ? 23.282  1.577   60.654 1.00 113.85 ? -61 DC  I "C3'" 1 
ATOM   6304  O  "O3'" . DC  I 5 12  ? 24.674  1.214   60.797 1.00 115.65 ? -61 DC  I "O3'" 1 
ATOM   6305  C  "C2'" . DC  I 5 12  ? 22.482  0.447   60.005 1.00 113.14 ? -61 DC  I "C2'" 1 
ATOM   6306  C  "C1'" . DC  I 5 12  ? 22.269  -0.441  61.228 1.00 112.97 ? -61 DC  I "C1'" 1 
ATOM   6307  N  N1    . DC  I 5 12  ? 21.207  -1.521  61.105 1.00 112.26 ? -61 DC  I N1    1 
ATOM   6308  C  C2    . DC  I 5 12  ? 21.472  -2.839  61.531 1.00 111.77 ? -61 DC  I C2    1 
ATOM   6309  O  O2    . DC  I 5 12  ? 22.574  -3.139  62.014 1.00 111.65 ? -61 DC  I O2    1 
ATOM   6310  N  N3    . DC  I 5 12  ? 20.493  -3.775  61.411 1.00 111.53 ? -61 DC  I N3    1 
ATOM   6311  C  C4    . DC  I 5 12  ? 19.304  -3.448  60.898 1.00 111.42 ? -61 DC  I C4    1 
ATOM   6312  N  N4    . DC  I 5 12  ? 18.381  -4.410  60.803 1.00 111.20 ? -61 DC  I N4    1 
ATOM   6313  C  C5    . DC  I 5 12  ? 19.011  -2.122  60.458 1.00 111.57 ? -61 DC  I C5    1 
ATOM   6314  C  C6    . DC  I 5 12  ? 19.979  -1.205  60.580 1.00 111.88 ? -61 DC  I C6    1 
ATOM   6315  P  P     . DC  I 5 13  ? 25.727  1.301   59.578 1.00 117.00 ? -60 DC  I P     1 
ATOM   6316  O  OP1   . DC  I 5 13  ? 26.972  1.917   60.096 1.00 116.92 ? -60 DC  I OP1   1 
ATOM   6317  O  OP2   . DC  I 5 13  ? 25.035  1.945   58.433 1.00 116.71 ? -60 DC  I OP2   1 
ATOM   6318  O  "O5'" . DC  I 5 13  ? 26.019  -0.238  59.217 1.00 118.02 ? -60 DC  I "O5'" 1 
ATOM   6319  C  "C5'" . DC  I 5 13  ? 27.092  -0.968  59.843 1.00 120.38 ? -60 DC  I "C5'" 1 
ATOM   6320  C  "C4'" . DC  I 5 13  ? 27.280  -2.354  59.227 1.00 122.00 ? -60 DC  I "C4'" 1 
ATOM   6321  O  "O4'" . DC  I 5 13  ? 26.057  -3.137  59.379 1.00 122.04 ? -60 DC  I "O4'" 1 
ATOM   6322  C  "C3'" . DC  I 5 13  ? 27.624  -2.372  57.734 1.00 123.00 ? -60 DC  I "C3'" 1 
ATOM   6323  O  "O3'" . DC  I 5 13  ? 28.627  -3.360  57.438 1.00 124.65 ? -60 DC  I "O3'" 1 
ATOM   6324  C  "C2'" . DC  I 5 13  ? 26.285  -2.708  57.077 1.00 122.66 ? -60 DC  I "C2'" 1 
ATOM   6325  C  "C1'" . DC  I 5 13  ? 25.648  -3.635  58.114 1.00 121.99 ? -60 DC  I "C1'" 1 
ATOM   6326  N  N1    . DC  I 5 13  ? 24.141  -3.694  58.039 1.00 121.25 ? -60 DC  I N1    1 
ATOM   6327  C  C2    . DC  I 5 13  ? 23.479  -4.938  57.949 1.00 120.62 ? -60 DC  I C2    1 
ATOM   6328  O  O2    . DC  I 5 13  ? 24.130  -5.993  57.932 1.00 119.65 ? -60 DC  I O2    1 
ATOM   6329  N  N3    . DC  I 5 13  ? 22.117  -4.947  57.882 1.00 120.41 ? -60 DC  I N3    1 
ATOM   6330  C  C4    . DC  I 5 13  ? 21.429  -3.796  57.901 1.00 120.06 ? -60 DC  I C4    1 
ATOM   6331  N  N4    . DC  I 5 13  ? 20.098  -3.853  57.830 1.00 119.60 ? -60 DC  I N4    1 
ATOM   6332  C  C5    . DC  I 5 13  ? 22.077  -2.529  57.989 1.00 120.48 ? -60 DC  I C5    1 
ATOM   6333  C  C6    . DC  I 5 13  ? 23.417  -2.528  58.056 1.00 120.92 ? -60 DC  I C6    1 
ATOM   6334  P  P     . DT  I 5 14  ? 29.359  -3.416  56.002 1.00 125.67 ? -59 DT  I P     1 
ATOM   6335  O  OP1   . DT  I 5 14  ? 30.564  -2.564  56.116 1.00 125.80 ? -59 DT  I OP1   1 
ATOM   6336  O  OP2   . DT  I 5 14  ? 28.374  -3.142  54.924 1.00 125.03 ? -59 DT  I OP2   1 
ATOM   6337  O  "O5'" . DT  I 5 14  ? 29.845  -4.942  55.874 1.00 126.18 ? -59 DT  I "O5'" 1 
ATOM   6338  C  "C5'" . DT  I 5 14  ? 29.014  -6.049  56.261 1.00 127.02 ? -59 DT  I "C5'" 1 
ATOM   6339  C  "C4'" . DT  I 5 14  ? 28.362  -6.765  55.081 1.00 127.66 ? -59 DT  I "C4'" 1 
ATOM   6340  O  "O4'" . DT  I 5 14  ? 26.920  -6.586  55.140 1.00 127.60 ? -59 DT  I "O4'" 1 
ATOM   6341  C  "C3'" . DT  I 5 14  ? 28.773  -6.352  53.662 1.00 128.17 ? -59 DT  I "C3'" 1 
ATOM   6342  O  "O3'" . DT  I 5 14  ? 28.972  -7.533  52.873 1.00 128.44 ? -59 DT  I "O3'" 1 
ATOM   6343  C  "C2'" . DT  I 5 14  ? 27.583  -5.535  53.151 1.00 127.84 ? -59 DT  I "C2'" 1 
ATOM   6344  C  "C1'" . DT  I 5 14  ? 26.435  -6.268  53.848 1.00 127.55 ? -59 DT  I "C1'" 1 
ATOM   6345  N  N1    . DT  I 5 14  ? 25.130  -5.537  54.005 1.00 127.08 ? -59 DT  I N1    1 
ATOM   6346  C  C2    . DT  I 5 14  ? 23.989  -6.283  54.259 1.00 127.04 ? -59 DT  I C2    1 
ATOM   6347  O  O2    . DT  I 5 14  ? 23.981  -7.503  54.354 1.00 127.34 ? -59 DT  I O2    1 
ATOM   6348  N  N3    . DT  I 5 14  ? 22.837  -5.546  54.397 1.00 126.67 ? -59 DT  I N3    1 
ATOM   6349  C  C4    . DT  I 5 14  ? 22.711  -4.167  54.310 1.00 126.66 ? -59 DT  I C4    1 
ATOM   6350  O  O4    . DT  I 5 14  ? 21.627  -3.605  54.451 1.00 126.23 ? -59 DT  I O4    1 
ATOM   6351  C  C5    . DT  I 5 14  ? 23.940  -3.446  54.045 1.00 126.89 ? -59 DT  I C5    1 
ATOM   6352  C  C7    . DT  I 5 14  ? 23.935  -1.946  53.929 1.00 126.77 ? -59 DT  I C7    1 
ATOM   6353  C  C6    . DT  I 5 14  ? 25.075  -4.155  53.908 1.00 126.85 ? -59 DT  I C6    1 
ATOM   6354  P  P     . DG  I 5 15  ? 30.059  -7.575  51.691 1.00 128.20 ? -58 DG  I P     1 
ATOM   6355  O  OP1   . DG  I 5 15  ? 31.382  -7.386  52.338 1.00 128.56 ? -58 DG  I OP1   1 
ATOM   6356  O  OP2   . DG  I 5 15  ? 29.629  -6.643  50.614 1.00 127.45 ? -58 DG  I OP2   1 
ATOM   6357  O  "O5'" . DG  I 5 15  ? 29.974  -9.082  51.128 1.00 127.35 ? -58 DG  I "O5'" 1 
ATOM   6358  C  "C5'" . DG  I 5 15  ? 29.284  -10.170 51.782 1.00 126.02 ? -58 DG  I "C5'" 1 
ATOM   6359  C  "C4'" . DG  I 5 15  ? 28.308  -10.895 50.849 1.00 125.31 ? -58 DG  I "C4'" 1 
ATOM   6360  O  "O4'" . DG  I 5 15  ? 27.000  -10.272 50.926 1.00 124.92 ? -58 DG  I "O4'" 1 
ATOM   6361  C  "C3'" . DG  I 5 15  ? 28.611  -10.933 49.344 1.00 124.97 ? -58 DG  I "C3'" 1 
ATOM   6362  O  "O3'" . DG  I 5 15  ? 27.850  -11.925 48.649 1.00 124.46 ? -58 DG  I "O3'" 1 
ATOM   6363  C  "C2'" . DG  I 5 15  ? 28.040  -9.593  48.908 1.00 124.80 ? -58 DG  I "C2'" 1 
ATOM   6364  C  "C1'" . DG  I 5 15  ? 26.717  -9.655  49.676 1.00 124.72 ? -58 DG  I "C1'" 1 
ATOM   6365  N  N9    . DG  I 5 15  ? 26.066  -8.371  49.922 1.00 124.21 ? -58 DG  I N9    1 
ATOM   6366  C  C8    . DG  I 5 15  ? 26.603  -7.107  49.819 1.00 124.15 ? -58 DG  I C8    1 
ATOM   6367  N  N7    . DG  I 5 15  ? 25.760  -6.160  50.112 1.00 123.67 ? -58 DG  I N7    1 
ATOM   6368  C  C5    . DG  I 5 15  ? 24.595  -6.842  50.427 1.00 123.19 ? -58 DG  I C5    1 
ATOM   6369  C  C6    . DG  I 5 15  ? 23.342  -6.343  50.823 1.00 122.77 ? -58 DG  I C6    1 
ATOM   6370  O  O6    . DG  I 5 15  ? 23.037  -5.157  50.967 1.00 122.34 ? -58 DG  I O6    1 
ATOM   6371  N  N1    . DG  I 5 15  ? 22.414  -7.363  51.054 1.00 122.95 ? -58 DG  I N1    1 
ATOM   6372  C  C2    . DG  I 5 15  ? 22.683  -8.709  50.914 1.00 123.18 ? -58 DG  I C2    1 
ATOM   6373  N  N2    . DG  I 5 15  ? 21.688  -9.567  51.170 1.00 123.01 ? -58 DG  I N2    1 
ATOM   6374  N  N3    . DG  I 5 15  ? 23.860  -9.189  50.541 1.00 123.62 ? -58 DG  I N3    1 
ATOM   6375  C  C4    . DG  I 5 15  ? 24.763  -8.201  50.316 1.00 123.73 ? -58 DG  I C4    1 
ATOM   6376  P  P     . DC  I 5 16  ? 28.079  -13.506 48.744 1.00 124.41 ? -57 DC  I P     1 
ATOM   6377  O  OP1   . DC  I 5 16  ? 28.209  -13.910 50.167 1.00 124.30 ? -57 DC  I OP1   1 
ATOM   6378  O  OP2   . DC  I 5 16  ? 29.153  -13.820 47.775 1.00 124.26 ? -57 DC  I OP2   1 
ATOM   6379  O  "O5'" . DC  I 5 16  ? 26.689  -14.091 48.177 1.00 123.44 ? -57 DC  I "O5'" 1 
ATOM   6380  C  "C5'" . DC  I 5 16  ? 25.432  -13.862 48.858 1.00 121.13 ? -57 DC  I "C5'" 1 
ATOM   6381  C  "C4'" . DC  I 5 16  ? 24.310  -13.355 47.949 1.00 119.17 ? -57 DC  I "C4'" 1 
ATOM   6382  O  "O4'" . DC  I 5 16  ? 24.112  -11.925 48.107 1.00 118.17 ? -57 DC  I "O4'" 1 
ATOM   6383  C  "C3'" . DC  I 5 16  ? 24.464  -13.591 46.442 1.00 118.03 ? -57 DC  I "C3'" 1 
ATOM   6384  O  "O3'" . DC  I 5 16  ? 23.258  -14.113 45.957 1.00 116.83 ? -57 DC  I "O3'" 1 
ATOM   6385  C  "C2'" . DC  I 5 16  ? 24.679  -12.201 45.857 1.00 117.78 ? -57 DC  I "C2'" 1 
ATOM   6386  C  "C1'" . DC  I 5 16  ? 23.814  -11.402 46.825 1.00 117.77 ? -57 DC  I "C1'" 1 
ATOM   6387  N  N1    . DC  I 5 16  ? 24.027  -9.927  46.848 1.00 117.34 ? -57 DC  I N1    1 
ATOM   6388  C  C2    . DC  I 5 16  ? 22.983  -9.123  47.313 1.00 117.06 ? -57 DC  I C2    1 
ATOM   6389  O  O2    . DC  I 5 16  ? 21.934  -9.662  47.676 1.00 117.18 ? -57 DC  I O2    1 
ATOM   6390  N  N3    . DC  I 5 16  ? 23.149  -7.779  47.349 1.00 116.79 ? -57 DC  I N3    1 
ATOM   6391  C  C4    . DC  I 5 16  ? 24.300  -7.239  46.944 1.00 116.92 ? -57 DC  I C4    1 
ATOM   6392  N  N4    . DC  I 5 16  ? 24.414  -5.909  46.997 1.00 116.86 ? -57 DC  I N4    1 
ATOM   6393  C  C5    . DC  I 5 16  ? 25.385  -8.039  46.469 1.00 116.98 ? -57 DC  I C5    1 
ATOM   6394  C  C6    . DC  I 5 16  ? 25.206  -9.366  46.437 1.00 117.25 ? -57 DC  I C6    1 
ATOM   6395  P  P     . DA  I 5 17  ? 23.189  -15.642 45.527 1.00 116.29 ? -56 DA  I P     1 
ATOM   6396  O  OP1   . DA  I 5 17  ? 23.740  -16.439 46.648 1.00 116.16 ? -56 DA  I OP1   1 
ATOM   6397  O  OP2   . DA  I 5 17  ? 23.748  -15.743 44.156 1.00 116.27 ? -56 DA  I OP2   1 
ATOM   6398  O  "O5'" . DA  I 5 17  ? 21.619  -15.928 45.443 1.00 114.77 ? -56 DA  I "O5'" 1 
ATOM   6399  C  "C5'" . DA  I 5 17  ? 20.799  -15.797 46.609 1.00 112.81 ? -56 DA  I "C5'" 1 
ATOM   6400  C  "C4'" . DA  I 5 17  ? 19.523  -15.015 46.316 1.00 111.12 ? -56 DA  I "C4'" 1 
ATOM   6401  O  "O4'" . DA  I 5 17  ? 19.821  -13.635 45.991 1.00 110.17 ? -56 DA  I "O4'" 1 
ATOM   6402  C  "C3'" . DA  I 5 17  ? 18.669  -15.515 45.156 1.00 110.29 ? -56 DA  I "C3'" 1 
ATOM   6403  O  "O3'" . DA  I 5 17  ? 17.302  -15.270 45.475 1.00 109.05 ? -56 DA  I "O3'" 1 
ATOM   6404  C  "C2'" . DA  I 5 17  ? 19.155  -14.681 43.967 1.00 110.09 ? -56 DA  I "C2'" 1 
ATOM   6405  C  "C1'" . DA  I 5 17  ? 19.469  -13.353 44.647 1.00 110.24 ? -56 DA  I "C1'" 1 
ATOM   6406  N  N9    . DA  I 5 17  ? 20.608  -12.619 44.112 1.00 110.13 ? -56 DA  I N9    1 
ATOM   6407  C  C8    . DA  I 5 17  ? 21.678  -13.100 43.405 1.00 110.11 ? -56 DA  I C8    1 
ATOM   6408  N  N7    . DA  I 5 17  ? 22.555  -12.175 43.086 1.00 109.87 ? -56 DA  I N7    1 
ATOM   6409  C  C5    . DA  I 5 17  ? 22.026  -11.017 43.632 1.00 109.53 ? -56 DA  I C5    1 
ATOM   6410  C  C6    . DA  I 5 17  ? 22.468  -9.679  43.649 1.00 109.12 ? -56 DA  I C6    1 
ATOM   6411  N  N6    . DA  I 5 17  ? 23.604  -9.296  43.068 1.00 108.94 ? -56 DA  I N6    1 
ATOM   6412  N  N1    . DA  I 5 17  ? 21.701  -8.754  44.274 1.00 108.65 ? -56 DA  I N1    1 
ATOM   6413  C  C2    . DA  I 5 17  ? 20.558  -9.148  44.847 1.00 108.73 ? -56 DA  I C2    1 
ATOM   6414  N  N3    . DA  I 5 17  ? 20.040  -10.377 44.900 1.00 109.42 ? -56 DA  I N3    1 
ATOM   6415  C  C4    . DA  I 5 17  ? 20.828  -11.271 44.270 1.00 109.73 ? -56 DA  I C4    1 
ATOM   6416  P  P     . DG  I 5 18  ? 16.124  -15.702 44.480 1.00 108.73 ? -55 DG  I P     1 
ATOM   6417  O  OP1   . DG  I 5 18  ? 15.052  -16.337 45.286 1.00 108.88 ? -55 DG  I OP1   1 
ATOM   6418  O  OP2   . DG  I 5 18  ? 16.705  -16.413 43.313 1.00 108.78 ? -55 DG  I OP2   1 
ATOM   6419  O  "O5'" . DG  I 5 18  ? 15.590  -14.303 43.944 1.00 106.96 ? -55 DG  I "O5'" 1 
ATOM   6420  C  "C5'" . DG  I 5 18  ? 15.098  -13.328 44.835 1.00 104.96 ? -55 DG  I "C5'" 1 
ATOM   6421  C  "C4'" . DG  I 5 18  ? 15.135  -12.002 44.106 1.00 103.52 ? -55 DG  I "C4'" 1 
ATOM   6422  O  "O4'" . DG  I 5 18  ? 16.500  -11.684 43.730 1.00 103.42 ? -55 DG  I "O4'" 1 
ATOM   6423  C  "C3'" . DG  I 5 18  ? 14.339  -11.980 42.806 1.00 102.57 ? -55 DG  I "C3'" 1 
ATOM   6424  O  "O3'" . DG  I 5 18  ? 13.635  -10.763 42.779 1.00 101.55 ? -55 DG  I "O3'" 1 
ATOM   6425  C  "C2'" . DG  I 5 18  ? 15.398  -12.023 41.706 1.00 102.74 ? -55 DG  I "C2'" 1 
ATOM   6426  C  "C1'" . DG  I 5 18  ? 16.489  -11.216 42.396 1.00 103.03 ? -55 DG  I "C1'" 1 
ATOM   6427  N  N9    . DG  I 5 18  ? 17.834  -11.301 41.824 1.00 103.21 ? -55 DG  I N9    1 
ATOM   6428  C  C8    . DG  I 5 18  ? 18.502  -12.406 41.346 1.00 103.24 ? -55 DG  I C8    1 
ATOM   6429  N  N7    . DG  I 5 18  ? 19.700  -12.136 40.904 1.00 103.23 ? -55 DG  I N7    1 
ATOM   6430  C  C5    . DG  I 5 18  ? 19.833  -10.765 41.093 1.00 103.18 ? -55 DG  I C5    1 
ATOM   6431  C  C6    . DG  I 5 18  ? 20.915  -9.893  40.801 1.00 103.02 ? -55 DG  I C6    1 
ATOM   6432  O  O6    . DG  I 5 18  ? 22.009  -10.195 40.301 1.00 102.43 ? -55 DG  I O6    1 
ATOM   6433  N  N1    . DG  I 5 18  ? 20.639  -8.563  41.158 1.00 102.45 ? -55 DG  I N1    1 
ATOM   6434  C  C2    . DG  I 5 18  ? 19.455  -8.137  41.726 1.00 102.58 ? -55 DG  I C2    1 
ATOM   6435  N  N2    . DG  I 5 18  ? 19.335  -6.831  42.014 1.00 102.43 ? -55 DG  I N2    1 
ATOM   6436  N  N3    . DG  I 5 18  ? 18.439  -8.946  41.999 1.00 102.95 ? -55 DG  I N3    1 
ATOM   6437  C  C4    . DG  I 5 18  ? 18.694  -10.239 41.661 1.00 103.15 ? -55 DG  I C4    1 
ATOM   6438  P  P     . DA  I 5 19  ? 12.227  -10.650 42.058 1.00 100.06 ? -54 DA  I P     1 
ATOM   6439  O  OP1   . DA  I 5 19  ? 11.208  -11.214 42.970 1.00 100.02 ? -54 DA  I OP1   1 
ATOM   6440  O  OP2   . DA  I 5 19  ? 12.369  -11.161 40.673 1.00 100.42 ? -54 DA  I OP2   1 
ATOM   6441  O  "O5'" . DA  I 5 19  ? 12.026  -9.076  42.022 1.00 100.26 ? -54 DA  I "O5'" 1 
ATOM   6442  C  "C5'" . DA  I 5 19  ? 12.240  -8.375  40.828 1.00 101.77 ? -54 DA  I "C5'" 1 
ATOM   6443  C  "C4'" . DA  I 5 19  ? 13.206  -7.243  41.089 1.00 102.57 ? -54 DA  I "C4'" 1 
ATOM   6444  O  "O4'" . DA  I 5 19  ? 14.522  -7.800  41.267 1.00 102.43 ? -54 DA  I "O4'" 1 
ATOM   6445  C  "C3'" . DA  I 5 19  ? 13.278  -6.266  39.932 1.00 103.19 ? -54 DA  I "C3'" 1 
ATOM   6446  O  "O3'" . DA  I 5 19  ? 12.583  -5.098  40.314 1.00 104.52 ? -54 DA  I "O3'" 1 
ATOM   6447  C  "C2'" . DA  I 5 19  ? 14.759  -5.977  39.745 1.00 103.23 ? -54 DA  I "C2'" 1 
ATOM   6448  C  "C1'" . DA  I 5 19  ? 15.478  -7.018  40.590 1.00 102.65 ? -54 DA  I "C1'" 1 
ATOM   6449  N  N9    . DA  I 5 19  ? 16.317  -7.905  39.799 1.00 102.54 ? -54 DA  I N9    1 
ATOM   6450  C  C8    . DA  I 5 19  ? 16.090  -9.219  39.509 1.00 102.72 ? -54 DA  I C8    1 
ATOM   6451  N  N7    . DA  I 5 19  ? 17.029  -9.769  38.782 1.00 102.75 ? -54 DA  I N7    1 
ATOM   6452  C  C5    . DA  I 5 19  ? 17.932  -8.741  38.582 1.00 102.84 ? -54 DA  I C5    1 
ATOM   6453  C  C6    . DA  I 5 19  ? 19.155  -8.673  37.882 1.00 103.23 ? -54 DA  I C6    1 
ATOM   6454  N  N6    . DA  I 5 19  ? 19.690  -9.710  37.228 1.00 102.87 ? -54 DA  I N6    1 
ATOM   6455  N  N1    . DA  I 5 19  ? 19.805  -7.487  37.876 1.00 103.57 ? -54 DA  I N1    1 
ATOM   6456  C  C2    . DA  I 5 19  ? 19.268  -6.445  38.532 1.00 103.16 ? -54 DA  I C2    1 
ATOM   6457  N  N3    . DA  I 5 19  ? 18.128  -6.390  39.217 1.00 102.54 ? -54 DA  I N3    1 
ATOM   6458  C  C4    . DA  I 5 19  ? 17.505  -7.581  39.200 1.00 102.61 ? -54 DA  I C4    1 
ATOM   6459  P  P     . DT  I 5 20  ? 11.691  -4.336  39.236 1.00 106.29 ? -53 DT  I P     1 
ATOM   6460  O  OP1   . DT  I 5 20  ? 10.710  -3.479  39.948 1.00 106.65 ? -53 DT  I OP1   1 
ATOM   6461  O  OP2   . DT  I 5 20  ? 11.211  -5.343  38.262 1.00 106.03 ? -53 DT  I OP2   1 
ATOM   6462  O  "O5'" . DT  I 5 20  ? 12.756  -3.405  38.486 1.00 109.11 ? -53 DT  I "O5'" 1 
ATOM   6463  C  "C5'" . DT  I 5 20  ? 13.638  -2.494  39.150 1.00 112.74 ? -53 DT  I "C5'" 1 
ATOM   6464  C  "C4'" . DT  I 5 20  ? 14.861  -2.193  38.282 1.00 116.07 ? -53 DT  I "C4'" 1 
ATOM   6465  O  "O4'" . DT  I 5 20  ? 15.676  -3.383  38.077 1.00 116.51 ? -53 DT  I "O4'" 1 
ATOM   6466  C  "C3'" . DT  I 5 20  ? 14.599  -1.637  36.876 1.00 118.07 ? -53 DT  I "C3'" 1 
ATOM   6467  O  "O3'" . DT  I 5 20  ? 15.578  -0.630  36.571 1.00 121.24 ? -53 DT  I "O3'" 1 
ATOM   6468  C  "C2'" . DT  I 5 20  ? 14.781  -2.874  36.001 1.00 117.56 ? -53 DT  I "C2'" 1 
ATOM   6469  C  "C1'" . DT  I 5 20  ? 15.997  -3.464  36.701 1.00 117.43 ? -53 DT  I "C1'" 1 
ATOM   6470  N  N1    . DT  I 5 20  ? 16.350  -4.868  36.312 1.00 118.14 ? -53 DT  I N1    1 
ATOM   6471  C  C2    . DT  I 5 20  ? 17.647  -5.139  35.910 1.00 118.50 ? -53 DT  I C2    1 
ATOM   6472  O  O2    . DT  I 5 20  ? 18.532  -4.299  35.856 1.00 118.35 ? -53 DT  I O2    1 
ATOM   6473  N  N3    . DT  I 5 20  ? 17.879  -6.455  35.576 1.00 118.57 ? -53 DT  I N3    1 
ATOM   6474  C  C4    . DT  I 5 20  ? 16.962  -7.495  35.600 1.00 118.82 ? -53 DT  I C4    1 
ATOM   6475  O  O4    . DT  I 5 20  ? 17.279  -8.636  35.280 1.00 119.19 ? -53 DT  I O4    1 
ATOM   6476  C  C5    . DT  I 5 20  ? 15.623  -7.146  36.029 1.00 118.86 ? -53 DT  I C5    1 
ATOM   6477  C  C7    . DT  I 5 20  ? 14.537  -8.184  36.099 1.00 118.75 ? -53 DT  I C7    1 
ATOM   6478  C  C6    . DT  I 5 20  ? 15.387  -5.865  36.357 1.00 118.52 ? -53 DT  I C6    1 
ATOM   6479  P  P     . DA  I 5 21  ? 15.507  0.310   35.269 1.00 123.53 ? -52 DA  I P     1 
ATOM   6480  O  OP1   . DA  I 5 21  ? 14.646  1.462   35.623 1.00 123.57 ? -52 DA  I OP1   1 
ATOM   6481  O  OP2   . DA  I 5 21  ? 15.191  -0.498  34.065 1.00 123.33 ? -52 DA  I OP2   1 
ATOM   6482  O  "O5'" . DA  I 5 21  ? 17.020  0.821   35.124 1.00 125.88 ? -52 DA  I "O5'" 1 
ATOM   6483  C  "C5'" . DA  I 5 21  ? 18.099  -0.113  35.031 1.00 129.34 ? -52 DA  I "C5'" 1 
ATOM   6484  C  "C4'" . DA  I 5 21  ? 18.844  -0.065  33.702 1.00 131.80 ? -52 DA  I "C4'" 1 
ATOM   6485  O  "O4'" . DA  I 5 21  ? 19.332  -1.404  33.418 1.00 132.78 ? -52 DA  I "O4'" 1 
ATOM   6486  C  "C3'" . DA  I 5 21  ? 18.080  0.405   32.456 1.00 133.18 ? -52 DA  I "C3'" 1 
ATOM   6487  O  "O3'" . DA  I 5 21  ? 18.898  1.318   31.675 1.00 134.60 ? -52 DA  I "O3'" 1 
ATOM   6488  C  "C2'" . DA  I 5 21  ? 17.745  -0.908  31.751 1.00 133.47 ? -52 DA  I "C2'" 1 
ATOM   6489  C  "C1'" . DA  I 5 21  ? 18.941  -1.785  32.113 1.00 133.65 ? -52 DA  I "C1'" 1 
ATOM   6490  N  N9    . DA  I 5 21  ? 18.605  -3.207  32.071 1.00 134.24 ? -52 DA  I N9    1 
ATOM   6491  C  C8    . DA  I 5 21  ? 17.524  -3.809  32.664 1.00 134.40 ? -52 DA  I C8    1 
ATOM   6492  N  N7    . DA  I 5 21  ? 17.452  -5.100  32.451 1.00 134.74 ? -52 DA  I N7    1 
ATOM   6493  C  C5    . DA  I 5 21  ? 18.562  -5.362  31.660 1.00 134.96 ? -52 DA  I C5    1 
ATOM   6494  C  C6    . DA  I 5 21  ? 19.054  -6.555  31.087 1.00 135.41 ? -52 DA  I C6    1 
ATOM   6495  N  N6    . DA  I 5 21  ? 18.444  -7.733  31.260 1.00 135.57 ? -52 DA  I N6    1 
ATOM   6496  N  N1    . DA  I 5 21  ? 20.191  -6.490  30.346 1.00 135.55 ? -52 DA  I N1    1 
ATOM   6497  C  C2    . DA  I 5 21  ? 20.793  -5.296  30.185 1.00 135.21 ? -52 DA  I C2    1 
ATOM   6498  N  N3    . DA  I 5 21  ? 20.422  -4.108  30.677 1.00 134.83 ? -52 DA  I N3    1 
ATOM   6499  C  C4    . DA  I 5 21  ? 19.289  -4.208  31.410 1.00 134.63 ? -52 DA  I C4    1 
ATOM   6500  P  P     . DC  I 5 22  ? 18.942  1.438   30.068 1.00 135.69 ? -51 DC  I P     1 
ATOM   6501  O  OP1   . DC  I 5 22  ? 19.451  2.796   29.774 1.00 135.54 ? -51 DC  I OP1   1 
ATOM   6502  O  OP2   . DC  I 5 22  ? 17.649  1.021   29.474 1.00 135.38 ? -51 DC  I OP2   1 
ATOM   6503  O  "O5'" . DC  I 5 22  ? 20.045  0.345   29.659 1.00 137.51 ? -51 DC  I "O5'" 1 
ATOM   6504  C  "C5'" . DC  I 5 22  ? 21.170  0.674   28.825 1.00 140.21 ? -51 DC  I "C5'" 1 
ATOM   6505  C  "C4'" . DC  I 5 22  ? 21.357  -0.334  27.694 1.00 142.13 ? -51 DC  I "C4'" 1 
ATOM   6506  O  "O4'" . DC  I 5 22  ? 20.847  -1.640  28.086 1.00 142.54 ? -51 DC  I "O4'" 1 
ATOM   6507  C  "C3'" . DC  I 5 22  ? 20.686  0.018   26.359 1.00 143.28 ? -51 DC  I "C3'" 1 
ATOM   6508  O  "O3'" . DC  I 5 22  ? 21.631  -0.175  25.265 1.00 144.77 ? -51 DC  I "O3'" 1 
ATOM   6509  C  "C2'" . DC  I 5 22  ? 19.481  -0.927  26.344 1.00 143.27 ? -51 DC  I "C2'" 1 
ATOM   6510  C  "C1'" . DC  I 5 22  ? 20.102  -2.160  27.000 1.00 143.26 ? -51 DC  I "C1'" 1 
ATOM   6511  N  N1    . DC  I 5 22  ? 19.131  -3.220  27.470 1.00 143.67 ? -51 DC  I N1    1 
ATOM   6512  C  C2    . DC  I 5 22  ? 19.368  -4.591  27.203 1.00 143.92 ? -51 DC  I C2    1 
ATOM   6513  O  O2    . DC  I 5 22  ? 20.381  -4.954  26.583 1.00 144.03 ? -51 DC  I O2    1 
ATOM   6514  N  N3    . DC  I 5 22  ? 18.467  -5.512  27.647 1.00 143.75 ? -51 DC  I N3    1 
ATOM   6515  C  C4    . DC  I 5 22  ? 17.377  -5.117  28.316 1.00 143.54 ? -51 DC  I C4    1 
ATOM   6516  N  N4    . DC  I 5 22  ? 16.523  -6.052  28.732 1.00 143.23 ? -51 DC  I N4    1 
ATOM   6517  C  C5    . DC  I 5 22  ? 17.115  -3.739  28.592 1.00 143.65 ? -51 DC  I C5    1 
ATOM   6518  C  C6    . DC  I 5 22  ? 18.007  -2.838  28.157 1.00 143.65 ? -51 DC  I C6    1 
ATOM   6519  P  P     . DT  I 5 23  ? 21.258  -0.575  23.744 1.00 146.01 ? -50 DT  I P     1 
ATOM   6520  O  OP1   . DT  I 5 23  ? 22.485  -0.398  22.927 1.00 145.72 ? -50 DT  I OP1   1 
ATOM   6521  O  OP2   . DT  I 5 23  ? 20.017  0.144   23.366 1.00 145.82 ? -50 DT  I OP2   1 
ATOM   6522  O  "O5'" . DT  I 5 23  ? 20.915  -2.145  23.811 1.00 147.46 ? -50 DT  I "O5'" 1 
ATOM   6523  C  "C5'" . DT  I 5 23  ? 21.866  -3.164  23.455 1.00 149.34 ? -50 DT  I "C5'" 1 
ATOM   6524  C  "C4'" . DT  I 5 23  ? 21.182  -4.335  22.758 1.00 150.60 ? -50 DT  I "C4'" 1 
ATOM   6525  O  "O4'" . DT  I 5 23  ? 20.050  -4.805  23.549 1.00 150.88 ? -50 DT  I "O4'" 1 
ATOM   6526  C  "C3'" . DT  I 5 23  ? 20.622  -4.006  21.369 1.00 151.37 ? -50 DT  I "C3'" 1 
ATOM   6527  O  "O3'" . DT  I 5 23  ? 20.987  -4.999  20.396 1.00 151.84 ? -50 DT  I "O3'" 1 
ATOM   6528  C  "C2'" . DT  I 5 23  ? 19.112  -3.998  21.592 1.00 151.40 ? -50 DT  I "C2'" 1 
ATOM   6529  C  "C1'" . DT  I 5 23  ? 18.997  -5.089  22.648 1.00 151.33 ? -50 DT  I "C1'" 1 
ATOM   6530  N  N1    . DT  I 5 23  ? 17.667  -5.118  23.328 1.00 151.49 ? -50 DT  I N1    1 
ATOM   6531  C  C2    . DT  I 5 23  ? 16.985  -6.319  23.442 1.00 151.54 ? -50 DT  I C2    1 
ATOM   6532  O  O2    . DT  I 5 23  ? 17.401  -7.393  23.031 1.00 151.23 ? -50 DT  I O2    1 
ATOM   6533  N  N3    . DT  I 5 23  ? 15.769  -6.216  24.077 1.00 151.73 ? -50 DT  I N3    1 
ATOM   6534  C  C4    . DT  I 5 23  ? 15.177  -5.071  24.590 1.00 151.91 ? -50 DT  I C4    1 
ATOM   6535  O  O4    . DT  I 5 23  ? 14.078  -5.104  25.141 1.00 151.83 ? -50 DT  I O4    1 
ATOM   6536  C  C5    . DT  I 5 23  ? 15.944  -3.851  24.431 1.00 152.00 ? -50 DT  I C5    1 
ATOM   6537  C  C7    . DT  I 5 23  ? 15.425  -2.533  24.940 1.00 152.11 ? -50 DT  I C7    1 
ATOM   6538  C  C6    . DT  I 5 23  ? 17.132  -3.935  23.815 1.00 151.69 ? -50 DT  I C6    1 
ATOM   6539  P  P     . DA  I 5 24  ? 20.996  -4.632  18.831 1.00 151.87 ? -49 DA  I P     1 
ATOM   6540  O  OP1   . DA  I 5 24  ? 22.329  -4.034  18.551 1.00 151.52 ? -49 DA  I OP1   1 
ATOM   6541  O  OP2   . DA  I 5 24  ? 19.780  -3.827  18.525 1.00 151.76 ? -49 DA  I OP2   1 
ATOM   6542  O  "O5'" . DA  I 5 24  ? 20.862  -6.045  18.050 1.00 151.64 ? -49 DA  I "O5'" 1 
ATOM   6543  C  "C5'" . DA  I 5 24  ? 20.536  -7.300  18.690 1.00 151.39 ? -49 DA  I "C5'" 1 
ATOM   6544  C  "C4'" . DA  I 5 24  ? 19.324  -8.036  18.098 1.00 151.20 ? -49 DA  I "C4'" 1 
ATOM   6545  O  "O4'" . DA  I 5 24  ? 18.160  -7.794  18.942 1.00 151.36 ? -49 DA  I "O4'" 1 
ATOM   6546  C  "C3'" . DA  I 5 24  ? 18.875  -7.720  16.660 1.00 150.69 ? -49 DA  I "C3'" 1 
ATOM   6547  O  "O3'" . DA  I 5 24  ? 18.529  -8.933  15.965 1.00 149.52 ? -49 DA  I "O3'" 1 
ATOM   6548  C  "C2'" . DA  I 5 24  ? 17.637  -6.851  16.867 1.00 151.01 ? -49 DA  I "C2'" 1 
ATOM   6549  C  "C1'" . DA  I 5 24  ? 17.048  -7.482  18.126 1.00 151.35 ? -49 DA  I "C1'" 1 
ATOM   6550  N  N9    . DA  I 5 24  ? 16.167  -6.617  18.907 1.00 151.64 ? -49 DA  I N9    1 
ATOM   6551  C  C8    . DA  I 5 24  ? 16.230  -5.253  19.034 1.00 151.85 ? -49 DA  I C8    1 
ATOM   6552  N  N7    . DA  I 5 24  ? 15.306  -4.744  19.814 1.00 151.84 ? -49 DA  I N7    1 
ATOM   6553  C  C5    . DA  I 5 24  ? 14.591  -5.855  20.232 1.00 151.83 ? -49 DA  I C5    1 
ATOM   6554  C  C6    . DA  I 5 24  ? 13.477  -5.997  21.084 1.00 151.78 ? -49 DA  I C6    1 
ATOM   6555  N  N6    . DA  I 5 24  ? 12.887  -4.954  21.677 1.00 151.58 ? -49 DA  I N6    1 
ATOM   6556  N  N1    . DA  I 5 24  ? 13.000  -7.247  21.299 1.00 151.77 ? -49 DA  I N1    1 
ATOM   6557  C  C2    . DA  I 5 24  ? 13.603  -8.287  20.699 1.00 151.85 ? -49 DA  I C2    1 
ATOM   6558  N  N3    . DA  I 5 24  ? 14.658  -8.277  19.878 1.00 151.70 ? -49 DA  I N3    1 
ATOM   6559  C  C4    . DA  I 5 24  ? 15.108  -7.020  19.686 1.00 151.76 ? -49 DA  I C4    1 
ATOM   6560  P  P     . DC  I 5 25  ? 18.286  -9.005  14.377 1.00 148.82 ? -48 DC  I P     1 
ATOM   6561  O  OP1   . DC  I 5 25  ? 18.693  -10.369 13.956 1.00 148.93 ? -48 DC  I OP1   1 
ATOM   6562  O  OP2   . DC  I 5 25  ? 18.923  -7.813  13.757 1.00 148.70 ? -48 DC  I OP2   1 
ATOM   6563  O  "O5'" . DC  I 5 25  ? 16.692  -8.875  14.184 1.00 147.74 ? -48 DC  I "O5'" 1 
ATOM   6564  C  "C5'" . DC  I 5 25  ? 15.954  -9.819  13.377 1.00 146.29 ? -48 DC  I "C5'" 1 
ATOM   6565  C  "C4'" . DC  I 5 25  ? 15.238  -10.858 14.242 1.00 145.27 ? -48 DC  I "C4'" 1 
ATOM   6566  O  "O4'" . DC  I 5 25  ? 14.926  -10.298 15.548 1.00 145.51 ? -48 DC  I "O4'" 1 
ATOM   6567  C  "C3'" . DC  I 5 25  ? 13.903  -11.410 13.737 1.00 144.19 ? -48 DC  I "C3'" 1 
ATOM   6568  O  "O3'" . DC  I 5 25  ? 13.715  -12.747 14.235 1.00 142.40 ? -48 DC  I "O3'" 1 
ATOM   6569  C  "C2'" . DC  I 5 25  ? 12.892  -10.439 14.349 1.00 144.53 ? -48 DC  I "C2'" 1 
ATOM   6570  C  "C1'" . DC  I 5 25  ? 13.523  -10.133 15.710 1.00 145.12 ? -48 DC  I "C1'" 1 
ATOM   6571  N  N1    . DC  I 5 25  ? 13.235  -8.750  16.263 1.00 145.25 ? -48 DC  I N1    1 
ATOM   6572  C  C2    . DC  I 5 25  ? 12.082  -8.521  17.039 1.00 144.97 ? -48 DC  I C2    1 
ATOM   6573  O  O2    . DC  I 5 25  ? 11.298  -9.451  17.263 1.00 145.04 ? -48 DC  I O2    1 
ATOM   6574  N  N3    . DC  I 5 25  ? 11.852  -7.271  17.528 1.00 144.54 ? -48 DC  I N3    1 
ATOM   6575  C  C4    . DC  I 5 25  ? 12.712  -6.280  17.277 1.00 144.36 ? -48 DC  I C4    1 
ATOM   6576  N  N4    . DC  I 5 25  ? 12.440  -5.075  17.781 1.00 144.30 ? -48 DC  I N4    1 
ATOM   6577  C  C5    . DC  I 5 25  ? 13.889  -6.483  16.495 1.00 144.60 ? -48 DC  I C5    1 
ATOM   6578  C  C6    . DC  I 5 25  ? 14.106  -7.717  16.017 1.00 145.06 ? -48 DC  I C6    1 
ATOM   6579  P  P     . DC  I 5 26  ? 12.675  -13.805 13.602 1.00 140.86 ? -47 DC  I P     1 
ATOM   6580  O  OP1   . DC  I 5 26  ? 12.890  -15.101 14.285 1.00 140.57 ? -47 DC  I OP1   1 
ATOM   6581  O  OP2   . DC  I 5 26  ? 12.759  -13.746 12.123 1.00 140.95 ? -47 DC  I OP2   1 
ATOM   6582  O  "O5'" . DC  I 5 26  ? 11.241  -13.220 14.014 1.00 139.76 ? -47 DC  I "O5'" 1 
ATOM   6583  C  "C5'" . DC  I 5 26  ? 10.501  -13.836 15.096 1.00 138.04 ? -47 DC  I "C5'" 1 
ATOM   6584  C  "C4'" . DC  I 5 26  ? 9.105   -13.244 15.178 1.00 136.38 ? -47 DC  I "C4'" 1 
ATOM   6585  O  "O4'" . DC  I 5 26  ? 9.198   -11.827 15.465 1.00 136.62 ? -47 DC  I "O4'" 1 
ATOM   6586  C  "C3'" . DC  I 5 26  ? 8.292   -13.371 13.891 1.00 134.93 ? -47 DC  I "C3'" 1 
ATOM   6587  O  "O3'" . DC  I 5 26  ? 6.989   -13.842 14.210 1.00 132.25 ? -47 DC  I "O3'" 1 
ATOM   6588  C  "C2'" . DC  I 5 26  ? 8.267   -11.954 13.314 1.00 135.78 ? -47 DC  I "C2'" 1 
ATOM   6589  C  "C1'" . DC  I 5 26  ? 8.363   -11.108 14.580 1.00 136.73 ? -47 DC  I "C1'" 1 
ATOM   6590  N  N1    . DC  I 5 26  ? 8.967   -9.746  14.449 1.00 137.55 ? -47 DC  I N1    1 
ATOM   6591  C  C2    . DC  I 5 26  ? 8.751   -8.835  15.490 1.00 138.11 ? -47 DC  I C2    1 
ATOM   6592  O  O2    . DC  I 5 26  ? 8.068   -9.183  16.461 1.00 138.40 ? -47 DC  I O2    1 
ATOM   6593  N  N3    . DC  I 5 26  ? 9.294   -7.593  15.411 1.00 138.57 ? -47 DC  I N3    1 
ATOM   6594  C  C4    . DC  I 5 26  ? 10.029  -7.255  14.347 1.00 138.74 ? -47 DC  I C4    1 
ATOM   6595  N  N4    . DC  I 5 26  ? 10.539  -6.018  14.316 1.00 138.99 ? -47 DC  I N4    1 
ATOM   6596  C  C5    . DC  I 5 26  ? 10.267  -8.171  13.273 1.00 138.49 ? -47 DC  I C5    1 
ATOM   6597  C  C6    . DC  I 5 26  ? 9.725   -9.394  13.365 1.00 137.92 ? -47 DC  I C6    1 
ATOM   6598  P  P     . DA  I 5 27  ? 6.637   -15.408 14.175 1.00 130.05 ? -46 DA  I P     1 
ATOM   6599  O  OP1   . DA  I 5 27  ? 7.731   -16.153 14.846 1.00 129.99 ? -46 DA  I OP1   1 
ATOM   6600  O  OP2   . DA  I 5 27  ? 6.239   -15.756 12.792 1.00 130.09 ? -46 DA  I OP2   1 
ATOM   6601  O  "O5'" . DA  I 5 27  ? 5.306   -15.503 15.068 1.00 128.26 ? -46 DA  I "O5'" 1 
ATOM   6602  C  "C5'" . DA  I 5 27  ? 5.368   -15.222 16.477 1.00 125.22 ? -46 DA  I "C5'" 1 
ATOM   6603  C  "C4'" . DA  I 5 27  ? 4.382   -14.151 16.949 1.00 122.57 ? -46 DA  I "C4'" 1 
ATOM   6604  O  "O4'" . DA  I 5 27  ? 4.750   -12.806 16.517 1.00 121.81 ? -46 DA  I "O4'" 1 
ATOM   6605  C  "C3'" . DA  I 5 27  ? 2.925   -14.359 16.553 1.00 121.09 ? -46 DA  I "C3'" 1 
ATOM   6606  O  "O3'" . DA  I 5 27  ? 2.155   -14.256 17.762 1.00 118.81 ? -46 DA  I "O3'" 1 
ATOM   6607  C  "C2'" . DA  I 5 27  ? 2.671   -13.278 15.495 1.00 121.52 ? -46 DA  I "C2'" 1 
ATOM   6608  C  "C1'" . DA  I 5 27  ? 3.673   -12.175 15.840 1.00 121.76 ? -46 DA  I "C1'" 1 
ATOM   6609  N  N9    . DA  I 5 27  ? 4.254   -11.459 14.697 1.00 121.75 ? -46 DA  I N9    1 
ATOM   6610  C  C8    . DA  I 5 27  ? 4.437   -11.937 13.427 1.00 121.72 ? -46 DA  I C8    1 
ATOM   6611  N  N7    . DA  I 5 27  ? 5.001   -11.084 12.606 1.00 121.79 ? -46 DA  I N7    1 
ATOM   6612  C  C5    . DA  I 5 27  ? 5.214   -9.962  13.387 1.00 121.89 ? -46 DA  I C5    1 
ATOM   6613  C  C6    . DA  I 5 27  ? 5.788   -8.698  13.109 1.00 121.81 ? -46 DA  I C6    1 
ATOM   6614  N  N6    . DA  I 5 27  ? 6.262   -8.352  11.908 1.00 121.53 ? -46 DA  I N6    1 
ATOM   6615  N  N1    . DA  I 5 27  ? 5.849   -7.792  14.111 1.00 121.82 ? -46 DA  I N1    1 
ATOM   6616  C  C2    . DA  I 5 27  ? 5.366   -8.133  15.312 1.00 121.83 ? -46 DA  I C2    1 
ATOM   6617  N  N3    . DA  I 5 27  ? 4.813   -9.289  15.693 1.00 122.26 ? -46 DA  I N3    1 
ATOM   6618  C  C4    . DA  I 5 27  ? 4.761   -10.174 14.679 1.00 121.92 ? -46 DA  I C4    1 
ATOM   6619  P  P     . DA  I 5 28  ? 0.615   -13.818 17.853 1.00 116.92 ? -45 DA  I P     1 
ATOM   6620  O  OP1   . DA  I 5 28  ? 0.152   -14.156 19.219 1.00 116.90 ? -45 DA  I OP1   1 
ATOM   6621  O  OP2   . DA  I 5 28  ? -0.114  -14.338 16.673 1.00 116.72 ? -45 DA  I OP2   1 
ATOM   6622  O  "O5'" . DA  I 5 28  ? 0.693   -12.234 17.709 1.00 115.12 ? -45 DA  I "O5'" 1 
ATOM   6623  C  "C5'" . DA  I 5 28  ? 0.607   -11.370 18.831 1.00 113.68 ? -45 DA  I "C5'" 1 
ATOM   6624  C  "C4'" . DA  I 5 28  ? 0.259   -9.974  18.351 1.00 112.89 ? -45 DA  I "C4'" 1 
ATOM   6625  O  "O4'" . DA  I 5 28  ? 1.141   -9.585  17.260 1.00 113.51 ? -45 DA  I "O4'" 1 
ATOM   6626  C  "C3'" . DA  I 5 28  ? -1.154  -9.850  17.794 1.00 112.29 ? -45 DA  I "C3'" 1 
ATOM   6627  O  "O3'" . DA  I 5 28  ? -1.631  -8.568  18.093 1.00 110.17 ? -45 DA  I "O3'" 1 
ATOM   6628  C  "C2'" . DA  I 5 28  ? -0.950  -9.957  16.288 1.00 113.23 ? -45 DA  I "C2'" 1 
ATOM   6629  C  "C1'" . DA  I 5 28  ? 0.331   -9.133  16.191 1.00 113.89 ? -45 DA  I "C1'" 1 
ATOM   6630  N  N9    . DA  I 5 28  ? 1.008   -9.184  14.895 1.00 114.65 ? -45 DA  I N9    1 
ATOM   6631  C  C8    . DA  I 5 28  ? 1.092   -10.241 14.024 1.00 115.10 ? -45 DA  I C8    1 
ATOM   6632  N  N7    . DA  I 5 28  ? 1.759   -9.979  12.926 1.00 115.41 ? -45 DA  I N7    1 
ATOM   6633  C  C5    . DA  I 5 28  ? 2.126   -8.655  13.089 1.00 115.66 ? -45 DA  I C5    1 
ATOM   6634  C  C6    . DA  I 5 28  ? 2.854   -7.770  12.275 1.00 116.13 ? -45 DA  I C6    1 
ATOM   6635  N  N6    . DA  I 5 28  ? 3.350   -8.139  11.091 1.00 116.88 ? -45 DA  I N6    1 
ATOM   6636  N  N1    . DA  I 5 28  ? 3.061   -6.509  12.723 1.00 115.92 ? -45 DA  I N1    1 
ATOM   6637  C  C2    . DA  I 5 28  ? 2.564   -6.154  13.917 1.00 115.27 ? -45 DA  I C2    1 
ATOM   6638  N  N3    . DA  I 5 28  ? 1.861   -6.899  14.769 1.00 115.10 ? -45 DA  I N3    1 
ATOM   6639  C  C4    . DA  I 5 28  ? 1.675   -8.147  14.293 1.00 115.12 ? -45 DA  I C4    1 
ATOM   6640  P  P     . DA  I 5 29  ? -2.595  -8.302  19.325 1.00 108.86 ? -44 DA  I P     1 
ATOM   6641  O  OP1   . DA  I 5 29  ? -2.077  -8.992  20.521 1.00 109.12 ? -44 DA  I OP1   1 
ATOM   6642  O  OP2   . DA  I 5 29  ? -3.985  -8.520  18.860 1.00 109.11 ? -44 DA  I OP2   1 
ATOM   6643  O  "O5'" . DA  I 5 29  ? -2.343  -6.743  19.565 1.00 107.97 ? -44 DA  I "O5'" 1 
ATOM   6644  C  "C5'" . DA  I 5 29  ? -3.077  -5.817  18.801 1.00 106.69 ? -44 DA  I "C5'" 1 
ATOM   6645  C  "C4'" . DA  I 5 29  ? -2.199  -4.767  18.151 1.00 105.83 ? -44 DA  I "C4'" 1 
ATOM   6646  O  "O4'" . DA  I 5 29  ? -1.327  -5.368  17.158 1.00 105.75 ? -44 DA  I "O4'" 1 
ATOM   6647  C  "C3'" . DA  I 5 29  ? -3.066  -3.751  17.425 1.00 105.11 ? -44 DA  I "C3'" 1 
ATOM   6648  O  "O3'" . DA  I 5 29  ? -2.974  -2.480  18.033 1.00 104.57 ? -44 DA  I "O3'" 1 
ATOM   6649  C  "C2'" . DA  I 5 29  ? -2.576  -3.741  15.981 1.00 105.11 ? -44 DA  I "C2'" 1 
ATOM   6650  C  "C1'" . DA  I 5 29  ? -1.355  -4.646  15.940 1.00 105.18 ? -44 DA  I "C1'" 1 
ATOM   6651  N  N9    . DA  I 5 29  ? -1.371  -5.563  14.791 1.00 105.11 ? -44 DA  I N9    1 
ATOM   6652  C  C8    . DA  I 5 29  ? -1.952  -6.800  14.731 1.00 105.25 ? -44 DA  I C8    1 
ATOM   6653  N  N7    . DA  I 5 29  ? -1.812  -7.410  13.577 1.00 105.14 ? -44 DA  I N7    1 
ATOM   6654  C  C5    . DA  I 5 29  ? -1.092  -6.508  12.811 1.00 104.91 ? -44 DA  I C5    1 
ATOM   6655  C  C6    . DA  I 5 29  ? -0.615  -6.553  11.481 1.00 104.46 ? -44 DA  I C6    1 
ATOM   6656  N  N6    . DA  I 5 29  ? -0.810  -7.586  10.659 1.00 104.70 ? -44 DA  I N6    1 
ATOM   6657  N  N1    . DA  I 5 29  ? 0.069   -5.491  11.015 1.00 103.99 ? -44 DA  I N1    1 
ATOM   6658  C  C2    . DA  I 5 29  ? 0.268   -4.446  11.829 1.00 104.37 ? -44 DA  I C2    1 
ATOM   6659  N  N3    . DA  I 5 29  ? -0.125  -4.284  13.094 1.00 104.83 ? -44 DA  I N3    1 
ATOM   6660  C  C4    . DA  I 5 29  ? -0.812  -5.361  13.539 1.00 105.13 ? -44 DA  I C4    1 
ATOM   6661  P  P     . DA  I 5 30  ? -4.223  -1.498  17.856 1.00 105.22 ? -43 DA  I P     1 
ATOM   6662  O  OP1   . DA  I 5 30  ? -4.221  -0.514  18.956 1.00 105.30 ? -43 DA  I OP1   1 
ATOM   6663  O  OP2   . DA  I 5 30  ? -5.438  -2.305  17.609 1.00 104.59 ? -43 DA  I OP2   1 
ATOM   6664  O  "O5'" . DA  I 5 30  ? -3.871  -0.738  16.498 1.00 107.67 ? -43 DA  I "O5'" 1 
ATOM   6665  C  "C5'" . DA  I 5 30  ? -2.556  -0.218  16.259 1.00 110.70 ? -43 DA  I "C5'" 1 
ATOM   6666  C  "C4'" . DA  I 5 30  ? -2.342  0.095   14.784 1.00 112.60 ? -43 DA  I "C4'" 1 
ATOM   6667  O  "O4'" . DA  I 5 30  ? -2.090  -1.109  14.010 1.00 112.80 ? -43 DA  I "O4'" 1 
ATOM   6668  C  "C3'" . DA  I 5 30  ? -3.520  0.809   14.133 1.00 113.99 ? -43 DA  I "C3'" 1 
ATOM   6669  O  "O3'" . DA  I 5 30  ? -3.047  2.011   13.557 1.00 116.07 ? -43 DA  I "O3'" 1 
ATOM   6670  C  "C2'" . DA  I 5 30  ? -4.056  -0.182  13.098 1.00 113.84 ? -43 DA  I "C2'" 1 
ATOM   6671  C  "C1'" . DA  I 5 30  ? -2.853  -1.082  12.821 1.00 113.48 ? -43 DA  I "C1'" 1 
ATOM   6672  N  N9    . DA  I 5 30  ? -3.207  -2.456  12.465 1.00 113.93 ? -43 DA  I N9    1 
ATOM   6673  C  C8    . DA  I 5 30  ? -3.904  -3.357  13.224 1.00 114.42 ? -43 DA  I C8    1 
ATOM   6674  N  N7    . DA  I 5 30  ? -4.079  -4.529  12.658 1.00 114.53 ? -43 DA  I N7    1 
ATOM   6675  C  C5    . DA  I 5 30  ? -3.460  -4.386  11.427 1.00 114.91 ? -43 DA  I C5    1 
ATOM   6676  C  C6    . DA  I 5 30  ? -3.294  -5.268  10.332 1.00 115.00 ? -43 DA  I C6    1 
ATOM   6677  N  N6    . DA  I 5 30  ? -3.756  -6.522  10.319 1.00 114.87 ? -43 DA  I N6    1 
ATOM   6678  N  N1    . DA  I 5 30  ? -2.623  -4.812  9.248  1.00 115.06 ? -43 DA  I N1    1 
ATOM   6679  C  C2    . DA  I 5 30  ? -2.152  -3.556  9.253  1.00 114.77 ? -43 DA  I C2    1 
ATOM   6680  N  N3    . DA  I 5 30  ? -2.248  -2.638  10.219 1.00 114.82 ? -43 DA  I N3    1 
ATOM   6681  C  C4    . DA  I 5 30  ? -2.917  -3.115  11.290 1.00 114.64 ? -43 DA  I C4    1 
ATOM   6682  P  P     . DG  I 5 31  ? -4.063  3.163   13.120 1.00 117.64 ? -42 DG  I P     1 
ATOM   6683  O  OP1   . DG  I 5 31  ? -3.415  4.451   13.440 1.00 117.48 ? -42 DG  I OP1   1 
ATOM   6684  O  OP2   . DG  I 5 31  ? -5.416  2.862   13.639 1.00 117.55 ? -42 DG  I OP2   1 
ATOM   6685  O  "O5'" . DG  I 5 31  ? -4.110  2.982   11.533 1.00 120.21 ? -42 DG  I "O5'" 1 
ATOM   6686  C  "C5'" . DG  I 5 31  ? -2.919  2.704   10.781 1.00 123.82 ? -42 DG  I "C5'" 1 
ATOM   6687  C  "C4'" . DG  I 5 31  ? -3.229  2.525   9.300  1.00 126.51 ? -42 DG  I "C4'" 1 
ATOM   6688  O  "O4'" . DG  I 5 31  ? -3.313  1.115   8.954  1.00 127.38 ? -42 DG  I "O4'" 1 
ATOM   6689  C  "C3'" . DG  I 5 31  ? -4.536  3.156   8.828  1.00 127.93 ? -42 DG  I "C3'" 1 
ATOM   6690  O  "O3'" . DG  I 5 31  ? -4.295  3.807   7.597  1.00 129.71 ? -42 DG  I "O3'" 1 
ATOM   6691  C  "C2'" . DG  I 5 31  ? -5.478  1.964   8.682  1.00 128.07 ? -42 DG  I "C2'" 1 
ATOM   6692  C  "C1'" . DG  I 5 31  ? -4.521  0.859   8.268  1.00 128.29 ? -42 DG  I "C1'" 1 
ATOM   6693  N  N9    . DG  I 5 31  ? -5.001  -0.465  8.643  1.00 129.32 ? -42 DG  I N9    1 
ATOM   6694  C  C8    . DG  I 5 31  ? -5.462  -0.865  9.875  1.00 129.70 ? -42 DG  I C8    1 
ATOM   6695  N  N7    . DG  I 5 31  ? -5.831  -2.115  9.920  1.00 130.15 ? -42 DG  I N7    1 
ATOM   6696  C  C5    . DG  I 5 31  ? -5.601  -2.578  8.632  1.00 130.65 ? -42 DG  I C5    1 
ATOM   6697  C  C6    . DG  I 5 31  ? -5.810  -3.867  8.070  1.00 131.33 ? -42 DG  I C6    1 
ATOM   6698  O  O6    . DG  I 5 31  ? -6.255  -4.883  8.624  1.00 131.68 ? -42 DG  I O6    1 
ATOM   6699  N  N1    . DG  I 5 31  ? -5.448  -3.916  6.720  1.00 131.49 ? -42 DG  I N1    1 
ATOM   6700  C  C2    . DG  I 5 31  ? -4.946  -2.848  6.009  1.00 131.32 ? -42 DG  I C2    1 
ATOM   6701  N  N2    . DG  I 5 31  ? -4.651  -3.081  4.725  1.00 131.68 ? -42 DG  I N2    1 
ATOM   6702  N  N3    . DG  I 5 31  ? -4.745  -1.636  6.522  1.00 130.84 ? -42 DG  I N3    1 
ATOM   6703  C  C4    . DG  I 5 31  ? -5.092  -1.572  7.833  1.00 130.24 ? -42 DG  I C4    1 
ATOM   6704  P  P     . DT  I 5 32  ? -5.445  4.563   6.780  1.00 131.29 ? -41 DT  I P     1 
ATOM   6705  O  OP1   . DT  I 5 32  ? -5.263  6.010   7.026  1.00 130.88 ? -41 DT  I OP1   1 
ATOM   6706  O  OP2   . DT  I 5 32  ? -6.771  3.943   7.018  1.00 131.17 ? -41 DT  I OP2   1 
ATOM   6707  O  "O5'" . DT  I 5 32  ? -4.997  4.203   5.284  1.00 133.01 ? -41 DT  I "O5'" 1 
ATOM   6708  C  "C5'" . DT  I 5 32  ? -4.641  2.864   4.917  1.00 135.00 ? -41 DT  I "C5'" 1 
ATOM   6709  C  "C4'" . DT  I 5 32  ? -5.642  2.250   3.948  1.00 136.66 ? -41 DT  I "C4'" 1 
ATOM   6710  O  "O4'" . DT  I 5 32  ? -6.056  0.953   4.451  1.00 136.95 ? -41 DT  I "O4'" 1 
ATOM   6711  C  "C3'" . DT  I 5 32  ? -6.924  3.048   3.695  1.00 137.72 ? -41 DT  I "C3'" 1 
ATOM   6712  O  "O3'" . DT  I 5 32  ? -7.137  3.157   2.283  1.00 139.48 ? -41 DT  I "O3'" 1 
ATOM   6713  C  "C2'" . DT  I 5 32  ? -8.013  2.247   4.409  1.00 137.42 ? -41 DT  I "C2'" 1 
ATOM   6714  C  "C1'" . DT  I 5 32  ? -7.458  0.831   4.325  1.00 137.37 ? -41 DT  I "C1'" 1 
ATOM   6715  N  N1    . DT  I 5 32  ? -7.951  -0.069  5.406  1.00 137.53 ? -41 DT  I N1    1 
ATOM   6716  C  C2    . DT  I 5 32  ? -8.130  -1.422  5.152  1.00 137.85 ? -41 DT  I C2    1 
ATOM   6717  O  O2    . DT  I 5 32  ? -7.914  -1.967  4.079  1.00 137.97 ? -41 DT  I O2    1 
ATOM   6718  N  N3    . DT  I 5 32  ? -8.585  -2.140  6.230  1.00 137.96 ? -41 DT  I N3    1 
ATOM   6719  C  C4    . DT  I 5 32  ? -8.874  -1.660  7.499  1.00 137.91 ? -41 DT  I C4    1 
ATOM   6720  O  O4    . DT  I 5 32  ? -9.281  -2.405  8.385  1.00 137.93 ? -41 DT  I O4    1 
ATOM   6721  C  C5    . DT  I 5 32  ? -8.666  -0.240  7.696  1.00 137.89 ? -41 DT  I C5    1 
ATOM   6722  C  C7    . DT  I 5 32  ? -8.940  0.411   9.025  1.00 137.71 ? -41 DT  I C7    1 
ATOM   6723  C  C6    . DT  I 5 32  ? -8.218  0.474   6.652  1.00 137.65 ? -41 DT  I C6    1 
ATOM   6724  P  P     . DG  I 5 33  ? -8.487  3.739   1.636  1.00 140.86 ? -40 DG  I P     1 
ATOM   6725  O  OP1   . DG  I 5 33  ? -8.092  4.431   0.389  1.00 140.88 ? -40 DG  I OP1   1 
ATOM   6726  O  OP2   . DG  I 5 33  ? -9.289  4.464   2.652  1.00 140.82 ? -40 DG  I OP2   1 
ATOM   6727  O  "O5'" . DG  I 5 33  ? -9.277  2.392   1.290  1.00 141.54 ? -40 DG  I "O5'" 1 
ATOM   6728  C  "C5'" . DG  I 5 33  ? -9.130  1.725   0.037  1.00 142.40 ? -40 DG  I "C5'" 1 
ATOM   6729  C  "C4'" . DG  I 5 33  ? -10.325 0.811   -0.183 1.00 143.19 ? -40 DG  I "C4'" 1 
ATOM   6730  O  "O4'" . DG  I 5 33  ? -10.388 -0.152  0.897  1.00 143.55 ? -40 DG  I "O4'" 1 
ATOM   6731  C  "C3'" . DG  I 5 33  ? -11.694 1.503   -0.221 1.00 143.54 ? -40 DG  I "C3'" 1 
ATOM   6732  O  "O3'" . DG  I 5 33  ? -12.633 0.944   -1.171 1.00 143.36 ? -40 DG  I "O3'" 1 
ATOM   6733  C  "C2'" . DG  I 5 33  ? -12.219 1.278   1.197  1.00 144.03 ? -40 DG  I "C2'" 1 
ATOM   6734  C  "C1'" . DG  I 5 33  ? -11.692 -0.134  1.441  1.00 144.40 ? -40 DG  I "C1'" 1 
ATOM   6735  N  N9    . DG  I 5 33  ? -11.614 -0.580  2.831  1.00 145.23 ? -40 DG  I N9    1 
ATOM   6736  C  C8    . DG  I 5 33  ? -11.541 0.181   3.978  1.00 145.45 ? -40 DG  I C8    1 
ATOM   6737  N  N7    . DG  I 5 33  ? -11.481 -0.531  5.069  1.00 145.59 ? -40 DG  I N7    1 
ATOM   6738  C  C5    . DG  I 5 33  ? -11.513 -1.846  4.616  1.00 145.92 ? -40 DG  I C5    1 
ATOM   6739  C  C6    . DG  I 5 33  ? -11.478 -3.069  5.334  1.00 146.36 ? -40 DG  I C6    1 
ATOM   6740  O  O6    . DG  I 5 33  ? -11.406 -3.221  6.559  1.00 146.50 ? -40 DG  I O6    1 
ATOM   6741  N  N1    . DG  I 5 33  ? -11.534 -4.188  4.492  1.00 146.65 ? -40 DG  I N1    1 
ATOM   6742  C  C2    . DG  I 5 33  ? -11.615 -4.129  3.116  1.00 146.55 ? -40 DG  I C2    1 
ATOM   6743  N  N2    . DG  I 5 33  ? -11.658 -5.299  2.457  1.00 146.63 ? -40 DG  I N2    1 
ATOM   6744  N  N3    . DG  I 5 33  ? -11.649 -2.988  2.434  1.00 146.23 ? -40 DG  I N3    1 
ATOM   6745  C  C4    . DG  I 5 33  ? -11.595 -1.893  3.243  1.00 145.76 ? -40 DG  I C4    1 
ATOM   6746  P  P     . DT  I 5 34  ? -12.307 0.071   -2.484 1.00 143.13 ? -39 DT  I P     1 
ATOM   6747  O  OP1   . DT  I 5 34  ? -10.864 0.060   -2.811 1.00 143.26 ? -39 DT  I OP1   1 
ATOM   6748  O  OP2   . DT  I 5 34  ? -13.273 0.512   -3.515 1.00 143.17 ? -39 DT  I OP2   1 
ATOM   6749  O  "O5'" . DT  I 5 34  ? -12.714 -1.395  -2.008 1.00 142.20 ? -39 DT  I "O5'" 1 
ATOM   6750  C  "C5'" . DT  I 5 34  ? -14.065 -1.745  -2.113 1.00 141.28 ? -39 DT  I "C5'" 1 
ATOM   6751  C  "C4'" . DT  I 5 34  ? -14.199 -3.251  -2.165 1.00 140.61 ? -39 DT  I "C4'" 1 
ATOM   6752  O  "O4'" . DT  I 5 34  ? -13.888 -3.777  -0.845 1.00 140.36 ? -39 DT  I "O4'" 1 
ATOM   6753  C  "C3'" . DT  I 5 34  ? -15.618 -3.702  -2.478 1.00 140.24 ? -39 DT  I "C3'" 1 
ATOM   6754  O  "O3'" . DT  I 5 34  ? -15.604 -5.022  -3.037 1.00 139.59 ? -39 DT  I "O3'" 1 
ATOM   6755  C  "C2'" . DT  I 5 34  ? -16.232 -3.662  -1.081 1.00 140.27 ? -39 DT  I "C2'" 1 
ATOM   6756  C  "C1'" . DT  I 5 34  ? -15.088 -4.258  -0.259 1.00 140.04 ? -39 DT  I "C1'" 1 
ATOM   6757  N  N1    . DT  I 5 34  ? -15.167 -3.937  1.204  1.00 139.49 ? -39 DT  I N1    1 
ATOM   6758  C  C2    . DT  I 5 34  ? -15.336 -4.971  2.113  1.00 139.11 ? -39 DT  I C2    1 
ATOM   6759  O  O2    . DT  I 5 34  ? -15.414 -6.149  1.799  1.00 138.96 ? -39 DT  I O2    1 
ATOM   6760  N  N3    . DT  I 5 34  ? -15.408 -4.575  3.428  1.00 138.62 ? -39 DT  I N3    1 
ATOM   6761  C  C4    . DT  I 5 34  ? -15.333 -3.279  3.911  1.00 138.65 ? -39 DT  I C4    1 
ATOM   6762  O  O4    . DT  I 5 34  ? -15.408 -3.038  5.110  1.00 138.38 ? -39 DT  I O4    1 
ATOM   6763  C  C5    . DT  I 5 34  ? -15.163 -2.243  2.914  1.00 138.90 ? -39 DT  I C5    1 
ATOM   6764  C  C7    . DT  I 5 34  ? -15.069 -0.796  3.311  1.00 138.71 ? -39 DT  I C7    1 
ATOM   6765  C  C6    . DT  I 5 34  ? -15.092 -2.617  1.625  1.00 139.29 ? -39 DT  I C6    1 
ATOM   6766  P  P     . DA  I 5 35  ? -16.954 -5.860  -3.255 1.00 139.28 ? -38 DA  I P     1 
ATOM   6767  O  OP1   . DA  I 5 35  ? -16.586 -7.124  -3.948 1.00 139.10 ? -38 DA  I OP1   1 
ATOM   6768  O  OP2   . DA  I 5 35  ? -17.970 -4.943  -3.839 1.00 138.97 ? -38 DA  I OP2   1 
ATOM   6769  O  "O5'" . DA  I 5 35  ? -17.435 -6.218  -1.766 1.00 139.07 ? -38 DA  I "O5'" 1 
ATOM   6770  C  "C5'" . DA  I 5 35  ? -17.001 -7.422  -1.084 1.00 138.69 ? -38 DA  I "C5'" 1 
ATOM   6771  C  "C4'" . DA  I 5 35  ? -18.155 -8.024  -0.277 1.00 138.11 ? -38 DA  I "C4'" 1 
ATOM   6772  O  "O4'" . DA  I 5 35  ? -18.168 -7.486  1.080  1.00 138.21 ? -38 DA  I "O4'" 1 
ATOM   6773  C  "C3'" . DA  I 5 35  ? -19.539 -7.771  -0.878 1.00 137.41 ? -38 DA  I "C3'" 1 
ATOM   6774  O  "O3'" . DA  I 5 35  ? -20.196 -9.022  -1.219 1.00 135.89 ? -38 DA  I "O3'" 1 
ATOM   6775  C  "C2'" . DA  I 5 35  ? -20.278 -6.846  0.097  1.00 137.78 ? -38 DA  I "C2'" 1 
ATOM   6776  C  "C1'" . DA  I 5 35  ? -19.403 -6.834  1.358  1.00 138.42 ? -38 DA  I "C1'" 1 
ATOM   6777  N  N9    . DA  I 5 35  ? -19.124 -5.520  1.953  1.00 138.85 ? -38 DA  I N9    1 
ATOM   6778  C  C8    . DA  I 5 35  ? -18.837 -4.344  1.306  1.00 139.15 ? -38 DA  I C8    1 
ATOM   6779  N  N7    . DA  I 5 35  ? -18.625 -3.323  2.108  1.00 139.03 ? -38 DA  I N7    1 
ATOM   6780  C  C5    . DA  I 5 35  ? -18.784 -3.868  3.370  1.00 139.20 ? -38 DA  I C5    1 
ATOM   6781  C  C6    . DA  I 5 35  ? -18.690 -3.306  4.661  1.00 139.40 ? -38 DA  I C6    1 
ATOM   6782  N  N6    . DA  I 5 35  ? -18.399 -2.015  4.866  1.00 139.33 ? -38 DA  I N6    1 
ATOM   6783  N  N1    . DA  I 5 35  ? -18.906 -4.120  5.723  1.00 139.55 ? -38 DA  I N1    1 
ATOM   6784  C  C2    . DA  I 5 35  ? -19.196 -5.414  5.501  1.00 139.37 ? -38 DA  I C2    1 
ATOM   6785  N  N3    . DA  I 5 35  ? -19.310 -6.056  4.333  1.00 139.01 ? -38 DA  I N3    1 
ATOM   6786  C  C4    . DA  I 5 35  ? -19.091 -5.220  3.298  1.00 139.00 ? -38 DA  I C4    1 
ATOM   6787  P  P     . DT  I 5 36  ? -21.011 -10.044 -0.275 1.00 134.43 ? -37 DT  I P     1 
ATOM   6788  O  OP1   . DT  I 5 36  ? -20.551 -11.408 -0.624 1.00 134.28 ? -37 DT  I OP1   1 
ATOM   6789  O  OP2   . DT  I 5 36  ? -22.448 -9.690  -0.414 1.00 134.16 ? -37 DT  I OP2   1 
ATOM   6790  O  "O5'" . DT  I 5 36  ? -20.553 -9.818  1.240  1.00 133.09 ? -37 DT  I "O5'" 1 
ATOM   6791  C  "C5'" . DT  I 5 36  ? -21.556 -9.389  2.138  1.00 130.60 ? -37 DT  I "C5'" 1 
ATOM   6792  C  "C4'" . DT  I 5 36  ? -21.548 -10.057 3.495  1.00 128.55 ? -37 DT  I "C4'" 1 
ATOM   6793  O  "O4'" . DT  I 5 36  ? -21.206 -9.047  4.474  1.00 128.80 ? -37 DT  I "O4'" 1 
ATOM   6794  C  "C3'" . DT  I 5 36  ? -22.942 -10.515 3.897  1.00 126.94 ? -37 DT  I "C3'" 1 
ATOM   6795  O  "O3'" . DT  I 5 36  ? -22.930 -11.402 5.010  1.00 123.92 ? -37 DT  I "O3'" 1 
ATOM   6796  C  "C2'" . DT  I 5 36  ? -23.569 -9.187  4.288  1.00 127.83 ? -37 DT  I "C2'" 1 
ATOM   6797  C  "C1'" . DT  I 5 36  ? -22.408 -8.494  4.998  1.00 129.11 ? -37 DT  I "C1'" 1 
ATOM   6798  N  N1    . DT  I 5 36  ? -22.427 -7.001  4.836  1.00 129.99 ? -37 DT  I N1    1 
ATOM   6799  C  C2    . DT  I 5 36  ? -22.462 -6.214  5.973  1.00 130.55 ? -37 DT  I C2    1 
ATOM   6800  O  O2    . DT  I 5 36  ? -22.468 -6.657  7.112  1.00 131.06 ? -37 DT  I O2    1 
ATOM   6801  N  N3    . DT  I 5 36  ? -22.480 -4.862  5.725  1.00 130.73 ? -37 DT  I N3    1 
ATOM   6802  C  C4    . DT  I 5 36  ? -22.473 -4.230  4.493  1.00 130.46 ? -37 DT  I C4    1 
ATOM   6803  O  O4    . DT  I 5 36  ? -22.493 -3.008  4.397  1.00 130.27 ? -37 DT  I O4    1 
ATOM   6804  C  C5    . DT  I 5 36  ? -22.446 -5.107  3.343  1.00 130.48 ? -37 DT  I C5    1 
ATOM   6805  C  C7    . DT  I 5 36  ? -22.440 -4.545  1.948  1.00 130.65 ? -37 DT  I C7    1 
ATOM   6806  C  C6    . DT  I 5 36  ? -22.427 -6.430  3.569  1.00 130.23 ? -37 DT  I C6    1 
ATOM   6807  P  P     . DT  I 5 37  ? -24.270 -12.139 5.510  1.00 121.55 ? -36 DT  I P     1 
ATOM   6808  O  OP1   . DT  I 5 37  ? -24.216 -13.509 4.957  1.00 121.43 ? -36 DT  I OP1   1 
ATOM   6809  O  OP2   . DT  I 5 37  ? -25.465 -11.307 5.255  1.00 121.46 ? -36 DT  I OP2   1 
ATOM   6810  O  "O5'" . DT  I 5 37  ? -24.091 -12.219 7.103  1.00 120.42 ? -36 DT  I "O5'" 1 
ATOM   6811  C  "C5'" . DT  I 5 37  ? -23.287 -11.289 7.834  1.00 117.49 ? -36 DT  I "C5'" 1 
ATOM   6812  C  "C4'" . DT  I 5 37  ? -24.090 -10.459 8.828  1.00 115.44 ? -36 DT  I "C4'" 1 
ATOM   6813  O  "O4'" . DT  I 5 37  ? -24.165 -9.084  8.373  1.00 114.82 ? -36 DT  I "O4'" 1 
ATOM   6814  C  "C3'" . DT  I 5 37  ? -25.519 -10.904 9.143  1.00 114.00 ? -36 DT  I "C3'" 1 
ATOM   6815  O  "O3'" . DT  I 5 37  ? -25.462 -11.356 10.504 1.00 111.77 ? -36 DT  I "O3'" 1 
ATOM   6816  C  "C2'" . DT  I 5 37  ? -26.396 -9.667  8.870  1.00 113.99 ? -36 DT  I "C2'" 1 
ATOM   6817  C  "C1'" . DT  I 5 37  ? -25.394 -8.517  8.775  1.00 114.59 ? -36 DT  I "C1'" 1 
ATOM   6818  N  N1    . DT  I 5 37  ? -25.678 -7.387  7.809  1.00 114.89 ? -36 DT  I N1    1 
ATOM   6819  C  C2    . DT  I 5 37  ? -25.836 -6.097  8.290  1.00 115.28 ? -36 DT  I C2    1 
ATOM   6820  O  O2    . DT  I 5 37  ? -25.788 -5.787  9.466  1.00 115.76 ? -36 DT  I O2    1 
ATOM   6821  N  N3    . DT  I 5 37  ? -26.066 -5.145  7.330  1.00 115.38 ? -36 DT  I N3    1 
ATOM   6822  C  C4    . DT  I 5 37  ? -26.146 -5.336  5.964  1.00 115.37 ? -36 DT  I C4    1 
ATOM   6823  O  O4    . DT  I 5 37  ? -26.358 -4.402  5.196  1.00 115.54 ? -36 DT  I O4    1 
ATOM   6824  C  C5    . DT  I 5 37  ? -25.963 -6.696  5.514  1.00 115.34 ? -36 DT  I C5    1 
ATOM   6825  C  C7    . DT  I 5 37  ? -26.034 -7.023  4.048  1.00 114.96 ? -36 DT  I C7    1 
ATOM   6826  C  C6    . DT  I 5 37  ? -25.738 -7.638  6.447  1.00 115.23 ? -36 DT  I C6    1 
ATOM   6827  P  P     . DT  I 5 38  ? -26.698 -11.723 11.452 1.00 109.61 ? -35 DT  I P     1 
ATOM   6828  O  OP1   . DT  I 5 38  ? -26.270 -12.900 12.231 1.00 110.08 ? -35 DT  I OP1   1 
ATOM   6829  O  OP2   . DT  I 5 38  ? -27.964 -11.761 10.690 1.00 109.54 ? -35 DT  I OP2   1 
ATOM   6830  O  "O5'" . DT  I 5 38  ? -26.749 -10.465 12.427 1.00 109.54 ? -35 DT  I "O5'" 1 
ATOM   6831  C  "C5'" . DT  I 5 38  ? -25.560 -9.967  13.027 1.00 109.01 ? -35 DT  I "C5'" 1 
ATOM   6832  C  "C4'" . DT  I 5 38  ? -25.859 -8.634  13.686 1.00 108.85 ? -35 DT  I "C4'" 1 
ATOM   6833  O  "O4'" . DT  I 5 38  ? -26.226 -7.656  12.675 1.00 109.62 ? -35 DT  I "O4'" 1 
ATOM   6834  C  "C3'" . DT  I 5 38  ? -27.004 -8.689  14.688 1.00 108.37 ? -35 DT  I "C3'" 1 
ATOM   6835  O  "O3'" . DT  I 5 38  ? -26.569 -8.065  15.881 1.00 107.04 ? -35 DT  I "O3'" 1 
ATOM   6836  C  "C2'" . DT  I 5 38  ? -28.150 -7.921  14.017 1.00 109.24 ? -35 DT  I "C2'" 1 
ATOM   6837  C  "C1'" . DT  I 5 38  ? -27.455 -7.024  12.990 1.00 110.06 ? -35 DT  I "C1'" 1 
ATOM   6838  N  N1    . DT  I 5 38  ? -28.230 -6.747  11.702 1.00 110.96 ? -35 DT  I N1    1 
ATOM   6839  C  C2    . DT  I 5 38  ? -28.259 -5.460  11.156 1.00 111.18 ? -35 DT  I C2    1 
ATOM   6840  O  O2    . DT  I 5 38  ? -27.701 -4.481  11.628 1.00 110.51 ? -35 DT  I O2    1 
ATOM   6841  N  N3    . DT  I 5 38  ? -28.981 -5.341  9.992  1.00 111.56 ? -35 DT  I N3    1 
ATOM   6842  C  C4    . DT  I 5 38  ? -29.666 -6.344  9.320  1.00 112.31 ? -35 DT  I C4    1 
ATOM   6843  O  O4    . DT  I 5 38  ? -30.288 -6.109  8.283  1.00 113.00 ? -35 DT  I O4    1 
ATOM   6844  C  C5    . DT  I 5 38  ? -29.605 -7.660  9.933  1.00 112.26 ? -35 DT  I C5    1 
ATOM   6845  C  C7    . DT  I 5 38  ? -30.312 -8.837  9.308  1.00 112.40 ? -35 DT  I C7    1 
ATOM   6846  C  C6    . DT  I 5 38  ? -28.899 -7.793  11.072 1.00 111.38 ? -35 DT  I C6    1 
ATOM   6847  P  P     . DG  I 5 39  ? -27.032 -8.551  17.338 1.00 105.58 ? -34 DG  I P     1 
ATOM   6848  O  OP1   . DG  I 5 39  ? -25.810 -9.012  18.021 1.00 105.41 ? -34 DG  I OP1   1 
ATOM   6849  O  OP2   . DG  I 5 39  ? -28.188 -9.469  17.265 1.00 105.62 ? -34 DG  I OP2   1 
ATOM   6850  O  "O5'" . DG  I 5 39  ? -27.564 -7.184  17.984 1.00 106.44 ? -34 DG  I "O5'" 1 
ATOM   6851  C  "C5'" . DG  I 5 39  ? -27.306 -5.903  17.379 1.00 107.65 ? -34 DG  I "C5'" 1 
ATOM   6852  C  "C4'" . DG  I 5 39  ? -28.546 -5.041  17.141 1.00 108.82 ? -34 DG  I "C4'" 1 
ATOM   6853  O  "O4'" . DG  I 5 39  ? -29.056 -5.277  15.806 1.00 109.27 ? -34 DG  I "O4'" 1 
ATOM   6854  C  "C3'" . DG  I 5 39  ? -29.751 -5.239  18.064 1.00 109.95 ? -34 DG  I "C3'" 1 
ATOM   6855  O  "O3'" . DG  I 5 39  ? -30.254 -3.982  18.487 1.00 111.41 ? -34 DG  I "O3'" 1 
ATOM   6856  C  "C2'" . DG  I 5 39  ? -30.776 -5.953  17.196 1.00 109.70 ? -34 DG  I "C2'" 1 
ATOM   6857  C  "C1'" . DG  I 5 39  ? -30.468 -5.281  15.869 1.00 109.58 ? -34 DG  I "C1'" 1 
ATOM   6858  N  N9    . DG  I 5 39  ? -31.044 -5.918  14.682 1.00 109.70 ? -34 DG  I N9    1 
ATOM   6859  C  C8    . DG  I 5 39  ? -31.511 -7.207  14.541 1.00 109.51 ? -34 DG  I C8    1 
ATOM   6860  N  N7    . DG  I 5 39  ? -31.972 -7.475  13.351 1.00 109.45 ? -34 DG  I N7    1 
ATOM   6861  C  C5    . DG  I 5 39  ? -31.810 -6.282  12.652 1.00 110.06 ? -34 DG  I C5    1 
ATOM   6862  C  C6    . DG  I 5 39  ? -32.133 -5.948  11.306 1.00 109.90 ? -34 DG  I C6    1 
ATOM   6863  O  O6    . DG  I 5 39  ? -32.640 -6.678  10.438 1.00 109.38 ? -34 DG  I O6    1 
ATOM   6864  N  N1    . DG  I 5 39  ? -31.800 -4.620  11.003 1.00 109.73 ? -34 DG  I N1    1 
ATOM   6865  C  C2    . DG  I 5 39  ? -31.228 -3.727  11.888 1.00 109.64 ? -34 DG  I C2    1 
ATOM   6866  N  N2    . DG  I 5 39  ? -30.975 -2.492  11.436 1.00 109.44 ? -34 DG  I N2    1 
ATOM   6867  N  N3    . DG  I 5 39  ? -30.928 -4.027  13.146 1.00 109.79 ? -34 DG  I N3    1 
ATOM   6868  C  C4    . DG  I 5 39  ? -31.241 -5.314  13.461 1.00 109.84 ? -34 DG  I C4    1 
ATOM   6869  P  P     . DG  I 5 40  ? -30.060 -3.538  20.009 1.00 113.16 ? -33 DG  I P     1 
ATOM   6870  O  OP1   . DG  I 5 40  ? -28.772 -4.094  20.503 1.00 113.53 ? -33 DG  I OP1   1 
ATOM   6871  O  OP2   . DG  I 5 40  ? -31.332 -3.792  20.737 1.00 112.81 ? -33 DG  I OP2   1 
ATOM   6872  O  "O5'" . DG  I 5 40  ? -29.875 -1.962  19.879 1.00 114.81 ? -33 DG  I "O5'" 1 
ATOM   6873  C  "C5'" . DG  I 5 40  ? -31.024 -1.153  19.958 1.00 117.16 ? -33 DG  I "C5'" 1 
ATOM   6874  C  "C4'" . DG  I 5 40  ? -31.079 -0.199  18.778 1.00 118.58 ? -33 DG  I "C4'" 1 
ATOM   6875  O  "O4'" . DG  I 5 40  ? -31.185 -0.931  17.523 1.00 118.64 ? -33 DG  I "O4'" 1 
ATOM   6876  C  "C3'" . DG  I 5 40  ? -32.293 0.708   18.852 1.00 119.47 ? -33 DG  I "C3'" 1 
ATOM   6877  O  "O3'" . DG  I 5 40  ? -31.969 1.983   18.301 1.00 121.03 ? -33 DG  I "O3'" 1 
ATOM   6878  C  "C2'" . DG  I 5 40  ? -33.324 -0.060  18.025 1.00 119.31 ? -33 DG  I "C2'" 1 
ATOM   6879  C  "C1'" . DG  I 5 40  ? -32.463 -0.727  16.954 1.00 119.13 ? -33 DG  I "C1'" 1 
ATOM   6880  N  N9    . DG  I 5 40  ? -33.010 -2.008  16.519 1.00 119.34 ? -33 DG  I N9    1 
ATOM   6881  C  C8    . DG  I 5 40  ? -33.220 -3.127  17.293 1.00 119.65 ? -33 DG  I C8    1 
ATOM   6882  N  N7    . DG  I 5 40  ? -33.729 -4.131  16.633 1.00 119.73 ? -33 DG  I N7    1 
ATOM   6883  C  C5    . DG  I 5 40  ? -33.869 -3.647  15.337 1.00 119.55 ? -33 DG  I C5    1 
ATOM   6884  C  C6    . DG  I 5 40  ? -34.368 -4.284  14.171 1.00 119.41 ? -33 DG  I C6    1 
ATOM   6885  O  O6    . DG  I 5 40  ? -34.803 -5.438  14.055 1.00 119.63 ? -33 DG  I O6    1 
ATOM   6886  N  N1    . DG  I 5 40  ? -34.343 -3.441  13.060 1.00 119.31 ? -33 DG  I N1    1 
ATOM   6887  C  C2    . DG  I 5 40  ? -33.883 -2.143  13.078 1.00 119.46 ? -33 DG  I C2    1 
ATOM   6888  N  N2    . DG  I 5 40  ? -33.926 -1.483  11.916 1.00 119.76 ? -33 DG  I N2    1 
ATOM   6889  N  N3    . DG  I 5 40  ? -33.410 -1.532  14.158 1.00 119.66 ? -33 DG  I N3    1 
ATOM   6890  C  C4    . DG  I 5 40  ? -33.433 -2.340  15.251 1.00 119.56 ? -33 DG  I C4    1 
ATOM   6891  P  P     . DA  I 5 41  ? -32.865 3.278   18.598 1.00 122.26 ? -32 DA  I P     1 
ATOM   6892  O  OP1   . DA  I 5 41  ? -31.929 4.333   19.042 1.00 121.89 ? -32 DA  I OP1   1 
ATOM   6893  O  OP2   . DA  I 5 41  ? -34.012 2.906   19.464 1.00 122.19 ? -32 DA  I OP2   1 
ATOM   6894  O  "O5'" . DA  I 5 41  ? -33.437 3.678   17.149 1.00 123.39 ? -32 DA  I "O5'" 1 
ATOM   6895  C  "C5'" . DA  I 5 41  ? -33.755 2.690   16.147 1.00 124.55 ? -32 DA  I "C5'" 1 
ATOM   6896  C  "C4'" . DA  I 5 41  ? -35.029 3.025   15.374 1.00 125.73 ? -32 DA  I "C4'" 1 
ATOM   6897  O  "O4'" . DA  I 5 41  ? -35.503 1.813   14.721 1.00 125.95 ? -32 DA  I "O4'" 1 
ATOM   6898  C  "C3'" . DA  I 5 41  ? -36.187 3.567   16.212 1.00 126.77 ? -32 DA  I "C3'" 1 
ATOM   6899  O  "O3'" . DA  I 5 41  ? -36.694 4.773   15.596 1.00 128.62 ? -32 DA  I "O3'" 1 
ATOM   6900  C  "C2'" . DA  I 5 41  ? -37.199 2.413   16.287 1.00 126.42 ? -32 DA  I "C2'" 1 
ATOM   6901  C  "C1'" . DA  I 5 41  ? -36.805 1.466   15.154 1.00 126.08 ? -32 DA  I "C1'" 1 
ATOM   6902  N  N9    . DA  I 5 41  ? -36.809 0.067   15.585 1.00 125.80 ? -32 DA  I N9    1 
ATOM   6903  C  C8    . DA  I 5 41  ? -36.541 -0.394  16.846 1.00 125.93 ? -32 DA  I C8    1 
ATOM   6904  N  N7    . DA  I 5 41  ? -36.618 -1.696  16.975 1.00 125.81 ? -32 DA  I N7    1 
ATOM   6905  C  C5    . DA  I 5 41  ? -36.967 -2.125  15.706 1.00 125.54 ? -32 DA  I C5    1 
ATOM   6906  C  C6    . DA  I 5 41  ? -37.207 -3.411  15.178 1.00 125.22 ? -32 DA  I C6    1 
ATOM   6907  N  N6    . DA  I 5 41  ? -37.119 -4.527  15.907 1.00 124.84 ? -32 DA  I N6    1 
ATOM   6908  N  N1    . DA  I 5 41  ? -37.534 -3.506  13.870 1.00 125.27 ? -32 DA  I N1    1 
ATOM   6909  C  C2    . DA  I 5 41  ? -37.618 -2.382  13.143 1.00 125.33 ? -32 DA  I C2    1 
ATOM   6910  N  N3    . DA  I 5 41  ? -37.416 -1.120  13.530 1.00 125.53 ? -32 DA  I N3    1 
ATOM   6911  C  C4    . DA  I 5 41  ? -37.090 -1.054  14.835 1.00 125.57 ? -32 DA  I C4    1 
ATOM   6912  P  P     . DA  I 5 42  ? -38.196 5.322   15.786 1.00 130.28 ? -31 DA  I P     1 
ATOM   6913  O  OP1   . DA  I 5 42  ? -38.294 6.650   15.135 1.00 130.27 ? -31 DA  I OP1   1 
ATOM   6914  O  OP2   . DA  I 5 42  ? -38.602 5.166   17.206 1.00 129.98 ? -31 DA  I OP2   1 
ATOM   6915  O  "O5'" . DA  I 5 42  ? -39.007 4.253   14.923 1.00 131.10 ? -31 DA  I "O5'" 1 
ATOM   6916  C  "C5'" . DA  I 5 42  ? -39.524 4.545   13.643 1.00 132.50 ? -31 DA  I "C5'" 1 
ATOM   6917  C  "C4'" . DA  I 5 42  ? -40.754 3.682   13.467 1.00 133.55 ? -31 DA  I "C4'" 1 
ATOM   6918  O  "O4'" . DA  I 5 42  ? -40.420 2.303   13.775 1.00 133.99 ? -31 DA  I "O4'" 1 
ATOM   6919  C  "C3'" . DA  I 5 42  ? -41.925 4.057   14.372 1.00 133.94 ? -31 DA  I "C3'" 1 
ATOM   6920  O  "O3'" . DA  I 5 42  ? -43.103 4.030   13.585 1.00 134.48 ? -31 DA  I "O3'" 1 
ATOM   6921  C  "C2'" . DA  I 5 42  ? -41.920 2.956   15.430 1.00 133.98 ? -31 DA  I "C2'" 1 
ATOM   6922  C  "C1'" . DA  I 5 42  ? -41.450 1.776   14.587 1.00 134.33 ? -31 DA  I "C1'" 1 
ATOM   6923  N  N9    . DA  I 5 42  ? -40.972 0.617   15.345 1.00 134.77 ? -31 DA  I N9    1 
ATOM   6924  C  C8    . DA  I 5 42  ? -40.342 0.610   16.562 1.00 135.00 ? -31 DA  I C8    1 
ATOM   6925  N  N7    . DA  I 5 42  ? -40.040 -0.590  16.998 1.00 135.19 ? -31 DA  I N7    1 
ATOM   6926  C  C5    . DA  I 5 42  ? -40.504 -1.435  15.999 1.00 135.30 ? -31 DA  I C5    1 
ATOM   6927  C  C6    . DA  I 5 42  ? -40.494 -2.845  15.847 1.00 135.44 ? -31 DA  I C6    1 
ATOM   6928  N  N6    . DA  I 5 42  ? -39.972 -3.681  16.752 1.00 135.53 ? -31 DA  I N6    1 
ATOM   6929  N  N1    . DA  I 5 42  ? -41.043 -3.370  14.726 1.00 135.31 ? -31 DA  I N1    1 
ATOM   6930  C  C2    . DA  I 5 42  ? -41.569 -2.537  13.816 1.00 135.28 ? -31 DA  I C2    1 
ATOM   6931  N  N3    . DA  I 5 42  ? -41.638 -1.202  13.849 1.00 135.18 ? -31 DA  I N3    1 
ATOM   6932  C  C4    . DA  I 5 42  ? -41.085 -0.705  14.974 1.00 135.01 ? -31 DA  I C4    1 
ATOM   6933  P  P     . DA  I 5 43  ? -44.469 4.702   14.066 1.00 134.75 ? -30 DA  I P     1 
ATOM   6934  O  OP1   . DA  I 5 43  ? -44.336 6.161   13.848 1.00 134.63 ? -30 DA  I OP1   1 
ATOM   6935  O  OP2   . DA  I 5 43  ? -44.815 4.180   15.409 1.00 134.72 ? -30 DA  I OP2   1 
ATOM   6936  O  "O5'" . DA  I 5 43  ? -45.534 4.104   13.026 1.00 135.51 ? -30 DA  I "O5'" 1 
ATOM   6937  C  "C5'" . DA  I 5 43  ? -45.212 2.979   12.198 1.00 136.68 ? -30 DA  I "C5'" 1 
ATOM   6938  C  "C4'" . DA  I 5 43  ? -45.869 1.685   12.661 1.00 137.66 ? -30 DA  I "C4'" 1 
ATOM   6939  O  "O4'" . DA  I 5 43  ? -44.975 0.947   13.543 1.00 138.35 ? -30 DA  I "O4'" 1 
ATOM   6940  C  "C3'" . DA  I 5 43  ? -47.188 1.817   13.429 1.00 137.99 ? -30 DA  I "C3'" 1 
ATOM   6941  O  "O3'" . DA  I 5 43  ? -48.156 0.919   12.876 1.00 137.74 ? -30 DA  I "O3'" 1 
ATOM   6942  C  "C2'" . DA  I 5 43  ? -46.793 1.409   14.847 1.00 138.46 ? -30 DA  I "C2'" 1 
ATOM   6943  C  "C1'" . DA  I 5 43  ? -45.795 0.315   14.504 1.00 138.82 ? -30 DA  I "C1'" 1 
ATOM   6944  N  N9    . DA  I 5 43  ? -45.019 -0.198  15.633 1.00 139.57 ? -30 DA  I N9    1 
ATOM   6945  C  C8    . DA  I 5 43  ? -44.483 0.516   16.673 1.00 139.86 ? -30 DA  I C8    1 
ATOM   6946  N  N7    . DA  I 5 43  ? -43.840 -0.220  17.549 1.00 140.12 ? -30 DA  I N7    1 
ATOM   6947  C  C5    . DA  I 5 43  ? -43.961 -1.509  17.055 1.00 140.37 ? -30 DA  I C5    1 
ATOM   6948  C  C6    . DA  I 5 43  ? -43.494 -2.760  17.522 1.00 140.74 ? -30 DA  I C6    1 
ATOM   6949  N  N6    . DA  I 5 43  ? -42.780 -2.899  18.645 1.00 141.00 ? -30 DA  I N6    1 
ATOM   6950  N  N1    . DA  I 5 43  ? -43.787 -3.863  16.790 1.00 140.82 ? -30 DA  I N1    1 
ATOM   6951  C  C2    . DA  I 5 43  ? -44.502 -3.718  15.664 1.00 140.78 ? -30 DA  I C2    1 
ATOM   6952  N  N3    . DA  I 5 43  ? -44.995 -2.596  15.128 1.00 140.47 ? -30 DA  I N3    1 
ATOM   6953  C  C4    . DA  I 5 43  ? -44.688 -1.516  15.874 1.00 140.14 ? -30 DA  I C4    1 
ATOM   6954  P  P     . DC  I 5 44  ? -49.692 0.925   13.345 1.00 137.51 ? -29 DC  I P     1 
ATOM   6955  O  OP1   . DC  I 5 44  ? -50.493 1.417   12.196 1.00 137.77 ? -29 DC  I OP1   1 
ATOM   6956  O  OP2   . DC  I 5 44  ? -49.812 1.610   14.660 1.00 137.38 ? -29 DC  I OP2   1 
ATOM   6957  O  "O5'" . DC  I 5 44  ? -50.000 -0.639  13.537 1.00 137.32 ? -29 DC  I "O5'" 1 
ATOM   6958  C  "C5'" . DC  I 5 44  ? -49.452 -1.320  14.661 1.00 136.76 ? -29 DC  I "C5'" 1 
ATOM   6959  C  "C4'" . DC  I 5 44  ? -49.686 -2.826  14.662 1.00 136.12 ? -29 DC  I "C4'" 1 
ATOM   6960  O  "O4'" . DC  I 5 44  ? -48.541 -3.472  15.283 1.00 136.15 ? -29 DC  I "O4'" 1 
ATOM   6961  C  "C3'" . DC  I 5 44  ? -50.908 -3.284  15.452 1.00 135.37 ? -29 DC  I "C3'" 1 
ATOM   6962  O  "O3'" . DC  I 5 44  ? -51.609 -4.274  14.723 1.00 134.22 ? -29 DC  I "O3'" 1 
ATOM   6963  C  "C2'" . DC  I 5 44  ? -50.370 -3.893  16.747 1.00 135.71 ? -29 DC  I "C2'" 1 
ATOM   6964  C  "C1'" . DC  I 5 44  ? -48.855 -3.882  16.604 1.00 135.88 ? -29 DC  I "C1'" 1 
ATOM   6965  N  N1    . DC  I 5 44  ? -48.209 -3.009  17.653 1.00 135.68 ? -29 DC  I N1    1 
ATOM   6966  C  C2    . DC  I 5 44  ? -47.661 -3.625  18.786 1.00 135.55 ? -29 DC  I C2    1 
ATOM   6967  O  O2    . DC  I 5 44  ? -47.716 -4.854  18.883 1.00 135.64 ? -29 DC  I O2    1 
ATOM   6968  N  N3    . DC  I 5 44  ? -47.083 -2.854  19.746 1.00 135.32 ? -29 DC  I N3    1 
ATOM   6969  C  C4    . DC  I 5 44  ? -47.045 -1.525  19.610 1.00 135.26 ? -29 DC  I C4    1 
ATOM   6970  N  N4    . DC  I 5 44  ? -46.466 -0.809  20.578 1.00 135.38 ? -29 DC  I N4    1 
ATOM   6971  C  C5    . DC  I 5 44  ? -47.602 -0.870  18.472 1.00 135.34 ? -29 DC  I C5    1 
ATOM   6972  C  C6    . DC  I 5 44  ? -48.167 -1.644  17.537 1.00 135.58 ? -29 DC  I C6    1 
ATOM   6973  P  P     . DT  I 5 45  ? -53.122 -4.656  15.094 1.00 133.63 ? -28 DT  I P     1 
ATOM   6974  O  OP1   . DT  I 5 45  ? -53.946 -4.209  13.939 1.00 133.71 ? -28 DT  I OP1   1 
ATOM   6975  O  OP2   . DT  I 5 45  ? -53.463 -4.170  16.455 1.00 133.17 ? -28 DT  I OP2   1 
ATOM   6976  O  "O5'" . DT  I 5 45  ? -53.099 -6.264  15.117 1.00 132.47 ? -28 DT  I "O5'" 1 
ATOM   6977  C  "C5'" . DT  I 5 45  ? -51.974 -7.036  15.586 1.00 130.31 ? -28 DT  I "C5'" 1 
ATOM   6978  C  "C4'" . DT  I 5 45  ? -52.202 -7.666  16.959 1.00 128.78 ? -28 DT  I "C4'" 1 
ATOM   6979  O  "O4'" . DT  I 5 45  ? -51.254 -7.063  17.883 1.00 128.58 ? -28 DT  I "O4'" 1 
ATOM   6980  C  "C3'" . DT  I 5 45  ? -53.602 -7.476  17.569 1.00 127.88 ? -28 DT  I "C3'" 1 
ATOM   6981  O  "O3'" . DT  I 5 45  ? -54.296 -8.673  18.045 1.00 126.23 ? -28 DT  I "O3'" 1 
ATOM   6982  C  "C2'" . DT  I 5 45  ? -53.357 -6.506  18.727 1.00 127.98 ? -28 DT  I "C2'" 1 
ATOM   6983  C  "C1'" . DT  I 5 45  ? -51.912 -6.825  19.111 1.00 128.09 ? -28 DT  I "C1'" 1 
ATOM   6984  N  N1    . DT  I 5 45  ? -51.167 -5.763  19.898 1.00 127.66 ? -28 DT  I N1    1 
ATOM   6985  C  C2    . DT  I 5 45  ? -49.998 -6.106  20.569 1.00 127.58 ? -28 DT  I C2    1 
ATOM   6986  O  O2    . DT  I 5 45  ? -49.501 -7.221  20.572 1.00 127.75 ? -28 DT  I O2    1 
ATOM   6987  N  N3    . DT  I 5 45  ? -49.401 -5.077  21.254 1.00 127.03 ? -28 DT  I N3    1 
ATOM   6988  C  C4    . DT  I 5 45  ? -49.835 -3.768  21.348 1.00 127.12 ? -28 DT  I C4    1 
ATOM   6989  O  O4    . DT  I 5 45  ? -49.208 -2.937  21.998 1.00 126.83 ? -28 DT  I O4    1 
ATOM   6990  C  C5    . DT  I 5 45  ? -51.059 -3.466  20.630 1.00 127.43 ? -28 DT  I C5    1 
ATOM   6991  C  C7    . DT  I 5 45  ? -51.644 -2.078  20.646 1.00 127.48 ? -28 DT  I C7    1 
ATOM   6992  C  C6    . DT  I 5 45  ? -51.655 -4.465  19.956 1.00 127.43 ? -28 DT  I C6    1 
ATOM   6993  P  P     . DG  I 5 46  ? -53.998 -10.225 17.716 1.00 125.14 ? -27 DG  I P     1 
ATOM   6994  O  OP1   . DG  I 5 46  ? -53.386 -10.386 16.376 1.00 124.68 ? -27 DG  I OP1   1 
ATOM   6995  O  OP2   . DG  I 5 46  ? -55.240 -10.971 18.029 1.00 124.87 ? -27 DG  I OP2   1 
ATOM   6996  O  "O5'" . DG  I 5 46  ? -52.894 -10.567 18.832 1.00 124.27 ? -27 DG  I "O5'" 1 
ATOM   6997  C  "C5'" . DG  I 5 46  ? -52.987 -11.722 19.680 1.00 121.54 ? -27 DG  I "C5'" 1 
ATOM   6998  C  "C4'" . DG  I 5 46  ? -52.750 -11.407 21.152 1.00 119.11 ? -27 DG  I "C4'" 1 
ATOM   6999  O  "O4'" . DG  I 5 46  ? -52.441 -10.005 21.367 1.00 118.71 ? -27 DG  I "O4'" 1 
ATOM   7000  C  "C3'" . DG  I 5 46  ? -53.934 -11.726 22.062 1.00 117.95 ? -27 DG  I "C3'" 1 
ATOM   7001  O  "O3'" . DG  I 5 46  ? -53.541 -12.706 23.024 1.00 116.09 ? -27 DG  I "O3'" 1 
ATOM   7002  C  "C2'" . DG  I 5 46  ? -54.275 -10.387 22.723 1.00 118.38 ? -27 DG  I "C2'" 1 
ATOM   7003  C  "C1'" . DG  I 5 46  ? -52.952 -9.632  22.628 1.00 118.49 ? -27 DG  I "C1'" 1 
ATOM   7004  N  N9    . DG  I 5 46  ? -53.042 -8.171  22.678 1.00 118.44 ? -27 DG  I N9    1 
ATOM   7005  C  C8    . DG  I 5 46  ? -53.986 -7.378  22.074 1.00 118.64 ? -27 DG  I C8    1 
ATOM   7006  N  N7    . DG  I 5 46  ? -53.819 -6.101  22.278 1.00 118.64 ? -27 DG  I N7    1 
ATOM   7007  C  C5    . DG  I 5 46  ? -52.687 -6.034  23.071 1.00 118.86 ? -27 DG  I C5    1 
ATOM   7008  C  C6    . DG  I 5 46  ? -52.020 -4.902  23.610 1.00 119.37 ? -27 DG  I C6    1 
ATOM   7009  O  O6    . DG  I 5 46  ? -52.322 -3.705  23.488 1.00 119.61 ? -27 DG  I O6    1 
ATOM   7010  N  N1    . DG  I 5 46  ? -50.900 -5.261  24.368 1.00 119.48 ? -27 DG  I N1    1 
ATOM   7011  C  C2    . DG  I 5 46  ? -50.478 -6.558  24.572 1.00 119.09 ? -27 DG  I C2    1 
ATOM   7012  N  N2    . DG  I 5 46  ? -49.383 -6.710  25.330 1.00 118.25 ? -27 DG  I N2    1 
ATOM   7013  N  N3    . DG  I 5 46  ? -51.095 -7.628  24.065 1.00 119.01 ? -27 DG  I N3    1 
ATOM   7014  C  C4    . DG  I 5 46  ? -52.192 -7.299  23.327 1.00 118.79 ? -27 DG  I C4    1 
ATOM   7015  P  P     . DC  I 5 47  ? -53.710 -14.280 22.736 1.00 114.36 ? -26 DC  I P     1 
ATOM   7016  O  OP1   . DC  I 5 47  ? -53.080 -14.619 21.432 1.00 114.13 ? -26 DC  I OP1   1 
ATOM   7017  O  OP2   . DC  I 5 47  ? -55.135 -14.614 22.982 1.00 114.73 ? -26 DC  I OP2   1 
ATOM   7018  O  "O5'" . DC  I 5 47  ? -52.841 -14.943 23.905 1.00 112.25 ? -26 DC  I "O5'" 1 
ATOM   7019  C  "C5'" . DC  I 5 47  ? -53.029 -14.544 25.253 1.00 109.17 ? -26 DC  I "C5'" 1 
ATOM   7020  C  "C4'" . DC  I 5 47  ? -51.748 -13.944 25.823 1.00 106.76 ? -26 DC  I "C4'" 1 
ATOM   7021  O  "O4'" . DC  I 5 47  ? -51.739 -12.509 25.590 1.00 106.31 ? -26 DC  I "O4'" 1 
ATOM   7022  C  "C3'" . DC  I 5 47  ? -51.617 -14.088 27.338 1.00 105.09 ? -26 DC  I "C3'" 1 
ATOM   7023  O  "O3'" . DC  I 5 47  ? -50.262 -13.972 27.753 1.00 101.93 ? -26 DC  I "O3'" 1 
ATOM   7024  C  "C2'" . DC  I 5 47  ? -52.396 -12.879 27.822 1.00 105.56 ? -26 DC  I "C2'" 1 
ATOM   7025  C  "C1'" . DC  I 5 47  ? -51.867 -11.840 26.838 1.00 105.93 ? -26 DC  I "C1'" 1 
ATOM   7026  N  N1    . DC  I 5 47  ? -52.729 -10.621 26.704 1.00 105.89 ? -26 DC  I N1    1 
ATOM   7027  C  C2    . DC  I 5 47  ? -52.161 -9.366  26.965 1.00 105.39 ? -26 DC  I C2    1 
ATOM   7028  O  O2    . DC  I 5 47  ? -50.975 -9.295  27.295 1.00 105.28 ? -26 DC  I O2    1 
ATOM   7029  N  N3    . DC  I 5 47  ? -52.926 -8.254  26.849 1.00 105.44 ? -26 DC  I N3    1 
ATOM   7030  C  C4    . DC  I 5 47  ? -54.206 -8.368  26.492 1.00 105.78 ? -26 DC  I C4    1 
ATOM   7031  N  N4    . DC  I 5 47  ? -54.908 -7.241  26.389 1.00 106.01 ? -26 DC  I N4    1 
ATOM   7032  C  C5    . DC  I 5 47  ? -54.817 -9.634  26.221 1.00 106.06 ? -26 DC  I C5    1 
ATOM   7033  C  C6    . DC  I 5 47  ? -54.048 -10.726 26.339 1.00 106.20 ? -26 DC  I C6    1 
ATOM   7034  P  P     . DT  I 5 48  ? -49.547 -15.174 28.528 1.00 99.19  ? -25 DT  I P     1 
ATOM   7035  O  OP1   . DT  I 5 48  ? -48.602 -15.843 27.590 1.00 99.41  ? -25 DT  I OP1   1 
ATOM   7036  O  OP2   . DT  I 5 48  ? -50.585 -15.957 29.248 1.00 99.35  ? -25 DT  I OP2   1 
ATOM   7037  O  "O5'" . DT  I 5 48  ? -48.676 -14.368 29.574 1.00 97.82  ? -25 DT  I "O5'" 1 
ATOM   7038  C  "C5'" . DT  I 5 48  ? -49.254 -14.141 30.808 1.00 96.54  ? -25 DT  I "C5'" 1 
ATOM   7039  C  "C4'" . DT  I 5 48  ? -49.117 -12.685 31.179 1.00 95.37  ? -25 DT  I "C4'" 1 
ATOM   7040  O  "O4'" . DT  I 5 48  ? -50.046 -11.844 30.449 1.00 95.71  ? -25 DT  I "O4'" 1 
ATOM   7041  C  "C3'" . DT  I 5 48  ? -49.492 -12.486 32.633 1.00 94.33  ? -25 DT  I "C3'" 1 
ATOM   7042  O  "O3'" . DT  I 5 48  ? -48.815 -11.361 33.091 1.00 91.28  ? -25 DT  I "O3'" 1 
ATOM   7043  C  "C2'" . DT  I 5 48  ? -50.975 -12.198 32.545 1.00 95.07  ? -25 DT  I "C2'" 1 
ATOM   7044  C  "C1'" . DT  I 5 48  ? -50.820 -11.173 31.434 1.00 96.39  ? -25 DT  I "C1'" 1 
ATOM   7045  N  N1    . DT  I 5 48  ? -52.106 -10.608 30.942 1.00 97.53  ? -25 DT  I N1    1 
ATOM   7046  C  C2    . DT  I 5 48  ? -52.228 -9.233  30.891 1.00 98.10  ? -25 DT  I C2    1 
ATOM   7047  O  O2    . DT  I 5 48  ? -51.339 -8.459  31.210 1.00 98.44  ? -25 DT  I O2    1 
ATOM   7048  N  N3    . DT  I 5 48  ? -53.447 -8.789  30.441 1.00 98.72  ? -25 DT  I N3    1 
ATOM   7049  C  C4    . DT  I 5 48  ? -54.528 -9.569  30.047 1.00 99.27  ? -25 DT  I C4    1 
ATOM   7050  O  O4    . DT  I 5 48  ? -55.583 -9.079  29.651 1.00 99.75  ? -25 DT  I O4    1 
ATOM   7051  C  C5    . DT  I 5 48  ? -54.332 -10.997 30.130 1.00 99.05  ? -25 DT  I C5    1 
ATOM   7052  C  C7    . DT  I 5 48  ? -55.441 -11.928 29.732 1.00 99.28  ? -25 DT  I C7    1 
ATOM   7053  C  C6    . DT  I 5 48  ? -53.147 -11.446 30.576 1.00 98.37  ? -25 DT  I C6    1 
ATOM   7054  P  P     . DC  I 5 49  ? -47.807 -11.641 34.265 1.00 89.37  ? -24 DC  I P     1 
ATOM   7055  O  OP1   . DC  I 5 49  ? -46.668 -12.361 33.664 1.00 89.97  ? -24 DC  I OP1   1 
ATOM   7056  O  OP2   . DC  I 5 49  ? -48.579 -12.262 35.363 1.00 90.26  ? -24 DC  I OP2   1 
ATOM   7057  O  "O5'" . DC  I 5 49  ? -47.358 -10.201 34.790 1.00 89.35  ? -24 DC  I "O5'" 1 
ATOM   7058  C  "C5'" . DC  I 5 49  ? -47.393 -9.030  33.975 1.00 87.86  ? -24 DC  I "C5'" 1 
ATOM   7059  C  "C4'" . DC  I 5 49  ? -48.258 -7.958  34.612 1.00 86.41  ? -24 DC  I "C4'" 1 
ATOM   7060  O  "O4'" . DC  I 5 49  ? -49.584 -8.069  34.052 1.00 86.73  ? -24 DC  I "O4'" 1 
ATOM   7061  C  "C3'" . DC  I 5 49  ? -48.439 -8.029  36.127 1.00 85.53  ? -24 DC  I "C3'" 1 
ATOM   7062  O  "O3'" . DC  I 5 49  ? -48.089 -6.770  36.676 1.00 84.15  ? -24 DC  I "O3'" 1 
ATOM   7063  C  "C2'" . DC  I 5 49  ? -49.919 -8.362  36.325 1.00 86.17  ? -24 DC  I "C2'" 1 
ATOM   7064  C  "C1'" . DC  I 5 49  ? -50.523 -7.775  35.059 1.00 87.16  ? -24 DC  I "C1'" 1 
ATOM   7065  N  N1    . DC  I 5 49  ? -51.823 -8.341  34.586 1.00 88.30  ? -24 DC  I N1    1 
ATOM   7066  C  C2    . DC  I 5 49  ? -52.820 -7.483  34.079 1.00 88.47  ? -24 DC  I C2    1 
ATOM   7067  O  O2    . DC  I 5 49  ? -52.644 -6.260  34.035 1.00 88.98  ? -24 DC  I O2    1 
ATOM   7068  N  N3    . DC  I 5 49  ? -53.984 -8.023  33.643 1.00 89.00  ? -24 DC  I N3    1 
ATOM   7069  C  C4    . DC  I 5 49  ? -54.175 -9.345  33.687 1.00 88.94  ? -24 DC  I C4    1 
ATOM   7070  N  N4    . DC  I 5 49  ? -55.341 -9.818  33.241 1.00 89.48  ? -24 DC  I N4    1 
ATOM   7071  C  C5    . DC  I 5 49  ? -53.181 -10.236 34.190 1.00 88.93  ? -24 DC  I C5    1 
ATOM   7072  C  C6    . DC  I 5 49  ? -52.030 -9.697  34.621 1.00 88.75  ? -24 DC  I C6    1 
ATOM   7073  P  P     . DC  I 5 50  ? -47.918 -6.536  38.247 1.00 83.32  ? -23 DC  I P     1 
ATOM   7074  O  OP1   . DC  I 5 50  ? -46.614 -5.898  38.479 1.00 83.13  ? -23 DC  I OP1   1 
ATOM   7075  O  OP2   . DC  I 5 50  ? -48.278 -7.786  38.939 1.00 84.11  ? -23 DC  I OP2   1 
ATOM   7076  O  "O5'" . DC  I 5 50  ? -49.042 -5.463  38.607 1.00 86.97  ? -23 DC  I "O5'" 1 
ATOM   7077  C  "C5'" . DC  I 5 50  ? -49.081 -4.196  37.914 1.00 90.79  ? -23 DC  I "C5'" 1 
ATOM   7078  C  "C4'" . DC  I 5 50  ? -50.382 -3.444  38.160 1.00 93.15  ? -23 DC  I "C4'" 1 
ATOM   7079  O  "O4'" . DC  I 5 50  ? -51.476 -4.112  37.484 1.00 94.18  ? -23 DC  I "O4'" 1 
ATOM   7080  C  "C3'" . DC  I 5 50  ? -50.788 -3.309  39.619 1.00 94.60  ? -23 DC  I "C3'" 1 
ATOM   7081  O  "O3'" . DC  I 5 50  ? -51.155 -1.961  39.855 1.00 97.17  ? -23 DC  I "O3'" 1 
ATOM   7082  C  "C2'" . DC  I 5 50  ? -51.953 -4.288  39.766 1.00 94.96  ? -23 DC  I "C2'" 1 
ATOM   7083  C  "C1'" . DC  I 5 50  ? -52.566 -4.264  38.371 1.00 95.33  ? -23 DC  I "C1'" 1 
ATOM   7084  N  N1    . DC  I 5 50  ? -53.338 -5.485  37.930 1.00 96.38  ? -23 DC  I N1    1 
ATOM   7085  C  C2    . DC  I 5 50  ? -54.674 -5.350  37.473 1.00 97.27  ? -23 DC  I C2    1 
ATOM   7086  O  O2    . DC  I 5 50  ? -55.227 -4.234  37.459 1.00 97.74  ? -23 DC  I O2    1 
ATOM   7087  N  N3    . DC  I 5 50  ? -55.345 -6.463  37.061 1.00 96.99  ? -23 DC  I N3    1 
ATOM   7088  C  C4    . DC  I 5 50  ? -54.736 -7.657  37.085 1.00 96.90  ? -23 DC  I C4    1 
ATOM   7089  N  N4    . DC  I 5 50  ? -55.431 -8.723  36.675 1.00 96.49  ? -23 DC  I N4    1 
ATOM   7090  C  C5    . DC  I 5 50  ? -53.385 -7.811  37.536 1.00 96.89  ? -23 DC  I C5    1 
ATOM   7091  C  C6    . DC  I 5 50  ? -52.731 -6.713  37.940 1.00 96.34  ? -23 DC  I C6    1 
ATOM   7092  P  P     . DA  I 5 51  ? -51.276 -1.353  41.339 1.00 100.09 ? -22 DA  I P     1 
ATOM   7093  O  OP1   . DA  I 5 51  ? -50.338 -0.211  41.438 1.00 99.27  ? -22 DA  I OP1   1 
ATOM   7094  O  OP2   . DA  I 5 51  ? -51.180 -2.459  42.329 1.00 100.17 ? -22 DA  I OP2   1 
ATOM   7095  O  "O5'" . DA  I 5 51  ? -52.792 -0.807  41.411 1.00 102.51 ? -22 DA  I "O5'" 1 
ATOM   7096  C  "C5'" . DA  I 5 51  ? -53.564 -0.466  40.234 1.00 106.21 ? -22 DA  I "C5'" 1 
ATOM   7097  C  "C4'" . DA  I 5 51  ? -55.036 -0.852  40.365 1.00 109.55 ? -22 DA  I "C4'" 1 
ATOM   7098  O  "O4'" . DA  I 5 51  ? -55.238 -2.191  39.849 1.00 110.64 ? -22 DA  I "O4'" 1 
ATOM   7099  C  "C3'" . DA  I 5 51  ? -55.629 -0.851  41.776 1.00 111.48 ? -22 DA  I "C3'" 1 
ATOM   7100  O  "O3'" . DA  I 5 51  ? -56.578 0.222   41.907 1.00 114.35 ? -22 DA  I "O3'" 1 
ATOM   7101  C  "C2'" . DA  I 5 51  ? -56.283 -2.223  41.947 1.00 111.14 ? -22 DA  I "C2'" 1 
ATOM   7102  C  "C1'" . DA  I 5 51  ? -56.293 -2.815  40.546 1.00 111.20 ? -22 DA  I "C1'" 1 
ATOM   7103  N  N9    . DA  I 5 51  ? -56.052 -4.255  40.538 1.00 111.91 ? -22 DA  I N9    1 
ATOM   7104  C  C8    . DA  I 5 51  ? -54.950 -4.903  41.029 1.00 112.45 ? -22 DA  I C8    1 
ATOM   7105  N  N7    . DA  I 5 51  ? -54.985 -6.208  40.898 1.00 112.64 ? -22 DA  I N7    1 
ATOM   7106  C  C5    . DA  I 5 51  ? -56.201 -6.437  40.275 1.00 112.69 ? -22 DA  I C5    1 
ATOM   7107  C  C6    . DA  I 5 51  ? -56.843 -7.623  39.848 1.00 112.92 ? -22 DA  I C6    1 
ATOM   7108  N  N6    . DA  I 5 51  ? -56.306 -8.839  40.009 1.00 113.03 ? -22 DA  I N6    1 
ATOM   7109  N  N1    . DA  I 5 51  ? -58.059 -7.514  39.256 1.00 112.61 ? -22 DA  I N1    1 
ATOM   7110  C  C2    . DA  I 5 51  ? -58.584 -6.288  39.103 1.00 112.86 ? -22 DA  I C2    1 
ATOM   7111  N  N3    . DA  I 5 51  ? -58.075 -5.102  39.460 1.00 112.65 ? -22 DA  I N3    1 
ATOM   7112  C  C4    . DA  I 5 51  ? -56.872 -5.244  40.047 1.00 112.33 ? -22 DA  I C4    1 
ATOM   7113  P  P     . DT  I 5 52  ? -57.363 0.520   43.278 1.00 115.87 ? -21 DT  I P     1 
ATOM   7114  O  OP1   . DT  I 5 52  ? -57.726 1.951   43.295 1.00 116.24 ? -21 DT  I OP1   1 
ATOM   7115  O  OP2   . DT  I 5 52  ? -56.634 -0.073  44.420 1.00 116.00 ? -21 DT  I OP2   1 
ATOM   7116  O  "O5'" . DT  I 5 52  ? -58.681 -0.342  43.081 1.00 118.45 ? -21 DT  I "O5'" 1 
ATOM   7117  C  "C5'" . DT  I 5 52  ? -59.516 -0.167  41.948 1.00 122.47 ? -21 DT  I "C5'" 1 
ATOM   7118  C  "C4'" . DT  I 5 52  ? -60.718 -1.065  42.153 1.00 125.51 ? -21 DT  I "C4'" 1 
ATOM   7119  O  "O4'" . DT  I 5 52  ? -60.366 -2.424  41.783 1.00 125.66 ? -21 DT  I "O4'" 1 
ATOM   7120  C  "C3'" . DT  I 5 52  ? -61.175 -1.135  43.611 1.00 127.65 ? -21 DT  I "C3'" 1 
ATOM   7121  O  "O3'" . DT  I 5 52  ? -62.587 -1.129  43.675 1.00 130.94 ? -21 DT  I "O3'" 1 
ATOM   7122  C  "C2'" . DT  I 5 52  ? -60.618 -2.467  44.097 1.00 126.76 ? -21 DT  I "C2'" 1 
ATOM   7123  C  "C1'" . DT  I 5 52  ? -60.786 -3.279  42.822 1.00 126.18 ? -21 DT  I "C1'" 1 
ATOM   7124  N  N1    . DT  I 5 52  ? -59.996 -4.534  42.798 1.00 126.22 ? -21 DT  I N1    1 
ATOM   7125  C  C2    . DT  I 5 52  ? -60.556 -5.655  42.218 1.00 126.20 ? -21 DT  I C2    1 
ATOM   7126  O  O2    . DT  I 5 52  ? -61.671 -5.675  41.715 1.00 126.47 ? -21 DT  I O2    1 
ATOM   7127  N  N3    . DT  I 5 52  ? -59.749 -6.767  42.256 1.00 125.98 ? -21 DT  I N3    1 
ATOM   7128  C  C4    . DT  I 5 52  ? -58.474 -6.862  42.797 1.00 125.91 ? -21 DT  I C4    1 
ATOM   7129  O  O4    . DT  I 5 52  ? -57.842 -7.913  42.772 1.00 126.00 ? -21 DT  I O4    1 
ATOM   7130  C  C5    . DT  I 5 52  ? -57.950 -5.647  43.384 1.00 125.86 ? -21 DT  I C5    1 
ATOM   7131  C  C7    . DT  I 5 52  ? -56.583 -5.612  44.007 1.00 125.61 ? -21 DT  I C7    1 
ATOM   7132  C  C6    . DT  I 5 52  ? -58.728 -4.557  43.358 1.00 126.06 ? -21 DT  I C6    1 
ATOM   7133  P  P     . DC  I 5 53  ? -63.349 -0.592  44.974 1.00 133.08 ? -20 DC  I P     1 
ATOM   7134  O  OP1   . DC  I 5 53  ? -63.412 0.882   44.830 1.00 133.05 ? -20 DC  I OP1   1 
ATOM   7135  O  OP2   . DC  I 5 53  ? -62.751 -1.187  46.195 1.00 132.85 ? -20 DC  I OP2   1 
ATOM   7136  O  "O5'" . DC  I 5 53  ? -64.816 -1.217  44.781 1.00 134.60 ? -20 DC  I "O5'" 1 
ATOM   7137  C  "C5'" . DC  I 5 53  ? -65.110 -2.158  43.739 1.00 136.86 ? -20 DC  I "C5'" 1 
ATOM   7138  C  "C4'" . DC  I 5 53  ? -65.175 -3.573  44.282 1.00 138.72 ? -20 DC  I "C4'" 1 
ATOM   7139  O  "O4'" . DC  I 5 53  ? -63.847 -4.160  44.269 1.00 139.70 ? -20 DC  I "O4'" 1 
ATOM   7140  C  "C3'" . DC  I 5 53  ? -65.666 -3.692  45.726 1.00 139.69 ? -20 DC  I "C3'" 1 
ATOM   7141  O  "O3'" . DC  I 5 53  ? -66.590 -4.766  45.828 1.00 140.55 ? -20 DC  I "O3'" 1 
ATOM   7142  C  "C2'" . DC  I 5 53  ? -64.390 -3.987  46.508 1.00 140.33 ? -20 DC  I "C2'" 1 
ATOM   7143  C  "C1'" . DC  I 5 53  ? -63.727 -4.891  45.473 1.00 140.79 ? -20 DC  I "C1'" 1 
ATOM   7144  N  N1    . DC  I 5 53  ? -62.302 -5.324  45.732 1.00 141.66 ? -20 DC  I N1    1 
ATOM   7145  C  C2    . DC  I 5 53  ? -61.847 -6.511  45.121 1.00 142.12 ? -20 DC  I C2    1 
ATOM   7146  O  O2    . DC  I 5 53  ? -62.611 -7.161  44.388 1.00 142.55 ? -20 DC  I O2    1 
ATOM   7147  N  N3    . DC  I 5 53  ? -60.569 -6.923  45.347 1.00 142.24 ? -20 DC  I N3    1 
ATOM   7148  C  C4    . DC  I 5 53  ? -59.765 -6.203  46.142 1.00 142.47 ? -20 DC  I C4    1 
ATOM   7149  N  N4    . DC  I 5 53  ? -58.522 -6.660  46.328 1.00 142.59 ? -20 DC  I N4    1 
ATOM   7150  C  C5    . DC  I 5 53  ? -60.205 -4.994  46.780 1.00 142.34 ? -20 DC  I C5    1 
ATOM   7151  C  C6    . DC  I 5 53  ? -61.469 -4.600  46.553 1.00 142.00 ? -20 DC  I C6    1 
ATOM   7152  P  P     . DA  I 5 54  ? -68.124 -4.475  46.180 1.00 141.60 ? -19 DA  I P     1 
ATOM   7153  O  OP1   . DA  I 5 54  ? -68.455 -3.110  45.710 1.00 141.57 ? -19 DA  I OP1   1 
ATOM   7154  O  OP2   . DA  I 5 54  ? -68.337 -4.826  47.606 1.00 140.90 ? -19 DA  I OP2   1 
ATOM   7155  O  "O5'" . DA  I 5 54  ? -68.925 -5.512  45.250 1.00 142.43 ? -19 DA  I "O5'" 1 
ATOM   7156  C  "C5'" . DA  I 5 54  ? -68.259 -6.452  44.387 1.00 143.82 ? -19 DA  I "C5'" 1 
ATOM   7157  C  "C4'" . DA  I 5 54  ? -68.117 -7.806  45.072 1.00 144.78 ? -19 DA  I "C4'" 1 
ATOM   7158  O  "O4'" . DA  I 5 54  ? -66.709 -8.031  45.371 1.00 145.47 ? -19 DA  I "O4'" 1 
ATOM   7159  C  "C3'" . DA  I 5 54  ? -68.878 -7.928  46.401 1.00 145.13 ? -19 DA  I "C3'" 1 
ATOM   7160  O  "O3'" . DA  I 5 54  ? -69.681 -9.125  46.441 1.00 145.13 ? -19 DA  I "O3'" 1 
ATOM   7161  C  "C2'" . DA  I 5 54  ? -67.773 -7.874  47.460 1.00 145.43 ? -19 DA  I "C2'" 1 
ATOM   7162  C  "C1'" . DA  I 5 54  ? -66.585 -8.470  46.717 1.00 145.76 ? -19 DA  I "C1'" 1 
ATOM   7163  N  N9    . DA  I 5 54  ? -65.304 -8.038  47.274 1.00 146.16 ? -19 DA  I N9    1 
ATOM   7164  C  C8    . DA  I 5 54  ? -65.067 -6.935  48.067 1.00 146.29 ? -19 DA  I C8    1 
ATOM   7165  N  N7    . DA  I 5 54  ? -63.813 -6.790  48.425 1.00 146.40 ? -19 DA  I N7    1 
ATOM   7166  C  C5    . DA  I 5 54  ? -63.182 -7.880  47.829 1.00 146.51 ? -19 DA  I C5    1 
ATOM   7167  C  C6    . DA  I 5 54  ? -61.835 -8.311  47.825 1.00 146.33 ? -19 DA  I C6    1 
ATOM   7168  N  N6    . DA  I 5 54  ? -60.860 -7.660  48.476 1.00 145.67 ? -19 DA  I N6    1 
ATOM   7169  N  N1    . DA  I 5 54  ? -61.538 -9.446  47.131 1.00 146.52 ? -19 DA  I N1    1 
ATOM   7170  C  C2    . DA  I 5 54  ? -62.526 -10.106 46.493 1.00 146.64 ? -19 DA  I C2    1 
ATOM   7171  N  N3    . DA  I 5 54  ? -63.823 -9.799  46.420 1.00 146.57 ? -19 DA  I N3    1 
ATOM   7172  C  C4    . DA  I 5 54  ? -64.088 -8.666  47.120 1.00 146.47 ? -19 DA  I C4    1 
ATOM   7173  P  P     . DA  I 5 55  ? -69.915 -10.005 47.782 1.00 145.11 ? -18 DA  I P     1 
ATOM   7174  O  OP1   . DA  I 5 55  ? -70.990 -11.014 47.520 1.00 145.07 ? -18 DA  I OP1   1 
ATOM   7175  O  OP2   . DA  I 5 55  ? -70.018 -9.119  48.987 1.00 145.24 ? -18 DA  I OP2   1 
ATOM   7176  O  "O5'" . DA  I 5 55  ? -68.501 -10.757 47.828 1.00 143.19 ? -18 DA  I "O5'" 1 
ATOM   7177  C  "C5'" . DA  I 5 55  ? -68.214 -11.784 46.882 1.00 140.94 ? -18 DA  I "C5'" 1 
ATOM   7178  C  "C4'" . DA  I 5 55  ? -67.944 -13.036 47.701 1.00 139.18 ? -18 DA  I "C4'" 1 
ATOM   7179  O  "O4'" . DA  I 5 55  ? -66.561 -13.016 48.156 1.00 139.19 ? -18 DA  I "O4'" 1 
ATOM   7180  C  "C3'" . DA  I 5 55  ? -68.846 -13.107 48.933 1.00 137.54 ? -18 DA  I "C3'" 1 
ATOM   7181  O  "O3'" . DA  I 5 55  ? -69.621 -14.318 48.876 1.00 135.16 ? -18 DA  I "O3'" 1 
ATOM   7182  C  "C2'" . DA  I 5 55  ? -67.905 -13.001 50.142 1.00 138.13 ? -18 DA  I "C2'" 1 
ATOM   7183  C  "C1'" . DA  I 5 55  ? -66.488 -12.917 49.572 1.00 138.45 ? -18 DA  I "C1'" 1 
ATOM   7184  N  N9    . DA  I 5 55  ? -65.769 -11.703 49.991 1.00 138.10 ? -18 DA  I N9    1 
ATOM   7185  C  C8    . DA  I 5 55  ? -66.282 -10.591 50.620 1.00 138.02 ? -18 DA  I C8    1 
ATOM   7186  N  N7    . DA  I 5 55  ? -65.392 -9.661  50.885 1.00 137.61 ? -18 DA  I N7    1 
ATOM   7187  C  C5    . DA  I 5 55  ? -64.208 -10.197 50.397 1.00 137.43 ? -18 DA  I C5    1 
ATOM   7188  C  C6    . DA  I 5 55  ? -62.883 -9.712  50.369 1.00 137.19 ? -18 DA  I C6    1 
ATOM   7189  N  N6    . DA  I 5 55  ? -62.523 -8.522  50.860 1.00 137.27 ? -18 DA  I N6    1 
ATOM   7190  N  N1    . DA  I 5 55  ? -61.932 -10.504 49.815 1.00 137.14 ? -18 DA  I N1    1 
ATOM   7191  C  C2    . DA  I 5 55  ? -62.295 -11.698 49.318 1.00 137.48 ? -18 DA  I C2    1 
ATOM   7192  N  N3    . DA  I 5 55  ? -63.501 -12.264 49.290 1.00 137.52 ? -18 DA  I N3    1 
ATOM   7193  C  C4    . DA  I 5 55  ? -64.423 -11.454 49.848 1.00 137.65 ? -18 DA  I C4    1 
ATOM   7194  P  P     . DA  I 5 56  ? -70.307 -15.005 50.170 1.00 133.23 ? -17 DA  I P     1 
ATOM   7195  O  OP1   . DA  I 5 56  ? -71.436 -15.817 49.655 1.00 133.12 ? -17 DA  I OP1   1 
ATOM   7196  O  OP2   . DA  I 5 56  ? -70.562 -13.981 51.218 1.00 132.87 ? -17 DA  I OP2   1 
ATOM   7197  O  "O5'" . DA  I 5 56  ? -69.158 -16.002 50.699 1.00 130.36 ? -17 DA  I "O5'" 1 
ATOM   7198  C  "C5'" . DA  I 5 56  ? -68.070 -16.444 49.850 1.00 125.38 ? -17 DA  I "C5'" 1 
ATOM   7199  C  "C4'" . DA  I 5 56  ? -66.821 -16.761 50.656 1.00 121.06 ? -17 DA  I "C4'" 1 
ATOM   7200  O  "O4'" . DA  I 5 56  ? -65.927 -15.617 50.729 1.00 119.80 ? -17 DA  I "O4'" 1 
ATOM   7201  C  "C3'" . DA  I 5 56  ? -67.116 -17.200 52.093 1.00 118.94 ? -17 DA  I "C3'" 1 
ATOM   7202  O  "O3'" . DA  I 5 56  ? -66.499 -18.446 52.406 1.00 117.44 ? -17 DA  I "O3'" 1 
ATOM   7203  C  "C2'" . DA  I 5 56  ? -66.517 -16.082 52.941 1.00 118.39 ? -17 DA  I "C2'" 1 
ATOM   7204  C  "C1'" . DA  I 5 56  ? -65.381 -15.597 52.036 1.00 118.62 ? -17 DA  I "C1'" 1 
ATOM   7205  N  N9    . DA  I 5 56  ? -64.830 -14.277 52.396 1.00 110.00 ? -17 DA  I N9    1 
ATOM   7206  C  C8    . DA  I 5 56  ? -65.508 -13.237 52.987 1.00 110.00 ? -17 DA  I C8    1 
ATOM   7207  N  N7    . DA  I 5 56  ? -64.774 -12.166 53.207 1.00 110.00 ? -17 DA  I N7    1 
ATOM   7208  C  C5    . DA  I 5 56  ? -63.515 -12.514 52.736 1.00 110.00 ? -17 DA  I C5    1 
ATOM   7209  C  C6    . DA  I 5 56  ? -62.286 -11.801 52.690 1.00 110.00 ? -17 DA  I C6    1 
ATOM   7210  N  N6    . DA  I 5 56  ? -62.129 -10.546 53.148 1.00 109.62 ? -17 DA  I N6    1 
ATOM   7211  N  N1    . DA  I 5 56  ? -61.216 -12.441 52.151 1.00 110.00 ? -17 DA  I N1    1 
ATOM   7212  C  C2    . DA  I 5 56  ? -61.375 -13.700 51.697 1.00 110.00 ? -17 DA  I C2    1 
ATOM   7213  N  N3    . DA  I 5 56  ? -62.473 -14.469 51.693 1.00 110.00 ? -17 DA  I N3    1 
ATOM   7214  C  C4    . DA  I 5 56  ? -63.528 -13.816 52.232 1.00 110.00 ? -17 DA  I C4    1 
ATOM   7215  P  P     . DA  I 5 57  ? -66.376 -19.714 51.416 1.00 116.14 ? -16 DA  I P     1 
ATOM   7216  O  OP1   . DA  I 5 57  ? -66.914 -19.395 50.062 1.00 115.85 ? -16 DA  I OP1   1 
ATOM   7217  O  OP2   . DA  I 5 57  ? -66.951 -20.852 52.176 1.00 116.04 ? -16 DA  I OP2   1 
ATOM   7218  O  "O5'" . DA  I 5 57  ? -64.780 -19.946 51.305 1.00 112.91 ? -16 DA  I "O5'" 1 
ATOM   7219  C  "C5'" . DA  I 5 57  ? -63.854 -18.886 50.943 1.00 108.20 ? -16 DA  I "C5'" 1 
ATOM   7220  C  "C4'" . DA  I 5 57  ? -62.755 -18.731 51.986 1.00 105.05 ? -16 DA  I "C4'" 1 
ATOM   7221  O  "O4'" . DA  I 5 57  ? -62.654 -17.349 52.431 1.00 103.18 ? -16 DA  I "O4'" 1 
ATOM   7222  C  "C3'" . DA  I 5 57  ? -62.950 -19.577 53.250 1.00 103.40 ? -16 DA  I "C3'" 1 
ATOM   7223  O  "O3'" . DA  I 5 57  ? -62.196 -20.839 53.045 1.00 100.98 ? -16 DA  I "O3'" 1 
ATOM   7224  C  "C2'" . DA  I 5 57  ? -62.590 -18.628 54.417 1.00 102.69 ? -16 DA  I "C2'" 1 
ATOM   7225  C  "C1'" . DA  I 5 57  ? -62.091 -17.341 53.735 1.00 102.65 ? -16 DA  I "C1'" 1 
ATOM   7226  N  N9    . DA  I 5 57  ? -62.416 -16.059 54.398 1.00 102.01 ? -16 DA  I N9    1 
ATOM   7227  C  C8    . DA  I 5 57  ? -63.622 -15.706 54.949 1.00 102.10 ? -16 DA  I C8    1 
ATOM   7228  N  N7    . DA  I 5 57  ? -63.662 -14.495 55.468 1.00 100.89 ? -16 DA  I N7    1 
ATOM   7229  C  C5    . DA  I 5 57  ? -62.387 -13.998 55.267 1.00 99.92  ? -16 DA  I C5    1 
ATOM   7230  C  C6    . DA  I 5 57  ? -61.781 -12.756 55.597 1.00 98.77  ? -16 DA  I C6    1 
ATOM   7231  N  N6    . DA  I 5 57  ? -62.406 -11.756 56.223 1.00 98.32  ? -16 DA  I N6    1 
ATOM   7232  N  N1    . DA  I 5 57  ? -60.491 -12.563 55.247 1.00 97.86  ? -16 DA  I N1    1 
ATOM   7233  C  C2    . DA  I 5 57  ? -59.841 -13.560 54.621 1.00 98.38  ? -16 DA  I C2    1 
ATOM   7234  N  N3    . DA  I 5 57  ? -60.302 -14.767 54.255 1.00 99.73  ? -16 DA  I N3    1 
ATOM   7235  C  C4    . DA  I 5 57  ? -61.600 -14.944 54.608 1.00 100.97 ? -16 DA  I C4    1 
ATOM   7236  P  P     . DG  I 5 58  ? -61.356 -21.698 54.118 1.00 100.12 ? -15 DG  I P     1 
ATOM   7237  O  OP1   . DG  I 5 58  ? -60.361 -22.505 53.359 1.00 99.37  ? -15 DG  I OP1   1 
ATOM   7238  O  OP2   . DG  I 5 58  ? -62.276 -22.383 55.070 1.00 99.95  ? -15 DG  I OP2   1 
ATOM   7239  O  "O5'" . DG  I 5 58  ? -60.603 -20.534 54.909 1.00 98.56  ? -15 DG  I "O5'" 1 
ATOM   7240  C  "C5'" . DG  I 5 58  ? -59.534 -19.790 54.310 1.00 95.52  ? -15 DG  I "C5'" 1 
ATOM   7241  C  "C4'" . DG  I 5 58  ? -58.889 -18.992 55.425 1.00 93.90  ? -15 DG  I "C4'" 1 
ATOM   7242  O  "O4'" . DG  I 5 58  ? -59.759 -17.960 55.935 1.00 93.82  ? -15 DG  I "O4'" 1 
ATOM   7243  C  "C3'" . DG  I 5 58  ? -58.547 -19.808 56.669 1.00 91.58  ? -15 DG  I "C3'" 1 
ATOM   7244  O  "O3'" . DG  I 5 58  ? -57.302 -20.466 56.358 1.00 87.93  ? -15 DG  I "O3'" 1 
ATOM   7245  C  "C2'" . DG  I 5 58  ? -58.510 -18.745 57.772 1.00 92.54  ? -15 DG  I "C2'" 1 
ATOM   7246  C  "C1'" . DG  I 5 58  ? -59.118 -17.508 57.103 1.00 94.16  ? -15 DG  I "C1'" 1 
ATOM   7247  N  N9    . DG  I 5 58  ? -60.129 -16.840 57.907 1.00 95.78  ? -15 DG  I N9    1 
ATOM   7248  C  C8    . DG  I 5 58  ? -61.219 -17.418 58.523 1.00 96.41  ? -15 DG  I C8    1 
ATOM   7249  N  N7    . DG  I 5 58  ? -61.953 -16.558 59.179 1.00 96.97  ? -15 DG  I N7    1 
ATOM   7250  C  C5    . DG  I 5 58  ? -61.313 -15.337 58.984 1.00 97.07  ? -15 DG  I C5    1 
ATOM   7251  C  C6    . DG  I 5 58  ? -61.647 -14.036 59.459 1.00 97.55  ? -15 DG  I C6    1 
ATOM   7252  O  O6    . DG  I 5 58  ? -62.614 -13.705 60.172 1.00 97.57  ? -15 DG  I O6    1 
ATOM   7253  N  N1    . DG  I 5 58  ? -60.726 -13.074 59.025 1.00 96.18  ? -15 DG  I N1    1 
ATOM   7254  C  C2    . DG  I 5 58  ? -59.626 -13.349 58.238 1.00 95.35  ? -15 DG  I C2    1 
ATOM   7255  N  N2    . DG  I 5 58  ? -58.850 -12.311 57.916 1.00 94.96  ? -15 DG  I N2    1 
ATOM   7256  N  N3    . DG  I 5 58  ? -59.302 -14.555 57.788 1.00 94.94  ? -15 DG  I N3    1 
ATOM   7257  C  C4    . DG  I 5 58  ? -60.187 -15.497 58.196 1.00 96.09  ? -15 DG  I C4    1 
ATOM   7258  P  P     . DG  I 5 59  ? -56.180 -20.939 57.407 1.00 85.23  ? -14 DG  I P     1 
ATOM   7259  O  OP1   . DG  I 5 59  ? -55.158 -21.657 56.607 1.00 85.36  ? -14 DG  I OP1   1 
ATOM   7260  O  OP2   . DG  I 5 59  ? -56.826 -21.642 58.544 1.00 82.78  ? -14 DG  I OP2   1 
ATOM   7261  O  "O5'" . DG  I 5 59  ? -55.553 -19.547 57.901 1.00 83.24  ? -14 DG  I "O5'" 1 
ATOM   7262  C  "C5'" . DG  I 5 59  ? -54.936 -18.673 56.971 1.00 81.56  ? -14 DG  I "C5'" 1 
ATOM   7263  C  "C4'" . DG  I 5 59  ? -54.279 -17.530 57.723 1.00 81.45  ? -14 DG  I "C4'" 1 
ATOM   7264  O  "O4'" . DG  I 5 59  ? -55.292 -16.704 58.365 1.00 81.97  ? -14 DG  I "O4'" 1 
ATOM   7265  C  "C3'" . DG  I 5 59  ? -53.284 -17.945 58.810 1.00 80.29  ? -14 DG  I "C3'" 1 
ATOM   7266  O  "O3'" . DG  I 5 59  ? -52.157 -17.077 58.614 1.00 78.74  ? -14 DG  I "O3'" 1 
ATOM   7267  C  "C2'" . DG  I 5 59  ? -54.070 -17.746 60.102 1.00 81.18  ? -14 DG  I "C2'" 1 
ATOM   7268  C  "C1'" . DG  I 5 59  ? -55.003 -16.583 59.748 1.00 83.37  ? -14 DG  I "C1'" 1 
ATOM   7269  N  N9    . DG  I 5 59  ? -56.272 -16.542 60.488 1.00 85.08  ? -14 DG  I N9    1 
ATOM   7270  C  C8    . DG  I 5 59  ? -57.198 -17.556 60.587 1.00 86.22  ? -14 DG  I C8    1 
ATOM   7271  N  N7    . DG  I 5 59  ? -58.240 -17.242 61.311 1.00 87.58  ? -14 DG  I N7    1 
ATOM   7272  C  C5    . DG  I 5 59  ? -57.995 -15.933 61.721 1.00 87.22  ? -14 DG  I C5    1 
ATOM   7273  C  C6    . DG  I 5 59  ? -58.777 -15.064 62.528 1.00 87.68  ? -14 DG  I C6    1 
ATOM   7274  O  O6    . DG  I 5 59  ? -59.877 -15.297 63.047 1.00 88.78  ? -14 DG  I O6    1 
ATOM   7275  N  N1    . DG  I 5 59  ? -58.175 -13.819 62.717 1.00 87.66  ? -14 DG  I N1    1 
ATOM   7276  C  C2    . DG  I 5 59  ? -56.960 -13.455 62.173 1.00 87.63  ? -14 DG  I C2    1 
ATOM   7277  N  N2    . DG  I 5 59  ? -56.522 -12.211 62.450 1.00 87.27  ? -14 DG  I N2    1 
ATOM   7278  N  N3    . DG  I 5 59  ? -56.219 -14.263 61.413 1.00 87.06  ? -14 DG  I N3    1 
ATOM   7279  C  C4    . DG  I 5 59  ? -56.790 -15.486 61.221 1.00 86.27  ? -14 DG  I C4    1 
ATOM   7280  P  P     . DC  I 5 60  ? -50.951 -16.750 59.618 1.00 77.69  ? -13 DC  I P     1 
ATOM   7281  O  OP1   . DC  I 5 60  ? -49.859 -16.345 58.698 1.00 76.33  ? -13 DC  I OP1   1 
ATOM   7282  O  OP2   . DC  I 5 60  ? -50.793 -17.856 60.600 1.00 77.40  ? -13 DC  I OP2   1 
ATOM   7283  O  "O5'" . DC  I 5 60  ? -51.457 -15.480 60.464 1.00 77.96  ? -13 DC  I "O5'" 1 
ATOM   7284  C  "C5'" . DC  I 5 60  ? -51.408 -14.151 59.958 1.00 78.68  ? -13 DC  I "C5'" 1 
ATOM   7285  C  "C4'" . DC  I 5 60  ? -51.722 -13.178 61.082 1.00 79.27  ? -13 DC  I "C4'" 1 
ATOM   7286  O  "O4'" . DC  I 5 60  ? -52.998 -13.516 61.689 1.00 79.48  ? -13 DC  I "O4'" 1 
ATOM   7287  C  "C3'" . DC  I 5 60  ? -50.724 -13.152 62.239 1.00 79.22  ? -13 DC  I "C3'" 1 
ATOM   7288  O  "O3'" . DC  I 5 60  ? -50.675 -11.829 62.674 1.00 78.35  ? -13 DC  I "O3'" 1 
ATOM   7289  C  "C2'" . DC  I 5 60  ? -51.350 -14.045 63.311 1.00 79.06  ? -13 DC  I "C2'" 1 
ATOM   7290  C  "C1'" . DC  I 5 60  ? -52.831 -13.750 63.083 1.00 79.01  ? -13 DC  I "C1'" 1 
ATOM   7291  N  N1    . DC  I 5 60  ? -53.818 -14.815 63.477 1.00 78.21  ? -13 DC  I N1    1 
ATOM   7292  C  C2    . DC  I 5 60  ? -54.900 -14.471 64.306 1.00 77.38  ? -13 DC  I C2    1 
ATOM   7293  O  O2    . DC  I 5 60  ? -54.978 -13.300 64.695 1.00 76.95  ? -13 DC  I O2    1 
ATOM   7294  N  N3    . DC  I 5 60  ? -55.817 -15.419 64.659 1.00 76.76  ? -13 DC  I N3    1 
ATOM   7295  C  C4    . DC  I 5 60  ? -55.673 -16.673 64.204 1.00 77.84  ? -13 DC  I C4    1 
ATOM   7296  N  N4    . DC  I 5 60  ? -56.568 -17.608 64.548 1.00 77.28  ? -13 DC  I N4    1 
ATOM   7297  C  C5    . DC  I 5 60  ? -54.577 -17.039 63.358 1.00 78.20  ? -13 DC  I C5    1 
ATOM   7298  C  C6    . DC  I 5 60  ? -53.686 -16.092 63.018 1.00 77.77  ? -13 DC  I C6    1 
ATOM   7299  P  P     . DA  I 5 61  ? -49.410 -11.254 63.425 1.00 78.83  ? -12 DA  I P     1 
ATOM   7300  O  OP1   . DA  I 5 61  ? -48.785 -10.243 62.542 1.00 80.26  ? -12 DA  I OP1   1 
ATOM   7301  O  OP2   . DA  I 5 61  ? -48.629 -12.379 63.967 1.00 79.55  ? -12 DA  I OP2   1 
ATOM   7302  O  "O5'" . DA  I 5 61  ? -50.089 -10.500 64.654 1.00 80.97  ? -12 DA  I "O5'" 1 
ATOM   7303  C  "C5'" . DA  I 5 61  ? -50.862 -9.313  64.445 1.00 83.11  ? -12 DA  I "C5'" 1 
ATOM   7304  C  "C4'" . DA  I 5 61  ? -51.637 -9.023  65.708 1.00 85.28  ? -12 DA  I "C4'" 1 
ATOM   7305  O  "O4'" . DA  I 5 61  ? -52.561 -10.114 65.955 1.00 85.81  ? -12 DA  I "O4'" 1 
ATOM   7306  C  "C3'" . DA  I 5 61  ? -50.750 -8.898  66.943 1.00 86.78  ? -12 DA  I "C3'" 1 
ATOM   7307  O  "O3'" . DA  I 5 61  ? -51.061 -7.652  67.536 1.00 89.12  ? -12 DA  I "O3'" 1 
ATOM   7308  C  "C2'" . DA  I 5 61  ? -51.096 -10.117 67.808 1.00 86.63  ? -12 DA  I "C2'" 1 
ATOM   7309  C  "C1'" . DA  I 5 61  ? -52.478 -10.531 67.303 1.00 87.06  ? -12 DA  I "C1'" 1 
ATOM   7310  N  N9    . DA  I 5 61  ? -52.782 -11.959 67.284 1.00 88.49  ? -12 DA  I N9    1 
ATOM   7311  C  C8    . DA  I 5 61  ? -52.139 -12.919 66.559 1.00 89.39  ? -12 DA  I C8    1 
ATOM   7312  N  N7    . DA  I 5 61  ? -52.628 -14.127 66.712 1.00 89.92  ? -12 DA  I N7    1 
ATOM   7313  C  C5    . DA  I 5 61  ? -53.674 -13.949 67.591 1.00 89.94  ? -12 DA  I C5    1 
ATOM   7314  C  C6    . DA  I 5 61  ? -54.596 -14.853 68.154 1.00 90.55  ? -12 DA  I C6    1 
ATOM   7315  N  N6    . DA  I 5 61  ? -54.581 -16.158 67.874 1.00 91.20  ? -12 DA  I N6    1 
ATOM   7316  N  N1    . DA  I 5 61  ? -55.526 -14.369 69.010 1.00 90.79  ? -12 DA  I N1    1 
ATOM   7317  C  C2    . DA  I 5 61  ? -55.527 -13.054 69.273 1.00 90.91  ? -12 DA  I C2    1 
ATOM   7318  N  N3    . DA  I 5 61  ? -54.707 -12.107 68.799 1.00 90.87  ? -12 DA  I N3    1 
ATOM   7319  C  C4    . DA  I 5 61  ? -53.790 -12.620 67.954 1.00 89.94  ? -12 DA  I C4    1 
ATOM   7320  P  P     . DT  I 5 62  ? -50.184 -6.959  68.688 1.00 92.13  ? -11 DT  I P     1 
ATOM   7321  O  OP1   . DT  I 5 62  ? -50.399 -5.497  68.574 1.00 91.59  ? -11 DT  I OP1   1 
ATOM   7322  O  OP2   . DT  I 5 62  ? -48.795 -7.477  68.689 1.00 91.83  ? -11 DT  I OP2   1 
ATOM   7323  O  "O5'" . DT  I 5 62  ? -50.933 -7.502  69.997 1.00 92.81  ? -11 DT  I "O5'" 1 
ATOM   7324  C  "C5'" . DT  I 5 62  ? -52.328 -7.225  70.175 1.00 94.59  ? -11 DT  I "C5'" 1 
ATOM   7325  C  "C4'" . DT  I 5 62  ? -52.909 -7.933  71.386 1.00 95.48  ? -11 DT  I "C4'" 1 
ATOM   7326  O  "O4'" . DT  I 5 62  ? -53.258 -9.289  71.009 1.00 94.98  ? -11 DT  I "O4'" 1 
ATOM   7327  C  "C3'" . DT  I 5 62  ? -51.975 -8.023  72.590 1.00 96.62  ? -11 DT  I "C3'" 1 
ATOM   7328  O  "O3'" . DT  I 5 62  ? -52.658 -7.623  73.764 1.00 99.64  ? -11 DT  I "O3'" 1 
ATOM   7329  C  "C2'" . DT  I 5 62  ? -51.612 -9.502  72.640 1.00 96.12  ? -11 DT  I "C2'" 1 
ATOM   7330  C  "C1'" . DT  I 5 62  ? -52.848 -10.153 72.042 1.00 95.18  ? -11 DT  I "C1'" 1 
ATOM   7331  N  N1    . DT  I 5 62  ? -52.595 -11.507 71.484 1.00 94.83  ? -11 DT  I N1    1 
ATOM   7332  C  C2    . DT  I 5 62  ? -53.550 -12.486 71.655 1.00 94.69  ? -11 DT  I C2    1 
ATOM   7333  O  O2    . DT  I 5 62  ? -54.602 -12.298 72.233 1.00 95.17  ? -11 DT  I O2    1 
ATOM   7334  N  N3    . DT  I 5 62  ? -53.231 -13.707 71.110 1.00 94.59  ? -11 DT  I N3    1 
ATOM   7335  C  C4    . DT  I 5 62  ? -52.067 -14.038 70.433 1.00 94.50  ? -11 DT  I C4    1 
ATOM   7336  O  O4    . DT  I 5 62  ? -51.882 -15.159 69.985 1.00 94.40  ? -11 DT  I O4    1 
ATOM   7337  C  C5    . DT  I 5 62  ? -51.103 -12.970 70.289 1.00 94.59  ? -11 DT  I C5    1 
ATOM   7338  C  C7    . DT  I 5 62  ? -49.802 -13.192 69.579 1.00 94.06  ? -11 DT  I C7    1 
ATOM   7339  C  C6    . DT  I 5 62  ? -51.409 -11.775 70.819 1.00 94.93  ? -11 DT  I C6    1 
ATOM   7340  P  P     . DG  I 5 63  ? -51.910 -7.450  75.178 1.00 102.40 ? -10 DG  I P     1 
ATOM   7341  O  OP1   . DG  I 5 63  ? -51.651 -6.002  75.341 1.00 101.85 ? -10 DG  I OP1   1 
ATOM   7342  O  OP2   . DG  I 5 63  ? -50.803 -8.423  75.315 1.00 102.15 ? -10 DG  I OP2   1 
ATOM   7343  O  "O5'" . DG  I 5 63  ? -53.032 -7.891  76.227 1.00 103.82 ? -10 DG  I "O5'" 1 
ATOM   7344  C  "C5'" . DG  I 5 63  ? -53.971 -8.920  75.901 1.00 106.56 ? -10 DG  I "C5'" 1 
ATOM   7345  C  "C4'" . DG  I 5 63  ? -54.210 -9.836  77.097 1.00 108.62 ? -10 DG  I "C4'" 1 
ATOM   7346  O  "O4'" . DG  I 5 63  ? -54.019 -11.230 76.733 1.00 109.51 ? -10 DG  I "O4'" 1 
ATOM   7347  C  "C3'" . DG  I 5 63  ? -53.321 -9.627  78.315 1.00 109.40 ? -10 DG  I "C3'" 1 
ATOM   7348  O  "O3'" . DG  I 5 63  ? -54.057 -10.029 79.466 1.00 109.70 ? -10 DG  I "O3'" 1 
ATOM   7349  C  "C2'" . DG  I 5 63  ? -52.144 -10.556 78.019 1.00 109.75 ? -10 DG  I "C2'" 1 
ATOM   7350  C  "C1'" . DG  I 5 63  ? -52.852 -11.738 77.364 1.00 110.09 ? -10 DG  I "C1'" 1 
ATOM   7351  N  N9    . DG  I 5 63  ? -52.047 -12.428 76.357 1.00 110.84 ? -10 DG  I N9    1 
ATOM   7352  C  C8    . DG  I 5 63  ? -50.977 -11.938 75.641 1.00 110.95 ? -10 DG  I C8    1 
ATOM   7353  N  N7    . DG  I 5 63  ? -50.465 -12.801 74.809 1.00 111.20 ? -10 DG  I N7    1 
ATOM   7354  C  C5    . DG  I 5 63  ? -51.248 -13.935 74.981 1.00 111.53 ? -10 DG  I C5    1 
ATOM   7355  C  C6    . DG  I 5 63  ? -51.173 -15.199 74.348 1.00 111.64 ? -10 DG  I C6    1 
ATOM   7356  O  O6    . DG  I 5 63  ? -50.372 -15.567 73.483 1.00 112.07 ? -10 DG  I O6    1 
ATOM   7357  N  N1    . DG  I 5 63  ? -52.158 -16.076 74.810 1.00 111.68 ? -10 DG  I N1    1 
ATOM   7358  C  C2    . DG  I 5 63  ? -53.101 -15.766 75.767 1.00 111.26 ? -10 DG  I C2    1 
ATOM   7359  N  N2    . DG  I 5 63  ? -53.970 -16.734 76.084 1.00 110.90 ? -10 DG  I N2    1 
ATOM   7360  N  N3    . DG  I 5 63  ? -53.184 -14.585 76.370 1.00 111.10 ? -10 DG  I N3    1 
ATOM   7361  C  C4    . DG  I 5 63  ? -52.229 -13.722 75.929 1.00 111.34 ? -10 DG  I C4    1 
ATOM   7362  P  P     . DT  I 5 64  ? -53.436 -9.995  80.947 1.00 109.65 ? -9  DT  I P     1 
ATOM   7363  O  OP1   . DT  I 5 64  ? -54.423 -9.274  81.785 1.00 109.91 ? -9  DT  I OP1   1 
ATOM   7364  O  OP2   . DT  I 5 64  ? -52.027 -9.531  80.902 1.00 109.36 ? -9  DT  I OP2   1 
ATOM   7365  O  "O5'" . DT  I 5 64  ? -53.437 -11.545 81.353 1.00 108.93 ? -9  DT  I "O5'" 1 
ATOM   7366  C  "C5'" . DT  I 5 64  ? -54.399 -12.441 80.779 1.00 108.42 ? -9  DT  I "C5'" 1 
ATOM   7367  C  "C4'" . DT  I 5 64  ? -54.120 -13.884 81.166 1.00 108.46 ? -9  DT  I "C4'" 1 
ATOM   7368  O  "O4'" . DT  I 5 64  ? -53.409 -14.570 80.097 1.00 108.37 ? -9  DT  I "O4'" 1 
ATOM   7369  C  "C3'" . DT  I 5 64  ? -53.289 -14.086 82.432 1.00 108.30 ? -9  DT  I "C3'" 1 
ATOM   7370  O  "O3'" . DT  I 5 64  ? -53.851 -15.167 83.154 1.00 108.02 ? -9  DT  I "O3'" 1 
ATOM   7371  C  "C2'" . DT  I 5 64  ? -51.898 -14.419 81.892 1.00 108.44 ? -9  DT  I "C2'" 1 
ATOM   7372  C  "C1'" . DT  I 5 64  ? -52.243 -15.186 80.617 1.00 108.51 ? -9  DT  I "C1'" 1 
ATOM   7373  N  N1    . DT  I 5 64  ? -51.165 -15.196 79.567 1.00 108.48 ? -9  DT  I N1    1 
ATOM   7374  C  C2    . DT  I 5 64  ? -50.884 -16.363 78.871 1.00 108.30 ? -9  DT  I C2    1 
ATOM   7375  O  O2    . DT  I 5 64  ? -51.455 -17.426 79.048 1.00 107.92 ? -9  DT  I O2    1 
ATOM   7376  N  N3    . DT  I 5 64  ? -49.881 -16.242 77.938 1.00 108.39 ? -9  DT  I N3    1 
ATOM   7377  C  C4    . DT  I 5 64  ? -49.148 -15.105 77.631 1.00 108.46 ? -9  DT  I C4    1 
ATOM   7378  O  O4    . DT  I 5 64  ? -48.270 -15.112 76.772 1.00 108.47 ? -9  DT  I O4    1 
ATOM   7379  C  C5    . DT  I 5 64  ? -49.491 -13.923 78.392 1.00 108.32 ? -9  DT  I C5    1 
ATOM   7380  C  C7    . DT  I 5 64  ? -48.776 -12.623 78.167 1.00 108.21 ? -9  DT  I C7    1 
ATOM   7381  C  C6    . DT  I 5 64  ? -50.468 -14.027 79.304 1.00 108.40 ? -9  DT  I C6    1 
ATOM   7382  P  P     . DT  I 5 65  ? -53.347 -15.585 84.617 1.00 108.30 ? -8  DT  I P     1 
ATOM   7383  O  OP1   . DT  I 5 65  ? -54.363 -15.058 85.558 1.00 108.37 ? -8  DT  I OP1   1 
ATOM   7384  O  OP2   . DT  I 5 65  ? -51.912 -15.234 84.793 1.00 108.25 ? -8  DT  I OP2   1 
ATOM   7385  O  "O5'" . DT  I 5 65  ? -53.445 -17.183 84.607 1.00 107.16 ? -8  DT  I "O5'" 1 
ATOM   7386  C  "C5'" . DT  I 5 65  ? -53.548 -17.932 83.393 1.00 106.53 ? -8  DT  I "C5'" 1 
ATOM   7387  C  "C4'" . DT  I 5 65  ? -52.388 -18.903 83.204 1.00 105.75 ? -8  DT  I "C4'" 1 
ATOM   7388  O  "O4'" . DT  I 5 65  ? -51.500 -18.434 82.147 1.00 105.81 ? -8  DT  I "O4'" 1 
ATOM   7389  C  "C3'" . DT  I 5 65  ? -51.512 -19.142 84.436 1.00 104.88 ? -8  DT  I "C3'" 1 
ATOM   7390  O  "O3'" . DT  I 5 65  ? -51.396 -20.544 84.679 1.00 103.15 ? -8  DT  I "O3'" 1 
ATOM   7391  C  "C2'" . DT  I 5 65  ? -50.163 -18.520 84.058 1.00 105.65 ? -8  DT  I "C2'" 1 
ATOM   7392  C  "C1'" . DT  I 5 65  ? -50.173 -18.731 82.545 1.00 105.75 ? -8  DT  I "C1'" 1 
ATOM   7393  N  N1    . DT  I 5 65  ? -49.177 -17.928 81.748 1.00 105.52 ? -8  DT  I N1    1 
ATOM   7394  C  C2    . DT  I 5 65  ? -48.448 -18.561 80.754 1.00 105.30 ? -8  DT  I C2    1 
ATOM   7395  O  O2    . DT  I 5 65  ? -48.561 -19.745 80.477 1.00 105.53 ? -8  DT  I O2    1 
ATOM   7396  N  N3    . DT  I 5 65  ? -47.564 -17.749 80.082 1.00 104.58 ? -8  DT  I N3    1 
ATOM   7397  C  C4    . DT  I 5 65  ? -47.335 -16.402 80.296 1.00 104.32 ? -8  DT  I C4    1 
ATOM   7398  O  O4    . DT  I 5 65  ? -46.518 -15.776 79.632 1.00 103.49 ? -8  DT  I O4    1 
ATOM   7399  C  C5    . DT  I 5 65  ? -48.125 -15.799 81.347 1.00 105.05 ? -8  DT  I C5    1 
ATOM   7400  C  C7    . DT  I 5 65  ? -47.976 -14.342 81.687 1.00 105.35 ? -8  DT  I C7    1 
ATOM   7401  C  C6    . DT  I 5 65  ? -48.994 -16.580 82.011 1.00 105.46 ? -8  DT  I C6    1 
ATOM   7402  P  P     . DC  I 5 66  ? -50.997 -21.098 86.128 1.00 102.18 ? -7  DC  I P     1 
ATOM   7403  O  OP1   . DC  I 5 66  ? -52.079 -22.017 86.565 1.00 102.00 ? -7  DC  I OP1   1 
ATOM   7404  O  OP2   . DC  I 5 66  ? -50.599 -19.938 86.958 1.00 101.78 ? -7  DC  I OP2   1 
ATOM   7405  O  "O5'" . DC  I 5 66  ? -49.666 -21.956 85.870 1.00 101.24 ? -7  DC  I "O5'" 1 
ATOM   7406  C  "C5'" . DC  I 5 66  ? -49.668 -23.177 85.106 1.00 99.00  ? -7  DC  I "C5'" 1 
ATOM   7407  C  "C4'" . DC  I 5 66  ? -48.307 -23.406 84.461 1.00 96.97  ? -7  DC  I "C4'" 1 
ATOM   7408  O  "O4'" . DC  I 5 66  ? -47.885 -22.205 83.754 1.00 96.92  ? -7  DC  I "O4'" 1 
ATOM   7409  C  "C3'" . DC  I 5 66  ? -47.171 -23.746 85.429 1.00 95.33  ? -7  DC  I "C3'" 1 
ATOM   7410  O  "O3'" . DC  I 5 66  ? -46.406 -24.810 84.902 1.00 92.72  ? -7  DC  I "O3'" 1 
ATOM   7411  C  "C2'" . DC  I 5 66  ? -46.339 -22.468 85.474 1.00 95.78  ? -7  DC  I "C2'" 1 
ATOM   7412  C  "C1'" . DC  I 5 66  ? -46.512 -22.005 84.031 1.00 96.70  ? -7  DC  I "C1'" 1 
ATOM   7413  N  N1    . DC  I 5 66  ? -46.123 -20.591 83.736 1.00 97.30  ? -7  DC  I N1    1 
ATOM   7414  C  C2    . DC  I 5 66  ? -45.465 -20.286 82.532 1.00 97.37  ? -7  DC  I C2    1 
ATOM   7415  O  O2    . DC  I 5 66  ? -45.210 -21.185 81.719 1.00 97.29  ? -7  DC  I O2    1 
ATOM   7416  N  N3    . DC  I 5 66  ? -45.120 -18.999 82.284 1.00 97.60  ? -7  DC  I N3    1 
ATOM   7417  C  C4    . DC  I 5 66  ? -45.403 -18.040 83.172 1.00 98.09  ? -7  DC  I C4    1 
ATOM   7418  N  N4    . DC  I 5 66  ? -45.047 -16.786 82.883 1.00 98.42  ? -7  DC  I N4    1 
ATOM   7419  C  C5    . DC  I 5 66  ? -46.070 -18.324 84.401 1.00 98.35  ? -7  DC  I C5    1 
ATOM   7420  C  C6    . DC  I 5 66  ? -46.408 -19.600 84.636 1.00 98.08  ? -7  DC  I C6    1 
ATOM   7421  P  P     . DA  I 5 67  ? -46.579 -26.292 85.464 1.00 91.31  ? -6  DA  I P     1 
ATOM   7422  O  OP1   . DA  I 5 67  ? -48.036 -26.562 85.498 1.00 90.92  ? -6  DA  I OP1   1 
ATOM   7423  O  OP2   . DA  I 5 67  ? -45.737 -26.390 86.681 1.00 90.39  ? -6  DA  I OP2   1 
ATOM   7424  O  "O5'" . DA  I 5 67  ? -45.913 -27.225 84.340 1.00 88.96  ? -6  DA  I "O5'" 1 
ATOM   7425  C  "C5'" . DA  I 5 67  ? -46.295 -27.114 82.956 1.00 86.15  ? -6  DA  I "C5'" 1 
ATOM   7426  C  "C4'" . DA  I 5 67  ? -45.124 -27.228 81.975 1.00 83.51  ? -6  DA  I "C4'" 1 
ATOM   7427  O  "O4'" . DA  I 5 67  ? -44.503 -25.933 81.773 1.00 82.05  ? -6  DA  I "O4'" 1 
ATOM   7428  C  "C3'" . DA  I 5 67  ? -43.991 -28.184 82.339 1.00 81.83  ? -6  DA  I "C3'" 1 
ATOM   7429  O  "O3'" . DA  I 5 67  ? -43.577 -28.834 81.151 1.00 80.10  ? -6  DA  I "O3'" 1 
ATOM   7430  C  "C2'" . DA  I 5 67  ? -42.914 -27.274 82.934 1.00 81.39  ? -6  DA  I "C2'" 1 
ATOM   7431  C  "C1'" . DA  I 5 67  ? -43.150 -25.963 82.188 1.00 82.33  ? -6  DA  I "C1'" 1 
ATOM   7432  N  N9    . DA  I 5 67  ? -42.936 -24.739 82.953 1.00 82.75  ? -6  DA  I N9    1 
ATOM   7433  C  C8    . DA  I 5 67  ? -43.175 -24.532 84.282 1.00 83.81  ? -6  DA  I C8    1 
ATOM   7434  N  N7    . DA  I 5 67  ? -42.901 -23.315 84.705 1.00 83.72  ? -6  DA  I N7    1 
ATOM   7435  C  C5    . DA  I 5 67  ? -42.459 -22.676 83.569 1.00 83.67  ? -6  DA  I C5    1 
ATOM   7436  C  C6    . DA  I 5 67  ? -42.014 -21.360 83.345 1.00 84.10  ? -6  DA  I C6    1 
ATOM   7437  N  N6    . DA  I 5 67  ? -41.951 -20.448 84.317 1.00 84.56  ? -6  DA  I N6    1 
ATOM   7438  N  N1    . DA  I 5 67  ? -41.634 -21.021 82.087 1.00 84.54  ? -6  DA  I N1    1 
ATOM   7439  C  C2    . DA  I 5 67  ? -41.692 -21.951 81.120 1.00 84.23  ? -6  DA  I C2    1 
ATOM   7440  N  N3    . DA  I 5 67  ? -42.098 -23.226 81.216 1.00 84.40  ? -6  DA  I N3    1 
ATOM   7441  C  C4    . DA  I 5 67  ? -42.473 -23.533 82.477 1.00 83.77  ? -6  DA  I C4    1 
ATOM   7442  P  P     . DG  I 5 68  ? -42.578 -30.093 81.144 1.00 80.64  ? -5  DG  I P     1 
ATOM   7443  O  OP1   . DG  I 5 68  ? -43.141 -31.075 80.190 1.00 80.78  ? -5  DG  I OP1   1 
ATOM   7444  O  OP2   . DG  I 5 68  ? -42.262 -30.547 82.517 1.00 80.60  ? -5  DG  I OP2   1 
ATOM   7445  O  "O5'" . DG  I 5 68  ? -41.232 -29.470 80.541 1.00 79.18  ? -5  DG  I "O5'" 1 
ATOM   7446  C  "C5'" . DG  I 5 68  ? -41.233 -28.272 79.773 1.00 78.16  ? -5  DG  I "C5'" 1 
ATOM   7447  C  "C4'" . DG  I 5 68  ? -39.885 -27.576 79.847 1.00 78.51  ? -5  DG  I "C4'" 1 
ATOM   7448  O  "O4'" . DG  I 5 68  ? -39.967 -26.423 80.720 1.00 78.96  ? -5  DG  I "O4'" 1 
ATOM   7449  C  "C3'" . DG  I 5 68  ? -38.723 -28.409 80.397 1.00 78.78  ? -5  DG  I "C3'" 1 
ATOM   7450  O  "O3'" . DG  I 5 68  ? -37.530 -28.015 79.762 1.00 77.37  ? -5  DG  I "O3'" 1 
ATOM   7451  C  "C2'" . DG  I 5 68  ? -38.634 -27.984 81.853 1.00 78.89  ? -5  DG  I "C2'" 1 
ATOM   7452  C  "C1'" . DG  I 5 68  ? -38.896 -26.503 81.645 1.00 79.54  ? -5  DG  I "C1'" 1 
ATOM   7453  N  N9    . DG  I 5 68  ? -39.200 -25.788 82.875 1.00 80.87  ? -5  DG  I N9    1 
ATOM   7454  C  C8    . DG  I 5 68  ? -39.664 -26.305 84.065 1.00 81.88  ? -5  DG  I C8    1 
ATOM   7455  N  N7    . DG  I 5 68  ? -39.832 -25.404 84.992 1.00 82.31  ? -5  DG  I N7    1 
ATOM   7456  C  C5    . DG  I 5 68  ? -39.444 -24.216 84.375 1.00 82.58  ? -5  DG  I C5    1 
ATOM   7457  C  C6    . DG  I 5 68  ? -39.399 -22.886 84.877 1.00 83.04  ? -5  DG  I C6    1 
ATOM   7458  O  O6    . DG  I 5 68  ? -39.709 -22.492 86.010 1.00 84.00  ? -5  DG  I O6    1 
ATOM   7459  N  N1    . DG  I 5 68  ? -38.941 -21.970 83.923 1.00 82.49  ? -5  DG  I N1    1 
ATOM   7460  C  C2    . DG  I 5 68  ? -38.571 -22.307 82.639 1.00 82.41  ? -5  DG  I C2    1 
ATOM   7461  N  N2    . DG  I 5 68  ? -38.162 -21.309 81.850 1.00 82.55  ? -5  DG  I N2    1 
ATOM   7462  N  N3    . DG  I 5 68  ? -38.609 -23.543 82.154 1.00 82.21  ? -5  DG  I N3    1 
ATOM   7463  C  C4    . DG  I 5 68  ? -39.052 -24.440 83.072 1.00 81.83  ? -5  DG  I C4    1 
ATOM   7464  P  P     . DC  I 5 69  ? -36.884 -28.887 78.602 1.00 75.38  ? -4  DC  I P     1 
ATOM   7465  O  OP1   . DC  I 5 69  ? -37.952 -29.227 77.629 1.00 74.15  ? -4  DC  I OP1   1 
ATOM   7466  O  OP2   . DC  I 5 69  ? -36.061 -29.946 79.241 1.00 75.12  ? -4  DC  I OP2   1 
ATOM   7467  O  "O5'" . DC  I 5 69  ? -35.916 -27.780 77.973 1.00 73.03  ? -4  DC  I "O5'" 1 
ATOM   7468  C  "C5'" . DC  I 5 69  ? -36.526 -26.670 77.353 1.00 70.50  ? -4  DC  I "C5'" 1 
ATOM   7469  C  "C4'" . DC  I 5 69  ? -35.715 -25.408 77.532 1.00 68.95  ? -4  DC  I "C4'" 1 
ATOM   7470  O  "O4'" . DC  I 5 69  ? -36.032 -24.753 78.787 1.00 69.24  ? -4  DC  I "O4'" 1 
ATOM   7471  C  "C3'" . DC  I 5 69  ? -34.209 -25.604 77.492 1.00 67.65  ? -4  DC  I "C3'" 1 
ATOM   7472  O  "O3'" . DC  I 5 69  ? -33.664 -24.608 76.618 1.00 64.96  ? -4  DC  I "O3'" 1 
ATOM   7473  C  "C2'" . DC  I 5 69  ? -33.786 -25.392 78.938 1.00 68.88  ? -4  DC  I "C2'" 1 
ATOM   7474  C  "C1'" . DC  I 5 69  ? -34.843 -24.435 79.469 1.00 70.09  ? -4  DC  I "C1'" 1 
ATOM   7475  N  N1    . DC  I 5 69  ? -35.062 -24.632 80.932 1.00 72.41  ? -4  DC  I N1    1 
ATOM   7476  C  C2    . DC  I 5 69  ? -35.094 -23.531 81.813 1.00 72.80  ? -4  DC  I C2    1 
ATOM   7477  O  O2    . DC  I 5 69  ? -34.956 -22.379 81.392 1.00 72.50  ? -4  DC  I O2    1 
ATOM   7478  N  N3    . DC  I 5 69  ? -35.285 -23.759 83.130 1.00 73.41  ? -4  DC  I N3    1 
ATOM   7479  C  C4    . DC  I 5 69  ? -35.435 -25.011 83.575 1.00 74.72  ? -4  DC  I C4    1 
ATOM   7480  N  N4    . DC  I 5 69  ? -35.627 -25.189 84.890 1.00 75.96  ? -4  DC  I N4    1 
ATOM   7481  C  C5    . DC  I 5 69  ? -35.397 -26.144 82.702 1.00 73.86  ? -4  DC  I C5    1 
ATOM   7482  C  C6    . DC  I 5 69  ? -35.211 -25.911 81.401 1.00 72.49  ? -4  DC  I C6    1 
ATOM   7483  P  P     . DT  I 5 70  ? -32.151 -24.649 76.133 1.00 60.68  ? -3  DT  I P     1 
ATOM   7484  O  OP1   . DT  I 5 70  ? -32.170 -24.463 74.666 1.00 61.08  ? -3  DT  I OP1   1 
ATOM   7485  O  OP2   . DT  I 5 70  ? -31.445 -25.791 76.755 1.00 60.33  ? -3  DT  I OP2   1 
ATOM   7486  O  "O5'" . DT  I 5 70  ? -31.557 -23.352 76.815 1.00 61.43  ? -3  DT  I "O5'" 1 
ATOM   7487  C  "C5'" . DT  I 5 70  ? -32.258 -22.131 76.756 1.00 63.52  ? -3  DT  I "C5'" 1 
ATOM   7488  C  "C4'" . DT  I 5 70  ? -31.597 -21.135 77.692 1.00 65.35  ? -3  DT  I "C4'" 1 
ATOM   7489  O  "O4'" . DT  I 5 70  ? -31.850 -21.475 79.078 1.00 67.41  ? -3  DT  I "O4'" 1 
ATOM   7490  C  "C3'" . DT  I 5 70  ? -30.087 -21.061 77.587 1.00 66.30  ? -3  DT  I "C3'" 1 
ATOM   7491  O  "O3'" . DT  I 5 70  ? -29.777 -19.712 77.740 1.00 67.15  ? -3  DT  I "O3'" 1 
ATOM   7492  C  "C2'" . DT  I 5 70  ? -29.568 -21.916 78.741 1.00 66.88  ? -3  DT  I "C2'" 1 
ATOM   7493  C  "C1'" . DT  I 5 70  ? -30.641 -21.653 79.785 1.00 67.85  ? -3  DT  I "C1'" 1 
ATOM   7494  N  N1    . DT  I 5 70  ? -30.884 -22.736 80.775 1.00 69.64  ? -3  DT  I N1    1 
ATOM   7495  C  C2    . DT  I 5 70  ? -31.270 -22.355 82.043 1.00 70.88  ? -3  DT  I C2    1 
ATOM   7496  O  O2    . DT  I 5 70  ? -31.399 -21.185 82.366 1.00 71.99  ? -3  DT  I O2    1 
ATOM   7497  N  N3    . DT  I 5 70  ? -31.490 -23.390 82.921 1.00 70.69  ? -3  DT  I N3    1 
ATOM   7498  C  C4    . DT  I 5 70  ? -31.365 -24.737 82.649 1.00 71.07  ? -3  DT  I C4    1 
ATOM   7499  O  O4    . DT  I 5 70  ? -31.583 -25.586 83.505 1.00 71.80  ? -3  DT  I O4    1 
ATOM   7500  C  C5    . DT  I 5 70  ? -30.962 -25.077 81.296 1.00 71.10  ? -3  DT  I C5    1 
ATOM   7501  C  C7    . DT  I 5 70  ? -30.802 -26.518 80.890 1.00 69.61  ? -3  DT  I C7    1 
ATOM   7502  C  C6    . DT  I 5 70  ? -30.746 -24.069 80.430 1.00 70.38  ? -3  DT  I C6    1 
ATOM   7503  P  P     . DG  I 5 71  ? -28.334 -19.160 77.383 1.00 67.47  ? -2  DG  I P     1 
ATOM   7504  O  OP1   . DG  I 5 71  ? -28.551 -17.908 76.632 1.00 65.88  ? -2  DG  I OP1   1 
ATOM   7505  O  OP2   . DG  I 5 71  ? -27.514 -20.298 76.924 1.00 66.67  ? -2  DG  I OP2   1 
ATOM   7506  O  "O5'" . DG  I 5 71  ? -27.678 -18.795 78.785 1.00 70.51  ? -2  DG  I "O5'" 1 
ATOM   7507  C  "C5'" . DG  I 5 71  ? -28.183 -17.740 79.582 1.00 73.95  ? -2  DG  I "C5'" 1 
ATOM   7508  C  "C4'" . DG  I 5 71  ? -27.704 -17.975 80.996 1.00 76.50  ? -2  DG  I "C4'" 1 
ATOM   7509  O  "O4'" . DG  I 5 71  ? -28.095 -19.300 81.415 1.00 77.66  ? -2  DG  I "O4'" 1 
ATOM   7510  C  "C3'" . DG  I 5 71  ? -26.189 -17.935 81.140 1.00 78.15  ? -2  DG  I "C3'" 1 
ATOM   7511  O  "O3'" . DG  I 5 71  ? -25.925 -16.892 82.040 1.00 79.94  ? -2  DG  I "O3'" 1 
ATOM   7512  C  "C2'" . DG  I 5 71  ? -25.788 -19.319 81.662 1.00 77.77  ? -2  DG  I "C2'" 1 
ATOM   7513  C  "C1'" . DG  I 5 71  ? -27.098 -19.790 82.271 1.00 78.47  ? -2  DG  I "C1'" 1 
ATOM   7514  N  N9    . DG  I 5 71  ? -27.305 -21.225 82.320 1.00 79.61  ? -2  DG  I N9    1 
ATOM   7515  C  C8    . DG  I 5 71  ? -27.120 -22.147 81.324 1.00 80.26  ? -2  DG  I C8    1 
ATOM   7516  N  N7    . DG  I 5 71  ? -27.403 -23.370 81.671 1.00 80.34  ? -2  DG  I N7    1 
ATOM   7517  C  C5    . DG  I 5 71  ? -27.805 -23.242 82.989 1.00 81.75  ? -2  DG  I C5    1 
ATOM   7518  C  C6    . DG  I 5 71  ? -28.237 -24.223 83.913 1.00 82.33  ? -2  DG  I C6    1 
ATOM   7519  O  O6    . DG  I 5 71  ? -28.349 -25.439 83.728 1.00 83.24  ? -2  DG  I O6    1 
ATOM   7520  N  N1    . DG  I 5 71  ? -28.555 -23.682 85.156 1.00 82.36  ? -2  DG  I N1    1 
ATOM   7521  C  C2    . DG  I 5 71  ? -28.467 -22.348 85.466 1.00 82.72  ? -2  DG  I C2    1 
ATOM   7522  N  N2    . DG  I 5 71  ? -28.815 -21.998 86.710 1.00 82.77  ? -2  DG  I N2    1 
ATOM   7523  N  N3    . DG  I 5 71  ? -28.070 -21.414 84.607 1.00 82.93  ? -2  DG  I N3    1 
ATOM   7524  C  C4    . DG  I 5 71  ? -27.757 -21.930 83.396 1.00 81.18  ? -2  DG  I C4    1 
ATOM   7525  P  P     . DA  I 5 72  ? -24.453 -16.358 82.336 1.00 81.53  ? -1  DA  I P     1 
ATOM   7526  O  OP1   . DA  I 5 72  ? -24.466 -14.901 82.065 1.00 81.93  ? -1  DA  I OP1   1 
ATOM   7527  O  OP2   . DA  I 5 72  ? -23.432 -17.248 81.755 1.00 79.72  ? -1  DA  I OP2   1 
ATOM   7528  O  "O5'" . DA  I 5 72  ? -24.348 -16.565 83.912 1.00 84.22  ? -1  DA  I "O5'" 1 
ATOM   7529  C  "C5'" . DA  I 5 72  ? -25.387 -16.150 84.798 1.00 86.52  ? -1  DA  I "C5'" 1 
ATOM   7530  C  "C4'" . DA  I 5 72  ? -25.160 -16.779 86.161 1.00 88.35  ? -1  DA  I "C4'" 1 
ATOM   7531  O  "O4'" . DA  I 5 72  ? -25.556 -18.174 86.152 1.00 88.62  ? -1  DA  I "O4'" 1 
ATOM   7532  C  "C3'" . DA  I 5 72  ? -23.717 -16.740 86.649 1.00 89.66  ? -1  DA  I "C3'" 1 
ATOM   7533  O  "O3'" . DA  I 5 72  ? -23.743 -16.238 87.984 1.00 92.66  ? -1  DA  I "O3'" 1 
ATOM   7534  C  "C2'" . DA  I 5 72  ? -23.234 -18.187 86.545 1.00 88.74  ? -1  DA  I "C2'" 1 
ATOM   7535  C  "C1'" . DA  I 5 72  ? -24.526 -18.980 86.679 1.00 88.90  ? -1  DA  I "C1'" 1 
ATOM   7536  N  N9    . DA  I 5 72  ? -24.566 -20.235 85.937 1.00 89.52  ? -1  DA  I N9    1 
ATOM   7537  C  C8    . DA  I 5 72  ? -24.192 -20.447 84.641 1.00 89.79  ? -1  DA  I C8    1 
ATOM   7538  N  N7    . DA  I 5 72  ? -24.347 -21.685 84.241 1.00 90.01  ? -1  DA  I N7    1 
ATOM   7539  C  C5    . DA  I 5 72  ? -24.866 -22.332 85.347 1.00 90.13  ? -1  DA  I C5    1 
ATOM   7540  C  C6    . DA  I 5 72  ? -25.262 -23.667 85.582 1.00 90.21  ? -1  DA  I C6    1 
ATOM   7541  N  N6    . DA  I 5 72  ? -25.183 -24.635 84.668 1.00 90.05  ? -1  DA  I N6    1 
ATOM   7542  N  N1    . DA  I 5 72  ? -25.740 -23.986 86.803 1.00 90.68  ? -1  DA  I N1    1 
ATOM   7543  C  C2    . DA  I 5 72  ? -25.821 -23.028 87.734 1.00 91.09  ? -1  DA  I C2    1 
ATOM   7544  N  N3    . DA  I 5 72  ? -25.485 -21.739 87.628 1.00 91.35  ? -1  DA  I N3    1 
ATOM   7545  C  C4    . DA  I 5 72  ? -25.010 -21.450 86.400 1.00 90.29  ? -1  DA  I C4    1 
ATOM   7546  P  P     . DA  I 5 73  ? -22.420 -15.935 88.839 1.00 94.39  ? 0   DA  I P     1 
ATOM   7547  O  OP1   . DA  I 5 73  ? -22.757 -14.860 89.796 1.00 94.58  ? 0   DA  I OP1   1 
ATOM   7548  O  OP2   . DA  I 5 73  ? -21.279 -15.747 87.913 1.00 93.71  ? 0   DA  I OP2   1 
ATOM   7549  O  "O5'" . DA  I 5 73  ? -22.217 -17.301 89.646 1.00 94.72  ? 0   DA  I "O5'" 1 
ATOM   7550  C  "C5'" . DA  I 5 73  ? -23.311 -17.923 90.296 1.00 96.46  ? 0   DA  I "C5'" 1 
ATOM   7551  C  "C4'" . DA  I 5 73  ? -22.814 -19.115 91.091 1.00 98.59  ? 0   DA  I "C4'" 1 
ATOM   7552  O  "O4'" . DA  I 5 73  ? -23.059 -20.347 90.368 1.00 99.47  ? 0   DA  I "O4'" 1 
ATOM   7553  C  "C3'" . DA  I 5 73  ? -21.328 -19.103 91.442 1.00 99.74  ? 0   DA  I "C3'" 1 
ATOM   7554  O  "O3'" . DA  I 5 73  ? -21.238 -19.410 92.827 1.00 101.30 ? 0   DA  I "O3'" 1 
ATOM   7555  C  "C2'" . DA  I 5 73  ? -20.708 -20.173 90.547 1.00 99.88  ? 0   DA  I "C2'" 1 
ATOM   7556  C  "C1'" . DA  I 5 73  ? -21.877 -21.111 90.270 1.00 100.21 ? 0   DA  I "C1'" 1 
ATOM   7557  N  N9    . DA  I 5 73  ? -21.853 -21.700 88.938 1.00 101.44 ? 0   DA  I N9    1 
ATOM   7558  C  C8    . DA  I 5 73  ? -21.577 -21.068 87.754 1.00 101.68 ? 0   DA  I C8    1 
ATOM   7559  N  N7    . DA  I 5 73  ? -21.628 -21.854 86.705 1.00 102.39 ? 0   DA  I N7    1 
ATOM   7560  C  C5    . DA  I 5 73  ? -21.976 -23.085 87.240 1.00 102.74 ? 0   DA  I C5    1 
ATOM   7561  C  C6    . DA  I 5 73  ? -22.193 -24.351 86.656 1.00 103.08 ? 0   DA  I C6    1 
ATOM   7562  N  N6    . DA  I 5 73  ? -22.088 -24.571 85.342 1.00 103.31 ? 0   DA  I N6    1 
ATOM   7563  N  N1    . DA  I 5 73  ? -22.527 -25.379 87.472 1.00 103.50 ? 0   DA  I N1    1 
ATOM   7564  C  C2    . DA  I 5 73  ? -22.634 -25.155 88.793 1.00 103.32 ? 0   DA  I C2    1 
ATOM   7565  N  N3    . DA  I 5 73  ? -22.448 -24.010 89.456 1.00 102.82 ? 0   DA  I N3    1 
ATOM   7566  C  C4    . DA  I 5 73  ? -22.121 -23.008 88.617 1.00 102.27 ? 0   DA  I C4    1 
ATOM   7567  P  P     . DT  I 5 74  ? -19.867 -19.632 93.619 1.00 102.27 ? 1   DT  I P     1 
ATOM   7568  O  OP1   . DT  I 5 74  ? -20.156 -19.294 95.033 1.00 102.23 ? 1   DT  I OP1   1 
ATOM   7569  O  OP2   . DT  I 5 74  ? -18.761 -18.957 92.892 1.00 102.28 ? 1   DT  I OP2   1 
ATOM   7570  O  "O5'" . DT  I 5 74  ? -19.646 -21.213 93.517 1.00 101.34 ? 1   DT  I "O5'" 1 
ATOM   7571  C  "C5'" . DT  I 5 74  ? -20.556 -22.119 94.121 1.00 100.46 ? 1   DT  I "C5'" 1 
ATOM   7572  C  "C4'" . DT  I 5 74  ? -20.058 -23.527 93.879 1.00 100.67 ? 1   DT  I "C4'" 1 
ATOM   7573  O  "O4'" . DT  I 5 74  ? -20.291 -23.885 92.493 1.00 100.62 ? 1   DT  I "O4'" 1 
ATOM   7574  C  "C3'" . DT  I 5 74  ? -18.563 -23.718 94.129 1.00 101.03 ? 1   DT  I "C3'" 1 
ATOM   7575  O  "O3'" . DT  I 5 74  ? -18.389 -24.808 95.037 1.00 102.41 ? 1   DT  I "O3'" 1 
ATOM   7576  C  "C2'" . DT  I 5 74  ? -17.965 -24.002 92.749 1.00 100.42 ? 1   DT  I "C2'" 1 
ATOM   7577  C  "C1'" . DT  I 5 74  ? -19.163 -24.583 92.002 1.00 99.82  ? 1   DT  I "C1'" 1 
ATOM   7578  N  N1    . DT  I 5 74  ? -19.109 -24.476 90.498 1.00 98.68  ? 1   DT  I N1    1 
ATOM   7579  C  C2    . DT  I 5 74  ? -19.383 -25.597 89.731 1.00 97.96  ? 1   DT  I C2    1 
ATOM   7580  O  O2    . DT  I 5 74  ? -19.675 -26.688 90.191 1.00 96.96  ? 1   DT  I O2    1 
ATOM   7581  N  N3    . DT  I 5 74  ? -19.306 -25.392 88.373 1.00 97.98  ? 1   DT  I N3    1 
ATOM   7582  C  C4    . DT  I 5 74  ? -18.986 -24.215 87.709 1.00 98.21  ? 1   DT  I C4    1 
ATOM   7583  O  O4    . DT  I 5 74  ? -18.955 -24.155 86.478 1.00 97.90  ? 1   DT  I O4    1 
ATOM   7584  C  C5    . DT  I 5 74  ? -18.712 -23.079 88.570 1.00 98.26  ? 1   DT  I C5    1 
ATOM   7585  C  C7    . DT  I 5 74  ? -18.349 -21.738 87.987 1.00 97.99  ? 1   DT  I C7    1 
ATOM   7586  C  C6    . DT  I 5 74  ? -18.788 -23.265 89.900 1.00 98.17  ? 1   DT  I C6    1 
ATOM   7587  P  P     . DC  I 5 75  ? -16.977 -25.150 95.726 1.00 103.12 ? 2   DC  I P     1 
ATOM   7588  O  OP1   . DC  I 5 75  ? -17.277 -25.670 97.079 1.00 102.94 ? 2   DC  I OP1   1 
ATOM   7589  O  OP2   . DC  I 5 75  ? -16.065 -23.988 95.576 1.00 102.93 ? 2   DC  I OP2   1 
ATOM   7590  O  "O5'" . DC  I 5 75  ? -16.437 -26.356 94.820 1.00 102.59 ? 2   DC  I "O5'" 1 
ATOM   7591  C  "C5'" . DC  I 5 75  ? -17.200 -27.558 94.711 1.00 102.67 ? 2   DC  I "C5'" 1 
ATOM   7592  C  "C4'" . DC  I 5 75  ? -16.576 -28.523 93.720 1.00 102.80 ? 2   DC  I "C4'" 1 
ATOM   7593  O  "O4'" . DC  I 5 75  ? -16.811 -28.063 92.363 1.00 102.55 ? 2   DC  I "O4'" 1 
ATOM   7594  C  "C3'" . DC  I 5 75  ? -15.069 -28.678 93.869 1.00 102.99 ? 2   DC  I "C3'" 1 
ATOM   7595  O  "O3'" . DC  I 5 75  ? -14.744 -30.046 93.964 1.00 103.74 ? 2   DC  I "O3'" 1 
ATOM   7596  C  "C2'" . DC  I 5 75  ? -14.498 -28.060 92.596 1.00 102.79 ? 2   DC  I "C2'" 1 
ATOM   7597  C  "C1'" . DC  I 5 75  ? -15.639 -28.250 91.604 1.00 102.16 ? 2   DC  I "C1'" 1 
ATOM   7598  N  N1    . DC  I 5 75  ? -15.636 -27.276 90.462 1.00 101.64 ? 2   DC  I N1    1 
ATOM   7599  C  C2    . DC  I 5 75  ? -15.931 -27.700 89.152 1.00 101.20 ? 2   DC  I C2    1 
ATOM   7600  O  O2    . DC  I 5 75  ? -16.195 -28.888 88.922 1.00 100.49 ? 2   DC  I O2    1 
ATOM   7601  N  N3    . DC  I 5 75  ? -15.913 -26.778 88.152 1.00 101.28 ? 2   DC  I N3    1 
ATOM   7602  C  C4    . DC  I 5 75  ? -15.623 -25.497 88.415 1.00 101.12 ? 2   DC  I C4    1 
ATOM   7603  N  N4    . DC  I 5 75  ? -15.616 -24.626 87.404 1.00 101.05 ? 2   DC  I N4    1 
ATOM   7604  C  C5    . DC  I 5 75  ? -15.322 -25.046 89.731 1.00 101.28 ? 2   DC  I C5    1 
ATOM   7605  C  C6    . DC  I 5 75  ? -15.342 -25.960 90.709 1.00 101.62 ? 2   DC  I C6    1 
ATOM   7606  P  P     . DA  I 5 76  ? -13.550 -30.512 94.922 1.00 104.32 ? 3   DA  I P     1 
ATOM   7607  O  OP1   . DA  I 5 76  ? -14.117 -30.633 96.284 1.00 104.14 ? 3   DA  I OP1   1 
ATOM   7608  O  OP2   . DA  I 5 76  ? -12.369 -29.646 94.666 1.00 103.49 ? 3   DA  I OP2   1 
ATOM   7609  O  "O5'" . DA  I 5 76  ? -13.225 -31.990 94.403 1.00 103.66 ? 3   DA  I "O5'" 1 
ATOM   7610  C  "C5'" . DA  I 5 76  ? -14.268 -32.812 93.871 1.00 103.87 ? 3   DA  I "C5'" 1 
ATOM   7611  C  "C4'" . DA  I 5 76  ? -13.907 -33.342 92.491 1.00 103.75 ? 3   DA  I "C4'" 1 
ATOM   7612  O  "O4'" . DA  I 5 76  ? -14.018 -32.289 91.491 1.00 103.96 ? 3   DA  I "O4'" 1 
ATOM   7613  C  "C3'" . DA  I 5 76  ? -12.484 -33.884 92.368 1.00 103.15 ? 3   DA  I "C3'" 1 
ATOM   7614  O  "O3'" . DA  I 5 76  ? -12.534 -35.081 91.626 1.00 102.14 ? 3   DA  I "O3'" 1 
ATOM   7615  C  "C2'" . DA  I 5 76  ? -11.740 -32.786 91.608 1.00 103.18 ? 3   DA  I "C2'" 1 
ATOM   7616  C  "C1'" . DA  I 5 76  ? -12.859 -32.322 90.684 1.00 103.50 ? 3   DA  I "C1'" 1 
ATOM   7617  N  N9    . DA  I 5 76  ? -12.669 -31.010 90.086 1.00 103.57 ? 3   DA  I N9    1 
ATOM   7618  C  C8    . DA  I 5 76  ? -12.192 -29.879 90.688 1.00 103.66 ? 3   DA  I C8    1 
ATOM   7619  N  N7    . DA  I 5 76  ? -12.138 -28.839 89.887 1.00 103.91 ? 3   DA  I N7    1 
ATOM   7620  C  C5    . DA  I 5 76  ? -12.612 -29.320 88.672 1.00 103.83 ? 3   DA  I C5    1 
ATOM   7621  C  C6    . DA  I 5 76  ? -12.808 -28.717 87.406 1.00 103.21 ? 3   DA  I C6    1 
ATOM   7622  N  N6    . DA  I 5 76  ? -12.534 -27.437 87.144 1.00 102.74 ? 3   DA  I N6    1 
ATOM   7623  N  N1    . DA  I 5 76  ? -13.298 -29.489 86.409 1.00 103.26 ? 3   DA  I N1    1 
ATOM   7624  C  C2    . DA  I 5 76  ? -13.574 -30.780 86.660 1.00 103.41 ? 3   DA  I C2    1 
ATOM   7625  N  N3    . DA  I 5 76  ? -13.437 -31.458 87.802 1.00 103.70 ? 3   DA  I N3    1 
ATOM   7626  C  C4    . DA  I 5 76  ? -12.946 -30.665 88.780 1.00 104.02 ? 3   DA  I C4    1 
ATOM   7627  P  P     . DG  I 5 77  ? -11.430 -36.224 91.835 1.00 102.12 ? 4   DG  I P     1 
ATOM   7628  O  OP1   . DG  I 5 77  ? -11.808 -36.935 93.079 1.00 102.45 ? 4   DG  I OP1   1 
ATOM   7629  O  OP2   . DG  I 5 77  ? -10.073 -35.627 91.710 1.00 101.21 ? 4   DG  I OP2   1 
ATOM   7630  O  "O5'" . DG  I 5 77  ? -11.681 -37.237 90.609 1.00 99.77  ? 4   DG  I "O5'" 1 
ATOM   7631  C  "C5'" . DG  I 5 77  ? -12.694 -37.010 89.622 1.00 96.35  ? 4   DG  I "C5'" 1 
ATOM   7632  C  "C4'" . DG  I 5 77  ? -12.098 -36.598 88.282 1.00 93.62  ? 4   DG  I "C4'" 1 
ATOM   7633  O  "O4'" . DG  I 5 77  ? -11.761 -35.185 88.247 1.00 92.38  ? 4   DG  I "O4'" 1 
ATOM   7634  C  "C3'" . DG  I 5 77  ? -10.823 -37.325 87.887 1.00 91.72  ? 4   DG  I "C3'" 1 
ATOM   7635  O  "O3'" . DG  I 5 77  ? -10.982 -37.709 86.551 1.00 90.14  ? 4   DG  I "O3'" 1 
ATOM   7636  C  "C2'" . DG  I 5 77  ? -9.736  -36.263 88.048 1.00 91.58  ? 4   DG  I "C2'" 1 
ATOM   7637  C  "C1'" . DG  I 5 77  ? -10.513 -35.034 87.604 1.00 91.96  ? 4   DG  I "C1'" 1 
ATOM   7638  N  N9    . DG  I 5 77  ? -9.939  -33.734 87.962 1.00 92.08  ? 4   DG  I N9    1 
ATOM   7639  C  C8    . DG  I 5 77  ? -9.267  -33.417 89.117 1.00 92.12  ? 4   DG  I C8    1 
ATOM   7640  N  N7    . DG  I 5 77  ? -8.877  -32.174 89.172 1.00 92.63  ? 4   DG  I N7    1 
ATOM   7641  C  C5    . DG  I 5 77  ? -9.311  -31.619 87.977 1.00 92.05  ? 4   DG  I C5    1 
ATOM   7642  C  C6    . DG  I 5 77  ? -9.168  -30.298 87.480 1.00 91.60  ? 4   DG  I C6    1 
ATOM   7643  O  O6    . DG  I 5 77  ? -8.617  -29.336 88.017 1.00 90.73  ? 4   DG  I O6    1 
ATOM   7644  N  N1    . DG  I 5 77  ? -9.748  -30.137 86.224 1.00 92.41  ? 4   DG  I N1    1 
ATOM   7645  C  C2    . DG  I 5 77  ? -10.390 -31.141 85.531 1.00 92.45  ? 4   DG  I C2    1 
ATOM   7646  N  N2    . DG  I 5 77  ? -10.891 -30.799 84.335 1.00 92.40  ? 4   DG  I N2    1 
ATOM   7647  N  N3    . DG  I 5 77  ? -10.534 -32.386 85.985 1.00 92.34  ? 4   DG  I N3    1 
ATOM   7648  C  C4    . DG  I 5 77  ? -9.971  -32.563 87.216 1.00 92.29  ? 4   DG  I C4    1 
ATOM   7649  P  P     . DC  I 5 78  ? -10.020 -38.826 85.954 1.00 89.97  ? 5   DC  I P     1 
ATOM   7650  O  OP1   . DC  I 5 78  ? -10.875 -40.001 85.690 1.00 90.05  ? 5   DC  I OP1   1 
ATOM   7651  O  OP2   . DC  I 5 78  ? -8.841  -38.942 86.842 1.00 89.98  ? 5   DC  I OP2   1 
ATOM   7652  O  "O5'" . DC  I 5 78  ? -9.511  -38.257 84.534 1.00 89.67  ? 5   DC  I "O5'" 1 
ATOM   7653  C  "C5'" . DC  I 5 78  ? -10.034 -37.082 83.902 1.00 88.06  ? 5   DC  I "C5'" 1 
ATOM   7654  C  "C4'" . DC  I 5 78  ? -8.938  -36.190 83.331 1.00 86.99  ? 5   DC  I "C4'" 1 
ATOM   7655  O  "O4'" . DC  I 5 78  ? -8.590  -35.192 84.318 1.00 87.65  ? 5   DC  I "O4'" 1 
ATOM   7656  C  "C3'" . DC  I 5 78  ? -7.605  -36.830 82.935 1.00 86.04  ? 5   DC  I "C3'" 1 
ATOM   7657  O  "O3'" . DC  I 5 78  ? -7.250  -36.412 81.636 1.00 83.97  ? 5   DC  I "O3'" 1 
ATOM   7658  C  "C2'" . DC  I 5 78  ? -6.581  -36.255 83.906 1.00 87.08  ? 5   DC  I "C2'" 1 
ATOM   7659  C  "C1'" . DC  I 5 78  ? -7.217  -34.901 84.164 1.00 88.52  ? 5   DC  I "C1'" 1 
ATOM   7660  N  N1    . DC  I 5 78  ? -6.766  -34.164 85.380 1.00 90.07  ? 5   DC  I N1    1 
ATOM   7661  C  C2    . DC  I 5 78  ? -6.664  -32.765 85.324 1.00 91.10  ? 5   DC  I C2    1 
ATOM   7662  O  O2    . DC  I 5 78  ? -6.938  -32.180 84.262 1.00 91.49  ? 5   DC  I O2    1 
ATOM   7663  N  N3    . DC  I 5 78  ? -6.262  -32.091 86.439 1.00 91.72  ? 5   DC  I N3    1 
ATOM   7664  C  C4    . DC  I 5 78  ? -5.977  -32.760 87.563 1.00 92.03  ? 5   DC  I C4    1 
ATOM   7665  N  N4    . DC  I 5 78  ? -5.584  -32.061 88.635 1.00 92.53  ? 5   DC  I N4    1 
ATOM   7666  C  C5    . DC  I 5 78  ? -6.080  -34.185 87.638 1.00 91.90  ? 5   DC  I C5    1 
ATOM   7667  C  C6    . DC  I 5 78  ? -6.476  -34.839 86.536 1.00 90.89  ? 5   DC  I C6    1 
ATOM   7668  P  P     . DT  I 5 79  ? -7.188  -37.439 80.411 1.00 82.12  ? 6   DT  I P     1 
ATOM   7669  O  OP1   . DT  I 5 79  ? -8.360  -38.340 80.541 1.00 81.98  ? 6   DT  I OP1   1 
ATOM   7670  O  OP2   . DT  I 5 79  ? -5.802  -37.965 80.296 1.00 80.30  ? 6   DT  I OP2   1 
ATOM   7671  O  "O5'" . DT  I 5 79  ? -7.461  -36.494 79.151 1.00 79.48  ? 6   DT  I "O5'" 1 
ATOM   7672  C  "C5'" . DT  I 5 79  ? -8.471  -35.503 79.188 1.00 75.54  ? 6   DT  I "C5'" 1 
ATOM   7673  C  "C4'" . DT  I 5 79  ? -7.889  -34.187 78.697 1.00 73.11  ? 6   DT  I "C4'" 1 
ATOM   7674  O  "O4'" . DT  I 5 79  ? -7.269  -33.450 79.781 1.00 73.16  ? 6   DT  I "O4'" 1 
ATOM   7675  C  "C3'" . DT  I 5 79  ? -6.819  -34.264 77.615 1.00 71.32  ? 6   DT  I "C3'" 1 
ATOM   7676  O  "O3'" . DT  I 5 79  ? -6.951  -33.080 76.891 1.00 68.55  ? 6   DT  I "O3'" 1 
ATOM   7677  C  "C2'" . DT  I 5 79  ? -5.525  -34.202 78.404 1.00 72.11  ? 6   DT  I "C2'" 1 
ATOM   7678  C  "C1'" . DT  I 5 79  ? -5.932  -33.165 79.440 1.00 73.93  ? 6   DT  I "C1'" 1 
ATOM   7679  N  N1    . DT  I 5 79  ? -5.146  -33.158 80.695 1.00 76.53  ? 6   DT  I N1    1 
ATOM   7680  C  C2    . DT  I 5 79  ? -5.096  -31.981 81.418 1.00 77.67  ? 6   DT  I C2    1 
ATOM   7681  O  O2    . DT  I 5 79  ? -5.655  -30.951 81.082 1.00 76.24  ? 6   DT  I O2    1 
ATOM   7682  N  N3    . DT  I 5 79  ? -4.345  -32.053 82.565 1.00 79.22  ? 6   DT  I N3    1 
ATOM   7683  C  C4    . DT  I 5 79  ? -3.664  -33.154 83.053 1.00 80.29  ? 6   DT  I C4    1 
ATOM   7684  O  O4    . DT  I 5 79  ? -3.029  -33.083 84.106 1.00 82.41  ? 6   DT  I O4    1 
ATOM   7685  C  C5    . DT  I 5 79  ? -3.762  -34.359 82.246 1.00 79.45  ? 6   DT  I C5    1 
ATOM   7686  C  C7    . DT  I 5 79  ? -3.075  -35.633 82.650 1.00 79.46  ? 6   DT  I C7    1 
ATOM   7687  C  C6    . DT  I 5 79  ? -4.489  -34.301 81.122 1.00 77.67  ? 6   DT  I C6    1 
ATOM   7688  P  P     . DG  I 5 80  ? -7.003  -32.958 75.309 1.00 65.13  ? 7   DG  I P     1 
ATOM   7689  O  OP1   . DG  I 5 80  ? -8.403  -32.593 75.019 1.00 63.91  ? 7   DG  I OP1   1 
ATOM   7690  O  OP2   . DG  I 5 80  ? -6.325  -34.094 74.637 1.00 65.24  ? 7   DG  I OP2   1 
ATOM   7691  O  "O5'" . DG  I 5 80  ? -6.103  -31.661 75.092 1.00 63.98  ? 7   DG  I "O5'" 1 
ATOM   7692  C  "C5'" . DG  I 5 80  ? -6.336  -30.501 75.888 1.00 62.36  ? 7   DG  I "C5'" 1 
ATOM   7693  C  "C4'" . DG  I 5 80  ? -5.049  -29.752 76.189 1.00 61.25  ? 7   DG  I "C4'" 1 
ATOM   7694  O  "O4'" . DG  I 5 80  ? -4.405  -30.332 77.349 1.00 61.55  ? 7   DG  I "O4'" 1 
ATOM   7695  C  "C3'" . DG  I 5 80  ? -4.003  -29.726 75.073 1.00 60.15  ? 7   DG  I "C3'" 1 
ATOM   7696  O  "O3'" . DG  I 5 80  ? -3.529  -28.395 74.996 1.00 56.92  ? 7   DG  I "O3'" 1 
ATOM   7697  C  "C2'" . DG  I 5 80  ? -2.946  -30.713 75.565 1.00 60.87  ? 7   DG  I "C2'" 1 
ATOM   7698  C  "C1'" . DG  I 5 80  ? -3.033  -30.466 77.067 1.00 62.96  ? 7   DG  I "C1'" 1 
ATOM   7699  N  N9    . DG  I 5 80  ? -2.480  -31.525 77.903 1.00 65.59  ? 7   DG  I N9    1 
ATOM   7700  C  C8    . DG  I 5 80  ? -2.425  -32.873 77.648 1.00 66.81  ? 7   DG  I C8    1 
ATOM   7701  N  N7    . DG  I 5 80  ? -1.858  -33.567 78.589 1.00 67.96  ? 7   DG  I N7    1 
ATOM   7702  C  C5    . DG  I 5 80  ? -1.509  -32.608 79.532 1.00 69.49  ? 7   DG  I C5    1 
ATOM   7703  C  C6    . DG  I 5 80  ? -0.861  -32.739 80.787 1.00 70.53  ? 7   DG  I C6    1 
ATOM   7704  O  O6    . DG  I 5 80  ? -0.449  -33.774 81.323 1.00 72.12  ? 7   DG  I O6    1 
ATOM   7705  N  N1    . DG  I 5 80  ? -0.695  -31.512 81.426 1.00 70.33  ? 7   DG  I N1    1 
ATOM   7706  C  C2    . DG  I 5 80  ? -1.117  -30.308 80.921 1.00 69.45  ? 7   DG  I C2    1 
ATOM   7707  N  N2    . DG  I 5 80  ? -0.886  -29.219 81.659 1.00 69.80  ? 7   DG  I N2    1 
ATOM   7708  N  N3    . DG  I 5 80  ? -1.730  -30.174 79.761 1.00 69.28  ? 7   DG  I N3    1 
ATOM   7709  C  C4    . DG  I 5 80  ? -1.888  -31.353 79.121 1.00 67.86  ? 7   DG  I C4    1 
ATOM   7710  P  P     . DA  I 5 81  ? -2.459  -27.899 73.932 1.00 54.35  ? 8   DA  I P     1 
ATOM   7711  O  OP1   . DA  I 5 81  ? -3.237  -27.163 72.910 1.00 55.56  ? 8   DA  I OP1   1 
ATOM   7712  O  OP2   . DA  I 5 81  ? -1.541  -28.983 73.549 1.00 55.45  ? 8   DA  I OP2   1 
ATOM   7713  O  "O5'" . DA  I 5 81  ? -1.552  -26.892 74.752 1.00 54.73  ? 8   DA  I "O5'" 1 
ATOM   7714  C  "C5'" . DA  I 5 81  ? -2.130  -26.102 75.792 1.00 55.36  ? 8   DA  I "C5'" 1 
ATOM   7715  C  "C4'" . DA  I 5 81  ? -1.034  -25.366 76.548 1.00 55.87  ? 8   DA  I "C4'" 1 
ATOM   7716  O  "O4'" . DA  I 5 81  ? -0.518  -26.171 77.633 1.00 56.57  ? 8   DA  I "O4'" 1 
ATOM   7717  C  "C3'" . DA  I 5 81  ? 0.192   -24.936 75.746 1.00 55.11  ? 8   DA  I "C3'" 1 
ATOM   7718  O  "O3'" . DA  I 5 81  ? 0.625   -23.769 76.392 1.00 56.25  ? 8   DA  I "O3'" 1 
ATOM   7719  C  "C2'" . DA  I 5 81  ? 1.163   -26.089 75.921 1.00 55.01  ? 8   DA  I "C2'" 1 
ATOM   7720  C  "C1'" . DA  I 5 81  ? 0.799   -26.598 77.313 1.00 58.21  ? 8   DA  I "C1'" 1 
ATOM   7721  N  N9    . DA  I 5 81  ? 0.845   -28.056 77.450 1.00 60.42  ? 8   DA  I N9    1 
ATOM   7722  C  C8    . DA  I 5 81  ? 0.348   -29.001 76.598 1.00 60.50  ? 8   DA  I C8    1 
ATOM   7723  N  N7    . DA  I 5 81  ? 0.528   -30.234 76.984 1.00 60.74  ? 8   DA  I N7    1 
ATOM   7724  C  C5    . DA  I 5 81  ? 1.198   -30.092 78.180 1.00 62.56  ? 8   DA  I C5    1 
ATOM   7725  C  C6    . DA  I 5 81  ? 1.687   -31.032 79.111 1.00 62.15  ? 8   DA  I C6    1 
ATOM   7726  N  N6    . DA  I 5 81  ? 1.558   -32.342 78.935 1.00 60.92  ? 8   DA  I N6    1 
ATOM   7727  N  N1    . DA  I 5 81  ? 2.310   -30.559 80.217 1.00 62.44  ? 8   DA  I N1    1 
ATOM   7728  C  C2    . DA  I 5 81  ? 2.434   -29.237 80.393 1.00 62.47  ? 8   DA  I C2    1 
ATOM   7729  N  N3    . DA  I 5 81  ? 2.017   -28.252 79.592 1.00 63.31  ? 8   DA  I N3    1 
ATOM   7730  C  C4    . DA  I 5 81  ? 1.403   -28.753 78.491 1.00 62.59  ? 8   DA  I C4    1 
ATOM   7731  P  P     . DA  I 5 82  ? 1.828   -22.868 75.904 1.00 56.15  ? 9   DA  I P     1 
ATOM   7732  O  OP1   . DA  I 5 82  ? 1.412   -21.480 76.213 1.00 56.53  ? 9   DA  I OP1   1 
ATOM   7733  O  OP2   . DA  I 5 82  ? 2.192   -23.328 74.540 1.00 57.71  ? 9   DA  I OP2   1 
ATOM   7734  O  "O5'" . DA  I 5 82  ? 3.090   -23.262 76.799 1.00 57.73  ? 9   DA  I "O5'" 1 
ATOM   7735  C  "C5'" . DA  I 5 82  ? 3.128   -23.032 78.203 1.00 60.44  ? 9   DA  I "C5'" 1 
ATOM   7736  C  "C4'" . DA  I 5 82  ? 4.366   -23.687 78.790 1.00 61.72  ? 9   DA  I "C4'" 1 
ATOM   7737  O  "O4'" . DA  I 5 82  ? 4.233   -25.122 78.709 1.00 61.91  ? 9   DA  I "O4'" 1 
ATOM   7738  C  "C3'" . DA  I 5 82  ? 5.677   -23.359 78.083 1.00 63.07  ? 9   DA  I "C3'" 1 
ATOM   7739  O  "O3'" . DA  I 5 82  ? 6.590   -22.846 79.033 1.00 64.43  ? 9   DA  I "O3'" 1 
ATOM   7740  C  "C2'" . DA  I 5 82  ? 6.158   -24.682 77.500 1.00 62.89  ? 9   DA  I "C2'" 1 
ATOM   7741  C  "C1'" . DA  I 5 82  ? 5.490   -25.685 78.418 1.00 64.29  ? 9   DA  I "C1'" 1 
ATOM   7742  N  N9    . DA  I 5 82  ? 5.208   -27.000 77.850 1.00 67.84  ? 9   DA  I N9    1 
ATOM   7743  C  C8    . DA  I 5 82  ? 4.713   -27.287 76.608 1.00 70.24  ? 9   DA  I C8    1 
ATOM   7744  N  N7    . DA  I 5 82  ? 4.535   -28.568 76.368 1.00 71.24  ? 9   DA  I N7    1 
ATOM   7745  C  C5    . DA  I 5 82  ? 4.929   -29.173 77.542 1.00 71.64  ? 9   DA  I C5    1 
ATOM   7746  C  C6    . DA  I 5 82  ? 4.988   -30.529 77.946 1.00 72.56  ? 9   DA  I C6    1 
ATOM   7747  N  N6    . DA  I 5 82  ? 4.624   -31.544 77.156 1.00 72.62  ? 9   DA  I N6    1 
ATOM   7748  N  N1    . DA  I 5 82  ? 5.437   -30.808 79.191 1.00 71.56  ? 9   DA  I N1    1 
ATOM   7749  C  C2    . DA  I 5 82  ? 5.805   -29.793 79.975 1.00 72.21  ? 9   DA  I C2    1 
ATOM   7750  N  N3    . DA  I 5 82  ? 5.794   -28.480 79.705 1.00 72.90  ? 9   DA  I N3    1 
ATOM   7751  C  C4    . DA  I 5 82  ? 5.346   -28.224 78.460 1.00 70.74  ? 9   DA  I C4    1 
ATOM   7752  P  P     . DC  I 5 83  ? 8.074   -22.406 78.627 1.00 64.07  ? 10  DC  I P     1 
ATOM   7753  O  OP1   . DC  I 5 83  ? 8.418   -21.378 79.631 1.00 65.13  ? 10  DC  I OP1   1 
ATOM   7754  O  OP2   . DC  I 5 83  ? 8.180   -22.150 77.172 1.00 64.62  ? 10  DC  I OP2   1 
ATOM   7755  O  "O5'" . DC  I 5 83  ? 8.958   -23.694 78.857 1.00 65.94  ? 10  DC  I "O5'" 1 
ATOM   7756  C  "C5'" . DC  I 5 83  ? 8.994   -24.394 80.077 1.00 67.75  ? 10  DC  I "C5'" 1 
ATOM   7757  C  "C4'" . DC  I 5 83  ? 9.890   -25.587 79.836 1.00 69.53  ? 10  DC  I "C4'" 1 
ATOM   7758  O  "O4'" . DC  I 5 83  ? 9.112   -26.603 79.177 1.00 69.84  ? 10  DC  I "O4'" 1 
ATOM   7759  C  "C3'" . DC  I 5 83  ? 11.077  -25.346 78.909 1.00 71.38  ? 10  DC  I "C3'" 1 
ATOM   7760  O  "O3'" . DC  I 5 83  ? 12.150  -26.144 79.357 1.00 75.01  ? 10  DC  I "O3'" 1 
ATOM   7761  C  "C2'" . DC  I 5 83  ? 10.593  -25.880 77.568 1.00 71.67  ? 10  DC  I "C2'" 1 
ATOM   7762  C  "C1'" . DC  I 5 83  ? 9.945   -27.110 78.171 1.00 72.08  ? 10  DC  I "C1'" 1 
ATOM   7763  N  N1    . DC  I 5 83  ? 9.153   -27.976 77.286 1.00 74.10  ? 10  DC  I N1    1 
ATOM   7764  C  C2    . DC  I 5 83  ? 8.891   -29.274 77.745 1.00 74.45  ? 10  DC  I C2    1 
ATOM   7765  O  O2    . DC  I 5 83  ? 9.321   -29.607 78.846 1.00 75.43  ? 10  DC  I O2    1 
ATOM   7766  N  N3    . DC  I 5 83  ? 8.172   -30.121 76.972 1.00 75.25  ? 10  DC  I N3    1 
ATOM   7767  C  C4    . DC  I 5 83  ? 7.740   -29.689 75.779 1.00 74.91  ? 10  DC  I C4    1 
ATOM   7768  N  N4    . DC  I 5 83  ? 7.040   -30.537 75.040 1.00 74.76  ? 10  DC  I N4    1 
ATOM   7769  C  C5    . DC  I 5 83  ? 7.999   -28.372 75.283 1.00 75.03  ? 10  DC  I C5    1 
ATOM   7770  C  C6    . DC  I 5 83  ? 8.707   -27.543 76.065 1.00 74.58  ? 10  DC  I C6    1 
ATOM   7771  P  P     . DA  I 5 84  ? 13.648  -25.588 79.341 1.00 77.44  ? 11  DA  I P     1 
ATOM   7772  O  OP1   . DA  I 5 84  ? 13.688  -24.452 80.282 1.00 77.49  ? 11  DA  I OP1   1 
ATOM   7773  O  OP2   . DA  I 5 84  ? 14.072  -25.417 77.931 1.00 77.13  ? 11  DA  I OP2   1 
ATOM   7774  O  "O5'" . DA  I 5 84  ? 14.494  -26.794 79.950 1.00 79.77  ? 11  DA  I "O5'" 1 
ATOM   7775  C  "C5'" . DA  I 5 84  ? 13.924  -27.715 80.878 1.00 83.02  ? 11  DA  I "C5'" 1 
ATOM   7776  C  "C4'" . DA  I 5 84  ? 14.553  -29.084 80.677 1.00 85.12  ? 11  DA  I "C4'" 1 
ATOM   7777  O  "O4'" . DA  I 5 84  ? 13.639  -29.961 79.970 1.00 85.33  ? 11  DA  I "O4'" 1 
ATOM   7778  C  "C3'" . DA  I 5 84  ? 15.853  -29.069 79.879 1.00 86.95  ? 11  DA  I "C3'" 1 
ATOM   7779  O  "O3'" . DA  I 5 84  ? 16.762  -29.990 80.477 1.00 90.43  ? 11  DA  I "O3'" 1 
ATOM   7780  C  "C2'" . DA  I 5 84  ? 15.417  -29.481 78.477 1.00 87.16  ? 11  DA  I "C2'" 1 
ATOM   7781  C  "C1'" . DA  I 5 84  ? 14.188  -30.356 78.723 1.00 86.65  ? 11  DA  I "C1'" 1 
ATOM   7782  N  N9    . DA  I 5 84  ? 13.186  -30.222 77.657 1.00 87.04  ? 11  DA  I N9    1 
ATOM   7783  C  C8    . DA  I 5 84  ? 12.764  -29.064 77.057 1.00 87.39  ? 11  DA  I C8    1 
ATOM   7784  N  N7    . DA  I 5 84  ? 11.861  -29.230 76.123 1.00 87.01  ? 11  DA  I N7    1 
ATOM   7785  C  C5    . DA  I 5 84  ? 11.673  -30.599 76.106 1.00 87.13  ? 11  DA  I C5    1 
ATOM   7786  C  C6    . DA  I 5 84  ? 10.837  -31.432 75.326 1.00 87.28  ? 11  DA  I C6    1 
ATOM   7787  N  N6    . DA  I 5 84  ? 10.006  -30.964 74.391 1.00 86.34  ? 11  DA  I N6    1 
ATOM   7788  N  N1    . DA  I 5 84  ? 10.885  -32.767 75.555 1.00 87.43  ? 11  DA  I N1    1 
ATOM   7789  C  C2    . DA  I 5 84  ? 11.719  -33.238 76.498 1.00 87.32  ? 11  DA  I C2    1 
ATOM   7790  N  N3    . DA  I 5 84  ? 12.554  -32.554 77.287 1.00 86.97  ? 11  DA  I N3    1 
ATOM   7791  C  C4    . DA  I 5 84  ? 12.483  -31.230 77.040 1.00 86.91  ? 11  DA  I C4    1 
ATOM   7792  P  P     . DT  I 5 85  ? 18.244  -30.302 79.931 1.00 92.23  ? 12  DT  I P     1 
ATOM   7793  O  OP1   . DT  I 5 85  ? 19.046  -30.698 81.115 1.00 92.40  ? 12  DT  I OP1   1 
ATOM   7794  O  OP2   . DT  I 5 85  ? 18.719  -29.222 79.030 1.00 91.69  ? 12  DT  I OP2   1 
ATOM   7795  O  "O5'" . DT  I 5 85  ? 17.981  -31.596 79.037 1.00 92.26  ? 12  DT  I "O5'" 1 
ATOM   7796  C  "C5'" . DT  I 5 85  ? 17.346  -32.744 79.585 1.00 93.98  ? 12  DT  I "C5'" 1 
ATOM   7797  C  "C4'" . DT  I 5 85  ? 17.352  -33.852 78.549 1.00 95.38  ? 12  DT  I "C4'" 1 
ATOM   7798  O  "O4'" . DT  I 5 85  ? 16.224  -33.648 77.662 1.00 96.11  ? 12  DT  I "O4'" 1 
ATOM   7799  C  "C3'" . DT  I 5 85  ? 18.598  -33.893 77.661 1.00 96.07  ? 12  DT  I "C3'" 1 
ATOM   7800  O  "O3'" . DT  I 5 85  ? 19.013  -35.244 77.437 1.00 96.85  ? 12  DT  I "O3'" 1 
ATOM   7801  C  "C2'" . DT  I 5 85  ? 18.153  -33.202 76.372 1.00 96.22  ? 12  DT  I "C2'" 1 
ATOM   7802  C  "C1'" . DT  I 5 85  ? 16.679  -33.598 76.323 1.00 96.66  ? 12  DT  I "C1'" 1 
ATOM   7803  N  N1    . DT  I 5 85  ? 15.783  -32.696 75.522 1.00 97.10  ? 12  DT  I N1    1 
ATOM   7804  C  C2    . DT  I 5 85  ? 14.732  -33.273 74.834 1.00 97.54  ? 12  DT  I C2    1 
ATOM   7805  O  O2    . DT  I 5 85  ? 14.488  -34.466 74.846 1.00 97.91  ? 12  DT  I O2    1 
ATOM   7806  N  N3    . DT  I 5 85  ? 13.955  -32.391 74.125 1.00 97.91  ? 12  DT  I N3    1 
ATOM   7807  C  C4    . DT  I 5 85  ? 14.116  -31.021 74.027 1.00 97.84  ? 12  DT  I C4    1 
ATOM   7808  O  O4    . DT  I 5 85  ? 13.345  -30.341 73.357 1.00 98.10  ? 12  DT  I O4    1 
ATOM   7809  C  C5    . DT  I 5 85  ? 15.234  -30.473 74.772 1.00 97.62  ? 12  DT  I C5    1 
ATOM   7810  C  C7    . DT  I 5 85  ? 15.523  -29.000 74.754 1.00 97.20  ? 12  DT  I C7    1 
ATOM   7811  C  C6    . DT  I 5 85  ? 16.003  -31.327 75.472 1.00 97.24  ? 12  DT  I C6    1 
ATOM   7812  P  P     . DG  I 5 86  ? 20.490  -35.597 76.895 1.00 97.04  ? 13  DG  I P     1 
ATOM   7813  O  OP1   . DG  I 5 86  ? 21.201  -36.211 78.038 1.00 96.85  ? 13  DG  I OP1   1 
ATOM   7814  O  OP2   . DG  I 5 86  ? 21.065  -34.435 76.160 1.00 95.37  ? 13  DG  I OP2   1 
ATOM   7815  O  "O5'" . DG  I 5 86  ? 20.229  -36.769 75.829 1.00 96.56  ? 13  DG  I "O5'" 1 
ATOM   7816  C  "C5'" . DG  I 5 86  ? 18.999  -37.523 75.763 1.00 94.56  ? 13  DG  I "C5'" 1 
ATOM   7817  C  "C4'" . DG  I 5 86  ? 18.737  -37.966 74.324 1.00 93.38  ? 13  DG  I "C4'" 1 
ATOM   7818  O  "O4'" . DG  I 5 86  ? 17.857  -37.029 73.641 1.00 93.37  ? 13  DG  I "O4'" 1 
ATOM   7819  C  "C3'" . DG  I 5 86  ? 19.958  -38.077 73.409 1.00 92.41  ? 13  DG  I "C3'" 1 
ATOM   7820  O  "O3'" . DG  I 5 86  ? 19.735  -39.137 72.483 1.00 90.84  ? 13  DG  I "O3'" 1 
ATOM   7821  C  "C2'" . DG  I 5 86  ? 20.000  -36.709 72.715 1.00 92.89  ? 13  DG  I "C2'" 1 
ATOM   7822  C  "C1'" . DG  I 5 86  ? 18.503  -36.517 72.478 1.00 93.47  ? 13  DG  I "C1'" 1 
ATOM   7823  N  N9    . DG  I 5 86  ? 18.020  -35.151 72.253 1.00 93.54  ? 13  DG  I N9    1 
ATOM   7824  C  C8    . DG  I 5 86  ? 18.349  -33.984 72.915 1.00 93.96  ? 13  DG  I C8    1 
ATOM   7825  N  N7    . DG  I 5 86  ? 17.714  -32.924 72.485 1.00 92.92  ? 13  DG  I N7    1 
ATOM   7826  C  C5    . DG  I 5 86  ? 16.903  -33.424 71.471 1.00 93.25  ? 13  DG  I C5    1 
ATOM   7827  C  C6    . DG  I 5 86  ? 15.981  -32.765 70.619 1.00 92.82  ? 13  DG  I C6    1 
ATOM   7828  O  O6    . DG  I 5 86  ? 15.683  -31.563 70.600 1.00 92.39  ? 13  DG  I O6    1 
ATOM   7829  N  N1    . DG  I 5 86  ? 15.374  -33.652 69.725 1.00 92.92  ? 13  DG  I N1    1 
ATOM   7830  C  C2    . DG  I 5 86  ? 15.622  -35.011 69.662 1.00 92.79  ? 13  DG  I C2    1 
ATOM   7831  N  N2    . DG  I 5 86  ? 14.959  -35.729 68.746 1.00 92.46  ? 13  DG  I N2    1 
ATOM   7832  N  N3    . DG  I 5 86  ? 16.481  -35.635 70.450 1.00 93.27  ? 13  DG  I N3    1 
ATOM   7833  C  C4    . DG  I 5 86  ? 17.078  -34.788 71.325 1.00 93.47  ? 13  DG  I C4    1 
ATOM   7834  P  P     . DC  I 5 87  ? 20.935  -39.744 71.616 1.00 89.96  ? 14  DC  I P     1 
ATOM   7835  O  OP1   . DC  I 5 87  ? 21.369  -40.949 72.354 1.00 90.59  ? 14  DC  I OP1   1 
ATOM   7836  O  OP2   . DC  I 5 87  ? 21.883  -38.664 71.251 1.00 88.97  ? 14  DC  I OP2   1 
ATOM   7837  O  "O5'" . DC  I 5 87  ? 20.291  -40.248 70.246 1.00 89.74  ? 14  DC  I "O5'" 1 
ATOM   7838  C  "C5'" . DC  I 5 87  ? 18.895  -40.211 70.024 1.00 88.41  ? 14  DC  I "C5'" 1 
ATOM   7839  C  "C4'" . DC  I 5 87  ? 18.602  -39.487 68.721 1.00 86.77  ? 14  DC  I "C4'" 1 
ATOM   7840  O  "O4'" . DC  I 5 87  ? 18.411  -38.073 68.929 1.00 85.21  ? 14  DC  I "O4'" 1 
ATOM   7841  C  "C3'" . DC  I 5 87  ? 19.615  -39.649 67.581 1.00 85.96  ? 14  DC  I "C3'" 1 
ATOM   7842  O  "O3'" . DC  I 5 87  ? 18.779  -40.304 66.632 1.00 84.86  ? 14  DC  I "O3'" 1 
ATOM   7843  C  "C2'" . DC  I 5 87  ? 20.010  -38.204 67.234 1.00 85.06  ? 14  DC  I "C2'" 1 
ATOM   7844  C  "C1'" . DC  I 5 87  ? 18.773  -37.450 67.720 1.00 84.83  ? 14  DC  I "C1'" 1 
ATOM   7845  N  N1    . DC  I 5 87  ? 18.891  -36.034 68.116 1.00 84.43  ? 14  DC  I N1    1 
ATOM   7846  C  C2    . DC  I 5 87  ? 18.044  -35.070 67.526 1.00 84.42  ? 14  DC  I C2    1 
ATOM   7847  O  O2    . DC  I 5 87  ? 17.229  -35.402 66.645 1.00 84.32  ? 14  DC  I O2    1 
ATOM   7848  N  N3    . DC  I 5 87  ? 18.156  -33.776 67.943 1.00 83.75  ? 14  DC  I N3    1 
ATOM   7849  C  C4    . DC  I 5 87  ? 19.043  -33.442 68.892 1.00 83.50  ? 14  DC  I C4    1 
ATOM   7850  N  N4    . DC  I 5 87  ? 19.115  -32.164 69.263 1.00 83.00  ? 14  DC  I N4    1 
ATOM   7851  C  C5    . DC  I 5 87  ? 19.893  -34.412 69.510 1.00 83.88  ? 14  DC  I C5    1 
ATOM   7852  C  C6    . DC  I 5 87  ? 19.777  -35.684 69.102 1.00 83.88  ? 14  DC  I C6    1 
ATOM   7853  P  P     . DC  I 5 88  ? 19.251  -41.083 65.296 1.00 85.02  ? 15  DC  I P     1 
ATOM   7854  O  OP1   . DC  I 5 88  ? 19.334  -42.478 65.793 1.00 85.47  ? 15  DC  I OP1   1 
ATOM   7855  O  OP2   . DC  I 5 88  ? 20.453  -40.485 64.641 1.00 84.38  ? 15  DC  I OP2   1 
ATOM   7856  O  "O5'" . DC  I 5 88  ? 17.984  -41.005 64.308 1.00 84.50  ? 15  DC  I "O5'" 1 
ATOM   7857  C  "C5'" . DC  I 5 88  ? 16.649  -40.900 64.841 1.00 82.36  ? 15  DC  I "C5'" 1 
ATOM   7858  C  "C4'" . DC  I 5 88  ? 15.742  -40.054 63.949 1.00 81.12  ? 15  DC  I "C4'" 1 
ATOM   7859  O  "O4'" . DC  I 5 88  ? 16.040  -38.644 64.073 1.00 80.49  ? 15  DC  I "O4'" 1 
ATOM   7860  C  "C3'" . DC  I 5 88  ? 15.811  -40.325 62.449 1.00 79.90  ? 15  DC  I "C3'" 1 
ATOM   7861  O  "O3'" . DC  I 5 88  ? 14.549  -39.985 61.911 1.00 78.18  ? 15  DC  I "O3'" 1 
ATOM   7862  C  "C2'" . DC  I 5 88  ? 16.897  -39.367 61.984 1.00 79.77  ? 15  DC  I "C2'" 1 
ATOM   7863  C  "C1'" . DC  I 5 88  ? 16.534  -38.161 62.838 1.00 81.61  ? 15  DC  I "C1'" 1 
ATOM   7864  N  N1    . DC  I 5 88  ? 17.634  -37.248 63.202 1.00 84.01  ? 15  DC  I N1    1 
ATOM   7865  C  C2    . DC  I 5 88  ? 17.452  -35.866 63.045 1.00 85.63  ? 15  DC  I C2    1 
ATOM   7866  O  O2    . DC  I 5 88  ? 16.389  -35.421 62.580 1.00 86.50  ? 15  DC  I O2    1 
ATOM   7867  N  N3    . DC  I 5 88  ? 18.470  -35.044 63.410 1.00 87.25  ? 15  DC  I N3    1 
ATOM   7868  C  C4    . DC  I 5 88  ? 19.608  -35.552 63.915 1.00 87.92  ? 15  DC  I C4    1 
ATOM   7869  N  N4    . DC  I 5 88  ? 20.584  -34.706 64.266 1.00 88.53  ? 15  DC  I N4    1 
ATOM   7870  C  C5    . DC  I 5 88  ? 19.803  -36.956 64.083 1.00 87.24  ? 15  DC  I C5    1 
ATOM   7871  C  C6    . DC  I 5 88  ? 18.794  -37.758 63.722 1.00 85.72  ? 15  DC  I C6    1 
ATOM   7872  P  P     . DT  I 5 89  ? 13.972  -40.658 60.577 1.00 77.72  ? 16  DT  I P     1 
ATOM   7873  O  OP1   . DT  I 5 89  ? 12.792  -41.463 60.980 1.00 76.72  ? 16  DT  I OP1   1 
ATOM   7874  O  OP2   . DT  I 5 89  ? 15.083  -41.248 59.785 1.00 76.02  ? 16  DT  I OP2   1 
ATOM   7875  O  "O5'" . DT  I 5 89  ? 13.450  -39.374 59.775 1.00 75.13  ? 16  DT  I "O5'" 1 
ATOM   7876  C  "C5'" . DT  I 5 89  ? 12.848  -38.319 60.501 1.00 72.53  ? 16  DT  I "C5'" 1 
ATOM   7877  C  "C4'" . DT  I 5 89  ? 13.137  -37.021 59.795 1.00 70.13  ? 16  DT  I "C4'" 1 
ATOM   7878  O  "O4'" . DT  I 5 89  ? 14.485  -36.578 60.072 1.00 69.39  ? 16  DT  I "O4'" 1 
ATOM   7879  C  "C3'" . DT  I 5 89  ? 13.010  -37.154 58.288 1.00 68.77  ? 16  DT  I "C3'" 1 
ATOM   7880  O  "O3'" . DT  I 5 89  ? 11.911  -36.317 57.926 1.00 66.38  ? 16  DT  I "O3'" 1 
ATOM   7881  C  "C2'" . DT  I 5 89  ? 14.383  -36.728 57.757 1.00 68.75  ? 16  DT  I "C2'" 1 
ATOM   7882  C  "C1'" . DT  I 5 89  ? 14.987  -35.945 58.918 1.00 70.05  ? 16  DT  I "C1'" 1 
ATOM   7883  N  N1    . DT  I 5 89  ? 16.498  -35.920 58.997 1.00 71.54  ? 16  DT  I N1    1 
ATOM   7884  C  C2    . DT  I 5 89  ? 17.187  -34.712 58.905 1.00 72.39  ? 16  DT  I C2    1 
ATOM   7885  O  O2    . DT  I 5 89  ? 16.665  -33.622 58.750 1.00 72.60  ? 16  DT  I O2    1 
ATOM   7886  N  N3    . DT  I 5 89  ? 18.555  -34.823 58.990 1.00 73.23  ? 16  DT  I N3    1 
ATOM   7887  C  C4    . DT  I 5 89  ? 19.298  -35.987 59.169 1.00 72.32  ? 16  DT  I C4    1 
ATOM   7888  O  O4    . DT  I 5 89  ? 20.530  -35.976 59.238 1.00 71.88  ? 16  DT  I O4    1 
ATOM   7889  C  C5    . DT  I 5 89  ? 18.516  -37.196 59.261 1.00 70.92  ? 16  DT  I C5    1 
ATOM   7890  C  C7    . DT  I 5 89  ? 19.188  -38.512 59.444 1.00 71.66  ? 16  DT  I C7    1 
ATOM   7891  C  C6    . DT  I 5 89  ? 17.184  -37.111 59.176 1.00 70.89  ? 16  DT  I C6    1 
ATOM   7892  P  P     . DT  I 5 90  ? 11.429  -36.117 56.413 1.00 66.16  ? 17  DT  I P     1 
ATOM   7893  O  OP1   . DT  I 5 90  ? 9.948   -36.295 56.457 1.00 66.11  ? 17  DT  I OP1   1 
ATOM   7894  O  OP2   . DT  I 5 90  ? 12.309  -36.903 55.507 1.00 63.05  ? 17  DT  I OP2   1 
ATOM   7895  O  "O5'" . DT  I 5 90  ? 11.752  -34.589 56.047 1.00 65.32  ? 17  DT  I "O5'" 1 
ATOM   7896  C  "C5'" . DT  I 5 90  ? 11.533  -33.546 56.973 1.00 63.85  ? 17  DT  I "C5'" 1 
ATOM   7897  C  "C4'" . DT  I 5 90  ? 12.459  -32.409 56.626 1.00 64.24  ? 17  DT  I "C4'" 1 
ATOM   7898  O  "O4'" . DT  I 5 90  ? 13.827  -32.816 56.859 1.00 65.74  ? 17  DT  I "O4'" 1 
ATOM   7899  C  "C3'" . DT  I 5 90  ? 12.403  -31.939 55.176 1.00 63.64  ? 17  DT  I "C3'" 1 
ATOM   7900  O  "O3'" . DT  I 5 90  ? 12.270  -30.541 55.216 1.00 61.07  ? 17  DT  I "O3'" 1 
ATOM   7901  C  "C2'" . DT  I 5 90  ? 13.742  -32.370 54.593 1.00 64.37  ? 17  DT  I "C2'" 1 
ATOM   7902  C  "C1'" . DT  I 5 90  ? 14.621  -32.269 55.830 1.00 66.85  ? 17  DT  I "C1'" 1 
ATOM   7903  N  N1    . DT  I 5 90  ? 15.890  -33.052 55.813 1.00 69.35  ? 17  DT  I N1    1 
ATOM   7904  C  C2    . DT  I 5 90  ? 17.100  -32.413 56.042 1.00 70.49  ? 17  DT  I C2    1 
ATOM   7905  O  O2    . DT  I 5 90  ? 17.223  -31.209 56.251 1.00 71.45  ? 17  DT  I O2    1 
ATOM   7906  N  N3    . DT  I 5 90  ? 18.185  -33.258 56.017 1.00 71.57  ? 17  DT  I N3    1 
ATOM   7907  C  C4    . DT  I 5 90  ? 18.194  -34.629 55.788 1.00 71.44  ? 17  DT  I C4    1 
ATOM   7908  O  O4    . DT  I 5 90  ? 19.222  -35.294 55.790 1.00 71.67  ? 17  DT  I O4    1 
ATOM   7909  C  C5    . DT  I 5 90  ? 16.907  -35.231 55.558 1.00 71.78  ? 17  DT  I C5    1 
ATOM   7910  C  C7    . DT  I 5 90  ? 16.805  -36.712 55.303 1.00 70.80  ? 17  DT  I C7    1 
ATOM   7911  C  C6    . DT  I 5 90  ? 15.828  -34.421 55.588 1.00 70.74  ? 17  DT  I C6    1 
ATOM   7912  P  P     . DT  I 5 91  ? 11.994  -29.671 53.921 1.00 60.66  ? 18  DT  I P     1 
ATOM   7913  O  OP1   . DT  I 5 91  ? 10.934  -28.754 54.384 1.00 61.14  ? 18  DT  I OP1   1 
ATOM   7914  O  OP2   . DT  I 5 91  ? 11.835  -30.496 52.693 1.00 59.10  ? 18  DT  I OP2   1 
ATOM   7915  O  "O5'" . DT  I 5 91  ? 13.354  -28.830 53.777 1.00 62.73  ? 18  DT  I "O5'" 1 
ATOM   7916  C  "C5'" . DT  I 5 91  ? 13.993  -28.244 54.917 1.00 65.47  ? 18  DT  I "C5'" 1 
ATOM   7917  C  "C4'" . DT  I 5 91  ? 15.397  -27.782 54.565 1.00 69.76  ? 18  DT  I "C4'" 1 
ATOM   7918  O  "O4'" . DT  I 5 91  ? 16.337  -28.894 54.593 1.00 71.43  ? 18  DT  I "O4'" 1 
ATOM   7919  C  "C3'" . DT  I 5 91  ? 15.533  -27.171 53.172 1.00 72.59  ? 18  DT  I "C3'" 1 
ATOM   7920  O  "O3'" . DT  I 5 91  ? 16.346  -25.998 53.259 1.00 75.82  ? 18  DT  I "O3'" 1 
ATOM   7921  C  "C2'" . DT  I 5 91  ? 16.182  -28.281 52.337 1.00 72.71  ? 18  DT  I "C2'" 1 
ATOM   7922  C  "C1'" . DT  I 5 91  ? 17.085  -28.926 53.384 1.00 72.74  ? 18  DT  I "C1'" 1 
ATOM   7923  N  N1    . DT  I 5 91  ? 17.534  -30.344 53.131 1.00 73.92  ? 18  DT  I N1    1 
ATOM   7924  C  C2    . DT  I 5 91  ? 18.876  -30.680 53.298 1.00 75.40  ? 18  DT  I C2    1 
ATOM   7925  O  O2    . DT  I 5 91  ? 19.761  -29.897 53.619 1.00 75.29  ? 18  DT  I O2    1 
ATOM   7926  N  N3    . DT  I 5 91  ? 19.172  -32.007 53.061 1.00 76.55  ? 18  DT  I N3    1 
ATOM   7927  C  C4    . DT  I 5 91  ? 18.295  -33.016 52.691 1.00 76.38  ? 18  DT  I C4    1 
ATOM   7928  O  O4    . DT  I 5 91  ? 18.690  -34.163 52.507 1.00 77.02  ? 18  DT  I O4    1 
ATOM   7929  C  C5    . DT  I 5 91  ? 16.908  -32.603 52.541 1.00 76.28  ? 18  DT  I C5    1 
ATOM   7930  C  C7    . DT  I 5 91  ? 15.848  -33.590 52.131 1.00 75.12  ? 18  DT  I C7    1 
ATOM   7931  C  C6    . DT  I 5 91  ? 16.603  -31.309 52.773 1.00 74.71  ? 18  DT  I C6    1 
ATOM   7932  P  P     . DT  I 5 92  ? 16.401  -24.897 52.082 1.00 78.61  ? 19  DT  I P     1 
ATOM   7933  O  OP1   . DT  I 5 92  ? 16.317  -23.596 52.775 1.00 78.17  ? 19  DT  I OP1   1 
ATOM   7934  O  OP2   . DT  I 5 92  ? 15.439  -25.204 50.993 1.00 77.64  ? 19  DT  I OP2   1 
ATOM   7935  O  "O5'" . DT  I 5 92  ? 17.860  -25.087 51.449 1.00 81.48  ? 19  DT  I "O5'" 1 
ATOM   7936  C  "C5'" . DT  I 5 92  ? 19.047  -25.056 52.227 1.00 86.05  ? 19  DT  I "C5'" 1 
ATOM   7937  C  "C4'" . DT  I 5 92  ? 20.165  -25.645 51.392 1.00 89.49  ? 19  DT  I "C4'" 1 
ATOM   7938  O  "O4'" . DT  I 5 92  ? 20.059  -27.093 51.362 1.00 89.83  ? 19  DT  I "O4'" 1 
ATOM   7939  C  "C3'" . DT  I 5 92  ? 20.181  -25.191 49.932 1.00 92.40  ? 19  DT  I "C3'" 1 
ATOM   7940  O  "O3'" . DT  I 5 92  ? 21.512  -24.740 49.637 1.00 96.96  ? 19  DT  I "O3'" 1 
ATOM   7941  C  "C2'" . DT  I 5 92  ? 19.745  -26.438 49.147 1.00 91.16  ? 19  DT  I "C2'" 1 
ATOM   7942  C  "C1'" . DT  I 5 92  ? 20.328  -27.527 50.041 1.00 90.81  ? 19  DT  I "C1'" 1 
ATOM   7943  N  N1    . DT  I 5 92  ? 19.821  -28.934 49.884 1.00 91.17  ? 19  DT  I N1    1 
ATOM   7944  C  C2    . DT  I 5 92  ? 20.740  -29.973 49.894 1.00 91.33  ? 19  DT  I C2    1 
ATOM   7945  O  O2    . DT  I 5 92  ? 21.946  -29.815 50.009 1.00 91.93  ? 19  DT  I O2    1 
ATOM   7946  N  N3    . DT  I 5 92  ? 20.189  -31.226 49.762 1.00 91.15  ? 19  DT  I N3    1 
ATOM   7947  C  C4    . DT  I 5 92  ? 18.846  -31.544 49.633 1.00 91.22  ? 19  DT  I C4    1 
ATOM   7948  O  O4    . DT  I 5 92  ? 18.455  -32.704 49.520 1.00 91.60  ? 19  DT  I O4    1 
ATOM   7949  C  C5    . DT  I 5 92  ? 17.940  -30.418 49.633 1.00 91.07  ? 19  DT  I C5    1 
ATOM   7950  C  C7    . DT  I 5 92  ? 16.462  -30.641 49.484 1.00 90.97  ? 19  DT  I C7    1 
ATOM   7951  C  C6    . DT  I 5 92  ? 18.462  -29.186 49.759 1.00 91.24  ? 19  DT  I C6    1 
ATOM   7952  P  P     . DG  I 5 93  ? 21.859  -23.835 48.364 1.00 100.34 ? 20  DG  I P     1 
ATOM   7953  O  OP1   . DG  I 5 93  ? 21.604  -22.440 48.774 1.00 100.34 ? 20  DG  I OP1   1 
ATOM   7954  O  OP2   . DG  I 5 93  ? 21.177  -24.357 47.156 1.00 100.75 ? 20  DG  I OP2   1 
ATOM   7955  O  "O5'" . DG  I 5 93  ? 23.427  -24.087 48.177 1.00 103.54 ? 20  DG  I "O5'" 1 
ATOM   7956  C  "C5'" . DG  I 5 93  ? 24.023  -25.318 48.584 1.00 109.01 ? 20  DG  I "C5'" 1 
ATOM   7957  C  "C4'" . DG  I 5 93  ? 24.407  -26.251 47.439 1.00 113.30 ? 20  DG  I "C4'" 1 
ATOM   7958  O  "O4'" . DG  I 5 93  ? 23.602  -27.455 47.512 1.00 114.20 ? 20  DG  I "O4'" 1 
ATOM   7959  C  "C3'" . DG  I 5 93  ? 24.279  -25.760 45.992 1.00 115.88 ? 20  DG  I "C3'" 1 
ATOM   7960  O  "O3'" . DG  I 5 93  ? 25.471  -26.162 45.305 1.00 119.93 ? 20  DG  I "O3'" 1 
ATOM   7961  C  "C2'" . DG  I 5 93  ? 23.040  -26.499 45.483 1.00 115.33 ? 20  DG  I "C2'" 1 
ATOM   7962  C  "C1'" . DG  I 5 93  ? 23.265  -27.826 46.193 1.00 114.92 ? 20  DG  I "C1'" 1 
ATOM   7963  N  N9    . DG  I 5 93  ? 22.155  -28.771 46.267 1.00 115.41 ? 20  DG  I N9    1 
ATOM   7964  C  C8    . DG  I 5 93  ? 20.812  -28.553 46.078 1.00 115.68 ? 20  DG  I C8    1 
ATOM   7965  N  N7    . DG  I 5 93  ? 20.089  -29.628 46.225 1.00 115.86 ? 20  DG  I N7    1 
ATOM   7966  C  C5    . DG  I 5 93  ? 21.010  -30.620 46.535 1.00 116.26 ? 20  DG  I C5    1 
ATOM   7967  C  C6    . DG  I 5 93  ? 20.826  -32.001 46.802 1.00 116.70 ? 20  DG  I C6    1 
ATOM   7968  O  O6    . DG  I 5 93  ? 19.764  -32.636 46.821 1.00 116.95 ? 20  DG  I O6    1 
ATOM   7969  N  N1    . DG  I 5 93  ? 22.032  -32.656 47.073 1.00 116.99 ? 20  DG  I N1    1 
ATOM   7970  C  C2    . DG  I 5 93  ? 23.269  -32.045 47.080 1.00 117.08 ? 20  DG  I C2    1 
ATOM   7971  N  N2    . DG  I 5 93  ? 24.328  -32.821 47.356 1.00 117.28 ? 20  DG  I N2    1 
ATOM   7972  N  N3    . DG  I 5 93  ? 23.454  -30.753 46.829 1.00 116.70 ? 20  DG  I N3    1 
ATOM   7973  C  C4    . DG  I 5 93  ? 22.286  -30.105 46.566 1.00 116.11 ? 20  DG  I C4    1 
ATOM   7974  P  P     . DA  I 5 94  ? 25.828  -25.768 43.789 1.00 123.42 ? 21  DA  I P     1 
ATOM   7975  O  OP1   . DA  I 5 94  ? 27.304  -25.844 43.711 1.00 123.43 ? 21  DA  I OP1   1 
ATOM   7976  O  OP2   . DA  I 5 94  ? 25.140  -24.503 43.438 1.00 123.62 ? 21  DA  I OP2   1 
ATOM   7977  O  "O5'" . DA  I 5 94  ? 25.174  -26.927 42.890 1.00 124.71 ? 21  DA  I "O5'" 1 
ATOM   7978  C  "C5'" . DA  I 5 94  ? 25.945  -27.650 41.930 1.00 127.31 ? 21  DA  I "C5'" 1 
ATOM   7979  C  "C4'" . DA  I 5 94  ? 26.719  -28.787 42.582 1.00 129.28 ? 21  DA  I "C4'" 1 
ATOM   7980  O  "O4'" . DA  I 5 94  ? 26.072  -29.182 43.822 1.00 129.52 ? 21  DA  I "O4'" 1 
ATOM   7981  C  "C3'" . DA  I 5 94  ? 26.809  -30.049 41.733 1.00 130.90 ? 21  DA  I "C3'" 1 
ATOM   7982  O  "O3'" . DA  I 5 94  ? 28.034  -30.058 40.990 1.00 133.03 ? 21  DA  I "O3'" 1 
ATOM   7983  C  "C2'" . DA  I 5 94  ? 26.783  -31.158 42.781 1.00 130.63 ? 21  DA  I "C2'" 1 
ATOM   7984  C  "C1'" . DA  I 5 94  ? 25.842  -30.581 43.833 1.00 130.06 ? 21  DA  I "C1'" 1 
ATOM   7985  N  N9    . DA  I 5 94  ? 24.420  -30.867 43.598 1.00 130.07 ? 21  DA  I N9    1 
ATOM   7986  C  C8    . DA  I 5 94  ? 23.436  -29.964 43.296 1.00 129.96 ? 21  DA  I C8    1 
ATOM   7987  N  N7    . DA  I 5 94  ? 22.245  -30.489 43.142 1.00 129.79 ? 21  DA  I N7    1 
ATOM   7988  C  C5    . DA  I 5 94  ? 22.455  -31.837 43.356 1.00 129.80 ? 21  DA  I C5    1 
ATOM   7989  C  C6    . DA  I 5 94  ? 21.581  -32.942 43.337 1.00 129.64 ? 21  DA  I C6    1 
ATOM   7990  N  N6    . DA  I 5 94  ? 20.280  -32.819 43.078 1.00 129.41 ? 21  DA  I N6    1 
ATOM   7991  N  N1    . DA  I 5 94  ? 22.091  -34.170 43.593 1.00 129.88 ? 21  DA  I N1    1 
ATOM   7992  C  C2    . DA  I 5 94  ? 23.403  -34.278 43.852 1.00 130.25 ? 21  DA  I C2    1 
ATOM   7993  N  N3    . DA  I 5 94  ? 24.324  -33.308 43.897 1.00 130.39 ? 21  DA  I N3    1 
ATOM   7994  C  C4    . DA  I 5 94  ? 23.786  -32.096 43.639 1.00 130.06 ? 21  DA  I C4    1 
ATOM   7995  P  P     . DT  I 5 95  ? 28.102  -30.265 39.395 1.00 134.25 ? 22  DT  I P     1 
ATOM   7996  O  OP1   . DT  I 5 95  ? 29.027  -29.219 38.902 1.00 134.13 ? 22  DT  I OP1   1 
ATOM   7997  O  OP2   . DT  I 5 95  ? 26.738  -30.358 38.818 1.00 133.81 ? 22  DT  I OP2   1 
ATOM   7998  O  "O5'" . DT  I 5 95  ? 28.803  -31.699 39.206 1.00 135.95 ? 22  DT  I "O5'" 1 
ATOM   7999  C  "C5'" . DT  I 5 95  ? 28.667  -32.780 40.148 1.00 138.21 ? 22  DT  I "C5'" 1 
ATOM   8000  C  "C4'" . DT  I 5 95  ? 27.726  -33.877 39.665 1.00 139.97 ? 22  DT  I "C4'" 1 
ATOM   8001  O  "O4'" . DT  I 5 95  ? 26.395  -33.686 40.228 1.00 140.39 ? 22  DT  I "O4'" 1 
ATOM   8002  C  "C3'" . DT  I 5 95  ? 27.546  -33.981 38.146 1.00 140.83 ? 22  DT  I "C3'" 1 
ATOM   8003  O  "O3'" . DT  I 5 95  ? 27.779  -35.317 37.694 1.00 142.06 ? 22  DT  I "O3'" 1 
ATOM   8004  C  "C2'" . DT  I 5 95  ? 26.090  -33.569 37.925 1.00 140.79 ? 22  DT  I "C2'" 1 
ATOM   8005  C  "C1'" . DT  I 5 95  ? 25.459  -34.053 39.230 1.00 140.58 ? 22  DT  I "C1'" 1 
ATOM   8006  N  N1    . DT  I 5 95  ? 24.091  -33.479 39.487 1.00 140.43 ? 22  DT  I N1    1 
ATOM   8007  C  C2    . DT  I 5 95  ? 23.011  -34.335 39.641 1.00 140.23 ? 22  DT  I C2    1 
ATOM   8008  O  O2    . DT  I 5 95  ? 23.091  -35.554 39.599 1.00 139.70 ? 22  DT  I O2    1 
ATOM   8009  N  N3    . DT  I 5 95  ? 21.810  -33.699 39.856 1.00 140.30 ? 22  DT  I N3    1 
ATOM   8010  C  C4    . DT  I 5 95  ? 21.580  -32.333 39.927 1.00 140.20 ? 22  DT  I C4    1 
ATOM   8011  O  O4    . DT  I 5 95  ? 20.457  -31.883 40.124 1.00 140.12 ? 22  DT  I O4    1 
ATOM   8012  C  C5    . DT  I 5 95  ? 22.745  -31.493 39.753 1.00 140.22 ? 22  DT  I C5    1 
ATOM   8013  C  C7    . DT  I 5 95  ? 22.641  -29.995 39.804 1.00 139.99 ? 22  DT  I C7    1 
ATOM   8014  C  C6    . DT  I 5 95  ? 23.924  -32.101 39.542 1.00 140.48 ? 22  DT  I C6    1 
ATOM   8015  P  P     . DG  I 5 96  ? 28.250  -35.584 36.183 1.00 143.12 ? 23  DG  I P     1 
ATOM   8016  O  OP1   . DG  I 5 96  ? 29.717  -35.402 36.165 1.00 143.03 ? 23  DG  I OP1   1 
ATOM   8017  O  OP2   . DG  I 5 96  ? 27.418  -34.773 35.260 1.00 142.99 ? 23  DG  I OP2   1 
ATOM   8018  O  "O5'" . DG  I 5 96  ? 27.916  -37.136 35.932 1.00 143.54 ? 23  DG  I "O5'" 1 
ATOM   8019  C  "C5'" . DG  I 5 96  ? 26.958  -37.864 36.715 1.00 143.95 ? 23  DG  I "C5'" 1 
ATOM   8020  C  "C4'" . DG  I 5 96  ? 25.673  -38.180 35.953 1.00 144.24 ? 23  DG  I "C4'" 1 
ATOM   8021  O  "O4'" . DG  I 5 96  ? 24.601  -37.295 36.378 1.00 144.64 ? 23  DG  I "O4'" 1 
ATOM   8022  C  "C3'" . DG  I 5 96  ? 25.696  -38.096 34.424 1.00 144.19 ? 23  DG  I "C3'" 1 
ATOM   8023  O  "O3'" . DG  I 5 96  ? 24.934  -39.174 33.889 1.00 143.57 ? 23  DG  I "O3'" 1 
ATOM   8024  C  "C2'" . DG  I 5 96  ? 24.997  -36.770 34.140 1.00 144.51 ? 23  DG  I "C2'" 1 
ATOM   8025  C  "C1'" . DG  I 5 96  ? 23.919  -36.858 35.218 1.00 144.89 ? 23  DG  I "C1'" 1 
ATOM   8026  N  N9    . DG  I 5 96  ? 23.175  -35.636 35.521 1.00 145.21 ? 23  DG  I N9    1 
ATOM   8027  C  C8    . DG  I 5 96  ? 23.517  -34.326 35.268 1.00 145.36 ? 23  DG  I C8    1 
ATOM   8028  N  N7    . DG  I 5 96  ? 22.620  -33.466 35.667 1.00 145.33 ? 23  DG  I N7    1 
ATOM   8029  C  C5    . DG  I 5 96  ? 21.618  -34.258 36.215 1.00 145.46 ? 23  DG  I C5    1 
ATOM   8030  C  C6    . DG  I 5 96  ? 20.386  -33.894 36.810 1.00 145.54 ? 23  DG  I C6    1 
ATOM   8031  O  O6    . DG  I 5 96  ? 19.938  -32.751 36.965 1.00 145.51 ? 23  DG  I O6    1 
ATOM   8032  N  N1    . DG  I 5 96  ? 19.656  -35.010 37.241 1.00 145.73 ? 23  DG  I N1    1 
ATOM   8033  C  C2    . DG  I 5 96  ? 20.075  -36.321 37.113 1.00 145.82 ? 23  DG  I C2    1 
ATOM   8034  N  N2    . DG  I 5 96  ? 19.257  -37.277 37.580 1.00 145.79 ? 23  DG  I N2    1 
ATOM   8035  N  N3    . DG  I 5 96  ? 21.230  -36.673 36.558 1.00 145.75 ? 23  DG  I N3    1 
ATOM   8036  C  C4    . DG  I 5 96  ? 21.945  -35.595 36.133 1.00 145.50 ? 23  DG  I C4    1 
ATOM   8037  P  P     . DG  I 5 97  ? 25.643  -40.475 33.282 1.00 142.70 ? 24  DG  I P     1 
ATOM   8038  O  OP1   . DG  I 5 97  ? 26.566  -41.025 34.307 1.00 142.86 ? 24  DG  I OP1   1 
ATOM   8039  O  OP2   . DG  I 5 97  ? 26.161  -40.089 31.945 1.00 142.59 ? 24  DG  I OP2   1 
ATOM   8040  O  "O5'" . DG  I 5 97  ? 24.431  -41.512 33.072 1.00 141.35 ? 24  DG  I "O5'" 1 
ATOM   8041  C  "C5'" . DG  I 5 97  ? 23.323  -41.613 33.987 1.00 138.84 ? 24  DG  I "C5'" 1 
ATOM   8042  C  "C4'" . DG  I 5 97  ? 21.990  -41.342 33.296 1.00 136.83 ? 24  DG  I "C4'" 1 
ATOM   8043  O  "O4'" . DG  I 5 97  ? 21.506  -40.024 33.657 1.00 136.36 ? 24  DG  I "O4'" 1 
ATOM   8044  C  "C3'" . DG  I 5 97  ? 22.041  -41.370 31.764 1.00 135.51 ? 24  DG  I "C3'" 1 
ATOM   8045  O  "O3'" . DG  I 5 97  ? 21.395  -42.580 31.289 1.00 133.89 ? 24  DG  I "O3'" 1 
ATOM   8046  C  "C2'" . DG  I 5 97  ? 21.456  -40.026 31.310 1.00 135.47 ? 24  DG  I "C2'" 1 
ATOM   8047  C  "C1'" . DG  I 5 97  ? 20.749  -39.531 32.571 1.00 135.62 ? 24  DG  I "C1'" 1 
ATOM   8048  N  N9    . DG  I 5 97  ? 20.623  -38.079 32.717 1.00 135.00 ? 24  DG  I N9    1 
ATOM   8049  C  C8    . DG  I 5 97  ? 21.465  -37.095 32.247 1.00 134.84 ? 24  DG  I C8    1 
ATOM   8050  N  N7    . DG  I 5 97  ? 21.072  -35.886 32.552 1.00 134.61 ? 24  DG  I N7    1 
ATOM   8051  C  C5    . DG  I 5 97  ? 19.895  -36.073 33.275 1.00 134.24 ? 24  DG  I C5    1 
ATOM   8052  C  C6    . DG  I 5 97  ? 19.010  -35.133 33.876 1.00 133.50 ? 24  DG  I C6    1 
ATOM   8053  O  O6    . DG  I 5 97  ? 19.084  -33.896 33.893 1.00 132.48 ? 24  DG  I O6    1 
ATOM   8054  N  N1    . DG  I 5 97  ? 17.938  -35.761 34.513 1.00 133.37 ? 24  DG  I N1    1 
ATOM   8055  C  C2    . DG  I 5 97  ? 17.741  -37.125 34.566 1.00 133.66 ? 24  DG  I C2    1 
ATOM   8056  N  N2    . DG  I 5 97  ? 16.654  -37.562 35.218 1.00 133.41 ? 24  DG  I N2    1 
ATOM   8057  N  N3    . DG  I 5 97  ? 18.560  -38.011 34.010 1.00 134.04 ? 24  DG  I N3    1 
ATOM   8058  C  C4    . DG  I 5 97  ? 19.612  -37.421 33.383 1.00 134.44 ? 24  DG  I C4    1 
ATOM   8059  P  P     . DA  I 5 98  ? 20.004  -42.699 30.489 1.00 132.77 ? 25  DA  I P     1 
ATOM   8060  O  OP1   . DA  I 5 98  ? 19.755  -44.144 30.281 1.00 132.61 ? 25  DA  I OP1   1 
ATOM   8061  O  OP2   . DA  I 5 98  ? 20.072  -41.807 29.304 1.00 132.50 ? 25  DA  I OP2   1 
ATOM   8062  O  "O5'" . DA  I 5 98  ? 18.911  -42.144 31.530 1.00 131.71 ? 25  DA  I "O5'" 1 
ATOM   8063  C  "C5'" . DA  I 5 98  ? 17.852  -42.982 32.022 1.00 129.38 ? 25  DA  I "C5'" 1 
ATOM   8064  C  "C4'" . DA  I 5 98  ? 16.479  -42.499 31.561 1.00 127.67 ? 25  DA  I "C4'" 1 
ATOM   8065  O  "O4'" . DA  I 5 98  ? 16.398  -41.054 31.576 1.00 127.02 ? 25  DA  I "O4'" 1 
ATOM   8066  C  "C3'" . DA  I 5 98  ? 16.046  -42.907 30.153 1.00 126.79 ? 25  DA  I "C3'" 1 
ATOM   8067  O  "O3'" . DA  I 5 98  ? 14.619  -43.060 30.063 1.00 126.29 ? 25  DA  I "O3'" 1 
ATOM   8068  C  "C2'" . DA  I 5 98  ? 16.508  -41.713 29.322 1.00 126.19 ? 25  DA  I "C2'" 1 
ATOM   8069  C  "C1'" . DA  I 5 98  ? 16.165  -40.569 30.270 1.00 125.98 ? 25  DA  I "C1'" 1 
ATOM   8070  N  N9    . DA  I 5 98  ? 16.965  -39.356 30.149 1.00 125.63 ? 25  DA  I N9    1 
ATOM   8071  C  C8    . DA  I 5 98  ? 18.214  -39.224 29.607 1.00 125.45 ? 25  DA  I C8    1 
ATOM   8072  N  N7    . DA  I 5 98  ? 18.687  -37.999 29.658 1.00 125.32 ? 25  DA  I N7    1 
ATOM   8073  C  C5    . DA  I 5 98  ? 17.683  -37.275 30.282 1.00 125.11 ? 25  DA  I C5    1 
ATOM   8074  C  C6    . DA  I 5 98  ? 17.565  -35.912 30.637 1.00 124.62 ? 25  DA  I C6    1 
ATOM   8075  N  N6    . DA  I 5 98  ? 18.516  -35.008 30.395 1.00 124.29 ? 25  DA  I N6    1 
ATOM   8076  N  N1    . DA  I 5 98  ? 16.428  -35.510 31.250 1.00 124.51 ? 25  DA  I N1    1 
ATOM   8077  C  C2    . DA  I 5 98  ? 15.470  -36.418 31.498 1.00 124.71 ? 25  DA  I C2    1 
ATOM   8078  N  N3    . DA  I 5 98  ? 15.465  -37.723 31.210 1.00 124.97 ? 25  DA  I N3    1 
ATOM   8079  C  C4    . DA  I 5 98  ? 16.611  -38.097 30.597 1.00 125.41 ? 25  DA  I C4    1 
ATOM   8080  P  P     . DG  I 5 99  ? 13.736  -44.118 30.909 1.00 125.84 ? 26  DG  I P     1 
ATOM   8081  O  OP1   . DG  I 5 99  ? 14.548  -44.753 31.975 1.00 125.92 ? 26  DG  I OP1   1 
ATOM   8082  O  OP2   . DG  I 5 99  ? 13.045  -44.974 29.917 1.00 125.54 ? 26  DG  I OP2   1 
ATOM   8083  O  "O5'" . DG  I 5 99  ? 12.622  -43.205 31.624 1.00 124.44 ? 26  DG  I "O5'" 1 
ATOM   8084  C  "C5'" . DG  I 5 99  ? 12.912  -41.907 32.180 1.00 121.48 ? 26  DG  I "C5'" 1 
ATOM   8085  C  "C4'" . DG  I 5 99  ? 11.916  -40.846 31.713 1.00 118.97 ? 26  DG  I "C4'" 1 
ATOM   8086  O  "O4'" . DG  I 5 99  ? 12.601  -39.772 31.013 1.00 118.76 ? 26  DG  I "O4'" 1 
ATOM   8087  C  "C3'" . DG  I 5 99  ? 10.820  -41.317 30.758 1.00 117.07 ? 26  DG  I "C3'" 1 
ATOM   8088  O  "O3'" . DG  I 5 99  ? 9.633   -40.575 31.037 1.00 113.56 ? 26  DG  I "O3'" 1 
ATOM   8089  C  "C2'" . DG  I 5 99  ? 11.426  -40.999 29.393 1.00 117.96 ? 26  DG  I "C2'" 1 
ATOM   8090  C  "C1'" . DG  I 5 99  ? 12.092  -39.664 29.695 1.00 118.84 ? 26  DG  I "C1'" 1 
ATOM   8091  N  N9    . DG  I 5 99  ? 13.200  -39.306 28.815 1.00 119.61 ? 26  DG  I N9    1 
ATOM   8092  C  C8    . DG  I 5 99  ? 13.985  -40.128 28.032 1.00 120.01 ? 26  DG  I C8    1 
ATOM   8093  N  N7    . DG  I 5 99  ? 14.906  -39.488 27.360 1.00 120.12 ? 26  DG  I N7    1 
ATOM   8094  C  C5    . DG  I 5 99  ? 14.708  -38.156 27.718 1.00 120.05 ? 26  DG  I C5    1 
ATOM   8095  C  C6    . DG  I 5 99  ? 15.393  -36.983 27.315 1.00 120.15 ? 26  DG  I C6    1 
ATOM   8096  O  O6    . DG  I 5 99  ? 16.349  -36.899 26.532 1.00 120.79 ? 26  DG  I O6    1 
ATOM   8097  N  N1    . DG  I 5 99  ? 14.874  -35.832 27.917 1.00 119.78 ? 26  DG  I N1    1 
ATOM   8098  C  C2    . DG  I 5 99  ? 13.815  -35.818 28.796 1.00 119.65 ? 26  DG  I C2    1 
ATOM   8099  N  N2    . DG  I 5 99  ? 13.440  -34.630 29.285 1.00 119.37 ? 26  DG  I N2    1 
ATOM   8100  N  N3    . DG  I 5 99  ? 13.168  -36.907 29.185 1.00 119.65 ? 26  DG  I N3    1 
ATOM   8101  C  C4    . DG  I 5 99  ? 13.664  -38.031 28.608 1.00 119.74 ? 26  DG  I C4    1 
ATOM   8102  P  P     . DC  I 5 100 ? 8.255   -40.741 30.230 1.00 110.84 ? 27  DC  I P     1 
ATOM   8103  O  OP1   . DC  I 5 100 ? 7.434   -41.767 30.917 1.00 110.19 ? 27  DC  I OP1   1 
ATOM   8104  O  OP2   . DC  I 5 100 ? 8.525   -40.846 28.774 1.00 110.52 ? 27  DC  I OP2   1 
ATOM   8105  O  "O5'" . DC  I 5 100 ? 7.604   -39.300 30.475 1.00 108.67 ? 27  DC  I "O5'" 1 
ATOM   8106  C  "C5'" . DC  I 5 100 ? 8.435   -38.163 30.741 1.00 105.10 ? 27  DC  I "C5'" 1 
ATOM   8107  C  "C4'" . DC  I 5 100 ? 8.058   -36.927 29.932 1.00 102.37 ? 27  DC  I "C4'" 1 
ATOM   8108  O  "O4'" . DC  I 5 100 ? 9.148   -36.559 29.048 1.00 101.84 ? 27  DC  I "O4'" 1 
ATOM   8109  C  "C3'" . DC  I 5 100 ? 6.847   -37.027 29.014 1.00 101.32 ? 27  DC  I "C3'" 1 
ATOM   8110  O  "O3'" . DC  I 5 100 ? 6.388   -35.707 28.807 1.00 99.86  ? 27  DC  I "O3'" 1 
ATOM   8111  C  "C2'" . DC  I 5 100 ? 7.468   -37.531 27.720 1.00 101.38 ? 27  DC  I "C2'" 1 
ATOM   8112  C  "C1'" . DC  I 5 100 ? 8.712   -36.640 27.699 1.00 101.64 ? 27  DC  I "C1'" 1 
ATOM   8113  N  N1    . DC  I 5 100 ? 9.843   -37.096 26.810 1.00 101.81 ? 27  DC  I N1    1 
ATOM   8114  C  C2    . DC  I 5 100 ? 10.848  -36.182 26.453 1.00 101.69 ? 27  DC  I C2    1 
ATOM   8115  O  O2    . DC  I 5 100 ? 10.799  -35.022 26.868 1.00 101.32 ? 27  DC  I O2    1 
ATOM   8116  N  N3    . DC  I 5 100 ? 11.860  -36.594 25.652 1.00 101.99 ? 27  DC  I N3    1 
ATOM   8117  C  C4    . DC  I 5 100 ? 11.896  -37.855 25.214 1.00 102.64 ? 27  DC  I C4    1 
ATOM   8118  N  N4    . DC  I 5 100 ? 12.920  -38.204 24.431 1.00 103.20 ? 27  DC  I N4    1 
ATOM   8119  C  C5    . DC  I 5 100 ? 10.889  -38.812 25.559 1.00 102.60 ? 27  DC  I C5    1 
ATOM   8120  C  C6    . DC  I 5 100 ? 9.893   -38.390 26.350 1.00 102.13 ? 27  DC  I C6    1 
ATOM   8121  P  P     . DA  I 5 101 ? 4.957   -35.207 29.273 1.00 97.48  ? 28  DA  I P     1 
ATOM   8122  O  OP1   . DA  I 5 101 ? 4.453   -36.065 30.357 1.00 98.12  ? 28  DA  I OP1   1 
ATOM   8123  O  OP2   . DA  I 5 101 ? 4.144   -34.991 28.064 1.00 97.12  ? 28  DA  I OP2   1 
ATOM   8124  O  "O5'" . DA  I 5 101 ? 5.388   -33.825 29.927 1.00 100.74 ? 28  DA  I "O5'" 1 
ATOM   8125  C  "C5'" . DA  I 5 101 ? 4.938   -32.590 29.409 1.00 105.29 ? 28  DA  I "C5'" 1 
ATOM   8126  C  "C4'" . DA  I 5 101 ? 6.015   -31.839 28.642 1.00 108.10 ? 28  DA  I "C4'" 1 
ATOM   8127  O  "O4'" . DA  I 5 101 ? 6.909   -32.730 27.924 1.00 108.64 ? 28  DA  I "O4'" 1 
ATOM   8128  C  "C3'" . DA  I 5 101 ? 5.393   -30.944 27.584 1.00 110.15 ? 28  DA  I "C3'" 1 
ATOM   8129  O  "O3'" . DA  I 5 101 ? 5.835   -29.631 27.825 1.00 113.32 ? 28  DA  I "O3'" 1 
ATOM   8130  C  "C2'" . DA  I 5 101 ? 5.889   -31.496 26.250 1.00 109.75 ? 28  DA  I "C2'" 1 
ATOM   8131  C  "C1'" . DA  I 5 101 ? 7.180   -32.179 26.659 1.00 109.11 ? 28  DA  I "C1'" 1 
ATOM   8132  N  N9    . DA  I 5 101 ? 7.570   -33.283 25.796 1.00 109.69 ? 28  DA  I N9    1 
ATOM   8133  C  C8    . DA  I 5 101 ? 6.889   -34.452 25.601 1.00 110.20 ? 28  DA  I C8    1 
ATOM   8134  N  N7    . DA  I 5 101 ? 7.481   -35.281 24.773 1.00 110.53 ? 28  DA  I N7    1 
ATOM   8135  C  C5    . DA  I 5 101 ? 8.631   -34.608 24.401 1.00 110.37 ? 28  DA  I C5    1 
ATOM   8136  C  C6    . DA  I 5 101 ? 9.693   -34.950 23.537 1.00 110.44 ? 28  DA  I C6    1 
ATOM   8137  N  N6    . DA  I 5 101 ? 9.755   -36.105 22.868 1.00 110.94 ? 28  DA  I N6    1 
ATOM   8138  N  N1    . DA  I 5 101 ? 10.689  -34.051 23.383 1.00 110.66 ? 28  DA  I N1    1 
ATOM   8139  C  C2    . DA  I 5 101 ? 10.625  -32.888 24.052 1.00 110.73 ? 28  DA  I C2    1 
ATOM   8140  N  N3    . DA  I 5 101 ? 9.682   -32.457 24.894 1.00 110.38 ? 28  DA  I N3    1 
ATOM   8141  C  C4    . DA  I 5 101 ? 8.704   -33.372 25.026 1.00 110.21 ? 28  DA  I C4    1 
ATOM   8142  P  P     . DG  I 5 102 ? 4.832   -28.405 27.617 1.00 115.50 ? 29  DG  I P     1 
ATOM   8143  O  OP1   . DG  I 5 102 ? 4.513   -27.878 28.962 1.00 114.13 ? 29  DG  I OP1   1 
ATOM   8144  O  OP2   . DG  I 5 102 ? 3.735   -28.845 26.710 1.00 115.28 ? 29  DG  I OP2   1 
ATOM   8145  O  "O5'" . DG  I 5 102 ? 5.737   -27.337 26.814 1.00 117.76 ? 29  DG  I "O5'" 1 
ATOM   8146  C  "C5'" . DG  I 5 102 ? 7.107   -27.619 26.441 1.00 120.99 ? 29  DG  I "C5'" 1 
ATOM   8147  C  "C4'" . DG  I 5 102 ? 7.362   -27.745 24.938 1.00 123.18 ? 29  DG  I "C4'" 1 
ATOM   8148  O  "O4'" . DG  I 5 102 ? 7.497   -29.139 24.547 1.00 123.27 ? 29  DG  I "O4'" 1 
ATOM   8149  C  "C3'" . DG  I 5 102 ? 6.313   -27.157 23.989 1.00 125.05 ? 29  DG  I "C3'" 1 
ATOM   8150  O  "O3'" . DG  I 5 102 ? 6.941   -26.244 23.081 1.00 128.65 ? 29  DG  I "O3'" 1 
ATOM   8151  C  "C2'" . DG  I 5 102 ? 5.781   -28.383 23.252 1.00 124.15 ? 29  DG  I "C2'" 1 
ATOM   8152  C  "C1'" . DG  I 5 102 ? 7.061   -29.206 23.209 1.00 123.29 ? 29  DG  I "C1'" 1 
ATOM   8153  N  N9    . DG  I 5 102 ? 6.931   -30.594 22.767 1.00 122.82 ? 29  DG  I N9    1 
ATOM   8154  C  C8    . DG  I 5 102 ? 5.948   -31.496 23.101 1.00 122.77 ? 29  DG  I C8    1 
ATOM   8155  N  N7    . DG  I 5 102 ? 6.099   -32.667 22.548 1.00 122.72 ? 29  DG  I N7    1 
ATOM   8156  C  C5    . DG  I 5 102 ? 7.257   -32.535 21.789 1.00 122.50 ? 29  DG  I C5    1 
ATOM   8157  C  C6    . DG  I 5 102 ? 7.920   -33.478 20.962 1.00 122.34 ? 29  DG  I C6    1 
ATOM   8158  O  O6    . DG  I 5 102 ? 7.603   -34.655 20.728 1.00 122.24 ? 29  DG  I O6    1 
ATOM   8159  N  N1    . DG  I 5 102 ? 9.066   -32.937 20.371 1.00 122.48 ? 29  DG  I N1    1 
ATOM   8160  C  C2    . DG  I 5 102 ? 9.515   -31.648 20.553 1.00 122.23 ? 29  DG  I C2    1 
ATOM   8161  N  N2    . DG  I 5 102 ? 10.639  -31.311 19.898 1.00 122.22 ? 29  DG  I N2    1 
ATOM   8162  N  N3    . DG  I 5 102 ? 8.900   -30.757 21.325 1.00 122.22 ? 29  DG  I N3    1 
ATOM   8163  C  C4    . DG  I 5 102 ? 7.782   -31.264 21.912 1.00 122.45 ? 29  DG  I C4    1 
ATOM   8164  P  P     . DT  I 5 103 ? 6.154   -24.971 22.489 1.00 131.23 ? 30  DT  I P     1 
ATOM   8165  O  OP1   . DT  I 5 103 ? 6.422   -23.828 23.397 1.00 130.88 ? 30  DT  I OP1   1 
ATOM   8166  O  OP2   . DT  I 5 103 ? 4.756   -25.368 22.177 1.00 130.82 ? 30  DT  I OP2   1 
ATOM   8167  O  "O5'" . DT  I 5 103 ? 6.862   -24.687 21.084 1.00 133.46 ? 30  DT  I "O5'" 1 
ATOM   8168  C  "C5'" . DT  I 5 103 ? 8.281   -24.648 20.959 1.00 137.51 ? 30  DT  I "C5'" 1 
ATOM   8169  C  "C4'" . DT  I 5 103 ? 8.683   -25.380 19.691 1.00 140.50 ? 30  DT  I "C4'" 1 
ATOM   8170  O  "O4'" . DT  I 5 103 ? 8.388   -26.794 19.849 1.00 140.92 ? 30  DT  I "O4'" 1 
ATOM   8171  C  "C3'" . DT  I 5 103 ? 7.942   -24.929 18.427 1.00 142.64 ? 30  DT  I "C3'" 1 
ATOM   8172  O  "O3'" . DT  I 5 103 ? 8.879   -24.626 17.377 1.00 145.69 ? 30  DT  I "O3'" 1 
ATOM   8173  C  "C2'" . DT  I 5 103 ? 7.060   -26.133 18.084 1.00 142.28 ? 30  DT  I "C2'" 1 
ATOM   8174  C  "C1'" . DT  I 5 103 ? 7.938   -27.269 18.597 1.00 141.69 ? 30  DT  I "C1'" 1 
ATOM   8175  N  N1    . DT  I 5 103 ? 7.262   -28.609 18.734 1.00 141.80 ? 30  DT  I N1    1 
ATOM   8176  C  C2    . DT  I 5 103 ? 7.844   -29.735 18.162 1.00 141.78 ? 30  DT  I C2    1 
ATOM   8177  O  O2    . DT  I 5 103 ? 8.893   -29.731 17.539 1.00 141.73 ? 30  DT  I O2    1 
ATOM   8178  N  N3    . DT  I 5 103 ? 7.144   -30.904 18.346 1.00 141.78 ? 30  DT  I N3    1 
ATOM   8179  C  C4    . DT  I 5 103 ? 5.948   -31.065 19.027 1.00 141.74 ? 30  DT  I C4    1 
ATOM   8180  O  O4    . DT  I 5 103 ? 5.412   -32.167 19.128 1.00 141.25 ? 30  DT  I O4    1 
ATOM   8181  C  C5    . DT  I 5 103 ? 5.391   -29.853 19.600 1.00 141.94 ? 30  DT  I C5    1 
ATOM   8182  C  C7    . DT  I 5 103 ? 4.096   -29.884 20.365 1.00 141.95 ? 30  DT  I C7    1 
ATOM   8183  C  C6    . DT  I 5 103 ? 6.065   -28.702 19.427 1.00 141.94 ? 30  DT  I C6    1 
ATOM   8184  P  P     . DT  I 5 104 ? 8.500   -23.753 16.076 1.00 147.83 ? 31  DT  I P     1 
ATOM   8185  O  OP1   . DT  I 5 104 ? 9.352   -22.542 16.135 1.00 147.91 ? 31  DT  I OP1   1 
ATOM   8186  O  OP2   . DT  I 5 104 ? 7.024   -23.622 15.992 1.00 147.52 ? 31  DT  I OP2   1 
ATOM   8187  O  "O5'" . DT  I 5 104 ? 8.976   -24.655 14.831 1.00 149.21 ? 31  DT  I "O5'" 1 
ATOM   8188  C  "C5'" . DT  I 5 104 ? 8.800   -26.076 14.852 1.00 151.30 ? 31  DT  I "C5'" 1 
ATOM   8189  C  "C4'" . DT  I 5 104 ? 8.840   -26.756 13.483 1.00 152.88 ? 31  DT  I "C4'" 1 
ATOM   8190  O  "O4'" . DT  I 5 104 ? 8.331   -28.108 13.640 1.00 153.30 ? 31  DT  I "O4'" 1 
ATOM   8191  C  "C3'" . DT  I 5 104 ? 7.992   -26.172 12.353 1.00 153.82 ? 31  DT  I "C3'" 1 
ATOM   8192  O  "O3'" . DT  I 5 104 ? 8.505   -26.590 11.076 1.00 154.85 ? 31  DT  I "O3'" 1 
ATOM   8193  C  "C2'" . DT  I 5 104 ? 6.630   -26.799 12.638 1.00 154.03 ? 31  DT  I "C2'" 1 
ATOM   8194  C  "C1'" . DT  I 5 104 ? 7.016   -28.197 13.123 1.00 154.01 ? 31  DT  I "C1'" 1 
ATOM   8195  N  N1    . DT  I 5 104 ? 6.124   -28.761 14.190 1.00 154.55 ? 31  DT  I N1    1 
ATOM   8196  C  C2    . DT  I 5 104 ? 6.071   -30.132 14.374 1.00 154.84 ? 31  DT  I C2    1 
ATOM   8197  O  O2    . DT  I 5 104 ? 6.710   -30.938 13.718 1.00 155.09 ? 31  DT  I O2    1 
ATOM   8198  N  N3    . DT  I 5 104 ? 5.224   -30.539 15.376 1.00 155.01 ? 31  DT  I N3    1 
ATOM   8199  C  C4    . DT  I 5 104 ? 4.446   -29.734 16.192 1.00 155.02 ? 31  DT  I C4    1 
ATOM   8200  O  O4    . DT  I 5 104 ? 3.719   -30.209 17.056 1.00 155.41 ? 31  DT  I O4    1 
ATOM   8201  C  C5    . DT  I 5 104 ? 4.545   -28.312 15.953 1.00 154.92 ? 31  DT  I C5    1 
ATOM   8202  C  C7    . DT  I 5 104 ? 3.749   -27.335 16.773 1.00 154.85 ? 31  DT  I C7    1 
ATOM   8203  C  C6    . DT  I 5 104 ? 5.369   -27.903 14.977 1.00 154.79 ? 31  DT  I C6    1 
ATOM   8204  P  P     . DT  I 5 105 ? 8.029   -25.916 9.695  1.00 155.64 ? 32  DT  I P     1 
ATOM   8205  O  OP1   . DT  I 5 105 ? 8.659   -24.580 9.630  1.00 155.54 ? 32  DT  I OP1   1 
ATOM   8206  O  OP2   . DT  I 5 105 ? 6.558   -26.039 9.571  1.00 155.64 ? 32  DT  I OP2   1 
ATOM   8207  O  "O5'" . DT  I 5 105 ? 8.670   -26.853 8.562  1.00 156.33 ? 32  DT  I "O5'" 1 
ATOM   8208  C  "C5'" . DT  I 5 105 ? 8.918   -28.244 8.791  1.00 157.66 ? 32  DT  I "C5'" 1 
ATOM   8209  C  "C4'" . DT  I 5 105 ? 7.753   -29.157 8.412  1.00 158.65 ? 32  DT  I "C4'" 1 
ATOM   8210  O  "O4'" . DT  I 5 105 ? 6.861   -29.349 9.544  1.00 158.97 ? 32  DT  I "O4'" 1 
ATOM   8211  C  "C3'" . DT  I 5 105 ? 6.853   -28.755 7.234  1.00 158.98 ? 32  DT  I "C3'" 1 
ATOM   8212  O  "O3'" . DT  I 5 105 ? 6.998   -29.708 6.169  1.00 159.38 ? 32  DT  I "O3'" 1 
ATOM   8213  C  "C2'" . DT  I 5 105 ? 5.442   -28.783 7.829  1.00 159.15 ? 32  DT  I "C2'" 1 
ATOM   8214  C  "C1'" . DT  I 5 105 ? 5.634   -29.760 8.984  1.00 159.26 ? 32  DT  I "C1'" 1 
ATOM   8215  N  N1    . DT  I 5 105 ? 4.545   -29.796 10.027 1.00 159.47 ? 32  DT  I N1    1 
ATOM   8216  C  C2    . DT  I 5 105 ? 3.929   -31.004 10.330 1.00 159.52 ? 32  DT  I C2    1 
ATOM   8217  O  O2    . DT  I 5 105 ? 4.204   -32.070 9.802  1.00 159.20 ? 32  DT  I O2    1 
ATOM   8218  N  N3    . DT  I 5 105 ? 2.953   -30.923 11.295 1.00 159.78 ? 32  DT  I N3    1 
ATOM   8219  C  C4    . DT  I 5 105 ? 2.536   -29.790 11.976 1.00 159.93 ? 32  DT  I C4    1 
ATOM   8220  O  O4    . DT  I 5 105 ? 1.648   -29.838 12.824 1.00 160.11 ? 32  DT  I O4    1 
ATOM   8221  C  C5    . DT  I 5 105 ? 3.218   -28.564 11.614 1.00 159.82 ? 32  DT  I C5    1 
ATOM   8222  C  C7    . DT  I 5 105 ? 2.863   -27.262 12.274 1.00 159.73 ? 32  DT  I C7    1 
ATOM   8223  C  C6    . DT  I 5 105 ? 4.174   -28.627 10.672 1.00 159.68 ? 32  DT  I C6    1 
ATOM   8224  P  P     . DC  I 5 106 ? 6.399   -29.493 4.691  1.00 159.85 ? 33  DC  I P     1 
ATOM   8225  O  OP1   . DC  I 5 106 ? 7.456   -29.871 3.722  1.00 159.86 ? 33  DC  I OP1   1 
ATOM   8226  O  OP2   . DC  I 5 106 ? 5.814   -28.133 4.608  1.00 159.71 ? 33  DC  I OP2   1 
ATOM   8227  O  "O5'" . DC  I 5 106 ? 5.199   -30.566 4.629  1.00 160.02 ? 33  DC  I "O5'" 1 
ATOM   8228  C  "C5'" . DC  I 5 106 ? 5.327   -31.820 3.918  1.00 160.06 ? 33  DC  I "C5'" 1 
ATOM   8229  C  "C4'" . DC  I 5 106 ? 4.559   -32.962 4.587  1.00 159.97 ? 33  DC  I "C4'" 1 
ATOM   8230  O  "O4'" . DC  I 5 106 ? 4.351   -32.694 5.998  1.00 160.21 ? 33  DC  I "O4'" 1 
ATOM   8231  C  "C3'" . DC  I 5 106 ? 3.156   -33.222 4.034  1.00 159.65 ? 33  DC  I "C3'" 1 
ATOM   8232  O  "O3'" . DC  I 5 106 ? 3.257   -34.081 2.889  1.00 158.87 ? 33  DC  I "O3'" 1 
ATOM   8233  C  "C2'" . DC  I 5 106 ? 2.475   -33.940 5.204  1.00 160.00 ? 33  DC  I "C2'" 1 
ATOM   8234  C  "C1'" . DC  I 5 106 ? 3.180   -33.369 6.438  1.00 160.45 ? 33  DC  I "C1'" 1 
ATOM   8235  N  N1    . DC  I 5 106 ? 2.316   -32.444 7.267  1.00 160.98 ? 33  DC  I N1    1 
ATOM   8236  C  C2    . DC  I 5 106 ? 1.396   -32.976 8.197  1.00 161.17 ? 33  DC  I C2    1 
ATOM   8237  O  O2    . DC  I 5 106 ? 1.294   -34.207 8.337  1.00 161.28 ? 33  DC  I O2    1 
ATOM   8238  N  N3    . DC  I 5 106 ? 0.633   -32.113 8.929  1.00 161.07 ? 33  DC  I N3    1 
ATOM   8239  C  C4    . DC  I 5 106 ? 0.756   -30.788 8.767  1.00 161.08 ? 33  DC  I C4    1 
ATOM   8240  N  N4    . DC  I 5 106 ? -0.018  -29.987 9.510  1.00 161.09 ? 33  DC  I N4    1 
ATOM   8241  C  C5    . DC  I 5 106 ? 1.676   -30.227 7.830  1.00 161.06 ? 33  DC  I C5    1 
ATOM   8242  C  C6    . DC  I 5 106 ? 2.425   -31.083 7.113  1.00 161.07 ? 33  DC  I C6    1 
ATOM   8243  P  P     . DC  I 5 107 ? 1.964   -34.539 2.050  1.00 158.42 ? 34  DC  I P     1 
ATOM   8244  O  OP1   . DC  I 5 107 ? 2.418   -34.912 0.689  1.00 158.45 ? 34  DC  I OP1   1 
ATOM   8245  O  OP2   . DC  I 5 107 ? 0.907   -33.509 2.205  1.00 158.50 ? 34  DC  I OP2   1 
ATOM   8246  O  "O5'" . DC  I 5 107 ? 1.502   -35.868 2.820  1.00 156.77 ? 34  DC  I "O5'" 1 
ATOM   8247  C  "C5'" . DC  I 5 107 ? 0.354   -36.594 2.386  1.00 154.16 ? 34  DC  I "C5'" 1 
ATOM   8248  C  "C4'" . DC  I 5 107 ? -0.854  -36.378 3.287  1.00 152.11 ? 34  DC  I "C4'" 1 
ATOM   8249  O  "O4'" . DC  I 5 107 ? -0.672  -35.274 4.217  1.00 151.84 ? 34  DC  I "O4'" 1 
ATOM   8250  C  "C3'" . DC  I 5 107 ? -2.141  -36.070 2.526  1.00 150.76 ? 34  DC  I "C3'" 1 
ATOM   8251  O  "O3'" . DC  I 5 107 ? -3.117  -37.040 2.858  1.00 148.70 ? 34  DC  I "O3'" 1 
ATOM   8252  C  "C2'" . DC  I 5 107 ? -2.560  -34.692 3.029  1.00 151.15 ? 34  DC  I "C2'" 1 
ATOM   8253  C  "C1'" . DC  I 5 107 ? -1.947  -34.704 4.424  1.00 151.39 ? 34  DC  I "C1'" 1 
ATOM   8254  N  N1    . DC  I 5 107 ? -1.854  -33.358 5.094  1.00 151.32 ? 34  DC  I N1    1 
ATOM   8255  C  C2    . DC  I 5 107 ? -2.413  -33.178 6.374  1.00 151.17 ? 34  DC  I C2    1 
ATOM   8256  O  O2    . DC  I 5 107 ? -2.970  -34.128 6.942  1.00 150.90 ? 34  DC  I O2    1 
ATOM   8257  N  N3    . DC  I 5 107 ? -2.323  -31.952 6.963  1.00 151.12 ? 34  DC  I N3    1 
ATOM   8258  C  C4    . DC  I 5 107 ? -1.716  -30.940 6.331  1.00 151.04 ? 34  DC  I C4    1 
ATOM   8259  N  N4    . DC  I 5 107 ? -1.654  -29.756 6.951  1.00 150.75 ? 34  DC  I N4    1 
ATOM   8260  C  C5    . DC  I 5 107 ? -1.146  -31.101 5.031  1.00 151.15 ? 34  DC  I C5    1 
ATOM   8261  C  C6    . DC  I 5 107 ? -1.237  -32.310 4.459  1.00 151.27 ? 34  DC  I C6    1 
ATOM   8262  P  P     . DA  I 5 108 ? -3.350  -38.327 1.939  1.00 146.89 ? 35  DA  I P     1 
ATOM   8263  O  OP1   . DA  I 5 108 ? -2.214  -38.431 0.995  1.00 147.07 ? 35  DA  I OP1   1 
ATOM   8264  O  OP2   . DA  I 5 108 ? -4.735  -38.247 1.424  1.00 146.77 ? 35  DA  I OP2   1 
ATOM   8265  O  "O5'" . DA  I 5 108 ? -3.280  -39.558 2.966  1.00 145.11 ? 35  DA  I "O5'" 1 
ATOM   8266  C  "C5'" . DA  I 5 108 ? -3.090  -39.382 4.378  1.00 142.10 ? 35  DA  I "C5'" 1 
ATOM   8267  C  "C4'" . DA  I 5 108 ? -4.386  -39.445 5.187  1.00 139.56 ? 35  DA  I "C4'" 1 
ATOM   8268  O  "O4'" . DA  I 5 108 ? -4.728  -38.119 5.662  1.00 139.02 ? 35  DA  I "O4'" 1 
ATOM   8269  C  "C3'" . DA  I 5 108 ? -5.636  -39.996 4.500  1.00 137.94 ? 35  DA  I "C3'" 1 
ATOM   8270  O  "O3'" . DA  I 5 108 ? -6.258  -40.952 5.369  1.00 135.40 ? 35  DA  I "O3'" 1 
ATOM   8271  C  "C2'" . DA  I 5 108 ? -6.489  -38.757 4.218  1.00 138.08 ? 35  DA  I "C2'" 1 
ATOM   8272  C  "C1'" . DA  I 5 108 ? -6.054  -37.786 5.306  1.00 138.79 ? 35  DA  I "C1'" 1 
ATOM   8273  N  N9    . DA  I 5 108 ? -6.033  -36.387 4.889  1.00 139.19 ? 35  DA  I N9    1 
ATOM   8274  C  C8    . DA  I 5 108 ? -5.948  -35.890 3.616  1.00 139.33 ? 35  DA  I C8    1 
ATOM   8275  N  N7    . DA  I 5 108 ? -5.942  -34.579 3.552  1.00 139.33 ? 35  DA  I N7    1 
ATOM   8276  C  C5    . DA  I 5 108 ? -6.025  -34.184 4.876  1.00 139.46 ? 35  DA  I C5    1 
ATOM   8277  C  C6    . DA  I 5 108 ? -6.064  -32.911 5.492  1.00 139.60 ? 35  DA  I C6    1 
ATOM   8278  N  N6    . DA  I 5 108 ? -6.021  -31.758 4.815  1.00 139.58 ? 35  DA  I N6    1 
ATOM   8279  N  N1    . DA  I 5 108 ? -6.151  -32.870 6.841  1.00 139.63 ? 35  DA  I N1    1 
ATOM   8280  C  C2    . DA  I 5 108 ? -6.195  -34.027 7.523  1.00 139.68 ? 35  DA  I C2    1 
ATOM   8281  N  N3    . DA  I 5 108 ? -6.166  -35.278 7.058  1.00 139.40 ? 35  DA  I N3    1 
ATOM   8282  C  C4    . DA  I 5 108 ? -6.080  -35.288 5.714  1.00 139.41 ? 35  DA  I C4    1 
ATOM   8283  P  P     . DA  I 5 109 ? -7.833  -41.266 5.374  1.00 133.84 ? 36  DA  I P     1 
ATOM   8284  O  OP1   . DA  I 5 109 ? -8.020  -42.632 5.921  1.00 133.43 ? 36  DA  I OP1   1 
ATOM   8285  O  OP2   . DA  I 5 109 ? -8.418  -40.905 4.062  1.00 133.52 ? 36  DA  I OP2   1 
ATOM   8286  O  "O5'" . DA  I 5 109 ? -8.366  -40.221 6.453  1.00 131.88 ? 36  DA  I "O5'" 1 
ATOM   8287  C  "C5'" . DA  I 5 109 ? -7.981  -40.350 7.819  1.00 128.22 ? 36  DA  I "C5'" 1 
ATOM   8288  C  "C4'" . DA  I 5 109 ? -8.899  -39.508 8.677  1.00 125.32 ? 36  DA  I "C4'" 1 
ATOM   8289  O  "O4'" . DA  I 5 109 ? -8.814  -38.136 8.223  1.00 124.39 ? 36  DA  I "O4'" 1 
ATOM   8290  C  "C3'" . DA  I 5 109 ? -10.368 -39.919 8.611  1.00 123.73 ? 36  DA  I "C3'" 1 
ATOM   8291  O  "O3'" . DA  I 5 109 ? -10.869 -40.062 9.950  1.00 121.61 ? 36  DA  I "O3'" 1 
ATOM   8292  C  "C2'" . DA  I 5 109 ? -11.024 -38.812 7.780  1.00 123.74 ? 36  DA  I "C2'" 1 
ATOM   8293  C  "C1'" . DA  I 5 109 ? -10.109 -37.620 8.027  1.00 124.05 ? 36  DA  I "C1'" 1 
ATOM   8294  N  N9    . DA  I 5 109 ? -10.032 -36.676 6.920  1.00 124.17 ? 36  DA  I N9    1 
ATOM   8295  C  C8    . DA  I 5 109 ? -10.106 -36.958 5.588  1.00 124.43 ? 36  DA  I C8    1 
ATOM   8296  N  N7    . DA  I 5 109 ? -10.002 -35.901 4.820  1.00 124.69 ? 36  DA  I N7    1 
ATOM   8297  C  C5    . DA  I 5 109 ? -9.844  -34.849 5.707  1.00 124.56 ? 36  DA  I C5    1 
ATOM   8298  C  C6    . DA  I 5 109 ? -9.675  -33.453 5.528  1.00 124.71 ? 36  DA  I C6    1 
ATOM   8299  N  N6    . DA  I 5 109 ? -9.644  -32.858 4.330  1.00 124.41 ? 36  DA  I N6    1 
ATOM   8300  N  N1    . DA  I 5 109 ? -9.546  -32.680 6.632  1.00 124.77 ? 36  DA  I N1    1 
ATOM   8301  C  C2    . DA  I 5 109 ? -9.579  -33.268 7.836  1.00 124.77 ? 36  DA  I C2    1 
ATOM   8302  N  N3    . DA  I 5 109 ? -9.730  -34.564 8.124  1.00 124.90 ? 36  DA  I N3    1 
ATOM   8303  C  C4    . DA  I 5 109 ? -9.859  -35.312 7.010  1.00 124.56 ? 36  DA  I C4    1 
ATOM   8304  P  P     . DA  I 5 110 ? -12.416 -39.915 10.343 1.00 120.11 ? 37  DA  I P     1 
ATOM   8305  O  OP1   . DA  I 5 110 ? -12.570 -40.400 11.732 1.00 119.83 ? 37  DA  I OP1   1 
ATOM   8306  O  OP2   . DA  I 5 110 ? -13.251 -40.490 9.265  1.00 120.16 ? 37  DA  I OP2   1 
ATOM   8307  O  "O5'" . DA  I 5 110 ? -12.632 -38.330 10.327 1.00 118.95 ? 37  DA  I "O5'" 1 
ATOM   8308  C  "C5'" . DA  I 5 110 ? -11.929 -37.485 11.244 1.00 116.80 ? 37  DA  I "C5'" 1 
ATOM   8309  C  "C4'" . DA  I 5 110 ? -12.514 -36.084 11.239 1.00 115.05 ? 37  DA  I "C4'" 1 
ATOM   8310  O  "O4'" . DA  I 5 110 ? -12.159 -35.412 10.005 1.00 114.79 ? 37  DA  I "O4'" 1 
ATOM   8311  C  "C3'" . DA  I 5 110 ? -14.039 -36.018 11.333 1.00 114.15 ? 37  DA  I "C3'" 1 
ATOM   8312  O  "O3'" . DA  I 5 110 ? -14.431 -35.023 12.274 1.00 112.53 ? 37  DA  I "O3'" 1 
ATOM   8313  C  "C2'" . DA  I 5 110 ? -14.457 -35.626 9.922  1.00 114.75 ? 37  DA  I "C2'" 1 
ATOM   8314  C  "C1'" . DA  I 5 110 ? -13.299 -34.719 9.538  1.00 115.17 ? 37  DA  I "C1'" 1 
ATOM   8315  N  N9    . DA  I 5 110 ? -13.206 -34.477 8.097  1.00 115.54 ? 37  DA  I N9    1 
ATOM   8316  C  C8    . DA  I 5 110 ? -13.342 -35.403 7.101  1.00 115.65 ? 37  DA  I C8    1 
ATOM   8317  N  N7    . DA  I 5 110 ? -13.213 -34.906 5.897  1.00 116.01 ? 37  DA  I N7    1 
ATOM   8318  C  C5    . DA  I 5 110 ? -12.978 -33.559 6.109  1.00 116.15 ? 37  DA  I C5    1 
ATOM   8319  C  C6    . DA  I 5 110 ? -12.753 -32.473 5.229  1.00 116.29 ? 37  DA  I C6    1 
ATOM   8320  N  N6    . DA  I 5 110 ? -12.725 -32.599 3.900  1.00 116.45 ? 37  DA  I N6    1 
ATOM   8321  N  N1    . DA  I 5 110 ? -12.546 -31.247 5.761  1.00 116.19 ? 37  DA  I N1    1 
ATOM   8322  C  C2    . DA  I 5 110 ? -12.562 -31.120 7.093  1.00 116.14 ? 37  DA  I C2    1 
ATOM   8323  N  N3    . DA  I 5 110 ? -12.768 -32.065 8.016  1.00 116.21 ? 37  DA  I N3    1 
ATOM   8324  C  C4    . DA  I 5 110 ? -12.972 -33.275 7.461  1.00 115.90 ? 37  DA  I C4    1 
ATOM   8325  P  P     . DT  I 5 111 ? -15.960 -34.851 12.715 1.00 110.84 ? 38  DT  I P     1 
ATOM   8326  O  OP1   . DT  I 5 111 ? -16.066 -35.303 14.119 1.00 110.81 ? 38  DT  I OP1   1 
ATOM   8327  O  OP2   . DT  I 5 111 ? -16.831 -35.446 11.675 1.00 109.98 ? 38  DT  I OP2   1 
ATOM   8328  O  "O5'" . DT  I 5 111 ? -16.186 -33.268 12.659 1.00 109.64 ? 38  DT  I "O5'" 1 
ATOM   8329  C  "C5'" . DT  I 5 111 ? -15.142 -32.329 12.900 1.00 107.44 ? 38  DT  I "C5'" 1 
ATOM   8330  C  "C4'" . DT  I 5 111 ? -15.469 -30.975 12.281 1.00 106.31 ? 38  DT  I "C4'" 1 
ATOM   8331  O  "O4'" . DT  I 5 111 ? -15.088 -30.985 10.881 1.00 106.24 ? 38  DT  I "O4'" 1 
ATOM   8332  C  "C3'" . DT  I 5 111 ? -16.935 -30.540 12.312 1.00 105.49 ? 38  DT  I "C3'" 1 
ATOM   8333  O  "O3'" . DT  I 5 111 ? -17.036 -29.119 12.516 1.00 104.41 ? 38  DT  I "O3'" 1 
ATOM   8334  C  "C2'" . DT  I 5 111 ? -17.426 -30.957 10.930 1.00 105.75 ? 38  DT  I "C2'" 1 
ATOM   8335  C  "C1'" . DT  I 5 111 ? -16.200 -30.633 10.084 1.00 106.33 ? 38  DT  I "C1'" 1 
ATOM   8336  N  N1    . DT  I 5 111 ? -16.171 -31.346 8.750  1.00 106.94 ? 38  DT  I N1    1 
ATOM   8337  C  C2    . DT  I 5 111 ? -15.786 -30.653 7.610  1.00 106.46 ? 38  DT  I C2    1 
ATOM   8338  O  O2    . DT  I 5 111 ? -15.449 -29.483 7.597  1.00 105.86 ? 38  DT  I O2    1 
ATOM   8339  N  N3    . DT  I 5 111 ? -15.808 -31.394 6.457  1.00 106.85 ? 38  DT  I N3    1 
ATOM   8340  C  C4    . DT  I 5 111 ? -16.170 -32.724 6.322  1.00 107.32 ? 38  DT  I C4    1 
ATOM   8341  O  O4    . DT  I 5 111 ? -16.144 -33.280 5.229  1.00 107.01 ? 38  DT  I O4    1 
ATOM   8342  C  C5    . DT  I 5 111 ? -16.562 -33.397 7.545  1.00 107.44 ? 38  DT  I C5    1 
ATOM   8343  C  C7    . DT  I 5 111 ? -16.981 -34.842 7.540  1.00 107.07 ? 38  DT  I C7    1 
ATOM   8344  C  C6    . DT  I 5 111 ? -16.545 -32.682 8.681  1.00 107.19 ? 38  DT  I C6    1 
ATOM   8345  P  P     . DA  I 5 112 ? -18.438 -28.332 12.472 1.00 103.21 ? 39  DA  I P     1 
ATOM   8346  O  OP1   . DA  I 5 112 ? -18.580 -27.559 13.726 1.00 102.67 ? 39  DA  I OP1   1 
ATOM   8347  O  OP2   . DA  I 5 112 ? -19.498 -29.277 12.058 1.00 102.76 ? 39  DA  I OP2   1 
ATOM   8348  O  "O5'" . DA  I 5 112 ? -18.243 -27.309 11.269 1.00 103.78 ? 39  DA  I "O5'" 1 
ATOM   8349  C  "C5'" . DA  I 5 112 ? -17.199 -26.346 11.314 1.00 106.12 ? 39  DA  I "C5'" 1 
ATOM   8350  C  "C4'" . DA  I 5 112 ? -17.135 -25.564 10.013 1.00 107.65 ? 39  DA  I "C4'" 1 
ATOM   8351  O  "O4'" . DA  I 5 112 ? -16.853 -26.472 8.912  1.00 108.12 ? 39  DA  I "O4'" 1 
ATOM   8352  C  "C3'" . DA  I 5 112 ? -18.416 -24.808 9.666  1.00 108.46 ? 39  DA  I "C3'" 1 
ATOM   8353  O  "O3'" . DA  I 5 112 ? -18.113 -23.478 9.249  1.00 109.69 ? 39  DA  I "O3'" 1 
ATOM   8354  C  "C2'" . DA  I 5 112 ? -19.045 -25.640 8.548  1.00 108.59 ? 39  DA  I "C2'" 1 
ATOM   8355  C  "C1'" . DA  I 5 112 ? -17.863 -26.377 7.926  1.00 108.59 ? 39  DA  I "C1'" 1 
ATOM   8356  N  N9    . DA  I 5 112 ? -18.233 -27.717 7.471  1.00 108.99 ? 39  DA  I N9    1 
ATOM   8357  C  C8    . DA  I 5 112 ? -18.568 -28.796 8.244  1.00 109.06 ? 39  DA  I C8    1 
ATOM   8358  N  N7    . DA  I 5 112 ? -18.867 -29.874 7.559  1.00 109.32 ? 39  DA  I N7    1 
ATOM   8359  C  C5    . DA  I 5 112 ? -18.723 -29.473 6.239  1.00 109.71 ? 39  DA  I C5    1 
ATOM   8360  C  C6    . DA  I 5 112 ? -18.893 -30.147 5.009  1.00 109.80 ? 39  DA  I C6    1 
ATOM   8361  N  N6    . DA  I 5 112 ? -19.261 -31.428 4.918  1.00 110.17 ? 39  DA  I N6    1 
ATOM   8362  N  N1    . DA  I 5 112 ? -18.673 -29.452 3.869  1.00 110.04 ? 39  DA  I N1    1 
ATOM   8363  C  C2    . DA  I 5 112 ? -18.301 -28.166 3.948  1.00 109.86 ? 39  DA  I C2    1 
ATOM   8364  N  N3    . DA  I 5 112 ? -18.107 -27.427 5.041  1.00 109.76 ? 39  DA  I N3    1 
ATOM   8365  C  C4    . DA  I 5 112 ? -18.336 -28.143 6.165  1.00 109.65 ? 39  DA  I C4    1 
ATOM   8366  P  P     . DC  I 5 113 ? -19.270 -22.398 8.996  1.00 111.09 ? 40  DC  I P     1 
ATOM   8367  O  OP1   . DC  I 5 113 ? -19.123 -21.330 10.009 1.00 111.20 ? 40  DC  I OP1   1 
ATOM   8368  O  OP2   . DC  I 5 113 ? -20.564 -23.108 8.882  1.00 111.17 ? 40  DC  I OP2   1 
ATOM   8369  O  "O5'" . DC  I 5 113 ? -18.903 -21.789 7.553  1.00 113.34 ? 40  DC  I "O5'" 1 
ATOM   8370  C  "C5'" . DC  I 5 113 ? -18.434 -22.612 6.456  1.00 116.04 ? 40  DC  I "C5'" 1 
ATOM   8371  C  "C4'" . DC  I 5 113 ? -19.324 -22.609 5.208  1.00 117.59 ? 40  DC  I "C4'" 1 
ATOM   8372  O  "O4'" . DC  I 5 113 ? -19.542 -23.980 4.765  1.00 117.60 ? 40  DC  I "O4'" 1 
ATOM   8373  C  "C3'" . DC  I 5 113 ? -20.723 -21.999 5.336  1.00 118.78 ? 40  DC  I "C3'" 1 
ATOM   8374  O  "O3'" . DC  I 5 113 ? -21.099 -21.329 4.122  1.00 120.51 ? 40  DC  I "O3'" 1 
ATOM   8375  C  "C2'" . DC  I 5 113 ? -21.583 -23.231 5.595  1.00 118.29 ? 40  DC  I "C2'" 1 
ATOM   8376  C  "C1'" . DC  I 5 113 ? -20.929 -24.199 4.618  1.00 117.86 ? 40  DC  I "C1'" 1 
ATOM   8377  N  N1    . DC  I 5 113 ? -21.263 -25.635 4.862  1.00 118.02 ? 40  DC  I N1    1 
ATOM   8378  C  C2    . DC  I 5 113 ? -21.213 -26.551 3.799  1.00 117.90 ? 40  DC  I C2    1 
ATOM   8379  O  O2    . DC  I 5 113 ? -20.877 -26.159 2.673  1.00 117.72 ? 40  DC  I O2    1 
ATOM   8380  N  N3    . DC  I 5 113 ? -21.531 -27.853 4.039  1.00 117.82 ? 40  DC  I N3    1 
ATOM   8381  C  C4    . DC  I 5 113 ? -21.888 -28.242 5.269  1.00 117.99 ? 40  DC  I C4    1 
ATOM   8382  N  N4    . DC  I 5 113 ? -22.192 -29.528 5.465  1.00 118.01 ? 40  DC  I N4    1 
ATOM   8383  C  C5    . DC  I 5 113 ? -21.951 -27.326 6.363  1.00 118.14 ? 40  DC  I C5    1 
ATOM   8384  C  C6    . DC  I 5 113 ? -21.637 -26.048 6.115  1.00 118.12 ? 40  DC  I C6    1 
ATOM   8385  P  P     . DA  I 5 114 ? -22.527 -20.601 3.978  1.00 121.80 ? 41  DA  I P     1 
ATOM   8386  O  OP1   . DA  I 5 114 ? -22.462 -19.347 4.762  1.00 121.42 ? 41  DA  I OP1   1 
ATOM   8387  O  OP2   . DA  I 5 114 ? -23.599 -21.582 4.276  1.00 121.33 ? 41  DA  I OP2   1 
ATOM   8388  O  "O5'" . DA  I 5 114 ? -22.603 -20.233 2.418  1.00 122.64 ? 41  DA  I "O5'" 1 
ATOM   8389  C  "C5'" . DA  I 5 114 ? -22.009 -21.057 1.418  1.00 124.39 ? 41  DA  I "C5'" 1 
ATOM   8390  C  "C4'" . DA  I 5 114 ? -23.040 -21.908 0.694  1.00 126.05 ? 41  DA  I "C4'" 1 
ATOM   8391  O  "O4'" . DA  I 5 114 ? -23.022 -23.243 1.261  1.00 126.37 ? 41  DA  I "O4'" 1 
ATOM   8392  C  "C3'" . DA  I 5 114 ? -24.500 -21.443 0.747  1.00 127.18 ? 41  DA  I "C3'" 1 
ATOM   8393  O  "O3'" . DA  I 5 114 ? -25.065 -21.481 -0.579 1.00 128.81 ? 41  DA  I "O3'" 1 
ATOM   8394  C  "C2'" . DA  I 5 114 ? -25.146 -22.456 1.694  1.00 126.92 ? 41  DA  I "C2'" 1 
ATOM   8395  C  "C1'" . DA  I 5 114 ? -24.358 -23.696 1.299  1.00 127.15 ? 41  DA  I "C1'" 1 
ATOM   8396  N  N9    . DA  I 5 114 ? -24.473 -24.854 2.186  1.00 127.70 ? 41  DA  I N9    1 
ATOM   8397  C  C8    . DA  I 5 114 ? -24.366 -24.885 3.551  1.00 127.69 ? 41  DA  I C8    1 
ATOM   8398  N  N7    . DA  I 5 114 ? -24.515 -26.085 4.064  1.00 127.84 ? 41  DA  I N7    1 
ATOM   8399  C  C5    . DA  I 5 114 ? -24.732 -26.899 2.962  1.00 128.00 ? 41  DA  I C5    1 
ATOM   8400  C  C6    . DA  I 5 114 ? -24.967 -28.287 2.822  1.00 128.13 ? 41  DA  I C6    1 
ATOM   8401  N  N6    . DA  I 5 114 ? -25.015 -29.130 3.858  1.00 128.13 ? 41  DA  I N6    1 
ATOM   8402  N  N1    . DA  I 5 114 ? -25.150 -28.782 1.572  1.00 128.11 ? 41  DA  I N1    1 
ATOM   8403  C  C2    . DA  I 5 114 ? -25.100 -27.943 0.528  1.00 127.83 ? 41  DA  I C2    1 
ATOM   8404  N  N3    . DA  I 5 114 ? -24.891 -26.624 0.537  1.00 127.75 ? 41  DA  I N3    1 
ATOM   8405  C  C4    . DA  I 5 114 ? -24.711 -26.156 1.792  1.00 127.92 ? 41  DA  I C4    1 
ATOM   8406  P  P     . DC  I 5 115 ? -26.587 -21.071 -0.911 1.00 129.96 ? 42  DC  I P     1 
ATOM   8407  O  OP1   . DC  I 5 115 ? -26.594 -19.616 -1.169 1.00 129.62 ? 42  DC  I OP1   1 
ATOM   8408  O  OP2   . DC  I 5 115 ? -27.497 -21.633 0.110  1.00 129.76 ? 42  DC  I OP2   1 
ATOM   8409  O  "O5'" . DC  I 5 115 ? -26.893 -21.860 -2.273 1.00 131.28 ? 42  DC  I "O5'" 1 
ATOM   8410  C  "C5'" . DC  I 5 115 ? -26.365 -23.171 -2.516 1.00 133.23 ? 42  DC  I "C5'" 1 
ATOM   8411  C  "C4'" . DC  I 5 115 ? -27.413 -24.283 -2.529 1.00 134.76 ? 42  DC  I "C4'" 1 
ATOM   8412  O  "O4'" . DC  I 5 115 ? -27.172 -25.173 -1.402 1.00 135.12 ? 42  DC  I "O4'" 1 
ATOM   8413  C  "C3'" . DC  I 5 115 ? -28.892 -23.882 -2.449 1.00 135.77 ? 42  DC  I "C3'" 1 
ATOM   8414  O  "O3'" . DC  I 5 115 ? -29.668 -24.666 -3.371 1.00 137.33 ? 42  DC  I "O3'" 1 
ATOM   8415  C  "C2'" . DC  I 5 115 ? -29.242 -24.202 -0.999 1.00 135.64 ? 42  DC  I "C2'" 1 
ATOM   8416  C  "C1'" . DC  I 5 115 ? -28.411 -25.464 -0.784 1.00 135.37 ? 42  DC  I "C1'" 1 
ATOM   8417  N  N1    . DC  I 5 115 ? -28.230 -25.872 0.659  1.00 135.22 ? 42  DC  I N1    1 
ATOM   8418  C  C2    . DC  I 5 115 ? -28.367 -27.225 1.040  1.00 135.01 ? 42  DC  I C2    1 
ATOM   8419  O  O2    . DC  I 5 115 ? -28.624 -28.095 0.193  1.00 134.70 ? 42  DC  I O2    1 
ATOM   8420  N  N3    . DC  I 5 115 ? -28.201 -27.555 2.349  1.00 135.05 ? 42  DC  I N3    1 
ATOM   8421  C  C4    . DC  I 5 115 ? -27.923 -26.609 3.259  1.00 134.81 ? 42  DC  I C4    1 
ATOM   8422  N  N4    . DC  I 5 115 ? -27.767 -26.989 4.530  1.00 134.34 ? 42  DC  I N4    1 
ATOM   8423  C  C5    . DC  I 5 115 ? -27.783 -25.232 2.900  1.00 135.08 ? 42  DC  I C5    1 
ATOM   8424  C  C6    . DC  I 5 115 ? -27.943 -24.915 1.606  1.00 135.21 ? 42  DC  I C6    1 
ATOM   8425  P  P     . DT  I 5 116 ? -31.258 -24.492 -3.555 1.00 138.48 ? 43  DT  I P     1 
ATOM   8426  O  OP1   . DT  I 5 116 ? -31.486 -23.182 -4.202 1.00 138.53 ? 43  DT  I OP1   1 
ATOM   8427  O  OP2   . DT  I 5 116 ? -31.952 -24.821 -2.291 1.00 138.03 ? 43  DT  I OP2   1 
ATOM   8428  O  "O5'" . DT  I 5 116 ? -31.624 -25.663 -4.584 1.00 139.92 ? 43  DT  I "O5'" 1 
ATOM   8429  C  "C5'" . DT  I 5 116 ? -30.968 -26.938 -4.511 1.00 141.56 ? 43  DT  I "C5'" 1 
ATOM   8430  C  "C4'" . DT  I 5 116 ? -31.705 -27.990 -3.679 1.00 142.43 ? 43  DT  I "C4'" 1 
ATOM   8431  O  "O4'" . DT  I 5 116 ? -31.278 -27.950 -2.288 1.00 143.00 ? 43  DT  I "O4'" 1 
ATOM   8432  C  "C3'" . DT  I 5 116 ? -33.241 -27.956 -3.655 1.00 142.50 ? 43  DT  I "C3'" 1 
ATOM   8433  O  "O3'" . DT  I 5 116 ? -33.719 -29.197 -4.205 1.00 142.40 ? 43  DT  I "O3'" 1 
ATOM   8434  C  "C2'" . DT  I 5 116 ? -33.570 -27.812 -2.167 1.00 142.94 ? 43  DT  I "C2'" 1 
ATOM   8435  C  "C1'" . DT  I 5 116 ? -32.352 -28.477 -1.534 1.00 143.43 ? 43  DT  I "C1'" 1 
ATOM   8436  N  N1    . DT  I 5 116 ? -32.184 -28.239 -0.048 1.00 143.90 ? 43  DT  I N1    1 
ATOM   8437  C  C2    . DT  I 5 116 ? -32.273 -29.302 0.848  1.00 143.89 ? 43  DT  I C2    1 
ATOM   8438  O  O2    . DT  I 5 116 ? -32.478 -30.464 0.529  1.00 143.72 ? 43  DT  I O2    1 
ATOM   8439  N  N3    . DT  I 5 116 ? -32.105 -28.952 2.168  1.00 143.93 ? 43  DT  I N3    1 
ATOM   8440  C  C4    . DT  I 5 116 ? -31.867 -27.683 2.678  1.00 144.13 ? 43  DT  I C4    1 
ATOM   8441  O  O4    . DT  I 5 116 ? -31.731 -27.473 3.879  1.00 144.19 ? 43  DT  I O4    1 
ATOM   8442  C  C5    . DT  I 5 116 ? -31.788 -26.624 1.698  1.00 144.26 ? 43  DT  I C5    1 
ATOM   8443  C  C7    . DT  I 5 116 ? -31.534 -25.206 2.124  1.00 144.44 ? 43  DT  I C7    1 
ATOM   8444  C  C6    . DT  I 5 116 ? -31.949 -26.948 0.406  1.00 144.22 ? 43  DT  I C6    1 
ATOM   8445  P  P     . DT  I 5 117 ? -35.238 -29.725 -4.144 1.00 142.11 ? 44  DT  I P     1 
ATOM   8446  O  OP1   . DT  I 5 117 ? -35.494 -30.410 -5.434 1.00 142.29 ? 44  DT  I OP1   1 
ATOM   8447  O  OP2   . DT  I 5 117 ? -36.144 -28.640 -3.696 1.00 142.03 ? 44  DT  I OP2   1 
ATOM   8448  O  "O5'" . DT  I 5 117 ? -35.179 -30.819 -2.981 1.00 141.30 ? 44  DT  I "O5'" 1 
ATOM   8449  C  "C5'" . DT  I 5 117 ? -35.767 -32.106 -3.179 1.00 140.40 ? 44  DT  I "C5'" 1 
ATOM   8450  C  "C4'" . DT  I 5 117 ? -35.901 -32.867 -1.869 1.00 139.62 ? 44  DT  I "C4'" 1 
ATOM   8451  O  "O4'" . DT  I 5 117 ? -35.325 -32.113 -0.766 1.00 139.95 ? 44  DT  I "O4'" 1 
ATOM   8452  C  "C3'" . DT  I 5 117 ? -37.344 -33.179 -1.478 1.00 138.93 ? 44  DT  I "C3'" 1 
ATOM   8453  O  "O3'" . DT  I 5 117 ? -37.433 -34.559 -1.131 1.00 137.27 ? 44  DT  I "O3'" 1 
ATOM   8454  C  "C2'" . DT  I 5 117 ? -37.609 -32.250 -0.294 1.00 139.29 ? 44  DT  I "C2'" 1 
ATOM   8455  C  "C1'" . DT  I 5 117 ? -36.223 -32.115 0.328  1.00 139.76 ? 44  DT  I "C1'" 1 
ATOM   8456  N  N1    . DT  I 5 117 ? -36.059 -30.869 1.164  1.00 139.71 ? 44  DT  I N1    1 
ATOM   8457  C  C2    . DT  I 5 117 ? -35.756 -30.973 2.515  1.00 139.37 ? 44  DT  I C2    1 
ATOM   8458  O  O2    . DT  I 5 117 ? -35.598 -32.025 3.109  1.00 138.90 ? 44  DT  I O2    1 
ATOM   8459  N  N3    . DT  I 5 117 ? -35.641 -29.771 3.169  1.00 139.45 ? 44  DT  I N3    1 
ATOM   8460  C  C4    . DT  I 5 117 ? -35.795 -28.505 2.628  1.00 139.72 ? 44  DT  I C4    1 
ATOM   8461  O  O4    . DT  I 5 117 ? -35.665 -27.498 3.317  1.00 139.92 ? 44  DT  I O4    1 
ATOM   8462  C  C5    . DT  I 5 117 ? -36.115 -28.462 1.215  1.00 139.73 ? 44  DT  I C5    1 
ATOM   8463  C  C7    . DT  I 5 117 ? -36.309 -27.158 0.493  1.00 139.68 ? 44  DT  I C7    1 
ATOM   8464  C  C6    . DT  I 5 117 ? -36.229 -29.629 0.565  1.00 139.68 ? 44  DT  I C6    1 
ATOM   8465  P  P     . DT  I 5 118 ? -38.808 -35.294 -0.742 1.00 136.18 ? 45  DT  I P     1 
ATOM   8466  O  OP1   . DT  I 5 118 ? -39.240 -36.093 -1.911 1.00 136.33 ? 45  DT  I OP1   1 
ATOM   8467  O  OP2   . DT  I 5 118 ? -39.757 -34.332 -0.130 1.00 136.13 ? 45  DT  I OP2   1 
ATOM   8468  O  "O5'" . DT  I 5 118 ? -38.305 -36.288 0.412  1.00 135.30 ? 45  DT  I "O5'" 1 
ATOM   8469  C  "C5'" . DT  I 5 118 ? -37.183 -35.941 1.262  1.00 133.34 ? 45  DT  I "C5'" 1 
ATOM   8470  C  "C4'" . DT  I 5 118 ? -37.563 -35.686 2.720  1.00 131.44 ? 45  DT  I "C4'" 1 
ATOM   8471  O  "O4'" . DT  I 5 118 ? -37.519 -34.263 3.012  1.00 131.30 ? 45  DT  I "O4'" 1 
ATOM   8472  C  "C3'" . DT  I 5 118 ? -38.953 -36.158 3.156  1.00 130.02 ? 45  DT  I "C3'" 1 
ATOM   8473  O  "O3'" . DT  I 5 118 ? -38.829 -37.006 4.289  1.00 127.38 ? 45  DT  I "O3'" 1 
ATOM   8474  C  "C2'" . DT  I 5 118 ? -39.703 -34.865 3.477  1.00 130.54 ? 45  DT  I "C2'" 1 
ATOM   8475  C  "C1'" . DT  I 5 118 ? -38.544 -33.996 3.944  1.00 131.44 ? 45  DT  I "C1'" 1 
ATOM   8476  N  N1    . DT  I 5 118 ? -38.832 -32.527 4.007  1.00 132.18 ? 45  DT  I N1    1 
ATOM   8477  C  C2    . DT  I 5 118 ? -38.583 -31.836 5.184  1.00 132.57 ? 45  DT  I C2    1 
ATOM   8478  O  O2    . DT  I 5 118 ? -38.135 -32.346 6.199  1.00 132.63 ? 45  DT  I O2    1 
ATOM   8479  N  N3    . DT  I 5 118 ? -38.883 -30.496 5.138  1.00 132.82 ? 45  DT  I N3    1 
ATOM   8480  C  C4    . DT  I 5 118 ? -39.395 -29.791 4.062  1.00 132.95 ? 45  DT  I C4    1 
ATOM   8481  O  O4    . DT  I 5 118 ? -39.624 -28.586 4.139  1.00 133.06 ? 45  DT  I O4    1 
ATOM   8482  C  C5    . DT  I 5 118 ? -39.633 -30.573 2.863  1.00 132.99 ? 45  DT  I C5    1 
ATOM   8483  C  C7    . DT  I 5 118 ? -40.185 -29.939 1.619  1.00 133.23 ? 45  DT  I C7    1 
ATOM   8484  C  C6    . DT  I 5 118 ? -39.343 -31.883 2.893  1.00 132.51 ? 45  DT  I C6    1 
ATOM   8485  P  P     . DT  I 5 119 ? -40.085 -37.816 4.855  1.00 125.69 ? 46  DT  I P     1 
ATOM   8486  O  OP1   . DT  I 5 119 ? -39.533 -38.816 5.803  1.00 125.30 ? 46  DT  I OP1   1 
ATOM   8487  O  OP2   . DT  I 5 119 ? -40.922 -38.263 3.721  1.00 125.77 ? 46  DT  I OP2   1 
ATOM   8488  O  "O5'" . DT  I 5 119 ? -40.936 -36.681 5.601  1.00 124.16 ? 46  DT  I "O5'" 1 
ATOM   8489  C  "C5'" . DT  I 5 119 ? -41.415 -36.861 6.926  1.00 122.05 ? 46  DT  I "C5'" 1 
ATOM   8490  C  "C4'" . DT  I 5 119 ? -40.330 -36.592 7.965  1.00 119.91 ? 46  DT  I "C4'" 1 
ATOM   8491  O  "O4'" . DT  I 5 119 ? -39.681 -35.310 7.755  1.00 119.65 ? 46  DT  I "O4'" 1 
ATOM   8492  C  "C3'" . DT  I 5 119 ? -40.850 -36.570 9.389  1.00 118.16 ? 46  DT  I "C3'" 1 
ATOM   8493  O  "O3'" . DT  I 5 119 ? -39.933 -37.245 10.216 1.00 115.43 ? 46  DT  I "O3'" 1 
ATOM   8494  C  "C2'" . DT  I 5 119 ? -40.950 -35.094 9.749  1.00 118.80 ? 46  DT  I "C2'" 1 
ATOM   8495  C  "C1'" . DT  I 5 119 ? -40.068 -34.372 8.741  1.00 119.57 ? 46  DT  I "C1'" 1 
ATOM   8496  N  N1    . DT  I 5 119 ? -40.773 -33.207 8.105  1.00 120.52 ? 46  DT  I N1    1 
ATOM   8497  C  C2    . DT  I 5 119 ? -40.947 -32.028 8.818  1.00 121.07 ? 46  DT  I C2    1 
ATOM   8498  O  O2    . DT  I 5 119 ? -40.558 -31.853 9.961  1.00 121.22 ? 46  DT  I O2    1 
ATOM   8499  N  N3    . DT  I 5 119 ? -41.606 -31.031 8.136  1.00 121.43 ? 46  DT  I N3    1 
ATOM   8500  C  C4    . DT  I 5 119 ? -42.101 -31.084 6.841  1.00 121.73 ? 46  DT  I C4    1 
ATOM   8501  O  O4    . DT  I 5 119 ? -42.678 -30.125 6.328  1.00 121.73 ? 46  DT  I O4    1 
ATOM   8502  C  C5    . DT  I 5 119 ? -41.887 -32.342 6.153  1.00 121.66 ? 46  DT  I C5    1 
ATOM   8503  C  C7    . DT  I 5 119 ? -42.369 -32.549 4.746  1.00 121.97 ? 46  DT  I C7    1 
ATOM   8504  C  C6    . DT  I 5 119 ? -41.247 -33.321 6.809  1.00 121.12 ? 46  DT  I C6    1 
ATOM   8505  P  P     . DG  I 5 120 ? -40.450 -38.107 11.465 1.00 113.69 ? 47  DG  I P     1 
ATOM   8506  O  OP1   . DG  I 5 120 ? -39.655 -39.354 11.474 1.00 113.40 ? 47  DG  I OP1   1 
ATOM   8507  O  OP2   . DG  I 5 120 ? -41.932 -38.164 11.499 1.00 113.62 ? 47  DG  I OP2   1 
ATOM   8508  O  "O5'" . DG  I 5 120 ? -40.008 -37.208 12.705 1.00 112.27 ? 47  DG  I "O5'" 1 
ATOM   8509  C  "C5'" . DG  I 5 120 ? -38.814 -36.427 12.644 1.00 110.13 ? 47  DG  I "C5'" 1 
ATOM   8510  C  "C4'" . DG  I 5 120 ? -38.830 -35.325 13.688 1.00 108.29 ? 47  DG  I "C4'" 1 
ATOM   8511  O  "O4'" . DG  I 5 120 ? -39.622 -34.199 13.229 1.00 107.92 ? 47  DG  I "O4'" 1 
ATOM   8512  C  "C3'" . DG  I 5 120 ? -39.377 -35.687 15.067 1.00 107.06 ? 47  DG  I "C3'" 1 
ATOM   8513  O  "O3'" . DG  I 5 120 ? -38.552 -34.995 15.986 1.00 104.59 ? 47  DG  I "O3'" 1 
ATOM   8514  C  "C2'" . DG  I 5 120 ? -40.823 -35.187 15.047 1.00 107.54 ? 47  DG  I "C2'" 1 
ATOM   8515  C  "C1'" . DG  I 5 120 ? -40.798 -34.066 14.009 1.00 108.29 ? 47  DG  I "C1'" 1 
ATOM   8516  N  N9    . DG  I 5 120 ? -41.923 -34.048 13.071 1.00 109.05 ? 47  DG  I N9    1 
ATOM   8517  C  C8    . DG  I 5 120 ? -42.664 -35.104 12.581 1.00 109.51 ? 47  DG  I C8    1 
ATOM   8518  N  N7    . DG  I 5 120 ? -43.600 -34.750 11.743 1.00 109.26 ? 47  DG  I N7    1 
ATOM   8519  C  C5    . DG  I 5 120 ? -43.468 -33.371 11.669 1.00 109.08 ? 47  DG  I C5    1 
ATOM   8520  C  C6    . DG  I 5 120 ? -44.204 -32.420 10.921 1.00 109.45 ? 47  DG  I C6    1 
ATOM   8521  O  O6    . DG  I 5 120 ? -45.155 -32.631 10.148 1.00 109.47 ? 47  DG  I O6    1 
ATOM   8522  N  N1    . DG  I 5 120 ? -43.742 -31.113 11.145 1.00 109.38 ? 47  DG  I N1    1 
ATOM   8523  C  C2    . DG  I 5 120 ? -42.697 -30.769 11.984 1.00 108.61 ? 47  DG  I C2    1 
ATOM   8524  N  N2    . DG  I 5 120 ? -42.383 -29.472 12.081 1.00 107.01 ? 47  DG  I N2    1 
ATOM   8525  N  N3    . DG  I 5 120 ? -42.004 -31.655 12.685 1.00 108.83 ? 47  DG  I N3    1 
ATOM   8526  C  C4    . DG  I 5 120 ? -42.441 -32.926 12.477 1.00 109.01 ? 47  DG  I C4    1 
ATOM   8527  P  P     . DG  I 5 121 ? -38.836 -34.805 17.545 1.00 101.91 ? 48  DG  I P     1 
ATOM   8528  O  OP1   . DG  I 5 121 ? -37.488 -34.661 18.143 1.00 101.50 ? 48  DG  I OP1   1 
ATOM   8529  O  OP2   . DG  I 5 121 ? -39.785 -35.844 18.022 1.00 102.04 ? 48  DG  I OP2   1 
ATOM   8530  O  "O5'" . DG  I 5 121 ? -39.593 -33.402 17.597 1.00 99.77  ? 48  DG  I "O5'" 1 
ATOM   8531  C  "C5'" . DG  I 5 121 ? -38.850 -32.200 17.556 1.00 97.85  ? 48  DG  I "C5'" 1 
ATOM   8532  C  "C4'" . DG  I 5 121 ? -39.794 -31.023 17.677 1.00 96.73  ? 48  DG  I "C4'" 1 
ATOM   8533  O  "O4'" . DG  I 5 121 ? -40.787 -31.139 16.630 1.00 97.44  ? 48  DG  I "O4'" 1 
ATOM   8534  C  "C3'" . DG  I 5 121 ? -40.560 -30.923 18.996 1.00 95.97  ? 48  DG  I "C3'" 1 
ATOM   8535  O  "O3'" . DG  I 5 121 ? -40.537 -29.570 19.465 1.00 93.88  ? 48  DG  I "O3'" 1 
ATOM   8536  C  "C2'" . DG  I 5 121 ? -41.966 -31.406 18.629 1.00 96.35  ? 48  DG  I "C2'" 1 
ATOM   8537  C  "C1'" . DG  I 5 121 ? -42.083 -30.983 17.169 1.00 97.44  ? 48  DG  I "C1'" 1 
ATOM   8538  N  N9    . DG  I 5 121 ? -43.012 -31.753 16.337 1.00 98.08  ? 48  DG  I N9    1 
ATOM   8539  C  C8    . DG  I 5 121 ? -43.162 -33.118 16.280 1.00 98.59  ? 48  DG  I C8    1 
ATOM   8540  N  N7    . DG  I 5 121 ? -44.066 -33.521 15.430 1.00 98.58  ? 48  DG  I N7    1 
ATOM   8541  C  C5    . DG  I 5 121 ? -44.555 -32.341 14.890 1.00 98.58  ? 48  DG  I C5    1 
ATOM   8542  C  C6    . DG  I 5 121 ? -45.559 -32.136 13.912 1.00 98.54  ? 48  DG  I C6    1 
ATOM   8543  O  O6    . DG  I 5 121 ? -46.230 -32.997 13.321 1.00 98.13  ? 48  DG  I O6    1 
ATOM   8544  N  N1    . DG  I 5 121 ? -45.751 -30.778 13.637 1.00 98.64  ? 48  DG  I N1    1 
ATOM   8545  C  C2    . DG  I 5 121 ? -45.057 -29.745 14.237 1.00 98.81  ? 48  DG  I C2    1 
ATOM   8546  N  N2    . DG  I 5 121 ? -45.366 -28.494 13.856 1.00 98.34  ? 48  DG  I N2    1 
ATOM   8547  N  N3    . DG  I 5 121 ? -44.112 -29.932 15.154 1.00 99.02  ? 48  DG  I N3    1 
ATOM   8548  C  C4    . DG  I 5 121 ? -43.913 -31.246 15.432 1.00 98.44  ? 48  DG  I C4    1 
ATOM   8549  P  P     . DT  I 5 122 ? -40.841 -29.134 20.979 1.00 92.42  ? 49  DT  I P     1 
ATOM   8550  O  OP1   . DT  I 5 122 ? -39.568 -28.597 21.510 1.00 92.33  ? 49  DT  I OP1   1 
ATOM   8551  O  OP2   . DT  I 5 122 ? -41.564 -30.200 21.697 1.00 92.13  ? 49  DT  I OP2   1 
ATOM   8552  O  "O5'" . DT  I 5 122 ? -41.901 -27.948 20.802 1.00 93.77  ? 49  DT  I "O5'" 1 
ATOM   8553  C  "C5'" . DT  I 5 122 ? -41.784 -27.021 19.709 1.00 95.79  ? 49  DT  I "C5'" 1 
ATOM   8554  C  "C4'" . DT  I 5 122 ? -43.123 -26.474 19.225 1.00 96.96  ? 49  DT  I "C4'" 1 
ATOM   8555  O  "O4'" . DT  I 5 122 ? -43.719 -27.408 18.288 1.00 97.25  ? 49  DT  I "O4'" 1 
ATOM   8556  C  "C3'" . DT  I 5 122 ? -44.151 -26.212 20.322 1.00 97.27  ? 49  DT  I "C3'" 1 
ATOM   8557  O  "O3'" . DT  I 5 122 ? -44.251 -24.814 20.560 1.00 97.97  ? 49  DT  I "O3'" 1 
ATOM   8558  C  "C2'" . DT  I 5 122 ? -45.454 -26.806 19.787 1.00 97.72  ? 49  DT  I "C2'" 1 
ATOM   8559  C  "C1'" . DT  I 5 122 ? -45.124 -27.345 18.399 1.00 98.10  ? 49  DT  I "C1'" 1 
ATOM   8560  N  N1    . DT  I 5 122 ? -45.726 -28.703 18.127 1.00 99.20  ? 49  DT  I N1    1 
ATOM   8561  C  C2    . DT  I 5 122 ? -46.709 -28.820 17.158 1.00 99.59  ? 49  DT  I C2    1 
ATOM   8562  O  O2    . DT  I 5 122 ? -47.124 -27.886 16.492 1.00 99.13  ? 49  DT  I O2    1 
ATOM   8563  N  N3    . DT  I 5 122 ? -47.196 -30.097 16.990 1.00 100.56 ? 49  DT  I N3    1 
ATOM   8564  C  C4    . DT  I 5 122 ? -46.819 -31.247 17.673 1.00 101.04 ? 49  DT  I C4    1 
ATOM   8565  O  O4    . DT  I 5 122 ? -47.319 -32.350 17.446 1.00 102.03 ? 49  DT  I O4    1 
ATOM   8566  C  C5    . DT  I 5 122 ? -45.796 -31.059 18.671 1.00 100.49 ? 49  DT  I C5    1 
ATOM   8567  C  C7    . DT  I 5 122 ? -45.318 -32.237 19.474 1.00 100.42 ? 49  DT  I C7    1 
ATOM   8568  C  C6    . DT  I 5 122 ? -45.307 -29.816 18.846 1.00 99.96  ? 49  DT  I C6    1 
ATOM   8569  P  P     . DA  I 5 123 ? -45.272 -24.221 21.640 1.00 99.29  ? 50  DA  I P     1 
ATOM   8570  O  OP1   . DA  I 5 123 ? -44.690 -22.975 22.170 1.00 99.05  ? 50  DA  I OP1   1 
ATOM   8571  O  OP2   . DA  I 5 123 ? -45.688 -25.290 22.570 1.00 99.27  ? 50  DA  I OP2   1 
ATOM   8572  O  "O5'" . DA  I 5 123 ? -46.563 -23.881 20.765 1.00 102.11 ? 50  DA  I "O5'" 1 
ATOM   8573  C  "C5'" . DA  I 5 123 ? -46.547 -22.938 19.693 1.00 106.05 ? 50  DA  I "C5'" 1 
ATOM   8574  C  "C4'" . DA  I 5 123 ? -47.942 -22.817 19.091 1.00 108.96 ? 50  DA  I "C4'" 1 
ATOM   8575  O  "O4'" . DA  I 5 123 ? -48.345 -24.116 18.586 1.00 109.55 ? 50  DA  I "O4'" 1 
ATOM   8576  C  "C3'" . DA  I 5 123 ? -49.040 -22.363 20.056 1.00 110.79 ? 50  DA  I "C3'" 1 
ATOM   8577  O  "O3'" . DA  I 5 123 ? -49.904 -21.394 19.453 1.00 113.70 ? 50  DA  I "O3'" 1 
ATOM   8578  C  "C2'" . DA  I 5 123 ? -49.803 -23.638 20.401 1.00 110.65 ? 50  DA  I "C2'" 1 
ATOM   8579  C  "C1'" . DA  I 5 123 ? -49.522 -24.565 19.227 1.00 110.61 ? 50  DA  I "C1'" 1 
ATOM   8580  N  N9    . DA  I 5 123 ? -49.306 -25.936 19.672 1.00 111.52 ? 50  DA  I N9    1 
ATOM   8581  C  C8    . DA  I 5 123 ? -48.650 -26.337 20.807 1.00 111.99 ? 50  DA  I C8    1 
ATOM   8582  N  N7    . DA  I 5 123 ? -48.604 -27.639 20.965 1.00 112.19 ? 50  DA  I N7    1 
ATOM   8583  C  C5    . DA  I 5 123 ? -49.281 -28.128 19.861 1.00 111.99 ? 50  DA  I C5    1 
ATOM   8584  C  C6    . DA  I 5 123 ? -49.585 -29.440 19.438 1.00 111.97 ? 50  DA  I C6    1 
ATOM   8585  N  N6    . DA  I 5 123 ? -49.219 -30.528 20.121 1.00 111.74 ? 50  DA  I N6    1 
ATOM   8586  N  N1    . DA  I 5 123 ? -50.280 -29.587 18.287 1.00 112.16 ? 50  DA  I N1    1 
ATOM   8587  C  C2    . DA  I 5 123 ? -50.645 -28.489 17.606 1.00 112.28 ? 50  DA  I C2    1 
ATOM   8588  N  N3    . DA  I 5 123 ? -50.415 -27.206 17.903 1.00 112.06 ? 50  DA  I N3    1 
ATOM   8589  C  C4    . DA  I 5 123 ? -49.722 -27.091 19.052 1.00 111.87 ? 50  DA  I C4    1 
ATOM   8590  P  P     . DG  I 5 124 ? -51.128 -20.702 20.245 1.00 116.03 ? 51  DG  I P     1 
ATOM   8591  O  OP1   . DG  I 5 124 ? -51.304 -19.353 19.652 1.00 116.11 ? 51  DG  I OP1   1 
ATOM   8592  O  OP2   . DG  I 5 124 ? -50.929 -20.832 21.709 1.00 115.52 ? 51  DG  I OP2   1 
ATOM   8593  O  "O5'" . DG  I 5 124 ? -52.381 -21.617 19.847 1.00 117.11 ? 51  DG  I "O5'" 1 
ATOM   8594  C  "C5'" . DG  I 5 124 ? -52.759 -21.726 18.478 1.00 119.57 ? 51  DG  I "C5'" 1 
ATOM   8595  C  "C4'" . DG  I 5 124 ? -53.855 -22.754 18.282 1.00 121.29 ? 51  DG  I "C4'" 1 
ATOM   8596  O  "O4'" . DG  I 5 124 ? -53.314 -24.088 18.459 1.00 121.41 ? 51  DG  I "O4'" 1 
ATOM   8597  C  "C3'" . DG  I 5 124 ? -55.049 -22.613 19.227 1.00 122.45 ? 51  DG  I "C3'" 1 
ATOM   8598  O  "O3'" . DG  I 5 124 ? -56.238 -22.393 18.436 1.00 123.74 ? 51  DG  I "O3'" 1 
ATOM   8599  C  "C2'" . DG  I 5 124 ? -55.033 -23.912 20.040 1.00 122.34 ? 51  DG  I "C2'" 1 
ATOM   8600  C  "C1'" . DG  I 5 124 ? -54.278 -24.873 19.128 1.00 122.19 ? 51  DG  I "C1'" 1 
ATOM   8601  N  N9    . DG  I 5 124 ? -53.592 -25.913 19.885 1.00 122.62 ? 51  DG  I N9    1 
ATOM   8602  C  C8    . DG  I 5 124 ? -52.580 -25.715 20.794 1.00 122.79 ? 51  DG  I C8    1 
ATOM   8603  N  N7    . DG  I 5 124 ? -52.142 -26.812 21.337 1.00 123.02 ? 51  DG  I N7    1 
ATOM   8604  C  C5    . DG  I 5 124 ? -52.917 -27.808 20.754 1.00 123.15 ? 51  DG  I C5    1 
ATOM   8605  C  C6    . DG  I 5 124 ? -52.894 -29.212 20.960 1.00 123.30 ? 51  DG  I C6    1 
ATOM   8606  O  O6    . DG  I 5 124 ? -52.155 -29.853 21.721 1.00 123.14 ? 51  DG  I O6    1 
ATOM   8607  N  N1    . DG  I 5 124 ? -53.843 -29.879 20.178 1.00 123.33 ? 51  DG  I N1    1 
ATOM   8608  C  C2    . DG  I 5 124 ? -54.707 -29.258 19.303 1.00 123.11 ? 51  DG  I C2    1 
ATOM   8609  N  N2    . DG  I 5 124 ? -55.545 -30.069 18.643 1.00 123.01 ? 51  DG  I N2    1 
ATOM   8610  N  N3    . DG  I 5 124 ? -54.742 -27.940 19.100 1.00 122.98 ? 51  DG  I N3    1 
ATOM   8611  C  C4    . DG  I 5 124 ? -53.822 -27.274 19.855 1.00 122.92 ? 51  DG  I C4    1 
ATOM   8612  P  P     . DT  I 5 125 ? -57.681 -23.038 18.727 1.00 124.81 ? 52  DT  I P     1 
ATOM   8613  O  OP1   . DT  I 5 125 ? -58.609 -22.364 17.795 1.00 124.89 ? 52  DT  I OP1   1 
ATOM   8614  O  OP2   . DT  I 5 125 ? -57.955 -22.992 20.184 1.00 125.10 ? 52  DT  I OP2   1 
ATOM   8615  O  "O5'" . DT  I 5 125 ? -57.509 -24.574 18.286 1.00 125.70 ? 52  DT  I "O5'" 1 
ATOM   8616  C  "C5'" . DT  I 5 125 ? -58.631 -25.362 17.890 1.00 127.33 ? 52  DT  I "C5'" 1 
ATOM   8617  C  "C4'" . DT  I 5 125 ? -59.027 -26.372 18.956 1.00 128.67 ? 52  DT  I "C4'" 1 
ATOM   8618  O  "O4'" . DT  I 5 125 ? -57.853 -26.936 19.592 1.00 129.08 ? 52  DT  I "O4'" 1 
ATOM   8619  C  "C3'" . DT  I 5 125 ? -59.881 -25.846 20.115 1.00 129.46 ? 52  DT  I "C3'" 1 
ATOM   8620  O  "O3'" . DT  I 5 125 ? -61.308 -25.986 19.843 1.00 130.30 ? 52  DT  I "O3'" 1 
ATOM   8621  C  "C2'" . DT  I 5 125 ? -59.385 -26.611 21.350 1.00 129.42 ? 52  DT  I "C2'" 1 
ATOM   8622  C  "C1'" . DT  I 5 125 ? -58.307 -27.541 20.788 1.00 129.41 ? 52  DT  I "C1'" 1 
ATOM   8623  N  N1    . DT  I 5 125 ? -57.162 -27.797 21.734 1.00 129.64 ? 52  DT  I N1    1 
ATOM   8624  C  C2    . DT  I 5 125 ? -56.780 -29.105 22.021 1.00 129.64 ? 52  DT  I C2    1 
ATOM   8625  O  O2    . DT  I 5 125 ? -57.307 -30.105 21.551 1.00 129.82 ? 52  DT  I O2    1 
ATOM   8626  N  N3    . DT  I 5 125 ? -55.729 -29.211 22.902 1.00 129.65 ? 52  DT  I N3    1 
ATOM   8627  C  C4    . DT  I 5 125 ? -55.035 -28.173 23.517 1.00 129.58 ? 52  DT  I C4    1 
ATOM   8628  O  O4    . DT  I 5 125 ? -54.108 -28.392 24.292 1.00 129.02 ? 52  DT  I O4    1 
ATOM   8629  C  C5    . DT  I 5 125 ? -55.483 -26.832 23.179 1.00 129.71 ? 52  DT  I C5    1 
ATOM   8630  C  C7    . DT  I 5 125 ? -54.821 -25.614 23.773 1.00 129.56 ? 52  DT  I C7    1 
ATOM   8631  C  C6    . DT  I 5 125 ? -56.510 -26.714 22.318 1.00 129.78 ? 52  DT  I C6    1 
ATOM   8632  P  P     . DA  I 5 126 ? -62.239 -27.259 20.174 1.00 130.59 ? 53  DA  I P     1 
ATOM   8633  O  OP1   . DA  I 5 126 ? -63.352 -27.209 19.198 1.00 130.59 ? 53  DA  I OP1   1 
ATOM   8634  O  OP2   . DA  I 5 126 ? -62.548 -27.260 21.626 1.00 130.14 ? 53  DA  I OP2   1 
ATOM   8635  O  "O5'" . DA  I 5 126 ? -61.311 -28.530 19.863 1.00 130.59 ? 53  DA  I "O5'" 1 
ATOM   8636  C  "C5'" . DA  I 5 126 ? -61.834 -29.743 19.332 1.00 130.98 ? 53  DA  I "C5'" 1 
ATOM   8637  C  "C4'" . DA  I 5 126 ? -61.564 -30.934 20.245 1.00 131.32 ? 53  DA  I "C4'" 1 
ATOM   8638  O  "O4'" . DA  I 5 126 ? -60.376 -30.738 21.070 1.00 131.62 ? 53  DA  I "O4'" 1 
ATOM   8639  C  "C3'" . DA  I 5 126 ? -62.702 -31.272 21.214 1.00 131.09 ? 53  DA  I "C3'" 1 
ATOM   8640  O  "O3'" . DA  I 5 126 ? -62.937 -32.682 21.194 1.00 130.23 ? 53  DA  I "O3'" 1 
ATOM   8641  C  "C2'" . DA  I 5 126 ? -62.127 -30.841 22.562 1.00 131.45 ? 53  DA  I "C2'" 1 
ATOM   8642  C  "C1'" . DA  I 5 126 ? -60.690 -31.291 22.334 1.00 131.84 ? 53  DA  I "C1'" 1 
ATOM   8643  N  N9    . DA  I 5 126 ? -59.736 -30.895 23.371 1.00 132.22 ? 53  DA  I N9    1 
ATOM   8644  C  C8    . DA  I 5 126 ? -59.482 -29.640 23.861 1.00 132.27 ? 53  DA  I C8    1 
ATOM   8645  N  N7    . DA  I 5 126 ? -58.567 -29.613 24.800 1.00 132.13 ? 53  DA  I N7    1 
ATOM   8646  C  C5    . DA  I 5 126 ? -58.201 -30.944 24.936 1.00 132.28 ? 53  DA  I C5    1 
ATOM   8647  C  C6    . DA  I 5 126 ? -57.270 -31.601 25.768 1.00 132.18 ? 53  DA  I C6    1 
ATOM   8648  N  N6    . DA  I 5 126 ? -56.513 -30.952 26.655 1.00 131.86 ? 53  DA  I N6    1 
ATOM   8649  N  N1    . DA  I 5 126 ? -57.147 -32.945 25.656 1.00 132.22 ? 53  DA  I N1    1 
ATOM   8650  C  C2    . DA  I 5 126 ? -57.907 -33.597 24.764 1.00 132.23 ? 53  DA  I C2    1 
ATOM   8651  N  N3    . DA  I 5 126 ? -58.814 -33.088 23.927 1.00 132.34 ? 53  DA  I N3    1 
ATOM   8652  C  C4    . DA  I 5 126 ? -58.913 -31.749 24.065 1.00 132.29 ? 53  DA  I C4    1 
ATOM   8653  P  P     . DT  I 5 127 ? -64.318 -33.318 21.698 1.00 129.82 ? 54  DT  I P     1 
ATOM   8654  O  OP1   . DT  I 5 127 ? -65.182 -33.477 20.508 1.00 129.89 ? 54  DT  I OP1   1 
ATOM   8655  O  OP2   . DT  I 5 127 ? -64.813 -32.574 22.887 1.00 129.55 ? 54  DT  I OP2   1 
ATOM   8656  O  "O5'" . DT  I 5 127 ? -63.857 -34.775 22.165 1.00 128.48 ? 54  DT  I "O5'" 1 
ATOM   8657  C  "C5'" . DT  I 5 127 ? -64.047 -35.155 23.511 1.00 126.66 ? 54  DT  I "C5'" 1 
ATOM   8658  C  "C4'" . DT  I 5 127 ? -62.882 -35.991 24.004 1.00 125.16 ? 54  DT  I "C4'" 1 
ATOM   8659  O  "O4'" . DT  I 5 127 ? -61.729 -35.147 24.284 1.00 125.08 ? 54  DT  I "O4'" 1 
ATOM   8660  C  "C3'" . DT  I 5 127 ? -63.236 -36.721 25.285 1.00 123.87 ? 54  DT  I "C3'" 1 
ATOM   8661  O  "O3'" . DT  I 5 127 ? -62.961 -38.102 25.154 1.00 121.79 ? 54  DT  I "O3'" 1 
ATOM   8662  C  "C2'" . DT  I 5 127 ? -62.384 -36.076 26.369 1.00 124.28 ? 54  DT  I "C2'" 1 
ATOM   8663  C  "C1'" . DT  I 5 127 ? -61.282 -35.339 25.616 1.00 124.74 ? 54  DT  I "C1'" 1 
ATOM   8664  N  N1    . DT  I 5 127 ? -60.966 -34.020 26.285 1.00 124.63 ? 54  DT  I N1    1 
ATOM   8665  C  C2    . DT  I 5 127 ? -59.943 -33.955 27.225 1.00 124.37 ? 54  DT  I C2    1 
ATOM   8666  O  O2    . DT  I 5 127 ? -59.243 -34.905 27.544 1.00 123.94 ? 54  DT  I O2    1 
ATOM   8667  N  N3    . DT  I 5 127 ? -59.751 -32.707 27.776 1.00 124.10 ? 54  DT  I N3    1 
ATOM   8668  C  C4    . DT  I 5 127 ? -60.462 -31.547 27.503 1.00 123.97 ? 54  DT  I C4    1 
ATOM   8669  O  O4    . DT  I 5 127 ? -60.208 -30.481 28.054 1.00 123.29 ? 54  DT  I O4    1 
ATOM   8670  C  C5    . DT  I 5 127 ? -61.519 -31.686 26.525 1.00 124.34 ? 54  DT  I C5    1 
ATOM   8671  C  C7    . DT  I 5 127 ? -62.366 -30.504 26.143 1.00 124.60 ? 54  DT  I C7    1 
ATOM   8672  C  C6    . DT  I 5 127 ? -61.719 -32.895 25.976 1.00 124.45 ? 54  DT  I C6    1 
ATOM   8673  P  P     . DC  I 5 128 ? -63.683 -39.141 26.137 1.00 120.27 ? 55  DC  I P     1 
ATOM   8674  O  OP1   . DC  I 5 128 ? -63.807 -40.434 25.429 1.00 120.39 ? 55  DC  I OP1   1 
ATOM   8675  O  OP2   . DC  I 5 128 ? -64.874 -38.494 26.739 1.00 120.15 ? 55  DC  I OP2   1 
ATOM   8676  O  "O5'" . DC  I 5 128 ? -62.597 -39.321 27.287 1.00 119.02 ? 55  DC  I "O5'" 1 
ATOM   8677  C  "C5'" . DC  I 5 128 ? -61.241 -39.606 26.947 1.00 116.52 ? 55  DC  I "C5'" 1 
ATOM   8678  C  "C4'" . DC  I 5 128 ? -60.351 -39.381 28.156 1.00 114.37 ? 55  DC  I "C4'" 1 
ATOM   8679  O  "O4'" . DC  I 5 128 ? -60.292 -37.964 28.459 1.00 114.26 ? 55  DC  I "O4'" 1 
ATOM   8680  C  "C3'" . DC  I 5 128 ? -60.834 -40.076 29.429 1.00 112.61 ? 55  DC  I "C3'" 1 
ATOM   8681  O  "O3'" . DC  I 5 128 ? -59.762 -40.871 29.914 1.00 109.50 ? 55  DC  I "O3'" 1 
ATOM   8682  C  "C2'" . DC  I 5 128 ? -61.238 -38.939 30.372 1.00 112.94 ? 55  DC  I "C2'" 1 
ATOM   8683  C  "C1'" . DC  I 5 128 ? -60.356 -37.803 29.864 1.00 114.13 ? 55  DC  I "C1'" 1 
ATOM   8684  N  N1    . DC  I 5 128 ? -60.786 -36.388 30.176 1.00 114.67 ? 55  DC  I N1    1 
ATOM   8685  C  C2    . DC  I 5 128 ? -59.980 -35.595 31.013 1.00 114.91 ? 55  DC  I C2    1 
ATOM   8686  O  O2    . DC  I 5 128 ? -58.941 -36.065 31.498 1.00 115.07 ? 55  DC  I O2    1 
ATOM   8687  N  N3    . DC  I 5 128 ? -60.365 -34.318 31.276 1.00 115.02 ? 55  DC  I N3    1 
ATOM   8688  C  C4    . DC  I 5 128 ? -61.487 -33.825 30.744 1.00 114.78 ? 55  DC  I C4    1 
ATOM   8689  N  N4    . DC  I 5 128 ? -61.807 -32.565 31.047 1.00 114.72 ? 55  DC  I N4    1 
ATOM   8690  C  C5    . DC  I 5 128 ? -62.321 -34.606 29.886 1.00 114.55 ? 55  DC  I C5    1 
ATOM   8691  C  C6    . DC  I 5 128 ? -61.932 -35.864 29.634 1.00 114.69 ? 55  DC  I C6    1 
ATOM   8692  P  P     . DT  I 5 129 ? -59.963 -42.029 31.001 1.00 107.14 ? 56  DT  I P     1 
ATOM   8693  O  OP1   . DT  I 5 129 ? -58.996 -43.108 30.684 1.00 106.48 ? 56  DT  I OP1   1 
ATOM   8694  O  OP2   . DT  I 5 129 ? -61.402 -42.340 31.159 1.00 106.72 ? 56  DT  I OP2   1 
ATOM   8695  O  "O5'" . DT  I 5 129 ? -59.500 -41.275 32.328 1.00 105.71 ? 56  DT  I "O5'" 1 
ATOM   8696  C  "C5'" . DT  I 5 129 ? -58.155 -40.799 32.476 1.00 102.68 ? 56  DT  I "C5'" 1 
ATOM   8697  C  "C4'" . DT  I 5 129 ? -57.971 -40.173 33.844 1.00 100.37 ? 56  DT  I "C4'" 1 
ATOM   8698  O  "O4'" . DT  I 5 129 ? -58.539 -38.843 33.830 1.00 100.35 ? 56  DT  I "O4'" 1 
ATOM   8699  C  "C3'" . DT  I 5 129 ? -58.660 -40.931 34.981 1.00 98.66  ? 56  DT  I "C3'" 1 
ATOM   8700  O  "O3'" . DT  I 5 129 ? -57.772 -41.091 36.082 1.00 95.45  ? 56  DT  I "O3'" 1 
ATOM   8701  C  "C2'" . DT  I 5 129 ? -59.861 -40.051 35.334 1.00 99.69  ? 56  DT  I "C2'" 1 
ATOM   8702  C  "C1'" . DT  I 5 129 ? -59.323 -38.665 34.992 1.00 100.73 ? 56  DT  I "C1'" 1 
ATOM   8703  N  N1    . DT  I 5 129 ? -60.338 -37.602 34.697 1.00 101.66 ? 56  DT  I N1    1 
ATOM   8704  C  C2    . DT  I 5 129 ? -60.181 -36.356 35.278 1.00 102.44 ? 56  DT  I C2    1 
ATOM   8705  O  O2    . DT  I 5 129 ? -59.270 -36.059 36.035 1.00 102.00 ? 56  DT  I O2    1 
ATOM   8706  N  N3    . DT  I 5 129 ? -61.155 -35.450 34.939 1.00 103.30 ? 56  DT  I N3    1 
ATOM   8707  C  C4    . DT  I 5 129 ? -62.237 -35.649 34.099 1.00 103.26 ? 56  DT  I C4    1 
ATOM   8708  O  O4    . DT  I 5 129 ? -63.048 -34.757 33.870 1.00 103.80 ? 56  DT  I O4    1 
ATOM   8709  C  C5    . DT  I 5 129 ? -62.337 -36.967 33.523 1.00 102.89 ? 56  DT  I C5    1 
ATOM   8710  C  C7    . DT  I 5 129 ? -63.471 -37.305 32.600 1.00 103.54 ? 56  DT  I C7    1 
ATOM   8711  C  C6    . DT  I 5 129 ? -61.396 -37.866 33.843 1.00 102.33 ? 56  DT  I C6    1 
ATOM   8712  P  P     . DG  I 5 130 ? -56.553 -42.141 36.104 1.00 93.40  ? 57  DG  I P     1 
ATOM   8713  O  OP1   . DG  I 5 130 ? -56.437 -42.828 34.794 1.00 93.67  ? 57  DG  I OP1   1 
ATOM   8714  O  OP2   . DG  I 5 130 ? -56.677 -42.946 37.337 1.00 92.82  ? 57  DG  I OP2   1 
ATOM   8715  O  "O5'" . DG  I 5 130 ? -55.310 -41.145 36.265 1.00 92.41  ? 57  DG  I "O5'" 1 
ATOM   8716  C  "C5'" . DG  I 5 130 ? -54.422 -41.247 37.364 1.00 90.68  ? 57  DG  I "C5'" 1 
ATOM   8717  C  "C4'" . DG  I 5 130 ? -54.243 -39.934 38.114 1.00 89.39  ? 57  DG  I "C4'" 1 
ATOM   8718  O  "O4'" . DG  I 5 130 ? -55.369 -39.033 37.958 1.00 89.00  ? 57  DG  I "O4'" 1 
ATOM   8719  C  "C3'" . DG  I 5 130 ? -54.066 -40.114 39.614 1.00 89.00  ? 57  DG  I "C3'" 1 
ATOM   8720  O  "O3'" . DG  I 5 130 ? -53.052 -39.213 40.071 1.00 88.24  ? 57  DG  I "O3'" 1 
ATOM   8721  C  "C2'" . DG  I 5 130 ? -55.456 -39.812 40.182 1.00 89.10  ? 57  DG  I "C2'" 1 
ATOM   8722  C  "C1'" . DG  I 5 130 ? -56.005 -38.782 39.201 1.00 89.08  ? 57  DG  I "C1'" 1 
ATOM   8723  N  N9    . DG  I 5 130 ? -57.439 -38.862 38.933 1.00 89.41  ? 57  DG  I N9    1 
ATOM   8724  C  C8    . DG  I 5 130 ? -58.131 -39.988 38.572 1.00 89.46  ? 57  DG  I C8    1 
ATOM   8725  N  N7    . DG  I 5 130 ? -59.398 -39.779 38.366 1.00 89.97  ? 57  DG  I N7    1 
ATOM   8726  C  C5    . DG  I 5 130 ? -59.570 -38.426 38.596 1.00 90.28  ? 57  DG  I C5    1 
ATOM   8727  C  C6    . DG  I 5 130 ? -60.745 -37.628 38.526 1.00 91.14  ? 57  DG  I C6    1 
ATOM   8728  O  O6    . DG  I 5 130 ? -61.902 -37.971 38.232 1.00 91.76  ? 57  DG  I O6    1 
ATOM   8729  N  N1    . DG  I 5 130 ? -60.487 -36.294 38.840 1.00 90.66  ? 57  DG  I N1    1 
ATOM   8730  C  C2    . DG  I 5 130 ? -59.248 -35.801 39.176 1.00 90.27  ? 57  DG  I C2    1 
ATOM   8731  N  N2    . DG  I 5 130 ? -59.190 -34.490 39.443 1.00 90.16  ? 57  DG  I N2    1 
ATOM   8732  N  N3    . DG  I 5 130 ? -58.144 -36.541 39.247 1.00 90.13  ? 57  DG  I N3    1 
ATOM   8733  C  C4    . DG  I 5 130 ? -58.371 -37.844 38.946 1.00 89.83  ? 57  DG  I C4    1 
ATOM   8734  P  P     . DC  I 5 131 ? -52.370 -39.386 41.509 1.00 86.89  ? 58  DC  I P     1 
ATOM   8735  O  OP1   . DC  I 5 131 ? -50.987 -38.872 41.432 1.00 87.83  ? 58  DC  I OP1   1 
ATOM   8736  O  OP2   . DC  I 5 131 ? -52.598 -40.763 41.992 1.00 88.30  ? 58  DC  I OP2   1 
ATOM   8737  O  "O5'" . DC  I 5 131 ? -53.237 -38.404 42.411 1.00 86.73  ? 58  DC  I "O5'" 1 
ATOM   8738  C  "C5'" . DC  I 5 131 ? -53.537 -37.098 41.968 1.00 86.86  ? 58  DC  I "C5'" 1 
ATOM   8739  C  "C4'" . DC  I 5 131 ? -54.505 -36.451 42.934 1.00 88.05  ? 58  DC  I "C4'" 1 
ATOM   8740  O  "O4'" . DC  I 5 131 ? -55.863 -36.668 42.482 1.00 88.65  ? 58  DC  I "O4'" 1 
ATOM   8741  C  "C3'" . DC  I 5 131 ? -54.450 -36.979 44.363 1.00 88.71  ? 58  DC  I "C3'" 1 
ATOM   8742  O  "O3'" . DC  I 5 131 ? -54.628 -35.875 45.222 1.00 89.81  ? 58  DC  I "O3'" 1 
ATOM   8743  C  "C2'" . DC  I 5 131 ? -55.639 -37.936 44.425 1.00 88.75  ? 58  DC  I "C2'" 1 
ATOM   8744  C  "C1'" . DC  I 5 131 ? -56.633 -37.170 43.555 1.00 88.94  ? 58  DC  I "C1'" 1 
ATOM   8745  N  N1    . DC  I 5 131 ? -57.777 -37.941 42.955 1.00 89.04  ? 58  DC  I N1    1 
ATOM   8746  C  C2    . DC  I 5 131 ? -58.943 -37.254 42.562 1.00 88.87  ? 58  DC  I C2    1 
ATOM   8747  O  O2    . DC  I 5 131 ? -59.039 -36.027 42.721 1.00 89.22  ? 58  DC  I O2    1 
ATOM   8748  N  N3    . DC  I 5 131 ? -59.958 -37.959 42.007 1.00 88.52  ? 58  DC  I N3    1 
ATOM   8749  C  C4    . DC  I 5 131 ? -59.848 -39.276 41.842 1.00 88.41  ? 58  DC  I C4    1 
ATOM   8750  N  N4    . DC  I 5 131 ? -60.885 -39.910 41.297 1.00 88.49  ? 58  DC  I N4    1 
ATOM   8751  C  C5    . DC  I 5 131 ? -58.677 -39.999 42.225 1.00 88.60  ? 58  DC  I C5    1 
ATOM   8752  C  C6    . DC  I 5 131 ? -57.676 -39.296 42.772 1.00 88.97  ? 58  DC  I C6    1 
ATOM   8753  P  P     . DA  I 5 132 ? -53.399 -35.083 45.885 1.00 90.58  ? 59  DA  I P     1 
ATOM   8754  O  OP1   . DA  I 5 132 ? -52.385 -34.803 44.838 1.00 89.12  ? 59  DA  I OP1   1 
ATOM   8755  O  OP2   . DA  I 5 132 ? -53.023 -35.792 47.136 1.00 88.70  ? 59  DA  I OP2   1 
ATOM   8756  O  "O5'" . DA  I 5 132 ? -54.114 -33.707 46.305 1.00 91.06  ? 59  DA  I "O5'" 1 
ATOM   8757  C  "C5'" . DA  I 5 132 ? -54.603 -32.807 45.303 1.00 93.02  ? 59  DA  I "C5'" 1 
ATOM   8758  C  "C4'" . DA  I 5 132 ? -55.828 -32.001 45.742 1.00 94.52  ? 59  DA  I "C4'" 1 
ATOM   8759  O  "O4'" . DA  I 5 132 ? -57.037 -32.785 45.597 1.00 94.78  ? 59  DA  I "O4'" 1 
ATOM   8760  C  "C3'" . DA  I 5 132 ? -55.895 -31.463 47.173 1.00 95.39  ? 59  DA  I "C3'" 1 
ATOM   8761  O  "O3'" . DA  I 5 132 ? -56.680 -30.247 47.165 1.00 96.76  ? 59  DA  I "O3'" 1 
ATOM   8762  C  "C2'" . DA  I 5 132 ? -56.570 -32.615 47.919 1.00 94.98  ? 59  DA  I "C2'" 1 
ATOM   8763  C  "C1'" . DA  I 5 132 ? -57.569 -33.105 46.872 1.00 95.02  ? 59  DA  I "C1'" 1 
ATOM   8764  N  N9    . DA  I 5 132 ? -57.765 -34.540 46.789 1.00 95.24  ? 59  DA  I N9    1 
ATOM   8765  C  C8    . DA  I 5 132 ? -56.893 -35.525 47.160 1.00 95.42  ? 59  DA  I C8    1 
ATOM   8766  N  N7    . DA  I 5 132 ? -57.342 -36.734 46.938 1.00 95.50  ? 59  DA  I N7    1 
ATOM   8767  C  C5    . DA  I 5 132 ? -58.587 -36.520 46.365 1.00 95.43  ? 59  DA  I C5    1 
ATOM   8768  C  C6    . DA  I 5 132 ? -59.578 -37.403 45.897 1.00 95.46  ? 59  DA  I C6    1 
ATOM   8769  N  N6    . DA  I 5 132 ? -59.425 -38.729 45.944 1.00 96.22  ? 59  DA  I N6    1 
ATOM   8770  N  N1    . DA  I 5 132 ? -60.716 -36.878 45.387 1.00 95.07  ? 59  DA  I N1    1 
ATOM   8771  C  C2    . DA  I 5 132 ? -60.852 -35.544 45.348 1.00 94.88  ? 59  DA  I C2    1 
ATOM   8772  N  N3    . DA  I 5 132 ? -59.988 -34.613 45.756 1.00 94.94  ? 59  DA  I N3    1 
ATOM   8773  C  C4    . DA  I 5 132 ? -58.867 -35.172 46.260 1.00 95.29  ? 59  DA  I C4    1 
ATOM   8774  P  P     . DG  I 5 133 ? -57.036 -29.388 48.479 1.00 97.59  ? 60  DG  I P     1 
ATOM   8775  O  OP1   . DG  I 5 133 ? -57.251 -27.991 48.042 1.00 97.59  ? 60  DG  I OP1   1 
ATOM   8776  O  OP2   . DG  I 5 133 ? -56.074 -29.706 49.561 1.00 97.10  ? 60  DG  I OP2   1 
ATOM   8777  O  "O5'" . DG  I 5 133 ? -58.416 -30.022 48.958 1.00 99.08  ? 60  DG  I "O5'" 1 
ATOM   8778  C  "C5'" . DG  I 5 133 ? -59.705 -29.577 48.553 1.00 101.35 ? 60  DG  I "C5'" 1 
ATOM   8779  C  "C4'" . DG  I 5 133 ? -60.718 -30.474 49.247 1.00 103.56 ? 60  DG  I "C4'" 1 
ATOM   8780  O  "O4'" . DG  I 5 133 ? -60.456 -31.870 48.932 1.00 103.64 ? 60  DG  I "O4'" 1 
ATOM   8781  C  "C3'" . DG  I 5 133 ? -60.709 -30.405 50.774 1.00 105.20 ? 60  DG  I "C3'" 1 
ATOM   8782  O  "O3'" . DG  I 5 133 ? -62.048 -30.341 51.224 1.00 108.49 ? 60  DG  I "O3'" 1 
ATOM   8783  C  "C2'" . DG  I 5 133 ? -60.056 -31.718 51.211 1.00 104.15 ? 60  DG  I "C2'" 1 
ATOM   8784  C  "C1'" . DG  I 5 133 ? -60.612 -32.624 50.119 1.00 103.58 ? 60  DG  I "C1'" 1 
ATOM   8785  N  N9    . DG  I 5 133 ? -60.002 -33.951 49.971 1.00 102.88 ? 60  DG  I N9    1 
ATOM   8786  C  C8    . DG  I 5 133 ? -58.708 -34.342 50.239 1.00 102.50 ? 60  DG  I C8    1 
ATOM   8787  N  N7    . DG  I 5 133 ? -58.479 -35.604 50.007 1.00 101.95 ? 60  DG  I N7    1 
ATOM   8788  C  C5    . DG  I 5 133 ? -59.701 -36.086 49.552 1.00 102.01 ? 60  DG  I C5    1 
ATOM   8789  C  C6    . DG  I 5 133 ? -60.072 -37.393 49.139 1.00 101.57 ? 60  DG  I C6    1 
ATOM   8790  O  O6    . DG  I 5 133 ? -59.363 -38.408 49.097 1.00 101.29 ? 60  DG  I O6    1 
ATOM   8791  N  N1    . DG  I 5 133 ? -61.411 -37.462 48.750 1.00 101.41 ? 60  DG  I N1    1 
ATOM   8792  C  C2    . DG  I 5 133 ? -62.283 -36.391 48.766 1.00 102.04 ? 60  DG  I C2    1 
ATOM   8793  N  N2    . DG  I 5 133 ? -63.536 -36.638 48.358 1.00 102.45 ? 60  DG  I N2    1 
ATOM   8794  N  N3    . DG  I 5 133 ? -61.953 -35.162 49.152 1.00 101.85 ? 60  DG  I N3    1 
ATOM   8795  C  C4    . DG  I 5 133 ? -60.648 -35.082 49.526 1.00 102.30 ? 60  DG  I C4    1 
ATOM   8796  P  P     . DG  I 5 134 ? -62.493 -29.242 52.297 1.00 111.07 ? 61  DG  I P     1 
ATOM   8797  O  OP1   . DG  I 5 134 ? -62.739 -27.983 51.551 1.00 111.08 ? 61  DG  I OP1   1 
ATOM   8798  O  OP2   . DG  I 5 134 ? -61.519 -29.264 53.421 1.00 110.83 ? 61  DG  I OP2   1 
ATOM   8799  O  "O5'" . DG  I 5 134 ? -63.890 -29.816 52.848 1.00 112.45 ? 61  DG  I "O5'" 1 
ATOM   8800  C  "C5'" . DG  I 5 134 ? -64.852 -30.411 51.971 1.00 114.65 ? 61  DG  I "C5'" 1 
ATOM   8801  C  "C4'" . DG  I 5 134 ? -65.247 -31.806 52.431 1.00 116.14 ? 61  DG  I "C4'" 1 
ATOM   8802  O  "O4'" . DG  I 5 134 ? -64.301 -32.780 51.926 1.00 116.06 ? 61  DG  I "O4'" 1 
ATOM   8803  C  "C3'" . DG  I 5 134 ? -65.264 -32.040 53.943 1.00 117.35 ? 61  DG  I "C3'" 1 
ATOM   8804  O  "O3'" . DG  I 5 134 ? -66.608 -31.843 54.427 1.00 120.09 ? 61  DG  I "O3'" 1 
ATOM   8805  C  "C2'" . DG  I 5 134 ? -64.713 -33.460 54.111 1.00 116.58 ? 61  DG  I "C2'" 1 
ATOM   8806  C  "C1'" . DG  I 5 134 ? -64.524 -33.954 52.676 1.00 115.97 ? 61  DG  I "C1'" 1 
ATOM   8807  N  N9    . DG  I 5 134 ? -63.412 -34.900 52.540 1.00 115.20 ? 61  DG  I N9    1 
ATOM   8808  C  C8    . DG  I 5 134 ? -62.091 -34.665 52.839 1.00 114.80 ? 61  DG  I C8    1 
ATOM   8809  N  N7    . DG  I 5 134 ? -61.315 -35.692 52.643 1.00 114.32 ? 61  DG  I N7    1 
ATOM   8810  C  C5    . DG  I 5 134 ? -62.173 -36.678 52.181 1.00 113.97 ? 61  DG  I C5    1 
ATOM   8811  C  C6    . DG  I 5 134 ? -61.893 -38.014 51.804 1.00 113.61 ? 61  DG  I C6    1 
ATOM   8812  O  O6    . DG  I 5 134 ? -60.794 -38.584 51.805 1.00 112.94 ? 61  DG  I O6    1 
ATOM   8813  N  N1    . DG  I 5 134 ? -63.039 -38.697 51.391 1.00 113.70 ? 61  DG  I N1    1 
ATOM   8814  C  C2    . DG  I 5 134 ? -64.304 -38.150 51.358 1.00 113.93 ? 61  DG  I C2    1 
ATOM   8815  N  N2    . DG  I 5 134 ? -65.287 -38.959 50.936 1.00 113.96 ? 61  DG  I N2    1 
ATOM   8816  N  N3    . DG  I 5 134 ? -64.579 -36.896 51.715 1.00 114.22 ? 61  DG  I N3    1 
ATOM   8817  C  C4    . DG  I 5 134 ? -63.470 -36.214 52.115 1.00 114.42 ? 61  DG  I C4    1 
ATOM   8818  P  P     . DT  I 5 135 ? -67.423 -32.811 55.424 1.00 122.22 ? 62  DT  I P     1 
ATOM   8819  O  OP1   . DT  I 5 135 ? -68.513 -31.994 56.015 1.00 121.79 ? 62  DT  I OP1   1 
ATOM   8820  O  OP2   . DT  I 5 135 ? -66.479 -33.511 56.329 1.00 122.09 ? 62  DT  I OP2   1 
ATOM   8821  O  "O5'" . DT  I 5 135 ? -68.050 -33.896 54.420 1.00 123.21 ? 62  DT  I "O5'" 1 
ATOM   8822  C  "C5'" . DT  I 5 135 ? -69.241 -34.623 54.751 1.00 124.59 ? 62  DT  I "C5'" 1 
ATOM   8823  C  "C4'" . DT  I 5 135 ? -68.920 -35.968 55.380 1.00 125.33 ? 62  DT  I "C4'" 1 
ATOM   8824  O  "O4'" . DT  I 5 135 ? -67.697 -36.492 54.793 1.00 125.51 ? 62  DT  I "O4'" 1 
ATOM   8825  C  "C3'" . DT  I 5 135 ? -68.691 -35.927 56.896 1.00 125.81 ? 62  DT  I "C3'" 1 
ATOM   8826  O  "O3'" . DT  I 5 135 ? -69.836 -36.462 57.626 1.00 126.43 ? 62  DT  I "O3'" 1 
ATOM   8827  C  "C2'" . DT  I 5 135 ? -67.369 -36.676 57.096 1.00 125.84 ? 62  DT  I "C2'" 1 
ATOM   8828  C  "C1'" . DT  I 5 135 ? -67.137 -37.359 55.749 1.00 125.55 ? 62  DT  I "C1'" 1 
ATOM   8829  N  N1    . DT  I 5 135 ? -65.688 -37.644 55.472 1.00 125.42 ? 62  DT  I N1    1 
ATOM   8830  C  C2    . DT  I 5 135 ? -65.320 -38.843 54.880 1.00 125.40 ? 62  DT  I C2    1 
ATOM   8831  O  O2    . DT  I 5 135 ? -66.110 -39.703 54.534 1.00 125.86 ? 62  DT  I O2    1 
ATOM   8832  N  N3    . DT  I 5 135 ? -63.970 -39.008 54.695 1.00 125.19 ? 62  DT  I N3    1 
ATOM   8833  C  C4    . DT  I 5 135 ? -62.967 -38.116 55.041 1.00 125.39 ? 62  DT  I C4    1 
ATOM   8834  O  O4    . DT  I 5 135 ? -61.784 -38.366 54.824 1.00 125.28 ? 62  DT  I O4    1 
ATOM   8835  C  C5    . DT  I 5 135 ? -63.413 -36.883 55.662 1.00 125.46 ? 62  DT  I C5    1 
ATOM   8836  C  C7    . DT  I 5 135 ? -62.434 -35.825 56.089 1.00 125.21 ? 62  DT  I C7    1 
ATOM   8837  C  C6    . DT  I 5 135 ? -64.731 -36.714 55.846 1.00 125.56 ? 62  DT  I C6    1 
ATOM   8838  P  P     . DG  I 5 136 ? -69.833 -37.703 58.658 1.00 126.44 ? 63  DG  I P     1 
ATOM   8839  O  OP1   . DG  I 5 136 ? -71.225 -37.871 59.134 1.00 126.15 ? 63  DG  I OP1   1 
ATOM   8840  O  OP2   . DG  I 5 136 ? -68.764 -37.515 59.669 1.00 126.58 ? 63  DG  I OP2   1 
ATOM   8841  O  "O5'" . DG  I 5 136 ? -69.431 -38.933 57.702 1.00 126.36 ? 63  DG  I "O5'" 1 
ATOM   8842  C  "C5'" . DG  I 5 136 ? -70.151 -40.173 57.687 1.00 126.28 ? 63  DG  I "C5'" 1 
ATOM   8843  C  "C4'" . DG  I 5 136 ? -69.492 -41.212 58.582 1.00 126.15 ? 63  DG  I "C4'" 1 
ATOM   8844  O  "O4'" . DG  I 5 136 ? -68.070 -41.258 58.304 1.00 125.83 ? 63  DG  I "O4'" 1 
ATOM   8845  C  "C3'" . DG  I 5 136 ? -69.653 -40.950 60.083 1.00 126.21 ? 63  DG  I "C3'" 1 
ATOM   8846  O  "O3'" . DG  I 5 136 ? -70.440 -42.019 60.695 1.00 126.18 ? 63  DG  I "O3'" 1 
ATOM   8847  C  "C2'" . DG  I 5 136 ? -68.229 -40.712 60.609 1.00 125.92 ? 63  DG  I "C2'" 1 
ATOM   8848  C  "C1'" . DG  I 5 136 ? -67.329 -41.291 59.511 1.00 125.74 ? 63  DG  I "C1'" 1 
ATOM   8849  N  N9    . DG  I 5 136 ? -66.042 -40.602 59.300 1.00 125.11 ? 63  DG  I N9    1 
ATOM   8850  C  C8    . DG  I 5 136 ? -65.768 -39.257 59.448 1.00 124.66 ? 63  DG  I C8    1 
ATOM   8851  N  N7    . DG  I 5 136 ? -64.529 -38.940 59.184 1.00 124.18 ? 63  DG  I N7    1 
ATOM   8852  C  C5    . DG  I 5 136 ? -63.935 -40.149 58.835 1.00 124.13 ? 63  DG  I C5    1 
ATOM   8853  C  C6    . DG  I 5 136 ? -62.597 -40.445 58.448 1.00 123.92 ? 63  DG  I C6    1 
ATOM   8854  O  O6    . DG  I 5 136 ? -61.645 -39.664 58.333 1.00 124.34 ? 63  DG  I O6    1 
ATOM   8855  N  N1    . DG  I 5 136 ? -62.394 -41.800 58.176 1.00 123.29 ? 63  DG  I N1    1 
ATOM   8856  C  C2    . DG  I 5 136 ? -63.371 -42.763 58.270 1.00 123.38 ? 63  DG  I C2    1 
ATOM   8857  N  N2    . DG  I 5 136 ? -62.993 -44.016 57.970 1.00 123.10 ? 63  DG  I N2    1 
ATOM   8858  N  N3    . DG  I 5 136 ? -64.628 -42.505 58.633 1.00 123.86 ? 63  DG  I N3    1 
ATOM   8859  C  C4    . DG  I 5 136 ? -64.848 -41.184 58.902 1.00 124.37 ? 63  DG  I C4    1 
ATOM   8860  P  P     . DG  I 5 137 ? -69.936 -43.227 61.635 1.00 125.89 ? 64  DG  I P     1 
ATOM   8861  O  OP1   . DG  I 5 137 ? -71.094 -44.133 61.810 1.00 125.90 ? 64  DG  I OP1   1 
ATOM   8862  O  OP2   . DG  I 5 137 ? -69.293 -42.630 62.834 1.00 125.58 ? 64  DG  I OP2   1 
ATOM   8863  O  "O5'" . DG  I 5 137 ? -68.849 -44.027 60.762 1.00 124.55 ? 64  DG  I "O5'" 1 
ATOM   8864  C  "C5'" . DG  I 5 137 ? -68.569 -45.413 61.027 1.00 122.62 ? 64  DG  I "C5'" 1 
ATOM   8865  C  "C4'" . DG  I 5 137 ? -67.328 -45.598 61.890 1.00 121.11 ? 64  DG  I "C4'" 1 
ATOM   8866  O  "O4'" . DG  I 5 137 ? -66.329 -44.604 61.535 1.00 120.44 ? 64  DG  I "O4'" 1 
ATOM   8867  C  "C3'" . DG  I 5 137 ? -67.557 -45.444 63.396 1.00 120.38 ? 64  DG  I "C3'" 1 
ATOM   8868  O  "O3'" . DG  I 5 137 ? -67.552 -46.730 64.058 1.00 119.56 ? 64  DG  I "O3'" 1 
ATOM   8869  C  "C2'" . DG  I 5 137 ? -66.478 -44.467 63.882 1.00 119.94 ? 64  DG  I "C2'" 1 
ATOM   8870  C  "C1'" . DG  I 5 137 ? -65.553 -44.299 62.677 1.00 119.21 ? 64  DG  I "C1'" 1 
ATOM   8871  N  N9    . DG  I 5 137 ? -64.987 -42.950 62.551 1.00 117.67 ? 64  DG  I N9    1 
ATOM   8872  C  C8    . DG  I 5 137 ? -65.617 -41.754 62.824 1.00 117.35 ? 64  DG  I C8    1 
ATOM   8873  N  N7    . DG  I 5 137 ? -64.873 -40.702 62.627 1.00 116.46 ? 64  DG  I N7    1 
ATOM   8874  C  C5    . DG  I 5 137 ? -63.666 -41.232 62.196 1.00 116.08 ? 64  DG  I C5    1 
ATOM   8875  C  C6    . DG  I 5 137 ? -62.469 -40.568 61.830 1.00 115.71 ? 64  DG  I C6    1 
ATOM   8876  O  O6    . DG  I 5 137 ? -62.265 -39.344 61.819 1.00 115.80 ? 64  DG  I O6    1 
ATOM   8877  N  N1    . DG  I 5 137 ? -61.465 -41.468 61.445 1.00 114.84 ? 64  DG  I N1    1 
ATOM   8878  C  C2    . DG  I 5 137 ? -61.608 -42.839 61.424 1.00 114.52 ? 64  DG  I C2    1 
ATOM   8879  N  N2    . DG  I 5 137 ? -60.545 -43.550 61.029 1.00 113.54 ? 64  DG  I N2    1 
ATOM   8880  N  N3    . DG  I 5 137 ? -62.727 -43.471 61.767 1.00 115.28 ? 64  DG  I N3    1 
ATOM   8881  C  C4    . DG  I 5 137 ? -63.714 -42.611 62.142 1.00 116.36 ? 64  DG  I C4    1 
ATOM   8882  P  P     . DA  I 5 138 ? -66.279 -47.462 64.723 1.00 119.09 ? 65  DA  I P     1 
ATOM   8883  O  OP1   . DA  I 5 138 ? -66.741 -48.819 65.102 1.00 119.18 ? 65  DA  I OP1   1 
ATOM   8884  O  OP2   . DA  I 5 138 ? -65.695 -46.577 65.762 1.00 118.58 ? 65  DA  I OP2   1 
ATOM   8885  O  "O5'" . DA  I 5 138 ? -65.215 -47.605 63.531 1.00 117.45 ? 65  DA  I "O5'" 1 
ATOM   8886  C  "C5'" . DA  I 5 138 ? -64.534 -48.848 63.311 1.00 114.22 ? 65  DA  I "C5'" 1 
ATOM   8887  C  "C4'" . DA  I 5 138 ? -63.074 -48.771 63.736 1.00 111.48 ? 65  DA  I "C4'" 1 
ATOM   8888  O  "O4'" . DA  I 5 138 ? -62.580 -47.422 63.529 1.00 110.60 ? 65  DA  I "O4'" 1 
ATOM   8889  C  "C3'" . DA  I 5 138 ? -62.783 -49.135 65.195 1.00 109.97 ? 65  DA  I "C3'" 1 
ATOM   8890  O  "O3'" . DA  I 5 138 ? -61.682 -50.082 65.232 1.00 108.46 ? 65  DA  I "O3'" 1 
ATOM   8891  C  "C2'" . DA  I 5 138 ? -62.500 -47.777 65.840 1.00 109.88 ? 65  DA  I "C2'" 1 
ATOM   8892  C  "C1'" . DA  I 5 138 ? -61.865 -47.017 64.677 1.00 109.79 ? 65  DA  I "C1'" 1 
ATOM   8893  N  N9    . DA  I 5 138 ? -61.953 -45.563 64.787 1.00 108.54 ? 65  DA  I N9    1 
ATOM   8894  C  C8    . DA  I 5 138 ? -63.058 -44.833 65.132 1.00 108.44 ? 65  DA  I C8    1 
ATOM   8895  N  N7    . DA  I 5 138 ? -62.862 -43.535 65.153 1.00 107.75 ? 65  DA  I N7    1 
ATOM   8896  C  C5    . DA  I 5 138 ? -61.530 -43.404 64.794 1.00 107.09 ? 65  DA  I C5    1 
ATOM   8897  C  C6    . DA  I 5 138 ? -60.701 -42.272 64.636 1.00 105.70 ? 65  DA  I C6    1 
ATOM   8898  N  N6    . DA  I 5 138 ? -61.129 -41.019 64.826 1.00 104.47 ? 65  DA  I N6    1 
ATOM   8899  N  N1    . DA  I 5 138 ? -59.419 -42.486 64.269 1.00 105.43 ? 65  DA  I N1    1 
ATOM   8900  C  C2    . DA  I 5 138 ? -58.993 -43.744 64.076 1.00 105.76 ? 65  DA  I C2    1 
ATOM   8901  N  N3    . DA  I 5 138 ? -59.676 -44.884 64.199 1.00 106.64 ? 65  DA  I N3    1 
ATOM   8902  C  C4    . DA  I 5 138 ? -60.951 -44.645 64.564 1.00 107.50 ? 65  DA  I C4    1 
ATOM   8903  P  P     . DT  I 5 139 ? -60.538 -50.160 66.367 1.00 107.85 ? 66  DT  I P     1 
ATOM   8904  O  OP1   . DT  I 5 139 ? -59.957 -51.526 66.376 1.00 106.73 ? 66  DT  I OP1   1 
ATOM   8905  O  OP2   . DT  I 5 139 ? -61.111 -49.597 67.618 1.00 107.23 ? 66  DT  I OP2   1 
ATOM   8906  O  "O5'" . DT  I 5 139 ? -59.419 -49.150 65.802 1.00 105.77 ? 66  DT  I "O5'" 1 
ATOM   8907  C  "C5'" . DT  I 5 139 ? -58.036 -49.527 65.710 1.00 102.24 ? 66  DT  I "C5'" 1 
ATOM   8908  C  "C4'" . DT  I 5 139 ? -57.106 -48.523 66.390 1.00 99.37  ? 66  DT  I "C4'" 1 
ATOM   8909  O  "O4'" . DT  I 5 139 ? -57.656 -47.180 66.283 1.00 97.98  ? 66  DT  I "O4'" 1 
ATOM   8910  C  "C3'" . DT  I 5 139 ? -56.853 -48.757 67.885 1.00 97.89  ? 66  DT  I "C3'" 1 
ATOM   8911  O  "O3'" . DT  I 5 139 ? -55.529 -48.390 68.266 1.00 96.34  ? 66  DT  I "O3'" 1 
ATOM   8912  C  "C2'" . DT  I 5 139 ? -57.820 -47.772 68.526 1.00 97.49  ? 66  DT  I "C2'" 1 
ATOM   8913  C  "C1'" . DT  I 5 139 ? -57.604 -46.603 67.572 1.00 96.70  ? 66  DT  I "C1'" 1 
ATOM   8914  N  N1    . DT  I 5 139 ? -58.572 -45.474 67.694 1.00 95.37  ? 66  DT  I N1    1 
ATOM   8915  C  C2    . DT  I 5 139 ? -58.177 -44.203 67.298 1.00 94.93  ? 66  DT  I C2    1 
ATOM   8916  O  O2    . DT  I 5 139 ? -57.074 -43.935 66.841 1.00 94.76  ? 66  DT  I O2    1 
ATOM   8917  N  N3    . DT  I 5 139 ? -59.136 -43.233 67.452 1.00 94.04  ? 66  DT  I N3    1 
ATOM   8918  C  C4    . DT  I 5 139 ? -60.411 -43.405 67.956 1.00 93.90  ? 66  DT  I C4    1 
ATOM   8919  O  O4    . DT  I 5 139 ? -61.185 -42.464 68.052 1.00 93.48  ? 66  DT  I O4    1 
ATOM   8920  C  C5    . DT  I 5 139 ? -60.759 -44.755 68.350 1.00 94.38  ? 66  DT  I C5    1 
ATOM   8921  C  C7    . DT  I 5 139 ? -62.114 -45.077 68.911 1.00 94.90  ? 66  DT  I C7    1 
ATOM   8922  C  C6    . DT  I 5 139 ? -59.834 -45.712 68.203 1.00 94.57  ? 66  DT  I C6    1 
ATOM   8923  P  P     . DA  I 5 140 ? -54.245 -49.344 68.137 1.00 95.79  ? 67  DA  I P     1 
ATOM   8924  O  OP1   . DA  I 5 140 ? -54.451 -50.304 67.024 1.00 95.43  ? 67  DA  I OP1   1 
ATOM   8925  O  OP2   . DA  I 5 140 ? -53.919 -49.825 69.499 1.00 94.57  ? 67  DA  I OP2   1 
ATOM   8926  O  "O5'" . DA  I 5 140 ? -53.089 -48.316 67.700 1.00 94.76  ? 67  DA  I "O5'" 1 
ATOM   8927  C  "C5'" . DA  I 5 140 ? -53.396 -47.187 66.858 1.00 92.76  ? 67  DA  I "C5'" 1 
ATOM   8928  C  "C4'" . DA  I 5 140 ? -52.723 -45.882 67.272 1.00 91.03  ? 67  DA  I "C4'" 1 
ATOM   8929  O  "O4'" . DA  I 5 140 ? -53.719 -44.855 67.547 1.00 90.22  ? 67  DA  I "O4'" 1 
ATOM   8930  C  "C3'" . DA  I 5 140 ? -51.800 -45.904 68.489 1.00 90.11  ? 67  DA  I "C3'" 1 
ATOM   8931  O  "O3'" . DA  I 5 140 ? -50.622 -45.195 68.133 1.00 89.08  ? 67  DA  I "O3'" 1 
ATOM   8932  C  "C2'" . DA  I 5 140 ? -52.599 -45.195 69.584 1.00 89.64  ? 67  DA  I "C2'" 1 
ATOM   8933  C  "C1'" . DA  I 5 140 ? -53.467 -44.224 68.791 1.00 89.04  ? 67  DA  I "C1'" 1 
ATOM   8934  N  N9    . DA  I 5 140 ? -54.776 -43.938 69.374 1.00 88.14  ? 67  DA  I N9    1 
ATOM   8935  C  C8    . DA  I 5 140 ? -55.750 -44.852 69.654 1.00 87.94  ? 67  DA  I C8    1 
ATOM   8936  N  N7    . DA  I 5 140 ? -56.845 -44.336 70.155 1.00 87.56  ? 67  DA  I N7    1 
ATOM   8937  C  C5    . DA  I 5 140 ? -56.579 -42.982 70.208 1.00 87.41  ? 67  DA  I C5    1 
ATOM   8938  C  C6    . DA  I 5 140 ? -57.342 -41.878 70.649 1.00 87.30  ? 67  DA  I C6    1 
ATOM   8939  N  N6    . DA  I 5 140 ? -58.579 -41.986 71.134 1.00 87.08  ? 67  DA  I N6    1 
ATOM   8940  N  N1    . DA  I 5 140 ? -56.789 -40.646 70.570 1.00 87.20  ? 67  DA  I N1    1 
ATOM   8941  C  C2    . DA  I 5 140 ? -55.548 -40.533 70.085 1.00 87.11  ? 67  DA  I C2    1 
ATOM   8942  N  N3    . DA  I 5 140 ? -54.735 -41.497 69.643 1.00 87.66  ? 67  DA  I N3    1 
ATOM   8943  C  C4    . DA  I 5 140 ? -55.309 -42.714 69.728 1.00 87.78  ? 67  DA  I C4    1 
ATOM   8944  P  P     . DT  I 5 141 ? -49.316 -45.195 69.051 1.00 89.01  ? 68  DT  I P     1 
ATOM   8945  O  OP1   . DT  I 5 141 ? -48.143 -45.261 68.151 1.00 89.02  ? 68  DT  I OP1   1 
ATOM   8946  O  OP2   . DT  I 5 141 ? -49.474 -46.210 70.117 1.00 88.51  ? 68  DT  I OP2   1 
ATOM   8947  O  "O5'" . DT  I 5 141 ? -49.378 -43.740 69.713 1.00 87.16  ? 68  DT  I "O5'" 1 
ATOM   8948  C  "C5'" . DT  I 5 141 ? -49.520 -42.619 68.846 1.00 86.39  ? 68  DT  I "C5'" 1 
ATOM   8949  C  "C4'" . DT  I 5 141 ? -49.649 -41.306 69.595 1.00 85.23  ? 68  DT  I "C4'" 1 
ATOM   8950  O  "O4'" . DT  I 5 141 ? -50.984 -41.170 70.130 1.00 85.34  ? 68  DT  I "O4'" 1 
ATOM   8951  C  "C3'" . DT  I 5 141 ? -48.697 -41.106 70.772 1.00 85.23  ? 68  DT  I "C3'" 1 
ATOM   8952  O  "O3'" . DT  I 5 141 ? -48.139 -39.793 70.633 1.00 84.06  ? 68  DT  I "O3'" 1 
ATOM   8953  C  "C2'" . DT  I 5 141 ? -49.583 -41.268 72.015 1.00 85.23  ? 68  DT  I "C2'" 1 
ATOM   8954  C  "C1'" . DT  I 5 141 ? -50.930 -40.772 71.490 1.00 85.45  ? 68  DT  I "C1'" 1 
ATOM   8955  N  N1    . DT  I 5 141 ? -52.183 -41.285 72.165 1.00 85.35  ? 68  DT  I N1    1 
ATOM   8956  C  C2    . DT  I 5 141 ? -53.198 -40.389 72.465 1.00 85.69  ? 68  DT  I C2    1 
ATOM   8957  O  O2    . DT  I 5 141 ? -53.157 -39.195 72.241 1.00 86.07  ? 68  DT  I O2    1 
ATOM   8958  N  N3    . DT  I 5 141 ? -54.301 -40.941 73.062 1.00 86.18  ? 68  DT  I N3    1 
ATOM   8959  C  C4    . DT  I 5 141 ? -54.501 -42.270 73.383 1.00 85.91  ? 68  DT  I C4    1 
ATOM   8960  O  O4    . DT  I 5 141 ? -55.539 -42.641 73.914 1.00 86.41  ? 68  DT  I O4    1 
ATOM   8961  C  C5    . DT  I 5 141 ? -53.417 -43.161 73.045 1.00 85.30  ? 68  DT  I C5    1 
ATOM   8962  C  C7    . DT  I 5 141 ? -53.522 -44.624 73.342 1.00 85.26  ? 68  DT  I C7    1 
ATOM   8963  C  C6    . DT  I 5 141 ? -52.328 -42.636 72.456 1.00 85.40  ? 68  DT  I C6    1 
ATOM   8964  P  P     . DT  I 5 142 ? -46.918 -39.269 71.529 1.00 82.35  ? 69  DT  I P     1 
ATOM   8965  O  OP1   . DT  I 5 142 ? -46.180 -38.253 70.756 1.00 82.12  ? 69  DT  I OP1   1 
ATOM   8966  O  OP2   . DT  I 5 142 ? -46.213 -40.464 72.061 1.00 82.12  ? 69  DT  I OP2   1 
ATOM   8967  O  "O5'" . DT  I 5 142 ? -47.670 -38.471 72.695 1.00 81.55  ? 69  DT  I "O5'" 1 
ATOM   8968  C  "C5'" . DT  I 5 142 ? -48.694 -37.546 72.308 1.00 80.96  ? 69  DT  I "C5'" 1 
ATOM   8969  C  "C4'" . DT  I 5 142 ? -49.465 -36.972 73.486 1.00 80.39  ? 69  DT  I "C4'" 1 
ATOM   8970  O  "O4'" . DT  I 5 142 ? -50.540 -37.866 73.890 1.00 80.29  ? 69  DT  I "O4'" 1 
ATOM   8971  C  "C3'" . DT  I 5 142 ? -48.637 -36.712 74.739 1.00 79.97  ? 69  DT  I "C3'" 1 
ATOM   8972  O  "O3'" . DT  I 5 142 ? -48.959 -35.409 75.203 1.00 79.03  ? 69  DT  I "O3'" 1 
ATOM   8973  C  "C2'" . DT  I 5 142 ? -49.078 -37.818 75.705 1.00 80.62  ? 69  DT  I "C2'" 1 
ATOM   8974  C  "C1'" . DT  I 5 142 ? -50.543 -37.984 75.303 1.00 79.87  ? 69  DT  I "C1'" 1 
ATOM   8975  N  N1    . DT  I 5 142 ? -51.220 -39.280 75.614 1.00 78.57  ? 69  DT  I N1    1 
ATOM   8976  C  C2    . DT  I 5 142 ? -52.563 -39.245 75.944 1.00 78.29  ? 69  DT  I C2    1 
ATOM   8977  O  O2    . DT  I 5 142 ? -53.213 -38.214 76.021 1.00 77.69  ? 69  DT  I O2    1 
ATOM   8978  N  N3    . DT  I 5 142 ? -53.127 -40.477 76.188 1.00 78.27  ? 69  DT  I N3    1 
ATOM   8979  C  C4    . DT  I 5 142 ? -52.494 -41.707 76.134 1.00 78.92  ? 69  DT  I C4    1 
ATOM   8980  O  O4    . DT  I 5 142 ? -53.101 -42.749 76.379 1.00 80.20  ? 69  DT  I O4    1 
ATOM   8981  C  C5    . DT  I 5 142 ? -51.086 -41.671 75.785 1.00 78.23  ? 69  DT  I C5    1 
ATOM   8982  C  C7    . DT  I 5 142 ? -50.289 -42.937 75.699 1.00 77.63  ? 69  DT  I C7    1 
ATOM   8983  C  C6    . DT  I 5 142 ? -50.526 -40.477 75.538 1.00 78.27  ? 69  DT  I C6    1 
ATOM   8984  P  P     . DG  I 5 143 ? -48.012 -34.652 76.241 1.00 78.89  ? 70  DG  I P     1 
ATOM   8985  O  OP1   . DG  I 5 143 ? -47.858 -33.259 75.778 1.00 77.81  ? 70  DG  I OP1   1 
ATOM   8986  O  OP2   . DG  I 5 143 ? -46.842 -35.505 76.560 1.00 77.80  ? 70  DG  I OP2   1 
ATOM   8987  O  "O5'" . DG  I 5 143 ? -48.948 -34.576 77.523 1.00 82.12  ? 70  DG  I "O5'" 1 
ATOM   8988  C  "C5'" . DG  I 5 143 ? -50.208 -33.871 77.448 1.00 85.03  ? 70  DG  I "C5'" 1 
ATOM   8989  C  "C4'" . DG  I 5 143 ? -51.080 -34.229 78.639 1.00 86.13  ? 70  DG  I "C4'" 1 
ATOM   8990  O  "O4'" . DG  I 5 143 ? -51.546 -35.596 78.503 1.00 86.30  ? 70  DG  I "O4'" 1 
ATOM   8991  C  "C3'" . DG  I 5 143 ? -50.327 -34.170 79.962 1.00 87.28  ? 70  DG  I "C3'" 1 
ATOM   8992  O  "O3'" . DG  I 5 143 ? -51.135 -33.545 80.945 1.00 90.14  ? 70  DG  I "O3'" 1 
ATOM   8993  C  "C2'" . DG  I 5 143 ? -50.028 -35.636 80.269 1.00 86.44  ? 70  DG  I "C2'" 1 
ATOM   8994  C  "C1'" . DG  I 5 143 ? -51.293 -36.273 79.714 1.00 85.91  ? 70  DG  I "C1'" 1 
ATOM   8995  N  N9    . DG  I 5 143 ? -51.225 -37.718 79.503 1.00 85.51  ? 70  DG  I N9    1 
ATOM   8996  C  C8    . DG  I 5 143 ? -50.136 -38.493 79.152 1.00 85.31  ? 70  DG  I C8    1 
ATOM   8997  N  N7    . DG  I 5 143 ? -50.424 -39.767 79.056 1.00 85.90  ? 70  DG  I N7    1 
ATOM   8998  C  C5    . DG  I 5 143 ? -51.787 -39.842 79.368 1.00 85.48  ? 70  DG  I C5    1 
ATOM   8999  C  C6    . DG  I 5 143 ? -52.673 -40.956 79.440 1.00 84.75  ? 70  DG  I C6    1 
ATOM   9000  O  O6    . DG  I 5 143 ? -52.413 -42.150 79.229 1.00 84.69  ? 70  DG  I O6    1 
ATOM   9001  N  N1    . DG  I 5 143 ? -53.974 -40.580 79.798 1.00 84.42  ? 70  DG  I N1    1 
ATOM   9002  C  C2    . DG  I 5 143 ? -54.368 -39.285 80.060 1.00 84.83  ? 70  DG  I C2    1 
ATOM   9003  N  N2    . DG  I 5 143 ? -55.655 -39.090 80.384 1.00 85.77  ? 70  DG  I N2    1 
ATOM   9004  N  N3    . DG  I 5 143 ? -53.555 -38.237 79.997 1.00 84.80  ? 70  DG  I N3    1 
ATOM   9005  C  C4    . DG  I 5 143 ? -52.289 -38.584 79.646 1.00 85.24  ? 70  DG  I C4    1 
ATOM   9006  P  P     . DA  I 5 144 ? -50.462 -33.067 82.324 1.00 93.14  ? 71  DA  I P     1 
ATOM   9007  O  OP1   . DA  I 5 144 ? -49.714 -31.825 82.025 1.00 93.18  ? 71  DA  I OP1   1 
ATOM   9008  O  OP2   . DA  I 5 144 ? -49.737 -34.203 82.944 1.00 92.55  ? 71  DA  I OP2   1 
ATOM   9009  O  "O5'" . DA  I 5 144 ? -51.717 -32.701 83.255 1.00 93.17  ? 71  DA  I "O5'" 1 
ATOM   9010  C  "C5'" . DA  I 5 144 ? -53.063 -32.674 82.761 1.00 93.73  ? 71  DA  I "C5'" 1 
ATOM   9011  C  "C4'" . DA  I 5 144 ? -53.921 -33.707 83.477 1.00 94.10  ? 71  DA  I "C4'" 1 
ATOM   9012  O  "O4'" . DA  I 5 144 ? -53.743 -34.999 82.836 1.00 93.25  ? 71  DA  I "O4'" 1 
ATOM   9013  C  "C3'" . DA  I 5 144 ? -53.589 -33.906 84.960 1.00 94.87  ? 71  DA  I "C3'" 1 
ATOM   9014  O  "O3'" . DA  I 5 144 ? -54.740 -33.737 85.797 1.00 97.60  ? 71  DA  I "O3'" 1 
ATOM   9015  C  "C2'" . DA  I 5 144 ? -53.085 -35.339 85.040 1.00 93.87  ? 71  DA  I "C2'" 1 
ATOM   9016  C  "C1'" . DA  I 5 144 ? -53.764 -35.984 83.840 1.00 92.42  ? 71  DA  I "C1'" 1 
ATOM   9017  N  N9    . DA  I 5 144 ? -53.034 -37.175 83.428 1.00 90.64  ? 71  DA  I N9    1 
ATOM   9018  C  C8    . DA  I 5 144 ? -51.727 -37.243 83.041 1.00 90.09  ? 71  DA  I C8    1 
ATOM   9019  N  N7    . DA  I 5 144 ? -51.317 -38.455 82.745 1.00 89.65  ? 71  DA  I N7    1 
ATOM   9020  C  C5    . DA  I 5 144 ? -52.434 -39.236 82.963 1.00 89.19  ? 71  DA  I C5    1 
ATOM   9021  C  C6    . DA  I 5 144 ? -52.653 -40.615 82.833 1.00 88.84  ? 71  DA  I C6    1 
ATOM   9022  N  N6    . DA  I 5 144 ? -51.703 -41.457 82.429 1.00 88.54  ? 71  DA  I N6    1 
ATOM   9023  N  N1    . DA  I 5 144 ? -53.882 -41.089 83.134 1.00 89.65  ? 71  DA  I N1    1 
ATOM   9024  C  C2    . DA  I 5 144 ? -54.828 -40.225 83.535 1.00 89.86  ? 71  DA  I C2    1 
ATOM   9025  N  N3    . DA  I 5 144 ? -54.735 -38.903 83.694 1.00 89.53  ? 71  DA  I N3    1 
ATOM   9026  C  C4    . DA  I 5 144 ? -53.501 -38.467 83.391 1.00 89.76  ? 71  DA  I C4    1 
ATOM   9027  P  P     . DT  I 5 145 ? -54.635 -33.432 87.385 1.00 98.99  ? 72  DT  I P     1 
ATOM   9028  O  OP1   . DT  I 5 145 ? -55.701 -32.449 87.698 1.00 97.35  ? 72  DT  I OP1   1 
ATOM   9029  O  OP2   . DT  I 5 145 ? -53.223 -33.145 87.751 1.00 98.11  ? 72  DT  I OP2   1 
ATOM   9030  O  "O5'" . DT  I 5 145 ? -55.003 -34.845 88.047 1.00 99.12  ? 72  DT  I "O5'" 1 
ATOM   9031  C  "C5'" . DT  I 5 145 ? -56.276 -35.444 87.840 1.00 99.84  ? 72  DT  I "C5'" 1 
ATOM   9032  C  "C4'" . DT  I 5 145 ? -56.227 -36.888 88.298 1.00 100.77 ? 72  DT  I "C4'" 1 
ATOM   9033  O  "O4'" . DT  I 5 145 ? -55.447 -37.664 87.350 1.00 100.95 ? 72  DT  I "O4'" 1 
ATOM   9034  C  "C3'" . DT  I 5 145 ? -55.578 -37.091 89.672 1.00 101.26 ? 72  DT  I "C3'" 1 
ATOM   9035  O  "O3'" . DT  I 5 145 ? -56.469 -37.785 90.554 1.00 101.40 ? 72  DT  I "O3'" 1 
ATOM   9036  C  "C2'" . DT  I 5 145 ? -54.320 -37.906 89.372 1.00 101.17 ? 72  DT  I "C2'" 1 
ATOM   9037  C  "C1'" . DT  I 5 145 ? -54.739 -38.631 88.096 1.00 101.28 ? 72  DT  I "C1'" 1 
ATOM   9038  N  N1    . DT  I 5 145 ? -53.599 -39.218 87.314 1.00 101.34 ? 72  DT  I N1    1 
ATOM   9039  C  C2    . DT  I 5 145 ? -53.648 -40.553 86.952 1.00 101.38 ? 72  DT  I C2    1 
ATOM   9040  O  O2    . DT  I 5 145 ? -54.577 -41.298 87.217 1.00 101.91 ? 72  DT  I O2    1 
ATOM   9041  N  N3    . DT  I 5 145 ? -52.551 -40.995 86.254 1.00 101.35 ? 72  DT  I N3    1 
ATOM   9042  C  C4    . DT  I 5 145 ? -51.437 -40.254 85.895 1.00 101.56 ? 72  DT  I C4    1 
ATOM   9043  O  O4    . DT  I 5 145 ? -50.513 -40.759 85.263 1.00 102.60 ? 72  DT  I O4    1 
ATOM   9044  C  C5    . DT  I 5 145 ? -51.445 -38.864 86.301 1.00 100.97 ? 72  DT  I C5    1 
ATOM   9045  C  C7    . DT  I 5 145 ? -50.295 -37.955 85.975 1.00 100.40 ? 72  DT  I C7    1 
ATOM   9046  C  C6    . DT  I 5 145 ? -52.510 -38.423 86.986 1.00 101.24 ? 72  DT  I C6    1 
ATOM   9047  O  "O5'" . DA  J 6 1   ? -50.445 -51.442 83.871 1.00 121.61 ? -72 DA  J "O5'" 1 
ATOM   9048  C  "C5'" . DA  J 6 1   ? -51.813 -51.798 84.098 1.00 121.36 ? -72 DA  J "C5'" 1 
ATOM   9049  C  "C4'" . DA  J 6 1   ? -52.456 -50.959 85.198 1.00 120.98 ? -72 DA  J "C4'" 1 
ATOM   9050  O  "O4'" . DA  J 6 1   ? -51.500 -50.051 85.804 1.00 120.72 ? -72 DA  J "O4'" 1 
ATOM   9051  C  "C3'" . DA  J 6 1   ? -53.562 -50.021 84.738 1.00 120.88 ? -72 DA  J "C3'" 1 
ATOM   9052  O  "O3'" . DA  J 6 1   ? -54.785 -50.730 84.548 1.00 121.29 ? -72 DA  J "O3'" 1 
ATOM   9053  C  "C2'" . DA  J 6 1   ? -53.646 -49.049 85.914 1.00 120.56 ? -72 DA  J "C2'" 1 
ATOM   9054  C  "C1'" . DA  J 6 1   ? -52.210 -48.990 86.430 1.00 120.23 ? -72 DA  J "C1'" 1 
ATOM   9055  N  N9    . DA  J 6 1   ? -51.528 -47.711 86.186 1.00 119.56 ? -72 DA  J N9    1 
ATOM   9056  C  C8    . DA  J 6 1   ? -50.305 -47.546 85.591 1.00 119.10 ? -72 DA  J C8    1 
ATOM   9057  N  N7    . DA  J 6 1   ? -49.915 -46.298 85.499 1.00 118.51 ? -72 DA  J N7    1 
ATOM   9058  C  C5    . DA  J 6 1   ? -50.953 -45.582 86.070 1.00 118.19 ? -72 DA  J C5    1 
ATOM   9059  C  C6    . DA  J 6 1   ? -51.150 -44.198 86.272 1.00 117.43 ? -72 DA  J C6    1 
ATOM   9060  N  N6    . DA  J 6 1   ? -50.260 -43.278 85.903 1.00 116.58 ? -72 DA  J N6    1 
ATOM   9061  N  N1    . DA  J 6 1   ? -52.294 -43.795 86.871 1.00 117.40 ? -72 DA  J N1    1 
ATOM   9062  C  C2    . DA  J 6 1   ? -53.185 -44.727 87.241 1.00 118.11 ? -72 DA  J C2    1 
ATOM   9063  N  N3    . DA  J 6 1   ? -53.112 -46.058 87.103 1.00 118.70 ? -72 DA  J N3    1 
ATOM   9064  C  C4    . DA  J 6 1   ? -51.959 -46.432 86.505 1.00 118.91 ? -72 DA  J C4    1 
ATOM   9065  P  P     . DT  J 6 2   ? -56.119 -49.980 84.055 1.00 121.81 ? -71 DT  J P     1 
ATOM   9066  O  OP1   . DT  J 6 2   ? -57.158 -51.016 83.853 1.00 122.31 ? -71 DT  J OP1   1 
ATOM   9067  O  OP2   . DT  J 6 2   ? -55.775 -49.099 82.913 1.00 121.44 ? -71 DT  J OP2   1 
ATOM   9068  O  "O5'" . DT  J 6 2   ? -56.489 -49.072 85.328 1.00 121.47 ? -71 DT  J "O5'" 1 
ATOM   9069  C  "C5'" . DT  J 6 2   ? -57.789 -49.047 85.929 1.00 121.14 ? -71 DT  J "C5'" 1 
ATOM   9070  C  "C4'" . DT  J 6 2   ? -58.488 -47.748 85.583 1.00 120.65 ? -71 DT  J "C4'" 1 
ATOM   9071  O  "O4'" . DT  J 6 2   ? -57.522 -46.667 85.679 1.00 120.47 ? -71 DT  J "O4'" 1 
ATOM   9072  C  "C3'" . DT  J 6 2   ? -59.054 -47.715 84.160 1.00 120.77 ? -71 DT  J "C3'" 1 
ATOM   9073  O  "O3'" . DT  J 6 2   ? -60.468 -47.422 84.068 1.00 120.92 ? -71 DT  J "O3'" 1 
ATOM   9074  C  "C2'" . DT  J 6 2   ? -58.192 -46.707 83.405 1.00 120.64 ? -71 DT  J "C2'" 1 
ATOM   9075  C  "C1'" . DT  J 6 2   ? -57.581 -45.858 84.517 1.00 120.27 ? -71 DT  J "C1'" 1 
ATOM   9076  N  N1    . DT  J 6 2   ? -56.233 -45.297 84.127 1.00 119.64 ? -71 DT  J N1    1 
ATOM   9077  C  C2    . DT  J 6 2   ? -56.065 -43.924 84.056 1.00 119.22 ? -71 DT  J C2    1 
ATOM   9078  O  O2    . DT  J 6 2   ? -56.943 -43.118 84.314 1.00 119.09 ? -71 DT  J O2    1 
ATOM   9079  N  N3    . DT  J 6 2   ? -54.808 -43.520 83.676 1.00 118.87 ? -71 DT  J N3    1 
ATOM   9080  C  C4    . DT  J 6 2   ? -53.726 -44.326 83.355 1.00 118.96 ? -71 DT  J C4    1 
ATOM   9081  O  O4    . DT  J 6 2   ? -52.640 -43.859 83.026 1.00 118.73 ? -71 DT  J O4    1 
ATOM   9082  C  C5    . DT  J 6 2   ? -53.964 -45.750 83.439 1.00 118.97 ? -71 DT  J C5    1 
ATOM   9083  C  C7    . DT  J 6 2   ? -52.868 -46.725 83.112 1.00 118.44 ? -71 DT  J C7    1 
ATOM   9084  C  C6    . DT  J 6 2   ? -55.188 -46.157 83.813 1.00 119.34 ? -71 DT  J C6    1 
ATOM   9085  P  P     . DC  J 6 3   ? -61.260 -46.221 84.790 1.00 120.90 ? -70 DC  J P     1 
ATOM   9086  O  OP1   . DC  J 6 3   ? -61.153 -46.439 86.255 1.00 121.08 ? -70 DC  J OP1   1 
ATOM   9087  O  OP2   . DC  J 6 3   ? -62.594 -46.159 84.143 1.00 120.65 ? -70 DC  J OP2   1 
ATOM   9088  O  "O5'" . DC  J 6 3   ? -60.493 -44.868 84.400 1.00 119.16 ? -70 DC  J "O5'" 1 
ATOM   9089  C  "C5'" . DC  J 6 3   ? -60.974 -43.609 84.878 1.00 116.89 ? -70 DC  J "C5'" 1 
ATOM   9090  C  "C4'" . DC  J 6 3   ? -60.938 -42.540 83.797 1.00 115.21 ? -70 DC  J "C4'" 1 
ATOM   9091  O  "O4'" . DC  J 6 3   ? -59.609 -42.462 83.219 1.00 114.47 ? -70 DC  J "O4'" 1 
ATOM   9092  C  "C3'" . DC  J 6 3   ? -61.896 -42.720 82.620 1.00 114.25 ? -70 DC  J "C3'" 1 
ATOM   9093  O  "O3'" . DC  J 6 3   ? -62.395 -41.429 82.275 1.00 113.21 ? -70 DC  J "O3'" 1 
ATOM   9094  C  "C2'" . DC  J 6 3   ? -60.983 -43.269 81.528 1.00 114.11 ? -70 DC  J "C2'" 1 
ATOM   9095  C  "C1'" . DC  J 6 3   ? -59.730 -42.441 81.813 1.00 113.96 ? -70 DC  J "C1'" 1 
ATOM   9096  N  N1    . DC  J 6 3   ? -58.441 -42.937 81.235 1.00 113.28 ? -70 DC  J N1    1 
ATOM   9097  C  C2    . DC  J 6 3   ? -57.347 -42.056 81.129 1.00 112.71 ? -70 DC  J C2    1 
ATOM   9098  O  O2    . DC  J 6 3   ? -57.461 -40.882 81.507 1.00 111.72 ? -70 DC  J O2    1 
ATOM   9099  N  N3    . DC  J 6 3   ? -56.182 -42.524 80.605 1.00 112.75 ? -70 DC  J N3    1 
ATOM   9100  C  C4    . DC  J 6 3   ? -56.089 -43.801 80.202 1.00 113.30 ? -70 DC  J C4    1 
ATOM   9101  N  N4    . DC  J 6 3   ? -54.926 -44.222 79.692 1.00 113.01 ? -70 DC  J N4    1 
ATOM   9102  C  C5    . DC  J 6 3   ? -57.190 -44.710 80.302 1.00 113.38 ? -70 DC  J C5    1 
ATOM   9103  C  C6    . DC  J 6 3   ? -58.331 -44.239 80.819 1.00 113.26 ? -70 DC  J C6    1 
ATOM   9104  P  P     . DA  J 6 4   ? -63.658 -41.222 81.307 1.00 112.54 ? -69 DA  J P     1 
ATOM   9105  O  OP1   . DA  J 6 4   ? -64.858 -41.526 82.117 1.00 112.36 ? -69 DA  J OP1   1 
ATOM   9106  O  OP2   . DA  J 6 4   ? -63.410 -41.954 80.036 1.00 112.16 ? -69 DA  J OP2   1 
ATOM   9107  O  "O5'" . DA  J 6 4   ? -63.667 -39.647 80.984 1.00 110.58 ? -69 DA  J "O5'" 1 
ATOM   9108  C  "C5'" . DA  J 6 4   ? -62.621 -38.757 81.423 1.00 107.70 ? -69 DA  J "C5'" 1 
ATOM   9109  C  "C4'" . DA  J 6 4   ? -61.776 -38.192 80.282 1.00 105.05 ? -69 DA  J "C4'" 1 
ATOM   9110  O  "O4'" . DA  J 6 4   ? -60.598 -39.008 80.035 1.00 103.78 ? -69 DA  J "O4'" 1 
ATOM   9111  C  "C3'" . DA  J 6 4   ? -62.451 -38.043 78.918 1.00 104.00 ? -69 DA  J "C3'" 1 
ATOM   9112  O  "O3'" . DA  J 6 4   ? -62.061 -36.802 78.365 1.00 103.38 ? -69 DA  J "O3'" 1 
ATOM   9113  C  "C2'" . DA  J 6 4   ? -61.852 -39.184 78.107 1.00 103.17 ? -69 DA  J "C2'" 1 
ATOM   9114  C  "C1'" . DA  J 6 4   ? -60.432 -39.050 78.633 1.00 102.13 ? -69 DA  J "C1'" 1 
ATOM   9115  N  N9    . DA  J 6 4   ? -59.504 -40.110 78.264 1.00 100.30 ? -69 DA  J N9    1 
ATOM   9116  C  C8    . DA  J 6 4   ? -59.726 -41.459 78.220 1.00 99.75  ? -69 DA  J C8    1 
ATOM   9117  N  N7    . DA  J 6 4   ? -58.679 -42.152 77.843 1.00 99.06  ? -69 DA  J N7    1 
ATOM   9118  C  C5    . DA  J 6 4   ? -57.709 -41.187 77.626 1.00 98.39  ? -69 DA  J C5    1 
ATOM   9119  C  C6    . DA  J 6 4   ? -56.368 -41.260 77.210 1.00 97.34  ? -69 DA  J C6    1 
ATOM   9120  N  N6    . DA  J 6 4   ? -55.752 -42.409 76.932 1.00 96.55  ? -69 DA  J N6    1 
ATOM   9121  N  N1    . DA  J 6 4   ? -55.683 -40.103 77.093 1.00 96.93  ? -69 DA  J N1    1 
ATOM   9122  C  C2    . DA  J 6 4   ? -56.293 -38.945 77.372 1.00 96.92  ? -69 DA  J C2    1 
ATOM   9123  N  N3    . DA  J 6 4   ? -57.543 -38.747 77.775 1.00 97.81  ? -69 DA  J N3    1 
ATOM   9124  C  C4    . DA  J 6 4   ? -58.200 -39.919 77.881 1.00 99.06  ? -69 DA  J C4    1 
ATOM   9125  P  P     . DA  J 6 5   ? -63.121 -35.618 78.233 1.00 103.31 ? -68 DA  J P     1 
ATOM   9126  O  OP1   . DA  J 6 5   ? -63.506 -35.220 79.607 1.00 103.19 ? -68 DA  J OP1   1 
ATOM   9127  O  OP2   . DA  J 6 5   ? -64.136 -36.053 77.245 1.00 103.61 ? -68 DA  J OP2   1 
ATOM   9128  O  "O5'" . DA  J 6 5   ? -62.304 -34.416 77.554 1.00 103.14 ? -68 DA  J "O5'" 1 
ATOM   9129  C  "C5'" . DA  J 6 5   ? -61.002 -34.017 78.027 1.00 101.67 ? -68 DA  J "C5'" 1 
ATOM   9130  C  "C4'" . DA  J 6 5   ? -59.971 -33.945 76.905 1.00 99.85  ? -68 DA  J "C4'" 1 
ATOM   9131  O  "O4'" . DA  J 6 5   ? -59.337 -35.231 76.670 1.00 99.31  ? -68 DA  J "O4'" 1 
ATOM   9132  C  "C3'" . DA  J 6 5   ? -60.500 -33.454 75.561 1.00 99.19  ? -68 DA  J "C3'" 1 
ATOM   9133  O  "O3'" . DA  J 6 5   ? -59.783 -32.265 75.250 1.00 99.38  ? -68 DA  J "O3'" 1 
ATOM   9134  C  "C2'" . DA  J 6 5   ? -60.259 -34.616 74.592 1.00 98.14  ? -68 DA  J "C2'" 1 
ATOM   9135  C  "C1'" . DA  J 6 5   ? -59.151 -35.411 75.283 1.00 98.39  ? -68 DA  J "C1'" 1 
ATOM   9136  N  N9    . DA  J 6 5   ? -59.134 -36.856 75.042 1.00 97.54  ? -68 DA  J N9    1 
ATOM   9137  C  C8    . DA  J 6 5   ? -60.166 -37.740 75.205 1.00 97.82  ? -68 DA  J C8    1 
ATOM   9138  N  N7    . DA  J 6 5   ? -59.860 -38.988 74.918 1.00 97.15  ? -68 DA  J N7    1 
ATOM   9139  C  C5    . DA  J 6 5   ? -58.527 -38.922 74.548 1.00 96.33  ? -68 DA  J C5    1 
ATOM   9140  C  C6    . DA  J 6 5   ? -57.601 -39.906 74.133 1.00 95.80  ? -68 DA  J C6    1 
ATOM   9141  N  N6    . DA  J 6 5   ? -57.901 -41.200 74.014 1.00 95.45  ? -68 DA  J N6    1 
ATOM   9142  N  N1    . DA  J 6 5   ? -56.345 -39.512 73.837 1.00 95.39  ? -68 DA  J N1    1 
ATOM   9143  C  C2    . DA  J 6 5   ? -56.040 -38.212 73.950 1.00 95.86  ? -68 DA  J C2    1 
ATOM   9144  N  N3    . DA  J 6 5   ? -56.823 -37.197 74.331 1.00 96.09  ? -68 DA  J N3    1 
ATOM   9145  C  C4    . DA  J 6 5   ? -58.065 -37.618 74.621 1.00 96.51  ? -68 DA  J C4    1 
ATOM   9146  P  P     . DT  J 6 6   ? -60.208 -31.273 74.063 1.00 99.72  ? -67 DT  J P     1 
ATOM   9147  O  OP1   . DT  J 6 6   ? -59.818 -29.901 74.464 1.00 98.60  ? -67 DT  J OP1   1 
ATOM   9148  O  OP2   . DT  J 6 6   ? -61.597 -31.579 73.643 1.00 99.65  ? -67 DT  J OP2   1 
ATOM   9149  O  "O5'" . DT  J 6 6   ? -59.250 -31.762 72.880 1.00 98.81  ? -67 DT  J "O5'" 1 
ATOM   9150  C  "C5'" . DT  J 6 6   ? -57.847 -31.937 73.098 1.00 96.46  ? -67 DT  J "C5'" 1 
ATOM   9151  C  "C4'" . DT  J 6 6   ? -57.236 -32.820 72.024 1.00 94.53  ? -67 DT  J "C4'" 1 
ATOM   9152  O  "O4'" . DT  J 6 6   ? -57.560 -34.210 72.253 1.00 94.15  ? -67 DT  J "O4'" 1 
ATOM   9153  C  "C3'" . DT  J 6 6   ? -57.688 -32.507 70.599 1.00 93.69  ? -67 DT  J "C3'" 1 
ATOM   9154  O  "O3'" . DT  J 6 6   ? -56.593 -31.819 69.976 1.00 92.55  ? -67 DT  J "O3'" 1 
ATOM   9155  C  "C2'" . DT  J 6 6   ? -58.048 -33.868 69.994 1.00 93.32  ? -67 DT  J "C2'" 1 
ATOM   9156  C  "C1'" . DT  J 6 6   ? -57.477 -34.858 71.004 1.00 93.56  ? -67 DT  J "C1'" 1 
ATOM   9157  N  N1    . DT  J 6 6   ? -58.198 -36.170 71.082 1.00 93.22  ? -67 DT  J N1    1 
ATOM   9158  C  C2    . DT  J 6 6   ? -57.519 -37.339 70.784 1.00 93.05  ? -67 DT  J C2    1 
ATOM   9159  O  O2    . DT  J 6 6   ? -56.349 -37.375 70.451 1.00 92.99  ? -67 DT  J O2    1 
ATOM   9160  N  N3    . DT  J 6 6   ? -58.269 -38.489 70.883 1.00 93.04  ? -67 DT  J N3    1 
ATOM   9161  C  C4    . DT  J 6 6   ? -59.601 -38.585 71.248 1.00 93.13  ? -67 DT  J C4    1 
ATOM   9162  O  O4    . DT  J 6 6   ? -60.163 -39.672 71.303 1.00 92.90  ? -67 DT  J O4    1 
ATOM   9163  C  C5    . DT  J 6 6   ? -60.258 -37.325 71.550 1.00 93.34  ? -67 DT  J C5    1 
ATOM   9164  C  C7    . DT  J 6 6   ? -61.703 -37.272 71.961 1.00 93.58  ? -67 DT  J C7    1 
ATOM   9165  C  C6    . DT  J 6 6   ? -59.535 -36.197 71.451 1.00 93.31  ? -67 DT  J C6    1 
ATOM   9166  P  P     . DA  J 6 7   ? -56.319 -31.663 68.403 1.00 90.92  ? -66 DA  J P     1 
ATOM   9167  O  OP1   . DA  J 6 7   ? -55.499 -30.431 68.307 1.00 90.33  ? -66 DA  J OP1   1 
ATOM   9168  O  OP2   . DA  J 6 7   ? -57.566 -31.798 67.605 1.00 90.07  ? -66 DA  J OP2   1 
ATOM   9169  O  "O5'" . DA  J 6 7   ? -55.415 -32.938 68.091 1.00 89.27  ? -66 DA  J "O5'" 1 
ATOM   9170  C  "C5'" . DA  J 6 7   ? -54.149 -33.069 68.705 1.00 87.93  ? -66 DA  J "C5'" 1 
ATOM   9171  C  "C4'" . DA  J 6 7   ? -53.468 -34.323 68.203 1.00 87.49  ? -66 DA  J "C4'" 1 
ATOM   9172  O  "O4'" . DA  J 6 7   ? -54.294 -35.481 68.513 1.00 87.70  ? -66 DA  J "O4'" 1 
ATOM   9173  C  "C3'" . DA  J 6 7   ? -53.243 -34.342 66.697 1.00 86.93  ? -66 DA  J "C3'" 1 
ATOM   9174  O  "O3'" . DA  J 6 7   ? -51.984 -34.968 66.388 1.00 85.89  ? -66 DA  J "O3'" 1 
ATOM   9175  C  "C2'" . DA  J 6 7   ? -54.450 -35.141 66.202 1.00 87.37  ? -66 DA  J "C2'" 1 
ATOM   9176  C  "C1'" . DA  J 6 7   ? -54.627 -36.170 67.321 1.00 87.67  ? -66 DA  J "C1'" 1 
ATOM   9177  N  N9    . DA  J 6 7   ? -55.982 -36.745 67.390 1.00 87.79  ? -66 DA  J N9    1 
ATOM   9178  C  C8    . DA  J 6 7   ? -57.159 -36.061 67.570 1.00 87.73  ? -66 DA  J C8    1 
ATOM   9179  N  N7    . DA  J 6 7   ? -58.231 -36.822 67.576 1.00 87.09  ? -66 DA  J N7    1 
ATOM   9180  C  C5    . DA  J 6 7   ? -57.732 -38.096 67.380 1.00 87.07  ? -66 DA  J C5    1 
ATOM   9181  C  C6    . DA  J 6 7   ? -58.362 -39.357 67.293 1.00 87.13  ? -66 DA  J C6    1 
ATOM   9182  N  N6    . DA  J 6 7   ? -59.684 -39.510 67.397 1.00 87.06  ? -66 DA  J N6    1 
ATOM   9183  N  N1    . DA  J 6 7   ? -57.587 -40.448 67.094 1.00 86.81  ? -66 DA  J N1    1 
ATOM   9184  C  C2    . DA  J 6 7   ? -56.262 -40.275 66.995 1.00 86.90  ? -66 DA  J C2    1 
ATOM   9185  N  N3    . DA  J 6 7   ? -55.556 -39.141 67.064 1.00 86.68  ? -66 DA  J N3    1 
ATOM   9186  C  C4    . DA  J 6 7   ? -56.350 -38.074 67.261 1.00 87.01  ? -66 DA  J C4    1 
ATOM   9187  P  P     . DT  J 6 8   ? -51.478 -35.085 64.872 1.00 84.03  ? -65 DT  J P     1 
ATOM   9188  O  OP1   . DT  J 6 8   ? -50.010 -35.231 64.900 1.00 84.80  ? -65 DT  J OP1   1 
ATOM   9189  O  OP2   . DT  J 6 8   ? -52.119 -34.006 64.088 1.00 83.52  ? -65 DT  J OP2   1 
ATOM   9190  O  "O5'" . DT  J 6 8   ? -52.054 -36.490 64.406 1.00 84.71  ? -65 DT  J "O5'" 1 
ATOM   9191  C  "C5'" . DT  J 6 8   ? -51.650 -37.644 65.135 1.00 86.54  ? -65 DT  J "C5'" 1 
ATOM   9192  C  "C4'" . DT  J 6 8   ? -52.064 -38.932 64.441 1.00 87.40  ? -65 DT  J "C4'" 1 
ATOM   9193  O  "O4'" . DT  J 6 8   ? -53.467 -39.193 64.701 1.00 87.52  ? -65 DT  J "O4'" 1 
ATOM   9194  C  "C3'" . DT  J 6 8   ? -51.906 -38.980 62.923 1.00 87.32  ? -65 DT  J "C3'" 1 
ATOM   9195  O  "O3'" . DT  J 6 8   ? -51.356 -40.258 62.639 1.00 87.86  ? -65 DT  J "O3'" 1 
ATOM   9196  C  "C2'" . DT  J 6 8   ? -53.340 -38.807 62.410 1.00 87.16  ? -65 DT  J "C2'" 1 
ATOM   9197  C  "C1'" . DT  J 6 8   ? -54.105 -39.563 63.495 1.00 87.03  ? -65 DT  J "C1'" 1 
ATOM   9198  N  N1    . DT  J 6 8   ? -55.581 -39.300 63.664 1.00 86.47  ? -65 DT  J N1    1 
ATOM   9199  C  C2    . DT  J 6 8   ? -56.428 -40.371 63.918 1.00 85.88  ? -65 DT  J C2    1 
ATOM   9200  O  O2    . DT  J 6 8   ? -56.053 -41.530 64.002 1.00 86.44  ? -65 DT  J O2    1 
ATOM   9201  N  N3    . DT  J 6 8   ? -57.750 -40.042 64.080 1.00 84.94  ? -65 DT  J N3    1 
ATOM   9202  C  C4    . DT  J 6 8   ? -58.304 -38.776 64.013 1.00 85.75  ? -65 DT  J C4    1 
ATOM   9203  O  O4    . DT  J 6 8   ? -59.506 -38.578 64.168 1.00 85.41  ? -65 DT  J O4    1 
ATOM   9204  C  C5    . DT  J 6 8   ? -57.371 -37.703 63.749 1.00 86.31  ? -65 DT  J C5    1 
ATOM   9205  C  C7    . DT  J 6 8   ? -57.861 -36.285 63.660 1.00 86.46  ? -65 DT  J C7    1 
ATOM   9206  C  C6    . DT  J 6 8   ? -56.070 -38.007 63.595 1.00 86.30  ? -65 DT  J C6    1 
ATOM   9207  P  P     . DC  J 6 9   ? -50.748 -40.672 61.221 1.00 88.00  ? -64 DC  J P     1 
ATOM   9208  O  OP1   . DC  J 6 9   ? -49.414 -41.242 61.499 1.00 87.35  ? -64 DC  J OP1   1 
ATOM   9209  O  OP2   . DC  J 6 9   ? -50.948 -39.549 60.270 1.00 87.55  ? -64 DC  J OP2   1 
ATOM   9210  O  "O5'" . DC  J 6 9   ? -51.696 -41.874 60.753 1.00 88.83  ? -64 DC  J "O5'" 1 
ATOM   9211  C  "C5'" . DC  J 6 9   ? -51.819 -43.074 61.516 1.00 89.79  ? -64 DC  J "C5'" 1 
ATOM   9212  C  "C4'" . DC  J 6 9   ? -53.039 -43.850 61.052 1.00 90.89  ? -64 DC  J "C4'" 1 
ATOM   9213  O  "O4'" . DC  J 6 9   ? -54.233 -43.188 61.529 1.00 90.48  ? -64 DC  J "O4'" 1 
ATOM   9214  C  "C3'" . DC  J 6 9   ? -53.180 -43.929 59.534 1.00 91.54  ? -64 DC  J "C3'" 1 
ATOM   9215  O  "O3'" . DC  J 6 9   ? -52.823 -45.231 59.089 1.00 93.12  ? -64 DC  J "O3'" 1 
ATOM   9216  C  "C2'" . DC  J 6 9   ? -54.644 -43.623 59.229 1.00 91.03  ? -64 DC  J "C2'" 1 
ATOM   9217  C  "C1'" . DC  J 6 9   ? -55.274 -43.385 60.593 1.00 90.29  ? -64 DC  J "C1'" 1 
ATOM   9218  N  N1    . DC  J 6 9   ? -56.167 -42.192 60.622 1.00 89.49  ? -64 DC  J N1    1 
ATOM   9219  C  C2    . DC  J 6 9   ? -57.539 -42.379 60.850 1.00 89.56  ? -64 DC  J C2    1 
ATOM   9220  O  O2    . DC  J 6 9   ? -57.971 -43.531 61.013 1.00 90.35  ? -64 DC  J O2    1 
ATOM   9221  N  N3    . DC  J 6 9   ? -58.357 -41.289 60.886 1.00 88.60  ? -64 DC  J N3    1 
ATOM   9222  C  C4    . DC  J 6 9   ? -57.849 -40.067 60.704 1.00 87.63  ? -64 DC  J C4    1 
ATOM   9223  N  N4    . DC  J 6 9   ? -58.686 -39.028 60.746 1.00 86.51  ? -64 DC  J N4    1 
ATOM   9224  C  C5    . DC  J 6 9   ? -56.455 -39.862 60.465 1.00 88.24  ? -64 DC  J C5    1 
ATOM   9225  C  C6    . DC  J 6 9   ? -55.656 -40.937 60.436 1.00 88.42  ? -64 DC  J C6    1 
ATOM   9226  P  P     . DC  J 6 10  ? -52.624 -45.522 57.524 1.00 94.52  ? -63 DC  J P     1 
ATOM   9227  O  OP1   . DC  J 6 10  ? -51.596 -46.583 57.385 1.00 93.87  ? -63 DC  J OP1   1 
ATOM   9228  O  OP2   . DC  J 6 10  ? -52.457 -44.229 56.812 1.00 94.81  ? -63 DC  J OP2   1 
ATOM   9229  O  "O5'" . DC  J 6 10  ? -54.053 -46.119 57.116 1.00 94.65  ? -63 DC  J "O5'" 1 
ATOM   9230  C  "C5'" . DC  J 6 10  ? -54.721 -47.058 57.956 1.00 95.04  ? -63 DC  J "C5'" 1 
ATOM   9231  C  "C4'" . DC  J 6 10  ? -56.143 -47.251 57.471 1.00 95.45  ? -63 DC  J "C4'" 1 
ATOM   9232  O  "O4'" . DC  J 6 10  ? -56.986 -46.197 58.006 1.00 94.56  ? -63 DC  J "O4'" 1 
ATOM   9233  C  "C3'" . DC  J 6 10  ? -56.278 -47.242 55.946 1.00 95.85  ? -63 DC  J "C3'" 1 
ATOM   9234  O  "O3'" . DC  J 6 10  ? -56.695 -48.535 55.497 1.00 96.96  ? -63 DC  J "O3'" 1 
ATOM   9235  C  "C2'" . DC  J 6 10  ? -57.289 -46.135 55.644 1.00 95.01  ? -63 DC  J "C2'" 1 
ATOM   9236  C  "C1'" . DC  J 6 10  ? -57.892 -45.796 57.005 1.00 94.25  ? -63 DC  J "C1'" 1 
ATOM   9237  N  N1    . DC  J 6 10  ? -58.151 -44.348 57.173 1.00 93.16  ? -63 DC  J N1    1 
ATOM   9238  C  C2    . DC  J 6 10  ? -59.387 -43.946 57.695 1.00 93.69  ? -63 DC  J C2    1 
ATOM   9239  O  O2    . DC  J 6 10  ? -60.223 -44.811 58.008 1.00 94.04  ? -63 DC  J O2    1 
ATOM   9240  N  N3    . DC  J 6 10  ? -59.630 -42.612 57.842 1.00 93.23  ? -63 DC  J N3    1 
ATOM   9241  C  C4    . DC  J 6 10  ? -58.698 -41.716 57.491 1.00 92.49  ? -63 DC  J C4    1 
ATOM   9242  N  N4    . DC  J 6 10  ? -58.986 -40.421 57.659 1.00 91.26  ? -63 DC  J N4    1 
ATOM   9243  C  C5    . DC  J 6 10  ? -57.434 -42.115 56.953 1.00 92.31  ? -63 DC  J C5    1 
ATOM   9244  C  C6    . DC  J 6 10  ? -57.207 -43.427 56.813 1.00 92.33  ? -63 DC  J C6    1 
ATOM   9245  P  P     . DA  J 6 11  ? -57.180 -48.852 53.996 1.00 98.16  ? -62 DA  J P     1 
ATOM   9246  O  OP1   . DA  J 6 11  ? -57.193 -50.330 53.881 1.00 97.50  ? -62 DA  J OP1   1 
ATOM   9247  O  OP2   . DA  J 6 11  ? -56.422 -48.040 53.009 1.00 97.07  ? -62 DA  J OP2   1 
ATOM   9248  O  "O5'" . DA  J 6 11  ? -58.690 -48.314 54.026 1.00 98.03  ? -62 DA  J "O5'" 1 
ATOM   9249  C  "C5'" . DA  J 6 11  ? -59.696 -49.051 54.725 1.00 97.59  ? -62 DA  J "C5'" 1 
ATOM   9250  C  "C4'" . DA  J 6 11  ? -61.071 -48.726 54.169 1.00 96.93  ? -62 DA  J "C4'" 1 
ATOM   9251  O  "O4'" . DA  J 6 11  ? -61.455 -47.414 54.647 1.00 96.11  ? -62 DA  J "O4'" 1 
ATOM   9252  C  "C3'" . DA  J 6 11  ? -61.147 -48.695 52.644 1.00 96.59  ? -62 DA  J "C3'" 1 
ATOM   9253  O  "O3'" . DA  J 6 11  ? -62.287 -49.449 52.183 1.00 97.08  ? -62 DA  J "O3'" 1 
ATOM   9254  C  "C2'" . DA  J 6 11  ? -61.213 -47.205 52.307 1.00 95.79  ? -62 DA  J "C2'" 1 
ATOM   9255  C  "C1'" . DA  J 6 11  ? -61.783 -46.571 53.569 1.00 95.66  ? -62 DA  J "C1'" 1 
ATOM   9256  N  N9    . DA  J 6 11  ? -61.211 -45.261 53.865 1.00 95.35  ? -62 DA  J N9    1 
ATOM   9257  C  C8    . DA  J 6 11  ? -59.882 -44.928 53.876 1.00 95.37  ? -62 DA  J C8    1 
ATOM   9258  N  N7    . DA  J 6 11  ? -59.654 -43.669 54.174 1.00 94.93  ? -62 DA  J N7    1 
ATOM   9259  C  C5    . DA  J 6 11  ? -60.918 -43.139 54.371 1.00 94.33  ? -62 DA  J C5    1 
ATOM   9260  C  C6    . DA  J 6 11  ? -61.362 -41.843 54.714 1.00 94.01  ? -62 DA  J C6    1 
ATOM   9261  N  N6    . DA  J 6 11  ? -60.525 -40.825 54.921 1.00 93.69  ? -62 DA  J N6    1 
ATOM   9262  N  N1    . DA  J 6 11  ? -62.696 -41.632 54.832 1.00 93.73  ? -62 DA  J N1    1 
ATOM   9263  C  C2    . DA  J 6 11  ? -63.523 -42.669 54.620 1.00 94.33  ? -62 DA  J C2    1 
ATOM   9264  N  N3    . DA  J 6 11  ? -63.225 -43.933 54.295 1.00 94.16  ? -62 DA  J N3    1 
ATOM   9265  C  C4    . DA  J 6 11  ? -61.893 -44.106 54.184 1.00 94.65  ? -62 DA  J C4    1 
ATOM   9266  P  P     . DC  J 6 12  ? -62.662 -49.596 50.619 1.00 97.65  ? -61 DC  J P     1 
ATOM   9267  O  OP1   . DC  J 6 12  ? -63.127 -50.982 50.367 1.00 97.93  ? -61 DC  J OP1   1 
ATOM   9268  O  OP2   . DC  J 6 12  ? -61.538 -49.094 49.785 1.00 97.60  ? -61 DC  J OP2   1 
ATOM   9269  O  "O5'" . DC  J 6 12  ? -63.906 -48.587 50.467 1.00 97.49  ? -61 DC  J "O5'" 1 
ATOM   9270  C  "C5'" . DC  J 6 12  ? -64.694 -48.125 51.584 1.00 98.24  ? -61 DC  J "C5'" 1 
ATOM   9271  C  "C4'" . DC  J 6 12  ? -65.455 -46.867 51.182 1.00 99.31  ? -61 DC  J "C4'" 1 
ATOM   9272  O  "O4'" . DC  J 6 12  ? -64.683 -45.713 51.608 1.00 99.77  ? -61 DC  J "O4'" 1 
ATOM   9273  C  "C3'" . DC  J 6 12  ? -65.673 -46.686 49.674 1.00 100.16 ? -61 DC  J "C3'" 1 
ATOM   9274  O  "O3'" . DC  J 6 12  ? -67.020 -46.266 49.388 1.00 101.68 ? -61 DC  J "O3'" 1 
ATOM   9275  C  "C2'" . DC  J 6 12  ? -64.638 -45.625 49.285 1.00 99.98  ? -61 DC  J "C2'" 1 
ATOM   9276  C  "C1'" . DC  J 6 12  ? -64.642 -44.769 50.548 1.00 99.41  ? -61 DC  J "C1'" 1 
ATOM   9277  N  N1    . DC  J 6 12  ? -63.465 -43.825 50.699 1.00 98.48  ? -61 DC  J N1    1 
ATOM   9278  C  C2    . DC  J 6 12  ? -63.676 -42.488 51.109 1.00 97.75  ? -61 DC  J C2    1 
ATOM   9279  O  O2    . DC  J 6 12  ? -64.823 -42.084 51.349 1.00 97.17  ? -61 DC  J O2    1 
ATOM   9280  N  N3    . DC  J 6 12  ? -62.604 -41.656 51.237 1.00 97.48  ? -61 DC  J N3    1 
ATOM   9281  C  C4    . DC  J 6 12  ? -61.368 -42.102 50.975 1.00 97.55  ? -61 DC  J C4    1 
ATOM   9282  N  N4    . DC  J 6 12  ? -60.348 -41.246 51.118 1.00 96.15  ? -61 DC  J N4    1 
ATOM   9283  C  C5    . DC  J 6 12  ? -61.133 -43.455 50.554 1.00 98.14  ? -61 DC  J C5    1 
ATOM   9284  C  C6    . DC  J 6 12  ? -62.194 -44.270 50.430 1.00 98.07  ? -61 DC  J C6    1 
ATOM   9285  P  P     . DC  J 6 13  ? -67.547 -46.019 47.882 1.00 102.65 ? -60 DC  J P     1 
ATOM   9286  O  OP1   . DC  J 6 13  ? -68.944 -46.506 47.798 1.00 102.56 ? -60 DC  J OP1   1 
ATOM   9287  O  OP2   . DC  J 6 13  ? -66.533 -46.520 46.921 1.00 101.86 ? -60 DC  J OP2   1 
ATOM   9288  O  "O5'" . DC  J 6 13  ? -67.594 -44.423 47.802 1.00 103.87 ? -60 DC  J "O5'" 1 
ATOM   9289  C  "C5'" . DC  J 6 13  ? -68.525 -43.681 48.605 1.00 105.48 ? -60 DC  J "C5'" 1 
ATOM   9290  C  "C4'" . DC  J 6 13  ? -68.586 -42.233 48.143 1.00 106.92 ? -60 DC  J "C4'" 1 
ATOM   9291  O  "O4'" . DC  J 6 13  ? -67.349 -41.554 48.503 1.00 107.03 ? -60 DC  J "O4'" 1 
ATOM   9292  C  "C3'" . DC  J 6 13  ? -68.752 -42.046 46.636 1.00 107.83 ? -60 DC  J "C3'" 1 
ATOM   9293  O  "O3'" . DC  J 6 13  ? -69.626 -40.941 46.368 1.00 109.71 ? -60 DC  J "O3'" 1 
ATOM   9294  C  "C2'" . DC  J 6 13  ? -67.323 -41.763 46.181 1.00 107.86 ? -60 DC  J "C2'" 1 
ATOM   9295  C  "C1'" . DC  J 6 13  ? -66.815 -40.928 47.354 1.00 107.24 ? -60 DC  J "C1'" 1 
ATOM   9296  N  N1    . DC  J 6 13  ? -65.314 -40.820 47.456 1.00 106.89 ? -60 DC  J N1    1 
ATOM   9297  C  C2    . DC  J 6 13  ? -64.712 -39.607 47.852 1.00 106.77 ? -60 DC  J C2    1 
ATOM   9298  O  O2    . DC  J 6 13  ? -65.424 -38.626 48.129 1.00 106.92 ? -60 DC  J O2    1 
ATOM   9299  N  N3    . DC  J 6 13  ? -63.354 -39.537 47.930 1.00 105.87 ? -60 DC  J N3    1 
ATOM   9300  C  C4    . DC  J 6 13  ? -62.612 -40.606 47.628 1.00 106.08 ? -60 DC  J C4    1 
ATOM   9301  N  N4    . DC  J 6 13  ? -61.282 -40.505 47.717 1.00 105.56 ? -60 DC  J N4    1 
ATOM   9302  C  C5    . DC  J 6 13  ? -63.202 -41.842 47.221 1.00 106.69 ? -60 DC  J C5    1 
ATOM   9303  C  C6    . DC  J 6 13  ? -64.539 -41.904 47.149 1.00 106.78 ? -60 DC  J C6    1 
ATOM   9304  P  P     . DT  J 6 14  ? -70.267 -40.695 44.913 1.00 110.94 ? -59 DT  J P     1 
ATOM   9305  O  OP1   . DT  J 6 14  ? -71.617 -41.308 44.935 1.00 110.52 ? -59 DT  J OP1   1 
ATOM   9306  O  OP2   . DT  J 6 14  ? -69.300 -41.139 43.877 1.00 110.97 ? -59 DT  J OP2   1 
ATOM   9307  O  "O5'" . DT  J 6 14  ? -70.423 -39.093 44.812 1.00 111.02 ? -59 DT  J "O5'" 1 
ATOM   9308  C  "C5'" . DT  J 6 14  ? -69.706 -38.163 45.649 1.00 111.80 ? -59 DT  J "C5'" 1 
ATOM   9309  C  "C4'" . DT  J 6 14  ? -68.849 -37.162 44.869 1.00 112.39 ? -59 DT  J "C4'" 1 
ATOM   9310  O  "O4'" . DT  J 6 14  ? -67.435 -37.449 45.092 1.00 112.47 ? -59 DT  J "O4'" 1 
ATOM   9311  C  "C3'" . DT  J 6 14  ? -69.029 -37.122 43.343 1.00 112.48 ? -59 DT  J "C3'" 1 
ATOM   9312  O  "O3'" . DT  J 6 14  ? -69.076 -35.775 42.854 1.00 112.34 ? -59 DT  J "O3'" 1 
ATOM   9313  C  "C2'" . DT  J 6 14  ? -67.791 -37.842 42.816 1.00 112.29 ? -59 DT  J "C2'" 1 
ATOM   9314  C  "C1'" . DT  J 6 14  ? -66.775 -37.354 43.845 1.00 112.12 ? -59 DT  J "C1'" 1 
ATOM   9315  N  N1    . DT  J 6 14  ? -65.506 -38.121 43.888 1.00 111.45 ? -59 DT  J N1    1 
ATOM   9316  C  C2    . DT  J 6 14  ? -64.347 -37.472 44.274 1.00 111.21 ? -59 DT  J C2    1 
ATOM   9317  O  O2    . DT  J 6 14  ? -64.300 -36.291 44.591 1.00 110.54 ? -59 DT  J O2    1 
ATOM   9318  N  N3    . DT  J 6 14  ? -63.231 -38.275 44.273 1.00 111.16 ? -59 DT  J N3    1 
ATOM   9319  C  C4    . DT  J 6 14  ? -63.164 -39.619 43.931 1.00 111.26 ? -59 DT  J C4    1 
ATOM   9320  O  O4    . DT  J 6 14  ? -62.107 -40.243 43.966 1.00 110.79 ? -59 DT  J O4    1 
ATOM   9321  C  C5    . DT  J 6 14  ? -64.418 -40.227 43.535 1.00 111.43 ? -59 DT  J C5    1 
ATOM   9322  C  C7    . DT  J 6 14  ? -64.499 -41.675 43.144 1.00 111.50 ? -59 DT  J C7    1 
ATOM   9323  C  C6    . DT  J 6 14  ? -65.512 -39.457 43.533 1.00 111.42 ? -59 DT  J C6    1 
ATOM   9324  P  P     . DG  J 6 15  ? -69.888 -35.457 41.504 1.00 112.55 ? -58 DG  J P     1 
ATOM   9325  O  OP1   . DG  J 6 15  ? -71.313 -35.682 41.848 1.00 112.35 ? -58 DG  J OP1   1 
ATOM   9326  O  OP2   . DG  J 6 15  ? -69.280 -36.215 40.376 1.00 111.74 ? -58 DG  J OP2   1 
ATOM   9327  O  "O5'" . DG  J 6 15  ? -69.662 -33.884 41.224 1.00 111.61 ? -58 DG  J "O5'" 1 
ATOM   9328  C  "C5'" . DG  J 6 15  ? -69.070 -32.952 42.164 1.00 109.85 ? -58 DG  J "C5'" 1 
ATOM   9329  C  "C4'" . DG  J 6 15  ? -67.921 -32.136 41.557 1.00 108.67 ? -58 DG  J "C4'" 1 
ATOM   9330  O  "O4'" . DG  J 6 15  ? -66.681 -32.884 41.645 1.00 108.25 ? -58 DG  J "O4'" 1 
ATOM   9331  C  "C3'" . DG  J 6 15  ? -68.001 -31.736 40.078 1.00 108.24 ? -58 DG  J "C3'" 1 
ATOM   9332  O  "O3'" . DG  J 6 15  ? -67.086 -30.694 39.739 1.00 107.16 ? -58 DG  J "O3'" 1 
ATOM   9333  C  "C2'" . DG  J 6 15  ? -67.453 -32.992 39.416 1.00 108.52 ? -58 DG  J "C2'" 1 
ATOM   9334  C  "C1'" . DG  J 6 15  ? -66.250 -33.215 40.333 1.00 108.14 ? -58 DG  J "C1'" 1 
ATOM   9335  N  N9    . DG  J 6 15  ? -65.735 -34.574 40.350 1.00 107.60 ? -58 DG  J N9    1 
ATOM   9336  C  C8    . DG  J 6 15  ? -66.362 -35.723 39.935 1.00 107.56 ? -58 DG  J C8    1 
ATOM   9337  N  N7    . DG  J 6 15  ? -65.634 -36.793 40.082 1.00 107.58 ? -58 DG  J N7    1 
ATOM   9338  C  C5    . DG  J 6 15  ? -64.451 -36.316 40.629 1.00 107.22 ? -58 DG  J C5    1 
ATOM   9339  C  C6    . DG  J 6 15  ? -63.283 -37.011 41.008 1.00 106.94 ? -58 DG  J C6    1 
ATOM   9340  O  O6    . DG  J 6 15  ? -63.073 -38.225 40.926 1.00 106.83 ? -58 DG  J O6    1 
ATOM   9341  N  N1    . DG  J 6 15  ? -62.307 -36.154 41.524 1.00 107.14 ? -58 DG  J N1    1 
ATOM   9342  C  C2    . DG  J 6 15  ? -62.448 -34.787 41.657 1.00 107.06 ? -58 DG  J C2    1 
ATOM   9343  N  N2    . DG  J 6 15  ? -61.409 -34.116 42.173 1.00 106.48 ? -58 DG  J N2    1 
ATOM   9344  N  N3    . DG  J 6 15  ? -63.541 -34.123 41.302 1.00 107.25 ? -58 DG  J N3    1 
ATOM   9345  C  C4    . DG  J 6 15  ? -64.496 -34.951 40.800 1.00 107.43 ? -58 DG  J C4    1 
ATOM   9346  P  P     . DC  J 6 16  ? -67.303 -29.143 40.041 1.00 106.10 ? -57 DC  J P     1 
ATOM   9347  O  OP1   . DC  J 6 16  ? -67.581 -28.968 41.489 1.00 106.22 ? -57 DC  J OP1   1 
ATOM   9348  O  OP2   . DC  J 6 16  ? -68.231 -28.630 39.005 1.00 106.13 ? -57 DC  J OP2   1 
ATOM   9349  O  "O5'" . DC  J 6 16  ? -65.855 -28.535 39.733 1.00 105.44 ? -57 DC  J "O5'" 1 
ATOM   9350  C  "C5'" . DC  J 6 16  ? -64.708 -28.882 40.524 1.00 104.24 ? -57 DC  J "C5'" 1 
ATOM   9351  C  "C4'" . DC  J 6 16  ? -63.478 -29.143 39.664 1.00 103.06 ? -57 DC  J "C4'" 1 
ATOM   9352  O  "O4'" . DC  J 6 16  ? -63.258 -30.566 39.503 1.00 102.14 ? -57 DC  J "O4'" 1 
ATOM   9353  C  "C3'" . DC  J 6 16  ? -63.505 -28.566 38.245 1.00 102.86 ? -57 DC  J "C3'" 1 
ATOM   9354  O  "O3'" . DC  J 6 16  ? -62.247 -28.004 37.975 1.00 103.16 ? -57 DC  J "O3'" 1 
ATOM   9355  C  "C2'" . DC  J 6 16  ? -63.738 -29.786 37.363 1.00 102.27 ? -57 DC  J "C2'" 1 
ATOM   9356  C  "C1'" . DC  J 6 16  ? -62.903 -30.784 38.155 1.00 101.92 ? -57 DC  J "C1'" 1 
ATOM   9357  N  N1    . DC  J 6 16  ? -63.098 -32.224 37.844 1.00 101.70 ? -57 DC  J N1    1 
ATOM   9358  C  C2    . DC  J 6 16  ? -62.174 -33.127 38.370 1.00 101.17 ? -57 DC  J C2    1 
ATOM   9359  O  O2    . DC  J 6 16  ? -61.244 -32.692 39.059 1.00 100.94 ? -57 DC  J O2    1 
ATOM   9360  N  N3    . DC  J 6 16  ? -62.328 -34.447 38.100 1.00 101.02 ? -57 DC  J N3    1 
ATOM   9361  C  C4    . DC  J 6 16  ? -63.345 -34.872 37.347 1.00 100.78 ? -57 DC  J C4    1 
ATOM   9362  N  N4    . DC  J 6 16  ? -63.442 -36.183 37.114 1.00 100.34 ? -57 DC  J N4    1 
ATOM   9363  C  C5    . DC  J 6 16  ? -64.303 -33.968 36.802 1.00 101.01 ? -57 DC  J C5    1 
ATOM   9364  C  C6    . DC  J 6 16  ? -64.140 -32.666 37.074 1.00 101.72 ? -57 DC  J C6    1 
ATOM   9365  P  P     . DA  J 6 17  ? -61.982 -26.447 38.199 1.00 103.95 ? -56 DA  J P     1 
ATOM   9366  O  OP1   . DA  J 6 17  ? -62.806 -25.947 39.331 1.00 103.98 ? -56 DA  J OP1   1 
ATOM   9367  O  OP2   . DA  J 6 17  ? -62.078 -25.837 36.851 1.00 103.97 ? -56 DA  J OP2   1 
ATOM   9368  O  "O5'" . DA  J 6 17  ? -60.451 -26.392 38.667 1.00 103.68 ? -56 DA  J "O5'" 1 
ATOM   9369  C  "C5'" . DA  J 6 17  ? -60.037 -26.976 39.914 1.00 102.99 ? -56 DA  J "C5'" 1 
ATOM   9370  C  "C4'" . DA  J 6 17  ? -58.696 -27.685 39.772 1.00 102.45 ? -56 DA  J "C4'" 1 
ATOM   9371  O  "O4'" . DA  J 6 17  ? -58.866 -28.934 39.063 1.00 102.10 ? -56 DA  J "O4'" 1 
ATOM   9372  C  "C3'" . DA  J 6 17  ? -57.620 -26.950 38.978 1.00 102.50 ? -56 DA  J "C3'" 1 
ATOM   9373  O  "O3'" . DA  J 6 17  ? -56.336 -27.346 39.464 1.00 102.35 ? -56 DA  J "O3'" 1 
ATOM   9374  C  "C2'" . DA  J 6 17  ? -57.849 -27.418 37.541 1.00 101.83 ? -56 DA  J "C2'" 1 
ATOM   9375  C  "C1'" . DA  J 6 17  ? -58.284 -28.857 37.775 1.00 101.68 ? -56 DA  J "C1'" 1 
ATOM   9376  N  N9    . DA  J 6 17  ? -59.284 -29.339 36.839 1.00 101.77 ? -56 DA  J N9    1 
ATOM   9377  C  C8    . DA  J 6 17  ? -60.189 -28.624 36.102 1.00 102.04 ? -56 DA  J C8    1 
ATOM   9378  N  N7    . DA  J 6 17  ? -60.962 -29.369 35.346 1.00 102.06 ? -56 DA  J N7    1 
ATOM   9379  C  C5    . DA  J 6 17  ? -60.532 -30.660 35.610 1.00 101.98 ? -56 DA  J C5    1 
ATOM   9380  C  C6    . DA  J 6 17  ? -60.936 -31.929 35.139 1.00 102.16 ? -56 DA  J C6    1 
ATOM   9381  N  N6    . DA  J 6 17  ? -61.918 -32.111 34.248 1.00 102.35 ? -56 DA  J N6    1 
ATOM   9382  N  N1    . DA  J 6 17  ? -60.283 -33.015 35.613 1.00 101.76 ? -56 DA  J N1    1 
ATOM   9383  C  C2    . DA  J 6 17  ? -59.298 -32.850 36.501 1.00 101.73 ? -56 DA  J C2    1 
ATOM   9384  N  N3    . DA  J 6 17  ? -58.837 -31.714 37.020 1.00 101.98 ? -56 DA  J N3    1 
ATOM   9385  C  C4    . DA  J 6 17  ? -59.500 -30.654 36.530 1.00 101.89 ? -56 DA  J C4    1 
ATOM   9386  P  P     . DG  J 6 18  ? -54.983 -26.747 38.843 1.00 102.45 ? -55 DG  J P     1 
ATOM   9387  O  OP1   . DG  J 6 18  ? -54.065 -26.482 39.975 1.00 101.86 ? -55 DG  J OP1   1 
ATOM   9388  O  OP2   . DG  J 6 18  ? -55.283 -25.658 37.882 1.00 102.37 ? -55 DG  J OP2   1 
ATOM   9389  O  "O5'" . DG  J 6 18  ? -54.466 -27.976 37.967 1.00 101.18 ? -55 DG  J "O5'" 1 
ATOM   9390  C  "C5'" . DG  J 6 18  ? -54.246 -29.240 38.566 1.00 100.51 ? -55 DG  J "C5'" 1 
ATOM   9391  C  "C4'" . DG  J 6 18  ? -54.095 -30.289 37.483 1.00 100.02 ? -55 DG  J "C4'" 1 
ATOM   9392  O  "O4'" . DG  J 6 18  ? -55.365 -30.449 36.800 1.00 100.51 ? -55 DG  J "O4'" 1 
ATOM   9393  C  "C3'" . DG  J 6 18  ? -53.067 -29.967 36.399 1.00 99.30  ? -55 DG  J "C3'" 1 
ATOM   9394  O  "O3'" . DG  J 6 18  ? -52.353 -31.149 36.069 1.00 98.67  ? -55 DG  J "O3'" 1 
ATOM   9395  C  "C2'" . DG  J 6 18  ? -53.923 -29.516 35.222 1.00 99.55  ? -55 DG  J "C2'" 1 
ATOM   9396  C  "C1'" . DG  J 6 18  ? -55.095 -30.473 35.414 1.00 100.28 ? -55 DG  J "C1'" 1 
ATOM   9397  N  N9    . DG  J 6 18  ? -56.291 -30.173 34.625 1.00 100.08 ? -55 DG  J N9    1 
ATOM   9398  C  C8    . DG  J 6 18  ? -56.841 -28.945 34.332 1.00 100.02 ? -55 DG  J C8    1 
ATOM   9399  N  N7    . DG  J 6 18  ? -57.910 -29.026 33.589 1.00 100.16 ? -55 DG  J N7    1 
ATOM   9400  C  C5    . DG  J 6 18  ? -58.078 -30.388 33.370 1.00 100.15 ? -55 DG  J C5    1 
ATOM   9401  C  C6    . DG  J 6 18  ? -59.070 -31.096 32.633 1.00 100.25 ? -55 DG  J C6    1 
ATOM   9402  O  O6    . DG  J 6 18  ? -60.034 -30.634 32.005 1.00 99.94  ? -55 DG  J O6    1 
ATOM   9403  N  N1    . DG  J 6 18  ? -58.867 -32.482 32.673 1.00 99.57  ? -55 DG  J N1    1 
ATOM   9404  C  C2    . DG  J 6 18  ? -57.836 -33.099 33.345 1.00 98.82  ? -55 DG  J C2    1 
ATOM   9405  N  N2    . DG  J 6 18  ? -57.787 -34.430 33.277 1.00 98.04  ? -55 DG  J N2    1 
ATOM   9406  N  N3    . DG  J 6 18  ? -56.904 -32.451 34.033 1.00 99.26  ? -55 DG  J N3    1 
ATOM   9407  C  C4    . DG  J 6 18  ? -57.085 -31.105 34.004 1.00 99.85  ? -55 DG  J C4    1 
ATOM   9408  P  P     . DA  J 6 19  ? -50.834 -31.070 35.583 1.00 97.84  ? -54 DA  J P     1 
ATOM   9409  O  OP1   . DA  J 6 19  ? -50.017 -30.587 36.718 1.00 98.31  ? -54 DA  J OP1   1 
ATOM   9410  O  OP2   . DA  J 6 19  ? -50.801 -30.361 34.283 1.00 97.60  ? -54 DA  J OP2   1 
ATOM   9411  O  "O5'" . DA  J 6 19  ? -50.471 -32.604 35.354 1.00 97.43  ? -54 DA  J "O5'" 1 
ATOM   9412  C  "C5'" . DA  J 6 19  ? -50.414 -33.134 34.053 1.00 97.12  ? -54 DA  J "C5'" 1 
ATOM   9413  C  "C4'" . DA  J 6 19  ? -51.548 -34.114 33.872 1.00 97.26  ? -54 DA  J "C4'" 1 
ATOM   9414  O  "O4'" . DA  J 6 19  ? -52.810 -33.421 33.936 1.00 97.37  ? -54 DA  J "O4'" 1 
ATOM   9415  C  "C3'" . DA  J 6 19  ? -51.531 -34.818 32.532 1.00 97.47  ? -54 DA  J "C3'" 1 
ATOM   9416  O  "O3'" . DA  J 6 19  ? -50.821 -36.013 32.719 1.00 98.49  ? -54 DA  J "O3'" 1 
ATOM   9417  C  "C2'" . DA  J 6 19  ? -53.001 -35.101 32.250 1.00 97.12  ? -54 DA  J "C2'" 1 
ATOM   9418  C  "C1'" . DA  J 6 19  ? -53.738 -34.038 33.058 1.00 97.21  ? -54 DA  J "C1'" 1 
ATOM   9419  N  N9    . DA  J 6 19  ? -54.389 -32.985 32.275 1.00 97.06  ? -54 DA  J N9    1 
ATOM   9420  C  C8    . DA  J 6 19  ? -54.103 -31.652 32.346 1.00 97.25  ? -54 DA  J C8    1 
ATOM   9421  N  N7    . DA  J 6 19  ? -54.835 -30.903 31.563 1.00 97.74  ? -54 DA  J N7    1 
ATOM   9422  C  C5    . DA  J 6 19  ? -55.667 -31.808 30.931 1.00 97.21  ? -54 DA  J C5    1 
ATOM   9423  C  C6    . DA  J 6 19  ? -56.681 -31.636 29.970 1.00 96.72  ? -54 DA  J C6    1 
ATOM   9424  N  N6    . DA  J 6 19  ? -57.012 -30.440 29.483 1.00 96.95  ? -54 DA  J N6    1 
ATOM   9425  N  N1    . DA  J 6 19  ? -57.334 -32.731 29.531 1.00 96.55  ? -54 DA  J N1    1 
ATOM   9426  C  C2    . DA  J 6 19  ? -56.986 -33.925 30.027 1.00 97.01  ? -54 DA  J C2    1 
ATOM   9427  N  N3    . DA  J 6 19  ? -56.053 -34.214 30.938 1.00 97.25  ? -54 DA  J N3    1 
ATOM   9428  C  C4    . DA  J 6 19  ? -55.413 -33.100 31.353 1.00 97.25  ? -54 DA  J C4    1 
ATOM   9429  P  P     . DT  J 6 20  ? -49.703 -36.453 31.676 1.00 100.09 ? -53 DT  J P     1 
ATOM   9430  O  OP1   . DT  J 6 20  ? -48.862 -37.492 32.318 1.00 100.07 ? -53 DT  J OP1   1 
ATOM   9431  O  OP2   . DT  J 6 20  ? -49.066 -35.237 31.131 1.00 99.48  ? -53 DT  J OP2   1 
ATOM   9432  O  "O5'" . DT  J 6 20  ? -50.573 -37.116 30.503 1.00 102.21 ? -53 DT  J "O5'" 1 
ATOM   9433  C  "C5'" . DT  J 6 20  ? -51.408 -38.255 30.739 1.00 104.42 ? -53 DT  J "C5'" 1 
ATOM   9434  C  "C4'" . DT  J 6 20  ? -52.484 -38.355 29.668 1.00 106.62 ? -53 DT  J "C4'" 1 
ATOM   9435  O  "O4'" . DT  J 6 20  ? -53.277 -37.135 29.619 1.00 106.73 ? -53 DT  J "O4'" 1 
ATOM   9436  C  "C3'" . DT  J 6 20  ? -51.975 -38.614 28.247 1.00 107.94 ? -53 DT  J "C3'" 1 
ATOM   9437  O  "O3'" . DT  J 6 20  ? -52.692 -39.733 27.699 1.00 110.16 ? -53 DT  J "O3'" 1 
ATOM   9438  C  "C2'" . DT  J 6 20  ? -52.259 -37.296 27.522 1.00 107.59 ? -53 DT  J "C2'" 1 
ATOM   9439  C  "C1'" . DT  J 6 20  ? -53.477 -36.766 28.270 1.00 107.35 ? -53 DT  J "C1'" 1 
ATOM   9440  N  N1    . DT  J 6 20  ? -53.661 -35.281 28.186 1.00 107.85 ? -53 DT  J N1    1 
ATOM   9441  C  C2    . DT  J 6 20  ? -54.686 -34.740 27.424 1.00 107.96 ? -53 DT  J C2    1 
ATOM   9442  O  O2    . DT  J 6 20  ? -55.484 -35.401 26.786 1.00 108.40 ? -53 DT  J O2    1 
ATOM   9443  N  N3    . DT  J 6 20  ? -54.750 -33.367 27.432 1.00 108.01 ? -53 DT  J N3    1 
ATOM   9444  C  C4    . DT  J 6 20  ? -53.910 -32.495 28.112 1.00 108.43 ? -53 DT  J C4    1 
ATOM   9445  O  O4    . DT  J 6 20  ? -54.052 -31.278 28.058 1.00 108.46 ? -53 DT  J O4    1 
ATOM   9446  C  C5    . DT  J 6 20  ? -52.861 -33.119 28.889 1.00 108.49 ? -53 DT  J C5    1 
ATOM   9447  C  C7    . DT  J 6 20  ? -51.882 -32.295 29.674 1.00 108.61 ? -53 DT  J C7    1 
ATOM   9448  C  C6    . DT  J 6 20  ? -52.790 -34.460 28.884 1.00 108.40 ? -53 DT  J C6    1 
ATOM   9449  P  P     . DA  J 6 21  ? -52.395 -40.430 26.280 1.00 112.07 ? -52 DA  J P     1 
ATOM   9450  O  OP1   . DA  J 6 21  ? -51.917 -41.798 26.555 1.00 111.70 ? -52 DA  J OP1   1 
ATOM   9451  O  OP2   . DA  J 6 21  ? -51.583 -39.538 25.419 1.00 112.00 ? -52 DA  J OP2   1 
ATOM   9452  O  "O5'" . DA  J 6 21  ? -53.862 -40.544 25.640 1.00 114.21 ? -52 DA  J "O5'" 1 
ATOM   9453  C  "C5'" . DA  J 6 21  ? -54.741 -39.415 25.583 1.00 117.19 ? -52 DA  J "C5'" 1 
ATOM   9454  C  "C4'" . DA  J 6 21  ? -55.282 -39.139 24.182 1.00 119.45 ? -52 DA  J "C4'" 1 
ATOM   9455  O  "O4'" . DA  J 6 21  ? -55.581 -37.722 24.058 1.00 119.79 ? -52 DA  J "O4'" 1 
ATOM   9456  C  "C3'" . DA  J 6 21  ? -54.378 -39.503 23.000 1.00 120.70 ? -52 DA  J "C3'" 1 
ATOM   9457  O  "O3'" . DA  J 6 21  ? -55.153 -40.220 21.984 1.00 122.90 ? -52 DA  J "O3'" 1 
ATOM   9458  C  "C2'" . DA  J 6 21  ? -53.757 -38.159 22.604 1.00 120.32 ? -52 DA  J "C2'" 1 
ATOM   9459  C  "C1'" . DA  J 6 21  ? -54.815 -37.140 23.022 1.00 120.08 ? -52 DA  J "C1'" 1 
ATOM   9460  N  N9    . DA  J 6 21  ? -54.277 -35.865 23.499 1.00 120.32 ? -52 DA  J N9    1 
ATOM   9461  C  C8    . DA  J 6 21  ? -53.235 -35.667 24.366 1.00 120.49 ? -52 DA  J C8    1 
ATOM   9462  N  N7    . DA  J 6 21  ? -52.975 -34.403 24.613 1.00 120.40 ? -52 DA  J N7    1 
ATOM   9463  C  C5    . DA  J 6 21  ? -53.910 -33.720 23.855 1.00 120.41 ? -52 DA  J C5    1 
ATOM   9464  C  C6    . DA  J 6 21  ? -54.173 -32.345 23.671 1.00 120.26 ? -52 DA  J C6    1 
ATOM   9465  N  N6    . DA  J 6 21  ? -53.477 -31.379 24.273 1.00 119.64 ? -52 DA  J N6    1 
ATOM   9466  N  N1    . DA  J 6 21  ? -55.186 -31.995 22.844 1.00 120.69 ? -52 DA  J N1    1 
ATOM   9467  C  C2    . DA  J 6 21  ? -55.889 -32.959 22.236 1.00 120.99 ? -52 DA  J C2    1 
ATOM   9468  N  N3    . DA  J 6 21  ? -55.736 -34.284 22.334 1.00 121.09 ? -52 DA  J N3    1 
ATOM   9469  C  C4    . DA  J 6 21  ? -54.723 -34.605 23.163 1.00 120.60 ? -52 DA  J C4    1 
ATOM   9470  P  P     . DC  J 6 22  ? -55.262 -39.919 20.400 1.00 124.53 ? -51 DC  J P     1 
ATOM   9471  O  OP1   . DC  J 6 22  ? -56.014 -41.042 19.796 1.00 124.31 ? -51 DC  J OP1   1 
ATOM   9472  O  OP2   . DC  J 6 22  ? -53.936 -39.575 19.837 1.00 123.94 ? -51 DC  J OP2   1 
ATOM   9473  O  "O5'" . DC  J 6 22  ? -56.184 -38.611 20.384 1.00 126.23 ? -51 DC  J "O5'" 1 
ATOM   9474  C  "C5'" . DC  J 6 22  ? -57.344 -38.525 19.568 1.00 128.90 ? -51 DC  J "C5'" 1 
ATOM   9475  C  "C4'" . DC  J 6 22  ? -57.226 -37.340 18.626 1.00 130.88 ? -51 DC  J "C4'" 1 
ATOM   9476  O  "O4'" . DC  J 6 22  ? -56.525 -36.243 19.277 1.00 131.21 ? -51 DC  J "O4'" 1 
ATOM   9477  C  "C3'" . DC  J 6 22  ? -56.477 -37.612 17.323 1.00 132.07 ? -51 DC  J "C3'" 1 
ATOM   9478  O  "O3'" . DC  J 6 22  ? -57.282 -37.094 16.258 1.00 133.92 ? -51 DC  J "O3'" 1 
ATOM   9479  C  "C2'" . DC  J 6 22  ? -55.153 -36.869 17.516 1.00 131.76 ? -51 DC  J "C2'" 1 
ATOM   9480  C  "C1'" . DC  J 6 22  ? -55.617 -35.678 18.351 1.00 131.63 ? -51 DC  J "C1'" 1 
ATOM   9481  N  N1    . DC  J 6 22  ? -54.535 -34.918 19.083 1.00 131.64 ? -51 DC  J N1    1 
ATOM   9482  C  C2    . DC  J 6 22  ? -54.506 -33.506 19.066 1.00 131.36 ? -51 DC  J C2    1 
ATOM   9483  O  O2    . DC  J 6 22  ? -55.368 -32.865 18.449 1.00 131.08 ? -51 DC  J O2    1 
ATOM   9484  N  N3    . DC  J 6 22  ? -53.514 -32.863 19.742 1.00 131.42 ? -51 DC  J N3    1 
ATOM   9485  C  C4    . DC  J 6 22  ? -52.584 -33.560 20.410 1.00 131.62 ? -51 DC  J C4    1 
ATOM   9486  N  N4    . DC  J 6 22  ? -51.628 -32.886 21.059 1.00 131.33 ? -51 DC  J N4    1 
ATOM   9487  C  C5    . DC  J 6 22  ? -52.593 -34.989 20.441 1.00 131.69 ? -51 DC  J C5    1 
ATOM   9488  C  C6    . DC  J 6 22  ? -53.576 -35.614 19.777 1.00 131.83 ? -51 DC  J C6    1 
ATOM   9489  P  P     . DT  J 6 23  ? -56.772 -36.867 14.749 1.00 135.78 ? -50 DT  J P     1 
ATOM   9490  O  OP1   . DT  J 6 23  ? -57.976 -37.005 13.893 1.00 135.83 ? -50 DT  J OP1   1 
ATOM   9491  O  OP2   . DT  J 6 23  ? -55.593 -37.738 14.495 1.00 135.29 ? -50 DT  J OP2   1 
ATOM   9492  O  "O5'" . DT  J 6 23  ? -56.301 -35.327 14.724 1.00 136.12 ? -50 DT  J "O5'" 1 
ATOM   9493  C  "C5'" . DT  J 6 23  ? -57.240 -34.268 14.475 1.00 136.91 ? -50 DT  J "C5'" 1 
ATOM   9494  C  "C4'" . DT  J 6 23  ? -56.565 -32.956 14.080 1.00 137.58 ? -50 DT  J "C4'" 1 
ATOM   9495  O  "O4'" . DT  J 6 23  ? -55.653 -32.537 15.134 1.00 137.70 ? -50 DT  J "O4'" 1 
ATOM   9496  C  "C3'" . DT  J 6 23  ? -55.753 -32.984 12.778 1.00 138.01 ? -50 DT  J "C3'" 1 
ATOM   9497  O  "O3'" . DT  J 6 23  ? -55.980 -31.803 11.989 1.00 138.55 ? -50 DT  J "O3'" 1 
ATOM   9498  C  "C2'" . DT  J 6 23  ? -54.312 -33.022 13.274 1.00 137.98 ? -50 DT  J "C2'" 1 
ATOM   9499  C  "C1'" . DT  J 6 23  ? -54.414 -32.185 14.549 1.00 138.07 ? -50 DT  J "C1'" 1 
ATOM   9500  N  N1    . DT  J 6 23  ? -53.296 -32.427 15.513 1.00 138.32 ? -50 DT  J N1    1 
ATOM   9501  C  C2    . DT  J 6 23  ? -52.636 -31.360 16.107 1.00 138.48 ? -50 DT  J C2    1 
ATOM   9502  O  O2    . DT  J 6 23  ? -52.906 -30.184 15.911 1.00 138.38 ? -50 DT  J O2    1 
ATOM   9503  N  N3    . DT  J 6 23  ? -51.624 -31.728 16.964 1.00 138.59 ? -50 DT  J N3    1 
ATOM   9504  C  C4    . DT  J 6 23  ? -51.214 -33.018 17.278 1.00 138.74 ? -50 DT  J C4    1 
ATOM   9505  O  O4    . DT  J 6 23  ? -50.292 -33.228 18.063 1.00 138.90 ? -50 DT  J O4    1 
ATOM   9506  C  C5    . DT  J 6 23  ? -51.944 -34.085 16.621 1.00 138.72 ? -50 DT  J C5    1 
ATOM   9507  C  C7    . DT  J 6 23  ? -51.612 -35.533 16.858 1.00 138.50 ? -50 DT  J C7    1 
ATOM   9508  C  C6    . DT  J 6 23  ? -52.931 -33.736 15.785 1.00 138.64 ? -50 DT  J C6    1 
ATOM   9509  P  P     . DA  J 6 24  ? -55.850 -31.831 10.385 1.00 138.85 ? -49 DA  J P     1 
ATOM   9510  O  OP1   . DA  J 6 24  ? -56.973 -32.653 9.882  1.00 138.70 ? -49 DA  J OP1   1 
ATOM   9511  O  OP2   . DA  J 6 24  ? -54.463 -32.196 10.016 1.00 138.38 ? -49 DA  J OP2   1 
ATOM   9512  O  "O5'" . DA  J 6 24  ? -56.091 -30.311 9.923  1.00 139.24 ? -49 DA  J "O5'" 1 
ATOM   9513  C  "C5'" . DA  J 6 24  ? -56.129 -29.195 10.827 1.00 139.47 ? -49 DA  J "C5'" 1 
ATOM   9514  C  "C4'" . DA  J 6 24  ? -54.857 -28.357 10.779 1.00 139.84 ? -49 DA  J "C4'" 1 
ATOM   9515  O  "O4'" . DA  J 6 24  ? -53.872 -28.932 11.681 1.00 140.39 ? -49 DA  J "O4'" 1 
ATOM   9516  C  "C3'" . DA  J 6 24  ? -54.167 -28.233 9.417  1.00 139.81 ? -49 DA  J "C3'" 1 
ATOM   9517  O  "O3'" . DA  J 6 24  ? -53.796 -26.870 9.161  1.00 139.16 ? -49 DA  J "O3'" 1 
ATOM   9518  C  "C2'" . DA  J 6 24  ? -52.946 -29.144 9.554  1.00 140.33 ? -49 DA  J "C2'" 1 
ATOM   9519  C  "C1'" . DA  J 6 24  ? -52.617 -28.969 11.033 1.00 140.67 ? -49 DA  J "C1'" 1 
ATOM   9520  N  N9    . DA  J 6 24  ? -51.805 -30.029 11.632 1.00 141.15 ? -49 DA  J N9    1 
ATOM   9521  C  C8    . DA  J 6 24  ? -51.796 -31.362 11.314 1.00 141.53 ? -49 DA  J C8    1 
ATOM   9522  N  N7    . DA  J 6 24  ? -50.958 -32.079 12.026 1.00 141.59 ? -49 DA  J N7    1 
ATOM   9523  C  C5    . DA  J 6 24  ? -50.372 -31.155 12.874 1.00 141.54 ? -49 DA  J C5    1 
ATOM   9524  C  C6    . DA  J 6 24  ? -49.389 -31.273 13.883 1.00 141.62 ? -49 DA  J C6    1 
ATOM   9525  N  N6    . DA  J 6 24  ? -48.806 -32.429 14.220 1.00 141.66 ? -49 DA  J N6    1 
ATOM   9526  N  N1    . DA  J 6 24  ? -49.027 -30.149 14.541 1.00 141.81 ? -49 DA  J N1    1 
ATOM   9527  C  C2    . DA  J 6 24  ? -49.608 -28.983 14.210 1.00 141.95 ? -49 DA  J C2    1 
ATOM   9528  N  N3    . DA  J 6 24  ? -50.540 -28.748 13.284 1.00 141.75 ? -49 DA  J N3    1 
ATOM   9529  C  C4    . DA  J 6 24  ? -50.883 -29.885 12.644 1.00 141.47 ? -49 DA  J C4    1 
ATOM   9530  P  P     . DC  J 6 25  ? -53.466 -26.345 7.677  1.00 139.00 ? -48 DC  J P     1 
ATOM   9531  O  OP1   . DC  J 6 25  ? -53.533 -24.863 7.715  1.00 138.84 ? -48 DC  J OP1   1 
ATOM   9532  O  OP2   . DC  J 6 25  ? -54.323 -27.090 6.722  1.00 139.23 ? -48 DC  J OP2   1 
ATOM   9533  O  "O5'" . DC  J 6 25  ? -51.954 -26.825 7.422  1.00 137.60 ? -48 DC  J "O5'" 1 
ATOM   9534  C  "C5'" . DC  J 6 25  ? -50.926 -25.904 7.057  1.00 135.82 ? -48 DC  J "C5'" 1 
ATOM   9535  C  "C4'" . DC  J 6 25  ? -50.308 -25.256 8.289  1.00 134.71 ? -48 DC  J "C4'" 1 
ATOM   9536  O  "O4'" . DC  J 6 25  ? -50.294 -26.172 9.416  1.00 134.49 ? -48 DC  J "O4'" 1 
ATOM   9537  C  "C3'" . DC  J 6 25  ? -48.874 -24.785 8.113  1.00 133.84 ? -48 DC  J "C3'" 1 
ATOM   9538  O  "O3'" . DC  J 6 25  ? -48.753 -23.498 8.677  1.00 132.70 ? -48 DC  J "O3'" 1 
ATOM   9539  C  "C2'" . DC  J 6 25  ? -48.010 -25.794 8.863  1.00 133.79 ? -48 DC  J "C2'" 1 
ATOM   9540  C  "C1'" . DC  J 6 25  ? -48.974 -26.418 9.865  1.00 134.03 ? -48 DC  J "C1'" 1 
ATOM   9541  N  N1    . DC  J 6 25  ? -48.767 -27.895 10.015 1.00 133.99 ? -48 DC  J N1    1 
ATOM   9542  C  C2    . DC  J 6 25  ? -47.936 -28.384 11.041 1.00 133.91 ? -48 DC  J C2    1 
ATOM   9543  O  O2    . DC  J 6 25  ? -47.382 -27.590 11.817 1.00 133.67 ? -48 DC  J O2    1 
ATOM   9544  N  N3    . DC  J 6 25  ? -47.761 -29.731 11.154 1.00 133.76 ? -48 DC  J N3    1 
ATOM   9545  C  C4    . DC  J 6 25  ? -48.368 -30.568 10.301 1.00 133.82 ? -48 DC  J C4    1 
ATOM   9546  N  N4    . DC  J 6 25  ? -48.166 -31.882 10.454 1.00 133.72 ? -48 DC  J N4    1 
ATOM   9547  C  C5    . DC  J 6 25  ? -49.216 -30.091 9.253  1.00 133.98 ? -48 DC  J C5    1 
ATOM   9548  C  C6    . DC  J 6 25  ? -49.381 -28.764 9.147  1.00 133.90 ? -48 DC  J C6    1 
ATOM   9549  P  P     . DC  J 6 26  ? -47.802 -22.440 7.955  1.00 132.13 ? -47 DC  J P     1 
ATOM   9550  O  OP1   . DC  J 6 26  ? -48.113 -21.102 8.516  1.00 132.07 ? -47 DC  J OP1   1 
ATOM   9551  O  OP2   . DC  J 6 26  ? -47.890 -22.668 6.495  1.00 132.27 ? -47 DC  J OP2   1 
ATOM   9552  O  "O5'" . DC  J 6 26  ? -46.338 -22.905 8.406  1.00 130.47 ? -47 DC  J "O5'" 1 
ATOM   9553  C  "C5'" . DC  J 6 26  ? -45.862 -22.669 9.728  1.00 127.93 ? -47 DC  J "C5'" 1 
ATOM   9554  C  "C4'" . DC  J 6 26  ? -44.487 -23.288 9.923  1.00 125.93 ? -47 DC  J "C4'" 1 
ATOM   9555  O  "O4'" . DC  J 6 26  ? -44.604 -24.725 10.022 1.00 125.71 ? -47 DC  J "O4'" 1 
ATOM   9556  C  "C3'" . DC  J 6 26  ? -43.482 -23.028 8.805  1.00 124.65 ? -47 DC  J "C3'" 1 
ATOM   9557  O  "O3'" . DC  J 6 26  ? -42.224 -22.710 9.388  1.00 122.43 ? -47 DC  J "O3'" 1 
ATOM   9558  C  "C2'" . DC  J 6 26  ? -43.444 -24.345 8.033  1.00 125.07 ? -47 DC  J "C2'" 1 
ATOM   9559  C  "C1'" . DC  J 6 26  ? -43.672 -25.341 9.163  1.00 125.57 ? -47 DC  J "C1'" 1 
ATOM   9560  N  N1    . DC  J 6 26  ? -44.295 -26.635 8.800  1.00 126.11 ? -47 DC  J N1    1 
ATOM   9561  C  C2    . DC  J 6 26  ? -44.311 -27.650 9.766  1.00 126.54 ? -47 DC  J C2    1 
ATOM   9562  O  O2    . DC  J 6 26  ? -43.792 -27.445 10.871 1.00 126.90 ? -47 DC  J O2    1 
ATOM   9563  N  N3    . DC  J 6 26  ? -44.892 -28.840 9.466  1.00 126.84 ? -47 DC  J N3    1 
ATOM   9564  C  C4    . DC  J 6 26  ? -45.445 -29.030 8.266  1.00 126.90 ? -47 DC  J C4    1 
ATOM   9565  N  N4    . DC  J 6 26  ? -46.001 -30.223 8.026  1.00 126.92 ? -47 DC  J N4    1 
ATOM   9566  C  C5    . DC  J 6 26  ? -45.447 -28.004 7.269  1.00 126.90 ? -47 DC  J C5    1 
ATOM   9567  C  C6    . DC  J 6 26  ? -44.870 -26.832 7.575  1.00 126.35 ? -47 DC  J C6    1 
ATOM   9568  P  P     . DA  J 6 27  ? -41.835 -21.187 9.688  1.00 120.53 ? -46 DA  J P     1 
ATOM   9569  O  OP1   . DA  J 6 27  ? -42.951 -20.544 10.422 1.00 120.16 ? -46 DA  J OP1   1 
ATOM   9570  O  OP2   . DA  J 6 27  ? -41.342 -20.604 8.420  1.00 120.45 ? -46 DA  J OP2   1 
ATOM   9571  O  "O5'" . DA  J 6 27  ? -40.579 -21.318 10.672 1.00 119.56 ? -46 DA  J "O5'" 1 
ATOM   9572  C  "C5'" . DA  J 6 27  ? -40.775 -21.535 12.074 1.00 117.14 ? -46 DA  J "C5'" 1 
ATOM   9573  C  "C4'" . DA  J 6 27  ? -39.748 -22.494 12.666 1.00 115.19 ? -46 DA  J "C4'" 1 
ATOM   9574  O  "O4'" . DA  J 6 27  ? -39.872 -23.835 12.120 1.00 114.63 ? -46 DA  J "O4'" 1 
ATOM   9575  C  "C3'" . DA  J 6 27  ? -38.281 -22.109 12.501 1.00 113.83 ? -46 DA  J "C3'" 1 
ATOM   9576  O  "O3'" . DA  J 6 27  ? -37.680 -22.353 13.780 1.00 111.70 ? -46 DA  J "O3'" 1 
ATOM   9577  C  "C2'" . DA  J 6 27  ? -37.792 -22.974 11.334 1.00 113.82 ? -46 DA  J "C2'" 1 
ATOM   9578  C  "C1'" . DA  J 6 27  ? -38.742 -24.170 11.335 1.00 114.40 ? -46 DA  J "C1'" 1 
ATOM   9579  N  N9    . DA  J 6 27  ? -39.263 -24.551 10.022 1.00 114.94 ? -46 DA  J N9    1 
ATOM   9580  C  C8    . DA  J 6 27  ? -39.246 -23.819 8.864  1.00 114.95 ? -46 DA  J C8    1 
ATOM   9581  N  N7    . DA  J 6 27  ? -39.805 -24.426 7.844  1.00 114.96 ? -46 DA  J N7    1 
ATOM   9582  C  C5    . DA  J 6 27  ? -40.225 -25.637 8.366  1.00 114.97 ? -46 DA  J C5    1 
ATOM   9583  C  C6    . DA  J 6 27  ? -40.891 -26.744 7.795  1.00 115.03 ? -46 DA  J C6    1 
ATOM   9584  N  N6    . DA  J 6 27  ? -41.268 -26.798 6.515  1.00 114.79 ? -46 DA  J N6    1 
ATOM   9585  N  N1    . DA  J 6 27  ? -41.164 -27.797 8.594  1.00 115.24 ? -46 DA  J N1    1 
ATOM   9586  C  C2    . DA  J 6 27  ? -40.785 -27.748 9.877  1.00 115.10 ? -46 DA  J C2    1 
ATOM   9587  N  N3    . DA  J 6 27  ? -40.157 -26.768 10.524 1.00 114.98 ? -46 DA  J N3    1 
ATOM   9588  C  C4    . DA  J 6 27  ? -39.901 -25.731 9.707  1.00 114.95 ? -46 DA  J C4    1 
ATOM   9589  P  P     . DA  J 6 28  ? -36.246 -23.006 14.071 1.00 110.09 ? -45 DA  J P     1 
ATOM   9590  O  OP1   . DA  J 6 28  ? -36.043 -22.875 15.535 1.00 110.53 ? -45 DA  J OP1   1 
ATOM   9591  O  OP2   . DA  J 6 28  ? -35.251 -22.435 13.130 1.00 110.32 ? -45 DA  J OP2   1 
ATOM   9592  O  "O5'" . DA  J 6 28  ? -36.438 -24.561 13.724 1.00 109.06 ? -45 DA  J "O5'" 1 
ATOM   9593  C  "C5'" . DA  J 6 28  ? -36.148 -25.578 14.684 1.00 107.03 ? -45 DA  J "C5'" 1 
ATOM   9594  C  "C4'" . DA  J 6 28  ? -35.572 -26.807 14.009 1.00 105.61 ? -45 DA  J "C4'" 1 
ATOM   9595  O  "O4'" . DA  J 6 28  ? -36.234 -27.013 12.738 1.00 105.45 ? -45 DA  J "O4'" 1 
ATOM   9596  C  "C3'" . DA  J 6 28  ? -34.086 -26.722 13.690 1.00 105.11 ? -45 DA  J "C3'" 1 
ATOM   9597  O  "O3'" . DA  J 6 28  ? -33.577 -28.027 13.730 1.00 104.58 ? -45 DA  J "O3'" 1 
ATOM   9598  C  "C2'" . DA  J 6 28  ? -34.078 -26.234 12.250 1.00 105.54 ? -45 DA  J "C2'" 1 
ATOM   9599  C  "C1'" . DA  J 6 28  ? -35.248 -27.062 11.725 1.00 106.04 ? -45 DA  J "C1'" 1 
ATOM   9600  N  N9    . DA  J 6 28  ? -35.803 -26.655 10.429 1.00 106.75 ? -45 DA  J N9    1 
ATOM   9601  C  C8    . DA  J 6 28  ? -35.675 -25.444 9.799  1.00 106.92 ? -45 DA  J C8    1 
ATOM   9602  N  N7    . DA  J 6 28  ? -36.284 -25.384 8.639  1.00 107.11 ? -45 DA  J N7    1 
ATOM   9603  C  C5    . DA  J 6 28  ? -36.845 -26.640 8.493  1.00 106.82 ? -45 DA  J C5    1 
ATOM   9604  C  C6    . DA  J 6 28  ? -37.619 -27.223 7.472  1.00 106.91 ? -45 DA  J C6    1 
ATOM   9605  N  N6    . DA  J 6 28  ? -37.975 -26.571 6.362  1.00 107.11 ? -45 DA  J N6    1 
ATOM   9606  N  N1    . DA  J 6 28  ? -38.023 -28.501 7.635  1.00 107.06 ? -45 DA  J N1    1 
ATOM   9607  C  C2    . DA  J 6 28  ? -37.676 -29.155 8.750  1.00 107.01 ? -45 DA  J C2    1 
ATOM   9608  N  N3    . DA  J 6 28  ? -36.946 -28.716 9.772  1.00 106.82 ? -45 DA  J N3    1 
ATOM   9609  C  C4    . DA  J 6 28  ? -36.560 -27.439 9.584  1.00 106.84 ? -45 DA  J C4    1 
ATOM   9610  P  P     . DA  J 6 29  ? -32.820 -28.616 15.002 1.00 104.60 ? -44 DA  J P     1 
ATOM   9611  O  OP1   . DA  J 6 29  ? -33.495 -28.210 16.249 1.00 104.81 ? -44 DA  J OP1   1 
ATOM   9612  O  OP2   . DA  J 6 29  ? -31.370 -28.378 14.801 1.00 104.57 ? -44 DA  J OP2   1 
ATOM   9613  O  "O5'" . DA  J 6 29  ? -33.155 -30.168 14.864 1.00 105.15 ? -44 DA  J "O5'" 1 
ATOM   9614  C  "C5'" . DA  J 6 29  ? -32.308 -31.002 14.118 1.00 105.70 ? -44 DA  J "C5'" 1 
ATOM   9615  C  "C4'" . DA  J 6 29  ? -33.115 -31.960 13.273 1.00 105.90 ? -44 DA  J "C4'" 1 
ATOM   9616  O  "O4'" . DA  J 6 29  ? -34.048 -31.231 12.441 1.00 106.29 ? -44 DA  J "O4'" 1 
ATOM   9617  C  "C3'" . DA  J 6 29  ? -32.205 -32.758 12.361 1.00 106.11 ? -44 DA  J "C3'" 1 
ATOM   9618  O  "O3'" . DA  J 6 29  ? -32.243 -34.102 12.750 1.00 106.79 ? -44 DA  J "O3'" 1 
ATOM   9619  C  "C2'" . DA  J 6 29  ? -32.755 -32.584 10.951 1.00 106.67 ? -44 DA  J "C2'" 1 
ATOM   9620  C  "C1'" . DA  J 6 29  ? -33.920 -31.613 11.084 1.00 106.88 ? -44 DA  J "C1'" 1 
ATOM   9621  N  N9    . DA  J 6 29  ? -33.740 -30.431 10.239 1.00 107.44 ? -44 DA  J N9    1 
ATOM   9622  C  C8    . DA  J 6 29  ? -33.008 -29.307 10.512 1.00 107.59 ? -44 DA  J C8    1 
ATOM   9623  N  N7    . DA  J 6 29  ? -33.029 -28.407 9.556  1.00 107.55 ? -44 DA  J N7    1 
ATOM   9624  C  C5    . DA  J 6 29  ? -33.822 -28.983 8.579  1.00 107.73 ? -44 DA  J C5    1 
ATOM   9625  C  C6    . DA  J 6 29  ? -34.244 -28.541 7.303  1.00 107.68 ? -44 DA  J C6    1 
ATOM   9626  N  N6    . DA  J 6 29  ? -33.901 -27.361 6.775  1.00 106.84 ? -44 DA  J N6    1 
ATOM   9627  N  N1    . DA  J 6 29  ? -35.039 -29.368 6.584  1.00 107.80 ? -44 DA  J N1    1 
ATOM   9628  C  C2    . DA  J 6 29  ? -35.384 -30.558 7.100  1.00 107.62 ? -44 DA  J C2    1 
ATOM   9629  N  N3    . DA  J 6 29  ? -35.053 -31.077 8.283  1.00 107.78 ? -44 DA  J N3    1 
ATOM   9630  C  C4    . DA  J 6 29  ? -34.266 -30.234 8.982  1.00 107.76 ? -44 DA  J C4    1 
ATOM   9631  P  P     . DA  J 6 30  ? -30.927 -34.988 12.555 1.00 108.03 ? -43 DA  J P     1 
ATOM   9632  O  OP1   . DA  J 6 30  ? -30.993 -36.130 13.495 1.00 108.50 ? -43 DA  J OP1   1 
ATOM   9633  O  OP2   . DA  J 6 30  ? -29.726 -34.119 12.525 1.00 107.69 ? -43 DA  J OP2   1 
ATOM   9634  O  "O5'" . DA  J 6 30  ? -31.115 -35.540 11.073 1.00 109.60 ? -43 DA  J "O5'" 1 
ATOM   9635  C  "C5'" . DA  J 6 30  ? -32.309 -36.203 10.669 1.00 110.77 ? -43 DA  J "C5'" 1 
ATOM   9636  C  "C4'" . DA  J 6 30  ? -32.340 -36.222 9.157  1.00 111.29 ? -43 DA  J "C4'" 1 
ATOM   9637  O  "O4'" . DA  J 6 30  ? -32.434 -34.859 8.682  1.00 110.95 ? -43 DA  J "O4'" 1 
ATOM   9638  C  "C3'" . DA  J 6 30  ? -31.092 -36.830 8.518  1.00 112.12 ? -43 DA  J "C3'" 1 
ATOM   9639  O  "O3'" . DA  J 6 30  ? -31.508 -37.827 7.587  1.00 113.70 ? -43 DA  J "O3'" 1 
ATOM   9640  C  "C2'" . DA  J 6 30  ? -30.387 -35.640 7.861  1.00 111.71 ? -43 DA  J "C2'" 1 
ATOM   9641  C  "C1'" . DA  J 6 30  ? -31.560 -34.706 7.589  1.00 111.52 ? -43 DA  J "C1'" 1 
ATOM   9642  N  N9    . DA  J 6 30  ? -31.217 -33.292 7.457  1.00 111.68 ? -43 DA  J N9    1 
ATOM   9643  C  C8    . DA  J 6 30  ? -30.313 -32.570 8.187  1.00 111.87 ? -43 DA  J C8    1 
ATOM   9644  N  N7    . DA  J 6 30  ? -30.228 -31.309 7.829  1.00 111.68 ? -43 DA  J N7    1 
ATOM   9645  C  C5    . DA  J 6 30  ? -31.142 -31.194 6.794  1.00 111.76 ? -43 DA  J C5    1 
ATOM   9646  C  C6    . DA  J 6 30  ? -31.536 -30.114 5.972  1.00 111.68 ? -43 DA  J C6    1 
ATOM   9647  N  N6    . DA  J 6 30  ? -31.037 -28.880 6.073  1.00 111.67 ? -43 DA  J N6    1 
ATOM   9648  N  N1    . DA  J 6 30  ? -32.475 -30.346 5.031  1.00 111.83 ? -43 DA  J N1    1 
ATOM   9649  C  C2    . DA  J 6 30  ? -32.985 -31.578 4.914  1.00 112.07 ? -43 DA  J C2    1 
ATOM   9650  N  N3    . DA  J 6 30  ? -32.696 -32.668 5.624  1.00 111.99 ? -43 DA  J N3    1 
ATOM   9651  C  C4    . DA  J 6 30  ? -31.760 -32.409 6.555  1.00 111.82 ? -43 DA  J C4    1 
ATOM   9652  P  P     . DG  J 6 31  ? -30.498 -38.787 6.797  1.00 114.59 ? -42 DG  J P     1 
ATOM   9653  O  OP1   . DG  J 6 31  ? -31.214 -40.070 6.603  1.00 114.58 ? -42 DG  J OP1   1 
ATOM   9654  O  OP2   . DG  J 6 31  ? -29.168 -38.791 7.439  1.00 114.19 ? -42 DG  J OP2   1 
ATOM   9655  O  "O5'" . DG  J 6 31  ? -30.341 -38.015 5.405  1.00 116.57 ? -42 DG  J "O5'" 1 
ATOM   9656  C  "C5'" . DG  J 6 31  ? -31.397 -38.016 4.453  1.00 120.12 ? -42 DG  J "C5'" 1 
ATOM   9657  C  "C4'" . DG  J 6 31  ? -31.027 -37.256 3.186  1.00 123.07 ? -42 DG  J "C4'" 1 
ATOM   9658  O  "O4'" . DG  J 6 31  ? -30.981 -35.837 3.473  1.00 123.66 ? -42 DG  J "O4'" 1 
ATOM   9659  C  "C3'" . DG  J 6 31  ? -29.694 -37.621 2.523  1.00 124.98 ? -42 DG  J "C3'" 1 
ATOM   9660  O  "O3'" . DG  J 6 31  ? -29.917 -37.931 1.128  1.00 127.54 ? -42 DG  J "O3'" 1 
ATOM   9661  C  "C2'" . DG  J 6 31  ? -28.839 -36.368 2.733  1.00 124.89 ? -42 DG  J "C2'" 1 
ATOM   9662  C  "C1'" . DG  J 6 31  ? -29.895 -35.271 2.775  1.00 124.91 ? -42 DG  J "C1'" 1 
ATOM   9663  N  N9    . DG  J 6 31  ? -29.492 -34.049 3.470  1.00 125.94 ? -42 DG  J N9    1 
ATOM   9664  C  C8    . DG  J 6 31  ? -29.224 -33.919 4.812  1.00 126.31 ? -42 DG  J C8    1 
ATOM   9665  N  N7    . DG  J 6 31  ? -28.890 -32.708 5.160  1.00 126.90 ? -42 DG  J N7    1 
ATOM   9666  C  C5    . DG  J 6 31  ? -28.946 -31.979 3.976  1.00 127.04 ? -42 DG  J C5    1 
ATOM   9667  C  C6    . DG  J 6 31  ? -28.682 -30.603 3.726  1.00 127.25 ? -42 DG  J C6    1 
ATOM   9668  O  O6    . DG  J 6 31  ? -28.342 -29.726 4.532  1.00 127.30 ? -42 DG  J O6    1 
ATOM   9669  N  N1    . DG  J 6 31  ? -28.847 -30.264 2.380  1.00 127.59 ? -42 DG  J N1    1 
ATOM   9670  C  C2    . DG  J 6 31  ? -29.224 -31.149 1.393  1.00 127.62 ? -42 DG  J C2    1 
ATOM   9671  N  N2    . DG  J 6 31  ? -29.331 -30.648 0.154  1.00 127.53 ? -42 DG  J N2    1 
ATOM   9672  N  N3    . DG  J 6 31  ? -29.470 -32.441 1.614  1.00 127.37 ? -42 DG  J N3    1 
ATOM   9673  C  C4    . DG  J 6 31  ? -29.314 -32.793 2.923  1.00 126.78 ? -42 DG  J C4    1 
ATOM   9674  P  P     . DT  J 6 32  ? -28.829 -38.618 0.152  1.00 129.45 ? -41 DT  J P     1 
ATOM   9675  O  OP1   . DT  J 6 32  ? -29.302 -39.993 -0.131 1.00 129.52 ? -41 DT  J OP1   1 
ATOM   9676  O  OP2   . DT  J 6 32  ? -27.459 -38.405 0.673  1.00 129.42 ? -41 DT  J OP2   1 
ATOM   9677  O  "O5'" . DT  J 6 32  ? -28.959 -37.723 -1.170 1.00 130.80 ? -41 DT  J "O5'" 1 
ATOM   9678  C  "C5'" . DT  J 6 32  ? -29.164 -36.310 -1.059 1.00 132.86 ? -41 DT  J "C5'" 1 
ATOM   9679  C  "C4'" . DT  J 6 32  ? -28.115 -35.465 -1.777 1.00 134.35 ? -41 DT  J "C4'" 1 
ATOM   9680  O  "O4'" . DT  J 6 32  ? -27.872 -34.261 -0.997 1.00 134.78 ? -41 DT  J "O4'" 1 
ATOM   9681  C  "C3'" . DT  J 6 32  ? -26.749 -36.101 -2.059 1.00 135.02 ? -41 DT  J "C3'" 1 
ATOM   9682  O  "O3'" . DT  J 6 32  ? -26.418 -35.878 -3.442 1.00 135.96 ? -41 DT  J "O3'" 1 
ATOM   9683  C  "C2'" . DT  J 6 32  ? -25.802 -35.389 -1.090 1.00 135.05 ? -41 DT  J "C2'" 1 
ATOM   9684  C  "C1'" . DT  J 6 32  ? -26.485 -34.041 -0.847 1.00 134.97 ? -41 DT  J "C1'" 1 
ATOM   9685  N  N1    . DT  J 6 32  ? -26.237 -33.449 0.514  1.00 134.94 ? -41 DT  J N1    1 
ATOM   9686  C  C2    . DT  J 6 32  ? -26.226 -32.071 0.689  1.00 134.78 ? -41 DT  J C2    1 
ATOM   9687  O  O2    . DT  J 6 32  ? -26.414 -31.258 -0.201 1.00 134.37 ? -41 DT  J O2    1 
ATOM   9688  N  N3    . DT  J 6 32  ? -25.988 -31.665 1.982  1.00 134.91 ? -41 DT  J N3    1 
ATOM   9689  C  C4    . DT  J 6 32  ? -25.762 -32.471 3.089  1.00 134.99 ? -41 DT  J C4    1 
ATOM   9690  O  O4    . DT  J 6 32  ? -25.559 -31.998 4.204  1.00 134.89 ? -41 DT  J O4    1 
ATOM   9691  C  C5    . DT  J 6 32  ? -25.788 -33.897 2.839  1.00 135.11 ? -41 DT  J C5    1 
ATOM   9692  C  C7    . DT  J 6 32  ? -25.558 -34.884 3.947  1.00 135.15 ? -41 DT  J C7    1 
ATOM   9693  C  C6    . DT  J 6 32  ? -26.021 -34.306 1.584  1.00 135.00 ? -41 DT  J C6    1 
ATOM   9694  P  P     . DG  J 6 33  ? -25.019 -36.271 -4.134 1.00 136.47 ? -40 DG  J P     1 
ATOM   9695  O  OP1   . DG  J 6 33  ? -25.335 -36.571 -5.548 1.00 136.51 ? -40 DG  J OP1   1 
ATOM   9696  O  OP2   . DG  J 6 33  ? -24.320 -37.292 -3.313 1.00 136.04 ? -40 DG  J OP2   1 
ATOM   9697  O  "O5'" . DG  J 6 33  ? -24.179 -34.902 -4.078 1.00 137.04 ? -40 DG  J "O5'" 1 
ATOM   9698  C  "C5'" . DG  J 6 33  ? -24.678 -33.679 -4.653 1.00 138.02 ? -40 DG  J "C5'" 1 
ATOM   9699  C  "C4'" . DG  J 6 33  ? -23.717 -32.506 -4.466 1.00 138.89 ? -40 DG  J "C4'" 1 
ATOM   9700  O  "O4'" . DG  J 6 33  ? -23.701 -32.063 -3.079 1.00 139.76 ? -40 DG  J "O4'" 1 
ATOM   9701  C  "C3'" . DG  J 6 33  ? -22.257 -32.778 -4.827 1.00 138.99 ? -40 DG  J "C3'" 1 
ATOM   9702  O  "O3'" . DG  J 6 33  ? -21.680 -31.633 -5.446 1.00 138.14 ? -40 DG  J "O3'" 1 
ATOM   9703  C  "C2'" . DG  J 6 33  ? -21.601 -33.047 -3.475 1.00 139.78 ? -40 DG  J "C2'" 1 
ATOM   9704  C  "C1'" . DG  J 6 33  ? -22.370 -32.073 -2.586 1.00 140.47 ? -40 DG  J "C1'" 1 
ATOM   9705  N  N9    . DG  J 6 33  ? -22.347 -32.423 -1.163 1.00 141.32 ? -40 DG  J N9    1 
ATOM   9706  C  C8    . DG  J 6 33  ? -22.519 -33.671 -0.610 1.00 141.56 ? -40 DG  J C8    1 
ATOM   9707  N  N7    . DG  J 6 33  ? -22.443 -33.683 0.691  1.00 141.99 ? -40 DG  J N7    1 
ATOM   9708  C  C5    . DG  J 6 33  ? -22.204 -32.357 1.030  1.00 142.27 ? -40 DG  J C5    1 
ATOM   9709  C  C6    . DG  J 6 33  ? -22.030 -31.753 2.306  1.00 142.60 ? -40 DG  J C6    1 
ATOM   9710  O  O6    . DG  J 6 33  ? -22.053 -32.296 3.420  1.00 142.69 ? -40 DG  J O6    1 
ATOM   9711  N  N1    . DG  J 6 33  ? -21.808 -30.377 2.212  1.00 142.77 ? -40 DG  J N1    1 
ATOM   9712  C  C2    . DG  J 6 33  ? -21.762 -29.675 1.026  1.00 142.90 ? -40 DG  J C2    1 
ATOM   9713  N  N2    . DG  J 6 33  ? -21.540 -28.356 1.121  1.00 143.23 ? -40 DG  J N2    1 
ATOM   9714  N  N3    . DG  J 6 33  ? -21.924 -30.229 -0.174 1.00 142.57 ? -40 DG  J N3    1 
ATOM   9715  C  C4    . DG  J 6 33  ? -22.140 -31.569 -0.101 1.00 141.99 ? -40 DG  J C4    1 
ATOM   9716  P  P     . DT  J 6 34  ? -20.257 -31.755 -6.168 1.00 137.65 ? -39 DT  J P     1 
ATOM   9717  O  OP1   . DT  J 6 34  ? -20.144 -30.601 -7.092 1.00 137.27 ? -39 DT  J OP1   1 
ATOM   9718  O  OP2   . DT  J 6 34  ? -20.107 -33.142 -6.671 1.00 137.80 ? -39 DT  J OP2   1 
ATOM   9719  O  "O5'" . DT  J 6 34  ? -19.197 -31.617 -4.976 1.00 137.03 ? -39 DT  J "O5'" 1 
ATOM   9720  C  "C5'" . DT  J 6 34  ? -17.932 -31.007 -5.201 1.00 135.92 ? -39 DT  J "C5'" 1 
ATOM   9721  C  "C4'" . DT  J 6 34  ? -18.001 -29.542 -4.789 1.00 135.01 ? -39 DT  J "C4'" 1 
ATOM   9722  O  "O4'" . DT  J 6 34  ? -18.722 -29.400 -3.535 1.00 135.00 ? -39 DT  J "O4'" 1 
ATOM   9723  C  "C3'" . DT  J 6 34  ? -16.674 -28.839 -4.545 1.00 134.15 ? -39 DT  J "C3'" 1 
ATOM   9724  O  "O3'" . DT  J 6 34  ? -16.903 -27.437 -4.754 1.00 132.68 ? -39 DT  J "O3'" 1 
ATOM   9725  C  "C2'" . DT  J 6 34  ? -16.412 -29.215 -3.086 1.00 134.45 ? -39 DT  J "C2'" 1 
ATOM   9726  C  "C1'" . DT  J 6 34  ? -17.815 -29.127 -2.479 1.00 134.78 ? -39 DT  J "C1'" 1 
ATOM   9727  N  N1    . DT  J 6 34  ? -18.083 -30.058 -1.315 1.00 134.71 ? -39 DT  J N1    1 
ATOM   9728  C  C2    . DT  J 6 34  ? -18.323 -29.536 -0.049 1.00 134.54 ? -39 DT  J C2    1 
ATOM   9729  O  O2    . DT  J 6 34  ? -18.328 -28.342 0.221  1.00 134.03 ? -39 DT  J O2    1 
ATOM   9730  N  N3    . DT  J 6 34  ? -18.552 -30.481 0.923  1.00 134.65 ? -39 DT  J N3    1 
ATOM   9731  C  C4    . DT  J 6 34  ? -18.575 -31.859 0.774  1.00 134.70 ? -39 DT  J C4    1 
ATOM   9732  O  O4    . DT  J 6 34  ? -18.794 -32.607 1.723  1.00 134.70 ? -39 DT  J O4    1 
ATOM   9733  C  C5    . DT  J 6 34  ? -18.324 -32.340 -0.568 1.00 134.78 ? -39 DT  J C5    1 
ATOM   9734  C  C7    . DT  J 6 34  ? -18.321 -33.813 -0.871 1.00 134.88 ? -39 DT  J C7    1 
ATOM   9735  C  C6    . DT  J 6 34  ? -18.095 -31.430 -1.529 1.00 134.68 ? -39 DT  J C6    1 
ATOM   9736  P  P     . DA  J 6 35  ? -15.888 -26.289 -4.281 1.00 131.78 ? -38 DA  J P     1 
ATOM   9737  O  OP1   . DA  J 6 35  ? -16.269 -25.057 -5.015 1.00 131.67 ? -38 DA  J OP1   1 
ATOM   9738  O  OP2   . DA  J 6 35  ? -14.492 -26.800 -4.379 1.00 131.29 ? -38 DA  J OP2   1 
ATOM   9739  O  "O5'" . DA  J 6 35  ? -16.265 -26.134 -2.723 1.00 131.08 ? -38 DA  J "O5'" 1 
ATOM   9740  C  "C5'" . DA  J 6 35  ? -16.861 -24.943 -2.178 1.00 129.51 ? -38 DA  J "C5'" 1 
ATOM   9741  C  "C4'" . DA  J 6 35  ? -16.225 -24.572 -0.844 1.00 128.24 ? -38 DA  J "C4'" 1 
ATOM   9742  O  "O4'" . DA  J 6 35  ? -16.387 -25.645 0.126  1.00 127.29 ? -38 DA  J "O4'" 1 
ATOM   9743  C  "C3'" . DA  J 6 35  ? -14.729 -24.278 -0.917 1.00 127.94 ? -38 DA  J "C3'" 1 
ATOM   9744  O  "O3'" . DA  J 6 35  ? -14.430 -23.110 -0.136 1.00 128.14 ? -38 DA  J "O3'" 1 
ATOM   9745  C  "C2'" . DA  J 6 35  ? -14.092 -25.558 -0.374 1.00 127.38 ? -38 DA  J "C2'" 1 
ATOM   9746  C  "C1'" . DA  J 6 35  ? -15.126 -26.030 0.644  1.00 127.07 ? -38 DA  J "C1'" 1 
ATOM   9747  N  N9    . DA  J 6 35  ? -15.144 -27.477 0.862  1.00 126.73 ? -38 DA  J N9    1 
ATOM   9748  C  C8    . DA  J 6 35  ? -15.224 -28.438 -0.106 1.00 126.81 ? -38 DA  J C8    1 
ATOM   9749  N  N7    . DA  J 6 35  ? -15.233 -29.669 0.343  1.00 126.60 ? -38 DA  J N7    1 
ATOM   9750  C  C5    . DA  J 6 35  ? -15.150 -29.511 1.713  1.00 126.46 ? -38 DA  J C5    1 
ATOM   9751  C  C6    . DA  J 6 35  ? -15.114 -30.449 2.768  1.00 126.13 ? -38 DA  J C6    1 
ATOM   9752  N  N6    . DA  J 6 35  ? -15.166 -31.765 2.560  1.00 125.69 ? -38 DA  J N6    1 
ATOM   9753  N  N1    . DA  J 6 35  ? -15.025 -29.981 4.035  1.00 125.93 ? -38 DA  J N1    1 
ATOM   9754  C  C2    . DA  J 6 35  ? -14.978 -28.653 4.224  1.00 125.93 ? -38 DA  J C2    1 
ATOM   9755  N  N3    . DA  J 6 35  ? -15.004 -27.675 3.311  1.00 126.10 ? -38 DA  J N3    1 
ATOM   9756  C  C4    . DA  J 6 35  ? -15.093 -28.169 2.058  1.00 126.47 ? -38 DA  J C4    1 
ATOM   9757  P  P     . DT  J 6 36  ? -13.005 -22.366 -0.187 1.00 128.12 ? -37 DT  J P     1 
ATOM   9758  O  OP1   . DT  J 6 36  ? -13.183 -21.049 0.467  1.00 128.07 ? -37 DT  J OP1   1 
ATOM   9759  O  OP2   . DT  J 6 36  ? -12.467 -22.414 -1.565 1.00 128.68 ? -37 DT  J OP2   1 
ATOM   9760  O  "O5'" . DT  J 6 36  ? -12.094 -23.348 0.687  1.00 128.02 ? -37 DT  J "O5'" 1 
ATOM   9761  C  "C5'" . DT  J 6 36  ? -11.309 -22.878 1.768  1.00 127.86 ? -37 DT  J "C5'" 1 
ATOM   9762  C  "C4'" . DT  J 6 36  ? -11.934 -23.207 3.120  1.00 127.38 ? -37 DT  J "C4'" 1 
ATOM   9763  O  "O4'" . DT  J 6 36  ? -12.606 -24.498 3.124  1.00 127.14 ? -37 DT  J "O4'" 1 
ATOM   9764  C  "C3'" . DT  J 6 36  ? -10.906 -23.258 4.240  1.00 126.97 ? -37 DT  J "C3'" 1 
ATOM   9765  O  "O3'" . DT  J 6 36  ? -11.401 -22.558 5.377  1.00 126.13 ? -37 DT  J "O3'" 1 
ATOM   9766  C  "C2'" . DT  J 6 36  ? -10.704 -24.749 4.499  1.00 127.13 ? -37 DT  J "C2'" 1 
ATOM   9767  C  "C1'" . DT  J 6 36  ? -12.030 -25.372 4.079  1.00 127.45 ? -37 DT  J "C1'" 1 
ATOM   9768  N  N1    . DT  J 6 36  ? -11.876 -26.755 3.493  1.00 128.23 ? -37 DT  J N1    1 
ATOM   9769  C  C2    . DT  J 6 36  ? -11.810 -27.867 4.322  1.00 128.61 ? -37 DT  J C2    1 
ATOM   9770  O  O2    . DT  J 6 36  ? -11.873 -27.828 5.538  1.00 128.98 ? -37 DT  J O2    1 
ATOM   9771  N  N3    . DT  J 6 36  ? -11.671 -29.068 3.671  1.00 128.88 ? -37 DT  J N3    1 
ATOM   9772  C  C4    . DT  J 6 36  ? -11.590 -29.275 2.304  1.00 129.29 ? -37 DT  J C4    1 
ATOM   9773  O  O4    . DT  J 6 36  ? -11.467 -30.401 1.830  1.00 129.31 ? -37 DT  J O4    1 
ATOM   9774  C  C5    . DT  J 6 36  ? -11.662 -28.078 1.488  1.00 129.27 ? -37 DT  J C5    1 
ATOM   9775  C  C7    . DT  J 6 36  ? -11.585 -28.156 -0.013 1.00 129.21 ? -37 DT  J C7    1 
ATOM   9776  C  C6    . DT  J 6 36  ? -11.796 -26.898 2.117  1.00 128.78 ? -37 DT  J C6    1 
ATOM   9777  P  P     . DT  J 6 37  ? -10.395 -21.864 6.414  1.00 125.57 ? -36 DT  J P     1 
ATOM   9778  O  OP1   . DT  J 6 37  ? -10.687 -20.412 6.419  1.00 125.42 ? -36 DT  J OP1   1 
ATOM   9779  O  OP2   . DT  J 6 37  ? -9.008  -22.338 6.148  1.00 125.54 ? -36 DT  J OP2   1 
ATOM   9780  O  "O5'" . DT  J 6 37  ? -10.843 -22.464 7.837  1.00 125.60 ? -36 DT  J "O5'" 1 
ATOM   9781  C  "C5'" . DT  J 6 37  ? -11.647 -23.644 7.942  1.00 124.69 ? -36 DT  J "C5'" 1 
ATOM   9782  C  "C4'" . DT  J 6 37  ? -11.067 -24.688 8.885  1.00 124.14 ? -36 DT  J "C4'" 1 
ATOM   9783  O  "O4'" . DT  J 6 37  ? -10.890 -25.945 8.181  1.00 123.87 ? -36 DT  J "O4'" 1 
ATOM   9784  C  "C3'" . DT  J 6 37  ? -9.732  -24.377 9.557  1.00 124.16 ? -36 DT  J "C3'" 1 
ATOM   9785  O  "O3'" . DT  J 6 37  ? -9.955  -24.520 10.968 1.00 123.65 ? -36 DT  J "O3'" 1 
ATOM   9786  C  "C2'" . DT  J 6 37  ? -8.760  -25.395 8.945  1.00 124.10 ? -36 DT  J "C2'" 1 
ATOM   9787  C  "C1'" . DT  J 6 37  ? -9.677  -26.553 8.567  1.00 123.97 ? -36 DT  J "C1'" 1 
ATOM   9788  N  N1    . DT  J 6 37  ? -9.250  -27.417 7.413  1.00 124.28 ? -36 DT  J N1    1 
ATOM   9789  C  C2    . DT  J 6 37  ? -9.494  -28.782 7.449  1.00 124.49 ? -36 DT  J C2    1 
ATOM   9790  O  O2    . DT  J 6 37  ? -10.030 -29.354 8.382  1.00 124.64 ? -36 DT  J O2    1 
ATOM   9791  N  N3    . DT  J 6 37  ? -9.079  -29.477 6.335  1.00 124.68 ? -36 DT  J N3    1 
ATOM   9792  C  C4    . DT  J 6 37  ? -8.461  -28.959 5.205  1.00 124.73 ? -36 DT  J C4    1 
ATOM   9793  O  O4    . DT  J 6 37  ? -8.131  -29.677 4.262  1.00 124.63 ? -36 DT  J O4    1 
ATOM   9794  C  C5    . DT  J 6 37  ? -8.239  -27.527 5.228  1.00 124.57 ? -36 DT  J C5    1 
ATOM   9795  C  C7    . DT  J 6 37  ? -7.579  -26.826 4.076  1.00 124.60 ? -36 DT  J C7    1 
ATOM   9796  C  C6    . DT  J 6 37  ? -8.639  -26.841 6.311  1.00 124.45 ? -36 DT  J C6    1 
ATOM   9797  P  P     . DT  J 6 38  ? -8.820  -24.563 12.104 1.00 123.20 ? -35 DT  J P     1 
ATOM   9798  O  OP1   . DT  J 6 38  ? -9.447  -23.944 13.292 1.00 123.31 ? -35 DT  J OP1   1 
ATOM   9799  O  OP2   . DT  J 6 38  ? -7.533  -24.031 11.589 1.00 122.71 ? -35 DT  J OP2   1 
ATOM   9800  O  "O5'" . DT  J 6 38  ? -8.642  -26.131 12.368 1.00 122.54 ? -35 DT  J "O5'" 1 
ATOM   9801  C  "C5'" . DT  J 6 38  ? -9.791  -26.908 12.661 1.00 122.82 ? -35 DT  J "C5'" 1 
ATOM   9802  C  "C4'" . DT  J 6 38  ? -9.440  -28.352 12.948 1.00 123.21 ? -35 DT  J "C4'" 1 
ATOM   9803  O  "O4'" . DT  J 6 38  ? -9.082  -29.014 11.712 1.00 123.62 ? -35 DT  J "O4'" 1 
ATOM   9804  C  "C3'" . DT  J 6 38  ? -8.274  -28.542 13.907 1.00 123.54 ? -35 DT  J "C3'" 1 
ATOM   9805  O  "O3'" . DT  J 6 38  ? -8.637  -29.503 14.890 1.00 123.46 ? -35 DT  J "O3'" 1 
ATOM   9806  C  "C2'" . DT  J 6 38  ? -7.126  -29.028 13.022 1.00 123.86 ? -35 DT  J "C2'" 1 
ATOM   9807  C  "C1'" . DT  J 6 38  ? -7.857  -29.703 11.865 1.00 124.22 ? -35 DT  J "C1'" 1 
ATOM   9808  N  N1    . DT  J 6 38  ? -7.140  -29.677 10.541 1.00 124.88 ? -35 DT  J N1    1 
ATOM   9809  C  C2    . DT  J 6 38  ? -6.995  -30.851 9.816  1.00 125.09 ? -35 DT  J C2    1 
ATOM   9810  O  O2    . DT  J 6 38  ? -7.408  -31.939 10.185 1.00 124.76 ? -35 DT  J O2    1 
ATOM   9811  N  N3    . DT  J 6 38  ? -6.331  -30.705 8.618  1.00 125.20 ? -35 DT  J N3    1 
ATOM   9812  C  C4    . DT  J 6 38  ? -5.812  -29.538 8.081  1.00 125.22 ? -35 DT  J C4    1 
ATOM   9813  O  O4    . DT  J 6 38  ? -5.238  -29.536 6.995  1.00 125.35 ? -35 DT  J O4    1 
ATOM   9814  C  C5    . DT  J 6 38  ? -5.998  -28.347 8.885  1.00 125.37 ? -35 DT  J C5    1 
ATOM   9815  C  C7    . DT  J 6 38  ? -5.486  -27.007 8.431  1.00 125.58 ? -35 DT  J C7    1 
ATOM   9816  C  C6    . DT  J 6 38  ? -6.645  -28.475 10.055 1.00 125.21 ? -35 DT  J C6    1 
ATOM   9817  P  P     . DG  J 6 39  ? -8.386  -29.225 16.445 1.00 123.08 ? -34 DG  J P     1 
ATOM   9818  O  OP1   . DG  J 6 39  ? -9.689  -28.880 17.050 1.00 122.40 ? -34 DG  J OP1   1 
ATOM   9819  O  OP2   . DG  J 6 39  ? -7.241  -28.292 16.580 1.00 122.72 ? -34 DG  J OP2   1 
ATOM   9820  O  "O5'" . DG  J 6 39  ? -7.916  -30.655 16.996 1.00 124.73 ? -34 DG  J "O5'" 1 
ATOM   9821  C  "C5'" . DG  J 6 39  ? -8.124  -31.882 16.276 1.00 127.18 ? -34 DG  J "C5'" 1 
ATOM   9822  C  "C4'" . DG  J 6 39  ? -6.828  -32.645 16.007 1.00 128.89 ? -34 DG  J "C4'" 1 
ATOM   9823  O  "O4'" . DG  J 6 39  ? -6.201  -32.131 14.802 1.00 128.95 ? -34 DG  J "O4'" 1 
ATOM   9824  C  "C3'" . DG  J 6 39  ? -5.753  -32.591 17.103 1.00 130.19 ? -34 DG  J "C3'" 1 
ATOM   9825  O  "O3'" . DG  J 6 39  ? -5.119  -33.863 17.349 1.00 131.98 ? -34 DG  J "O3'" 1 
ATOM   9826  C  "C2'" . DG  J 6 39  ? -4.743  -31.589 16.544 1.00 129.90 ? -34 DG  J "C2'" 1 
ATOM   9827  C  "C1'" . DG  J 6 39  ? -4.825  -31.927 15.061 1.00 129.50 ? -34 DG  J "C1'" 1 
ATOM   9828  N  N9    . DG  J 6 39  ? -4.330  -30.913 14.130 1.00 129.56 ? -34 DG  J N9    1 
ATOM   9829  C  C8    . DG  J 6 39  ? -3.956  -29.611 14.377 1.00 129.48 ? -34 DG  J C8    1 
ATOM   9830  N  N7    . DG  J 6 39  ? -3.560  -28.975 13.308 1.00 129.49 ? -34 DG  J N7    1 
ATOM   9831  C  C5    . DG  J 6 39  ? -3.677  -29.912 12.289 1.00 129.46 ? -34 DG  J C5    1 
ATOM   9832  C  C6    . DG  J 6 39  ? -3.396  -29.810 10.903 1.00 129.37 ? -34 DG  J C6    1 
ATOM   9833  O  O6    . DG  J 6 39  ? -2.971  -28.825 10.283 1.00 129.39 ? -34 DG  J O6    1 
ATOM   9834  N  N1    . DG  J 6 39  ? -3.656  -31.007 10.226 1.00 129.30 ? -34 DG  J N1    1 
ATOM   9835  C  C2    . DG  J 6 39  ? -4.129  -32.158 10.822 1.00 129.45 ? -34 DG  J C2    1 
ATOM   9836  N  N2    . DG  J 6 39  ? -4.326  -33.224 10.037 1.00 129.42 ? -34 DG  J N2    1 
ATOM   9837  N  N3    . DG  J 6 39  ? -4.396  -32.263 12.116 1.00 129.56 ? -34 DG  J N3    1 
ATOM   9838  C  C4    . DG  J 6 39  ? -4.148  -31.108 12.783 1.00 129.49 ? -34 DG  J C4    1 
ATOM   9839  P  P     . DG  J 6 40  ? -5.931  -35.184 17.754 1.00 133.64 ? -33 DG  J P     1 
ATOM   9840  O  OP1   . DG  J 6 40  ? -6.270  -35.911 16.511 1.00 133.69 ? -33 DG  J OP1   1 
ATOM   9841  O  OP2   . DG  J 6 40  ? -7.011  -34.794 18.691 1.00 133.41 ? -33 DG  J OP2   1 
ATOM   9842  O  "O5'" . DG  J 6 40  ? -4.860  -36.048 18.571 1.00 135.45 ? -33 DG  J "O5'" 1 
ATOM   9843  C  "C5'" . DG  J 6 40  ? -3.577  -36.365 18.041 1.00 137.88 ? -33 DG  J "C5'" 1 
ATOM   9844  C  "C4'" . DG  J 6 40  ? -3.639  -37.470 16.996 1.00 139.78 ? -33 DG  J "C4'" 1 
ATOM   9845  O  "O4'" . DG  J 6 40  ? -3.725  -36.858 15.683 1.00 140.33 ? -33 DG  J "O4'" 1 
ATOM   9846  C  "C3'" . DG  J 6 40  ? -2.412  -38.371 16.925 1.00 141.05 ? -33 DG  J "C3'" 1 
ATOM   9847  O  "O3'" . DG  J 6 40  ? -2.715  -39.630 16.306 1.00 142.54 ? -33 DG  J "O3'" 1 
ATOM   9848  C  "C2'" . DG  J 6 40  ? -1.492  -37.533 16.047 1.00 141.17 ? -33 DG  J "C2'" 1 
ATOM   9849  C  "C1'" . DG  J 6 40  ? -2.467  -36.937 15.035 1.00 141.02 ? -33 DG  J "C1'" 1 
ATOM   9850  N  N9    . DG  J 6 40  ? -2.039  -35.615 14.580 1.00 141.30 ? -33 DG  J N9    1 
ATOM   9851  C  C8    . DG  J 6 40  ? -1.757  -34.511 15.352 1.00 141.26 ? -33 DG  J C8    1 
ATOM   9852  N  N7    . DG  J 6 40  ? -1.384  -33.470 14.661 1.00 141.35 ? -33 DG  J N7    1 
ATOM   9853  C  C5    . DG  J 6 40  ? -1.414  -33.911 13.343 1.00 141.72 ? -33 DG  J C5    1 
ATOM   9854  C  C6    . DG  J 6 40  ? -1.109  -33.225 12.134 1.00 141.83 ? -33 DG  J C6    1 
ATOM   9855  O  O6    . DG  J 6 40  ? -0.739  -32.050 11.986 1.00 141.68 ? -33 DG  J O6    1 
ATOM   9856  N  N1    . DG  J 6 40  ? -1.272  -34.045 11.014 1.00 142.10 ? -33 DG  J N1    1 
ATOM   9857  C  C2    . DG  J 6 40  ? -1.678  -35.364 11.053 1.00 142.21 ? -33 DG  J C2    1 
ATOM   9858  N  N2    . DG  J 6 40  ? -1.779  -35.998 9.873  1.00 142.37 ? -33 DG  J N2    1 
ATOM   9859  N  N3    . DG  J 6 40  ? -1.965  -36.016 12.177 1.00 141.98 ? -33 DG  J N3    1 
ATOM   9860  C  C4    . DG  J 6 40  ? -1.812  -35.232 13.278 1.00 141.68 ? -33 DG  J C4    1 
ATOM   9861  P  P     . DA  J 6 41  ? -1.655  -40.841 16.236 1.00 143.58 ? -32 DA  J P     1 
ATOM   9862  O  OP1   . DA  J 6 41  ? -2.247  -41.956 17.008 1.00 143.79 ? -32 DA  J OP1   1 
ATOM   9863  O  OP2   . DA  J 6 41  ? -0.300  -40.349 16.586 1.00 143.29 ? -32 DA  J OP2   1 
ATOM   9864  O  "O5'" . DA  J 6 41  ? -1.655  -41.250 14.685 1.00 144.29 ? -32 DA  J "O5'" 1 
ATOM   9865  C  "C5'" . DA  J 6 41  ? -1.242  -40.325 13.679 1.00 145.20 ? -32 DA  J "C5'" 1 
ATOM   9866  C  "C4'" . DA  J 6 41  ? 0.038   -40.749 12.967 1.00 145.89 ? -32 DA  J "C4'" 1 
ATOM   9867  O  "O4'" . DA  J 6 41  ? 0.671   -39.566 12.418 1.00 146.06 ? -32 DA  J "O4'" 1 
ATOM   9868  C  "C3'" . DA  J 6 41  ? 1.118   -41.453 13.792 1.00 146.23 ? -32 DA  J "C3'" 1 
ATOM   9869  O  "O3'" . DA  J 6 41  ? 1.741   -42.471 12.988 1.00 146.52 ? -32 DA  J "O3'" 1 
ATOM   9870  C  "C2'" . DA  J 6 41  ? 2.058   -40.319 14.199 1.00 146.30 ? -32 DA  J "C2'" 1 
ATOM   9871  C  "C1'" . DA  J 6 41  ? 1.888   -39.294 13.083 1.00 146.55 ? -32 DA  J "C1'" 1 
ATOM   9872  N  N9    . DA  J 6 41  ? 1.837   -37.917 13.571 1.00 147.25 ? -32 DA  J N9    1 
ATOM   9873  C  C8    . DA  J 6 41  ? 1.561   -37.506 14.846 1.00 147.38 ? -32 DA  J C8    1 
ATOM   9874  N  N7    . DA  J 6 41  ? 1.583   -36.205 15.010 1.00 147.61 ? -32 DA  J N7    1 
ATOM   9875  C  C5    . DA  J 6 41  ? 1.899   -35.720 13.752 1.00 147.92 ? -32 DA  J C5    1 
ATOM   9876  C  C6    . DA  J 6 41  ? 2.078   -34.409 13.252 1.00 148.12 ? -32 DA  J C6    1 
ATOM   9877  N  N6    . DA  J 6 41  ? 1.954   -33.311 14.006 1.00 148.13 ? -32 DA  J N6    1 
ATOM   9878  N  N1    . DA  J 6 41  ? 2.391   -34.268 11.941 1.00 148.32 ? -32 DA  J N1    1 
ATOM   9879  C  C2    . DA  J 6 41  ? 2.516   -35.369 11.182 1.00 148.29 ? -32 DA  J C2    1 
ATOM   9880  N  N3    . DA  J 6 41  ? 2.369   -36.650 11.541 1.00 148.13 ? -32 DA  J N3    1 
ATOM   9881  C  C4    . DA  J 6 41  ? 2.059   -36.763 12.850 1.00 147.82 ? -32 DA  J C4    1 
ATOM   9882  P  P     . DA  J 6 42  ? 3.251   -42.994 13.156 1.00 146.75 ? -31 DA  J P     1 
ATOM   9883  O  OP1   . DA  J 6 42  ? 3.312   -44.323 12.509 1.00 146.77 ? -31 DA  J OP1   1 
ATOM   9884  O  OP2   . DA  J 6 42  ? 3.674   -42.853 14.570 1.00 146.60 ? -31 DA  J OP2   1 
ATOM   9885  O  "O5'" . DA  J 6 42  ? 4.084   -41.952 12.267 1.00 147.51 ? -31 DA  J "O5'" 1 
ATOM   9886  C  "C5'" . DA  J 6 42  ? 5.267   -42.347 11.562 1.00 148.36 ? -31 DA  J "C5'" 1 
ATOM   9887  C  "C4'" . DA  J 6 42  ? 6.217   -41.176 11.342 1.00 148.89 ? -31 DA  J "C4'" 1 
ATOM   9888  O  "O4'" . DA  J 6 42  ? 5.610   -39.930 11.796 1.00 149.06 ? -31 DA  J "O4'" 1 
ATOM   9889  C  "C3'" . DA  J 6 42  ? 7.556   -41.289 12.075 1.00 149.35 ? -31 DA  J "C3'" 1 
ATOM   9890  O  "O3'" . DA  J 6 42  ? 8.652   -40.945 11.207 1.00 149.76 ? -31 DA  J "O3'" 1 
ATOM   9891  C  "C2'" . DA  J 6 42  ? 7.400   -40.290 13.223 1.00 149.29 ? -31 DA  J "C2'" 1 
ATOM   9892  C  "C1'" . DA  J 6 42  ? 6.572   -39.206 12.540 1.00 149.19 ? -31 DA  J "C1'" 1 
ATOM   9893  N  N9    . DA  J 6 42  ? 5.951   -38.249 13.467 1.00 149.11 ? -31 DA  J N9    1 
ATOM   9894  C  C8    . DA  J 6 42  ? 5.195   -38.533 14.576 1.00 149.02 ? -31 DA  J C8    1 
ATOM   9895  N  N7    . DA  J 6 42  ? 4.779   -37.472 15.228 1.00 148.77 ? -31 DA  J N7    1 
ATOM   9896  C  C5    . DA  J 6 42  ? 5.296   -36.411 14.504 1.00 148.73 ? -31 DA  J C5    1 
ATOM   9897  C  C6    . DA  J 6 42  ? 5.213   -35.009 14.671 1.00 148.49 ? -31 DA  J C6    1 
ATOM   9898  N  N6    . DA  J 6 42  ? 4.550   -34.424 15.670 1.00 148.42 ? -31 DA  J N6    1 
ATOM   9899  N  N1    . DA  J 6 42  ? 5.845   -34.221 13.773 1.00 148.51 ? -31 DA  J N1    1 
ATOM   9900  C  C2    . DA  J 6 42  ? 6.515   -34.806 12.767 1.00 148.91 ? -31 DA  J C2    1 
ATOM   9901  N  N3    . DA  J 6 42  ? 6.663   -36.109 12.504 1.00 148.93 ? -31 DA  J N3    1 
ATOM   9902  C  C4    . DA  J 6 42  ? 6.025   -36.871 13.416 1.00 148.92 ? -31 DA  J C4    1 
ATOM   9903  P  P     . DA  J 6 43  ? 10.187  -41.241 11.595 1.00 149.99 ? -30 DA  J P     1 
ATOM   9904  O  OP1   . DA  J 6 43  ? 10.522  -42.568 11.033 1.00 149.81 ? -30 DA  J OP1   1 
ATOM   9905  O  OP2   . DA  J 6 43  ? 10.383  -40.993 13.043 1.00 149.71 ? -30 DA  J OP2   1 
ATOM   9906  O  "O5'" . DA  J 6 43  ? 11.006  -40.109 10.801 1.00 149.79 ? -30 DA  J "O5'" 1 
ATOM   9907  C  "C5'" . DA  J 6 43  ? 10.511  -38.766 10.682 1.00 149.57 ? -30 DA  J "C5'" 1 
ATOM   9908  C  "C4'" . DA  J 6 43  ? 11.266  -37.744 11.528 1.00 149.31 ? -30 DA  J "C4'" 1 
ATOM   9909  O  "O4'" . DA  J 6 43  ? 10.312  -37.025 12.363 1.00 149.06 ? -30 DA  J "O4'" 1 
ATOM   9910  C  "C3'" . DA  J 6 43  ? 12.357  -38.256 12.476 1.00 149.37 ? -30 DA  J "C3'" 1 
ATOM   9911  O  "O3'" . DA  J 6 43  ? 13.508  -37.404 12.408 1.00 149.66 ? -30 DA  J "O3'" 1 
ATOM   9912  C  "C2'" . DA  J 6 43  ? 11.673  -38.164 13.837 1.00 149.20 ? -30 DA  J "C2'" 1 
ATOM   9913  C  "C1'" . DA  J 6 43  ? 10.883  -36.875 13.649 1.00 149.03 ? -30 DA  J "C1'" 1 
ATOM   9914  N  N9    . DA  J 6 43  ? 9.859   -36.626 14.673 1.00 148.68 ? -30 DA  J N9    1 
ATOM   9915  C  C8    . DA  J 6 43  ? 9.187   -37.559 15.421 1.00 148.48 ? -30 DA  J C8    1 
ATOM   9916  N  N7    . DA  J 6 43  ? 8.328   -37.054 16.274 1.00 148.26 ? -30 DA  J N7    1 
ATOM   9917  C  C5    . DA  J 6 43  ? 8.441   -35.689 16.080 1.00 148.24 ? -30 DA  J C5    1 
ATOM   9918  C  C6    . DA  J 6 43  ? 7.793   -34.590 16.684 1.00 148.17 ? -30 DA  J C6    1 
ATOM   9919  N  N6    . DA  J 6 43  ? 6.867   -34.728 17.639 1.00 148.02 ? -30 DA  J N6    1 
ATOM   9920  N  N1    . DA  J 6 43  ? 8.131   -33.345 16.265 1.00 148.24 ? -30 DA  J N1    1 
ATOM   9921  C  C2    . DA  J 6 43  ? 9.062   -33.213 15.305 1.00 148.22 ? -30 DA  J C2    1 
ATOM   9922  N  N3    . DA  J 6 43  ? 9.740   -34.172 14.665 1.00 148.37 ? -30 DA  J N3    1 
ATOM   9923  C  C4    . DA  J 6 43  ? 9.383   -35.401 15.100 1.00 148.47 ? -30 DA  J C4    1 
ATOM   9924  P  P     . DC  J 6 44  ? 14.836  -37.657 13.281 1.00 149.98 ? -29 DC  J P     1 
ATOM   9925  O  OP1   . DC  J 6 44  ? 15.576  -38.777 12.653 1.00 149.88 ? -29 DC  J OP1   1 
ATOM   9926  O  OP2   . DC  J 6 44  ? 14.476  -37.742 14.718 1.00 149.67 ? -29 DC  J OP2   1 
ATOM   9927  O  "O5'" . DC  J 6 44  ? 15.642  -36.288 13.052 1.00 149.56 ? -29 DC  J "O5'" 1 
ATOM   9928  C  "C5'" . DC  J 6 44  ? 16.149  -35.548 14.159 1.00 149.15 ? -29 DC  J "C5'" 1 
ATOM   9929  C  "C4'" . DC  J 6 44  ? 15.246  -34.378 14.516 1.00 148.79 ? -29 DC  J "C4'" 1 
ATOM   9930  O  "O4'" . DC  J 6 44  ? 13.916  -34.826 14.868 1.00 148.72 ? -29 DC  J "O4'" 1 
ATOM   9931  C  "C3'" . DC  J 6 44  ? 15.700  -33.616 15.746 1.00 148.44 ? -29 DC  J "C3'" 1 
ATOM   9932  O  "O3'" . DC  J 6 44  ? 16.621  -32.625 15.358 1.00 148.11 ? -29 DC  J "O3'" 1 
ATOM   9933  C  "C2'" . DC  J 6 44  ? 14.423  -32.966 16.260 1.00 148.56 ? -29 DC  J "C2'" 1 
ATOM   9934  C  "C1'" . DC  J 6 44  ? 13.317  -33.876 15.737 1.00 148.69 ? -29 DC  J "C1'" 1 
ATOM   9935  N  N1    . DC  J 6 44  ? 12.519  -34.567 16.822 1.00 148.85 ? -29 DC  J N1    1 
ATOM   9936  C  C2    . DC  J 6 44  ? 11.697  -33.832 17.707 1.00 148.64 ? -29 DC  J C2    1 
ATOM   9937  O  O2    . DC  J 6 44  ? 11.614  -32.597 17.620 1.00 148.45 ? -29 DC  J O2    1 
ATOM   9938  N  N3    . DC  J 6 44  ? 10.998  -34.504 18.661 1.00 148.52 ? -29 DC  J N3    1 
ATOM   9939  C  C4    . DC  J 6 44  ? 11.082  -35.835 18.758 1.00 148.58 ? -29 DC  J C4    1 
ATOM   9940  N  N4    . DC  J 6 44  ? 10.372  -36.442 19.716 1.00 148.44 ? -29 DC  J N4    1 
ATOM   9941  C  C5    . DC  J 6 44  ? 11.905  -36.600 17.877 1.00 148.77 ? -29 DC  J C5    1 
ATOM   9942  C  C6    . DC  J 6 44  ? 12.593  -35.932 16.939 1.00 148.93 ? -29 DC  J C6    1 
ATOM   9943  P  P     . DT  J 6 45  ? 17.987  -32.444 16.166 1.00 147.92 ? -28 DT  J P     1 
ATOM   9944  O  OP1   . DT  J 6 45  ? 19.072  -32.817 15.232 1.00 147.93 ? -28 DT  J OP1   1 
ATOM   9945  O  OP2   . DT  J 6 45  ? 17.873  -33.141 17.470 1.00 147.72 ? -28 DT  J OP2   1 
ATOM   9946  O  "O5'" . DT  J 6 45  ? 18.055  -30.863 16.435 1.00 147.32 ? -28 DT  J "O5'" 1 
ATOM   9947  C  "C5'" . DT  J 6 45  ? 16.890  -30.114 16.808 1.00 146.40 ? -28 DT  J "C5'" 1 
ATOM   9948  C  "C4'" . DT  J 6 45  ? 16.827  -29.799 18.303 1.00 145.62 ? -28 DT  J "C4'" 1 
ATOM   9949  O  "O4'" . DT  J 6 45  ? 15.721  -30.523 18.908 1.00 145.75 ? -28 DT  J "O4'" 1 
ATOM   9950  C  "C3'" . DT  J 6 45  ? 18.078  -30.124 19.135 1.00 144.88 ? -28 DT  J "C3'" 1 
ATOM   9951  O  "O3'" . DT  J 6 45  ? 18.567  -29.002 19.918 1.00 143.40 ? -28 DT  J "O3'" 1 
ATOM   9952  C  "C2'" . DT  J 6 45  ? 17.653  -31.297 20.020 1.00 145.26 ? -28 DT  J "C2'" 1 
ATOM   9953  C  "C1'" . DT  J 6 45  ? 16.141  -31.094 20.131 1.00 145.68 ? -28 DT  J "C1'" 1 
ATOM   9954  N  N1    . DT  J 6 45  ? 15.310  -32.321 20.417 1.00 145.94 ? -28 DT  J N1    1 
ATOM   9955  C  C2    . DT  J 6 45  ? 14.103  -32.166 21.082 1.00 145.86 ? -28 DT  J C2    1 
ATOM   9956  O  O2    . DT  J 6 45  ? 13.668  -31.088 21.455 1.00 145.62 ? -28 DT  J O2    1 
ATOM   9957  N  N3    . DT  J 6 45  ? 13.414  -33.338 21.299 1.00 145.94 ? -28 DT  J N3    1 
ATOM   9958  C  C4    . DT  J 6 45  ? 13.798  -34.619 20.926 1.00 146.09 ? -28 DT  J C4    1 
ATOM   9959  O  O4    . DT  J 6 45  ? 13.100  -35.598 21.173 1.00 146.15 ? -28 DT  J O4    1 
ATOM   9960  C  C5    . DT  J 6 45  ? 15.069  -34.716 20.234 1.00 146.19 ? -28 DT  J C5    1 
ATOM   9961  C  C7    . DT  J 6 45  ? 15.602  -36.047 19.776 1.00 146.12 ? -28 DT  J C7    1 
ATOM   9962  C  C6    . DT  J 6 45  ? 15.751  -33.578 20.016 1.00 146.18 ? -28 DT  J C6    1 
ATOM   9963  P  P     . DG  J 6 46  ? 17.698  -27.718 20.363 1.00 142.19 ? -27 DG  J P     1 
ATOM   9964  O  OP1   . DG  J 6 46  ? 17.158  -27.046 19.158 1.00 142.11 ? -27 DG  J OP1   1 
ATOM   9965  O  OP2   . DG  J 6 46  ? 18.523  -26.931 21.310 1.00 141.86 ? -27 DG  J OP2   1 
ATOM   9966  O  "O5'" . DG  J 6 46  ? 16.487  -28.394 21.163 1.00 141.22 ? -27 DG  J "O5'" 1 
ATOM   9967  C  "C5'" . DG  J 6 46  ? 15.718  -27.682 22.117 1.00 139.08 ? -27 DG  J "C5'" 1 
ATOM   9968  C  "C4'" . DG  J 6 46  ? 15.840  -28.335 23.485 1.00 137.18 ? -27 DG  J "C4'" 1 
ATOM   9969  O  "O4'" . DG  J 6 46  ? 15.531  -29.744 23.387 1.00 137.14 ? -27 DG  J "O4'" 1 
ATOM   9970  C  "C3'" . DG  J 6 46  ? 17.224  -28.258 24.136 1.00 135.62 ? -27 DG  J "C3'" 1 
ATOM   9971  O  "O3'" . DG  J 6 46  ? 17.111  -27.608 25.395 1.00 132.97 ? -27 DG  J "O3'" 1 
ATOM   9972  C  "C2'" . DG  J 6 46  ? 17.654  -29.717 24.297 1.00 136.32 ? -27 DG  J "C2'" 1 
ATOM   9973  C  "C1'" . DG  J 6 46  ? 16.289  -30.385 24.384 1.00 137.15 ? -27 DG  J "C1'" 1 
ATOM   9974  N  N9    . DG  J 6 46  ? 16.211  -31.819 24.123 1.00 137.98 ? -27 DG  J N9    1 
ATOM   9975  C  C8    . DG  J 6 46  ? 17.006  -32.597 23.315 1.00 138.42 ? -27 DG  J C8    1 
ATOM   9976  N  N7    . DG  J 6 46  ? 16.650  -33.854 23.289 1.00 138.71 ? -27 DG  J N7    1 
ATOM   9977  C  C5    . DG  J 6 46  ? 15.543  -33.914 24.129 1.00 138.56 ? -27 DG  J C5    1 
ATOM   9978  C  C6    . DG  J 6 46  ? 14.722  -35.011 24.503 1.00 138.40 ? -27 DG  J C6    1 
ATOM   9979  O  O6    . DG  J 6 46  ? 14.816  -36.194 24.147 1.00 138.04 ? -27 DG  J O6    1 
ATOM   9980  N  N1    . DG  J 6 46  ? 13.704  -34.630 25.382 1.00 138.62 ? -27 DG  J N1    1 
ATOM   9981  C  C2    . DG  J 6 46  ? 13.505  -33.345 25.843 1.00 138.88 ? -27 DG  J C2    1 
ATOM   9982  N  N2    . DG  J 6 46  ? 12.481  -33.146 26.686 1.00 138.95 ? -27 DG  J N2    1 
ATOM   9983  N  N3    . DG  J 6 46  ? 14.265  -32.312 25.500 1.00 138.90 ? -27 DG  J N3    1 
ATOM   9984  C  C4    . DG  J 6 46  ? 15.261  -32.666 24.644 1.00 138.55 ? -27 DG  J C4    1 
ATOM   9985  P  P     . DC  J 6 47  ? 16.975  -26.013 25.489 1.00 131.13 ? -26 DC  J P     1 
ATOM   9986  O  OP1   . DC  J 6 47  ? 15.965  -25.568 24.506 1.00 131.23 ? -26 DC  J OP1   1 
ATOM   9987  O  OP2   . DC  J 6 47  ? 18.341  -25.454 25.426 1.00 131.53 ? -26 DC  J OP2   1 
ATOM   9988  O  "O5'" . DC  J 6 47  ? 16.392  -25.714 26.952 1.00 129.09 ? -26 DC  J "O5'" 1 
ATOM   9989  C  "C5'" . DC  J 6 47  ? 16.460  -26.666 28.006 1.00 125.87 ? -26 DC  J "C5'" 1 
ATOM   9990  C  "C4'" . DC  J 6 47  ? 15.080  -27.042 28.546 1.00 123.29 ? -26 DC  J "C4'" 1 
ATOM   9991  O  "O4'" . DC  J 6 47  ? 14.658  -28.339 28.042 1.00 122.77 ? -26 DC  J "O4'" 1 
ATOM   9992  C  "C3'" . DC  J 6 47  ? 15.017  -27.197 30.059 1.00 121.58 ? -26 DC  J "C3'" 1 
ATOM   9993  O  "O3'" . DC  J 6 47  ? 13.686  -27.160 30.553 1.00 118.75 ? -26 DC  J "O3'" 1 
ATOM   9994  C  "C2'" . DC  J 6 47  ? 15.548  -28.615 30.192 1.00 121.94 ? -26 DC  J "C2'" 1 
ATOM   9995  C  "C1'" . DC  J 6 47  ? 14.780  -29.307 29.071 1.00 122.31 ? -26 DC  J "C1'" 1 
ATOM   9996  N  N1    . DC  J 6 47  ? 15.451  -30.550 28.566 1.00 122.55 ? -26 DC  J N1    1 
ATOM   9997  C  C2    . DC  J 6 47  ? 14.826  -31.794 28.752 1.00 122.75 ? -26 DC  J C2    1 
ATOM   9998  O  O2    . DC  J 6 47  ? 13.730  -31.851 29.323 1.00 122.75 ? -26 DC  J O2    1 
ATOM   9999  N  N3    . DC  J 6 47  ? 15.443  -32.917 28.298 1.00 122.92 ? -26 DC  J N3    1 
ATOM   10000 C  C4    . DC  J 6 47  ? 16.626  -32.830 27.684 1.00 123.04 ? -26 DC  J C4    1 
ATOM   10001 N  N4    . DC  J 6 47  ? 17.187  -33.964 27.253 1.00 123.34 ? -26 DC  J N4    1 
ATOM   10002 C  C5    . DC  J 6 47  ? 17.282  -31.576 27.484 1.00 122.81 ? -26 DC  J C5    1 
ATOM   10003 C  C6    . DC  J 6 47  ? 16.666  -30.477 27.937 1.00 122.52 ? -26 DC  J C6    1 
ATOM   10004 P  P     . DT  J 6 48  ? 12.877  -25.803 30.792 1.00 116.51 ? -25 DT  J P     1 
ATOM   10005 O  OP1   . DT  J 6 48  ? 12.476  -25.347 29.441 1.00 116.38 ? -25 DT  J OP1   1 
ATOM   10006 O  OP2   . DT  J 6 48  ? 13.656  -24.939 31.712 1.00 116.42 ? -25 DT  J OP2   1 
ATOM   10007 O  "O5'" . DT  J 6 48  ? 11.569  -26.273 31.588 1.00 113.15 ? -25 DT  J "O5'" 1 
ATOM   10008 C  "C5'" . DT  J 6 48  ? 11.705  -26.711 32.926 1.00 108.69 ? -25 DT  J "C5'" 1 
ATOM   10009 C  "C4'" . DT  J 6 48  ? 11.536  -28.215 33.094 1.00 105.19 ? -25 DT  J "C4'" 1 
ATOM   10010 O  "O4'" . DT  J 6 48  ? 12.542  -29.000 32.387 1.00 105.32 ? -25 DT  J "O4'" 1 
ATOM   10011 C  "C3'" . DT  J 6 48  ? 11.665  -28.649 34.550 1.00 102.76 ? -25 DT  J "C3'" 1 
ATOM   10012 O  "O3'" . DT  J 6 48  ? 10.736  -29.684 34.801 1.00 98.22  ? -25 DT  J "O3'" 1 
ATOM   10013 C  "C2'" . DT  J 6 48  ? 13.085  -29.196 34.603 1.00 104.15 ? -25 DT  J "C2'" 1 
ATOM   10014 C  "C1'" . DT  J 6 48  ? 13.014  -29.978 33.299 1.00 105.79 ? -25 DT  J "C1'" 1 
ATOM   10015 N  N1    . DT  J 6 48  ? 14.274  -30.710 32.856 1.00 107.66 ? -25 DT  J N1    1 
ATOM   10016 C  C2    . DT  J 6 48  ? 14.149  -32.015 32.410 1.00 108.60 ? -25 DT  J C2    1 
ATOM   10017 O  O2    . DT  J 6 48  ? 13.083  -32.600 32.344 1.00 109.62 ? -25 DT  J O2    1 
ATOM   10018 N  N3    . DT  J 6 48  ? 15.320  -32.627 32.027 1.00 109.06 ? -25 DT  J N3    1 
ATOM   10019 C  C4    . DT  J 6 48  ? 16.595  -32.086 32.045 1.00 109.52 ? -25 DT  J C4    1 
ATOM   10020 O  O4    . DT  J 6 48  ? 17.582  -32.731 31.677 1.00 109.67 ? -25 DT  J O4    1 
ATOM   10021 C  C5    . DT  J 6 48  ? 16.663  -30.720 32.529 1.00 109.29 ? -25 DT  J C5    1 
ATOM   10022 C  C7    . DT  J 6 48  ? 17.980  -30.006 32.604 1.00 109.57 ? -25 DT  J C7    1 
ATOM   10023 C  C6    . DT  J 6 48  ? 15.523  -30.111 32.911 1.00 108.48 ? -25 DT  J C6    1 
ATOM   10024 P  P     . DC  J 6 49  ? 9.753   -29.604 36.048 1.00 93.76  ? -24 DC  J P     1 
ATOM   10025 O  OP1   . DC  J 6 49  ? 8.594   -28.826 35.559 1.00 93.95  ? -24 DC  J OP1   1 
ATOM   10026 O  OP2   . DC  J 6 49  ? 10.503  -29.194 37.255 1.00 92.90  ? -24 DC  J OP2   1 
ATOM   10027 O  "O5'" . DC  J 6 49  ? 9.324   -31.117 36.311 1.00 92.30  ? -24 DC  J "O5'" 1 
ATOM   10028 C  "C5'" . DC  J 6 49  ? 9.301   -32.095 35.281 1.00 90.10  ? -24 DC  J "C5'" 1 
ATOM   10029 C  "C4'" . DC  J 6 49  ? 9.976   -33.377 35.744 1.00 88.66  ? -24 DC  J "C4'" 1 
ATOM   10030 O  "O4'" . DC  J 6 49  ? 11.363  -33.344 35.332 1.00 88.90  ? -24 DC  J "O4'" 1 
ATOM   10031 C  "C3'" . DC  J 6 49  ? 9.989   -33.643 37.253 1.00 87.28  ? -24 DC  J "C3'" 1 
ATOM   10032 O  "O3'" . DC  J 6 49  ? 9.546   -34.973 37.545 1.00 83.55  ? -24 DC  J "O3'" 1 
ATOM   10033 C  "C2'" . DC  J 6 49  ? 11.448  -33.423 37.656 1.00 88.34  ? -24 DC  J "C2'" 1 
ATOM   10034 C  "C1'" . DC  J 6 49  ? 12.160  -33.847 36.383 1.00 89.89  ? -24 DC  J "C1'" 1 
ATOM   10035 N  N1    . DC  J 6 49  ? 13.520  -33.276 36.198 1.00 91.84  ? -24 DC  J N1    1 
ATOM   10036 C  C2    . DC  J 6 49  ? 14.503  -34.022 35.518 1.00 92.29  ? -24 DC  J C2    1 
ATOM   10037 O  O2    . DC  J 6 49  ? 14.246  -35.160 35.084 1.00 92.09  ? -24 DC  J O2    1 
ATOM   10038 N  N3    . DC  J 6 49  ? 15.732  -33.457 35.360 1.00 93.17  ? -24 DC  J N3    1 
ATOM   10039 C  C4    . DC  J 6 49  ? 15.998  -32.227 35.831 1.00 93.31  ? -24 DC  J C4    1 
ATOM   10040 N  N4    . DC  J 6 49  ? 17.226  -31.727 35.643 1.00 93.03  ? -24 DC  J N4    1 
ATOM   10041 C  C5    . DC  J 6 49  ? 15.011  -31.456 36.521 1.00 93.33  ? -24 DC  J C5    1 
ATOM   10042 C  C6    . DC  J 6 49  ? 13.799  -32.016 36.673 1.00 92.73  ? -24 DC  J C6    1 
ATOM   10043 P  P     . DC  J 6 50  ? 9.371   -35.447 39.057 1.00 79.96  ? -23 DC  J P     1 
ATOM   10044 O  OP1   . DC  J 6 50  ? 7.973   -35.852 39.242 1.00 80.44  ? -23 DC  J OP1   1 
ATOM   10045 O  OP2   . DC  J 6 50  ? 9.988   -34.455 39.956 1.00 80.90  ? -23 DC  J OP2   1 
ATOM   10046 O  "O5'" . DC  J 6 50  ? 10.263  -36.753 39.156 1.00 84.08  ? -23 DC  J "O5'" 1 
ATOM   10047 C  "C5'" . DC  J 6 50  ? 10.634  -37.499 37.992 1.00 88.30  ? -23 DC  J "C5'" 1 
ATOM   10048 C  "C4'" . DC  J 6 50  ? 11.895  -38.312 38.250 1.00 91.03  ? -23 DC  J "C4'" 1 
ATOM   10049 O  "O4'" . DC  J 6 50  ? 13.054  -37.515 37.915 1.00 91.29  ? -23 DC  J "O4'" 1 
ATOM   10050 C  "C3'" . DC  J 6 50  ? 12.097  -38.779 39.688 1.00 92.40  ? -23 DC  J "C3'" 1 
ATOM   10051 O  "O3'" . DC  J 6 50  ? 12.410  -40.160 39.670 1.00 95.10  ? -23 DC  J "O3'" 1 
ATOM   10052 C  "C2'" . DC  J 6 50  ? 13.243  -37.915 40.210 1.00 91.59  ? -23 DC  J "C2'" 1 
ATOM   10053 C  "C1'" . DC  J 6 50  ? 14.021  -37.626 38.935 1.00 92.04  ? -23 DC  J "C1'" 1 
ATOM   10054 N  N1    . DC  J 6 50  ? 14.841  -36.360 38.911 1.00 92.91  ? -23 DC  J N1    1 
ATOM   10055 C  C2    . DC  J 6 50  ? 16.137  -36.350 38.331 1.00 93.17  ? -23 DC  J C2    1 
ATOM   10056 O  O2    . DC  J 6 50  ? 16.625  -37.384 37.845 1.00 92.98  ? -23 DC  J O2    1 
ATOM   10057 N  N3    . DC  J 6 50  ? 16.842  -35.186 38.317 1.00 93.05  ? -23 DC  J N3    1 
ATOM   10058 C  C4    . DC  J 6 50  ? 16.304  -34.077 38.841 1.00 93.35  ? -23 DC  J C4    1 
ATOM   10059 N  N4    . DC  J 6 50  ? 17.027  -32.954 38.814 1.00 93.26  ? -23 DC  J N4    1 
ATOM   10060 C  C5    . DC  J 6 50  ? 15.001  -34.063 39.432 1.00 93.26  ? -23 DC  J C5    1 
ATOM   10061 C  C6    . DC  J 6 50  ? 14.312  -35.211 39.436 1.00 93.02  ? -23 DC  J C6    1 
ATOM   10062 P  P     . DA  J 6 51  ? 12.305  -41.078 40.978 1.00 97.54  ? -22 DA  J P     1 
ATOM   10063 O  OP1   . DA  J 6 51  ? 11.702  -42.362 40.547 1.00 97.42  ? -22 DA  J OP1   1 
ATOM   10064 O  OP2   . DA  J 6 51  ? 11.740  -40.329 42.122 1.00 96.89  ? -22 DA  J OP2   1 
ATOM   10065 O  "O5'" . DA  J 6 51  ? 13.845  -41.311 41.303 1.00 100.46 ? -22 DA  J "O5'" 1 
ATOM   10066 C  "C5'" . DA  J 6 51  ? 14.711  -41.864 40.317 1.00 104.65 ? -22 DA  J "C5'" 1 
ATOM   10067 C  "C4'" . DA  J 6 51  ? 16.132  -41.769 40.826 1.00 107.63 ? -22 DA  J "C4'" 1 
ATOM   10068 O  "O4'" . DA  J 6 51  ? 16.659  -40.473 40.461 1.00 107.28 ? -22 DA  J "O4'" 1 
ATOM   10069 C  "C3'" . DA  J 6 51  ? 16.258  -41.907 42.345 1.00 109.76 ? -22 DA  J "C3'" 1 
ATOM   10070 O  "O3'" . DA  J 6 51  ? 17.038  -43.075 42.659 1.00 113.84 ? -22 DA  J "O3'" 1 
ATOM   10071 C  "C2'" . DA  J 6 51  ? 16.909  -40.604 42.803 1.00 108.88 ? -22 DA  J "C2'" 1 
ATOM   10072 C  "C1'" . DA  J 6 51  ? 17.469  -40.017 41.515 1.00 108.02 ? -22 DA  J "C1'" 1 
ATOM   10073 N  N9    . DA  J 6 51  ? 17.402  -38.569 41.497 1.00 108.22 ? -22 DA  J N9    1 
ATOM   10074 C  C8    . DA  J 6 51  ? 16.311  -37.785 41.749 1.00 108.01 ? -22 DA  J C8    1 
ATOM   10075 N  N7    . DA  J 6 51  ? 16.551  -36.502 41.654 1.00 108.08 ? -22 DA  J N7    1 
ATOM   10076 C  C5    . DA  J 6 51  ? 17.894  -36.443 41.318 1.00 108.39 ? -22 DA  J C5    1 
ATOM   10077 C  C6    . DA  J 6 51  ? 18.777  -35.369 41.073 1.00 108.47 ? -22 DA  J C6    1 
ATOM   10078 N  N6    . DA  J 6 51  ? 18.418  -34.087 41.132 1.00 108.46 ? -22 DA  J N6    1 
ATOM   10079 N  N1    . DA  J 6 51  ? 20.059  -35.662 40.763 1.00 109.15 ? -22 DA  J N1    1 
ATOM   10080 C  C2    . DA  J 6 51  ? 20.442  -36.946 40.699 1.00 109.22 ? -22 DA  J C2    1 
ATOM   10081 N  N3    . DA  J 6 51  ? 19.706  -38.039 40.912 1.00 108.94 ? -22 DA  J N3    1 
ATOM   10082 C  C4    . DA  J 6 51  ? 18.435  -37.713 41.219 1.00 108.54 ? -22 DA  J C4    1 
ATOM   10083 P  P     . DT  J 6 52  ? 17.416  -43.527 44.160 1.00 116.42 ? -21 DT  J P     1 
ATOM   10084 O  OP1   . DT  J 6 52  ? 17.447  -45.005 44.158 1.00 116.51 ? -21 DT  J OP1   1 
ATOM   10085 O  OP2   . DT  J 6 52  ? 16.539  -42.840 45.138 1.00 116.33 ? -21 DT  J OP2   1 
ATOM   10086 O  "O5'" . DT  J 6 52  ? 18.901  -42.951 44.341 1.00 117.87 ? -21 DT  J "O5'" 1 
ATOM   10087 C  "C5'" . DT  J 6 52  ? 19.830  -42.934 43.245 1.00 120.86 ? -21 DT  J "C5'" 1 
ATOM   10088 C  "C4'" . DT  J 6 52  ? 21.115  -42.247 43.669 1.00 123.23 ? -21 DT  J "C4'" 1 
ATOM   10089 O  "O4'" . DT  J 6 52  ? 21.048  -40.842 43.321 1.00 123.43 ? -21 DT  J "O4'" 1 
ATOM   10090 C  "C3'" . DT  J 6 52  ? 21.386  -42.317 45.172 1.00 124.66 ? -21 DT  J "C3'" 1 
ATOM   10091 O  "O3'" . DT  J 6 52  ? 22.722  -42.710 45.430 1.00 126.66 ? -21 DT  J "O3'" 1 
ATOM   10092 C  "C2'" . DT  J 6 52  ? 21.129  -40.904 45.675 1.00 124.25 ? -21 DT  J "C2'" 1 
ATOM   10093 C  "C1'" . DT  J 6 52  ? 21.413  -40.064 44.441 1.00 124.17 ? -21 DT  J "C1'" 1 
ATOM   10094 N  N1    . DT  J 6 52  ? 20.604  -38.824 44.444 1.00 124.70 ? -21 DT  J N1    1 
ATOM   10095 C  C2    . DT  J 6 52  ? 21.123  -37.660 43.906 1.00 125.07 ? -21 DT  J C2    1 
ATOM   10096 O  O2    . DT  J 6 52  ? 22.234  -37.578 43.401 1.00 125.55 ? -21 DT  J O2    1 
ATOM   10097 N  N3    . DT  J 6 52  ? 20.271  -36.581 43.978 1.00 124.93 ? -21 DT  J N3    1 
ATOM   10098 C  C4    . DT  J 6 52  ? 18.992  -36.558 44.520 1.00 125.17 ? -21 DT  J C4    1 
ATOM   10099 O  O4    . DT  J 6 52  ? 18.313  -35.536 44.530 1.00 125.35 ? -21 DT  J O4    1 
ATOM   10100 C  C5    . DT  J 6 52  ? 18.517  -37.812 45.067 1.00 125.13 ? -21 DT  J C5    1 
ATOM   10101 C  C7    . DT  J 6 52  ? 17.153  -37.933 45.688 1.00 125.19 ? -21 DT  J C7    1 
ATOM   10102 C  C6    . DT  J 6 52  ? 19.337  -38.866 45.002 1.00 124.91 ? -21 DT  J C6    1 
ATOM   10103 P  P     . DC  J 6 53  ? 23.135  -43.238 46.888 1.00 128.34 ? -20 DC  J P     1 
ATOM   10104 O  OP1   . DC  J 6 53  ? 22.872  -44.699 46.923 1.00 128.21 ? -20 DC  J OP1   1 
ATOM   10105 O  OP2   . DC  J 6 53  ? 22.539  -42.357 47.927 1.00 128.52 ? -20 DC  J OP2   1 
ATOM   10106 O  "O5'" . DC  J 6 53  ? 24.715  -42.971 46.890 1.00 129.23 ? -20 DC  J "O5'" 1 
ATOM   10107 C  "C5'" . DC  J 6 53  ? 25.266  -41.910 46.096 1.00 130.20 ? -20 DC  J "C5'" 1 
ATOM   10108 C  "C4'" . DC  J 6 53  ? 25.758  -40.746 46.944 1.00 130.91 ? -20 DC  J "C4'" 1 
ATOM   10109 O  "O4'" . DC  J 6 53  ? 24.993  -39.551 46.635 1.00 131.02 ? -20 DC  J "O4'" 1 
ATOM   10110 C  "C3'" . DC  J 6 53  ? 25.727  -40.912 48.468 1.00 131.27 ? -20 DC  J "C3'" 1 
ATOM   10111 O  "O3'" . DC  J 6 53  ? 27.012  -40.529 48.965 1.00 131.84 ? -20 DC  J "O3'" 1 
ATOM   10112 C  "C2'" . DC  J 6 53  ? 24.609  -39.958 48.887 1.00 131.11 ? -20 DC  J "C2'" 1 
ATOM   10113 C  "C1'" . DC  J 6 53  ? 24.786  -38.853 47.847 1.00 131.04 ? -20 DC  J "C1'" 1 
ATOM   10114 N  N1    . DC  J 6 53  ? 23.628  -37.897 47.720 1.00 130.89 ? -20 DC  J N1    1 
ATOM   10115 C  C2    . DC  J 6 53  ? 23.880  -36.524 47.539 1.00 130.60 ? -20 DC  J C2    1 
ATOM   10116 O  O2    . DC  J 6 53  ? 25.052  -36.114 47.480 1.00 130.49 ? -20 DC  J O2    1 
ATOM   10117 N  N3    . DC  J 6 53  ? 22.818  -35.679 47.431 1.00 130.30 ? -20 DC  J N3    1 
ATOM   10118 C  C4    . DC  J 6 53  ? 21.567  -36.155 47.499 1.00 130.33 ? -20 DC  J C4    1 
ATOM   10119 N  N4    . DC  J 6 53  ? 20.562  -35.286 47.389 1.00 130.46 ? -20 DC  J N4    1 
ATOM   10120 C  C5    . DC  J 6 53  ? 21.285  -37.543 47.684 1.00 130.36 ? -20 DC  J C5    1 
ATOM   10121 C  C6    . DC  J 6 53  ? 22.337  -38.365 47.788 1.00 130.78 ? -20 DC  J C6    1 
ATOM   10122 P  P     . DA  J 6 54  ? 27.411  -40.337 50.512 1.00 132.21 ? -19 DA  J P     1 
ATOM   10123 O  OP1   . DA  J 6 54  ? 27.908  -41.638 51.024 1.00 132.20 ? -19 DA  J OP1   1 
ATOM   10124 O  OP2   . DA  J 6 54  ? 26.350  -39.614 51.255 1.00 132.19 ? -19 DA  J OP2   1 
ATOM   10125 O  "O5'" . DA  J 6 54  ? 28.644  -39.328 50.349 1.00 131.24 ? -19 DA  J "O5'" 1 
ATOM   10126 C  "C5'" . DA  J 6 54  ? 28.561  -38.191 49.480 1.00 129.59 ? -19 DA  J "C5'" 1 
ATOM   10127 C  "C4'" . DA  J 6 54  ? 28.868  -36.895 50.216 1.00 128.44 ? -19 DA  J "C4'" 1 
ATOM   10128 O  "O4'" . DA  J 6 54  ? 27.759  -35.974 50.045 1.00 128.22 ? -19 DA  J "O4'" 1 
ATOM   10129 C  "C3'" . DA  J 6 54  ? 29.116  -37.012 51.720 1.00 127.89 ? -19 DA  J "C3'" 1 
ATOM   10130 O  "O3'" . DA  J 6 54  ? 30.231  -36.177 52.098 1.00 127.29 ? -19 DA  J "O3'" 1 
ATOM   10131 C  "C2'" . DA  J 6 54  ? 27.781  -36.592 52.337 1.00 127.90 ? -19 DA  J "C2'" 1 
ATOM   10132 C  "C1'" . DA  J 6 54  ? 27.179  -35.644 51.296 1.00 127.93 ? -19 DA  J "C1'" 1 
ATOM   10133 N  N9    . DA  J 6 54  ? 25.712  -35.725 51.197 1.00 127.45 ? -19 DA  J N9    1 
ATOM   10134 C  C8    . DA  J 6 54  ? 24.937  -36.839 51.378 1.00 127.24 ? -19 DA  J C8    1 
ATOM   10135 N  N7    . DA  J 6 54  ? 23.651  -36.640 51.234 1.00 126.80 ? -19 DA  J N7    1 
ATOM   10136 C  C5    . DA  J 6 54  ? 23.562  -35.295 50.938 1.00 126.64 ? -19 DA  J C5    1 
ATOM   10137 C  C6    . DA  J 6 54  ? 22.455  -34.460 50.672 1.00 126.28 ? -19 DA  J C6    1 
ATOM   10138 N  N6    . DA  J 6 54  ? 21.194  -34.903 50.671 1.00 125.69 ? -19 DA  J N6    1 
ATOM   10139 N  N1    . DA  J 6 54  ? 22.700  -33.156 50.410 1.00 126.07 ? -19 DA  J N1    1 
ATOM   10140 C  C2    . DA  J 6 54  ? 23.970  -32.721 50.420 1.00 126.08 ? -19 DA  J C2    1 
ATOM   10141 N  N3    . DA  J 6 54  ? 25.090  -33.413 50.654 1.00 126.53 ? -19 DA  J N3    1 
ATOM   10142 C  C4    . DA  J 6 54  ? 24.820  -34.709 50.911 1.00 126.93 ? -19 DA  J C4    1 
ATOM   10143 P  P     . DA  J 6 55  ? 30.718  -35.936 53.621 1.00 126.60 ? -18 DA  J P     1 
ATOM   10144 O  OP1   . DA  J 6 55  ? 32.194  -35.824 53.613 1.00 126.68 ? -18 DA  J OP1   1 
ATOM   10145 O  OP2   . DA  J 6 55  ? 30.078  -36.937 54.511 1.00 126.69 ? -18 DA  J OP2   1 
ATOM   10146 O  "O5'" . DA  J 6 55  ? 30.104  -34.487 53.960 1.00 125.83 ? -18 DA  J "O5'" 1 
ATOM   10147 C  "C5'" . DA  J 6 55  ? 30.302  -33.370 53.078 1.00 123.82 ? -18 DA  J "C5'" 1 
ATOM   10148 C  "C4'" . DA  J 6 55  ? 29.423  -32.190 53.467 1.00 122.20 ? -18 DA  J "C4'" 1 
ATOM   10149 O  "O4'" . DA  J 6 55  ? 28.031  -32.452 53.134 1.00 122.04 ? -18 DA  J "O4'" 1 
ATOM   10150 C  "C3'" . DA  J 6 55  ? 29.470  -31.807 54.943 1.00 120.87 ? -18 DA  J "C3'" 1 
ATOM   10151 O  "O3'" . DA  J 6 55  ? 29.816  -30.423 55.017 1.00 119.01 ? -18 DA  J "O3'" 1 
ATOM   10152 C  "C2'" . DA  J 6 55  ? 28.069  -32.137 55.474 1.00 121.05 ? -18 DA  J "C2'" 1 
ATOM   10153 C  "C1'" . DA  J 6 55  ? 27.193  -32.095 54.221 1.00 121.52 ? -18 DA  J "C1'" 1 
ATOM   10154 N  N9    . DA  J 6 55  ? 26.046  -33.014 54.241 1.00 121.35 ? -18 DA  J N9    1 
ATOM   10155 C  C8    . DA  J 6 55  ? 26.063  -34.362 54.487 1.00 121.41 ? -18 DA  J C8    1 
ATOM   10156 N  N7    . DA  J 6 55  ? 24.885  -34.942 54.435 1.00 121.05 ? -18 DA  J N7    1 
ATOM   10157 C  C5    . DA  J 6 55  ? 24.022  -33.904 54.134 1.00 120.93 ? -18 DA  J C5    1 
ATOM   10158 C  C6    . DA  J 6 55  ? 22.622  -33.851 53.940 1.00 120.49 ? -18 DA  J C6    1 
ATOM   10159 N  N6    . DA  J 6 55  ? 21.817  -34.911 54.026 1.00 120.02 ? -18 DA  J N6    1 
ATOM   10160 N  N1    . DA  J 6 55  ? 22.070  -32.654 53.651 1.00 120.37 ? -18 DA  J N1    1 
ATOM   10161 C  C2    . DA  J 6 55  ? 22.867  -31.581 53.558 1.00 120.52 ? -18 DA  J C2    1 
ATOM   10162 N  N3    . DA  J 6 55  ? 24.190  -31.505 53.724 1.00 120.95 ? -18 DA  J N3    1 
ATOM   10163 C  C4    . DA  J 6 55  ? 24.719  -32.710 54.010 1.00 121.07 ? -18 DA  J C4    1 
ATOM   10164 P  P     . DA  J 6 56  ? 29.818  -29.584 56.391 1.00 117.64 ? -17 DA  J P     1 
ATOM   10165 O  OP1   . DA  J 6 56  ? 30.865  -28.542 56.261 1.00 117.72 ? -17 DA  J OP1   1 
ATOM   10166 O  OP2   . DA  J 6 56  ? 29.811  -30.490 57.572 1.00 116.50 ? -17 DA  J OP2   1 
ATOM   10167 O  "O5'" . DA  J 6 56  ? 28.387  -28.870 56.320 1.00 115.69 ? -17 DA  J "O5'" 1 
ATOM   10168 C  "C5'" . DA  J 6 56  ? 27.845  -28.327 55.100 1.00 111.90 ? -17 DA  J "C5'" 1 
ATOM   10169 C  "C4'" . DA  J 6 56  ? 26.489  -27.716 55.415 1.00 108.51 ? -17 DA  J "C4'" 1 
ATOM   10170 O  "O4'" . DA  J 6 56  ? 25.477  -28.754 55.407 1.00 107.46 ? -17 DA  J "O4'" 1 
ATOM   10171 C  "C3'" . DA  J 6 56  ? 26.468  -27.071 56.804 1.00 106.65 ? -17 DA  J "C3'" 1 
ATOM   10172 O  "O3'" . DA  J 6 56  ? 26.096  -25.662 56.616 1.00 103.97 ? -17 DA  J "O3'" 1 
ATOM   10173 C  "C2'" . DA  J 6 56  ? 25.551  -27.981 57.649 1.00 106.53 ? -17 DA  J "C2'" 1 
ATOM   10174 C  "C1'" . DA  J 6 56  ? 24.718  -28.729 56.604 1.00 106.82 ? -17 DA  J "C1'" 1 
ATOM   10175 N  N9    . DA  J 6 56  ? 24.310  -30.116 56.901 1.00 106.39 ? -17 DA  J N9    1 
ATOM   10176 C  C8    . DA  J 6 56  ? 25.079  -31.168 57.338 1.00 106.40 ? -17 DA  J C8    1 
ATOM   10177 N  N7    . DA  J 6 56  ? 24.408  -32.295 57.494 1.00 106.02 ? -17 DA  J N7    1 
ATOM   10178 C  C5    . DA  J 6 56  ? 23.101  -31.978 57.128 1.00 105.44 ? -17 DA  J C5    1 
ATOM   10179 C  C6    . DA  J 6 56  ? 21.889  -32.727 57.058 1.00 104.42 ? -17 DA  J C6    1 
ATOM   10180 N  N6    . DA  J 6 56  ? 21.775  -34.022 57.377 1.00 102.30 ? -17 DA  J N6    1 
ATOM   10181 N  N1    . DA  J 6 56  ? 20.769  -32.085 56.651 1.00 104.52 ? -17 DA  J N1    1 
ATOM   10182 C  C2    . DA  J 6 56  ? 20.846  -30.784 56.325 1.00 105.64 ? -17 DA  J C2    1 
ATOM   10183 N  N3    . DA  J 6 56  ? 21.916  -29.976 56.343 1.00 106.15 ? -17 DA  J N3    1 
ATOM   10184 C  C4    . DA  J 6 56  ? 23.029  -30.636 56.757 1.00 106.29 ? -17 DA  J C4    1 
ATOM   10185 P  P     . DA  J 6 57  ? 25.011  -24.836 57.478 1.00 102.32 ? -16 DA  J P     1 
ATOM   10186 O  OP1   . DA  J 6 57  ? 24.954  -23.438 56.965 1.00 101.42 ? -16 DA  J OP1   1 
ATOM   10187 O  OP2   . DA  J 6 57  ? 25.262  -25.083 58.937 1.00 102.51 ? -16 DA  J OP2   1 
ATOM   10188 O  "O5'" . DA  J 6 57  ? 23.643  -25.590 57.050 1.00 100.50 ? -16 DA  J "O5'" 1 
ATOM   10189 C  "C5'" . DA  J 6 57  ? 22.449  -24.871 56.717 1.00 97.16  ? -16 DA  J "C5'" 1 
ATOM   10190 C  "C4'" . DA  J 6 57  ? 21.377  -25.263 57.712 1.00 94.66  ? -16 DA  J "C4'" 1 
ATOM   10191 O  "O4'" . DA  J 6 57  ? 21.404  -26.711 57.858 1.00 94.29  ? -16 DA  J "O4'" 1 
ATOM   10192 C  "C3'" . DA  J 6 57  ? 21.630  -24.705 59.110 1.00 93.29  ? -16 DA  J "C3'" 1 
ATOM   10193 O  "O3'" . DA  J 6 57  ? 20.534  -23.835 59.445 1.00 90.93  ? -16 DA  J "O3'" 1 
ATOM   10194 C  "C2'" . DA  J 6 57  ? 21.768  -25.950 60.003 1.00 93.51  ? -16 DA  J "C2'" 1 
ATOM   10195 C  "C1'" . DA  J 6 57  ? 21.078  -27.037 59.190 1.00 94.29  ? -16 DA  J "C1'" 1 
ATOM   10196 N  N9    . DA  J 6 57  ? 21.508  -28.413 59.480 1.00 95.24  ? -16 DA  J N9    1 
ATOM   10197 C  C8    . DA  J 6 57  ? 22.775  -28.835 59.811 1.00 96.02  ? -16 DA  J C8    1 
ATOM   10198 N  N7    . DA  J 6 57  ? 22.888  -30.130 60.022 1.00 95.88  ? -16 DA  J N7    1 
ATOM   10199 C  C5    . DA  J 6 57  ? 21.596  -30.604 59.825 1.00 96.30  ? -16 DA  J C5    1 
ATOM   10200 C  C6    . DA  J 6 57  ? 21.029  -31.905 59.901 1.00 96.82  ? -16 DA  J C6    1 
ATOM   10201 N  N6    . DA  J 6 57  ? 21.730  -33.006 60.199 1.00 97.38  ? -16 DA  J N6    1 
AT