data_4KHQ
# 
_entry.id   4KHQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4KHQ         
NDB   NA2390       
RCSB  RCSB079353   
WWPDB D_1000079353 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4KHU . unspecified 
PDB 4KHW . unspecified 
PDB 4KHY . unspecified 
PDB 4KI4 . unspecified 
PDB 4KI6 . unspecified 
PDB 4KHS . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4KHQ 
_pdbx_database_status.recvd_initial_deposition_date   2013-05-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Clausen, A.R.'  1 
'Pedersen, L.C.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structure-function analysis of ribonucleotide bypass by B family DNA replicases.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            110 
_citation.page_first                16802 
_citation.page_last                 16807 
_citation.year                      2013 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24082122 
_citation.pdbx_database_id_DOI      10.1073/pnas.1309119110 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Clausen, A.R.'  1 
primary 'Murray, M.S.'   2 
primary 'Passer, A.R.'   3 
primary 'Pedersen, L.C.' 4 
primary 'Kunkel, T.A.'   5 
# 
_cell.entry_id           4KHQ 
_cell.length_a           80.659 
_cell.length_b           119.360 
_cell.length_c           128.070 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4KHQ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase'                                                       104689.156 1   2.7.7.7 
'D327A, D222A, L415F' ? ?                 
2 polymer     syn 
;DNA (5'-D(*AP*CP*AP*GP*GP*TP*AP*AP*GP*CP*AP*GP*TP*CP*CP*GP*CP*G)-3')
;
5550.605   1   ?       ?                     ? 'TEMPLATE STRAND' 
3 polymer     syn 
;DNA (5'-D(*GP*CP*GP*GP*AP*CP*TP*GP*CP*TP*TP*AP*CP*C)-3')
;
4256.766   1   ?       ?                     ? 'PRIMER STRAND'   
4 non-polymer syn 'CALCIUM ION'                                                          40.078     3   ?       ? ? ? 
5 non-polymer syn 
;2'-DEOXYURIDINE 5'-ALPHA,BETA-IMIDO-TRIPHOSPHATE
;
467.157    1   ?       ?                     ? ?                 
6 non-polymer syn 'SODIUM ION'                                                           22.990     8   ?       ? ? ? 
7 water       nat water                                                                  18.015     578 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Gp43 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSFYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSFYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
A ? 
2 polydeoxyribonucleotide no no '(DA)(DC)(DA)(DG)(DG)(DT)(DA)(DA)(DG)(DC)(DA)(DG)(DT)(DC)(DC)(DG)(DC)(DG)' ACAGGTAAGCAGTCCGCG T ? 
3 polydeoxyribonucleotide no no '(DG)(DC)(DG)(DG)(DA)(DC)(DT)(DG)(DC)(DT)(DT)(DA)(DC)(DC)' GCGGACTGCTTACC P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   GLU n 
1 4   PHE n 
1 5   TYR n 
1 6   LEU n 
1 7   THR n 
1 8   VAL n 
1 9   GLU n 
1 10  GLN n 
1 11  ILE n 
1 12  GLY n 
1 13  ASP n 
1 14  SER n 
1 15  ILE n 
1 16  PHE n 
1 17  GLU n 
1 18  ARG n 
1 19  TYR n 
1 20  ILE n 
1 21  ASP n 
1 22  SER n 
1 23  ASN n 
1 24  GLY n 
1 25  ARG n 
1 26  GLU n 
1 27  ARG n 
1 28  THR n 
1 29  ARG n 
1 30  GLU n 
1 31  VAL n 
1 32  GLU n 
1 33  TYR n 
1 34  LYS n 
1 35  PRO n 
1 36  SER n 
1 37  LEU n 
1 38  PHE n 
1 39  ALA n 
1 40  HIS n 
1 41  CYS n 
1 42  PRO n 
1 43  GLU n 
1 44  SER n 
1 45  GLN n 
1 46  ALA n 
1 47  THR n 
1 48  LYS n 
1 49  TYR n 
1 50  PHE n 
1 51  ASP n 
1 52  ILE n 
1 53  TYR n 
1 54  GLY n 
1 55  LYS n 
1 56  PRO n 
1 57  CYS n 
1 58  THR n 
1 59  ARG n 
1 60  LYS n 
1 61  LEU n 
1 62  PHE n 
1 63  ALA n 
1 64  ASN n 
1 65  MET n 
1 66  ARG n 
1 67  ASP n 
1 68  ALA n 
1 69  SER n 
1 70  GLN n 
1 71  TRP n 
1 72  ILE n 
1 73  LYS n 
1 74  ARG n 
1 75  MET n 
1 76  GLU n 
1 77  ASP n 
1 78  ILE n 
1 79  GLY n 
1 80  LEU n 
1 81  GLU n 
1 82  ALA n 
1 83  LEU n 
1 84  GLY n 
1 85  MET n 
1 86  ASP n 
1 87  ASP n 
1 88  PHE n 
1 89  LYS n 
1 90  LEU n 
1 91  ALA n 
1 92  TYR n 
1 93  LEU n 
1 94  SER n 
1 95  ASP n 
1 96  THR n 
1 97  TYR n 
1 98  ASN n 
1 99  TYR n 
1 100 GLU n 
1 101 ILE n 
1 102 LYS n 
1 103 TYR n 
1 104 ASP n 
1 105 HIS n 
1 106 THR n 
1 107 LYS n 
1 108 ILE n 
1 109 ARG n 
1 110 VAL n 
1 111 ALA n 
1 112 ASN n 
1 113 PHE n 
1 114 ASP n 
1 115 ILE n 
1 116 GLU n 
1 117 VAL n 
1 118 THR n 
1 119 SER n 
1 120 PRO n 
1 121 ASP n 
1 122 GLY n 
1 123 PHE n 
1 124 PRO n 
1 125 GLU n 
1 126 PRO n 
1 127 SER n 
1 128 GLN n 
1 129 ALA n 
1 130 LYS n 
1 131 HIS n 
1 132 PRO n 
1 133 ILE n 
1 134 ASP n 
1 135 ALA n 
1 136 ILE n 
1 137 THR n 
1 138 HIS n 
1 139 TYR n 
1 140 ASP n 
1 141 SER n 
1 142 ILE n 
1 143 ASP n 
1 144 ASP n 
1 145 ARG n 
1 146 PHE n 
1 147 TYR n 
1 148 VAL n 
1 149 PHE n 
1 150 ASP n 
1 151 LEU n 
1 152 LEU n 
1 153 ASN n 
1 154 SER n 
1 155 PRO n 
1 156 TYR n 
1 157 GLY n 
1 158 ASN n 
1 159 VAL n 
1 160 GLU n 
1 161 GLU n 
1 162 TRP n 
1 163 SER n 
1 164 ILE n 
1 165 GLU n 
1 166 ILE n 
1 167 ALA n 
1 168 ALA n 
1 169 LYS n 
1 170 LEU n 
1 171 GLN n 
1 172 GLU n 
1 173 GLN n 
1 174 GLY n 
1 175 GLY n 
1 176 ASP n 
1 177 GLU n 
1 178 VAL n 
1 179 PRO n 
1 180 SER n 
1 181 GLU n 
1 182 ILE n 
1 183 ILE n 
1 184 ASP n 
1 185 LYS n 
1 186 ILE n 
1 187 ILE n 
1 188 TYR n 
1 189 MET n 
1 190 PRO n 
1 191 PHE n 
1 192 ASP n 
1 193 ASN n 
1 194 GLU n 
1 195 LYS n 
1 196 GLU n 
1 197 LEU n 
1 198 LEU n 
1 199 MET n 
1 200 GLU n 
1 201 TYR n 
1 202 LEU n 
1 203 ASN n 
1 204 PHE n 
1 205 TRP n 
1 206 GLN n 
1 207 GLN n 
1 208 LYS n 
1 209 THR n 
1 210 PRO n 
1 211 VAL n 
1 212 ILE n 
1 213 LEU n 
1 214 THR n 
1 215 GLY n 
1 216 TRP n 
1 217 ASN n 
1 218 VAL n 
1 219 GLU n 
1 220 SER n 
1 221 PHE n 
1 222 ALA n 
1 223 ILE n 
1 224 PRO n 
1 225 TYR n 
1 226 VAL n 
1 227 TYR n 
1 228 ASN n 
1 229 ARG n 
1 230 ILE n 
1 231 LYS n 
1 232 ASN n 
1 233 ILE n 
1 234 PHE n 
1 235 GLY n 
1 236 GLU n 
1 237 SER n 
1 238 THR n 
1 239 ALA n 
1 240 LYS n 
1 241 ARG n 
1 242 LEU n 
1 243 SER n 
1 244 PRO n 
1 245 HIS n 
1 246 ARG n 
1 247 LYS n 
1 248 THR n 
1 249 ARG n 
1 250 VAL n 
1 251 LYS n 
1 252 VAL n 
1 253 ILE n 
1 254 GLU n 
1 255 ASN n 
1 256 MET n 
1 257 TYR n 
1 258 GLY n 
1 259 SER n 
1 260 ARG n 
1 261 GLU n 
1 262 ILE n 
1 263 ILE n 
1 264 THR n 
1 265 LEU n 
1 266 PHE n 
1 267 GLY n 
1 268 ILE n 
1 269 SER n 
1 270 VAL n 
1 271 LEU n 
1 272 ASP n 
1 273 TYR n 
1 274 ILE n 
1 275 ASP n 
1 276 LEU n 
1 277 TYR n 
1 278 LYS n 
1 279 LYS n 
1 280 PHE n 
1 281 SER n 
1 282 PHE n 
1 283 THR n 
1 284 ASN n 
1 285 GLN n 
1 286 PRO n 
1 287 SER n 
1 288 TYR n 
1 289 SER n 
1 290 LEU n 
1 291 ASP n 
1 292 TYR n 
1 293 ILE n 
1 294 SER n 
1 295 GLU n 
1 296 PHE n 
1 297 GLU n 
1 298 LEU n 
1 299 ASN n 
1 300 VAL n 
1 301 GLY n 
1 302 LYS n 
1 303 LEU n 
1 304 LYS n 
1 305 TYR n 
1 306 ASP n 
1 307 GLY n 
1 308 PRO n 
1 309 ILE n 
1 310 SER n 
1 311 LYS n 
1 312 LEU n 
1 313 ARG n 
1 314 GLU n 
1 315 SER n 
1 316 ASN n 
1 317 HIS n 
1 318 GLN n 
1 319 ARG n 
1 320 TYR n 
1 321 ILE n 
1 322 SER n 
1 323 TYR n 
1 324 ASN n 
1 325 ILE n 
1 326 ILE n 
1 327 ALA n 
1 328 VAL n 
1 329 TYR n 
1 330 ARG n 
1 331 VAL n 
1 332 LEU n 
1 333 GLN n 
1 334 ILE n 
1 335 ASP n 
1 336 ALA n 
1 337 LYS n 
1 338 ARG n 
1 339 GLN n 
1 340 PHE n 
1 341 ILE n 
1 342 ASN n 
1 343 LEU n 
1 344 SER n 
1 345 LEU n 
1 346 ASP n 
1 347 MET n 
1 348 GLY n 
1 349 TYR n 
1 350 TYR n 
1 351 ALA n 
1 352 LYS n 
1 353 ILE n 
1 354 GLN n 
1 355 ILE n 
1 356 GLN n 
1 357 SER n 
1 358 VAL n 
1 359 PHE n 
1 360 SER n 
1 361 PRO n 
1 362 ILE n 
1 363 LYS n 
1 364 THR n 
1 365 TRP n 
1 366 ASP n 
1 367 ALA n 
1 368 ILE n 
1 369 ILE n 
1 370 PHE n 
1 371 ASN n 
1 372 SER n 
1 373 LEU n 
1 374 LYS n 
1 375 GLU n 
1 376 GLN n 
1 377 ASN n 
1 378 LYS n 
1 379 VAL n 
1 380 ILE n 
1 381 PRO n 
1 382 GLN n 
1 383 GLY n 
1 384 ARG n 
1 385 SER n 
1 386 HIS n 
1 387 PRO n 
1 388 VAL n 
1 389 GLN n 
1 390 PRO n 
1 391 TYR n 
1 392 PRO n 
1 393 GLY n 
1 394 ALA n 
1 395 PHE n 
1 396 VAL n 
1 397 LYS n 
1 398 GLU n 
1 399 PRO n 
1 400 ILE n 
1 401 PRO n 
1 402 ASN n 
1 403 ARG n 
1 404 TYR n 
1 405 LYS n 
1 406 TYR n 
1 407 VAL n 
1 408 MET n 
1 409 SER n 
1 410 PHE n 
1 411 ASP n 
1 412 LEU n 
1 413 THR n 
1 414 SER n 
1 415 PHE n 
1 416 TYR n 
1 417 PRO n 
1 418 SER n 
1 419 ILE n 
1 420 ILE n 
1 421 ARG n 
1 422 GLN n 
1 423 VAL n 
1 424 ASN n 
1 425 ILE n 
1 426 SER n 
1 427 PRO n 
1 428 GLU n 
1 429 THR n 
1 430 ILE n 
1 431 ALA n 
1 432 GLY n 
1 433 THR n 
1 434 PHE n 
1 435 LYS n 
1 436 VAL n 
1 437 ALA n 
1 438 PRO n 
1 439 LEU n 
1 440 HIS n 
1 441 ASP n 
1 442 TYR n 
1 443 ILE n 
1 444 ASN n 
1 445 ALA n 
1 446 VAL n 
1 447 ALA n 
1 448 GLU n 
1 449 ARG n 
1 450 PRO n 
1 451 SER n 
1 452 ASP n 
1 453 VAL n 
1 454 TYR n 
1 455 SER n 
1 456 CYS n 
1 457 SER n 
1 458 PRO n 
1 459 ASN n 
1 460 GLY n 
1 461 MET n 
1 462 MET n 
1 463 TYR n 
1 464 TYR n 
1 465 LYS n 
1 466 ASP n 
1 467 ARG n 
1 468 ASP n 
1 469 GLY n 
1 470 VAL n 
1 471 VAL n 
1 472 PRO n 
1 473 THR n 
1 474 GLU n 
1 475 ILE n 
1 476 THR n 
1 477 LYS n 
1 478 VAL n 
1 479 PHE n 
1 480 ASN n 
1 481 GLN n 
1 482 ARG n 
1 483 LYS n 
1 484 GLU n 
1 485 HIS n 
1 486 LYS n 
1 487 GLY n 
1 488 TYR n 
1 489 MET n 
1 490 LEU n 
1 491 ALA n 
1 492 ALA n 
1 493 GLN n 
1 494 ARG n 
1 495 ASN n 
1 496 GLY n 
1 497 GLU n 
1 498 ILE n 
1 499 ILE n 
1 500 LYS n 
1 501 GLU n 
1 502 ALA n 
1 503 LEU n 
1 504 HIS n 
1 505 ASN n 
1 506 PRO n 
1 507 ASN n 
1 508 LEU n 
1 509 SER n 
1 510 VAL n 
1 511 ASP n 
1 512 GLU n 
1 513 PRO n 
1 514 LEU n 
1 515 ASP n 
1 516 VAL n 
1 517 ASP n 
1 518 TYR n 
1 519 ARG n 
1 520 PHE n 
1 521 ASP n 
1 522 PHE n 
1 523 SER n 
1 524 ASP n 
1 525 GLU n 
1 526 ILE n 
1 527 LYS n 
1 528 GLU n 
1 529 LYS n 
1 530 ILE n 
1 531 LYS n 
1 532 LYS n 
1 533 LEU n 
1 534 SER n 
1 535 ALA n 
1 536 LYS n 
1 537 SER n 
1 538 LEU n 
1 539 ASN n 
1 540 GLU n 
1 541 MET n 
1 542 LEU n 
1 543 PHE n 
1 544 ARG n 
1 545 ALA n 
1 546 GLN n 
1 547 ARG n 
1 548 THR n 
1 549 GLU n 
1 550 VAL n 
1 551 ALA n 
1 552 GLY n 
1 553 MET n 
1 554 THR n 
1 555 ALA n 
1 556 GLN n 
1 557 ILE n 
1 558 ASN n 
1 559 ARG n 
1 560 LYS n 
1 561 LEU n 
1 562 LEU n 
1 563 ILE n 
1 564 ASN n 
1 565 SER n 
1 566 LEU n 
1 567 TYR n 
1 568 GLY n 
1 569 ALA n 
1 570 LEU n 
1 571 GLY n 
1 572 ASN n 
1 573 VAL n 
1 574 TRP n 
1 575 PHE n 
1 576 ARG n 
1 577 TYR n 
1 578 TYR n 
1 579 ASP n 
1 580 LEU n 
1 581 ARG n 
1 582 ASN n 
1 583 ALA n 
1 584 THR n 
1 585 ALA n 
1 586 ILE n 
1 587 THR n 
1 588 THR n 
1 589 PHE n 
1 590 GLY n 
1 591 GLN n 
1 592 MET n 
1 593 ALA n 
1 594 LEU n 
1 595 GLN n 
1 596 TRP n 
1 597 ILE n 
1 598 GLU n 
1 599 ARG n 
1 600 LYS n 
1 601 VAL n 
1 602 ASN n 
1 603 GLU n 
1 604 TYR n 
1 605 LEU n 
1 606 ASN n 
1 607 GLU n 
1 608 VAL n 
1 609 CYS n 
1 610 GLY n 
1 611 THR n 
1 612 GLU n 
1 613 GLY n 
1 614 GLU n 
1 615 ALA n 
1 616 PHE n 
1 617 VAL n 
1 618 LEU n 
1 619 TYR n 
1 620 GLY n 
1 621 ASP n 
1 622 THR n 
1 623 ASP n 
1 624 SER n 
1 625 ILE n 
1 626 TYR n 
1 627 VAL n 
1 628 SER n 
1 629 ALA n 
1 630 ASP n 
1 631 LYS n 
1 632 ILE n 
1 633 ILE n 
1 634 ASP n 
1 635 LYS n 
1 636 VAL n 
1 637 GLY n 
1 638 GLU n 
1 639 SER n 
1 640 LYS n 
1 641 PHE n 
1 642 ARG n 
1 643 ASP n 
1 644 THR n 
1 645 ASN n 
1 646 HIS n 
1 647 TRP n 
1 648 VAL n 
1 649 ASP n 
1 650 PHE n 
1 651 LEU n 
1 652 ASP n 
1 653 LYS n 
1 654 PHE n 
1 655 ALA n 
1 656 ARG n 
1 657 GLU n 
1 658 ARG n 
1 659 MET n 
1 660 GLU n 
1 661 PRO n 
1 662 ALA n 
1 663 ILE n 
1 664 ASP n 
1 665 ARG n 
1 666 GLY n 
1 667 PHE n 
1 668 ARG n 
1 669 GLU n 
1 670 MET n 
1 671 CYS n 
1 672 GLU n 
1 673 TYR n 
1 674 MET n 
1 675 ASN n 
1 676 ASN n 
1 677 LYS n 
1 678 GLN n 
1 679 HIS n 
1 680 LEU n 
1 681 MET n 
1 682 PHE n 
1 683 MET n 
1 684 ASP n 
1 685 ARG n 
1 686 GLU n 
1 687 ALA n 
1 688 ILE n 
1 689 ALA n 
1 690 GLY n 
1 691 PRO n 
1 692 PRO n 
1 693 LEU n 
1 694 GLY n 
1 695 SER n 
1 696 LYS n 
1 697 GLY n 
1 698 ILE n 
1 699 GLY n 
1 700 GLY n 
1 701 PHE n 
1 702 TRP n 
1 703 THR n 
1 704 GLY n 
1 705 LYS n 
1 706 LYS n 
1 707 ARG n 
1 708 TYR n 
1 709 ALA n 
1 710 LEU n 
1 711 ASN n 
1 712 VAL n 
1 713 TRP n 
1 714 ASP n 
1 715 MET n 
1 716 GLU n 
1 717 GLY n 
1 718 THR n 
1 719 ARG n 
1 720 TYR n 
1 721 ALA n 
1 722 GLU n 
1 723 PRO n 
1 724 LYS n 
1 725 LEU n 
1 726 LYS n 
1 727 ILE n 
1 728 MET n 
1 729 GLY n 
1 730 LEU n 
1 731 GLU n 
1 732 THR n 
1 733 GLN n 
1 734 LYS n 
1 735 SER n 
1 736 SER n 
1 737 THR n 
1 738 PRO n 
1 739 LYS n 
1 740 ALA n 
1 741 VAL n 
1 742 GLN n 
1 743 LYS n 
1 744 ALA n 
1 745 LEU n 
1 746 LYS n 
1 747 GLU n 
1 748 CYS n 
1 749 ILE n 
1 750 ARG n 
1 751 ARG n 
1 752 MET n 
1 753 LEU n 
1 754 GLN n 
1 755 GLU n 
1 756 GLY n 
1 757 GLU n 
1 758 GLU n 
1 759 SER n 
1 760 LEU n 
1 761 GLN n 
1 762 GLU n 
1 763 TYR n 
1 764 PHE n 
1 765 LYS n 
1 766 GLU n 
1 767 PHE n 
1 768 GLU n 
1 769 LYS n 
1 770 GLU n 
1 771 PHE n 
1 772 ARG n 
1 773 GLN n 
1 774 LEU n 
1 775 ASN n 
1 776 TYR n 
1 777 ILE n 
1 778 SER n 
1 779 ILE n 
1 780 ALA n 
1 781 SER n 
1 782 VAL n 
1 783 SER n 
1 784 SER n 
1 785 ALA n 
1 786 ASN n 
1 787 ASN n 
1 788 ILE n 
1 789 ALA n 
1 790 LYS n 
1 791 TYR n 
1 792 ASP n 
1 793 VAL n 
1 794 GLY n 
1 795 GLY n 
1 796 PHE n 
1 797 PRO n 
1 798 GLY n 
1 799 PRO n 
1 800 LYS n 
1 801 CYS n 
1 802 PRO n 
1 803 PHE n 
1 804 HIS n 
1 805 ILE n 
1 806 ARG n 
1 807 GLY n 
1 808 ILE n 
1 809 LEU n 
1 810 THR n 
1 811 TYR n 
1 812 ASN n 
1 813 ARG n 
1 814 ALA n 
1 815 ILE n 
1 816 LYS n 
1 817 GLY n 
1 818 ASN n 
1 819 ILE n 
1 820 ASP n 
1 821 ALA n 
1 822 PRO n 
1 823 GLN n 
1 824 VAL n 
1 825 VAL n 
1 826 GLU n 
1 827 GLY n 
1 828 GLU n 
1 829 LYS n 
1 830 VAL n 
1 831 TYR n 
1 832 VAL n 
1 833 LEU n 
1 834 PRO n 
1 835 LEU n 
1 836 ARG n 
1 837 GLU n 
1 838 GLY n 
1 839 ASN n 
1 840 PRO n 
1 841 PHE n 
1 842 GLY n 
1 843 ASP n 
1 844 LYS n 
1 845 CYS n 
1 846 ILE n 
1 847 ALA n 
1 848 TRP n 
1 849 PRO n 
1 850 SER n 
1 851 GLY n 
1 852 THR n 
1 853 GLU n 
1 854 ILE n 
1 855 THR n 
1 856 ASP n 
1 857 LEU n 
1 858 ILE n 
1 859 LYS n 
1 860 ASP n 
1 861 ASP n 
1 862 VAL n 
1 863 LEU n 
1 864 HIS n 
1 865 TRP n 
1 866 MET n 
1 867 ASP n 
1 868 TYR n 
1 869 THR n 
1 870 VAL n 
1 871 LEU n 
1 872 LEU n 
1 873 GLU n 
1 874 LYS n 
1 875 THR n 
1 876 PHE n 
1 877 ILE n 
1 878 LYS n 
1 879 PRO n 
1 880 LEU n 
1 881 GLU n 
1 882 GLY n 
1 883 PHE n 
1 884 THR n 
1 885 SER n 
1 886 ALA n 
1 887 ALA n 
1 888 LYS n 
1 889 LEU n 
1 890 ASP n 
1 891 TYR n 
1 892 GLU n 
1 893 LYS n 
1 894 LYS n 
1 895 ALA n 
1 896 SER n 
1 897 LEU n 
1 898 PHE n 
1 899 ASP n 
1 900 MET n 
1 901 PHE n 
1 902 ASP n 
1 903 PHE n 
2 1   DA  n 
2 2   DC  n 
2 3   DA  n 
2 4   DG  n 
2 5   DG  n 
2 6   DT  n 
2 7   DA  n 
2 8   DA  n 
2 9   DG  n 
2 10  DC  n 
2 11  DA  n 
2 12  DG  n 
2 13  DT  n 
2 14  DC  n 
2 15  DC  n 
2 16  DG  n 
2 17  DC  n 
2 18  DG  n 
3 1   DG  n 
3 2   DC  n 
3 3   DG  n 
3 4   DG  n 
3 5   DA  n 
3 6   DC  n 
3 7   DT  n 
3 8   DG  n 
3 9   DC  n 
3 10  DT  n 
3 11  DT  n 
3 12  DA  n 
3 13  DC  n 
3 14  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 43 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage RB69' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     12353 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPR69 Q38087 1 
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFDIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIDVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
1 ? 
2 PDB 4KHQ       4KHQ   2 ? ? ? 
3 PDB 4KHQ       4KHQ   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4KHQ A 1 ? 903 ? Q38087 1   ? 903 ? 1   903 
2 2 4KHQ T 1 ? 18  ? 4KHQ   1   ? 18  ? 1   18  
3 3 4KHQ P 1 ? 14  ? 4KHQ   102 ? 115 ? 102 115 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4KHQ ALA A 222 ? UNP Q38087 ASP 222 'ENGINEERED MUTATION' 222 1 
1 4KHQ ALA A 327 ? UNP Q38087 ASP 327 'ENGINEERED MUTATION' 327 2 
1 4KHQ PHE A 415 ? UNP Q38087 LEU 415 'ENGINEERED MUTATION' 415 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                            ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                           ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                         ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                    ? 'C4 H7 N O4'       133.103 
CA  non-polymer         . 'CALCIUM ION'                                      ? 'Ca 2'             40.078  
CYS 'L-peptide linking' y CYSTEINE                                           ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"               ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                ? 'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"               ? 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                       ? 'C10 H15 N2 O8 P'  322.208 
DUP non-polymer         . 
;2'-DEOXYURIDINE 5'-ALPHA,BETA-IMIDO-TRIPHOSPHATE
;
? 'C9 H16 N3 O13 P3' 467.157 
GLN 'L-peptide linking' y GLUTAMINE                                          ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                    ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                            ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                          ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                              ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                         ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                            ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                             ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                         ? 'C5 H11 N O2 S'    149.211 
NA  non-polymer         . 'SODIUM ION'                                       ? 'Na 1'             22.990  
PHE 'L-peptide linking' y PHENYLALANINE                                      ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                            ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                             ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                          ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                         ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                           ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                             ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          4KHQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.69 
_exptl_crystal.density_percent_sol   54.31 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'50 MM TRIS, PH 7.5, 10% PEG350, 180 MM CALCIUM CHLORIDE, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 295K, temperature 298K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2010-07-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4KHQ 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.186 
_reflns.number_obs                   64251 
_reflns.number_all                   64251 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.07400 
_reflns.pdbx_netI_over_sigmaI        11.9000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.000 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.19 
_reflns_shell.d_res_low              2.24 
_reflns_shell.percent_possible_all   99.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.52000 
_reflns_shell.meanI_over_sigI_obs    3.100 
_reflns_shell.pdbx_redundancy        5.20 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4KHQ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     64171 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.236 
_refine.ls_d_res_high                            2.186 
_refine.ls_percent_reflns_obs                    99.22 
_refine.ls_R_factor_obs                          0.1808 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1791 
_refine.ls_R_factor_R_free                       0.2125 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.99 
_refine.ls_number_reflns_R_free                  3204 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -1.27100 
_refine.aniso_B[2][2]                            -3.34920 
_refine.aniso_B[3][3]                            5.28920 
_refine.aniso_B[1][2]                            -0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             1.00 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.22 
_refine.pdbx_overall_phase_error                 22.36 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7215 
_refine_hist.pdbx_number_atoms_nucleic_acid   649 
_refine_hist.pdbx_number_atoms_ligand         39 
_refine_hist.number_atoms_solvent             578 
_refine_hist.number_atoms_total               8481 
_refine_hist.d_res_high                       2.186 
_refine_hist.d_res_low                        46.236 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.010  ? ? 8339  'X-RAY DIFFRACTION' ? 
f_angle_d          0.724  ? ? 11485 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 11.517 ? ? 2805  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.051  ? ? 1213  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 1374  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.1857 2.2183  2215 0.2344 84.00  0.2640 . . 105 . . . . 
'X-RAY DIFFRACTION' . 2.2183 2.2529  2610 0.2279 99.00  0.2892 . . 147 . . . . 
'X-RAY DIFFRACTION' . 2.2529 2.2899  2645 0.2325 100.00 0.2928 . . 137 . . . . 
'X-RAY DIFFRACTION' . 2.2899 2.3294  2613 0.2192 100.00 0.2653 . . 143 . . . . 
'X-RAY DIFFRACTION' . 2.3294 2.3717  2653 0.2144 100.00 0.2856 . . 148 . . . . 
'X-RAY DIFFRACTION' . 2.3717 2.4173  2627 0.2034 100.00 0.2327 . . 120 . . . . 
'X-RAY DIFFRACTION' . 2.4173 2.4667  2655 0.2064 100.00 0.2711 . . 139 . . . . 
'X-RAY DIFFRACTION' . 2.4667 2.5203  2643 0.2022 100.00 0.2589 . . 149 . . . . 
'X-RAY DIFFRACTION' . 2.5203 2.5789  2652 0.2087 100.00 0.2320 . . 128 . . . . 
'X-RAY DIFFRACTION' . 2.5789 2.6434  2615 0.2070 100.00 0.2686 . . 173 . . . . 
'X-RAY DIFFRACTION' . 2.6434 2.7149  2666 0.2076 100.00 0.2578 . . 145 . . . . 
'X-RAY DIFFRACTION' . 2.7149 2.7948  2631 0.2072 100.00 0.2757 . . 140 . . . . 
'X-RAY DIFFRACTION' . 2.7948 2.8850  2656 0.2026 100.00 0.2224 . . 132 . . . . 
'X-RAY DIFFRACTION' . 2.8850 2.9880  2675 0.2116 100.00 0.2186 . . 136 . . . . 
'X-RAY DIFFRACTION' . 2.9880 3.1077  2669 0.1980 100.00 0.2537 . . 130 . . . . 
'X-RAY DIFFRACTION' . 3.1077 3.2491  2674 0.2042 100.00 0.2798 . . 129 . . . . 
'X-RAY DIFFRACTION' . 3.2491 3.4203  2668 0.1894 100.00 0.2138 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.4203 3.6345  2690 0.1770 100.00 0.2000 . . 136 . . . . 
'X-RAY DIFFRACTION' . 3.6345 3.9150  2677 0.1632 100.00 0.1988 . . 148 . . . . 
'X-RAY DIFFRACTION' . 3.9150 4.3087  2690 0.1395 100.00 0.1517 . . 147 . . . . 
'X-RAY DIFFRACTION' . 4.3087 4.9316  2723 0.1274 100.00 0.1567 . . 143 . . . . 
'X-RAY DIFFRACTION' . 4.9316 6.2109  2745 0.1585 100.00 0.1701 . . 160 . . . . 
'X-RAY DIFFRACTION' . 6.2109 46.2466 2875 0.1777 99.00  0.2131 . . 127 . . . . 
# 
_struct.entry_id                  4KHQ 
_struct.title                     'Ternary complex of RB69 mutant L415F wit DUMPNPP' 
_struct.pdbx_descriptor           'DNA polymerase (E.C.2.7.7.7), dna' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4KHQ 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'NUCLEOTIDE, TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 7 ? 
Q N N 7 ? 
R N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 64  ? GLY A 79  ? ASN A 64  GLY A 79  1 ? 16 
HELX_P HELX_P2  2  ASP A 87  ? TYR A 97  ? ASP A 87  TYR A 97  1 ? 11 
HELX_P HELX_P3  3  ASP A 104 ? ILE A 108 ? ASP A 104 ILE A 108 5 ? 5  
HELX_P HELX_P4  4  SER A 163 ? LYS A 169 ? SER A 163 LYS A 169 1 ? 7  
HELX_P HELX_P5  5  LEU A 170 ? GLY A 174 ? LEU A 170 GLY A 174 5 ? 5  
HELX_P HELX_P6  6  PRO A 179 ? ASP A 184 ? PRO A 179 ASP A 184 1 ? 6  
HELX_P HELX_P7  7  ASN A 193 ? LYS A 208 ? ASN A 193 LYS A 208 1 ? 16 
HELX_P HELX_P8  8  PHE A 221 ? GLY A 235 ? PHE A 221 GLY A 235 1 ? 15 
HELX_P HELX_P9  9  GLY A 235 ? LYS A 240 ? GLY A 235 LYS A 240 1 ? 6  
HELX_P HELX_P10 10 ARG A 241 ? SER A 243 ? ARG A 241 SER A 243 5 ? 3  
HELX_P HELX_P11 11 ASP A 272 ? SER A 281 ? ASP A 272 SER A 281 1 ? 10 
HELX_P HELX_P12 12 SER A 289 ? ASN A 299 ? SER A 289 ASN A 299 1 ? 11 
HELX_P HELX_P13 13 PRO A 308 ? SER A 310 ? PRO A 308 SER A 310 5 ? 3  
HELX_P HELX_P14 14 LYS A 311 ? ASN A 316 ? LYS A 311 ASN A 316 1 ? 6  
HELX_P HELX_P15 15 ASN A 316 ? GLN A 339 ? ASN A 316 GLN A 339 1 ? 24 
HELX_P HELX_P16 16 GLN A 339 ? LYS A 352 ? GLN A 339 LYS A 352 1 ? 14 
HELX_P HELX_P17 17 GLN A 354 ? PHE A 359 ? GLN A 354 PHE A 359 5 ? 6  
HELX_P HELX_P18 18 SER A 360 ? GLU A 375 ? SER A 360 GLU A 375 1 ? 16 
HELX_P HELX_P19 19 SER A 414 ? ASN A 424 ? SER A 414 ASN A 424 1 ? 11 
HELX_P HELX_P20 20 PRO A 438 ? ASN A 444 ? PRO A 438 ASN A 444 1 ? 7  
HELX_P HELX_P21 21 GLY A 469 ? LEU A 503 ? GLY A 469 LEU A 503 1 ? 35 
HELX_P HELX_P22 22 SER A 523 ? LYS A 531 ? SER A 523 LYS A 531 1 ? 9  
HELX_P HELX_P23 23 SER A 534 ? LEU A 570 ? SER A 534 LEU A 570 1 ? 37 
HELX_P HELX_P24 24 ASP A 579 ? GLY A 610 ? ASP A 579 GLY A 610 1 ? 32 
HELX_P HELX_P25 25 ALA A 629 ? GLY A 637 ? ALA A 629 GLY A 637 1 ? 9  
HELX_P HELX_P26 26 GLU A 638 ? PHE A 641 ? GLU A 638 PHE A 641 5 ? 4  
HELX_P HELX_P27 27 ASP A 643 ? ARG A 658 ? ASP A 643 ARG A 658 1 ? 16 
HELX_P HELX_P28 28 ARG A 658 ? MET A 674 ? ARG A 658 MET A 674 1 ? 17 
HELX_P HELX_P29 29 LEU A 730 ? LYS A 734 ? LEU A 730 LYS A 734 5 ? 5  
HELX_P HELX_P30 30 PRO A 738 ? GLU A 755 ? PRO A 738 GLU A 755 1 ? 18 
HELX_P HELX_P31 31 GLY A 756 ? PHE A 771 ? GLY A 756 PHE A 771 1 ? 16 
HELX_P HELX_P32 32 ARG A 772 ? LEU A 774 ? ARG A 772 LEU A 774 5 ? 3  
HELX_P HELX_P33 33 ILE A 788 ? LYS A 790 ? ILE A 788 LYS A 790 5 ? 3  
HELX_P HELX_P34 34 PRO A 802 ? ILE A 815 ? PRO A 802 ILE A 815 1 ? 14 
HELX_P HELX_P35 35 ILE A 858 ? MET A 866 ? ILE A 858 MET A 866 1 ? 9  
HELX_P HELX_P36 36 ASP A 867 ? PHE A 876 ? ASP A 867 PHE A 876 1 ? 10 
HELX_P HELX_P37 37 PHE A 876 ? LYS A 888 ? PHE A 876 LYS A 888 1 ? 13 
HELX_P HELX_P38 38 SER A 896 ? PHE A 901 ? SER A 896 PHE A 901 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D CA  .   CA    ? ? ? 1_555 G DUP .  O2B ? ? A CA  1001 A DUP 1005 1_555 ? ? ? ? ? ? ?            2.243 ? 
metalc2  metalc ? ? D CA  .   CA    ? ? ? 1_555 G DUP .  O3G ? ? A CA  1001 A DUP 1005 1_555 ? ? ? ? ? ? ?            2.270 ? 
metalc3  metalc ? ? A LYS 531 O     ? ? ? 1_555 F CA  .  CA  ? ? A LYS 531  A CA  1004 1_555 ? ? ? ? ? ? ?            2.279 ? 
metalc4  metalc ? ? A GLU 686 OE1   ? ? ? 1_555 M NA  .  NA  ? ? A GLU 686  A NA  1010 1_555 ? ? ? ? ? ? ?            2.302 ? 
metalc5  metalc ? ? A ASP 411 OD1   ? ? ? 1_555 D CA  .  CA  ? ? A ASP 411  A CA  1001 1_555 ? ? ? ? ? ? ?            2.304 ? 
metalc6  metalc ? ? D CA  .   CA    ? ? ? 1_555 G DUP .  O1A ? ? A CA  1001 A DUP 1005 1_555 ? ? ? ? ? ? ?            2.322 ? 
metalc7  metalc ? ? A ASP 192 OD2   ? ? ? 1_555 E CA  .  CA  ? ? A ASP 192  A CA  1003 1_555 ? ? ? ? ? ? ?            2.362 ? 
metalc8  metalc ? ? A LEU 412 O     ? ? ? 1_555 D CA  .  CA  ? ? A LEU 412  A CA  1001 1_555 ? ? ? ? ? ? ?            2.375 ? 
metalc9  metalc ? ? E CA  .   CA    ? ? ? 1_555 P HOH .  O   ? ? A CA  1003 A HOH 1458 1_555 ? ? ? ? ? ? ?            2.382 ? 
metalc10 metalc ? ? F CA  .   CA    ? ? ? 1_555 P HOH .  O   ? ? A CA  1004 A HOH 1472 1_555 ? ? ? ? ? ? ?            2.384 ? 
metalc11 metalc ? ? A ASP 623 OD1   ? ? ? 1_555 D CA  .  CA  ? ? A ASP 623  A CA  1001 1_555 ? ? ? ? ? ? ?            2.394 ? 
metalc12 metalc ? ? O NA  .   NA    ? ? ? 1_555 P HOH .  O   ? ? A NA  1012 A HOH 1568 1_555 ? ? ? ? ? ? ?            2.396 ? 
metalc13 metalc ? ? N NA  .   NA    ? ? ? 1_555 P HOH .  O   ? ? A NA  1011 A HOH 1545 1_555 ? ? ? ? ? ? ?            2.399 ? 
metalc14 metalc ? ? E CA  .   CA    ? ? ? 1_555 P HOH .  O   ? ? A CA  1003 A HOH 1443 1_555 ? ? ? ? ? ? ?            2.399 ? 
metalc15 metalc ? ? M NA  .   NA    ? ? ? 1_555 P HOH .  O   ? ? A NA  1010 A HOH 1323 1_555 ? ? ? ? ? ? ?            2.401 ? 
metalc16 metalc ? ? J NA  .   NA    ? ? ? 1_555 P HOH .  O   ? ? A NA  1008 A HOH 1539 1_555 ? ? ? ? ? ? ?            2.406 ? 
metalc17 metalc ? ? N NA  .   NA    ? ? ? 1_555 P HOH .  O   ? ? A NA  1011 A HOH 1452 1_555 ? ? ? ? ? ? ?            2.406 ? 
metalc18 metalc ? ? H NA  .   NA    ? ? ? 1_555 P HOH .  O   ? ? A NA  1006 A HOH 1465 1_555 ? ? ? ? ? ? ?            2.410 ? 
metalc19 metalc ? ? F CA  .   CA    ? ? ? 1_555 P HOH .  O   ? ? A CA  1004 A HOH 1471 1_555 ? ? ? ? ? ? ?            2.410 ? 
metalc20 metalc ? ? J NA  .   NA    ? ? ? 1_555 P HOH .  O   ? ? A NA  1008 A HOH 1346 1_555 ? ? ? ? ? ? ?            2.410 ? 
metalc21 metalc ? ? H NA  .   NA    ? ? ? 1_555 P HOH .  O   ? ? A NA  1006 A HOH 1463 1_555 ? ? ? ? ? ? ?            2.412 ? 
metalc22 metalc ? ? N NA  .   NA    ? ? ? 1_555 P HOH .  O   ? ? A NA  1011 A HOH 1453 1_555 ? ? ? ? ? ? ?            2.414 ? 
metalc23 metalc ? ? A GLU 196 OE2   ? ? ? 1_555 E CA  .  CA  ? ? A GLU 196  A CA  1003 1_555 ? ? ? ? ? ? ?            2.415 ? 
metalc24 metalc ? ? O NA  .   NA    ? ? ? 1_555 P HOH .  O   ? ? A NA  1012 A HOH 1178 1_555 ? ? ? ? ? ? ?            2.418 ? 
metalc25 metalc ? ? J NA  .   NA    ? ? ? 1_555 P HOH .  O   ? ? A NA  1008 A HOH 1540 1_555 ? ? ? ? ? ? ?            2.418 ? 
metalc26 metalc ? ? H NA  .   NA    ? ? ? 1_555 P HOH .  O   ? ? A NA  1006 A HOH 1251 1_555 ? ? ? ? ? ? ?            2.423 ? 
metalc27 metalc ? ? A ASP 684 OD2   ? ? ? 1_555 O NA  .  NA  ? ? A ASP 684  A NA  1012 1_555 ? ? ? ? ? ? ?            2.427 ? 
metalc28 metalc ? ? H NA  .   NA    ? ? ? 1_555 P HOH .  O   ? ? A NA  1006 A HOH 1464 1_555 ? ? ? ? ? ? ?            2.427 ? 
metalc29 metalc ? ? F CA  .   CA    ? ? ? 1_555 P HOH .  O   ? ? A CA  1004 A HOH 1554 1_555 ? ? ? ? ? ? ?            2.430 ? 
metalc30 metalc ? ? J NA  .   NA    ? ? ? 1_555 P HOH .  O   ? ? A NA  1008 A HOH 1499 1_555 ? ? ? ? ? ? ?            2.438 ? 
metalc31 metalc ? ? M NA  .   NA    ? ? ? 1_555 P HOH .  O   ? ? A NA  1010 A HOH 1442 1_555 ? ? ? ? ? ? ?            2.439 ? 
metalc32 metalc ? ? A ASP 623 OD2   ? ? ? 1_555 L NA  .  NA  ? ? A ASP 623  A NA  1009 1_555 ? ? ? ? ? ? ?            2.439 ? 
metalc33 metalc ? ? A ASN 232 OD1   ? ? ? 1_555 J NA  .  NA  ? ? A ASN 232  A NA  1008 1_555 ? ? ? ? ? ? ?            2.441 ? 
metalc34 metalc ? ? A ASN 505 O     A ? ? 1_555 F CA  .  CA  ? ? A ASN 505  A CA  1004 1_555 ? ? ? ? ? ? ?            2.458 ? 
metalc35 metalc ? ? A ASN 505 O     B ? ? 1_555 F CA  .  CA  ? ? A ASN 505  A CA  1004 1_555 ? ? ? ? ? ? ?            2.461 ? 
metalc36 metalc ? ? A ASN 507 OD1   ? ? ? 1_555 F CA  .  CA  ? ? A ASN 507  A CA  1004 1_555 ? ? ? ? ? ? ?            2.471 ? 
metalc37 metalc ? ? A GLU 196 OE1   ? ? ? 1_555 E CA  .  CA  ? ? A GLU 196  A CA  1003 1_555 ? ? ? ? ? ? ?            2.475 ? 
metalc38 metalc ? ? A GLU 116 OE2   ? ? ? 1_555 H NA  .  NA  ? ? A GLU 116  A NA  1006 1_555 ? ? ? ? ? ? ?            2.507 ? 
metalc39 metalc ? ? A ASP 192 OD1   ? ? ? 1_555 E CA  .  CA  ? ? A ASP 192  A CA  1003 1_555 ? ? ? ? ? ? ?            2.513 ? 
metalc40 metalc ? ? M NA  .   NA    ? ? ? 1_555 P HOH .  O   ? ? A NA  1010 A HOH 1134 1_555 ? ? ? ? ? ? ?            2.568 ? 
metalc41 metalc ? ? A GLU 716 OE1   ? ? ? 1_555 N NA  .  NA  ? ? A GLU 716  A NA  1011 1_555 ? ? ? ? ? ? ?            2.685 ? 
metalc42 metalc ? ? G DUP .   O1A   ? ? ? 1_555 L NA  .  NA  ? ? A DUP 1005 A NA  1009 1_555 ? ? ? ? ? ? ?            2.722 ? 
metalc43 metalc ? ? A GLU 177 OE2   ? ? ? 1_555 I NA  .  NA  ? ? A GLU 177  A NA  1007 1_555 ? ? ? ? ? ? ?            2.727 ? 
metalc44 metalc ? ? C DC  14  "O3'" ? ? ? 1_555 L NA  .  NA  ? ? P DC  115  A NA  1009 1_555 ? ? ? ? ? ? ?            2.839 ? 
metalc45 metalc ? ? A ASP 114 OD2   ? ? ? 1_555 H NA  .  NA  ? ? A ASP 114  A NA  1006 1_555 ? ? ? ? ? ? ?            2.865 ? 
metalc46 metalc ? ? A GLU 660 OE1   ? ? ? 1_555 O NA  .  NA  ? ? A GLU 660  A NA  1012 1_555 ? ? ? ? ? ? ?            2.927 ? 
metalc47 metalc ? ? A GLU 716 OE1   ? ? ? 1_555 M NA  .  NA  ? ? A GLU 716  A NA  1010 1_555 ? ? ? ? ? ? ?            2.930 ? 
metalc48 metalc ? ? N NA  .   NA    ? ? ? 1_555 P HOH .  O   ? ? A NA  1011 A HOH 1134 1_555 ? ? ? ? ? ? ?            3.029 ? 
metalc49 metalc ? ? A ILE 115 O     ? ? ? 1_555 H NA  .  NA  ? ? A ILE 115  A NA  1006 1_555 ? ? ? ? ? ? ?            3.130 ? 
metalc50 metalc ? ? A GLU 177 OE1   ? ? ? 1_555 I NA  .  NA  ? ? A GLU 177  A NA  1007 1_555 ? ? ? ? ? ? ?            3.156 ? 
metalc51 metalc ? ? O NA  .   NA    ? ? ? 1_555 P HOH .  O   ? ? A NA  1012 A HOH 1570 1_555 ? ? ? ? ? ? ?            3.172 ? 
metalc52 metalc ? ? A GLU 172 OE1   ? ? ? 1_555 I NA  .  NA  ? ? A GLU 172  A NA  1007 1_555 ? ? ? ? ? ? ?            3.177 ? 
hydrog1  hydrog ? ? B DG  4   N1    ? ? ? 1_555 C DC  14 N3  ? ? T DG  4    P DC  115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  4   N2    ? ? ? 1_555 C DC  14 O2  ? ? T DG  4    P DC  115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  4   O6    ? ? ? 1_555 C DC  14 N4  ? ? T DG  4    P DC  115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  5   N1    ? ? ? 1_555 C DC  13 N3  ? ? T DG  5    P DC  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  5   N2    ? ? ? 1_555 C DC  13 O2  ? ? T DG  5    P DC  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  5   O6    ? ? ? 1_555 C DC  13 N4  ? ? T DG  5    P DC  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  12 N1  ? ? T DT  6    P DA  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  12 N6  ? ? T DT  6    P DA  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  7   N1    ? ? ? 1_555 C DT  11 N3  ? ? T DA  7    P DT  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DA  7   N6    ? ? ? 1_555 C DT  11 O4  ? ? T DA  7    P DT  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  10 N3  ? ? T DA  8    P DT  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  10 O4  ? ? T DA  8    P DT  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  9   N1    ? ? ? 1_555 C DC  9  N3  ? ? T DG  9    P DC  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  9   N2    ? ? ? 1_555 C DC  9  O2  ? ? T DG  9    P DC  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  9   O6    ? ? ? 1_555 C DC  9  N4  ? ? T DG  9    P DC  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  10  N3    ? ? ? 1_555 C DG  8  N1  ? ? T DC  10   P DG  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  10  N4    ? ? ? 1_555 C DG  8  O6  ? ? T DC  10   P DG  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  10  O2    ? ? ? 1_555 C DG  8  N2  ? ? T DC  10   P DG  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DA  11  N1    ? ? ? 1_555 C DT  7  N3  ? ? T DA  11   P DT  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DA  11  N6    ? ? ? 1_555 C DT  7  O4  ? ? T DA  11   P DT  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DG  12  N1    ? ? ? 1_555 C DC  6  N3  ? ? T DG  12   P DC  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DG  12  N2    ? ? ? 1_555 C DC  6  O2  ? ? T DG  12   P DC  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DG  12  O6    ? ? ? 1_555 C DC  6  N4  ? ? T DG  12   P DC  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DT  13  N3    ? ? ? 1_555 C DA  5  N1  ? ? T DT  13   P DA  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DT  13  O4    ? ? ? 1_555 C DA  5  N6  ? ? T DT  13   P DA  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DC  14  N3    ? ? ? 1_555 C DG  4  N1  ? ? T DC  14   P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DC  14  N4    ? ? ? 1_555 C DG  4  O6  ? ? T DC  14   P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DC  14  O2    ? ? ? 1_555 C DG  4  N2  ? ? T DC  14   P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DC  15  N3    ? ? ? 1_555 C DG  3  N1  ? ? T DC  15   P DG  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DC  15  N4    ? ? ? 1_555 C DG  3  O6  ? ? T DC  15   P DG  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DC  15  O2    ? ? ? 1_555 C DG  3  N2  ? ? T DC  15   P DG  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DG  16  N1    ? ? ? 1_555 C DC  2  N3  ? ? T DG  16   P DC  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DG  16  N2    ? ? ? 1_555 C DC  2  O2  ? ? T DG  16   P DC  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DG  16  O6    ? ? ? 1_555 C DC  2  N4  ? ? T DG  16   P DC  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? B DC  17  N3    ? ? ? 1_555 C DG  1  N1  ? ? T DC  17   P DG  102  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? B DC  17  N4    ? ? ? 1_555 C DG  1  O6  ? ? T DC  17   P DG  102  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? B DC  17  O2    ? ? ? 1_555 C DG  1  N2  ? ? T DC  17   P DG  102  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 2 ? 
D ? 6 ? 
E ? 2 ? 
F ? 2 ? 
G ? 7 ? 
H ? 4 ? 
I ? 3 ? 
J ? 3 ? 
K ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
G 6 7 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 4   ? ILE A 11  ? PHE A 4   ILE A 11  
A 2 SER A 14  ? ILE A 20  ? SER A 14  ILE A 20  
A 3 GLU A 26  ? VAL A 31  ? GLU A 26  VAL A 31  
B 1 SER A 36  ? HIS A 40  ? SER A 36  HIS A 40  
B 2 CYS A 57  ? LEU A 61  ? CYS A 57  LEU A 61  
C 1 PHE A 50  ? ASP A 51  ? PHE A 50  ASP A 51  
C 2 LYS A 378 ? VAL A 379 ? LYS A 378 VAL A 379 
D 1 ILE A 186 ? PHE A 191 ? ILE A 186 PHE A 191 
D 2 ARG A 145 ? LEU A 151 ? ARG A 145 LEU A 151 
D 3 ILE A 133 ? ASP A 140 ? ILE A 133 ASP A 140 
D 4 VAL A 110 ? VAL A 117 ? VAL A 110 VAL A 117 
D 5 ILE A 212 ? THR A 214 ? ILE A 212 THR A 214 
D 6 SER A 269 ? VAL A 270 ? SER A 269 VAL A 270 
E 1 ASN A 153 ? SER A 154 ? ASN A 153 SER A 154 
E 2 GLY A 157 ? ASN A 158 ? GLY A 157 ASN A 158 
F 1 THR A 248 ? ILE A 253 ? THR A 248 ILE A 253 
F 2 ARG A 260 ? LEU A 265 ? ARG A 260 LEU A 265 
G 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
G 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
G 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
G 4 MET A 683 ? ALA A 689 ? MET A 683 ALA A 689 
G 5 VAL A 407 ? LEU A 412 ? VAL A 407 LEU A 412 
G 6 SER A 624 ? SER A 628 ? SER A 624 SER A 628 
G 7 VAL A 617 ? ASP A 621 ? VAL A 617 ASP A 621 
H 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
H 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
H 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
H 4 THR A 718 ? MET A 728 ? THR A 718 MET A 728 
I 1 ILE A 430 ? THR A 433 ? ILE A 430 THR A 433 
I 2 MET A 461 ? TYR A 463 ? MET A 461 TYR A 463 
I 3 SER A 455 ? CYS A 456 ? SER A 455 CYS A 456 
J 1 SER A 781 ? SER A 784 ? SER A 781 SER A 784 
J 2 LYS A 829 ? PRO A 834 ? LYS A 829 PRO A 834 
J 3 CYS A 845 ? PRO A 849 ? CYS A 845 PRO A 849 
K 1 ASP A 792 ? VAL A 793 ? ASP A 792 VAL A 793 
K 2 PHE A 796 ? PRO A 797 ? PHE A 796 PRO A 797 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 6   ? N LEU A 6   O ARG A 18  ? O ARG A 18  
A 2 3 N TYR A 19  ? N TYR A 19  O ARG A 27  ? O ARG A 27  
B 1 2 N LEU A 37  ? N LEU A 37  O LYS A 60  ? O LYS A 60  
C 1 2 N PHE A 50  ? N PHE A 50  O VAL A 379 ? O VAL A 379 
D 1 2 O ILE A 187 ? O ILE A 187 N PHE A 146 ? N PHE A 146 
D 2 3 O PHE A 149 ? O PHE A 149 N ILE A 136 ? N ILE A 136 
D 3 4 O TYR A 139 ? O TYR A 139 N ASN A 112 ? N ASN A 112 
D 4 5 N ALA A 111 ? N ALA A 111 O ILE A 212 ? O ILE A 212 
D 5 6 N LEU A 213 ? N LEU A 213 O SER A 269 ? O SER A 269 
E 1 2 N SER A 154 ? N SER A 154 O GLY A 157 ? O GLY A 157 
F 1 2 N ARG A 249 ? N ARG A 249 O THR A 264 ? O THR A 264 
G 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
G 2 3 N THR A 703 ? N THR A 703 O ARG A 707 ? O ARG A 707 
G 3 4 O TRP A 713 ? O TRP A 713 N ILE A 688 ? N ILE A 688 
G 4 5 O GLU A 686 ? O GLU A 686 N SER A 409 ? N SER A 409 
G 5 6 N MET A 408 ? N MET A 408 O VAL A 627 ? O VAL A 627 
G 6 7 O TYR A 626 ? O TYR A 626 N LEU A 618 ? N LEU A 618 
H 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
H 2 3 N THR A 703 ? N THR A 703 O ARG A 707 ? O ARG A 707 
H 3 4 N LEU A 710 ? N LEU A 710 O LYS A 726 ? O LYS A 726 
I 1 2 N ALA A 431 ? N ALA A 431 O MET A 462 ? O MET A 462 
I 2 3 O TYR A 463 ? O TYR A 463 N SER A 455 ? N SER A 455 
J 1 2 N SER A 783 ? N SER A 783 O VAL A 830 ? O VAL A 830 
J 2 3 N TYR A 831 ? N TYR A 831 O TRP A 848 ? O TRP A 848 
K 1 2 N VAL A 793 ? N VAL A 793 O PHE A 796 ? O PHE A 796 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 1001'  
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE NA A 1002'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 1003'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 1004'  
AC5 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE DUP A 1005' 
AC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NA A 1006'  
AC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE NA A 1007'  
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 1008'  
AC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 1009'  
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 1010'  
BC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 1011'  
BC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 1012'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ASP A 411 ? ASP A 411  . ? 1_555 ? 
2  AC1 4  LEU A 412 ? LEU A 412  . ? 1_555 ? 
3  AC1 4  ASP A 623 ? ASP A 623  . ? 1_555 ? 
4  AC1 4  DUP G .   ? DUP A 1005 . ? 1_555 ? 
5  AC2 2  GLY A 610 ? GLY A 610  . ? 1_555 ? 
6  AC2 2  THR A 611 ? THR A 611  . ? 1_555 ? 
7  AC3 5  ASP A 192 ? ASP A 192  . ? 1_555 ? 
8  AC3 5  GLU A 196 ? GLU A 196  . ? 1_555 ? 
9  AC3 5  ASP A 860 ? ASP A 860  . ? 4_556 ? 
10 AC3 5  HOH P .   ? HOH A 1443 . ? 1_555 ? 
11 AC3 5  HOH P .   ? HOH A 1458 . ? 1_555 ? 
12 AC4 6  ASN A 505 ? ASN A 505  . ? 1_555 ? 
13 AC4 6  ASN A 507 ? ASN A 507  . ? 1_555 ? 
14 AC4 6  LYS A 531 ? LYS A 531  . ? 1_555 ? 
15 AC4 6  HOH P .   ? HOH A 1471 . ? 1_555 ? 
16 AC4 6  HOH P .   ? HOH A 1472 . ? 1_555 ? 
17 AC4 6  HOH P .   ? HOH A 1554 . ? 1_555 ? 
18 AC5 22 ASP A 411 ? ASP A 411  . ? 1_555 ? 
19 AC5 22 LEU A 412 ? LEU A 412  . ? 1_555 ? 
20 AC5 22 THR A 413 ? THR A 413  . ? 1_555 ? 
21 AC5 22 SER A 414 ? SER A 414  . ? 1_555 ? 
22 AC5 22 PHE A 415 ? PHE A 415  . ? 1_555 ? 
23 AC5 22 TYR A 416 ? TYR A 416  . ? 1_555 ? 
24 AC5 22 ARG A 482 ? ARG A 482  . ? 1_555 ? 
25 AC5 22 LYS A 560 ? LYS A 560  . ? 1_555 ? 
26 AC5 22 ASN A 564 ? ASN A 564  . ? 1_555 ? 
27 AC5 22 ASP A 623 ? ASP A 623  . ? 1_555 ? 
28 AC5 22 CA  D .   ? CA  A 1001 . ? 1_555 ? 
29 AC5 22 NA  L .   ? NA  A 1009 . ? 1_555 ? 
30 AC5 22 HOH P .   ? HOH A 1111 . ? 1_555 ? 
31 AC5 22 HOH P .   ? HOH A 1124 . ? 1_555 ? 
32 AC5 22 HOH P .   ? HOH A 1134 . ? 1_555 ? 
33 AC5 22 HOH P .   ? HOH A 1168 . ? 1_555 ? 
34 AC5 22 HOH P .   ? HOH A 1323 . ? 1_555 ? 
35 AC5 22 HOH P .   ? HOH A 1442 . ? 1_555 ? 
36 AC5 22 HOH P .   ? HOH A 1530 . ? 1_555 ? 
37 AC5 22 DC  C 14  ? DC  P 115  . ? 1_555 ? 
38 AC5 22 DA  B 3   ? DA  T 3    . ? 1_555 ? 
39 AC5 22 DG  B 4   ? DG  T 4    . ? 1_555 ? 
40 AC6 7  ASP A 114 ? ASP A 114  . ? 1_555 ? 
41 AC6 7  ILE A 115 ? ILE A 115  . ? 1_555 ? 
42 AC6 7  GLU A 116 ? GLU A 116  . ? 1_555 ? 
43 AC6 7  HOH P .   ? HOH A 1251 . ? 1_555 ? 
44 AC6 7  HOH P .   ? HOH A 1463 . ? 1_555 ? 
45 AC6 7  HOH P .   ? HOH A 1464 . ? 1_555 ? 
46 AC6 7  HOH P .   ? HOH A 1465 . ? 1_555 ? 
47 AC7 2  GLU A 172 ? GLU A 172  . ? 1_555 ? 
48 AC7 2  GLU A 177 ? GLU A 177  . ? 1_555 ? 
49 AC8 5  ASN A 232 ? ASN A 232  . ? 1_555 ? 
50 AC8 5  HOH P .   ? HOH A 1346 . ? 1_555 ? 
51 AC8 5  HOH P .   ? HOH A 1499 . ? 1_555 ? 
52 AC8 5  HOH P .   ? HOH A 1539 . ? 1_555 ? 
53 AC8 5  HOH P .   ? HOH A 1540 . ? 1_555 ? 
54 AC9 4  ASP A 411 ? ASP A 411  . ? 1_555 ? 
55 AC9 4  ASP A 623 ? ASP A 623  . ? 1_555 ? 
56 AC9 4  DUP G .   ? DUP A 1005 . ? 1_555 ? 
57 AC9 4  DC  C 14  ? DC  P 115  . ? 1_555 ? 
58 BC1 5  GLU A 686 ? GLU A 686  . ? 1_555 ? 
59 BC1 5  GLU A 716 ? GLU A 716  . ? 1_555 ? 
60 BC1 5  HOH P .   ? HOH A 1134 . ? 1_555 ? 
61 BC1 5  HOH P .   ? HOH A 1323 . ? 1_555 ? 
62 BC1 5  HOH P .   ? HOH A 1442 . ? 1_555 ? 
63 BC2 6  GLU A 686 ? GLU A 686  . ? 1_555 ? 
64 BC2 6  GLU A 716 ? GLU A 716  . ? 1_555 ? 
65 BC2 6  HOH P .   ? HOH A 1134 . ? 1_555 ? 
66 BC2 6  HOH P .   ? HOH A 1452 . ? 1_555 ? 
67 BC2 6  HOH P .   ? HOH A 1453 . ? 1_555 ? 
68 BC2 6  HOH P .   ? HOH A 1545 . ? 1_555 ? 
69 BC3 4  GLU A 660 ? GLU A 660  . ? 1_555 ? 
70 BC3 4  ASP A 684 ? ASP A 684  . ? 1_555 ? 
71 BC3 4  HOH P .   ? HOH A 1178 . ? 1_555 ? 
72 BC3 4  HOH P .   ? HOH A 1568 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4KHQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4KHQ 
_atom_sites.fract_transf_matrix[1][1]   0.012398 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008378 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007808 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
H  
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? 37.658  38.978 30.596  1.00 74.59  ? 1    MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? 36.463  39.533 29.972  1.00 71.82  ? 1    MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? 36.401  41.046 30.142  1.00 68.37  ? 1    MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? 37.118  41.619 30.963  1.00 67.64  ? 1    MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? 35.203  38.886 30.555  1.00 72.71  ? 1    MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? 35.164  38.857 32.077  1.00 74.05  ? 1    MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? 33.549  38.389 32.740  1.00 95.11  ? 1    MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? 33.344  36.743 32.061  1.00 49.49  ? 1    MET A CE    1 
ATOM   9    N  N     . LYS A 1 2   ? 35.545  41.689 29.355  1.00 64.77  ? 2    LYS A N     1 
ATOM   10   C  CA    . LYS A 1 2   ? 35.323  43.123 29.480  1.00 60.24  ? 2    LYS A CA    1 
ATOM   11   C  C     . LYS A 1 2   ? 34.535  43.415 30.751  1.00 52.02  ? 2    LYS A C     1 
ATOM   12   O  O     . LYS A 1 2   ? 33.615  42.678 31.101  1.00 50.16  ? 2    LYS A O     1 
ATOM   13   C  CB    . LYS A 1 2   ? 34.571  43.660 28.261  1.00 62.11  ? 2    LYS A CB    1 
ATOM   14   C  CG    . LYS A 1 2   ? 35.357  43.594 26.962  1.00 66.50  ? 2    LYS A CG    1 
ATOM   15   C  CD    . LYS A 1 2   ? 36.546  44.544 26.982  1.00 69.16  ? 2    LYS A CD    1 
ATOM   16   C  CE    . LYS A 1 2   ? 36.099  45.994 27.102  1.00 66.42  ? 2    LYS A CE    1 
ATOM   17   N  NZ    . LYS A 1 2   ? 37.247  46.942 27.047  1.00 66.37  ? 2    LYS A NZ    1 
ATOM   18   N  N     . GLU A 1 3   ? 34.902  44.491 31.439  1.00 47.10  ? 3    GLU A N     1 
ATOM   19   C  CA    . GLU A 1 3   ? 34.235  44.868 32.678  1.00 46.75  ? 3    GLU A CA    1 
ATOM   20   C  C     . GLU A 1 3   ? 32.814  45.365 32.417  1.00 43.48  ? 3    GLU A C     1 
ATOM   21   O  O     . GLU A 1 3   ? 32.517  45.893 31.346  1.00 41.91  ? 3    GLU A O     1 
ATOM   22   C  CB    . GLU A 1 3   ? 35.041  45.941 33.415  1.00 48.70  ? 3    GLU A CB    1 
ATOM   23   C  CG    . GLU A 1 3   ? 36.493  45.560 33.666  1.00 57.63  ? 3    GLU A CG    1 
ATOM   24   C  CD    . GLU A 1 3   ? 37.200  46.530 34.593  1.00 62.71  ? 3    GLU A CD    1 
ATOM   25   O  OE1   . GLU A 1 3   ? 38.394  46.311 34.889  1.00 71.75  ? 3    GLU A OE1   1 
ATOM   26   O  OE2   . GLU A 1 3   ? 36.563  47.508 35.030  1.00 63.06  ? 3    GLU A OE2   1 
ATOM   27   N  N     . PHE A 1 4   ? 31.937  45.183 33.398  1.00 39.29  ? 4    PHE A N     1 
ATOM   28   C  CA    . PHE A 1 4   ? 30.582  45.720 33.313  1.00 37.72  ? 4    PHE A CA    1 
ATOM   29   C  C     . PHE A 1 4   ? 30.033  46.056 34.695  1.00 34.71  ? 4    PHE A C     1 
ATOM   30   O  O     . PHE A 1 4   ? 30.364  45.399 35.683  1.00 36.61  ? 4    PHE A O     1 
ATOM   31   C  CB    . PHE A 1 4   ? 29.644  44.776 32.548  1.00 34.22  ? 4    PHE A CB    1 
ATOM   32   C  CG    . PHE A 1 4   ? 29.402  43.455 33.229  1.00 35.49  ? 4    PHE A CG    1 
ATOM   33   C  CD1   . PHE A 1 4   ? 30.326  42.427 33.133  1.00 38.66  ? 4    PHE A CD1   1 
ATOM   34   C  CD2   . PHE A 1 4   ? 28.234  43.233 33.942  1.00 33.38  ? 4    PHE A CD2   1 
ATOM   35   C  CE1   . PHE A 1 4   ? 30.099  41.207 33.751  1.00 38.88  ? 4    PHE A CE1   1 
ATOM   36   C  CE2   . PHE A 1 4   ? 27.999  42.017 34.561  1.00 33.81  ? 4    PHE A CE2   1 
ATOM   37   C  CZ    . PHE A 1 4   ? 28.932  41.002 34.465  1.00 35.48  ? 4    PHE A CZ    1 
ATOM   38   N  N     . TYR A 1 5   ? 29.209  47.097 34.757  1.00 31.92  ? 5    TYR A N     1 
ATOM   39   C  CA    . TYR A 1 5   ? 28.660  47.556 36.025  1.00 33.23  ? 5    TYR A CA    1 
ATOM   40   C  C     . TYR A 1 5   ? 27.555  46.627 36.517  1.00 33.30  ? 5    TYR A C     1 
ATOM   41   O  O     . TYR A 1 5   ? 26.962  45.879 35.739  1.00 30.48  ? 5    TYR A O     1 
ATOM   42   C  CB    . TYR A 1 5   ? 28.138  48.995 35.906  1.00 34.59  ? 5    TYR A CB    1 
ATOM   43   C  CG    . TYR A 1 5   ? 26.920  49.155 35.017  1.00 32.89  ? 5    TYR A CG    1 
ATOM   44   C  CD1   . TYR A 1 5   ? 27.054  49.362 33.652  1.00 33.99  ? 5    TYR A CD1   1 
ATOM   45   C  CD2   . TYR A 1 5   ? 25.637  49.110 35.548  1.00 29.11  ? 5    TYR A CD2   1 
ATOM   46   C  CE1   . TYR A 1 5   ? 25.946  49.510 32.839  1.00 30.31  ? 5    TYR A CE1   1 
ATOM   47   C  CE2   . TYR A 1 5   ? 24.521  49.258 34.743  1.00 27.80  ? 5    TYR A CE2   1 
ATOM   48   C  CZ    . TYR A 1 5   ? 24.683  49.458 33.388  1.00 32.24  ? 5    TYR A CZ    1 
ATOM   49   O  OH    . TYR A 1 5   ? 23.582  49.606 32.577  1.00 31.02  ? 5    TYR A OH    1 
ATOM   50   N  N     . LEU A 1 6   ? 27.296  46.675 37.817  1.00 34.43  ? 6    LEU A N     1 
ATOM   51   C  CA    . LEU A 1 6   ? 26.185  45.946 38.409  1.00 31.84  ? 6    LEU A CA    1 
ATOM   52   C  C     . LEU A 1 6   ? 25.130  46.952 38.846  1.00 33.78  ? 6    LEU A C     1 
ATOM   53   O  O     . LEU A 1 6   ? 23.979  46.896 38.410  1.00 31.31  ? 6    LEU A O     1 
ATOM   54   C  CB    . LEU A 1 6   ? 26.662  45.126 39.608  1.00 32.16  ? 6    LEU A CB    1 
ATOM   55   C  CG    . LEU A 1 6   ? 27.650  44.001 39.295  1.00 34.06  ? 6    LEU A CG    1 
ATOM   56   C  CD1   . LEU A 1 6   ? 28.237  43.428 40.574  1.00 34.03  ? 6    LEU A CD1   1 
ATOM   57   C  CD2   . LEU A 1 6   ? 26.965  42.915 38.482  1.00 32.78  ? 6    LEU A CD2   1 
ATOM   58   N  N     . THR A 1 7   ? 25.536  47.873 39.714  1.00 32.20  ? 7    THR A N     1 
ATOM   59   C  CA    . THR A 1 7   ? 24.667  48.949 40.170  1.00 33.49  ? 7    THR A CA    1 
ATOM   60   C  C     . THR A 1 7   ? 25.455  50.254 40.209  1.00 34.30  ? 7    THR A C     1 
ATOM   61   O  O     . THR A 1 7   ? 26.684  50.245 40.268  1.00 35.41  ? 7    THR A O     1 
ATOM   62   C  CB    . THR A 1 7   ? 24.113  48.683 41.584  1.00 33.78  ? 7    THR A CB    1 
ATOM   63   O  OG1   . THR A 1 7   ? 25.200  48.591 42.514  1.00 32.92  ? 7    THR A OG1   1 
ATOM   64   C  CG2   . THR A 1 7   ? 23.298  47.390 41.627  1.00 30.27  ? 7    THR A CG2   1 
ATOM   65   N  N     . VAL A 1 8   ? 24.743  51.374 40.168  1.00 32.77  ? 8    VAL A N     1 
ATOM   66   C  CA    . VAL A 1 8   ? 25.366  52.681 40.328  1.00 33.23  ? 8    VAL A CA    1 
ATOM   67   C  C     . VAL A 1 8   ? 24.437  53.597 41.123  1.00 35.01  ? 8    VAL A C     1 
ATOM   68   O  O     . VAL A 1 8   ? 23.212  53.518 40.993  1.00 32.57  ? 8    VAL A O     1 
ATOM   69   C  CB    . VAL A 1 8   ? 25.733  53.316 38.961  1.00 40.90  ? 8    VAL A CB    1 
ATOM   70   C  CG1   . VAL A 1 8   ? 24.478  53.695 38.179  1.00 37.09  ? 8    VAL A CG1   1 
ATOM   71   C  CG2   . VAL A 1 8   ? 26.628  54.529 39.157  1.00 42.64  ? 8    VAL A CG2   1 
ATOM   72   N  N     . GLU A 1 9   ? 25.021  54.436 41.972  1.00 34.91  ? 9    GLU A N     1 
ATOM   73   C  CA    . GLU A 1 9   ? 24.255  55.378 42.780  1.00 36.28  ? 9    GLU A CA    1 
ATOM   74   C  C     . GLU A 1 9   ? 25.022  56.686 42.916  1.00 41.70  ? 9    GLU A C     1 
ATOM   75   O  O     . GLU A 1 9   ? 26.252  56.700 42.845  1.00 42.14  ? 9    GLU A O     1 
ATOM   76   C  CB    . GLU A 1 9   ? 23.998  54.814 44.182  1.00 37.36  ? 9    GLU A CB    1 
ATOM   77   C  CG    . GLU A 1 9   ? 23.264  53.482 44.230  1.00 40.34  ? 9    GLU A CG    1 
ATOM   78   C  CD    . GLU A 1 9   ? 21.772  53.608 43.974  1.00 40.20  ? 9    GLU A CD    1 
ATOM   79   O  OE1   . GLU A 1 9   ? 21.288  54.734 43.729  1.00 38.85  ? 9    GLU A OE1   1 
ATOM   80   O  OE2   . GLU A 1 9   ? 21.082  52.569 44.024  1.00 40.31  ? 9    GLU A OE2   1 
ATOM   81   N  N     . GLN A 1 10  ? 24.299  57.785 43.111  1.00 41.25  ? 10   GLN A N     1 
ATOM   82   C  CA    . GLN A 1 10  ? 24.936  59.043 43.481  1.00 39.46  ? 10   GLN A CA    1 
ATOM   83   C  C     . GLN A 1 10  ? 24.605  59.387 44.923  1.00 41.88  ? 10   GLN A C     1 
ATOM   84   O  O     . GLN A 1 10  ? 23.440  59.565 45.275  1.00 43.53  ? 10   GLN A O     1 
ATOM   85   C  CB    . GLN A 1 10  ? 24.509  60.196 42.571  1.00 37.36  ? 10   GLN A CB    1 
ATOM   86   C  CG    . GLN A 1 10  ? 25.102  61.532 43.014  1.00 40.85  ? 10   GLN A CG    1 
ATOM   87   C  CD    . GLN A 1 10  ? 24.524  62.728 42.277  1.00 42.87  ? 10   GLN A CD    1 
ATOM   88   O  OE1   . GLN A 1 10  ? 23.791  62.579 41.300  1.00 41.23  ? 10   GLN A OE1   1 
ATOM   89   N  NE2   . GLN A 1 10  ? 24.853  63.926 42.751  1.00 43.92  ? 10   GLN A NE2   1 
ATOM   90   N  N     . ILE A 1 11  ? 25.635  59.474 45.755  1.00 45.05  ? 11   ILE A N     1 
ATOM   91   C  CA    . ILE A 1 11  ? 25.463  59.883 47.142  1.00 47.98  ? 11   ILE A CA    1 
ATOM   92   C  C     . ILE A 1 11  ? 26.340  61.097 47.418  1.00 50.89  ? 11   ILE A C     1 
ATOM   93   O  O     . ILE A 1 11  ? 27.535  60.967 47.684  1.00 52.96  ? 11   ILE A O     1 
ATOM   94   C  CB    . ILE A 1 11  ? 25.821  58.748 48.118  1.00 49.22  ? 11   ILE A CB    1 
ATOM   95   C  CG1   . ILE A 1 11  ? 25.040  57.479 47.765  1.00 48.12  ? 11   ILE A CG1   1 
ATOM   96   C  CG2   . ILE A 1 11  ? 25.546  59.177 49.554  1.00 49.54  ? 11   ILE A CG2   1 
ATOM   97   C  CD1   . ILE A 1 11  ? 25.294  56.319 48.700  1.00 50.14  ? 11   ILE A CD1   1 
ATOM   98   N  N     . GLY A 1 12  ? 25.739  62.280 47.343  1.00 52.24  ? 12   GLY A N     1 
ATOM   99   C  CA    . GLY A 1 12  ? 26.484  63.517 47.471  1.00 50.86  ? 12   GLY A CA    1 
ATOM   100  C  C     . GLY A 1 12  ? 27.407  63.709 46.284  1.00 49.19  ? 12   GLY A C     1 
ATOM   101  O  O     . GLY A 1 12  ? 26.974  63.637 45.134  1.00 49.09  ? 12   GLY A O     1 
ATOM   102  N  N     . ASP A 1 13  ? 28.685  63.943 46.563  1.00 47.89  ? 13   ASP A N     1 
ATOM   103  C  CA    . ASP A 1 13  ? 29.677  64.133 45.511  1.00 49.41  ? 13   ASP A CA    1 
ATOM   104  C  C     . ASP A 1 13  ? 30.365  62.828 45.128  1.00 47.44  ? 13   ASP A C     1 
ATOM   105  O  O     . ASP A 1 13  ? 31.373  62.831 44.423  1.00 44.23  ? 13   ASP A O     1 
ATOM   106  C  CB    . ASP A 1 13  ? 30.718  65.168 45.938  1.00 52.62  ? 13   ASP A CB    1 
ATOM   107  C  CG    . ASP A 1 13  ? 30.138  66.561 46.046  1.00 56.05  ? 13   ASP A CG    1 
ATOM   108  O  OD1   . ASP A 1 13  ? 29.171  66.855 45.314  1.00 54.72  ? 13   ASP A OD1   1 
ATOM   109  O  OD2   . ASP A 1 13  ? 30.647  67.358 46.861  1.00 61.66  ? 13   ASP A OD2   1 
ATOM   110  N  N     . SER A 1 14  ? 29.814  61.711 45.589  1.00 49.75  ? 14   SER A N     1 
ATOM   111  C  CA    . SER A 1 14  ? 30.393  60.409 45.294  1.00 48.25  ? 14   SER A CA    1 
ATOM   112  C  C     . SER A 1 14  ? 29.486  59.546 44.427  1.00 44.54  ? 14   SER A C     1 
ATOM   113  O  O     . SER A 1 14  ? 28.271  59.493 44.629  1.00 39.45  ? 14   SER A O     1 
ATOM   114  C  CB    . SER A 1 14  ? 30.739  59.664 46.586  1.00 49.40  ? 14   SER A CB    1 
ATOM   115  O  OG    . SER A 1 14  ? 31.966  60.119 47.126  1.00 52.24  ? 14   SER A OG    1 
ATOM   116  N  N     . ILE A 1 15  ? 30.091  58.882 43.449  1.00 44.77  ? 15   ILE A N     1 
ATOM   117  C  CA    . ILE A 1 15  ? 29.420  57.828 42.709  1.00 40.63  ? 15   ILE A CA    1 
ATOM   118  C  C     . ILE A 1 15  ? 29.817  56.493 43.322  1.00 39.61  ? 15   ILE A C     1 
ATOM   119  O  O     . ILE A 1 15  ? 30.998  56.142 43.353  1.00 43.29  ? 15   ILE A O     1 
ATOM   120  C  CB    . ILE A 1 15  ? 29.806  57.840 41.220  1.00 39.91  ? 15   ILE A CB    1 
ATOM   121  C  CG1   . ILE A 1 15  ? 29.138  59.015 40.505  1.00 38.22  ? 15   ILE A CG1   1 
ATOM   122  C  CG2   . ILE A 1 15  ? 29.406  56.531 40.553  1.00 36.50  ? 15   ILE A CG2   1 
ATOM   123  C  CD1   . ILE A 1 15  ? 27.625  58.972 40.545  1.00 36.19  ? 15   ILE A CD1   1 
ATOM   124  N  N     . PHE A 1 16  ? 28.834  55.766 43.839  1.00 35.65  ? 16   PHE A N     1 
ATOM   125  C  CA    . PHE A 1 16  ? 29.073  54.429 44.365  1.00 38.20  ? 16   PHE A CA    1 
ATOM   126  C  C     . PHE A 1 16  ? 28.701  53.389 43.318  1.00 38.92  ? 16   PHE A C     1 
ATOM   127  O  O     . PHE A 1 16  ? 27.543  53.293 42.909  1.00 37.33  ? 16   PHE A O     1 
ATOM   128  C  CB    . PHE A 1 16  ? 28.278  54.199 45.652  1.00 39.05  ? 16   PHE A CB    1 
ATOM   129  C  CG    . PHE A 1 16  ? 28.887  54.847 46.864  1.00 44.57  ? 16   PHE A CG    1 
ATOM   130  C  CD1   . PHE A 1 16  ? 29.765  54.145 47.673  1.00 47.45  ? 16   PHE A CD1   1 
ATOM   131  C  CD2   . PHE A 1 16  ? 28.582  56.157 47.192  1.00 47.46  ? 16   PHE A CD2   1 
ATOM   132  C  CE1   . PHE A 1 16  ? 30.328  54.738 48.789  1.00 51.09  ? 16   PHE A CE1   1 
ATOM   133  C  CE2   . PHE A 1 16  ? 29.142  56.757 48.307  1.00 49.06  ? 16   PHE A CE2   1 
ATOM   134  C  CZ    . PHE A 1 16  ? 30.015  56.046 49.105  1.00 51.19  ? 16   PHE A CZ    1 
ATOM   135  N  N     . GLU A 1 17  ? 29.690  52.617 42.880  1.00 38.23  ? 17   GLU A N     1 
ATOM   136  C  CA    . GLU A 1 17  ? 29.460  51.605 41.858  1.00 35.00  ? 17   GLU A CA    1 
ATOM   137  C  C     . GLU A 1 17  ? 29.855  50.208 42.316  1.00 38.21  ? 17   GLU A C     1 
ATOM   138  O  O     . GLU A 1 17  ? 30.930  50.005 42.878  1.00 40.31  ? 17   GLU A O     1 
ATOM   139  C  CB    . GLU A 1 17  ? 30.223  51.943 40.575  1.00 36.89  ? 17   GLU A CB    1 
ATOM   140  C  CG    . GLU A 1 17  ? 29.995  50.932 39.458  1.00 37.09  ? 17   GLU A CG    1 
ATOM   141  C  CD    . GLU A 1 17  ? 30.988  51.061 38.322  1.00 41.33  ? 17   GLU A CD    1 
ATOM   142  O  OE1   . GLU A 1 17  ? 30.742  50.461 37.255  1.00 43.45  ? 17   GLU A OE1   1 
ATOM   143  O  OE2   . GLU A 1 17  ? 32.017  51.748 38.495  1.00 39.94  ? 17   GLU A OE2   1 
ATOM   144  N  N     . ARG A 1 18  ? 28.968  49.249 42.078  1.00 36.41  ? 18   ARG A N     1 
ATOM   145  C  CA    . ARG A 1 18  ? 29.322  47.844 42.175  1.00 35.89  ? 18   ARG A CA    1 
ATOM   146  C  C     . ARG A 1 18  ? 29.525  47.357 40.750  1.00 35.07  ? 18   ARG A C     1 
ATOM   147  O  O     . ARG A 1 18  ? 28.753  47.707 39.858  1.00 34.24  ? 18   ARG A O     1 
ATOM   148  C  CB    . ARG A 1 18  ? 28.211  47.050 42.861  1.00 34.87  ? 18   ARG A CB    1 
ATOM   149  C  CG    . ARG A 1 18  ? 27.894  47.525 44.272  1.00 36.27  ? 18   ARG A CG    1 
ATOM   150  C  CD    . ARG A 1 18  ? 26.627  46.867 44.809  1.00 37.86  ? 18   ARG A CD    1 
ATOM   151  N  NE    . ARG A 1 18  ? 26.811  45.444 45.082  1.00 33.21  ? 18   ARG A NE    1 
ATOM   152  C  CZ    . ARG A 1 18  ? 25.813  44.588 45.280  1.00 44.73  ? 18   ARG A CZ    1 
ATOM   153  N  NH1   . ARG A 1 18  ? 24.554  45.008 45.224  1.00 32.02  ? 18   ARG A NH1   1 
ATOM   154  N  NH2   . ARG A 1 18  ? 26.072  43.311 45.527  1.00 33.57  ? 18   ARG A NH2   1 
ATOM   155  N  N     . TYR A 1 19  ? 30.569  46.567 40.527  1.00 34.51  ? 19   TYR A N     1 
ATOM   156  C  CA    . TYR A 1 19  ? 30.882  46.118 39.175  1.00 34.87  ? 19   TYR A CA    1 
ATOM   157  C  C     . TYR A 1 19  ? 31.650  44.803 39.156  1.00 35.82  ? 19   TYR A C     1 
ATOM   158  O  O     . TYR A 1 19  ? 32.218  44.383 40.164  1.00 40.21  ? 19   TYR A O     1 
ATOM   159  C  CB    . TYR A 1 19  ? 31.676  47.194 38.426  1.00 38.16  ? 19   TYR A CB    1 
ATOM   160  C  CG    . TYR A 1 19  ? 33.090  47.388 38.935  1.00 38.68  ? 19   TYR A CG    1 
ATOM   161  C  CD1   . TYR A 1 19  ? 33.336  48.061 40.125  1.00 36.87  ? 19   TYR A CD1   1 
ATOM   162  C  CD2   . TYR A 1 19  ? 34.179  46.900 38.223  1.00 42.65  ? 19   TYR A CD2   1 
ATOM   163  C  CE1   . TYR A 1 19  ? 34.626  48.242 40.594  1.00 40.05  ? 19   TYR A CE1   1 
ATOM   164  C  CE2   . TYR A 1 19  ? 35.473  47.077 38.683  1.00 46.54  ? 19   TYR A CE2   1 
ATOM   165  C  CZ    . TYR A 1 19  ? 35.690  47.750 39.869  1.00 45.72  ? 19   TYR A CZ    1 
ATOM   166  O  OH    . TYR A 1 19  ? 36.974  47.928 40.333  1.00 51.37  ? 19   TYR A OH    1 
ATOM   167  N  N     . ILE A 1 20  ? 31.649  44.157 37.996  1.00 36.04  ? 20   ILE A N     1 
ATOM   168  C  CA    . ILE A 1 20  ? 32.444  42.961 37.765  1.00 37.80  ? 20   ILE A CA    1 
ATOM   169  C  C     . ILE A 1 20  ? 33.689  43.358 36.981  1.00 43.05  ? 20   ILE A C     1 
ATOM   170  O  O     . ILE A 1 20  ? 33.584  43.952 35.907  1.00 40.42  ? 20   ILE A O     1 
ATOM   171  C  CB    . ILE A 1 20  ? 31.650  41.923 36.953  1.00 38.02  ? 20   ILE A CB    1 
ATOM   172  C  CG1   . ILE A 1 20  ? 30.389  41.498 37.712  1.00 36.15  ? 20   ILE A CG1   1 
ATOM   173  C  CG2   . ILE A 1 20  ? 32.518  40.719 36.635  1.00 39.85  ? 20   ILE A CG2   1 
ATOM   174  C  CD1   . ILE A 1 20  ? 30.670  40.730 38.986  1.00 37.00  ? 20   ILE A CD1   1 
ATOM   175  N  N     . ASP A 1 21  ? 34.868  43.042 37.513  1.00 47.20  ? 21   ASP A N     1 
ATOM   176  C  CA    . ASP A 1 21  ? 36.112  43.471 36.874  1.00 48.19  ? 21   ASP A CA    1 
ATOM   177  C  C     . ASP A 1 21  ? 36.558  42.552 35.734  1.00 49.96  ? 21   ASP A C     1 
ATOM   178  O  O     . ASP A 1 21  ? 35.849  41.618 35.359  1.00 48.25  ? 21   ASP A O     1 
ATOM   179  C  CB    . ASP A 1 21  ? 37.240  43.673 37.902  1.00 46.47  ? 21   ASP A CB    1 
ATOM   180  C  CG    . ASP A 1 21  ? 37.607  42.395 38.650  1.00 47.17  ? 21   ASP A CG    1 
ATOM   181  O  OD1   . ASP A 1 21  ? 37.323  41.287 38.153  1.00 47.34  ? 21   ASP A OD1   1 
ATOM   182  O  OD2   . ASP A 1 21  ? 38.199  42.505 39.744  1.00 48.04  ? 21   ASP A OD2   1 
ATOM   183  N  N     . SER A 1 22  ? 37.745  42.824 35.202  1.00 50.72  ? 22   SER A N     1 
ATOM   184  C  CA    . SER A 1 22  ? 38.269  42.094 34.053  1.00 54.61  ? 22   SER A CA    1 
ATOM   185  C  C     . SER A 1 22  ? 38.622  40.646 34.386  1.00 57.87  ? 22   SER A C     1 
ATOM   186  O  O     . SER A 1 22  ? 38.821  39.827 33.489  1.00 61.40  ? 22   SER A O     1 
ATOM   187  C  CB    . SER A 1 22  ? 39.489  42.817 33.477  1.00 57.52  ? 22   SER A CB    1 
ATOM   188  O  OG    . SER A 1 22  ? 40.501  42.960 34.458  1.00 59.99  ? 22   SER A OG    1 
ATOM   189  N  N     . ASN A 1 23  ? 38.703  40.337 35.676  1.00 57.68  ? 23   ASN A N     1 
ATOM   190  C  CA    . ASN A 1 23  ? 38.957  38.969 36.119  1.00 60.30  ? 23   ASN A CA    1 
ATOM   191  C  C     . ASN A 1 23  ? 37.685  38.299 36.634  1.00 59.43  ? 23   ASN A C     1 
ATOM   192  O  O     . ASN A 1 23  ? 37.738  37.247 37.269  1.00 51.48  ? 23   ASN A O     1 
ATOM   193  C  CB    . ASN A 1 23  ? 40.053  38.941 37.185  1.00 62.99  ? 23   ASN A CB    1 
ATOM   194  C  CG    . ASN A 1 23  ? 41.363  39.521 36.687  1.00 65.34  ? 23   ASN A CG    1 
ATOM   195  O  OD1   . ASN A 1 23  ? 41.799  39.231 35.573  1.00 66.21  ? 23   ASN A OD1   1 
ATOM   196  N  ND2   . ASN A 1 23  ? 41.991  40.355 37.507  1.00 66.07  ? 23   ASN A ND2   1 
ATOM   197  N  N     . GLY A 1 24  ? 36.543  38.925 36.362  1.00 54.95  ? 24   GLY A N     1 
ATOM   198  C  CA    . GLY A 1 24  ? 35.252  38.345 36.686  1.00 51.98  ? 24   GLY A CA    1 
ATOM   199  C  C     . GLY A 1 24  ? 34.866  38.414 38.152  1.00 50.86  ? 24   GLY A C     1 
ATOM   200  O  O     . GLY A 1 24  ? 33.971  37.695 38.594  1.00 48.87  ? 24   GLY A O     1 
ATOM   201  N  N     . ARG A 1 25  ? 35.531  39.284 38.906  1.00 51.10  ? 25   ARG A N     1 
ATOM   202  C  CA    . ARG A 1 25  ? 35.273  39.410 40.338  1.00 53.30  ? 25   ARG A CA    1 
ATOM   203  C  C     . ARG A 1 25  ? 34.444  40.653 40.662  1.00 49.30  ? 25   ARG A C     1 
ATOM   204  O  O     . ARG A 1 25  ? 34.663  41.721 40.088  1.00 49.62  ? 25   ARG A O     1 
ATOM   205  C  CB    . ARG A 1 25  ? 36.596  39.431 41.109  1.00 62.26  ? 25   ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 25  ? 36.459  39.664 42.604  1.00 68.15  ? 25   ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 25  ? 37.778  39.413 43.319  1.00 76.18  ? 25   ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 25  ? 37.755  39.895 44.697  1.00 81.47  ? 25   ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 25  ? 38.738  39.707 45.572  1.00 87.87  ? 25   ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 25  ? 39.827  39.038 45.217  1.00 91.41  ? 25   ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 25  ? 38.631  40.185 46.804  1.00 89.52  ? 25   ARG A NH2   1 
ATOM   212  N  N     . GLU A 1 26  ? 33.489  40.512 41.578  1.00 45.55  ? 26   GLU A N     1 
ATOM   213  C  CA    . GLU A 1 26  ? 32.661  41.645 41.984  1.00 46.01  ? 26   GLU A CA    1 
ATOM   214  C  C     . GLU A 1 26  ? 33.419  42.595 42.901  1.00 45.61  ? 26   GLU A C     1 
ATOM   215  O  O     . GLU A 1 26  ? 34.023  42.174 43.887  1.00 42.00  ? 26   GLU A O     1 
ATOM   216  C  CB    . GLU A 1 26  ? 31.372  41.185 42.673  1.00 46.24  ? 26   GLU A CB    1 
ATOM   217  C  CG    . GLU A 1 26  ? 30.583  42.339 43.283  1.00 45.28  ? 26   GLU A CG    1 
ATOM   218  C  CD    . GLU A 1 26  ? 29.257  41.912 43.884  1.00 47.28  ? 26   GLU A CD    1 
ATOM   219  O  OE1   . GLU A 1 26  ? 28.696  40.887 43.441  1.00 47.27  ? 26   GLU A OE1   1 
ATOM   220  O  OE2   . GLU A 1 26  ? 28.775  42.609 44.802  1.00 45.56  ? 26   GLU A OE2   1 
ATOM   221  N  N     . ARG A 1 27  ? 33.382  43.882 42.569  1.00 45.05  ? 27   ARG A N     1 
ATOM   222  C  CA    . ARG A 1 27  ? 34.032  44.899 43.384  1.00 46.27  ? 27   ARG A CA    1 
ATOM   223  C  C     . ARG A 1 27  ? 33.141  46.122 43.566  1.00 43.11  ? 27   ARG A C     1 
ATOM   224  O  O     . ARG A 1 27  ? 32.188  46.330 42.814  1.00 42.06  ? 27   ARG A O     1 
ATOM   225  C  CB    . ARG A 1 27  ? 35.375  45.304 42.773  1.00 51.28  ? 27   ARG A CB    1 
ATOM   226  C  CG    . ARG A 1 27  ? 36.380  44.165 42.705  1.00 56.65  ? 27   ARG A CG    1 
ATOM   227  C  CD    . ARG A 1 27  ? 37.746  44.638 42.253  1.00 63.78  ? 27   ARG A CD    1 
ATOM   228  N  NE    . ARG A 1 27  ? 38.688  43.526 42.167  1.00 68.99  ? 27   ARG A NE    1 
ATOM   229  C  CZ    . ARG A 1 27  ? 39.422  43.087 43.184  1.00 70.47  ? 27   ARG A CZ    1 
ATOM   230  N  NH1   . ARG A 1 27  ? 39.325  43.666 44.374  1.00 70.60  ? 27   ARG A NH1   1 
ATOM   231  N  NH2   . ARG A 1 27  ? 40.252  42.067 43.013  1.00 70.56  ? 27   ARG A NH2   1 
ATOM   232  N  N     . THR A 1 28  ? 33.454  46.919 44.580  1.00 43.81  ? 28   THR A N     1 
ATOM   233  C  CA    . THR A 1 28  ? 32.727  48.149 44.848  1.00 43.88  ? 28   THR A CA    1 
ATOM   234  C  C     . THR A 1 28  ? 33.725  49.288 44.966  1.00 46.45  ? 28   THR A C     1 
ATOM   235  O  O     . THR A 1 28  ? 34.758  49.145 45.618  1.00 46.91  ? 28   THR A O     1 
ATOM   236  C  CB    . THR A 1 28  ? 31.917  48.050 46.154  1.00 47.49  ? 28   THR A CB    1 
ATOM   237  O  OG1   . THR A 1 28  ? 30.959  46.989 46.049  1.00 57.20  ? 28   THR A OG1   1 
ATOM   238  C  CG2   . THR A 1 28  ? 31.186  49.354 46.433  1.00 42.71  ? 28   THR A CG2   1 
ATOM   239  N  N     . ARG A 1 29  ? 33.425  50.414 44.328  1.00 45.75  ? 29   ARG A N     1 
ATOM   240  C  CA    . ARG A 1 29  ? 34.298  51.578 44.413  1.00 48.22  ? 29   ARG A CA    1 
ATOM   241  C  C     . ARG A 1 29  ? 33.526  52.875 44.615  1.00 47.80  ? 29   ARG A C     1 
ATOM   242  O  O     . ARG A 1 29  ? 32.380  53.010 44.186  1.00 43.77  ? 29   ARG A O     1 
ATOM   243  C  CB    . ARG A 1 29  ? 35.194  51.683 43.175  1.00 50.01  ? 29   ARG A CB    1 
ATOM   244  C  CG    . ARG A 1 29  ? 34.448  51.789 41.856  1.00 50.26  ? 29   ARG A CG    1 
ATOM   245  C  CD    . ARG A 1 29  ? 35.428  51.760 40.692  1.00 51.27  ? 29   ARG A CD    1 
ATOM   246  N  NE    . ARG A 1 29  ? 34.760  51.569 39.408  1.00 47.83  ? 29   ARG A NE    1 
ATOM   247  C  CZ    . ARG A 1 29  ? 35.371  51.136 38.311  1.00 48.53  ? 29   ARG A CZ    1 
ATOM   248  N  NH1   . ARG A 1 29  ? 36.665  50.842 38.341  1.00 55.41  ? 29   ARG A NH1   1 
ATOM   249  N  NH2   . ARG A 1 29  ? 34.690  50.988 37.183  1.00 45.47  ? 29   ARG A NH2   1 
ATOM   250  N  N     . GLU A 1 30  ? 34.168  53.821 45.290  1.00 52.98  ? 30   GLU A N     1 
ATOM   251  C  CA    . GLU A 1 30  ? 33.613  55.151 45.474  1.00 54.95  ? 30   GLU A CA    1 
ATOM   252  C  C     . GLU A 1 30  ? 34.416  56.127 44.629  1.00 50.88  ? 30   GLU A C     1 
ATOM   253  O  O     . GLU A 1 30  ? 35.616  56.298 44.838  1.00 54.10  ? 30   GLU A O     1 
ATOM   254  C  CB    . GLU A 1 30  ? 33.668  55.555 46.947  1.00 59.54  ? 30   GLU A CB    1 
ATOM   255  C  CG    . GLU A 1 30  ? 33.087  56.926 47.237  1.00 62.02  ? 30   GLU A CG    1 
ATOM   256  C  CD    . GLU A 1 30  ? 33.169  57.295 48.705  1.00 66.26  ? 30   GLU A CD    1 
ATOM   257  O  OE1   . GLU A 1 30  ? 33.786  56.532 49.479  1.00 68.04  ? 30   GLU A OE1   1 
ATOM   258  O  OE2   . GLU A 1 30  ? 32.614  58.346 49.087  1.00 67.60  ? 30   GLU A OE2   1 
ATOM   259  N  N     . VAL A 1 31  ? 33.753  56.756 43.665  1.00 48.59  ? 31   VAL A N     1 
ATOM   260  C  CA    . VAL A 1 31  ? 34.428  57.664 42.748  1.00 47.81  ? 31   VAL A CA    1 
ATOM   261  C  C     . VAL A 1 31  ? 33.923  59.093 42.905  1.00 45.15  ? 31   VAL A C     1 
ATOM   262  O  O     . VAL A 1 31  ? 32.728  59.354 42.783  1.00 43.88  ? 31   VAL A O     1 
ATOM   263  C  CB    . VAL A 1 31  ? 34.240  57.223 41.283  1.00 48.99  ? 31   VAL A CB    1 
ATOM   264  C  CG1   . VAL A 1 31  ? 34.939  58.189 40.343  1.00 51.07  ? 31   VAL A CG1   1 
ATOM   265  C  CG2   . VAL A 1 31  ? 34.761  55.809 41.081  1.00 48.76  ? 31   VAL A CG2   1 
ATOM   266  N  N     . GLU A 1 32  ? 34.836  60.018 43.184  1.00 47.31  ? 32   GLU A N     1 
ATOM   267  C  CA    . GLU A 1 32  ? 34.486  61.431 43.225  1.00 49.05  ? 32   GLU A CA    1 
ATOM   268  C  C     . GLU A 1 32  ? 34.396  61.949 41.793  1.00 44.88  ? 32   GLU A C     1 
ATOM   269  O  O     . GLU A 1 32  ? 35.305  62.613 41.297  1.00 47.37  ? 32   GLU A O     1 
ATOM   270  C  CB    . GLU A 1 32  ? 35.515  62.226 44.028  1.00 52.41  ? 32   GLU A CB    1 
ATOM   271  C  CG    . GLU A 1 32  ? 35.076  63.644 44.363  1.00 57.91  ? 32   GLU A CG    1 
ATOM   272  N  N     . TYR A 1 33  ? 33.286  61.624 41.138  1.00 41.12  ? 33   TYR A N     1 
ATOM   273  C  CA    . TYR A 1 33  ? 33.088  61.897 39.719  1.00 40.69  ? 33   TYR A CA    1 
ATOM   274  C  C     . TYR A 1 33  ? 33.049  63.389 39.406  1.00 39.55  ? 33   TYR A C     1 
ATOM   275  O  O     . TYR A 1 33  ? 32.341  64.155 40.060  1.00 37.41  ? 33   TYR A O     1 
ATOM   276  C  CB    . TYR A 1 33  ? 31.798  61.221 39.249  1.00 40.93  ? 33   TYR A CB    1 
ATOM   277  C  CG    . TYR A 1 33  ? 31.481  61.387 37.779  1.00 39.49  ? 33   TYR A CG    1 
ATOM   278  C  CD1   . TYR A 1 33  ? 32.363  60.944 36.799  1.00 38.16  ? 33   TYR A CD1   1 
ATOM   279  C  CD2   . TYR A 1 33  ? 30.284  61.963 37.373  1.00 37.03  ? 33   TYR A CD2   1 
ATOM   280  C  CE1   . TYR A 1 33  ? 32.063  61.088 35.453  1.00 35.37  ? 33   TYR A CE1   1 
ATOM   281  C  CE2   . TYR A 1 33  ? 29.977  62.108 36.033  1.00 32.20  ? 33   TYR A CE2   1 
ATOM   282  C  CZ    . TYR A 1 33  ? 30.866  61.670 35.079  1.00 32.27  ? 33   TYR A CZ    1 
ATOM   283  O  OH    . TYR A 1 33  ? 30.551  61.819 33.748  1.00 35.08  ? 33   TYR A OH    1 
ATOM   284  N  N     . LYS A 1 34  ? 33.825  63.789 38.404  1.00 40.11  ? 34   LYS A N     1 
ATOM   285  C  CA    . LYS A 1 34  ? 33.837  65.168 37.936  1.00 40.78  ? 34   LYS A CA    1 
ATOM   286  C  C     . LYS A 1 34  ? 33.032  65.276 36.648  1.00 38.39  ? 34   LYS A C     1 
ATOM   287  O  O     . LYS A 1 34  ? 33.521  64.936 35.571  1.00 40.50  ? 34   LYS A O     1 
ATOM   288  C  CB    . LYS A 1 34  ? 35.273  65.647 37.714  1.00 44.19  ? 34   LYS A CB    1 
ATOM   289  C  CG    . LYS A 1 34  ? 36.062  65.828 39.003  1.00 48.95  ? 34   LYS A CG    1 
ATOM   290  C  CD    . LYS A 1 34  ? 37.565  65.824 38.755  1.00 56.99  ? 34   LYS A CD    1 
ATOM   291  C  CE    . LYS A 1 34  ? 38.063  64.425 38.423  1.00 61.25  ? 34   LYS A CE    1 
ATOM   292  N  N     . PRO A 1 35  ? 31.783  65.746 36.760  1.00 34.88  ? 35   PRO A N     1 
ATOM   293  C  CA    . PRO A 1 35  ? 30.876  65.807 35.612  1.00 36.50  ? 35   PRO A CA    1 
ATOM   294  C  C     . PRO A 1 35  ? 31.143  67.028 34.749  1.00 37.85  ? 35   PRO A C     1 
ATOM   295  O  O     . PRO A 1 35  ? 31.728  68.004 35.215  1.00 40.02  ? 35   PRO A O     1 
ATOM   296  C  CB    . PRO A 1 35  ? 29.506  65.943 36.274  1.00 34.25  ? 35   PRO A CB    1 
ATOM   297  C  CG    . PRO A 1 35  ? 29.790  66.722 37.514  1.00 36.42  ? 35   PRO A CG    1 
ATOM   298  C  CD    . PRO A 1 35  ? 31.156  66.274 37.985  1.00 38.02  ? 35   PRO A CD    1 
ATOM   299  N  N     . SER A 1 36  ? 30.718  66.964 33.494  1.00 37.56  ? 36   SER A N     1 
ATOM   300  C  CA    . SER A 1 36  ? 30.780  68.119 32.615  1.00 38.17  ? 36   SER A CA    1 
ATOM   301  C  C     . SER A 1 36  ? 29.382  68.509 32.151  1.00 39.91  ? 36   SER A C     1 
ATOM   302  O  O     . SER A 1 36  ? 28.533  67.650 31.907  1.00 38.25  ? 36   SER A O     1 
ATOM   303  C  CB    . SER A 1 36  ? 31.675  67.835 31.408  1.00 40.03  ? 36   SER A CB    1 
ATOM   304  O  OG    . SER A 1 36  ? 33.043  67.777 31.783  1.00 46.94  ? 36   SER A OG    1 
ATOM   305  N  N     . LEU A 1 37  ? 29.144  69.811 32.056  1.00 37.92  ? 37   LEU A N     1 
ATOM   306  C  CA    . LEU A 1 37  ? 27.936  70.329 31.428  1.00 36.95  ? 37   LEU A CA    1 
ATOM   307  C  C     . LEU A 1 37  ? 28.371  71.369 30.410  1.00 36.66  ? 37   LEU A C     1 
ATOM   308  O  O     . LEU A 1 37  ? 29.557  71.682 30.315  1.00 38.77  ? 37   LEU A O     1 
ATOM   309  C  CB    . LEU A 1 37  ? 26.989  70.932 32.464  1.00 34.93  ? 37   LEU A CB    1 
ATOM   310  C  CG    . LEU A 1 37  ? 26.430  69.936 33.480  1.00 36.83  ? 37   LEU A CG    1 
ATOM   311  C  CD1   . LEU A 1 37  ? 25.670  70.664 34.574  1.00 38.88  ? 37   LEU A CD1   1 
ATOM   312  C  CD2   . LEU A 1 37  ? 25.545  68.899 32.797  1.00 37.35  ? 37   LEU A CD2   1 
ATOM   313  N  N     . PHE A 1 38  ? 27.425  71.901 29.645  1.00 35.53  ? 38   PHE A N     1 
ATOM   314  C  CA    . PHE A 1 38  ? 27.776  72.747 28.512  1.00 34.05  ? 38   PHE A CA    1 
ATOM   315  C  C     . PHE A 1 38  ? 26.950  74.023 28.450  1.00 34.55  ? 38   PHE A C     1 
ATOM   316  O  O     . PHE A 1 38  ? 25.812  74.064 28.913  1.00 35.14  ? 38   PHE A O     1 
ATOM   317  C  CB    . PHE A 1 38  ? 27.619  71.968 27.202  1.00 35.77  ? 38   PHE A CB    1 
ATOM   318  C  CG    . PHE A 1 38  ? 28.486  70.742 27.112  1.00 31.38  ? 38   PHE A CG    1 
ATOM   319  C  CD1   . PHE A 1 38  ? 28.097  69.553 27.709  1.00 39.01  ? 38   PHE A CD1   1 
ATOM   320  C  CD2   . PHE A 1 38  ? 29.679  70.774 26.415  1.00 32.18  ? 38   PHE A CD2   1 
ATOM   321  C  CE1   . PHE A 1 38  ? 28.891  68.425 27.628  1.00 38.76  ? 38   PHE A CE1   1 
ATOM   322  C  CE2   . PHE A 1 38  ? 30.478  69.645 26.327  1.00 38.66  ? 38   PHE A CE2   1 
ATOM   323  C  CZ    . PHE A 1 38  ? 30.082  68.472 26.935  1.00 38.31  ? 38   PHE A CZ    1 
ATOM   324  N  N     . ALA A 1 39  ? 27.543  75.066 27.878  1.00 38.48  ? 39   ALA A N     1 
ATOM   325  C  CA    . ALA A 1 39  ? 26.840  76.314 27.626  1.00 37.38  ? 39   ALA A CA    1 
ATOM   326  C  C     . ALA A 1 39  ? 27.147  76.776 26.209  1.00 37.62  ? 39   ALA A C     1 
ATOM   327  O  O     . ALA A 1 39  ? 28.249  76.556 25.708  1.00 34.94  ? 39   ALA A O     1 
ATOM   328  C  CB    . ALA A 1 39  ? 27.259  77.375 28.634  1.00 38.78  ? 39   ALA A CB    1 
ATOM   329  N  N     . HIS A 1 40  ? 26.168  77.399 25.561  1.00 36.70  ? 40   HIS A N     1 
ATOM   330  C  CA    . HIS A 1 40  ? 26.378  77.976 24.239  1.00 38.87  ? 40   HIS A CA    1 
ATOM   331  C  C     . HIS A 1 40  ? 27.496  79.009 24.289  1.00 39.32  ? 40   HIS A C     1 
ATOM   332  O  O     . HIS A 1 40  ? 27.631  79.743 25.268  1.00 40.99  ? 40   HIS A O     1 
ATOM   333  C  CB    . HIS A 1 40  ? 25.088  78.616 23.721  1.00 38.90  ? 40   HIS A CB    1 
ATOM   334  C  CG    . HIS A 1 40  ? 24.056  77.624 23.282  1.00 40.73  ? 40   HIS A CG    1 
ATOM   335  N  ND1   . HIS A 1 40  ? 22.739  77.695 23.678  1.00 42.87  ? 40   HIS A ND1   1 
ATOM   336  C  CD2   . HIS A 1 40  ? 24.148  76.542 22.472  1.00 39.55  ? 40   HIS A CD2   1 
ATOM   337  C  CE1   . HIS A 1 40  ? 22.063  76.695 23.137  1.00 44.32  ? 40   HIS A CE1   1 
ATOM   338  N  NE2   . HIS A 1 40  ? 22.897  75.982 22.399  1.00 42.18  ? 40   HIS A NE2   1 
ATOM   339  N  N     . CYS A 1 41  ? 28.302  79.056 23.235  1.00 40.86  ? 41   CYS A N     1 
ATOM   340  C  CA    . CYS A 1 41  ? 29.437  79.971 23.180  1.00 42.06  ? 41   CYS A CA    1 
ATOM   341  C  C     . CYS A 1 41  ? 29.465  80.676 21.826  1.00 42.15  ? 41   CYS A C     1 
ATOM   342  O  O     . CYS A 1 41  ? 28.818  80.218 20.884  1.00 42.13  ? 41   CYS A O     1 
ATOM   343  C  CB    . CYS A 1 41  ? 30.739  79.201 23.406  1.00 44.14  ? 41   CYS A CB    1 
ATOM   344  S  SG    . CYS A 1 41  ? 31.228  78.123 22.037  1.00 44.34  ? 41   CYS A SG    1 
ATOM   345  N  N     . PRO A 1 42  ? 30.205  81.798 21.721  1.00 43.93  ? 42   PRO A N     1 
ATOM   346  C  CA    . PRO A 1 42  ? 30.293  82.493 20.430  1.00 45.73  ? 42   PRO A CA    1 
ATOM   347  C  C     . PRO A 1 42  ? 30.846  81.580 19.342  1.00 50.29  ? 42   PRO A C     1 
ATOM   348  O  O     . PRO A 1 42  ? 31.576  80.636 19.649  1.00 50.29  ? 42   PRO A O     1 
ATOM   349  C  CB    . PRO A 1 42  ? 31.281  83.629 20.711  1.00 44.40  ? 42   PRO A CB    1 
ATOM   350  C  CG    . PRO A 1 42  ? 31.168  83.875 22.170  1.00 44.93  ? 42   PRO A CG    1 
ATOM   351  C  CD    . PRO A 1 42  ? 30.925  82.523 22.784  1.00 40.22  ? 42   PRO A CD    1 
ATOM   352  N  N     . GLU A 1 43  ? 30.497  81.855 18.090  1.00 53.01  ? 43   GLU A N     1 
ATOM   353  C  CA    . GLU A 1 43  ? 30.945  81.022 16.980  1.00 60.84  ? 43   GLU A CA    1 
ATOM   354  C  C     . GLU A 1 43  ? 32.424  81.228 16.672  1.00 62.12  ? 43   GLU A C     1 
ATOM   355  O  O     . GLU A 1 43  ? 33.055  80.392 16.023  1.00 63.81  ? 43   GLU A O     1 
ATOM   356  C  CB    . GLU A 1 43  ? 30.094  81.273 15.734  1.00 69.56  ? 43   GLU A CB    1 
ATOM   357  C  CG    . GLU A 1 43  ? 28.653  80.817 15.885  1.00 77.29  ? 43   GLU A CG    1 
ATOM   358  C  CD    . GLU A 1 43  ? 27.959  80.623 14.554  1.00 82.83  ? 43   GLU A CD    1 
ATOM   359  O  OE1   . GLU A 1 43  ? 27.051  79.768 14.479  1.00 84.33  ? 43   GLU A OE1   1 
ATOM   360  O  OE2   . GLU A 1 43  ? 28.322  81.321 13.584  1.00 84.37  ? 43   GLU A OE2   1 
ATOM   361  N  N     . SER A 1 44  ? 32.973  82.340 17.149  1.00 62.30  ? 44   SER A N     1 
ATOM   362  C  CA    . SER A 1 44  ? 34.387  82.638 16.958  1.00 68.78  ? 44   SER A CA    1 
ATOM   363  C  C     . SER A 1 44  ? 35.260  81.757 17.845  1.00 71.31  ? 44   SER A C     1 
ATOM   364  O  O     . SER A 1 44  ? 36.474  81.686 17.661  1.00 75.57  ? 44   SER A O     1 
ATOM   365  C  CB    . SER A 1 44  ? 34.668  84.118 17.238  1.00 69.93  ? 44   SER A CB    1 
ATOM   366  O  OG    . SER A 1 44  ? 34.329  84.460 18.572  1.00 69.60  ? 44   SER A OG    1 
ATOM   367  N  N     . GLN A 1 45  ? 34.638  81.087 18.810  1.00 71.54  ? 45   GLN A N     1 
ATOM   368  C  CA    . GLN A 1 45  ? 35.366  80.191 19.698  1.00 73.98  ? 45   GLN A CA    1 
ATOM   369  C  C     . GLN A 1 45  ? 35.431  78.772 19.145  1.00 74.38  ? 45   GLN A C     1 
ATOM   370  O  O     . GLN A 1 45  ? 34.407  78.103 18.996  1.00 72.93  ? 45   GLN A O     1 
ATOM   371  C  CB    . GLN A 1 45  ? 34.750  80.181 21.098  1.00 74.84  ? 45   GLN A CB    1 
ATOM   372  C  CG    . GLN A 1 45  ? 35.336  79.111 22.005  1.00 79.54  ? 45   GLN A CG    1 
ATOM   373  C  CD    . GLN A 1 45  ? 35.282  79.489 23.471  1.00 85.04  ? 45   GLN A CD    1 
ATOM   374  O  OE1   . GLN A 1 45  ? 34.626  80.459 23.852  1.00 87.09  ? 45   GLN A OE1   1 
ATOM   375  N  NE2   . GLN A 1 45  ? 35.983  78.725 24.304  1.00 86.33  ? 45   GLN A NE2   1 
ATOM   376  N  N     . ALA A 1 46  ? 36.644  78.322 18.841  1.00 74.61  ? 46   ALA A N     1 
ATOM   377  C  CA    . ALA A 1 46  ? 36.859  76.969 18.346  1.00 73.44  ? 46   ALA A CA    1 
ATOM   378  C  C     . ALA A 1 46  ? 36.515  75.942 19.420  1.00 73.13  ? 46   ALA A C     1 
ATOM   379  O  O     . ALA A 1 46  ? 36.847  76.118 20.593  1.00 75.97  ? 46   ALA A O     1 
ATOM   380  C  CB    . ALA A 1 46  ? 38.298  76.795 17.883  1.00 74.68  ? 46   ALA A CB    1 
ATOM   381  N  N     . THR A 1 47  ? 35.843  74.874 19.008  1.00 68.08  ? 47   THR A N     1 
ATOM   382  C  CA    . THR A 1 47  ? 35.450  73.811 19.922  1.00 61.84  ? 47   THR A CA    1 
ATOM   383  C  C     . THR A 1 47  ? 35.097  72.560 19.131  1.00 54.90  ? 47   THR A C     1 
ATOM   384  O  O     . THR A 1 47  ? 34.889  72.623 17.920  1.00 56.11  ? 47   THR A O     1 
ATOM   385  C  CB    . THR A 1 47  ? 34.232  74.225 20.772  1.00 64.40  ? 47   THR A CB    1 
ATOM   386  O  OG1   . THR A 1 47  ? 33.915  73.183 21.702  1.00 65.56  ? 47   THR A OG1   1 
ATOM   387  C  CG2   . THR A 1 47  ? 33.027  74.489 19.882  1.00 64.14  ? 47   THR A CG2   1 
ATOM   388  N  N     . LYS A 1 48  ? 35.034  71.424 19.815  1.00 50.62  ? 48   LYS A N     1 
ATOM   389  C  CA    . LYS A 1 48  ? 34.620  70.181 19.176  1.00 53.74  ? 48   LYS A CA    1 
ATOM   390  C  C     . LYS A 1 48  ? 33.185  69.823 19.551  1.00 49.47  ? 48   LYS A C     1 
ATOM   391  O  O     . LYS A 1 48  ? 32.623  68.854 19.040  1.00 49.89  ? 48   LYS A O     1 
ATOM   392  C  CB    . LYS A 1 48  ? 35.572  69.039 19.539  1.00 58.47  ? 48   LYS A CB    1 
ATOM   393  C  CG    . LYS A 1 48  ? 35.797  68.855 21.031  1.00 63.73  ? 48   LYS A CG    1 
ATOM   394  C  CD    . LYS A 1 48  ? 36.750  67.699 21.297  1.00 69.76  ? 48   LYS A CD    1 
ATOM   395  C  CE    . LYS A 1 48  ? 37.119  67.606 22.769  1.00 74.28  ? 48   LYS A CE    1 
ATOM   396  N  NZ    . LYS A 1 48  ? 38.019  66.450 23.045  1.00 77.87  ? 48   LYS A NZ    1 
ATOM   397  N  N     . TYR A 1 49  ? 32.594  70.619 20.437  1.00 46.09  ? 49   TYR A N     1 
ATOM   398  C  CA    . TYR A 1 49  ? 31.238  70.366 20.914  1.00 41.98  ? 49   TYR A CA    1 
ATOM   399  C  C     . TYR A 1 49  ? 30.201  71.262 20.243  1.00 39.68  ? 49   TYR A C     1 
ATOM   400  O  O     . TYR A 1 49  ? 30.401  72.470 20.097  1.00 36.63  ? 49   TYR A O     1 
ATOM   401  C  CB    . TYR A 1 49  ? 31.167  70.546 22.431  1.00 42.28  ? 49   TYR A CB    1 
ATOM   402  C  CG    . TYR A 1 49  ? 32.197  69.747 23.197  1.00 42.53  ? 49   TYR A CG    1 
ATOM   403  C  CD1   . TYR A 1 49  ? 33.308  70.366 23.754  1.00 42.53  ? 49   TYR A CD1   1 
ATOM   404  C  CD2   . TYR A 1 49  ? 32.058  68.375 23.362  1.00 43.83  ? 49   TYR A CD2   1 
ATOM   405  C  CE1   . TYR A 1 49  ? 34.251  69.642 24.458  1.00 46.10  ? 49   TYR A CE1   1 
ATOM   406  C  CE2   . TYR A 1 49  ? 32.996  67.641 24.064  1.00 43.97  ? 49   TYR A CE2   1 
ATOM   407  C  CZ    . TYR A 1 49  ? 34.091  68.280 24.610  1.00 46.44  ? 49   TYR A CZ    1 
ATOM   408  O  OH    . TYR A 1 49  ? 35.028  67.557 25.311  1.00 47.67  ? 49   TYR A OH    1 
ATOM   409  N  N     . PHE A 1 50  ? 29.089  70.656 19.842  1.00 40.12  ? 50   PHE A N     1 
ATOM   410  C  CA    . PHE A 1 50  ? 27.975  71.381 19.244  1.00 38.19  ? 50   PHE A CA    1 
ATOM   411  C  C     . PHE A 1 50  ? 26.675  70.771 19.746  1.00 40.59  ? 50   PHE A C     1 
ATOM   412  O  O     . PHE A 1 50  ? 26.611  69.564 19.986  1.00 39.84  ? 50   PHE A O     1 
ATOM   413  C  CB    . PHE A 1 50  ? 28.024  71.272 17.719  1.00 37.44  ? 50   PHE A CB    1 
ATOM   414  C  CG    . PHE A 1 50  ? 29.297  71.786 17.109  1.00 41.84  ? 50   PHE A CG    1 
ATOM   415  C  CD1   . PHE A 1 50  ? 30.384  70.945 16.922  1.00 42.39  ? 50   PHE A CD1   1 
ATOM   416  C  CD2   . PHE A 1 50  ? 29.404  73.109 16.712  1.00 43.61  ? 50   PHE A CD2   1 
ATOM   417  C  CE1   . PHE A 1 50  ? 31.555  71.419 16.358  1.00 43.28  ? 50   PHE A CE1   1 
ATOM   418  C  CE2   . PHE A 1 50  ? 30.572  73.587 16.148  1.00 45.43  ? 50   PHE A CE2   1 
ATOM   419  C  CZ    . PHE A 1 50  ? 31.648  72.740 15.971  1.00 45.09  ? 50   PHE A CZ    1 
ATOM   420  N  N     . ASP A 1 51  ? 25.633  71.583 19.907  1.00 40.57  ? 51   ASP A N     1 
ATOM   421  C  CA    . ASP A 1 51  ? 24.327  71.013 20.221  1.00 38.40  ? 51   ASP A CA    1 
ATOM   422  C  C     . ASP A 1 51  ? 23.774  70.310 18.982  1.00 37.70  ? 51   ASP A C     1 
ATOM   423  O  O     . ASP A 1 51  ? 24.397  70.346 17.919  1.00 40.84  ? 51   ASP A O     1 
ATOM   424  C  CB    . ASP A 1 51  ? 23.348  72.051 20.806  1.00 36.53  ? 51   ASP A CB    1 
ATOM   425  C  CG    . ASP A 1 51  ? 22.914  73.120 19.802  1.00 37.90  ? 51   ASP A CG    1 
ATOM   426  O  OD1   . ASP A 1 51  ? 23.130  72.968 18.582  1.00 40.90  ? 51   ASP A OD1   1 
ATOM   427  O  OD2   . ASP A 1 51  ? 22.328  74.128 20.251  1.00 39.51  ? 51   ASP A OD2   1 
ATOM   428  N  N     . ILE A 1 52  ? 22.610  69.684 19.107  1.00 35.31  ? 52   ILE A N     1 
ATOM   429  C  CA    . ILE A 1 52  ? 22.064  68.901 18.002  1.00 36.21  ? 52   ILE A CA    1 
ATOM   430  C  C     . ILE A 1 52  ? 21.660  69.772 16.810  1.00 38.81  ? 52   ILE A C     1 
ATOM   431  O  O     . ILE A 1 52  ? 21.442  69.265 15.711  1.00 43.04  ? 52   ILE A O     1 
ATOM   432  C  CB    . ILE A 1 52  ? 20.875  68.025 18.449  1.00 35.35  ? 52   ILE A CB    1 
ATOM   433  C  CG1   . ILE A 1 52  ? 19.660  68.891 18.782  1.00 35.63  ? 52   ILE A CG1   1 
ATOM   434  C  CG2   . ILE A 1 52  ? 21.266  67.168 19.643  1.00 33.70  ? 52   ILE A CG2   1 
ATOM   435  C  CD1   . ILE A 1 52  ? 18.441  68.088 19.216  1.00 36.47  ? 52   ILE A CD1   1 
ATOM   436  N  N     . TYR A 1 53  ? 21.577  71.082 17.027  1.00 36.78  ? 53   TYR A N     1 
ATOM   437  C  CA    . TYR A 1 53  ? 21.213  72.008 15.960  1.00 39.04  ? 53   TYR A CA    1 
ATOM   438  C  C     . TYR A 1 53  ? 22.437  72.663 15.322  1.00 39.90  ? 53   TYR A C     1 
ATOM   439  O  O     . TYR A 1 53  ? 22.303  73.517 14.447  1.00 40.76  ? 53   TYR A O     1 
ATOM   440  C  CB    . TYR A 1 53  ? 20.246  73.078 16.474  1.00 40.51  ? 53   TYR A CB    1 
ATOM   441  C  CG    . TYR A 1 53  ? 19.054  72.511 17.211  1.00 41.29  ? 53   TYR A CG    1 
ATOM   442  C  CD1   . TYR A 1 53  ? 18.974  72.577 18.597  1.00 38.83  ? 53   TYR A CD1   1 
ATOM   443  C  CD2   . TYR A 1 53  ? 18.012  71.899 16.522  1.00 40.84  ? 53   TYR A CD2   1 
ATOM   444  C  CE1   . TYR A 1 53  ? 17.885  72.056 19.276  1.00 39.48  ? 53   TYR A CE1   1 
ATOM   445  C  CE2   . TYR A 1 53  ? 16.922  71.376 17.191  1.00 39.96  ? 53   TYR A CE2   1 
ATOM   446  C  CZ    . TYR A 1 53  ? 16.864  71.456 18.568  1.00 38.96  ? 53   TYR A CZ    1 
ATOM   447  O  OH    . TYR A 1 53  ? 15.780  70.934 19.236  1.00 42.60  ? 53   TYR A OH    1 
ATOM   448  N  N     . GLY A 1 54  ? 23.627  72.264 15.763  1.00 40.19  ? 54   GLY A N     1 
ATOM   449  C  CA    . GLY A 1 54  ? 24.860  72.740 15.159  1.00 39.55  ? 54   GLY A CA    1 
ATOM   450  C  C     . GLY A 1 54  ? 25.477  73.968 15.808  1.00 40.74  ? 54   GLY A C     1 
ATOM   451  O  O     . GLY A 1 54  ? 26.451  74.523 15.298  1.00 46.40  ? 54   GLY A O     1 
ATOM   452  N  N     . LYS A 1 55  ? 24.918  74.396 16.934  1.00 40.10  ? 55   LYS A N     1 
ATOM   453  C  CA    . LYS A 1 55  ? 25.435  75.566 17.642  1.00 41.25  ? 55   LYS A CA    1 
ATOM   454  C  C     . LYS A 1 55  ? 26.572  75.182 18.588  1.00 35.86  ? 55   LYS A C     1 
ATOM   455  O  O     . LYS A 1 55  ? 26.447  74.232 19.359  1.00 34.94  ? 55   LYS A O     1 
ATOM   456  C  CB    . LYS A 1 55  ? 24.312  76.261 18.413  1.00 42.61  ? 55   LYS A CB    1 
ATOM   457  C  CG    . LYS A 1 55  ? 23.163  76.728 17.536  1.00 46.07  ? 55   LYS A CG    1 
ATOM   458  N  N     . PRO A 1 56  ? 27.686  75.928 18.535  1.00 36.54  ? 56   PRO A N     1 
ATOM   459  C  CA    . PRO A 1 56  ? 28.876  75.604 19.330  1.00 38.84  ? 56   PRO A CA    1 
ATOM   460  C  C     . PRO A 1 56  ? 28.658  75.758 20.835  1.00 37.34  ? 56   PRO A C     1 
ATOM   461  O  O     . PRO A 1 56  ? 27.920  76.642 21.268  1.00 38.72  ? 56   PRO A O     1 
ATOM   462  C  CB    . PRO A 1 56  ? 29.914  76.618 18.835  1.00 38.49  ? 56   PRO A CB    1 
ATOM   463  C  CG    . PRO A 1 56  ? 29.110  77.763 18.327  1.00 38.91  ? 56   PRO A CG    1 
ATOM   464  C  CD    . PRO A 1 56  ? 27.874  77.147 17.729  1.00 37.69  ? 56   PRO A CD    1 
ATOM   465  N  N     . CYS A 1 57  ? 29.300  74.890 21.612  1.00 35.09  ? 57   CYS A N     1 
ATOM   466  C  CA    . CYS A 1 57  ? 29.245  74.950 23.068  1.00 45.21  ? 57   CYS A CA    1 
ATOM   467  C  C     . CYS A 1 57  ? 30.653  74.840 23.635  1.00 45.46  ? 57   CYS A C     1 
ATOM   468  O  O     . CYS A 1 57  ? 31.546  74.295 22.988  1.00 43.62  ? 57   CYS A O     1 
ATOM   469  C  CB    . CYS A 1 57  ? 28.409  73.796 23.628  1.00 45.93  ? 57   CYS A CB    1 
ATOM   470  S  SG    . CYS A 1 57  ? 26.711  73.691 23.033  1.00 48.02  ? 57   CYS A SG    1 
ATOM   471  N  N     . THR A 1 58  ? 30.850  75.358 24.844  1.00 44.16  ? 58   THR A N     1 
ATOM   472  C  CA    . THR A 1 58  ? 32.074  75.083 25.587  1.00 45.58  ? 58   THR A CA    1 
ATOM   473  C  C     . THR A 1 58  ? 31.760  74.145 26.737  1.00 41.83  ? 58   THR A C     1 
ATOM   474  O  O     . THR A 1 58  ? 30.687  74.219 27.339  1.00 42.54  ? 58   THR A O     1 
ATOM   475  C  CB    . THR A 1 58  ? 32.733  76.352 26.159  1.00 47.07  ? 58   THR A CB    1 
ATOM   476  O  OG1   . THR A 1 58  ? 31.819  77.025 27.032  1.00 51.36  ? 58   THR A OG1   1 
ATOM   477  C  CG2   . THR A 1 58  ? 33.150  77.284 25.047  1.00 49.88  ? 58   THR A CG2   1 
ATOM   478  N  N     . ARG A 1 59  ? 32.702  73.262 27.039  1.00 40.27  ? 59   ARG A N     1 
ATOM   479  C  CA    . ARG A 1 59  ? 32.531  72.314 28.125  1.00 40.80  ? 59   ARG A CA    1 
ATOM   480  C  C     . ARG A 1 59  ? 32.954  72.934 29.450  1.00 38.38  ? 59   ARG A C     1 
ATOM   481  O  O     . ARG A 1 59  ? 34.023  73.529 29.555  1.00 40.45  ? 59   ARG A O     1 
ATOM   482  C  CB    . ARG A 1 59  ? 33.344  71.048 27.855  1.00 42.00  ? 59   ARG A CB    1 
ATOM   483  C  CG    . ARG A 1 59  ? 33.164  69.969 28.903  1.00 40.97  ? 59   ARG A CG    1 
ATOM   484  C  CD    . ARG A 1 59  ? 33.904  68.697 28.519  1.00 39.76  ? 59   ARG A CD    1 
ATOM   485  N  NE    . ARG A 1 59  ? 35.341  68.919 28.374  1.00 39.79  ? 59   ARG A NE    1 
ATOM   486  C  CZ    . ARG A 1 59  ? 36.199  68.922 29.388  1.00 43.05  ? 59   ARG A CZ    1 
ATOM   487  N  NH1   . ARG A 1 59  ? 35.764  68.722 30.626  1.00 41.93  ? 59   ARG A NH1   1 
ATOM   488  N  NH2   . ARG A 1 59  ? 37.491  69.129 29.168  1.00 45.54  ? 59   ARG A NH2   1 
ATOM   489  N  N     . LYS A 1 60  ? 32.101  72.798 30.457  1.00 41.09  ? 60   LYS A N     1 
ATOM   490  C  CA    . LYS A 1 60  ? 32.426  73.242 31.802  1.00 47.60  ? 60   LYS A CA    1 
ATOM   491  C  C     . LYS A 1 60  ? 32.719  72.024 32.667  1.00 47.73  ? 60   LYS A C     1 
ATOM   492  O  O     . LYS A 1 60  ? 31.830  71.212 32.921  1.00 43.93  ? 60   LYS A O     1 
ATOM   493  C  CB    . LYS A 1 60  ? 31.250  74.012 32.403  1.00 53.71  ? 60   LYS A CB    1 
ATOM   494  C  CG    . LYS A 1 60  ? 30.786  75.204 31.582  1.00 59.53  ? 60   LYS A CG    1 
ATOM   495  C  CD    . LYS A 1 60  ? 31.332  76.506 32.141  1.00 62.76  ? 60   LYS A CD    1 
ATOM   496  C  CE    . LYS A 1 60  ? 30.906  76.710 33.588  1.00 63.12  ? 60   LYS A CE    1 
ATOM   497  N  NZ    . LYS A 1 60  ? 31.457  77.974 34.154  1.00 68.04  ? 60   LYS A NZ    1 
ATOM   498  N  N     . LEU A 1 61  ? 33.963  71.886 33.114  1.00 50.75  ? 61   LEU A N     1 
ATOM   499  C  CA    . LEU A 1 61  ? 34.292  70.818 34.051  1.00 52.19  ? 61   LEU A CA    1 
ATOM   500  C  C     . LEU A 1 61  ? 34.099  71.320 35.475  1.00 51.10  ? 61   LEU A C     1 
ATOM   501  O  O     . LEU A 1 61  ? 34.521  72.425 35.816  1.00 49.28  ? 61   LEU A O     1 
ATOM   502  C  CB    . LEU A 1 61  ? 35.726  70.321 33.858  1.00 56.12  ? 61   LEU A CB    1 
ATOM   503  C  CG    . LEU A 1 61  ? 36.078  69.085 34.695  1.00 57.00  ? 61   LEU A CG    1 
ATOM   504  C  CD1   . LEU A 1 61  ? 35.389  67.848 34.137  1.00 52.93  ? 61   LEU A CD1   1 
ATOM   505  C  CD2   . LEU A 1 61  ? 37.583  68.877 34.785  1.00 60.79  ? 61   LEU A CD2   1 
ATOM   506  N  N     . PHE A 1 62  ? 33.456  70.504 36.302  1.00 49.70  ? 62   PHE A N     1 
ATOM   507  C  CA    . PHE A 1 62  ? 33.187  70.879 37.683  1.00 48.24  ? 62   PHE A CA    1 
ATOM   508  C  C     . PHE A 1 62  ? 34.007  70.033 38.651  1.00 50.38  ? 62   PHE A C     1 
ATOM   509  O  O     . PHE A 1 62  ? 34.312  68.873 38.369  1.00 51.63  ? 62   PHE A O     1 
ATOM   510  C  CB    . PHE A 1 62  ? 31.691  70.758 37.980  1.00 43.50  ? 62   PHE A CB    1 
ATOM   511  C  CG    . PHE A 1 62  ? 30.834  71.644 37.118  1.00 43.22  ? 62   PHE A CG    1 
ATOM   512  C  CD1   . PHE A 1 62  ? 30.302  71.175 35.927  1.00 40.76  ? 62   PHE A CD1   1 
ATOM   513  C  CD2   . PHE A 1 62  ? 30.575  72.953 37.492  1.00 42.19  ? 62   PHE A CD2   1 
ATOM   514  C  CE1   . PHE A 1 62  ? 29.522  71.992 35.131  1.00 40.07  ? 62   PHE A CE1   1 
ATOM   515  C  CE2   . PHE A 1 62  ? 29.798  73.774 36.700  1.00 43.12  ? 62   PHE A CE2   1 
ATOM   516  C  CZ    . PHE A 1 62  ? 29.269  73.293 35.519  1.00 41.03  ? 62   PHE A CZ    1 
ATOM   517  N  N     . ALA A 1 63  ? 34.367  70.622 39.787  1.00 50.61  ? 63   ALA A N     1 
ATOM   518  C  CA    . ALA A 1 63  ? 35.173  69.933 40.790  1.00 53.63  ? 63   ALA A CA    1 
ATOM   519  C  C     . ALA A 1 63  ? 34.398  68.792 41.440  1.00 54.35  ? 63   ALA A C     1 
ATOM   520  O  O     . ALA A 1 63  ? 34.985  67.821 41.919  1.00 55.63  ? 63   ALA A O     1 
ATOM   521  C  CB    . ALA A 1 63  ? 35.660  70.916 41.845  1.00 56.33  ? 63   ALA A CB    1 
ATOM   522  N  N     . ASN A 1 64  ? 33.075  68.920 41.452  1.00 51.42  ? 64   ASN A N     1 
ATOM   523  C  CA    . ASN A 1 64  ? 32.202  67.896 42.010  1.00 46.96  ? 64   ASN A CA    1 
ATOM   524  C  C     . ASN A 1 64  ? 30.780  68.045 41.484  1.00 45.05  ? 64   ASN A C     1 
ATOM   525  O  O     . ASN A 1 64  ? 30.437  69.064 40.883  1.00 45.21  ? 64   ASN A O     1 
ATOM   526  C  CB    . ASN A 1 64  ? 32.212  67.949 43.539  1.00 48.36  ? 64   ASN A CB    1 
ATOM   527  C  CG    . ASN A 1 64  ? 31.977  69.348 44.073  1.00 51.77  ? 64   ASN A CG    1 
ATOM   528  O  OD1   . ASN A 1 64  ? 30.854  69.850 44.055  1.00 51.38  ? 64   ASN A OD1   1 
ATOM   529  N  ND2   . ASN A 1 64  ? 33.039  69.983 44.555  1.00 53.41  ? 64   ASN A ND2   1 
ATOM   530  N  N     . MET A 1 65  ? 29.956  67.029 41.713  1.00 43.51  ? 65   MET A N     1 
ATOM   531  C  CA    . MET A 1 65  ? 28.597  67.012 41.182  1.00 40.55  ? 65   MET A CA    1 
ATOM   532  C  C     . MET A 1 65  ? 27.705  68.098 41.782  1.00 43.54  ? 65   MET A C     1 
ATOM   533  O  O     . MET A 1 65  ? 26.783  68.584 41.125  1.00 44.76  ? 65   MET A O     1 
ATOM   534  C  CB    . MET A 1 65  ? 27.971  65.626 41.359  1.00 38.03  ? 65   MET A CB    1 
ATOM   535  C  CG    . MET A 1 65  ? 28.587  64.565 40.455  1.00 37.50  ? 65   MET A CG    1 
ATOM   536  S  SD    . MET A 1 65  ? 27.881  62.918 40.671  1.00 39.73  ? 65   MET A SD    1 
ATOM   537  C  CE    . MET A 1 65  ? 28.630  62.412 42.216  1.00 37.60  ? 65   MET A CE    1 
ATOM   538  N  N     . ARG A 1 66  ? 27.985  68.482 43.024  1.00 45.02  ? 66   ARG A N     1 
ATOM   539  C  CA    . ARG A 1 66  ? 27.229  69.542 43.685  1.00 45.50  ? 66   ARG A CA    1 
ATOM   540  C  C     . ARG A 1 66  ? 27.428  70.882 42.984  1.00 45.05  ? 66   ARG A C     1 
ATOM   541  O  O     . ARG A 1 66  ? 26.477  71.638 42.789  1.00 44.18  ? 66   ARG A O     1 
ATOM   542  C  CB    . ARG A 1 66  ? 27.635  69.660 45.154  1.00 49.22  ? 66   ARG A CB    1 
ATOM   543  N  N     . ASP A 1 67  ? 28.671  71.173 42.611  1.00 45.22  ? 67   ASP A N     1 
ATOM   544  C  CA    . ASP A 1 67  ? 28.987  72.409 41.903  1.00 48.37  ? 67   ASP A CA    1 
ATOM   545  C  C     . ASP A 1 67  ? 28.289  72.459 40.548  1.00 49.29  ? 67   ASP A C     1 
ATOM   546  O  O     . ASP A 1 67  ? 27.893  73.527 40.083  1.00 50.63  ? 67   ASP A O     1 
ATOM   547  C  CB    . ASP A 1 67  ? 30.498  72.564 41.722  1.00 49.50  ? 67   ASP A CB    1 
ATOM   548  C  CG    . ASP A 1 67  ? 31.202  72.959 43.006  1.00 53.53  ? 67   ASP A CG    1 
ATOM   549  O  OD1   . ASP A 1 67  ? 30.510  73.342 43.974  1.00 56.49  ? 67   ASP A OD1   1 
ATOM   550  O  OD2   . ASP A 1 67  ? 32.449  72.898 43.043  1.00 54.19  ? 67   ASP A OD2   1 
ATOM   551  N  N     . ALA A 1 68  ? 28.140  71.296 39.921  1.00 45.31  ? 68   ALA A N     1 
ATOM   552  C  CA    . ALA A 1 68  ? 27.459  71.201 38.636  1.00 44.42  ? 68   ALA A CA    1 
ATOM   553  C  C     . ALA A 1 68  ? 25.969  71.488 38.788  1.00 46.48  ? 68   ALA A C     1 
ATOM   554  O  O     . ALA A 1 68  ? 25.380  72.201 37.975  1.00 45.09  ? 68   ALA A O     1 
ATOM   555  C  CB    . ALA A 1 68  ? 27.678  69.833 38.020  1.00 33.88  ? 68   ALA A CB    1 
ATOM   556  N  N     . SER A 1 69  ? 25.367  70.929 39.835  1.00 46.27  ? 69   SER A N     1 
ATOM   557  C  CA    . SER A 1 69  ? 23.952  71.147 40.114  1.00 46.30  ? 69   SER A CA    1 
ATOM   558  C  C     . SER A 1 69  ? 23.673  72.613 40.424  1.00 49.13  ? 69   SER A C     1 
ATOM   559  O  O     . SER A 1 69  ? 22.681  73.178 39.962  1.00 50.85  ? 69   SER A O     1 
ATOM   560  C  CB    . SER A 1 69  ? 23.494  70.274 41.285  1.00 46.73  ? 69   SER A CB    1 
ATOM   561  O  OG    . SER A 1 69  ? 23.637  68.899 40.981  1.00 50.22  ? 69   SER A OG    1 
ATOM   562  N  N     . GLN A 1 70  ? 24.554  73.223 41.212  1.00 47.37  ? 70   GLN A N     1 
ATOM   563  C  CA    . GLN A 1 70  ? 24.410  74.625 41.585  1.00 49.92  ? 70   GLN A CA    1 
ATOM   564  C  C     . GLN A 1 70  ? 24.565  75.542 40.377  1.00 46.00  ? 70   GLN A C     1 
ATOM   565  O  O     . GLN A 1 70  ? 23.955  76.609 40.316  1.00 46.85  ? 70   GLN A O     1 
ATOM   566  C  CB    . GLN A 1 70  ? 25.421  75.000 42.670  1.00 55.03  ? 70   GLN A CB    1 
ATOM   567  C  CG    . GLN A 1 70  ? 25.166  74.330 44.011  1.00 63.63  ? 70   GLN A CG    1 
ATOM   568  C  CD    . GLN A 1 70  ? 26.290  74.559 45.005  1.00 74.53  ? 70   GLN A CD    1 
ATOM   569  O  OE1   . GLN A 1 70  ? 27.299  75.191 44.687  1.00 77.91  ? 70   GLN A OE1   1 
ATOM   570  N  NE2   . GLN A 1 70  ? 26.122  74.041 46.218  1.00 77.50  ? 70   GLN A NE2   1 
ATOM   571  N  N     . TRP A 1 71  ? 25.383  75.121 39.417  1.00 41.39  ? 71   TRP A N     1 
ATOM   572  C  CA    . TRP A 1 71  ? 25.585  75.894 38.195  1.00 39.91  ? 71   TRP A CA    1 
ATOM   573  C  C     . TRP A 1 71  ? 24.320  75.886 37.347  1.00 41.00  ? 71   TRP A C     1 
ATOM   574  O  O     . TRP A 1 71  ? 23.952  76.901 36.757  1.00 42.81  ? 71   TRP A O     1 
ATOM   575  C  CB    . TRP A 1 71  ? 26.764  75.344 37.392  1.00 37.56  ? 71   TRP A CB    1 
ATOM   576  C  CG    . TRP A 1 71  ? 27.020  76.080 36.110  1.00 38.34  ? 71   TRP A CG    1 
ATOM   577  C  CD1   . TRP A 1 71  ? 27.652  77.284 35.966  1.00 39.99  ? 71   TRP A CD1   1 
ATOM   578  C  CD2   . TRP A 1 71  ? 26.658  75.657 34.789  1.00 36.34  ? 71   TRP A CD2   1 
ATOM   579  N  NE1   . TRP A 1 71  ? 27.702  77.637 34.638  1.00 39.04  ? 71   TRP A NE1   1 
ATOM   580  C  CE2   . TRP A 1 71  ? 27.100  76.655 33.895  1.00 39.52  ? 71   TRP A CE2   1 
ATOM   581  C  CE3   . TRP A 1 71  ? 26.004  74.532 34.276  1.00 37.03  ? 71   TRP A CE3   1 
ATOM   582  C  CZ2   . TRP A 1 71  ? 26.906  76.563 32.517  1.00 35.29  ? 71   TRP A CZ2   1 
ATOM   583  C  CZ3   . TRP A 1 71  ? 25.814  74.441 32.905  1.00 36.85  ? 71   TRP A CZ3   1 
ATOM   584  C  CH2   . TRP A 1 71  ? 26.265  75.451 32.043  1.00 34.05  ? 71   TRP A CH2   1 
ATOM   585  N  N     . ILE A 1 72  ? 23.662  74.731 37.293  1.00 42.28  ? 72   ILE A N     1 
ATOM   586  C  CA    . ILE A 1 72  ? 22.393  74.595 36.588  1.00 42.99  ? 72   ILE A CA    1 
ATOM   587  C  C     . ILE A 1 72  ? 21.371  75.578 37.148  1.00 45.22  ? 72   ILE A C     1 
ATOM   588  O  O     . ILE A 1 72  ? 20.677  76.264 36.397  1.00 45.76  ? 72   ILE A O     1 
ATOM   589  C  CB    . ILE A 1 72  ? 21.837  73.164 36.708  1.00 40.73  ? 72   ILE A CB    1 
ATOM   590  C  CG1   . ILE A 1 72  ? 22.727  72.182 35.946  1.00 41.53  ? 72   ILE A CG1   1 
ATOM   591  C  CG2   . ILE A 1 72  ? 20.411  73.092 36.184  1.00 41.02  ? 72   ILE A CG2   1 
ATOM   592  C  CD1   . ILE A 1 72  ? 22.249  70.748 36.011  1.00 40.81  ? 72   ILE A CD1   1 
ATOM   593  N  N     . LYS A 1 73  ? 21.299  75.646 38.474  1.00 46.76  ? 73   LYS A N     1 
ATOM   594  C  CA    . LYS A 1 73  ? 20.375  76.545 39.155  1.00 49.70  ? 73   LYS A CA    1 
ATOM   595  C  C     . LYS A 1 73  ? 20.684  78.006 38.842  1.00 47.20  ? 73   LYS A C     1 
ATOM   596  O  O     . LYS A 1 73  ? 19.776  78.796 38.588  1.00 46.53  ? 73   LYS A O     1 
ATOM   597  C  CB    . LYS A 1 73  ? 20.412  76.306 40.666  1.00 55.89  ? 73   LYS A CB    1 
ATOM   598  C  CG    . LYS A 1 73  ? 19.408  77.130 41.458  1.00 64.60  ? 73   LYS A CG    1 
ATOM   599  C  CD    . LYS A 1 73  ? 20.105  78.153 42.343  1.00 71.87  ? 73   LYS A CD    1 
ATOM   600  C  CE    . LYS A 1 73  ? 19.116  78.867 43.254  1.00 77.31  ? 73   LYS A CE    1 
ATOM   601  N  NZ    . LYS A 1 73  ? 18.110  79.651 42.486  1.00 78.56  ? 73   LYS A NZ    1 
ATOM   602  N  N     . ARG A 1 74  ? 21.965  78.363 38.859  1.00 47.29  ? 74   ARG A N     1 
ATOM   603  C  CA    . ARG A 1 74  ? 22.367  79.732 38.550  1.00 50.45  ? 74   ARG A CA    1 
ATOM   604  C  C     . ARG A 1 74  ? 22.069  80.098 37.100  1.00 49.37  ? 74   ARG A C     1 
ATOM   605  O  O     . ARG A 1 74  ? 21.636  81.214 36.815  1.00 49.55  ? 74   ARG A O     1 
ATOM   606  C  CB    . ARG A 1 74  ? 23.846  79.967 38.871  1.00 52.46  ? 74   ARG A CB    1 
ATOM   607  C  CG    . ARG A 1 74  ? 24.130  80.172 40.352  1.00 55.42  ? 74   ARG A CG    1 
ATOM   608  C  CD    . ARG A 1 74  ? 25.488  80.818 40.575  1.00 56.17  ? 74   ARG A CD    1 
ATOM   609  N  NE    . ARG A 1 74  ? 26.568  80.045 39.970  1.00 55.79  ? 74   ARG A NE    1 
ATOM   610  C  CZ    . ARG A 1 74  ? 27.158  79.006 40.552  1.00 55.47  ? 74   ARG A CZ    1 
ATOM   611  N  NH1   . ARG A 1 74  ? 26.771  78.611 41.758  1.00 57.65  ? 74   ARG A NH1   1 
ATOM   612  N  NH2   . ARG A 1 74  ? 28.134  78.360 39.928  1.00 51.56  ? 74   ARG A NH2   1 
ATOM   613  N  N     . MET A 1 75  ? 22.298  79.155 36.191  1.00 40.30  ? 75   MET A N     1 
ATOM   614  C  CA    . MET A 1 75  ? 21.996  79.368 34.779  1.00 41.14  ? 75   MET A CA    1 
ATOM   615  C  C     . MET A 1 75  ? 20.502  79.592 34.571  1.00 42.53  ? 75   MET A C     1 
ATOM   616  O  O     . MET A 1 75  ? 20.094  80.333 33.677  1.00 40.62  ? 75   MET A O     1 
ATOM   617  C  CB    . MET A 1 75  ? 22.482  78.187 33.936  1.00 41.58  ? 75   MET A CB    1 
ATOM   618  C  CG    . MET A 1 75  ? 23.993  78.138 33.767  1.00 38.99  ? 75   MET A CG    1 
ATOM   619  S  SD    . MET A 1 75  ? 24.616  79.446 32.692  1.00 42.99  ? 75   MET A SD    1 
ATOM   620  C  CE    . MET A 1 75  ? 24.190  78.789 31.080  1.00 36.38  ? 75   MET A CE    1 
ATOM   621  N  N     . GLU A 1 76  ? 19.692  78.950 35.406  1.00 42.75  ? 76   GLU A N     1 
ATOM   622  C  CA    . GLU A 1 76  ? 18.252  79.165 35.384  1.00 46.26  ? 76   GLU A CA    1 
ATOM   623  C  C     . GLU A 1 76  ? 17.927  80.571 35.879  1.00 48.02  ? 76   GLU A C     1 
ATOM   624  O  O     . GLU A 1 76  ? 17.073  81.253 35.315  1.00 46.32  ? 76   GLU A O     1 
ATOM   625  C  CB    . GLU A 1 76  ? 17.536  78.122 36.244  1.00 49.71  ? 76   GLU A CB    1 
ATOM   626  C  CG    . GLU A 1 76  ? 16.029  78.316 36.325  1.00 59.33  ? 76   GLU A CG    1 
ATOM   627  C  CD    . GLU A 1 76  ? 15.357  77.299 37.228  1.00 65.91  ? 76   GLU A CD    1 
ATOM   628  O  OE1   . GLU A 1 76  ? 14.230  77.568 37.694  1.00 71.11  ? 76   GLU A OE1   1 
ATOM   629  O  OE2   . GLU A 1 76  ? 15.954  76.229 37.468  1.00 68.71  ? 76   GLU A OE2   1 
ATOM   630  N  N     . ASP A 1 77  ? 18.623  80.999 36.929  1.00 49.97  ? 77   ASP A N     1 
ATOM   631  C  CA    . ASP A 1 77  ? 18.430  82.332 37.493  1.00 57.61  ? 77   ASP A CA    1 
ATOM   632  C  C     . ASP A 1 77  ? 18.847  83.423 36.510  1.00 59.03  ? 77   ASP A C     1 
ATOM   633  O  O     . ASP A 1 77  ? 18.391  84.561 36.607  1.00 64.59  ? 77   ASP A O     1 
ATOM   634  C  CB    . ASP A 1 77  ? 19.208  82.485 38.803  1.00 60.75  ? 77   ASP A CB    1 
ATOM   635  C  CG    . ASP A 1 77  ? 18.691  81.576 39.901  1.00 64.31  ? 77   ASP A CG    1 
ATOM   636  O  OD1   . ASP A 1 77  ? 17.543  81.096 39.786  1.00 64.13  ? 77   ASP A OD1   1 
ATOM   637  O  OD2   . ASP A 1 77  ? 19.431  81.346 40.882  1.00 66.37  ? 77   ASP A OD2   1 
ATOM   638  N  N     . ILE A 1 78  ? 19.719  83.070 35.571  1.00 54.45  ? 78   ILE A N     1 
ATOM   639  C  CA    . ILE A 1 78  ? 20.166  84.005 34.543  1.00 51.62  ? 78   ILE A CA    1 
ATOM   640  C  C     . ILE A 1 78  ? 19.214  83.982 33.351  1.00 51.89  ? 78   ILE A C     1 
ATOM   641  O  O     . ILE A 1 78  ? 18.938  85.014 32.743  1.00 55.37  ? 78   ILE A O     1 
ATOM   642  C  CB    . ILE A 1 78  ? 21.600  83.681 34.068  1.00 47.90  ? 78   ILE A CB    1 
ATOM   643  C  CG1   . ILE A 1 78  ? 22.582  83.771 35.238  1.00 46.59  ? 78   ILE A CG1   1 
ATOM   644  C  CG2   . ILE A 1 78  ? 22.031  84.624 32.950  1.00 45.83  ? 78   ILE A CG2   1 
ATOM   645  C  CD1   . ILE A 1 78  ? 24.003  83.404 34.873  1.00 43.89  ? 78   ILE A CD1   1 
ATOM   646  N  N     . GLY A 1 79  ? 18.703  82.798 33.028  1.00 50.65  ? 79   GLY A N     1 
ATOM   647  C  CA    . GLY A 1 79  ? 17.795  82.647 31.907  1.00 46.17  ? 79   GLY A CA    1 
ATOM   648  C  C     . GLY A 1 79  ? 18.495  82.108 30.676  1.00 44.82  ? 79   GLY A C     1 
ATOM   649  O  O     . GLY A 1 79  ? 18.126  82.431 29.548  1.00 44.41  ? 79   GLY A O     1 
ATOM   650  N  N     . LEU A 1 80  ? 19.514  81.282 30.895  1.00 42.12  ? 80   LEU A N     1 
ATOM   651  C  CA    . LEU A 1 80  ? 20.256  80.672 29.798  1.00 42.09  ? 80   LEU A CA    1 
ATOM   652  C  C     . LEU A 1 80  ? 20.233  79.154 29.912  1.00 41.60  ? 80   LEU A C     1 
ATOM   653  O  O     . LEU A 1 80  ? 20.186  78.607 31.013  1.00 41.39  ? 80   LEU A O     1 
ATOM   654  C  CB    . LEU A 1 80  ? 21.700  81.171 29.782  1.00 38.77  ? 80   LEU A CB    1 
ATOM   655  C  CG    . LEU A 1 80  ? 21.937  82.620 29.361  1.00 40.08  ? 80   LEU A CG    1 
ATOM   656  C  CD1   . LEU A 1 80  ? 23.379  83.015 29.641  1.00 41.89  ? 80   LEU A CD1   1 
ATOM   657  C  CD2   . LEU A 1 80  ? 21.603  82.810 27.890  1.00 39.94  ? 80   LEU A CD2   1 
ATOM   658  N  N     . GLU A 1 81  ? 20.277  78.480 28.767  1.00 41.14  ? 81   GLU A N     1 
ATOM   659  C  CA    . GLU A 1 81  ? 20.207  77.024 28.734  1.00 39.62  ? 81   GLU A CA    1 
ATOM   660  C  C     . GLU A 1 81  ? 21.468  76.372 29.297  1.00 37.46  ? 81   GLU A C     1 
ATOM   661  O  O     . GLU A 1 81  ? 22.589  76.769 28.969  1.00 34.19  ? 81   GLU A O     1 
ATOM   662  C  CB    . GLU A 1 81  ? 19.953  76.531 27.306  1.00 40.65  ? 81   GLU A CB    1 
ATOM   663  C  CG    . GLU A 1 81  ? 19.804  75.021 27.191  1.00 42.05  ? 81   GLU A CG    1 
ATOM   664  C  CD    . GLU A 1 81  ? 19.509  74.564 25.773  1.00 44.05  ? 81   GLU A CD    1 
ATOM   665  O  OE1   . GLU A 1 81  ? 19.539  75.408 24.853  1.00 45.14  ? 81   GLU A OE1   1 
ATOM   666  O  OE2   . GLU A 1 81  ? 19.246  73.359 25.579  1.00 42.05  ? 81   GLU A OE2   1 
ATOM   667  N  N     . ALA A 1 82  ? 21.272  75.374 30.152  1.00 33.68  ? 82   ALA A N     1 
ATOM   668  C  CA    . ALA A 1 82  ? 22.369  74.563 30.661  1.00 33.50  ? 82   ALA A CA    1 
ATOM   669  C  C     . ALA A 1 82  ? 22.309  73.191 30.003  1.00 32.17  ? 82   ALA A C     1 
ATOM   670  O  O     . ALA A 1 82  ? 21.470  72.364 30.352  1.00 33.08  ? 82   ALA A O     1 
ATOM   671  C  CB    . ALA A 1 82  ? 22.279  74.435 32.172  1.00 36.54  ? 82   ALA A CB    1 
ATOM   672  N  N     . LEU A 1 83  ? 23.201  72.957 29.047  1.00 31.36  ? 83   LEU A N     1 
ATOM   673  C  CA    . LEU A 1 83  ? 23.161  71.744 28.235  1.00 33.60  ? 83   LEU A CA    1 
ATOM   674  C  C     . LEU A 1 83  ? 23.975  70.593 28.832  1.00 35.71  ? 83   LEU A C     1 
ATOM   675  O  O     . LEU A 1 83  ? 24.891  70.811 29.624  1.00 33.71  ? 83   LEU A O     1 
ATOM   676  C  CB    . LEU A 1 83  ? 23.646  72.039 26.813  1.00 31.51  ? 83   LEU A CB    1 
ATOM   677  C  CG    . LEU A 1 83  ? 22.850  73.032 25.960  1.00 35.20  ? 83   LEU A CG    1 
ATOM   678  C  CD1   . LEU A 1 83  ? 23.298  74.470 26.203  1.00 37.00  ? 83   LEU A CD1   1 
ATOM   679  C  CD2   . LEU A 1 83  ? 22.969  72.675 24.486  1.00 37.84  ? 83   LEU A CD2   1 
ATOM   680  N  N     . GLY A 1 84  ? 23.631  69.369 28.440  1.00 33.99  ? 84   GLY A N     1 
ATOM   681  C  CA    . GLY A 1 84  ? 24.348  68.190 28.890  1.00 33.48  ? 84   GLY A CA    1 
ATOM   682  C  C     . GLY A 1 84  ? 23.501  67.255 29.735  1.00 34.28  ? 84   GLY A C     1 
ATOM   683  O  O     . GLY A 1 84  ? 22.389  67.597 30.138  1.00 30.04  ? 84   GLY A O     1 
ATOM   684  N  N     . MET A 1 85  ? 24.033  66.066 30.002  1.00 32.45  ? 85   MET A N     1 
ATOM   685  C  CA    . MET A 1 85  ? 23.347  65.083 30.832  1.00 31.76  ? 85   MET A CA    1 
ATOM   686  C  C     . MET A 1 85  ? 23.345  65.514 32.296  1.00 30.83  ? 85   MET A C     1 
ATOM   687  O  O     . MET A 1 85  ? 24.395  65.569 32.937  1.00 29.47  ? 85   MET A O     1 
ATOM   688  C  CB    . MET A 1 85  ? 24.008  63.711 30.682  1.00 33.59  ? 85   MET A CB    1 
ATOM   689  C  CG    . MET A 1 85  ? 23.468  62.655 31.630  1.00 31.24  ? 85   MET A CG    1 
ATOM   690  S  SD    . MET A 1 85  ? 21.672  62.517 31.560  1.00 35.23  ? 85   MET A SD    1 
ATOM   691  C  CE    . MET A 1 85  ? 21.446  61.958 29.872  1.00 26.98  ? 85   MET A CE    1 
ATOM   692  N  N     . ASP A 1 86  ? 22.162  65.820 32.819  1.00 31.86  ? 86   ASP A N     1 
ATOM   693  C  CA    . ASP A 1 86  ? 22.035  66.307 34.189  1.00 36.48  ? 86   ASP A CA    1 
ATOM   694  C  C     . ASP A 1 86  ? 21.852  65.170 35.194  1.00 37.91  ? 86   ASP A C     1 
ATOM   695  O  O     . ASP A 1 86  ? 21.928  65.384 36.402  1.00 37.23  ? 86   ASP A O     1 
ATOM   696  C  CB    . ASP A 1 86  ? 20.897  67.327 34.301  1.00 39.69  ? 86   ASP A CB    1 
ATOM   697  C  CG    . ASP A 1 86  ? 19.581  66.797 33.766  1.00 46.23  ? 86   ASP A CG    1 
ATOM   698  O  OD1   . ASP A 1 86  ? 18.526  67.153 34.330  1.00 54.57  ? 86   ASP A OD1   1 
ATOM   699  O  OD2   . ASP A 1 86  ? 19.600  66.030 32.781  1.00 42.94  ? 86   ASP A OD2   1 
ATOM   700  N  N     . ASP A 1 87  ? 21.603  63.964 34.691  1.00 36.83  ? 87   ASP A N     1 
ATOM   701  C  CA    . ASP A 1 87  ? 21.615  62.772 35.532  1.00 33.10  ? 87   ASP A CA    1 
ATOM   702  C  C     . ASP A 1 87  ? 23.040  62.236 35.512  1.00 34.19  ? 87   ASP A C     1 
ATOM   703  O  O     . ASP A 1 87  ? 23.431  61.522 34.588  1.00 31.11  ? 87   ASP A O     1 
ATOM   704  C  CB    . ASP A 1 87  ? 20.636  61.721 35.001  1.00 37.14  ? 87   ASP A CB    1 
ATOM   705  C  CG    . ASP A 1 87  ? 20.469  60.529 35.947  1.00 38.78  ? 87   ASP A CG    1 
ATOM   706  O  OD1   . ASP A 1 87  ? 21.333  60.310 36.824  1.00 35.58  ? 87   ASP A OD1   1 
ATOM   707  O  OD2   . ASP A 1 87  ? 19.464  59.802 35.805  1.00 37.63  ? 87   ASP A OD2   1 
ATOM   708  N  N     . PHE A 1 88  ? 23.810  62.587 36.536  1.00 30.62  ? 88   PHE A N     1 
ATOM   709  C  CA    . PHE A 1 88  ? 25.244  62.305 36.558  1.00 32.48  ? 88   PHE A CA    1 
ATOM   710  C  C     . PHE A 1 88  ? 25.590  60.815 36.602  1.00 33.89  ? 88   PHE A C     1 
ATOM   711  O  O     . PHE A 1 88  ? 26.685  60.422 36.197  1.00 36.11  ? 88   PHE A O     1 
ATOM   712  C  CB    . PHE A 1 88  ? 25.909  63.053 37.715  1.00 34.57  ? 88   PHE A CB    1 
ATOM   713  C  CG    . PHE A 1 88  ? 25.687  64.537 37.672  1.00 36.99  ? 88   PHE A CG    1 
ATOM   714  C  CD1   . PHE A 1 88  ? 25.910  65.246 36.503  1.00 35.27  ? 88   PHE A CD1   1 
ATOM   715  C  CD2   . PHE A 1 88  ? 25.227  65.218 38.787  1.00 38.76  ? 88   PHE A CD2   1 
ATOM   716  C  CE1   . PHE A 1 88  ? 25.697  66.611 36.452  1.00 35.84  ? 88   PHE A CE1   1 
ATOM   717  C  CE2   . PHE A 1 88  ? 25.010  66.584 38.741  1.00 38.07  ? 88   PHE A CE2   1 
ATOM   718  C  CZ    . PHE A 1 88  ? 25.246  67.281 37.571  1.00 36.01  ? 88   PHE A CZ    1 
ATOM   719  N  N     . LYS A 1 89  ? 24.662  59.994 37.088  1.00 32.18  ? 89   LYS A N     1 
ATOM   720  C  CA    . LYS A 1 89  ? 24.860  58.546 37.100  1.00 35.01  ? 89   LYS A CA    1 
ATOM   721  C  C     . LYS A 1 89  ? 24.978  58.023 35.675  1.00 32.43  ? 89   LYS A C     1 
ATOM   722  O  O     . LYS A 1 89  ? 25.837  57.196 35.378  1.00 35.40  ? 89   LYS A O     1 
ATOM   723  C  CB    . LYS A 1 89  ? 23.708  57.835 37.818  1.00 37.12  ? 89   LYS A CB    1 
ATOM   724  C  CG    . LYS A 1 89  ? 23.563  58.199 39.287  1.00 42.29  ? 89   LYS A CG    1 
ATOM   725  C  CD    . LYS A 1 89  ? 22.569  57.285 39.991  1.00 42.20  ? 89   LYS A CD    1 
ATOM   726  C  CE    . LYS A 1 89  ? 21.212  57.307 39.311  1.00 41.66  ? 89   LYS A CE    1 
ATOM   727  N  NZ    . LYS A 1 89  ? 20.610  58.668 39.316  1.00 36.24  ? 89   LYS A NZ    1 
ATOM   728  N  N     . LEU A 1 90  ? 24.112  58.518 34.795  1.00 32.12  ? 90   LEU A N     1 
ATOM   729  C  CA    . LEU A 1 90  ? 24.127  58.112 33.393  1.00 30.89  ? 90   LEU A CA    1 
ATOM   730  C  C     . LEU A 1 90  ? 25.393  58.583 32.688  1.00 34.26  ? 90   LEU A C     1 
ATOM   731  O  O     . LEU A 1 90  ? 25.949  57.870 31.849  1.00 36.71  ? 90   LEU A O     1 
ATOM   732  C  CB    . LEU A 1 90  ? 22.892  58.640 32.663  1.00 26.96  ? 90   LEU A CB    1 
ATOM   733  C  CG    . LEU A 1 90  ? 21.543  58.150 33.187  1.00 32.91  ? 90   LEU A CG    1 
ATOM   734  C  CD1   . LEU A 1 90  ? 20.421  58.563 32.242  1.00 34.23  ? 90   LEU A CD1   1 
ATOM   735  C  CD2   . LEU A 1 90  ? 21.558  56.642 33.389  1.00 33.16  ? 90   LEU A CD2   1 
ATOM   736  N  N     . ALA A 1 91  ? 25.840  59.788 33.029  1.00 30.83  ? 91   ALA A N     1 
ATOM   737  C  CA    . ALA A 1 91  ? 27.071  60.333 32.469  1.00 32.77  ? 91   ALA A CA    1 
ATOM   738  C  C     . ALA A 1 91  ? 28.274  59.507 32.915  1.00 35.26  ? 91   ALA A C     1 
ATOM   739  O  O     . ALA A 1 91  ? 29.171  59.221 32.121  1.00 37.36  ? 91   ALA A O     1 
ATOM   740  C  CB    . ALA A 1 91  ? 27.240  61.790 32.879  1.00 31.43  ? 91   ALA A CB    1 
ATOM   741  N  N     . TYR A 1 92  ? 28.280  59.120 34.187  1.00 35.22  ? 92   TYR A N     1 
ATOM   742  C  CA    . TYR A 1 92  ? 29.345  58.285 34.732  1.00 36.76  ? 92   TYR A CA    1 
ATOM   743  C  C     . TYR A 1 92  ? 29.419  56.942 34.013  1.00 33.89  ? 92   TYR A C     1 
ATOM   744  O  O     . TYR A 1 92  ? 30.501  56.489 33.641  1.00 32.63  ? 92   TYR A O     1 
ATOM   745  C  CB    . TYR A 1 92  ? 29.146  58.063 36.235  1.00 40.25  ? 92   TYR A CB    1 
ATOM   746  C  CG    . TYR A 1 92  ? 30.102  57.052 36.832  1.00 39.87  ? 92   TYR A CG    1 
ATOM   747  C  CD1   . TYR A 1 92  ? 29.728  55.722 36.992  1.00 38.13  ? 92   TYR A CD1   1 
ATOM   748  C  CD2   . TYR A 1 92  ? 31.380  57.426 37.228  1.00 40.41  ? 92   TYR A CD2   1 
ATOM   749  C  CE1   . TYR A 1 92  ? 30.598  54.794 37.529  1.00 39.50  ? 92   TYR A CE1   1 
ATOM   750  C  CE2   . TYR A 1 92  ? 32.259  56.503 37.770  1.00 42.37  ? 92   TYR A CE2   1 
ATOM   751  C  CZ    . TYR A 1 92  ? 31.860  55.188 37.917  1.00 42.16  ? 92   TYR A CZ    1 
ATOM   752  O  OH    . TYR A 1 92  ? 32.725  54.263 38.453  1.00 47.72  ? 92   TYR A OH    1 
ATOM   753  N  N     . LEU A 1 93  ? 28.263  56.307 33.832  1.00 36.36  ? 93   LEU A N     1 
ATOM   754  C  CA    . LEU A 1 93  ? 28.192  55.022 33.142  1.00 36.70  ? 93   LEU A CA    1 
ATOM   755  C  C     . LEU A 1 93  ? 28.682  55.136 31.706  1.00 36.55  ? 93   LEU A C     1 
ATOM   756  O  O     . LEU A 1 93  ? 29.389  54.258 31.210  1.00 35.57  ? 93   LEU A O     1 
ATOM   757  C  CB    . LEU A 1 93  ? 26.764  54.474 33.157  1.00 35.44  ? 93   LEU A CB    1 
ATOM   758  C  CG    . LEU A 1 93  ? 26.252  53.920 34.487  1.00 34.26  ? 93   LEU A CG    1 
ATOM   759  C  CD1   . LEU A 1 93  ? 24.855  53.334 34.319  1.00 32.06  ? 93   LEU A CD1   1 
ATOM   760  C  CD2   . LEU A 1 93  ? 27.217  52.877 35.028  1.00 33.35  ? 93   LEU A CD2   1 
ATOM   761  N  N     . SER A 1 94  ? 28.300  56.224 31.045  1.00 36.75  ? 94   SER A N     1 
ATOM   762  C  CA    . SER A 1 94  ? 28.709  56.466 29.669  1.00 38.64  ? 94   SER A CA    1 
ATOM   763  C  C     . SER A 1 94  ? 30.218  56.670 29.567  1.00 41.15  ? 94   SER A C     1 
ATOM   764  O  O     . SER A 1 94  ? 30.847  56.220 28.610  1.00 42.83  ? 94   SER A O     1 
ATOM   765  C  CB    . SER A 1 94  ? 27.973  57.680 29.097  1.00 39.43  ? 94   SER A CB    1 
ATOM   766  O  OG    . SER A 1 94  ? 28.305  57.871 27.733  1.00 39.75  ? 94   SER A OG    1 
ATOM   767  N  N     . ASP A 1 95  ? 30.790  57.351 30.557  1.00 41.71  ? 95   ASP A N     1 
ATOM   768  C  CA    . ASP A 1 95  ? 32.229  57.597 30.598  1.00 42.05  ? 95   ASP A CA    1 
ATOM   769  C  C     . ASP A 1 95  ? 33.003  56.330 30.941  1.00 48.01  ? 95   ASP A C     1 
ATOM   770  O  O     . ASP A 1 95  ? 34.051  56.052 30.359  1.00 49.67  ? 95   ASP A O     1 
ATOM   771  C  CB    . ASP A 1 95  ? 32.568  58.678 31.627  1.00 42.90  ? 95   ASP A CB    1 
ATOM   772  C  CG    . ASP A 1 95  ? 32.230  60.074 31.145  1.00 45.75  ? 95   ASP A CG    1 
ATOM   773  O  OD1   . ASP A 1 95  ? 32.145  60.988 31.991  1.00 43.33  ? 95   ASP A OD1   1 
ATOM   774  O  OD2   . ASP A 1 95  ? 32.047  60.255 29.924  1.00 47.79  ? 95   ASP A OD2   1 
ATOM   775  N  N     . THR A 1 96  ? 32.484  55.571 31.899  1.00 45.66  ? 96   THR A N     1 
ATOM   776  C  CA    . THR A 1 96  ? 33.180  54.390 32.392  1.00 44.89  ? 96   THR A CA    1 
ATOM   777  C  C     . THR A 1 96  ? 33.067  53.229 31.409  1.00 43.45  ? 96   THR A C     1 
ATOM   778  O  O     . THR A 1 96  ? 33.979  52.412 31.293  1.00 42.86  ? 96   THR A O     1 
ATOM   779  C  CB    . THR A 1 96  ? 32.643  53.960 33.772  1.00 41.56  ? 96   THR A CB    1 
ATOM   780  O  OG1   . THR A 1 96  ? 32.578  55.101 34.637  1.00 39.04  ? 96   THR A OG1   1 
ATOM   781  C  CG2   . THR A 1 96  ? 33.546  52.910 34.397  1.00 39.00  ? 96   THR A CG2   1 
ATOM   782  N  N     . TYR A 1 97  ? 31.952  53.169 30.689  1.00 42.79  ? 97   TYR A N     1 
ATOM   783  C  CA    . TYR A 1 97  ? 31.709  52.070 29.760  1.00 43.16  ? 97   TYR A CA    1 
ATOM   784  C  C     . TYR A 1 97  ? 31.484  52.565 28.335  1.00 44.51  ? 97   TYR A C     1 
ATOM   785  O  O     . TYR A 1 97  ? 30.375  52.504 27.806  1.00 41.00  ? 97   TYR A O     1 
ATOM   786  C  CB    . TYR A 1 97  ? 30.546  51.208 30.260  1.00 38.74  ? 97   TYR A CB    1 
ATOM   787  C  CG    . TYR A 1 97  ? 30.829  50.650 31.636  1.00 39.13  ? 97   TYR A CG    1 
ATOM   788  C  CD1   . TYR A 1 97  ? 30.334  51.270 32.777  1.00 32.15  ? 97   TYR A CD1   1 
ATOM   789  C  CD2   . TYR A 1 97  ? 31.638  49.532 31.795  1.00 40.33  ? 97   TYR A CD2   1 
ATOM   790  C  CE1   . TYR A 1 97  ? 30.617  50.773 34.037  1.00 35.63  ? 97   TYR A CE1   1 
ATOM   791  C  CE2   . TYR A 1 97  ? 31.923  49.027 33.047  1.00 40.17  ? 97   TYR A CE2   1 
ATOM   792  C  CZ    . TYR A 1 97  ? 31.413  49.651 34.163  1.00 38.03  ? 97   TYR A CZ    1 
ATOM   793  O  OH    . TYR A 1 97  ? 31.701  49.147 35.408  1.00 39.35  ? 97   TYR A OH    1 
ATOM   794  N  N     . ASN A 1 98  ? 32.560  53.049 27.721  1.00 45.83  ? 98   ASN A N     1 
ATOM   795  C  CA    . ASN A 1 98  ? 32.507  53.621 26.380  1.00 49.06  ? 98   ASN A CA    1 
ATOM   796  C  C     . ASN A 1 98  ? 32.561  52.570 25.274  1.00 48.40  ? 98   ASN A C     1 
ATOM   797  O  O     . ASN A 1 98  ? 33.307  52.709 24.306  1.00 52.35  ? 98   ASN A O     1 
ATOM   798  C  CB    . ASN A 1 98  ? 33.631  54.645 26.197  1.00 59.17  ? 98   ASN A CB    1 
ATOM   799  C  CG    . ASN A 1 98  ? 34.991  54.103 26.608  1.00 70.79  ? 98   ASN A CG    1 
ATOM   800  O  OD1   . ASN A 1 98  ? 35.317  52.944 26.350  1.00 76.71  ? 98   ASN A OD1   1 
ATOM   801  N  ND2   . ASN A 1 98  ? 35.788  54.942 27.259  1.00 75.40  ? 98   ASN A ND2   1 
ATOM   802  N  N     . TYR A 1 99  ? 31.765  51.519 25.428  1.00 46.80  ? 99   TYR A N     1 
ATOM   803  C  CA    . TYR A 1 99  ? 31.707  50.445 24.446  1.00 48.07  ? 99   TYR A CA    1 
ATOM   804  C  C     . TYR A 1 99  ? 30.404  49.679 24.605  1.00 47.20  ? 99   TYR A C     1 
ATOM   805  O  O     . TYR A 1 99  ? 29.684  49.869 25.584  1.00 45.90  ? 99   TYR A O     1 
ATOM   806  C  CB    . TYR A 1 99  ? 32.900  49.498 24.611  1.00 49.26  ? 99   TYR A CB    1 
ATOM   807  C  CG    . TYR A 1 99  ? 33.131  49.030 26.033  1.00 47.24  ? 99   TYR A CG    1 
ATOM   808  C  CD1   . TYR A 1 99  ? 34.002  49.711 26.876  1.00 46.07  ? 99   TYR A CD1   1 
ATOM   809  C  CD2   . TYR A 1 99  ? 32.484  47.905 26.532  1.00 47.09  ? 99   TYR A CD2   1 
ATOM   810  C  CE1   . TYR A 1 99  ? 34.219  49.289 28.174  1.00 45.42  ? 99   TYR A CE1   1 
ATOM   811  C  CE2   . TYR A 1 99  ? 32.695  47.474 27.830  1.00 46.53  ? 99   TYR A CE2   1 
ATOM   812  C  CZ    . TYR A 1 99  ? 33.564  48.169 28.647  1.00 46.45  ? 99   TYR A CZ    1 
ATOM   813  O  OH    . TYR A 1 99  ? 33.781  47.745 29.938  1.00 43.08  ? 99   TYR A OH    1 
ATOM   814  N  N     . GLU A 1 100 ? 30.099  48.816 23.642  1.00 51.11  ? 100  GLU A N     1 
ATOM   815  C  CA    . GLU A 1 100 ? 28.919  47.971 23.744  1.00 51.49  ? 100  GLU A CA    1 
ATOM   816  C  C     . GLU A 1 100 ? 29.121  46.960 24.864  1.00 48.99  ? 100  GLU A C     1 
ATOM   817  O  O     . GLU A 1 100 ? 29.970  46.073 24.770  1.00 50.28  ? 100  GLU A O     1 
ATOM   818  C  CB    . GLU A 1 100 ? 28.639  47.257 22.422  1.00 55.88  ? 100  GLU A CB    1 
ATOM   819  C  CG    . GLU A 1 100 ? 27.387  46.395 22.442  1.00 60.37  ? 100  GLU A CG    1 
ATOM   820  C  CD    . GLU A 1 100 ? 27.119  45.724 21.108  1.00 69.30  ? 100  GLU A CD    1 
ATOM   821  O  OE1   . GLU A 1 100 ? 26.240  44.838 21.054  1.00 70.86  ? 100  GLU A OE1   1 
ATOM   822  O  OE2   . GLU A 1 100 ? 27.787  46.083 20.115  1.00 74.51  ? 100  GLU A OE2   1 
ATOM   823  N  N     . ILE A 1 101 ? 28.346  47.107 25.931  1.00 44.23  ? 101  ILE A N     1 
ATOM   824  C  CA    . ILE A 1 101 ? 28.504  46.252 27.099  1.00 40.95  ? 101  ILE A CA    1 
ATOM   825  C  C     . ILE A 1 101 ? 28.067  44.817 26.836  1.00 47.67  ? 101  ILE A C     1 
ATOM   826  O  O     . ILE A 1 101 ? 26.907  44.552 26.518  1.00 52.24  ? 101  ILE A O     1 
ATOM   827  C  CB    . ILE A 1 101 ? 27.731  46.799 28.310  1.00 37.66  ? 101  ILE A CB    1 
ATOM   828  C  CG1   . ILE A 1 101 ? 28.367  48.101 28.797  1.00 38.37  ? 101  ILE A CG1   1 
ATOM   829  C  CG2   . ILE A 1 101 ? 27.706  45.769 29.434  1.00 36.72  ? 101  ILE A CG2   1 
ATOM   830  C  CD1   . ILE A 1 101 ? 27.625  48.751 29.934  1.00 37.85  ? 101  ILE A CD1   1 
ATOM   831  N  N     . LYS A 1 102 ? 29.013  43.895 26.961  1.00 48.04  ? 102  LYS A N     1 
ATOM   832  C  CA    . LYS A 1 102 ? 28.696  42.477 26.957  1.00 50.30  ? 102  LYS A CA    1 
ATOM   833  C  C     . LYS A 1 102 ? 28.796  41.971 28.388  1.00 46.74  ? 102  LYS A C     1 
ATOM   834  O  O     . LYS A 1 102 ? 29.852  42.056 29.013  1.00 45.04  ? 102  LYS A O     1 
ATOM   835  C  CB    . LYS A 1 102 ? 29.640  41.708 26.034  1.00 55.68  ? 102  LYS A CB    1 
ATOM   836  C  CG    . LYS A 1 102 ? 29.542  42.126 24.575  1.00 63.01  ? 102  LYS A CG    1 
ATOM   837  C  CD    . LYS A 1 102 ? 29.605  40.919 23.652  1.00 70.63  ? 102  LYS A CD    1 
ATOM   838  C  CE    . LYS A 1 102 ? 28.442  39.972 23.911  1.00 70.89  ? 102  LYS A CE    1 
ATOM   839  N  NZ    . LYS A 1 102 ? 28.492  38.771 23.034  1.00 73.89  ? 102  LYS A NZ    1 
ATOM   840  N  N     . TYR A 1 103 ? 27.686  41.467 28.913  1.00 46.28  ? 103  TYR A N     1 
ATOM   841  C  CA    . TYR A 1 103 ? 27.629  41.080 30.316  1.00 42.73  ? 103  TYR A CA    1 
ATOM   842  C  C     . TYR A 1 103 ? 27.534  39.572 30.493  1.00 40.95  ? 103  TYR A C     1 
ATOM   843  O  O     . TYR A 1 103 ? 27.097  38.854 29.594  1.00 38.46  ? 103  TYR A O     1 
ATOM   844  C  CB    . TYR A 1 103 ? 26.460  41.776 31.021  1.00 42.06  ? 103  TYR A CB    1 
ATOM   845  C  CG    . TYR A 1 103 ? 25.088  41.348 30.536  1.00 40.36  ? 103  TYR A CG    1 
ATOM   846  C  CD1   . TYR A 1 103 ? 24.526  41.905 29.393  1.00 37.23  ? 103  TYR A CD1   1 
ATOM   847  C  CD2   . TYR A 1 103 ? 24.351  40.396 31.230  1.00 37.61  ? 103  TYR A CD2   1 
ATOM   848  C  CE1   . TYR A 1 103 ? 23.271  41.519 28.952  1.00 37.82  ? 103  TYR A CE1   1 
ATOM   849  C  CE2   . TYR A 1 103 ? 23.097  40.005 30.798  1.00 37.57  ? 103  TYR A CE2   1 
ATOM   850  C  CZ    . TYR A 1 103 ? 22.562  40.569 29.660  1.00 39.06  ? 103  TYR A CZ    1 
ATOM   851  O  OH    . TYR A 1 103 ? 21.315  40.176 29.232  1.00 42.42  ? 103  TYR A OH    1 
ATOM   852  N  N     . ASP A 1 104 ? 27.958  39.105 31.663  1.00 42.07  ? 104  ASP A N     1 
ATOM   853  C  CA    . ASP A 1 104 ? 27.882  37.697 32.024  1.00 40.81  ? 104  ASP A CA    1 
ATOM   854  C  C     . ASP A 1 104 ? 26.872  37.554 33.157  1.00 41.25  ? 104  ASP A C     1 
ATOM   855  O  O     . ASP A 1 104 ? 27.162  37.914 34.299  1.00 42.26  ? 104  ASP A O     1 
ATOM   856  C  CB    . ASP A 1 104 ? 29.260  37.199 32.476  1.00 42.84  ? 104  ASP A CB    1 
ATOM   857  C  CG    . ASP A 1 104 ? 29.323  35.688 32.630  1.00 45.80  ? 104  ASP A CG    1 
ATOM   858  O  OD1   . ASP A 1 104 ? 28.259  35.041 32.733  1.00 40.87  ? 104  ASP A OD1   1 
ATOM   859  O  OD2   . ASP A 1 104 ? 30.448  35.145 32.656  1.00 52.26  ? 104  ASP A OD2   1 
ATOM   860  N  N     . HIS A 1 105 ? 25.691  37.027 32.842  1.00 39.85  ? 105  HIS A N     1 
ATOM   861  C  CA    . HIS A 1 105 ? 24.605  36.952 33.819  1.00 41.92  ? 105  HIS A CA    1 
ATOM   862  C  C     . HIS A 1 105 ? 24.934  36.036 34.999  1.00 37.76  ? 105  HIS A C     1 
ATOM   863  O  O     . HIS A 1 105 ? 24.430  36.235 36.104  1.00 35.11  ? 105  HIS A O     1 
ATOM   864  C  CB    . HIS A 1 105 ? 23.288  36.525 33.155  1.00 42.49  ? 105  HIS A CB    1 
ATOM   865  C  CG    . HIS A 1 105 ? 23.176  35.053 32.915  1.00 45.72  ? 105  HIS A CG    1 
ATOM   866  N  ND1   . HIS A 1 105 ? 23.554  34.457 31.734  1.00 49.55  ? 105  HIS A ND1   1 
ATOM   867  C  CD2   . HIS A 1 105 ? 22.717  34.051 33.710  1.00 45.63  ? 105  HIS A CD2   1 
ATOM   868  C  CE1   . HIS A 1 105 ? 23.341  33.154 31.807  1.00 49.53  ? 105  HIS A CE1   1 
ATOM   869  N  NE2   . HIS A 1 105 ? 22.835  32.886 32.999  1.00 46.10  ? 105  HIS A NE2   1 
ATOM   870  N  N     . THR A 1 106 ? 25.789  35.044 34.767  1.00 36.45  ? 106  THR A N     1 
ATOM   871  C  CA    . THR A 1 106 ? 26.170  34.108 35.823  1.00 37.58  ? 106  THR A CA    1 
ATOM   872  C  C     . THR A 1 106 ? 26.980  34.792 36.925  1.00 36.76  ? 106  THR A C     1 
ATOM   873  O  O     . THR A 1 106 ? 27.125  34.255 38.024  1.00 36.35  ? 106  THR A O     1 
ATOM   874  C  CB    . THR A 1 106 ? 26.973  32.913 35.271  1.00 41.24  ? 106  THR A CB    1 
ATOM   875  O  OG1   . THR A 1 106 ? 28.237  33.368 34.771  1.00 44.51  ? 106  THR A OG1   1 
ATOM   876  C  CG2   . THR A 1 106 ? 26.201  32.222 34.153  1.00 38.60  ? 106  THR A CG2   1 
ATOM   877  N  N     . LYS A 1 107 ? 27.497  35.980 36.626  1.00 35.83  ? 107  LYS A N     1 
ATOM   878  C  CA    . LYS A 1 107 ? 28.266  36.755 37.593  1.00 37.15  ? 107  LYS A CA    1 
ATOM   879  C  C     . LYS A 1 107 ? 27.374  37.700 38.395  1.00 35.73  ? 107  LYS A C     1 
ATOM   880  O  O     . LYS A 1 107 ? 27.797  38.260 39.407  1.00 37.64  ? 107  LYS A O     1 
ATOM   881  C  CB    . LYS A 1 107 ? 29.352  37.559 36.880  1.00 40.96  ? 107  LYS A CB    1 
ATOM   882  C  CG    . LYS A 1 107 ? 30.336  36.714 36.080  1.00 44.50  ? 107  LYS A CG    1 
ATOM   883  C  CD    . LYS A 1 107 ? 31.185  35.843 36.986  1.00 45.82  ? 107  LYS A CD    1 
ATOM   884  C  CE    . LYS A 1 107 ? 32.265  35.116 36.197  1.00 50.07  ? 107  LYS A CE    1 
ATOM   885  N  NZ    . LYS A 1 107 ? 33.225  34.423 37.095  1.00 51.61  ? 107  LYS A NZ    1 
ATOM   886  N  N     . ILE A 1 108 ? 26.139  37.875 37.937  1.00 32.85  ? 108  ILE A N     1 
ATOM   887  C  CA    . ILE A 1 108 ? 25.211  38.806 38.571  1.00 33.93  ? 108  ILE A CA    1 
ATOM   888  C  C     . ILE A 1 108 ? 24.371  38.106 39.632  1.00 34.56  ? 108  ILE A C     1 
ATOM   889  O  O     . ILE A 1 108 ? 23.620  37.180 39.325  1.00 34.98  ? 108  ILE A O     1 
ATOM   890  C  CB    . ILE A 1 108 ? 24.274  39.449 37.535  1.00 34.16  ? 108  ILE A CB    1 
ATOM   891  C  CG1   . ILE A 1 108 ? 25.089  40.070 36.397  1.00 34.49  ? 108  ILE A CG1   1 
ATOM   892  C  CG2   . ILE A 1 108 ? 23.368  40.487 38.196  1.00 33.49  ? 108  ILE A CG2   1 
ATOM   893  C  CD1   . ILE A 1 108 ? 24.246  40.758 35.345  1.00 30.92  ? 108  ILE A CD1   1 
ATOM   894  N  N     . ARG A 1 109 ? 24.496  38.549 40.879  1.00 28.45  ? 109  ARG A N     1 
ATOM   895  C  CA    . ARG A 1 109 ? 23.758  37.926 41.971  1.00 29.16  ? 109  ARG A CA    1 
ATOM   896  C  C     . ARG A 1 109 ? 22.284  38.325 41.943  1.00 32.10  ? 109  ARG A C     1 
ATOM   897  O  O     . ARG A 1 109 ? 21.921  39.435 42.328  1.00 29.14  ? 109  ARG A O     1 
ATOM   898  C  CB    . ARG A 1 109 ? 24.383  38.276 43.324  1.00 29.53  ? 109  ARG A CB    1 
ATOM   899  C  CG    . ARG A 1 109 ? 23.913  37.378 44.460  1.00 33.46  ? 109  ARG A CG    1 
ATOM   900  C  CD    . ARG A 1 109 ? 24.656  37.663 45.758  1.00 34.70  ? 109  ARG A CD    1 
ATOM   901  N  NE    . ARG A 1 109 ? 26.097  37.461 45.626  1.00 36.13  ? 109  ARG A NE    1 
ATOM   902  C  CZ    . ARG A 1 109 ? 26.713  36.295 45.801  1.00 35.83  ? 109  ARG A CZ    1 
ATOM   903  N  NH1   . ARG A 1 109 ? 26.017  35.207 46.116  1.00 31.24  ? 109  ARG A NH1   1 
ATOM   904  N  NH2   . ARG A 1 109 ? 28.028  36.214 45.654  1.00 34.02  ? 109  ARG A NH2   1 
ATOM   905  N  N     . VAL A 1 110 ? 21.440  37.413 41.475  1.00 33.90  ? 110  VAL A N     1 
ATOM   906  C  CA    . VAL A 1 110 ? 20.004  37.648 41.449  1.00 29.72  ? 110  VAL A CA    1 
ATOM   907  C  C     . VAL A 1 110 ? 19.347  36.912 42.608  1.00 32.71  ? 110  VAL A C     1 
ATOM   908  O  O     . VAL A 1 110 ? 19.428  35.687 42.701  1.00 31.75  ? 110  VAL A O     1 
ATOM   909  C  CB    . VAL A 1 110 ? 19.378  37.174 40.132  1.00 32.52  ? 110  VAL A CB    1 
ATOM   910  C  CG1   . VAL A 1 110 ? 17.879  37.461 40.118  1.00 30.69  ? 110  VAL A CG1   1 
ATOM   911  C  CG2   . VAL A 1 110 ? 20.071  37.836 38.952  1.00 31.92  ? 110  VAL A CG2   1 
ATOM   912  N  N     . ALA A 1 111 ? 18.704  37.665 43.493  1.00 31.54  ? 111  ALA A N     1 
ATOM   913  C  CA    . ALA A 1 111 ? 18.073  37.075 44.666  1.00 29.38  ? 111  ALA A CA    1 
ATOM   914  C  C     . ALA A 1 111 ? 16.555  37.094 44.569  1.00 30.37  ? 111  ALA A C     1 
ATOM   915  O  O     . ALA A 1 111 ? 15.953  38.131 44.299  1.00 29.41  ? 111  ALA A O     1 
ATOM   916  C  CB    . ALA A 1 111 ? 18.533  37.785 45.934  1.00 27.62  ? 111  ALA A CB    1 
ATOM   917  N  N     A ASN A 1 112 ? 15.956  35.924 44.765  0.63 31.33  ? 112  ASN A N     1 
ATOM   918  N  N     B ASN A 1 112 ? 15.938  35.938 44.791  0.37 31.22  ? 112  ASN A N     1 
ATOM   919  C  CA    A ASN A 1 112 ? 14.511  35.778 44.859  0.63 31.44  ? 112  ASN A CA    1 
ATOM   920  C  CA    B ASN A 1 112 ? 14.483  35.840 44.829  0.37 31.45  ? 112  ASN A CA    1 
ATOM   921  C  C     A ASN A 1 112 ? 14.151  35.453 46.296  0.63 32.23  ? 112  ASN A C     1 
ATOM   922  C  C     B ASN A 1 112 ? 14.033  35.404 46.217  0.37 32.06  ? 112  ASN A C     1 
ATOM   923  O  O     A ASN A 1 112 ? 14.622  34.457 46.844  0.63 31.27  ? 112  ASN A O     1 
ATOM   924  O  O     B ASN A 1 112 ? 14.328  34.290 46.648  0.37 31.82  ? 112  ASN A O     1 
ATOM   925  C  CB    A ASN A 1 112 ? 14.024  34.638 43.958  0.63 29.54  ? 112  ASN A CB    1 
ATOM   926  C  CB    B ASN A 1 112 ? 13.982  34.848 43.777  0.37 31.24  ? 112  ASN A CB    1 
ATOM   927  C  CG    A ASN A 1 112 ? 13.977  35.023 42.494  0.63 31.14  ? 112  ASN A CG    1 
ATOM   928  C  CG    B ASN A 1 112 ? 12.481  34.926 43.569  0.37 34.34  ? 112  ASN A CG    1 
ATOM   929  O  OD1   A ASN A 1 112 ? 15.006  35.288 41.873  0.63 32.30  ? 112  ASN A OD1   1 
ATOM   930  O  OD1   B ASN A 1 112 ? 11.712  34.197 44.196  0.37 35.84  ? 112  ASN A OD1   1 
ATOM   931  N  ND2   A ASN A 1 112 ? 12.777  35.037 41.928  0.63 29.88  ? 112  ASN A ND2   1 
ATOM   932  N  ND2   B ASN A 1 112 ? 12.056  35.815 42.681  0.37 35.11  ? 112  ASN A ND2   1 
ATOM   933  N  N     . PHE A 1 113 ? 13.325  36.283 46.919  1.00 31.64  ? 113  PHE A N     1 
ATOM   934  C  CA    . PHE A 1 113 ? 12.925  36.001 48.289  1.00 29.28  ? 113  PHE A CA    1 
ATOM   935  C  C     . PHE A 1 113 ? 11.464  36.290 48.609  1.00 26.64  ? 113  PHE A C     1 
ATOM   936  O  O     . PHE A 1 113 ? 10.765  36.991 47.873  1.00 23.16  ? 113  PHE A O     1 
ATOM   937  C  CB    . PHE A 1 113 ? 13.877  36.670 49.295  1.00 33.35  ? 113  PHE A CB    1 
ATOM   938  C  CG    . PHE A 1 113 ? 13.517  38.090 49.645  1.00 34.19  ? 113  PHE A CG    1 
ATOM   939  C  CD1   . PHE A 1 113 ? 13.251  38.441 50.959  1.00 36.78  ? 113  PHE A CD1   1 
ATOM   940  C  CD2   . PHE A 1 113 ? 13.466  39.073 48.672  1.00 33.42  ? 113  PHE A CD2   1 
ATOM   941  C  CE1   . PHE A 1 113 ? 12.931  39.746 51.298  1.00 37.05  ? 113  PHE A CE1   1 
ATOM   942  C  CE2   . PHE A 1 113 ? 13.144  40.381 49.002  1.00 35.56  ? 113  PHE A CE2   1 
ATOM   943  C  CZ    . PHE A 1 113 ? 12.875  40.716 50.318  1.00 35.84  ? 113  PHE A CZ    1 
ATOM   944  N  N     . ASP A 1 114 ? 11.017  35.713 49.717  1.00 25.88  ? 114  ASP A N     1 
ATOM   945  C  CA    . ASP A 1 114 ? 9.643   35.824 50.164  1.00 24.96  ? 114  ASP A CA    1 
ATOM   946  C  C     . ASP A 1 114 ? 9.637   35.601 51.668  1.00 29.29  ? 114  ASP A C     1 
ATOM   947  O  O     . ASP A 1 114 ? 10.358  34.740 52.175  1.00 27.39  ? 114  ASP A O     1 
ATOM   948  C  CB    . ASP A 1 114 ? 8.778   34.772 49.469  1.00 27.11  ? 114  ASP A CB    1 
ATOM   949  C  CG    . ASP A 1 114 ? 7.299   34.931 49.775  1.00 35.31  ? 114  ASP A CG    1 
ATOM   950  O  OD1   . ASP A 1 114 ? 6.685   35.887 49.257  1.00 37.38  ? 114  ASP A OD1   1 
ATOM   951  O  OD2   . ASP A 1 114 ? 6.747   34.095 50.523  1.00 38.22  ? 114  ASP A OD2   1 
ATOM   952  N  N     . ILE A 1 115 ? 8.842   36.388 52.382  1.00 29.18  ? 115  ILE A N     1 
ATOM   953  C  CA    . ILE A 1 115 ? 8.765   36.262 53.830  1.00 28.27  ? 115  ILE A CA    1 
ATOM   954  C  C     . ILE A 1 115 ? 7.361   35.867 54.252  1.00 32.00  ? 115  ILE A C     1 
ATOM   955  O  O     . ILE A 1 115 ? 6.399   36.065 53.510  1.00 33.57  ? 115  ILE A O     1 
ATOM   956  C  CB    . ILE A 1 115 ? 9.156   37.572 54.548  1.00 29.33  ? 115  ILE A CB    1 
ATOM   957  C  CG1   . ILE A 1 115 ? 8.030   38.605 54.450  1.00 27.70  ? 115  ILE A CG1   1 
ATOM   958  C  CG2   . ILE A 1 115 ? 10.450  38.131 53.979  1.00 29.69  ? 115  ILE A CG2   1 
ATOM   959  C  CD1   . ILE A 1 115 ? 8.320   39.895 55.199  1.00 30.70  ? 115  ILE A CD1   1 
ATOM   960  N  N     . GLU A 1 116 ? 7.248   35.292 55.442  1.00 31.02  ? 116  GLU A N     1 
ATOM   961  C  CA    . GLU A 1 116 ? 5.943   34.999 56.009  1.00 34.09  ? 116  GLU A CA    1 
ATOM   962  C  C     . GLU A 1 116 ? 5.799   35.744 57.328  1.00 34.53  ? 116  GLU A C     1 
ATOM   963  O  O     . GLU A 1 116 ? 6.761   35.865 58.090  1.00 32.81  ? 116  GLU A O     1 
ATOM   964  C  CB    . GLU A 1 116 ? 5.755   33.494 56.205  1.00 35.00  ? 116  GLU A CB    1 
ATOM   965  C  CG    . GLU A 1 116 ? 5.809   32.677 54.912  1.00 38.88  ? 116  GLU A CG    1 
ATOM   966  C  CD    . GLU A 1 116 ? 4.688   33.018 53.939  1.00 41.56  ? 116  GLU A CD    1 
ATOM   967  O  OE1   . GLU A 1 116 ? 3.599   33.428 54.391  1.00 43.77  ? 116  GLU A OE1   1 
ATOM   968  O  OE2   . GLU A 1 116 ? 4.894   32.875 52.716  1.00 46.68  ? 116  GLU A OE2   1 
ATOM   969  N  N     . VAL A 1 117 ? 4.604   36.269 57.575  1.00 31.37  ? 117  VAL A N     1 
ATOM   970  C  CA    . VAL A 1 117 ? 4.320   37.005 58.802  1.00 31.75  ? 117  VAL A CA    1 
ATOM   971  C  C     . VAL A 1 117 ? 2.943   36.621 59.329  1.00 34.75  ? 117  VAL A C     1 
ATOM   972  O  O     . VAL A 1 117 ? 1.925   36.940 58.711  1.00 33.53  ? 117  VAL A O     1 
ATOM   973  C  CB    . VAL A 1 117 ? 4.347   38.537 58.575  1.00 33.90  ? 117  VAL A CB    1 
ATOM   974  C  CG1   . VAL A 1 117 ? 3.983   39.272 59.855  1.00 31.98  ? 117  VAL A CG1   1 
ATOM   975  C  CG2   . VAL A 1 117 ? 5.712   38.992 58.072  1.00 32.58  ? 117  VAL A CG2   1 
ATOM   976  N  N     . THR A 1 118 ? 2.909   35.931 60.464  1.00 36.21  ? 118  THR A N     1 
ATOM   977  C  CA    . THR A 1 118 ? 1.641   35.582 61.095  1.00 34.28  ? 118  THR A CA    1 
ATOM   978  C  C     . THR A 1 118 ? 1.052   36.804 61.785  1.00 40.75  ? 118  THR A C     1 
ATOM   979  O  O     . THR A 1 118 ? 1.731   37.479 62.558  1.00 41.05  ? 118  THR A O     1 
ATOM   980  C  CB    . THR A 1 118 ? 1.798   34.439 62.121  1.00 35.58  ? 118  THR A CB    1 
ATOM   981  O  OG1   . THR A 1 118 ? 2.129   33.223 61.439  1.00 38.20  ? 118  THR A OG1   1 
ATOM   982  C  CG2   . THR A 1 118 ? 0.504   34.232 62.895  1.00 37.45  ? 118  THR A CG2   1 
ATOM   983  N  N     . SER A 1 119 ? -0.211  37.093 61.491  1.00 44.74  ? 119  SER A N     1 
ATOM   984  C  CA    . SER A 1 119 ? -0.894  38.225 62.098  1.00 51.62  ? 119  SER A CA    1 
ATOM   985  C  C     . SER A 1 119 ? -2.339  37.875 62.434  1.00 59.88  ? 119  SER A C     1 
ATOM   986  O  O     . SER A 1 119 ? -3.138  37.592 61.542  1.00 62.23  ? 119  SER A O     1 
ATOM   987  C  CB    . SER A 1 119 ? -0.847  39.437 61.170  1.00 53.42  ? 119  SER A CB    1 
ATOM   988  O  OG    . SER A 1 119 ? -1.636  40.498 61.680  1.00 59.36  ? 119  SER A OG    1 
ATOM   989  N  N     . PRO A 1 120 ? -2.675  37.886 63.732  1.00 63.61  ? 120  PRO A N     1 
ATOM   990  C  CA    . PRO A 1 120 ? -4.033  37.573 64.191  1.00 68.53  ? 120  PRO A CA    1 
ATOM   991  C  C     . PRO A 1 120 ? -5.020  38.715 63.953  1.00 72.87  ? 120  PRO A C     1 
ATOM   992  O  O     . PRO A 1 120 ? -6.216  38.460 63.810  1.00 76.44  ? 120  PRO A O     1 
ATOM   993  C  CB    . PRO A 1 120 ? -3.845  37.343 65.693  1.00 67.50  ? 120  PRO A CB    1 
ATOM   994  C  CG    . PRO A 1 120 ? -2.662  38.169 66.049  1.00 67.31  ? 120  PRO A CG    1 
ATOM   995  C  CD    . PRO A 1 120 ? -1.749  38.116 64.855  1.00 63.60  ? 120  PRO A CD    1 
ATOM   996  N  N     . ASP A 1 121 ? -4.529  39.950 63.906  1.00 71.74  ? 121  ASP A N     1 
ATOM   997  C  CA    . ASP A 1 121 ? -5.409  41.107 63.758  1.00 75.72  ? 121  ASP A CA    1 
ATOM   998  C  C     . ASP A 1 121 ? -5.384  41.711 62.352  1.00 71.36  ? 121  ASP A C     1 
ATOM   999  O  O     . ASP A 1 121 ? -5.319  42.929 62.191  1.00 71.34  ? 121  ASP A O     1 
ATOM   1000 C  CB    . ASP A 1 121 ? -5.089  42.176 64.811  1.00 83.11  ? 121  ASP A CB    1 
ATOM   1001 C  CG    . ASP A 1 121 ? -3.701  42.765 64.645  1.00 87.58  ? 121  ASP A CG    1 
ATOM   1002 O  OD1   . ASP A 1 121 ? -2.825  42.072 64.086  1.00 87.56  ? 121  ASP A OD1   1 
ATOM   1003 O  OD2   . ASP A 1 121 ? -3.487  43.921 65.069  1.00 91.10  ? 121  ASP A OD2   1 
ATOM   1004 N  N     . GLY A 1 122 ? -5.445  40.854 61.338  1.00 68.30  ? 122  GLY A N     1 
ATOM   1005 C  CA    . GLY A 1 122 ? -5.532  41.313 59.964  1.00 68.36  ? 122  GLY A CA    1 
ATOM   1006 C  C     . GLY A 1 122 ? -4.195  41.445 59.259  1.00 65.97  ? 122  GLY A C     1 
ATOM   1007 O  O     . GLY A 1 122 ? -3.190  40.893 59.702  1.00 63.42  ? 122  GLY A O     1 
ATOM   1008 N  N     . PHE A 1 123 ? -4.192  42.185 58.153  1.00 65.17  ? 123  PHE A N     1 
ATOM   1009 C  CA    . PHE A 1 123 ? -2.994  42.371 57.337  1.00 62.47  ? 123  PHE A CA    1 
ATOM   1010 C  C     . PHE A 1 123 ? -1.898  43.117 58.096  1.00 58.34  ? 123  PHE A C     1 
ATOM   1011 O  O     . PHE A 1 123 ? -2.153  44.159 58.699  1.00 61.46  ? 123  PHE A O     1 
ATOM   1012 C  CB    . PHE A 1 123 ? -3.353  43.116 56.048  1.00 62.31  ? 123  PHE A CB    1 
ATOM   1013 C  CG    . PHE A 1 123 ? -2.179  43.391 55.152  1.00 59.36  ? 123  PHE A CG    1 
ATOM   1014 C  CD1   . PHE A 1 123 ? -1.693  42.410 54.303  1.00 58.40  ? 123  PHE A CD1   1 
ATOM   1015 C  CD2   . PHE A 1 123 ? -1.576  44.638 55.142  1.00 59.42  ? 123  PHE A CD2   1 
ATOM   1016 C  CE1   . PHE A 1 123 ? -0.615  42.663 53.473  1.00 57.48  ? 123  PHE A CE1   1 
ATOM   1017 C  CE2   . PHE A 1 123 ? -0.500  44.898 54.314  1.00 58.47  ? 123  PHE A CE2   1 
ATOM   1018 C  CZ    . PHE A 1 123 ? -0.019  43.908 53.478  1.00 57.65  ? 123  PHE A CZ    1 
ATOM   1019 N  N     . PRO A 1 124 ? -0.667  42.582 58.063  1.00 53.01  ? 124  PRO A N     1 
ATOM   1020 C  CA    . PRO A 1 124 ? 0.468   43.194 58.761  1.00 48.50  ? 124  PRO A CA    1 
ATOM   1021 C  C     . PRO A 1 124 ? 1.074   44.339 57.957  1.00 43.66  ? 124  PRO A C     1 
ATOM   1022 O  O     . PRO A 1 124 ? 1.871   44.094 57.051  1.00 44.82  ? 124  PRO A O     1 
ATOM   1023 C  CB    . PRO A 1 124 ? 1.479   42.041 58.875  1.00 48.05  ? 124  PRO A CB    1 
ATOM   1024 C  CG    . PRO A 1 124 ? 0.877   40.865 58.120  1.00 49.03  ? 124  PRO A CG    1 
ATOM   1025 C  CD    . PRO A 1 124 ? -0.260  41.388 57.309  1.00 49.30  ? 124  PRO A CD    1 
ATOM   1026 N  N     . GLU A 1 125 ? 0.698   45.570 58.289  1.00 40.05  ? 125  GLU A N     1 
ATOM   1027 C  CA    . GLU A 1 125 ? 1.217   46.743 57.592  1.00 42.21  ? 125  GLU A CA    1 
ATOM   1028 C  C     . GLU A 1 125 ? 2.731   46.853 57.738  1.00 43.21  ? 125  GLU A C     1 
ATOM   1029 O  O     . GLU A 1 125 ? 3.246   46.931 58.854  1.00 42.82  ? 125  GLU A O     1 
ATOM   1030 C  CB    . GLU A 1 125 ? 0.545   48.019 58.104  1.00 49.91  ? 125  GLU A CB    1 
ATOM   1031 C  CG    . GLU A 1 125 ? -0.924  48.148 57.726  1.00 59.29  ? 125  GLU A CG    1 
ATOM   1032 C  CD    . GLU A 1 125 ? -1.141  48.336 56.232  1.00 64.48  ? 125  GLU A CD    1 
ATOM   1033 O  OE1   . GLU A 1 125 ? -0.176  48.689 55.518  1.00 64.07  ? 125  GLU A OE1   1 
ATOM   1034 O  OE2   . GLU A 1 125 ? -2.284  48.134 55.770  1.00 68.07  ? 125  GLU A OE2   1 
ATOM   1035 N  N     . PRO A 1 126 ? 3.450   46.846 56.604  1.00 41.73  ? 126  PRO A N     1 
ATOM   1036 C  CA    . PRO A 1 126 ? 4.916   46.932 56.591  1.00 40.13  ? 126  PRO A CA    1 
ATOM   1037 C  C     . PRO A 1 126 ? 5.461   48.192 57.270  1.00 41.73  ? 126  PRO A C     1 
ATOM   1038 O  O     . PRO A 1 126 ? 6.555   48.150 57.832  1.00 41.33  ? 126  PRO A O     1 
ATOM   1039 C  CB    . PRO A 1 126 ? 5.262   46.925 55.093  1.00 38.96  ? 126  PRO A CB    1 
ATOM   1040 C  CG    . PRO A 1 126 ? 3.975   47.231 54.381  1.00 42.36  ? 126  PRO A CG    1 
ATOM   1041 C  CD    . PRO A 1 126 ? 2.896   46.678 55.251  1.00 41.21  ? 126  PRO A CD    1 
ATOM   1042 N  N     . SER A 1 127 ? 4.712   49.289 57.229  1.00 40.63  ? 127  SER A N     1 
ATOM   1043 C  CA    . SER A 1 127 ? 5.158   50.526 57.861  1.00 45.12  ? 127  SER A CA    1 
ATOM   1044 C  C     . SER A 1 127 ? 5.193   50.390 59.381  1.00 47.78  ? 127  SER A C     1 
ATOM   1045 O  O     . SER A 1 127 ? 5.993   51.042 60.052  1.00 50.60  ? 127  SER A O     1 
ATOM   1046 C  CB    . SER A 1 127 ? 4.260   51.697 57.458  1.00 49.96  ? 127  SER A CB    1 
ATOM   1047 O  OG    . SER A 1 127 ? 2.982   51.591 58.060  1.00 55.34  ? 127  SER A OG    1 
ATOM   1048 N  N     . GLN A 1 128 ? 4.323   49.541 59.919  1.00 48.12  ? 128  GLN A N     1 
ATOM   1049 C  CA    . GLN A 1 128 ? 4.279   49.302 61.357  1.00 51.24  ? 128  GLN A CA    1 
ATOM   1050 C  C     . GLN A 1 128 ? 5.160   48.118 61.741  1.00 48.04  ? 128  GLN A C     1 
ATOM   1051 O  O     . GLN A 1 128 ? 5.922   48.194 62.707  1.00 48.56  ? 128  GLN A O     1 
ATOM   1052 C  CB    . GLN A 1 128 ? 2.839   49.073 61.823  1.00 57.41  ? 128  GLN A CB    1 
ATOM   1053 C  CG    . GLN A 1 128 ? 1.909   50.243 61.541  1.00 63.40  ? 128  GLN A CG    1 
ATOM   1054 C  CD    . GLN A 1 128 ? 2.426   51.545 62.119  1.00 72.78  ? 128  GLN A CD    1 
ATOM   1055 O  OE1   . GLN A 1 128 ? 2.622   52.525 61.397  1.00 76.05  ? 128  GLN A OE1   1 
ATOM   1056 N  NE2   . GLN A 1 128 ? 2.650   51.565 63.429  1.00 76.30  ? 128  GLN A NE2   1 
ATOM   1057 N  N     . ALA A 1 129 ? 5.052   47.037 60.971  1.00 42.48  ? 129  ALA A N     1 
ATOM   1058 C  CA    . ALA A 1 129 ? 5.837   45.822 61.187  1.00 41.20  ? 129  ALA A CA    1 
ATOM   1059 C  C     . ALA A 1 129 ? 5.791   45.349 62.639  1.00 41.09  ? 129  ALA A C     1 
ATOM   1060 O  O     . ALA A 1 129 ? 6.826   45.078 63.247  1.00 46.07  ? 129  ALA A O     1 
ATOM   1061 C  CB    . ALA A 1 129 ? 7.282   46.031 60.734  1.00 37.78  ? 129  ALA A CB    1 
ATOM   1062 N  N     . LYS A 1 130 ? 4.586   45.251 63.188  1.00 37.46  ? 130  LYS A N     1 
ATOM   1063 C  CA    . LYS A 1 130 ? 4.423   44.950 64.606  1.00 41.17  ? 130  LYS A CA    1 
ATOM   1064 C  C     . LYS A 1 130 ? 4.353   43.454 64.905  1.00 37.84  ? 130  LYS A C     1 
ATOM   1065 O  O     . LYS A 1 130 ? 4.289   43.052 66.066  1.00 40.58  ? 130  LYS A O     1 
ATOM   1066 C  CB    . LYS A 1 130 ? 3.192   45.668 65.169  1.00 45.98  ? 130  LYS A CB    1 
ATOM   1067 C  CG    . LYS A 1 130 ? 1.895   45.343 64.452  1.00 48.28  ? 130  LYS A CG    1 
ATOM   1068 C  CD    . LYS A 1 130 ? 0.741   46.159 65.013  1.00 51.26  ? 130  LYS A CD    1 
ATOM   1069 N  N     . HIS A 1 131 ? 4.370   42.634 63.859  1.00 37.74  ? 131  HIS A N     1 
ATOM   1070 C  CA    . HIS A 1 131 ? 4.328   41.185 64.028  1.00 38.94  ? 131  HIS A CA    1 
ATOM   1071 C  C     . HIS A 1 131 ? 5.649   40.549 63.612  1.00 36.34  ? 131  HIS A C     1 
ATOM   1072 O  O     . HIS A 1 131 ? 6.289   41.005 62.666  1.00 34.15  ? 131  HIS A O     1 
ATOM   1073 C  CB    . HIS A 1 131 ? 3.176   40.582 63.226  1.00 40.98  ? 131  HIS A CB    1 
ATOM   1074 C  CG    . HIS A 1 131 ? 1.847   41.202 63.522  1.00 45.82  ? 131  HIS A CG    1 
ATOM   1075 N  ND1   . HIS A 1 131 ? 1.179   40.993 64.710  1.00 50.73  ? 131  HIS A ND1   1 
ATOM   1076 C  CD2   . HIS A 1 131 ? 1.065   42.026 62.789  1.00 46.56  ? 131  HIS A CD2   1 
ATOM   1077 C  CE1   . HIS A 1 131 ? 0.041   41.663 64.693  1.00 52.12  ? 131  HIS A CE1   1 
ATOM   1078 N  NE2   . HIS A 1 131 ? -0.054  42.298 63.540  1.00 50.54  ? 131  HIS A NE2   1 
ATOM   1079 N  N     . PRO A 1 132 ? 6.063   39.493 64.326  1.00 39.34  ? 132  PRO A N     1 
ATOM   1080 C  CA    . PRO A 1 132 ? 7.324   38.804 64.033  1.00 37.45  ? 132  PRO A CA    1 
ATOM   1081 C  C     . PRO A 1 132 ? 7.365   38.211 62.627  1.00 38.26  ? 132  PRO A C     1 
ATOM   1082 O  O     . PRO A 1 132 ? 6.359   37.693 62.141  1.00 39.33  ? 132  PRO A O     1 
ATOM   1083 C  CB    . PRO A 1 132 ? 7.356   37.677 65.070  1.00 36.54  ? 132  PRO A CB    1 
ATOM   1084 C  CG    . PRO A 1 132 ? 6.491   38.159 66.184  1.00 39.72  ? 132  PRO A CG    1 
ATOM   1085 C  CD    . PRO A 1 132 ? 5.404   38.951 65.528  1.00 39.73  ? 132  PRO A CD    1 
ATOM   1086 N  N     . ILE A 1 133 ? 8.520   38.307 61.979  1.00 37.98  ? 133  ILE A N     1 
ATOM   1087 C  CA    . ILE A 1 133 ? 8.764   37.578 60.745  1.00 35.44  ? 133  ILE A CA    1 
ATOM   1088 C  C     . ILE A 1 133 ? 9.135   36.155 61.135  1.00 34.72  ? 133  ILE A C     1 
ATOM   1089 O  O     . ILE A 1 133 ? 10.161  35.934 61.779  1.00 37.10  ? 133  ILE A O     1 
ATOM   1090 C  CB    . ILE A 1 133 ? 9.923   38.197 59.946  1.00 32.50  ? 133  ILE A CB    1 
ATOM   1091 C  CG1   . ILE A 1 133 ? 9.629   39.664 59.632  1.00 31.25  ? 133  ILE A CG1   1 
ATOM   1092 C  CG2   . ILE A 1 133 ? 10.172  37.414 58.664  1.00 30.01  ? 133  ILE A CG2   1 
ATOM   1093 C  CD1   . ILE A 1 133 ? 10.743  40.352 58.887  1.00 32.19  ? 133  ILE A CD1   1 
ATOM   1094 N  N     . ASP A 1 134 ? 8.296   35.192 60.765  1.00 32.27  ? 134  ASP A N     1 
ATOM   1095 C  CA    . ASP A 1 134 ? 8.504   33.815 61.205  1.00 32.68  ? 134  ASP A CA    1 
ATOM   1096 C  C     . ASP A 1 134 ? 8.986   32.861 60.110  1.00 33.02  ? 134  ASP A C     1 
ATOM   1097 O  O     . ASP A 1 134 ? 9.119   31.660 60.344  1.00 35.85  ? 134  ASP A O     1 
ATOM   1098 C  CB    . ASP A 1 134 ? 7.252   33.264 61.901  1.00 34.22  ? 134  ASP A CB    1 
ATOM   1099 C  CG    . ASP A 1 134 ? 5.986   33.489 61.099  1.00 32.08  ? 134  ASP A CG    1 
ATOM   1100 O  OD1   . ASP A 1 134 ? 6.049   33.443 59.854  1.00 31.30  ? 134  ASP A OD1   1 
ATOM   1101 O  OD2   . ASP A 1 134 ? 4.924   33.709 61.722  1.00 33.33  ? 134  ASP A OD2   1 
ATOM   1102 N  N     . ALA A 1 135 ? 9.253   33.398 58.923  1.00 31.54  ? 135  ALA A N     1 
ATOM   1103 C  CA    . ALA A 1 135 ? 9.847   32.610 57.846  1.00 33.29  ? 135  ALA A CA    1 
ATOM   1104 C  C     . ALA A 1 135 ? 10.416  33.496 56.746  1.00 35.14  ? 135  ALA A C     1 
ATOM   1105 O  O     . ALA A 1 135 ? 9.789   34.472 56.334  1.00 34.23  ? 135  ALA A O     1 
ATOM   1106 C  CB    . ALA A 1 135 ? 8.824   31.632 57.259  1.00 27.65  ? 135  ALA A CB    1 
ATOM   1107 N  N     . ILE A 1 136 ? 11.616  33.158 56.285  1.00 34.95  ? 136  ILE A N     1 
ATOM   1108 C  CA    . ILE A 1 136 ? 12.183  33.774 55.093  1.00 32.75  ? 136  ILE A CA    1 
ATOM   1109 C  C     . ILE A 1 136 ? 12.820  32.707 54.216  1.00 32.85  ? 136  ILE A C     1 
ATOM   1110 O  O     . ILE A 1 136 ? 13.669  31.944 54.676  1.00 33.79  ? 136  ILE A O     1 
ATOM   1111 C  CB    . ILE A 1 136 ? 13.273  34.819 55.421  1.00 31.53  ? 136  ILE A CB    1 
ATOM   1112 C  CG1   . ILE A 1 136 ? 12.769  35.854 56.426  1.00 32.20  ? 136  ILE A CG1   1 
ATOM   1113 C  CG2   . ILE A 1 136 ? 13.754  35.498 54.140  1.00 27.50  ? 136  ILE A CG2   1 
ATOM   1114 C  CD1   . ILE A 1 136 ? 13.810  36.887 56.800  1.00 32.94  ? 136  ILE A CD1   1 
ATOM   1115 N  N     . THR A 1 137 ? 12.405  32.648 52.956  1.00 33.85  ? 137  THR A N     1 
ATOM   1116 C  CA    . THR A 1 137 ? 13.109  31.839 51.969  1.00 30.18  ? 137  THR A CA    1 
ATOM   1117 C  C     . THR A 1 137 ? 13.784  32.760 50.959  1.00 27.78  ? 137  THR A C     1 
ATOM   1118 O  O     . THR A 1 137 ? 13.140  33.620 50.360  1.00 30.03  ? 137  THR A O     1 
ATOM   1119 C  CB    . THR A 1 137 ? 12.179  30.846 51.251  1.00 30.44  ? 137  THR A CB    1 
ATOM   1120 O  OG1   . THR A 1 137 ? 11.660  29.908 52.202  1.00 32.42  ? 137  THR A OG1   1 
ATOM   1121 C  CG2   . THR A 1 137 ? 12.944  30.083 50.179  1.00 29.38  ? 137  THR A CG2   1 
ATOM   1122 N  N     . HIS A 1 138 ? 15.086  32.577 50.786  1.00 26.98  ? 138  HIS A N     1 
ATOM   1123 C  CA    . HIS A 1 138 ? 15.891  33.464 49.958  1.00 29.13  ? 138  HIS A CA    1 
ATOM   1124 C  C     . HIS A 1 138 ? 16.713  32.632 48.980  1.00 28.09  ? 138  HIS A C     1 
ATOM   1125 O  O     . HIS A 1 138 ? 17.644  31.936 49.379  1.00 27.42  ? 138  HIS A O     1 
ATOM   1126 C  CB    . HIS A 1 138 ? 16.797  34.301 50.866  1.00 27.38  ? 138  HIS A CB    1 
ATOM   1127 C  CG    . HIS A 1 138 ? 17.697  35.255 50.139  1.00 33.79  ? 138  HIS A CG    1 
ATOM   1128 N  ND1   . HIS A 1 138 ? 17.713  36.607 50.409  1.00 32.26  ? 138  HIS A ND1   1 
ATOM   1129 C  CD2   . HIS A 1 138 ? 18.640  35.051 49.189  1.00 35.45  ? 138  HIS A CD2   1 
ATOM   1130 C  CE1   . HIS A 1 138 ? 18.611  37.196 49.642  1.00 33.54  ? 138  HIS A CE1   1 
ATOM   1131 N  NE2   . HIS A 1 138 ? 19.188  36.276 48.891  1.00 33.45  ? 138  HIS A NE2   1 
ATOM   1132 N  N     . TYR A 1 139 ? 16.359  32.693 47.700  1.00 24.26  ? 139  TYR A N     1 
ATOM   1133 C  CA    . TYR A 1 139 ? 17.108  31.970 46.675  1.00 26.05  ? 139  TYR A CA    1 
ATOM   1134 C  C     . TYR A 1 139 ? 18.211  32.839 46.078  1.00 29.81  ? 139  TYR A C     1 
ATOM   1135 O  O     . TYR A 1 139 ? 17.960  33.965 45.649  1.00 28.44  ? 139  TYR A O     1 
ATOM   1136 C  CB    . TYR A 1 139 ? 16.175  31.474 45.566  1.00 26.79  ? 139  TYR A CB    1 
ATOM   1137 C  CG    . TYR A 1 139 ? 16.907  30.878 44.385  1.00 29.40  ? 139  TYR A CG    1 
ATOM   1138 C  CD1   . TYR A 1 139 ? 17.176  31.640 43.253  1.00 28.73  ? 139  TYR A CD1   1 
ATOM   1139 C  CD2   . TYR A 1 139 ? 17.336  29.556 44.403  1.00 27.00  ? 139  TYR A CD2   1 
ATOM   1140 C  CE1   . TYR A 1 139 ? 17.849  31.105 42.175  1.00 30.68  ? 139  TYR A CE1   1 
ATOM   1141 C  CE2   . TYR A 1 139 ? 18.010  29.010 43.327  1.00 29.86  ? 139  TYR A CE2   1 
ATOM   1142 C  CZ    . TYR A 1 139 ? 18.264  29.790 42.215  1.00 33.08  ? 139  TYR A CZ    1 
ATOM   1143 O  OH    . TYR A 1 139 ? 18.935  29.258 41.138  1.00 33.17  ? 139  TYR A OH    1 
ATOM   1144 N  N     . ASP A 1 140 ? 19.428  32.304 46.053  1.00 29.83  ? 140  ASP A N     1 
ATOM   1145 C  CA    . ASP A 1 140 ? 20.576  32.984 45.462  1.00 30.57  ? 140  ASP A CA    1 
ATOM   1146 C  C     . ASP A 1 140 ? 20.957  32.324 44.135  1.00 31.01  ? 140  ASP A C     1 
ATOM   1147 O  O     . ASP A 1 140 ? 21.211  31.122 44.091  1.00 31.29  ? 140  ASP A O     1 
ATOM   1148 C  CB    . ASP A 1 140 ? 21.763  32.933 46.427  1.00 33.08  ? 140  ASP A CB    1 
ATOM   1149 C  CG    . ASP A 1 140 ? 22.952  33.730 45.935  1.00 36.66  ? 140  ASP A CG    1 
ATOM   1150 O  OD1   . ASP A 1 140 ? 23.680  33.231 45.050  1.00 34.33  ? 140  ASP A OD1   1 
ATOM   1151 O  OD2   . ASP A 1 140 ? 23.162  34.853 46.443  1.00 39.78  ? 140  ASP A OD2   1 
ATOM   1152 N  N     . SER A 1 141 ? 21.013  33.109 43.062  1.00 29.42  ? 141  SER A N     1 
ATOM   1153 C  CA    . SER A 1 141 ? 21.229  32.561 41.721  1.00 28.95  ? 141  SER A CA    1 
ATOM   1154 C  C     . SER A 1 141 ? 22.655  32.067 41.491  1.00 31.42  ? 141  SER A C     1 
ATOM   1155 O  O     . SER A 1 141 ? 22.888  31.199 40.649  1.00 34.18  ? 141  SER A O     1 
ATOM   1156 C  CB    . SER A 1 141 ? 20.877  33.597 40.653  1.00 32.41  ? 141  SER A CB    1 
ATOM   1157 O  OG    . SER A 1 141 ? 21.818  34.656 40.656  1.00 33.02  ? 141  SER A OG    1 
ATOM   1158 N  N     . ILE A 1 142 ? 23.608  32.633 42.223  1.00 32.12  ? 142  ILE A N     1 
ATOM   1159 C  CA    . ILE A 1 142 ? 25.001  32.212 42.113  1.00 34.42  ? 142  ILE A CA    1 
ATOM   1160 C  C     . ILE A 1 142 ? 25.242  30.884 42.837  1.00 36.64  ? 142  ILE A C     1 
ATOM   1161 O  O     . ILE A 1 142 ? 25.886  29.982 42.301  1.00 34.02  ? 142  ILE A O     1 
ATOM   1162 C  CB    . ILE A 1 142 ? 25.961  33.297 42.637  1.00 33.51  ? 142  ILE A CB    1 
ATOM   1163 C  CG1   . ILE A 1 142 ? 25.909  34.526 41.724  1.00 31.68  ? 142  ILE A CG1   1 
ATOM   1164 C  CG2   . ILE A 1 142 ? 27.382  32.761 42.728  1.00 37.03  ? 142  ILE A CG2   1 
ATOM   1165 C  CD1   . ILE A 1 142 ? 26.727  35.693 42.220  1.00 37.47  ? 142  ILE A CD1   1 
ATOM   1166 N  N     . ASP A 1 143 ? 24.709  30.764 44.049  1.00 36.58  ? 143  ASP A N     1 
ATOM   1167 C  CA    . ASP A 1 143 ? 24.806  29.520 44.805  1.00 34.03  ? 143  ASP A CA    1 
ATOM   1168 C  C     . ASP A 1 143 ? 23.837  28.470 44.276  1.00 30.90  ? 143  ASP A C     1 
ATOM   1169 O  O     . ASP A 1 143 ? 24.050  27.274 44.466  1.00 36.52  ? 143  ASP A O     1 
ATOM   1170 C  CB    . ASP A 1 143 ? 24.520  29.764 46.288  1.00 37.64  ? 143  ASP A CB    1 
ATOM   1171 C  CG    . ASP A 1 143 ? 25.546  30.665 46.940  1.00 44.20  ? 143  ASP A CG    1 
ATOM   1172 O  OD1   . ASP A 1 143 ? 26.637  30.851 46.359  1.00 40.73  ? 143  ASP A OD1   1 
ATOM   1173 O  OD2   . ASP A 1 143 ? 25.261  31.184 48.039  1.00 49.44  ? 143  ASP A OD2   1 
ATOM   1174 N  N     . ASP A 1 144 ? 22.773  28.930 43.618  1.00 32.14  ? 144  ASP A N     1 
ATOM   1175 C  CA    . ASP A 1 144 ? 21.678  28.062 43.189  1.00 31.60  ? 144  ASP A CA    1 
ATOM   1176 C  C     . ASP A 1 144 ? 21.136  27.297 44.395  1.00 32.45  ? 144  ASP A C     1 
ATOM   1177 O  O     . ASP A 1 144 ? 20.989  26.075 44.364  1.00 35.04  ? 144  ASP A O     1 
ATOM   1178 C  CB    . ASP A 1 144 ? 22.138  27.105 42.082  1.00 33.10  ? 144  ASP A CB    1 
ATOM   1179 C  CG    . ASP A 1 144 ? 20.986  26.350 41.444  1.00 37.08  ? 144  ASP A CG    1 
ATOM   1180 O  OD1   . ASP A 1 144 ? 19.853  26.880 41.431  1.00 34.35  ? 144  ASP A OD1   1 
ATOM   1181 O  OD2   . ASP A 1 144 ? 21.219  25.223 40.957  1.00 37.45  ? 144  ASP A OD2   1 
ATOM   1182 N  N     . ARG A 1 145 ? 20.859  28.032 45.467  1.00 31.51  ? 145  ARG A N     1 
ATOM   1183 C  CA    . ARG A 1 145 ? 20.418  27.431 46.720  1.00 32.70  ? 145  ARG A CA    1 
ATOM   1184 C  C     . ARG A 1 145 ? 19.263  28.216 47.326  1.00 31.77  ? 145  ARG A C     1 
ATOM   1185 O  O     . ARG A 1 145 ? 19.232  29.443 47.250  1.00 30.48  ? 145  ARG A O     1 
ATOM   1186 C  CB    . ARG A 1 145 ? 21.574  27.383 47.722  1.00 27.27  ? 145  ARG A CB    1 
ATOM   1187 C  CG    . ARG A 1 145 ? 22.698  26.434 47.346  1.00 31.81  ? 145  ARG A CG    1 
ATOM   1188 C  CD    . ARG A 1 145 ? 22.231  24.986 47.369  1.00 31.69  ? 145  ARG A CD    1 
ATOM   1189 N  NE    . ARG A 1 145 ? 23.334  24.058 47.142  1.00 36.58  ? 145  ARG A NE    1 
ATOM   1190 C  CZ    . ARG A 1 145 ? 23.712  23.620 45.945  1.00 37.26  ? 145  ARG A CZ    1 
ATOM   1191 N  NH1   . ARG A 1 145 ? 23.075  24.021 44.853  1.00 35.35  ? 145  ARG A NH1   1 
ATOM   1192 N  NH2   . ARG A 1 145 ? 24.729  22.776 45.839  1.00 35.82  ? 145  ARG A NH2   1 
ATOM   1193 N  N     . PHE A 1 146 ? 18.321  27.502 47.932  1.00 31.02  ? 146  PHE A N     1 
ATOM   1194 C  CA    . PHE A 1 146 ? 17.231  28.135 48.663  1.00 31.26  ? 146  PHE A CA    1 
ATOM   1195 C  C     . PHE A 1 146 ? 17.591  28.188 50.141  1.00 33.69  ? 146  PHE A C     1 
ATOM   1196 O  O     . PHE A 1 146 ? 17.628  27.158 50.815  1.00 34.57  ? 146  PHE A O     1 
ATOM   1197 C  CB    . PHE A 1 146 ? 15.926  27.353 48.483  1.00 28.47  ? 146  PHE A CB    1 
ATOM   1198 C  CG    . PHE A 1 146 ? 15.440  27.288 47.059  1.00 28.20  ? 146  PHE A CG    1 
ATOM   1199 C  CD1   . PHE A 1 146 ? 15.953  26.348 46.180  1.00 27.50  ? 146  PHE A CD1   1 
ATOM   1200 C  CD2   . PHE A 1 146 ? 14.462  28.160 46.605  1.00 26.27  ? 146  PHE A CD2   1 
ATOM   1201 C  CE1   . PHE A 1 146 ? 15.508  26.282 44.873  1.00 25.35  ? 146  PHE A CE1   1 
ATOM   1202 C  CE2   . PHE A 1 146 ? 14.009  28.098 45.300  1.00 28.10  ? 146  PHE A CE2   1 
ATOM   1203 C  CZ    . PHE A 1 146 ? 14.534  27.159 44.432  1.00 24.66  ? 146  PHE A CZ    1 
ATOM   1204 N  N     . TYR A 1 147 ? 17.862  29.386 50.644  1.00 27.60  ? 147  TYR A N     1 
ATOM   1205 C  CA    . TYR A 1 147 ? 18.185  29.550 52.055  1.00 28.32  ? 147  TYR A CA    1 
ATOM   1206 C  C     . TYR A 1 147 ? 16.916  29.809 52.857  1.00 27.36  ? 147  TYR A C     1 
ATOM   1207 O  O     . TYR A 1 147 ? 16.227  30.805 52.643  1.00 27.11  ? 147  TYR A O     1 
ATOM   1208 C  CB    . TYR A 1 147 ? 19.205  30.676 52.246  1.00 27.28  ? 147  TYR A CB    1 
ATOM   1209 C  CG    . TYR A 1 147 ? 20.547  30.373 51.614  1.00 28.51  ? 147  TYR A CG    1 
ATOM   1210 C  CD1   . TYR A 1 147 ? 20.823  30.753 50.306  1.00 28.79  ? 147  TYR A CD1   1 
ATOM   1211 C  CD2   . TYR A 1 147 ? 21.532  29.696 52.322  1.00 30.04  ? 147  TYR A CD2   1 
ATOM   1212 C  CE1   . TYR A 1 147 ? 22.046  30.473 49.725  1.00 32.13  ? 147  TYR A CE1   1 
ATOM   1213 C  CE2   . TYR A 1 147 ? 22.759  29.411 51.749  1.00 32.10  ? 147  TYR A CE2   1 
ATOM   1214 C  CZ    . TYR A 1 147 ? 23.009  29.801 50.449  1.00 33.54  ? 147  TYR A CZ    1 
ATOM   1215 O  OH    . TYR A 1 147 ? 24.225  29.523 49.870  1.00 38.23  ? 147  TYR A OH    1 
ATOM   1216 N  N     . VAL A 1 148 ? 16.607  28.899 53.776  1.00 28.69  ? 148  VAL A N     1 
ATOM   1217 C  CA    . VAL A 1 148 ? 15.352  28.962 54.514  1.00 30.69  ? 148  VAL A CA    1 
ATOM   1218 C  C     . VAL A 1 148 ? 15.572  29.303 55.983  1.00 35.56  ? 148  VAL A C     1 
ATOM   1219 O  O     . VAL A 1 148 ? 16.239  28.566 56.710  1.00 39.80  ? 148  VAL A O     1 
ATOM   1220 C  CB    . VAL A 1 148 ? 14.573  27.639 54.407  1.00 31.77  ? 148  VAL A CB    1 
ATOM   1221 C  CG1   . VAL A 1 148 ? 13.225  27.753 55.109  1.00 28.02  ? 148  VAL A CG1   1 
ATOM   1222 C  CG2   . VAL A 1 148 ? 14.388  27.256 52.949  1.00 28.95  ? 148  VAL A CG2   1 
ATOM   1223 N  N     . PHE A 1 149 ? 15.002  30.426 56.408  1.00 32.36  ? 149  PHE A N     1 
ATOM   1224 C  CA    . PHE A 1 149 ? 15.129  30.898 57.781  1.00 33.44  ? 149  PHE A CA    1 
ATOM   1225 C  C     . PHE A 1 149 ? 13.807  30.684 58.505  1.00 35.13  ? 149  PHE A C     1 
ATOM   1226 O  O     . PHE A 1 149 ? 12.816  31.358 58.222  1.00 34.33  ? 149  PHE A O     1 
ATOM   1227 C  CB    . PHE A 1 149 ? 15.518  32.379 57.804  1.00 33.94  ? 149  PHE A CB    1 
ATOM   1228 C  CG    . PHE A 1 149 ? 16.835  32.672 57.137  1.00 31.71  ? 149  PHE A CG    1 
ATOM   1229 C  CD1   . PHE A 1 149 ? 16.926  32.753 55.756  1.00 31.77  ? 149  PHE A CD1   1 
ATOM   1230 C  CD2   . PHE A 1 149 ? 17.981  32.871 57.890  1.00 34.51  ? 149  PHE A CD2   1 
ATOM   1231 C  CE1   . PHE A 1 149 ? 18.133  33.021 55.139  1.00 32.56  ? 149  PHE A CE1   1 
ATOM   1232 C  CE2   . PHE A 1 149 ? 19.193  33.142 57.278  1.00 34.10  ? 149  PHE A CE2   1 
ATOM   1233 C  CZ    . PHE A 1 149 ? 19.267  33.217 55.899  1.00 33.53  ? 149  PHE A CZ    1 
ATOM   1234 N  N     . ASP A 1 150 ? 13.798  29.741 59.440  1.00 29.24  ? 150  ASP A N     1 
ATOM   1235 C  CA    . ASP A 1 150 ? 12.556  29.289 60.053  1.00 38.37  ? 150  ASP A CA    1 
ATOM   1236 C  C     . ASP A 1 150 ? 12.514  29.602 61.543  1.00 40.67  ? 150  ASP A C     1 
ATOM   1237 O  O     . ASP A 1 150 ? 13.374  29.162 62.306  1.00 45.07  ? 150  ASP A O     1 
ATOM   1238 C  CB    . ASP A 1 150 ? 12.388  27.787 59.811  1.00 38.32  ? 150  ASP A CB    1 
ATOM   1239 C  CG    . ASP A 1 150 ? 11.101  27.232 60.390  1.00 38.70  ? 150  ASP A CG    1 
ATOM   1240 O  OD1   . ASP A 1 150 ? 10.176  28.017 60.697  1.00 39.62  ? 150  ASP A OD1   1 
ATOM   1241 O  OD2   . ASP A 1 150 ? 11.015  25.995 60.523  1.00 34.79  ? 150  ASP A OD2   1 
ATOM   1242 N  N     . LEU A 1 151 ? 11.504  30.364 61.949  1.00 36.90  ? 151  LEU A N     1 
ATOM   1243 C  CA    . LEU A 1 151 ? 11.330  30.729 63.350  1.00 37.88  ? 151  LEU A CA    1 
ATOM   1244 C  C     . LEU A 1 151 ? 10.500  29.692 64.102  1.00 37.20  ? 151  LEU A C     1 
ATOM   1245 O  O     . LEU A 1 151 ? 9.306   29.531 63.846  1.00 34.82  ? 151  LEU A O     1 
ATOM   1246 C  CB    . LEU A 1 151 ? 10.673  32.104 63.466  1.00 40.88  ? 151  LEU A CB    1 
ATOM   1247 C  CG    . LEU A 1 151 ? 10.420  32.602 64.889  1.00 45.13  ? 151  LEU A CG    1 
ATOM   1248 C  CD1   . LEU A 1 151 ? 11.723  32.641 65.668  1.00 43.88  ? 151  LEU A CD1   1 
ATOM   1249 C  CD2   . LEU A 1 151 ? 9.756   33.971 64.875  1.00 44.34  ? 151  LEU A CD2   1 
ATOM   1250 N  N     . LEU A 1 152 ? 11.135  28.995 65.037  1.00 37.04  ? 152  LEU A N     1 
ATOM   1251 C  CA    . LEU A 1 152 ? 10.447  27.967 65.809  1.00 38.70  ? 152  LEU A CA    1 
ATOM   1252 C  C     . LEU A 1 152 ? 9.687   28.553 66.993  1.00 42.79  ? 152  LEU A C     1 
ATOM   1253 O  O     . LEU A 1 152 ? 8.641   28.034 67.383  1.00 43.28  ? 152  LEU A O     1 
ATOM   1254 C  CB    . LEU A 1 152 ? 11.430  26.900 66.291  1.00 38.14  ? 152  LEU A CB    1 
ATOM   1255 C  CG    . LEU A 1 152 ? 12.175  26.120 65.209  1.00 39.69  ? 152  LEU A CG    1 
ATOM   1256 C  CD1   . LEU A 1 152 ? 12.924  24.948 65.826  1.00 40.31  ? 152  LEU A CD1   1 
ATOM   1257 C  CD2   . LEU A 1 152 ? 11.220  25.647 64.120  1.00 37.60  ? 152  LEU A CD2   1 
ATOM   1258 N  N     . ASN A 1 153 ? 10.213  29.634 67.563  1.00 41.92  ? 153  ASN A N     1 
ATOM   1259 C  CA    . ASN A 1 153 ? 9.601   30.239 68.743  1.00 42.72  ? 153  ASN A CA    1 
ATOM   1260 C  C     . ASN A 1 153 ? 9.069   31.648 68.509  1.00 44.50  ? 153  ASN A C     1 
ATOM   1261 O  O     . ASN A 1 153 ? 9.824   32.578 68.228  1.00 45.40  ? 153  ASN A O     1 
ATOM   1262 C  CB    . ASN A 1 153 ? 10.573  30.226 69.922  1.00 45.17  ? 153  ASN A CB    1 
ATOM   1263 C  CG    . ASN A 1 153 ? 10.947  28.823 70.349  1.00 49.77  ? 153  ASN A CG    1 
ATOM   1264 O  OD1   . ASN A 1 153 ? 10.109  27.922 70.362  1.00 53.87  ? 153  ASN A OD1   1 
ATOM   1265 N  ND2   . ASN A 1 153 ? 12.213  28.627 70.696  1.00 51.32  ? 153  ASN A ND2   1 
ATOM   1266 N  N     . SER A 1 154 ? 7.757   31.790 68.644  1.00 44.67  ? 154  SER A N     1 
ATOM   1267 C  CA    . SER A 1 154 ? 7.080   33.054 68.413  1.00 44.77  ? 154  SER A CA    1 
ATOM   1268 C  C     . SER A 1 154 ? 6.046   33.261 69.510  1.00 46.93  ? 154  SER A C     1 
ATOM   1269 O  O     . SER A 1 154 ? 5.584   32.294 70.111  1.00 49.16  ? 154  SER A O     1 
ATOM   1270 C  CB    . SER A 1 154 ? 6.399   33.026 67.041  1.00 43.97  ? 154  SER A CB    1 
ATOM   1271 O  OG    . SER A 1 154 ? 5.509   34.114 66.870  1.00 43.59  ? 154  SER A OG    1 
ATOM   1272 N  N     . PRO A 1 155 ? 5.683   34.524 69.787  1.00 49.23  ? 155  PRO A N     1 
ATOM   1273 C  CA    . PRO A 1 155 ? 4.584   34.777 70.723  1.00 50.06  ? 155  PRO A CA    1 
ATOM   1274 C  C     . PRO A 1 155 ? 3.269   34.201 70.210  1.00 48.45  ? 155  PRO A C     1 
ATOM   1275 O  O     . PRO A 1 155 ? 2.324   34.038 70.983  1.00 52.44  ? 155  PRO A O     1 
ATOM   1276 C  CB    . PRO A 1 155 ? 4.509   36.310 70.775  1.00 52.04  ? 155  PRO A CB    1 
ATOM   1277 C  CG    . PRO A 1 155 ? 5.250   36.785 69.562  1.00 49.63  ? 155  PRO A CG    1 
ATOM   1278 C  CD    . PRO A 1 155 ? 6.329   35.773 69.351  1.00 47.08  ? 155  PRO A CD    1 
ATOM   1279 N  N     . TYR A 1 156 ? 3.220   33.889 68.919  1.00 45.73  ? 156  TYR A N     1 
ATOM   1280 C  CA    . TYR A 1 156 ? 2.024   33.330 68.302  1.00 49.20  ? 156  TYR A CA    1 
ATOM   1281 C  C     . TYR A 1 156 ? 2.082   31.807 68.212  1.00 52.48  ? 156  TYR A C     1 
ATOM   1282 O  O     . TYR A 1 156 ? 1.226   31.186 67.581  1.00 54.81  ? 156  TYR A O     1 
ATOM   1283 C  CB    . TYR A 1 156 ? 1.809   33.931 66.911  1.00 49.91  ? 156  TYR A CB    1 
ATOM   1284 C  CG    . TYR A 1 156 ? 1.650   35.435 66.914  1.00 54.31  ? 156  TYR A CG    1 
ATOM   1285 C  CD1   . TYR A 1 156 ? 1.082   36.090 68.000  1.00 59.32  ? 156  TYR A CD1   1 
ATOM   1286 C  CD2   . TYR A 1 156 ? 2.074   36.201 65.837  1.00 53.47  ? 156  TYR A CD2   1 
ATOM   1287 C  CE1   . TYR A 1 156 ? 0.937   37.465 68.010  1.00 61.44  ? 156  TYR A CE1   1 
ATOM   1288 C  CE2   . TYR A 1 156 ? 1.934   37.578 65.838  1.00 55.61  ? 156  TYR A CE2   1 
ATOM   1289 C  CZ    . TYR A 1 156 ? 1.364   38.204 66.927  1.00 59.77  ? 156  TYR A CZ    1 
ATOM   1290 O  OH    . TYR A 1 156 ? 1.221   39.573 66.935  1.00 62.17  ? 156  TYR A OH    1 
ATOM   1291 N  N     . GLY A 1 157 ? 3.091   31.207 68.837  1.00 52.68  ? 157  GLY A N     1 
ATOM   1292 C  CA    . GLY A 1 157 ? 3.176   29.758 68.901  1.00 52.07  ? 157  GLY A CA    1 
ATOM   1293 C  C     . GLY A 1 157 ? 4.567   29.172 68.738  1.00 48.48  ? 157  GLY A C     1 
ATOM   1294 O  O     . GLY A 1 157 ? 5.364   29.641 67.926  1.00 48.33  ? 157  GLY A O     1 
ATOM   1295 N  N     . ASN A 1 158 ? 4.851   28.137 69.523  1.00 45.99  ? 158  ASN A N     1 
ATOM   1296 C  CA    . ASN A 1 158 ? 6.096   27.388 69.408  1.00 44.50  ? 158  ASN A CA    1 
ATOM   1297 C  C     . ASN A 1 158 ? 5.873   26.113 68.611  1.00 44.69  ? 158  ASN A C     1 
ATOM   1298 O  O     . ASN A 1 158 ? 4.962   25.340 68.907  1.00 47.29  ? 158  ASN A O     1 
ATOM   1299 C  CB    . ASN A 1 158 ? 6.648   27.049 70.794  1.00 47.24  ? 158  ASN A CB    1 
ATOM   1300 C  CG    . ASN A 1 158 ? 7.104   28.277 71.554  1.00 50.94  ? 158  ASN A CG    1 
ATOM   1301 O  OD1   . ASN A 1 158 ? 6.966   29.402 71.077  1.00 52.72  ? 158  ASN A OD1   1 
ATOM   1302 N  ND2   . ASN A 1 158 ? 7.651   28.067 72.747  1.00 54.74  ? 158  ASN A ND2   1 
ATOM   1303 N  N     . VAL A 1 159 ? 6.702   25.896 67.595  1.00 43.18  ? 159  VAL A N     1 
ATOM   1304 C  CA    . VAL A 1 159 ? 6.519   24.763 66.695  1.00 42.46  ? 159  VAL A CA    1 
ATOM   1305 C  C     . VAL A 1 159 ? 7.788   23.933 66.538  1.00 43.55  ? 159  VAL A C     1 
ATOM   1306 O  O     . VAL A 1 159 ? 8.881   24.370 66.899  1.00 44.28  ? 159  VAL A O     1 
ATOM   1307 C  CB    . VAL A 1 159 ? 6.062   25.228 65.301  1.00 43.24  ? 159  VAL A CB    1 
ATOM   1308 C  CG1   . VAL A 1 159 ? 4.699   25.902 65.388  1.00 45.22  ? 159  VAL A CG1   1 
ATOM   1309 C  CG2   . VAL A 1 159 ? 7.094   26.166 64.691  1.00 39.45  ? 159  VAL A CG2   1 
ATOM   1310 N  N     . GLU A 1 160 ? 7.630   22.732 65.992  1.00 41.16  ? 160  GLU A N     1 
ATOM   1311 C  CA    . GLU A 1 160 ? 8.755   21.839 65.749  1.00 43.16  ? 160  GLU A CA    1 
ATOM   1312 C  C     . GLU A 1 160 ? 9.414   22.184 64.423  1.00 41.20  ? 160  GLU A C     1 
ATOM   1313 O  O     . GLU A 1 160 ? 8.854   22.932 63.623  1.00 40.09  ? 160  GLU A O     1 
ATOM   1314 C  CB    . GLU A 1 160 ? 8.281   20.388 65.726  1.00 47.87  ? 160  GLU A CB    1 
ATOM   1315 C  CG    . GLU A 1 160 ? 7.589   19.942 67.000  1.00 56.22  ? 160  GLU A CG    1 
ATOM   1316 C  CD    . GLU A 1 160 ? 6.793   18.666 66.810  1.00 65.55  ? 160  GLU A CD    1 
ATOM   1317 O  OE1   . GLU A 1 160 ? 6.542   18.290 65.644  1.00 66.47  ? 160  GLU A OE1   1 
ATOM   1318 O  OE2   . GLU A 1 160 ? 6.420   18.039 67.825  1.00 72.47  ? 160  GLU A OE2   1 
ATOM   1319 N  N     . GLU A 1 161 ? 10.601  21.634 64.191  1.00 41.30  ? 161  GLU A N     1 
ATOM   1320 C  CA    . GLU A 1 161 ? 11.333  21.894 62.957  1.00 41.55  ? 161  GLU A CA    1 
ATOM   1321 C  C     . GLU A 1 161 ? 10.598  21.377 61.727  1.00 39.99  ? 161  GLU A C     1 
ATOM   1322 O  O     . GLU A 1 161 ? 9.872   20.385 61.784  1.00 40.32  ? 161  GLU A O     1 
ATOM   1323 C  CB    . GLU A 1 161 ? 12.733  21.277 63.009  1.00 45.21  ? 161  GLU A CB    1 
ATOM   1324 C  CG    . GLU A 1 161 ? 13.658  21.899 64.038  1.00 50.20  ? 161  GLU A CG    1 
ATOM   1325 C  CD    . GLU A 1 161 ? 15.093  21.436 63.883  1.00 55.02  ? 161  GLU A CD    1 
ATOM   1326 O  OE1   . GLU A 1 161 ? 15.390  20.734 62.893  1.00 57.98  ? 161  GLU A OE1   1 
ATOM   1327 O  OE2   . GLU A 1 161 ? 15.927  21.776 64.749  1.00 55.66  ? 161  GLU A OE2   1 
ATOM   1328 N  N     . TRP A 1 162 ? 10.795  22.074 60.615  1.00 40.74  ? 162  TRP A N     1 
ATOM   1329 C  CA    . TRP A 1 162 ? 10.300  21.638 59.321  1.00 39.14  ? 162  TRP A CA    1 
ATOM   1330 C  C     . TRP A 1 162 ? 11.103  20.422 58.886  1.00 38.52  ? 162  TRP A C     1 
ATOM   1331 O  O     . TRP A 1 162 ? 12.314  20.366 59.096  1.00 40.43  ? 162  TRP A O     1 
ATOM   1332 C  CB    . TRP A 1 162 ? 10.456  22.782 58.320  1.00 39.27  ? 162  TRP A CB    1 
ATOM   1333 C  CG    . TRP A 1 162 ? 10.300  22.423 56.872  1.00 36.85  ? 162  TRP A CG    1 
ATOM   1334 C  CD1   . TRP A 1 162 ? 9.135   22.324 56.170  1.00 33.89  ? 162  TRP A CD1   1 
ATOM   1335 C  CD2   . TRP A 1 162 ? 11.355  22.167 55.936  1.00 33.50  ? 162  TRP A CD2   1 
ATOM   1336 N  NE1   . TRP A 1 162 ? 9.398   22.008 54.858  1.00 33.57  ? 162  TRP A NE1   1 
ATOM   1337 C  CE2   . TRP A 1 162 ? 10.754  21.908 54.689  1.00 31.33  ? 162  TRP A CE2   1 
ATOM   1338 C  CE3   . TRP A 1 162 ? 12.748  22.127 56.034  1.00 34.58  ? 162  TRP A CE3   1 
ATOM   1339 C  CZ2   . TRP A 1 162 ? 11.498  21.609 53.551  1.00 29.76  ? 162  TRP A CZ2   1 
ATOM   1340 C  CZ3   . TRP A 1 162 ? 13.484  21.831 54.903  1.00 34.52  ? 162  TRP A CZ3   1 
ATOM   1341 C  CH2   . TRP A 1 162 ? 12.858  21.575 53.677  1.00 30.54  ? 162  TRP A CH2   1 
ATOM   1342 N  N     . SER A 1 163 ? 10.424  19.443 58.299  1.00 39.80  ? 163  SER A N     1 
ATOM   1343 C  CA    . SER A 1 163 ? 11.078  18.219 57.850  1.00 39.89  ? 163  SER A CA    1 
ATOM   1344 C  C     . SER A 1 163 ? 11.183  18.157 56.329  1.00 38.60  ? 163  SER A C     1 
ATOM   1345 O  O     . SER A 1 163 ? 10.171  18.191 55.627  1.00 38.36  ? 163  SER A O     1 
ATOM   1346 C  CB    . SER A 1 163 ? 10.325  16.993 58.367  1.00 40.66  ? 163  SER A CB    1 
ATOM   1347 O  OG    . SER A 1 163 ? 10.713  15.831 57.656  1.00 40.39  ? 163  SER A OG    1 
ATOM   1348 N  N     . ILE A 1 164 ? 12.408  18.058 55.824  1.00 36.84  ? 164  ILE A N     1 
ATOM   1349 C  CA    . ILE A 1 164 ? 12.629  18.005 54.385  1.00 36.96  ? 164  ILE A CA    1 
ATOM   1350 C  C     . ILE A 1 164 ? 12.157  16.670 53.814  1.00 39.88  ? 164  ILE A C     1 
ATOM   1351 O  O     . ILE A 1 164 ? 11.785  16.581 52.641  1.00 40.76  ? 164  ILE A O     1 
ATOM   1352 C  CB    . ILE A 1 164 ? 14.112  18.265 54.018  1.00 38.57  ? 164  ILE A CB    1 
ATOM   1353 C  CG1   . ILE A 1 164 ? 14.258  18.534 52.517  1.00 40.00  ? 164  ILE A CG1   1 
ATOM   1354 C  CG2   . ILE A 1 164 ? 14.998  17.110 54.466  1.00 37.50  ? 164  ILE A CG2   1 
ATOM   1355 C  CD1   . ILE A 1 164 ? 15.591  19.149 52.132  1.00 40.07  ? 164  ILE A CD1   1 
ATOM   1356 N  N     . GLU A 1 165 ? 12.153  15.640 54.654  1.00 35.30  ? 165  GLU A N     1 
ATOM   1357 C  CA    . GLU A 1 165 ? 11.698  14.318 54.242  1.00 41.02  ? 165  GLU A CA    1 
ATOM   1358 C  C     . GLU A 1 165 ? 10.203  14.346 53.960  1.00 39.61  ? 165  GLU A C     1 
ATOM   1359 O  O     . GLU A 1 165 ? 9.738   13.812 52.954  1.00 39.30  ? 165  GLU A O     1 
ATOM   1360 C  CB    . GLU A 1 165 ? 12.011  13.272 55.318  1.00 49.69  ? 165  GLU A CB    1 
ATOM   1361 C  CG    . GLU A 1 165 ? 13.495  12.997 55.523  1.00 55.79  ? 165  GLU A CG    1 
ATOM   1362 C  CD    . GLU A 1 165 ? 14.200  14.100 56.292  1.00 63.14  ? 165  GLU A CD    1 
ATOM   1363 O  OE1   . GLU A 1 165 ? 13.518  14.854 57.020  1.00 62.10  ? 165  GLU A OE1   1 
ATOM   1364 O  OE2   . GLU A 1 165 ? 15.437  14.214 56.162  1.00 68.98  ? 165  GLU A OE2   1 
ATOM   1365 N  N     . ILE A 1 166 ? 9.455   14.974 54.858  1.00 41.26  ? 166  ILE A N     1 
ATOM   1366 C  CA    . ILE A 1 166 ? 8.011   15.091 54.704  1.00 43.02  ? 166  ILE A CA    1 
ATOM   1367 C  C     . ILE A 1 166 ? 7.662   16.085 53.594  1.00 40.66  ? 166  ILE A C     1 
ATOM   1368 O  O     . ILE A 1 166 ? 6.682   15.907 52.872  1.00 40.01  ? 166  ILE A O     1 
ATOM   1369 C  CB    . ILE A 1 166 ? 7.342   15.475 56.042  1.00 45.04  ? 166  ILE A CB    1 
ATOM   1370 C  CG1   . ILE A 1 166 ? 7.492   14.324 57.043  1.00 48.79  ? 166  ILE A CG1   1 
ATOM   1371 C  CG2   . ILE A 1 166 ? 5.871   15.821 55.846  1.00 39.63  ? 166  ILE A CG2   1 
ATOM   1372 C  CD1   . ILE A 1 166 ? 6.988   14.641 58.432  1.00 50.33  ? 166  ILE A CD1   1 
ATOM   1373 N  N     . ALA A 1 167 ? 8.486   17.117 53.444  1.00 36.88  ? 167  ALA A N     1 
ATOM   1374 C  CA    . ALA A 1 167 ? 8.289   18.104 52.386  1.00 37.95  ? 167  ALA A CA    1 
ATOM   1375 C  C     . ALA A 1 167 ? 8.327   17.467 50.996  1.00 40.43  ? 167  ALA A C     1 
ATOM   1376 O  O     . ALA A 1 167 ? 7.560   17.844 50.111  1.00 39.55  ? 167  ALA A O     1 
ATOM   1377 C  CB    . ALA A 1 167 ? 9.335   19.195 52.485  1.00 32.27  ? 167  ALA A CB    1 
ATOM   1378 N  N     . ALA A 1 168 ? 9.221   16.501 50.817  1.00 36.76  ? 168  ALA A N     1 
ATOM   1379 C  CA    . ALA A 1 168 ? 9.426   15.866 49.518  1.00 38.40  ? 168  ALA A CA    1 
ATOM   1380 C  C     . ALA A 1 168 ? 8.328   14.864 49.166  1.00 40.18  ? 168  ALA A C     1 
ATOM   1381 O  O     . ALA A 1 168 ? 8.098   14.577 47.993  1.00 44.61  ? 168  ALA A O     1 
ATOM   1382 C  CB    . ALA A 1 168 ? 10.793  15.189 49.471  1.00 36.44  ? 168  ALA A CB    1 
ATOM   1383 N  N     . LYS A 1 169 ? 7.656   14.334 50.182  1.00 39.13  ? 169  LYS A N     1 
ATOM   1384 C  CA    . LYS A 1 169 ? 6.623   13.325 49.965  1.00 43.05  ? 169  LYS A CA    1 
ATOM   1385 C  C     . LYS A 1 169 ? 5.413   13.872 49.212  1.00 42.26  ? 169  LYS A C     1 
ATOM   1386 O  O     . LYS A 1 169 ? 5.113   15.065 49.274  1.00 42.71  ? 169  LYS A O     1 
ATOM   1387 C  CB    . LYS A 1 169 ? 6.176   12.712 51.295  1.00 43.85  ? 169  LYS A CB    1 
ATOM   1388 C  CG    . LYS A 1 169 ? 7.245   11.893 51.994  1.00 50.02  ? 169  LYS A CG    1 
ATOM   1389 C  CD    . LYS A 1 169 ? 6.700   11.243 53.255  1.00 57.40  ? 169  LYS A CD    1 
ATOM   1390 C  CE    . LYS A 1 169 ? 7.777   10.456 53.983  1.00 62.92  ? 169  LYS A CE    1 
ATOM   1391 N  NZ    . LYS A 1 169 ? 8.364   9.391  53.122  1.00 66.48  ? 169  LYS A NZ    1 
ATOM   1392 N  N     . LEU A 1 170 ? 4.728   12.982 48.501  1.00 41.52  ? 170  LEU A N     1 
ATOM   1393 C  CA    . LEU A 1 170 ? 3.493   13.315 47.802  1.00 41.34  ? 170  LEU A CA    1 
ATOM   1394 C  C     . LEU A 1 170 ? 2.439   13.757 48.810  1.00 44.88  ? 170  LEU A C     1 
ATOM   1395 O  O     . LEU A 1 170 ? 2.505   13.386 49.982  1.00 38.24  ? 170  LEU A O     1 
ATOM   1396 C  CB    . LEU A 1 170 ? 2.969   12.094 47.033  1.00 44.49  ? 170  LEU A CB    1 
ATOM   1397 C  CG    . LEU A 1 170 ? 3.637   11.607 45.740  1.00 48.20  ? 170  LEU A CG    1 
ATOM   1398 C  CD1   . LEU A 1 170 ? 5.085   11.173 45.948  1.00 51.33  ? 170  LEU A CD1   1 
ATOM   1399 C  CD2   . LEU A 1 170 ? 2.826   10.465 45.142  1.00 47.12  ? 170  LEU A CD2   1 
ATOM   1400 N  N     . GLN A 1 171 ? 1.467   14.544 48.356  1.00 37.86  ? 171  GLN A N     1 
ATOM   1401 C  CA    . GLN A 1 171 ? 0.361   14.946 49.218  1.00 45.71  ? 171  GLN A CA    1 
ATOM   1402 C  C     . GLN A 1 171 ? -0.448  13.725 49.627  1.00 45.87  ? 171  GLN A C     1 
ATOM   1403 O  O     . GLN A 1 171 ? -1.008  13.673 50.723  1.00 40.93  ? 171  GLN A O     1 
ATOM   1404 C  CB    . GLN A 1 171 ? -0.534  15.976 48.526  1.00 52.26  ? 171  GLN A CB    1 
ATOM   1405 C  CG    . GLN A 1 171 ? 0.147   17.315 48.297  1.00 61.43  ? 171  GLN A CG    1 
ATOM   1406 C  CD    . GLN A 1 171 ? -0.816  18.484 48.375  1.00 71.01  ? 171  GLN A CD    1 
ATOM   1407 O  OE1   . GLN A 1 171 ? -1.994  18.360 48.037  1.00 77.16  ? 171  GLN A OE1   1 
ATOM   1408 N  NE2   . GLN A 1 171 ? -0.318  19.628 48.833  1.00 71.14  ? 171  GLN A NE2   1 
ATOM   1409 N  N     . GLU A 1 172 ? -0.486  12.733 48.744  1.00 46.66  ? 172  GLU A N     1 
ATOM   1410 C  CA    . GLU A 1 172 ? -1.166  11.477 49.024  1.00 49.01  ? 172  GLU A CA    1 
ATOM   1411 C  C     . GLU A 1 172 ? -0.431  10.687 50.107  1.00 48.31  ? 172  GLU A C     1 
ATOM   1412 O  O     . GLU A 1 172 ? -0.961  9.717  50.645  1.00 50.50  ? 172  GLU A O     1 
ATOM   1413 C  CB    . GLU A 1 172 ? -1.300  10.640 47.748  1.00 52.97  ? 172  GLU A CB    1 
ATOM   1414 C  CG    . GLU A 1 172 ? -2.291  11.193 46.728  1.00 56.78  ? 172  GLU A CG    1 
ATOM   1415 C  CD    . GLU A 1 172 ? -1.744  12.364 45.927  1.00 60.96  ? 172  GLU A CD    1 
ATOM   1416 O  OE1   . GLU A 1 172 ? -2.548  13.052 45.262  1.00 62.82  ? 172  GLU A OE1   1 
ATOM   1417 O  OE2   . GLU A 1 172 ? -0.516  12.596 45.954  1.00 61.98  ? 172  GLU A OE2   1 
ATOM   1418 N  N     . GLN A 1 173 ? 0.793   11.107 50.416  1.00 45.50  ? 173  GLN A N     1 
ATOM   1419 C  CA    . GLN A 1 173 ? 1.562   10.511 51.503  1.00 44.72  ? 173  GLN A CA    1 
ATOM   1420 C  C     . GLN A 1 173 ? 1.518   11.391 52.747  1.00 44.66  ? 173  GLN A C     1 
ATOM   1421 O  O     . GLN A 1 173 ? 2.131   11.071 53.765  1.00 47.04  ? 173  GLN A O     1 
ATOM   1422 C  CB    . GLN A 1 173 ? 3.018   10.302 51.086  1.00 45.19  ? 173  GLN A CB    1 
ATOM   1423 C  CG    . GLN A 1 173 ? 3.221   9.321  49.946  1.00 50.01  ? 173  GLN A CG    1 
ATOM   1424 C  CD    . GLN A 1 173 ? 4.690   9.068  49.663  1.00 51.06  ? 173  GLN A CD    1 
ATOM   1425 O  OE1   . GLN A 1 173 ? 5.336   9.831  48.945  1.00 48.38  ? 173  GLN A OE1   1 
ATOM   1426 N  NE2   . GLN A 1 173 ? 5.227   7.998  50.237  1.00 54.45  ? 173  GLN A NE2   1 
ATOM   1427 N  N     . GLY A 1 174 ? 0.792   12.501 52.661  1.00 42.81  ? 174  GLY A N     1 
ATOM   1428 C  CA    . GLY A 1 174 ? 0.727   13.449 53.758  1.00 40.23  ? 174  GLY A CA    1 
ATOM   1429 C  C     . GLY A 1 174 ? 1.869   14.445 53.679  1.00 38.46  ? 174  GLY A C     1 
ATOM   1430 O  O     . GLY A 1 174 ? 2.132   15.187 54.625  1.00 38.41  ? 174  GLY A O     1 
ATOM   1431 N  N     . GLY A 1 175 ? 2.551   14.453 52.539  1.00 37.66  ? 175  GLY A N     1 
ATOM   1432 C  CA    . GLY A 1 175 ? 3.674   15.344 52.321  1.00 37.31  ? 175  GLY A CA    1 
ATOM   1433 C  C     . GLY A 1 175 ? 3.256   16.655 51.689  1.00 35.80  ? 175  GLY A C     1 
ATOM   1434 O  O     . GLY A 1 175 ? 2.066   16.934 51.547  1.00 35.71  ? 175  GLY A O     1 
ATOM   1435 N  N     . ASP A 1 176 ? 4.239   17.458 51.296  1.00 35.31  ? 176  ASP A N     1 
ATOM   1436 C  CA    . ASP A 1 176 ? 3.970   18.797 50.784  1.00 35.38  ? 176  ASP A CA    1 
ATOM   1437 C  C     . ASP A 1 176 ? 4.248   18.938 49.290  1.00 39.21  ? 176  ASP A C     1 
ATOM   1438 O  O     . ASP A 1 176 ? 3.945   19.972 48.693  1.00 40.81  ? 176  ASP A O     1 
ATOM   1439 C  CB    . ASP A 1 176 ? 4.787   19.828 51.562  1.00 31.85  ? 176  ASP A CB    1 
ATOM   1440 C  CG    . ASP A 1 176 ? 4.466   19.829 53.042  1.00 37.26  ? 176  ASP A CG    1 
ATOM   1441 O  OD1   . ASP A 1 176 ? 3.280   19.654 53.392  1.00 35.63  ? 176  ASP A OD1   1 
ATOM   1442 O  OD2   . ASP A 1 176 ? 5.399   20.003 53.854  1.00 39.19  ? 176  ASP A OD2   1 
ATOM   1443 N  N     . GLU A 1 177 ? 4.829   17.899 48.698  1.00 42.90  ? 177  GLU A N     1 
ATOM   1444 C  CA    . GLU A 1 177 ? 5.147   17.885 47.270  1.00 46.37  ? 177  GLU A CA    1 
ATOM   1445 C  C     . GLU A 1 177 ? 6.033   19.045 46.825  1.00 45.07  ? 177  GLU A C     1 
ATOM   1446 O  O     . GLU A 1 177 ? 5.837   19.601 45.744  1.00 49.18  ? 177  GLU A O     1 
ATOM   1447 C  CB    . GLU A 1 177 ? 3.872   17.838 46.421  1.00 49.66  ? 177  GLU A CB    1 
ATOM   1448 C  CG    . GLU A 1 177 ? 3.491   16.442 45.961  1.00 57.05  ? 177  GLU A CG    1 
ATOM   1449 C  CD    . GLU A 1 177 ? 2.083   16.374 45.405  1.00 62.42  ? 177  GLU A CD    1 
ATOM   1450 O  OE1   . GLU A 1 177 ? 1.716   17.244 44.587  1.00 66.85  ? 177  GLU A OE1   1 
ATOM   1451 O  OE2   . GLU A 1 177 ? 1.338   15.454 45.798  1.00 62.87  ? 177  GLU A OE2   1 
ATOM   1452 N  N     . VAL A 1 178 ? 6.995   19.416 47.664  1.00 38.49  ? 178  VAL A N     1 
ATOM   1453 C  CA    . VAL A 1 178 ? 8.043   20.329 47.238  1.00 37.27  ? 178  VAL A CA    1 
ATOM   1454 C  C     . VAL A 1 178 ? 8.776   19.645 46.092  1.00 41.51  ? 178  VAL A C     1 
ATOM   1455 O  O     . VAL A 1 178 ? 9.281   18.537 46.264  1.00 40.29  ? 178  VAL A O     1 
ATOM   1456 C  CB    . VAL A 1 178 ? 9.035   20.629 48.372  1.00 36.93  ? 178  VAL A CB    1 
ATOM   1457 C  CG1   . VAL A 1 178 ? 10.230  21.408 47.840  1.00 37.60  ? 178  VAL A CG1   1 
ATOM   1458 C  CG2   . VAL A 1 178 ? 8.348   21.393 49.495  1.00 35.54  ? 178  VAL A CG2   1 
ATOM   1459 N  N     . PRO A 1 179 ? 8.810   20.295 44.916  1.00 37.69  ? 179  PRO A N     1 
ATOM   1460 C  CA    . PRO A 1 179 ? 9.371   19.733 43.681  1.00 38.44  ? 179  PRO A CA    1 
ATOM   1461 C  C     . PRO A 1 179 ? 10.726  19.065 43.900  1.00 36.37  ? 179  PRO A C     1 
ATOM   1462 O  O     . PRO A 1 179 ? 11.609  19.645 44.530  1.00 35.01  ? 179  PRO A O     1 
ATOM   1463 C  CB    . PRO A 1 179 ? 9.512   20.961 42.780  1.00 41.31  ? 179  PRO A CB    1 
ATOM   1464 C  CG    . PRO A 1 179 ? 8.398   21.850 43.216  1.00 39.47  ? 179  PRO A CG    1 
ATOM   1465 C  CD    . PRO A 1 179 ? 8.288   21.658 44.709  1.00 37.13  ? 179  PRO A CD    1 
ATOM   1466 N  N     . SER A 1 180 ? 10.871  17.848 43.385  1.00 38.25  ? 180  SER A N     1 
ATOM   1467 C  CA    . SER A 1 180 ? 12.057  17.035 43.634  1.00 40.37  ? 180  SER A CA    1 
ATOM   1468 C  C     . SER A 1 180 ? 13.355  17.683 43.154  1.00 39.95  ? 180  SER A C     1 
ATOM   1469 O  O     . SER A 1 180 ? 14.427  17.401 43.688  1.00 43.13  ? 180  SER A O     1 
ATOM   1470 C  CB    . SER A 1 180 ? 11.896  15.650 43.001  1.00 44.83  ? 180  SER A CB    1 
ATOM   1471 O  OG    . SER A 1 180 ? 11.814  15.742 41.589  1.00 47.11  ? 180  SER A OG    1 
ATOM   1472 N  N     . GLU A 1 181 ? 13.261  18.559 42.158  1.00 38.37  ? 181  GLU A N     1 
ATOM   1473 C  CA    . GLU A 1 181 ? 14.459  19.161 41.577  1.00 39.66  ? 181  GLU A CA    1 
ATOM   1474 C  C     . GLU A 1 181 ? 15.079  20.280 42.424  1.00 38.12  ? 181  GLU A C     1 
ATOM   1475 O  O     . GLU A 1 181 ? 16.152  20.781 42.094  1.00 42.57  ? 181  GLU A O     1 
ATOM   1476 C  CB    . GLU A 1 181 ? 14.196  19.653 40.146  1.00 40.92  ? 181  GLU A CB    1 
ATOM   1477 C  CG    . GLU A 1 181 ? 13.215  20.813 40.031  1.00 40.50  ? 181  GLU A CG    1 
ATOM   1478 C  CD    . GLU A 1 181 ? 11.765  20.364 39.936  1.00 45.98  ? 181  GLU A CD    1 
ATOM   1479 O  OE1   . GLU A 1 181 ? 11.466  19.202 40.288  1.00 46.87  ? 181  GLU A OE1   1 
ATOM   1480 O  OE2   . GLU A 1 181 ? 10.921  21.179 39.502  1.00 47.03  ? 181  GLU A OE2   1 
ATOM   1481 N  N     . ILE A 1 182 ? 14.416  20.671 43.510  1.00 32.57  ? 182  ILE A N     1 
ATOM   1482 C  CA    . ILE A 1 182 ? 14.978  21.700 44.387  1.00 31.74  ? 182  ILE A CA    1 
ATOM   1483 C  C     . ILE A 1 182 ? 15.268  21.203 45.801  1.00 32.75  ? 182  ILE A C     1 
ATOM   1484 O  O     . ILE A 1 182 ? 15.825  21.940 46.613  1.00 35.11  ? 182  ILE A O     1 
ATOM   1485 C  CB    . ILE A 1 182 ? 14.080  22.964 44.478  1.00 29.93  ? 182  ILE A CB    1 
ATOM   1486 C  CG1   . ILE A 1 182 ? 12.841  22.691 45.333  1.00 28.17  ? 182  ILE A CG1   1 
ATOM   1487 C  CG2   . ILE A 1 182 ? 13.711  23.467 43.087  1.00 34.44  ? 182  ILE A CG2   1 
ATOM   1488 C  CD1   . ILE A 1 182 ? 11.991  23.924 45.586  1.00 27.03  ? 182  ILE A CD1   1 
ATOM   1489 N  N     . ILE A 1 183 ? 14.892  19.959 46.087  1.00 33.85  ? 183  ILE A N     1 
ATOM   1490 C  CA    . ILE A 1 183 ? 15.095  19.371 47.411  1.00 34.55  ? 183  ILE A CA    1 
ATOM   1491 C  C     . ILE A 1 183 ? 16.558  19.410 47.852  1.00 36.12  ? 183  ILE A C     1 
ATOM   1492 O  O     . ILE A 1 183 ? 16.865  19.788 48.984  1.00 38.55  ? 183  ILE A O     1 
ATOM   1493 C  CB    . ILE A 1 183 ? 14.568  17.916 47.472  1.00 38.42  ? 183  ILE A CB    1 
ATOM   1494 C  CG1   . ILE A 1 183 ? 13.042  17.910 47.549  1.00 37.57  ? 183  ILE A CG1   1 
ATOM   1495 C  CG2   . ILE A 1 183 ? 15.141  17.181 48.675  1.00 38.81  ? 183  ILE A CG2   1 
ATOM   1496 C  CD1   . ILE A 1 183 ? 12.494  18.585 48.791  1.00 34.41  ? 183  ILE A CD1   1 
ATOM   1497 N  N     . ASP A 1 184 ? 17.460  19.041 46.948  1.00 33.85  ? 184  ASP A N     1 
ATOM   1498 C  CA    . ASP A 1 184 ? 18.886  19.030 47.259  1.00 35.35  ? 184  ASP A CA    1 
ATOM   1499 C  C     . ASP A 1 184 ? 19.490  20.432 47.282  1.00 38.28  ? 184  ASP A C     1 
ATOM   1500 O  O     . ASP A 1 184 ? 20.664  20.602 47.611  1.00 40.02  ? 184  ASP A O     1 
ATOM   1501 C  CB    . ASP A 1 184 ? 19.648  18.155 46.261  1.00 40.13  ? 184  ASP A CB    1 
ATOM   1502 C  CG    . ASP A 1 184 ? 19.271  16.691 46.364  1.00 48.41  ? 184  ASP A CG    1 
ATOM   1503 O  OD1   . ASP A 1 184 ? 18.734  16.283 47.417  1.00 51.18  ? 184  ASP A OD1   1 
ATOM   1504 O  OD2   . ASP A 1 184 ? 19.517  15.946 45.392  1.00 52.46  ? 184  ASP A OD2   1 
ATOM   1505 N  N     . LYS A 1 185 ? 18.686  21.433 46.936  1.00 33.81  ? 185  LYS A N     1 
ATOM   1506 C  CA    . LYS A 1 185 ? 19.162  22.812 46.875  1.00 36.57  ? 185  LYS A CA    1 
ATOM   1507 C  C     . LYS A 1 185 ? 18.696  23.631 48.074  1.00 34.20  ? 185  LYS A C     1 
ATOM   1508 O  O     . LYS A 1 185 ? 18.924  24.837 48.140  1.00 36.16  ? 185  LYS A O     1 
ATOM   1509 C  CB    . LYS A 1 185 ? 18.696  23.479 45.579  1.00 36.43  ? 185  LYS A CB    1 
ATOM   1510 C  CG    . LYS A 1 185 ? 19.121  22.741 44.319  1.00 39.95  ? 185  LYS A CG    1 
ATOM   1511 C  CD    . LYS A 1 185 ? 18.760  23.526 43.072  1.00 41.37  ? 185  LYS A CD    1 
ATOM   1512 C  CE    . LYS A 1 185 ? 19.251  22.821 41.818  1.00 45.14  ? 185  LYS A CE    1 
ATOM   1513 N  NZ    . LYS A 1 185 ? 19.042  23.657 40.605  1.00 45.66  ? 185  LYS A NZ    1 
ATOM   1514 N  N     . ILE A 1 186 ? 18.040  22.971 49.020  1.00 32.63  ? 186  ILE A N     1 
ATOM   1515 C  CA    . ILE A 1 186 ? 17.503  23.661 50.185  1.00 33.40  ? 186  ILE A CA    1 
ATOM   1516 C  C     . ILE A 1 186 ? 18.480  23.643 51.356  1.00 33.81  ? 186  ILE A C     1 
ATOM   1517 O  O     . ILE A 1 186 ? 18.955  22.585 51.768  1.00 33.38  ? 186  ILE A O     1 
ATOM   1518 C  CB    . ILE A 1 186 ? 16.158  23.052 50.632  1.00 35.86  ? 186  ILE A CB    1 
ATOM   1519 C  CG1   . ILE A 1 186 ? 15.104  23.240 49.538  1.00 34.03  ? 186  ILE A CG1   1 
ATOM   1520 C  CG2   . ILE A 1 186 ? 15.693  23.681 51.939  1.00 35.24  ? 186  ILE A CG2   1 
ATOM   1521 C  CD1   . ILE A 1 186 ? 13.759  22.635 49.876  1.00 32.96  ? 186  ILE A CD1   1 
ATOM   1522 N  N     . ILE A 1 187 ? 18.781  24.826 51.880  1.00 33.43  ? 187  ILE A N     1 
ATOM   1523 C  CA    . ILE A 1 187 ? 19.606  24.952 53.073  1.00 36.20  ? 187  ILE A CA    1 
ATOM   1524 C  C     . ILE A 1 187 ? 18.752  25.506 54.210  1.00 36.89  ? 187  ILE A C     1 
ATOM   1525 O  O     . ILE A 1 187 ? 18.395  26.682 54.220  1.00 34.89  ? 187  ILE A O     1 
ATOM   1526 C  CB    . ILE A 1 187 ? 20.842  25.836 52.815  1.00 37.32  ? 187  ILE A CB    1 
ATOM   1527 C  CG1   . ILE A 1 187 ? 21.742  25.169 51.769  1.00 40.30  ? 187  ILE A CG1   1 
ATOM   1528 C  CG2   . ILE A 1 187 ? 21.610  26.078 54.108  1.00 34.68  ? 187  ILE A CG2   1 
ATOM   1529 C  CD1   . ILE A 1 187 ? 23.002  25.942 51.451  1.00 42.89  ? 187  ILE A CD1   1 
ATOM   1530 N  N     . TYR A 1 188 ? 18.421  24.634 55.159  1.00 39.91  ? 188  TYR A N     1 
ATOM   1531 C  CA    . TYR A 1 188 ? 17.429  24.930 56.188  1.00 38.25  ? 188  TYR A CA    1 
ATOM   1532 C  C     . TYR A 1 188 ? 18.056  25.376 57.507  1.00 38.08  ? 188  TYR A C     1 
ATOM   1533 O  O     . TYR A 1 188 ? 18.944  24.712 58.040  1.00 34.58  ? 188  TYR A O     1 
ATOM   1534 C  CB    . TYR A 1 188 ? 16.541  23.702 56.412  1.00 34.93  ? 188  TYR A CB    1 
ATOM   1535 C  CG    . TYR A 1 188 ? 15.558  23.841 57.550  1.00 34.55  ? 188  TYR A CG    1 
ATOM   1536 C  CD1   . TYR A 1 188 ? 14.459  24.683 57.443  1.00 32.15  ? 188  TYR A CD1   1 
ATOM   1537 C  CD2   . TYR A 1 188 ? 15.722  23.120 58.729  1.00 36.82  ? 188  TYR A CD2   1 
ATOM   1538 C  CE1   . TYR A 1 188 ? 13.552  24.810 58.476  1.00 34.50  ? 188  TYR A CE1   1 
ATOM   1539 C  CE2   . TYR A 1 188 ? 14.822  23.242 59.774  1.00 34.59  ? 188  TYR A CE2   1 
ATOM   1540 C  CZ    . TYR A 1 188 ? 13.738  24.090 59.640  1.00 37.14  ? 188  TYR A CZ    1 
ATOM   1541 O  OH    . TYR A 1 188 ? 12.833  24.220 60.667  1.00 38.96  ? 188  TYR A OH    1 
ATOM   1542 N  N     . MET A 1 189 ? 17.580  26.504 58.030  1.00 40.74  ? 189  MET A N     1 
ATOM   1543 C  CA    . MET A 1 189 ? 18.111  27.066 59.269  1.00 40.04  ? 189  MET A CA    1 
ATOM   1544 C  C     . MET A 1 189 ? 16.999  27.454 60.245  1.00 38.52  ? 189  MET A C     1 
ATOM   1545 O  O     . MET A 1 189 ? 16.284  28.430 60.019  1.00 37.23  ? 189  MET A O     1 
ATOM   1546 C  CB    . MET A 1 189 ? 18.981  28.286 58.962  1.00 40.72  ? 189  MET A CB    1 
ATOM   1547 C  CG    . MET A 1 189 ? 20.266  27.961 58.215  1.00 44.22  ? 189  MET A CG    1 
ATOM   1548 S  SD    . MET A 1 189 ? 20.957  29.401 57.376  1.00 44.58  ? 189  MET A SD    1 
ATOM   1549 C  CE    . MET A 1 189 ? 19.716  29.660 56.112  1.00 31.91  ? 189  MET A CE    1 
ATOM   1550 N  N     . PRO A 1 190 ? 16.850  26.682 61.334  1.00 39.92  ? 190  PRO A N     1 
ATOM   1551 C  CA    . PRO A 1 190 ? 15.866  26.967 62.384  1.00 42.79  ? 190  PRO A CA    1 
ATOM   1552 C  C     . PRO A 1 190 ? 16.424  27.915 63.449  1.00 43.24  ? 190  PRO A C     1 
ATOM   1553 O  O     . PRO A 1 190 ? 17.633  27.938 63.678  1.00 42.54  ? 190  PRO A O     1 
ATOM   1554 C  CB    . PRO A 1 190 ? 15.612  25.588 62.988  1.00 44.15  ? 190  PRO A CB    1 
ATOM   1555 C  CG    . PRO A 1 190 ? 16.920  24.887 62.840  1.00 43.46  ? 190  PRO A CG    1 
ATOM   1556 C  CD    . PRO A 1 190 ? 17.536  25.397 61.557  1.00 39.85  ? 190  PRO A CD    1 
ATOM   1557 N  N     . PHE A 1 191 ? 15.551  28.687 64.088  1.00 41.29  ? 191  PHE A N     1 
ATOM   1558 C  CA    . PHE A 1 191 ? 15.980  29.653 65.098  1.00 41.73  ? 191  PHE A CA    1 
ATOM   1559 C  C     . PHE A 1 191 ? 15.055  29.636 66.312  1.00 44.30  ? 191  PHE A C     1 
ATOM   1560 O  O     . PHE A 1 191 ? 13.851  29.415 66.176  1.00 45.24  ? 191  PHE A O     1 
ATOM   1561 C  CB    . PHE A 1 191 ? 16.045  31.062 64.499  1.00 39.37  ? 191  PHE A CB    1 
ATOM   1562 C  CG    . PHE A 1 191 ? 17.069  31.211 63.407  1.00 36.48  ? 191  PHE A CG    1 
ATOM   1563 C  CD1   . PHE A 1 191 ? 16.735  30.964 62.085  1.00 32.67  ? 191  PHE A CD1   1 
ATOM   1564 C  CD2   . PHE A 1 191 ? 18.366  31.600 63.704  1.00 36.79  ? 191  PHE A CD2   1 
ATOM   1565 C  CE1   . PHE A 1 191 ? 17.675  31.099 61.080  1.00 33.76  ? 191  PHE A CE1   1 
ATOM   1566 C  CE2   . PHE A 1 191 ? 19.311  31.738 62.704  1.00 36.48  ? 191  PHE A CE2   1 
ATOM   1567 C  CZ    . PHE A 1 191 ? 18.964  31.489 61.389  1.00 35.45  ? 191  PHE A CZ    1 
ATOM   1568 N  N     . ASP A 1 192 ? 15.620  29.874 67.494  1.00 43.55  ? 192  ASP A N     1 
ATOM   1569 C  CA    . ASP A 1 192 ? 14.848  29.825 68.735  1.00 47.34  ? 192  ASP A CA    1 
ATOM   1570 C  C     . ASP A 1 192 ? 14.230  31.170 69.128  1.00 48.20  ? 192  ASP A C     1 
ATOM   1571 O  O     . ASP A 1 192 ? 13.471  31.249 70.091  1.00 52.01  ? 192  ASP A O     1 
ATOM   1572 C  CB    . ASP A 1 192 ? 15.677  29.243 69.889  1.00 50.55  ? 192  ASP A CB    1 
ATOM   1573 C  CG    . ASP A 1 192 ? 17.002  29.966 70.097  1.00 54.62  ? 192  ASP A CG    1 
ATOM   1574 O  OD1   . ASP A 1 192 ? 17.085  31.189 69.851  1.00 52.59  ? 192  ASP A OD1   1 
ATOM   1575 O  OD2   . ASP A 1 192 ? 17.969  29.302 70.521  1.00 56.45  ? 192  ASP A OD2   1 
ATOM   1576 N  N     . ASN A 1 193 ? 14.580  32.223 68.396  1.00 45.77  ? 193  ASN A N     1 
ATOM   1577 C  CA    . ASN A 1 193 ? 13.878  33.503 68.493  1.00 49.07  ? 193  ASN A CA    1 
ATOM   1578 C  C     . ASN A 1 193 ? 14.156  34.419 67.301  1.00 46.83  ? 193  ASN A C     1 
ATOM   1579 O  O     . ASN A 1 193 ? 15.134  34.234 66.574  1.00 45.73  ? 193  ASN A O     1 
ATOM   1580 C  CB    . ASN A 1 193 ? 14.141  34.220 69.824  1.00 56.13  ? 193  ASN A CB    1 
ATOM   1581 C  CG    . ASN A 1 193 ? 15.609  34.331 70.150  1.00 61.07  ? 193  ASN A CG    1 
ATOM   1582 O  OD1   . ASN A 1 193 ? 16.352  35.047 69.481  1.00 63.92  ? 193  ASN A OD1   1 
ATOM   1583 N  ND2   . ASN A 1 193 ? 16.035  33.636 71.200  1.00 62.20  ? 193  ASN A ND2   1 
ATOM   1584 N  N     . GLU A 1 194 ? 13.280  35.400 67.112  1.00 43.67  ? 194  GLU A N     1 
ATOM   1585 C  CA    . GLU A 1 194 ? 13.288  36.245 65.923  1.00 40.82  ? 194  GLU A CA    1 
ATOM   1586 C  C     . GLU A 1 194 ? 14.561  37.076 65.754  1.00 39.26  ? 194  GLU A C     1 
ATOM   1587 O  O     . GLU A 1 194 ? 15.062  37.232 64.640  1.00 39.96  ? 194  GLU A O     1 
ATOM   1588 C  CB    . GLU A 1 194 ? 12.067  37.167 65.934  1.00 42.49  ? 194  GLU A CB    1 
ATOM   1589 C  CG    . GLU A 1 194 ? 11.895  37.988 64.671  1.00 39.08  ? 194  GLU A CG    1 
ATOM   1590 C  CD    . GLU A 1 194 ? 10.794  39.017 64.800  1.00 41.17  ? 194  GLU A CD    1 
ATOM   1591 O  OE1   . GLU A 1 194 ? 10.428  39.626 63.772  1.00 41.25  ? 194  GLU A OE1   1 
ATOM   1592 O  OE2   . GLU A 1 194 ? 10.297  39.219 65.928  1.00 40.50  ? 194  GLU A OE2   1 
ATOM   1593 N  N     . LYS A 1 195 ? 15.069  37.616 66.857  1.00 42.85  ? 195  LYS A N     1 
ATOM   1594 C  CA    . LYS A 1 195 ? 16.264  38.455 66.821  1.00 44.09  ? 195  LYS A CA    1 
ATOM   1595 C  C     . LYS A 1 195 ? 17.463  37.718 66.233  1.00 44.93  ? 195  LYS A C     1 
ATOM   1596 O  O     . LYS A 1 195 ? 18.236  38.288 65.465  1.00 45.54  ? 195  LYS A O     1 
ATOM   1597 C  CB    . LYS A 1 195 ? 16.601  38.974 68.219  1.00 44.77  ? 195  LYS A CB    1 
ATOM   1598 C  CG    . LYS A 1 195 ? 15.660  40.058 68.717  1.00 49.55  ? 195  LYS A CG    1 
ATOM   1599 N  N     . GLU A 1 196 ? 17.607  36.448 66.594  1.00 43.92  ? 196  GLU A N     1 
ATOM   1600 C  CA    . GLU A 1 196 ? 18.700  35.632 66.081  1.00 43.52  ? 196  GLU A CA    1 
ATOM   1601 C  C     . GLU A 1 196 ? 18.506  35.303 64.601  1.00 40.60  ? 196  GLU A C     1 
ATOM   1602 O  O     . GLU A 1 196 ? 19.476  35.224 63.846  1.00 40.79  ? 196  GLU A O     1 
ATOM   1603 C  CB    . GLU A 1 196 ? 18.853  34.353 66.908  1.00 40.57  ? 196  GLU A CB    1 
ATOM   1604 C  CG    . GLU A 1 196 ? 19.305  34.600 68.345  1.00 44.07  ? 196  GLU A CG    1 
ATOM   1605 C  CD    . GLU A 1 196 ? 19.224  33.354 69.216  1.00 47.52  ? 196  GLU A CD    1 
ATOM   1606 O  OE1   . GLU A 1 196 ? 19.505  32.247 68.714  1.00 46.37  ? 196  GLU A OE1   1 
ATOM   1607 O  OE2   . GLU A 1 196 ? 18.870  33.477 70.406  1.00 49.99  ? 196  GLU A OE2   1 
ATOM   1608 N  N     . LEU A 1 197 ? 17.255  35.116 64.191  1.00 36.98  ? 197  LEU A N     1 
ATOM   1609 C  CA    . LEU A 1 197 ? 16.939  34.876 62.787  1.00 34.58  ? 197  LEU A CA    1 
ATOM   1610 C  C     . LEU A 1 197 ? 17.330  36.093 61.958  1.00 34.40  ? 197  LEU A C     1 
ATOM   1611 O  O     . LEU A 1 197 ? 18.053  35.980 60.968  1.00 33.28  ? 197  LEU A O     1 
ATOM   1612 C  CB    . LEU A 1 197 ? 15.443  34.571 62.614  1.00 31.59  ? 197  LEU A CB    1 
ATOM   1613 C  CG    . LEU A 1 197 ? 14.898  34.191 61.227  1.00 35.68  ? 197  LEU A CG    1 
ATOM   1614 C  CD1   . LEU A 1 197 ? 13.649  33.326 61.364  1.00 33.76  ? 197  LEU A CD1   1 
ATOM   1615 C  CD2   . LEU A 1 197 ? 14.586  35.416 60.362  1.00 32.75  ? 197  LEU A CD2   1 
ATOM   1616 N  N     . LEU A 1 198 ? 16.841  37.257 62.374  1.00 39.52  ? 198  LEU A N     1 
ATOM   1617 C  CA    . LEU A 1 198 ? 17.052  38.494 61.634  1.00 36.33  ? 198  LEU A CA    1 
ATOM   1618 C  C     . LEU A 1 198 ? 18.521  38.891 61.575  1.00 37.15  ? 198  LEU A C     1 
ATOM   1619 O  O     . LEU A 1 198 ? 19.009  39.327 60.534  1.00 35.27  ? 198  LEU A O     1 
ATOM   1620 C  CB    . LEU A 1 198 ? 16.210  39.622 62.230  1.00 36.25  ? 198  LEU A CB    1 
ATOM   1621 C  CG    . LEU A 1 198 ? 14.705  39.476 61.993  1.00 34.01  ? 198  LEU A CG    1 
ATOM   1622 C  CD1   . LEU A 1 198 ? 13.928  40.572 62.703  1.00 34.42  ? 198  LEU A CD1   1 
ATOM   1623 C  CD2   . LEU A 1 198 ? 14.414  39.490 60.505  1.00 31.30  ? 198  LEU A CD2   1 
ATOM   1624 N  N     . MET A 1 199 ? 19.223  38.731 62.691  1.00 41.00  ? 199  MET A N     1 
ATOM   1625 C  CA    . MET A 1 199 ? 20.644  39.050 62.739  1.00 46.35  ? 199  MET A CA    1 
ATOM   1626 C  C     . MET A 1 199 ? 21.433  38.121 61.821  1.00 45.05  ? 199  MET A C     1 
ATOM   1627 O  O     . MET A 1 199 ? 22.350  38.554 61.123  1.00 41.30  ? 199  MET A O     1 
ATOM   1628 C  CB    . MET A 1 199 ? 21.177  38.967 64.172  1.00 48.45  ? 199  MET A CB    1 
ATOM   1629 C  CG    . MET A 1 199 ? 22.643  39.349 64.300  1.00 56.27  ? 199  MET A CG    1 
ATOM   1630 S  SD    . MET A 1 199 ? 23.036  40.882 63.425  1.00 83.33  ? 199  MET A SD    1 
ATOM   1631 C  CE    . MET A 1 199 ? 22.009  42.057 64.306  1.00 70.95  ? 199  MET A CE    1 
ATOM   1632 N  N     . GLU A 1 200 ? 21.068  36.843 61.822  1.00 43.96  ? 200  GLU A N     1 
ATOM   1633 C  CA    . GLU A 1 200 ? 21.704  35.877 60.937  1.00 47.18  ? 200  GLU A CA    1 
ATOM   1634 C  C     . GLU A 1 200 ? 21.392  36.191 59.474  1.00 46.73  ? 200  GLU A C     1 
ATOM   1635 O  O     . GLU A 1 200 ? 22.254  36.054 58.603  1.00 35.15  ? 200  GLU A O     1 
ATOM   1636 C  CB    . GLU A 1 200 ? 21.261  34.454 61.278  1.00 53.11  ? 200  GLU A CB    1 
ATOM   1637 C  CG    . GLU A 1 200 ? 21.834  33.396 60.352  1.00 62.86  ? 200  GLU A CG    1 
ATOM   1638 C  CD    . GLU A 1 200 ? 23.352  33.418 60.306  1.00 72.04  ? 200  GLU A CD    1 
ATOM   1639 O  OE1   . GLU A 1 200 ? 23.914  33.217 59.208  1.00 76.01  ? 200  GLU A OE1   1 
ATOM   1640 O  OE2   . GLU A 1 200 ? 23.981  33.631 61.366  1.00 72.44  ? 200  GLU A OE2   1 
ATOM   1641 N  N     . TYR A 1 201 ? 20.160  36.618 59.209  1.00 32.96  ? 201  TYR A N     1 
ATOM   1642 C  CA    . TYR A 1 201 ? 19.760  36.972 57.854  1.00 32.71  ? 201  TYR A CA    1 
ATOM   1643 C  C     . TYR A 1 201 ? 20.558  38.168 57.337  1.00 35.78  ? 201  TYR A C     1 
ATOM   1644 O  O     . TYR A 1 201 ? 20.913  38.224 56.161  1.00 36.16  ? 201  TYR A O     1 
ATOM   1645 C  CB    . TYR A 1 201 ? 18.258  37.257 57.779  1.00 31.58  ? 201  TYR A CB    1 
ATOM   1646 C  CG    . TYR A 1 201 ? 17.775  37.505 56.369  1.00 31.30  ? 201  TYR A CG    1 
ATOM   1647 C  CD1   . TYR A 1 201 ? 17.683  36.461 55.457  1.00 30.40  ? 201  TYR A CD1   1 
ATOM   1648 C  CD2   . TYR A 1 201 ? 17.419  38.779 55.946  1.00 31.70  ? 201  TYR A CD2   1 
ATOM   1649 C  CE1   . TYR A 1 201 ? 17.250  36.676 54.166  1.00 30.53  ? 201  TYR A CE1   1 
ATOM   1650 C  CE2   . TYR A 1 201 ? 16.980  39.005 54.652  1.00 32.59  ? 201  TYR A CE2   1 
ATOM   1651 C  CZ    . TYR A 1 201 ? 16.900  37.948 53.766  1.00 32.46  ? 201  TYR A CZ    1 
ATOM   1652 O  OH    . TYR A 1 201 ? 16.470  38.154 52.474  1.00 33.89  ? 201  TYR A OH    1 
ATOM   1653 N  N     . LEU A 1 202 ? 20.844  39.116 58.225  1.00 37.99  ? 202  LEU A N     1 
ATOM   1654 C  CA    . LEU A 1 202 ? 21.635  40.288 57.863  1.00 36.53  ? 202  LEU A CA    1 
ATOM   1655 C  C     . LEU A 1 202 ? 23.083  39.924 57.554  1.00 34.19  ? 202  LEU A C     1 
ATOM   1656 O  O     . LEU A 1 202 ? 23.677  40.459 56.620  1.00 35.76  ? 202  LEU A O     1 
ATOM   1657 C  CB    . LEU A 1 202 ? 21.585  41.340 58.969  1.00 37.63  ? 202  LEU A CB    1 
ATOM   1658 C  CG    . LEU A 1 202 ? 20.332  42.211 58.999  1.00 38.96  ? 202  LEU A CG    1 
ATOM   1659 C  CD1   . LEU A 1 202 ? 20.442  43.232 60.105  1.00 38.08  ? 202  LEU A CD1   1 
ATOM   1660 C  CD2   . LEU A 1 202 ? 20.127  42.896 57.658  1.00 36.61  ? 202  LEU A CD2   1 
ATOM   1661 N  N     . ASN A 1 203 ? 23.648  39.018 58.345  1.00 34.97  ? 203  ASN A N     1 
ATOM   1662 C  CA    . ASN A 1 203 ? 25.005  38.545 58.100  1.00 44.08  ? 203  ASN A CA    1 
ATOM   1663 C  C     . ASN A 1 203 ? 25.089  37.778 56.786  1.00 44.23  ? 203  ASN A C     1 
ATOM   1664 O  O     . ASN A 1 203 ? 26.062  37.898 56.042  1.00 41.11  ? 203  ASN A O     1 
ATOM   1665 C  CB    . ASN A 1 203 ? 25.494  37.677 59.258  1.00 51.62  ? 203  ASN A CB    1 
ATOM   1666 C  CG    . ASN A 1 203 ? 25.732  38.476 60.523  1.00 58.36  ? 203  ASN A CG    1 
ATOM   1667 O  OD1   . ASN A 1 203 ? 25.871  39.700 60.481  1.00 55.73  ? 203  ASN A OD1   1 
ATOM   1668 N  ND2   . ASN A 1 203 ? 25.791  37.787 61.658  1.00 61.63  ? 203  ASN A ND2   1 
ATOM   1669 N  N     . PHE A 1 204 ? 24.052  36.994 56.510  1.00 42.49  ? 204  PHE A N     1 
ATOM   1670 C  CA    . PHE A 1 204 ? 23.924  36.270 55.252  1.00 38.46  ? 204  PHE A CA    1 
ATOM   1671 C  C     . PHE A 1 204 ? 23.811  37.249 54.084  1.00 40.13  ? 204  PHE A C     1 
ATOM   1672 O  O     . PHE A 1 204 ? 24.441  37.066 53.043  1.00 43.83  ? 204  PHE A O     1 
ATOM   1673 C  CB    . PHE A 1 204 ? 22.698  35.356 55.325  1.00 36.66  ? 204  PHE A CB    1 
ATOM   1674 C  CG    . PHE A 1 204 ? 22.188  34.887 53.990  1.00 34.66  ? 204  PHE A CG    1 
ATOM   1675 C  CD1   . PHE A 1 204 ? 22.733  33.769 53.379  1.00 37.88  ? 204  PHE A CD1   1 
ATOM   1676 C  CD2   . PHE A 1 204 ? 21.133  35.536 53.370  1.00 32.72  ? 204  PHE A CD2   1 
ATOM   1677 C  CE1   . PHE A 1 204 ? 22.249  33.325 52.162  1.00 35.88  ? 204  PHE A CE1   1 
ATOM   1678 C  CE2   . PHE A 1 204 ? 20.646  35.099 52.152  1.00 32.80  ? 204  PHE A CE2   1 
ATOM   1679 C  CZ    . PHE A 1 204 ? 21.206  33.991 51.547  1.00 32.68  ? 204  PHE A CZ    1 
ATOM   1680 N  N     . TRP A 1 205 ? 23.005  38.290 54.276  1.00 35.67  ? 205  TRP A N     1 
ATOM   1681 C  CA    . TRP A 1 205 ? 22.801  39.332 53.276  1.00 34.43  ? 205  TRP A CA    1 
ATOM   1682 C  C     . TRP A 1 205 ? 24.111  40.033 52.914  1.00 37.86  ? 205  TRP A C     1 
ATOM   1683 O  O     . TRP A 1 205 ? 24.344  40.360 51.753  1.00 38.41  ? 205  TRP A O     1 
ATOM   1684 C  CB    . TRP A 1 205 ? 21.784  40.351 53.798  1.00 33.36  ? 205  TRP A CB    1 
ATOM   1685 C  CG    . TRP A 1 205 ? 21.345  41.391 52.804  1.00 32.70  ? 205  TRP A CG    1 
ATOM   1686 C  CD1   . TRP A 1 205 ? 22.034  42.506 52.423  1.00 32.84  ? 205  TRP A CD1   1 
ATOM   1687 C  CD2   . TRP A 1 205 ? 20.098  41.430 52.096  1.00 33.02  ? 205  TRP A CD2   1 
ATOM   1688 N  NE1   . TRP A 1 205 ? 21.302  43.226 51.508  1.00 31.21  ? 205  TRP A NE1   1 
ATOM   1689 C  CE2   . TRP A 1 205 ? 20.108  42.588 51.293  1.00 31.86  ? 205  TRP A CE2   1 
ATOM   1690 C  CE3   . TRP A 1 205 ? 18.978  40.594 52.057  1.00 29.84  ? 205  TRP A CE3   1 
ATOM   1691 C  CZ2   . TRP A 1 205 ? 19.043  42.933 50.462  1.00 32.09  ? 205  TRP A CZ2   1 
ATOM   1692 C  CZ3   . TRP A 1 205 ? 17.919  40.938 51.231  1.00 31.79  ? 205  TRP A CZ3   1 
ATOM   1693 C  CH2   . TRP A 1 205 ? 17.960  42.097 50.445  1.00 32.08  ? 205  TRP A CH2   1 
ATOM   1694 N  N     . GLN A 1 206 ? 24.967  40.260 53.905  1.00 35.69  ? 206  GLN A N     1 
ATOM   1695 C  CA    . GLN A 1 206 ? 26.247  40.926 53.664  1.00 45.53  ? 206  GLN A CA    1 
ATOM   1696 C  C     . GLN A 1 206 ? 27.223  40.059 52.870  1.00 45.47  ? 206  GLN A C     1 
ATOM   1697 O  O     . GLN A 1 206 ? 27.976  40.568 52.041  1.00 45.36  ? 206  GLN A O     1 
ATOM   1698 C  CB    . GLN A 1 206 ? 26.885  41.378 54.980  1.00 54.12  ? 206  GLN A CB    1 
ATOM   1699 C  CG    . GLN A 1 206 ? 26.166  42.542 55.639  1.00 60.63  ? 206  GLN A CG    1 
ATOM   1700 C  CD    . GLN A 1 206 ? 26.929  43.108 56.821  1.00 67.16  ? 206  GLN A CD    1 
ATOM   1701 O  OE1   . GLN A 1 206 ? 26.573  44.158 57.358  1.00 67.21  ? 206  GLN A OE1   1 
ATOM   1702 N  NE2   . GLN A 1 206 ? 27.986  42.413 57.233  1.00 70.62  ? 206  GLN A NE2   1 
ATOM   1703 N  N     . GLN A 1 207 ? 27.205  38.754 53.126  1.00 43.54  ? 207  GLN A N     1 
ATOM   1704 C  CA    . GLN A 1 207 ? 28.044  37.816 52.385  1.00 47.10  ? 207  GLN A CA    1 
ATOM   1705 C  C     . GLN A 1 207 ? 27.563  37.670 50.947  1.00 42.35  ? 207  GLN A C     1 
ATOM   1706 O  O     . GLN A 1 207 ? 28.364  37.538 50.022  1.00 44.97  ? 207  GLN A O     1 
ATOM   1707 C  CB    . GLN A 1 207 ? 28.034  36.436 53.047  1.00 53.60  ? 207  GLN A CB    1 
ATOM   1708 C  CG    . GLN A 1 207 ? 28.673  36.371 54.419  1.00 63.38  ? 207  GLN A CG    1 
ATOM   1709 C  CD    . GLN A 1 207 ? 28.694  34.958 54.971  1.00 74.07  ? 207  GLN A CD    1 
ATOM   1710 O  OE1   . GLN A 1 207 ? 28.186  34.027 54.343  1.00 76.09  ? 207  GLN A OE1   1 
ATOM   1711 N  NE2   . GLN A 1 207 ? 29.285  34.788 56.148  1.00 79.94  ? 207  GLN A NE2   1 
ATOM   1712 N  N     . LYS A 1 208 ? 26.247  37.681 50.771  1.00 39.54  ? 208  LYS A N     1 
ATOM   1713 C  CA    . LYS A 1 208 ? 25.643  37.449 49.465  1.00 39.10  ? 208  LYS A CA    1 
ATOM   1714 C  C     . LYS A 1 208 ? 24.687  38.578 49.108  1.00 38.30  ? 208  LYS A C     1 
ATOM   1715 O  O     . LYS A 1 208 ? 23.481  38.364 48.956  1.00 36.44  ? 208  LYS A O     1 
ATOM   1716 C  CB    . LYS A 1 208 ? 24.905  36.110 49.459  1.00 38.49  ? 208  LYS A CB    1 
ATOM   1717 C  CG    . LYS A 1 208 ? 25.766  34.938 49.920  1.00 41.36  ? 208  LYS A CG    1 
ATOM   1718 C  CD    . LYS A 1 208 ? 24.941  33.679 50.097  1.00 39.30  ? 208  LYS A CD    1 
ATOM   1719 C  CE    . LYS A 1 208 ? 25.737  32.596 50.810  1.00 40.86  ? 208  LYS A CE    1 
ATOM   1720 N  NZ    . LYS A 1 208 ? 26.886  32.140 49.989  1.00 39.15  ? 208  LYS A NZ    1 
ATOM   1721 N  N     . THR A 1 209 ? 25.234  39.782 48.975  1.00 34.00  ? 209  THR A N     1 
ATOM   1722 C  CA    . THR A 1 209 ? 24.425  40.968 48.727  1.00 34.71  ? 209  THR A CA    1 
ATOM   1723 C  C     . THR A 1 209 ? 23.858  40.964 47.320  1.00 34.34  ? 209  THR A C     1 
ATOM   1724 O  O     . THR A 1 209 ? 24.609  40.982 46.346  1.00 37.05  ? 209  THR A O     1 
ATOM   1725 C  CB    . THR A 1 209 ? 25.233  42.254 48.953  1.00 37.19  ? 209  THR A CB    1 
ATOM   1726 O  OG1   . THR A 1 209 ? 25.805  42.230 50.266  1.00 40.97  ? 209  THR A OG1   1 
ATOM   1727 C  CG2   . THR A 1 209 ? 24.337  43.476 48.816  1.00 27.70  ? 209  THR A CG2   1 
ATOM   1728 N  N     . PRO A 1 210 ? 22.521  40.934 47.215  1.00 34.11  ? 210  PRO A N     1 
ATOM   1729 C  CA    . PRO A 1 210 ? 21.812  40.892 45.934  1.00 33.95  ? 210  PRO A CA    1 
ATOM   1730 C  C     . PRO A 1 210 ? 22.182  42.077 45.057  1.00 32.14  ? 210  PRO A C     1 
ATOM   1731 O  O     . PRO A 1 210 ? 22.349  43.185 45.564  1.00 31.29  ? 210  PRO A O     1 
ATOM   1732 C  CB    . PRO A 1 210 ? 20.340  41.002 46.347  1.00 31.31  ? 210  PRO A CB    1 
ATOM   1733 C  CG    . PRO A 1 210 ? 20.302  40.499 47.748  1.00 30.10  ? 210  PRO A CG    1 
ATOM   1734 C  CD    . PRO A 1 210 ? 21.592  40.951 48.357  1.00 33.91  ? 210  PRO A CD    1 
ATOM   1735 N  N     . VAL A 1 211 ? 22.331  41.835 43.760  1.00 29.43  ? 211  VAL A N     1 
ATOM   1736 C  CA    . VAL A 1 211 ? 22.457  42.916 42.795  1.00 29.43  ? 211  VAL A CA    1 
ATOM   1737 C  C     . VAL A 1 211 ? 21.063  43.181 42.247  1.00 29.77  ? 211  VAL A C     1 
ATOM   1738 O  O     . VAL A 1 211 ? 20.560  44.302 42.300  1.00 29.76  ? 211  VAL A O     1 
ATOM   1739 C  CB    . VAL A 1 211 ? 23.417  42.553 41.649  1.00 29.03  ? 211  VAL A CB    1 
ATOM   1740 C  CG1   . VAL A 1 211 ? 23.290  43.554 40.512  1.00 29.70  ? 211  VAL A CG1   1 
ATOM   1741 C  CG2   . VAL A 1 211 ? 24.855  42.489 42.159  1.00 27.54  ? 211  VAL A CG2   1 
ATOM   1742 N  N     . ILE A 1 212 ? 20.440  42.130 41.729  1.00 28.31  ? 212  ILE A N     1 
ATOM   1743 C  CA    . ILE A 1 212 ? 19.036  42.180 41.360  1.00 28.28  ? 212  ILE A CA    1 
ATOM   1744 C  C     . ILE A 1 212 ? 18.228  41.538 42.478  1.00 30.86  ? 212  ILE A C     1 
ATOM   1745 O  O     . ILE A 1 212 ? 18.500  40.405 42.877  1.00 30.19  ? 212  ILE A O     1 
ATOM   1746 C  CB    . ILE A 1 212 ? 18.766  41.425 40.049  1.00 28.84  ? 212  ILE A CB    1 
ATOM   1747 C  CG1   . ILE A 1 212 ? 19.666  41.957 38.932  1.00 27.27  ? 212  ILE A CG1   1 
ATOM   1748 C  CG2   . ILE A 1 212 ? 17.294  41.537 39.664  1.00 30.42  ? 212  ILE A CG2   1 
ATOM   1749 C  CD1   . ILE A 1 212 ? 19.512  43.444 38.673  1.00 26.16  ? 212  ILE A CD1   1 
ATOM   1750 N  N     . LEU A 1 213 ? 17.248  42.270 42.995  1.00 29.65  ? 213  LEU A N     1 
ATOM   1751 C  CA    . LEU A 1 213 ? 16.385  41.750 44.047  1.00 27.05  ? 213  LEU A CA    1 
ATOM   1752 C  C     . LEU A 1 213 ? 14.955  41.634 43.533  1.00 29.93  ? 213  LEU A C     1 
ATOM   1753 O  O     . LEU A 1 213 ? 14.365  42.619 43.088  1.00 29.39  ? 213  LEU A O     1 
ATOM   1754 C  CB    . LEU A 1 213 ? 16.436  42.659 45.276  1.00 24.48  ? 213  LEU A CB    1 
ATOM   1755 C  CG    . LEU A 1 213 ? 15.716  42.159 46.530  1.00 29.27  ? 213  LEU A CG    1 
ATOM   1756 C  CD1   . LEU A 1 213 ? 16.245  40.796 46.931  1.00 27.47  ? 213  LEU A CD1   1 
ATOM   1757 C  CD2   . LEU A 1 213 ? 15.876  43.157 47.671  1.00 31.96  ? 213  LEU A CD2   1 
ATOM   1758 N  N     . THR A 1 214 ? 14.401  40.429 43.586  1.00 27.70  ? 214  THR A N     1 
ATOM   1759 C  CA    . THR A 1 214 ? 13.063  40.205 43.055  1.00 28.22  ? 214  THR A CA    1 
ATOM   1760 C  C     . THR A 1 214 ? 12.238  39.256 43.923  1.00 28.16  ? 214  THR A C     1 
ATOM   1761 O  O     . THR A 1 214 ? 12.647  38.880 45.024  1.00 27.38  ? 214  THR A O     1 
ATOM   1762 C  CB    . THR A 1 214 ? 13.105  39.706 41.586  1.00 30.10  ? 214  THR A CB    1 
ATOM   1763 O  OG1   . THR A 1 214 ? 11.773  39.637 41.058  1.00 30.83  ? 214  THR A OG1   1 
ATOM   1764 C  CG2   . THR A 1 214 ? 13.763  38.342 41.494  1.00 27.39  ? 214  THR A CG2   1 
ATOM   1765 N  N     . GLY A 1 215 ? 11.070  38.880 43.416  1.00 29.04  ? 215  GLY A N     1 
ATOM   1766 C  CA    . GLY A 1 215 ? 10.109  38.105 44.178  1.00 28.74  ? 215  GLY A CA    1 
ATOM   1767 C  C     . GLY A 1 215 ? 8.727   38.650 43.882  1.00 27.03  ? 215  GLY A C     1 
ATOM   1768 O  O     . GLY A 1 215 ? 8.560   39.411 42.934  1.00 28.97  ? 215  GLY A O     1 
ATOM   1769 N  N     . TRP A 1 216 ? 7.738   38.274 44.687  1.00 26.15  ? 216  TRP A N     1 
ATOM   1770 C  CA    . TRP A 1 216 ? 6.363   38.692 44.433  1.00 28.78  ? 216  TRP A CA    1 
ATOM   1771 C  C     . TRP A 1 216 ? 5.876   39.705 45.467  1.00 28.75  ? 216  TRP A C     1 
ATOM   1772 O  O     . TRP A 1 216 ? 5.767   39.391 46.652  1.00 28.50  ? 216  TRP A O     1 
ATOM   1773 C  CB    . TRP A 1 216 ? 5.429   37.479 44.380  1.00 28.48  ? 216  TRP A CB    1 
ATOM   1774 C  CG    . TRP A 1 216 ? 4.144   37.756 43.647  1.00 29.90  ? 216  TRP A CG    1 
ATOM   1775 C  CD1   . TRP A 1 216 ? 2.923   38.022 44.198  1.00 29.48  ? 216  TRP A CD1   1 
ATOM   1776 C  CD2   . TRP A 1 216 ? 3.962   37.803 42.227  1.00 26.85  ? 216  TRP A CD2   1 
ATOM   1777 N  NE1   . TRP A 1 216 ? 1.991   38.230 43.207  1.00 31.14  ? 216  TRP A NE1   1 
ATOM   1778 C  CE2   . TRP A 1 216 ? 2.604   38.100 41.988  1.00 31.17  ? 216  TRP A CE2   1 
ATOM   1779 C  CE3   . TRP A 1 216 ? 4.814   37.621 41.133  1.00 30.54  ? 216  TRP A CE3   1 
ATOM   1780 C  CZ2   . TRP A 1 216 ? 2.081   38.221 40.703  1.00 33.54  ? 216  TRP A CZ2   1 
ATOM   1781 C  CZ3   . TRP A 1 216 ? 4.293   37.742 39.857  1.00 35.18  ? 216  TRP A CZ3   1 
ATOM   1782 C  CH2   . TRP A 1 216 ? 2.939   38.039 39.653  1.00 35.83  ? 216  TRP A CH2   1 
ATOM   1783 N  N     . ASN A 1 217 ? 5.584   40.919 45.001  1.00 28.39  ? 217  ASN A N     1 
ATOM   1784 C  CA    . ASN A 1 217 ? 5.227   42.043 45.873  1.00 27.54  ? 217  ASN A CA    1 
ATOM   1785 C  C     . ASN A 1 217 ? 6.326   42.443 46.854  1.00 27.21  ? 217  ASN A C     1 
ATOM   1786 O  O     . ASN A 1 217 ? 6.045   43.033 47.897  1.00 30.95  ? 217  ASN A O     1 
ATOM   1787 C  CB    . ASN A 1 217 ? 3.921   41.782 46.633  1.00 31.92  ? 217  ASN A CB    1 
ATOM   1788 C  CG    . ASN A 1 217 ? 2.696   42.008 45.777  1.00 42.18  ? 217  ASN A CG    1 
ATOM   1789 O  OD1   . ASN A 1 217 ? 1.837   41.134 45.658  1.00 50.56  ? 217  ASN A OD1   1 
ATOM   1790 N  ND2   . ASN A 1 217 ? 2.608   43.187 45.174  1.00 41.91  ? 217  ASN A ND2   1 
ATOM   1791 N  N     . VAL A 1 218 ? 7.575   42.131 46.517  1.00 26.37  ? 218  VAL A N     1 
ATOM   1792 C  CA    . VAL A 1 218 ? 8.690   42.419 47.417  1.00 28.26  ? 218  VAL A CA    1 
ATOM   1793 C  C     . VAL A 1 218 ? 8.864   43.913 47.689  1.00 30.76  ? 218  VAL A C     1 
ATOM   1794 O  O     . VAL A 1 218 ? 9.257   44.304 48.785  1.00 34.39  ? 218  VAL A O     1 
ATOM   1795 C  CB    . VAL A 1 218 ? 10.023  41.810 46.922  1.00 26.70  ? 218  VAL A CB    1 
ATOM   1796 C  CG1   . VAL A 1 218 ? 9.996   40.292 47.066  1.00 25.09  ? 218  VAL A CG1   1 
ATOM   1797 C  CG2   . VAL A 1 218 ? 10.314  42.220 45.482  1.00 28.07  ? 218  VAL A CG2   1 
ATOM   1798 N  N     . GLU A 1 219 ? 8.554   44.747 46.701  1.00 30.33  ? 219  GLU A N     1 
ATOM   1799 C  CA    . GLU A 1 219 ? 8.734   46.186 46.860  1.00 35.17  ? 219  GLU A CA    1 
ATOM   1800 C  C     . GLU A 1 219 ? 7.681   46.800 47.780  1.00 34.63  ? 219  GLU A C     1 
ATOM   1801 O  O     . GLU A 1 219 ? 7.973   47.720 48.542  1.00 35.46  ? 219  GLU A O     1 
ATOM   1802 C  CB    . GLU A 1 219 ? 8.737   46.895 45.502  1.00 38.29  ? 219  GLU A CB    1 
ATOM   1803 C  CG    . GLU A 1 219 ? 8.967   48.398 45.603  1.00 47.42  ? 219  GLU A CG    1 
ATOM   1804 C  CD    . GLU A 1 219 ? 9.157   49.060 44.252  1.00 53.93  ? 219  GLU A CD    1 
ATOM   1805 O  OE1   . GLU A 1 219 ? 8.170   49.598 43.707  1.00 53.94  ? 219  GLU A OE1   1 
ATOM   1806 O  OE2   . GLU A 1 219 ? 10.296  49.045 43.739  1.00 57.56  ? 219  GLU A OE2   1 
ATOM   1807 N  N     . SER A 1 220 ? 6.460   46.280 47.716  1.00 32.04  ? 220  SER A N     1 
ATOM   1808 C  CA    . SER A 1 220 ? 5.364   46.836 48.502  1.00 34.84  ? 220  SER A CA    1 
ATOM   1809 C  C     . SER A 1 220 ? 5.157   46.130 49.842  1.00 34.14  ? 220  SER A C     1 
ATOM   1810 O  O     . SER A 1 220 ? 4.511   46.673 50.735  1.00 35.67  ? 220  SER A O     1 
ATOM   1811 C  CB    . SER A 1 220 ? 4.064   46.828 47.693  1.00 39.89  ? 220  SER A CB    1 
ATOM   1812 O  OG    . SER A 1 220 ? 3.699   45.507 47.336  1.00 43.97  ? 220  SER A OG    1 
ATOM   1813 N  N     . PHE A 1 221 ? 5.697   44.924 49.989  1.00 35.45  ? 221  PHE A N     1 
ATOM   1814 C  CA    . PHE A 1 221 ? 5.543   44.204 51.253  1.00 36.53  ? 221  PHE A CA    1 
ATOM   1815 C  C     . PHE A 1 221 ? 6.846   43.705 51.877  1.00 33.98  ? 221  PHE A C     1 
ATOM   1816 O  O     . PHE A 1 221 ? 7.260   44.202 52.922  1.00 36.65  ? 221  PHE A O     1 
ATOM   1817 C  CB    . PHE A 1 221 ? 4.550   43.045 51.127  1.00 36.99  ? 221  PHE A CB    1 
ATOM   1818 C  CG    . PHE A 1 221 ? 4.341   42.298 52.414  1.00 36.18  ? 221  PHE A CG    1 
ATOM   1819 C  CD1   . PHE A 1 221 ? 4.936   41.065 52.624  1.00 32.57  ? 221  PHE A CD1   1 
ATOM   1820 C  CD2   . PHE A 1 221 ? 3.573   42.849 53.428  1.00 37.27  ? 221  PHE A CD2   1 
ATOM   1821 C  CE1   . PHE A 1 221 ? 4.757   40.387 53.816  1.00 35.35  ? 221  PHE A CE1   1 
ATOM   1822 C  CE2   . PHE A 1 221 ? 3.388   42.175 54.621  1.00 36.61  ? 221  PHE A CE2   1 
ATOM   1823 C  CZ    . PHE A 1 221 ? 3.981   40.942 54.815  1.00 34.20  ? 221  PHE A CZ    1 
ATOM   1824 N  N     . ALA A 1 222 ? 7.474   42.719 51.241  1.00 31.43  ? 222  ALA A N     1 
ATOM   1825 C  CA    . ALA A 1 222 ? 8.642   42.043 51.805  1.00 32.87  ? 222  ALA A CA    1 
ATOM   1826 C  C     . ALA A 1 222 ? 9.763   42.998 52.220  1.00 31.64  ? 222  ALA A C     1 
ATOM   1827 O  O     . ALA A 1 222 ? 10.196  42.988 53.372  1.00 29.55  ? 222  ALA A O     1 
ATOM   1828 C  CB    . ALA A 1 222 ? 9.173   40.985 50.838  1.00 26.95  ? 222  ALA A CB    1 
ATOM   1829 N  N     . ILE A 1 223 ? 10.228  43.819 51.286  1.00 26.77  ? 223  ILE A N     1 
ATOM   1830 C  CA    . ILE A 1 223 ? 11.309  44.757 51.584  1.00 28.97  ? 223  ILE A CA    1 
ATOM   1831 C  C     . ILE A 1 223 ? 10.952  45.775 52.682  1.00 30.76  ? 223  ILE A C     1 
ATOM   1832 O  O     . ILE A 1 223 ? 11.694  45.900 53.658  1.00 33.45  ? 223  ILE A O     1 
ATOM   1833 C  CB    . ILE A 1 223 ? 11.844  45.464 50.313  1.00 28.92  ? 223  ILE A CB    1 
ATOM   1834 C  CG1   . ILE A 1 223 ? 12.377  44.430 49.316  1.00 27.82  ? 223  ILE A CG1   1 
ATOM   1835 C  CG2   . ILE A 1 223 ? 12.926  46.469 50.680  1.00 28.31  ? 223  ILE A CG2   1 
ATOM   1836 C  CD1   . ILE A 1 223 ? 12.727  45.007 47.960  1.00 26.62  ? 223  ILE A CD1   1 
ATOM   1837 N  N     . PRO A 1 224 ? 9.817   46.493 52.545  1.00 32.40  ? 224  PRO A N     1 
ATOM   1838 C  CA    . PRO A 1 224 ? 9.516   47.436 53.629  1.00 33.34  ? 224  PRO A CA    1 
ATOM   1839 C  C     . PRO A 1 224 ? 9.210   46.757 54.965  1.00 34.88  ? 224  PRO A C     1 
ATOM   1840 O  O     . PRO A 1 224 ? 9.476   47.353 56.011  1.00 33.55  ? 224  PRO A O     1 
ATOM   1841 C  CB    . PRO A 1 224 ? 8.286   48.190 53.113  1.00 32.15  ? 224  PRO A CB    1 
ATOM   1842 C  CG    . PRO A 1 224 ? 7.679   47.289 52.099  1.00 34.46  ? 224  PRO A CG    1 
ATOM   1843 C  CD    . PRO A 1 224 ? 8.829   46.586 51.453  1.00 31.10  ? 224  PRO A CD    1 
ATOM   1844 N  N     . TYR A 1 225 ? 8.669   45.542 54.944  1.00 30.92  ? 225  TYR A N     1 
ATOM   1845 C  CA    . TYR A 1 225 ? 8.406   44.858 56.204  1.00 34.27  ? 225  TYR A CA    1 
ATOM   1846 C  C     . TYR A 1 225 ? 9.712   44.477 56.893  1.00 34.61  ? 225  TYR A C     1 
ATOM   1847 O  O     . TYR A 1 225 ? 9.879   44.721 58.087  1.00 36.07  ? 225  TYR A O     1 
ATOM   1848 C  CB    . TYR A 1 225 ? 7.507   43.626 56.040  1.00 31.19  ? 225  TYR A CB    1 
ATOM   1849 C  CG    . TYR A 1 225 ? 6.856   43.235 57.350  1.00 33.41  ? 225  TYR A CG    1 
ATOM   1850 C  CD1   . TYR A 1 225 ? 7.568   42.540 58.324  1.00 32.97  ? 225  TYR A CD1   1 
ATOM   1851 C  CD2   . TYR A 1 225 ? 5.544   43.594 57.631  1.00 34.63  ? 225  TYR A CD2   1 
ATOM   1852 C  CE1   . TYR A 1 225 ? 6.986   42.203 59.532  1.00 34.82  ? 225  TYR A CE1   1 
ATOM   1853 C  CE2   . TYR A 1 225 ? 4.953   43.258 58.836  1.00 38.85  ? 225  TYR A CE2   1 
ATOM   1854 C  CZ    . TYR A 1 225 ? 5.679   42.564 59.783  1.00 39.55  ? 225  TYR A CZ    1 
ATOM   1855 O  OH    . TYR A 1 225 ? 5.095   42.229 60.984  1.00 42.82  ? 225  TYR A OH    1 
ATOM   1856 N  N     . VAL A 1 226 ? 10.628  43.877 56.138  1.00 34.24  ? 226  VAL A N     1 
ATOM   1857 C  CA    . VAL A 1 226 ? 11.923  43.479 56.682  1.00 33.02  ? 226  VAL A CA    1 
ATOM   1858 C  C     . VAL A 1 226 ? 12.692  44.689 57.211  1.00 31.47  ? 226  VAL A C     1 
ATOM   1859 O  O     . VAL A 1 226 ? 13.239  44.654 58.313  1.00 31.89  ? 226  VAL A O     1 
ATOM   1860 C  CB    . VAL A 1 226 ? 12.777  42.736 55.633  1.00 32.00  ? 226  VAL A CB    1 
ATOM   1861 C  CG1   . VAL A 1 226 ? 14.194  42.537 56.142  1.00 29.97  ? 226  VAL A CG1   1 
ATOM   1862 C  CG2   . VAL A 1 226 ? 12.143  41.394 55.278  1.00 34.87  ? 226  VAL A CG2   1 
ATOM   1863 N  N     . TYR A 1 227 ? 12.717  45.761 56.426  1.00 33.38  ? 227  TYR A N     1 
ATOM   1864 C  CA    . TYR A 1 227 ? 13.438  46.970 56.810  1.00 31.82  ? 227  TYR A CA    1 
ATOM   1865 C  C     . TYR A 1 227 ? 12.895  47.561 58.106  1.00 32.85  ? 227  TYR A C     1 
ATOM   1866 O  O     . TYR A 1 227 ? 13.657  47.894 59.014  1.00 35.21  ? 227  TYR A O     1 
ATOM   1867 C  CB    . TYR A 1 227 ? 13.379  48.014 55.693  1.00 33.03  ? 227  TYR A CB    1 
ATOM   1868 C  CG    . TYR A 1 227 ? 14.164  49.270 55.999  1.00 38.47  ? 227  TYR A CG    1 
ATOM   1869 C  CD1   . TYR A 1 227 ? 15.545  49.295 55.860  1.00 38.88  ? 227  TYR A CD1   1 
ATOM   1870 C  CD2   . TYR A 1 227 ? 13.527  50.428 56.426  1.00 43.92  ? 227  TYR A CD2   1 
ATOM   1871 C  CE1   . TYR A 1 227 ? 16.271  50.432 56.138  1.00 42.76  ? 227  TYR A CE1   1 
ATOM   1872 C  CE2   . TYR A 1 227 ? 14.248  51.576 56.707  1.00 47.64  ? 227  TYR A CE2   1 
ATOM   1873 C  CZ    . TYR A 1 227 ? 15.620  51.570 56.560  1.00 47.99  ? 227  TYR A CZ    1 
ATOM   1874 O  OH    . TYR A 1 227 ? 16.351  52.703 56.832  1.00 51.71  ? 227  TYR A OH    1 
ATOM   1875 N  N     . ASN A 1 228 ? 11.574  47.682 58.191  1.00 30.02  ? 228  ASN A N     1 
ATOM   1876 C  CA    . ASN A 1 228 ? 10.940  48.278 59.362  1.00 35.33  ? 228  ASN A CA    1 
ATOM   1877 C  C     . ASN A 1 228 ? 10.968  47.385 60.598  1.00 36.67  ? 228  ASN A C     1 
ATOM   1878 O  O     . ASN A 1 228 ? 11.052  47.883 61.721  1.00 38.02  ? 228  ASN A O     1 
ATOM   1879 C  CB    . ASN A 1 228 ? 9.507   48.709 59.042  1.00 36.08  ? 228  ASN A CB    1 
ATOM   1880 C  CG    . ASN A 1 228 ? 9.454   50.008 58.262  1.00 38.62  ? 228  ASN A CG    1 
ATOM   1881 O  OD1   . ASN A 1 228 ? 10.011  51.019 58.688  1.00 41.08  ? 228  ASN A OD1   1 
ATOM   1882 N  ND2   . ASN A 1 228 ? 8.794   49.985 57.109  1.00 36.22  ? 228  ASN A ND2   1 
ATOM   1883 N  N     . ARG A 1 229 ? 10.895  46.071 60.391  1.00 34.34  ? 229  ARG A N     1 
ATOM   1884 C  CA    . ARG A 1 229 ? 10.959  45.128 61.503  1.00 31.94  ? 229  ARG A CA    1 
ATOM   1885 C  C     . ARG A 1 229 ? 12.341  45.182 62.141  1.00 32.43  ? 229  ARG A C     1 
ATOM   1886 O  O     . ARG A 1 229 ? 12.470  45.229 63.362  1.00 34.10  ? 229  ARG A O     1 
ATOM   1887 C  CB    . ARG A 1 229 ? 10.647  43.705 61.030  1.00 35.95  ? 229  ARG A CB    1 
ATOM   1888 C  CG    . ARG A 1 229 ? 10.528  42.682 62.153  1.00 35.59  ? 229  ARG A CG    1 
ATOM   1889 C  CD    . ARG A 1 229 ? 9.386   43.024 63.098  1.00 36.94  ? 229  ARG A CD    1 
ATOM   1890 N  NE    . ARG A 1 229 ? 9.265   42.062 64.191  1.00 37.54  ? 229  ARG A NE    1 
ATOM   1891 C  CZ    . ARG A 1 229 ? 8.437   42.202 65.221  1.00 39.90  ? 229  ARG A CZ    1 
ATOM   1892 N  NH1   . ARG A 1 229 ? 7.655   43.269 65.306  1.00 41.34  ? 229  ARG A NH1   1 
ATOM   1893 N  NH2   . ARG A 1 229 ? 8.393   41.277 66.171  1.00 39.68  ? 229  ARG A NH2   1 
ATOM   1894 N  N     . ILE A 1 230 ? 13.372  45.184 61.303  1.00 37.71  ? 230  ILE A N     1 
ATOM   1895 C  CA    . ILE A 1 230 ? 14.747  45.264 61.780  1.00 37.79  ? 230  ILE A CA    1 
ATOM   1896 C  C     . ILE A 1 230 ? 15.022  46.625 62.415  1.00 42.51  ? 230  ILE A C     1 
ATOM   1897 O  O     . ILE A 1 230 ? 15.708  46.713 63.437  1.00 44.30  ? 230  ILE A O     1 
ATOM   1898 C  CB    . ILE A 1 230 ? 15.763  44.981 60.650  1.00 34.83  ? 230  ILE A CB    1 
ATOM   1899 C  CG1   . ILE A 1 230 ? 15.641  43.528 60.184  1.00 32.18  ? 230  ILE A CG1   1 
ATOM   1900 C  CG2   . ILE A 1 230 ? 17.185  45.264 61.114  1.00 35.75  ? 230  ILE A CG2   1 
ATOM   1901 C  CD1   . ILE A 1 230 ? 16.639  43.133 59.115  1.00 28.65  ? 230  ILE A CD1   1 
ATOM   1902 N  N     . LYS A 1 231 ? 14.475  47.681 61.819  1.00 39.47  ? 231  LYS A N     1 
ATOM   1903 C  CA    . LYS A 1 231 ? 14.635  49.024 62.368  1.00 41.42  ? 231  LYS A CA    1 
ATOM   1904 C  C     . LYS A 1 231 ? 14.036  49.117 63.769  1.00 43.96  ? 231  LYS A C     1 
ATOM   1905 O  O     . LYS A 1 231 ? 14.656  49.656 64.682  1.00 43.74  ? 231  LYS A O     1 
ATOM   1906 C  CB    . LYS A 1 231 ? 13.994  50.079 61.461  1.00 38.60  ? 231  LYS A CB    1 
ATOM   1907 C  CG    . LYS A 1 231 ? 14.146  51.498 62.001  1.00 50.23  ? 231  LYS A CG    1 
ATOM   1908 C  CD    . LYS A 1 231 ? 13.204  52.489 61.332  1.00 56.05  ? 231  LYS A CD    1 
ATOM   1909 C  CE    . LYS A 1 231 ? 13.709  52.921 59.970  1.00 60.29  ? 231  LYS A CE    1 
ATOM   1910 N  NZ    . LYS A 1 231 ? 12.857  54.001 59.393  1.00 65.13  ? 231  LYS A NZ    1 
ATOM   1911 N  N     . ASN A 1 232 ? 12.831  48.581 63.935  1.00 43.18  ? 232  ASN A N     1 
ATOM   1912 C  CA    . ASN A 1 232 ? 12.132  48.655 65.213  1.00 49.15  ? 232  ASN A CA    1 
ATOM   1913 C  C     . ASN A 1 232 ? 12.780  47.813 66.311  1.00 49.46  ? 232  ASN A C     1 
ATOM   1914 O  O     . ASN A 1 232 ? 12.667  48.129 67.495  1.00 51.57  ? 232  ASN A O     1 
ATOM   1915 C  CB    . ASN A 1 232 ? 10.661  48.269 65.039  1.00 50.24  ? 232  ASN A CB    1 
ATOM   1916 C  CG    . ASN A 1 232 ? 9.876   49.305 64.258  1.00 50.51  ? 232  ASN A CG    1 
ATOM   1917 O  OD1   . ASN A 1 232 ? 10.414  50.338 63.863  1.00 55.06  ? 232  ASN A OD1   1 
ATOM   1918 N  ND2   . ASN A 1 232 ? 8.600   49.028 64.022  1.00 48.78  ? 232  ASN A ND2   1 
ATOM   1919 N  N     . ILE A 1 233 ? 13.464  46.745 65.913  1.00 46.45  ? 233  ILE A N     1 
ATOM   1920 C  CA    . ILE A 1 233 ? 14.105  45.851 66.871  1.00 46.92  ? 233  ILE A CA    1 
ATOM   1921 C  C     . ILE A 1 233 ? 15.542  46.261 67.196  1.00 45.96  ? 233  ILE A C     1 
ATOM   1922 O  O     . ILE A 1 233 ? 15.921  46.344 68.364  1.00 50.07  ? 233  ILE A O     1 
ATOM   1923 C  CB    . ILE A 1 233 ? 14.095  44.389 66.373  1.00 50.20  ? 233  ILE A CB    1 
ATOM   1924 C  CG1   . ILE A 1 233 ? 12.662  43.862 66.300  1.00 48.03  ? 233  ILE A CG1   1 
ATOM   1925 C  CG2   . ILE A 1 233 ? 14.938  43.505 67.280  1.00 53.77  ? 233  ILE A CG2   1 
ATOM   1926 C  CD1   . ILE A 1 233 ? 12.559  42.452 65.764  1.00 49.11  ? 233  ILE A CD1   1 
ATOM   1927 N  N     . PHE A 1 234 ? 16.336  46.526 66.163  1.00 45.08  ? 234  PHE A N     1 
ATOM   1928 C  CA    . PHE A 1 234 ? 17.762  46.783 66.347  1.00 46.55  ? 234  PHE A CA    1 
ATOM   1929 C  C     . PHE A 1 234 ? 18.147  48.255 66.214  1.00 49.57  ? 234  PHE A C     1 
ATOM   1930 O  O     . PHE A 1 234 ? 19.200  48.672 66.698  1.00 50.82  ? 234  PHE A O     1 
ATOM   1931 C  CB    . PHE A 1 234 ? 18.583  45.961 65.353  1.00 44.07  ? 234  PHE A CB    1 
ATOM   1932 C  CG    . PHE A 1 234 ? 18.347  44.483 65.440  1.00 44.17  ? 234  PHE A CG    1 
ATOM   1933 C  CD1   . PHE A 1 234 ? 17.468  43.857 64.571  1.00 42.01  ? 234  PHE A CD1   1 
ATOM   1934 C  CD2   . PHE A 1 234 ? 19.009  43.716 66.384  1.00 46.97  ? 234  PHE A CD2   1 
ATOM   1935 C  CE1   . PHE A 1 234 ? 17.249  42.494 64.646  1.00 41.43  ? 234  PHE A CE1   1 
ATOM   1936 C  CE2   . PHE A 1 234 ? 18.795  42.353 66.463  1.00 45.77  ? 234  PHE A CE2   1 
ATOM   1937 C  CZ    . PHE A 1 234 ? 17.914  41.742 65.594  1.00 40.77  ? 234  PHE A CZ    1 
ATOM   1938 N  N     . GLY A 1 235 ? 17.305  49.037 65.549  1.00 47.06  ? 235  GLY A N     1 
ATOM   1939 C  CA    . GLY A 1 235 ? 17.614  50.435 65.305  1.00 46.38  ? 235  GLY A CA    1 
ATOM   1940 C  C     . GLY A 1 235 ? 17.933  50.696 63.845  1.00 43.15  ? 235  GLY A C     1 
ATOM   1941 O  O     . GLY A 1 235 ? 18.221  49.768 63.088  1.00 42.05  ? 235  GLY A O     1 
ATOM   1942 N  N     . GLU A 1 236 ? 17.889  51.967 63.456  1.00 44.47  ? 236  GLU A N     1 
ATOM   1943 C  CA    . GLU A 1 236 ? 18.061  52.367 62.061  1.00 45.34  ? 236  GLU A CA    1 
ATOM   1944 C  C     . GLU A 1 236 ? 19.409  51.949 61.473  1.00 41.09  ? 236  GLU A C     1 
ATOM   1945 O  O     . GLU A 1 236 ? 19.474  51.483 60.335  1.00 39.14  ? 236  GLU A O     1 
ATOM   1946 C  CB    . GLU A 1 236 ? 17.874  53.881 61.921  1.00 52.69  ? 236  GLU A CB    1 
ATOM   1947 C  CG    . GLU A 1 236 ? 17.892  54.383 60.487  1.00 57.29  ? 236  GLU A CG    1 
ATOM   1948 N  N     . SER A 1 237 ? 20.476  52.118 62.251  1.00 44.69  ? 237  SER A N     1 
ATOM   1949 C  CA    . SER A 1 237 ? 21.830  51.806 61.794  1.00 46.54  ? 237  SER A CA    1 
ATOM   1950 C  C     . SER A 1 237 ? 21.959  50.360 61.329  1.00 43.67  ? 237  SER A C     1 
ATOM   1951 O  O     . SER A 1 237 ? 22.601  50.076 60.318  1.00 43.18  ? 237  SER A O     1 
ATOM   1952 C  CB    . SER A 1 237 ? 22.850  52.087 62.899  1.00 50.58  ? 237  SER A CB    1 
ATOM   1953 O  OG    . SER A 1 237 ? 22.948  53.476 63.162  1.00 57.72  ? 237  SER A OG    1 
ATOM   1954 N  N     . THR A 1 238 ? 21.336  49.452 62.071  1.00 41.22  ? 238  THR A N     1 
ATOM   1955 C  CA    . THR A 1 238 ? 21.378  48.033 61.746  1.00 36.69  ? 238  THR A CA    1 
ATOM   1956 C  C     . THR A 1 238 ? 20.545  47.719 60.504  1.00 39.07  ? 238  THR A C     1 
ATOM   1957 O  O     . THR A 1 238 ? 20.954  46.926 59.656  1.00 35.06  ? 238  THR A O     1 
ATOM   1958 C  CB    . THR A 1 238 ? 20.901  47.186 62.940  1.00 37.50  ? 238  THR A CB    1 
ATOM   1959 O  OG1   . THR A 1 238 ? 21.890  47.230 63.976  1.00 39.97  ? 238  THR A OG1   1 
ATOM   1960 C  CG2   . THR A 1 238 ? 20.681  45.741 62.530  1.00 36.21  ? 238  THR A CG2   1 
ATOM   1961 N  N     . ALA A 1 239 ? 19.384  48.358 60.393  1.00 38.31  ? 239  ALA A N     1 
ATOM   1962 C  CA    . ALA A 1 239 ? 18.497  48.141 59.253  1.00 38.50  ? 239  ALA A CA    1 
ATOM   1963 C  C     . ALA A 1 239 ? 19.136  48.598 57.944  1.00 40.47  ? 239  ALA A C     1 
ATOM   1964 O  O     . ALA A 1 239 ? 18.844  48.055 56.878  1.00 37.09  ? 239  ALA A O     1 
ATOM   1965 C  CB    . ALA A 1 239 ? 17.169  48.844 59.470  1.00 36.93  ? 239  ALA A CB    1 
ATOM   1966 N  N     . LYS A 1 240 ? 20.016  49.591 58.032  1.00 38.77  ? 240  LYS A N     1 
ATOM   1967 C  CA    . LYS A 1 240 ? 20.684  50.128 56.851  1.00 40.69  ? 240  LYS A CA    1 
ATOM   1968 C  C     . LYS A 1 240 ? 21.735  49.177 56.282  1.00 41.20  ? 240  LYS A C     1 
ATOM   1969 O  O     . LYS A 1 240 ? 22.298  49.432 55.217  1.00 41.40  ? 240  LYS A O     1 
ATOM   1970 C  CB    . LYS A 1 240 ? 21.309  51.491 57.154  1.00 44.55  ? 240  LYS A CB    1 
ATOM   1971 C  CG    . LYS A 1 240 ? 20.293  52.608 57.319  1.00 47.58  ? 240  LYS A CG    1 
ATOM   1972 C  CD    . LYS A 1 240 ? 20.973  53.943 57.563  1.00 51.54  ? 240  LYS A CD    1 
ATOM   1973 C  CE    . LYS A 1 240 ? 19.959  55.073 57.615  1.00 54.91  ? 240  LYS A CE    1 
ATOM   1974 N  NZ    . LYS A 1 240 ? 20.616  56.388 57.860  1.00 57.32  ? 240  LYS A NZ    1 
ATOM   1975 N  N     . ARG A 1 241 ? 21.993  48.080 56.990  1.00 38.76  ? 241  ARG A N     1 
ATOM   1976 C  CA    . ARG A 1 241 ? 22.897  47.047 56.494  1.00 38.89  ? 241  ARG A CA    1 
ATOM   1977 C  C     . ARG A 1 241 ? 22.311  46.350 55.266  1.00 35.23  ? 241  ARG A C     1 
ATOM   1978 O  O     . ARG A 1 241 ? 23.016  45.638 54.553  1.00 37.63  ? 241  ARG A O     1 
ATOM   1979 C  CB    . ARG A 1 241 ? 23.212  46.023 57.590  1.00 37.74  ? 241  ARG A CB    1 
ATOM   1980 C  CG    . ARG A 1 241 ? 24.068  46.569 58.722  1.00 41.49  ? 241  ARG A CG    1 
ATOM   1981 C  CD    . ARG A 1 241 ? 24.243  45.541 59.831  1.00 44.67  ? 241  ARG A CD    1 
ATOM   1982 N  NE    . ARG A 1 241 ? 24.830  44.300 59.335  1.00 45.93  ? 241  ARG A NE    1 
ATOM   1983 C  CZ    . ARG A 1 241 ? 24.916  43.177 60.041  1.00 45.38  ? 241  ARG A CZ    1 
ATOM   1984 N  NH1   . ARG A 1 241 ? 24.451  43.132 61.283  1.00 40.02  ? 241  ARG A NH1   1 
ATOM   1985 N  NH2   . ARG A 1 241 ? 25.464  42.096 59.503  1.00 48.55  ? 241  ARG A NH2   1 
ATOM   1986 N  N     . LEU A 1 242 ? 21.020  46.562 55.024  1.00 34.16  ? 242  LEU A N     1 
ATOM   1987 C  CA    . LEU A 1 242 ? 20.360  46.029 53.836  1.00 35.89  ? 242  LEU A CA    1 
ATOM   1988 C  C     . LEU A 1 242 ? 20.863  46.717 52.571  1.00 37.26  ? 242  LEU A C     1 
ATOM   1989 O  O     . LEU A 1 242 ? 20.679  46.213 51.465  1.00 35.04  ? 242  LEU A O     1 
ATOM   1990 C  CB    . LEU A 1 242 ? 18.841  46.176 53.949  1.00 36.97  ? 242  LEU A CB    1 
ATOM   1991 C  CG    . LEU A 1 242 ? 18.158  45.242 54.949  1.00 40.60  ? 242  LEU A CG    1 
ATOM   1992 C  CD1   . LEU A 1 242 ? 16.664  45.526 55.015  1.00 39.48  ? 242  LEU A CD1   1 
ATOM   1993 C  CD2   . LEU A 1 242 ? 18.418  43.786 54.584  1.00 36.97  ? 242  LEU A CD2   1 
ATOM   1994 N  N     . SER A 1 243 ? 21.489  47.876 52.744  1.00 37.18  ? 243  SER A N     1 
ATOM   1995 C  CA    . SER A 1 243 ? 22.139  48.576 51.645  1.00 37.20  ? 243  SER A CA    1 
ATOM   1996 C  C     . SER A 1 243 ? 23.649  48.391 51.733  1.00 35.50  ? 243  SER A C     1 
ATOM   1997 O  O     . SER A 1 243 ? 24.240  48.599 52.792  1.00 37.60  ? 243  SER A O     1 
ATOM   1998 C  CB    . SER A 1 243 ? 21.799  50.066 51.687  1.00 40.55  ? 243  SER A CB    1 
ATOM   1999 O  OG    . SER A 1 243 ? 22.615  50.800 50.789  1.00 40.52  ? 243  SER A OG    1 
ATOM   2000 N  N     . PRO A 1 244 ? 24.281  47.995 50.618  1.00 34.44  ? 244  PRO A N     1 
ATOM   2001 C  CA    . PRO A 1 244 ? 25.739  47.818 50.594  1.00 34.71  ? 244  PRO A CA    1 
ATOM   2002 C  C     . PRO A 1 244 ? 26.491  49.136 50.779  1.00 37.13  ? 244  PRO A C     1 
ATOM   2003 O  O     . PRO A 1 244 ? 27.699  49.121 51.006  1.00 38.86  ? 244  PRO A O     1 
ATOM   2004 C  CB    . PRO A 1 244 ? 26.001  47.241 49.199  1.00 35.37  ? 244  PRO A CB    1 
ATOM   2005 C  CG    . PRO A 1 244 ? 24.819  47.649 48.385  1.00 35.14  ? 244  PRO A CG    1 
ATOM   2006 C  CD    . PRO A 1 244 ? 23.659  47.634 49.333  1.00 33.45  ? 244  PRO A CD    1 
ATOM   2007 N  N     . HIS A 1 245 ? 25.784  50.258 50.676  1.00 35.22  ? 245  HIS A N     1 
ATOM   2008 C  CA    . HIS A 1 245 ? 26.388  51.560 50.920  1.00 42.16  ? 245  HIS A CA    1 
ATOM   2009 C  C     . HIS A 1 245 ? 25.795  52.184 52.178  1.00 46.15  ? 245  HIS A C     1 
ATOM   2010 O  O     . HIS A 1 245 ? 26.021  53.362 52.456  1.00 49.66  ? 245  HIS A O     1 
ATOM   2011 C  CB    . HIS A 1 245 ? 26.184  52.489 49.722  1.00 39.76  ? 245  HIS A CB    1 
ATOM   2012 C  CG    . HIS A 1 245 ? 26.481  51.847 48.402  1.00 36.70  ? 245  HIS A CG    1 
ATOM   2013 N  ND1   . HIS A 1 245 ? 27.677  51.224 48.129  1.00 37.01  ? 245  HIS A ND1   1 
ATOM   2014 C  CD2   . HIS A 1 245 ? 25.733  51.736 47.277  1.00 33.67  ? 245  HIS A CD2   1 
ATOM   2015 C  CE1   . HIS A 1 245 ? 27.656  50.753 46.893  1.00 37.93  ? 245  HIS A CE1   1 
ATOM   2016 N  NE2   . HIS A 1 245 ? 26.487  51.053 46.356  1.00 36.23  ? 245  HIS A NE2   1 
ATOM   2017 N  N     A ARG A 1 246 ? 25.034  51.386 52.923  0.49 46.06  ? 246  ARG A N     1 
ATOM   2018 N  N     B ARG A 1 246 ? 25.035  51.385 52.924  0.51 46.07  ? 246  ARG A N     1 
ATOM   2019 C  CA    A ARG A 1 246 ? 24.406  51.822 54.171  0.49 46.64  ? 246  ARG A CA    1 
ATOM   2020 C  CA    B ARG A 1 246 ? 24.400  51.826 54.167  0.51 46.64  ? 246  ARG A CA    1 
ATOM   2021 C  C     A ARG A 1 246 ? 23.521  53.055 53.985  0.49 46.79  ? 246  ARG A C     1 
ATOM   2022 C  C     B ARG A 1 246 ? 23.510  53.051 53.986  0.51 46.77  ? 246  ARG A C     1 
ATOM   2023 O  O     A ARG A 1 246 ? 23.324  53.834 54.916  0.49 49.32  ? 246  ARG A O     1 
ATOM   2024 O  O     B ARG A 1 246 ? 23.298  53.821 54.922  0.51 49.31  ? 246  ARG A O     1 
ATOM   2025 C  CB    A ARG A 1 246 ? 25.465  52.083 55.250  0.49 48.36  ? 246  ARG A CB    1 
ATOM   2026 C  CB    B ARG A 1 246 ? 25.447  52.097 55.248  0.51 48.35  ? 246  ARG A CB    1 
ATOM   2027 C  CG    A ARG A 1 246 ? 26.427  50.926 55.477  0.49 48.29  ? 246  ARG A CG    1 
ATOM   2028 C  CG    B ARG A 1 246 ? 26.096  50.851 55.806  0.51 48.25  ? 246  ARG A CG    1 
ATOM   2029 C  CD    A ARG A 1 246 ? 25.722  49.709 56.061  0.49 46.69  ? 246  ARG A CD    1 
ATOM   2030 C  CD    B ARG A 1 246 ? 26.806  51.177 57.097  0.51 51.01  ? 246  ARG A CD    1 
ATOM   2031 N  NE    A ARG A 1 246 ? 26.649  48.604 56.292  0.49 45.02  ? 246  ARG A NE    1 
ATOM   2032 N  NE    B ARG A 1 246 ? 26.024  52.110 57.905  0.51 51.25  ? 246  ARG A NE    1 
ATOM   2033 C  CZ    A ARG A 1 246 ? 26.802  47.569 55.471  0.49 44.31  ? 246  ARG A CZ    1 
ATOM   2034 C  CZ    B ARG A 1 246 ? 25.042  51.750 58.725  0.51 46.70  ? 246  ARG A CZ    1 
ATOM   2035 N  NH1   A ARG A 1 246 ? 26.082  47.486 54.361  0.49 34.28  ? 246  ARG A NH1   1 
ATOM   2036 N  NH1   B ARG A 1 246 ? 24.720  50.472 58.853  0.51 38.28  ? 246  ARG A NH1   1 
ATOM   2037 N  NH2   A ARG A 1 246 ? 27.672  46.612 55.764  0.49 45.03  ? 246  ARG A NH2   1 
ATOM   2038 N  NH2   B ARG A 1 246 ? 24.383  52.668 59.417  0.51 40.30  ? 246  ARG A NH2   1 
ATOM   2039 N  N     . LYS A 1 247 ? 22.992  53.225 52.777  1.00 45.01  ? 247  LYS A N     1 
ATOM   2040 C  CA    . LYS A 1 247 ? 22.114  54.346 52.481  1.00 47.65  ? 247  LYS A CA    1 
ATOM   2041 C  C     . LYS A 1 247 ? 20.744  53.851 52.041  1.00 47.11  ? 247  LYS A C     1 
ATOM   2042 O  O     . LYS A 1 247 ? 20.622  53.088 51.082  1.00 43.29  ? 247  LYS A O     1 
ATOM   2043 C  CB    . LYS A 1 247 ? 22.725  55.238 51.397  1.00 53.06  ? 247  LYS A CB    1 
ATOM   2044 C  CG    . LYS A 1 247 ? 21.841  56.401 50.966  1.00 59.86  ? 247  LYS A CG    1 
ATOM   2045 C  CD    . LYS A 1 247 ? 21.779  57.485 52.031  1.00 67.99  ? 247  LYS A CD    1 
ATOM   2046 C  CE    . LYS A 1 247 ? 20.872  58.630 51.603  1.00 69.85  ? 247  LYS A CE    1 
ATOM   2047 N  NZ    . LYS A 1 247 ? 21.300  59.232 50.310  1.00 68.83  ? 247  LYS A NZ    1 
ATOM   2048 N  N     . THR A 1 248 ? 19.713  54.276 52.756  1.00 47.12  ? 248  THR A N     1 
ATOM   2049 C  CA    . THR A 1 248 ? 18.349  53.983 52.351  1.00 48.23  ? 248  THR A CA    1 
ATOM   2050 C  C     . THR A 1 248 ? 17.571  55.282 52.216  1.00 52.04  ? 248  THR A C     1 
ATOM   2051 O  O     . THR A 1 248 ? 17.996  56.325 52.712  1.00 54.92  ? 248  THR A O     1 
ATOM   2052 C  CB    . THR A 1 248 ? 17.632  53.078 53.366  1.00 45.07  ? 248  THR A CB    1 
ATOM   2053 O  OG1   . THR A 1 248 ? 17.607  53.721 54.647  1.00 49.47  ? 248  THR A OG1   1 
ATOM   2054 C  CG2   . THR A 1 248 ? 18.345  51.738 53.485  1.00 39.31  ? 248  THR A CG2   1 
ATOM   2055 N  N     . ARG A 1 249 ? 16.436  55.218 51.531  1.00 49.58  ? 249  ARG A N     1 
ATOM   2056 C  CA    . ARG A 1 249 ? 15.519  56.346 51.481  1.00 53.03  ? 249  ARG A CA    1 
ATOM   2057 C  C     . ARG A 1 249 ? 14.097  55.852 51.696  1.00 52.44  ? 249  ARG A C     1 
ATOM   2058 O  O     . ARG A 1 249 ? 13.637  54.939 51.009  1.00 45.99  ? 249  ARG A O     1 
ATOM   2059 C  CB    . ARG A 1 249 ? 15.623  57.095 50.151  1.00 55.41  ? 249  ARG A CB    1 
ATOM   2060 C  CG    . ARG A 1 249 ? 14.781  58.365 50.108  1.00 61.87  ? 249  ARG A CG    1 
ATOM   2061 C  CD    . ARG A 1 249 ? 14.867  59.072 48.763  1.00 66.96  ? 249  ARG A CD    1 
ATOM   2062 N  NE    . ARG A 1 249 ? 14.275  58.285 47.685  1.00 69.39  ? 249  ARG A NE    1 
ATOM   2063 C  CZ    . ARG A 1 249 ? 14.976  57.637 46.760  1.00 69.10  ? 249  ARG A CZ    1 
ATOM   2064 N  NH1   . ARG A 1 249 ? 16.301  57.687 46.777  1.00 72.63  ? 249  ARG A NH1   1 
ATOM   2065 N  NH2   . ARG A 1 249 ? 14.354  56.946 45.815  1.00 65.29  ? 249  ARG A NH2   1 
ATOM   2066 N  N     . VAL A 1 250 ? 13.411  56.452 52.660  1.00 56.79  ? 250  VAL A N     1 
ATOM   2067 C  CA    . VAL A 1 250 ? 12.025  56.106 52.931  1.00 58.34  ? 250  VAL A CA    1 
ATOM   2068 C  C     . VAL A 1 250 ? 11.098  57.110 52.260  1.00 63.87  ? 250  VAL A C     1 
ATOM   2069 O  O     . VAL A 1 250 ? 11.016  58.266 52.675  1.00 63.37  ? 250  VAL A O     1 
ATOM   2070 C  CB    . VAL A 1 250 ? 11.732  56.080 54.441  1.00 58.21  ? 250  VAL A CB    1 
ATOM   2071 C  CG1   . VAL A 1 250 ? 10.309  55.606 54.694  1.00 58.77  ? 250  VAL A CG1   1 
ATOM   2072 C  CG2   . VAL A 1 250 ? 12.732  55.189 55.161  1.00 57.79  ? 250  VAL A CG2   1 
ATOM   2073 N  N     . LYS A 1 251 ? 10.415  56.666 51.210  1.00 70.05  ? 251  LYS A N     1 
ATOM   2074 C  CA    . LYS A 1 251 ? 9.415   57.487 50.540  1.00 79.89  ? 251  LYS A CA    1 
ATOM   2075 C  C     . LYS A 1 251 ? 8.033   57.108 51.058  1.00 86.18  ? 251  LYS A C     1 
ATOM   2076 O  O     . LYS A 1 251 ? 7.633   55.944 50.985  1.00 84.59  ? 251  LYS A O     1 
ATOM   2077 C  CB    . LYS A 1 251 ? 9.491   57.300 49.024  1.00 78.84  ? 251  LYS A CB    1 
ATOM   2078 N  N     . VAL A 1 252 ? 7.308   58.090 51.584  1.00 91.51  ? 252  VAL A N     1 
ATOM   2079 C  CA    . VAL A 1 252 ? 6.041   57.821 52.256  1.00 94.65  ? 252  VAL A CA    1 
ATOM   2080 C  C     . VAL A 1 252 ? 4.821   58.311 51.479  1.00 99.15  ? 252  VAL A C     1 
ATOM   2081 O  O     . VAL A 1 252 ? 4.874   59.324 50.781  1.00 98.95  ? 252  VAL A O     1 
ATOM   2082 C  CB    . VAL A 1 252 ? 6.014   58.439 53.669  1.00 95.84  ? 252  VAL A CB    1 
ATOM   2083 N  N     . ILE A 1 253 ? 3.723   57.574 51.613  1.00 102.22 ? 253  ILE A N     1 
ATOM   2084 C  CA    . ILE A 1 253 ? 2.453   57.946 51.002  1.00 106.17 ? 253  ILE A CA    1 
ATOM   2085 C  C     . ILE A 1 253 ? 1.328   57.800 52.022  1.00 107.64 ? 253  ILE A C     1 
ATOM   2086 O  O     . ILE A 1 253 ? 1.055   56.701 52.505  1.00 105.27 ? 253  ILE A O     1 
ATOM   2087 C  CB    . ILE A 1 253 ? 2.141   57.078 49.769  1.00 104.54 ? 253  ILE A CB    1 
ATOM   2088 N  N     . GLU A 1 254 ? 0.683   58.915 52.351  1.00 111.35 ? 254  GLU A N     1 
ATOM   2089 C  CA    . GLU A 1 254 ? -0.378  58.919 53.353  1.00 113.39 ? 254  GLU A CA    1 
ATOM   2090 C  C     . GLU A 1 254 ? -1.746  58.640 52.737  1.00 114.99 ? 254  GLU A C     1 
ATOM   2091 O  O     . GLU A 1 254 ? -2.135  59.266 51.750  1.00 116.16 ? 254  GLU A O     1 
ATOM   2092 C  CB    . GLU A 1 254 ? -0.399  60.253 54.103  1.00 116.61 ? 254  GLU A CB    1 
ATOM   2093 N  N     . ASN A 1 255 ? -2.472  57.696 53.328  1.00 113.96 ? 255  ASN A N     1 
ATOM   2094 C  CA    . ASN A 1 255 ? -3.795  57.326 52.840  1.00 114.50 ? 255  ASN A CA    1 
ATOM   2095 C  C     . ASN A 1 255 ? -4.898  58.181 53.456  1.00 117.62 ? 255  ASN A C     1 
ATOM   2096 O  O     . ASN A 1 255 ? -5.307  57.957 54.595  1.00 117.54 ? 255  ASN A O     1 
ATOM   2097 C  CB    . ASN A 1 255 ? -4.069  55.844 53.104  1.00 112.13 ? 255  ASN A CB    1 
ATOM   2098 N  N     . SER A 1 259 ? -0.866  54.976 55.705  1.00 105.99 ? 259  SER A N     1 
ATOM   2099 C  CA    . SER A 1 259 ? 0.577   55.073 55.886  1.00 103.26 ? 259  SER A CA    1 
ATOM   2100 C  C     . SER A 1 259 ? 1.308   53.936 55.180  1.00 100.24 ? 259  SER A C     1 
ATOM   2101 O  O     . SER A 1 259 ? 1.512   52.866 55.754  1.00 99.99  ? 259  SER A O     1 
ATOM   2102 C  CB    . SER A 1 259 ? 0.931   55.077 57.374  1.00 102.71 ? 259  SER A CB    1 
ATOM   2103 O  OG    . SER A 1 259 ? 2.336   55.090 57.564  1.00 99.42  ? 259  SER A OG    1 
ATOM   2104 N  N     . ARG A 1 260 ? 1.699   54.175 53.932  1.00 97.48  ? 260  ARG A N     1 
ATOM   2105 C  CA    . ARG A 1 260 ? 2.457   53.192 53.166  1.00 89.97  ? 260  ARG A CA    1 
ATOM   2106 C  C     . ARG A 1 260 ? 3.848   53.714 52.824  1.00 84.82  ? 260  ARG A C     1 
ATOM   2107 O  O     . ARG A 1 260 ? 4.022   54.891 52.505  1.00 85.13  ? 260  ARG A O     1 
ATOM   2108 C  CB    . ARG A 1 260 ? 1.711   52.802 51.889  1.00 89.12  ? 260  ARG A CB    1 
ATOM   2109 C  CG    . ARG A 1 260 ? 0.453   51.984 52.129  1.00 89.43  ? 260  ARG A CG    1 
ATOM   2110 C  CD    . ARG A 1 260 ? -0.189  51.567 50.816  1.00 88.68  ? 260  ARG A CD    1 
ATOM   2111 N  NE    . ARG A 1 260 ? -1.385  50.757 51.026  1.00 89.81  ? 260  ARG A NE    1 
ATOM   2112 N  N     . GLU A 1 261 ? 4.835   52.828 52.893  1.00 79.34  ? 261  GLU A N     1 
ATOM   2113 C  CA    . GLU A 1 261 ? 6.215   53.199 52.618  1.00 75.52  ? 261  GLU A CA    1 
ATOM   2114 C  C     . GLU A 1 261 ? 6.815   52.339 51.515  1.00 70.41  ? 261  GLU A C     1 
ATOM   2115 O  O     . GLU A 1 261 ? 6.609   51.125 51.477  1.00 63.74  ? 261  GLU A O     1 
ATOM   2116 C  CB    . GLU A 1 261 ? 7.071   53.049 53.878  1.00 74.01  ? 261  GLU A CB    1 
ATOM   2117 C  CG    . GLU A 1 261 ? 6.661   53.928 55.046  1.00 74.18  ? 261  GLU A CG    1 
ATOM   2118 C  CD    . GLU A 1 261 ? 7.478   53.640 56.292  1.00 70.80  ? 261  GLU A CD    1 
ATOM   2119 O  OE1   . GLU A 1 261 ? 7.394   54.425 57.260  1.00 69.74  ? 261  GLU A OE1   1 
ATOM   2120 O  OE2   . GLU A 1 261 ? 8.206   52.624 56.302  1.00 69.05  ? 261  GLU A OE2   1 
ATOM   2121 N  N     . ILE A 1 262 ? 7.555   52.977 50.615  1.00 69.64  ? 262  ILE A N     1 
ATOM   2122 C  CA    . ILE A 1 262 ? 8.425   52.250 49.701  1.00 64.73  ? 262  ILE A CA    1 
ATOM   2123 C  C     . ILE A 1 262 ? 9.873   52.612 50.006  1.00 56.37  ? 262  ILE A C     1 
ATOM   2124 O  O     . ILE A 1 262 ? 10.261  53.779 49.952  1.00 56.15  ? 262  ILE A O     1 
ATOM   2125 C  CB    . ILE A 1 262 ? 8.102   52.532 48.223  1.00 68.05  ? 262  ILE A CB    1 
ATOM   2126 C  CG1   . ILE A 1 262 ? 6.789   51.850 47.832  1.00 69.70  ? 262  ILE A CG1   1 
ATOM   2127 C  CG2   . ILE A 1 262 ? 9.228   52.034 47.331  1.00 65.18  ? 262  ILE A CG2   1 
ATOM   2128 C  CD1   . ILE A 1 262 ? 6.505   51.877 46.347  1.00 72.04  ? 262  ILE A CD1   1 
ATOM   2129 N  N     . ILE A 1 263 ? 10.664  51.602 50.345  1.00 50.23  ? 263  ILE A N     1 
ATOM   2130 C  CA    . ILE A 1 263 ? 12.045  51.818 50.738  1.00 47.84  ? 263  ILE A CA    1 
ATOM   2131 C  C     . ILE A 1 263 ? 12.968  51.708 49.534  1.00 46.31  ? 263  ILE A C     1 
ATOM   2132 O  O     . ILE A 1 263 ? 12.857  50.776 48.740  1.00 49.60  ? 263  ILE A O     1 
ATOM   2133 C  CB    . ILE A 1 263 ? 12.491  50.791 51.799  1.00 48.10  ? 263  ILE A CB    1 
ATOM   2134 C  CG1   . ILE A 1 263 ? 11.459  50.699 52.926  1.00 50.18  ? 263  ILE A CG1   1 
ATOM   2135 C  CG2   . ILE A 1 263 ? 13.863  51.149 52.346  1.00 47.60  ? 263  ILE A CG2   1 
ATOM   2136 C  CD1   . ILE A 1 263 ? 11.245  51.996 53.672  1.00 51.02  ? 263  ILE A CD1   1 
ATOM   2137 N  N     . THR A 1 264 ? 13.874  52.668 49.395  1.00 41.37  ? 264  THR A N     1 
ATOM   2138 C  CA    . THR A 1 264 ? 14.904  52.587 48.372  1.00 37.82  ? 264  THR A CA    1 
ATOM   2139 C  C     . THR A 1 264 ? 16.209  52.136 49.010  1.00 36.87  ? 264  THR A C     1 
ATOM   2140 O  O     . THR A 1 264 ? 16.743  52.813 49.888  1.00 33.40  ? 264  THR A O     1 
ATOM   2141 C  CB    . THR A 1 264 ? 15.121  53.939 47.676  1.00 41.24  ? 264  THR A CB    1 
ATOM   2142 O  OG1   . THR A 1 264 ? 13.902  54.354 47.051  1.00 43.53  ? 264  THR A OG1   1 
ATOM   2143 C  CG2   . THR A 1 264 ? 16.215  53.826 46.623  1.00 42.11  ? 264  THR A CG2   1 
ATOM   2144 N  N     . LEU A 1 265 ? 16.709  50.983 48.578  1.00 33.94  ? 265  LEU A N     1 
ATOM   2145 C  CA    . LEU A 1 265 ? 17.968  50.454 49.083  1.00 36.35  ? 265  LEU A CA    1 
ATOM   2146 C  C     . LEU A 1 265 ? 19.082  50.770 48.094  1.00 40.25  ? 265  LEU A C     1 
ATOM   2147 O  O     . LEU A 1 265 ? 19.198  50.119 47.054  1.00 41.15  ? 265  LEU A O     1 
ATOM   2148 C  CB    . LEU A 1 265 ? 17.872  48.940 49.290  1.00 33.23  ? 265  LEU A CB    1 
ATOM   2149 C  CG    . LEU A 1 265 ? 16.720  48.423 50.155  1.00 34.66  ? 265  LEU A CG    1 
ATOM   2150 C  CD1   . LEU A 1 265 ? 16.696  46.903 50.155  1.00 36.68  ? 265  LEU A CD1   1 
ATOM   2151 C  CD2   . LEU A 1 265 ? 16.828  48.958 51.576  1.00 38.06  ? 265  LEU A CD2   1 
ATOM   2152 N  N     . PHE A 1 266 ? 19.891  51.774 48.419  1.00 37.69  ? 266  PHE A N     1 
ATOM   2153 C  CA    . PHE A 1 266 ? 20.976  52.204 47.543  1.00 35.22  ? 266  PHE A CA    1 
ATOM   2154 C  C     . PHE A 1 266 ? 21.992  51.090 47.329  1.00 33.87  ? 266  PHE A C     1 
ATOM   2155 O  O     . PHE A 1 266 ? 22.441  50.453 48.283  1.00 33.52  ? 266  PHE A O     1 
ATOM   2156 C  CB    . PHE A 1 266 ? 21.671  53.448 48.108  1.00 36.53  ? 266  PHE A CB    1 
ATOM   2157 C  CG    . PHE A 1 266 ? 20.899  54.723 47.902  1.00 45.21  ? 266  PHE A CG    1 
ATOM   2158 C  CD1   . PHE A 1 266 ? 19.694  54.935 48.551  1.00 48.69  ? 266  PHE A CD1   1 
ATOM   2159 C  CD2   . PHE A 1 266 ? 21.386  55.715 47.066  1.00 51.57  ? 266  PHE A CD2   1 
ATOM   2160 C  CE1   . PHE A 1 266 ? 18.984  56.107 48.364  1.00 54.43  ? 266  PHE A CE1   1 
ATOM   2161 C  CE2   . PHE A 1 266 ? 20.682  56.891 46.875  1.00 56.23  ? 266  PHE A CE2   1 
ATOM   2162 C  CZ    . PHE A 1 266 ? 19.480  57.086 47.526  1.00 56.91  ? 266  PHE A CZ    1 
ATOM   2163 N  N     . GLY A 1 267 ? 22.344  50.860 46.069  1.00 30.89  ? 267  GLY A N     1 
ATOM   2164 C  CA    . GLY A 1 267 ? 23.304  49.831 45.720  1.00 32.53  ? 267  GLY A CA    1 
ATOM   2165 C  C     . GLY A 1 267 ? 22.637  48.522 45.353  1.00 32.70  ? 267  GLY A C     1 
ATOM   2166 O  O     . GLY A 1 267 ? 23.308  47.519 45.108  1.00 33.85  ? 267  GLY A O     1 
ATOM   2167 N  N     . ILE A 1 268 ? 21.307  48.534 45.323  1.00 35.28  ? 268  ILE A N     1 
ATOM   2168 C  CA    . ILE A 1 268 ? 20.525  47.363 44.943  1.00 33.84  ? 268  ILE A CA    1 
ATOM   2169 C  C     . ILE A 1 268 ? 19.488  47.739 43.887  1.00 34.70  ? 268  ILE A C     1 
ATOM   2170 O  O     . ILE A 1 268 ? 18.849  48.786 43.981  1.00 35.47  ? 268  ILE A O     1 
ATOM   2171 C  CB    . ILE A 1 268 ? 19.812  46.742 46.166  1.00 34.95  ? 268  ILE A CB    1 
ATOM   2172 C  CG1   . ILE A 1 268 ? 20.841  46.280 47.198  1.00 35.36  ? 268  ILE A CG1   1 
ATOM   2173 C  CG2   . ILE A 1 268 ? 18.921  45.574 45.745  1.00 32.93  ? 268  ILE A CG2   1 
ATOM   2174 C  CD1   . ILE A 1 268 ? 20.249  45.484 48.332  1.00 37.95  ? 268  ILE A CD1   1 
ATOM   2175 N  N     . SER A 1 269 ? 19.337  46.891 42.874  1.00 30.48  ? 269  SER A N     1 
ATOM   2176 C  CA    . SER A 1 269 ? 18.331  47.104 41.842  1.00 31.48  ? 269  SER A CA    1 
ATOM   2177 C  C     . SER A 1 269 ? 17.132  46.185 42.055  1.00 31.70  ? 269  SER A C     1 
ATOM   2178 O  O     . SER A 1 269 ? 17.182  44.995 41.736  1.00 32.27  ? 269  SER A O     1 
ATOM   2179 C  CB    . SER A 1 269 ? 18.930  46.880 40.454  1.00 29.67  ? 269  SER A CB    1 
ATOM   2180 O  OG    . SER A 1 269 ? 19.871  47.889 40.140  1.00 34.07  ? 269  SER A OG    1 
ATOM   2181 N  N     . VAL A 1 270 ? 16.057  46.745 42.600  1.00 29.34  ? 270  VAL A N     1 
ATOM   2182 C  CA    . VAL A 1 270 ? 14.849  45.977 42.874  1.00 30.32  ? 270  VAL A CA    1 
ATOM   2183 C  C     . VAL A 1 270 ? 13.947  45.881 41.647  1.00 29.84  ? 270  VAL A C     1 
ATOM   2184 O  O     . VAL A 1 270 ? 13.480  46.893 41.124  1.00 32.05  ? 270  VAL A O     1 
ATOM   2185 C  CB    . VAL A 1 270 ? 14.039  46.586 44.037  1.00 33.86  ? 270  VAL A CB    1 
ATOM   2186 C  CG1   . VAL A 1 270 ? 12.764  45.786 44.267  1.00 33.76  ? 270  VAL A CG1   1 
ATOM   2187 C  CG2   . VAL A 1 270 ? 14.879  46.636 45.304  1.00 28.37  ? 270  VAL A CG2   1 
ATOM   2188 N  N     . LEU A 1 271 ? 13.712  44.657 41.190  1.00 30.16  ? 271  LEU A N     1 
ATOM   2189 C  CA    . LEU A 1 271 ? 12.789  44.408 40.092  1.00 29.36  ? 271  LEU A CA    1 
ATOM   2190 C  C     . LEU A 1 271 ? 11.673  43.501 40.577  1.00 28.06  ? 271  LEU A C     1 
ATOM   2191 O  O     . LEU A 1 271 ? 11.726  42.288 40.373  1.00 28.26  ? 271  LEU A O     1 
ATOM   2192 C  CB    . LEU A 1 271 ? 13.501  43.725 38.922  1.00 29.92  ? 271  LEU A CB    1 
ATOM   2193 C  CG    . LEU A 1 271 ? 14.722  44.393 38.284  1.00 34.64  ? 271  LEU A CG    1 
ATOM   2194 C  CD1   . LEU A 1 271 ? 15.331  43.471 37.233  1.00 31.57  ? 271  LEU A CD1   1 
ATOM   2195 C  CD2   . LEU A 1 271 ? 14.353  45.727 37.674  1.00 34.32  ? 271  LEU A CD2   1 
ATOM   2196 N  N     A ASP A 1 272 ? 10.670  44.088 41.224  0.50 29.02  ? 272  ASP A N     1 
ATOM   2197 N  N     B ASP A 1 272 ? 10.670  44.088 41.224  0.50 29.02  ? 272  ASP A N     1 
ATOM   2198 C  CA    A ASP A 1 272 ? 9.522   43.333 41.708  0.50 29.38  ? 272  ASP A CA    1 
ATOM   2199 C  CA    B ASP A 1 272 ? 9.523   43.332 41.710  0.50 29.38  ? 272  ASP A CA    1 
ATOM   2200 C  C     A ASP A 1 272 ? 8.862   42.619 40.536  0.50 27.48  ? 272  ASP A C     1 
ATOM   2201 C  C     B ASP A 1 272 ? 8.860   42.620 40.538  0.50 27.49  ? 272  ASP A C     1 
ATOM   2202 O  O     A ASP A 1 272 ? 8.484   43.251 39.551  0.50 28.59  ? 272  ASP A O     1 
ATOM   2203 O  O     B ASP A 1 272 ? 8.479   43.252 39.555  0.50 28.59  ? 272  ASP A O     1 
ATOM   2204 C  CB    A ASP A 1 272 ? 8.523   44.269 42.390  0.50 30.79  ? 272  ASP A CB    1 
ATOM   2205 C  CB    B ASP A 1 272 ? 8.525   44.267 42.395  0.50 30.78  ? 272  ASP A CB    1 
ATOM   2206 C  CG    A ASP A 1 272 ? 7.533   43.530 43.269  0.50 32.76  ? 272  ASP A CG    1 
ATOM   2207 C  CG    B ASP A 1 272 ? 7.541   43.527 43.279  0.50 32.76  ? 272  ASP A CG    1 
ATOM   2208 O  OD1   A ASP A 1 272 ? 7.205   42.364 42.961  0.50 34.91  ? 272  ASP A OD1   1 
ATOM   2209 O  OD1   B ASP A 1 272 ? 7.208   42.363 42.970  0.50 34.93  ? 272  ASP A OD1   1 
ATOM   2210 O  OD2   A ASP A 1 272 ? 7.084   44.119 44.273  0.50 33.19  ? 272  ASP A OD2   1 
ATOM   2211 O  OD2   B ASP A 1 272 ? 7.102   44.113 44.290  0.50 33.18  ? 272  ASP A OD2   1 
ATOM   2212 N  N     . TYR A 1 273 ? 8.733   41.301 40.639  1.00 26.90  ? 273  TYR A N     1 
ATOM   2213 C  CA    . TYR A 1 273 ? 8.230   40.512 39.520  1.00 27.70  ? 273  TYR A CA    1 
ATOM   2214 C  C     . TYR A 1 273 ? 6.782   40.813 39.135  1.00 25.88  ? 273  TYR A C     1 
ATOM   2215 O  O     . TYR A 1 273 ? 6.400   40.633 37.983  1.00 29.13  ? 273  TYR A O     1 
ATOM   2216 C  CB    . TYR A 1 273 ? 8.454   39.008 39.715  1.00 22.73  ? 273  TYR A CB    1 
ATOM   2217 C  CG    . TYR A 1 273 ? 8.805   38.350 38.405  1.00 25.75  ? 273  TYR A CG    1 
ATOM   2218 C  CD1   . TYR A 1 273 ? 7.811   37.933 37.528  1.00 22.78  ? 273  TYR A CD1   1 
ATOM   2219 C  CD2   . TYR A 1 273 ? 10.130  38.196 38.019  1.00 26.04  ? 273  TYR A CD2   1 
ATOM   2220 C  CE1   . TYR A 1 273 ? 8.128   37.359 36.316  1.00 24.49  ? 273  TYR A CE1   1 
ATOM   2221 C  CE2   . TYR A 1 273 ? 10.458  37.622 36.810  1.00 27.74  ? 273  TYR A CE2   1 
ATOM   2222 C  CZ    . TYR A 1 273 ? 9.453   37.208 35.962  1.00 28.08  ? 273  TYR A CZ    1 
ATOM   2223 O  OH    . TYR A 1 273 ? 9.777   36.638 34.756  1.00 29.67  ? 273  TYR A OH    1 
ATOM   2224 N  N     . ILE A 1 274 ? 5.984   41.286 40.086  1.00 25.99  ? 274  ILE A N     1 
ATOM   2225 C  CA    . ILE A 1 274 ? 4.612   41.665 39.768  1.00 29.80  ? 274  ILE A CA    1 
ATOM   2226 C  C     . ILE A 1 274 ? 4.597   42.893 38.855  1.00 28.67  ? 274  ILE A C     1 
ATOM   2227 O  O     . ILE A 1 274 ? 3.732   43.024 37.990  1.00 31.90  ? 274  ILE A O     1 
ATOM   2228 C  CB    . ILE A 1 274 ? 3.749   41.888 41.035  1.00 29.53  ? 274  ILE A CB    1 
ATOM   2229 C  CG1   . ILE A 1 274 ? 2.271   42.012 40.655  1.00 31.44  ? 274  ILE A CG1   1 
ATOM   2230 C  CG2   . ILE A 1 274 ? 4.226   43.107 41.821  1.00 30.14  ? 274  ILE A CG2   1 
ATOM   2231 C  CD1   . ILE A 1 274 ? 1.338   42.111 41.842  1.00 35.54  ? 274  ILE A CD1   1 
ATOM   2232 N  N     . ASP A 1 275 ? 5.581   43.772 39.025  1.00 27.26  ? 275  ASP A N     1 
ATOM   2233 C  CA    . ASP A 1 275 ? 5.707   44.952 38.176  1.00 26.87  ? 275  ASP A CA    1 
ATOM   2234 C  C     . ASP A 1 275 ? 6.269   44.578 36.810  1.00 29.60  ? 275  ASP A C     1 
ATOM   2235 O  O     . ASP A 1 275 ? 5.857   45.131 35.791  1.00 28.75  ? 275  ASP A O     1 
ATOM   2236 C  CB    . ASP A 1 275 ? 6.586   46.010 38.843  1.00 31.17  ? 275  ASP A CB    1 
ATOM   2237 C  CG    . ASP A 1 275 ? 5.972   46.554 40.117  1.00 36.89  ? 275  ASP A CG    1 
ATOM   2238 O  OD1   . ASP A 1 275 ? 4.726   46.612 40.199  1.00 33.71  ? 275  ASP A OD1   1 
ATOM   2239 O  OD2   . ASP A 1 275 ? 6.735   46.920 41.036  1.00 44.86  ? 275  ASP A OD2   1 
ATOM   2240 N  N     . LEU A 1 276 ? 7.218   43.645 36.795  1.00 27.47  ? 276  LEU A N     1 
ATOM   2241 C  CA    . LEU A 1 276 ? 7.744   43.124 35.540  1.00 30.19  ? 276  LEU A CA    1 
ATOM   2242 C  C     . LEU A 1 276 ? 6.618   42.456 34.763  1.00 27.04  ? 276  LEU A C     1 
ATOM   2243 O  O     . LEU A 1 276 ? 6.457   42.678 33.563  1.00 25.60  ? 276  LEU A O     1 
ATOM   2244 C  CB    . LEU A 1 276 ? 8.865   42.112 35.790  1.00 23.64  ? 276  LEU A CB    1 
ATOM   2245 C  CG    . LEU A 1 276 ? 10.215  42.636 36.281  1.00 26.21  ? 276  LEU A CG    1 
ATOM   2246 C  CD1   . LEU A 1 276 ? 11.183  41.482 36.502  1.00 26.05  ? 276  LEU A CD1   1 
ATOM   2247 C  CD2   . LEU A 1 276 ? 10.792  43.630 35.289  1.00 26.79  ? 276  LEU A CD2   1 
ATOM   2248 N  N     . TYR A 1 277 ? 5.839   41.641 35.465  1.00 22.75  ? 277  TYR A N     1 
ATOM   2249 C  CA    . TYR A 1 277 ? 4.739   40.912 34.847  1.00 24.27  ? 277  TYR A CA    1 
ATOM   2250 C  C     . TYR A 1 277 ? 3.699   41.864 34.261  1.00 26.06  ? 277  TYR A C     1 
ATOM   2251 O  O     . TYR A 1 277 ? 3.289   41.710 33.115  1.00 28.41  ? 277  TYR A O     1 
ATOM   2252 C  CB    . TYR A 1 277 ? 4.089   39.969 35.861  1.00 23.24  ? 277  TYR A CB    1 
ATOM   2253 C  CG    . TYR A 1 277 ? 3.077   39.016 35.267  1.00 22.71  ? 277  TYR A CG    1 
ATOM   2254 C  CD1   . TYR A 1 277 ? 3.463   37.759 34.815  1.00 22.24  ? 277  TYR A CD1   1 
ATOM   2255 C  CD2   . TYR A 1 277 ? 1.734   39.365 35.171  1.00 25.01  ? 277  TYR A CD2   1 
ATOM   2256 C  CE1   . TYR A 1 277 ? 2.543   36.878 34.277  1.00 24.44  ? 277  TYR A CE1   1 
ATOM   2257 C  CE2   . TYR A 1 277 ? 0.804   38.488 34.634  1.00 24.61  ? 277  TYR A CE2   1 
ATOM   2258 C  CZ    . TYR A 1 277 ? 1.216   37.247 34.187  1.00 24.74  ? 277  TYR A CZ    1 
ATOM   2259 O  OH    . TYR A 1 277 ? 0.303   36.366 33.653  1.00 27.13  ? 277  TYR A OH    1 
ATOM   2260 N  N     . LYS A 1 278 ? 3.282   42.854 35.042  1.00 26.26  ? 278  LYS A N     1 
ATOM   2261 C  CA    . LYS A 1 278 ? 2.260   43.794 34.582  1.00 26.61  ? 278  LYS A CA    1 
ATOM   2262 C  C     . LYS A 1 278 ? 2.717   44.607 33.373  1.00 27.73  ? 278  LYS A C     1 
ATOM   2263 O  O     . LYS A 1 278 ? 1.911   44.958 32.513  1.00 29.82  ? 278  LYS A O     1 
ATOM   2264 C  CB    . LYS A 1 278 ? 1.826   44.732 35.714  1.00 27.42  ? 278  LYS A CB    1 
ATOM   2265 C  CG    . LYS A 1 278 ? 0.959   44.064 36.770  1.00 30.42  ? 278  LYS A CG    1 
ATOM   2266 C  CD    . LYS A 1 278 ? 0.549   45.043 37.860  1.00 30.77  ? 278  LYS A CD    1 
ATOM   2267 C  CE    . LYS A 1 278 ? -0.376  44.381 38.867  1.00 31.95  ? 278  LYS A CE    1 
ATOM   2268 N  NZ    . LYS A 1 278 ? -0.722  45.295 39.987  1.00 37.42  ? 278  LYS A NZ    1 
ATOM   2269 N  N     . LYS A 1 279 ? 4.011   44.897 33.305  1.00 29.20  ? 279  LYS A N     1 
ATOM   2270 C  CA    . LYS A 1 279 ? 4.534   45.737 32.234  1.00 29.85  ? 279  LYS A CA    1 
ATOM   2271 C  C     . LYS A 1 279 ? 4.874   44.967 30.956  1.00 29.70  ? 279  LYS A C     1 
ATOM   2272 O  O     . LYS A 1 279 ? 4.722   45.495 29.854  1.00 31.26  ? 279  LYS A O     1 
ATOM   2273 C  CB    . LYS A 1 279 ? 5.762   46.519 32.708  1.00 27.76  ? 279  LYS A CB    1 
ATOM   2274 C  CG    . LYS A 1 279 ? 6.153   47.659 31.771  1.00 31.80  ? 279  LYS A CG    1 
ATOM   2275 C  CD    . LYS A 1 279 ? 7.520   48.223 32.114  1.00 39.99  ? 279  LYS A CD    1 
ATOM   2276 C  CE    . LYS A 1 279 ? 7.919   49.350 31.164  1.00 45.14  ? 279  LYS A CE    1 
ATOM   2277 N  NZ    . LYS A 1 279 ? 7.067   50.566 31.341  1.00 51.68  ? 279  LYS A NZ    1 
ATOM   2278 N  N     . PHE A 1 280 ? 5.325   43.722 31.098  1.00 25.53  ? 280  PHE A N     1 
ATOM   2279 C  CA    . PHE A 1 280 ? 5.870   42.989 29.955  1.00 25.83  ? 280  PHE A CA    1 
ATOM   2280 C  C     . PHE A 1 280 ? 5.074   41.754 29.505  1.00 27.23  ? 280  PHE A C     1 
ATOM   2281 O  O     . PHE A 1 280 ? 5.365   41.187 28.452  1.00 29.16  ? 280  PHE A O     1 
ATOM   2282 C  CB    . PHE A 1 280 ? 7.327   42.591 30.227  1.00 26.11  ? 280  PHE A CB    1 
ATOM   2283 C  CG    . PHE A 1 280 ? 8.242   43.759 30.491  1.00 29.31  ? 280  PHE A CG    1 
ATOM   2284 C  CD1   . PHE A 1 280 ? 9.131   43.733 31.554  1.00 34.33  ? 280  PHE A CD1   1 
ATOM   2285 C  CD2   . PHE A 1 280 ? 8.224   44.873 29.670  1.00 31.90  ? 280  PHE A CD2   1 
ATOM   2286 C  CE1   . PHE A 1 280 ? 9.976   44.801 31.800  1.00 36.18  ? 280  PHE A CE1   1 
ATOM   2287 C  CE2   . PHE A 1 280 ? 9.066   45.945 29.908  1.00 36.78  ? 280  PHE A CE2   1 
ATOM   2288 C  CZ    . PHE A 1 280 ? 9.943   45.909 30.975  1.00 40.66  ? 280  PHE A CZ    1 
ATOM   2289 N  N     . SER A 1 281 ? 4.079   41.334 30.282  1.00 29.67  ? 281  SER A N     1 
ATOM   2290 C  CA    . SER A 1 281 ? 3.362   40.096 29.960  1.00 27.46  ? 281  SER A CA    1 
ATOM   2291 C  C     . SER A 1 281 ? 2.257   40.296 28.934  1.00 29.20  ? 281  SER A C     1 
ATOM   2292 O  O     . SER A 1 281 ? 1.848   39.345 28.266  1.00 32.41  ? 281  SER A O     1 
ATOM   2293 C  CB    . SER A 1 281 ? 2.771   39.449 31.214  1.00 25.65  ? 281  SER A CB    1 
ATOM   2294 O  OG    . SER A 1 281 ? 1.656   40.186 31.686  1.00 25.49  ? 281  SER A OG    1 
ATOM   2295 N  N     . PHE A 1 282 ? 1.776   41.530 28.820  1.00 28.88  ? 282  PHE A N     1 
ATOM   2296 C  CA    . PHE A 1 282 ? 0.650   41.857 27.950  1.00 30.60  ? 282  PHE A CA    1 
ATOM   2297 C  C     . PHE A 1 282 ? -0.575  41.001 28.255  1.00 33.77  ? 282  PHE A C     1 
ATOM   2298 O  O     . PHE A 1 282 ? -1.180  40.395 27.369  1.00 33.77  ? 282  PHE A O     1 
ATOM   2299 C  CB    . PHE A 1 282 ? 1.051   41.789 26.475  1.00 34.96  ? 282  PHE A CB    1 
ATOM   2300 C  CG    . PHE A 1 282 ? 1.947   42.916 26.054  1.00 38.65  ? 282  PHE A CG    1 
ATOM   2301 C  CD1   . PHE A 1 282 ? 1.414   44.079 25.525  1.00 36.22  ? 282  PHE A CD1   1 
ATOM   2302 C  CD2   . PHE A 1 282 ? 3.319   42.826 26.221  1.00 35.62  ? 282  PHE A CD2   1 
ATOM   2303 C  CE1   . PHE A 1 282 ? 2.236   45.125 25.150  1.00 37.81  ? 282  PHE A CE1   1 
ATOM   2304 C  CE2   . PHE A 1 282 ? 4.145   43.869 25.847  1.00 35.60  ? 282  PHE A CE2   1 
ATOM   2305 C  CZ    . PHE A 1 282 ? 3.603   45.019 25.311  1.00 35.45  ? 282  PHE A CZ    1 
ATOM   2306 N  N     . THR A 1 283 ? -0.915  40.954 29.536  1.00 32.37  ? 283  THR A N     1 
ATOM   2307 C  CA    . THR A 1 283 ? -2.143  40.337 29.996  1.00 34.74  ? 283  THR A CA    1 
ATOM   2308 C  C     . THR A 1 283 ? -2.847  41.340 30.892  1.00 36.93  ? 283  THR A C     1 
ATOM   2309 O  O     . THR A 1 283 ? -2.251  42.329 31.318  1.00 37.49  ? 283  THR A O     1 
ATOM   2310 C  CB    . THR A 1 283 ? -1.859  39.092 30.840  1.00 36.04  ? 283  THR A CB    1 
ATOM   2311 O  OG1   . THR A 1 283 ? -1.142  39.478 32.020  1.00 39.71  ? 283  THR A OG1   1 
ATOM   2312 C  CG2   . THR A 1 283 ? -1.033  38.079 30.054  1.00 32.41  ? 283  THR A CG2   1 
ATOM   2313 N  N     . ASN A 1 284 ? -4.119  41.091 31.168  1.00 33.29  ? 284  ASN A N     1 
ATOM   2314 C  CA    . ASN A 1 284 ? -4.826  41.821 32.207  1.00 32.38  ? 284  ASN A CA    1 
ATOM   2315 C  C     . ASN A 1 284 ? -5.583  40.806 33.046  1.00 34.03  ? 284  ASN A C     1 
ATOM   2316 O  O     . ASN A 1 284 ? -6.588  40.252 32.606  1.00 35.06  ? 284  ASN A O     1 
ATOM   2317 C  CB    . ASN A 1 284 ? -5.768  42.868 31.609  1.00 31.12  ? 284  ASN A CB    1 
ATOM   2318 C  CG    . ASN A 1 284 ? -6.220  43.896 32.632  1.00 34.46  ? 284  ASN A CG    1 
ATOM   2319 O  OD1   . ASN A 1 284 ? -5.843  43.831 33.803  1.00 35.51  ? 284  ASN A OD1   1 
ATOM   2320 N  ND2   . ASN A 1 284 ? -7.019  44.860 32.189  1.00 32.40  ? 284  ASN A ND2   1 
ATOM   2321 N  N     . GLN A 1 285 ? -5.073  40.545 34.245  1.00 30.11  ? 285  GLN A N     1 
ATOM   2322 C  CA    . GLN A 1 285 ? -5.568  39.443 35.061  1.00 29.03  ? 285  GLN A CA    1 
ATOM   2323 C  C     . GLN A 1 285 ? -6.633  39.883 36.058  1.00 30.60  ? 285  GLN A C     1 
ATOM   2324 O  O     . GLN A 1 285 ? -6.567  40.989 36.595  1.00 30.14  ? 285  GLN A O     1 
ATOM   2325 C  CB    . GLN A 1 285 ? -4.405  38.767 35.799  1.00 29.56  ? 285  GLN A CB    1 
ATOM   2326 C  CG    . GLN A 1 285 ? -3.283  38.265 34.895  1.00 29.66  ? 285  GLN A CG    1 
ATOM   2327 C  CD    . GLN A 1 285 ? -3.644  36.989 34.152  1.00 33.45  ? 285  GLN A CD    1 
ATOM   2328 O  OE1   . GLN A 1 285 ? -4.793  36.551 34.167  1.00 32.59  ? 285  GLN A OE1   1 
ATOM   2329 N  NE2   . GLN A 1 285 ? -2.655  36.384 33.501  1.00 34.04  ? 285  GLN A NE2   1 
ATOM   2330 N  N     . PRO A 1 286 ? -7.623  39.010 36.304  1.00 29.32  ? 286  PRO A N     1 
ATOM   2331 C  CA    . PRO A 1 286 ? -8.666  39.254 37.306  1.00 33.75  ? 286  PRO A CA    1 
ATOM   2332 C  C     . PRO A 1 286 ? -8.080  39.323 38.713  1.00 33.56  ? 286  PRO A C     1 
ATOM   2333 O  O     . PRO A 1 286 ? -8.693  39.901 39.609  1.00 33.74  ? 286  PRO A O     1 
ATOM   2334 C  CB    . PRO A 1 286 ? -9.569  38.023 37.177  1.00 36.22  ? 286  PRO A CB    1 
ATOM   2335 C  CG    . PRO A 1 286 ? -9.311  37.499 35.806  1.00 35.35  ? 286  PRO A CG    1 
ATOM   2336 C  CD    . PRO A 1 286 ? -7.862  37.766 35.553  1.00 28.53  ? 286  PRO A CD    1 
ATOM   2337 N  N     . SER A 1 287 ? -6.904  38.734 38.896  1.00 31.97  ? 287  SER A N     1 
ATOM   2338 C  CA    . SER A 1 287 ? -6.240  38.715 40.193  1.00 34.32  ? 287  SER A CA    1 
ATOM   2339 C  C     . SER A 1 287 ? -4.731  38.603 40.016  1.00 32.45  ? 287  SER A C     1 
ATOM   2340 O  O     . SER A 1 287 ? -4.259  37.992 39.058  1.00 31.27  ? 287  SER A O     1 
ATOM   2341 C  CB    . SER A 1 287 ? -6.751  37.543 41.031  1.00 36.63  ? 287  SER A CB    1 
ATOM   2342 O  OG    . SER A 1 287 ? -5.920  37.317 42.152  1.00 35.73  ? 287  SER A OG    1 
ATOM   2343 N  N     . TYR A 1 288 ? -3.978  39.192 40.940  1.00 29.48  ? 288  TYR A N     1 
ATOM   2344 C  CA    . TYR A 1 288 ? -2.522  39.135 40.877  1.00 30.05  ? 288  TYR A CA    1 
ATOM   2345 C  C     . TYR A 1 288 ? -1.894  38.493 42.111  1.00 31.10  ? 288  TYR A C     1 
ATOM   2346 O  O     . TYR A 1 288 ? -0.767  38.811 42.479  1.00 32.49  ? 288  TYR A O     1 
ATOM   2347 C  CB    . TYR A 1 288 ? -1.925  40.522 40.613  1.00 29.54  ? 288  TYR A CB    1 
ATOM   2348 C  CG    . TYR A 1 288 ? -2.167  41.007 39.204  1.00 28.91  ? 288  TYR A CG    1 
ATOM   2349 C  CD1   . TYR A 1 288 ? -3.272  41.795 38.900  1.00 30.05  ? 288  TYR A CD1   1 
ATOM   2350 C  CD2   . TYR A 1 288 ? -1.302  40.661 38.172  1.00 27.79  ? 288  TYR A CD2   1 
ATOM   2351 C  CE1   . TYR A 1 288 ? -3.502  42.233 37.609  1.00 28.45  ? 288  TYR A CE1   1 
ATOM   2352 C  CE2   . TYR A 1 288 ? -1.526  41.094 36.877  1.00 26.98  ? 288  TYR A CE2   1 
ATOM   2353 C  CZ    . TYR A 1 288 ? -2.628  41.879 36.603  1.00 30.09  ? 288  TYR A CZ    1 
ATOM   2354 O  OH    . TYR A 1 288 ? -2.858  42.314 35.316  1.00 31.96  ? 288  TYR A OH    1 
ATOM   2355 N  N     . SER A 1 289 ? -2.624  37.585 42.748  1.00 30.82  ? 289  SER A N     1 
ATOM   2356 C  CA    . SER A 1 289 ? -2.025  36.776 43.797  1.00 34.15  ? 289  SER A CA    1 
ATOM   2357 C  C     . SER A 1 289 ? -1.070  35.815 43.109  1.00 35.41  ? 289  SER A C     1 
ATOM   2358 O  O     . SER A 1 289 ? -1.311  35.411 41.969  1.00 34.34  ? 289  SER A O     1 
ATOM   2359 C  CB    . SER A 1 289 ? -3.090  35.998 44.563  1.00 32.85  ? 289  SER A CB    1 
ATOM   2360 O  OG    . SER A 1 289 ? -3.547  34.895 43.805  1.00 37.34  ? 289  SER A OG    1 
ATOM   2361 N  N     . LEU A 1 290 ? 0.014   35.455 43.788  1.00 35.59  ? 290  LEU A N     1 
ATOM   2362 C  CA    . LEU A 1 290 ? 1.005   34.555 43.204  1.00 31.92  ? 290  LEU A CA    1 
ATOM   2363 C  C     . LEU A 1 290 ? 0.370   33.218 42.846  1.00 30.77  ? 290  LEU A C     1 
ATOM   2364 O  O     . LEU A 1 290 ? 0.718   32.602 41.838  1.00 35.41  ? 290  LEU A O     1 
ATOM   2365 C  CB    . LEU A 1 290 ? 2.179   34.344 44.160  1.00 28.71  ? 290  LEU A CB    1 
ATOM   2366 C  CG    . LEU A 1 290 ? 3.274   33.410 43.643  1.00 29.85  ? 290  LEU A CG    1 
ATOM   2367 C  CD1   . LEU A 1 290 ? 3.760   33.868 42.274  1.00 27.56  ? 290  LEU A CD1   1 
ATOM   2368 C  CD2   . LEU A 1 290 ? 4.426   33.339 44.632  1.00 31.03  ? 290  LEU A CD2   1 
ATOM   2369 N  N     . ASP A 1 291 ? -0.570  32.791 43.681  1.00 31.56  ? 291  ASP A N     1 
ATOM   2370 C  CA    . ASP A 1 291 ? -1.310  31.555 43.475  1.00 37.36  ? 291  ASP A CA    1 
ATOM   2371 C  C     . ASP A 1 291 ? -2.008  31.579 42.120  1.00 37.79  ? 291  ASP A C     1 
ATOM   2372 O  O     . ASP A 1 291 ? -1.933  30.624 41.346  1.00 38.56  ? 291  ASP A O     1 
ATOM   2373 C  CB    . ASP A 1 291 ? -2.353  31.401 44.585  1.00 47.79  ? 291  ASP A CB    1 
ATOM   2374 C  CG    . ASP A 1 291 ? -2.693  29.956 44.875  1.00 55.95  ? 291  ASP A CG    1 
ATOM   2375 O  OD1   . ASP A 1 291 ? -2.283  29.073 44.092  1.00 61.70  ? 291  ASP A OD1   1 
ATOM   2376 O  OD2   . ASP A 1 291 ? -3.378  29.705 45.888  1.00 58.48  ? 291  ASP A OD2   1 
ATOM   2377 N  N     . TYR A 1 292 ? -2.679  32.691 41.839  1.00 36.70  ? 292  TYR A N     1 
ATOM   2378 C  CA    . TYR A 1 292 ? -3.469  32.835 40.623  1.00 38.14  ? 292  TYR A CA    1 
ATOM   2379 C  C     . TYR A 1 292 ? -2.596  32.879 39.373  1.00 32.47  ? 292  TYR A C     1 
ATOM   2380 O  O     . TYR A 1 292 ? -2.896  32.230 38.372  1.00 31.58  ? 292  TYR A O     1 
ATOM   2381 C  CB    . TYR A 1 292 ? -4.318  34.103 40.702  1.00 37.12  ? 292  TYR A CB    1 
ATOM   2382 C  CG    . TYR A 1 292 ? -5.387  34.189 39.642  1.00 38.19  ? 292  TYR A CG    1 
ATOM   2383 C  CD1   . TYR A 1 292 ? -5.127  34.765 38.404  1.00 35.18  ? 292  TYR A CD1   1 
ATOM   2384 C  CD2   . TYR A 1 292 ? -6.661  33.694 39.882  1.00 40.29  ? 292  TYR A CD2   1 
ATOM   2385 C  CE1   . TYR A 1 292 ? -6.109  34.842 37.436  1.00 38.96  ? 292  TYR A CE1   1 
ATOM   2386 C  CE2   . TYR A 1 292 ? -7.646  33.768 38.925  1.00 42.76  ? 292  TYR A CE2   1 
ATOM   2387 C  CZ    . TYR A 1 292 ? -7.368  34.341 37.706  1.00 40.01  ? 292  TYR A CZ    1 
ATOM   2388 O  OH    . TYR A 1 292 ? -8.359  34.409 36.760  1.00 38.45  ? 292  TYR A OH    1 
ATOM   2389 N  N     . ILE A 1 293 ? -1.519  33.654 39.437  1.00 32.02  ? 293  ILE A N     1 
ATOM   2390 C  CA    . ILE A 1 293 ? -0.623  33.820 38.300  1.00 31.47  ? 293  ILE A CA    1 
ATOM   2391 C  C     . ILE A 1 293 ? 0.148   32.534 38.004  1.00 29.31  ? 293  ILE A C     1 
ATOM   2392 O  O     . ILE A 1 293 ? 0.368   32.186 36.842  1.00 30.98  ? 293  ILE A O     1 
ATOM   2393 C  CB    . ILE A 1 293 ? 0.352   34.992 38.529  1.00 30.19  ? 293  ILE A CB    1 
ATOM   2394 C  CG1   . ILE A 1 293 ? -0.430  36.275 38.808  1.00 32.64  ? 293  ILE A CG1   1 
ATOM   2395 C  CG2   . ILE A 1 293 ? 1.270   35.180 37.329  1.00 30.42  ? 293  ILE A CG2   1 
ATOM   2396 C  CD1   . ILE A 1 293 ? -1.313  36.718 37.653  1.00 29.40  ? 293  ILE A CD1   1 
ATOM   2397 N  N     . SER A 1 294 ? 0.545   31.825 39.057  1.00 26.17  ? 294  SER A N     1 
ATOM   2398 C  CA    . SER A 1 294 ? 1.253   30.560 38.894  1.00 30.68  ? 294  SER A CA    1 
ATOM   2399 C  C     . SER A 1 294 ? 0.373   29.546 38.180  1.00 33.87  ? 294  SER A C     1 
ATOM   2400 O  O     . SER A 1 294 ? 0.837   28.814 37.308  1.00 34.80  ? 294  SER A O     1 
ATOM   2401 C  CB    . SER A 1 294 ? 1.697   30.001 40.248  1.00 31.29  ? 294  SER A CB    1 
ATOM   2402 O  OG    . SER A 1 294 ? 2.653   30.848 40.859  1.00 34.29  ? 294  SER A OG    1 
ATOM   2403 N  N     . GLU A 1 295 ? -0.901  29.511 38.557  1.00 36.65  ? 295  GLU A N     1 
ATOM   2404 C  CA    . GLU A 1 295 ? -1.860  28.616 37.928  1.00 38.16  ? 295  GLU A CA    1 
ATOM   2405 C  C     . GLU A 1 295 ? -2.002  28.973 36.456  1.00 33.85  ? 295  GLU A C     1 
ATOM   2406 O  O     . GLU A 1 295 ? -1.989  28.098 35.595  1.00 35.23  ? 295  GLU A O     1 
ATOM   2407 C  CB    . GLU A 1 295 ? -3.221  28.704 38.630  1.00 44.01  ? 295  GLU A CB    1 
ATOM   2408 C  CG    . GLU A 1 295 ? -4.128  27.494 38.423  1.00 55.58  ? 295  GLU A CG    1 
ATOM   2409 C  CD    . GLU A 1 295 ? -4.695  27.403 37.017  1.00 66.28  ? 295  GLU A CD    1 
ATOM   2410 O  OE1   . GLU A 1 295 ? -5.028  28.460 36.439  1.00 69.56  ? 295  GLU A OE1   1 
ATOM   2411 O  OE2   . GLU A 1 295 ? -4.802  26.276 36.488  1.00 71.59  ? 295  GLU A OE2   1 
ATOM   2412 N  N     . PHE A 1 296 ? -2.132  30.263 36.170  1.00 31.61  ? 296  PHE A N     1 
ATOM   2413 C  CA    . PHE A 1 296 ? -2.313  30.716 34.797  1.00 30.83  ? 296  PHE A CA    1 
ATOM   2414 C  C     . PHE A 1 296 ? -1.080  30.423 33.949  1.00 28.62  ? 296  PHE A C     1 
ATOM   2415 O  O     . PHE A 1 296 ? -1.192  29.931 32.828  1.00 30.29  ? 296  PHE A O     1 
ATOM   2416 C  CB    . PHE A 1 296 ? -2.631  32.214 34.764  1.00 32.17  ? 296  PHE A CB    1 
ATOM   2417 C  CG    . PHE A 1 296 ? -2.816  32.770 33.377  1.00 32.64  ? 296  PHE A CG    1 
ATOM   2418 C  CD1   . PHE A 1 296 ? -4.070  32.789 32.787  1.00 33.19  ? 296  PHE A CD1   1 
ATOM   2419 C  CD2   . PHE A 1 296 ? -1.740  33.283 32.668  1.00 29.76  ? 296  PHE A CD2   1 
ATOM   2420 C  CE1   . PHE A 1 296 ? -4.248  33.304 31.515  1.00 30.05  ? 296  PHE A CE1   1 
ATOM   2421 C  CE2   . PHE A 1 296 ? -1.910  33.798 31.396  1.00 34.23  ? 296  PHE A CE2   1 
ATOM   2422 C  CZ    . PHE A 1 296 ? -3.167  33.807 30.818  1.00 34.56  ? 296  PHE A CZ    1 
ATOM   2423 N  N     . GLU A 1 297 ? 0.095   30.725 34.492  1.00 26.56  ? 297  GLU A N     1 
ATOM   2424 C  CA    . GLU A 1 297 ? 1.334   30.650 33.723  1.00 26.99  ? 297  GLU A CA    1 
ATOM   2425 C  C     . GLU A 1 297 ? 1.909   29.239 33.609  1.00 29.82  ? 297  GLU A C     1 
ATOM   2426 O  O     . GLU A 1 297 ? 2.461   28.875 32.571  1.00 31.72  ? 297  GLU A O     1 
ATOM   2427 C  CB    . GLU A 1 297 ? 2.383   31.595 34.316  1.00 25.00  ? 297  GLU A CB    1 
ATOM   2428 C  CG    . GLU A 1 297 ? 2.037   33.075 34.186  1.00 28.94  ? 297  GLU A CG    1 
ATOM   2429 C  CD    . GLU A 1 297 ? 2.180   33.588 32.764  1.00 33.49  ? 297  GLU A CD    1 
ATOM   2430 O  OE1   . GLU A 1 297 ? 3.004   33.027 32.009  1.00 34.77  ? 297  GLU A OE1   1 
ATOM   2431 O  OE2   . GLU A 1 297 ? 1.467   34.550 32.402  1.00 32.62  ? 297  GLU A OE2   1 
ATOM   2432 N  N     . LEU A 1 298 ? 1.777   28.449 34.671  1.00 28.06  ? 298  LEU A N     1 
ATOM   2433 C  CA    . LEU A 1 298 ? 2.464   27.162 34.758  1.00 30.84  ? 298  LEU A CA    1 
ATOM   2434 C  C     . LEU A 1 298 ? 1.521   25.959 34.781  1.00 37.75  ? 298  LEU A C     1 
ATOM   2435 O  O     . LEU A 1 298 ? 1.973   24.817 34.696  1.00 37.21  ? 298  LEU A O     1 
ATOM   2436 C  CB    . LEU A 1 298 ? 3.334   27.119 36.016  1.00 28.95  ? 298  LEU A CB    1 
ATOM   2437 C  CG    . LEU A 1 298 ? 4.258   28.302 36.299  1.00 29.03  ? 298  LEU A CG    1 
ATOM   2438 C  CD1   . LEU A 1 298 ? 4.840   28.183 37.702  1.00 25.19  ? 298  LEU A CD1   1 
ATOM   2439 C  CD2   . LEU A 1 298 ? 5.364   28.384 35.259  1.00 30.61  ? 298  LEU A CD2   1 
ATOM   2440 N  N     A ASN A 1 299 ? 0.221   26.219 34.890  0.43 41.71  ? 299  ASN A N     1 
ATOM   2441 N  N     B ASN A 1 299 ? 0.225   26.232 34.916  0.57 41.64  ? 299  ASN A N     1 
ATOM   2442 C  CA    A ASN A 1 299 ? -0.779  25.159 35.017  0.43 45.73  ? 299  ASN A CA    1 
ATOM   2443 C  CA    B ASN A 1 299 ? -0.800  25.194 35.027  0.57 45.37  ? 299  ASN A CA    1 
ATOM   2444 C  C     A ASN A 1 299 ? -0.486  24.243 36.206  0.43 47.65  ? 299  ASN A C     1 
ATOM   2445 C  C     B ASN A 1 299 ? -0.602  24.284 36.238  0.57 47.65  ? 299  ASN A C     1 
ATOM   2446 O  O     A ASN A 1 299 ? -0.649  23.026 36.131  0.43 49.55  ? 299  ASN A O     1 
ATOM   2447 O  O     B ASN A 1 299 ? -0.960  23.107 36.208  0.57 50.20  ? 299  ASN A O     1 
ATOM   2448 C  CB    A ASN A 1 299 ? -0.907  24.352 33.717  0.43 48.67  ? 299  ASN A CB    1 
ATOM   2449 C  CB    B ASN A 1 299 ? -0.900  24.372 33.738  0.57 48.28  ? 299  ASN A CB    1 
ATOM   2450 C  CG    A ASN A 1 299 ? -2.125  23.443 33.707  0.43 51.21  ? 299  ASN A CG    1 
ATOM   2451 C  CG    B ASN A 1 299 ? -1.100  25.238 32.510  0.57 49.80  ? 299  ASN A CG    1 
ATOM   2452 O  OD1   A ASN A 1 299 ? -3.148  23.749 34.321  0.43 53.36  ? 299  ASN A OD1   1 
ATOM   2453 O  OD1   B ASN A 1 299 ? -0.280  25.231 31.593  0.57 52.93  ? 299  ASN A OD1   1 
ATOM   2454 N  ND2   A ASN A 1 299 ? -2.015  22.313 33.018  0.43 51.53  ? 299  ASN A ND2   1 
ATOM   2455 N  ND2   B ASN A 1 299 ? -2.191  25.996 32.490  0.57 50.23  ? 299  ASN A ND2   1 
ATOM   2456 N  N     . VAL A 1 300 ? -0.031  24.840 37.302  1.00 47.91  ? 300  VAL A N     1 
ATOM   2457 C  CA    . VAL A 1 300 ? 0.153   24.102 38.542  1.00 51.09  ? 300  VAL A CA    1 
ATOM   2458 C  C     . VAL A 1 300 ? -1.106  24.266 39.379  1.00 56.77  ? 300  VAL A C     1 
ATOM   2459 O  O     . VAL A 1 300 ? -1.818  25.263 39.250  1.00 61.89  ? 300  VAL A O     1 
ATOM   2460 C  CB    . VAL A 1 300 ? 1.374   24.598 39.341  1.00 47.22  ? 300  VAL A CB    1 
ATOM   2461 C  CG1   . VAL A 1 300 ? 2.664   24.203 38.642  1.00 43.36  ? 300  VAL A CG1   1 
ATOM   2462 C  CG2   . VAL A 1 300 ? 1.304   26.104 39.547  1.00 47.36  ? 300  VAL A CG2   1 
ATOM   2463 N  N     . GLY A 1 301 ? -1.387  23.285 40.227  1.00 56.32  ? 301  GLY A N     1 
ATOM   2464 C  CA    . GLY A 1 301 ? -2.572  23.332 41.060  1.00 57.13  ? 301  GLY A CA    1 
ATOM   2465 C  C     . GLY A 1 301 ? -2.455  24.379 42.148  1.00 57.77  ? 301  GLY A C     1 
ATOM   2466 O  O     . GLY A 1 301 ? -1.354  24.697 42.602  1.00 52.15  ? 301  GLY A O     1 
ATOM   2467 N  N     . LYS A 1 302 ? -3.593  24.926 42.559  1.00 63.47  ? 302  LYS A N     1 
ATOM   2468 C  CA    . LYS A 1 302 ? -3.624  25.864 43.670  1.00 67.85  ? 302  LYS A CA    1 
ATOM   2469 C  C     . LYS A 1 302 ? -3.160  25.157 44.936  1.00 71.05  ? 302  LYS A C     1 
ATOM   2470 O  O     . LYS A 1 302 ? -3.553  24.020 45.199  1.00 70.76  ? 302  LYS A O     1 
ATOM   2471 C  CB    . LYS A 1 302 ? -5.035  26.422 43.865  1.00 70.03  ? 302  LYS A CB    1 
ATOM   2472 N  N     . LEU A 1 303 ? -2.306  25.823 45.706  1.00 73.02  ? 303  LEU A N     1 
ATOM   2473 C  CA    . LEU A 1 303 ? -1.849  25.282 46.978  1.00 76.08  ? 303  LEU A CA    1 
ATOM   2474 C  C     . LEU A 1 303 ? -3.044  25.092 47.905  1.00 78.48  ? 303  LEU A C     1 
ATOM   2475 O  O     . LEU A 1 303 ? -3.936  25.938 47.961  1.00 81.52  ? 303  LEU A O     1 
ATOM   2476 C  CB    . LEU A 1 303 ? -0.818  26.211 47.617  1.00 74.69  ? 303  LEU A CB    1 
ATOM   2477 C  CG    . LEU A 1 303 ? 0.466   26.434 46.815  1.00 72.56  ? 303  LEU A CG    1 
ATOM   2478 C  CD1   . LEU A 1 303 ? 1.281   27.564 47.418  1.00 74.18  ? 303  LEU A CD1   1 
ATOM   2479 C  CD2   . LEU A 1 303 ? 1.289   25.157 46.749  1.00 70.92  ? 303  LEU A CD2   1 
ATOM   2480 N  N     . LYS A 1 304 ? -3.065  23.976 48.624  1.00 76.80  ? 304  LYS A N     1 
ATOM   2481 C  CA    . LYS A 1 304 ? -4.213  23.643 49.456  1.00 77.84  ? 304  LYS A CA    1 
ATOM   2482 C  C     . LYS A 1 304 ? -3.875  23.620 50.943  1.00 79.66  ? 304  LYS A C     1 
ATOM   2483 O  O     . LYS A 1 304 ? -2.823  23.124 51.347  1.00 78.97  ? 304  LYS A O     1 
ATOM   2484 C  CB    . LYS A 1 304 ? -4.804  22.295 49.032  1.00 78.00  ? 304  LYS A CB    1 
ATOM   2485 N  N     . TYR A 1 305 ? -4.775  24.173 51.749  1.00 82.12  ? 305  TYR A N     1 
ATOM   2486 C  CA    . TYR A 1 305 ? -4.678  24.073 53.200  1.00 84.84  ? 305  TYR A CA    1 
ATOM   2487 C  C     . TYR A 1 305 ? -6.033  24.299 53.859  1.00 83.80  ? 305  TYR A C     1 
ATOM   2488 O  O     . TYR A 1 305 ? -6.908  24.952 53.292  1.00 83.31  ? 305  TYR A O     1 
ATOM   2489 C  CB    . TYR A 1 305 ? -3.626  25.037 53.768  1.00 87.63  ? 305  TYR A CB    1 
ATOM   2490 C  CG    . TYR A 1 305 ? -3.810  26.494 53.394  1.00 89.08  ? 305  TYR A CG    1 
ATOM   2491 C  CD1   . TYR A 1 305 ? -4.749  27.290 54.041  1.00 92.02  ? 305  TYR A CD1   1 
ATOM   2492 C  CD2   . TYR A 1 305 ? -3.021  27.082 52.414  1.00 87.73  ? 305  TYR A CD2   1 
ATOM   2493 C  CE1   . TYR A 1 305 ? -4.911  28.622 53.708  1.00 92.62  ? 305  TYR A CE1   1 
ATOM   2494 C  CE2   . TYR A 1 305 ? -3.173  28.414 52.075  1.00 88.55  ? 305  TYR A CE2   1 
ATOM   2495 C  CZ    . TYR A 1 305 ? -4.119  29.179 52.725  1.00 91.02  ? 305  TYR A CZ    1 
ATOM   2496 O  OH    . TYR A 1 305 ? -4.275  30.505 52.390  1.00 90.47  ? 305  TYR A OH    1 
ATOM   2497 N  N     . ASP A 1 306 ? -6.200  23.750 55.056  1.00 85.79  ? 306  ASP A N     1 
ATOM   2498 C  CA    . ASP A 1 306 ? -7.433  23.923 55.810  1.00 88.45  ? 306  ASP A CA    1 
ATOM   2499 C  C     . ASP A 1 306 ? -7.302  25.123 56.739  1.00 89.14  ? 306  ASP A C     1 
ATOM   2500 O  O     . ASP A 1 306 ? -6.217  25.409 57.245  1.00 89.21  ? 306  ASP A O     1 
ATOM   2501 C  CB    . ASP A 1 306 ? -7.749  22.662 56.614  1.00 90.68  ? 306  ASP A CB    1 
ATOM   2502 C  CG    . ASP A 1 306 ? -7.563  21.394 55.804  1.00 90.32  ? 306  ASP A CG    1 
ATOM   2503 O  OD1   . ASP A 1 306 ? -7.597  21.474 54.557  1.00 88.77  ? 306  ASP A OD1   1 
ATOM   2504 O  OD2   . ASP A 1 306 ? -7.381  20.318 56.412  1.00 90.62  ? 306  ASP A OD2   1 
ATOM   2505 N  N     . GLY A 1 307 ? -8.407  25.827 56.957  1.00 89.09  ? 307  GLY A N     1 
ATOM   2506 C  CA    . GLY A 1 307 ? -8.403  26.999 57.812  1.00 86.87  ? 307  GLY A CA    1 
ATOM   2507 C  C     . GLY A 1 307 ? -7.747  28.196 57.151  1.00 82.69  ? 307  GLY A C     1 
ATOM   2508 O  O     . GLY A 1 307 ? -7.240  28.092 56.033  1.00 81.32  ? 307  GLY A O     1 
ATOM   2509 N  N     . PRO A 1 308 ? -7.753  29.346 57.841  1.00 80.74  ? 308  PRO A N     1 
ATOM   2510 C  CA    . PRO A 1 308 ? -7.160  30.583 57.324  1.00 76.39  ? 308  PRO A CA    1 
ATOM   2511 C  C     . PRO A 1 308 ? -5.640  30.568 57.420  1.00 74.52  ? 308  PRO A C     1 
ATOM   2512 O  O     . PRO A 1 308 ? -5.079  29.801 58.203  1.00 73.10  ? 308  PRO A O     1 
ATOM   2513 C  CB    . PRO A 1 308 ? -7.731  31.651 58.256  1.00 77.01  ? 308  PRO A CB    1 
ATOM   2514 C  CG    . PRO A 1 308 ? -7.943  30.934 59.542  1.00 79.14  ? 308  PRO A CG    1 
ATOM   2515 C  CD    . PRO A 1 308 ? -8.361  29.538 59.170  1.00 80.91  ? 308  PRO A CD    1 
ATOM   2516 N  N     . ILE A 1 309 ? -4.986  31.416 56.632  1.00 75.33  ? 309  ILE A N     1 
ATOM   2517 C  CA    . ILE A 1 309 ? -3.530  31.502 56.630  1.00 74.13  ? 309  ILE A CA    1 
ATOM   2518 C  C     . ILE A 1 309 ? -3.011  32.082 57.948  1.00 75.57  ? 309  ILE A C     1 
ATOM   2519 O  O     . ILE A 1 309 ? -1.878  31.816 58.354  1.00 75.21  ? 309  ILE A O     1 
ATOM   2520 C  CB    . ILE A 1 309 ? -3.018  32.337 55.430  1.00 73.72  ? 309  ILE A CB    1 
ATOM   2521 C  CG1   . ILE A 1 309 ? -1.490  32.288 55.338  1.00 71.09  ? 309  ILE A CG1   1 
ATOM   2522 C  CG2   . ILE A 1 309 ? -3.519  33.772 55.516  1.00 75.71  ? 309  ILE A CG2   1 
ATOM   2523 N  N     . SER A 1 310 ? -3.858  32.850 58.628  1.00 75.41  ? 310  SER A N     1 
ATOM   2524 C  CA    . SER A 1 310 ? -3.485  33.479 59.892  1.00 76.59  ? 310  SER A CA    1 
ATOM   2525 C  C     . SER A 1 310 ? -3.236  32.458 61.001  1.00 79.94  ? 310  SER A C     1 
ATOM   2526 O  O     . SER A 1 310 ? -2.733  32.802 62.070  1.00 83.48  ? 310  SER A O     1 
ATOM   2527 C  CB    . SER A 1 310 ? -4.561  34.475 60.333  1.00 79.01  ? 310  SER A CB    1 
ATOM   2528 O  OG    . SER A 1 310 ? -5.769  33.810 60.662  1.00 82.60  ? 310  SER A OG    1 
ATOM   2529 N  N     . LYS A 1 311 ? -3.593  31.203 60.743  1.00 63.78  ? 311  LYS A N     1 
ATOM   2530 C  CA    . LYS A 1 311 ? -3.392  30.136 61.715  1.00 56.08  ? 311  LYS A CA    1 
ATOM   2531 C  C     . LYS A 1 311 ? -2.717  28.915 61.090  1.00 45.29  ? 311  LYS A C     1 
ATOM   2532 O  O     . LYS A 1 311 ? -2.688  27.839 61.688  1.00 47.30  ? 311  LYS A O     1 
ATOM   2533 C  CB    . LYS A 1 311 ? -4.725  29.735 62.351  1.00 58.55  ? 311  LYS A CB    1 
ATOM   2534 N  N     . LEU A 1 312 ? -2.172  29.083 59.889  1.00 42.60  ? 312  LEU A N     1 
ATOM   2535 C  CA    . LEU A 1 312 ? -1.517  27.976 59.197  1.00 43.73  ? 312  LEU A CA    1 
ATOM   2536 C  C     . LEU A 1 312 ? -0.244  27.528 59.912  1.00 43.82  ? 312  LEU A C     1 
ATOM   2537 O  O     . LEU A 1 312 ? 0.024   26.332 60.019  1.00 43.74  ? 312  LEU A O     1 
ATOM   2538 C  CB    . LEU A 1 312 ? -1.209  28.339 57.743  1.00 42.72  ? 312  LEU A CB    1 
ATOM   2539 C  CG    . LEU A 1 312 ? -0.551  27.234 56.911  1.00 42.40  ? 312  LEU A CG    1 
ATOM   2540 C  CD1   . LEU A 1 312 ? -1.398  25.968 56.927  1.00 40.90  ? 312  LEU A CD1   1 
ATOM   2541 C  CD2   . LEU A 1 312 ? -0.317  27.701 55.485  1.00 37.13  ? 312  LEU A CD2   1 
ATOM   2542 N  N     . ARG A 1 313 ? 0.533   28.490 60.401  1.00 43.22  ? 313  ARG A N     1 
ATOM   2543 C  CA    . ARG A 1 313 ? 1.784   28.183 61.088  1.00 44.27  ? 313  ARG A CA    1 
ATOM   2544 C  C     . ARG A 1 313 ? 1.552   27.360 62.353  1.00 46.26  ? 313  ARG A C     1 
ATOM   2545 O  O     . ARG A 1 313 ? 2.268   26.392 62.614  1.00 44.07  ? 313  ARG A O     1 
ATOM   2546 C  CB    . ARG A 1 313 ? 2.546   29.466 61.432  1.00 44.50  ? 313  ARG A CB    1 
ATOM   2547 C  CG    . ARG A 1 313 ? 3.842   29.221 62.191  1.00 44.11  ? 313  ARG A CG    1 
ATOM   2548 C  CD    . ARG A 1 313 ? 4.559   30.520 62.526  1.00 40.71  ? 313  ARG A CD    1 
ATOM   2549 N  NE    . ARG A 1 313 ? 5.770   30.279 63.305  1.00 35.70  ? 313  ARG A NE    1 
ATOM   2550 C  CZ    . ARG A 1 313 ? 5.791   30.157 64.628  1.00 38.83  ? 313  ARG A CZ    1 
ATOM   2551 N  NH1   . ARG A 1 313 ? 4.664   30.255 65.320  1.00 42.34  ? 313  ARG A NH1   1 
ATOM   2552 N  NH2   . ARG A 1 313 ? 6.936   29.937 65.260  1.00 37.61  ? 313  ARG A NH2   1 
ATOM   2553 N  N     . GLU A 1 314 ? 0.546   27.746 63.132  1.00 47.75  ? 314  GLU A N     1 
ATOM   2554 C  CA    . GLU A 1 314 ? 0.244   27.065 64.387  1.00 52.47  ? 314  GLU A CA    1 
ATOM   2555 C  C     . GLU A 1 314 ? -0.284  25.649 64.162  1.00 50.02  ? 314  GLU A C     1 
ATOM   2556 O  O     . GLU A 1 314 ? 0.098   24.717 64.869  1.00 54.96  ? 314  GLU A O     1 
ATOM   2557 C  CB    . GLU A 1 314 ? -0.759  27.876 65.214  1.00 53.49  ? 314  GLU A CB    1 
ATOM   2558 O  OE1   . GLU A 1 314 ? -2.495  33.719 64.856  1.00 78.66  ? 314  GLU A OE1   1 
ATOM   2559 N  N     . SER A 1 315 ? -1.160  25.492 63.174  1.00 43.77  ? 315  SER A N     1 
ATOM   2560 C  CA    . SER A 1 315 ? -1.782  24.198 62.909  1.00 47.42  ? 315  SER A CA    1 
ATOM   2561 C  C     . SER A 1 315 ? -0.911  23.288 62.043  1.00 45.87  ? 315  SER A C     1 
ATOM   2562 O  O     . SER A 1 315 ? -0.818  22.085 62.293  1.00 45.38  ? 315  SER A O     1 
ATOM   2563 C  CB    . SER A 1 315 ? -3.157  24.385 62.260  1.00 45.32  ? 315  SER A CB    1 
ATOM   2564 O  OG    . SER A 1 315 ? -3.056  25.106 61.046  1.00 47.59  ? 315  SER A OG    1 
ATOM   2565 N  N     . ASN A 1 316 ? -0.276  23.864 61.026  1.00 41.49  ? 316  ASN A N     1 
ATOM   2566 C  CA    . ASN A 1 316 ? 0.534   23.083 60.096  1.00 39.79  ? 316  ASN A CA    1 
ATOM   2567 C  C     . ASN A 1 316 ? 1.804   23.821 59.672  1.00 36.76  ? 316  ASN A C     1 
ATOM   2568 O  O     . ASN A 1 316 ? 1.929   24.263 58.529  1.00 37.35  ? 316  ASN A O     1 
ATOM   2569 C  CB    . ASN A 1 316 ? -0.293  22.695 58.867  1.00 38.08  ? 316  ASN A CB    1 
ATOM   2570 C  CG    . ASN A 1 316 ? 0.253   21.469 58.159  1.00 40.73  ? 316  ASN A CG    1 
ATOM   2571 O  OD1   . ASN A 1 316 ? 1.422   21.114 58.315  1.00 43.78  ? 316  ASN A OD1   1 
ATOM   2572 N  ND2   . ASN A 1 316 ? -0.594  20.815 57.372  1.00 37.10  ? 316  ASN A ND2   1 
ATOM   2573 N  N     . HIS A 1 317 ? 2.741   23.943 60.606  1.00 36.36  ? 317  HIS A N     1 
ATOM   2574 C  CA    . HIS A 1 317 ? 4.005   24.628 60.368  1.00 35.51  ? 317  HIS A CA    1 
ATOM   2575 C  C     . HIS A 1 317 ? 4.819   23.951 59.269  1.00 37.12  ? 317  HIS A C     1 
ATOM   2576 O  O     . HIS A 1 317 ? 5.539   24.612 58.518  1.00 38.68  ? 317  HIS A O     1 
ATOM   2577 C  CB    . HIS A 1 317 ? 4.812   24.692 61.666  1.00 38.05  ? 317  HIS A CB    1 
ATOM   2578 C  CG    . HIS A 1 317 ? 6.221   25.158 61.485  1.00 38.32  ? 317  HIS A CG    1 
ATOM   2579 N  ND1   . HIS A 1 317 ? 7.307   24.331 61.676  1.00 39.60  ? 317  HIS A ND1   1 
ATOM   2580 C  CD2   . HIS A 1 317 ? 6.726   26.368 61.143  1.00 37.66  ? 317  HIS A CD2   1 
ATOM   2581 C  CE1   . HIS A 1 317 ? 8.420   25.009 61.455  1.00 37.56  ? 317  HIS A CE1   1 
ATOM   2582 N  NE2   . HIS A 1 317 ? 8.093   26.247 61.130  1.00 37.44  ? 317  HIS A NE2   1 
ATOM   2583 N  N     . GLN A 1 318 ? 4.696   22.631 59.181  1.00 37.90  ? 318  GLN A N     1 
ATOM   2584 C  CA    . GLN A 1 318 ? 5.358   21.857 58.137  1.00 39.51  ? 318  GLN A CA    1 
ATOM   2585 C  C     . GLN A 1 318 ? 4.978   22.373 56.752  1.00 37.98  ? 318  GLN A C     1 
ATOM   2586 O  O     . GLN A 1 318 ? 5.842   22.659 55.919  1.00 37.39  ? 318  GLN A O     1 
ATOM   2587 C  CB    . GLN A 1 318 ? 4.984   20.379 58.266  1.00 43.28  ? 318  GLN A CB    1 
ATOM   2588 C  CG    . GLN A 1 318 ? 5.439   19.517 57.103  1.00 42.18  ? 318  GLN A CG    1 
ATOM   2589 C  CD    . GLN A 1 318 ? 6.945   19.386 57.029  1.00 39.70  ? 318  GLN A CD    1 
ATOM   2590 O  OE1   . GLN A 1 318 ? 7.634   19.396 58.051  1.00 40.84  ? 318  GLN A OE1   1 
ATOM   2591 N  NE2   . GLN A 1 318 ? 7.468   19.269 55.814  1.00 37.73  ? 318  GLN A NE2   1 
ATOM   2592 N  N     . ARG A 1 319 ? 3.676   22.503 56.524  1.00 33.47  ? 319  ARG A N     1 
ATOM   2593 C  CA    . ARG A 1 319 ? 3.150   22.971 55.247  1.00 33.20  ? 319  ARG A CA    1 
ATOM   2594 C  C     . ARG A 1 319 ? 3.415   24.462 55.063  1.00 32.82  ? 319  ARG A C     1 
ATOM   2595 O  O     . ARG A 1 319 ? 3.654   24.931 53.950  1.00 33.92  ? 319  ARG A O     1 
ATOM   2596 C  CB    . ARG A 1 319 ? 1.651   22.679 55.165  1.00 36.29  ? 319  ARG A CB    1 
ATOM   2597 C  CG    . ARG A 1 319 ? 0.976   23.189 53.911  1.00 41.45  ? 319  ARG A CG    1 
ATOM   2598 C  CD    . ARG A 1 319 ? -0.113  22.233 53.465  1.00 53.32  ? 319  ARG A CD    1 
ATOM   2599 N  NE    . ARG A 1 319 ? 0.440   20.939 53.074  1.00 59.93  ? 319  ARG A NE    1 
ATOM   2600 C  CZ    . ARG A 1 319 ? -0.291  19.899 52.687  1.00 66.66  ? 319  ARG A CZ    1 
ATOM   2601 N  NH1   . ARG A 1 319 ? -1.613  19.997 52.639  1.00 68.66  ? 319  ARG A NH1   1 
ATOM   2602 N  NH2   . ARG A 1 319 ? 0.300   18.761 52.350  1.00 68.23  ? 319  ARG A NH2   1 
ATOM   2603 N  N     . TYR A 1 320 ? 3.375   25.191 56.173  1.00 34.90  ? 320  TYR A N     1 
ATOM   2604 C  CA    . TYR A 1 320 ? 3.637   26.625 56.199  1.00 32.89  ? 320  TYR A CA    1 
ATOM   2605 C  C     . TYR A 1 320 ? 4.998   26.963 55.591  1.00 32.97  ? 320  TYR A C     1 
ATOM   2606 O  O     . TYR A 1 320 ? 5.108   27.858 54.754  1.00 33.05  ? 320  TYR A O     1 
ATOM   2607 C  CB    . TYR A 1 320 ? 3.575   27.105 57.648  1.00 34.58  ? 320  TYR A CB    1 
ATOM   2608 C  CG    . TYR A 1 320 ? 3.648   28.603 57.868  1.00 35.82  ? 320  TYR A CG    1 
ATOM   2609 C  CD1   . TYR A 1 320 ? 2.555   29.421 57.606  1.00 35.43  ? 320  TYR A CD1   1 
ATOM   2610 C  CD2   . TYR A 1 320 ? 4.792   29.189 58.392  1.00 35.24  ? 320  TYR A CD2   1 
ATOM   2611 C  CE1   . TYR A 1 320 ? 2.613   30.787 57.835  1.00 36.75  ? 320  TYR A CE1   1 
ATOM   2612 C  CE2   . TYR A 1 320 ? 4.861   30.548 58.623  1.00 37.75  ? 320  TYR A CE2   1 
ATOM   2613 C  CZ    . TYR A 1 320 ? 3.769   31.343 58.344  1.00 36.51  ? 320  TYR A CZ    1 
ATOM   2614 O  OH    . TYR A 1 320 ? 3.837   32.694 58.578  1.00 36.57  ? 320  TYR A OH    1 
ATOM   2615 N  N     . ILE A 1 321 ? 6.029   26.239 56.017  1.00 36.05  ? 321  ILE A N     1 
ATOM   2616 C  CA    . ILE A 1 321 ? 7.383   26.461 55.519  1.00 34.55  ? 321  ILE A CA    1 
ATOM   2617 C  C     . ILE A 1 321 ? 7.532   25.974 54.080  1.00 32.70  ? 321  ILE A C     1 
ATOM   2618 O  O     . ILE A 1 321 ? 8.137   26.652 53.246  1.00 28.91  ? 321  ILE A O     1 
ATOM   2619 C  CB    . ILE A 1 321 ? 8.432   25.771 56.417  1.00 32.50  ? 321  ILE A CB    1 
ATOM   2620 C  CG1   . ILE A 1 321 ? 8.383   26.357 57.827  1.00 33.20  ? 321  ILE A CG1   1 
ATOM   2621 C  CG2   . ILE A 1 321 ? 9.833   25.921 55.833  1.00 29.69  ? 321  ILE A CG2   1 
ATOM   2622 C  CD1   . ILE A 1 321 ? 8.571   27.857 57.865  1.00 32.73  ? 321  ILE A CD1   1 
ATOM   2623 N  N     . SER A 1 322 ? 6.965   24.806 53.791  1.00 31.64  ? 322  SER A N     1 
ATOM   2624 C  CA    . SER A 1 322 ? 7.028   24.242 52.444  1.00 30.97  ? 322  SER A CA    1 
ATOM   2625 C  C     . SER A 1 322 ? 6.403   25.174 51.411  1.00 30.19  ? 322  SER A C     1 
ATOM   2626 O  O     . SER A 1 322 ? 6.926   25.321 50.308  1.00 29.09  ? 322  SER A O     1 
ATOM   2627 C  CB    . SER A 1 322 ? 6.348   22.873 52.388  1.00 29.37  ? 322  SER A CB    1 
ATOM   2628 O  OG    . SER A 1 322 ? 7.093   21.893 53.092  1.00 30.70  ? 322  SER A OG    1 
ATOM   2629 N  N     . TYR A 1 323 ? 5.289   25.806 51.771  1.00 32.16  ? 323  TYR A N     1 
ATOM   2630 C  CA    . TYR A 1 323 ? 4.613   26.721 50.853  1.00 29.35  ? 323  TYR A CA    1 
ATOM   2631 C  C     . TYR A 1 323 ? 5.399   28.014 50.656  1.00 28.90  ? 323  TYR A C     1 
ATOM   2632 O  O     . TYR A 1 323 ? 5.355   28.617 49.583  1.00 32.60  ? 323  TYR A O     1 
ATOM   2633 C  CB    . TYR A 1 323 ? 3.185   27.022 51.319  1.00 35.73  ? 323  TYR A CB    1 
ATOM   2634 C  CG    . TYR A 1 323 ? 2.205   25.908 51.024  1.00 44.33  ? 323  TYR A CG    1 
ATOM   2635 C  CD1   . TYR A 1 323 ? 0.871   26.008 51.401  1.00 48.74  ? 323  TYR A CD1   1 
ATOM   2636 C  CD2   . TYR A 1 323 ? 2.615   24.752 50.370  1.00 49.02  ? 323  TYR A CD2   1 
ATOM   2637 C  CE1   . TYR A 1 323 ? -0.027  24.991 51.130  1.00 50.71  ? 323  TYR A CE1   1 
ATOM   2638 C  CE2   . TYR A 1 323 ? 1.727   23.729 50.098  1.00 51.71  ? 323  TYR A CE2   1 
ATOM   2639 C  CZ    . TYR A 1 323 ? 0.407   23.854 50.480  1.00 53.84  ? 323  TYR A CZ    1 
ATOM   2640 O  OH    . TYR A 1 323 ? -0.481  22.838 50.211  1.00 58.85  ? 323  TYR A OH    1 
ATOM   2641 N  N     . ASN A 1 324 ? 6.112   28.436 51.696  1.00 26.97  ? 324  ASN A N     1 
ATOM   2642 C  CA    . ASN A 1 324 ? 6.997   29.593 51.595  1.00 25.93  ? 324  ASN A CA    1 
ATOM   2643 C  C     . ASN A 1 324 ? 8.103   29.321 50.581  1.00 28.52  ? 324  ASN A C     1 
ATOM   2644 O  O     . ASN A 1 324 ? 8.401   30.159 49.728  1.00 27.24  ? 324  ASN A O     1 
ATOM   2645 C  CB    . ASN A 1 324 ? 7.578   29.945 52.970  1.00 26.01  ? 324  ASN A CB    1 
ATOM   2646 C  CG    . ASN A 1 324 ? 8.573   31.095 52.916  1.00 31.74  ? 324  ASN A CG    1 
ATOM   2647 O  OD1   . ASN A 1 324 ? 9.704   30.970 53.384  1.00 31.37  ? 324  ASN A OD1   1 
ATOM   2648 N  ND2   . ASN A 1 324 ? 8.155   32.220 52.344  1.00 29.27  ? 324  ASN A ND2   1 
ATOM   2649 N  N     . ILE A 1 325 ? 8.687   28.129 50.665  1.00 29.18  ? 325  ILE A N     1 
ATOM   2650 C  CA    . ILE A 1 325 ? 9.720   27.701 49.729  1.00 27.75  ? 325  ILE A CA    1 
ATOM   2651 C  C     . ILE A 1 325 ? 9.165   27.597 48.308  1.00 29.93  ? 325  ILE A C     1 
ATOM   2652 O  O     . ILE A 1 325 ? 9.795   28.043 47.347  1.00 28.60  ? 325  ILE A O     1 
ATOM   2653 C  CB    . ILE A 1 325 ? 10.319  26.337 50.148  1.00 29.67  ? 325  ILE A CB    1 
ATOM   2654 C  CG1   . ILE A 1 325 ? 11.013  26.453 51.508  1.00 27.05  ? 325  ILE A CG1   1 
ATOM   2655 C  CG2   . ILE A 1 325 ? 11.284  25.824 49.087  1.00 26.31  ? 325  ILE A CG2   1 
ATOM   2656 C  CD1   . ILE A 1 325 ? 11.398  25.117 52.118  1.00 27.94  ? 325  ILE A CD1   1 
ATOM   2657 N  N     . ILE A 1 326 ? 7.981   27.006 48.183  1.00 29.77  ? 326  ILE A N     1 
ATOM   2658 C  CA    . ILE A 1 326 ? 7.338   26.847 46.884  1.00 29.88  ? 326  ILE A CA    1 
ATOM   2659 C  C     . ILE A 1 326 ? 7.018   28.198 46.242  1.00 29.45  ? 326  ILE A C     1 
ATOM   2660 O  O     . ILE A 1 326 ? 7.214   28.381 45.039  1.00 32.43  ? 326  ILE A O     1 
ATOM   2661 C  CB    . ILE A 1 326 ? 6.060   25.985 46.991  1.00 32.07  ? 326  ILE A CB    1 
ATOM   2662 C  CG1   . ILE A 1 326 ? 6.424   24.537 47.326  1.00 33.28  ? 326  ILE A CG1   1 
ATOM   2663 C  CG2   . ILE A 1 326 ? 5.270   26.035 45.698  1.00 33.12  ? 326  ILE A CG2   1 
ATOM   2664 C  CD1   . ILE A 1 326 ? 5.226   23.644 47.603  1.00 36.47  ? 326  ILE A CD1   1 
ATOM   2665 N  N     . ALA A 1 327 ? 6.546   29.144 47.052  1.00 25.70  ? 327  ALA A N     1 
ATOM   2666 C  CA    . ALA A 1 327 ? 6.243   30.493 46.575  1.00 27.14  ? 327  ALA A CA    1 
ATOM   2667 C  C     . ALA A 1 327 ? 7.441   31.134 45.874  1.00 27.36  ? 327  ALA A C     1 
ATOM   2668 O  O     . ALA A 1 327 ? 7.293   31.764 44.827  1.00 28.96  ? 327  ALA A O     1 
ATOM   2669 C  CB    . ALA A 1 327 ? 5.763   31.374 47.729  1.00 25.30  ? 327  ALA A CB    1 
ATOM   2670 N  N     . VAL A 1 328 ? 8.625   30.959 46.451  1.00 26.28  ? 328  VAL A N     1 
ATOM   2671 C  CA    . VAL A 1 328 ? 9.852   31.479 45.856  1.00 26.09  ? 328  VAL A CA    1 
ATOM   2672 C  C     . VAL A 1 328 ? 10.155  30.768 44.541  1.00 24.38  ? 328  VAL A C     1 
ATOM   2673 O  O     . VAL A 1 328 ? 10.505  31.400 43.545  1.00 26.90  ? 328  VAL A O     1 
ATOM   2674 C  CB    . VAL A 1 328 ? 11.051  31.320 46.811  1.00 29.09  ? 328  VAL A CB    1 
ATOM   2675 C  CG1   . VAL A 1 328 ? 12.362  31.629 46.092  1.00 27.04  ? 328  VAL A CG1   1 
ATOM   2676 C  CG2   . VAL A 1 328 ? 10.876  32.213 48.028  1.00 27.88  ? 328  VAL A CG2   1 
ATOM   2677 N  N     . TYR A 1 329 ? 10.002  29.450 44.542  1.00 26.40  ? 329  TYR A N     1 
ATOM   2678 C  CA    . TYR A 1 329 ? 10.296  28.655 43.358  1.00 27.36  ? 329  TYR A CA    1 
ATOM   2679 C  C     . TYR A 1 329 ? 9.350   28.950 42.192  1.00 27.78  ? 329  TYR A C     1 
ATOM   2680 O  O     . TYR A 1 329 ? 9.760   28.913 41.033  1.00 29.79  ? 329  TYR A O     1 
ATOM   2681 C  CB    . TYR A 1 329 ? 10.286  27.162 43.693  1.00 25.58  ? 329  TYR A CB    1 
ATOM   2682 C  CG    . TYR A 1 329 ? 10.673  26.280 42.529  1.00 30.76  ? 329  TYR A CG    1 
ATOM   2683 C  CD1   . TYR A 1 329 ? 11.804  26.558 41.768  1.00 31.79  ? 329  TYR A CD1   1 
ATOM   2684 C  CD2   . TYR A 1 329 ? 9.915   25.163 42.194  1.00 31.02  ? 329  TYR A CD2   1 
ATOM   2685 C  CE1   . TYR A 1 329 ? 12.166  25.750 40.702  1.00 32.12  ? 329  TYR A CE1   1 
ATOM   2686 C  CE2   . TYR A 1 329 ? 10.271  24.351 41.130  1.00 34.54  ? 329  TYR A CE2   1 
ATOM   2687 C  CZ    . TYR A 1 329 ? 11.397  24.651 40.388  1.00 34.16  ? 329  TYR A CZ    1 
ATOM   2688 O  OH    . TYR A 1 329 ? 11.758  23.849 39.329  1.00 40.51  ? 329  TYR A OH    1 
ATOM   2689 N  N     A ARG A 1 330 ? 8.093   29.248 42.505  0.49 28.11  ? 330  ARG A N     1 
ATOM   2690 N  N     C ARG A 1 330 ? 8.089   29.238 42.503  0.51 28.11  ? 330  ARG A N     1 
ATOM   2691 C  CA    A ARG A 1 330 ? 7.102   29.540 41.473  0.49 27.29  ? 330  ARG A CA    1 
ATOM   2692 C  CA    C ARG A 1 330 ? 7.097   29.544 41.474  0.51 27.28  ? 330  ARG A CA    1 
ATOM   2693 C  C     A ARG A 1 330 ? 7.463   30.778 40.653  0.49 26.93  ? 330  ARG A C     1 
ATOM   2694 C  C     C ARG A 1 330 ? 7.494   30.765 40.645  0.51 26.94  ? 330  ARG A C     1 
ATOM   2695 O  O     A ARG A 1 330 ? 7.220   30.823 39.448  0.49 27.87  ? 330  ARG A O     1 
ATOM   2696 O  O     C ARG A 1 330 ? 7.303   30.787 39.429  0.51 27.73  ? 330  ARG A O     1 
ATOM   2697 C  CB    A ARG A 1 330 ? 5.703   29.674 42.082  0.49 27.40  ? 330  ARG A CB    1 
ATOM   2698 C  CB    C ARG A 1 330 ? 5.714   29.757 42.096  0.51 27.29  ? 330  ARG A CB    1 
ATOM   2699 C  CG    A ARG A 1 330 ? 5.142   28.358 42.598  0.49 28.02  ? 330  ARG A CG    1 
ATOM   2700 C  CG    C ARG A 1 330 ? 5.105   28.509 42.724  0.51 27.82  ? 330  ARG A CG    1 
ATOM   2701 C  CD    A ARG A 1 330 ? 3.664   28.461 42.935  0.49 28.10  ? 330  ARG A CD    1 
ATOM   2702 C  CD    C ARG A 1 330 ? 4.708   27.476 41.676  0.51 28.59  ? 330  ARG A CD    1 
ATOM   2703 N  NE    A ARG A 1 330 ? 3.070   27.141 43.132  0.49 28.67  ? 330  ARG A NE    1 
ATOM   2704 N  NE    C ARG A 1 330 ? 3.950   26.375 42.267  0.51 29.66  ? 330  ARG A NE    1 
ATOM   2705 C  CZ    A ARG A 1 330 ? 1.767   26.913 43.259  0.49 26.53  ? 330  ARG A CZ    1 
ATOM   2706 C  CZ    C ARG A 1 330 ? 4.331   25.101 42.250  0.51 25.96  ? 330  ARG A CZ    1 
ATOM   2707 N  NH1   A ARG A 1 330 ? 0.904   27.918 43.210  0.49 23.20  ? 330  ARG A NH1   1 
ATOM   2708 N  NH1   C ARG A 1 330 ? 5.463   24.746 41.658  0.51 24.50  ? 330  ARG A NH1   1 
ATOM   2709 N  NH2   A ARG A 1 330 ? 1.325   25.675 43.431  0.49 31.74  ? 330  ARG A NH2   1 
ATOM   2710 N  NH2   C ARG A 1 330 ? 3.571   24.178 42.822  0.51 24.46  ? 330  ARG A NH2   1 
ATOM   2711 N  N     . VAL A 1 331 ? 8.052   31.774 41.306  1.00 26.20  ? 331  VAL A N     1 
ATOM   2712 C  CA    . VAL A 1 331 ? 8.495   32.980 40.613  1.00 27.53  ? 331  VAL A CA    1 
ATOM   2713 C  C     . VAL A 1 331 ? 9.664   32.656 39.684  1.00 26.05  ? 331  VAL A C     1 
ATOM   2714 O  O     . VAL A 1 331 ? 9.725   33.138 38.553  1.00 27.64  ? 331  VAL A O     1 
ATOM   2715 C  CB    . VAL A 1 331 ? 8.898   34.096 41.601  1.00 30.19  ? 331  VAL A CB    1 
ATOM   2716 C  CG1   . VAL A 1 331 ? 9.389   35.318 40.845  1.00 27.29  ? 331  VAL A CG1   1 
ATOM   2717 C  CG2   . VAL A 1 331 ? 7.722   34.461 42.491  1.00 30.70  ? 331  VAL A CG2   1 
ATOM   2718 N  N     . LEU A 1 332 ? 10.582  31.823 40.167  1.00 25.44  ? 332  LEU A N     1 
ATOM   2719 C  CA    . LEU A 1 332 ? 11.692  31.345 39.350  1.00 27.10  ? 332  LEU A CA    1 
ATOM   2720 C  C     . LEU A 1 332 ? 11.181  30.591 38.127  1.00 29.15  ? 332  LEU A C     1 
ATOM   2721 O  O     . LEU A 1 332 ? 11.710  30.745 37.026  1.00 29.47  ? 332  LEU A O     1 
ATOM   2722 C  CB    . LEU A 1 332 ? 12.611  30.441 40.175  1.00 27.76  ? 332  LEU A CB    1 
ATOM   2723 C  CG    . LEU A 1 332 ? 13.378  31.127 41.307  1.00 29.99  ? 332  LEU A CG    1 
ATOM   2724 C  CD1   . LEU A 1 332 ? 14.035  30.094 42.207  1.00 33.57  ? 332  LEU A CD1   1 
ATOM   2725 C  CD2   . LEU A 1 332 ? 14.416  32.091 40.738  1.00 25.07  ? 332  LEU A CD2   1 
ATOM   2726 N  N     . GLN A 1 333 ? 10.147  29.778 38.331  1.00 25.64  ? 333  GLN A N     1 
ATOM   2727 C  CA    . GLN A 1 333 ? 9.537   29.018 37.246  1.00 28.06  ? 333  GLN A CA    1 
ATOM   2728 C  C     . GLN A 1 333 ? 8.858   29.927 36.229  1.00 24.78  ? 333  GLN A C     1 
ATOM   2729 O  O     . GLN A 1 333 ? 8.941   29.694 35.024  1.00 27.91  ? 333  GLN A O     1 
ATOM   2730 C  CB    . GLN A 1 333 ? 8.527   28.011 37.796  1.00 31.30  ? 333  GLN A CB    1 
ATOM   2731 C  CG    . GLN A 1 333 ? 9.150   26.859 38.561  1.00 32.46  ? 333  GLN A CG    1 
ATOM   2732 C  CD    . GLN A 1 333 ? 8.105   25.911 39.120  1.00 35.36  ? 333  GLN A CD    1 
ATOM   2733 O  OE1   . GLN A 1 333 ? 7.342   26.270 40.016  1.00 33.15  ? 333  GLN A OE1   1 
ATOM   2734 N  NE2   . GLN A 1 333 ? 8.062   24.696 38.586  1.00 35.31  ? 333  GLN A NE2   1 
ATOM   2735 N  N     . ILE A 1 334 ? 8.179   30.958 36.718  1.00 28.17  ? 334  ILE A N     1 
ATOM   2736 C  CA    . ILE A 1 334 ? 7.539   31.923 35.833  1.00 30.07  ? 334  ILE A CA    1 
ATOM   2737 C  C     . ILE A 1 334 ? 8.592   32.665 35.005  1.00 31.62  ? 334  ILE A C     1 
ATOM   2738 O  O     . ILE A 1 334 ? 8.415   32.873 33.802  1.00 31.68  ? 334  ILE A O     1 
ATOM   2739 C  CB    . ILE A 1 334 ? 6.663   32.922 36.620  1.00 27.65  ? 334  ILE A CB    1 
ATOM   2740 C  CG1   . ILE A 1 334 ? 5.438   32.208 37.196  1.00 23.52  ? 334  ILE A CG1   1 
ATOM   2741 C  CG2   . ILE A 1 334 ? 6.221   34.076 35.728  1.00 24.83  ? 334  ILE A CG2   1 
ATOM   2742 C  CD1   . ILE A 1 334 ? 4.665   33.034 38.201  1.00 24.59  ? 334  ILE A CD1   1 
ATOM   2743 N  N     . ASP A 1 335 ? 9.697   33.039 35.644  1.00 30.18  ? 335  ASP A N     1 
ATOM   2744 C  CA    . ASP A 1 335 ? 10.771  33.727 34.935  1.00 27.05  ? 335  ASP A CA    1 
ATOM   2745 C  C     . ASP A 1 335 ? 11.457  32.826 33.915  1.00 27.89  ? 335  ASP A C     1 
ATOM   2746 O  O     . ASP A 1 335 ? 11.856  33.286 32.855  1.00 30.46  ? 335  ASP A O     1 
ATOM   2747 C  CB    . ASP A 1 335 ? 11.809  34.306 35.896  1.00 25.53  ? 335  ASP A CB    1 
ATOM   2748 C  CG    . ASP A 1 335 ? 12.780  35.245 35.196  1.00 34.51  ? 335  ASP A CG    1 
ATOM   2749 O  OD1   . ASP A 1 335 ? 12.313  36.213 34.558  1.00 31.89  ? 335  ASP A OD1   1 
ATOM   2750 O  OD2   . ASP A 1 335 ? 14.005  35.007 35.264  1.00 33.68  ? 335  ASP A OD2   1 
ATOM   2751 N  N     . ALA A 1 336 ? 11.594  31.544 34.237  1.00 29.21  ? 336  ALA A N     1 
ATOM   2752 C  CA    . ALA A 1 336 ? 12.196  30.598 33.302  1.00 29.60  ? 336  ALA A CA    1 
ATOM   2753 C  C     . ALA A 1 336 ? 11.361  30.509 32.025  1.00 30.50  ? 336  ALA A C     1 
ATOM   2754 O  O     . ALA A 1 336 ? 11.879  30.229 30.945  1.00 33.17  ? 336  ALA A O     1 
ATOM   2755 C  CB    . ALA A 1 336 ? 12.344  29.228 33.947  1.00 27.97  ? 336  ALA A CB    1 
ATOM   2756 N  N     . LYS A 1 337 ? 10.063  30.758 32.159  1.00 31.42  ? 337  LYS A N     1 
ATOM   2757 C  CA    . LYS A 1 337 ? 9.158   30.760 31.018  1.00 31.75  ? 337  LYS A CA    1 
ATOM   2758 C  C     . LYS A 1 337 ? 9.148   32.120 30.319  1.00 30.97  ? 337  LYS A C     1 
ATOM   2759 O  O     . LYS A 1 337 ? 9.417   32.212 29.121  1.00 30.18  ? 337  LYS A O     1 
ATOM   2760 C  CB    . LYS A 1 337 ? 7.743   30.401 31.470  1.00 29.64  ? 337  LYS A CB    1 
ATOM   2761 C  CG    . LYS A 1 337 ? 6.714   30.408 30.357  1.00 30.56  ? 337  LYS A CG    1 
ATOM   2762 C  CD    . LYS A 1 337 ? 5.301   30.450 30.920  1.00 33.40  ? 337  LYS A CD    1 
ATOM   2763 C  CE    . LYS A 1 337 ? 4.258   30.296 29.822  1.00 37.77  ? 337  LYS A CE    1 
ATOM   2764 N  NZ    . LYS A 1 337 ? 2.886   30.587 30.326  1.00 39.77  ? 337  LYS A NZ    1 
ATOM   2765 N  N     . ARG A 1 338 ? 8.849   33.170 31.080  1.00 28.79  ? 338  ARG A N     1 
ATOM   2766 C  CA    . ARG A 1 338 ? 8.670   34.511 30.528  1.00 29.28  ? 338  ARG A CA    1 
ATOM   2767 C  C     . ARG A 1 338 ? 9.984   35.248 30.267  1.00 30.30  ? 338  ARG A C     1 
ATOM   2768 O  O     . ARG A 1 338 ? 10.088  36.008 29.306  1.00 29.28  ? 338  ARG A O     1 
ATOM   2769 C  CB    . ARG A 1 338 ? 7.777   35.349 31.448  1.00 31.06  ? 338  ARG A CB    1 
ATOM   2770 C  CG    . ARG A 1 338 ? 6.330   34.876 31.526  1.00 34.72  ? 338  ARG A CG    1 
ATOM   2771 C  CD    . ARG A 1 338 ? 5.558   35.205 30.251  1.00 32.41  ? 338  ARG A CD    1 
ATOM   2772 N  NE    . ARG A 1 338 ? 4.114   35.141 30.463  1.00 31.68  ? 338  ARG A NE    1 
ATOM   2773 C  CZ    . ARG A 1 338 ? 3.221   35.839 29.766  1.00 31.13  ? 338  ARG A CZ    1 
ATOM   2774 N  NH1   . ARG A 1 338 ? 3.619   36.666 28.808  1.00 30.01  ? 338  ARG A NH1   1 
ATOM   2775 N  NH2   . ARG A 1 338 ? 1.928   35.718 30.035  1.00 28.21  ? 338  ARG A NH2   1 
ATOM   2776 N  N     . GLN A 1 339 ? 10.970  35.038 31.135  1.00 25.02  ? 339  GLN A N     1 
ATOM   2777 C  CA    . GLN A 1 339 ? 12.307  35.617 30.960  1.00 29.53  ? 339  GLN A CA    1 
ATOM   2778 C  C     . GLN A 1 339 ? 12.324  37.148 30.980  1.00 27.51  ? 339  GLN A C     1 
ATOM   2779 O  O     . GLN A 1 339 ? 12.958  37.786 30.137  1.00 29.73  ? 339  GLN A O     1 
ATOM   2780 C  CB    . GLN A 1 339 ? 12.972  35.058 29.695  1.00 29.80  ? 339  GLN A CB    1 
ATOM   2781 C  CG    . GLN A 1 339 ? 13.037  33.536 29.687  1.00 35.47  ? 339  GLN A CG    1 
ATOM   2782 C  CD    . GLN A 1 339 ? 13.587  32.964 28.393  1.00 42.22  ? 339  GLN A CD    1 
ATOM   2783 O  OE1   . GLN A 1 339 ? 14.051  33.697 27.521  1.00 47.81  ? 339  GLN A OE1   1 
ATOM   2784 N  NE2   . GLN A 1 339 ? 13.535  31.642 28.264  1.00 38.53  ? 339  GLN A NE2   1 
ATOM   2785 N  N     . PHE A 1 340 ? 11.639  37.727 31.962  1.00 23.15  ? 340  PHE A N     1 
ATOM   2786 C  CA    . PHE A 1 340 ? 11.581  39.175 32.112  1.00 24.83  ? 340  PHE A CA    1 
ATOM   2787 C  C     . PHE A 1 340 ? 12.861  39.730 32.736  1.00 27.72  ? 340  PHE A C     1 
ATOM   2788 O  O     . PHE A 1 340 ? 13.230  40.880 32.491  1.00 29.31  ? 340  PHE A O     1 
ATOM   2789 C  CB    . PHE A 1 340 ? 10.361  39.582 32.942  1.00 26.53  ? 340  PHE A CB    1 
ATOM   2790 C  CG    . PHE A 1 340 ? 9.046   39.279 32.276  1.00 29.40  ? 340  PHE A CG    1 
ATOM   2791 C  CD1   . PHE A 1 340 ? 8.949   39.224 30.894  1.00 27.37  ? 340  PHE A CD1   1 
ATOM   2792 C  CD2   . PHE A 1 340 ? 7.908   39.046 33.033  1.00 29.04  ? 340  PHE A CD2   1 
ATOM   2793 C  CE1   . PHE A 1 340 ? 7.743   38.947 30.279  1.00 27.47  ? 340  PHE A CE1   1 
ATOM   2794 C  CE2   . PHE A 1 340 ? 6.697   38.768 32.423  1.00 28.62  ? 340  PHE A CE2   1 
ATOM   2795 C  CZ    . PHE A 1 340 ? 6.614   38.718 31.046  1.00 29.31  ? 340  PHE A CZ    1 
ATOM   2796 N  N     A ILE A 1 341 ? 13.533  38.915 33.542  0.31 27.94  ? 341  ILE A N     1 
ATOM   2797 N  N     B ILE A 1 341 ? 13.528  38.913 33.546  0.69 27.76  ? 341  ILE A N     1 
ATOM   2798 C  CA    A ILE A 1 341 ? 14.800  39.325 34.138  0.31 28.53  ? 341  ILE A CA    1 
ATOM   2799 C  CA    B ILE A 1 341 ? 14.803  39.309 34.134  0.69 28.80  ? 341  ILE A CA    1 
ATOM   2800 C  C     A ILE A 1 341 ? 15.880  39.441 33.064  0.31 27.86  ? 341  ILE A C     1 
ATOM   2801 C  C     B ILE A 1 341 ? 15.851  39.461 33.040  0.69 27.25  ? 341  ILE A C     1 
ATOM   2802 O  O     A ILE A 1 341 ? 16.660  40.391 33.057  0.31 28.14  ? 341  ILE A O     1 
ATOM   2803 O  O     B ILE A 1 341 ? 16.581  40.449 32.997  0.69 28.21  ? 341  ILE A O     1 
ATOM   2804 C  CB    A ILE A 1 341 ? 15.251  38.359 35.254  0.31 29.37  ? 341  ILE A CB    1 
ATOM   2805 C  CB    B ILE A 1 341 ? 15.298  38.288 35.172  0.69 29.65  ? 341  ILE A CB    1 
ATOM   2806 C  CG1   A ILE A 1 341 ? 14.244  38.374 36.405  0.31 28.80  ? 341  ILE A CG1   1 
ATOM   2807 C  CG1   B ILE A 1 341 ? 14.354  38.251 36.375  0.69 28.88  ? 341  ILE A CG1   1 
ATOM   2808 C  CG2   A ILE A 1 341 ? 16.637  38.735 35.761  0.31 29.74  ? 341  ILE A CG2   1 
ATOM   2809 C  CG2   B ILE A 1 341 ? 16.710  38.633 35.623  0.69 29.70  ? 341  ILE A CG2   1 
ATOM   2810 C  CD1   A ILE A 1 341 ? 14.675  37.569 37.610  0.31 27.27  ? 341  ILE A CD1   1 
ATOM   2811 C  CD1   B ILE A 1 341 ? 14.253  39.571 37.107  0.69 28.98  ? 341  ILE A CD1   1 
ATOM   2812 N  N     . ASN A 1 342 ? 15.907  38.477 32.149  1.00 29.53  ? 342  ASN A N     1 
ATOM   2813 C  CA    . ASN A 1 342 ? 16.824  38.514 31.018  1.00 32.27  ? 342  ASN A CA    1 
ATOM   2814 C  C     . ASN A 1 342 ? 16.557  39.729 30.133  1.00 30.85  ? 342  ASN A C     1 
ATOM   2815 O  O     . ASN A 1 342 ? 17.486  40.371 29.641  1.00 29.18  ? 342  ASN A O     1 
ATOM   2816 C  CB    . ASN A 1 342 ? 16.702  37.230 30.197  1.00 28.46  ? 342  ASN A CB    1 
ATOM   2817 C  CG    . ASN A 1 342 ? 17.546  37.259 28.941  1.00 32.51  ? 342  ASN A CG    1 
ATOM   2818 O  OD1   . ASN A 1 342 ? 18.764  37.091 28.995  1.00 37.00  ? 342  ASN A OD1   1 
ATOM   2819 N  ND2   . ASN A 1 342 ? 16.902  37.466 27.798  1.00 32.09  ? 342  ASN A ND2   1 
ATOM   2820 N  N     . LEU A 1 343 ? 15.278  40.039 29.943  1.00 31.25  ? 343  LEU A N     1 
ATOM   2821 C  CA    . LEU A 1 343 ? 14.869  41.203 29.165  1.00 31.17  ? 343  LEU A CA    1 
ATOM   2822 C  C     . LEU A 1 343 ? 15.360  42.494 29.811  1.00 28.33  ? 343  LEU A C     1 
ATOM   2823 O  O     . LEU A 1 343 ? 15.908  43.363 29.136  1.00 31.67  ? 343  LEU A O     1 
ATOM   2824 C  CB    . LEU A 1 343 ? 13.347  41.238 29.029  1.00 33.50  ? 343  LEU A CB    1 
ATOM   2825 C  CG    . LEU A 1 343 ? 12.739  42.501 28.418  1.00 30.92  ? 343  LEU A CG    1 
ATOM   2826 C  CD1   . LEU A 1 343 ? 13.107  42.612 26.951  1.00 31.85  ? 343  LEU A CD1   1 
ATOM   2827 C  CD2   . LEU A 1 343 ? 11.229  42.504 28.604  1.00 28.04  ? 343  LEU A CD2   1 
ATOM   2828 N  N     . SER A 1 344 ? 15.163  42.607 31.122  1.00 25.40  ? 344  SER A N     1 
ATOM   2829 C  CA    . SER A 1 344 ? 15.590  43.786 31.872  1.00 26.90  ? 344  SER A CA    1 
ATOM   2830 C  C     . SER A 1 344 ? 17.098  44.010 31.780  1.00 31.32  ? 344  SER A C     1 
ATOM   2831 O  O     . SER A 1 344 ? 17.554  45.137 31.576  1.00 32.80  ? 344  SER A O     1 
ATOM   2832 C  CB    . SER A 1 344 ? 15.170  43.668 33.340  1.00 26.13  ? 344  SER A CB    1 
ATOM   2833 O  OG    . SER A 1 344 ? 13.757  43.600 33.463  1.00 23.93  ? 344  SER A OG    1 
ATOM   2834 N  N     . LEU A 1 345 ? 17.863  42.932 31.936  1.00 27.03  ? 345  LEU A N     1 
ATOM   2835 C  CA    . LEU A 1 345 ? 19.319  43.000 31.847  1.00 26.84  ? 345  LEU A CA    1 
ATOM   2836 C  C     . LEU A 1 345 ? 19.749  43.418 30.448  1.00 29.70  ? 345  LEU A C     1 
ATOM   2837 O  O     . LEU A 1 345 ? 20.589  44.307 30.290  1.00 26.84  ? 345  LEU A O     1 
ATOM   2838 C  CB    . LEU A 1 345 ? 19.945  41.651 32.213  1.00 28.88  ? 345  LEU A CB    1 
ATOM   2839 C  CG    . LEU A 1 345 ? 19.756  41.186 33.661  1.00 31.05  ? 345  LEU A CG    1 
ATOM   2840 C  CD1   . LEU A 1 345 ? 20.382  39.812 33.879  1.00 26.18  ? 345  LEU A CD1   1 
ATOM   2841 C  CD2   . LEU A 1 345 ? 20.329  42.204 34.639  1.00 31.78  ? 345  LEU A CD2   1 
ATOM   2842 N  N     . ASP A 1 346 ? 19.165  42.774 29.439  1.00 33.53  ? 346  ASP A N     1 
ATOM   2843 C  CA    . ASP A 1 346 ? 19.424  43.117 28.042  1.00 36.70  ? 346  ASP A CA    1 
ATOM   2844 C  C     . ASP A 1 346 ? 19.205  44.599 27.774  1.00 34.28  ? 346  ASP A C     1 
ATOM   2845 O  O     . ASP A 1 346 ? 20.102  45.290 27.293  1.00 32.93  ? 346  ASP A O     1 
ATOM   2846 C  CB    . ASP A 1 346 ? 18.516  42.314 27.108  1.00 40.30  ? 346  ASP A CB    1 
ATOM   2847 C  CG    . ASP A 1 346 ? 19.133  41.004 26.672  1.00 45.79  ? 346  ASP A CG    1 
ATOM   2848 O  OD1   . ASP A 1 346 ? 20.288  40.726 27.059  1.00 48.24  ? 346  ASP A OD1   1 
ATOM   2849 O  OD2   . ASP A 1 346 ? 18.467  40.259 25.924  1.00 48.63  ? 346  ASP A OD2   1 
ATOM   2850 N  N     A MET A 1 347 ? 17.998  45.067 28.082  0.47 31.94  ? 347  MET A N     1 
ATOM   2851 N  N     B MET A 1 347 ? 18.011  45.089 28.092  0.53 31.88  ? 347  MET A N     1 
ATOM   2852 C  CA    A MET A 1 347 ? 17.618  46.457 27.866  0.47 32.10  ? 347  MET A CA    1 
ATOM   2853 C  CA    B MET A 1 347 ? 17.664  46.481 27.820  0.53 32.02  ? 347  MET A CA    1 
ATOM   2854 C  C     A MET A 1 347 ? 18.494  47.413 28.661  0.47 30.45  ? 347  MET A C     1 
ATOM   2855 C  C     B MET A 1 347 ? 18.431  47.473 28.688  0.53 30.40  ? 347  MET A C     1 
ATOM   2856 O  O     A MET A 1 347 ? 18.978  48.411 28.128  0.47 30.19  ? 347  MET A O     1 
ATOM   2857 O  O     B MET A 1 347 ? 18.780  48.561 28.232  0.53 30.25  ? 347  MET A O     1 
ATOM   2858 C  CB    A MET A 1 347 ? 16.154  46.677 28.256  0.47 32.43  ? 347  MET A CB    1 
ATOM   2859 C  CB    B MET A 1 347 ? 16.157  46.703 27.963  0.53 32.77  ? 347  MET A CB    1 
ATOM   2860 C  CG    A MET A 1 347 ? 15.139  46.141 27.262  0.47 34.88  ? 347  MET A CG    1 
ATOM   2861 C  CG    B MET A 1 347 ? 15.327  46.030 26.880  0.53 35.33  ? 347  MET A CG    1 
ATOM   2862 S  SD    A MET A 1 347 ? 13.455  46.590 27.736  0.47 54.97  ? 347  MET A SD    1 
ATOM   2863 S  SD    B MET A 1 347 ? 15.846  46.472 25.207  0.53 49.71  ? 347  MET A SD    1 
ATOM   2864 C  CE    A MET A 1 347 ? 13.650  48.349 28.017  0.47 19.70  ? 347  MET A CE    1 
ATOM   2865 C  CE    B MET A 1 347 ? 16.698  44.987 24.694  0.53 30.42  ? 347  MET A CE    1 
ATOM   2866 N  N     . GLY A 1 348 ? 18.685  47.101 29.938  1.00 29.91  ? 348  GLY A N     1 
ATOM   2867 C  CA    . GLY A 1 348 ? 19.430  47.958 30.843  1.00 30.90  ? 348  GLY A CA    1 
ATOM   2868 C  C     . GLY A 1 348 ? 20.852  48.216 30.385  1.00 31.25  ? 348  GLY A C     1 
ATOM   2869 O  O     . GLY A 1 348 ? 21.290  49.362 30.311  1.00 33.58  ? 348  GLY A O     1 
ATOM   2870 N  N     . TYR A 1 349 ? 21.571  47.147 30.064  1.00 32.19  ? 349  TYR A N     1 
ATOM   2871 C  CA    . TYR A 1 349 ? 22.956  47.269 29.625  1.00 31.96  ? 349  TYR A CA    1 
ATOM   2872 C  C     . TYR A 1 349 ? 23.067  47.881 28.232  1.00 32.56  ? 349  TYR A C     1 
ATOM   2873 O  O     . TYR A 1 349 ? 24.066  48.522 27.907  1.00 33.34  ? 349  TYR A O     1 
ATOM   2874 C  CB    . TYR A 1 349 ? 23.664  45.913 29.682  1.00 29.86  ? 349  TYR A CB    1 
ATOM   2875 C  CG    . TYR A 1 349 ? 23.997  45.474 31.091  1.00 31.82  ? 349  TYR A CG    1 
ATOM   2876 C  CD1   . TYR A 1 349 ? 24.823  46.244 31.899  1.00 32.63  ? 349  TYR A CD1   1 
ATOM   2877 C  CD2   . TYR A 1 349 ? 23.486  44.293 31.612  1.00 30.04  ? 349  TYR A CD2   1 
ATOM   2878 C  CE1   . TYR A 1 349 ? 25.130  45.853 33.186  1.00 30.72  ? 349  TYR A CE1   1 
ATOM   2879 C  CE2   . TYR A 1 349 ? 23.790  43.889 32.899  1.00 31.28  ? 349  TYR A CE2   1 
ATOM   2880 C  CZ    . TYR A 1 349 ? 24.613  44.673 33.681  1.00 32.69  ? 349  TYR A CZ    1 
ATOM   2881 O  OH    . TYR A 1 349 ? 24.923  44.283 34.963  1.00 33.96  ? 349  TYR A OH    1 
ATOM   2882 N  N     . TYR A 1 350 ? 22.040  47.683 27.412  1.00 33.08  ? 350  TYR A N     1 
ATOM   2883 C  CA    . TYR A 1 350 ? 22.006  48.286 26.085  1.00 37.83  ? 350  TYR A CA    1 
ATOM   2884 C  C     . TYR A 1 350 ? 21.919  49.804 26.195  1.00 37.61  ? 350  TYR A C     1 
ATOM   2885 O  O     . TYR A 1 350 ? 22.605  50.527 25.477  1.00 40.90  ? 350  TYR A O     1 
ATOM   2886 C  CB    . TYR A 1 350 ? 20.821  47.754 25.275  1.00 38.33  ? 350  TYR A CB    1 
ATOM   2887 C  CG    . TYR A 1 350 ? 20.728  48.331 23.879  1.00 39.76  ? 350  TYR A CG    1 
ATOM   2888 C  CD1   . TYR A 1 350 ? 21.526  47.844 22.852  1.00 40.50  ? 350  TYR A CD1   1 
ATOM   2889 C  CD2   . TYR A 1 350 ? 19.843  49.364 23.588  1.00 38.45  ? 350  TYR A CD2   1 
ATOM   2890 C  CE1   . TYR A 1 350 ? 21.447  48.369 21.574  1.00 43.77  ? 350  TYR A CE1   1 
ATOM   2891 C  CE2   . TYR A 1 350 ? 19.755  49.895 22.313  1.00 38.19  ? 350  TYR A CE2   1 
ATOM   2892 C  CZ    . TYR A 1 350 ? 20.558  49.392 21.310  1.00 41.23  ? 350  TYR A CZ    1 
ATOM   2893 O  OH    . TYR A 1 350 ? 20.476  49.915 20.039  1.00 39.74  ? 350  TYR A OH    1 
ATOM   2894 N  N     . ALA A 1 351 ? 21.075  50.276 27.107  1.00 33.38  ? 351  ALA A N     1 
ATOM   2895 C  CA    . ALA A 1 351 ? 20.852  51.706 27.287  1.00 32.79  ? 351  ALA A CA    1 
ATOM   2896 C  C     . ALA A 1 351 ? 21.898  52.349 28.192  1.00 32.92  ? 351  ALA A C     1 
ATOM   2897 O  O     . ALA A 1 351 ? 22.070  53.568 28.173  1.00 32.27  ? 351  ALA A O     1 
ATOM   2898 C  CB    . ALA A 1 351 ? 19.455  51.952 27.846  1.00 28.73  ? 351  ALA A CB    1 
ATOM   2899 N  N     . LYS A 1 352 ? 22.589  51.519 28.973  1.00 29.93  ? 352  LYS A N     1 
ATOM   2900 C  CA    . LYS A 1 352 ? 23.510  51.979 30.016  1.00 31.49  ? 352  LYS A CA    1 
ATOM   2901 C  C     . LYS A 1 352 ? 22.788  52.784 31.096  1.00 33.33  ? 352  LYS A C     1 
ATOM   2902 O  O     . LYS A 1 352 ? 23.085  53.958 31.326  1.00 29.29  ? 352  LYS A O     1 
ATOM   2903 C  CB    . LYS A 1 352 ? 24.692  52.754 29.426  1.00 31.72  ? 352  LYS A CB    1 
ATOM   2904 C  CG    . LYS A 1 352 ? 25.629  51.872 28.619  1.00 34.36  ? 352  LYS A CG    1 
ATOM   2905 C  CD    . LYS A 1 352 ? 26.565  52.680 27.740  1.00 36.01  ? 352  LYS A CD    1 
ATOM   2906 C  CE    . LYS A 1 352 ? 27.446  51.749 26.924  1.00 36.76  ? 352  LYS A CE    1 
ATOM   2907 N  NZ    . LYS A 1 352 ? 28.258  52.474 25.914  1.00 39.68  ? 352  LYS A NZ    1 
ATOM   2908 N  N     . ILE A 1 353 ? 21.834  52.124 31.748  1.00 33.40  ? 353  ILE A N     1 
ATOM   2909 C  CA    . ILE A 1 353 ? 21.054  52.711 32.828  1.00 26.02  ? 353  ILE A CA    1 
ATOM   2910 C  C     . ILE A 1 353 ? 21.087  51.792 34.034  1.00 25.80  ? 353  ILE A C     1 
ATOM   2911 O  O     . ILE A 1 353 ? 21.542  50.651 33.935  1.00 28.40  ? 353  ILE A O     1 
ATOM   2912 C  CB    . ILE A 1 353 ? 19.581  52.868 32.419  1.00 25.92  ? 353  ILE A CB    1 
ATOM   2913 C  CG1   . ILE A 1 353 ? 19.036  51.532 31.901  1.00 30.50  ? 353  ILE A CG1   1 
ATOM   2914 C  CG2   . ILE A 1 353 ? 19.440  53.926 31.356  1.00 28.05  ? 353  ILE A CG2   1 
ATOM   2915 C  CD1   . ILE A 1 353 ? 17.579  51.574 31.476  1.00 29.84  ? 353  ILE A CD1   1 
ATOM   2916 N  N     . GLN A 1 354 ? 20.609  52.289 35.171  1.00 23.55  ? 354  GLN A N     1 
ATOM   2917 C  CA    . GLN A 1 354 ? 20.313  51.422 36.303  1.00 29.73  ? 354  GLN A CA    1 
ATOM   2918 C  C     . GLN A 1 354 ? 19.294  50.412 35.807  1.00 31.93  ? 354  GLN A C     1 
ATOM   2919 O  O     . GLN A 1 354 ? 18.358  50.781 35.095  1.00 29.94  ? 354  GLN A O     1 
ATOM   2920 C  CB    . GLN A 1 354 ? 19.714  52.216 37.465  1.00 28.05  ? 354  GLN A CB    1 
ATOM   2921 C  CG    . GLN A 1 354 ? 20.648  53.234 38.100  1.00 29.91  ? 354  GLN A CG    1 
ATOM   2922 C  CD    . GLN A 1 354 ? 20.005  53.940 39.281  1.00 33.85  ? 354  GLN A CD    1 
ATOM   2923 O  OE1   . GLN A 1 354 ? 18.876  54.421 39.189  1.00 33.92  ? 354  GLN A OE1   1 
ATOM   2924 N  NE2   . GLN A 1 354 ? 20.714  53.990 40.401  1.00 33.61  ? 354  GLN A NE2   1 
ATOM   2925 N  N     . ILE A 1 355 ? 19.474  49.146 36.170  1.00 31.25  ? 355  ILE A N     1 
ATOM   2926 C  CA    . ILE A 1 355 ? 18.600  48.085 35.671  1.00 29.97  ? 355  ILE A CA    1 
ATOM   2927 C  C     . ILE A 1 355 ? 17.118  48.355 35.958  1.00 28.78  ? 355  ILE A C     1 
ATOM   2928 O  O     . ILE A 1 355 ? 16.263  48.083 35.117  1.00 28.53  ? 355  ILE A O     1 
ATOM   2929 C  CB    . ILE A 1 355 ? 19.001  46.695 36.212  1.00 30.82  ? 355  ILE A CB    1 
ATOM   2930 C  CG1   . ILE A 1 355 ? 20.485  46.425 35.949  1.00 29.42  ? 355  ILE A CG1   1 
ATOM   2931 C  CG2   . ILE A 1 355 ? 18.145  45.605 35.574  1.00 31.17  ? 355  ILE A CG2   1 
ATOM   2932 C  CD1   . ILE A 1 355 ? 20.876  46.521 34.490  1.00 29.99  ? 355  ILE A CD1   1 
ATOM   2933 N  N     . GLN A 1 356 ? 16.815  48.919 37.124  1.00 28.01  ? 356  GLN A N     1 
ATOM   2934 C  CA    . GLN A 1 356 ? 15.421  49.188 37.482  1.00 28.61  ? 356  GLN A CA    1 
ATOM   2935 C  C     . GLN A 1 356 ? 14.762  50.260 36.608  1.00 30.36  ? 356  GLN A C     1 
ATOM   2936 O  O     . GLN A 1 356 ? 13.544  50.435 36.652  1.00 29.22  ? 356  GLN A O     1 
ATOM   2937 C  CB    . GLN A 1 356 ? 15.274  49.546 38.968  1.00 27.49  ? 356  GLN A CB    1 
ATOM   2938 C  CG    . GLN A 1 356 ? 15.953  50.844 39.392  1.00 24.07  ? 356  GLN A CG    1 
ATOM   2939 C  CD    . GLN A 1 356 ? 17.369  50.628 39.897  1.00 29.32  ? 356  GLN A CD    1 
ATOM   2940 O  OE1   . GLN A 1 356 ? 18.087  49.753 39.412  1.00 29.21  ? 356  GLN A OE1   1 
ATOM   2941 N  NE2   . GLN A 1 356 ? 17.774  51.424 40.881  1.00 27.03  ? 356  GLN A NE2   1 
ATOM   2942 N  N     . SER A 1 357 ? 15.562  50.968 35.811  1.00 29.17  ? 357  SER A N     1 
ATOM   2943 C  CA    . SER A 1 357 ? 15.029  52.002 34.925  1.00 25.66  ? 357  SER A CA    1 
ATOM   2944 C  C     . SER A 1 357 ? 14.386  51.434 33.661  1.00 29.50  ? 357  SER A C     1 
ATOM   2945 O  O     . SER A 1 357 ? 13.898  52.189 32.820  1.00 30.25  ? 357  SER A O     1 
ATOM   2946 C  CB    . SER A 1 357 ? 16.107  53.025 34.549  1.00 26.78  ? 357  SER A CB    1 
ATOM   2947 O  OG    . SER A 1 357 ? 16.415  53.878 35.639  1.00 30.12  ? 357  SER A OG    1 
ATOM   2948 N  N     . VAL A 1 358 ? 14.375  50.110 33.522  1.00 24.53  ? 358  VAL A N     1 
ATOM   2949 C  CA    . VAL A 1 358 ? 13.671  49.491 32.401  1.00 28.10  ? 358  VAL A CA    1 
ATOM   2950 C  C     . VAL A 1 358 ? 12.157  49.703 32.503  1.00 24.91  ? 358  VAL A C     1 
ATOM   2951 O  O     . VAL A 1 358 ? 11.434  49.538 31.523  1.00 26.63  ? 358  VAL A O     1 
ATOM   2952 C  CB    . VAL A 1 358 ? 13.975  47.986 32.271  1.00 31.28  ? 358  VAL A CB    1 
ATOM   2953 C  CG1   . VAL A 1 358 ? 15.464  47.767 32.005  1.00 35.74  ? 358  VAL A CG1   1 
ATOM   2954 C  CG2   . VAL A 1 358 ? 13.508  47.235 33.516  1.00 26.59  ? 358  VAL A CG2   1 
ATOM   2955 N  N     . PHE A 1 359 ? 11.686  50.070 33.691  1.00 24.42  ? 359  PHE A N     1 
ATOM   2956 C  CA    . PHE A 1 359 ? 10.280  50.419 33.884  1.00 29.07  ? 359  PHE A CA    1 
ATOM   2957 C  C     . PHE A 1 359 ? 9.952   51.781 33.274  1.00 30.45  ? 359  PHE A C     1 
ATOM   2958 O  O     . PHE A 1 359 ? 8.784   52.143 33.140  1.00 35.99  ? 359  PHE A O     1 
ATOM   2959 C  CB    . PHE A 1 359 ? 9.919   50.417 35.373  1.00 27.89  ? 359  PHE A CB    1 
ATOM   2960 C  CG    . PHE A 1 359 ? 9.870   49.045 35.985  1.00 30.55  ? 359  PHE A CG    1 
ATOM   2961 C  CD1   . PHE A 1 359 ? 8.951   48.110 35.539  1.00 29.69  ? 359  PHE A CD1   1 
ATOM   2962 C  CD2   . PHE A 1 359 ? 10.731  48.695 37.012  1.00 31.86  ? 359  PHE A CD2   1 
ATOM   2963 C  CE1   . PHE A 1 359 ? 8.898   46.847 36.099  1.00 33.85  ? 359  PHE A CE1   1 
ATOM   2964 C  CE2   . PHE A 1 359 ? 10.681  47.432 37.578  1.00 30.61  ? 359  PHE A CE2   1 
ATOM   2965 C  CZ    . PHE A 1 359 ? 9.764   46.509 37.121  1.00 31.17  ? 359  PHE A CZ    1 
ATOM   2966 N  N     . SER A 1 360 ? 10.986  52.535 32.912  1.00 30.17  ? 360  SER A N     1 
ATOM   2967 C  CA    . SER A 1 360 ? 10.793  53.863 32.334  1.00 28.36  ? 360  SER A CA    1 
ATOM   2968 C  C     . SER A 1 360 ? 11.383  53.957 30.932  1.00 25.32  ? 360  SER A C     1 
ATOM   2969 O  O     . SER A 1 360 ? 12.599  54.063 30.771  1.00 26.02  ? 360  SER A O     1 
ATOM   2970 C  CB    . SER A 1 360 ? 11.412  54.935 33.233  1.00 29.10  ? 360  SER A CB    1 
ATOM   2971 O  OG    . SER A 1 360 ? 11.308  56.216 32.640  1.00 28.99  ? 360  SER A OG    1 
ATOM   2972 N  N     . PRO A 1 361 ? 10.520  53.913 29.908  1.00 27.03  ? 361  PRO A N     1 
ATOM   2973 C  CA    . PRO A 1 361 ? 10.980  54.041 28.521  1.00 26.00  ? 361  PRO A CA    1 
ATOM   2974 C  C     . PRO A 1 361 ? 11.557  55.427 28.232  1.00 26.24  ? 361  PRO A C     1 
ATOM   2975 O  O     . PRO A 1 361 ? 12.403  55.566 27.348  1.00 30.10  ? 361  PRO A O     1 
ATOM   2976 C  CB    . PRO A 1 361 ? 9.705   53.803 27.702  1.00 26.66  ? 361  PRO A CB    1 
ATOM   2977 C  CG    . PRO A 1 361 ? 8.580   54.110 28.644  1.00 27.47  ? 361  PRO A CG    1 
ATOM   2978 C  CD    . PRO A 1 361 ? 9.068   53.680 29.993  1.00 27.32  ? 361  PRO A CD    1 
ATOM   2979 N  N     . ILE A 1 362 ? 11.112  56.438 28.971  1.00 30.44  ? 362  ILE A N     1 
ATOM   2980 C  CA    . ILE A 1 362 ? 11.646  57.787 28.795  1.00 27.87  ? 362  ILE A CA    1 
ATOM   2981 C  C     . ILE A 1 362 ? 13.088  57.881 29.292  1.00 29.92  ? 362  ILE A C     1 
ATOM   2982 O  O     . ILE A 1 362 ? 13.958  58.416 28.599  1.00 30.81  ? 362  ILE A O     1 
ATOM   2983 C  CB    . ILE A 1 362 ? 10.755  58.851 29.466  1.00 28.73  ? 362  ILE A CB    1 
ATOM   2984 C  CG1   . ILE A 1 362 ? 9.551   59.161 28.570  1.00 27.82  ? 362  ILE A CG1   1 
ATOM   2985 C  CG2   . ILE A 1 362 ? 11.544  60.130 29.741  1.00 27.72  ? 362  ILE A CG2   1 
ATOM   2986 C  CD1   . ILE A 1 362 ? 8.557   60.118 29.188  1.00 32.34  ? 362  ILE A CD1   1 
ATOM   2987 N  N     . LYS A 1 363 ? 13.343  57.348 30.483  1.00 26.26  ? 363  LYS A N     1 
ATOM   2988 C  CA    . LYS A 1 363 ? 14.703  57.298 31.014  1.00 25.69  ? 363  LYS A CA    1 
ATOM   2989 C  C     . LYS A 1 363 ? 15.584  56.434 30.119  1.00 27.78  ? 363  LYS A C     1 
ATOM   2990 O  O     . LYS A 1 363 ? 16.736  56.775 29.847  1.00 29.13  ? 363  LYS A O     1 
ATOM   2991 C  CB    . LYS A 1 363 ? 14.708  56.754 32.444  1.00 27.85  ? 363  LYS A CB    1 
ATOM   2992 C  CG    . LYS A 1 363 ? 16.097  56.483 33.005  1.00 33.65  ? 363  LYS A CG    1 
ATOM   2993 C  CD    . LYS A 1 363 ? 16.910  57.764 33.143  1.00 37.93  ? 363  LYS A CD    1 
ATOM   2994 C  CE    . LYS A 1 363 ? 16.341  58.670 34.223  1.00 39.50  ? 363  LYS A CE    1 
ATOM   2995 N  NZ    . LYS A 1 363 ? 17.175  59.890 34.422  1.00 41.29  ? 363  LYS A NZ    1 
ATOM   2996 N  N     . THR A 1 364 ? 15.025  55.319 29.658  1.00 25.81  ? 364  THR A N     1 
ATOM   2997 C  CA    . THR A 1 364 ? 15.738  54.399 28.780  1.00 25.15  ? 364  THR A CA    1 
ATOM   2998 C  C     . THR A 1 364 ? 16.165  55.074 27.479  1.00 28.16  ? 364  THR A C     1 
ATOM   2999 O  O     . THR A 1 364 ? 17.315  54.958 27.058  1.00 30.86  ? 364  THR A O     1 
ATOM   3000 C  CB    . THR A 1 364 ? 14.878  53.163 28.444  1.00 27.48  ? 364  THR A CB    1 
ATOM   3001 O  OG1   . THR A 1 364 ? 14.504  52.492 29.653  1.00 28.33  ? 364  THR A OG1   1 
ATOM   3002 C  CG2   . THR A 1 364 ? 15.649  52.200 27.551  1.00 26.67  ? 364  THR A CG2   1 
ATOM   3003 N  N     . TRP A 1 365 ? 15.236  55.782 26.845  1.00 30.06  ? 365  TRP A N     1 
ATOM   3004 C  CA    . TRP A 1 365 ? 15.528  56.448 25.579  1.00 30.52  ? 365  TRP A CA    1 
ATOM   3005 C  C     . TRP A 1 365 ? 16.413  57.681 25.740  1.00 26.38  ? 365  TRP A C     1 
ATOM   3006 O  O     . TRP A 1 365 ? 17.217  57.984 24.862  1.00 30.09  ? 365  TRP A O     1 
ATOM   3007 C  CB    . TRP A 1 365 ? 14.240  56.801 24.832  1.00 29.18  ? 365  TRP A CB    1 
ATOM   3008 C  CG    . TRP A 1 365 ? 13.677  55.643 24.070  1.00 29.04  ? 365  TRP A CG    1 
ATOM   3009 C  CD1   . TRP A 1 365 ? 12.490  55.011 24.295  1.00 28.48  ? 365  TRP A CD1   1 
ATOM   3010 C  CD2   . TRP A 1 365 ? 14.290  54.966 22.966  1.00 29.96  ? 365  TRP A CD2   1 
ATOM   3011 N  NE1   . TRP A 1 365 ? 12.321  53.987 23.391  1.00 26.05  ? 365  TRP A NE1   1 
ATOM   3012 C  CE2   . TRP A 1 365 ? 13.413  53.940 22.565  1.00 26.99  ? 365  TRP A CE2   1 
ATOM   3013 C  CE3   . TRP A 1 365 ? 15.493  55.135 22.272  1.00 32.53  ? 365  TRP A CE3   1 
ATOM   3014 C  CZ2   . TRP A 1 365 ? 13.700  53.084 21.505  1.00 26.54  ? 365  TRP A CZ2   1 
ATOM   3015 C  CZ3   . TRP A 1 365 ? 15.776  54.286 21.220  1.00 30.92  ? 365  TRP A CZ3   1 
ATOM   3016 C  CH2   . TRP A 1 365 ? 14.883  53.272 20.847  1.00 30.46  ? 365  TRP A CH2   1 
ATOM   3017 N  N     . ASP A 1 366 ? 16.263  58.384 26.859  1.00 26.20  ? 366  ASP A N     1 
ATOM   3018 C  CA    . ASP A 1 366 ? 17.114  59.531 27.155  1.00 26.48  ? 366  ASP A CA    1 
ATOM   3019 C  C     . ASP A 1 366 ? 18.571  59.089 27.200  1.00 30.52  ? 366  ASP A C     1 
ATOM   3020 O  O     . ASP A 1 366 ? 19.455  59.774 26.686  1.00 33.38  ? 366  ASP A O     1 
ATOM   3021 C  CB    . ASP A 1 366 ? 16.720  60.176 28.487  1.00 28.19  ? 366  ASP A CB    1 
ATOM   3022 C  CG    . ASP A 1 366 ? 17.324  61.560 28.668  1.00 34.56  ? 366  ASP A CG    1 
ATOM   3023 O  OD1   . ASP A 1 366 ? 17.358  62.329 27.684  1.00 35.54  ? 366  ASP A OD1   1 
ATOM   3024 O  OD2   . ASP A 1 366 ? 17.765  61.882 29.792  1.00 33.01  ? 366  ASP A OD2   1 
ATOM   3025 N  N     . ALA A 1 367 ? 18.811  57.928 27.801  1.00 29.42  ? 367  ALA A N     1 
ATOM   3026 C  CA    . ALA A 1 367 ? 20.165  57.405 27.925  1.00 30.94  ? 367  ALA A CA    1 
ATOM   3027 C  C     . ALA A 1 367 ? 20.703  56.860 26.606  1.00 26.12  ? 367  ALA A C     1 
ATOM   3028 O  O     . ALA A 1 367 ? 21.882  57.024 26.299  1.00 26.83  ? 367  ALA A O     1 
ATOM   3029 C  CB    . ALA A 1 367 ? 20.219  56.339 28.992  1.00 30.61  ? 367  ALA A CB    1 
ATOM   3030 N  N     . ILE A 1 368 ? 19.845  56.198 25.837  1.00 28.75  ? 368  ILE A N     1 
ATOM   3031 C  CA    . ILE A 1 368 ? 20.243  55.680 24.531  1.00 29.44  ? 368  ILE A CA    1 
ATOM   3032 C  C     . ILE A 1 368 ? 20.628  56.823 23.593  1.00 29.05  ? 368  ILE A C     1 
ATOM   3033 O  O     . ILE A 1 368 ? 21.677  56.789 22.952  1.00 31.18  ? 368  ILE A O     1 
ATOM   3034 C  CB    . ILE A 1 368 ? 19.124  54.838 23.884  1.00 28.31  ? 368  ILE A CB    1 
ATOM   3035 C  CG1   . ILE A 1 368 ? 18.943  53.516 24.635  1.00 32.91  ? 368  ILE A CG1   1 
ATOM   3036 C  CG2   . ILE A 1 368 ? 19.439  54.565 22.423  1.00 24.98  ? 368  ILE A CG2   1 
ATOM   3037 C  CD1   . ILE A 1 368 ? 17.779  52.676 24.133  1.00 32.37  ? 368  ILE A CD1   1 
ATOM   3038 N  N     . ILE A 1 369 ? 19.777  57.841 23.529  1.00 29.01  ? 369  ILE A N     1 
ATOM   3039 C  CA    . ILE A 1 369 ? 20.023  58.991 22.667  1.00 30.81  ? 369  ILE A CA    1 
ATOM   3040 C  C     . ILE A 1 369 ? 21.254  59.785 23.112  1.00 30.74  ? 369  ILE A C     1 
ATOM   3041 O  O     . ILE A 1 369 ? 22.066  60.200 22.283  1.00 35.55  ? 369  ILE A O     1 
ATOM   3042 C  CB    . ILE A 1 369 ? 18.781  59.906 22.589  1.00 29.29  ? 369  ILE A CB    1 
ATOM   3043 C  CG1   . ILE A 1 369 ? 17.633  59.173 21.890  1.00 31.45  ? 369  ILE A CG1   1 
ATOM   3044 C  CG2   . ILE A 1 369 ? 19.106  61.196 21.856  1.00 25.73  ? 369  ILE A CG2   1 
ATOM   3045 C  CD1   . ILE A 1 369 ? 16.313  59.925 21.916  1.00 31.66  ? 369  ILE A CD1   1 
ATOM   3046 N  N     . PHE A 1 370 ? 21.401  59.977 24.420  1.00 33.32  ? 370  PHE A N     1 
ATOM   3047 C  CA    . PHE A 1 370 ? 22.563  60.680 24.968  1.00 30.30  ? 370  PHE A CA    1 
ATOM   3048 C  C     . PHE A 1 370 ? 23.874  59.978 24.628  1.00 34.25  ? 370  PHE A C     1 
ATOM   3049 O  O     . PHE A 1 370 ? 24.849  60.627 24.250  1.00 35.02  ? 370  PHE A O     1 
ATOM   3050 C  CB    . PHE A 1 370 ? 22.430  60.855 26.485  1.00 32.95  ? 370  PHE A CB    1 
ATOM   3051 C  CG    . PHE A 1 370 ? 23.746  60.971 27.203  1.00 33.32  ? 370  PHE A CG    1 
ATOM   3052 C  CD1   . PHE A 1 370 ? 24.186  59.953 28.033  1.00 33.94  ? 370  PHE A CD1   1 
ATOM   3053 C  CD2   . PHE A 1 370 ? 24.547  62.092 27.044  1.00 34.45  ? 370  PHE A CD2   1 
ATOM   3054 C  CE1   . PHE A 1 370 ? 25.398  60.050 28.694  1.00 31.88  ? 370  PHE A CE1   1 
ATOM   3055 C  CE2   . PHE A 1 370 ? 25.762  62.194 27.701  1.00 35.85  ? 370  PHE A CE2   1 
ATOM   3056 C  CZ    . PHE A 1 370 ? 26.186  61.171 28.528  1.00 32.95  ? 370  PHE A CZ    1 
ATOM   3057 N  N     . ASN A 1 371 ? 23.900  58.656 24.763  1.00 33.30  ? 371  ASN A N     1 
ATOM   3058 C  CA    . ASN A 1 371 ? 25.094  57.893 24.417  1.00 36.37  ? 371  ASN A CA    1 
ATOM   3059 C  C     . ASN A 1 371 ? 25.421  57.972 22.930  1.00 36.59  ? 371  ASN A C     1 
ATOM   3060 O  O     . ASN A 1 371 ? 26.585  58.096 22.550  1.00 38.36  ? 371  ASN A O     1 
ATOM   3061 C  CB    . ASN A 1 371 ? 24.964  56.436 24.862  1.00 34.72  ? 371  ASN A CB    1 
ATOM   3062 C  CG    . ASN A 1 371 ? 25.324  56.244 26.319  1.00 35.14  ? 371  ASN A CG    1 
ATOM   3063 O  OD1   . ASN A 1 371 ? 26.501  56.161 26.668  1.00 34.10  ? 371  ASN A OD1   1 
ATOM   3064 N  ND2   . ASN A 1 371 ? 24.314  56.182 27.180  1.00 32.03  ? 371  ASN A ND2   1 
ATOM   3065 N  N     . SER A 1 372 ? 24.388  57.908 22.098  1.00 34.21  ? 372  SER A N     1 
ATOM   3066 C  CA    . SER A 1 372 ? 24.555  58.016 20.656  1.00 37.31  ? 372  SER A CA    1 
ATOM   3067 C  C     . SER A 1 372 ? 25.138  59.377 20.276  1.00 36.64  ? 372  SER A C     1 
ATOM   3068 O  O     . SER A 1 372 ? 26.052  59.466 19.459  1.00 39.14  ? 372  SER A O     1 
ATOM   3069 C  CB    . SER A 1 372 ? 23.209  57.810 19.958  1.00 40.64  ? 372  SER A CB    1 
ATOM   3070 O  OG    . SER A 1 372 ? 23.369  57.727 18.552  1.00 45.52  ? 372  SER A OG    1 
ATOM   3071 N  N     . LEU A 1 373 ? 24.605  60.432 20.881  1.00 37.06  ? 373  LEU A N     1 
ATOM   3072 C  CA    . LEU A 1 373 ? 25.047  61.792 20.593  1.00 36.38  ? 373  LEU A CA    1 
ATOM   3073 C  C     . LEU A 1 373 ? 26.441  62.070 21.150  1.00 37.44  ? 373  LEU A C     1 
ATOM   3074 O  O     . LEU A 1 373 ? 27.249  62.743 20.510  1.00 34.57  ? 373  LEU A O     1 
ATOM   3075 C  CB    . LEU A 1 373 ? 24.040  62.805 21.138  1.00 34.14  ? 373  LEU A CB    1 
ATOM   3076 C  CG    . LEU A 1 373 ? 22.722  62.883 20.370  1.00 33.17  ? 373  LEU A CG    1 
ATOM   3077 C  CD1   . LEU A 1 373 ? 21.723  63.779 21.089  1.00 32.31  ? 373  LEU A CD1   1 
ATOM   3078 C  CD2   . LEU A 1 373 ? 22.971  63.383 18.953  1.00 35.47  ? 373  LEU A CD2   1 
ATOM   3079 N  N     . LYS A 1 374 ? 26.716  61.545 22.340  1.00 40.68  ? 374  LYS A N     1 
ATOM   3080 C  CA    . LYS A 1 374 ? 28.021  61.715 22.972  1.00 45.16  ? 374  LYS A CA    1 
ATOM   3081 C  C     . LYS A 1 374 ? 29.146  61.171 22.093  1.00 47.83  ? 374  LYS A C     1 
ATOM   3082 O  O     . LYS A 1 374 ? 30.248  61.723 22.067  1.00 47.43  ? 374  LYS A O     1 
ATOM   3083 C  CB    . LYS A 1 374 ? 28.041  61.041 24.348  1.00 45.64  ? 374  LYS A CB    1 
ATOM   3084 C  CG    . LYS A 1 374 ? 29.415  60.977 24.995  1.00 49.60  ? 374  LYS A CG    1 
ATOM   3085 C  CD    . LYS A 1 374 ? 29.315  60.581 26.456  1.00 50.92  ? 374  LYS A CD    1 
ATOM   3086 C  CE    . LYS A 1 374 ? 30.682  60.280 27.043  1.00 52.04  ? 374  LYS A CE    1 
ATOM   3087 N  NZ    . LYS A 1 374 ? 31.291  59.067 26.431  1.00 58.23  ? 374  LYS A NZ    1 
ATOM   3088 N  N     . GLU A 1 375 ? 28.853  60.103 21.356  1.00 45.39  ? 375  GLU A N     1 
ATOM   3089 C  CA    . GLU A 1 375 ? 29.840  59.466 20.487  1.00 46.56  ? 375  GLU A CA    1 
ATOM   3090 C  C     . GLU A 1 375 ? 30.267  60.358 19.319  1.00 47.70  ? 375  GLU A C     1 
ATOM   3091 O  O     . GLU A 1 375 ? 31.304  60.123 18.703  1.00 51.10  ? 375  GLU A O     1 
ATOM   3092 C  CB    . GLU A 1 375 ? 29.308  58.130 19.959  1.00 46.57  ? 375  GLU A CB    1 
ATOM   3093 N  N     . GLN A 1 376 ? 29.464  61.374 19.017  1.00 44.89  ? 376  GLN A N     1 
ATOM   3094 C  CA    . GLN A 1 376 ? 29.778  62.301 17.934  1.00 46.18  ? 376  GLN A CA    1 
ATOM   3095 C  C     . GLN A 1 376 ? 30.128  63.682 18.474  1.00 44.32  ? 376  GLN A C     1 
ATOM   3096 O  O     . GLN A 1 376 ? 30.038  64.675 17.753  1.00 46.55  ? 376  GLN A O     1 
ATOM   3097 C  CB    . GLN A 1 376 ? 28.597  62.425 16.972  1.00 47.77  ? 376  GLN A CB    1 
ATOM   3098 C  CG    . GLN A 1 376 ? 28.040  61.104 16.476  1.00 54.08  ? 376  GLN A CG    1 
ATOM   3099 C  CD    . GLN A 1 376 ? 26.751  61.284 15.696  1.00 59.83  ? 376  GLN A CD    1 
ATOM   3100 O  OE1   . GLN A 1 376 ? 26.713  61.992 14.687  1.00 64.57  ? 376  GLN A OE1   1 
ATOM   3101 N  NE2   . GLN A 1 376 ? 25.681  60.656 16.168  1.00 58.92  ? 376  GLN A NE2   1 
ATOM   3102 N  N     . ASN A 1 377 ? 30.516  63.736 19.746  1.00 42.31  ? 377  ASN A N     1 
ATOM   3103 C  CA    . ASN A 1 377 ? 30.836  64.993 20.422  1.00 43.55  ? 377  ASN A CA    1 
ATOM   3104 C  C     . ASN A 1 377 ? 29.696  66.010 20.390  1.00 45.05  ? 377  ASN A C     1 
ATOM   3105 O  O     . ASN A 1 377 ? 29.927  67.216 20.448  1.00 47.21  ? 377  ASN A O     1 
ATOM   3106 C  CB    . ASN A 1 377 ? 32.119  65.609 19.857  1.00 44.76  ? 377  ASN A CB    1 
ATOM   3107 C  CG    . ASN A 1 377 ? 33.326  64.716 20.056  1.00 49.28  ? 377  ASN A CG    1 
ATOM   3108 O  OD1   . ASN A 1 377 ? 33.413  63.988 21.043  1.00 51.38  ? 377  ASN A OD1   1 
ATOM   3109 N  ND2   . ASN A 1 377 ? 34.264  64.765 19.116  1.00 52.13  ? 377  ASN A ND2   1 
ATOM   3110 N  N     . LYS A 1 378 ? 28.466  65.515 20.294  1.00 44.19  ? 378  LYS A N     1 
ATOM   3111 C  CA    . LYS A 1 378 ? 27.299  66.385 20.280  1.00 43.50  ? 378  LYS A CA    1 
ATOM   3112 C  C     . LYS A 1 378 ? 26.731  66.549 21.683  1.00 40.02  ? 378  LYS A C     1 
ATOM   3113 O  O     . LYS A 1 378 ? 26.913  65.683 22.540  1.00 39.55  ? 378  LYS A O     1 
ATOM   3114 C  CB    . LYS A 1 378 ? 26.238  65.853 19.316  1.00 47.59  ? 378  LYS A CB    1 
ATOM   3115 C  CG    . LYS A 1 378 ? 26.685  65.877 17.863  1.00 53.09  ? 378  LYS A CG    1 
ATOM   3116 C  CD    . LYS A 1 378 ? 25.619  65.333 16.929  1.00 56.69  ? 378  LYS A CD    1 
ATOM   3117 C  CE    . LYS A 1 378 ? 26.076  65.417 15.479  1.00 59.60  ? 378  LYS A CE    1 
ATOM   3118 N  NZ    . LYS A 1 378 ? 25.076  64.842 14.539  1.00 60.85  ? 378  LYS A NZ    1 
ATOM   3119 N  N     . VAL A 1 379 ? 26.044  67.666 21.907  1.00 35.81  ? 379  VAL A N     1 
ATOM   3120 C  CA    . VAL A 1 379 ? 25.560  68.023 23.235  1.00 33.21  ? 379  VAL A CA    1 
ATOM   3121 C  C     . VAL A 1 379 ? 24.036  68.048 23.300  1.00 34.96  ? 379  VAL A C     1 
ATOM   3122 O  O     . VAL A 1 379 ? 23.385  68.736 22.514  1.00 34.59  ? 379  VAL A O     1 
ATOM   3123 C  CB    . VAL A 1 379 ? 26.106  69.399 23.666  1.00 38.47  ? 379  VAL A CB    1 
ATOM   3124 C  CG1   . VAL A 1 379 ? 25.678  69.713 25.083  1.00 40.04  ? 379  VAL A CG1   1 
ATOM   3125 C  CG2   . VAL A 1 379 ? 27.623  69.425 23.550  1.00 36.66  ? 379  VAL A CG2   1 
ATOM   3126 N  N     . ILE A 1 380 ? 23.473  67.299 24.245  1.00 33.96  ? 380  ILE A N     1 
ATOM   3127 C  CA    . ILE A 1 380 ? 22.025  67.195 24.381  1.00 32.26  ? 380  ILE A CA    1 
ATOM   3128 C  C     . ILE A 1 380 ? 21.428  68.476 24.959  1.00 31.67  ? 380  ILE A C     1 
ATOM   3129 O  O     . ILE A 1 380 ? 22.081  69.174 25.735  1.00 33.55  ? 380  ILE A O     1 
ATOM   3130 C  CB    . ILE A 1 380 ? 21.617  65.968 25.243  1.00 37.10  ? 380  ILE A CB    1 
ATOM   3131 C  CG1   . ILE A 1 380 ? 22.005  66.168 26.709  1.00 35.13  ? 380  ILE A CG1   1 
ATOM   3132 C  CG2   . ILE A 1 380 ? 22.241  64.694 24.692  1.00 33.20  ? 380  ILE A CG2   1 
ATOM   3133 C  CD1   . ILE A 1 380 ? 21.621  64.998 27.593  1.00 34.41  ? 380  ILE A CD1   1 
ATOM   3134 N  N     . PRO A 1 381 ? 20.184  68.799 24.571  1.00 32.17  ? 381  PRO A N     1 
ATOM   3135 C  CA    . PRO A 1 381 ? 19.546  70.029 25.055  1.00 29.33  ? 381  PRO A CA    1 
ATOM   3136 C  C     . PRO A 1 381 ? 19.075  69.888 26.498  1.00 31.08  ? 381  PRO A C     1 
ATOM   3137 O  O     . PRO A 1 381 ? 18.941  68.771 26.993  1.00 33.45  ? 381  PRO A O     1 
ATOM   3138 C  CB    . PRO A 1 381 ? 18.342  70.180 24.124  1.00 28.32  ? 381  PRO A CB    1 
ATOM   3139 C  CG    . PRO A 1 381 ? 17.995  68.783 23.747  1.00 28.30  ? 381  PRO A CG    1 
ATOM   3140 C  CD    . PRO A 1 381 ? 19.313  68.055 23.641  1.00 28.19  ? 381  PRO A CD    1 
ATOM   3141 N  N     . GLN A 1 382 ? 18.834  71.011 27.166  1.00 33.33  ? 382  GLN A N     1 
ATOM   3142 C  CA    . GLN A 1 382 ? 18.291  70.977 28.517  1.00 36.81  ? 382  GLN A CA    1 
ATOM   3143 C  C     . GLN A 1 382 ? 16.816  70.603 28.473  1.00 34.60  ? 382  GLN A C     1 
ATOM   3144 O  O     . GLN A 1 382 ? 16.096  71.006 27.560  1.00 37.95  ? 382  GLN A O     1 
ATOM   3145 C  CB    . GLN A 1 382 ? 18.468  72.331 29.211  1.00 37.14  ? 382  GLN A CB    1 
ATOM   3146 C  CG    . GLN A 1 382 ? 18.022  72.342 30.666  1.00 37.88  ? 382  GLN A CG    1 
ATOM   3147 C  CD    . GLN A 1 382 ? 18.415  73.614 31.396  1.00 39.77  ? 382  GLN A CD    1 
ATOM   3148 O  OE1   . GLN A 1 382 ? 18.577  74.672 30.787  1.00 39.61  ? 382  GLN A OE1   1 
ATOM   3149 N  NE2   . GLN A 1 382 ? 18.577  73.513 32.709  1.00 40.86  ? 382  GLN A NE2   1 
ATOM   3150 N  N     . GLY A 1 383 ? 16.372  69.819 29.451  1.00 36.20  ? 383  GLY A N     1 
ATOM   3151 C  CA    . GLY A 1 383 ? 14.961  69.518 29.595  1.00 35.66  ? 383  GLY A CA    1 
ATOM   3152 C  C     . GLY A 1 383 ? 14.191  70.798 29.856  1.00 40.14  ? 383  GLY A C     1 
ATOM   3153 O  O     . GLY A 1 383 ? 14.694  71.703 30.525  1.00 41.16  ? 383  GLY A O     1 
ATOM   3154 N  N     . ARG A 1 384 ? 12.982  70.890 29.311  1.00 39.90  ? 384  ARG A N     1 
ATOM   3155 C  CA    . ARG A 1 384 ? 12.161  72.083 29.490  1.00 39.20  ? 384  ARG A CA    1 
ATOM   3156 C  C     . ARG A 1 384 ? 10.762  71.739 29.985  1.00 41.67  ? 384  ARG A C     1 
ATOM   3157 O  O     . ARG A 1 384 ? 10.261  70.637 29.761  1.00 40.04  ? 384  ARG A O     1 
ATOM   3158 C  CB    . ARG A 1 384 ? 12.073  72.885 28.189  1.00 43.62  ? 384  ARG A CB    1 
ATOM   3159 C  CG    . ARG A 1 384 ? 13.416  73.370 27.668  1.00 52.76  ? 384  ARG A CG    1 
ATOM   3160 C  CD    . ARG A 1 384 ? 13.264  74.243 26.430  1.00 60.73  ? 384  ARG A CD    1 
ATOM   3161 N  NE    . ARG A 1 384 ? 12.313  73.686 25.472  1.00 68.52  ? 384  ARG A NE    1 
ATOM   3162 C  CZ    . ARG A 1 384 ? 12.566  72.652 24.675  1.00 72.38  ? 384  ARG A CZ    1 
ATOM   3163 N  NH1   . ARG A 1 384 ? 13.745  72.044 24.721  1.00 76.44  ? 384  ARG A NH1   1 
ATOM   3164 N  NH2   . ARG A 1 384 ? 11.636  72.219 23.835  1.00 70.35  ? 384  ARG A NH2   1 
ATOM   3165 N  N     . SER A 1 385 ? 10.139  72.696 30.662  1.00 44.02  ? 385  SER A N     1 
ATOM   3166 C  CA    . SER A 1 385 ? 8.782   72.533 31.160  1.00 48.29  ? 385  SER A CA    1 
ATOM   3167 C  C     . SER A 1 385 ? 7.775   72.769 30.040  1.00 45.80  ? 385  SER A C     1 
ATOM   3168 O  O     . SER A 1 385 ? 7.900   73.722 29.272  1.00 45.87  ? 385  SER A O     1 
ATOM   3169 C  CB    . SER A 1 385 ? 8.527   73.506 32.312  1.00 52.41  ? 385  SER A CB    1 
ATOM   3170 O  OG    . SER A 1 385 ? 7.217   73.359 32.826  1.00 59.23  ? 385  SER A OG    1 
ATOM   3171 N  N     . HIS A 1 386 ? 6.778   71.895 29.949  1.00 42.11  ? 386  HIS A N     1 
ATOM   3172 C  CA    . HIS A 1 386 ? 5.731   72.030 28.941  1.00 39.96  ? 386  HIS A CA    1 
ATOM   3173 C  C     . HIS A 1 386 ? 4.364   71.722 29.535  1.00 39.03  ? 386  HIS A C     1 
ATOM   3174 O  O     . HIS A 1 386 ? 4.241   70.845 30.392  1.00 40.68  ? 386  HIS A O     1 
ATOM   3175 C  CB    . HIS A 1 386 ? 5.981   71.085 27.762  1.00 39.70  ? 386  HIS A CB    1 
ATOM   3176 C  CG    . HIS A 1 386 ? 7.281   71.307 27.064  1.00 42.14  ? 386  HIS A CG    1 
ATOM   3177 N  ND1   . HIS A 1 386 ? 8.389   70.519 27.278  1.00 41.76  ? 386  HIS A ND1   1 
ATOM   3178 C  CD2   . HIS A 1 386 ? 7.655   72.230 26.137  1.00 44.48  ? 386  HIS A CD2   1 
ATOM   3179 C  CE1   . HIS A 1 386 ? 9.388   70.939 26.522  1.00 43.99  ? 386  HIS A CE1   1 
ATOM   3180 N  NE2   . HIS A 1 386 ? 8.962   71.980 25.822  1.00 46.09  ? 386  HIS A NE2   1 
ATOM   3181 N  N     . PRO A 1 387 ? 3.328   72.439 29.077  1.00 36.70  ? 387  PRO A N     1 
ATOM   3182 C  CA    . PRO A 1 387 ? 1.952   72.126 29.473  1.00 38.07  ? 387  PRO A CA    1 
ATOM   3183 C  C     . PRO A 1 387 ? 1.434   70.909 28.714  1.00 40.01  ? 387  PRO A C     1 
ATOM   3184 O  O     . PRO A 1 387 ? 1.781   70.724 27.547  1.00 41.79  ? 387  PRO A O     1 
ATOM   3185 C  CB    . PRO A 1 387 ? 1.180   73.374 29.048  1.00 36.64  ? 387  PRO A CB    1 
ATOM   3186 C  CG    . PRO A 1 387 ? 1.958   73.913 27.899  1.00 38.18  ? 387  PRO A CG    1 
ATOM   3187 C  CD    . PRO A 1 387 ? 3.400   73.631 28.213  1.00 37.18  ? 387  PRO A CD    1 
ATOM   3188 N  N     . VAL A 1 388 ? 0.622   70.087 29.370  1.00 39.26  ? 388  VAL A N     1 
ATOM   3189 C  CA    . VAL A 1 388 ? 0.024   68.927 28.720  1.00 39.02  ? 388  VAL A CA    1 
ATOM   3190 C  C     . VAL A 1 388 ? -1.056  69.371 27.739  1.00 37.38  ? 388  VAL A C     1 
ATOM   3191 O  O     . VAL A 1 388 ? -1.939  70.148 28.092  1.00 41.57  ? 388  VAL A O     1 
ATOM   3192 C  CB    . VAL A 1 388 ? -0.586  67.960 29.749  1.00 38.93  ? 388  VAL A CB    1 
ATOM   3193 C  CG1   . VAL A 1 388 ? -1.259  66.783 29.048  1.00 34.76  ? 388  VAL A CG1   1 
ATOM   3194 C  CG2   . VAL A 1 388 ? 0.486   67.474 30.712  1.00 43.31  ? 388  VAL A CG2   1 
ATOM   3195 N  N     . GLN A 1 389 ? -0.971  68.882 26.505  1.00 34.61  ? 389  GLN A N     1 
ATOM   3196 C  CA    . GLN A 1 389 ? -1.935  69.223 25.467  1.00 36.06  ? 389  GLN A CA    1 
ATOM   3197 C  C     . GLN A 1 389 ? -2.356  67.978 24.699  1.00 33.26  ? 389  GLN A C     1 
ATOM   3198 O  O     . GLN A 1 389 ? -1.535  67.101 24.437  1.00 30.86  ? 389  GLN A O     1 
ATOM   3199 C  CB    . GLN A 1 389 ? -1.335  70.230 24.485  1.00 44.99  ? 389  GLN A CB    1 
ATOM   3200 C  CG    . GLN A 1 389 ? -0.934  71.558 25.092  1.00 56.24  ? 389  GLN A CG    1 
ATOM   3201 C  CD    . GLN A 1 389 ? -0.310  72.490 24.071  1.00 64.14  ? 389  GLN A CD    1 
ATOM   3202 O  OE1   . GLN A 1 389 ? -0.243  72.172 22.883  1.00 64.50  ? 389  GLN A OE1   1 
ATOM   3203 N  NE2   . GLN A 1 389 ? 0.152   73.648 24.529  1.00 69.33  ? 389  GLN A NE2   1 
ATOM   3204 N  N     . PRO A 1 390 ? -3.642  67.898 24.327  1.00 36.59  ? 390  PRO A N     1 
ATOM   3205 C  CA    . PRO A 1 390 ? -4.121  66.780 23.508  1.00 36.15  ? 390  PRO A CA    1 
ATOM   3206 C  C     . PRO A 1 390 ? -3.586  66.885 22.084  1.00 33.92  ? 390  PRO A C     1 
ATOM   3207 O  O     . PRO A 1 390 ? -3.211  67.975 21.654  1.00 36.04  ? 390  PRO A O     1 
ATOM   3208 C  CB    . PRO A 1 390 ? -5.646  66.969 23.502  1.00 37.61  ? 390  PRO A CB    1 
ATOM   3209 C  CG    . PRO A 1 390 ? -5.938  67.948 24.605  1.00 42.42  ? 390  PRO A CG    1 
ATOM   3210 C  CD    . PRO A 1 390 ? -4.729  68.820 24.695  1.00 39.62  ? 390  PRO A CD    1 
ATOM   3211 N  N     . TYR A 1 391 ? -3.543  65.768 21.367  1.00 28.95  ? 391  TYR A N     1 
ATOM   3212 C  CA    . TYR A 1 391 ? -3.153  65.775 19.959  1.00 29.65  ? 391  TYR A CA    1 
ATOM   3213 C  C     . TYR A 1 391 ? -3.742  64.544 19.264  1.00 31.69  ? 391  TYR A C     1 
ATOM   3214 O  O     . TYR A 1 391 ? -3.996  63.534 19.917  1.00 28.96  ? 391  TYR A O     1 
ATOM   3215 C  CB    . TYR A 1 391 ? -1.624  65.860 19.805  1.00 28.12  ? 391  TYR A CB    1 
ATOM   3216 C  CG    . TYR A 1 391 ? -0.855  64.605 20.166  1.00 27.68  ? 391  TYR A CG    1 
ATOM   3217 C  CD1   . TYR A 1 391 ? -0.375  64.407 21.455  1.00 28.32  ? 391  TYR A CD1   1 
ATOM   3218 C  CD2   . TYR A 1 391 ? -0.587  63.633 19.211  1.00 25.48  ? 391  TYR A CD2   1 
ATOM   3219 C  CE1   . TYR A 1 391 ? 0.341   63.268 21.785  1.00 27.41  ? 391  TYR A CE1   1 
ATOM   3220 C  CE2   . TYR A 1 391 ? 0.126   62.490 19.532  1.00 27.47  ? 391  TYR A CE2   1 
ATOM   3221 C  CZ    . TYR A 1 391 ? 0.586   62.312 20.819  1.00 29.51  ? 391  TYR A CZ    1 
ATOM   3222 O  OH    . TYR A 1 391 ? 1.297   61.176 21.143  1.00 34.32  ? 391  TYR A OH    1 
ATOM   3223 N  N     . PRO A 1 392 ? -3.978  64.627 17.942  1.00 32.66  ? 392  PRO A N     1 
ATOM   3224 C  CA    . PRO A 1 392 ? -4.722  63.557 17.268  1.00 31.49  ? 392  PRO A CA    1 
ATOM   3225 C  C     . PRO A 1 392 ? -3.922  62.268 17.097  1.00 31.88  ? 392  PRO A C     1 
ATOM   3226 O  O     . PRO A 1 392 ? -2.691  62.294 17.043  1.00 30.34  ? 392  PRO A O     1 
ATOM   3227 C  CB    . PRO A 1 392 ? -5.039  64.166 15.901  1.00 32.48  ? 392  PRO A CB    1 
ATOM   3228 C  CG    . PRO A 1 392 ? -3.914  65.104 15.655  1.00 35.05  ? 392  PRO A CG    1 
ATOM   3229 C  CD    . PRO A 1 392 ? -3.580  65.692 17.003  1.00 34.28  ? 392  PRO A CD    1 
ATOM   3230 N  N     . GLY A 1 393 ? -4.635  61.149 17.003  1.00 29.38  ? 393  GLY A N     1 
ATOM   3231 C  CA    . GLY A 1 393 ? -4.011  59.848 16.861  1.00 30.18  ? 393  GLY A CA    1 
ATOM   3232 C  C     . GLY A 1 393 ? -4.405  59.124 15.587  1.00 29.62  ? 393  GLY A C     1 
ATOM   3233 O  O     . GLY A 1 393 ? -4.423  59.711 14.503  1.00 26.71  ? 393  GLY A O     1 
ATOM   3234 N  N     . ALA A 1 394 ? -4.726  57.842 15.720  1.00 27.91  ? 394  ALA A N     1 
ATOM   3235 C  CA    . ALA A 1 394 ? -4.997  56.991 14.565  1.00 28.73  ? 394  ALA A CA    1 
ATOM   3236 C  C     . ALA A 1 394 ? -6.420  57.144 14.036  1.00 29.76  ? 394  ALA A C     1 
ATOM   3237 O  O     . ALA A 1 394 ? -7.297  57.675 14.716  1.00 33.19  ? 394  ALA A O     1 
ATOM   3238 C  CB    . ALA A 1 394 ? -4.716  55.535 14.910  1.00 23.96  ? 394  ALA A CB    1 
ATOM   3239 N  N     . PHE A 1 395 ? -6.637  56.675 12.812  1.00 29.46  ? 395  PHE A N     1 
ATOM   3240 C  CA    . PHE A 1 395 ? -7.965  56.654 12.218  1.00 29.49  ? 395  PHE A CA    1 
ATOM   3241 C  C     . PHE A 1 395 ? -8.560  55.258 12.342  1.00 30.57  ? 395  PHE A C     1 
ATOM   3242 O  O     . PHE A 1 395 ? -7.865  54.261 12.155  1.00 29.42  ? 395  PHE A O     1 
ATOM   3243 C  CB    . PHE A 1 395 ? -7.908  57.069 10.746  1.00 29.53  ? 395  PHE A CB    1 
ATOM   3244 C  CG    . PHE A 1 395 ? -9.227  56.948 10.028  1.00 35.45  ? 395  PHE A CG    1 
ATOM   3245 C  CD1   . PHE A 1 395 ? -10.191 57.936 10.152  1.00 36.64  ? 395  PHE A CD1   1 
ATOM   3246 C  CD2   . PHE A 1 395 ? -9.499  55.851 9.223   1.00 33.62  ? 395  PHE A CD2   1 
ATOM   3247 C  CE1   . PHE A 1 395 ? -11.403 57.829 9.495   1.00 38.89  ? 395  PHE A CE1   1 
ATOM   3248 C  CE2   . PHE A 1 395 ? -10.711 55.738 8.563   1.00 33.21  ? 395  PHE A CE2   1 
ATOM   3249 C  CZ    . PHE A 1 395 ? -11.664 56.728 8.699   1.00 36.25  ? 395  PHE A CZ    1 
ATOM   3250 N  N     . VAL A 1 396 ? -9.847  55.196 12.668  1.00 30.84  ? 396  VAL A N     1 
ATOM   3251 C  CA    . VAL A 1 396 ? -10.564 53.930 12.720  1.00 28.54  ? 396  VAL A CA    1 
ATOM   3252 C  C     . VAL A 1 396 ? -11.830 54.025 11.876  1.00 34.60  ? 396  VAL A C     1 
ATOM   3253 O  O     . VAL A 1 396 ? -12.663 54.906 12.088  1.00 36.53  ? 396  VAL A O     1 
ATOM   3254 C  CB    . VAL A 1 396 ? -10.945 53.541 14.162  1.00 29.22  ? 396  VAL A CB    1 
ATOM   3255 C  CG1   . VAL A 1 396 ? -11.641 52.187 14.180  1.00 27.97  ? 396  VAL A CG1   1 
ATOM   3256 C  CG2   . VAL A 1 396 ? -9.714  53.513 15.050  1.00 31.26  ? 396  VAL A CG2   1 
ATOM   3257 N  N     . LYS A 1 397 ? -11.963 53.118 10.915  1.00 32.83  ? 397  LYS A N     1 
ATOM   3258 C  CA    . LYS A 1 397 ? -13.119 53.100 10.028  1.00 37.29  ? 397  LYS A CA    1 
ATOM   3259 C  C     . LYS A 1 397 ? -14.347 52.559 10.752  1.00 38.16  ? 397  LYS A C     1 
ATOM   3260 O  O     . LYS A 1 397 ? -14.236 51.663 11.585  1.00 39.96  ? 397  LYS A O     1 
ATOM   3261 C  CB    . LYS A 1 397 ? -12.816 52.251 8.789   1.00 41.11  ? 397  LYS A CB    1 
ATOM   3262 C  CG    . LYS A 1 397 ? -13.959 52.151 7.790   1.00 45.94  ? 397  LYS A CG    1 
ATOM   3263 C  CD    . LYS A 1 397 ? -13.538 51.383 6.547   1.00 49.18  ? 397  LYS A CD    1 
ATOM   3264 C  CE    . LYS A 1 397 ? -14.726 51.093 5.646   1.00 48.57  ? 397  LYS A CE    1 
ATOM   3265 N  NZ    . LYS A 1 397 ? -15.446 52.336 5.259   1.00 50.27  ? 397  LYS A NZ    1 
ATOM   3266 N  N     . GLU A 1 398 ? -15.511 53.119 10.436  1.00 37.82  ? 398  GLU A N     1 
ATOM   3267 C  CA    . GLU A 1 398 ? -16.777 52.653 10.992  1.00 37.30  ? 398  GLU A CA    1 
ATOM   3268 C  C     . GLU A 1 398 ? -17.322 51.504 10.149  1.00 37.86  ? 398  GLU A C     1 
ATOM   3269 O  O     . GLU A 1 398 ? -17.815 51.720 9.044   1.00 40.32  ? 398  GLU A O     1 
ATOM   3270 C  CB    . GLU A 1 398 ? -17.794 53.796 11.022  1.00 37.86  ? 398  GLU A CB    1 
ATOM   3271 C  CG    . GLU A 1 398 ? -19.090 53.465 11.747  1.00 41.89  ? 398  GLU A CG    1 
ATOM   3272 C  CD    . GLU A 1 398 ? -18.913 53.397 13.254  1.00 43.63  ? 398  GLU A CD    1 
ATOM   3273 O  OE1   . GLU A 1 398 ? -18.651 54.452 13.872  1.00 40.54  ? 398  GLU A OE1   1 
ATOM   3274 O  OE2   . GLU A 1 398 ? -19.030 52.288 13.816  1.00 40.79  ? 398  GLU A OE2   1 
ATOM   3275 N  N     . PRO A 1 399 ? -17.239 50.273 10.669  1.00 38.99  ? 399  PRO A N     1 
ATOM   3276 C  CA    . PRO A 1 399 ? -17.682 49.125 9.876   1.00 38.75  ? 399  PRO A CA    1 
ATOM   3277 C  C     . PRO A 1 399 ? -19.198 49.007 9.857   1.00 38.10  ? 399  PRO A C     1 
ATOM   3278 O  O     . PRO A 1 399 ? -19.863 49.447 10.795  1.00 39.99  ? 399  PRO A O     1 
ATOM   3279 C  CB    . PRO A 1 399 ? -17.084 47.938 10.631  1.00 38.86  ? 399  PRO A CB    1 
ATOM   3280 C  CG    . PRO A 1 399 ? -17.067 48.388 12.050  1.00 39.39  ? 399  PRO A CG    1 
ATOM   3281 C  CD    . PRO A 1 399 ? -16.789 49.874 12.015  1.00 36.36  ? 399  PRO A CD    1 
ATOM   3282 N  N     . ILE A 1 400 ? -19.732 48.429 8.788   1.00 34.76  ? 400  ILE A N     1 
ATOM   3283 C  CA    . ILE A 1 400 ? -21.143 48.078 8.738   1.00 40.22  ? 400  ILE A CA    1 
ATOM   3284 C  C     . ILE A 1 400 ? -21.342 46.791 9.523   1.00 43.49  ? 400  ILE A C     1 
ATOM   3285 O  O     . ILE A 1 400 ? -20.798 45.750 9.152   1.00 42.68  ? 400  ILE A O     1 
ATOM   3286 C  CB    . ILE A 1 400 ? -21.620 47.853 7.296   1.00 40.32  ? 400  ILE A CB    1 
ATOM   3287 C  CG1   . ILE A 1 400 ? -21.353 49.099 6.445   1.00 43.31  ? 400  ILE A CG1   1 
ATOM   3288 C  CG2   . ILE A 1 400 ? -23.100 47.486 7.275   1.00 40.34  ? 400  ILE A CG2   1 
ATOM   3289 C  CD1   . ILE A 1 400 ? -21.726 48.932 4.988   1.00 44.68  ? 400  ILE A CD1   1 
ATOM   3290 N  N     . PRO A 1 401 ? -22.110 46.862 10.621  1.00 46.98  ? 401  PRO A N     1 
ATOM   3291 C  CA    . PRO A 1 401 ? -22.365 45.682 11.455  1.00 45.83  ? 401  PRO A CA    1 
ATOM   3292 C  C     . PRO A 1 401 ? -23.005 44.579 10.622  1.00 42.16  ? 401  PRO A C     1 
ATOM   3293 O  O     . PRO A 1 401 ? -24.091 44.778 10.083  1.00 43.43  ? 401  PRO A O     1 
ATOM   3294 C  CB    . PRO A 1 401 ? -23.354 46.200 12.503  1.00 45.75  ? 401  PRO A CB    1 
ATOM   3295 C  CG    . PRO A 1 401 ? -23.133 47.679 12.541  1.00 45.03  ? 401  PRO A CG    1 
ATOM   3296 C  CD    . PRO A 1 401 ? -22.791 48.062 11.134  1.00 45.14  ? 401  PRO A CD    1 
ATOM   3297 N  N     . ASN A 1 402 ? -22.326 43.441 10.513  1.00 42.48  ? 402  ASN A N     1 
ATOM   3298 C  CA    . ASN A 1 402 ? -22.772 42.362 9.642   1.00 38.85  ? 402  ASN A CA    1 
ATOM   3299 C  C     . ASN A 1 402 ? -21.887 41.139 9.809   1.00 42.76  ? 402  ASN A C     1 
ATOM   3300 O  O     . ASN A 1 402 ? -20.833 41.205 10.444  1.00 41.04  ? 402  ASN A O     1 
ATOM   3301 C  CB    . ASN A 1 402 ? -22.739 42.821 8.183   1.00 41.37  ? 402  ASN A CB    1 
ATOM   3302 C  CG    . ASN A 1 402 ? -23.723 42.072 7.308   1.00 46.26  ? 402  ASN A CG    1 
ATOM   3303 O  OD1   . ASN A 1 402 ? -24.525 41.275 7.793   1.00 45.80  ? 402  ASN A OD1   1 
ATOM   3304 N  ND2   . ASN A 1 402 ? -23.675 42.339 6.008   1.00 44.33  ? 402  ASN A ND2   1 
ATOM   3305 N  N     . ARG A 1 403 ? -22.322 40.017 9.247   1.00 43.76  ? 403  ARG A N     1 
ATOM   3306 C  CA    . ARG A 1 403 ? -21.466 38.848 9.146   1.00 41.81  ? 403  ARG A CA    1 
ATOM   3307 C  C     . ARG A 1 403 ? -20.552 39.053 7.945   1.00 43.57  ? 403  ARG A C     1 
ATOM   3308 O  O     . ARG A 1 403 ? -20.887 39.804 7.029   1.00 44.52  ? 403  ARG A O     1 
ATOM   3309 C  CB    . ARG A 1 403 ? -22.299 37.577 8.969   1.00 39.33  ? 403  ARG A CB    1 
ATOM   3310 C  CG    . ARG A 1 403 ? -23.094 37.535 7.671   1.00 42.59  ? 403  ARG A CG    1 
ATOM   3311 C  CD    . ARG A 1 403 ? -23.815 36.204 7.492   1.00 44.07  ? 403  ARG A CD    1 
ATOM   3312 N  NE    . ARG A 1 403 ? -24.946 36.061 8.403   1.00 47.09  ? 403  ARG A NE    1 
ATOM   3313 C  CZ    . ARG A 1 403 ? -25.734 34.990 8.452   1.00 52.70  ? 403  ARG A CZ    1 
ATOM   3314 N  NH1   . ARG A 1 403 ? -25.514 33.961 7.643   1.00 50.79  ? 403  ARG A NH1   1 
ATOM   3315 N  NH2   . ARG A 1 403 ? -26.743 34.947 9.310   1.00 53.21  ? 403  ARG A NH2   1 
ATOM   3316 N  N     . TYR A 1 404 ? -19.394 38.403 7.955   1.00 43.44  ? 404  TYR A N     1 
ATOM   3317 C  CA    . TYR A 1 404 ? -18.470 38.477 6.827   1.00 43.68  ? 404  TYR A CA    1 
ATOM   3318 C  C     . TYR A 1 404 ? -17.813 37.121 6.591   1.00 43.42  ? 404  TYR A C     1 
ATOM   3319 O  O     . TYR A 1 404 ? -16.942 36.701 7.356   1.00 46.27  ? 404  TYR A O     1 
ATOM   3320 C  CB    . TYR A 1 404 ? -17.421 39.570 7.051   1.00 43.37  ? 404  TYR A CB    1 
ATOM   3321 C  CG    . TYR A 1 404 ? -17.995 40.972 7.050   1.00 41.03  ? 404  TYR A CG    1 
ATOM   3322 C  CD1   . TYR A 1 404 ? -18.181 41.668 5.860   1.00 41.89  ? 404  TYR A CD1   1 
ATOM   3323 C  CD2   . TYR A 1 404 ? -18.357 41.597 8.238   1.00 37.79  ? 404  TYR A CD2   1 
ATOM   3324 C  CE1   . TYR A 1 404 ? -18.709 42.949 5.853   1.00 40.55  ? 404  TYR A CE1   1 
ATOM   3325 C  CE2   . TYR A 1 404 ? -18.884 42.877 8.241   1.00 38.11  ? 404  TYR A CE2   1 
ATOM   3326 C  CZ    . TYR A 1 404 ? -19.058 43.548 7.047   1.00 42.12  ? 404  TYR A CZ    1 
ATOM   3327 O  OH    . TYR A 1 404 ? -19.584 44.820 7.049   1.00 45.06  ? 404  TYR A OH    1 
ATOM   3328 N  N     . LYS A 1 405 ? -18.243 36.446 5.528   1.00 43.28  ? 405  LYS A N     1 
ATOM   3329 C  CA    . LYS A 1 405 ? -17.839 35.069 5.250   1.00 42.40  ? 405  LYS A CA    1 
ATOM   3330 C  C     . LYS A 1 405 ? -16.333 34.900 5.065   1.00 44.02  ? 405  LYS A C     1 
ATOM   3331 O  O     . LYS A 1 405 ? -15.666 34.288 5.897   1.00 42.79  ? 405  LYS A O     1 
ATOM   3332 C  CB    . LYS A 1 405 ? -18.581 34.532 4.023   1.00 44.96  ? 405  LYS A CB    1 
ATOM   3333 C  CG    . LYS A 1 405 ? -18.390 33.043 3.784   1.00 44.57  ? 405  LYS A CG    1 
ATOM   3334 C  CD    . LYS A 1 405 ? -19.201 32.566 2.585   1.00 45.90  ? 405  LYS A CD    1 
ATOM   3335 N  N     . TYR A 1 406 ? -15.806 35.433 3.968   1.00 46.76  ? 406  TYR A N     1 
ATOM   3336 C  CA    . TYR A 1 406 ? -14.377 35.338 3.684   1.00 45.55  ? 406  TYR A CA    1 
ATOM   3337 C  C     . TYR A 1 406 ? -13.681 36.672 3.926   1.00 44.97  ? 406  TYR A C     1 
ATOM   3338 O  O     . TYR A 1 406 ? -14.091 37.701 3.387   1.00 46.34  ? 406  TYR A O     1 
ATOM   3339 C  CB    . TYR A 1 406 ? -14.140 34.885 2.241   1.00 47.90  ? 406  TYR A CB    1 
ATOM   3340 C  CG    . TYR A 1 406 ? -14.550 33.456 1.959   1.00 48.37  ? 406  TYR A CG    1 
ATOM   3341 C  CD1   . TYR A 1 406 ? -13.797 32.391 2.438   1.00 47.53  ? 406  TYR A CD1   1 
ATOM   3342 C  CD2   . TYR A 1 406 ? -15.680 33.172 1.201   1.00 49.85  ? 406  TYR A CD2   1 
ATOM   3343 C  CE1   . TYR A 1 406 ? -14.162 31.080 2.179   1.00 49.12  ? 406  TYR A CE1   1 
ATOM   3344 C  CE2   . TYR A 1 406 ? -16.053 31.863 0.935   1.00 53.01  ? 406  TYR A CE2   1 
ATOM   3345 C  CZ    . TYR A 1 406 ? -15.290 30.822 1.427   1.00 52.93  ? 406  TYR A CZ    1 
ATOM   3346 O  OH    . TYR A 1 406 ? -15.653 29.520 1.169   1.00 53.89  ? 406  TYR A OH    1 
ATOM   3347 N  N     . VAL A 1 407 ? -12.625 36.649 4.735   1.00 40.94  ? 407  VAL A N     1 
ATOM   3348 C  CA    . VAL A 1 407 ? -11.886 37.861 5.071   1.00 38.64  ? 407  VAL A CA    1 
ATOM   3349 C  C     . VAL A 1 407 ? -10.373 37.657 5.003   1.00 41.06  ? 407  VAL A C     1 
ATOM   3350 O  O     . VAL A 1 407 ? -9.842  36.683 5.538   1.00 38.58  ? 407  VAL A O     1 
ATOM   3351 C  CB    . VAL A 1 407 ? -12.259 38.374 6.488   1.00 41.18  ? 407  VAL A CB    1 
ATOM   3352 C  CG1   . VAL A 1 407 ? -11.294 39.467 6.944   1.00 35.67  ? 407  VAL A CG1   1 
ATOM   3353 C  CG2   . VAL A 1 407 ? -13.701 38.872 6.524   1.00 37.48  ? 407  VAL A CG2   1 
ATOM   3354 N  N     . MET A 1 408 ? -9.688  38.579 4.332   1.00 43.78  ? 408  MET A N     1 
ATOM   3355 C  CA    . MET A 1 408 ? -8.233  38.637 4.373   1.00 46.85  ? 408  MET A CA    1 
ATOM   3356 C  C     . MET A 1 408 ? -7.811  39.951 5.017   1.00 43.60  ? 408  MET A C     1 
ATOM   3357 O  O     . MET A 1 408 ? -8.299  41.016 4.638   1.00 41.93  ? 408  MET A O     1 
ATOM   3358 C  CB    . MET A 1 408 ? -7.644  38.565 2.967   1.00 53.20  ? 408  MET A CB    1 
ATOM   3359 C  CG    . MET A 1 408 ? -8.310  37.568 2.045   1.00 59.98  ? 408  MET A CG    1 
ATOM   3360 S  SD    . MET A 1 408 ? -7.298  37.310 0.580   1.00 76.97  ? 408  MET A SD    1 
ATOM   3361 C  CE    . MET A 1 408 ? -5.837  36.622 1.351   1.00 52.15  ? 408  MET A CE    1 
ATOM   3362 N  N     . SER A 1 409 ? -6.907  39.884 5.988   1.00 38.39  ? 409  SER A N     1 
ATOM   3363 C  CA    . SER A 1 409 ? -6.429  41.100 6.636   1.00 37.84  ? 409  SER A CA    1 
ATOM   3364 C  C     . SER A 1 409 ? -4.993  41.434 6.244   1.00 37.97  ? 409  SER A C     1 
ATOM   3365 O  O     . SER A 1 409 ? -4.210  40.553 5.890   1.00 40.75  ? 409  SER A O     1 
ATOM   3366 C  CB    . SER A 1 409 ? -6.553  41.000 8.159   1.00 33.46  ? 409  SER A CB    1 
ATOM   3367 O  OG    . SER A 1 409 ? -5.720  39.978 8.673   1.00 38.63  ? 409  SER A OG    1 
ATOM   3368 N  N     . PHE A 1 410 ? -4.665  42.719 6.307   1.00 34.40  ? 410  PHE A N     1 
ATOM   3369 C  CA    . PHE A 1 410 ? -3.323  43.200 6.017   1.00 33.80  ? 410  PHE A CA    1 
ATOM   3370 C  C     . PHE A 1 410 ? -2.961  44.273 7.031   1.00 36.37  ? 410  PHE A C     1 
ATOM   3371 O  O     . PHE A 1 410 ? -3.827  45.025 7.475   1.00 33.50  ? 410  PHE A O     1 
ATOM   3372 C  CB    . PHE A 1 410 ? -3.261  43.815 4.615   1.00 35.36  ? 410  PHE A CB    1 
ATOM   3373 C  CG    . PHE A 1 410 ? -3.484  42.835 3.502   1.00 40.44  ? 410  PHE A CG    1 
ATOM   3374 C  CD1   . PHE A 1 410 ? -4.766  42.485 3.112   1.00 42.09  ? 410  PHE A CD1   1 
ATOM   3375 C  CD2   . PHE A 1 410 ? -2.409  42.284 2.825   1.00 42.26  ? 410  PHE A CD2   1 
ATOM   3376 C  CE1   . PHE A 1 410 ? -4.971  41.587 2.082   1.00 42.98  ? 410  PHE A CE1   1 
ATOM   3377 C  CE2   . PHE A 1 410 ? -2.608  41.386 1.792   1.00 43.75  ? 410  PHE A CE2   1 
ATOM   3378 C  CZ    . PHE A 1 410 ? -3.891  41.038 1.420   1.00 44.34  ? 410  PHE A CZ    1 
ATOM   3379 N  N     . ASP A 1 411 ? -1.687  44.351 7.396   1.00 36.39  ? 411  ASP A N     1 
ATOM   3380 C  CA    . ASP A 1 411 ? -1.222  45.457 8.223   1.00 39.64  ? 411  ASP A CA    1 
ATOM   3381 C  C     . ASP A 1 411 ? 0.249   45.746 7.965   1.00 39.40  ? 411  ASP A C     1 
ATOM   3382 O  O     . ASP A 1 411 ? 0.933   44.980 7.284   1.00 38.78  ? 411  ASP A O     1 
ATOM   3383 C  CB    . ASP A 1 411 ? -1.494  45.200 9.711   1.00 40.81  ? 411  ASP A CB    1 
ATOM   3384 C  CG    . ASP A 1 411 ? -0.309  44.591 10.431  1.00 42.67  ? 411  ASP A CG    1 
ATOM   3385 O  OD1   . ASP A 1 411 ? 0.061   45.117 11.502  1.00 42.42  ? 411  ASP A OD1   1 
ATOM   3386 O  OD2   . ASP A 1 411 ? 0.242   43.583 9.944   1.00 42.01  ? 411  ASP A OD2   1 
ATOM   3387 N  N     . LEU A 1 412 ? 0.731   46.858 8.509   1.00 37.00  ? 412  LEU A N     1 
ATOM   3388 C  CA    . LEU A 1 412 ? 2.098   47.294 8.261   1.00 36.69  ? 412  LEU A CA    1 
ATOM   3389 C  C     . LEU A 1 412 ? 3.062   46.884 9.372   1.00 37.59  ? 412  LEU A C     1 
ATOM   3390 O  O     . LEU A 1 412 ? 2.684   46.802 10.540  1.00 36.37  ? 412  LEU A O     1 
ATOM   3391 C  CB    . LEU A 1 412 ? 2.137   48.807 8.038   1.00 35.72  ? 412  LEU A CB    1 
ATOM   3392 C  CG    . LEU A 1 412 ? 1.494   49.257 6.722   1.00 36.97  ? 412  LEU A CG    1 
ATOM   3393 C  CD1   . LEU A 1 412 ? 0.286   50.147 6.970   1.00 37.97  ? 412  LEU A CD1   1 
ATOM   3394 C  CD2   . LEU A 1 412 ? 2.512   49.963 5.849   1.00 35.31  ? 412  LEU A CD2   1 
ATOM   3395 N  N     . THR A 1 413 ? 4.309   46.625 8.988   1.00 37.50  ? 413  THR A N     1 
ATOM   3396 C  CA    . THR A 1 413 ? 5.350   46.212 9.922   1.00 38.88  ? 413  THR A CA    1 
ATOM   3397 C  C     . THR A 1 413 ? 5.871   47.389 10.741  1.00 38.90  ? 413  THR A C     1 
ATOM   3398 O  O     . THR A 1 413 ? 6.396   48.352 10.174  1.00 37.34  ? 413  THR A O     1 
ATOM   3399 C  CB    . THR A 1 413 ? 6.543   45.579 9.174   1.00 41.52  ? 413  THR A CB    1 
ATOM   3400 O  OG1   . THR A 1 413 ? 6.147   44.323 8.612   1.00 43.47  ? 413  THR A OG1   1 
ATOM   3401 C  CG2   . THR A 1 413 ? 7.710   45.357 10.120  1.00 41.88  ? 413  THR A CG2   1 
ATOM   3402 N  N     A SER A 1 414 ? 5.721   47.301 12.062  0.53 35.91  ? 414  SER A N     1 
ATOM   3403 N  N     B SER A 1 414 ? 5.736   47.290 12.064  0.47 35.93  ? 414  SER A N     1 
ATOM   3404 C  CA    A SER A 1 414 ? 6.203   48.328 12.988  0.53 35.05  ? 414  SER A CA    1 
ATOM   3405 C  CA    B SER A 1 414 ? 6.184   48.327 12.999  0.47 34.94  ? 414  SER A CA    1 
ATOM   3406 C  C     A SER A 1 414 ? 5.803   49.727 12.522  0.53 33.18  ? 414  SER A C     1 
ATOM   3407 C  C     B SER A 1 414 ? 5.800   49.721 12.518  0.47 33.20  ? 414  SER A C     1 
ATOM   3408 O  O     A SER A 1 414 ? 6.661   50.545 12.199  0.53 33.08  ? 414  SER A O     1 
ATOM   3409 O  O     B SER A 1 414 ? 6.663   50.528 12.184  0.47 33.02  ? 414  SER A O     1 
ATOM   3410 C  CB    A SER A 1 414 ? 7.725   48.234 13.140  0.53 35.42  ? 414  SER A CB    1 
ATOM   3411 C  CB    B SER A 1 414 ? 7.694   48.233 13.231  0.47 35.34  ? 414  SER A CB    1 
ATOM   3412 O  OG    A SER A 1 414 ? 8.196   49.089 14.166  0.53 33.07  ? 414  SER A OG    1 
ATOM   3413 O  OG    B SER A 1 414 ? 8.021   47.039 13.921  0.47 37.54  ? 414  SER A OG    1 
ATOM   3414 N  N     . PHE A 1 415 ? 4.497   49.981 12.488  1.00 30.33  ? 415  PHE A N     1 
ATOM   3415 C  CA    . PHE A 1 415 ? 3.933   51.173 11.850  1.00 31.02  ? 415  PHE A CA    1 
ATOM   3416 C  C     . PHE A 1 415 ? 4.564   52.522 12.200  1.00 31.13  ? 415  PHE A C     1 
ATOM   3417 O  O     . PHE A 1 415 ? 5.165   53.168 11.341  1.00 33.25  ? 415  PHE A O     1 
ATOM   3418 C  CB    . PHE A 1 415 ? 2.423   51.228 12.091  1.00 30.69  ? 415  PHE A CB    1 
ATOM   3419 C  CG    . PHE A 1 415 ? 1.698   52.164 11.172  1.00 27.82  ? 415  PHE A CG    1 
ATOM   3420 C  CD1   . PHE A 1 415 ? 2.013   52.211 9.824   1.00 29.70  ? 415  PHE A CD1   1 
ATOM   3421 C  CD2   . PHE A 1 415 ? 0.686   52.978 11.649  1.00 26.99  ? 415  PHE A CD2   1 
ATOM   3422 C  CE1   . PHE A 1 415 ? 1.342   53.062 8.970   1.00 29.71  ? 415  PHE A CE1   1 
ATOM   3423 C  CE2   . PHE A 1 415 ? 0.007   53.830 10.797  1.00 29.62  ? 415  PHE A CE2   1 
ATOM   3424 C  CZ    . PHE A 1 415 ? 0.337   53.869 9.455   1.00 28.09  ? 415  PHE A CZ    1 
ATOM   3425 N  N     . TYR A 1 416 ? 4.422   52.950 13.449  1.00 26.87  ? 416  TYR A N     1 
ATOM   3426 C  CA    . TYR A 1 416 ? 4.930   54.262 13.843  1.00 27.66  ? 416  TYR A CA    1 
ATOM   3427 C  C     . TYR A 1 416 ? 6.458   54.395 13.755  1.00 30.39  ? 416  TYR A C     1 
ATOM   3428 O  O     . TYR A 1 416 ? 6.954   55.411 13.273  1.00 32.08  ? 416  TYR A O     1 
ATOM   3429 C  CB    . TYR A 1 416 ? 4.389   54.691 15.213  1.00 28.68  ? 416  TYR A CB    1 
ATOM   3430 C  CG    . TYR A 1 416 ? 2.943   55.143 15.188  1.00 27.38  ? 416  TYR A CG    1 
ATOM   3431 C  CD1   . TYR A 1 416 ? 2.184   55.057 14.027  1.00 23.70  ? 416  TYR A CD1   1 
ATOM   3432 C  CD2   . TYR A 1 416 ? 2.341   55.670 16.324  1.00 27.44  ? 416  TYR A CD2   1 
ATOM   3433 C  CE1   . TYR A 1 416 ? 0.865   55.471 14.001  1.00 23.29  ? 416  TYR A CE1   1 
ATOM   3434 C  CE2   . TYR A 1 416 ? 1.025   56.086 16.307  1.00 27.62  ? 416  TYR A CE2   1 
ATOM   3435 C  CZ    . TYR A 1 416 ? 0.292   55.987 15.144  1.00 27.62  ? 416  TYR A CZ    1 
ATOM   3436 O  OH    . TYR A 1 416 ? -1.020  56.407 15.130  1.00 24.57  ? 416  TYR A OH    1 
ATOM   3437 N  N     . PRO A 1 417 ? 7.212   53.379 14.218  1.00 30.27  ? 417  PRO A N     1 
ATOM   3438 C  CA    . PRO A 1 417 ? 8.661   53.465 14.002  1.00 30.83  ? 417  PRO A CA    1 
ATOM   3439 C  C     . PRO A 1 417 ? 9.056   53.496 12.523  1.00 32.04  ? 417  PRO A C     1 
ATOM   3440 O  O     . PRO A 1 417 ? 10.055  54.126 12.184  1.00 31.85  ? 417  PRO A O     1 
ATOM   3441 C  CB    . PRO A 1 417 ? 9.185   52.190 14.666  1.00 29.68  ? 417  PRO A CB    1 
ATOM   3442 C  CG    . PRO A 1 417 ? 8.200   51.916 15.746  1.00 30.51  ? 417  PRO A CG    1 
ATOM   3443 C  CD    . PRO A 1 417 ? 6.868   52.299 15.162  1.00 30.71  ? 417  PRO A CD    1 
ATOM   3444 N  N     . SER A 1 418 ? 8.289   52.836 11.660  1.00 28.99  ? 418  SER A N     1 
ATOM   3445 C  CA    . SER A 1 418 ? 8.595   52.846 10.232  1.00 29.16  ? 418  SER A CA    1 
ATOM   3446 C  C     . SER A 1 418 ? 8.318   54.214 9.618   1.00 28.23  ? 418  SER A C     1 
ATOM   3447 O  O     . SER A 1 418 ? 9.021   54.643 8.705   1.00 32.01  ? 418  SER A O     1 
ATOM   3448 C  CB    . SER A 1 418 ? 7.812   51.762 9.489   1.00 31.63  ? 418  SER A CB    1 
ATOM   3449 O  OG    . SER A 1 418 ? 8.182   50.471 9.937   1.00 35.16  ? 418  SER A OG    1 
ATOM   3450 N  N     . ILE A 1 419 ? 7.284   54.883 10.118  1.00 27.47  ? 419  ILE A N     1 
ATOM   3451 C  CA    . ILE A 1 419 ? 6.956   56.240 9.691   1.00 32.26  ? 419  ILE A CA    1 
ATOM   3452 C  C     . ILE A 1 419 ? 8.076   57.196 10.081  1.00 32.69  ? 419  ILE A C     1 
ATOM   3453 O  O     . ILE A 1 419 ? 8.483   58.045 9.291   1.00 34.75  ? 419  ILE A O     1 
ATOM   3454 C  CB    . ILE A 1 419 ? 5.630   56.723 10.321  1.00 29.72  ? 419  ILE A CB    1 
ATOM   3455 C  CG1   . ILE A 1 419 ? 4.455   55.937 9.744   1.00 26.44  ? 419  ILE A CG1   1 
ATOM   3456 C  CG2   . ILE A 1 419 ? 5.429   58.222 10.096  1.00 24.48  ? 419  ILE A CG2   1 
ATOM   3457 C  CD1   . ILE A 1 419 ? 3.141   56.225 10.436  1.00 27.71  ? 419  ILE A CD1   1 
ATOM   3458 N  N     . ILE A 1 420 ? 8.570   57.043 11.305  1.00 32.27  ? 420  ILE A N     1 
ATOM   3459 C  CA    . ILE A 1 420 ? 9.690   57.837 11.797  1.00 33.11  ? 420  ILE A CA    1 
ATOM   3460 C  C     . ILE A 1 420 ? 10.904  57.699 10.884  1.00 35.02  ? 420  ILE A C     1 
ATOM   3461 O  O     . ILE A 1 420 ? 11.510  58.693 10.481  1.00 34.22  ? 420  ILE A O     1 
ATOM   3462 C  CB    . ILE A 1 420 ? 10.077  57.420 13.231  1.00 30.72  ? 420  ILE A CB    1 
ATOM   3463 C  CG1   . ILE A 1 420 ? 9.016   57.896 14.225  1.00 30.58  ? 420  ILE A CG1   1 
ATOM   3464 C  CG2   . ILE A 1 420 ? 11.449  57.966 13.603  1.00 29.20  ? 420  ILE A CG2   1 
ATOM   3465 C  CD1   . ILE A 1 420 ? 9.283   57.482 15.659  1.00 31.62  ? 420  ILE A CD1   1 
ATOM   3466 N  N     . ARG A 1 421 ? 11.239  56.459 10.546  1.00 31.73  ? 421  ARG A N     1 
ATOM   3467 C  CA    . ARG A 1 421 ? 12.393  56.176 9.703   1.00 30.96  ? 421  ARG A CA    1 
ATOM   3468 C  C     . ARG A 1 421 ? 12.182  56.642 8.262   1.00 35.25  ? 421  ARG A C     1 
ATOM   3469 O  O     . ARG A 1 421 ? 13.095  57.187 7.641   1.00 37.13  ? 421  ARG A O     1 
ATOM   3470 C  CB    . ARG A 1 421 ? 12.717  54.681 9.737   1.00 28.33  ? 421  ARG A CB    1 
ATOM   3471 C  CG    . ARG A 1 421 ? 13.067  54.144 11.118  1.00 29.31  ? 421  ARG A CG    1 
ATOM   3472 C  CD    . ARG A 1 421 ? 13.045  52.623 11.127  1.00 29.76  ? 421  ARG A CD    1 
ATOM   3473 N  NE    . ARG A 1 421 ? 13.945  52.073 10.119  1.00 33.71  ? 421  ARG A NE    1 
ATOM   3474 C  CZ    . ARG A 1 421 ? 13.754  50.913 9.498   1.00 37.81  ? 421  ARG A CZ    1 
ATOM   3475 N  NH1   . ARG A 1 421 ? 12.687  50.175 9.779   1.00 36.37  ? 421  ARG A NH1   1 
ATOM   3476 N  NH2   . ARG A 1 421 ? 14.628  50.495 8.593   1.00 35.76  ? 421  ARG A NH2   1 
ATOM   3477 N  N     . GLN A 1 422 ? 10.979  56.432 7.737   1.00 35.64  ? 422  GLN A N     1 
ATOM   3478 C  CA    . GLN A 1 422 ? 10.672  56.811 6.359   1.00 38.25  ? 422  GLN A CA    1 
ATOM   3479 C  C     . GLN A 1 422 ? 10.703  58.324 6.145   1.00 39.89  ? 422  GLN A C     1 
ATOM   3480 O  O     . GLN A 1 422 ? 11.320  58.816 5.199   1.00 40.16  ? 422  GLN A O     1 
ATOM   3481 C  CB    . GLN A 1 422 ? 9.314   56.246 5.926   1.00 37.00  ? 422  GLN A CB    1 
ATOM   3482 C  CG    . GLN A 1 422 ? 8.735   56.915 4.684   1.00 37.83  ? 422  GLN A CG    1 
ATOM   3483 C  CD    . GLN A 1 422 ? 7.755   56.030 3.937   1.00 37.47  ? 422  GLN A CD    1 
ATOM   3484 O  OE1   . GLN A 1 422 ? 7.722   54.816 4.134   1.00 38.51  ? 422  GLN A OE1   1 
ATOM   3485 N  NE2   . GLN A 1 422 ? 6.949   56.637 3.075   1.00 37.86  ? 422  GLN A NE2   1 
ATOM   3486 N  N     . VAL A 1 423 ? 10.034  59.055 7.030   1.00 39.69  ? 423  VAL A N     1 
ATOM   3487 C  CA    . VAL A 1 423 ? 9.922   60.506 6.910   1.00 35.21  ? 423  VAL A CA    1 
ATOM   3488 C  C     . VAL A 1 423 ? 11.184  61.202 7.434   1.00 37.44  ? 423  VAL A C     1 
ATOM   3489 O  O     . VAL A 1 423 ? 11.470  62.344 7.064   1.00 37.56  ? 423  VAL A O     1 
ATOM   3490 C  CB    . VAL A 1 423 ? 8.666   61.022 7.653   1.00 32.34  ? 423  VAL A CB    1 
ATOM   3491 C  CG1   . VAL A 1 423 ? 8.456   62.515 7.423   1.00 31.47  ? 423  VAL A CG1   1 
ATOM   3492 C  CG2   . VAL A 1 423 ? 7.435   60.244 7.203   1.00 29.47  ? 423  VAL A CG2   1 
ATOM   3493 N  N     . ASN A 1 424 ? 11.938  60.485 8.269   1.00 35.31  ? 424  ASN A N     1 
ATOM   3494 C  CA    . ASN A 1 424 ? 13.145  60.996 8.934   1.00 34.31  ? 424  ASN A CA    1 
ATOM   3495 C  C     . ASN A 1 424 ? 12.801  62.008 10.025  1.00 33.59  ? 424  ASN A C     1 
ATOM   3496 O  O     . ASN A 1 424 ? 13.315  63.127 10.047  1.00 36.04  ? 424  ASN A O     1 
ATOM   3497 C  CB    . ASN A 1 424 ? 14.158  61.572 7.934   1.00 34.49  ? 424  ASN A CB    1 
ATOM   3498 C  CG    . ASN A 1 424 ? 15.559  61.655 8.506   1.00 40.80  ? 424  ASN A CG    1 
ATOM   3499 O  OD1   . ASN A 1 424 ? 15.947  60.845 9.349   1.00 44.78  ? 424  ASN A OD1   1 
ATOM   3500 N  ND2   . ASN A 1 424 ? 16.328  62.637 8.049   1.00 37.81  ? 424  ASN A ND2   1 
ATOM   3501 N  N     . ILE A 1 425 ? 11.925  61.593 10.934  1.00 29.94  ? 425  ILE A N     1 
ATOM   3502 C  CA    . ILE A 1 425 ? 11.424  62.465 11.986  1.00 31.11  ? 425  ILE A CA    1 
ATOM   3503 C  C     . ILE A 1 425 ? 12.317  62.434 13.223  1.00 32.52  ? 425  ILE A C     1 
ATOM   3504 O  O     . ILE A 1 425 ? 12.540  61.381 13.824  1.00 32.06  ? 425  ILE A O     1 
ATOM   3505 C  CB    . ILE A 1 425 ? 9.978   62.094 12.362  1.00 32.68  ? 425  ILE A CB    1 
ATOM   3506 C  CG1   . ILE A 1 425 ? 9.061   62.283 11.150  1.00 33.03  ? 425  ILE A CG1   1 
ATOM   3507 C  CG2   . ILE A 1 425 ? 9.501   62.931 13.534  1.00 34.18  ? 425  ILE A CG2   1 
ATOM   3508 C  CD1   . ILE A 1 425 ? 7.664   61.729 11.335  1.00 34.01  ? 425  ILE A CD1   1 
ATOM   3509 N  N     . SER A 1 426 ? 12.821  63.604 13.596  1.00 30.31  ? 426  SER A N     1 
ATOM   3510 C  CA    . SER A 1 426 ? 13.795  63.728 14.671  1.00 28.77  ? 426  SER A CA    1 
ATOM   3511 C  C     . SER A 1 426 ? 13.794  65.190 15.103  1.00 33.12  ? 426  SER A C     1 
ATOM   3512 O  O     . SER A 1 426 ? 13.387  66.057 14.328  1.00 35.09  ? 426  SER A O     1 
ATOM   3513 C  CB    . SER A 1 426 ? 15.179  63.321 14.153  1.00 30.55  ? 426  SER A CB    1 
ATOM   3514 O  OG    . SER A 1 426 ? 16.061  62.965 15.203  1.00 31.05  ? 426  SER A OG    1 
ATOM   3515 N  N     . PRO A 1 427 ? 14.230  65.475 16.343  1.00 31.51  ? 427  PRO A N     1 
ATOM   3516 C  CA    . PRO A 1 427 ? 14.291  66.872 16.792  1.00 32.51  ? 427  PRO A CA    1 
ATOM   3517 C  C     . PRO A 1 427 ? 15.185  67.749 15.915  1.00 35.70  ? 427  PRO A C     1 
ATOM   3518 O  O     . PRO A 1 427 ? 14.857  68.915 15.694  1.00 37.59  ? 427  PRO A O     1 
ATOM   3519 C  CB    . PRO A 1 427 ? 14.883  66.766 18.205  1.00 29.90  ? 427  PRO A CB    1 
ATOM   3520 C  CG    . PRO A 1 427 ? 15.477  65.388 18.286  1.00 29.21  ? 427  PRO A CG    1 
ATOM   3521 C  CD    . PRO A 1 427 ? 14.607  64.543 17.418  1.00 28.61  ? 427  PRO A CD    1 
ATOM   3522 N  N     . GLU A 1 428 ? 16.280  67.192 15.408  1.00 35.56  ? 428  GLU A N     1 
ATOM   3523 C  CA    . GLU A 1 428 ? 17.275  67.992 14.694  1.00 39.41  ? 428  GLU A CA    1 
ATOM   3524 C  C     . GLU A 1 428 ? 17.173  67.911 13.169  1.00 39.70  ? 428  GLU A C     1 
ATOM   3525 O  O     . GLU A 1 428 ? 17.976  68.517 12.461  1.00 40.52  ? 428  GLU A O     1 
ATOM   3526 C  CB    . GLU A 1 428 ? 18.692  67.612 15.145  1.00 37.96  ? 428  GLU A CB    1 
ATOM   3527 C  CG    . GLU A 1 428 ? 19.281  66.379 14.464  1.00 39.70  ? 428  GLU A CG    1 
ATOM   3528 C  CD    . GLU A 1 428 ? 18.796  65.064 15.055  1.00 41.33  ? 428  GLU A CD    1 
ATOM   3529 O  OE1   . GLU A 1 428 ? 17.635  64.992 15.515  1.00 38.94  ? 428  GLU A OE1   1 
ATOM   3530 O  OE2   . GLU A 1 428 ? 19.584  64.094 15.057  1.00 41.74  ? 428  GLU A OE2   1 
ATOM   3531 N  N     . THR A 1 429 ? 16.194  67.169 12.662  1.00 38.55  ? 429  THR A N     1 
ATOM   3532 C  CA    . THR A 1 429 ? 16.033  67.035 11.215  1.00 36.37  ? 429  THR A CA    1 
ATOM   3533 C  C     . THR A 1 429 ? 14.863  67.855 10.686  1.00 32.95  ? 429  THR A C     1 
ATOM   3534 O  O     . THR A 1 429 ? 14.523  67.771 9.507   1.00 32.91  ? 429  THR A O     1 
ATOM   3535 C  CB    . THR A 1 429 ? 15.844  65.570 10.786  1.00 32.15  ? 429  THR A CB    1 
ATOM   3536 O  OG1   . THR A 1 429 ? 14.719  65.011 11.474  1.00 31.34  ? 429  THR A OG1   1 
ATOM   3537 C  CG2   . THR A 1 429 ? 17.089  64.756 11.098  1.00 31.79  ? 429  THR A CG2   1 
ATOM   3538 N  N     . ILE A 1 430 ? 14.242  68.633 11.565  1.00 31.52  ? 430  ILE A N     1 
ATOM   3539 C  CA    . ILE A 1 430 ? 13.169  69.537 11.164  1.00 35.88  ? 430  ILE A CA    1 
ATOM   3540 C  C     . ILE A 1 430 ? 13.699  70.613 10.216  1.00 38.91  ? 430  ILE A C     1 
ATOM   3541 O  O     . ILE A 1 430 ? 14.674  71.298 10.526  1.00 40.64  ? 430  ILE A O     1 
ATOM   3542 C  CB    . ILE A 1 430 ? 12.515  70.196 12.389  1.00 37.20  ? 430  ILE A CB    1 
ATOM   3543 C  CG1   . ILE A 1 430 ? 11.866  69.127 13.272  1.00 38.02  ? 430  ILE A CG1   1 
ATOM   3544 C  CG2   . ILE A 1 430 ? 11.498  71.239 11.951  1.00 34.47  ? 430  ILE A CG2   1 
ATOM   3545 C  CD1   . ILE A 1 430 ? 11.236  69.662 14.543  1.00 38.63  ? 430  ILE A CD1   1 
ATOM   3546 N  N     . ALA A 1 431 ? 13.060  70.753 9.057   1.00 38.64  ? 431  ALA A N     1 
ATOM   3547 C  CA    . ALA A 1 431 ? 13.537  71.680 8.033   1.00 39.78  ? 431  ALA A CA    1 
ATOM   3548 C  C     . ALA A 1 431 ? 12.624  72.891 7.848   1.00 40.91  ? 431  ALA A C     1 
ATOM   3549 O  O     . ALA A 1 431 ? 13.075  73.958 7.433   1.00 44.33  ? 431  ALA A O     1 
ATOM   3550 C  CB    . ALA A 1 431 ? 13.726  70.951 6.708   1.00 40.67  ? 431  ALA A CB    1 
ATOM   3551 N  N     . GLY A 1 432 ? 11.342  72.722 8.151   1.00 40.10  ? 432  GLY A N     1 
ATOM   3552 C  CA    . GLY A 1 432 ? 10.385  73.801 7.994   1.00 38.70  ? 432  GLY A CA    1 
ATOM   3553 C  C     . GLY A 1 432 ? 8.960   73.294 7.902   1.00 43.02  ? 432  GLY A C     1 
ATOM   3554 O  O     . GLY A 1 432 ? 8.665   72.166 8.307   1.00 37.48  ? 432  GLY A O     1 
ATOM   3555 N  N     . THR A 1 433 ? 8.072   74.130 7.374   1.00 34.85  ? 433  THR A N     1 
ATOM   3556 C  CA    . THR A 1 433 ? 6.669   73.758 7.219   1.00 37.94  ? 433  THR A CA    1 
ATOM   3557 C  C     . THR A 1 433 ? 6.145   74.074 5.821   1.00 36.93  ? 433  THR A C     1 
ATOM   3558 O  O     . THR A 1 433 ? 6.778   74.808 5.064   1.00 39.64  ? 433  THR A O     1 
ATOM   3559 C  CB    . THR A 1 433 ? 5.770   74.488 8.240   1.00 38.94  ? 433  THR A CB    1 
ATOM   3560 O  OG1   . THR A 1 433 ? 5.859   75.903 8.032   1.00 39.70  ? 433  THR A OG1   1 
ATOM   3561 C  CG2   . THR A 1 433 ? 6.191   74.157 9.668   1.00 38.52  ? 433  THR A CG2   1 
ATOM   3562 N  N     . PHE A 1 434 ? 4.988   73.511 5.489   1.00 37.57  ? 434  PHE A N     1 
ATOM   3563 C  CA    . PHE A 1 434 ? 4.280   73.861 4.260   1.00 41.27  ? 434  PHE A CA    1 
ATOM   3564 C  C     . PHE A 1 434 ? 2.792   74.048 4.552   1.00 42.38  ? 434  PHE A C     1 
ATOM   3565 O  O     . PHE A 1 434 ? 2.311   73.666 5.619   1.00 40.12  ? 434  PHE A O     1 
ATOM   3566 C  CB    . PHE A 1 434 ? 4.496   72.801 3.172   1.00 39.79  ? 434  PHE A CB    1 
ATOM   3567 C  CG    . PHE A 1 434 ? 3.922   71.449 3.510   1.00 40.34  ? 434  PHE A CG    1 
ATOM   3568 C  CD1   . PHE A 1 434 ? 4.669   70.519 4.213   1.00 39.91  ? 434  PHE A CD1   1 
ATOM   3569 C  CD2   . PHE A 1 434 ? 2.640   71.104 3.109   1.00 39.99  ? 434  PHE A CD2   1 
ATOM   3570 C  CE1   . PHE A 1 434 ? 4.145   69.275 4.522   1.00 38.52  ? 434  PHE A CE1   1 
ATOM   3571 C  CE2   . PHE A 1 434 ? 2.111   69.863 3.414   1.00 37.85  ? 434  PHE A CE2   1 
ATOM   3572 C  CZ    . PHE A 1 434 ? 2.864   68.948 4.123   1.00 36.94  ? 434  PHE A CZ    1 
ATOM   3573 N  N     . LYS A 1 435 ? 2.069   74.637 3.605   1.00 43.26  ? 435  LYS A N     1 
ATOM   3574 C  CA    . LYS A 1 435 ? 0.641   74.888 3.777   1.00 46.32  ? 435  LYS A CA    1 
ATOM   3575 C  C     . LYS A 1 435 ? -0.175  73.618 3.570   1.00 46.62  ? 435  LYS A C     1 
ATOM   3576 O  O     . LYS A 1 435 ? -0.122  73.000 2.506   1.00 49.39  ? 435  LYS A O     1 
ATOM   3577 C  CB    . LYS A 1 435 ? 0.168   75.984 2.821   1.00 49.35  ? 435  LYS A CB    1 
ATOM   3578 C  CG    . LYS A 1 435 ? 0.832   77.331 3.054   1.00 53.95  ? 435  LYS A CG    1 
ATOM   3579 N  N     . VAL A 1 436 ? -0.938  73.237 4.590   1.00 42.92  ? 436  VAL A N     1 
ATOM   3580 C  CA    . VAL A 1 436 ? -1.683  71.984 4.549   1.00 42.33  ? 436  VAL A CA    1 
ATOM   3581 C  C     . VAL A 1 436 ? -3.005  72.090 3.795   1.00 45.10  ? 436  VAL A C     1 
ATOM   3582 O  O     . VAL A 1 436 ? -3.762  73.048 3.957   1.00 51.68  ? 436  VAL A O     1 
ATOM   3583 C  CB    . VAL A 1 436 ? -1.942  71.415 5.968   1.00 41.08  ? 436  VAL A CB    1 
ATOM   3584 C  CG1   . VAL A 1 436 ? -0.634  71.159 6.673   1.00 37.18  ? 436  VAL A CG1   1 
ATOM   3585 C  CG2   . VAL A 1 436 ? -2.807  72.362 6.790   1.00 46.65  ? 436  VAL A CG2   1 
ATOM   3586 N  N     . ALA A 1 437 ? -3.259  71.100 2.949   1.00 44.28  ? 437  ALA A N     1 
ATOM   3587 C  CA    . ALA A 1 437 ? -4.563  70.924 2.336   1.00 48.53  ? 437  ALA A CA    1 
ATOM   3588 C  C     . ALA A 1 437 ? -5.319  69.967 3.249   1.00 51.62  ? 437  ALA A C     1 
ATOM   3589 O  O     . ALA A 1 437 ? -4.703  69.328 4.102   1.00 49.25  ? 437  ALA A O     1 
ATOM   3590 C  CB    . ALA A 1 437 ? -4.407  70.334 0.947   1.00 47.20  ? 437  ALA A CB    1 
ATOM   3591 N  N     . PRO A 1 438 ? -6.653  69.879 3.098   1.00 50.47  ? 438  PRO A N     1 
ATOM   3592 C  CA    . PRO A 1 438 ? -7.400  68.892 3.886   1.00 45.07  ? 438  PRO A CA    1 
ATOM   3593 C  C     . PRO A 1 438 ? -6.818  67.491 3.710   1.00 44.72  ? 438  PRO A C     1 
ATOM   3594 O  O     . PRO A 1 438 ? -6.327  67.168 2.627   1.00 44.58  ? 438  PRO A O     1 
ATOM   3595 C  CB    . PRO A 1 438 ? -8.805  68.968 3.289   1.00 46.71  ? 438  PRO A CB    1 
ATOM   3596 C  CG    . PRO A 1 438 ? -8.921  70.374 2.808   1.00 45.14  ? 438  PRO A CG    1 
ATOM   3597 C  CD    . PRO A 1 438 ? -7.549  70.752 2.316   1.00 48.47  ? 438  PRO A CD    1 
ATOM   3598 N  N     . LEU A 1 439 ? -6.859  66.686 4.767   1.00 40.16  ? 439  LEU A N     1 
ATOM   3599 C  CA    . LEU A 1 439 ? -6.212  65.377 4.769   1.00 40.94  ? 439  LEU A CA    1 
ATOM   3600 C  C     . LEU A 1 439 ? -6.710  64.470 3.644   1.00 39.24  ? 439  LEU A C     1 
ATOM   3601 O  O     . LEU A 1 439 ? -5.945  63.684 3.087   1.00 42.16  ? 439  LEU A O     1 
ATOM   3602 C  CB    . LEU A 1 439 ? -6.395  64.687 6.125   1.00 39.99  ? 439  LEU A CB    1 
ATOM   3603 C  CG    . LEU A 1 439 ? -5.558  63.425 6.351   1.00 43.75  ? 439  LEU A CG    1 
ATOM   3604 C  CD1   . LEU A 1 439 ? -4.074  63.752 6.316   1.00 41.40  ? 439  LEU A CD1   1 
ATOM   3605 C  CD2   . LEU A 1 439 ? -5.930  62.756 7.666   1.00 46.96  ? 439  LEU A CD2   1 
ATOM   3606 N  N     . HIS A 1 440 ? -7.989  64.587 3.307   1.00 42.09  ? 440  HIS A N     1 
ATOM   3607 C  CA    . HIS A 1 440 ? -8.566  63.759 2.255   1.00 48.67  ? 440  HIS A CA    1 
ATOM   3608 C  C     . HIS A 1 440 ? -8.048  64.128 0.867   1.00 47.87  ? 440  HIS A C     1 
ATOM   3609 O  O     . HIS A 1 440 ? -8.119  63.321 -0.059  1.00 48.38  ? 440  HIS A O     1 
ATOM   3610 C  CB    . HIS A 1 440 ? -10.096 63.801 2.300   1.00 58.12  ? 440  HIS A CB    1 
ATOM   3611 C  CG    . HIS A 1 440 ? -10.689 62.914 3.350   1.00 69.93  ? 440  HIS A CG    1 
ATOM   3612 N  ND1   . HIS A 1 440 ? -11.123 61.633 3.084   1.00 73.72  ? 440  HIS A ND1   1 
ATOM   3613 C  CD2   . HIS A 1 440 ? -10.908 63.117 4.672   1.00 73.02  ? 440  HIS A CD2   1 
ATOM   3614 C  CE1   . HIS A 1 440 ? -11.591 61.088 4.193   1.00 73.70  ? 440  HIS A CE1   1 
ATOM   3615 N  NE2   . HIS A 1 440 ? -11.470 61.968 5.171   1.00 73.70  ? 440  HIS A NE2   1 
ATOM   3616 N  N     . ASP A 1 441 ? -7.522  65.342 0.725   1.00 46.41  ? 441  ASP A N     1 
ATOM   3617 C  CA    . ASP A 1 441 ? -6.901  65.752 -0.531  1.00 47.77  ? 441  ASP A CA    1 
ATOM   3618 C  C     . ASP A 1 441 ? -5.589  65.006 -0.764  1.00 48.27  ? 441  ASP A C     1 
ATOM   3619 O  O     . ASP A 1 441 ? -5.246  64.687 -1.903  1.00 40.49  ? 441  ASP A O     1 
ATOM   3620 C  CB    . ASP A 1 441 ? -6.663  67.264 -0.569  1.00 48.74  ? 441  ASP A CB    1 
ATOM   3621 C  CG    . ASP A 1 441 ? -7.938  68.047 -0.802  1.00 51.13  ? 441  ASP A CG    1 
ATOM   3622 O  OD1   . ASP A 1 441 ? -8.960  67.425 -1.158  1.00 50.98  ? 441  ASP A OD1   1 
ATOM   3623 O  OD2   . ASP A 1 441 ? -7.915  69.285 -0.641  1.00 56.43  ? 441  ASP A OD2   1 
ATOM   3624 N  N     . TYR A 1 442 ? -4.860  64.735 0.316   1.00 37.66  ? 442  TYR A N     1 
ATOM   3625 C  CA    . TYR A 1 442 ? -3.626  63.960 0.226   1.00 44.40  ? 442  TYR A CA    1 
ATOM   3626 C  C     . TYR A 1 442 ? -3.945  62.479 0.045   1.00 45.05  ? 442  TYR A C     1 
ATOM   3627 O  O     . TYR A 1 442 ? -3.280  61.781 -0.720  1.00 42.37  ? 442  TYR A O     1 
ATOM   3628 C  CB    . TYR A 1 442 ? -2.746  64.173 1.465   1.00 42.32  ? 442  TYR A CB    1 
ATOM   3629 C  CG    . TYR A 1 442 ? -2.217  65.584 1.598   1.00 41.71  ? 442  TYR A CG    1 
ATOM   3630 C  CD1   . TYR A 1 442 ? -1.254  66.070 0.722   1.00 43.16  ? 442  TYR A CD1   1 
ATOM   3631 C  CD2   . TYR A 1 442 ? -2.679  66.430 2.598   1.00 41.06  ? 442  TYR A CD2   1 
ATOM   3632 C  CE1   . TYR A 1 442 ? -0.769  67.362 0.833   1.00 41.62  ? 442  TYR A CE1   1 
ATOM   3633 C  CE2   . TYR A 1 442 ? -2.200  67.723 2.720   1.00 42.66  ? 442  TYR A CE2   1 
ATOM   3634 C  CZ    . TYR A 1 442 ? -1.246  68.183 1.833   1.00 42.26  ? 442  TYR A CZ    1 
ATOM   3635 O  OH    . TYR A 1 442 ? -0.769  69.467 1.950   1.00 43.19  ? 442  TYR A OH    1 
ATOM   3636 N  N     . ILE A 1 443 ? -4.970  62.014 0.755   1.00 47.49  ? 443  ILE A N     1 
ATOM   3637 C  CA    . ILE A 1 443 ? -5.450  60.642 0.629   1.00 46.50  ? 443  ILE A CA    1 
ATOM   3638 C  C     . ILE A 1 443 ? -5.877  60.348 -0.807  1.00 48.57  ? 443  ILE A C     1 
ATOM   3639 O  O     . ILE A 1 443 ? -5.600  59.274 -1.341  1.00 51.45  ? 443  ILE A O     1 
ATOM   3640 C  CB    . ILE A 1 443 ? -6.638  60.379 1.581   1.00 45.75  ? 443  ILE A CB    1 
ATOM   3641 C  CG1   . ILE A 1 443 ? -6.183  60.471 3.040   1.00 41.15  ? 443  ILE A CG1   1 
ATOM   3642 C  CG2   . ILE A 1 443 ? -7.262  59.018 1.311   1.00 44.76  ? 443  ILE A CG2   1 
ATOM   3643 C  CD1   . ILE A 1 443 ? -7.322  60.509 4.031   1.00 34.34  ? 443  ILE A CD1   1 
ATOM   3644 N  N     . ASN A 1 444 ? -6.537  61.319 -1.433  1.00 45.96  ? 444  ASN A N     1 
ATOM   3645 C  CA    . ASN A 1 444 ? -7.043  61.152 -2.793  1.00 47.73  ? 444  ASN A CA    1 
ATOM   3646 C  C     . ASN A 1 444 ? -6.081  61.640 -3.875  1.00 48.51  ? 444  ASN A C     1 
ATOM   3647 O  O     . ASN A 1 444 ? -6.461  61.747 -5.042  1.00 52.99  ? 444  ASN A O     1 
ATOM   3648 C  CB    . ASN A 1 444 ? -8.401  61.843 -2.944  1.00 51.50  ? 444  ASN A CB    1 
ATOM   3649 C  CG    . ASN A 1 444 ? -9.475  61.208 -2.084  1.00 54.27  ? 444  ASN A CG    1 
ATOM   3650 O  OD1   . ASN A 1 444 ? -9.497  59.992 -1.900  1.00 54.88  ? 444  ASN A OD1   1 
ATOM   3651 N  ND2   . ASN A 1 444 ? -10.370 62.030 -1.548  1.00 56.24  ? 444  ASN A ND2   1 
ATOM   3652 N  N     . ALA A 1 445 ? -4.843  61.930 -3.479  1.00 44.69  ? 445  ALA A N     1 
ATOM   3653 C  CA    . ALA A 1 445 ? -3.802  62.387 -4.402  1.00 47.03  ? 445  ALA A CA    1 
ATOM   3654 C  C     . ALA A 1 445 ? -4.237  63.599 -5.223  1.00 50.33  ? 445  ALA A C     1 
ATOM   3655 O  O     . ALA A 1 445 ? -3.959  63.685 -6.417  1.00 52.24  ? 445  ALA A O     1 
ATOM   3656 C  CB    . ALA A 1 445 ? -3.357  61.249 -5.317  1.00 47.50  ? 445  ALA A CB    1 
ATOM   3657 N  N     . VAL A 1 446 ? -4.921  64.531 -4.569  1.00 53.78  ? 446  VAL A N     1 
ATOM   3658 C  CA    . VAL A 1 446 ? -5.429  65.726 -5.229  1.00 55.79  ? 446  VAL A CA    1 
ATOM   3659 C  C     . VAL A 1 446 ? -4.611  66.954 -4.833  1.00 54.00  ? 446  VAL A C     1 
ATOM   3660 O  O     . VAL A 1 446 ? -4.332  67.827 -5.657  1.00 50.98  ? 446  VAL A O     1 
ATOM   3661 C  CB    . VAL A 1 446 ? -6.925  65.939 -4.895  1.00 59.38  ? 446  VAL A CB    1 
ATOM   3662 C  CG1   . VAL A 1 446 ? -7.328  67.398 -5.064  1.00 61.07  ? 446  VAL A CG1   1 
ATOM   3663 C  CG2   . VAL A 1 446 ? -7.794  65.027 -5.753  1.00 61.02  ? 446  VAL A CG2   1 
ATOM   3664 N  N     . ALA A 1 447 ? -4.215  67.003 -3.565  1.00 52.23  ? 447  ALA A N     1 
ATOM   3665 C  CA    . ALA A 1 447 ? -3.436  68.122 -3.048  1.00 52.15  ? 447  ALA A CA    1 
ATOM   3666 C  C     . ALA A 1 447 ? -2.079  68.242 -3.732  1.00 50.60  ? 447  ALA A C     1 
ATOM   3667 O  O     . ALA A 1 447 ? -1.484  67.243 -4.137  1.00 48.60  ? 447  ALA A O     1 
ATOM   3668 C  CB    . ALA A 1 447 ? -3.255  67.986 -1.552  1.00 49.76  ? 447  ALA A CB    1 
ATOM   3669 N  N     A GLU A 1 448 ? -1.596  69.470 -3.873  0.50 51.55  ? 448  GLU A N     1 
ATOM   3670 N  N     B GLU A 1 448 ? -1.600  69.477 -3.844  0.50 51.51  ? 448  GLU A N     1 
ATOM   3671 C  CA    A GLU A 1 448 ? -0.305  69.692 -4.508  0.50 52.37  ? 448  GLU A CA    1 
ATOM   3672 C  CA    B GLU A 1 448 ? -0.288  69.774 -4.407  0.50 52.01  ? 448  GLU A CA    1 
ATOM   3673 C  C     A GLU A 1 448 ? 0.820   69.122 -3.652  0.50 48.02  ? 448  GLU A C     1 
ATOM   3674 C  C     B GLU A 1 448 ? 0.812   69.066 -3.621  0.50 47.53  ? 448  GLU A C     1 
ATOM   3675 O  O     A GLU A 1 448 ? 0.751   69.138 -2.423  0.50 45.83  ? 448  GLU A O     1 
ATOM   3676 O  O     B GLU A 1 448 ? 0.716   68.928 -2.401  0.50 45.78  ? 448  GLU A O     1 
ATOM   3677 C  CB    A GLU A 1 448 ? -0.080  71.180 -4.787  0.50 54.65  ? 448  GLU A CB    1 
ATOM   3678 C  CB    B GLU A 1 448 ? -0.055  71.290 -4.388  0.50 53.46  ? 448  GLU A CB    1 
ATOM   3679 C  CG    A GLU A 1 448 ? -1.129  71.803 -5.703  0.50 59.46  ? 448  GLU A CG    1 
ATOM   3680 C  CG    B GLU A 1 448 ? 1.310   71.744 -4.880  0.50 56.10  ? 448  GLU A CG    1 
ATOM   3681 C  CD    A GLU A 1 448 ? -1.190  71.145 -7.072  0.50 61.37  ? 448  GLU A CD    1 
ATOM   3682 C  CD    B GLU A 1 448 ? 1.480   73.251 -4.805  0.50 60.08  ? 448  GLU A CD    1 
ATOM   3683 O  OE1   A GLU A 1 448 ? -0.141  70.679 -7.565  0.50 60.48  ? 448  GLU A OE1   1 
ATOM   3684 O  OE1   B GLU A 1 448 ? 0.562   73.930 -4.298  0.50 59.06  ? 448  GLU A OE1   1 
ATOM   3685 O  OE2   A GLU A 1 448 ? -2.293  71.093 -7.656  0.50 63.61  ? 448  GLU A OE2   1 
ATOM   3686 O  OE2   B GLU A 1 448 ? 2.530   73.756 -5.254  0.50 63.84  ? 448  GLU A OE2   1 
ATOM   3687 N  N     . ARG A 1 449 ? 1.845   68.607 -4.323  1.00 46.24  ? 449  ARG A N     1 
ATOM   3688 C  CA    . ARG A 1 449 ? 2.993   67.985 -3.673  1.00 46.53  ? 449  ARG A CA    1 
ATOM   3689 C  C     . ARG A 1 449 ? 3.646   68.961 -2.698  1.00 43.23  ? 449  ARG A C     1 
ATOM   3690 O  O     . ARG A 1 449 ? 4.078   70.043 -3.095  1.00 45.24  ? 449  ARG A O     1 
ATOM   3691 C  CB    . ARG A 1 449 ? 4.000   67.531 -4.732  1.00 50.65  ? 449  ARG A CB    1 
ATOM   3692 C  CG    . ARG A 1 449 ? 5.086   66.597 -4.230  1.00 51.82  ? 449  ARG A CG    1 
ATOM   3693 C  CD    . ARG A 1 449 ? 5.722   65.855 -5.397  1.00 53.30  ? 449  ARG A CD    1 
ATOM   3694 N  NE    . ARG A 1 449 ? 6.734   64.895 -4.968  1.00 52.61  ? 449  ARG A NE    1 
ATOM   3695 C  CZ    . ARG A 1 449 ? 8.037   65.040 -5.183  1.00 49.55  ? 449  ARG A CZ    1 
ATOM   3696 N  NH1   . ARG A 1 449 ? 8.487   66.107 -5.829  1.00 45.78  ? 449  ARG A NH1   1 
ATOM   3697 N  NH2   . ARG A 1 449 ? 8.890   64.115 -4.761  1.00 47.00  ? 449  ARG A NH2   1 
ATOM   3698 N  N     . PRO A 1 450 ? 3.696   68.585 -1.409  1.00 39.46  ? 450  PRO A N     1 
ATOM   3699 C  CA    . PRO A 1 450 ? 4.190   69.446 -0.327  1.00 37.68  ? 450  PRO A CA    1 
ATOM   3700 C  C     . PRO A 1 450 ? 5.562   70.041 -0.628  1.00 47.55  ? 450  PRO A C     1 
ATOM   3701 O  O     . PRO A 1 450 ? 5.749   71.253 -0.502  1.00 50.22  ? 450  PRO A O     1 
ATOM   3702 C  CB    . PRO A 1 450 ? 4.278   68.488 0.864   1.00 35.78  ? 450  PRO A CB    1 
ATOM   3703 C  CG    . PRO A 1 450 ? 3.240   67.456 0.583   1.00 38.15  ? 450  PRO A CG    1 
ATOM   3704 C  CD    . PRO A 1 450 ? 3.259   67.269 -0.909  1.00 37.16  ? 450  PRO A CD    1 
ATOM   3705 N  N     . SER A 1 451 ? 6.505   69.199 -1.037  1.00 45.77  ? 451  SER A N     1 
ATOM   3706 C  CA    . SER A 1 451 ? 7.861   69.660 -1.298  1.00 44.49  ? 451  SER A CA    1 
ATOM   3707 C  C     . SER A 1 451 ? 8.624   68.734 -2.235  1.00 43.82  ? 451  SER A C     1 
ATOM   3708 O  O     . SER A 1 451 ? 8.443   67.518 -2.210  1.00 43.10  ? 451  SER A O     1 
ATOM   3709 C  CB    . SER A 1 451 ? 8.631   69.805 0.016   1.00 43.46  ? 451  SER A CB    1 
ATOM   3710 O  OG    . SER A 1 451 ? 10.000  70.077 -0.224  1.00 44.52  ? 451  SER A OG    1 
ATOM   3711 N  N     A ASP A 1 452 ? 9.474   69.318 -3.073  0.64 46.01  ? 452  ASP A N     1 
ATOM   3712 N  N     B ASP A 1 452 ? 9.489   69.324 -3.051  0.36 46.16  ? 452  ASP A N     1 
ATOM   3713 C  CA    A ASP A 1 452 ? 10.328  68.530 -3.954  0.64 48.18  ? 452  ASP A CA    1 
ATOM   3714 C  CA    B ASP A 1 452 ? 10.328  68.564 -3.964  0.36 48.23  ? 452  ASP A CA    1 
ATOM   3715 C  C     A ASP A 1 452 ? 11.769  68.570 -3.460  0.64 47.55  ? 452  ASP A C     1 
ATOM   3716 C  C     B ASP A 1 452 ? 11.733  68.429 -3.387  0.36 47.22  ? 452  ASP A C     1 
ATOM   3717 O  O     A ASP A 1 452 ? 12.694  68.183 -4.175  0.64 48.49  ? 452  ASP A O     1 
ATOM   3718 O  O     B ASP A 1 452 ? 12.593  67.772 -3.967  0.36 48.43  ? 452  ASP A O     1 
ATOM   3719 C  CB    A ASP A 1 452 ? 10.231  69.021 -5.403  0.64 51.34  ? 452  ASP A CB    1 
ATOM   3720 C  CB    B ASP A 1 452 ? 10.387  69.259 -5.326  0.36 51.72  ? 452  ASP A CB    1 
ATOM   3721 C  CG    A ASP A 1 452 ? 10.802  70.414 -5.594  0.64 53.86  ? 452  ASP A CG    1 
ATOM   3722 C  CG    B ASP A 1 452 ? 9.012   69.494 -5.920  0.36 53.00  ? 452  ASP A CG    1 
ATOM   3723 O  OD1   A ASP A 1 452 ? 10.892  71.168 -4.602  0.64 56.06  ? 452  ASP A OD1   1 
ATOM   3724 O  OD1   B ASP A 1 452 ? 8.206   68.541 -5.956  0.36 53.12  ? 452  ASP A OD1   1 
ATOM   3725 O  OD2   A ASP A 1 452 ? 11.155  70.760 -6.742  0.64 54.06  ? 452  ASP A OD2   1 
ATOM   3726 O  OD2   B ASP A 1 452 ? 8.734   70.636 -6.342  0.36 56.04  ? 452  ASP A OD2   1 
ATOM   3727 N  N     . VAL A 1 453 ? 11.952  69.049 -2.233  1.00 44.37  ? 453  VAL A N     1 
ATOM   3728 C  CA    . VAL A 1 453 ? 13.275  69.106 -1.622  1.00 41.67  ? 453  VAL A CA    1 
ATOM   3729 C  C     . VAL A 1 453 ? 13.333  68.331 -0.304  1.00 41.39  ? 453  VAL A C     1 
ATOM   3730 O  O     . VAL A 1 453 ? 14.299  67.615 -0.037  1.00 42.42  ? 453  VAL A O     1 
ATOM   3731 C  CB    . VAL A 1 453 ? 13.713  70.568 -1.377  1.00 44.93  ? 453  VAL A CB    1 
ATOM   3732 C  CG1   . VAL A 1 453 ? 15.075  70.618 -0.703  1.00 43.44  ? 453  VAL A CG1   1 
ATOM   3733 C  CG2   . VAL A 1 453 ? 13.736  71.343 -2.687  1.00 44.73  ? 453  VAL A CG2   1 
ATOM   3734 N  N     . TYR A 1 454 ? 12.293  68.468 0.513   1.00 38.18  ? 454  TYR A N     1 
ATOM   3735 C  CA    . TYR A 1 454 ? 12.285  67.863 1.841   1.00 36.40  ? 454  TYR A CA    1 
ATOM   3736 C  C     . TYR A 1 454 ? 11.281  66.718 1.972   1.00 38.23  ? 454  TYR A C     1 
ATOM   3737 O  O     . TYR A 1 454 ? 10.347  66.599 1.179   1.00 36.92  ? 454  TYR A O     1 
ATOM   3738 C  CB    . TYR A 1 454 ? 12.009  68.929 2.905   1.00 37.52  ? 454  TYR A CB    1 
ATOM   3739 C  CG    . TYR A 1 454 ? 12.939  70.121 2.828   1.00 40.72  ? 454  TYR A CG    1 
ATOM   3740 C  CD1   . TYR A 1 454 ? 14.266  70.017 3.224   1.00 41.34  ? 454  TYR A CD1   1 
ATOM   3741 C  CD2   . TYR A 1 454 ? 12.489  71.348 2.359   1.00 41.66  ? 454  TYR A CD2   1 
ATOM   3742 C  CE1   . TYR A 1 454 ? 15.120  71.103 3.154   1.00 44.66  ? 454  TYR A CE1   1 
ATOM   3743 C  CE2   . TYR A 1 454 ? 13.334  72.440 2.286   1.00 44.86  ? 454  TYR A CE2   1 
ATOM   3744 C  CZ    . TYR A 1 454 ? 14.648  72.311 2.684   1.00 45.69  ? 454  TYR A CZ    1 
ATOM   3745 O  OH    . TYR A 1 454 ? 15.493  73.393 2.614   1.00 49.31  ? 454  TYR A OH    1 
ATOM   3746 N  N     . SER A 1 455 ? 11.489  65.878 2.984   1.00 36.91  ? 455  SER A N     1 
ATOM   3747 C  CA    . SER A 1 455 ? 10.585  64.770 3.284   1.00 34.05  ? 455  SER A CA    1 
ATOM   3748 C  C     . SER A 1 455 ? 9.452   65.256 4.184   1.00 35.72  ? 455  SER A C     1 
ATOM   3749 O  O     . SER A 1 455 ? 9.700   65.883 5.213   1.00 37.05  ? 455  SER A O     1 
ATOM   3750 C  CB    . SER A 1 455 ? 11.356  63.630 3.955   1.00 34.59  ? 455  SER A CB    1 
ATOM   3751 O  OG    . SER A 1 455 ? 10.481  62.629 4.441   1.00 35.72  ? 455  SER A OG    1 
ATOM   3752 N  N     . CYS A 1 456 ? 8.212   64.960 3.802   1.00 31.47  ? 456  CYS A N     1 
ATOM   3753 C  CA    . CYS A 1 456 ? 7.061   65.602 4.434   1.00 33.22  ? 456  CYS A CA    1 
ATOM   3754 C  C     . CYS A 1 456 ? 6.035   64.674 5.079   1.00 35.68  ? 456  CYS A C     1 
ATOM   3755 O  O     . CYS A 1 456 ? 5.940   63.491 4.756   1.00 34.38  ? 456  CYS A O     1 
ATOM   3756 C  CB    . CYS A 1 456 ? 6.345   66.504 3.425   1.00 33.85  ? 456  CYS A CB    1 
ATOM   3757 S  SG    . CYS A 1 456 ? 7.411   67.724 2.630   1.00 40.95  ? 456  CYS A SG    1 
ATOM   3758 N  N     . SER A 1 457 ? 5.263   65.249 5.995   1.00 37.91  ? 457  SER A N     1 
ATOM   3759 C  CA    . SER A 1 457 ? 4.095   64.602 6.573   1.00 35.51  ? 457  SER A CA    1 
ATOM   3760 C  C     . SER A 1 457 ? 2.900   65.526 6.353   1.00 36.20  ? 457  SER A C     1 
ATOM   3761 O  O     . SER A 1 457 ? 3.047   66.748 6.406   1.00 35.87  ? 457  SER A O     1 
ATOM   3762 C  CB    . SER A 1 457 ? 4.304   64.354 8.068   1.00 33.23  ? 457  SER A CB    1 
ATOM   3763 O  OG    . SER A 1 457 ? 3.099   63.944 8.693   1.00 34.40  ? 457  SER A OG    1 
ATOM   3764 N  N     . PRO A 1 458 ? 1.711   64.951 6.107   1.00 35.19  ? 458  PRO A N     1 
ATOM   3765 C  CA    . PRO A 1 458 ? 0.504   65.742 5.825   1.00 31.53  ? 458  PRO A CA    1 
ATOM   3766 C  C     . PRO A 1 458 ? 0.038   66.653 6.969   1.00 34.41  ? 458  PRO A C     1 
ATOM   3767 O  O     . PRO A 1 458 ? -0.964  67.351 6.805   1.00 36.56  ? 458  PRO A O     1 
ATOM   3768 C  CB    . PRO A 1 458 ? -0.554  64.675 5.523   1.00 33.92  ? 458  PRO A CB    1 
ATOM   3769 C  CG    . PRO A 1 458 ? -0.031  63.420 6.141   1.00 34.51  ? 458  PRO A CG    1 
ATOM   3770 C  CD    . PRO A 1 458 ? 1.456   63.505 6.000   1.00 35.56  ? 458  PRO A CD    1 
ATOM   3771 N  N     . ASN A 1 459 ? 0.739   66.653 8.099   1.00 33.27  ? 459  ASN A N     1 
ATOM   3772 C  CA    . ASN A 1 459 ? 0.436   67.599 9.169   1.00 32.98  ? 459  ASN A CA    1 
ATOM   3773 C  C     . ASN A 1 459 ? 1.097   68.955 8.921   1.00 34.78  ? 459  ASN A C     1 
ATOM   3774 O  O     . ASN A 1 459 ? 0.827   69.928 9.626   1.00 35.71  ? 459  ASN A O     1 
ATOM   3775 C  CB    . ASN A 1 459 ? 0.850   67.049 10.536  1.00 30.96  ? 459  ASN A CB    1 
ATOM   3776 C  CG    . ASN A 1 459 ? 2.335   67.208 10.808  1.00 29.14  ? 459  ASN A CG    1 
ATOM   3777 O  OD1   . ASN A 1 459 ? 3.168   67.004 9.927   1.00 29.73  ? 459  ASN A OD1   1 
ATOM   3778 N  ND2   . ASN A 1 459 ? 2.673   67.575 12.040  1.00 29.95  ? 459  ASN A ND2   1 
ATOM   3779 N  N     . GLY A 1 460 ? 1.970   69.005 7.918   1.00 35.95  ? 460  GLY A N     1 
ATOM   3780 C  CA    . GLY A 1 460 ? 2.601   70.249 7.509   1.00 34.83  ? 460  GLY A CA    1 
ATOM   3781 C  C     . GLY A 1 460 ? 4.093   70.326 7.766   1.00 36.84  ? 460  GLY A C     1 
ATOM   3782 O  O     . GLY A 1 460 ? 4.724   71.336 7.467   1.00 36.76  ? 460  GLY A O     1 
ATOM   3783 N  N     . MET A 1 461 ? 4.664   69.259 8.314   1.00 31.78  ? 461  MET A N     1 
ATOM   3784 C  CA    . MET A 1 461 ? 6.077   69.258 8.675   1.00 32.51  ? 461  MET A CA    1 
ATOM   3785 C  C     . MET A 1 461 ? 6.984   68.788 7.537   1.00 34.49  ? 461  MET A C     1 
ATOM   3786 O  O     . MET A 1 461 ? 6.645   67.866 6.794   1.00 31.03  ? 461  MET A O     1 
ATOM   3787 C  CB    . MET A 1 461 ? 6.304   68.406 9.925   1.00 29.13  ? 461  MET A CB    1 
ATOM   3788 C  CG    . MET A 1 461 ? 5.693   68.995 11.182  1.00 30.05  ? 461  MET A CG    1 
ATOM   3789 S  SD    . MET A 1 461 ? 6.486   70.546 11.648  1.00 36.51  ? 461  MET A SD    1 
ATOM   3790 C  CE    . MET A 1 461 ? 8.135   69.963 12.030  1.00 32.86  ? 461  MET A CE    1 
ATOM   3791 N  N     . MET A 1 462 ? 8.133   69.442 7.405   1.00 35.33  ? 462  MET A N     1 
ATOM   3792 C  CA    . MET A 1 462 ? 9.139   69.045 6.429   1.00 35.66  ? 462  MET A CA    1 
ATOM   3793 C  C     . MET A 1 462 ? 10.426  68.665 7.147   1.00 37.79  ? 462  MET A C     1 
ATOM   3794 O  O     . MET A 1 462 ? 10.809  69.297 8.132   1.00 38.31  ? 462  MET A O     1 
ATOM   3795 C  CB    . MET A 1 462 ? 9.412   70.175 5.436   1.00 37.44  ? 462  MET A CB    1 
ATOM   3796 C  CG    . MET A 1 462 ? 8.176   70.685 4.715   1.00 33.96  ? 462  MET A CG    1 
ATOM   3797 S  SD    . MET A 1 462 ? 8.576   71.657 3.250   1.00 39.08  ? 462  MET A SD    1 
ATOM   3798 C  CE    . MET A 1 462 ? 9.639   72.919 3.951   1.00 37.59  ? 462  MET A CE    1 
ATOM   3799 N  N     . TYR A 1 463 ? 11.091  67.630 6.649   1.00 31.48  ? 463  TYR A N     1 
ATOM   3800 C  CA    . TYR A 1 463 ? 12.322  67.149 7.259   1.00 31.38  ? 463  TYR A CA    1 
ATOM   3801 C  C     . TYR A 1 463 ? 13.418  66.987 6.213   1.00 37.67  ? 463  TYR A C     1 
ATOM   3802 O  O     . TYR A 1 463 ? 13.134  66.730 5.041   1.00 37.45  ? 463  TYR A O     1 
ATOM   3803 C  CB    . TYR A 1 463 ? 12.076  65.821 7.983   1.00 30.09  ? 463  TYR A CB    1 
ATOM   3804 C  CG    . TYR A 1 463 ? 11.013  65.900 9.056   1.00 33.07  ? 463  TYR A CG    1 
ATOM   3805 C  CD1   . TYR A 1 463 ? 9.668   65.736 8.743   1.00 33.20  ? 463  TYR A CD1   1 
ATOM   3806 C  CD2   . TYR A 1 463 ? 11.353  66.137 10.382  1.00 29.24  ? 463  TYR A CD2   1 
ATOM   3807 C  CE1   . TYR A 1 463 ? 8.693   65.808 9.721   1.00 29.89  ? 463  TYR A CE1   1 
ATOM   3808 C  CE2   . TYR A 1 463 ? 10.386  66.211 11.366  1.00 27.82  ? 463  TYR A CE2   1 
ATOM   3809 C  CZ    . TYR A 1 463 ? 9.057   66.046 11.030  1.00 31.70  ? 463  TYR A CZ    1 
ATOM   3810 O  OH    . TYR A 1 463 ? 8.091   66.119 12.008  1.00 28.17  ? 463  TYR A OH    1 
ATOM   3811 N  N     . TYR A 1 464 ? 14.668  67.148 6.638   1.00 39.09  ? 464  TYR A N     1 
ATOM   3812 C  CA    . TYR A 1 464 ? 15.801  66.969 5.737   1.00 42.35  ? 464  TYR A CA    1 
ATOM   3813 C  C     . TYR A 1 464 ? 15.889  65.506 5.316   1.00 43.71  ? 464  TYR A C     1 
ATOM   3814 O  O     . TYR A 1 464 ? 15.641  64.612 6.122   1.00 40.02  ? 464  TYR A O     1 
ATOM   3815 C  CB    . TYR A 1 464 ? 17.104  67.415 6.405   1.00 43.44  ? 464  TYR A CB    1 
ATOM   3816 C  CG    . TYR A 1 464 ? 17.191  68.904 6.666   1.00 47.54  ? 464  TYR A CG    1 
ATOM   3817 C  CD1   . TYR A 1 464 ? 17.055  69.415 7.951   1.00 48.11  ? 464  TYR A CD1   1 
ATOM   3818 C  CD2   . TYR A 1 464 ? 17.407  69.799 5.626   1.00 50.81  ? 464  TYR A CD2   1 
ATOM   3819 C  CE1   . TYR A 1 464 ? 17.135  70.776 8.193   1.00 48.46  ? 464  TYR A CE1   1 
ATOM   3820 C  CE2   . TYR A 1 464 ? 17.487  71.162 5.857   1.00 51.90  ? 464  TYR A CE2   1 
ATOM   3821 C  CZ    . TYR A 1 464 ? 17.350  71.644 7.142   1.00 52.91  ? 464  TYR A CZ    1 
ATOM   3822 O  OH    . TYR A 1 464 ? 17.432  72.998 7.375   1.00 57.40  ? 464  TYR A OH    1 
ATOM   3823 N  N     . LYS A 1 465 ? 16.233  65.270 4.053   1.00 48.04  ? 465  LYS A N     1 
ATOM   3824 C  CA    . LYS A 1 465 ? 16.290  63.916 3.507   1.00 50.61  ? 465  LYS A CA    1 
ATOM   3825 C  C     . LYS A 1 465 ? 17.689  63.314 3.567   1.00 55.91  ? 465  LYS A C     1 
ATOM   3826 O  O     . LYS A 1 465 ? 17.847  62.098 3.641   1.00 62.45  ? 465  LYS A O     1 
ATOM   3827 C  CB    . LYS A 1 465 ? 15.809  63.905 2.057   1.00 50.94  ? 465  LYS A CB    1 
ATOM   3828 C  CG    . LYS A 1 465 ? 14.341  64.220 1.875   1.00 52.81  ? 465  LYS A CG    1 
ATOM   3829 C  CD    . LYS A 1 465 ? 13.945  64.091 0.414   1.00 53.06  ? 465  LYS A CD    1 
ATOM   3830 C  CE    . LYS A 1 465 ? 14.247  62.698 -0.113  1.00 47.81  ? 465  LYS A CE    1 
ATOM   3831 N  NZ    . LYS A 1 465 ? 13.871  62.554 -1.544  1.00 48.05  ? 465  LYS A NZ    1 
ATOM   3832 N  N     . ASP A 1 466 ? 18.701  64.171 3.522   1.00 54.27  ? 466  ASP A N     1 
ATOM   3833 C  CA    . ASP A 1 466 ? 20.086  63.722 3.473   1.00 59.07  ? 466  ASP A CA    1 
ATOM   3834 C  C     . ASP A 1 466 ? 20.606  63.324 4.849   1.00 63.49  ? 466  ASP A C     1 
ATOM   3835 O  O     . ASP A 1 466 ? 21.293  62.314 4.998   1.00 66.07  ? 466  ASP A O     1 
ATOM   3836 C  CB    . ASP A 1 466 ? 20.967  64.829 2.895   1.00 61.26  ? 466  ASP A CB    1 
ATOM   3837 C  CG    . ASP A 1 466 ? 20.161  66.033 2.437   1.00 59.30  ? 466  ASP A CG    1 
ATOM   3838 O  OD1   . ASP A 1 466 ? 20.089  66.270 1.210   1.00 59.89  ? 466  ASP A OD1   1 
ATOM   3839 O  OD2   . ASP A 1 466 ? 19.591  66.734 3.304   1.00 50.53  ? 466  ASP A OD2   1 
ATOM   3840 N  N     . ARG A 1 467 ? 20.270  64.127 5.851   1.00 65.93  ? 467  ARG A N     1 
ATOM   3841 C  CA    . ARG A 1 467 ? 20.817  63.968 7.192   1.00 67.10  ? 467  ARG A CA    1 
ATOM   3842 C  C     . ARG A 1 467 ? 20.214  62.783 7.939   1.00 64.09  ? 467  ARG A C     1 
ATOM   3843 O  O     . ARG A 1 467 ? 19.014  62.525 7.851   1.00 59.55  ? 467  ARG A O     1 
ATOM   3844 C  CB    . ARG A 1 467 ? 20.596  65.252 7.992   1.00 68.55  ? 467  ARG A CB    1 
ATOM   3845 C  CG    . ARG A 1 467 ? 20.829  66.512 7.177   1.00 72.14  ? 467  ARG A CG    1 
ATOM   3846 C  CD    . ARG A 1 467 ? 20.619  67.767 8.001   1.00 72.56  ? 467  ARG A CD    1 
ATOM   3847 N  NE    . ARG A 1 467 ? 20.887  68.970 7.220   1.00 75.44  ? 467  ARG A NE    1 
ATOM   3848 C  CZ    . ARG A 1 467 ? 20.949  70.194 7.731   1.00 77.59  ? 467  ARG A CZ    1 
ATOM   3849 N  NH1   . ARG A 1 467 ? 20.765  70.381 9.031   1.00 76.39  ? 467  ARG A NH1   1 
ATOM   3850 N  NH2   . ARG A 1 467 ? 21.199  71.232 6.944   1.00 81.25  ? 467  ARG A NH2   1 
ATOM   3851 N  N     . ASP A 1 468 ? 21.057  62.065 8.674   1.00 66.76  ? 468  ASP A N     1 
ATOM   3852 C  CA    . ASP A 1 468 ? 20.586  60.996 9.543   1.00 66.76  ? 468  ASP A CA    1 
ATOM   3853 C  C     . ASP A 1 468 ? 20.170  61.597 10.880  1.00 61.55  ? 468  ASP A C     1 
ATOM   3854 O  O     . ASP A 1 468 ? 20.950  62.302 11.518  1.00 69.67  ? 468  ASP A O     1 
ATOM   3855 C  CB    . ASP A 1 468 ? 21.682  59.951 9.767   1.00 71.89  ? 468  ASP A CB    1 
ATOM   3856 C  CG    . ASP A 1 468 ? 22.333  59.497 8.473   1.00 77.59  ? 468  ASP A CG    1 
ATOM   3857 O  OD1   . ASP A 1 468 ? 21.685  58.755 7.705   1.00 80.05  ? 468  ASP A OD1   1 
ATOM   3858 O  OD2   . ASP A 1 468 ? 23.500  59.874 8.231   1.00 78.95  ? 468  ASP A OD2   1 
ATOM   3859 N  N     . GLY A 1 469 ? 18.937  61.330 11.296  1.00 50.14  ? 469  GLY A N     1 
ATOM   3860 C  CA    . GLY A 1 469 ? 18.454  61.802 12.581  1.00 43.02  ? 469  GLY A CA    1 
ATOM   3861 C  C     . GLY A 1 469 ? 18.728  60.793 13.677  1.00 40.26  ? 469  GLY A C     1 
ATOM   3862 O  O     . GLY A 1 469 ? 18.662  59.586 13.444  1.00 37.00  ? 469  GLY A O     1 
ATOM   3863 N  N     . VAL A 1 470 ? 19.034  61.282 14.875  1.00 38.59  ? 470  VAL A N     1 
ATOM   3864 C  CA    . VAL A 1 470 ? 19.367  60.402 15.992  1.00 36.89  ? 470  VAL A CA    1 
ATOM   3865 C  C     . VAL A 1 470 ? 18.185  59.514 16.405  1.00 34.11  ? 470  VAL A C     1 
ATOM   3866 O  O     . VAL A 1 470 ? 18.375  58.370 16.819  1.00 36.50  ? 470  VAL A O     1 
ATOM   3867 C  CB    . VAL A 1 470 ? 19.916  61.196 17.206  1.00 36.65  ? 470  VAL A CB    1 
ATOM   3868 C  CG1   . VAL A 1 470 ? 18.840  62.101 17.798  1.00 32.26  ? 470  VAL A CG1   1 
ATOM   3869 C  CG2   . VAL A 1 470 ? 20.470  60.248 18.259  1.00 36.25  ? 470  VAL A CG2   1 
ATOM   3870 N  N     . VAL A 1 471 ? 16.966  60.030 16.278  1.00 30.41  ? 471  VAL A N     1 
ATOM   3871 C  CA    . VAL A 1 471 ? 15.781  59.229 16.587  1.00 32.82  ? 471  VAL A CA    1 
ATOM   3872 C  C     . VAL A 1 471 ? 15.554  58.082 15.582  1.00 33.28  ? 471  VAL A C     1 
ATOM   3873 O  O     . VAL A 1 471 ? 15.368  56.940 15.995  1.00 31.28  ? 471  VAL A O     1 
ATOM   3874 C  CB    . VAL A 1 471 ? 14.505  60.096 16.786  1.00 26.10  ? 471  VAL A CB    1 
ATOM   3875 C  CG1   . VAL A 1 471 ? 13.261  59.225 16.799  1.00 25.10  ? 471  VAL A CG1   1 
ATOM   3876 C  CG2   . VAL A 1 471 ? 14.611  60.902 18.071  1.00 32.01  ? 471  VAL A CG2   1 
ATOM   3877 N  N     . PRO A 1 472 ? 15.577  58.372 14.264  1.00 32.91  ? 472  PRO A N     1 
ATOM   3878 C  CA    . PRO A 1 472 ? 15.504  57.247 13.320  1.00 32.14  ? 472  PRO A CA    1 
ATOM   3879 C  C     . PRO A 1 472 ? 16.690  56.288 13.438  1.00 35.33  ? 472  PRO A C     1 
ATOM   3880 O  O     . PRO A 1 472 ? 16.519  55.081 13.269  1.00 38.28  ? 472  PRO A O     1 
ATOM   3881 C  CB    . PRO A 1 472 ? 15.535  57.939 11.955  1.00 29.70  ? 472  PRO A CB    1 
ATOM   3882 C  CG    . PRO A 1 472 ? 14.962  59.281 12.205  1.00 31.31  ? 472  PRO A CG    1 
ATOM   3883 C  CD    . PRO A 1 472 ? 15.451  59.668 13.570  1.00 32.57  ? 472  PRO A CD    1 
ATOM   3884 N  N     . THR A 1 473 ? 17.874  56.823 13.720  1.00 31.51  ? 473  THR A N     1 
ATOM   3885 C  CA    . THR A 1 473 ? 19.083  56.010 13.817  1.00 35.82  ? 473  THR A CA    1 
ATOM   3886 C  C     . THR A 1 473 ? 18.999  54.988 14.947  1.00 34.61  ? 473  THR A C     1 
ATOM   3887 O  O     . THR A 1 473 ? 19.333  53.817 14.765  1.00 38.58  ? 473  THR A O     1 
ATOM   3888 C  CB    . THR A 1 473 ? 20.338  56.885 14.020  1.00 33.78  ? 473  THR A CB    1 
ATOM   3889 O  OG1   . THR A 1 473 ? 20.540  57.708 12.865  1.00 39.43  ? 473  THR A OG1   1 
ATOM   3890 C  CG2   . THR A 1 473 ? 21.573  56.019 14.236  1.00 32.93  ? 473  THR A CG2   1 
ATOM   3891 N  N     . GLU A 1 474 ? 18.540  55.435 16.110  1.00 29.57  ? 474  GLU A N     1 
ATOM   3892 C  CA    . GLU A 1 474 ? 18.507  54.583 17.292  1.00 33.21  ? 474  GLU A CA    1 
ATOM   3893 C  C     . GLU A 1 474 ? 17.280  53.682 17.326  1.00 34.12  ? 474  GLU A C     1 
ATOM   3894 O  O     . GLU A 1 474 ? 17.327  52.581 17.872  1.00 30.87  ? 474  GLU A O     1 
ATOM   3895 C  CB    . GLU A 1 474 ? 18.593  55.427 18.566  1.00 31.65  ? 474  GLU A CB    1 
ATOM   3896 C  CG    . GLU A 1 474 ? 19.921  56.149 18.715  1.00 33.29  ? 474  GLU A CG    1 
ATOM   3897 C  CD    . GLU A 1 474 ? 21.101  55.198 18.658  1.00 33.08  ? 474  GLU A CD    1 
ATOM   3898 O  OE1   . GLU A 1 474 ? 22.111  55.538 18.008  1.00 36.31  ? 474  GLU A OE1   1 
ATOM   3899 O  OE2   . GLU A 1 474 ? 21.020  54.109 19.266  1.00 35.97  ? 474  GLU A OE2   1 
ATOM   3900 N  N     . ILE A 1 475 ? 16.181  54.147 16.742  1.00 37.93  ? 475  ILE A N     1 
ATOM   3901 C  CA    . ILE A 1 475 ? 14.971  53.337 16.694  1.00 37.42  ? 475  ILE A CA    1 
ATOM   3902 C  C     . ILE A 1 475 ? 15.162  52.176 15.717  1.00 34.54  ? 475  ILE A C     1 
ATOM   3903 O  O     . ILE A 1 475 ? 14.607  51.098 15.910  1.00 32.26  ? 475  ILE A O     1 
ATOM   3904 C  CB    . ILE A 1 475 ? 13.717  54.181 16.344  1.00 31.78  ? 475  ILE A CB    1 
ATOM   3905 C  CG1   . ILE A 1 475 ? 12.455  53.556 16.943  1.00 33.44  ? 475  ILE A CG1   1 
ATOM   3906 C  CG2   . ILE A 1 475 ? 13.583  54.384 14.842  1.00 31.53  ? 475  ILE A CG2   1 
ATOM   3907 C  CD1   . ILE A 1 475 ? 11.201  54.394 16.750  1.00 33.72  ? 475  ILE A CD1   1 
ATOM   3908 N  N     . THR A 1 476 ? 15.979  52.396 14.690  1.00 31.61  ? 476  THR A N     1 
ATOM   3909 C  CA    . THR A 1 476 ? 16.265  51.368 13.695  1.00 33.56  ? 476  THR A CA    1 
ATOM   3910 C  C     . THR A 1 476 ? 17.067  50.218 14.304  1.00 36.72  ? 476  THR A C     1 
ATOM   3911 O  O     . THR A 1 476 ? 16.839  49.049 13.981  1.00 36.69  ? 476  THR A O     1 
ATOM   3912 C  CB    . THR A 1 476 ? 17.029  51.955 12.488  1.00 33.66  ? 476  THR A CB    1 
ATOM   3913 O  OG1   . THR A 1 476 ? 16.229  52.963 11.859  1.00 36.94  ? 476  THR A OG1   1 
ATOM   3914 C  CG2   . THR A 1 476 ? 17.349  50.873 11.469  1.00 34.96  ? 476  THR A CG2   1 
ATOM   3915 N  N     . LYS A 1 477 ? 18.002  50.554 15.188  1.00 34.10  ? 477  LYS A N     1 
ATOM   3916 C  CA    . LYS A 1 477 ? 18.835  49.547 15.839  1.00 34.76  ? 477  LYS A CA    1 
ATOM   3917 C  C     . LYS A 1 477 ? 18.001  48.599 16.694  1.00 35.75  ? 477  LYS A C     1 
ATOM   3918 O  O     . LYS A 1 477 ? 18.136  47.379 16.592  1.00 37.47  ? 477  LYS A O     1 
ATOM   3919 C  CB    . LYS A 1 477 ? 19.926  50.205 16.687  1.00 36.68  ? 477  LYS A CB    1 
ATOM   3920 C  CG    . LYS A 1 477 ? 20.975  50.950 15.876  1.00 39.86  ? 477  LYS A CG    1 
ATOM   3921 C  CD    . LYS A 1 477 ? 21.960  51.675 16.779  1.00 44.00  ? 477  LYS A CD    1 
ATOM   3922 C  CE    . LYS A 1 477 ? 22.910  52.543 15.970  1.00 50.18  ? 477  LYS A CE    1 
ATOM   3923 N  NZ    . LYS A 1 477 ? 23.832  53.332 16.835  1.00 54.23  ? 477  LYS A NZ    1 
ATOM   3924 N  N     . VAL A 1 478 ? 17.137  49.161 17.532  1.00 33.24  ? 478  VAL A N     1 
ATOM   3925 C  CA    . VAL A 1 478 ? 16.276  48.347 18.381  1.00 34.95  ? 478  VAL A CA    1 
ATOM   3926 C  C     . VAL A 1 478 ? 15.250  47.589 17.538  1.00 35.58  ? 478  VAL A C     1 
ATOM   3927 O  O     . VAL A 1 478 ? 14.937  46.433 17.826  1.00 36.28  ? 478  VAL A O     1 
ATOM   3928 C  CB    . VAL A 1 478 ? 15.570  49.185 19.462  1.00 34.42  ? 478  VAL A CB    1 
ATOM   3929 C  CG1   . VAL A 1 478 ? 14.702  48.297 20.344  1.00 35.53  ? 478  VAL A CG1   1 
ATOM   3930 C  CG2   . VAL A 1 478 ? 16.593  49.924 20.306  1.00 37.82  ? 478  VAL A CG2   1 
ATOM   3931 N  N     . PHE A 1 479 ? 14.743  48.233 16.488  1.00 29.20  ? 479  PHE A N     1 
ATOM   3932 C  CA    . PHE A 1 479 ? 13.816  47.572 15.575  1.00 29.75  ? 479  PHE A CA    1 
ATOM   3933 C  C     . PHE A 1 479 ? 14.429  46.322 14.954  1.00 32.70  ? 479  PHE A C     1 
ATOM   3934 O  O     . PHE A 1 479 ? 13.745  45.318 14.761  1.00 39.41  ? 479  PHE A O     1 
ATOM   3935 C  CB    . PHE A 1 479 ? 13.353  48.510 14.461  1.00 31.41  ? 479  PHE A CB    1 
ATOM   3936 C  CG    . PHE A 1 479 ? 12.699  47.792 13.309  1.00 35.82  ? 479  PHE A CG    1 
ATOM   3937 C  CD1   . PHE A 1 479 ? 11.408  47.301 13.426  1.00 37.55  ? 479  PHE A CD1   1 
ATOM   3938 C  CD2   . PHE A 1 479 ? 13.378  47.597 12.116  1.00 38.15  ? 479  PHE A CD2   1 
ATOM   3939 C  CE1   . PHE A 1 479 ? 10.806  46.636 12.374  1.00 41.50  ? 479  PHE A CE1   1 
ATOM   3940 C  CE2   . PHE A 1 479 ? 12.780  46.933 11.060  1.00 40.59  ? 479  PHE A CE2   1 
ATOM   3941 C  CZ    . PHE A 1 479 ? 11.492  46.453 11.189  1.00 41.64  ? 479  PHE A CZ    1 
ATOM   3942 N  N     . ASN A 1 480 ? 15.717  46.391 14.634  1.00 32.65  ? 480  ASN A N     1 
ATOM   3943 C  CA    . ASN A 1 480 ? 16.408  45.257 14.032  1.00 37.58  ? 480  ASN A CA    1 
ATOM   3944 C  C     . ASN A 1 480 ? 16.550  44.083 14.999  1.00 39.26  ? 480  ASN A C     1 
ATOM   3945 O  O     . ASN A 1 480 ? 16.476  42.923 14.591  1.00 38.24  ? 480  ASN A O     1 
ATOM   3946 C  CB    . ASN A 1 480 ? 17.769  45.676 13.473  1.00 39.71  ? 480  ASN A CB    1 
ATOM   3947 C  CG    . ASN A 1 480 ? 17.653  46.422 12.156  1.00 42.88  ? 480  ASN A CG    1 
ATOM   3948 O  OD1   . ASN A 1 480 ? 16.696  46.232 11.405  1.00 45.73  ? 480  ASN A OD1   1 
ATOM   3949 N  ND2   . ASN A 1 480 ? 18.633  47.271 11.864  1.00 40.29  ? 480  ASN A ND2   1 
ATOM   3950 N  N     . GLN A 1 481 ? 16.750  44.388 16.279  1.00 38.39  ? 481  GLN A N     1 
ATOM   3951 C  CA    . GLN A 1 481 ? 16.777  43.358 17.312  1.00 40.13  ? 481  GLN A CA    1 
ATOM   3952 C  C     . GLN A 1 481 ? 15.412  42.695 17.401  1.00 39.60  ? 481  GLN A C     1 
ATOM   3953 O  O     . GLN A 1 481 ? 15.309  41.473 17.493  1.00 41.85  ? 481  GLN A O     1 
ATOM   3954 C  CB    . GLN A 1 481 ? 17.131  43.957 18.673  1.00 39.54  ? 481  GLN A CB    1 
ATOM   3955 C  CG    . GLN A 1 481 ? 18.526  44.537 18.776  1.00 44.62  ? 481  GLN A CG    1 
ATOM   3956 C  CD    . GLN A 1 481 ? 18.764  45.216 20.112  1.00 52.51  ? 481  GLN A CD    1 
ATOM   3957 O  OE1   . GLN A 1 481 ? 18.075  44.939 21.097  1.00 50.66  ? 481  GLN A OE1   1 
ATOM   3958 N  NE2   . GLN A 1 481 ? 19.736  46.119 20.150  1.00 55.92  ? 481  GLN A NE2   1 
ATOM   3959 N  N     . ARG A 1 482 ? 14.369  43.522 17.373  1.00 39.04  ? 482  ARG A N     1 
ATOM   3960 C  CA    . ARG A 1 482 ? 12.990  43.054 17.442  1.00 39.80  ? 482  ARG A CA    1 
ATOM   3961 C  C     . ARG A 1 482 ? 12.684  42.072 16.319  1.00 41.34  ? 482  ARG A C     1 
ATOM   3962 O  O     . ARG A 1 482 ? 12.126  40.999 16.556  1.00 40.17  ? 482  ARG A O     1 
ATOM   3963 C  CB    . ARG A 1 482 ? 12.029  44.247 17.374  1.00 37.79  ? 482  ARG A CB    1 
ATOM   3964 C  CG    . ARG A 1 482 ? 10.562  43.897 17.592  1.00 36.59  ? 482  ARG A CG    1 
ATOM   3965 C  CD    . ARG A 1 482 ? 9.816   43.682 16.282  1.00 36.91  ? 482  ARG A CD    1 
ATOM   3966 N  NE    . ARG A 1 482 ? 8.492   43.108 16.507  1.00 39.34  ? 482  ARG A NE    1 
ATOM   3967 C  CZ    . ARG A 1 482 ? 7.397   43.468 15.845  1.00 36.92  ? 482  ARG A CZ    1 
ATOM   3968 N  NH1   . ARG A 1 482 ? 7.461   44.406 14.908  1.00 37.38  ? 482  ARG A NH1   1 
ATOM   3969 N  NH2   . ARG A 1 482 ? 6.237   42.887 16.119  1.00 31.56  ? 482  ARG A NH2   1 
ATOM   3970 N  N     . LYS A 1 483 ? 13.057  42.451 15.100  1.00 38.68  ? 483  LYS A N     1 
ATOM   3971 C  CA    . LYS A 1 483 ? 12.778  41.655 13.910  1.00 41.17  ? 483  LYS A CA    1 
ATOM   3972 C  C     . LYS A 1 483 ? 13.425  40.273 13.976  1.00 42.75  ? 483  LYS A C     1 
ATOM   3973 O  O     . LYS A 1 483 ? 12.865  39.289 13.493  1.00 44.68  ? 483  LYS A O     1 
ATOM   3974 C  CB    . LYS A 1 483 ? 13.251  42.400 12.658  1.00 44.15  ? 483  LYS A CB    1 
ATOM   3975 C  CG    . LYS A 1 483 ? 13.003  41.660 11.356  1.00 47.71  ? 483  LYS A CG    1 
ATOM   3976 C  CD    . LYS A 1 483 ? 13.528  42.451 10.165  1.00 53.34  ? 483  LYS A CD    1 
ATOM   3977 N  N     . GLU A 1 484 ? 14.609  40.208 14.574  1.00 43.97  ? 484  GLU A N     1 
ATOM   3978 C  CA    . GLU A 1 484 ? 15.325  38.947 14.722  1.00 45.19  ? 484  GLU A CA    1 
ATOM   3979 C  C     . GLU A 1 484 ? 14.591  37.991 15.662  1.00 45.87  ? 484  GLU A C     1 
ATOM   3980 O  O     . GLU A 1 484 ? 14.423  36.810 15.355  1.00 46.32  ? 484  GLU A O     1 
ATOM   3981 C  CB    . GLU A 1 484 ? 16.746  39.204 15.231  1.00 48.62  ? 484  GLU A CB    1 
ATOM   3982 C  CG    . GLU A 1 484 ? 17.470  37.960 15.716  1.00 56.47  ? 484  GLU A CG    1 
ATOM   3983 C  CD    . GLU A 1 484 ? 18.910  38.238 16.097  1.00 63.56  ? 484  GLU A CD    1 
ATOM   3984 O  OE1   . GLU A 1 484 ? 19.368  37.700 17.127  1.00 63.68  ? 484  GLU A OE1   1 
ATOM   3985 O  OE2   . GLU A 1 484 ? 19.586  38.992 15.364  1.00 67.28  ? 484  GLU A OE2   1 
ATOM   3986 N  N     . HIS A 1 485 ? 14.150  38.509 16.806  1.00 42.15  ? 485  HIS A N     1 
ATOM   3987 C  CA    . HIS A 1 485 ? 13.466  37.687 17.799  1.00 40.43  ? 485  HIS A CA    1 
ATOM   3988 C  C     . HIS A 1 485 ? 12.064  37.277 17.354  1.00 39.78  ? 485  HIS A C     1 
ATOM   3989 O  O     . HIS A 1 485 ? 11.570  36.220 17.747  1.00 39.70  ? 485  HIS A O     1 
ATOM   3990 C  CB    . HIS A 1 485 ? 13.413  38.399 19.152  1.00 39.95  ? 485  HIS A CB    1 
ATOM   3991 C  CG    . HIS A 1 485 ? 14.729  38.434 19.868  1.00 42.57  ? 485  HIS A CG    1 
ATOM   3992 N  ND1   . HIS A 1 485 ? 15.267  37.321 20.484  1.00 46.97  ? 485  HIS A ND1   1 
ATOM   3993 C  CD2   . HIS A 1 485 ? 15.608  39.438 20.069  1.00 41.82  ? 485  HIS A CD2   1 
ATOM   3994 C  CE1   . HIS A 1 485 ? 16.422  37.644 21.032  1.00 45.54  ? 485  HIS A CE1   1 
ATOM   3995 N  NE2   . HIS A 1 485 ? 16.657  38.922 20.798  1.00 44.60  ? 485  HIS A NE2   1 
ATOM   3996 N  N     . LYS A 1 486 ? 11.425  38.107 16.536  1.00 37.75  ? 486  LYS A N     1 
ATOM   3997 C  CA    . LYS A 1 486 ? 10.113  37.758 16.005  1.00 37.56  ? 486  LYS A CA    1 
ATOM   3998 C  C     . LYS A 1 486 ? 10.234  36.570 15.058  1.00 39.17  ? 486  LYS A C     1 
ATOM   3999 O  O     . LYS A 1 486 ? 9.354   35.708 15.009  1.00 40.00  ? 486  LYS A O     1 
ATOM   4000 C  CB    . LYS A 1 486 ? 9.462   38.945 15.289  1.00 37.52  ? 486  LYS A CB    1 
ATOM   4001 C  CG    . LYS A 1 486 ? 8.088   38.615 14.719  1.00 40.50  ? 486  LYS A CG    1 
ATOM   4002 C  CD    . LYS A 1 486 ? 7.385   39.831 14.147  1.00 46.19  ? 486  LYS A CD    1 
ATOM   4003 C  CE    . LYS A 1 486 ? 6.011   39.452 13.609  1.00 52.69  ? 486  LYS A CE    1 
ATOM   4004 N  NZ    . LYS A 1 486 ? 5.179   40.638 13.260  1.00 57.38  ? 486  LYS A NZ    1 
ATOM   4005 N  N     . GLY A 1 487 ? 11.334  36.531 14.311  1.00 37.94  ? 487  GLY A N     1 
ATOM   4006 C  CA    . GLY A 1 487 ? 11.610  35.423 13.417  1.00 38.18  ? 487  GLY A CA    1 
ATOM   4007 C  C     . GLY A 1 487 ? 11.707  34.108 14.166  1.00 40.10  ? 487  GLY A C     1 
ATOM   4008 O  O     . GLY A 1 487 ? 11.182  33.090 13.718  1.00 42.06  ? 487  GLY A O     1 
ATOM   4009 N  N     . TYR A 1 488 ? 12.380  34.132 15.313  1.00 42.00  ? 488  TYR A N     1 
ATOM   4010 C  CA    . TYR A 1 488 ? 12.491  32.948 16.159  1.00 42.63  ? 488  TYR A CA    1 
ATOM   4011 C  C     . TYR A 1 488 ? 11.120  32.536 16.687  1.00 41.26  ? 488  TYR A C     1 
ATOM   4012 O  O     . TYR A 1 488 ? 10.797  31.346 16.745  1.00 42.04  ? 488  TYR A O     1 
ATOM   4013 C  CB    . TYR A 1 488 ? 13.431  33.210 17.338  1.00 42.94  ? 488  TYR A CB    1 
ATOM   4014 C  CG    . TYR A 1 488 ? 14.840  33.607 16.954  1.00 46.21  ? 488  TYR A CG    1 
ATOM   4015 C  CD1   . TYR A 1 488 ? 15.419  33.159 15.772  1.00 46.60  ? 488  TYR A CD1   1 
ATOM   4016 C  CD2   . TYR A 1 488 ? 15.593  34.434 17.779  1.00 48.39  ? 488  TYR A CD2   1 
ATOM   4017 C  CE1   . TYR A 1 488 ? 16.710  33.525 15.426  1.00 48.21  ? 488  TYR A CE1   1 
ATOM   4018 C  CE2   . TYR A 1 488 ? 16.880  34.803 17.441  1.00 48.63  ? 488  TYR A CE2   1 
ATOM   4019 C  CZ    . TYR A 1 488 ? 17.434  34.348 16.266  1.00 49.60  ? 488  TYR A CZ    1 
ATOM   4020 O  OH    . TYR A 1 488 ? 18.715  34.719 15.932  1.00 51.92  ? 488  TYR A OH    1 
ATOM   4021 N  N     . MET A 1 489 ? 10.322  33.529 17.075  1.00 35.56  ? 489  MET A N     1 
ATOM   4022 C  CA    . MET A 1 489 ? 8.995   33.290 17.635  1.00 33.48  ? 489  MET A CA    1 
ATOM   4023 C  C     . MET A 1 489 ? 8.074   32.602 16.637  1.00 35.65  ? 489  MET A C     1 
ATOM   4024 O  O     . MET A 1 489 ? 7.450   31.588 16.951  1.00 37.96  ? 489  MET A O     1 
ATOM   4025 C  CB    . MET A 1 489 ? 8.352   34.602 18.086  1.00 31.19  ? 489  MET A CB    1 
ATOM   4026 C  CG    . MET A 1 489 ? 6.951   34.425 18.661  1.00 32.40  ? 489  MET A CG    1 
ATOM   4027 S  SD    . MET A 1 489 ? 6.025   35.962 18.813  1.00 52.67  ? 489  MET A SD    1 
ATOM   4028 C  CE    . MET A 1 489 ? 5.720   36.349 17.089  1.00 37.71  ? 489  MET A CE    1 
ATOM   4029 N  N     . LEU A 1 490 ? 7.988   33.166 15.437  1.00 34.36  ? 490  LEU A N     1 
ATOM   4030 C  CA    . LEU A 1 490 ? 7.101   32.635 14.407  1.00 41.77  ? 490  LEU A CA    1 
ATOM   4031 C  C     . LEU A 1 490 ? 7.529   31.249 13.940  1.00 42.73  ? 490  LEU A C     1 
ATOM   4032 O  O     . LEU A 1 490 ? 6.688   30.393 13.667  1.00 44.09  ? 490  LEU A O     1 
ATOM   4033 C  CB    . LEU A 1 490 ? 7.008   33.598 13.221  1.00 43.22  ? 490  LEU A CB    1 
ATOM   4034 C  CG    . LEU A 1 490 ? 6.197   34.867 13.489  1.00 42.68  ? 490  LEU A CG    1 
ATOM   4035 C  CD1   . LEU A 1 490 ? 6.134   35.749 12.250  1.00 43.00  ? 490  LEU A CD1   1 
ATOM   4036 C  CD2   . LEU A 1 490 ? 4.800   34.504 13.967  1.00 41.96  ? 490  LEU A CD2   1 
ATOM   4037 N  N     . ALA A 1 491 ? 8.838   31.033 13.851  1.00 41.51  ? 491  ALA A N     1 
ATOM   4038 C  CA    . ALA A 1 491 ? 9.374   29.729 13.479  1.00 43.67  ? 491  ALA A CA    1 
ATOM   4039 C  C     . ALA A 1 491 ? 9.007   28.681 14.525  1.00 43.36  ? 491  ALA A C     1 
ATOM   4040 O  O     . ALA A 1 491 ? 8.602   27.570 14.185  1.00 40.50  ? 491  ALA A O     1 
ATOM   4041 C  CB    . ALA A 1 491 ? 10.882  29.803 13.304  1.00 44.90  ? 491  ALA A CB    1 
ATOM   4042 N  N     . ALA A 1 492 ? 9.148   29.047 15.797  1.00 43.20  ? 492  ALA A N     1 
ATOM   4043 C  CA    . ALA A 1 492 ? 8.772   28.167 16.899  1.00 45.23  ? 492  ALA A CA    1 
ATOM   4044 C  C     . ALA A 1 492 ? 7.279   27.880 16.843  1.00 45.09  ? 492  ALA A C     1 
ATOM   4045 O  O     . ALA A 1 492 ? 6.833   26.771 17.140  1.00 40.76  ? 492  ALA A O     1 
ATOM   4046 C  CB    . ALA A 1 492 ? 9.139   28.800 18.233  1.00 40.61  ? 492  ALA A CB    1 
ATOM   4047 N  N     . GLN A 1 493 ? 6.517   28.896 16.452  1.00 42.13  ? 493  GLN A N     1 
ATOM   4048 C  CA    . GLN A 1 493 ? 5.072   28.784 16.313  1.00 40.81  ? 493  GLN A CA    1 
ATOM   4049 C  C     . GLN A 1 493 ? 4.709   27.835 15.173  1.00 41.74  ? 493  GLN A C     1 
ATOM   4050 O  O     . GLN A 1 493 ? 3.823   26.993 15.317  1.00 45.17  ? 493  GLN A O     1 
ATOM   4051 C  CB    . GLN A 1 493 ? 4.471   30.170 16.069  1.00 37.74  ? 493  GLN A CB    1 
ATOM   4052 C  CG    . GLN A 1 493 ? 2.957   30.223 16.048  1.00 38.54  ? 493  GLN A CG    1 
ATOM   4053 C  CD    . GLN A 1 493 ? 2.440   31.644 15.908  1.00 42.49  ? 493  GLN A CD    1 
ATOM   4054 O  OE1   . GLN A 1 493 ? 1.980   32.048 14.840  1.00 43.24  ? 493  GLN A OE1   1 
ATOM   4055 N  NE2   . GLN A 1 493 ? 2.522   32.413 16.989  1.00 42.06  ? 493  GLN A NE2   1 
ATOM   4056 N  N     . ARG A 1 494 ? 5.398   27.975 14.043  1.00 39.20  ? 494  ARG A N     1 
ATOM   4057 C  CA    . ARG A 1 494 ? 5.168   27.104 12.895  1.00 42.29  ? 494  ARG A CA    1 
ATOM   4058 C  C     . ARG A 1 494 ? 5.577   25.671 13.214  1.00 43.39  ? 494  ARG A C     1 
ATOM   4059 O  O     . ARG A 1 494 ? 4.912   24.720 12.803  1.00 46.25  ? 494  ARG A O     1 
ATOM   4060 C  CB    . ARG A 1 494 ? 5.919   27.609 11.658  1.00 43.41  ? 494  ARG A CB    1 
ATOM   4061 C  CG    . ARG A 1 494 ? 5.373   28.910 11.084  1.00 43.78  ? 494  ARG A CG    1 
ATOM   4062 C  CD    . ARG A 1 494 ? 5.998   29.233 9.730   1.00 44.86  ? 494  ARG A CD    1 
ATOM   4063 N  NE    . ARG A 1 494 ? 7.429   29.497 9.834   1.00 43.91  ? 494  ARG A NE    1 
ATOM   4064 C  CZ    . ARG A 1 494 ? 7.953   30.698 10.055  1.00 44.25  ? 494  ARG A CZ    1 
ATOM   4065 N  NH1   . ARG A 1 494 ? 7.164   31.755 10.193  1.00 43.29  ? 494  ARG A NH1   1 
ATOM   4066 N  NH2   . ARG A 1 494 ? 9.268   30.844 10.137  1.00 46.28  ? 494  ARG A NH2   1 
ATOM   4067 N  N     . ASN A 1 495 ? 6.674   25.523 13.950  1.00 43.74  ? 495  ASN A N     1 
ATOM   4068 C  CA    . ASN A 1 495 ? 7.124   24.212 14.397  1.00 49.19  ? 495  ASN A CA    1 
ATOM   4069 C  C     . ASN A 1 495 ? 6.099   23.559 15.314  1.00 47.97  ? 495  ASN A C     1 
ATOM   4070 O  O     . ASN A 1 495 ? 5.911   22.344 15.282  1.00 47.79  ? 495  ASN A O     1 
ATOM   4071 C  CB    . ASN A 1 495 ? 8.472   24.317 15.113  1.00 50.84  ? 495  ASN A CB    1 
ATOM   4072 C  CG    . ASN A 1 495 ? 9.623   24.563 14.159  1.00 51.90  ? 495  ASN A CG    1 
ATOM   4073 O  OD1   . ASN A 1 495 ? 9.578   24.159 12.996  1.00 54.03  ? 495  ASN A OD1   1 
ATOM   4074 N  ND2   . ASN A 1 495 ? 10.666  25.222 14.649  1.00 48.22  ? 495  ASN A ND2   1 
ATOM   4075 N  N     . GLY A 1 496 ? 5.438   24.379 16.127  1.00 46.72  ? 496  GLY A N     1 
ATOM   4076 C  CA    . GLY A 1 496 ? 4.411   23.900 17.033  1.00 44.89  ? 496  GLY A CA    1 
ATOM   4077 C  C     . GLY A 1 496 ? 3.245   23.260 16.302  1.00 48.89  ? 496  GLY A C     1 
ATOM   4078 O  O     . GLY A 1 496 ? 2.736   22.224 16.725  1.00 54.89  ? 496  GLY A O     1 
ATOM   4079 N  N     . GLU A 1 497 ? 2.826   23.877 15.201  1.00 49.60  ? 497  GLU A N     1 
ATOM   4080 C  CA    . GLU A 1 497 ? 1.720   23.357 14.403  1.00 48.19  ? 497  GLU A CA    1 
ATOM   4081 C  C     . GLU A 1 497 ? 2.078   22.032 13.739  1.00 50.82  ? 497  GLU A C     1 
ATOM   4082 O  O     . GLU A 1 497 ? 1.236   21.140 13.629  1.00 52.89  ? 497  GLU A O     1 
ATOM   4083 C  CB    . GLU A 1 497 ? 1.279   24.380 13.353  1.00 47.62  ? 497  GLU A CB    1 
ATOM   4084 C  CG    . GLU A 1 497 ? 0.671   25.642 13.950  1.00 45.67  ? 497  GLU A CG    1 
ATOM   4085 C  CD    . GLU A 1 497 ? -0.450  25.337 14.925  1.00 48.06  ? 497  GLU A CD    1 
ATOM   4086 O  OE1   . GLU A 1 497 ? -1.383  24.595 14.552  1.00 51.94  ? 497  GLU A OE1   1 
ATOM   4087 O  OE2   . GLU A 1 497 ? -0.392  25.826 16.072  1.00 50.36  ? 497  GLU A OE2   1 
ATOM   4088 N  N     . ILE A 1 498 ? 3.328   21.910 13.301  1.00 48.58  ? 498  ILE A N     1 
ATOM   4089 C  CA    . ILE A 1 498 ? 3.821   20.671 12.709  1.00 48.72  ? 498  ILE A CA    1 
ATOM   4090 C  C     . ILE A 1 498 ? 3.699   19.520 13.703  1.00 56.24  ? 498  ILE A C     1 
ATOM   4091 O  O     . ILE A 1 498 ? 3.253   18.427 13.353  1.00 58.51  ? 498  ILE A O     1 
ATOM   4092 C  CB    . ILE A 1 498 ? 5.290   20.810 12.260  1.00 56.23  ? 498  ILE A CB    1 
ATOM   4093 C  CG1   . ILE A 1 498 ? 5.403   21.797 11.096  1.00 56.60  ? 498  ILE A CG1   1 
ATOM   4094 C  CG2   . ILE A 1 498 ? 5.864   19.461 11.862  1.00 57.92  ? 498  ILE A CG2   1 
ATOM   4095 C  CD1   . ILE A 1 498 ? 6.818   21.985 10.586  1.00 48.75  ? 498  ILE A CD1   1 
ATOM   4096 N  N     . ILE A 1 499 ? 4.086   19.781 14.948  1.00 54.76  ? 499  ILE A N     1 
ATOM   4097 C  CA    . ILE A 1 499 ? 4.009   18.780 16.005  1.00 54.90  ? 499  ILE A CA    1 
ATOM   4098 C  C     . ILE A 1 499 ? 2.557   18.446 16.336  1.00 56.89  ? 499  ILE A C     1 
ATOM   4099 O  O     . ILE A 1 499 ? 2.218   17.285 16.568  1.00 62.48  ? 499  ILE A O     1 
ATOM   4100 C  CB    . ILE A 1 499 ? 4.744   19.250 17.277  1.00 54.86  ? 499  ILE A CB    1 
ATOM   4101 C  CG1   . ILE A 1 499 ? 6.198   19.593 16.950  1.00 57.10  ? 499  ILE A CG1   1 
ATOM   4102 C  CG2   . ILE A 1 499 ? 4.678   18.189 18.363  1.00 53.78  ? 499  ILE A CG2   1 
ATOM   4103 C  CD1   . ILE A 1 499 ? 6.982   20.132 18.124  1.00 54.84  ? 499  ILE A CD1   1 
ATOM   4104 N  N     . LYS A 1 500 ? 1.702   19.466 16.345  1.00 55.33  ? 500  LYS A N     1 
ATOM   4105 C  CA    . LYS A 1 500 ? 0.276   19.271 16.593  1.00 53.08  ? 500  LYS A CA    1 
ATOM   4106 C  C     . LYS A 1 500 ? -0.353  18.360 15.544  1.00 58.29  ? 500  LYS A C     1 
ATOM   4107 O  O     . LYS A 1 500 ? -1.230  17.553 15.856  1.00 61.26  ? 500  LYS A O     1 
ATOM   4108 C  CB    . LYS A 1 500 ? -0.458  20.612 16.626  1.00 50.32  ? 500  LYS A CB    1 
ATOM   4109 C  CG    . LYS A 1 500 ? -0.210  21.433 17.879  1.00 45.64  ? 500  LYS A CG    1 
ATOM   4110 C  CD    . LYS A 1 500 ? -0.923  22.775 17.799  1.00 46.69  ? 500  LYS A CD    1 
ATOM   4111 C  CE    . LYS A 1 500 ? -0.676  23.610 19.046  1.00 47.89  ? 500  LYS A CE    1 
ATOM   4112 N  NZ    . LYS A 1 500 ? -1.322  24.951 18.956  1.00 46.82  ? 500  LYS A NZ    1 
ATOM   4113 N  N     . GLU A 1 501 ? 0.094   18.496 14.300  1.00 60.19  ? 501  GLU A N     1 
ATOM   4114 C  CA    . GLU A 1 501 ? -0.384  17.638 13.222  1.00 67.37  ? 501  GLU A CA    1 
ATOM   4115 C  C     . GLU A 1 501 ? 0.039   16.191 13.451  1.00 65.70  ? 501  GLU A C     1 
ATOM   4116 O  O     . GLU A 1 501 ? -0.773  15.275 13.340  1.00 70.15  ? 501  GLU A O     1 
ATOM   4117 C  CB    . GLU A 1 501 ? 0.139   18.125 11.867  1.00 70.96  ? 501  GLU A CB    1 
ATOM   4118 C  CG    . GLU A 1 501 ? -0.412  19.472 11.414  1.00 74.38  ? 501  GLU A CG    1 
ATOM   4119 C  CD    . GLU A 1 501 ? -1.803  19.376 10.808  1.00 79.26  ? 501  GLU A CD    1 
ATOM   4120 O  OE1   . GLU A 1 501 ? -2.488  18.353 11.021  1.00 82.20  ? 501  GLU A OE1   1 
ATOM   4121 O  OE2   . GLU A 1 501 ? -2.212  20.329 10.110  1.00 78.41  ? 501  GLU A OE2   1 
ATOM   4122 N  N     . ALA A 1 502 ? 1.312   15.997 13.784  1.00 61.68  ? 502  ALA A N     1 
ATOM   4123 C  CA    . ALA A 1 502 ? 1.864   14.661 13.993  1.00 64.35  ? 502  ALA A CA    1 
ATOM   4124 C  C     . ALA A 1 502 ? 1.253   13.969 15.207  1.00 67.49  ? 502  ALA A C     1 
ATOM   4125 O  O     . ALA A 1 502 ? 1.359   12.751 15.355  1.00 72.03  ? 502  ALA A O     1 
ATOM   4126 C  CB    . ALA A 1 502 ? 3.376   14.725 14.124  1.00 63.15  ? 502  ALA A CB    1 
ATOM   4127 N  N     . LEU A 1 503 ? 0.611   14.749 16.072  1.00 67.66  ? 503  LEU A N     1 
ATOM   4128 C  CA    . LEU A 1 503 ? -0.057  14.203 17.249  1.00 70.92  ? 503  LEU A CA    1 
ATOM   4129 C  C     . LEU A 1 503 ? -1.381  13.531 16.895  1.00 76.97  ? 503  LEU A C     1 
ATOM   4130 O  O     . LEU A 1 503 ? -2.147  13.144 17.778  1.00 78.52  ? 503  LEU A O     1 
ATOM   4131 C  CB    . LEU A 1 503 ? -0.279  15.294 18.299  1.00 65.55  ? 503  LEU A CB    1 
ATOM   4132 C  CG    . LEU A 1 503 ? 0.882   15.520 19.268  1.00 62.23  ? 503  LEU A CG    1 
ATOM   4133 C  CD1   . LEU A 1 503 ? 0.657   16.768 20.110  1.00 56.85  ? 503  LEU A CD1   1 
ATOM   4134 C  CD2   . LEU A 1 503 ? 1.064   14.298 20.155  1.00 63.99  ? 503  LEU A CD2   1 
ATOM   4135 N  N     . HIS A 1 504 ? -1.646  13.400 15.600  1.00 80.51  ? 504  HIS A N     1 
ATOM   4136 C  CA    . HIS A 1 504 ? -2.819  12.679 15.127  1.00 85.25  ? 504  HIS A CA    1 
ATOM   4137 C  C     . HIS A 1 504 ? -2.458  11.228 14.821  1.00 87.95  ? 504  HIS A C     1 
ATOM   4138 O  O     . HIS A 1 504 ? -3.316  10.346 14.856  1.00 92.23  ? 504  HIS A O     1 
ATOM   4139 C  CB    . HIS A 1 504 ? -3.417  13.369 13.900  1.00 87.70  ? 504  HIS A CB    1 
ATOM   4140 C  CG    . HIS A 1 504 ? -4.002  14.714 14.193  1.00 89.57  ? 504  HIS A CG    1 
ATOM   4141 N  ND1   . HIS A 1 504 ? -3.875  15.788 13.337  1.00 89.41  ? 504  HIS A ND1   1 
ATOM   4142 C  CD2   . HIS A 1 504 ? -4.721  15.164 15.251  1.00 89.99  ? 504  HIS A CD2   1 
ATOM   4143 C  CE1   . HIS A 1 504 ? -4.487  16.838 13.853  1.00 86.97  ? 504  HIS A CE1   1 
ATOM   4144 N  NE2   . HIS A 1 504 ? -5.010  16.484 15.016  1.00 86.95  ? 504  HIS A NE2   1 
ATOM   4145 N  N     A ASN A 1 505 ? -1.183  10.989 14.526  0.50 86.96  ? 505  ASN A N     1 
ATOM   4146 N  N     B ASN A 1 505 ? -1.185  10.988 14.525  0.50 86.97  ? 505  ASN A N     1 
ATOM   4147 C  CA    A ASN A 1 505 ? -0.690  9.635  14.287  0.50 88.36  ? 505  ASN A CA    1 
ATOM   4148 C  CA    B ASN A 1 505 ? -0.697  9.634  14.291  0.50 88.36  ? 505  ASN A CA    1 
ATOM   4149 C  C     A ASN A 1 505 ? 0.515   9.284  15.160  0.50 86.12  ? 505  ASN A C     1 
ATOM   4150 C  C     B ASN A 1 505 ? 0.510   9.293  15.162  0.50 86.10  ? 505  ASN A C     1 
ATOM   4151 O  O     A ASN A 1 505 ? 1.613   9.054  14.643  0.50 85.82  ? 505  ASN A O     1 
ATOM   4152 O  O     B ASN A 1 505 ? 1.607   9.082  14.646  0.50 85.76  ? 505  ASN A O     1 
ATOM   4153 C  CB    A ASN A 1 505 ? -0.330  9.450  12.812  0.50 91.06  ? 505  ASN A CB    1 
ATOM   4154 C  CB    B ASN A 1 505 ? -0.339  9.443  12.816  0.50 91.07  ? 505  ASN A CB    1 
ATOM   4155 C  CG    A ASN A 1 505 ? -1.503  9.712  11.889  0.50 93.15  ? 505  ASN A CG    1 
ATOM   4156 C  CG    B ASN A 1 505 ? -1.498  9.750  11.889  0.50 93.07  ? 505  ASN A CG    1 
ATOM   4157 O  OD1   A ASN A 1 505 ? -2.649  9.409  12.220  0.50 94.49  ? 505  ASN A OD1   1 
ATOM   4158 O  OD1   B ASN A 1 505 ? -2.654  9.467  12.205  0.50 94.40  ? 505  ASN A OD1   1 
ATOM   4159 N  ND2   A ASN A 1 505 ? -1.220  10.281 10.723  0.50 93.37  ? 505  ASN A ND2   1 
ATOM   4160 N  ND2   B ASN A 1 505 ? -1.193  10.333 10.736  0.50 93.21  ? 505  ASN A ND2   1 
ATOM   4161 N  N     . PRO A 1 506 ? 0.314   9.233  16.489  1.00 84.16  ? 506  PRO A N     1 
ATOM   4162 C  CA    . PRO A 1 506 ? 1.436   8.945  17.386  1.00 83.18  ? 506  PRO A CA    1 
ATOM   4163 C  C     . PRO A 1 506 ? 1.828   7.472  17.349  1.00 83.08  ? 506  PRO A C     1 
ATOM   4164 O  O     . PRO A 1 506 ? 1.015   6.591  17.631  1.00 83.87  ? 506  PRO A O     1 
ATOM   4165 C  CB    . PRO A 1 506 ? 0.886   9.328  18.760  1.00 82.22  ? 506  PRO A CB    1 
ATOM   4166 C  CG    . PRO A 1 506 ? -0.572  9.086  18.654  1.00 83.72  ? 506  PRO A CG    1 
ATOM   4167 C  CD    . PRO A 1 506 ? -0.956  9.378  17.226  1.00 83.21  ? 506  PRO A CD    1 
ATOM   4168 N  N     . ASN A 1 507 ? 3.080   7.218  16.993  1.00 81.39  ? 507  ASN A N     1 
ATOM   4169 C  CA    . ASN A 1 507 ? 3.596   5.864  16.895  1.00 82.61  ? 507  ASN A CA    1 
ATOM   4170 C  C     . ASN A 1 507 ? 3.682   5.190  18.260  1.00 83.70  ? 507  ASN A C     1 
ATOM   4171 O  O     . ASN A 1 507 ? 4.265   5.736  19.196  1.00 79.73  ? 507  ASN A O     1 
ATOM   4172 C  CB    . ASN A 1 507 ? 4.964   5.888  16.218  1.00 81.11  ? 507  ASN A CB    1 
ATOM   4173 C  CG    . ASN A 1 507 ? 4.929   6.576  14.866  1.00 78.70  ? 507  ASN A CG    1 
ATOM   4174 O  OD1   . ASN A 1 507 ? 4.756   7.794  14.780  1.00 75.11  ? 507  ASN A OD1   1 
ATOM   4175 N  ND2   . ASN A 1 507 ? 5.092   5.799  13.802  1.00 81.43  ? 507  ASN A ND2   1 
ATOM   4176 N  N     . LEU A 1 508 ? 3.087   4.006  18.374  1.00 86.54  ? 508  LEU A N     1 
ATOM   4177 C  CA    . LEU A 1 508 ? 3.115   3.260  19.627  1.00 87.14  ? 508  LEU A CA    1 
ATOM   4178 C  C     . LEU A 1 508 ? 4.489   2.646  19.870  1.00 86.22  ? 508  LEU A C     1 
ATOM   4179 O  O     . LEU A 1 508 ? 4.697   1.455  19.640  1.00 86.91  ? 508  LEU A O     1 
ATOM   4180 C  CB    . LEU A 1 508 ? 2.039   2.172  19.639  1.00 89.67  ? 508  LEU A CB    1 
ATOM   4181 C  CG    . LEU A 1 508 ? 0.594   2.643  19.811  1.00 88.29  ? 508  LEU A CG    1 
ATOM   4182 N  N     . SER A 1 509 ? 5.423   3.470  20.334  1.00 81.38  ? 509  SER A N     1 
ATOM   4183 C  CA    . SER A 1 509 ? 6.768   3.007  20.647  1.00 84.21  ? 509  SER A CA    1 
ATOM   4184 C  C     . SER A 1 509 ? 7.358   3.805  21.804  1.00 85.40  ? 509  SER A C     1 
ATOM   4185 O  O     . SER A 1 509 ? 6.682   4.641  22.403  1.00 88.62  ? 509  SER A O     1 
ATOM   4186 C  CB    . SER A 1 509 ? 7.676   3.105  19.420  1.00 83.91  ? 509  SER A CB    1 
ATOM   4187 O  OG    . SER A 1 509 ? 7.898   4.454  19.051  1.00 83.39  ? 509  SER A OG    1 
ATOM   4188 N  N     . VAL A 1 510 ? 8.622   3.539  22.114  1.00 85.57  ? 510  VAL A N     1 
ATOM   4189 C  CA    . VAL A 1 510 ? 9.306   4.228  23.202  1.00 84.93  ? 510  VAL A CA    1 
ATOM   4190 C  C     . VAL A 1 510 ? 10.591  4.884  22.706  1.00 84.50  ? 510  VAL A C     1 
ATOM   4191 O  O     . VAL A 1 510 ? 11.536  4.200  22.312  1.00 85.95  ? 510  VAL A O     1 
ATOM   4192 C  CB    . VAL A 1 510 ? 9.642   3.264  24.356  1.00 87.78  ? 510  VAL A CB    1 
ATOM   4193 C  CG1   . VAL A 1 510 ? 10.429  3.985  25.441  1.00 87.44  ? 510  VAL A CG1   1 
ATOM   4194 C  CG2   . VAL A 1 510 ? 8.369   2.654  24.924  1.00 87.73  ? 510  VAL A CG2   1 
ATOM   4195 N  N     . ASP A 1 511 ? 10.620  6.212  22.726  1.00 80.84  ? 511  ASP A N     1 
ATOM   4196 C  CA    . ASP A 1 511 ? 11.782  6.957  22.254  1.00 81.08  ? 511  ASP A CA    1 
ATOM   4197 C  C     . ASP A 1 511 ? 11.998  8.247  23.039  1.00 79.25  ? 511  ASP A C     1 
ATOM   4198 O  O     . ASP A 1 511 ? 11.410  8.447  24.103  1.00 79.60  ? 511  ASP A O     1 
ATOM   4199 C  CB    . ASP A 1 511 ? 11.654  7.257  20.756  1.00 80.82  ? 511  ASP A CB    1 
ATOM   4200 C  CG    . ASP A 1 511 ? 10.300  7.838  20.387  1.00 82.33  ? 511  ASP A CG    1 
ATOM   4201 O  OD1   . ASP A 1 511 ? 9.789   8.698  21.135  1.00 68.89  ? 511  ASP A OD1   1 
ATOM   4202 O  OD2   . ASP A 1 511 ? 9.742   7.427  19.347  1.00 86.18  ? 511  ASP A OD2   1 
ATOM   4203 N  N     . GLU A 1 512 ? 12.846  9.119  22.505  1.00 77.52  ? 512  GLU A N     1 
ATOM   4204 C  CA    . GLU A 1 512 ? 13.152  10.389 23.150  1.00 78.85  ? 512  GLU A CA    1 
ATOM   4205 C  C     . GLU A 1 512 ? 12.857  11.551 22.207  1.00 79.15  ? 512  GLU A C     1 
ATOM   4206 O  O     . GLU A 1 512 ? 12.948  11.400 20.987  1.00 80.80  ? 512  GLU A O     1 
ATOM   4207 C  CB    . GLU A 1 512 ? 14.620  10.423 23.586  1.00 81.41  ? 512  GLU A CB    1 
ATOM   4208 N  N     . PRO A 1 513 ? 12.487  12.712 22.771  1.00 76.13  ? 513  PRO A N     1 
ATOM   4209 C  CA    . PRO A 1 513 ? 12.272  13.926 21.977  1.00 73.89  ? 513  PRO A CA    1 
ATOM   4210 C  C     . PRO A 1 513 ? 13.513  14.283 21.166  1.00 73.43  ? 513  PRO A C     1 
ATOM   4211 O  O     . PRO A 1 513 ? 14.633  14.090 21.639  1.00 73.67  ? 513  PRO A O     1 
ATOM   4212 C  CB    . PRO A 1 513 ? 12.016  14.993 23.042  1.00 72.78  ? 513  PRO A CB    1 
ATOM   4213 C  CG    . PRO A 1 513 ? 11.452  14.240 24.191  1.00 73.46  ? 513  PRO A CG    1 
ATOM   4214 C  CD    . PRO A 1 513 ? 12.161  12.919 24.194  1.00 75.40  ? 513  PRO A CD    1 
ATOM   4215 N  N     . LEU A 1 514 ? 13.310  14.792 19.955  1.00 70.55  ? 514  LEU A N     1 
ATOM   4216 C  CA    . LEU A 1 514 ? 14.419  15.136 19.073  1.00 72.30  ? 514  LEU A CA    1 
ATOM   4217 C  C     . LEU A 1 514 ? 15.124  16.411 19.520  1.00 74.43  ? 514  LEU A C     1 
ATOM   4218 C  CB    . LEU A 1 514 ? 13.926  15.298 17.633  1.00 71.10  ? 514  LEU A CB    1 
ATOM   4219 C  CG    . LEU A 1 514 ? 13.417  14.039 16.929  1.00 72.68  ? 514  LEU A CG    1 
ATOM   4220 C  CD1   . LEU A 1 514 ? 12.628  14.415 15.685  1.00 70.09  ? 514  LEU A CD1   1 
ATOM   4221 C  CD2   . LEU A 1 514 ? 14.574  13.115 16.575  1.00 74.67  ? 514  LEU A CD2   1 
ATOM   4222 N  N     . ASP A 1 515 ? 16.449  16.348 19.604  1.00 78.39  ? 515  ASP A N     1 
ATOM   4223 C  CA    . ASP A 1 515 ? 17.249  17.523 19.921  1.00 81.88  ? 515  ASP A CA    1 
ATOM   4224 C  C     . ASP A 1 515 ? 17.243  18.479 18.735  1.00 78.79  ? 515  ASP A C     1 
ATOM   4225 O  O     . ASP A 1 515 ? 17.960  18.272 17.754  1.00 79.32  ? 515  ASP A O     1 
ATOM   4226 C  CB    . ASP A 1 515 ? 18.683  17.119 20.275  1.00 88.10  ? 515  ASP A CB    1 
ATOM   4227 C  CG    . ASP A 1 515 ? 19.566  18.313 20.597  1.00 91.97  ? 515  ASP A CG    1 
ATOM   4228 O  OD1   . ASP A 1 515 ? 19.026  19.379 20.964  1.00 90.18  ? 515  ASP A OD1   1 
ATOM   4229 O  OD2   . ASP A 1 515 ? 20.803  18.183 20.489  1.00 95.33  ? 515  ASP A OD2   1 
ATOM   4230 N  N     . VAL A 1 516 ? 16.420  19.520 18.825  1.00 72.20  ? 516  VAL A N     1 
ATOM   4231 C  CA    . VAL A 1 516 ? 16.295  20.500 17.751  1.00 69.88  ? 516  VAL A CA    1 
ATOM   4232 C  C     . VAL A 1 516 ? 16.231  21.925 18.297  1.00 66.31  ? 516  VAL A C     1 
ATOM   4233 O  O     . VAL A 1 516 ? 15.767  22.154 19.415  1.00 64.88  ? 516  VAL A O     1 
ATOM   4234 C  CB    . VAL A 1 516 ? 15.035  20.246 16.890  1.00 70.35  ? 516  VAL A CB    1 
ATOM   4235 C  CG1   . VAL A 1 516 ? 15.138  18.914 16.158  1.00 73.03  ? 516  VAL A CG1   1 
ATOM   4236 C  CG2   . VAL A 1 516 ? 13.781  20.288 17.751  1.00 69.29  ? 516  VAL A CG2   1 
ATOM   4237 N  N     . ASP A 1 517 ? 16.708  22.881 17.505  1.00 62.64  ? 517  ASP A N     1 
ATOM   4238 C  CA    . ASP A 1 517 ? 16.568  24.290 17.843  1.00 57.23  ? 517  ASP A CA    1 
ATOM   4239 C  C     . ASP A 1 517 ? 15.240  24.776 17.277  1.00 54.86  ? 517  ASP A C     1 
ATOM   4240 O  O     . ASP A 1 517 ? 15.103  24.965 16.068  1.00 57.11  ? 517  ASP A O     1 
ATOM   4241 C  CB    . ASP A 1 517 ? 17.729  25.106 17.265  1.00 57.51  ? 517  ASP A CB    1 
ATOM   4242 C  CG    . ASP A 1 517 ? 17.804  26.515 17.841  1.00 56.17  ? 517  ASP A CG    1 
ATOM   4243 O  OD1   . ASP A 1 517 ? 18.921  27.069 17.915  1.00 57.98  ? 517  ASP A OD1   1 
ATOM   4244 O  OD2   . ASP A 1 517 ? 16.754  27.071 18.222  1.00 51.21  ? 517  ASP A OD2   1 
ATOM   4245 N  N     . TYR A 1 518 ? 14.262  24.975 18.156  1.00 46.80  ? 518  TYR A N     1 
ATOM   4246 C  CA    . TYR A 1 518 ? 12.912  25.338 17.733  1.00 43.15  ? 518  TYR A CA    1 
ATOM   4247 C  C     . TYR A 1 518 ? 12.823  26.738 17.127  1.00 43.03  ? 518  TYR A C     1 
ATOM   4248 O  O     . TYR A 1 518 ? 11.809  27.092 16.527  1.00 42.65  ? 518  TYR A O     1 
ATOM   4249 C  CB    . TYR A 1 518 ? 11.928  25.207 18.900  1.00 42.40  ? 518  TYR A CB    1 
ATOM   4250 C  CG    . TYR A 1 518 ? 11.817  23.802 19.448  1.00 49.57  ? 518  TYR A CG    1 
ATOM   4251 C  CD1   . TYR A 1 518 ? 12.632  23.376 20.490  1.00 49.26  ? 518  TYR A CD1   1 
ATOM   4252 C  CD2   . TYR A 1 518 ? 10.901  22.900 18.923  1.00 49.23  ? 518  TYR A CD2   1 
ATOM   4253 C  CE1   . TYR A 1 518 ? 12.536  22.094 20.993  1.00 50.24  ? 518  TYR A CE1   1 
ATOM   4254 C  CE2   . TYR A 1 518 ? 10.797  21.615 19.421  1.00 49.57  ? 518  TYR A CE2   1 
ATOM   4255 C  CZ    . TYR A 1 518 ? 11.616  21.218 20.456  1.00 50.20  ? 518  TYR A CZ    1 
ATOM   4256 O  OH    . TYR A 1 518 ? 11.517  19.940 20.955  1.00 50.54  ? 518  TYR A OH    1 
ATOM   4257 N  N     . ARG A 1 519 ? 13.883  27.527 17.279  1.00 46.79  ? 519  ARG A N     1 
ATOM   4258 C  CA    . ARG A 1 519 ? 13.913  28.885 16.740  1.00 47.47  ? 519  ARG A CA    1 
ATOM   4259 C  C     . ARG A 1 519 ? 14.002  28.914 15.214  1.00 52.82  ? 519  ARG A C     1 
ATOM   4260 O  O     . ARG A 1 519 ? 13.832  29.965 14.596  1.00 55.03  ? 519  ARG A O     1 
ATOM   4261 C  CB    . ARG A 1 519 ? 15.080  29.674 17.335  1.00 45.63  ? 519  ARG A CB    1 
ATOM   4262 C  CG    . ARG A 1 519 ? 14.972  29.928 18.826  1.00 46.73  ? 519  ARG A CG    1 
ATOM   4263 C  CD    . ARG A 1 519 ? 16.199  30.667 19.329  1.00 46.13  ? 519  ARG A CD    1 
ATOM   4264 N  NE    . ARG A 1 519 ? 17.424  29.921 19.057  1.00 45.65  ? 519  ARG A NE    1 
ATOM   4265 C  CZ    . ARG A 1 519 ? 18.647  30.429 19.164  1.00 48.40  ? 519  ARG A CZ    1 
ATOM   4266 N  NH1   . ARG A 1 519 ? 18.812  31.693 19.532  1.00 47.19  ? 519  ARG A NH1   1 
ATOM   4267 N  NH2   . ARG A 1 519 ? 19.706  29.676 18.896  1.00 51.36  ? 519  ARG A NH2   1 
ATOM   4268 N  N     . PHE A 1 520 ? 14.282  27.764 14.612  1.00 55.73  ? 520  PHE A N     1 
ATOM   4269 C  CA    . PHE A 1 520 ? 14.372  27.666 13.161  1.00 56.54  ? 520  PHE A CA    1 
ATOM   4270 C  C     . PHE A 1 520 ? 13.405  26.611 12.639  1.00 55.39  ? 520  PHE A C     1 
ATOM   4271 O  O     . PHE A 1 520 ? 13.152  25.607 13.306  1.00 56.55  ? 520  PHE A O     1 
ATOM   4272 C  CB    . PHE A 1 520 ? 15.804  27.334 12.734  1.00 58.37  ? 520  PHE A CB    1 
ATOM   4273 C  CG    . PHE A 1 520 ? 16.836  28.255 13.319  1.00 57.83  ? 520  PHE A CG    1 
ATOM   4274 C  CD1   . PHE A 1 520 ? 17.094  29.486 12.739  1.00 55.87  ? 520  PHE A CD1   1 
ATOM   4275 C  CD2   . PHE A 1 520 ? 17.543  27.891 14.453  1.00 57.70  ? 520  PHE A CD2   1 
ATOM   4276 C  CE1   . PHE A 1 520 ? 18.041  30.337 13.279  1.00 56.48  ? 520  PHE A CE1   1 
ATOM   4277 C  CE2   . PHE A 1 520 ? 18.491  28.738 14.998  1.00 57.34  ? 520  PHE A CE2   1 
ATOM   4278 C  CZ    . PHE A 1 520 ? 18.741  29.961 14.409  1.00 57.92  ? 520  PHE A CZ    1 
ATOM   4279 N  N     . ASP A 1 521 ? 12.863  26.849 11.448  1.00 54.26  ? 521  ASP A N     1 
ATOM   4280 C  CA    . ASP A 1 521 ? 11.922  25.923 10.830  1.00 55.32  ? 521  ASP A CA    1 
ATOM   4281 C  C     . ASP A 1 521 ? 12.542  24.544 10.657  1.00 54.57  ? 521  ASP A C     1 
ATOM   4282 O  O     . ASP A 1 521 ? 13.644  24.416 10.120  1.00 54.45  ? 521  ASP A O     1 
ATOM   4283 C  CB    . ASP A 1 521 ? 11.448  26.458 9.477   1.00 57.25  ? 521  ASP A CB    1 
ATOM   4284 C  CG    . ASP A 1 521 ? 10.665  27.750 9.603   1.00 57.11  ? 521  ASP A CG    1 
ATOM   4285 O  OD1   . ASP A 1 521 ? 9.452   27.684 9.896   1.00 56.77  ? 521  ASP A OD1   1 
ATOM   4286 O  OD2   . ASP A 1 521 ? 11.263  28.830 9.408   1.00 57.90  ? 521  ASP A OD2   1 
ATOM   4287 N  N     . PHE A 1 522 ? 11.828  23.523 11.126  1.00 54.97  ? 522  PHE A N     1 
ATOM   4288 C  CA    . PHE A 1 522 ? 12.282  22.137 11.045  1.00 55.01  ? 522  PHE A CA    1 
ATOM   4289 C  C     . PHE A 1 522 ? 12.727  21.770 9.637   1.00 60.52  ? 522  PHE A C     1 
ATOM   4290 O  O     . PHE A 1 522 ? 12.060  22.107 8.661   1.00 62.77  ? 522  PHE A O     1 
ATOM   4291 C  CB    . PHE A 1 522 ? 11.164  21.184 11.475  1.00 54.77  ? 522  PHE A CB    1 
ATOM   4292 C  CG    . PHE A 1 522 ? 10.858  21.224 12.947  1.00 54.29  ? 522  PHE A CG    1 
ATOM   4293 C  CD1   . PHE A 1 522 ? 11.815  21.639 13.860  1.00 52.04  ? 522  PHE A CD1   1 
ATOM   4294 C  CD2   . PHE A 1 522 ? 9.613   20.840 13.416  1.00 51.62  ? 522  PHE A CD2   1 
ATOM   4295 C  CE1   . PHE A 1 522 ? 11.532  21.671 15.214  1.00 49.60  ? 522  PHE A CE1   1 
ATOM   4296 C  CE2   . PHE A 1 522 ? 9.324   20.873 14.767  1.00 50.58  ? 522  PHE A CE2   1 
ATOM   4297 C  CZ    . PHE A 1 522 ? 10.285  21.288 15.667  1.00 49.32  ? 522  PHE A CZ    1 
ATOM   4298 N  N     . SER A 1 523 ? 13.861  21.086 9.535   1.00 63.64  ? 523  SER A N     1 
ATOM   4299 C  CA    . SER A 1 523 ? 14.316  20.573 8.250   1.00 67.51  ? 523  SER A CA    1 
ATOM   4300 C  C     . SER A 1 523 ? 13.494  19.343 7.886   1.00 69.83  ? 523  SER A C     1 
ATOM   4301 O  O     . SER A 1 523 ? 12.834  18.753 8.743   1.00 69.10  ? 523  SER A O     1 
ATOM   4302 C  CB    . SER A 1 523 ? 15.806  20.224 8.297   1.00 68.06  ? 523  SER A CB    1 
ATOM   4303 O  OG    . SER A 1 523 ? 16.052  19.136 9.171   1.00 69.69  ? 523  SER A OG    1 
ATOM   4304 N  N     . ASP A 1 524 ? 13.534  18.962 6.614   1.00 72.21  ? 524  ASP A N     1 
ATOM   4305 C  CA    . ASP A 1 524 ? 12.755  17.826 6.132   1.00 75.35  ? 524  ASP A CA    1 
ATOM   4306 C  C     . ASP A 1 524 ? 13.157  16.531 6.831   1.00 70.61  ? 524  ASP A C     1 
ATOM   4307 O  O     . ASP A 1 524 ? 12.327  15.643 7.031   1.00 68.61  ? 524  ASP A O     1 
ATOM   4308 C  CB    . ASP A 1 524 ? 12.895  17.686 4.617   1.00 84.94  ? 524  ASP A CB    1 
ATOM   4309 C  CG    . ASP A 1 524 ? 12.573  18.974 3.885   1.00 90.18  ? 524  ASP A CG    1 
ATOM   4310 O  OD1   . ASP A 1 524 ? 13.520  19.676 3.472   1.00 92.97  ? 524  ASP A OD1   1 
ATOM   4311 O  OD2   . ASP A 1 524 ? 11.374  19.291 3.735   1.00 91.13  ? 524  ASP A OD2   1 
ATOM   4312 N  N     . GLU A 1 525 ? 14.430  16.432 7.204   1.00 71.84  ? 525  GLU A N     1 
ATOM   4313 C  CA    . GLU A 1 525 ? 14.921  15.285 7.962   1.00 73.22  ? 525  GLU A CA    1 
ATOM   4314 C  C     . GLU A 1 525 ? 14.233  15.212 9.320   1.00 71.44  ? 525  GLU A C     1 
ATOM   4315 O  O     . GLU A 1 525 ? 13.808  14.143 9.755   1.00 74.28  ? 525  GLU A O     1 
ATOM   4316 C  CB    . GLU A 1 525 ? 16.439  15.360 8.150   1.00 73.80  ? 525  GLU A CB    1 
ATOM   4317 C  CG    . GLU A 1 525 ? 17.254  14.945 6.932   1.00 78.97  ? 525  GLU A CG    1 
ATOM   4318 C  CD    . GLU A 1 525 ? 17.260  15.994 5.836   1.00 81.32  ? 525  GLU A CD    1 
ATOM   4319 O  OE1   . GLU A 1 525 ? 17.322  15.613 4.648   1.00 85.22  ? 525  GLU A OE1   1 
ATOM   4320 O  OE2   . GLU A 1 525 ? 17.208  17.200 6.162   1.00 79.99  ? 525  GLU A OE2   1 
ATOM   4321 N  N     . ILE A 1 526 ? 14.125  16.360 9.981   1.00 69.73  ? 526  ILE A N     1 
ATOM   4322 C  CA    . ILE A 1 526 ? 13.475  16.442 11.284  1.00 67.92  ? 526  ILE A CA    1 
ATOM   4323 C  C     . ILE A 1 526 ? 11.985  16.115 11.188  1.00 65.77  ? 526  ILE A C     1 
ATOM   4324 O  O     . ILE A 1 526 ? 11.464  15.339 11.991  1.00 62.48  ? 526  ILE A O     1 
ATOM   4325 C  CB    . ILE A 1 526 ? 13.664  17.832 11.919  1.00 63.81  ? 526  ILE A CB    1 
ATOM   4326 C  CG1   . ILE A 1 526 ? 15.149  18.098 12.179  1.00 65.43  ? 526  ILE A CG1   1 
ATOM   4327 C  CG2   . ILE A 1 526 ? 12.866  17.946 13.210  1.00 59.78  ? 526  ILE A CG2   1 
ATOM   4328 C  CD1   . ILE A 1 526 ? 15.451  19.525 12.597  1.00 64.66  ? 526  ILE A CD1   1 
ATOM   4329 N  N     . LYS A 1 527 ? 11.311  16.703 10.201  1.00 62.97  ? 527  LYS A N     1 
ATOM   4330 C  CA    . LYS A 1 527 ? 9.891   16.441 9.970   1.00 63.03  ? 527  LYS A CA    1 
ATOM   4331 C  C     . LYS A 1 527 ? 9.635   14.955 9.745   1.00 67.09  ? 527  LYS A C     1 
ATOM   4332 O  O     . LYS A 1 527 ? 8.669   14.395 10.266  1.00 68.84  ? 527  LYS A O     1 
ATOM   4333 C  CB    . LYS A 1 527 ? 9.382   17.222 8.759   1.00 64.35  ? 527  LYS A CB    1 
ATOM   4334 C  CG    . LYS A 1 527 ? 9.490   18.731 8.869   1.00 66.32  ? 527  LYS A CG    1 
ATOM   4335 C  CD    . LYS A 1 527 ? 8.837   19.389 7.662   1.00 67.48  ? 527  LYS A CD    1 
ATOM   4336 C  CE    . LYS A 1 527 ? 9.341   20.801 7.444   1.00 63.24  ? 527  LYS A CE    1 
ATOM   4337 N  NZ    . LYS A 1 527 ? 8.821   21.367 6.169   1.00 62.76  ? 527  LYS A NZ    1 
ATOM   4338 N  N     . GLU A 1 528 ? 10.505  14.327 8.960   1.00 66.44  ? 528  GLU A N     1 
ATOM   4339 C  CA    . GLU A 1 528 ? 10.396  12.903 8.675   1.00 72.10  ? 528  GLU A CA    1 
ATOM   4340 C  C     . GLU A 1 528 ? 10.487  12.087 9.961   1.00 74.21  ? 528  GLU A C     1 
ATOM   4341 O  O     . GLU A 1 528 ? 9.721   11.147 10.166  1.00 76.67  ? 528  GLU A O     1 
ATOM   4342 C  CB    . GLU A 1 528 ? 11.488  12.467 7.695   1.00 75.58  ? 528  GLU A CB    1 
ATOM   4343 N  N     . LYS A 1 529 ? 11.424  12.461 10.826  1.00 72.46  ? 529  LYS A N     1 
ATOM   4344 C  CA    . LYS A 1 529 ? 11.611  11.770 12.095  1.00 74.88  ? 529  LYS A CA    1 
ATOM   4345 C  C     . LYS A 1 529 ? 10.443  12.017 13.043  1.00 73.08  ? 529  LYS A C     1 
ATOM   4346 O  O     . LYS A 1 529 ? 10.076  11.143 13.829  1.00 73.80  ? 529  LYS A O     1 
ATOM   4347 C  CB    . LYS A 1 529 ? 12.927  12.195 12.751  1.00 77.27  ? 529  LYS A CB    1 
ATOM   4348 C  CG    . LYS A 1 529 ? 14.169  11.702 12.023  1.00 84.17  ? 529  LYS A CG    1 
ATOM   4349 C  CD    . LYS A 1 529 ? 15.440  12.056 12.781  1.00 87.28  ? 529  LYS A CD    1 
ATOM   4350 C  CE    . LYS A 1 529 ? 16.669  11.469 12.101  1.00 94.00  ? 529  LYS A CE    1 
ATOM   4351 N  NZ    . LYS A 1 529 ? 17.924  11.775 12.842  1.00 96.26  ? 529  LYS A NZ    1 
ATOM   4352 N  N     . ILE A 1 530 ? 9.862   13.210 12.959  1.00 72.39  ? 530  ILE A N     1 
ATOM   4353 C  CA    . ILE A 1 530 ? 8.741   13.590 13.816  1.00 71.66  ? 530  ILE A CA    1 
ATOM   4354 C  C     . ILE A 1 530 ? 7.526   12.686 13.602  1.00 73.17  ? 530  ILE A C     1 
ATOM   4355 O  O     . ILE A 1 530 ? 6.846   12.306 14.557  1.00 75.07  ? 530  ILE A O     1 
ATOM   4356 C  CB    . ILE A 1 530 ? 8.357   15.074 13.613  1.00 67.62  ? 530  ILE A CB    1 
ATOM   4357 C  CG1   . ILE A 1 530 ? 9.370   15.980 14.314  1.00 65.94  ? 530  ILE A CG1   1 
ATOM   4358 C  CG2   . ILE A 1 530 ? 6.965   15.357 14.145  1.00 65.86  ? 530  ILE A CG2   1 
ATOM   4359 C  CD1   . ILE A 1 530 ? 9.028   17.444 14.236  1.00 63.20  ? 530  ILE A CD1   1 
ATOM   4360 N  N     . LYS A 1 531 ? 7.277   12.316 12.349  1.00 72.45  ? 531  LYS A N     1 
ATOM   4361 C  CA    . LYS A 1 531 ? 6.159   11.435 12.019  1.00 72.98  ? 531  LYS A CA    1 
ATOM   4362 C  C     . LYS A 1 531 ? 6.388   9.989  12.471  1.00 72.38  ? 531  LYS A C     1 
ATOM   4363 O  O     . LYS A 1 531 ? 5.593   9.100  12.160  1.00 71.53  ? 531  LYS A O     1 
ATOM   4364 C  CB    . LYS A 1 531 ? 5.870   11.475 10.515  1.00 71.83  ? 531  LYS A CB    1 
ATOM   4365 C  CG    . LYS A 1 531 ? 5.406   12.829 10.008  1.00 66.69  ? 531  LYS A CG    1 
ATOM   4366 N  N     . LYS A 1 532 ? 7.471   9.759  13.207  1.00 73.25  ? 532  LYS A N     1 
ATOM   4367 C  CA    . LYS A 1 532 ? 7.796   8.427  13.704  1.00 78.06  ? 532  LYS A CA    1 
ATOM   4368 C  C     . LYS A 1 532 ? 7.955   8.407  15.222  1.00 77.81  ? 532  LYS A C     1 
ATOM   4369 O  O     . LYS A 1 532 ? 8.377   7.402  15.795  1.00 77.65  ? 532  LYS A O     1 
ATOM   4370 C  CB    . LYS A 1 532 ? 9.073   7.906  13.041  1.00 82.53  ? 532  LYS A CB    1 
ATOM   4371 C  CG    . LYS A 1 532 ? 8.940   7.654  11.550  1.00 86.74  ? 532  LYS A CG    1 
ATOM   4372 C  CD    . LYS A 1 532 ? 10.244  7.146  10.959  1.00 90.09  ? 532  LYS A CD    1 
ATOM   4373 C  CE    . LYS A 1 532 ? 10.090  6.825  9.483   1.00 93.84  ? 532  LYS A CE    1 
ATOM   4374 N  NZ    . LYS A 1 532 ? 11.370  6.368  8.877   1.00 98.76  ? 532  LYS A NZ    1 
ATOM   4375 N  N     . LEU A 1 533 ? 7.613   9.515  15.872  1.00 75.76  ? 533  LEU A N     1 
ATOM   4376 C  CA    . LEU A 1 533 ? 7.783   9.632  17.317  1.00 74.19  ? 533  LEU A CA    1 
ATOM   4377 C  C     . LEU A 1 533 ? 6.539   9.224  18.099  1.00 72.64  ? 533  LEU A C     1 
ATOM   4378 O  O     . LEU A 1 533 ? 5.421   9.283  17.590  1.00 70.71  ? 533  LEU A O     1 
ATOM   4379 C  CB    . LEU A 1 533 ? 8.193   11.055 17.698  1.00 69.77  ? 533  LEU A CB    1 
ATOM   4380 C  CG    . LEU A 1 533 ? 9.635   11.448 17.380  1.00 70.98  ? 533  LEU A CG    1 
ATOM   4381 C  CD1   . LEU A 1 533 ? 9.880   12.900 17.740  1.00 69.15  ? 533  LEU A CD1   1 
ATOM   4382 C  CD2   . LEU A 1 533 ? 10.609  10.542 18.114  1.00 74.45  ? 533  LEU A CD2   1 
ATOM   4383 N  N     . SER A 1 534 ? 6.750   8.813  19.345  1.00 74.14  ? 534  SER A N     1 
ATOM   4384 C  CA    . SER A 1 534 ? 5.655   8.466  20.239  1.00 73.74  ? 534  SER A CA    1 
ATOM   4385 C  C     . SER A 1 534 ? 4.900   9.717  20.670  1.00 74.35  ? 534  SER A C     1 
ATOM   4386 O  O     . SER A 1 534 ? 5.384   10.836 20.495  1.00 68.89  ? 534  SER A O     1 
ATOM   4387 C  CB    . SER A 1 534 ? 6.191   7.740  21.472  1.00 76.08  ? 534  SER A CB    1 
ATOM   4388 O  OG    . SER A 1 534 ? 7.068   8.573  22.212  1.00 73.40  ? 534  SER A OG    1 
ATOM   4389 N  N     . ALA A 1 535 ? 3.712   9.521  21.233  1.00 75.94  ? 535  ALA A N     1 
ATOM   4390 C  CA    . ALA A 1 535 ? 2.918   10.628 21.751  1.00 69.26  ? 535  ALA A CA    1 
ATOM   4391 C  C     . ALA A 1 535 ? 3.653   11.304 22.902  1.00 68.63  ? 535  ALA A C     1 
ATOM   4392 O  O     . ALA A 1 535 ? 3.534   12.513 23.105  1.00 63.78  ? 535  ALA A O     1 
ATOM   4393 C  CB    . ALA A 1 535 ? 1.556   10.136 22.210  1.00 67.75  ? 535  ALA A CB    1 
ATOM   4394 N  N     . LYS A 1 536 ? 4.412   10.506 23.648  1.00 69.99  ? 536  LYS A N     1 
ATOM   4395 C  CA    . LYS A 1 536 ? 5.207   11.001 24.765  1.00 71.33  ? 536  LYS A CA    1 
ATOM   4396 C  C     . LYS A 1 536 ? 6.230   12.027 24.299  1.00 67.27  ? 536  LYS A C     1 
ATOM   4397 O  O     . LYS A 1 536 ? 6.284   13.143 24.816  1.00 66.28  ? 536  LYS A O     1 
ATOM   4398 C  CB    . LYS A 1 536 ? 5.924   9.841  25.458  1.00 77.33  ? 536  LYS A CB    1 
ATOM   4399 C  CG    . LYS A 1 536 ? 6.835   10.265 26.598  1.00 79.70  ? 536  LYS A CG    1 
ATOM   4400 C  CD    . LYS A 1 536 ? 7.742   9.122  27.026  1.00 85.96  ? 536  LYS A CD    1 
ATOM   4401 C  CE    . LYS A 1 536 ? 8.596   9.506  28.223  1.00 87.90  ? 536  LYS A CE    1 
ATOM   4402 N  NZ    . LYS A 1 536 ? 7.770   9.729  29.441  1.00 88.14  ? 536  LYS A NZ    1 
ATOM   4403 N  N     . SER A 1 537 ? 7.041   11.640 23.319  1.00 67.99  ? 537  SER A N     1 
ATOM   4404 C  CA    . SER A 1 537 ? 8.081   12.517 22.793  1.00 69.98  ? 537  SER A CA    1 
ATOM   4405 C  C     . SER A 1 537 ? 7.497   13.742 22.094  1.00 67.76  ? 537  SER A C     1 
ATOM   4406 O  O     . SER A 1 537 ? 8.028   14.844 22.218  1.00 66.97  ? 537  SER A O     1 
ATOM   4407 C  CB    . SER A 1 537 ? 9.005   11.753 21.841  1.00 72.35  ? 537  SER A CB    1 
ATOM   4408 O  OG    . SER A 1 537 ? 9.785   10.799 22.540  1.00 73.45  ? 537  SER A OG    1 
ATOM   4409 N  N     . LEU A 1 538 ? 6.401   13.545 21.367  1.00 66.33  ? 538  LEU A N     1 
ATOM   4410 C  CA    . LEU A 1 538 ? 5.762   14.635 20.634  1.00 64.22  ? 538  LEU A CA    1 
ATOM   4411 C  C     . LEU A 1 538 ? 5.218   15.717 21.562  1.00 64.49  ? 538  LEU A C     1 
ATOM   4412 O  O     . LEU A 1 538 ? 5.484   16.904 21.361  1.00 61.33  ? 538  LEU A O     1 
ATOM   4413 C  CB    . LEU A 1 538 ? 4.649   14.103 19.728  1.00 64.69  ? 538  LEU A CB    1 
ATOM   4414 C  CG    . LEU A 1 538 ? 5.091   13.483 18.400  1.00 64.26  ? 538  LEU A CG    1 
ATOM   4415 C  CD1   . LEU A 1 538 ? 3.885   13.028 17.592  1.00 63.23  ? 538  LEU A CD1   1 
ATOM   4416 C  CD2   . LEU A 1 538 ? 5.933   14.468 17.603  1.00 57.13  ? 538  LEU A CD2   1 
ATOM   4417 N  N     . ASN A 1 539 ? 4.459   15.307 22.575  1.00 64.88  ? 539  ASN A N     1 
ATOM   4418 C  CA    . ASN A 1 539 ? 3.915   16.251 23.547  1.00 63.29  ? 539  ASN A CA    1 
ATOM   4419 C  C     . ASN A 1 539 ? 5.006   17.030 24.274  1.00 61.01  ? 539  ASN A C     1 
ATOM   4420 O  O     . ASN A 1 539 ? 4.833   18.207 24.591  1.00 56.78  ? 539  ASN A O     1 
ATOM   4421 C  CB    . ASN A 1 539 ? 3.008   15.542 24.555  1.00 64.62  ? 539  ASN A CB    1 
ATOM   4422 C  CG    . ASN A 1 539 ? 1.634   15.240 23.990  1.00 65.75  ? 539  ASN A CG    1 
ATOM   4423 O  OD1   . ASN A 1 539 ? 1.160   14.106 24.051  1.00 71.78  ? 539  ASN A OD1   1 
ATOM   4424 N  ND2   . ASN A 1 539 ? 0.985   16.258 23.438  1.00 62.70  ? 539  ASN A ND2   1 
ATOM   4425 N  N     . GLU A 1 540 ? 6.130   16.369 24.531  1.00 63.82  ? 540  GLU A N     1 
ATOM   4426 C  CA    . GLU A 1 540 ? 7.266   17.031 25.157  1.00 64.40  ? 540  GLU A CA    1 
ATOM   4427 C  C     . GLU A 1 540 ? 7.910   18.024 24.192  1.00 62.03  ? 540  GLU A C     1 
ATOM   4428 O  O     . GLU A 1 540 ? 8.363   19.093 24.602  1.00 59.09  ? 540  GLU A O     1 
ATOM   4429 C  CB    . GLU A 1 540 ? 8.291   16.005 25.650  1.00 69.36  ? 540  GLU A CB    1 
ATOM   4430 C  CG    . GLU A 1 540 ? 9.559   16.610 26.245  1.00 77.08  ? 540  GLU A CG    1 
ATOM   4431 C  CD    . GLU A 1 540 ? 9.300   17.465 27.477  1.00 83.55  ? 540  GLU A CD    1 
ATOM   4432 O  OE1   . GLU A 1 540 ? 10.129  18.356 27.760  1.00 82.91  ? 540  GLU A OE1   1 
ATOM   4433 O  OE2   . GLU A 1 540 ? 8.279   17.245 28.165  1.00 86.34  ? 540  GLU A OE2   1 
ATOM   4434 N  N     . MET A 1 541 ? 7.944   17.674 22.909  1.00 59.53  ? 541  MET A N     1 
ATOM   4435 C  CA    . MET A 1 541 ? 8.467   18.581 21.894  1.00 56.66  ? 541  MET A CA    1 
ATOM   4436 C  C     . MET A 1 541 ? 7.536   19.776 21.702  1.00 53.54  ? 541  MET A C     1 
ATOM   4437 O  O     . MET A 1 541 ? 7.990   20.897 21.474  1.00 52.63  ? 541  MET A O     1 
ATOM   4438 C  CB    . MET A 1 541 ? 8.684   17.857 20.563  1.00 57.47  ? 541  MET A CB    1 
ATOM   4439 C  CG    . MET A 1 541 ? 9.808   16.834 20.582  1.00 62.29  ? 541  MET A CG    1 
ATOM   4440 S  SD    . MET A 1 541 ? 10.230  16.232 18.936  1.00 56.31  ? 541  MET A SD    1 
ATOM   4441 C  CE    . MET A 1 541 ? 11.107  17.645 18.273  1.00 67.95  ? 541  MET A CE    1 
ATOM   4442 N  N     . LEU A 1 542 ? 6.233   19.529 21.795  1.00 46.01  ? 542  LEU A N     1 
ATOM   4443 C  CA    . LEU A 1 542 ? 5.242   20.591 21.684  1.00 44.06  ? 542  LEU A CA    1 
ATOM   4444 C  C     . LEU A 1 542 ? 5.398   21.564 22.845  1.00 44.96  ? 542  LEU A C     1 
ATOM   4445 O  O     . LEU A 1 542 ? 5.244   22.773 22.682  1.00 43.51  ? 542  LEU A O     1 
ATOM   4446 C  CB    . LEU A 1 542 ? 3.828   20.009 21.670  1.00 46.04  ? 542  LEU A CB    1 
ATOM   4447 C  CG    . LEU A 1 542 ? 2.684   21.016 21.535  1.00 49.04  ? 542  LEU A CG    1 
ATOM   4448 C  CD1   . LEU A 1 542 ? 2.788   21.766 20.217  1.00 51.29  ? 542  LEU A CD1   1 
ATOM   4449 C  CD2   . LEU A 1 542 ? 1.334   20.327 21.659  1.00 48.71  ? 542  LEU A CD2   1 
ATOM   4450 N  N     . PHE A 1 543 ? 5.719   21.026 24.017  1.00 46.66  ? 543  PHE A N     1 
ATOM   4451 C  CA    . PHE A 1 543 ? 5.941   21.845 25.198  1.00 47.50  ? 543  PHE A CA    1 
ATOM   4452 C  C     . PHE A 1 543 ? 7.182   22.711 25.030  1.00 42.93  ? 543  PHE A C     1 
ATOM   4453 O  O     . PHE A 1 543 ? 7.192   23.879 25.416  1.00 45.23  ? 543  PHE A O     1 
ATOM   4454 C  CB    . PHE A 1 543 ? 6.075   20.970 26.447  1.00 50.99  ? 543  PHE A CB    1 
ATOM   4455 C  CG    . PHE A 1 543 ? 6.350   21.749 27.702  1.00 52.47  ? 543  PHE A CG    1 
ATOM   4456 C  CD1   . PHE A 1 543 ? 5.325   22.403 28.364  1.00 50.44  ? 543  PHE A CD1   1 
ATOM   4457 C  CD2   . PHE A 1 543 ? 7.635   21.828 28.219  1.00 52.19  ? 543  PHE A CD2   1 
ATOM   4458 C  CE1   . PHE A 1 543 ? 5.573   23.123 29.516  1.00 49.78  ? 543  PHE A CE1   1 
ATOM   4459 C  CE2   . PHE A 1 543 ? 7.889   22.547 29.371  1.00 50.24  ? 543  PHE A CE2   1 
ATOM   4460 C  CZ    . PHE A 1 543 ? 6.857   23.196 30.021  1.00 50.30  ? 543  PHE A CZ    1 
ATOM   4461 N  N     . ARG A 1 544 ? 8.229   22.132 24.453  1.00 40.73  ? 544  ARG A N     1 
ATOM   4462 C  CA    . ARG A 1 544 ? 9.483   22.847 24.254  1.00 41.82  ? 544  ARG A CA    1 
ATOM   4463 C  C     . ARG A 1 544 ? 9.356   23.880 23.140  1.00 46.56  ? 544  ARG A C     1 
ATOM   4464 O  O     . ARG A 1 544 ? 9.993   24.934 23.182  1.00 49.37  ? 544  ARG A O     1 
ATOM   4465 C  CB    . ARG A 1 544 ? 10.617  21.865 23.956  1.00 42.31  ? 544  ARG A CB    1 
ATOM   4466 C  CG    . ARG A 1 544 ? 10.922  20.930 25.113  1.00 45.48  ? 544  ARG A CG    1 
ATOM   4467 C  CD    . ARG A 1 544 ? 11.962  19.879 24.745  1.00 46.83  ? 544  ARG A CD    1 
ATOM   4468 N  NE    . ARG A 1 544 ? 12.194  18.952 25.849  1.00 48.61  ? 544  ARG A NE    1 
ATOM   4469 C  CZ    . ARG A 1 544 ? 13.114  17.993 25.846  1.00 51.71  ? 544  ARG A CZ    1 
ATOM   4470 N  NH1   . ARG A 1 544 ? 13.902  17.824 24.792  1.00 52.55  ? 544  ARG A NH1   1 
ATOM   4471 N  NH2   . ARG A 1 544 ? 13.246  17.202 26.902  1.00 55.12  ? 544  ARG A NH2   1 
ATOM   4472 N  N     . ALA A 1 545 ? 8.525   23.575 22.149  1.00 45.95  ? 545  ALA A N     1 
ATOM   4473 C  CA    . ALA A 1 545 ? 8.277   24.499 21.051  1.00 41.59  ? 545  ALA A CA    1 
ATOM   4474 C  C     . ALA A 1 545 ? 7.541   25.729 21.561  1.00 41.39  ? 545  ALA A C     1 
ATOM   4475 O  O     . ALA A 1 545 ? 7.862   26.858 21.193  1.00 40.34  ? 545  ALA A O     1 
ATOM   4476 C  CB    . ALA A 1 545 ? 7.473   23.819 19.959  1.00 43.53  ? 545  ALA A CB    1 
ATOM   4477 N  N     . GLN A 1 546 ? 6.552   25.499 22.418  1.00 42.93  ? 546  GLN A N     1 
ATOM   4478 C  CA    . GLN A 1 546 ? 5.749   26.583 22.965  1.00 43.56  ? 546  GLN A CA    1 
ATOM   4479 C  C     . GLN A 1 546 ? 6.541   27.426 23.960  1.00 41.06  ? 546  GLN A C     1 
ATOM   4480 O  O     . GLN A 1 546 ? 6.331   28.632 24.060  1.00 39.69  ? 546  GLN A O     1 
ATOM   4481 C  CB    . GLN A 1 546 ? 4.467   26.036 23.596  1.00 46.80  ? 546  GLN A CB    1 
ATOM   4482 C  CG    . GLN A 1 546 ? 3.497   25.464 22.570  1.00 50.58  ? 546  GLN A CG    1 
ATOM   4483 C  CD    . GLN A 1 546 ? 2.316   24.751 23.197  1.00 50.47  ? 546  GLN A CD    1 
ATOM   4484 O  OE1   . GLN A 1 546 ? 1.247   24.653 22.594  1.00 51.37  ? 546  GLN A OE1   1 
ATOM   4485 N  NE2   . GLN A 1 546 ? 2.505   24.240 24.407  1.00 51.37  ? 546  GLN A NE2   1 
ATOM   4486 N  N     . ARG A 1 547 ? 7.459   26.792 24.686  1.00 42.49  ? 547  ARG A N     1 
ATOM   4487 C  CA    . ARG A 1 547 ? 8.344   27.526 25.585  1.00 39.40  ? 547  ARG A CA    1 
ATOM   4488 C  C     . ARG A 1 547 ? 9.313   28.399 24.797  1.00 39.94  ? 547  ARG A C     1 
ATOM   4489 O  O     . ARG A 1 547 ? 9.623   29.519 25.203  1.00 40.70  ? 547  ARG A O     1 
ATOM   4490 C  CB    . ARG A 1 547 ? 9.110   26.574 26.505  1.00 41.14  ? 547  ARG A CB    1 
ATOM   4491 C  CG    . ARG A 1 547 ? 8.310   26.120 27.715  1.00 43.26  ? 547  ARG A CG    1 
ATOM   4492 C  CD    . ARG A 1 547 ? 7.837   27.320 28.520  1.00 44.25  ? 547  ARG A CD    1 
ATOM   4493 N  NE    . ARG A 1 547 ? 6.897   26.950 29.575  1.00 46.56  ? 547  ARG A NE    1 
ATOM   4494 C  CZ    . ARG A 1 547 ? 7.238   26.746 30.842  1.00 49.21  ? 547  ARG A CZ    1 
ATOM   4495 N  NH1   . ARG A 1 547 ? 8.504   26.871 31.219  1.00 50.21  ? 547  ARG A NH1   1 
ATOM   4496 N  NH2   . ARG A 1 547 ? 6.314   26.416 31.734  1.00 49.69  ? 547  ARG A NH2   1 
ATOM   4497 N  N     . THR A 1 548 ? 9.786   27.879 23.669  1.00 39.23  ? 548  THR A N     1 
ATOM   4498 C  CA    . THR A 1 548 ? 10.656  28.638 22.779  1.00 35.67  ? 548  THR A CA    1 
ATOM   4499 C  C     . THR A 1 548 ? 9.897   29.817 22.176  1.00 34.08  ? 548  THR A C     1 
ATOM   4500 O  O     . THR A 1 548 ? 10.438  30.915 22.044  1.00 36.17  ? 548  THR A O     1 
ATOM   4501 C  CB    . THR A 1 548 ? 11.217  27.752 21.648  1.00 36.61  ? 548  THR A CB    1 
ATOM   4502 O  OG1   . THR A 1 548 ? 11.986  26.684 22.215  1.00 39.12  ? 548  THR A OG1   1 
ATOM   4503 C  CG2   . THR A 1 548 ? 12.104  28.565 20.713  1.00 37.38  ? 548  THR A CG2   1 
ATOM   4504 N  N     . GLU A 1 549 ? 8.636   29.587 21.821  1.00 35.92  ? 549  GLU A N     1 
ATOM   4505 C  CA    . GLU A 1 549 ? 7.799   30.641 21.257  1.00 35.54  ? 549  GLU A CA    1 
ATOM   4506 C  C     . GLU A 1 549 ? 7.563   31.771 22.259  1.00 31.65  ? 549  GLU A C     1 
ATOM   4507 O  O     . GLU A 1 549 ? 7.626   32.948 21.904  1.00 34.54  ? 549  GLU A O     1 
ATOM   4508 C  CB    . GLU A 1 549 ? 6.462   30.072 20.778  1.00 39.06  ? 549  GLU A CB    1 
ATOM   4509 C  CG    . GLU A 1 549 ? 5.546   31.111 20.145  1.00 39.11  ? 549  GLU A CG    1 
ATOM   4510 C  CD    . GLU A 1 549 ? 4.167   30.565 19.817  1.00 39.75  ? 549  GLU A CD    1 
ATOM   4511 O  OE1   . GLU A 1 549 ? 4.018   29.327 19.709  1.00 39.25  ? 549  GLU A OE1   1 
ATOM   4512 O  OE2   . GLU A 1 549 ? 3.230   31.379 19.674  1.00 39.95  ? 549  GLU A OE2   1 
ATOM   4513 N  N     . VAL A 1 550 ? 7.294   31.409 23.511  1.00 32.73  ? 550  VAL A N     1 
ATOM   4514 C  CA    . VAL A 1 550 ? 7.064   32.399 24.561  1.00 31.38  ? 550  VAL A CA    1 
ATOM   4515 C  C     . VAL A 1 550 ? 8.327   33.222 24.813  1.00 33.54  ? 550  VAL A C     1 
ATOM   4516 O  O     . VAL A 1 550 ? 8.256   34.434 25.029  1.00 34.00  ? 550  VAL A O     1 
ATOM   4517 C  CB    . VAL A 1 550 ? 6.581   31.738 25.874  1.00 33.78  ? 550  VAL A CB    1 
ATOM   4518 C  CG1   . VAL A 1 550 ? 6.543   32.750 27.011  1.00 28.52  ? 550  VAL A CG1   1 
ATOM   4519 C  CG2   . VAL A 1 550 ? 5.208   31.109 25.676  1.00 30.52  ? 550  VAL A CG2   1 
ATOM   4520 N  N     . ALA A 1 551 ? 9.481   32.561 24.765  1.00 34.56  ? 551  ALA A N     1 
ATOM   4521 C  CA    . ALA A 1 551 ? 10.762  33.243 24.930  1.00 30.84  ? 551  ALA A CA    1 
ATOM   4522 C  C     . ALA A 1 551 ? 10.984  34.258 23.811  1.00 33.59  ? 551  ALA A C     1 
ATOM   4523 O  O     . ALA A 1 551 ? 11.422  35.382 24.057  1.00 35.98  ? 551  ALA A O     1 
ATOM   4524 C  CB    . ALA A 1 551 ? 11.904  32.232 24.967  1.00 31.36  ? 551  ALA A CB    1 
ATOM   4525 N  N     . GLY A 1 552 ? 10.682  33.852 22.582  1.00 30.66  ? 552  GLY A N     1 
ATOM   4526 C  CA    . GLY A 1 552 ? 10.773  34.745 21.443  1.00 29.29  ? 552  GLY A CA    1 
ATOM   4527 C  C     . GLY A 1 552 ? 9.743   35.857 21.524  1.00 33.47  ? 552  GLY A C     1 
ATOM   4528 O  O     . GLY A 1 552 ? 10.019  36.997 21.150  1.00 33.85  ? 552  GLY A O     1 
ATOM   4529 N  N     . MET A 1 553 ? 8.555   35.521 22.020  1.00 30.81  ? 553  MET A N     1 
ATOM   4530 C  CA    . MET A 1 553 ? 7.478   36.494 22.171  1.00 27.76  ? 553  MET A CA    1 
ATOM   4531 C  C     . MET A 1 553 ? 7.869   37.616 23.131  1.00 27.87  ? 553  MET A C     1 
ATOM   4532 O  O     . MET A 1 553 ? 7.692   38.792 22.823  1.00 28.13  ? 553  MET A O     1 
ATOM   4533 C  CB    . MET A 1 553 ? 6.197   35.808 22.655  1.00 27.34  ? 553  MET A CB    1 
ATOM   4534 C  CG    . MET A 1 553 ? 5.109   36.774 23.112  1.00 31.80  ? 553  MET A CG    1 
ATOM   4535 S  SD    . MET A 1 553 ? 4.501   37.832 21.783  1.00 45.32  ? 553  MET A SD    1 
ATOM   4536 C  CE    . MET A 1 553 ? 3.240   36.792 21.057  1.00 45.97  ? 553  MET A CE    1 
ATOM   4537 N  N     . THR A 1 554 ? 8.400   37.244 24.291  1.00 28.35  ? 554  THR A N     1 
ATOM   4538 C  CA    . THR A 1 554 ? 8.857   38.218 25.277  1.00 30.24  ? 554  THR A CA    1 
ATOM   4539 C  C     . THR A 1 554 ? 9.896   39.164 24.681  1.00 31.55  ? 554  THR A C     1 
ATOM   4540 O  O     . THR A 1 554 ? 9.799   40.383 24.826  1.00 30.05  ? 554  THR A O     1 
ATOM   4541 C  CB    . THR A 1 554 ? 9.471   37.520 26.503  1.00 29.81  ? 554  THR A CB    1 
ATOM   4542 O  OG1   . THR A 1 554 ? 8.437   36.868 27.252  1.00 30.96  ? 554  THR A OG1   1 
ATOM   4543 C  CG2   . THR A 1 554 ? 10.178  38.530 27.395  1.00 26.73  ? 554  THR A CG2   1 
ATOM   4544 N  N     . ALA A 1 555 ? 10.879  38.588 23.997  1.00 29.25  ? 555  ALA A N     1 
ATOM   4545 C  CA    . ALA A 1 555 ? 11.976  39.357 23.424  1.00 31.99  ? 555  ALA A CA    1 
ATOM   4546 C  C     . ALA A 1 555 ? 11.515  40.322 22.331  1.00 33.12  ? 555  ALA A C     1 
ATOM   4547 O  O     . ALA A 1 555 ? 11.963  41.468 22.280  1.00 32.44  ? 555  ALA A O     1 
ATOM   4548 C  CB    . ALA A 1 555 ? 13.056  38.419 22.892  1.00 33.58  ? 555  ALA A CB    1 
ATOM   4549 N  N     . GLN A 1 556 ? 10.615  39.866 21.465  1.00 31.23  ? 556  GLN A N     1 
ATOM   4550 C  CA    . GLN A 1 556 ? 10.175  40.694 20.343  1.00 33.57  ? 556  GLN A CA    1 
ATOM   4551 C  C     . GLN A 1 556 ? 9.110   41.731 20.716  1.00 30.25  ? 556  GLN A C     1 
ATOM   4552 O  O     . GLN A 1 556 ? 9.179   42.876 20.271  1.00 31.02  ? 556  GLN A O     1 
ATOM   4553 C  CB    . GLN A 1 556 ? 9.723   39.829 19.151  1.00 33.68  ? 556  GLN A CB    1 
ATOM   4554 C  CG    . GLN A 1 556 ? 8.373   39.133 19.304  1.00 34.52  ? 556  GLN A CG    1 
ATOM   4555 C  CD    . GLN A 1 556 ? 7.201   40.022 18.907  1.00 36.67  ? 556  GLN A CD    1 
ATOM   4556 O  OE1   . GLN A 1 556 ? 7.383   41.071 18.284  1.00 30.23  ? 556  GLN A OE1   1 
ATOM   4557 N  NE2   . GLN A 1 556 ? 5.993   39.611 19.281  1.00 33.54  ? 556  GLN A NE2   1 
ATOM   4558 N  N     . ILE A 1 557 ? 8.135   41.344 21.534  1.00 26.09  ? 557  ILE A N     1 
ATOM   4559 C  CA    . ILE A 1 557 ? 7.007   42.233 21.807  1.00 31.53  ? 557  ILE A CA    1 
ATOM   4560 C  C     . ILE A 1 557 ? 7.404   43.405 22.704  1.00 32.10  ? 557  ILE A C     1 
ATOM   4561 O  O     . ILE A 1 557 ? 6.804   44.481 22.638  1.00 30.78  ? 557  ILE A O     1 
ATOM   4562 C  CB    . ILE A 1 557 ? 5.793   41.480 22.404  1.00 32.34  ? 557  ILE A CB    1 
ATOM   4563 C  CG1   . ILE A 1 557 ? 4.502   42.259 22.140  1.00 32.34  ? 557  ILE A CG1   1 
ATOM   4564 C  CG2   . ILE A 1 557 ? 5.982   41.218 23.897  1.00 32.40  ? 557  ILE A CG2   1 
ATOM   4565 C  CD1   . ILE A 1 557 ? 3.255   41.560 22.638  1.00 35.24  ? 557  ILE A CD1   1 
ATOM   4566 N  N     . ASN A 1 558 ? 8.429   43.204 23.524  1.00 30.05  ? 558  ASN A N     1 
ATOM   4567 C  CA    . ASN A 1 558 ? 8.862   44.245 24.451  1.00 30.18  ? 558  ASN A CA    1 
ATOM   4568 C  C     . ASN A 1 558 ? 9.914   45.176 23.855  1.00 29.69  ? 558  ASN A C     1 
ATOM   4569 O  O     . ASN A 1 558 ? 10.127  46.284 24.349  1.00 32.03  ? 558  ASN A O     1 
ATOM   4570 C  CB    . ASN A 1 558 ? 9.330   43.632 25.770  1.00 24.59  ? 558  ASN A CB    1 
ATOM   4571 C  CG    . ASN A 1 558 ? 8.172   43.126 26.606  1.00 28.44  ? 558  ASN A CG    1 
ATOM   4572 O  OD1   . ASN A 1 558 ? 7.240   43.873 26.905  1.00 27.36  ? 558  ASN A OD1   1 
ATOM   4573 N  ND2   . ASN A 1 558 ? 8.207   41.846 26.962  1.00 24.77  ? 558  ASN A ND2   1 
ATOM   4574 N  N     . ARG A 1 559 ? 10.566  44.723 22.791  1.00 28.82  ? 559  ARG A N     1 
ATOM   4575 C  CA    . ARG A 1 559 ? 11.407  45.607 21.996  1.00 31.24  ? 559  ARG A CA    1 
ATOM   4576 C  C     . ARG A 1 559 ? 10.506  46.451 21.100  1.00 32.18  ? 559  ARG A C     1 
ATOM   4577 O  O     . ARG A 1 559 ? 10.802  47.616 20.829  1.00 33.60  ? 559  ARG A O     1 
ATOM   4578 C  CB    . ARG A 1 559 ? 12.419  44.811 21.171  1.00 27.94  ? 559  ARG A CB    1 
ATOM   4579 C  CG    . ARG A 1 559 ? 13.654  44.394 21.964  1.00 32.03  ? 559  ARG A CG    1 
ATOM   4580 C  CD    . ARG A 1 559 ? 14.487  43.371 21.210  1.00 29.95  ? 559  ARG A CD    1 
ATOM   4581 N  NE    . ARG A 1 559 ? 15.715  43.025 21.923  1.00 31.61  ? 559  ARG A NE    1 
ATOM   4582 C  CZ    . ARG A 1 559 ? 15.777  42.167 22.939  1.00 34.57  ? 559  ARG A CZ    1 
ATOM   4583 N  NH1   . ARG A 1 559 ? 14.676  41.571 23.380  1.00 29.38  ? 559  ARG A NH1   1 
ATOM   4584 N  NH2   . ARG A 1 559 ? 16.942  41.909 23.520  1.00 33.53  ? 559  ARG A NH2   1 
ATOM   4585 N  N     . LYS A 1 560 ? 9.402   45.858 20.652  1.00 30.41  ? 560  LYS A N     1 
ATOM   4586 C  CA    . LYS A 1 560 ? 8.379   46.603 19.926  1.00 32.65  ? 560  LYS A CA    1 
ATOM   4587 C  C     . LYS A 1 560 ? 7.753   47.652 20.837  1.00 30.04  ? 560  LYS A C     1 
ATOM   4588 O  O     . LYS A 1 560 ? 7.533   48.791 20.429  1.00 30.58  ? 560  LYS A O     1 
ATOM   4589 C  CB    . LYS A 1 560 ? 7.292   45.674 19.375  1.00 28.98  ? 560  LYS A CB    1 
ATOM   4590 C  CG    . LYS A 1 560 ? 6.064   46.429 18.863  1.00 34.20  ? 560  LYS A CG    1 
ATOM   4591 C  CD    . LYS A 1 560 ? 5.145   45.554 18.016  1.00 34.45  ? 560  LYS A CD    1 
ATOM   4592 C  CE    . LYS A 1 560 ? 4.513   44.438 18.831  1.00 31.97  ? 560  LYS A CE    1 
ATOM   4593 N  NZ    . LYS A 1 560 ? 3.412   43.777 18.076  1.00 36.31  ? 560  LYS A NZ    1 
ATOM   4594 N  N     . LEU A 1 561 ? 7.467   47.256 22.073  1.00 27.35  ? 561  LEU A N     1 
ATOM   4595 C  CA    . LEU A 1 561 ? 6.926   48.176 23.066  1.00 27.53  ? 561  LEU A CA    1 
ATOM   4596 C  C     . LEU A 1 561 ? 7.868   49.356 23.289  1.00 29.16  ? 561  LEU A C     1 
ATOM   4597 O  O     . LEU A 1 561 ? 7.431   50.502 23.384  1.00 33.26  ? 561  LEU A O     1 
ATOM   4598 C  CB    . LEU A 1 561 ? 6.679   47.451 24.390  1.00 25.63  ? 561  LEU A CB    1 
ATOM   4599 C  CG    . LEU A 1 561 ? 6.313   48.341 25.579  1.00 30.57  ? 561  LEU A CG    1 
ATOM   4600 C  CD1   . LEU A 1 561 ? 4.966   49.015 25.356  1.00 27.66  ? 561  LEU A CD1   1 
ATOM   4601 C  CD2   . LEU A 1 561 ? 6.321   47.546 26.882  1.00 30.80  ? 561  LEU A CD2   1 
ATOM   4602 N  N     . LEU A 1 562 ? 9.164   49.067 23.363  1.00 27.78  ? 562  LEU A N     1 
ATOM   4603 C  CA    . LEU A 1 562 ? 10.164  50.101 23.603  1.00 27.50  ? 562  LEU A CA    1 
ATOM   4604 C  C     . LEU A 1 562 ? 10.224  51.129 22.469  1.00 27.21  ? 562  LEU A C     1 
ATOM   4605 O  O     . LEU A 1 562 ? 10.254  52.334 22.723  1.00 30.79  ? 562  LEU A O     1 
ATOM   4606 C  CB    . LEU A 1 562 ? 11.545  49.477 23.839  1.00 29.82  ? 562  LEU A CB    1 
ATOM   4607 C  CG    . LEU A 1 562 ? 12.662  50.453 24.218  1.00 32.97  ? 562  LEU A CG    1 
ATOM   4608 C  CD1   . LEU A 1 562 ? 12.295  51.224 25.484  1.00 28.35  ? 562  LEU A CD1   1 
ATOM   4609 C  CD2   . LEU A 1 562 ? 13.993  49.730 24.388  1.00 33.58  ? 562  LEU A CD2   1 
ATOM   4610 N  N     . ILE A 1 563 ? 10.233  50.662 21.222  1.00 26.32  ? 563  ILE A N     1 
ATOM   4611 C  CA    . ILE A 1 563 ? 10.300  51.584 20.088  1.00 26.75  ? 563  ILE A CA    1 
ATOM   4612 C  C     . ILE A 1 563 ? 8.996   52.356 19.891  1.00 29.70  ? 563  ILE A C     1 
ATOM   4613 O  O     . ILE A 1 563 ? 9.017   53.528 19.518  1.00 30.43  ? 563  ILE A O     1 
ATOM   4614 C  CB    . ILE A 1 563 ? 10.734  50.892 18.768  1.00 27.68  ? 563  ILE A CB    1 
ATOM   4615 C  CG1   . ILE A 1 563 ? 9.808   49.726 18.423  1.00 26.03  ? 563  ILE A CG1   1 
ATOM   4616 C  CG2   . ILE A 1 563 ? 12.175  50.418 18.862  1.00 24.38  ? 563  ILE A CG2   1 
ATOM   4617 C  CD1   . ILE A 1 563 ? 10.159  49.043 17.115  1.00 24.60  ? 563  ILE A CD1   1 
ATOM   4618 N  N     . ASN A 1 564 ? 7.866   51.705 20.149  1.00 28.91  ? 564  ASN A N     1 
ATOM   4619 C  CA    . ASN A 1 564 ? 6.593   52.397 20.106  1.00 25.41  ? 564  ASN A CA    1 
ATOM   4620 C  C     . ASN A 1 564 ? 6.499   53.446 21.213  1.00 26.78  ? 564  ASN A C     1 
ATOM   4621 O  O     . ASN A 1 564 ? 5.837   54.475 21.057  1.00 27.13  ? 564  ASN A O     1 
ATOM   4622 C  CB    . ASN A 1 564 ? 5.427   51.408 20.184  1.00 26.77  ? 564  ASN A CB    1 
ATOM   4623 C  CG    . ASN A 1 564 ? 5.209   50.674 18.874  1.00 28.82  ? 564  ASN A CG    1 
ATOM   4624 O  OD1   . ASN A 1 564 ? 5.783   51.042 17.860  1.00 30.46  ? 564  ASN A OD1   1 
ATOM   4625 N  ND2   . ASN A 1 564 ? 4.375   49.640 18.888  1.00 26.53  ? 564  ASN A ND2   1 
ATOM   4626 N  N     . SER A 1 565 ? 7.178   53.182 22.324  1.00 26.35  ? 565  SER A N     1 
ATOM   4627 C  CA    . SER A 1 565 ? 7.211   54.123 23.439  1.00 26.03  ? 565  SER A CA    1 
ATOM   4628 C  C     . SER A 1 565 ? 8.110   55.320 23.140  1.00 24.87  ? 565  SER A C     1 
ATOM   4629 O  O     . SER A 1 565 ? 7.952   56.373 23.745  1.00 29.45  ? 565  SER A O     1 
ATOM   4630 C  CB    . SER A 1 565 ? 7.664   53.427 24.718  1.00 24.50  ? 565  SER A CB    1 
ATOM   4631 O  OG    . SER A 1 565 ? 6.702   52.469 25.117  1.00 27.24  ? 565  SER A OG    1 
ATOM   4632 N  N     . LEU A 1 566 ? 9.057   55.154 22.220  1.00 23.56  ? 566  LEU A N     1 
ATOM   4633 C  CA    . LEU A 1 566 ? 9.826   56.298 21.737  1.00 25.40  ? 566  LEU A CA    1 
ATOM   4634 C  C     . LEU A 1 566 ? 8.887   57.235 20.984  1.00 27.52  ? 566  LEU A C     1 
ATOM   4635 O  O     . LEU A 1 566 ? 8.941   58.451 21.181  1.00 28.33  ? 566  LEU A O     1 
ATOM   4636 C  CB    . LEU A 1 566 ? 11.009  55.881 20.861  1.00 28.07  ? 566  LEU A CB    1 
ATOM   4637 C  CG    . LEU A 1 566 ? 11.841  57.015 20.238  1.00 26.95  ? 566  LEU A CG    1 
ATOM   4638 C  CD1   . LEU A 1 566 ? 12.236  58.074 21.268  1.00 28.09  ? 566  LEU A CD1   1 
ATOM   4639 C  CD2   . LEU A 1 566 ? 13.076  56.436 19.588  1.00 25.31  ? 566  LEU A CD2   1 
ATOM   4640 N  N     . TYR A 1 567 ? 8.010   56.677 20.145  1.00 28.91  ? 567  TYR A N     1 
ATOM   4641 C  CA    . TYR A 1 567 ? 6.947   57.497 19.550  1.00 28.91  ? 567  TYR A CA    1 
ATOM   4642 C  C     . TYR A 1 567 ? 6.148   58.195 20.657  1.00 26.25  ? 567  TYR A C     1 
ATOM   4643 O  O     . TYR A 1 567 ? 5.919   59.404 20.605  1.00 27.47  ? 567  TYR A O     1 
ATOM   4644 C  CB    . TYR A 1 567 ? 5.977   56.690 18.666  1.00 28.76  ? 567  TYR A CB    1 
ATOM   4645 C  CG    . TYR A 1 567 ? 4.589   57.281 18.752  1.00 28.32  ? 567  TYR A CG    1 
ATOM   4646 C  CD1   . TYR A 1 567 ? 4.300   58.505 18.147  1.00 25.70  ? 567  TYR A CD1   1 
ATOM   4647 C  CD2   . TYR A 1 567 ? 3.587   56.662 19.491  1.00 29.58  ? 567  TYR A CD2   1 
ATOM   4648 C  CE1   . TYR A 1 567 ? 3.062   59.085 18.268  1.00 29.20  ? 567  TYR A CE1   1 
ATOM   4649 C  CE2   . TYR A 1 567 ? 2.331   57.234 19.606  1.00 31.11  ? 567  TYR A CE2   1 
ATOM   4650 C  CZ    . TYR A 1 567 ? 2.080   58.450 18.990  1.00 30.29  ? 567  TYR A CZ    1 
ATOM   4651 O  OH    . TYR A 1 567 ? 0.850   59.043 19.098  1.00 32.61  ? 567  TYR A OH    1 
ATOM   4652 N  N     . GLY A 1 568 ? 5.726   57.423 21.655  1.00 28.12  ? 568  GLY A N     1 
ATOM   4653 C  CA    . GLY A 1 568 ? 4.875   57.947 22.703  1.00 28.74  ? 568  GLY A CA    1 
ATOM   4654 C  C     . GLY A 1 568 ? 5.570   59.039 23.489  1.00 28.33  ? 568  GLY A C     1 
ATOM   4655 O  O     . GLY A 1 568 ? 4.962   60.050 23.844  1.00 28.73  ? 568  GLY A O     1 
ATOM   4656 N  N     . ALA A 1 569 ? 6.854   58.828 23.755  1.00 29.44  ? 569  ALA A N     1 
ATOM   4657 C  CA    . ALA A 1 569 ? 7.661   59.781 24.514  1.00 26.51  ? 569  ALA A CA    1 
ATOM   4658 C  C     . ALA A 1 569 ? 7.682   61.170 23.866  1.00 27.24  ? 569  ALA A C     1 
ATOM   4659 O  O     . ALA A 1 569 ? 7.708   62.185 24.560  1.00 30.59  ? 569  ALA A O     1 
ATOM   4660 C  CB    . ALA A 1 569 ? 9.069   59.246 24.679  1.00 22.43  ? 569  ALA A CB    1 
ATOM   4661 N  N     . LEU A 1 570 ? 7.639   61.214 22.539  1.00 26.07  ? 570  LEU A N     1 
ATOM   4662 C  CA    . LEU A 1 570 ? 7.568   62.483 21.813  1.00 29.49  ? 570  LEU A CA    1 
ATOM   4663 C  C     . LEU A 1 570 ? 6.305   63.267 22.174  1.00 29.08  ? 570  LEU A C     1 
ATOM   4664 O  O     . LEU A 1 570 ? 6.226   64.473 21.940  1.00 30.59  ? 570  LEU A O     1 
ATOM   4665 C  CB    . LEU A 1 570 ? 7.620   62.248 20.301  1.00 29.92  ? 570  LEU A CB    1 
ATOM   4666 C  CG    . LEU A 1 570 ? 8.912   61.669 19.718  1.00 32.42  ? 570  LEU A CG    1 
ATOM   4667 C  CD1   . LEU A 1 570 ? 8.690   61.213 18.282  1.00 32.24  ? 570  LEU A CD1   1 
ATOM   4668 C  CD2   . LEU A 1 570 ? 10.050  62.680 19.788  1.00 30.96  ? 570  LEU A CD2   1 
ATOM   4669 N  N     . GLY A 1 571 ? 5.323   62.575 22.746  1.00 27.29  ? 571  GLY A N     1 
ATOM   4670 C  CA    . GLY A 1 571 ? 4.090   63.206 23.177  1.00 26.20  ? 571  GLY A CA    1 
ATOM   4671 C  C     . GLY A 1 571 ? 3.964   63.325 24.688  1.00 30.76  ? 571  GLY A C     1 
ATOM   4672 O  O     . GLY A 1 571 ? 2.882   63.615 25.202  1.00 32.65  ? 571  GLY A O     1 
ATOM   4673 N  N     . ASN A 1 572 ? 5.065   63.096 25.401  1.00 25.90  ? 572  ASN A N     1 
ATOM   4674 C  CA    . ASN A 1 572 ? 5.085   63.257 26.855  1.00 27.33  ? 572  ASN A CA    1 
ATOM   4675 C  C     . ASN A 1 572 ? 5.974   64.422 27.275  1.00 27.85  ? 572  ASN A C     1 
ATOM   4676 O  O     . ASN A 1 572 ? 7.141   64.487 26.895  1.00 27.47  ? 572  ASN A O     1 
ATOM   4677 C  CB    . ASN A 1 572 ? 5.548   61.971 27.543  1.00 28.16  ? 572  ASN A CB    1 
ATOM   4678 C  CG    . ASN A 1 572 ? 5.505   62.074 29.056  1.00 33.30  ? 572  ASN A CG    1 
ATOM   4679 O  OD1   . ASN A 1 572 ? 6.400   62.647 29.678  1.00 31.29  ? 572  ASN A OD1   1 
ATOM   4680 N  ND2   . ASN A 1 572 ? 4.460   61.515 29.656  1.00 35.16  ? 572  ASN A ND2   1 
ATOM   4681 N  N     . VAL A 1 573 ? 5.418   65.335 28.068  1.00 30.68  ? 573  VAL A N     1 
ATOM   4682 C  CA    . VAL A 1 573 ? 6.093   66.590 28.404  1.00 31.28  ? 573  VAL A CA    1 
ATOM   4683 C  C     . VAL A 1 573 ? 7.383   66.411 29.202  1.00 31.82  ? 573  VAL A C     1 
ATOM   4684 O  O     . VAL A 1 573 ? 8.195   67.331 29.286  1.00 33.23  ? 573  VAL A O     1 
ATOM   4685 C  CB    . VAL A 1 573 ? 5.160   67.549 29.177  1.00 31.97  ? 573  VAL A CB    1 
ATOM   4686 C  CG1   . VAL A 1 573 ? 3.940   67.904 28.335  1.00 29.71  ? 573  VAL A CG1   1 
ATOM   4687 C  CG2   . VAL A 1 573 ? 4.741   66.934 30.503  1.00 31.63  ? 573  VAL A CG2   1 
ATOM   4688 N  N     . TRP A 1 574 ? 7.572   65.230 29.782  1.00 34.52  ? 574  TRP A N     1 
ATOM   4689 C  CA    . TRP A 1 574 ? 8.755   64.962 30.597  1.00 30.21  ? 574  TRP A CA    1 
ATOM   4690 C  C     . TRP A 1 574 ? 9.918   64.412 29.778  1.00 30.79  ? 574  TRP A C     1 
ATOM   4691 O  O     . TRP A 1 574 ? 11.009  64.191 30.302  1.00 34.23  ? 574  TRP A O     1 
ATOM   4692 C  CB    . TRP A 1 574 ? 8.408   64.020 31.751  1.00 28.64  ? 574  TRP A CB    1 
ATOM   4693 C  CG    . TRP A 1 574 ? 7.441   64.633 32.705  1.00 34.79  ? 574  TRP A CG    1 
ATOM   4694 C  CD1   . TRP A 1 574 ? 6.106   64.376 32.802  1.00 38.29  ? 574  TRP A CD1   1 
ATOM   4695 C  CD2   . TRP A 1 574 ? 7.729   65.640 33.683  1.00 40.39  ? 574  TRP A CD2   1 
ATOM   4696 N  NE1   . TRP A 1 574 ? 5.546   65.149 33.791  1.00 41.37  ? 574  TRP A NE1   1 
ATOM   4697 C  CE2   . TRP A 1 574 ? 6.521   65.935 34.346  1.00 42.64  ? 574  TRP A CE2   1 
ATOM   4698 C  CE3   . TRP A 1 574 ? 8.892   66.315 34.067  1.00 42.70  ? 574  TRP A CE3   1 
ATOM   4699 C  CZ2   . TRP A 1 574 ? 6.443   66.874 35.371  1.00 46.60  ? 574  TRP A CZ2   1 
ATOM   4700 C  CZ3   . TRP A 1 574 ? 8.812   67.248 35.085  1.00 45.60  ? 574  TRP A CZ3   1 
ATOM   4701 C  CH2   . TRP A 1 574 ? 7.596   67.519 35.725  1.00 47.88  ? 574  TRP A CH2   1 
ATOM   4702 N  N     . PHE A 1 575 ? 9.677   64.204 28.490  1.00 28.78  ? 575  PHE A N     1 
ATOM   4703 C  CA    . PHE A 1 575 ? 10.701  63.704 27.583  1.00 29.43  ? 575  PHE A CA    1 
ATOM   4704 C  C     . PHE A 1 575 ? 11.553  64.866 27.083  1.00 27.57  ? 575  PHE A C     1 
ATOM   4705 O  O     . PHE A 1 575 ? 11.027  65.910 26.699  1.00 31.41  ? 575  PHE A O     1 
ATOM   4706 C  CB    . PHE A 1 575 ? 10.038  62.977 26.415  1.00 29.98  ? 575  PHE A CB    1 
ATOM   4707 C  CG    . PHE A 1 575 ? 10.994  62.222 25.535  1.00 28.93  ? 575  PHE A CG    1 
ATOM   4708 C  CD1   . PHE A 1 575 ? 11.926  61.352 26.079  1.00 28.94  ? 575  PHE A CD1   1 
ATOM   4709 C  CD2   . PHE A 1 575 ? 10.934  62.357 24.156  1.00 25.80  ? 575  PHE A CD2   1 
ATOM   4710 C  CE1   . PHE A 1 575 ? 12.797  60.648 25.263  1.00 27.48  ? 575  PHE A CE1   1 
ATOM   4711 C  CE2   . PHE A 1 575 ? 11.795  61.654 23.336  1.00 26.78  ? 575  PHE A CE2   1 
ATOM   4712 C  CZ    . PHE A 1 575 ? 12.732  60.799 23.891  1.00 27.63  ? 575  PHE A CZ    1 
ATOM   4713 N  N     . ARG A 1 576 ? 12.869  64.682 27.097  1.00 32.30  ? 576  ARG A N     1 
ATOM   4714 C  CA    . ARG A 1 576 ? 13.808  65.729 26.704  1.00 30.91  ? 576  ARG A CA    1 
ATOM   4715 C  C     . ARG A 1 576 ? 13.562  66.216 25.276  1.00 33.66  ? 576  ARG A C     1 
ATOM   4716 O  O     . ARG A 1 576 ? 13.839  67.370 24.946  1.00 35.46  ? 576  ARG A O     1 
ATOM   4717 C  CB    . ARG A 1 576 ? 15.247  65.223 26.851  1.00 31.15  ? 576  ARG A CB    1 
ATOM   4718 C  CG    . ARG A 1 576 ? 16.317  66.292 26.680  1.00 32.72  ? 576  ARG A CG    1 
ATOM   4719 C  CD    . ARG A 1 576 ? 17.716  65.695 26.717  1.00 27.28  ? 576  ARG A CD    1 
ATOM   4720 N  NE    . ARG A 1 576 ? 17.968  64.948 27.947  1.00 27.63  ? 576  ARG A NE    1 
ATOM   4721 C  CZ    . ARG A 1 576 ? 18.429  65.487 29.072  1.00 31.75  ? 576  ARG A CZ    1 
ATOM   4722 N  NH1   . ARG A 1 576 ? 18.697  66.786 29.134  1.00 33.96  ? 576  ARG A NH1   1 
ATOM   4723 N  NH2   . ARG A 1 576 ? 18.626  64.724 30.140  1.00 32.43  ? 576  ARG A NH2   1 
ATOM   4724 N  N     . TYR A 1 577 ? 13.024  65.334 24.438  1.00 34.35  ? 577  TYR A N     1 
ATOM   4725 C  CA    . TYR A 1 577 ? 12.791  65.650 23.032  1.00 31.14  ? 577  TYR A CA    1 
ATOM   4726 C  C     . TYR A 1 577 ? 11.301  65.689 22.710  1.00 31.39  ? 577  TYR A C     1 
ATOM   4727 O  O     . TYR A 1 577 ? 10.883  65.403 21.586  1.00 32.83  ? 577  TYR A O     1 
ATOM   4728 C  CB    . TYR A 1 577 ? 13.523  64.646 22.138  1.00 27.91  ? 577  TYR A CB    1 
ATOM   4729 C  CG    . TYR A 1 577 ? 14.972  64.469 22.537  1.00 24.46  ? 577  TYR A CG    1 
ATOM   4730 C  CD1   . TYR A 1 577 ? 15.365  63.407 23.340  1.00 26.79  ? 577  TYR A CD1   1 
ATOM   4731 C  CD2   . TYR A 1 577 ? 15.938  65.382 22.138  1.00 28.90  ? 577  TYR A CD2   1 
ATOM   4732 C  CE1   . TYR A 1 577 ? 16.683  63.248 23.721  1.00 28.73  ? 577  TYR A CE1   1 
ATOM   4733 C  CE2   . TYR A 1 577 ? 17.261  65.234 22.512  1.00 29.46  ? 577  TYR A CE2   1 
ATOM   4734 C  CZ    . TYR A 1 577 ? 17.628  64.165 23.303  1.00 30.60  ? 577  TYR A CZ    1 
ATOM   4735 O  OH    . TYR A 1 577 ? 18.940  64.012 23.678  1.00 32.99  ? 577  TYR A OH    1 
ATOM   4736 N  N     . TYR A 1 578 ? 10.508  66.040 23.717  1.00 27.64  ? 578  TYR A N     1 
ATOM   4737 C  CA    . TYR A 1 578 ? 9.079   66.269 23.544  1.00 28.18  ? 578  TYR A CA    1 
ATOM   4738 C  C     . TYR A 1 578 ? 8.838   67.287 22.438  1.00 30.25  ? 578  TYR A C     1 
ATOM   4739 O  O     . TYR A 1 578 ? 9.503   68.320 22.388  1.00 30.46  ? 578  TYR A O     1 
ATOM   4740 C  CB    . TYR A 1 578 ? 8.477   66.773 24.857  1.00 28.05  ? 578  TYR A CB    1 
ATOM   4741 C  CG    . TYR A 1 578 ? 7.056   67.276 24.757  1.00 29.72  ? 578  TYR A CG    1 
ATOM   4742 C  CD1   . TYR A 1 578 ? 6.779   68.639 24.748  1.00 32.62  ? 578  TYR A CD1   1 
ATOM   4743 C  CD2   . TYR A 1 578 ? 5.989   66.390 24.683  1.00 28.64  ? 578  TYR A CD2   1 
ATOM   4744 C  CE1   . TYR A 1 578 ? 5.474   69.104 24.664  1.00 34.51  ? 578  TYR A CE1   1 
ATOM   4745 C  CE2   . TYR A 1 578 ? 4.685   66.845 24.599  1.00 30.19  ? 578  TYR A CE2   1 
ATOM   4746 C  CZ    . TYR A 1 578 ? 4.433   68.200 24.591  1.00 30.78  ? 578  TYR A CZ    1 
ATOM   4747 O  OH    . TYR A 1 578 ? 3.134   68.648 24.508  1.00 32.31  ? 578  TYR A OH    1 
ATOM   4748 N  N     . ASP A 1 579 ? 7.897   66.981 21.548  1.00 33.31  ? 579  ASP A N     1 
ATOM   4749 C  CA    . ASP A 1 579 ? 7.556   67.872 20.443  1.00 33.66  ? 579  ASP A CA    1 
ATOM   4750 C  C     . ASP A 1 579 ? 6.296   67.384 19.736  1.00 32.41  ? 579  ASP A C     1 
ATOM   4751 O  O     . ASP A 1 579 ? 6.337   66.408 18.989  1.00 29.04  ? 579  ASP A O     1 
ATOM   4752 C  CB    . ASP A 1 579 ? 8.710   67.948 19.440  1.00 33.26  ? 579  ASP A CB    1 
ATOM   4753 C  CG    . ASP A 1 579 ? 8.601   69.145 18.514  1.00 32.28  ? 579  ASP A CG    1 
ATOM   4754 O  OD1   . ASP A 1 579 ? 9.651   69.640 18.053  1.00 34.35  ? 579  ASP A OD1   1 
ATOM   4755 O  OD2   . ASP A 1 579 ? 7.468   69.596 18.252  1.00 31.77  ? 579  ASP A OD2   1 
ATOM   4756 N  N     . LEU A 1 580 ? 5.180   68.072 19.961  1.00 32.44  ? 580  LEU A N     1 
ATOM   4757 C  CA    . LEU A 1 580 ? 3.912   67.674 19.353  1.00 31.82  ? 580  LEU A CA    1 
ATOM   4758 C  C     . LEU A 1 580 ? 3.921   67.804 17.833  1.00 31.34  ? 580  LEU A C     1 
ATOM   4759 O  O     . LEU A 1 580 ? 3.094   67.199 17.158  1.00 31.58  ? 580  LEU A O     1 
ATOM   4760 C  CB    . LEU A 1 580 ? 2.740   68.463 19.944  1.00 32.89  ? 580  LEU A CB    1 
ATOM   4761 C  CG    . LEU A 1 580 ? 2.418   68.164 21.408  1.00 34.53  ? 580  LEU A CG    1 
ATOM   4762 C  CD1   . LEU A 1 580 ? 1.129   68.851 21.828  1.00 36.91  ? 580  LEU A CD1   1 
ATOM   4763 C  CD2   . LEU A 1 580 ? 2.335   66.666 21.636  1.00 34.72  ? 580  LEU A CD2   1 
ATOM   4764 N  N     . ARG A 1 581 ? 4.848   68.593 17.296  1.00 29.92  ? 581  ARG A N     1 
ATOM   4765 C  CA    . ARG A 1 581 ? 4.997   68.694 15.847  1.00 34.97  ? 581  ARG A CA    1 
ATOM   4766 C  C     . ARG A 1 581 ? 5.420   67.349 15.272  1.00 32.44  ? 581  ARG A C     1 
ATOM   4767 O  O     . ARG A 1 581 ? 4.896   66.906 14.250  1.00 29.94  ? 581  ARG A O     1 
ATOM   4768 C  CB    . ARG A 1 581 ? 6.023   69.762 15.463  1.00 32.99  ? 581  ARG A CB    1 
ATOM   4769 C  CG    . ARG A 1 581 ? 5.603   71.190 15.775  1.00 38.44  ? 581  ARG A CG    1 
ATOM   4770 C  CD    . ARG A 1 581 ? 6.724   72.163 15.426  1.00 37.17  ? 581  ARG A CD    1 
ATOM   4771 N  NE    . ARG A 1 581 ? 7.939   71.876 16.185  1.00 37.16  ? 581  ARG A NE    1 
ATOM   4772 C  CZ    . ARG A 1 581 ? 9.098   72.505 16.006  1.00 36.66  ? 581  ARG A CZ    1 
ATOM   4773 N  NH1   . ARG A 1 581 ? 9.205   73.451 15.084  1.00 32.63  ? 581  ARG A NH1   1 
ATOM   4774 N  NH2   . ARG A 1 581 ? 10.153  72.184 16.743  1.00 32.84  ? 581  ARG A NH2   1 
ATOM   4775 N  N     . ASN A 1 582 ? 6.374   66.705 15.939  1.00 30.16  ? 582  ASN A N     1 
ATOM   4776 C  CA    . ASN A 1 582 ? 6.864   65.402 15.514  1.00 28.24  ? 582  ASN A CA    1 
ATOM   4777 C  C     . ASN A 1 582 ? 5.870   64.282 15.822  1.00 30.04  ? 582  ASN A C     1 
ATOM   4778 O  O     . ASN A 1 582 ? 5.674   63.371 15.012  1.00 29.89  ? 582  ASN A O     1 
ATOM   4779 C  CB    . ASN A 1 582 ? 8.222   65.101 16.155  1.00 30.36  ? 582  ASN A CB    1 
ATOM   4780 C  CG    . ASN A 1 582 ? 9.352   65.904 15.532  1.00 32.18  ? 582  ASN A CG    1 
ATOM   4781 O  OD1   . ASN A 1 582 ? 9.224   66.419 14.420  1.00 29.29  ? 582  ASN A OD1   1 
ATOM   4782 N  ND2   . ASN A 1 582 ? 10.468  66.006 16.243  1.00 32.49  ? 582  ASN A ND2   1 
ATOM   4783 N  N     . ALA A 1 583 ? 5.241   64.355 16.992  1.00 28.53  ? 583  ALA A N     1 
ATOM   4784 C  CA    . ALA A 1 583 ? 4.262   63.348 17.389  1.00 31.51  ? 583  ALA A CA    1 
ATOM   4785 C  C     . ALA A 1 583 ? 3.067   63.352 16.439  1.00 30.66  ? 583  ALA A C     1 
ATOM   4786 O  O     . ALA A 1 583 ? 2.594   62.297 16.018  1.00 30.94  ? 583  ALA A O     1 
ATOM   4787 C  CB    . ALA A 1 583 ? 3.808   63.580 18.825  1.00 28.60  ? 583  ALA A CB    1 
ATOM   4788 N  N     . THR A 1 584 ? 2.593   64.545 16.098  1.00 26.39  ? 584  THR A N     1 
ATOM   4789 C  CA    . THR A 1 584 ? 1.468   64.691 15.185  1.00 28.96  ? 584  THR A CA    1 
ATOM   4790 C  C     . THR A 1 584 ? 1.865   64.341 13.752  1.00 30.48  ? 584  THR A C     1 
ATOM   4791 O  O     . THR A 1 584 ? 1.061   63.796 12.995  1.00 30.86  ? 584  THR A O     1 
ATOM   4792 C  CB    . THR A 1 584 ? 0.884   66.116 15.242  1.00 33.47  ? 584  THR A CB    1 
ATOM   4793 O  OG1   . THR A 1 584 ? 0.460   66.396 16.582  1.00 32.62  ? 584  THR A OG1   1 
ATOM   4794 C  CG2   . THR A 1 584 ? -0.303  66.257 14.308  1.00 34.76  ? 584  THR A CG2   1 
ATOM   4795 N  N     . ALA A 1 585 ? 3.108   64.646 13.387  1.00 28.68  ? 585  ALA A N     1 
ATOM   4796 C  CA    . ALA A 1 585 ? 3.621   64.290 12.066  1.00 29.93  ? 585  ALA A CA    1 
ATOM   4797 C  C     . ALA A 1 585 ? 3.516   62.787 11.842  1.00 30.48  ? 585  ALA A C     1 
ATOM   4798 O  O     . ALA A 1 585 ? 3.186   62.332 10.748  1.00 31.34  ? 585  ALA A O     1 
ATOM   4799 C  CB    . ALA A 1 585 ? 5.062   64.750 11.907  1.00 26.03  ? 585  ALA A CB    1 
ATOM   4800 N  N     . ILE A 1 586 ? 3.790   62.026 12.896  1.00 29.36  ? 586  ILE A N     1 
ATOM   4801 C  CA    . ILE A 1 586 ? 3.712   60.573 12.843  1.00 29.54  ? 586  ILE A CA    1 
ATOM   4802 C  C     . ILE A 1 586 ? 2.275   60.071 12.688  1.00 28.50  ? 586  ILE A C     1 
ATOM   4803 O  O     . ILE A 1 586 ? 1.972   59.331 11.751  1.00 26.31  ? 586  ILE A O     1 
ATOM   4804 C  CB    . ILE A 1 586 ? 4.348   59.945 14.098  1.00 26.97  ? 586  ILE A CB    1 
ATOM   4805 C  CG1   . ILE A 1 586 ? 5.846   60.261 14.143  1.00 25.76  ? 586  ILE A CG1   1 
ATOM   4806 C  CG2   . ILE A 1 586 ? 4.116   58.446 14.119  1.00 25.00  ? 586  ILE A CG2   1 
ATOM   4807 C  CD1   . ILE A 1 586 ? 6.469   60.087 15.511  1.00 21.84  ? 586  ILE A CD1   1 
ATOM   4808 N  N     . THR A 1 587 ? 1.393   60.476 13.600  1.00 27.77  ? 587  THR A N     1 
ATOM   4809 C  CA    . THR A 1 587 ? 0.015   59.982 13.590  1.00 30.07  ? 587  THR A CA    1 
ATOM   4810 C  C     . THR A 1 587 ? -0.782  60.435 12.365  1.00 31.18  ? 587  THR A C     1 
ATOM   4811 O  O     . THR A 1 587 ? -1.599  59.677 11.839  1.00 29.64  ? 587  THR A O     1 
ATOM   4812 C  CB    . THR A 1 587 ? -0.762  60.378 14.865  1.00 30.18  ? 587  THR A CB    1 
ATOM   4813 O  OG1   . THR A 1 587 ? -0.938  61.800 14.907  1.00 27.92  ? 587  THR A OG1   1 
ATOM   4814 C  CG2   . THR A 1 587 ? -0.025  59.913 16.115  1.00 25.94  ? 587  THR A CG2   1 
ATOM   4815 N  N     . THR A 1 588 ? -0.546  61.665 11.914  1.00 31.18  ? 588  THR A N     1 
ATOM   4816 C  CA    . THR A 1 588 ? -1.256  62.195 10.753  1.00 33.28  ? 588  THR A CA    1 
ATOM   4817 C  C     . THR A 1 588 ? -0.832  61.475 9.476   1.00 33.04  ? 588  THR A C     1 
ATOM   4818 O  O     . THR A 1 588 ? -1.668  61.137 8.638   1.00 31.99  ? 588  THR A O     1 
ATOM   4819 C  CB    . THR A 1 588 ? -1.030  63.708 10.583  1.00 35.12  ? 588  THR A CB    1 
ATOM   4820 O  OG1   . THR A 1 588 ? -1.318  64.379 11.816  1.00 33.37  ? 588  THR A OG1   1 
ATOM   4821 C  CG2   . THR A 1 588 ? -1.932  64.262 9.487   1.00 35.96  ? 588  THR A CG2   1 
ATOM   4822 N  N     . PHE A 1 589 ? 0.473   61.255 9.332   1.00 30.04  ? 589  PHE A N     1 
ATOM   4823 C  CA    . PHE A 1 589 ? 1.009   60.466 8.228   1.00 31.70  ? 589  PHE A CA    1 
ATOM   4824 C  C     . PHE A 1 589 ? 0.370   59.081 8.243   1.00 33.48  ? 589  PHE A C     1 
ATOM   4825 O  O     . PHE A 1 589 ? 0.034   58.529 7.196   1.00 33.56  ? 589  PHE A O     1 
ATOM   4826 C  CB    . PHE A 1 589 ? 2.531   60.339 8.362   1.00 30.36  ? 589  PHE A CB    1 
ATOM   4827 C  CG    . PHE A 1 589 ? 3.202   59.650 7.198   1.00 34.96  ? 589  PHE A CG    1 
ATOM   4828 C  CD1   . PHE A 1 589 ? 3.265   58.264 7.132   1.00 34.97  ? 589  PHE A CD1   1 
ATOM   4829 C  CD2   . PHE A 1 589 ? 3.796   60.391 6.188   1.00 32.43  ? 589  PHE A CD2   1 
ATOM   4830 C  CE1   . PHE A 1 589 ? 3.890   57.633 6.072   1.00 34.53  ? 589  PHE A CE1   1 
ATOM   4831 C  CE2   . PHE A 1 589 ? 4.422   59.766 5.125   1.00 33.65  ? 589  PHE A CE2   1 
ATOM   4832 C  CZ    . PHE A 1 589 ? 4.469   58.386 5.066   1.00 37.30  ? 589  PHE A CZ    1 
ATOM   4833 N  N     . GLY A 1 590 ? 0.208   58.529 9.443   1.00 31.18  ? 590  GLY A N     1 
ATOM   4834 C  CA    . GLY A 1 590 ? -0.388  57.217 9.610   1.00 30.08  ? 590  GLY A CA    1 
ATOM   4835 C  C     . GLY A 1 590 ? -1.835  57.177 9.162   1.00 33.51  ? 590  GLY A C     1 
ATOM   4836 O  O     . GLY A 1 590 ? -2.270  56.212 8.532   1.00 35.48  ? 590  GLY A O     1 
ATOM   4837 N  N     . GLN A 1 591 ? -2.585  58.225 9.490   1.00 29.68  ? 591  GLN A N     1 
ATOM   4838 C  CA    . GLN A 1 591 ? -3.968  58.334 9.039   1.00 31.42  ? 591  GLN A CA    1 
ATOM   4839 C  C     . GLN A 1 591 ? -4.031  58.366 7.516   1.00 37.04  ? 591  GLN A C     1 
ATOM   4840 O  O     . GLN A 1 591 ? -4.884  57.717 6.906   1.00 38.36  ? 591  GLN A O     1 
ATOM   4841 C  CB    . GLN A 1 591 ? -4.632  59.586 9.609   1.00 34.18  ? 591  GLN A CB    1 
ATOM   4842 C  CG    . GLN A 1 591 ? -4.934  59.517 11.097  1.00 36.31  ? 591  GLN A CG    1 
ATOM   4843 C  CD    . GLN A 1 591 ? -6.161  60.329 11.464  1.00 38.00  ? 591  GLN A CD    1 
ATOM   4844 O  OE1   . GLN A 1 591 ? -6.955  60.692 10.598  1.00 40.20  ? 591  GLN A OE1   1 
ATOM   4845 N  NE2   . GLN A 1 591 ? -6.323  60.619 12.751  1.00 35.48  ? 591  GLN A NE2   1 
ATOM   4846 N  N     . MET A 1 592 ? -3.123  59.126 6.911   1.00 32.86  ? 592  MET A N     1 
ATOM   4847 C  CA    . MET A 1 592 ? -3.044  59.215 5.459   1.00 33.74  ? 592  MET A CA    1 
ATOM   4848 C  C     . MET A 1 592 ? -2.743  57.855 4.847   1.00 32.72  ? 592  MET A C     1 
ATOM   4849 O  O     . MET A 1 592 ? -3.446  57.410 3.944   1.00 33.85  ? 592  MET A O     1 
ATOM   4850 C  CB    . MET A 1 592 ? -1.967  60.213 5.034   1.00 33.29  ? 592  MET A CB    1 
ATOM   4851 C  CG    . MET A 1 592 ? -1.803  60.317 3.525   1.00 38.23  ? 592  MET A CG    1 
ATOM   4852 S  SD    . MET A 1 592 ? -0.434  61.380 3.035   1.00 41.05  ? 592  MET A SD    1 
ATOM   4853 C  CE    . MET A 1 592 ? 0.962   60.456 3.670   1.00 42.03  ? 592  MET A CE    1 
ATOM   4854 N  N     . ALA A 1 593 ? -1.698  57.202 5.354   1.00 30.87  ? 593  ALA A N     1 
ATOM   4855 C  CA    . ALA A 1 593 ? -1.247  55.915 4.827   1.00 34.02  ? 593  ALA A CA    1 
ATOM   4856 C  C     . ALA A 1 593 ? -2.349  54.857 4.811   1.00 36.74  ? 593  ALA A C     1 
ATOM   4857 O  O     . ALA A 1 593 ? -2.524  54.153 3.817   1.00 37.45  ? 593  ALA A O     1 
ATOM   4858 C  CB    . ALA A 1 593 ? -0.040  55.412 5.612   1.00 30.21  ? 593  ALA A CB    1 
ATOM   4859 N  N     . LEU A 1 594 ? -3.085  54.748 5.913   1.00 36.41  ? 594  LEU A N     1 
ATOM   4860 C  CA    . LEU A 1 594 ? -4.172  53.779 6.013   1.00 36.20  ? 594  LEU A CA    1 
ATOM   4861 C  C     . LEU A 1 594 ? -5.250  54.034 4.965   1.00 37.29  ? 594  LEU A C     1 
ATOM   4862 O  O     . LEU A 1 594 ? -5.639  53.131 4.225   1.00 41.39  ? 594  LEU A O     1 
ATOM   4863 C  CB    . LEU A 1 594 ? -4.797  53.809 7.409   1.00 33.38  ? 594  LEU A CB    1 
ATOM   4864 C  CG    . LEU A 1 594 ? -6.098  53.012 7.544   1.00 38.02  ? 594  LEU A CG    1 
ATOM   4865 C  CD1   . LEU A 1 594 ? -5.849  51.544 7.241   1.00 38.09  ? 594  LEU A CD1   1 
ATOM   4866 C  CD2   . LEU A 1 594 ? -6.715  53.187 8.924   1.00 39.29  ? 594  LEU A CD2   1 
ATOM   4867 N  N     . GLN A 1 595 ? -5.727  55.270 4.903   1.00 37.32  ? 595  GLN A N     1 
ATOM   4868 C  CA    . GLN A 1 595 ? -6.813  55.615 3.995   1.00 41.01  ? 595  GLN A CA    1 
ATOM   4869 C  C     . GLN A 1 595 ? -6.343  55.740 2.543   1.00 42.39  ? 595  GLN A C     1 
ATOM   4870 O  O     . GLN A 1 595 ? -7.145  55.638 1.616   1.00 45.63  ? 595  GLN A O     1 
ATOM   4871 C  CB    . GLN A 1 595 ? -7.527  56.879 4.481   1.00 38.53  ? 595  GLN A CB    1 
ATOM   4872 C  CG    . GLN A 1 595 ? -8.145  56.704 5.868   1.00 37.00  ? 595  GLN A CG    1 
ATOM   4873 C  CD    . GLN A 1 595 ? -8.776  57.970 6.409   1.00 40.64  ? 595  GLN A CD    1 
ATOM   4874 O  OE1   . GLN A 1 595 ? -9.917  58.298 6.083   1.00 47.26  ? 595  GLN A OE1   1 
ATOM   4875 N  NE2   . GLN A 1 595 ? -8.038  58.686 7.249   1.00 38.78  ? 595  GLN A NE2   1 
ATOM   4876 N  N     . TRP A 1 596 ? -5.042  55.948 2.354   1.00 40.49  ? 596  TRP A N     1 
ATOM   4877 C  CA    . TRP A 1 596 ? -4.447  55.927 1.019   1.00 38.99  ? 596  TRP A CA    1 
ATOM   4878 C  C     . TRP A 1 596 ? -4.454  54.503 0.477   1.00 40.08  ? 596  TRP A C     1 
ATOM   4879 O  O     . TRP A 1 596 ? -4.831  54.268 -0.670  1.00 39.58  ? 596  TRP A O     1 
ATOM   4880 C  CB    . TRP A 1 596 ? -3.012  56.472 1.058   1.00 36.18  ? 596  TRP A CB    1 
ATOM   4881 C  CG    . TRP A 1 596 ? -2.229  56.322 -0.222  1.00 39.32  ? 596  TRP A CG    1 
ATOM   4882 C  CD1   . TRP A 1 596 ? -1.632  55.186 -0.691  1.00 42.32  ? 596  TRP A CD1   1 
ATOM   4883 C  CD2   . TRP A 1 596 ? -1.929  57.352 -1.176  1.00 39.94  ? 596  TRP A CD2   1 
ATOM   4884 N  NE1   . TRP A 1 596 ? -0.996  55.440 -1.881  1.00 42.72  ? 596  TRP A NE1   1 
ATOM   4885 C  CE2   . TRP A 1 596 ? -1.162  56.761 -2.202  1.00 41.68  ? 596  TRP A CE2   1 
ATOM   4886 C  CE3   . TRP A 1 596 ? -2.239  58.714 -1.265  1.00 40.75  ? 596  TRP A CE3   1 
ATOM   4887 C  CZ2   . TRP A 1 596 ? -0.702  57.483 -3.303  1.00 44.80  ? 596  TRP A CZ2   1 
ATOM   4888 C  CZ3   . TRP A 1 596 ? -1.782  59.430 -2.361  1.00 41.09  ? 596  TRP A CZ3   1 
ATOM   4889 C  CH2   . TRP A 1 596 ? -1.021  58.813 -3.364  1.00 44.56  ? 596  TRP A CH2   1 
ATOM   4890 N  N     . ILE A 1 597 ? -4.041  53.550 1.309   1.00 41.58  ? 597  ILE A N     1 
ATOM   4891 C  CA    . ILE A 1 597 ? -3.940  52.165 0.867   1.00 40.93  ? 597  ILE A CA    1 
ATOM   4892 C  C     . ILE A 1 597 ? -5.307  51.490 0.787   1.00 43.61  ? 597  ILE A C     1 
ATOM   4893 O  O     . ILE A 1 597 ? -5.481  50.520 0.050   1.00 45.89  ? 597  ILE A O     1 
ATOM   4894 C  CB    . ILE A 1 597 ? -2.971  51.336 1.742   1.00 38.03  ? 597  ILE A CB    1 
ATOM   4895 C  CG1   . ILE A 1 597 ? -2.320  50.234 0.905   1.00 39.01  ? 597  ILE A CG1   1 
ATOM   4896 C  CG2   . ILE A 1 597 ? -3.681  50.758 2.966   1.00 36.95  ? 597  ILE A CG2   1 
ATOM   4897 C  CD1   . ILE A 1 597 ? -1.570  50.756 -0.303  1.00 42.79  ? 597  ILE A CD1   1 
ATOM   4898 N  N     . GLU A 1 598 ? -6.273  52.007 1.540   1.00 40.62  ? 598  GLU A N     1 
ATOM   4899 C  CA    . GLU A 1 598 ? -7.642  51.524 1.443   1.00 43.66  ? 598  GLU A CA    1 
ATOM   4900 C  C     . GLU A 1 598 ? -8.164  51.817 0.044   1.00 44.80  ? 598  GLU A C     1 
ATOM   4901 O  O     . GLU A 1 598 ? -8.814  50.979 -0.581  1.00 47.23  ? 598  GLU A O     1 
ATOM   4902 C  CB    . GLU A 1 598 ? -8.533  52.202 2.485   1.00 42.43  ? 598  GLU A CB    1 
ATOM   4903 C  CG    . GLU A 1 598 ? -10.002 51.820 2.381   1.00 42.44  ? 598  GLU A CG    1 
ATOM   4904 C  CD    . GLU A 1 598 ? -10.890 52.660 3.278   1.00 43.31  ? 598  GLU A CD    1 
ATOM   4905 O  OE1   . GLU A 1 598 ? -10.412 53.691 3.797   1.00 45.24  ? 598  GLU A OE1   1 
ATOM   4906 O  OE2   . GLU A 1 598 ? -12.068 52.290 3.464   1.00 42.39  ? 598  GLU A OE2   1 
ATOM   4907 N  N     . ARG A 1 599 ? -7.864  53.017 -0.444  1.00 43.37  ? 599  ARG A N     1 
ATOM   4908 C  CA    . ARG A 1 599 ? -8.267  53.416 -1.784  1.00 42.57  ? 599  ARG A CA    1 
ATOM   4909 C  C     . ARG A 1 599 ? -7.585  52.546 -2.836  1.00 44.28  ? 599  ARG A C     1 
ATOM   4910 O  O     . ARG A 1 599 ? -8.247  51.987 -3.707  1.00 46.83  ? 599  ARG A O     1 
ATOM   4911 C  CB    . ARG A 1 599 ? -7.952  54.894 -2.031  1.00 43.85  ? 599  ARG A CB    1 
ATOM   4912 C  CG    . ARG A 1 599 ? -8.251  55.345 -3.453  1.00 47.12  ? 599  ARG A CG    1 
ATOM   4913 C  CD    . ARG A 1 599 ? -8.141  56.855 -3.618  1.00 49.75  ? 599  ARG A CD    1 
ATOM   4914 N  NE    . ARG A 1 599 ? -6.810  57.357 -3.291  1.00 49.18  ? 599  ARG A NE    1 
ATOM   4915 C  CZ    . ARG A 1 599 ? -5.761  57.281 -4.103  1.00 49.00  ? 599  ARG A CZ    1 
ATOM   4916 N  NH1   . ARG A 1 599 ? -5.880  56.712 -5.294  1.00 48.49  ? 599  ARG A NH1   1 
ATOM   4917 N  NH2   . ARG A 1 599 ? -4.588  57.768 -3.720  1.00 49.79  ? 599  ARG A NH2   1 
ATOM   4918 N  N     . LYS A 1 600 ? -6.263  52.432 -2.742  1.00 44.67  ? 600  LYS A N     1 
ATOM   4919 C  CA    . LYS A 1 600 ? -5.485  51.642 -3.694  1.00 48.10  ? 600  LYS A CA    1 
ATOM   4920 C  C     . LYS A 1 600 ? -5.945  50.187 -3.753  1.00 46.86  ? 600  LYS A C     1 
ATOM   4921 O  O     . LYS A 1 600 ? -6.074  49.615 -4.834  1.00 47.87  ? 600  LYS A O     1 
ATOM   4922 C  CB    . LYS A 1 600 ? -3.992  51.710 -3.361  1.00 46.59  ? 600  LYS A CB    1 
ATOM   4923 C  CG    . LYS A 1 600 ? -3.361  53.065 -3.625  1.00 47.32  ? 600  LYS A CG    1 
ATOM   4924 C  CD    . LYS A 1 600 ? -3.534  53.473 -5.080  1.00 45.80  ? 600  LYS A CD    1 
ATOM   4925 C  CE    . LYS A 1 600 ? -2.791  54.763 -5.384  1.00 48.58  ? 600  LYS A CE    1 
ATOM   4926 N  NZ    . LYS A 1 600 ? -1.867  54.604 -6.546  1.00 52.90  ? 600  LYS A NZ    1 
ATOM   4927 N  N     . VAL A 1 601 ? -6.196  49.598 -2.588  1.00 46.43  ? 601  VAL A N     1 
ATOM   4928 C  CA    . VAL A 1 601 ? -6.673  48.219 -2.518  1.00 46.07  ? 601  VAL A CA    1 
ATOM   4929 C  C     . VAL A 1 601 ? -8.062  48.069 -3.144  1.00 47.82  ? 601  VAL A C     1 
ATOM   4930 O  O     . VAL A 1 601 ? -8.309  47.128 -3.900  1.00 48.68  ? 601  VAL A O     1 
ATOM   4931 C  CB    . VAL A 1 601 ? -6.667  47.687 -1.068  1.00 42.77  ? 601  VAL A CB    1 
ATOM   4932 C  CG1   . VAL A 1 601 ? -7.516  46.431 -0.949  1.00 45.62  ? 601  VAL A CG1   1 
ATOM   4933 C  CG2   . VAL A 1 601 ? -5.236  47.416 -0.617  1.00 40.15  ? 601  VAL A CG2   1 
ATOM   4934 N  N     . ASN A 1 602 ? -8.959  49.002 -2.837  1.00 45.19  ? 602  ASN A N     1 
ATOM   4935 C  CA    . ASN A 1 602 ? -10.283 49.015 -3.457  1.00 47.22  ? 602  ASN A CA    1 
ATOM   4936 C  C     . ASN A 1 602 ? -10.205 49.143 -4.976  1.00 51.75  ? 602  ASN A C     1 
ATOM   4937 O  O     . ASN A 1 602 ? -10.871 48.403 -5.704  1.00 55.85  ? 602  ASN A O     1 
ATOM   4938 C  CB    . ASN A 1 602 ? -11.153 50.134 -2.878  1.00 47.34  ? 602  ASN A CB    1 
ATOM   4939 C  CG    . ASN A 1 602 ? -11.856 49.721 -1.599  1.00 48.90  ? 602  ASN A CG    1 
ATOM   4940 O  OD1   . ASN A 1 602 ? -12.084 48.534 -1.359  1.00 45.32  ? 602  ASN A OD1   1 
ATOM   4941 N  ND2   . ASN A 1 602 ? -12.211 50.700 -0.773  1.00 45.71  ? 602  ASN A ND2   1 
ATOM   4942 N  N     . GLU A 1 603 ? -9.387  50.080 -5.446  1.00 52.76  ? 603  GLU A N     1 
ATOM   4943 C  CA    . GLU A 1 603 ? -9.201  50.294 -6.878  1.00 55.12  ? 603  GLU A CA    1 
ATOM   4944 C  C     . GLU A 1 603 ? -8.655  49.042 -7.556  1.00 57.07  ? 603  GLU A C     1 
ATOM   4945 O  O     . GLU A 1 603 ? -9.163  48.617 -8.594  1.00 61.65  ? 603  GLU A O     1 
ATOM   4946 C  CB    . GLU A 1 603 ? -8.250  51.467 -7.128  1.00 57.69  ? 603  GLU A CB    1 
ATOM   4947 C  CG    . GLU A 1 603 ? -8.798  52.829 -6.736  1.00 59.66  ? 603  GLU A CG    1 
ATOM   4948 C  CD    . GLU A 1 603 ? -7.781  53.939 -6.929  1.00 61.31  ? 603  GLU A CD    1 
ATOM   4949 O  OE1   . GLU A 1 603 ? -6.631  53.630 -7.307  1.00 63.02  ? 603  GLU A OE1   1 
ATOM   4950 O  OE2   . GLU A 1 603 ? -8.129  55.118 -6.704  1.00 58.68  ? 603  GLU A OE2   1 
ATOM   4951 N  N     . TYR A 1 604 ? -7.621  48.454 -6.961  1.00 55.04  ? 604  TYR A N     1 
ATOM   4952 C  CA    . TYR A 1 604 ? -6.970  47.285 -7.544  1.00 57.94  ? 604  TYR A CA    1 
ATOM   4953 C  C     . TYR A 1 604 ? -7.899  46.081 -7.637  1.00 56.41  ? 604  TYR A C     1 
ATOM   4954 O  O     . TYR A 1 604 ? -7.937  45.395 -8.659  1.00 57.41  ? 604  TYR A O     1 
ATOM   4955 C  CB    . TYR A 1 604 ? -5.715  46.904 -6.757  1.00 56.72  ? 604  TYR A CB    1 
ATOM   4956 C  CG    . TYR A 1 604 ? -5.104  45.596 -7.212  1.00 59.08  ? 604  TYR A CG    1 
ATOM   4957 C  CD1   . TYR A 1 604 ? -5.292  44.425 -6.485  1.00 58.97  ? 604  TYR A CD1   1 
ATOM   4958 C  CD2   . TYR A 1 604 ? -4.353  45.529 -8.378  1.00 59.76  ? 604  TYR A CD2   1 
ATOM   4959 C  CE1   . TYR A 1 604 ? -4.741  43.227 -6.904  1.00 61.07  ? 604  TYR A CE1   1 
ATOM   4960 C  CE2   . TYR A 1 604 ? -3.797  44.337 -8.804  1.00 63.09  ? 604  TYR A CE2   1 
ATOM   4961 C  CZ    . TYR A 1 604 ? -3.994  43.189 -8.065  1.00 64.40  ? 604  TYR A CZ    1 
ATOM   4962 O  OH    . TYR A 1 604 ? -3.441  42.002 -8.490  1.00 63.60  ? 604  TYR A OH    1 
ATOM   4963 N  N     . LEU A 1 605 ? -8.641  45.823 -6.566  1.00 54.21  ? 605  LEU A N     1 
ATOM   4964 C  CA    . LEU A 1 605 ? -9.513  44.654 -6.518  1.00 56.83  ? 605  LEU A CA    1 
ATOM   4965 C  C     . LEU A 1 605 ? -10.672 44.745 -7.504  1.00 58.03  ? 605  LEU A C     1 
ATOM   4966 O  O     . LEU A 1 605 ? -11.045 43.746 -8.113  1.00 53.69  ? 605  LEU A O     1 
ATOM   4967 C  CB    . LEU A 1 605 ? -10.014 44.398 -5.096  1.00 53.73  ? 605  LEU A CB    1 
ATOM   4968 C  CG    . LEU A 1 605 ? -8.958  43.748 -4.201  1.00 54.77  ? 605  LEU A CG    1 
ATOM   4969 C  CD1   . LEU A 1 605 ? -9.462  43.603 -2.782  1.00 53.35  ? 605  LEU A CD1   1 
ATOM   4970 C  CD2   . LEU A 1 605 ? -8.543  42.395 -4.766  1.00 56.14  ? 605  LEU A CD2   1 
ATOM   4971 N  N     . ASN A 1 606 ? -11.236 45.939 -7.663  1.00 56.51  ? 606  ASN A N     1 
ATOM   4972 C  CA    . ASN A 1 606 ? -12.261 46.155 -8.679  1.00 60.94  ? 606  ASN A CA    1 
ATOM   4973 C  C     . ASN A 1 606 ? -11.722 45.890 -10.082 1.00 64.00  ? 606  ASN A C     1 
ATOM   4974 O  O     . ASN A 1 606 ? -12.413 45.322 -10.929 1.00 63.75  ? 606  ASN A O     1 
ATOM   4975 C  CB    . ASN A 1 606 ? -12.833 47.573 -8.592  1.00 58.31  ? 606  ASN A CB    1 
ATOM   4976 C  CG    . ASN A 1 606 ? -13.939 47.693 -7.562  1.00 52.49  ? 606  ASN A CG    1 
ATOM   4977 O  OD1   . ASN A 1 606 ? -15.096 47.380 -7.841  1.00 60.25  ? 606  ASN A OD1   1 
ATOM   4978 N  ND2   . ASN A 1 606 ? -13.590 48.148 -6.365  1.00 50.13  ? 606  ASN A ND2   1 
ATOM   4979 N  N     . GLU A 1 607 ? -10.480 46.299 -10.314 1.00 63.73  ? 607  GLU A N     1 
ATOM   4980 C  CA    . GLU A 1 607 ? -9.835  46.108 -11.607 1.00 65.00  ? 607  GLU A CA    1 
ATOM   4981 C  C     . GLU A 1 607 ? -9.616  44.629 -11.915 1.00 67.03  ? 607  GLU A C     1 
ATOM   4982 O  O     . GLU A 1 607 ? -10.035 44.136 -12.962 1.00 67.56  ? 607  GLU A O     1 
ATOM   4983 C  CB    . GLU A 1 607 ? -8.501  46.857 -11.652 1.00 61.22  ? 607  GLU A CB    1 
ATOM   4984 C  CG    . GLU A 1 607 ? -7.711  46.647 -12.932 1.00 59.18  ? 607  GLU A CG    1 
ATOM   4985 N  N     . VAL A 1 608 ? -8.963  43.924 -10.996 1.00 68.67  ? 608  VAL A N     1 
ATOM   4986 C  CA    . VAL A 1 608 ? -8.617  42.524 -11.222 1.00 69.46  ? 608  VAL A CA    1 
ATOM   4987 C  C     . VAL A 1 608 ? -9.846  41.611 -11.169 1.00 68.72  ? 608  VAL A C     1 
ATOM   4988 O  O     . VAL A 1 608 ? -9.827  40.508 -11.715 1.00 68.79  ? 608  VAL A O     1 
ATOM   4989 C  CB    . VAL A 1 608 ? -7.522  42.034 -10.242 1.00 69.62  ? 608  VAL A CB    1 
ATOM   4990 C  CG1   . VAL A 1 608 ? -8.131  41.614 -8.913  1.00 64.79  ? 608  VAL A CG1   1 
ATOM   4991 C  CG2   . VAL A 1 608 ? -6.733  40.887 -10.856 1.00 75.83  ? 608  VAL A CG2   1 
ATOM   4992 N  N     . CYS A 1 609 ? -10.914 42.075 -10.526 1.00 67.71  ? 609  CYS A N     1 
ATOM   4993 C  CA    . CYS A 1 609 ? -12.167 41.323 -10.499 1.00 70.31  ? 609  CYS A CA    1 
ATOM   4994 C  C     . CYS A 1 609 ? -13.055 41.687 -11.682 1.00 77.18  ? 609  CYS A C     1 
ATOM   4995 O  O     . CYS A 1 609 ? -13.882 40.886 -12.117 1.00 82.19  ? 609  CYS A O     1 
ATOM   4996 C  CB    . CYS A 1 609 ? -12.923 41.545 -9.186  1.00 66.40  ? 609  CYS A CB    1 
ATOM   4997 S  SG    . CYS A 1 609 ? -12.206 40.703 -7.755  1.00 72.66  ? 609  CYS A SG    1 
ATOM   4998 N  N     . GLY A 1 610 ? -12.882 42.900 -12.198 1.00 78.09  ? 610  GLY A N     1 
ATOM   4999 C  CA    . GLY A 1 610 ? -13.626 43.348 -13.361 1.00 79.65  ? 610  GLY A CA    1 
ATOM   5000 C  C     . GLY A 1 610 ? -14.817 44.227 -13.028 1.00 80.44  ? 610  GLY A C     1 
ATOM   5001 O  O     . GLY A 1 610 ? -15.506 44.713 -13.924 1.00 84.42  ? 610  GLY A O     1 
ATOM   5002 N  N     . THR A 1 611 ? -15.060 44.434 -11.738 1.00 79.39  ? 611  THR A N     1 
ATOM   5003 C  CA    . THR A 1 611 ? -16.186 45.251 -11.294 1.00 78.44  ? 611  THR A CA    1 
ATOM   5004 C  C     . THR A 1 611 ? -15.788 46.713 -11.109 1.00 74.23  ? 611  THR A C     1 
ATOM   5005 O  O     . THR A 1 611 ? -14.667 47.108 -11.430 1.00 73.91  ? 611  THR A O     1 
ATOM   5006 C  CB    . THR A 1 611 ? -16.777 44.723 -9.977  1.00 78.15  ? 611  THR A CB    1 
ATOM   5007 O  OG1   . THR A 1 611 ? -15.773 44.751 -8.954  1.00 75.47  ? 611  THR A OG1   1 
ATOM   5008 C  CG2   . THR A 1 611 ? -17.277 43.297 -10.153 1.00 80.84  ? 611  THR A CG2   1 
ATOM   5009 N  N     . GLU A 1 612 ? -16.714 47.513 -10.589 1.00 70.27  ? 612  GLU A N     1 
ATOM   5010 C  CA    . GLU A 1 612 ? -16.457 48.932 -10.372 1.00 68.84  ? 612  GLU A CA    1 
ATOM   5011 C  C     . GLU A 1 612 ? -17.266 49.495 -9.206  1.00 70.45  ? 612  GLU A C     1 
ATOM   5012 O  O     . GLU A 1 612 ? -18.473 49.269 -9.107  1.00 72.24  ? 612  GLU A O     1 
ATOM   5013 C  CB    . GLU A 1 612 ? -16.750 49.730 -11.644 1.00 70.12  ? 612  GLU A CB    1 
ATOM   5014 N  N     . GLY A 1 613 ? -16.588 50.221 -8.322  1.00 67.15  ? 613  GLY A N     1 
ATOM   5015 C  CA    . GLY A 1 613 ? -17.246 50.950 -7.252  1.00 64.70  ? 613  GLY A CA    1 
ATOM   5016 C  C     . GLY A 1 613 ? -17.636 50.136 -6.032  1.00 63.57  ? 613  GLY A C     1 
ATOM   5017 O  O     . GLY A 1 613 ? -18.292 50.648 -5.125  1.00 61.63  ? 613  GLY A O     1 
ATOM   5018 N  N     A GLU A 1 614 ? -17.246 48.867 -6.006  0.55 63.97  ? 614  GLU A N     1 
ATOM   5019 N  N     B GLU A 1 614 ? -17.221 48.874 -6.001  0.45 63.94  ? 614  GLU A N     1 
ATOM   5020 C  CA    A GLU A 1 614 ? -17.579 48.011 -4.874  0.55 63.04  ? 614  GLU A CA    1 
ATOM   5021 C  CA    B GLU A 1 614 ? -17.554 47.984 -4.894  0.45 62.98  ? 614  GLU A CA    1 
ATOM   5022 C  C     A GLU A 1 614 ? -16.547 48.104 -3.757  0.55 61.08  ? 614  GLU A C     1 
ATOM   5023 C  C     B GLU A 1 614 ? -16.540 48.096 -3.757  0.45 61.07  ? 614  GLU A C     1 
ATOM   5024 O  O     A GLU A 1 614 ? -15.342 48.136 -4.006  0.55 60.79  ? 614  GLU A O     1 
ATOM   5025 O  O     B GLU A 1 614 ? -15.332 48.134 -3.994  0.45 60.74  ? 614  GLU A O     1 
ATOM   5026 C  CB    A GLU A 1 614 ? -17.774 46.557 -5.314  0.55 63.92  ? 614  GLU A CB    1 
ATOM   5027 C  CB    B GLU A 1 614 ? -17.651 46.538 -5.388  0.45 63.84  ? 614  GLU A CB    1 
ATOM   5028 C  CG    A GLU A 1 614 ? -19.213 46.214 -5.676  0.55 65.60  ? 614  GLU A CG    1 
ATOM   5029 C  CG    B GLU A 1 614 ? -18.660 46.342 -6.512  0.45 66.07  ? 614  GLU A CG    1 
ATOM   5030 C  CD    A GLU A 1 614 ? -20.154 46.289 -4.482  0.55 64.35  ? 614  GLU A CD    1 
ATOM   5031 C  CD    B GLU A 1 614 ? -18.692 44.917 -7.033  0.45 67.81  ? 614  GLU A CD    1 
ATOM   5032 O  OE1   A GLU A 1 614 ? -19.673 46.212 -3.331  0.55 63.02  ? 614  GLU A OE1   1 
ATOM   5033 O  OE1   B GLU A 1 614 ? -17.831 44.112 -6.623  0.45 68.41  ? 614  GLU A OE1   1 
ATOM   5034 O  OE2   A GLU A 1 614 ? -21.377 46.426 -4.696  0.55 64.49  ? 614  GLU A OE2   1 
ATOM   5035 O  OE2   B GLU A 1 614 ? -19.579 44.604 -7.856  0.45 68.10  ? 614  GLU A OE2   1 
ATOM   5036 N  N     . ALA A 1 615 ? -17.038 48.150 -2.524  1.00 60.40  ? 615  ALA A N     1 
ATOM   5037 C  CA    . ALA A 1 615 ? -16.180 48.282 -1.350  1.00 58.59  ? 615  ALA A CA    1 
ATOM   5038 C  C     . ALA A 1 615 ? -15.635 46.937 -0.886  1.00 58.53  ? 615  ALA A C     1 
ATOM   5039 O  O     . ALA A 1 615 ? -16.375 46.098 -0.371  1.00 64.39  ? 615  ALA A O     1 
ATOM   5040 C  CB    . ALA A 1 615 ? -16.935 48.965 -0.217  1.00 55.60  ? 615  ALA A CB    1 
ATOM   5041 N  N     . PHE A 1 616 ? -14.334 46.740 -1.067  1.00 50.54  ? 616  PHE A N     1 
ATOM   5042 C  CA    . PHE A 1 616 ? -13.688 45.501 -0.658  1.00 49.86  ? 616  PHE A CA    1 
ATOM   5043 C  C     . PHE A 1 616 ? -13.148 45.597 0.766   1.00 49.21  ? 616  PHE A C     1 
ATOM   5044 O  O     . PHE A 1 616 ? -13.171 44.619 1.512   1.00 52.02  ? 616  PHE A O     1 
ATOM   5045 C  CB    . PHE A 1 616 ? -12.576 45.123 -1.638  1.00 51.07  ? 616  PHE A CB    1 
ATOM   5046 C  CG    . PHE A 1 616 ? -13.081 44.573 -2.943  1.00 55.12  ? 616  PHE A CG    1 
ATOM   5047 C  CD1   . PHE A 1 616 ? -13.129 43.205 -3.161  1.00 57.17  ? 616  PHE A CD1   1 
ATOM   5048 C  CD2   . PHE A 1 616 ? -13.514 45.422 -3.949  1.00 53.63  ? 616  PHE A CD2   1 
ATOM   5049 C  CE1   . PHE A 1 616 ? -13.594 42.695 -4.360  1.00 59.10  ? 616  PHE A CE1   1 
ATOM   5050 C  CE2   . PHE A 1 616 ? -13.980 44.918 -5.149  1.00 56.17  ? 616  PHE A CE2   1 
ATOM   5051 C  CZ    . PHE A 1 616 ? -14.020 43.553 -5.354  1.00 58.76  ? 616  PHE A CZ    1 
ATOM   5052 N  N     . VAL A 1 617 ? -12.666 46.778 1.139   1.00 46.58  ? 617  VAL A N     1 
ATOM   5053 C  CA    . VAL A 1 617 ? -12.205 47.009 2.504   1.00 46.25  ? 617  VAL A CA    1 
ATOM   5054 C  C     . VAL A 1 617 ? -13.391 47.327 3.410   1.00 43.85  ? 617  VAL A C     1 
ATOM   5055 O  O     . VAL A 1 617 ? -14.009 48.386 3.297   1.00 44.22  ? 617  VAL A O     1 
ATOM   5056 C  CB    . VAL A 1 617 ? -11.171 48.144 2.572   1.00 43.51  ? 617  VAL A CB    1 
ATOM   5057 C  CG1   . VAL A 1 617 ? -10.779 48.425 4.018   1.00 40.15  ? 617  VAL A CG1   1 
ATOM   5058 C  CG2   . VAL A 1 617 ? -9.951  47.790 1.741   1.00 41.74  ? 617  VAL A CG2   1 
ATOM   5059 N  N     . LEU A 1 618 ? -13.703 46.397 4.306   1.00 39.44  ? 618  LEU A N     1 
ATOM   5060 C  CA    . LEU A 1 618 ? -14.884 46.508 5.151   1.00 38.92  ? 618  LEU A CA    1 
ATOM   5061 C  C     . LEU A 1 618 ? -14.579 47.197 6.478   1.00 43.55  ? 618  LEU A C     1 
ATOM   5062 O  O     . LEU A 1 618 ? -15.487 47.671 7.162   1.00 47.09  ? 618  LEU A O     1 
ATOM   5063 C  CB    . LEU A 1 618 ? -15.476 45.119 5.409   1.00 37.38  ? 618  LEU A CB    1 
ATOM   5064 C  CG    . LEU A 1 618 ? -14.612 44.178 6.257   1.00 39.79  ? 618  LEU A CG    1 
ATOM   5065 C  CD1   . LEU A 1 618 ? -15.167 44.047 7.670   1.00 37.89  ? 618  LEU A CD1   1 
ATOM   5066 C  CD2   . LEU A 1 618 ? -14.465 42.811 5.601   1.00 37.58  ? 618  LEU A CD2   1 
ATOM   5067 N  N     . TYR A 1 619 ? -13.300 47.249 6.839   1.00 40.82  ? 619  TYR A N     1 
ATOM   5068 C  CA    . TYR A 1 619 ? -12.896 47.791 8.131   1.00 36.97  ? 619  TYR A CA    1 
ATOM   5069 C  C     . TYR A 1 619 ? -11.409 48.110 8.152   1.00 36.41  ? 619  TYR A C     1 
ATOM   5070 O  O     . TYR A 1 619 ? -10.635 47.549 7.378   1.00 38.89  ? 619  TYR A O     1 
ATOM   5071 C  CB    . TYR A 1 619 ? -13.238 46.803 9.251   1.00 34.91  ? 619  TYR A CB    1 
ATOM   5072 C  CG    . TYR A 1 619 ? -12.836 47.266 10.634  1.00 37.61  ? 619  TYR A CG    1 
ATOM   5073 C  CD1   . TYR A 1 619 ? -11.874 46.580 11.365  1.00 34.60  ? 619  TYR A CD1   1 
ATOM   5074 C  CD2   . TYR A 1 619 ? -13.407 48.396 11.202  1.00 35.98  ? 619  TYR A CD2   1 
ATOM   5075 C  CE1   . TYR A 1 619 ? -11.503 46.999 12.630  1.00 36.45  ? 619  TYR A CE1   1 
ATOM   5076 C  CE2   . TYR A 1 619 ? -13.044 48.822 12.464  1.00 35.67  ? 619  TYR A CE2   1 
ATOM   5077 C  CZ    . TYR A 1 619 ? -12.092 48.121 13.174  1.00 34.77  ? 619  TYR A CZ    1 
ATOM   5078 O  OH    . TYR A 1 619 ? -11.727 48.548 14.430  1.00 31.61  ? 619  TYR A OH    1 
ATOM   5079 N  N     . GLY A 1 620 ? -11.019 49.020 9.040   1.00 36.43  ? 620  GLY A N     1 
ATOM   5080 C  CA    . GLY A 1 620 ? -9.629  49.399 9.198   1.00 34.04  ? 620  GLY A CA    1 
ATOM   5081 C  C     . GLY A 1 620 ? -9.359  50.109 10.511  1.00 33.28  ? 620  GLY A C     1 
ATOM   5082 O  O     . GLY A 1 620 ? -10.198 50.866 11.000  1.00 33.60  ? 620  GLY A O     1 
ATOM   5083 N  N     . ASP A 1 621 ? -8.184  49.862 11.083  1.00 31.43  ? 621  ASP A N     1 
ATOM   5084 C  CA    . ASP A 1 621 ? -7.781  50.506 12.330  1.00 32.71  ? 621  ASP A CA    1 
ATOM   5085 C  C     . ASP A 1 621 ? -6.278  50.775 12.323  1.00 32.07  ? 621  ASP A C     1 
ATOM   5086 O  O     . ASP A 1 621 ? -5.472  49.846 12.234  1.00 31.85  ? 621  ASP A O     1 
ATOM   5087 C  CB    . ASP A 1 621 ? -8.160  49.635 13.536  1.00 29.72  ? 621  ASP A CB    1 
ATOM   5088 C  CG    . ASP A 1 621 ? -8.015  50.368 14.867  1.00 31.78  ? 621  ASP A CG    1 
ATOM   5089 O  OD1   . ASP A 1 621 ? -7.267  51.368 14.939  1.00 27.99  ? 621  ASP A OD1   1 
ATOM   5090 O  OD2   . ASP A 1 621 ? -8.652  49.935 15.852  1.00 29.30  ? 621  ASP A OD2   1 
ATOM   5091 N  N     . THR A 1 622 ? -5.923  52.055 12.419  1.00 26.94  ? 622  THR A N     1 
ATOM   5092 C  CA    . THR A 1 622 ? -4.531  52.500 12.506  1.00 25.52  ? 622  THR A CA    1 
ATOM   5093 C  C     . THR A 1 622 ? -3.700  52.151 11.270  1.00 28.74  ? 622  THR A C     1 
ATOM   5094 O  O     . THR A 1 622 ? -3.416  53.019 10.443  1.00 30.15  ? 622  THR A O     1 
ATOM   5095 C  CB    . THR A 1 622 ? -3.837  51.967 13.778  1.00 26.92  ? 622  THR A CB    1 
ATOM   5096 O  OG1   . THR A 1 622 ? -4.655  52.247 14.922  1.00 29.26  ? 622  THR A OG1   1 
ATOM   5097 C  CG2   . THR A 1 622 ? -2.473  52.619 13.959  1.00 24.03  ? 622  THR A CG2   1 
ATOM   5098 N  N     . ASP A 1 623 ? -3.322  50.882 11.139  1.00 29.38  ? 623  ASP A N     1 
ATOM   5099 C  CA    . ASP A 1 623 ? -2.471  50.458 10.030  1.00 34.80  ? 623  ASP A CA    1 
ATOM   5100 C  C     . ASP A 1 623 ? -2.958  49.170 9.368   1.00 35.73  ? 623  ASP A C     1 
ATOM   5101 O  O     . ASP A 1 623 ? -2.248  48.575 8.560   1.00 37.99  ? 623  ASP A O     1 
ATOM   5102 C  CB    . ASP A 1 623 ? -1.036  50.256 10.516  1.00 31.68  ? 623  ASP A CB    1 
ATOM   5103 C  CG    . ASP A 1 623 ? -0.882  49.020 11.380  1.00 32.05  ? 623  ASP A CG    1 
ATOM   5104 O  OD1   . ASP A 1 623 ? 0.212   48.414 11.365  1.00 32.26  ? 623  ASP A OD1   1 
ATOM   5105 O  OD2   . ASP A 1 623 ? -1.856  48.650 12.069  1.00 32.57  ? 623  ASP A OD2   1 
ATOM   5106 N  N     . SER A 1 624 ? -4.165  48.740 9.714   1.00 31.68  ? 624  SER A N     1 
ATOM   5107 C  CA    . SER A 1 624 ? -4.671  47.465 9.227   1.00 35.20  ? 624  SER A CA    1 
ATOM   5108 C  C     . SER A 1 624 ? -5.935  47.622 8.396   1.00 37.35  ? 624  SER A C     1 
ATOM   5109 O  O     . SER A 1 624 ? -6.747  48.510 8.646   1.00 36.75  ? 624  SER A O     1 
ATOM   5110 C  CB    . SER A 1 624 ? -4.936  46.516 10.399  1.00 35.57  ? 624  SER A CB    1 
ATOM   5111 O  OG    . SER A 1 624 ? -5.867  47.080 11.305  1.00 36.09  ? 624  SER A OG    1 
ATOM   5112 N  N     . ILE A 1 625 ? -6.092  46.758 7.400   1.00 36.40  ? 625  ILE A N     1 
ATOM   5113 C  CA    . ILE A 1 625 ? -7.324  46.713 6.623   1.00 34.32  ? 625  ILE A CA    1 
ATOM   5114 C  C     . ILE A 1 625 ? -7.881  45.299 6.605   1.00 34.50  ? 625  ILE A C     1 
ATOM   5115 O  O     . ILE A 1 625 ? -7.133  44.323 6.651   1.00 36.24  ? 625  ILE A O     1 
ATOM   5116 C  CB    . ILE A 1 625 ? -7.127  47.198 5.170   1.00 34.51  ? 625  ILE A CB    1 
ATOM   5117 C  CG1   . ILE A 1 625 ? -6.038  46.383 4.469   1.00 32.71  ? 625  ILE A CG1   1 
ATOM   5118 C  CG2   . ILE A 1 625 ? -6.802  48.684 5.139   1.00 36.40  ? 625  ILE A CG2   1 
ATOM   5119 C  CD1   . ILE A 1 625 ? -5.942  46.654 2.983   1.00 37.93  ? 625  ILE A CD1   1 
ATOM   5120 N  N     . TYR A 1 626 ? -9.203  45.199 6.552   1.00 34.75  ? 626  TYR A N     1 
ATOM   5121 C  CA    . TYR A 1 626 ? -9.869  43.910 6.463   1.00 36.08  ? 626  TYR A CA    1 
ATOM   5122 C  C     . TYR A 1 626 ? -10.664 43.837 5.170   1.00 38.46  ? 626  TYR A C     1 
ATOM   5123 O  O     . TYR A 1 626 ? -11.627 44.579 4.969   1.00 39.04  ? 626  TYR A O     1 
ATOM   5124 C  CB    . TYR A 1 626 ? -10.745 43.667 7.693   1.00 36.94  ? 626  TYR A CB    1 
ATOM   5125 C  CG    . TYR A 1 626 ? -9.927  43.450 8.946   1.00 37.18  ? 626  TYR A CG    1 
ATOM   5126 C  CD1   . TYR A 1 626 ? -9.389  44.526 9.642   1.00 39.62  ? 626  TYR A CD1   1 
ATOM   5127 C  CD2   . TYR A 1 626 ? -9.672  42.170 9.418   1.00 37.58  ? 626  TYR A CD2   1 
ATOM   5128 C  CE1   . TYR A 1 626 ? -8.629  44.334 10.779  1.00 39.58  ? 626  TYR A CE1   1 
ATOM   5129 C  CE2   . TYR A 1 626 ? -8.912  41.967 10.557  1.00 41.68  ? 626  TYR A CE2   1 
ATOM   5130 C  CZ    . TYR A 1 626 ? -8.393  43.054 11.232  1.00 41.90  ? 626  TYR A CZ    1 
ATOM   5131 O  OH    . TYR A 1 626 ? -7.638  42.861 12.365  1.00 43.63  ? 626  TYR A OH    1 
ATOM   5132 N  N     . VAL A 1 627 ? -10.233 42.943 4.289   1.00 39.06  ? 627  VAL A N     1 
ATOM   5133 C  CA    . VAL A 1 627 ? -10.762 42.873 2.938   1.00 41.25  ? 627  VAL A CA    1 
ATOM   5134 C  C     . VAL A 1 627 ? -11.744 41.725 2.768   1.00 40.70  ? 627  VAL A C     1 
ATOM   5135 O  O     . VAL A 1 627 ? -11.413 40.570 3.034   1.00 43.16  ? 627  VAL A O     1 
ATOM   5136 C  CB    . VAL A 1 627 ? -9.624  42.700 1.918   1.00 44.12  ? 627  VAL A CB    1 
ATOM   5137 C  CG1   . VAL A 1 627 ? -10.187 42.569 0.521   1.00 43.16  ? 627  VAL A CG1   1 
ATOM   5138 C  CG2   . VAL A 1 627 ? -8.652  43.870 2.006   1.00 45.27  ? 627  VAL A CG2   1 
ATOM   5139 N  N     . SER A 1 628 ? -12.954 42.047 2.321   1.00 41.14  ? 628  SER A N     1 
ATOM   5140 C  CA    . SER A 1 628 ? -13.940 41.025 1.998   1.00 45.71  ? 628  SER A CA    1 
ATOM   5141 C  C     . SER A 1 628 ? -13.486 40.256 0.763   1.00 50.02  ? 628  SER A C     1 
ATOM   5142 O  O     . SER A 1 628 ? -13.294 40.839 -0.305  1.00 51.23  ? 628  SER A O     1 
ATOM   5143 C  CB    . SER A 1 628 ? -15.311 41.657 1.753   1.00 48.08  ? 628  SER A CB    1 
ATOM   5144 O  OG    . SER A 1 628 ? -16.275 40.669 1.426   1.00 50.81  ? 628  SER A OG    1 
ATOM   5145 N  N     . ALA A 1 629 ? -13.311 38.948 0.913   1.00 51.43  ? 629  ALA A N     1 
ATOM   5146 C  CA    . ALA A 1 629 ? -12.787 38.122 -0.169  1.00 51.19  ? 629  ALA A CA    1 
ATOM   5147 C  C     . ALA A 1 629 ? -13.866 37.256 -0.811  1.00 54.63  ? 629  ALA A C     1 
ATOM   5148 O  O     . ALA A 1 629 ? -13.561 36.292 -1.514  1.00 57.91  ? 629  ALA A O     1 
ATOM   5149 C  CB    . ALA A 1 629 ? -11.640 37.257 0.335   1.00 51.32  ? 629  ALA A CB    1 
ATOM   5150 N  N     . ASP A 1 630 ? -15.125 37.608 -0.568  1.00 54.04  ? 630  ASP A N     1 
ATOM   5151 C  CA    . ASP A 1 630 ? -16.255 36.861 -1.114  1.00 56.81  ? 630  ASP A CA    1 
ATOM   5152 C  C     . ASP A 1 630 ? -16.229 36.818 -2.638  1.00 57.13  ? 630  ASP A C     1 
ATOM   5153 O  O     . ASP A 1 630 ? -16.481 35.777 -3.241  1.00 55.09  ? 630  ASP A O     1 
ATOM   5154 C  CB    . ASP A 1 630 ? -17.577 37.464 -0.635  1.00 61.16  ? 630  ASP A CB    1 
ATOM   5155 C  CG    . ASP A 1 630 ? -17.813 37.248 0.846   1.00 62.60  ? 630  ASP A CG    1 
ATOM   5156 O  OD1   . ASP A 1 630 ? -16.850 36.901 1.561   1.00 62.40  ? 630  ASP A OD1   1 
ATOM   5157 O  OD2   . ASP A 1 630 ? -18.964 37.431 1.296   1.00 64.02  ? 630  ASP A OD2   1 
ATOM   5158 N  N     . LYS A 1 631 ? -15.915 37.951 -3.258  1.00 57.49  ? 631  LYS A N     1 
ATOM   5159 C  CA    . LYS A 1 631 ? -15.917 38.047 -4.715  1.00 63.36  ? 631  LYS A CA    1 
ATOM   5160 C  C     . LYS A 1 631 ? -14.673 37.430 -5.350  1.00 61.79  ? 631  LYS A C     1 
ATOM   5161 O  O     . LYS A 1 631 ? -14.710 36.990 -6.497  1.00 61.43  ? 631  LYS A O     1 
ATOM   5162 C  CB    . LYS A 1 631 ? -16.094 39.500 -5.154  1.00 65.53  ? 631  LYS A CB    1 
ATOM   5163 C  CG    . LYS A 1 631 ? -17.492 40.030 -4.891  1.00 69.48  ? 631  LYS A CG    1 
ATOM   5164 C  CD    . LYS A 1 631 ? -17.501 41.534 -4.701  1.00 73.70  ? 631  LYS A CD    1 
ATOM   5165 C  CE    . LYS A 1 631 ? -18.892 42.020 -4.325  1.00 76.75  ? 631  LYS A CE    1 
ATOM   5166 N  NZ    . LYS A 1 631 ? -18.891 43.447 -3.902  1.00 75.07  ? 631  LYS A NZ    1 
ATOM   5167 N  N     . ILE A 1 632 ? -13.574 37.399 -4.602  1.00 61.40  ? 632  ILE A N     1 
ATOM   5168 C  CA    . ILE A 1 632 ? -12.365 36.725 -5.061  1.00 58.78  ? 632  ILE A CA    1 
ATOM   5169 C  C     . ILE A 1 632 ? -12.622 35.223 -5.126  1.00 59.25  ? 632  ILE A C     1 
ATOM   5170 O  O     . ILE A 1 632 ? -12.234 34.553 -6.084  1.00 60.75  ? 632  ILE A O     1 
ATOM   5171 C  CB    . ILE A 1 632 ? -11.169 37.008 -4.135  1.00 54.90  ? 632  ILE A CB    1 
ATOM   5172 C  CG1   . ILE A 1 632 ? -10.857 38.505 -4.111  1.00 54.77  ? 632  ILE A CG1   1 
ATOM   5173 C  CG2   . ILE A 1 632 ? -9.947  36.221 -4.581  1.00 53.77  ? 632  ILE A CG2   1 
ATOM   5174 C  CD1   . ILE A 1 632 ? -9.765  38.885 -3.133  1.00 54.45  ? 632  ILE A CD1   1 
ATOM   5175 N  N     . ILE A 1 633 ? -13.293 34.706 -4.101  1.00 60.16  ? 633  ILE A N     1 
ATOM   5176 C  CA    . ILE A 1 633 ? -13.672 33.298 -4.054  1.00 61.02  ? 633  ILE A CA    1 
ATOM   5177 C  C     . ILE A 1 633 ? -14.702 32.971 -5.134  1.00 65.12  ? 633  ILE A C     1 
ATOM   5178 O  O     . ILE A 1 633 ? -14.575 31.971 -5.842  1.00 65.70  ? 633  ILE A O     1 
ATOM   5179 C  CB    . ILE A 1 633 ? -14.240 32.915 -2.670  1.00 59.82  ? 633  ILE A CB    1 
ATOM   5180 C  CG1   . ILE A 1 633 ? -13.138 32.948 -1.608  1.00 57.62  ? 633  ILE A CG1   1 
ATOM   5181 C  CG2   . ILE A 1 633 ? -14.880 31.536 -2.713  1.00 56.94  ? 633  ILE A CG2   1 
ATOM   5182 C  CD1   . ILE A 1 633 ? -12.116 31.836 -1.747  1.00 53.44  ? 633  ILE A CD1   1 
ATOM   5183 N  N     . ASP A 1 634 ? -15.714 33.825 -5.262  1.00 66.50  ? 634  ASP A N     1 
ATOM   5184 C  CA    . ASP A 1 634 ? -16.796 33.597 -6.219  1.00 71.28  ? 634  ASP A CA    1 
ATOM   5185 C  C     . ASP A 1 634 ? -16.338 33.668 -7.674  1.00 72.65  ? 634  ASP A C     1 
ATOM   5186 O  O     . ASP A 1 634 ? -16.984 33.109 -8.559  1.00 73.72  ? 634  ASP A O     1 
ATOM   5187 C  CB    . ASP A 1 634 ? -17.948 34.578 -5.981  1.00 73.10  ? 634  ASP A CB    1 
ATOM   5188 C  CG    . ASP A 1 634 ? -18.684 34.310 -4.682  1.00 76.05  ? 634  ASP A CG    1 
ATOM   5189 O  OD1   . ASP A 1 634 ? -18.531 33.201 -4.127  1.00 76.65  ? 634  ASP A OD1   1 
ATOM   5190 O  OD2   . ASP A 1 634 ? -19.419 35.208 -4.218  1.00 77.74  ? 634  ASP A OD2   1 
ATOM   5191 N  N     . LYS A 1 635 ? -15.228 34.360 -7.916  1.00 74.91  ? 635  LYS A N     1 
ATOM   5192 C  CA    . LYS A 1 635 ? -14.659 34.462 -9.256  1.00 76.99  ? 635  LYS A CA    1 
ATOM   5193 C  C     . LYS A 1 635 ? -14.240 33.084 -9.756  1.00 77.87  ? 635  LYS A C     1 
ATOM   5194 O  O     . LYS A 1 635 ? -14.347 32.779 -10.945 1.00 80.37  ? 635  LYS A O     1 
ATOM   5195 C  CB    . LYS A 1 635 ? -13.455 35.406 -9.251  1.00 78.01  ? 635  LYS A CB    1 
ATOM   5196 C  CG    . LYS A 1 635 ? -13.611 36.638 -10.131 1.00 80.94  ? 635  LYS A CG    1 
ATOM   5197 C  CD    . LYS A 1 635 ? -13.558 36.280 -11.607 1.00 84.75  ? 635  LYS A CD    1 
ATOM   5198 C  CE    . LYS A 1 635 ? -13.475 37.526 -12.478 1.00 86.42  ? 635  LYS A CE    1 
ATOM   5199 N  NZ    . LYS A 1 635 ? -14.672 38.399 -12.327 1.00 86.46  ? 635  LYS A NZ    1 
ATOM   5200 N  N     . VAL A 1 636 ? -13.766 32.254 -8.835  1.00 75.59  ? 636  VAL A N     1 
ATOM   5201 C  CA    . VAL A 1 636 ? -13.375 30.889 -9.152  1.00 78.17  ? 636  VAL A CA    1 
ATOM   5202 C  C     . VAL A 1 636 ? -14.551 29.950 -8.897  1.00 82.29  ? 636  VAL A C     1 
ATOM   5203 O  O     . VAL A 1 636 ? -14.685 28.907 -9.541  1.00 87.38  ? 636  VAL A O     1 
ATOM   5204 C  CB    . VAL A 1 636 ? -12.159 30.455 -8.306  1.00 76.71  ? 636  VAL A CB    1 
ATOM   5205 C  CG1   . VAL A 1 636 ? -11.711 29.047 -8.673  1.00 77.06  ? 636  VAL A CG1   1 
ATOM   5206 C  CG2   . VAL A 1 636 ? -11.016 31.441 -8.488  1.00 76.64  ? 636  VAL A CG2   1 
ATOM   5207 N  N     . GLY A 1 637 ? -15.415 30.341 -7.966  1.00 80.06  ? 637  GLY A N     1 
ATOM   5208 C  CA    . GLY A 1 637 ? -16.539 29.514 -7.572  1.00 82.32  ? 637  GLY A CA    1 
ATOM   5209 C  C     . GLY A 1 637 ? -16.095 28.482 -6.556  1.00 83.11  ? 637  GLY A C     1 
ATOM   5210 O  O     . GLY A 1 637 ? -15.065 27.832 -6.740  1.00 84.32  ? 637  GLY A O     1 
ATOM   5211 N  N     . GLU A 1 638 ? -16.868 28.330 -5.485  1.00 82.94  ? 638  GLU A N     1 
ATOM   5212 C  CA    . GLU A 1 638 ? -16.505 27.430 -4.391  1.00 81.55  ? 638  GLU A CA    1 
ATOM   5213 C  C     . GLU A 1 638 ? -16.341 25.975 -4.825  1.00 83.12  ? 638  GLU A C     1 
ATOM   5214 O  O     . GLU A 1 638 ? -15.624 25.208 -4.182  1.00 83.11  ? 638  GLU A O     1 
ATOM   5215 C  CB    . GLU A 1 638 ? -17.531 27.511 -3.257  1.00 79.01  ? 638  GLU A CB    1 
ATOM   5216 C  CG    . GLU A 1 638 ? -17.318 28.665 -2.294  1.00 72.46  ? 638  GLU A CG    1 
ATOM   5217 C  CD    . GLU A 1 638 ? -18.100 28.489 -1.007  1.00 67.97  ? 638  GLU A CD    1 
ATOM   5218 O  OE1   . GLU A 1 638 ? -18.893 27.528 -0.920  1.00 66.28  ? 638  GLU A OE1   1 
ATOM   5219 O  OE2   . GLU A 1 638 ? -17.918 29.306 -0.080  1.00 67.05  ? 638  GLU A OE2   1 
ATOM   5220 N  N     . SER A 1 639 ? -17.008 25.606 -5.914  1.00 85.75  ? 639  SER A N     1 
ATOM   5221 C  CA    . SER A 1 639 ? -17.010 24.226 -6.393  1.00 87.91  ? 639  SER A CA    1 
ATOM   5222 C  C     . SER A 1 639 ? -15.619 23.724 -6.773  1.00 87.92  ? 639  SER A C     1 
ATOM   5223 O  O     . SER A 1 639 ? -15.312 22.544 -6.607  1.00 89.50  ? 639  SER A O     1 
ATOM   5224 C  CB    . SER A 1 639 ? -17.954 24.083 -7.590  1.00 91.33  ? 639  SER A CB    1 
ATOM   5225 N  N     . LYS A 1 640 ? -14.779 24.624 -7.274  1.00 86.68  ? 640  LYS A N     1 
ATOM   5226 C  CA    . LYS A 1 640 ? -13.459 24.248 -7.773  1.00 86.63  ? 640  LYS A CA    1 
ATOM   5227 C  C     . LYS A 1 640 ? -12.454 23.925 -6.665  1.00 82.53  ? 640  LYS A C     1 
ATOM   5228 O  O     . LYS A 1 640 ? -11.300 23.602 -6.946  1.00 84.71  ? 640  LYS A O     1 
ATOM   5229 C  CB    . LYS A 1 640 ? -12.900 25.346 -8.683  1.00 85.87  ? 640  LYS A CB    1 
ATOM   5230 N  N     . PHE A 1 641 ? -12.888 24.011 -5.411  1.00 75.82  ? 641  PHE A N     1 
ATOM   5231 C  CA    . PHE A 1 641 ? -12.003 23.730 -4.283  1.00 71.16  ? 641  PHE A CA    1 
ATOM   5232 C  C     . PHE A 1 641 ? -12.255 22.350 -3.680  1.00 71.88  ? 641  PHE A C     1 
ATOM   5233 O  O     . PHE A 1 641 ? -13.400 21.966 -3.438  1.00 72.20  ? 641  PHE A O     1 
ATOM   5234 C  CB    . PHE A 1 641 ? -12.128 24.813 -3.208  1.00 63.28  ? 641  PHE A CB    1 
ATOM   5235 C  CG    . PHE A 1 641 ? -11.697 26.176 -3.669  1.00 68.92  ? 641  PHE A CG    1 
ATOM   5236 C  CD1   . PHE A 1 641 ? -12.629 27.178 -3.883  1.00 61.88  ? 641  PHE A CD1   1 
ATOM   5237 C  CD2   . PHE A 1 641 ? -10.359 26.454 -3.896  1.00 69.59  ? 641  PHE A CD2   1 
ATOM   5238 C  CE1   . PHE A 1 641 ? -12.235 28.433 -4.309  1.00 60.93  ? 641  PHE A CE1   1 
ATOM   5239 C  CE2   . PHE A 1 641 ? -9.958  27.708 -4.324  1.00 68.74  ? 641  PHE A CE2   1 
ATOM   5240 C  CZ    . PHE A 1 641 ? -10.898 28.698 -4.530  1.00 66.98  ? 641  PHE A CZ    1 
ATOM   5241 N  N     . ARG A 1 642 ? -11.173 21.615 -3.439  1.00 72.53  ? 642  ARG A N     1 
ATOM   5242 C  CA    . ARG A 1 642 ? -11.254 20.276 -2.863  1.00 75.21  ? 642  ARG A CA    1 
ATOM   5243 C  C     . ARG A 1 642 ? -11.670 20.327 -1.397  1.00 73.89  ? 642  ARG A C     1 
ATOM   5244 O  O     . ARG A 1 642 ? -12.589 19.623 -0.977  1.00 76.16  ? 642  ARG A O     1 
ATOM   5245 C  CB    . ARG A 1 642 ? -9.909  19.556 -2.995  1.00 76.52  ? 642  ARG A CB    1 
ATOM   5246 C  CG    . ARG A 1 642 ? -9.478  19.295 -4.430  1.00 80.88  ? 642  ARG A CG    1 
ATOM   5247 C  CD    . ARG A 1 642 ? -8.113  18.627 -4.487  1.00 83.43  ? 642  ARG A CD    1 
ATOM   5248 N  NE    . ARG A 1 642 ? -7.077  19.452 -3.872  1.00 84.86  ? 642  ARG A NE    1 
ATOM   5249 C  CZ    . ARG A 1 642 ? -6.406  20.406 -4.510  1.00 86.06  ? 642  ARG A CZ    1 
ATOM   5250 N  NH1   . ARG A 1 642 ? -6.663  20.660 -5.787  1.00 87.70  ? 642  ARG A NH1   1 
ATOM   5251 N  NH2   . ARG A 1 642 ? -5.479  21.107 -3.872  1.00 84.45  ? 642  ARG A NH2   1 
ATOM   5252 N  N     . ASP A 1 643 ? -10.983 21.161 -0.622  1.00 68.15  ? 643  ASP A N     1 
ATOM   5253 C  CA    . ASP A 1 643 ? -11.275 21.304 0.800   1.00 65.56  ? 643  ASP A CA    1 
ATOM   5254 C  C     . ASP A 1 643 ? -10.996 22.721 1.299   1.00 62.97  ? 643  ASP A C     1 
ATOM   5255 O  O     . ASP A 1 643 ? -10.636 23.605 0.520   1.00 58.36  ? 643  ASP A O     1 
ATOM   5256 C  CB    . ASP A 1 643 ? -10.484 20.279 1.618   1.00 66.76  ? 643  ASP A CB    1 
ATOM   5257 C  CG    . ASP A 1 643 ? -9.028  20.191 1.199   1.00 68.86  ? 643  ASP A CG    1 
ATOM   5258 O  OD1   . ASP A 1 643 ? -8.459  21.220 0.781   1.00 68.10  ? 643  ASP A OD1   1 
ATOM   5259 O  OD2   . ASP A 1 643 ? -8.452  19.086 1.287   1.00 72.10  ? 643  ASP A OD2   1 
ATOM   5260 N  N     . THR A 1 644 ? -11.169 22.928 2.602   1.00 60.51  ? 644  THR A N     1 
ATOM   5261 C  CA    . THR A 1 644 ? -10.930 24.230 3.214   1.00 57.97  ? 644  THR A CA    1 
ATOM   5262 C  C     . THR A 1 644 ? -9.508  24.705 2.952   1.00 57.50  ? 644  THR A C     1 
ATOM   5263 O  O     . THR A 1 644 ? -9.290  25.839 2.529   1.00 55.32  ? 644  THR A O     1 
ATOM   5264 C  CB    . THR A 1 644 ? -11.171 24.193 4.736   1.00 52.43  ? 644  THR A CB    1 
ATOM   5265 O  OG1   . THR A 1 644 ? -12.555 23.933 4.999   1.00 61.03  ? 644  THR A OG1   1 
ATOM   5266 C  CG2   . THR A 1 644 ? -10.782 25.519 5.369   1.00 49.93  ? 644  THR A CG2   1 
ATOM   5267 N  N     . ASN A 1 645 ? -8.546  23.818 3.188   1.00 60.42  ? 645  ASN A N     1 
ATOM   5268 C  CA    . ASN A 1 645 ? -7.135  24.147 3.032   1.00 62.62  ? 645  ASN A CA    1 
ATOM   5269 C  C     . ASN A 1 645 ? -6.777  24.547 1.601   1.00 62.68  ? 645  ASN A C     1 
ATOM   5270 O  O     . ASN A 1 645 ? -5.789  25.246 1.373   1.00 59.68  ? 645  ASN A O     1 
ATOM   5271 C  CB    . ASN A 1 645 ? -6.264  22.975 3.493   1.00 65.52  ? 645  ASN A CB    1 
ATOM   5272 C  CG    . ASN A 1 645 ? -4.824  23.381 3.750   1.00 67.20  ? 645  ASN A CG    1 
ATOM   5273 O  OD1   . ASN A 1 645 ? -4.517  24.008 4.764   1.00 70.37  ? 645  ASN A OD1   1 
ATOM   5274 N  ND2   . ASN A 1 645 ? -3.933  23.015 2.836   1.00 66.39  ? 645  ASN A ND2   1 
ATOM   5275 N  N     . HIS A 1 646 ? -7.590  24.111 0.643   1.00 63.23  ? 646  HIS A N     1 
ATOM   5276 C  CA    . HIS A 1 646 ? -7.356  24.442 -0.757  1.00 64.09  ? 646  HIS A CA    1 
ATOM   5277 C  C     . HIS A 1 646 ? -7.586  25.928 -1.030  1.00 64.31  ? 646  HIS A C     1 
ATOM   5278 O  O     . HIS A 1 646 ? -6.725  26.594 -1.606  1.00 63.07  ? 646  HIS A O     1 
ATOM   5279 C  CB    . HIS A 1 646 ? -8.225  23.587 -1.683  1.00 66.91  ? 646  HIS A CB    1 
ATOM   5280 C  CG    . HIS A 1 646 ? -7.940  23.791 -3.140  1.00 70.79  ? 646  HIS A CG    1 
ATOM   5281 N  ND1   . HIS A 1 646 ? -8.771  23.326 -4.134  1.00 72.76  ? 646  HIS A ND1   1 
ATOM   5282 C  CD2   . HIS A 1 646 ? -6.909  24.409 -3.769  1.00 70.40  ? 646  HIS A CD2   1 
ATOM   5283 C  CE1   . HIS A 1 646 ? -8.270  23.652 -5.313  1.00 73.34  ? 646  HIS A CE1   1 
ATOM   5284 N  NE2   . HIS A 1 646 ? -7.143  24.308 -5.120  1.00 71.95  ? 646  HIS A NE2   1 
ATOM   5285 N  N     . TRP A 1 647 ? -8.740  26.451 -0.623  1.00 62.18  ? 647  TRP A N     1 
ATOM   5286 C  CA    . TRP A 1 647 ? -9.014  27.868 -0.846  1.00 60.49  ? 647  TRP A CA    1 
ATOM   5287 C  C     . TRP A 1 647 ? -8.161  28.761 0.049   1.00 55.72  ? 647  TRP A C     1 
ATOM   5288 O  O     . TRP A 1 647 ? -7.907  29.918 -0.283  1.00 57.56  ? 647  TRP A O     1 
ATOM   5289 C  CB    . TRP A 1 647 ? -10.511 28.206 -0.731  1.00 58.62  ? 647  TRP A CB    1 
ATOM   5290 C  CG    . TRP A 1 647 ? -11.144 27.994 0.621   1.00 55.42  ? 647  TRP A CG    1 
ATOM   5291 C  CD1   . TRP A 1 647 ? -11.934 26.948 0.996   1.00 57.13  ? 647  TRP A CD1   1 
ATOM   5292 C  CD2   . TRP A 1 647 ? -11.069 28.867 1.759   1.00 53.85  ? 647  TRP A CD2   1 
ATOM   5293 N  NE1   . TRP A 1 647 ? -12.346 27.107 2.298   1.00 55.35  ? 647  TRP A NE1   1 
ATOM   5294 C  CE2   . TRP A 1 647 ? -11.828 28.276 2.789   1.00 53.47  ? 647  TRP A CE2   1 
ATOM   5295 C  CE3   . TRP A 1 647 ? -10.429 30.085 2.010   1.00 54.10  ? 647  TRP A CE3   1 
ATOM   5296 C  CZ2   . TRP A 1 647 ? -11.963 28.859 4.048   1.00 53.95  ? 647  TRP A CZ2   1 
ATOM   5297 C  CZ3   . TRP A 1 647 ? -10.565 30.664 3.262   1.00 53.07  ? 647  TRP A CZ3   1 
ATOM   5298 C  CH2   . TRP A 1 647 ? -11.326 30.050 4.264   1.00 51.80  ? 647  TRP A CH2   1 
ATOM   5299 N  N     . VAL A 1 648 ? -7.714  28.218 1.178   1.00 53.17  ? 648  VAL A N     1 
ATOM   5300 C  CA    . VAL A 1 648 ? -6.796  28.940 2.052   1.00 52.42  ? 648  VAL A CA    1 
ATOM   5301 C  C     . VAL A 1 648 ? -5.454  29.126 1.346   1.00 57.39  ? 648  VAL A C     1 
ATOM   5302 O  O     . VAL A 1 648 ? -4.858  30.203 1.400   1.00 56.92  ? 648  VAL A O     1 
ATOM   5303 C  CB    . VAL A 1 648 ? -6.597  28.223 3.407   1.00 50.45  ? 648  VAL A CB    1 
ATOM   5304 C  CG1   . VAL A 1 648 ? -5.513  28.911 4.224   1.00 45.43  ? 648  VAL A CG1   1 
ATOM   5305 C  CG2   . VAL A 1 648 ? -7.903  28.190 4.187   1.00 49.74  ? 648  VAL A CG2   1 
ATOM   5306 N  N     . ASP A 1 649 ? -4.992  28.075 0.673   1.00 58.00  ? 649  ASP A N     1 
ATOM   5307 C  CA    . ASP A 1 649 ? -3.788  28.160 -0.148  1.00 59.22  ? 649  ASP A CA    1 
ATOM   5308 C  C     . ASP A 1 649 ? -3.994  29.153 -1.283  1.00 60.45  ? 649  ASP A C     1 
ATOM   5309 O  O     . ASP A 1 649 ? -3.090  29.916 -1.629  1.00 57.83  ? 649  ASP A O     1 
ATOM   5310 C  CB    . ASP A 1 649 ? -3.421  26.790 -0.727  1.00 62.38  ? 649  ASP A CB    1 
ATOM   5311 C  CG    . ASP A 1 649 ? -2.608  25.943 0.236   1.00 67.33  ? 649  ASP A CG    1 
ATOM   5312 O  OD1   . ASP A 1 649 ? -2.698  24.700 0.154   1.00 69.15  ? 649  ASP A OD1   1 
ATOM   5313 O  OD2   . ASP A 1 649 ? -1.878  26.520 1.071   1.00 65.40  ? 649  ASP A OD2   1 
ATOM   5314 N  N     . PHE A 1 650 ? -5.193  29.134 -1.858  1.00 59.79  ? 650  PHE A N     1 
ATOM   5315 C  CA    . PHE A 1 650 ? -5.536  30.018 -2.964  1.00 62.14  ? 650  PHE A CA    1 
ATOM   5316 C  C     . PHE A 1 650 ? -5.462  31.488 -2.563  1.00 57.64  ? 650  PHE A C     1 
ATOM   5317 O  O     . PHE A 1 650 ? -4.872  32.306 -3.272  1.00 54.35  ? 650  PHE A O     1 
ATOM   5318 C  CB    . PHE A 1 650 ? -6.929  29.684 -3.502  1.00 66.83  ? 650  PHE A CB    1 
ATOM   5319 C  CG    . PHE A 1 650 ? -7.426  30.651 -4.535  1.00 69.62  ? 650  PHE A CG    1 
ATOM   5320 C  CD1   . PHE A 1 650 ? -6.830  30.716 -5.782  1.00 73.55  ? 650  PHE A CD1   1 
ATOM   5321 C  CD2   . PHE A 1 650 ? -8.492  31.491 -4.261  1.00 69.62  ? 650  PHE A CD2   1 
ATOM   5322 C  CE1   . PHE A 1 650 ? -7.284  31.606 -6.737  1.00 74.54  ? 650  PHE A CE1   1 
ATOM   5323 C  CE2   . PHE A 1 650 ? -8.952  32.382 -5.211  1.00 70.23  ? 650  PHE A CE2   1 
ATOM   5324 C  CZ    . PHE A 1 650 ? -8.346  32.440 -6.450  1.00 73.16  ? 650  PHE A CZ    1 
ATOM   5325 N  N     . LEU A 1 651 ? -6.058  31.819 -1.422  1.00 56.25  ? 651  LEU A N     1 
ATOM   5326 C  CA    . LEU A 1 651 ? -6.043  33.190 -0.928  1.00 55.81  ? 651  LEU A CA    1 
ATOM   5327 C  C     . LEU A 1 651 ? -4.641  33.599 -0.484  1.00 56.03  ? 651  LEU A C     1 
ATOM   5328 O  O     . LEU A 1 651 ? -4.221  34.737 -0.702  1.00 56.44  ? 651  LEU A O     1 
ATOM   5329 C  CB    . LEU A 1 651 ? -7.045  33.367 0.215   1.00 54.66  ? 651  LEU A CB    1 
ATOM   5330 C  CG    . LEU A 1 651 ? -8.521  33.198 -0.153  1.00 53.01  ? 651  LEU A CG    1 
ATOM   5331 C  CD1   . LEU A 1 651 ? -9.415  33.555 1.025   1.00 47.49  ? 651  LEU A CD1   1 
ATOM   5332 C  CD2   . LEU A 1 651 ? -8.870  34.039 -1.373  1.00 51.84  ? 651  LEU A CD2   1 
ATOM   5333 N  N     . ASP A 1 652 ? -3.926  32.665 0.136   1.00 55.73  ? 652  ASP A N     1 
ATOM   5334 C  CA    . ASP A 1 652 ? -2.548  32.895 0.556   1.00 52.66  ? 652  ASP A CA    1 
ATOM   5335 C  C     . ASP A 1 652 ? -1.682  33.276 -0.638  1.00 54.46  ? 652  ASP A C     1 
ATOM   5336 O  O     . ASP A 1 652 ? -0.871  34.199 -0.562  1.00 52.15  ? 652  ASP A O     1 
ATOM   5337 C  CB    . ASP A 1 652 ? -1.982  31.646 1.235   1.00 53.01  ? 652  ASP A CB    1 
ATOM   5338 C  CG    . ASP A 1 652 ? -0.521  31.800 1.614   1.00 59.78  ? 652  ASP A CG    1 
ATOM   5339 O  OD1   . ASP A 1 652 ? -0.127  32.906 2.043   1.00 59.34  ? 652  ASP A OD1   1 
ATOM   5340 O  OD2   . ASP A 1 652 ? 0.234   30.814 1.478   1.00 64.53  ? 652  ASP A OD2   1 
ATOM   5341 N  N     . LYS A 1 653 ? -1.867  32.558 -1.740  1.00 53.91  ? 653  LYS A N     1 
ATOM   5342 C  CA    . LYS A 1 653 ? -1.147  32.836 -2.975  1.00 59.53  ? 653  LYS A CA    1 
ATOM   5343 C  C     . LYS A 1 653 ? -1.600  34.159 -3.581  1.00 57.52  ? 653  LYS A C     1 
ATOM   5344 O  O     . LYS A 1 653 ? -0.776  34.983 -3.976  1.00 54.44  ? 653  LYS A O     1 
ATOM   5345 C  CB    . LYS A 1 653 ? -1.372  31.708 -3.980  1.00 64.84  ? 653  LYS A CB    1 
ATOM   5346 C  CG    . LYS A 1 653 ? -0.123  30.927 -4.341  1.00 70.71  ? 653  LYS A CG    1 
ATOM   5347 C  CD    . LYS A 1 653 ? -0.488  29.669 -5.110  1.00 74.75  ? 653  LYS A CD    1 
ATOM   5348 C  CE    . LYS A 1 653 ? -1.401  28.779 -4.280  1.00 75.39  ? 653  LYS A CE    1 
ATOM   5349 N  NZ    . LYS A 1 653 ? -1.991  27.669 -5.077  1.00 79.36  ? 653  LYS A NZ    1 
ATOM   5350 N  N     . PHE A 1 654 ? -2.915  34.349 -3.651  1.00 57.54  ? 654  PHE A N     1 
ATOM   5351 C  CA    . PHE A 1 654 ? -3.502  35.547 -4.243  1.00 57.77  ? 654  PHE A CA    1 
ATOM   5352 C  C     . PHE A 1 654 ? -3.008  36.820 -3.563  1.00 56.90  ? 654  PHE A C     1 
ATOM   5353 O  O     . PHE A 1 654 ? -2.659  37.794 -4.231  1.00 54.55  ? 654  PHE A O     1 
ATOM   5354 C  CB    . PHE A 1 654 ? -5.031  35.478 -4.191  1.00 57.37  ? 654  PHE A CB    1 
ATOM   5355 C  CG    . PHE A 1 654 ? -5.717  36.610 -4.904  1.00 57.25  ? 654  PHE A CG    1 
ATOM   5356 C  CD1   . PHE A 1 654 ? -6.067  37.767 -4.225  1.00 59.20  ? 654  PHE A CD1   1 
ATOM   5357 C  CD2   . PHE A 1 654 ? -6.017  36.517 -6.251  1.00 55.85  ? 654  PHE A CD2   1 
ATOM   5358 C  CE1   . PHE A 1 654 ? -6.698  38.808 -4.879  1.00 57.39  ? 654  PHE A CE1   1 
ATOM   5359 C  CE2   . PHE A 1 654 ? -6.650  37.555 -6.909  1.00 58.41  ? 654  PHE A CE2   1 
ATOM   5360 C  CZ    . PHE A 1 654 ? -6.990  38.702 -6.222  1.00 55.82  ? 654  PHE A CZ    1 
ATOM   5361 N  N     . ALA A 1 655 ? -2.981  36.808 -2.234  1.00 55.91  ? 655  ALA A N     1 
ATOM   5362 C  CA    . ALA A 1 655 ? -2.510  37.958 -1.476  1.00 56.32  ? 655  ALA A CA    1 
ATOM   5363 C  C     . ALA A 1 655 ? -1.028  38.187 -1.729  1.00 58.47  ? 655  ALA A C     1 
ATOM   5364 O  O     . ALA A 1 655 ? -0.585  39.320 -1.911  1.00 56.31  ? 655  ALA A O     1 
ATOM   5365 C  CB    . ALA A 1 655 ? -2.761  37.754 0.008   1.00 53.50  ? 655  ALA A CB    1 
ATOM   5366 N  N     . ARG A 1 656 ? -0.271  37.096 -1.752  1.00 58.42  ? 656  ARG A N     1 
ATOM   5367 C  CA    . ARG A 1 656 ? 1.182   37.164 -1.835  1.00 61.01  ? 656  ARG A CA    1 
ATOM   5368 C  C     . ARG A 1 656 ? 1.686   37.467 -3.246  1.00 62.82  ? 656  ARG A C     1 
ATOM   5369 O  O     . ARG A 1 656 ? 2.682   38.170 -3.416  1.00 62.44  ? 656  ARG A O     1 
ATOM   5370 C  CB    . ARG A 1 656 ? 1.789   35.862 -1.305  1.00 65.66  ? 656  ARG A CB    1 
ATOM   5371 C  CG    . ARG A 1 656 ? 3.302   35.778 -1.372  1.00 71.24  ? 656  ARG A CG    1 
ATOM   5372 C  CD    . ARG A 1 656 ? 3.825   34.669 -0.467  1.00 75.31  ? 656  ARG A CD    1 
ATOM   5373 N  NE    . ARG A 1 656 ? 2.861   33.582 -0.305  1.00 77.65  ? 656  ARG A NE    1 
ATOM   5374 C  CZ    . ARG A 1 656 ? 2.700   32.586 -1.170  1.00 81.50  ? 656  ARG A CZ    1 
ATOM   5375 N  NH1   . ARG A 1 656 ? 3.435   32.536 -2.273  1.00 85.51  ? 656  ARG A NH1   1 
ATOM   5376 N  NH2   . ARG A 1 656 ? 1.798   31.642 -0.937  1.00 81.18  ? 656  ARG A NH2   1 
ATOM   5377 N  N     . GLU A 1 657 ? 0.993   36.948 -4.254  1.00 63.77  ? 657  GLU A N     1 
ATOM   5378 C  CA    . GLU A 1 657 ? 1.423   37.119 -5.639  1.00 66.78  ? 657  GLU A CA    1 
ATOM   5379 C  C     . GLU A 1 657 ? 0.793   38.328 -6.330  1.00 63.52  ? 657  GLU A C     1 
ATOM   5380 O  O     . GLU A 1 657 ? 1.414   38.943 -7.197  1.00 60.79  ? 657  GLU A O     1 
ATOM   5381 C  CB    . GLU A 1 657 ? 1.134   35.855 -6.453  1.00 69.84  ? 657  GLU A CB    1 
ATOM   5382 C  CG    . GLU A 1 657 ? 1.950   34.644 -6.039  1.00 73.45  ? 657  GLU A CG    1 
ATOM   5383 C  CD    . GLU A 1 657 ? 1.676   33.439 -6.914  1.00 79.75  ? 657  GLU A CD    1 
ATOM   5384 O  OE1   . GLU A 1 657 ? 2.565   32.569 -7.027  1.00 84.06  ? 657  GLU A OE1   1 
ATOM   5385 O  OE2   . GLU A 1 657 ? 0.569   33.361 -7.490  1.00 80.31  ? 657  GLU A OE2   1 
ATOM   5386 N  N     . ARG A 1 658 ? -0.435  38.664 -5.951  1.00 60.59  ? 658  ARG A N     1 
ATOM   5387 C  CA    . ARG A 1 658 ? -1.168  39.728 -6.631  1.00 60.52  ? 658  ARG A CA    1 
ATOM   5388 C  C     . ARG A 1 658 ? -1.357  40.995 -5.795  1.00 60.74  ? 658  ARG A C     1 
ATOM   5389 O  O     . ARG A 1 658 ? -0.948  42.082 -6.206  1.00 59.74  ? 658  ARG A O     1 
ATOM   5390 C  CB    . ARG A 1 658 ? -2.523  39.215 -7.128  1.00 65.51  ? 658  ARG A CB    1 
ATOM   5391 C  CG    . ARG A 1 658 ? -2.426  38.257 -8.305  1.00 72.84  ? 658  ARG A CG    1 
ATOM   5392 C  CD    . ARG A 1 658 ? -3.793  37.986 -8.913  1.00 77.17  ? 658  ARG A CD    1 
ATOM   5393 N  NE    . ARG A 1 658 ? -3.698  37.288 -10.193 1.00 80.34  ? 658  ARG A NE    1 
ATOM   5394 C  CZ    . ARG A 1 658 ? -3.675  37.895 -11.375 1.00 81.54  ? 658  ARG A CZ    1 
ATOM   5395 N  NH1   . ARG A 1 658 ? -3.743  39.217 -11.446 1.00 80.59  ? 658  ARG A NH1   1 
ATOM   5396 N  NH2   . ARG A 1 658 ? -3.586  37.179 -12.488 1.00 83.38  ? 658  ARG A NH2   1 
ATOM   5397 N  N     . MET A 1 659 ? -1.979  40.854 -4.629  1.00 58.39  ? 659  MET A N     1 
ATOM   5398 C  CA    . MET A 1 659 ? -2.338  42.011 -3.815  1.00 58.33  ? 659  MET A CA    1 
ATOM   5399 C  C     . MET A 1 659 ? -1.132  42.762 -3.251  1.00 57.74  ? 659  MET A C     1 
ATOM   5400 O  O     . MET A 1 659 ? -1.043  43.982 -3.383  1.00 58.01  ? 659  MET A O     1 
ATOM   5401 C  CB    . MET A 1 659 ? -3.297  41.608 -2.692  1.00 57.26  ? 659  MET A CB    1 
ATOM   5402 C  CG    . MET A 1 659 ? -4.640  41.105 -3.195  1.00 59.63  ? 659  MET A CG    1 
ATOM   5403 S  SD    . MET A 1 659 ? -5.824  40.784 -1.876  1.00 53.65  ? 659  MET A SD    1 
ATOM   5404 C  CE    . MET A 1 659 ? -6.079  42.440 -1.243  1.00 53.50  ? 659  MET A CE    1 
ATOM   5405 N  N     . GLU A 1 660 ? -0.209  42.033 -2.630  1.00 55.15  ? 660  GLU A N     1 
ATOM   5406 C  CA    . GLU A 1 660 ? 0.973   42.650 -2.022  1.00 54.33  ? 660  GLU A CA    1 
ATOM   5407 C  C     . GLU A 1 660 ? 1.848   43.477 -2.983  1.00 53.61  ? 660  GLU A C     1 
ATOM   5408 O  O     . GLU A 1 660 ? 2.251   44.586 -2.633  1.00 52.52  ? 660  GLU A O     1 
ATOM   5409 C  CB    . GLU A 1 660 ? 1.812   41.621 -1.251  1.00 52.20  ? 660  GLU A CB    1 
ATOM   5410 C  CG    . GLU A 1 660 ? 1.177   41.149 0.048   1.00 53.81  ? 660  GLU A CG    1 
ATOM   5411 C  CD    . GLU A 1 660 ? 2.075   40.208 0.827   1.00 57.95  ? 660  GLU A CD    1 
ATOM   5412 O  OE1   . GLU A 1 660 ? 3.284   40.146 0.518   1.00 57.77  ? 660  GLU A OE1   1 
ATOM   5413 O  OE2   . GLU A 1 660 ? 1.573   39.529 1.748   1.00 61.52  ? 660  GLU A OE2   1 
ATOM   5414 N  N     . PRO A 1 661 ? 2.153   42.948 -4.186  1.00 53.85  ? 661  PRO A N     1 
ATOM   5415 C  CA    . PRO A 1 661 ? 2.895   43.798 -5.128  1.00 54.56  ? 661  PRO A CA    1 
ATOM   5416 C  C     . PRO A 1 661 ? 2.141   45.076 -5.496  1.00 55.23  ? 661  PRO A C     1 
ATOM   5417 O  O     . PRO A 1 661 ? 2.764   46.123 -5.676  1.00 56.16  ? 661  PRO A O     1 
ATOM   5418 C  CB    . PRO A 1 661 ? 3.045   42.902 -6.359  1.00 54.55  ? 661  PRO A CB    1 
ATOM   5419 C  CG    . PRO A 1 661 ? 3.019   41.521 -5.812  1.00 54.55  ? 661  PRO A CG    1 
ATOM   5420 C  CD    . PRO A 1 661 ? 2.034   41.564 -4.683  1.00 51.35  ? 661  PRO A CD    1 
ATOM   5421 N  N     . ALA A 1 662 ? 0.818   44.988 -5.606  1.00 53.55  ? 662  ALA A N     1 
ATOM   5422 C  CA    . ALA A 1 662 ? 0.001   46.159 -5.901  1.00 54.36  ? 662  ALA A CA    1 
ATOM   5423 C  C     . ALA A 1 662 ? 0.052   47.144 -4.738  1.00 52.12  ? 662  ALA A C     1 
ATOM   5424 O  O     . ALA A 1 662 ? 0.167   48.353 -4.940  1.00 53.88  ? 662  ALA A O     1 
ATOM   5425 C  CB    . ALA A 1 662 ? -1.433  45.747 -6.187  1.00 54.69  ? 662  ALA A CB    1 
ATOM   5426 N  N     . ILE A 1 663 ? -0.031  46.612 -3.522  1.00 49.38  ? 663  ILE A N     1 
ATOM   5427 C  CA    . ILE A 1 663 ? 0.079   47.420 -2.314  1.00 49.21  ? 663  ILE A CA    1 
ATOM   5428 C  C     . ILE A 1 663 ? 1.444   48.099 -2.251  1.00 49.57  ? 663  ILE A C     1 
ATOM   5429 O  O     . ILE A 1 663 ? 1.548   49.274 -1.893  1.00 49.72  ? 663  ILE A O     1 
ATOM   5430 C  CB    . ILE A 1 663 ? -0.139  46.563 -1.048  1.00 47.85  ? 663  ILE A CB    1 
ATOM   5431 C  CG1   . ILE A 1 663 ? -1.573  46.031 -1.010  1.00 47.93  ? 663  ILE A CG1   1 
ATOM   5432 C  CG2   . ILE A 1 663 ? 0.159   47.365 0.213   1.00 42.30  ? 663  ILE A CG2   1 
ATOM   5433 C  CD1   . ILE A 1 663 ? -1.831  45.060 0.117   1.00 47.90  ? 663  ILE A CD1   1 
ATOM   5434 N  N     . ASP A 1 664 ? 2.484   47.355 -2.613  1.00 50.56  ? 664  ASP A N     1 
ATOM   5435 C  CA    . ASP A 1 664 ? 3.839   47.893 -2.639  1.00 54.33  ? 664  ASP A CA    1 
ATOM   5436 C  C     . ASP A 1 664 ? 3.952   49.061 -3.614  1.00 54.46  ? 664  ASP A C     1 
ATOM   5437 O  O     . ASP A 1 664 ? 4.549   50.087 -3.291  1.00 52.09  ? 664  ASP A O     1 
ATOM   5438 C  CB    . ASP A 1 664 ? 4.855   46.804 -2.993  1.00 61.59  ? 664  ASP A CB    1 
ATOM   5439 C  CG    . ASP A 1 664 ? 4.983   45.753 -1.908  1.00 67.88  ? 664  ASP A CG    1 
ATOM   5440 O  OD1   . ASP A 1 664 ? 4.474   45.987 -0.790  1.00 68.88  ? 664  ASP A OD1   1 
ATOM   5441 O  OD2   . ASP A 1 664 ? 5.598   44.698 -2.168  1.00 71.46  ? 664  ASP A OD2   1 
ATOM   5442 N  N     . ARG A 1 665 ? 3.372   48.905 -4.802  1.00 55.31  ? 665  ARG A N     1 
ATOM   5443 C  CA    . ARG A 1 665 ? 3.369   49.978 -5.793  1.00 55.59  ? 665  ARG A CA    1 
ATOM   5444 C  C     . ARG A 1 665 ? 2.627   51.201 -5.265  1.00 53.59  ? 665  ARG A C     1 
ATOM   5445 O  O     . ARG A 1 665 ? 3.053   52.336 -5.477  1.00 52.09  ? 665  ARG A O     1 
ATOM   5446 C  CB    . ARG A 1 665 ? 2.740   49.510 -7.109  1.00 57.54  ? 665  ARG A CB    1 
ATOM   5447 C  CG    . ARG A 1 665 ? 3.480   48.368 -7.789  1.00 60.86  ? 665  ARG A CG    1 
ATOM   5448 C  CD    . ARG A 1 665 ? 3.021   48.176 -9.231  1.00 63.91  ? 665  ARG A CD    1 
ATOM   5449 N  NE    . ARG A 1 665 ? 1.584   47.936 -9.338  1.00 64.60  ? 665  ARG A NE    1 
ATOM   5450 C  CZ    . ARG A 1 665 ? 1.024   46.729 -9.338  1.00 64.17  ? 665  ARG A CZ    1 
ATOM   5451 N  NH1   . ARG A 1 665 ? 1.780   45.645 -9.232  1.00 61.56  ? 665  ARG A NH1   1 
ATOM   5452 N  NH2   . ARG A 1 665 ? -0.292  46.607 -9.442  1.00 65.22  ? 665  ARG A NH2   1 
ATOM   5453 N  N     . GLY A 1 666 ? 1.520   50.959 -4.568  1.00 53.24  ? 666  GLY A N     1 
ATOM   5454 C  CA    . GLY A 1 666 ? 0.709   52.029 -4.017  1.00 51.51  ? 666  GLY A CA    1 
ATOM   5455 C  C     . GLY A 1 666 ? 1.446   52.868 -2.990  1.00 49.06  ? 666  GLY A C     1 
ATOM   5456 O  O     . GLY A 1 666 ? 1.355   54.095 -2.997  1.00 45.16  ? 666  GLY A O     1 
ATOM   5457 N  N     . PHE A 1 667 ? 2.184   52.206 -2.105  1.00 48.14  ? 667  PHE A N     1 
ATOM   5458 C  CA    . PHE A 1 667 ? 2.935   52.904 -1.066  1.00 47.31  ? 667  PHE A CA    1 
ATOM   5459 C  C     . PHE A 1 667 ? 4.180   53.596 -1.619  1.00 47.27  ? 667  PHE A C     1 
ATOM   5460 O  O     . PHE A 1 667 ? 4.555   54.673 -1.155  1.00 45.71  ? 667  PHE A O     1 
ATOM   5461 C  CB    . PHE A 1 667 ? 3.300   51.952 0.076   1.00 40.43  ? 667  PHE A CB    1 
ATOM   5462 C  CG    . PHE A 1 667 ? 2.231   51.833 1.127   1.00 38.43  ? 667  PHE A CG    1 
ATOM   5463 C  CD1   . PHE A 1 667 ? 1.617   52.965 1.636   1.00 37.98  ? 667  PHE A CD1   1 
ATOM   5464 C  CD2   . PHE A 1 667 ? 1.837   50.593 1.600   1.00 38.97  ? 667  PHE A CD2   1 
ATOM   5465 C  CE1   . PHE A 1 667 ? 0.632   52.864 2.603   1.00 35.07  ? 667  PHE A CE1   1 
ATOM   5466 C  CE2   . PHE A 1 667 ? 0.851   50.484 2.566   1.00 38.73  ? 667  PHE A CE2   1 
ATOM   5467 C  CZ    . PHE A 1 667 ? 0.248   51.625 3.068   1.00 36.11  ? 667  PHE A CZ    1 
ATOM   5468 N  N     . ARG A 1 668 ? 4.815   52.977 -2.611  1.00 49.25  ? 668  ARG A N     1 
ATOM   5469 C  CA    . ARG A 1 668 ? 5.963   53.587 -3.277  1.00 52.26  ? 668  ARG A CA    1 
ATOM   5470 C  C     . ARG A 1 668 ? 5.568   54.919 -3.902  1.00 51.01  ? 668  ARG A C     1 
ATOM   5471 O  O     . ARG A 1 668 ? 6.333   55.883 -3.869  1.00 50.25  ? 668  ARG A O     1 
ATOM   5472 C  CB    . ARG A 1 668 ? 6.534   52.658 -4.349  1.00 56.27  ? 668  ARG A CB    1 
ATOM   5473 C  CG    . ARG A 1 668 ? 7.329   51.489 -3.796  1.00 60.27  ? 668  ARG A CG    1 
ATOM   5474 C  CD    . ARG A 1 668 ? 7.994   50.695 -4.909  1.00 66.20  ? 668  ARG A CD    1 
ATOM   5475 N  NE    . ARG A 1 668 ? 8.729   49.547 -4.387  1.00 72.00  ? 668  ARG A NE    1 
ATOM   5476 C  CZ    . ARG A 1 668 ? 9.961   49.613 -3.893  1.00 74.71  ? 668  ARG A CZ    1 
ATOM   5477 N  NH1   . ARG A 1 668 ? 10.600  50.775 -3.854  1.00 74.77  ? 668  ARG A NH1   1 
ATOM   5478 N  NH2   . ARG A 1 668 ? 10.555  48.518 -3.437  1.00 75.48  ? 668  ARG A NH2   1 
ATOM   5479 N  N     . GLU A 1 669 ? 4.365   54.963 -4.466  1.00 45.49  ? 669  GLU A N     1 
ATOM   5480 C  CA    . GLU A 1 669 ? 3.832   56.193 -5.031  1.00 46.64  ? 669  GLU A CA    1 
ATOM   5481 C  C     . GLU A 1 669 ? 3.593   57.225 -3.935  1.00 42.28  ? 669  GLU A C     1 
ATOM   5482 O  O     . GLU A 1 669 ? 3.869   58.410 -4.117  1.00 40.54  ? 669  GLU A O     1 
ATOM   5483 C  CB    . GLU A 1 669 ? 2.535   55.920 -5.792  1.00 49.27  ? 669  GLU A CB    1 
ATOM   5484 C  CG    . GLU A 1 669 ? 1.881   57.168 -6.361  1.00 52.31  ? 669  GLU A CG    1 
ATOM   5485 C  CD    . GLU A 1 669 ? 0.580   56.870 -7.076  1.00 59.37  ? 669  GLU A CD    1 
ATOM   5486 O  OE1   . GLU A 1 669 ? 0.510   55.843 -7.784  1.00 64.67  ? 669  GLU A OE1   1 
ATOM   5487 O  OE2   . GLU A 1 669 ? -0.376  57.659 -6.926  1.00 62.31  ? 669  GLU A OE2   1 
ATOM   5488 N  N     . MET A 1 670 ? 3.085   56.766 -2.795  1.00 38.17  ? 670  MET A N     1 
ATOM   5489 C  CA    . MET A 1 670 ? 2.835   57.651 -1.662  1.00 39.85  ? 670  MET A CA    1 
ATOM   5490 C  C     . MET A 1 670 ? 4.145   58.217 -1.121  1.00 40.96  ? 670  MET A C     1 
ATOM   5491 O  O     . MET A 1 670 ? 4.213   59.381 -0.728  1.00 43.85  ? 670  MET A O     1 
ATOM   5492 C  CB    . MET A 1 670 ? 2.079   56.917 -0.551  1.00 38.48  ? 670  MET A CB    1 
ATOM   5493 C  CG    . MET A 1 670 ? 1.455   57.847 0.485   1.00 38.68  ? 670  MET A CG    1 
ATOM   5494 S  SD    . MET A 1 670 ? 0.763   56.986 1.911   1.00 40.28  ? 670  MET A SD    1 
ATOM   5495 C  CE    . MET A 1 670 ? 2.258   56.547 2.791   1.00 33.00  ? 670  MET A CE    1 
ATOM   5496 N  N     . CYS A 1 671 ? 5.181   57.383 -1.109  1.00 39.05  ? 671  CYS A N     1 
ATOM   5497 C  CA    . CYS A 1 671 ? 6.503   57.798 -0.658  1.00 38.55  ? 671  CYS A CA    1 
ATOM   5498 C  C     . CYS A 1 671 ? 7.055   58.903 -1.555  1.00 42.01  ? 671  CYS A C     1 
ATOM   5499 O  O     . CYS A 1 671 ? 7.673   59.853 -1.078  1.00 41.55  ? 671  CYS A O     1 
ATOM   5500 C  CB    . CYS A 1 671 ? 7.457   56.600 -0.641  1.00 42.14  ? 671  CYS A CB    1 
ATOM   5501 S  SG    . CYS A 1 671 ? 9.151   56.987 -0.133  1.00 46.79  ? 671  CYS A SG    1 
ATOM   5502 N  N     . GLU A 1 672 ? 6.821   58.766 -2.857  1.00 45.23  ? 672  GLU A N     1 
ATOM   5503 C  CA    . GLU A 1 672 ? 7.223   59.771 -3.835  1.00 50.48  ? 672  GLU A CA    1 
ATOM   5504 C  C     . GLU A 1 672 ? 6.397   61.043 -3.668  1.00 47.68  ? 672  GLU A C     1 
ATOM   5505 O  O     . GLU A 1 672 ? 6.912   62.154 -3.798  1.00 45.59  ? 672  GLU A O     1 
ATOM   5506 C  CB    . GLU A 1 672 ? 7.056   59.216 -5.253  1.00 56.71  ? 672  GLU A CB    1 
ATOM   5507 C  CG    . GLU A 1 672 ? 7.093   60.264 -6.358  1.00 67.15  ? 672  GLU A CG    1 
ATOM   5508 C  CD    . GLU A 1 672 ? 8.491   60.784 -6.637  1.00 75.29  ? 672  GLU A CD    1 
ATOM   5509 O  OE1   . GLU A 1 672 ? 9.465   60.178 -6.140  1.00 77.13  ? 672  GLU A OE1   1 
ATOM   5510 O  OE2   . GLU A 1 672 ? 8.614   61.800 -7.356  1.00 77.64  ? 672  GLU A OE2   1 
ATOM   5511 N  N     . TYR A 1 673 ? 5.113   60.862 -3.376  1.00 45.24  ? 673  TYR A N     1 
ATOM   5512 C  CA    . TYR A 1 673 ? 4.189   61.968 -3.148  1.00 44.06  ? 673  TYR A CA    1 
ATOM   5513 C  C     . TYR A 1 673 ? 4.676   62.852 -2.003  1.00 43.18  ? 673  TYR A C     1 
ATOM   5514 O  O     . TYR A 1 673 ? 4.671   64.080 -2.106  1.00 41.01  ? 673  TYR A O     1 
ATOM   5515 C  CB    . TYR A 1 673 ? 2.803   61.412 -2.817  1.00 43.88  ? 673  TYR A CB    1 
ATOM   5516 C  CG    . TYR A 1 673 ? 1.678   62.423 -2.842  1.00 43.47  ? 673  TYR A CG    1 
ATOM   5517 C  CD1   . TYR A 1 673 ? 1.801   63.626 -3.529  1.00 43.93  ? 673  TYR A CD1   1 
ATOM   5518 C  CD2   . TYR A 1 673 ? 0.488   62.169 -2.173  1.00 42.62  ? 673  TYR A CD2   1 
ATOM   5519 C  CE1   . TYR A 1 673 ? 0.764   64.546 -3.550  1.00 42.73  ? 673  TYR A CE1   1 
ATOM   5520 C  CE2   . TYR A 1 673 ? -0.550  63.081 -2.189  1.00 44.28  ? 673  TYR A CE2   1 
ATOM   5521 C  CZ    . TYR A 1 673 ? -0.408  64.265 -2.876  1.00 43.66  ? 673  TYR A CZ    1 
ATOM   5522 O  OH    . TYR A 1 673 ? -1.447  65.168 -2.886  1.00 48.12  ? 673  TYR A OH    1 
ATOM   5523 N  N     . MET A 1 674 ? 5.101   62.217 -0.915  1.00 40.08  ? 674  MET A N     1 
ATOM   5524 C  CA    . MET A 1 674 ? 5.576   62.932 0.264   1.00 38.48  ? 674  MET A CA    1 
ATOM   5525 C  C     . MET A 1 674 ? 7.078   63.204 0.201   1.00 38.76  ? 674  MET A C     1 
ATOM   5526 O  O     . MET A 1 674 ? 7.643   63.787 1.128   1.00 40.32  ? 674  MET A O     1 
ATOM   5527 C  CB    . MET A 1 674 ? 5.244   62.145 1.538   1.00 33.36  ? 674  MET A CB    1 
ATOM   5528 C  CG    . MET A 1 674 ? 3.759   62.086 1.870   1.00 34.45  ? 674  MET A CG    1 
ATOM   5529 S  SD    . MET A 1 674 ? 3.077   63.693 2.328   1.00 39.73  ? 674  MET A SD    1 
ATOM   5530 C  CE    . MET A 1 674 ? 1.865   63.930 1.032   1.00 38.99  ? 674  MET A CE    1 
ATOM   5531 N  N     . ASN A 1 675 ? 7.713   62.772 -0.888  1.00 37.32  ? 675  ASN A N     1 
ATOM   5532 C  CA    . ASN A 1 675 ? 9.155   62.935 -1.081  1.00 38.05  ? 675  ASN A CA    1 
ATOM   5533 C  C     . ASN A 1 675 ? 9.960   62.423 0.111   1.00 39.78  ? 675  ASN A C     1 
ATOM   5534 O  O     . ASN A 1 675 ? 10.922  63.056 0.545   1.00 41.73  ? 675  ASN A O     1 
ATOM   5535 C  CB    . ASN A 1 675 ? 9.502   64.400 -1.369  1.00 36.73  ? 675  ASN A CB    1 
ATOM   5536 C  CG    . ASN A 1 675 ? 10.904  64.572 -1.929  1.00 45.23  ? 675  ASN A CG    1 
ATOM   5537 O  OD1   . ASN A 1 675 ? 11.450  63.663 -2.553  1.00 44.70  ? 675  ASN A OD1   1 
ATOM   5538 N  ND2   . ASN A 1 675 ? 11.495  65.741 -1.702  1.00 44.53  ? 675  ASN A ND2   1 
ATOM   5539 N  N     . ASN A 1 676 ? 9.554   61.274 0.643   1.00 36.62  ? 676  ASN A N     1 
ATOM   5540 C  CA    . ASN A 1 676 ? 10.169  60.737 1.849   1.00 36.07  ? 676  ASN A CA    1 
ATOM   5541 C  C     . ASN A 1 676 ? 11.569  60.173 1.619   1.00 38.07  ? 676  ASN A C     1 
ATOM   5542 O  O     . ASN A 1 676 ? 11.954  59.883 0.490   1.00 40.72  ? 676  ASN A O     1 
ATOM   5543 C  CB    . ASN A 1 676 ? 9.264   59.686 2.496   1.00 37.56  ? 676  ASN A CB    1 
ATOM   5544 C  CG    . ASN A 1 676 ? 7.956   60.271 2.999   1.00 35.26  ? 676  ASN A CG    1 
ATOM   5545 O  OD1   . ASN A 1 676 ? 6.903   59.642 2.902   1.00 34.29  ? 676  ASN A OD1   1 
ATOM   5546 N  ND2   . ASN A 1 676 ? 8.018   61.487 3.533   1.00 33.87  ? 676  ASN A ND2   1 
ATOM   5547 N  N     . LYS A 1 677 ? 12.321  60.019 2.704   1.00 40.26  ? 677  LYS A N     1 
ATOM   5548 C  CA    . LYS A 1 677 ? 13.710  59.580 2.626   1.00 41.89  ? 677  LYS A CA    1 
ATOM   5549 C  C     . LYS A 1 677 ? 13.855  58.130 2.166   1.00 42.16  ? 677  LYS A C     1 
ATOM   5550 O  O     . LYS A 1 677 ? 14.728  57.814 1.359   1.00 42.13  ? 677  LYS A O     1 
ATOM   5551 C  CB    . LYS A 1 677 ? 14.410  59.774 3.975   1.00 43.07  ? 677  LYS A CB    1 
ATOM   5552 C  CG    . LYS A 1 677 ? 15.863  59.327 3.982   1.00 45.80  ? 677  LYS A CG    1 
ATOM   5553 C  CD    . LYS A 1 677 ? 16.551  59.652 5.297   1.00 49.34  ? 677  LYS A CD    1 
ATOM   5554 C  CE    . LYS A 1 677 ? 18.027  59.271 5.243   1.00 55.84  ? 677  LYS A CE    1 
ATOM   5555 N  NZ    . LYS A 1 677 ? 18.777  59.736 6.443   1.00 57.87  ? 677  LYS A NZ    1 
ATOM   5556 N  N     . GLN A 1 678 ? 13.003  57.250 2.679   1.00 44.63  ? 678  GLN A N     1 
ATOM   5557 C  CA    . GLN A 1 678 ? 13.107  55.831 2.352   1.00 47.74  ? 678  GLN A CA    1 
ATOM   5558 C  C     . GLN A 1 678 ? 11.772  55.105 2.471   1.00 44.78  ? 678  GLN A C     1 
ATOM   5559 O  O     . GLN A 1 678 ? 11.105  55.189 3.498   1.00 44.87  ? 678  GLN A O     1 
ATOM   5560 C  CB    . GLN A 1 678 ? 14.142  55.153 3.252   1.00 46.35  ? 678  GLN A CB    1 
ATOM   5561 C  CG    . GLN A 1 678 ? 14.295  53.663 3.000   1.00 50.70  ? 678  GLN A CG    1 
ATOM   5562 C  CD    . GLN A 1 678 ? 15.276  53.008 3.952   1.00 52.47  ? 678  GLN A CD    1 
ATOM   5563 O  OE1   . GLN A 1 678 ? 15.723  53.621 4.920   1.00 52.64  ? 678  GLN A OE1   1 
ATOM   5564 N  NE2   . GLN A 1 678 ? 15.617  51.754 3.679   1.00 56.62  ? 678  GLN A NE2   1 
ATOM   5565 N  N     . HIS A 1 679 ? 11.397  54.387 1.416   1.00 45.74  ? 679  HIS A N     1 
ATOM   5566 C  CA    . HIS A 1 679 ? 10.171  53.596 1.412   1.00 44.94  ? 679  HIS A CA    1 
ATOM   5567 C  C     . HIS A 1 679 ? 10.231  52.480 2.452   1.00 43.35  ? 679  HIS A C     1 
ATOM   5568 O  O     . HIS A 1 679 ? 11.025  51.548 2.327   1.00 45.00  ? 679  HIS A O     1 
ATOM   5569 C  CB    . HIS A 1 679 ? 9.923   53.004 0.023   1.00 44.24  ? 679  HIS A CB    1 
ATOM   5570 C  CG    . HIS A 1 679 ? 8.835   51.978 -0.009  1.00 45.24  ? 679  HIS A CG    1 
ATOM   5571 N  ND1   . HIS A 1 679 ? 7.584   52.200 0.525   1.00 43.56  ? 679  HIS A ND1   1 
ATOM   5572 C  CD2   . HIS A 1 679 ? 8.808   50.719 -0.514  1.00 46.67  ? 679  HIS A CD2   1 
ATOM   5573 C  CE1   . HIS A 1 679 ? 6.835   51.124 0.356   1.00 45.88  ? 679  HIS A CE1   1 
ATOM   5574 N  NE2   . HIS A 1 679 ? 7.556   50.212 -0.273  1.00 49.00  ? 679  HIS A NE2   1 
ATOM   5575 N  N     . LEU A 1 680 ? 9.392   52.579 3.479   1.00 39.23  ? 680  LEU A N     1 
ATOM   5576 C  CA    . LEU A 1 680 ? 9.386   51.592 4.556   1.00 36.42  ? 680  LEU A CA    1 
ATOM   5577 C  C     . LEU A 1 680 ? 7.976   51.192 4.975   1.00 36.18  ? 680  LEU A C     1 
ATOM   5578 O  O     . LEU A 1 680 ? 7.781   50.596 6.034   1.00 32.73  ? 680  LEU A O     1 
ATOM   5579 C  CB    . LEU A 1 680 ? 10.171  52.108 5.765   1.00 32.18  ? 680  LEU A CB    1 
ATOM   5580 C  CG    . LEU A 1 680 ? 11.682  52.223 5.563   1.00 37.64  ? 680  LEU A CG    1 
ATOM   5581 C  CD1   . LEU A 1 680 ? 12.323  53.001 6.695   1.00 34.27  ? 680  LEU A CD1   1 
ATOM   5582 C  CD2   . LEU A 1 680 ? 12.307  50.839 5.438   1.00 40.24  ? 680  LEU A CD2   1 
ATOM   5583 N  N     . MET A 1 681 ? 6.993   51.526 4.147   1.00 37.35  ? 681  MET A N     1 
ATOM   5584 C  CA    . MET A 1 681 ? 5.630   51.073 4.383   1.00 35.11  ? 681  MET A CA    1 
ATOM   5585 C  C     . MET A 1 681 ? 5.455   49.675 3.799   1.00 37.34  ? 681  MET A C     1 
ATOM   5586 O  O     . MET A 1 681 ? 5.117   49.521 2.624   1.00 41.04  ? 681  MET A O     1 
ATOM   5587 C  CB    . MET A 1 681 ? 4.617   52.043 3.768   1.00 37.63  ? 681  MET A CB    1 
ATOM   5588 C  CG    . MET A 1 681 ? 4.605   53.441 4.382   1.00 36.09  ? 681  MET A CG    1 
ATOM   5589 S  SD    . MET A 1 681 ? 4.043   53.491 6.098   1.00 34.42  ? 681  MET A SD    1 
ATOM   5590 C  CE    . MET A 1 681 ? 5.608   53.561 6.970   1.00 30.86  ? 681  MET A CE    1 
ATOM   5591 N  N     . PHE A 1 682 ? 5.699   48.660 4.625   1.00 36.85  ? 682  PHE A N     1 
ATOM   5592 C  CA    . PHE A 1 682 ? 5.630   47.267 4.192   1.00 41.76  ? 682  PHE A CA    1 
ATOM   5593 C  C     . PHE A 1 682 ? 4.376   46.579 4.732   1.00 41.42  ? 682  PHE A C     1 
ATOM   5594 O  O     . PHE A 1 682 ? 4.345   46.138 5.880   1.00 35.52  ? 682  PHE A O     1 
ATOM   5595 C  CB    . PHE A 1 682 ? 6.879   46.506 4.649   1.00 42.06  ? 682  PHE A CB    1 
ATOM   5596 C  CG    . PHE A 1 682 ? 8.173   47.121 4.185   1.00 44.78  ? 682  PHE A CG    1 
ATOM   5597 C  CD1   . PHE A 1 682 ? 8.252   47.771 2.964   1.00 44.38  ? 682  PHE A CD1   1 
ATOM   5598 C  CD2   . PHE A 1 682 ? 9.311   47.048 4.973   1.00 43.57  ? 682  PHE A CD2   1 
ATOM   5599 C  CE1   . PHE A 1 682 ? 9.441   48.336 2.536   1.00 47.39  ? 682  PHE A CE1   1 
ATOM   5600 C  CE2   . PHE A 1 682 ? 10.504  47.612 4.551   1.00 44.98  ? 682  PHE A CE2   1 
ATOM   5601 C  CZ    . PHE A 1 682 ? 10.569  48.256 3.330   1.00 46.91  ? 682  PHE A CZ    1 
ATOM   5602 N  N     . MET A 1 683 ? 3.344   46.491 3.900   1.00 43.78  ? 683  MET A N     1 
ATOM   5603 C  CA    . MET A 1 683 ? 2.074   45.906 4.317   1.00 44.92  ? 683  MET A CA    1 
ATOM   5604 C  C     . MET A 1 683 ? 1.917   44.475 3.806   1.00 48.21  ? 683  MET A C     1 
ATOM   5605 O  O     . MET A 1 683 ? 1.818   44.246 2.601   1.00 47.30  ? 683  MET A O     1 
ATOM   5606 C  CB    . MET A 1 683 ? 0.904   46.775 3.845   1.00 42.99  ? 683  MET A CB    1 
ATOM   5607 C  CG    . MET A 1 683 ? -0.458  46.120 3.990   1.00 43.46  ? 683  MET A CG    1 
ATOM   5608 S  SD    . MET A 1 683 ? -1.826  47.224 3.583   1.00 40.30  ? 683  MET A SD    1 
ATOM   5609 C  CE    . MET A 1 683 ? -2.198  47.927 5.189   1.00 40.21  ? 683  MET A CE    1 
ATOM   5610 N  N     . ASP A 1 684 ? 1.880   43.521 4.736   1.00 55.36  ? 684  ASP A N     1 
ATOM   5611 C  CA    . ASP A 1 684 ? 1.737   42.105 4.404   1.00 54.74  ? 684  ASP A CA    1 
ATOM   5612 C  C     . ASP A 1 684 ? 0.406   41.534 4.876   1.00 51.62  ? 684  ASP A C     1 
ATOM   5613 O  O     . ASP A 1 684 ? -0.277  42.115 5.725   1.00 51.03  ? 684  ASP A O     1 
ATOM   5614 C  CB    . ASP A 1 684 ? 2.871   41.293 5.032   1.00 59.76  ? 684  ASP A CB    1 
ATOM   5615 C  CG    . ASP A 1 684 ? 4.229   41.710 4.527   1.00 67.14  ? 684  ASP A CG    1 
ATOM   5616 O  OD1   . ASP A 1 684 ? 5.164   41.810 5.349   1.00 72.09  ? 684  ASP A OD1   1 
ATOM   5617 O  OD2   . ASP A 1 684 ? 4.359   41.942 3.308   1.00 68.71  ? 684  ASP A OD2   1 
ATOM   5618 N  N     . ARG A 1 685 ? 0.053   40.376 4.332   1.00 49.37  ? 685  ARG A N     1 
ATOM   5619 C  CA    . ARG A 1 685 ? -1.160  39.679 4.728   1.00 44.67  ? 685  ARG A CA    1 
ATOM   5620 C  C     . ARG A 1 685 ? -1.060  39.186 6.171   1.00 42.87  ? 685  ARG A C     1 
ATOM   5621 O  O     . ARG A 1 685 ? -0.047  38.639 6.590   1.00 37.25  ? 685  ARG A O     1 
ATOM   5622 C  CB    . ARG A 1 685 ? -1.433  38.505 3.777   1.00 47.41  ? 685  ARG A CB    1 
ATOM   5623 C  CG    . ARG A 1 685 ? -2.827  37.891 3.912   1.00 47.73  ? 685  ARG A CG    1 
ATOM   5624 C  CD    . ARG A 1 685 ? -2.857  36.751 4.915   1.00 44.73  ? 685  ARG A CD    1 
ATOM   5625 N  NE    . ARG A 1 685 ? -2.111  35.589 4.442   1.00 45.74  ? 685  ARG A NE    1 
ATOM   5626 C  CZ    . ARG A 1 685 ? -1.824  34.534 5.198   1.00 46.60  ? 685  ARG A CZ    1 
ATOM   5627 N  NH1   . ARG A 1 685 ? -2.221  34.495 6.469   1.00 40.25  ? 685  ARG A NH1   1 
ATOM   5628 N  NH2   . ARG A 1 685 ? -1.143  33.513 4.686   1.00 47.52  ? 685  ARG A NH2   1 
ATOM   5629 N  N     . GLU A 1 686 ? -2.130  39.379 6.928   1.00 44.01  ? 686  GLU A N     1 
ATOM   5630 C  CA    . GLU A 1 686 ? -2.174  38.905 8.301   1.00 44.12  ? 686  GLU A CA    1 
ATOM   5631 C  C     . GLU A 1 686 ? -3.022  37.631 8.397   1.00 39.09  ? 686  GLU A C     1 
ATOM   5632 O  O     . GLU A 1 686 ? -2.486  36.520 8.408   1.00 36.53  ? 686  GLU A O     1 
ATOM   5633 C  CB    . GLU A 1 686 ? -2.706  40.007 9.225   1.00 46.20  ? 686  GLU A CB    1 
ATOM   5634 C  CG    . GLU A 1 686 ? -2.165  39.961 10.645  1.00 54.67  ? 686  GLU A CG    1 
ATOM   5635 C  CD    . GLU A 1 686 ? -0.837  40.699 10.810  1.00 59.08  ? 686  GLU A CD    1 
ATOM   5636 O  OE1   . GLU A 1 686 ? -0.686  41.413 11.825  1.00 56.55  ? 686  GLU A OE1   1 
ATOM   5637 O  OE2   . GLU A 1 686 ? 0.053   40.565 9.936   1.00 61.35  ? 686  GLU A OE2   1 
ATOM   5638 N  N     . ALA A 1 687 ? -4.341  37.790 8.455   1.00 38.46  ? 687  ALA A N     1 
ATOM   5639 C  CA    . ALA A 1 687 ? -5.231  36.648 8.655   1.00 39.59  ? 687  ALA A CA    1 
ATOM   5640 C  C     . ALA A 1 687 ? -5.936  36.200 7.377   1.00 41.19  ? 687  ALA A C     1 
ATOM   5641 O  O     . ALA A 1 687 ? -6.269  37.014 6.515   1.00 38.18  ? 687  ALA A O     1 
ATOM   5642 C  CB    . ALA A 1 687 ? -6.263  36.962 9.729   1.00 39.01  ? 687  ALA A CB    1 
ATOM   5643 N  N     . ILE A 1 688 ? -6.144  34.894 7.254   1.00 39.52  ? 688  ILE A N     1 
ATOM   5644 C  CA    . ILE A 1 688 ? -7.084  34.381 6.271   1.00 41.55  ? 688  ILE A CA    1 
ATOM   5645 C  C     . ILE A 1 688 ? -8.239  33.738 7.029   1.00 42.51  ? 688  ILE A C     1 
ATOM   5646 O  O     . ILE A 1 688 ? -8.049  32.757 7.751   1.00 44.47  ? 688  ILE A O     1 
ATOM   5647 C  CB    . ILE A 1 688 ? -6.439  33.366 5.322   1.00 42.76  ? 688  ILE A CB    1 
ATOM   5648 C  CG1   . ILE A 1 688 ? -5.370  34.048 4.470   1.00 45.48  ? 688  ILE A CG1   1 
ATOM   5649 C  CG2   . ILE A 1 688 ? -7.497  32.746 4.425   1.00 43.56  ? 688  ILE A CG2   1 
ATOM   5650 C  CD1   . ILE A 1 688 ? -4.506  33.079 3.687   1.00 48.15  ? 688  ILE A CD1   1 
ATOM   5651 N  N     . ALA A 1 689 ? -9.433  34.301 6.880   1.00 41.84  ? 689  ALA A N     1 
ATOM   5652 C  CA    . ALA A 1 689 ? -10.579 33.834 7.650   1.00 41.94  ? 689  ALA A CA    1 
ATOM   5653 C  C     . ALA A 1 689 ? -11.728 33.363 6.767   1.00 43.82  ? 689  ALA A C     1 
ATOM   5654 O  O     . ALA A 1 689 ? -11.873 33.802 5.626   1.00 43.98  ? 689  ALA A O     1 
ATOM   5655 C  CB    . ALA A 1 689 ? -11.052 34.921 8.602   1.00 34.95  ? 689  ALA A CB    1 
ATOM   5656 N  N     . GLY A 1 690 ? -12.543 32.467 7.312   1.00 44.77  ? 690  GLY A N     1 
ATOM   5657 C  CA    . GLY A 1 690 ? -13.682 31.927 6.597   1.00 46.71  ? 690  GLY A CA    1 
ATOM   5658 C  C     . GLY A 1 690 ? -14.242 30.698 7.283   1.00 46.56  ? 690  GLY A C     1 
ATOM   5659 O  O     . GLY A 1 690 ? -13.575 30.096 8.124   1.00 47.31  ? 690  GLY A O     1 
ATOM   5660 N  N     . PRO A 1 691 ? -15.477 30.317 6.929   1.00 47.84  ? 691  PRO A N     1 
ATOM   5661 C  CA    . PRO A 1 691 ? -16.107 29.115 7.482   1.00 48.63  ? 691  PRO A CA    1 
ATOM   5662 C  C     . PRO A 1 691 ? -15.474 27.868 6.889   1.00 50.87  ? 691  PRO A C     1 
ATOM   5663 O  O     . PRO A 1 691 ? -14.845 27.962 5.835   1.00 53.53  ? 691  PRO A O     1 
ATOM   5664 C  CB    . PRO A 1 691 ? -17.550 29.233 6.995   1.00 51.02  ? 691  PRO A CB    1 
ATOM   5665 C  CG    . PRO A 1 691 ? -17.439 29.983 5.711   1.00 50.02  ? 691  PRO A CG    1 
ATOM   5666 C  CD    . PRO A 1 691 ? -16.335 30.981 5.932   1.00 46.92  ? 691  PRO A CD    1 
ATOM   5667 N  N     . PRO A 1 692 ? -15.619 26.716 7.563   1.00 48.82  ? 692  PRO A N     1 
ATOM   5668 C  CA    . PRO A 1 692 ? -15.180 25.457 6.957   1.00 49.81  ? 692  PRO A CA    1 
ATOM   5669 C  C     . PRO A 1 692 ? -15.970 25.219 5.680   1.00 55.94  ? 692  PRO A C     1 
ATOM   5670 O  O     . PRO A 1 692 ? -17.144 25.587 5.618   1.00 56.89  ? 692  PRO A O     1 
ATOM   5671 C  CB    . PRO A 1 692 ? -15.553 24.413 8.012   1.00 48.08  ? 692  PRO A CB    1 
ATOM   5672 C  CG    . PRO A 1 692 ? -15.596 25.168 9.296   1.00 45.47  ? 692  PRO A CG    1 
ATOM   5673 C  CD    . PRO A 1 692 ? -16.108 26.530 8.940   1.00 44.28  ? 692  PRO A CD    1 
ATOM   5674 N  N     . LEU A 1 693 ? -15.336 24.629 4.673   1.00 56.00  ? 693  LEU A N     1 
ATOM   5675 C  CA    . LEU A 1 693 ? -15.991 24.413 3.389   1.00 56.90  ? 693  LEU A CA    1 
ATOM   5676 C  C     . LEU A 1 693 ? -17.175 23.462 3.527   1.00 57.29  ? 693  LEU A C     1 
ATOM   5677 O  O     . LEU A 1 693 ? -17.051 22.380 4.100   1.00 60.01  ? 693  LEU A O     1 
ATOM   5678 C  CB    . LEU A 1 693 ? -14.995 23.873 2.360   1.00 58.04  ? 693  LEU A CB    1 
ATOM   5679 C  CG    . LEU A 1 693 ? -15.533 23.708 0.937   1.00 60.34  ? 693  LEU A CG    1 
ATOM   5680 C  CD1   . LEU A 1 693 ? -15.914 25.059 0.350   1.00 59.23  ? 693  LEU A CD1   1 
ATOM   5681 C  CD2   . LEU A 1 693 ? -14.521 22.996 0.049   1.00 60.45  ? 693  LEU A CD2   1 
ATOM   5682 N  N     . GLY A 1 694 ? -18.326 23.879 3.009   1.00 57.93  ? 694  GLY A N     1 
ATOM   5683 C  CA    . GLY A 1 694 ? -19.521 23.056 3.036   1.00 60.00  ? 694  GLY A CA    1 
ATOM   5684 C  C     . GLY A 1 694 ? -20.278 23.135 4.347   1.00 58.69  ? 694  GLY A C     1 
ATOM   5685 O  O     . GLY A 1 694 ? -21.261 22.422 4.545   1.00 59.31  ? 694  GLY A O     1 
ATOM   5686 N  N     . SER A 1 695 ? -19.821 24.003 5.245   1.00 55.32  ? 695  SER A N     1 
ATOM   5687 C  CA    . SER A 1 695 ? -20.460 24.161 6.546   1.00 54.11  ? 695  SER A CA    1 
ATOM   5688 C  C     . SER A 1 695 ? -21.494 25.280 6.518   1.00 55.00  ? 695  SER A C     1 
ATOM   5689 O  O     . SER A 1 695 ? -21.691 25.931 5.492   1.00 53.41  ? 695  SER A O     1 
ATOM   5690 C  CB    . SER A 1 695 ? -19.416 24.456 7.625   1.00 52.59  ? 695  SER A CB    1 
ATOM   5691 O  OG    . SER A 1 695 ? -18.940 25.789 7.518   1.00 53.86  ? 695  SER A OG    1 
ATOM   5692 N  N     . LYS A 1 696 ? -22.151 25.497 7.652   1.00 57.84  ? 696  LYS A N     1 
ATOM   5693 C  CA    . LYS A 1 696 ? -23.123 26.576 7.781   1.00 57.07  ? 696  LYS A CA    1 
ATOM   5694 C  C     . LYS A 1 696 ? -22.546 27.721 8.608   1.00 55.10  ? 696  LYS A C     1 
ATOM   5695 O  O     . LYS A 1 696 ? -23.262 28.648 8.990   1.00 51.76  ? 696  LYS A O     1 
ATOM   5696 C  CB    . LYS A 1 696 ? -24.420 26.067 8.411   1.00 59.86  ? 696  LYS A CB    1 
ATOM   5697 N  N     . GLY A 1 697 ? -21.248 27.649 8.883   1.00 54.69  ? 697  GLY A N     1 
ATOM   5698 C  CA    . GLY A 1 697 ? -20.565 28.704 9.610   1.00 52.58  ? 697  GLY A CA    1 
ATOM   5699 C  C     . GLY A 1 697 ? -20.577 30.009 8.837   1.00 49.31  ? 697  GLY A C     1 
ATOM   5700 O  O     . GLY A 1 697 ? -20.593 30.008 7.606   1.00 51.07  ? 697  GLY A O     1 
ATOM   5701 N  N     . ILE A 1 698 ? -20.575 31.126 9.557   1.00 46.34  ? 698  ILE A N     1 
ATOM   5702 C  CA    . ILE A 1 698 ? -20.648 32.437 8.920   1.00 44.57  ? 698  ILE A CA    1 
ATOM   5703 C  C     . ILE A 1 698 ? -19.269 33.065 8.716   1.00 41.95  ? 698  ILE A C     1 
ATOM   5704 O  O     . ILE A 1 698 ? -19.144 34.112 8.084   1.00 39.67  ? 698  ILE A O     1 
ATOM   5705 C  CB    . ILE A 1 698 ? -21.545 33.407 9.711   1.00 43.32  ? 698  ILE A CB    1 
ATOM   5706 C  CG1   . ILE A 1 698 ? -20.905 33.749 11.055  1.00 38.50  ? 698  ILE A CG1   1 
ATOM   5707 C  CG2   . ILE A 1 698 ? -22.932 32.806 9.909   1.00 43.90  ? 698  ILE A CG2   1 
ATOM   5708 C  CD1   . ILE A 1 698 ? -21.649 34.810 11.833  1.00 38.60  ? 698  ILE A CD1   1 
ATOM   5709 N  N     . GLY A 1 699 ? -18.236 32.422 9.253   1.00 40.29  ? 699  GLY A N     1 
ATOM   5710 C  CA    . GLY A 1 699 ? -16.873 32.876 9.044   1.00 40.93  ? 699  GLY A CA    1 
ATOM   5711 C  C     . GLY A 1 699 ? -16.433 33.969 9.997   1.00 42.24  ? 699  GLY A C     1 
ATOM   5712 O  O     . GLY A 1 699 ? -15.433 33.822 10.700  1.00 43.99  ? 699  GLY A O     1 
ATOM   5713 N  N     . GLY A 1 700 ? -17.174 35.073 10.020  1.00 39.64  ? 700  GLY A N     1 
ATOM   5714 C  CA    . GLY A 1 700 ? -16.841 36.184 10.893  1.00 39.84  ? 700  GLY A CA    1 
ATOM   5715 C  C     . GLY A 1 700 ? -17.963 37.193 11.036  1.00 38.39  ? 700  GLY A C     1 
ATOM   5716 O  O     . GLY A 1 700 ? -18.984 37.093 10.356  1.00 41.57  ? 700  GLY A O     1 
ATOM   5717 N  N     . PHE A 1 701 ? -17.780 38.155 11.937  1.00 36.42  ? 701  PHE A N     1 
ATOM   5718 C  CA    . PHE A 1 701 ? -18.719 39.265 12.082  1.00 38.74  ? 701  PHE A CA    1 
ATOM   5719 C  C     . PHE A 1 701 ? -18.105 40.475 12.784  1.00 40.13  ? 701  PHE A C     1 
ATOM   5720 O  O     . PHE A 1 701 ? -17.143 40.349 13.542  1.00 39.53  ? 701  PHE A O     1 
ATOM   5721 C  CB    . PHE A 1 701 ? -20.011 38.830 12.795  1.00 39.50  ? 701  PHE A CB    1 
ATOM   5722 C  CG    . PHE A 1 701 ? -19.820 38.428 14.236  1.00 38.87  ? 701  PHE A CG    1 
ATOM   5723 C  CD1   . PHE A 1 701 ? -19.705 37.093 14.586  1.00 39.83  ? 701  PHE A CD1   1 
ATOM   5724 C  CD2   . PHE A 1 701 ? -19.784 39.382 15.242  1.00 38.68  ? 701  PHE A CD2   1 
ATOM   5725 C  CE1   . PHE A 1 701 ? -19.540 36.718 15.910  1.00 39.17  ? 701  PHE A CE1   1 
ATOM   5726 C  CE2   . PHE A 1 701 ? -19.615 39.014 16.565  1.00 37.11  ? 701  PHE A CE2   1 
ATOM   5727 C  CZ    . PHE A 1 701 ? -19.494 37.682 16.900  1.00 37.64  ? 701  PHE A CZ    1 
ATOM   5728 N  N     . TRP A 1 702 ? -18.679 41.643 12.516  1.00 38.14  ? 702  TRP A N     1 
ATOM   5729 C  CA    . TRP A 1 702 ? -18.324 42.880 13.198  1.00 35.97  ? 702  TRP A CA    1 
ATOM   5730 C  C     . TRP A 1 702 ? -19.572 43.423 13.882  1.00 37.78  ? 702  TRP A C     1 
ATOM   5731 O  O     . TRP A 1 702 ? -20.668 43.342 13.326  1.00 37.42  ? 702  TRP A O     1 
ATOM   5732 C  CB    . TRP A 1 702 ? -17.821 43.916 12.190  1.00 35.57  ? 702  TRP A CB    1 
ATOM   5733 C  CG    . TRP A 1 702 ? -16.330 44.014 12.071  1.00 33.21  ? 702  TRP A CG    1 
ATOM   5734 C  CD1   . TRP A 1 702 ? -15.527 44.967 12.625  1.00 31.43  ? 702  TRP A CD1   1 
ATOM   5735 C  CD2   . TRP A 1 702 ? -15.463 43.135 11.340  1.00 37.13  ? 702  TRP A CD2   1 
ATOM   5736 N  NE1   . TRP A 1 702 ? -14.214 44.734 12.291  1.00 31.35  ? 702  TRP A NE1   1 
ATOM   5737 C  CE2   . TRP A 1 702 ? -14.148 43.617 11.502  1.00 34.44  ? 702  TRP A CE2   1 
ATOM   5738 C  CE3   . TRP A 1 702 ? -15.672 41.986 10.571  1.00 38.17  ? 702  TRP A CE3   1 
ATOM   5739 C  CZ2   . TRP A 1 702 ? -13.045 42.989 10.925  1.00 34.75  ? 702  TRP A CZ2   1 
ATOM   5740 C  CZ3   . TRP A 1 702 ? -14.576 41.365 9.995   1.00 40.70  ? 702  TRP A CZ3   1 
ATOM   5741 C  CH2   . TRP A 1 702 ? -13.279 41.868 10.177  1.00 37.68  ? 702  TRP A CH2   1 
ATOM   5742 N  N     . THR A 1 703 ? -19.416 43.973 15.082  1.00 37.89  ? 703  THR A N     1 
ATOM   5743 C  CA    . THR A 1 703 ? -20.530 44.642 15.746  1.00 35.39  ? 703  THR A CA    1 
ATOM   5744 C  C     . THR A 1 703 ? -20.313 46.151 15.714  1.00 33.12  ? 703  THR A C     1 
ATOM   5745 O  O     . THR A 1 703 ? -21.250 46.929 15.881  1.00 34.26  ? 703  THR A O     1 
ATOM   5746 C  CB    . THR A 1 703 ? -20.710 44.177 17.211  1.00 36.31  ? 703  THR A CB    1 
ATOM   5747 O  OG1   . THR A 1 703 ? -19.789 44.872 18.064  1.00 36.91  ? 703  THR A OG1   1 
ATOM   5748 C  CG2   . THR A 1 703 ? -20.492 42.677 17.330  1.00 37.37  ? 703  THR A CG2   1 
ATOM   5749 N  N     . GLY A 1 704 ? -19.067 46.552 15.490  1.00 36.37  ? 704  GLY A N     1 
ATOM   5750 C  CA    . GLY A 1 704 ? -18.701 47.957 15.455  1.00 38.79  ? 704  GLY A CA    1 
ATOM   5751 C  C     . GLY A 1 704 ? -17.195 48.128 15.503  1.00 37.04  ? 704  GLY A C     1 
ATOM   5752 O  O     . GLY A 1 704 ? -16.452 47.178 15.259  1.00 37.45  ? 704  GLY A O     1 
ATOM   5753 N  N     . LYS A 1 705 ? -16.743 49.339 15.813  1.00 33.66  ? 705  LYS A N     1 
ATOM   5754 C  CA    . LYS A 1 705 ? -15.315 49.613 15.926  1.00 32.75  ? 705  LYS A CA    1 
ATOM   5755 C  C     . LYS A 1 705 ? -14.680 48.799 17.049  1.00 31.50  ? 705  LYS A C     1 
ATOM   5756 O  O     . LYS A 1 705 ? -15.216 48.734 18.156  1.00 29.74  ? 705  LYS A O     1 
ATOM   5757 C  CB    . LYS A 1 705 ? -15.062 51.104 16.163  1.00 30.44  ? 705  LYS A CB    1 
ATOM   5758 C  CG    . LYS A 1 705 ? -15.314 51.989 14.949  1.00 30.84  ? 705  LYS A CG    1 
ATOM   5759 C  CD    . LYS A 1 705 ? -14.964 53.435 15.259  1.00 32.10  ? 705  LYS A CD    1 
ATOM   5760 C  CE    . LYS A 1 705 ? -15.179 54.335 14.055  1.00 28.98  ? 705  LYS A CE    1 
ATOM   5761 N  NZ    . LYS A 1 705 ? -14.773 55.732 14.350  1.00 29.37  ? 705  LYS A NZ    1 
ATOM   5762 N  N     . LYS A 1 706 ? -13.548 48.168 16.742  1.00 30.59  ? 706  LYS A N     1 
ATOM   5763 C  CA    . LYS A 1 706 ? -12.760 47.414 17.717  1.00 28.29  ? 706  LYS A CA    1 
ATOM   5764 C  C     . LYS A 1 706 ? -13.512 46.229 18.328  1.00 28.23  ? 706  LYS A C     1 
ATOM   5765 O  O     . LYS A 1 706 ? -13.158 45.748 19.403  1.00 27.04  ? 706  LYS A O     1 
ATOM   5766 C  CB    . LYS A 1 706 ? -12.230 48.342 18.817  1.00 27.87  ? 706  LYS A CB    1 
ATOM   5767 C  CG    . LYS A 1 706 ? -11.355 49.480 18.294  1.00 27.90  ? 706  LYS A CG    1 
ATOM   5768 C  CD    . LYS A 1 706 ? -10.920 50.408 19.412  1.00 29.32  ? 706  LYS A CD    1 
ATOM   5769 C  CE    . LYS A 1 706 ? -10.139 51.602 18.876  1.00 32.24  ? 706  LYS A CE    1 
ATOM   5770 N  NZ    . LYS A 1 706 ? -8.778  51.238 18.392  1.00 31.41  ? 706  LYS A NZ    1 
ATOM   5771 N  N     A ARG A 1 707 ? -14.551 45.761 17.642  0.34 30.03  ? 707  ARG A N     1 
ATOM   5772 N  N     B ARG A 1 707 ? -14.542 45.760 17.630  0.66 30.28  ? 707  ARG A N     1 
ATOM   5773 C  CA    A ARG A 1 707 ? -15.332 44.623 18.122  0.34 30.35  ? 707  ARG A CA    1 
ATOM   5774 C  CA    B ARG A 1 707 ? -15.340 44.632 18.099  0.66 30.19  ? 707  ARG A CA    1 
ATOM   5775 C  C     A ARG A 1 707 ? -15.684 43.669 16.982  0.34 31.46  ? 707  ARG A C     1 
ATOM   5776 C  C     B ARG A 1 707 ? -15.670 43.679 16.956  0.66 31.43  ? 707  ARG A C     1 
ATOM   5777 O  O     A ARG A 1 707 ? -16.611 43.923 16.214  0.34 32.56  ? 707  ARG A O     1 
ATOM   5778 O  O     B ARG A 1 707 ? -16.570 43.942 16.160  0.66 32.80  ? 707  ARG A O     1 
ATOM   5779 C  CB    A ARG A 1 707 ? -16.606 45.096 18.831  0.34 30.68  ? 707  ARG A CB    1 
ATOM   5780 C  CB    B ARG A 1 707 ? -16.631 45.125 18.754  0.66 30.40  ? 707  ARG A CB    1 
ATOM   5781 C  CG    A ARG A 1 707 ? -16.359 45.996 20.034  0.34 30.97  ? 707  ARG A CG    1 
ATOM   5782 C  CG    B ARG A 1 707 ? -16.435 45.798 20.102  0.66 30.99  ? 707  ARG A CG    1 
ATOM   5783 C  CD    A ARG A 1 707 ? -17.637 46.281 20.808  0.34 33.04  ? 707  ARG A CD    1 
ATOM   5784 C  CD    B ARG A 1 707 ? -17.760 46.279 20.672  0.66 33.67  ? 707  ARG A CD    1 
ATOM   5785 N  NE    A ARG A 1 707 ? -17.873 45.304 21.868  0.34 34.10  ? 707  ARG A NE    1 
ATOM   5786 N  NE    B ARG A 1 707 ? -18.706 45.183 20.868  0.66 34.24  ? 707  ARG A NE    1 
ATOM   5787 C  CZ    A ARG A 1 707 ? -18.797 44.350 21.819  0.34 34.88  ? 707  ARG A CZ    1 
ATOM   5788 C  CZ    B ARG A 1 707 ? -18.789 44.457 21.979  0.66 35.40  ? 707  ARG A CZ    1 
ATOM   5789 N  NH1   A ARG A 1 707 ? -19.589 44.241 20.760  0.34 34.87  ? 707  ARG A NH1   1 
ATOM   5790 N  NH1   B ARG A 1 707 ? -17.980 44.706 23.002  0.66 32.13  ? 707  ARG A NH1   1 
ATOM   5791 N  NH2   A ARG A 1 707 ? -18.935 43.508 22.835  0.34 34.43  ? 707  ARG A NH2   1 
ATOM   5792 N  NH2   B ARG A 1 707 ? -19.682 43.479 22.068  0.66 34.56  ? 707  ARG A NH2   1 
ATOM   5793 N  N     . TYR A 1 708 ? -14.943 42.569 16.882  1.00 31.70  ? 708  TYR A N     1 
ATOM   5794 C  CA    . TYR A 1 708 ? -15.161 41.594 15.819  1.00 33.15  ? 708  TYR A CA    1 
ATOM   5795 C  C     . TYR A 1 708 ? -14.627 40.204 16.157  1.00 34.37  ? 708  TYR A C     1 
ATOM   5796 O  O     . TYR A 1 708 ? -13.843 40.032 17.093  1.00 33.66  ? 708  TYR A O     1 
ATOM   5797 C  CB    . TYR A 1 708 ? -14.561 42.089 14.495  1.00 34.25  ? 708  TYR A CB    1 
ATOM   5798 C  CG    . TYR A 1 708 ? -13.073 42.381 14.545  1.00 34.90  ? 708  TYR A CG    1 
ATOM   5799 C  CD1   . TYR A 1 708 ? -12.601 43.602 15.008  1.00 32.14  ? 708  TYR A CD1   1 
ATOM   5800 C  CD2   . TYR A 1 708 ? -12.145 41.441 14.117  1.00 35.43  ? 708  TYR A CD2   1 
ATOM   5801 C  CE1   . TYR A 1 708 ? -11.246 43.877 15.053  1.00 31.91  ? 708  TYR A CE1   1 
ATOM   5802 C  CE2   . TYR A 1 708 ? -10.786 41.706 14.156  1.00 35.28  ? 708  TYR A CE2   1 
ATOM   5803 C  CZ    . TYR A 1 708 ? -10.343 42.927 14.626  1.00 37.73  ? 708  TYR A CZ    1 
ATOM   5804 O  OH    . TYR A 1 708 ? -8.992  43.198 14.671  1.00 37.35  ? 708  TYR A OH    1 
ATOM   5805 N  N     . ALA A 1 709 ? -15.068 39.216 15.385  1.00 31.74  ? 709  ALA A N     1 
ATOM   5806 C  CA    . ALA A 1 709 ? -14.611 37.843 15.543  1.00 33.49  ? 709  ALA A CA    1 
ATOM   5807 C  C     . ALA A 1 709 ? -14.381 37.213 14.174  1.00 37.34  ? 709  ALA A C     1 
ATOM   5808 O  O     . ALA A 1 709 ? -15.167 37.423 13.251  1.00 38.83  ? 709  ALA A O     1 
ATOM   5809 C  CB    . ALA A 1 709 ? -15.623 37.033 16.342  1.00 34.88  ? 709  ALA A CB    1 
ATOM   5810 N  N     . LEU A 1 710 ? -13.300 36.450 14.046  1.00 37.57  ? 710  LEU A N     1 
ATOM   5811 C  CA    . LEU A 1 710 ? -12.962 35.803 12.781  1.00 37.97  ? 710  LEU A CA    1 
ATOM   5812 C  C     . LEU A 1 710 ? -12.502 34.368 12.995  1.00 40.11  ? 710  LEU A C     1 
ATOM   5813 O  O     . LEU A 1 710 ? -11.738 34.084 13.920  1.00 38.93  ? 710  LEU A O     1 
ATOM   5814 C  CB    . LEU A 1 710 ? -11.855 36.577 12.059  1.00 39.06  ? 710  LEU A CB    1 
ATOM   5815 C  CG    . LEU A 1 710 ? -12.167 37.961 11.488  1.00 39.02  ? 710  LEU A CG    1 
ATOM   5816 C  CD1   . LEU A 1 710 ? -10.887 38.631 11.012  1.00 41.29  ? 710  LEU A CD1   1 
ATOM   5817 C  CD2   . LEU A 1 710 ? -13.170 37.853 10.353  1.00 36.76  ? 710  LEU A CD2   1 
ATOM   5818 N  N     . ASN A 1 711 ? -12.966 33.469 12.134  1.00 34.47  ? 711  ASN A N     1 
ATOM   5819 C  CA    . ASN A 1 711 ? -12.492 32.091 12.130  1.00 38.78  ? 711  ASN A CA    1 
ATOM   5820 C  C     . ASN A 1 711 ? -11.263 31.976 11.236  1.00 41.85  ? 711  ASN A C     1 
ATOM   5821 O  O     . ASN A 1 711 ? -11.381 31.827 10.021  1.00 45.38  ? 711  ASN A O     1 
ATOM   5822 C  CB    . ASN A 1 711 ? -13.592 31.146 11.641  1.00 38.62  ? 711  ASN A CB    1 
ATOM   5823 C  CG    . ASN A 1 711 ? -13.247 29.686 11.862  1.00 42.70  ? 711  ASN A CG    1 
ATOM   5824 O  OD1   . ASN A 1 711 ? -12.797 29.298 12.939  1.00 41.92  ? 711  ASN A OD1   1 
ATOM   5825 N  ND2   . ASN A 1 711 ? -13.449 28.869 10.835  1.00 46.50  ? 711  ASN A ND2   1 
ATOM   5826 N  N     . VAL A 1 712 ? -10.084 32.043 11.846  1.00 39.76  ? 712  VAL A N     1 
ATOM   5827 C  CA    . VAL A 1 712 ? -8.832  32.146 11.099  1.00 40.77  ? 712  VAL A CA    1 
ATOM   5828 C  C     . VAL A 1 712 ? -8.160  30.795 10.841  1.00 41.99  ? 712  VAL A C     1 
ATOM   5829 O  O     . VAL A 1 712 ? -8.065  29.954 11.735  1.00 40.46  ? 712  VAL A O     1 
ATOM   5830 C  CB    . VAL A 1 712 ? -7.848  33.096 11.818  1.00 40.35  ? 712  VAL A CB    1 
ATOM   5831 C  CG1   . VAL A 1 712 ? -6.502  33.130 11.107  1.00 36.69  ? 712  VAL A CG1   1 
ATOM   5832 C  CG2   . VAL A 1 712 ? -8.447  34.494 11.912  1.00 33.44  ? 712  VAL A CG2   1 
ATOM   5833 N  N     . TRP A 1 713 ? -7.694  30.602 9.609   1.00 43.61  ? 713  TRP A N     1 
ATOM   5834 C  CA    . TRP A 1 713 ? -7.017  29.372 9.213   1.00 44.75  ? 713  TRP A CA    1 
ATOM   5835 C  C     . TRP A 1 713 ? -5.512  29.576 9.062   1.00 45.97  ? 713  TRP A C     1 
ATOM   5836 O  O     . TRP A 1 713 ? -4.731  28.641 9.241   1.00 46.45  ? 713  TRP A O     1 
ATOM   5837 C  CB    . TRP A 1 713 ? -7.601  28.846 7.902   1.00 45.64  ? 713  TRP A CB    1 
ATOM   5838 C  CG    . TRP A 1 713 ? -9.056  28.521 7.997   1.00 45.68  ? 713  TRP A CG    1 
ATOM   5839 C  CD1   . TRP A 1 713 ? -10.101 29.361 7.748   1.00 42.02  ? 713  TRP A CD1   1 
ATOM   5840 C  CD2   . TRP A 1 713 ? -9.633  27.264 8.375   1.00 45.26  ? 713  TRP A CD2   1 
ATOM   5841 N  NE1   . TRP A 1 713 ? -11.292 28.706 7.944   1.00 41.53  ? 713  TRP A NE1   1 
ATOM   5842 C  CE2   . TRP A 1 713 ? -11.032 27.417 8.330   1.00 43.53  ? 713  TRP A CE2   1 
ATOM   5843 C  CE3   . TRP A 1 713 ? -9.100  26.025 8.746   1.00 46.76  ? 713  TRP A CE3   1 
ATOM   5844 C  CZ2   . TRP A 1 713 ? -11.907 26.378 8.642   1.00 42.77  ? 713  TRP A CZ2   1 
ATOM   5845 C  CZ3   . TRP A 1 713 ? -9.970  24.994 9.054   1.00 45.09  ? 713  TRP A CZ3   1 
ATOM   5846 C  CH2   . TRP A 1 713 ? -11.358 25.177 9.000   1.00 44.22  ? 713  TRP A CH2   1 
ATOM   5847 N  N     . ASP A 1 714 ? -5.113  30.799 8.725   1.00 46.82  ? 714  ASP A N     1 
ATOM   5848 C  CA    . ASP A 1 714 ? -3.701  31.126 8.561   1.00 45.71  ? 714  ASP A CA    1 
ATOM   5849 C  C     . ASP A 1 714 ? -3.418  32.518 9.109   1.00 41.21  ? 714  ASP A C     1 
ATOM   5850 O  O     . ASP A 1 714 ? -4.136  33.468 8.806   1.00 39.55  ? 714  ASP A O     1 
ATOM   5851 C  CB    . ASP A 1 714 ? -3.296  31.053 7.086   1.00 48.51  ? 714  ASP A CB    1 
ATOM   5852 C  CG    . ASP A 1 714 ? -1.788  31.029 6.892   1.00 50.88  ? 714  ASP A CG    1 
ATOM   5853 O  OD1   . ASP A 1 714 ? -1.137  32.071 7.118   1.00 50.25  ? 714  ASP A OD1   1 
ATOM   5854 O  OD2   . ASP A 1 714 ? -1.253  29.968 6.507   1.00 54.01  ? 714  ASP A OD2   1 
ATOM   5855 N  N     . MET A 1 715 ? -2.367  32.635 9.912   1.00 40.28  ? 715  MET A N     1 
ATOM   5856 C  CA    . MET A 1 715 ? -2.023  33.905 10.538  1.00 39.90  ? 715  MET A CA    1 
ATOM   5857 C  C     . MET A 1 715 ? -0.532  34.199 10.421  1.00 41.09  ? 715  MET A C     1 
ATOM   5858 O  O     . MET A 1 715 ? 0.283   33.560 11.087  1.00 43.50  ? 715  MET A O     1 
ATOM   5859 C  CB    . MET A 1 715 ? -2.434  33.889 12.011  1.00 39.49  ? 715  MET A CB    1 
ATOM   5860 C  CG    . MET A 1 715 ? -2.130  35.175 12.765  1.00 41.47  ? 715  MET A CG    1 
ATOM   5861 S  SD    . MET A 1 715 ? -3.062  36.606 12.187  1.00 48.68  ? 715  MET A SD    1 
ATOM   5862 C  CE    . MET A 1 715 ? -2.786  37.742 13.541  1.00 76.54  ? 715  MET A CE    1 
ATOM   5863 N  N     . GLU A 1 716 ? -0.190  35.170 9.577   1.00 41.89  ? 716  GLU A N     1 
ATOM   5864 C  CA    . GLU A 1 716 ? 1.197   35.579 9.356   1.00 47.12  ? 716  GLU A CA    1 
ATOM   5865 C  C     . GLU A 1 716 ? 2.113   34.434 8.931   1.00 45.87  ? 716  GLU A C     1 
ATOM   5866 O  O     . GLU A 1 716 ? 3.270   34.367 9.348   1.00 45.48  ? 716  GLU A O     1 
ATOM   5867 C  CB    . GLU A 1 716 ? 1.772   36.276 10.593  1.00 54.72  ? 716  GLU A CB    1 
ATOM   5868 C  CG    . GLU A 1 716 ? 1.395   37.743 10.722  1.00 61.91  ? 716  GLU A CG    1 
ATOM   5869 C  CD    . GLU A 1 716 ? 2.005   38.392 11.954  1.00 67.65  ? 716  GLU A CD    1 
ATOM   5870 O  OE1   . GLU A 1 716 ? 2.701   39.419 11.808  1.00 69.16  ? 716  GLU A OE1   1 
ATOM   5871 O  OE2   . GLU A 1 716 ? 1.786   37.874 13.070  1.00 71.05  ? 716  GLU A OE2   1 
ATOM   5872 N  N     . GLY A 1 717 ? 1.594   33.537 8.101   1.00 44.32  ? 717  GLY A N     1 
ATOM   5873 C  CA    . GLY A 1 717 ? 2.388   32.442 7.579   1.00 43.32  ? 717  GLY A CA    1 
ATOM   5874 C  C     . GLY A 1 717 ? 2.300   31.181 8.414   1.00 48.89  ? 717  GLY A C     1 
ATOM   5875 O  O     . GLY A 1 717 ? 2.951   30.182 8.109   1.00 49.80  ? 717  GLY A O     1 
ATOM   5876 N  N     . THR A 1 718 ? 1.499   31.222 9.473   1.00 47.56  ? 718  THR A N     1 
ATOM   5877 C  CA    . THR A 1 718 ? 1.293   30.043 10.306  1.00 47.82  ? 718  THR A CA    1 
ATOM   5878 C  C     . THR A 1 718 ? -0.013  29.354 9.933   1.00 47.33  ? 718  THR A C     1 
ATOM   5879 O  O     . THR A 1 718 ? -1.096  29.897 10.157  1.00 46.00  ? 718  THR A O     1 
ATOM   5880 C  CB    . THR A 1 718 ? 1.273   30.396 11.805  1.00 46.67  ? 718  THR A CB    1 
ATOM   5881 O  OG1   . THR A 1 718 ? 2.540   30.949 12.187  1.00 47.81  ? 718  THR A OG1   1 
ATOM   5882 C  CG2   . THR A 1 718 ? 0.993   29.155 12.641  1.00 42.49  ? 718  THR A CG2   1 
ATOM   5883 N  N     . ARG A 1 719 ? 0.097   28.163 9.353   1.00 44.86  ? 719  ARG A N     1 
ATOM   5884 C  CA    . ARG A 1 719 ? -1.073  27.374 8.985   1.00 47.01  ? 719  ARG A CA    1 
ATOM   5885 C  C     . ARG A 1 719 ? -1.516  26.528 10.171  1.00 45.62  ? 719  ARG A C     1 
ATOM   5886 O  O     . ARG A 1 719 ? -0.859  25.551 10.526  1.00 47.26  ? 719  ARG A O     1 
ATOM   5887 C  CB    . ARG A 1 719 ? -0.758  26.474 7.786   1.00 49.16  ? 719  ARG A CB    1 
ATOM   5888 C  CG    . ARG A 1 719 ? -1.975  25.802 7.162   1.00 46.70  ? 719  ARG A CG    1 
ATOM   5889 C  CD    . ARG A 1 719 ? -2.945  26.821 6.575   1.00 43.12  ? 719  ARG A CD    1 
ATOM   5890 N  NE    . ARG A 1 719 ? -2.313  27.673 5.571   1.00 43.18  ? 719  ARG A NE    1 
ATOM   5891 C  CZ    . ARG A 1 719 ? -2.279  27.400 4.270   1.00 51.86  ? 719  ARG A CZ    1 
ATOM   5892 N  NH1   . ARG A 1 719 ? -2.843  26.293 3.806   1.00 54.10  ? 719  ARG A NH1   1 
ATOM   5893 N  NH2   . ARG A 1 719 ? -1.680  28.234 3.431   1.00 51.71  ? 719  ARG A NH2   1 
ATOM   5894 N  N     . TYR A 1 720 ? -2.631  26.915 10.782  1.00 44.76  ? 720  TYR A N     1 
ATOM   5895 C  CA    . TYR A 1 720 ? -3.130  26.249 11.980  1.00 46.22  ? 720  TYR A CA    1 
ATOM   5896 C  C     . TYR A 1 720 ? -3.585  24.817 11.705  1.00 48.05  ? 720  TYR A C     1 
ATOM   5897 O  O     . TYR A 1 720 ? -4.181  24.532 10.666  1.00 44.62  ? 720  TYR A O     1 
ATOM   5898 C  CB    . TYR A 1 720 ? -4.284  27.050 12.585  1.00 48.34  ? 720  TYR A CB    1 
ATOM   5899 C  CG    . TYR A 1 720 ? -3.882  28.394 13.156  1.00 46.79  ? 720  TYR A CG    1 
ATOM   5900 C  CD1   . TYR A 1 720 ? -2.768  28.519 13.975  1.00 48.15  ? 720  TYR A CD1   1 
ATOM   5901 C  CD2   . TYR A 1 720 ? -4.617  29.538 12.870  1.00 47.29  ? 720  TYR A CD2   1 
ATOM   5902 C  CE1   . TYR A 1 720 ? -2.398  29.747 14.500  1.00 49.51  ? 720  TYR A CE1   1 
ATOM   5903 C  CE2   . TYR A 1 720 ? -4.257  30.770 13.389  1.00 46.62  ? 720  TYR A CE2   1 
ATOM   5904 C  CZ    . TYR A 1 720 ? -3.147  30.869 14.203  1.00 50.48  ? 720  TYR A CZ    1 
ATOM   5905 O  OH    . TYR A 1 720 ? -2.784  32.092 14.721  1.00 52.52  ? 720  TYR A OH    1 
ATOM   5906 N  N     . ALA A 1 721 ? -3.299  23.920 12.643  1.00 51.03  ? 721  ALA A N     1 
ATOM   5907 C  CA    . ALA A 1 721 ? -3.756  22.538 12.549  1.00 56.81  ? 721  ALA A CA    1 
ATOM   5908 C  C     . ALA A 1 721 ? -5.268  22.491 12.727  1.00 57.60  ? 721  ALA A C     1 
ATOM   5909 O  O     . ALA A 1 721 ? -5.961  21.707 12.078  1.00 58.96  ? 721  ALA A O     1 
ATOM   5910 C  CB    . ALA A 1 721 ? -3.068  21.678 13.595  1.00 55.97  ? 721  ALA A CB    1 
ATOM   5911 N  N     . GLU A 1 722 ? -5.763  23.337 13.624  1.00 56.85  ? 722  GLU A N     1 
ATOM   5912 C  CA    . GLU A 1 722 ? -7.193  23.524 13.826  1.00 56.57  ? 722  GLU A CA    1 
ATOM   5913 C  C     . GLU A 1 722 ? -7.487  25.016 13.775  1.00 54.09  ? 722  GLU A C     1 
ATOM   5914 O  O     . GLU A 1 722 ? -6.671  25.819 14.230  1.00 54.39  ? 722  GLU A O     1 
ATOM   5915 C  CB    . GLU A 1 722 ? -7.625  22.947 15.175  1.00 61.17  ? 722  GLU A CB    1 
ATOM   5916 C  CG    . GLU A 1 722 ? -7.639  21.429 15.221  1.00 68.72  ? 722  GLU A CG    1 
ATOM   5917 C  CD    . GLU A 1 722 ? -8.709  20.830 14.328  1.00 75.77  ? 722  GLU A CD    1 
ATOM   5918 O  OE1   . GLU A 1 722 ? -9.779  21.458 14.177  1.00 77.23  ? 722  GLU A OE1   1 
ATOM   5919 O  OE2   . GLU A 1 722 ? -8.479  19.735 13.774  1.00 80.93  ? 722  GLU A OE2   1 
ATOM   5920 N  N     . PRO A 1 723 ? -8.649  25.396 13.219  1.00 52.17  ? 723  PRO A N     1 
ATOM   5921 C  CA    . PRO A 1 723 ? -8.979  26.818 13.079  1.00 50.85  ? 723  PRO A CA    1 
ATOM   5922 C  C     . PRO A 1 723 ? -8.996  27.525 14.427  1.00 50.15  ? 723  PRO A C     1 
ATOM   5923 O  O     . PRO A 1 723 ? -9.514  26.985 15.405  1.00 49.02  ? 723  PRO A O     1 
ATOM   5924 C  CB    . PRO A 1 723 ? -10.385 26.795 12.471  1.00 49.21  ? 723  PRO A CB    1 
ATOM   5925 C  CG    . PRO A 1 723 ? -10.933 25.454 12.824  1.00 48.77  ? 723  PRO A CG    1 
ATOM   5926 C  CD    . PRO A 1 723 ? -9.758  24.529 12.788  1.00 50.65  ? 723  PRO A CD    1 
ATOM   5927 N  N     . LYS A 1 724 ? -8.415  28.719 14.474  1.00 51.77  ? 724  LYS A N     1 
ATOM   5928 C  CA    . LYS A 1 724 ? -8.352  29.486 15.708  1.00 49.55  ? 724  LYS A CA    1 
ATOM   5929 C  C     . LYS A 1 724 ? -9.218  30.735 15.604  1.00 44.06  ? 724  LYS A C     1 
ATOM   5930 O  O     . LYS A 1 724 ? -9.166  31.456 14.608  1.00 46.45  ? 724  LYS A O     1 
ATOM   5931 C  CB    . LYS A 1 724 ? -6.906  29.872 16.025  1.00 52.79  ? 724  LYS A CB    1 
ATOM   5932 C  CG    . LYS A 1 724 ? -6.720  30.510 17.389  1.00 55.66  ? 724  LYS A CG    1 
ATOM   5933 C  CD    . LYS A 1 724 ? -5.291  30.983 17.584  1.00 60.49  ? 724  LYS A CD    1 
ATOM   5934 C  CE    . LYS A 1 724 ? -5.109  31.631 18.948  1.00 63.61  ? 724  LYS A CE    1 
ATOM   5935 N  NZ    . LYS A 1 724 ? -3.749  32.213 19.108  1.00 65.26  ? 724  LYS A NZ    1 
ATOM   5936 N  N     . LEU A 1 725 ? -10.018 30.982 16.634  1.00 37.09  ? 725  LEU A N     1 
ATOM   5937 C  CA    . LEU A 1 725 ? -10.868 32.162 16.663  1.00 36.04  ? 725  LEU A CA    1 
ATOM   5938 C  C     . LEU A 1 725 ? -10.047 33.413 16.949  1.00 37.95  ? 725  LEU A C     1 
ATOM   5939 O  O     . LEU A 1 725 ? -9.317  33.474 17.938  1.00 37.27  ? 725  LEU A O     1 
ATOM   5940 C  CB    . LEU A 1 725 ? -11.960 32.011 17.724  1.00 35.67  ? 725  LEU A CB    1 
ATOM   5941 C  CG    . LEU A 1 725 ? -12.936 30.845 17.561  1.00 41.16  ? 725  LEU A CG    1 
ATOM   5942 C  CD1   . LEU A 1 725 ? -13.918 30.822 18.722  1.00 41.13  ? 725  LEU A CD1   1 
ATOM   5943 C  CD2   . LEU A 1 725 ? -13.673 30.941 16.235  1.00 42.29  ? 725  LEU A CD2   1 
ATOM   5944 N  N     . LYS A 1 726 ? -10.156 34.409 16.078  1.00 35.49  ? 726  LYS A N     1 
ATOM   5945 C  CA    . LYS A 1 726 ? -9.550  35.702 16.355  1.00 34.75  ? 726  LYS A CA    1 
ATOM   5946 C  C     . LYS A 1 726 ? -10.635 36.672 16.791  1.00 36.36  ? 726  LYS A C     1 
ATOM   5947 O  O     . LYS A 1 726 ? -11.384 37.197 15.967  1.00 37.13  ? 726  LYS A O     1 
ATOM   5948 C  CB    . LYS A 1 726 ? -8.798  36.246 15.141  1.00 39.95  ? 726  LYS A CB    1 
ATOM   5949 C  CG    . LYS A 1 726 ? -8.111  37.579 15.407  1.00 40.34  ? 726  LYS A CG    1 
ATOM   5950 C  CD    . LYS A 1 726 ? -7.062  37.890 14.354  1.00 45.03  ? 726  LYS A CD    1 
ATOM   5951 C  CE    . LYS A 1 726 ? -6.304  39.167 14.691  1.00 47.35  ? 726  LYS A CE    1 
ATOM   5952 N  NZ    . LYS A 1 726 ? -7.196  40.357 14.673  1.00 49.77  ? 726  LYS A NZ    1 
ATOM   5953 N  N     . ILE A 1 727 ? -10.718 36.896 18.097  1.00 30.76  ? 727  ILE A N     1 
ATOM   5954 C  CA    . ILE A 1 727 ? -11.759 37.735 18.669  1.00 30.86  ? 727  ILE A CA    1 
ATOM   5955 C  C     . ILE A 1 727 ? -11.144 38.962 19.322  1.00 34.01  ? 727  ILE A C     1 
ATOM   5956 O  O     . ILE A 1 727 ? -10.321 38.847 20.229  1.00 34.75  ? 727  ILE A O     1 
ATOM   5957 C  CB    . ILE A 1 727 ? -12.572 36.966 19.724  1.00 31.65  ? 727  ILE A CB    1 
ATOM   5958 C  CG1   . ILE A 1 727 ? -13.104 35.656 19.135  1.00 33.50  ? 727  ILE A CG1   1 
ATOM   5959 C  CG2   . ILE A 1 727 ? -13.706 37.825 20.251  1.00 28.58  ? 727  ILE A CG2   1 
ATOM   5960 C  CD1   . ILE A 1 727 ? -13.773 34.758 20.150  1.00 31.04  ? 727  ILE A CD1   1 
ATOM   5961 N  N     . MET A 1 728 ? -11.542 40.138 18.853  1.00 33.11  ? 728  MET A N     1 
ATOM   5962 C  CA    . MET A 1 728 ? -11.021 41.380 19.396  1.00 33.27  ? 728  MET A CA    1 
ATOM   5963 C  C     . MET A 1 728 ? -12.140 42.210 20.010  1.00 33.98  ? 728  MET A C     1 
ATOM   5964 O  O     . MET A 1 728 ? -13.172 42.433 19.380  1.00 32.89  ? 728  MET A O     1 
ATOM   5965 C  CB    . MET A 1 728 ? -10.310 42.188 18.305  1.00 34.31  ? 728  MET A CB    1 
ATOM   5966 C  CG    . MET A 1 728 ? -9.346  41.377 17.449  1.00 40.40  ? 728  MET A CG    1 
ATOM   5967 S  SD    . MET A 1 728 ? -8.101  40.481 18.395  1.00 43.24  ? 728  MET A SD    1 
ATOM   5968 C  CE    . MET A 1 728 ? -7.284  41.823 19.252  1.00 40.70  ? 728  MET A CE    1 
ATOM   5969 N  N     . GLY A 1 729 ? -11.935 42.653 21.246  1.00 31.07  ? 729  GLY A N     1 
ATOM   5970 C  CA    . GLY A 1 729 ? -12.834 43.605 21.873  1.00 31.40  ? 729  GLY A CA    1 
ATOM   5971 C  C     . GLY A 1 729 ? -14.068 43.016 22.530  1.00 31.42  ? 729  GLY A C     1 
ATOM   5972 O  O     . GLY A 1 729 ? -14.571 43.565 23.510  1.00 30.05  ? 729  GLY A O     1 
ATOM   5973 N  N     . LEU A 1 730 ? -14.562 41.905 21.993  1.00 30.79  ? 730  LEU A N     1 
ATOM   5974 C  CA    . LEU A 1 730 ? -15.764 41.269 22.531  1.00 31.37  ? 730  LEU A CA    1 
ATOM   5975 C  C     . LEU A 1 730 ? -15.567 40.815 23.979  1.00 32.87  ? 730  LEU A C     1 
ATOM   5976 O  O     . LEU A 1 730 ? -14.435 40.676 24.445  1.00 35.21  ? 730  LEU A O     1 
ATOM   5977 C  CB    . LEU A 1 730 ? -16.200 40.095 21.649  1.00 28.69  ? 730  LEU A CB    1 
ATOM   5978 C  CG    . LEU A 1 730 ? -16.408 40.420 20.165  1.00 33.16  ? 730  LEU A CG    1 
ATOM   5979 C  CD1   . LEU A 1 730 ? -17.088 39.264 19.446  1.00 35.26  ? 730  LEU A CD1   1 
ATOM   5980 C  CD2   . LEU A 1 730 ? -17.206 41.705 19.996  1.00 30.39  ? 730  LEU A CD2   1 
ATOM   5981 N  N     . GLU A 1 731 ? -16.676 40.587 24.679  1.00 31.00  ? 731  GLU A N     1 
ATOM   5982 C  CA    . GLU A 1 731 ? -16.660 40.297 26.114  1.00 31.10  ? 731  GLU A CA    1 
ATOM   5983 C  C     . GLU A 1 731 ? -15.800 39.093 26.499  1.00 30.97  ? 731  GLU A C     1 
ATOM   5984 O  O     . GLU A 1 731 ? -15.327 38.997 27.631  1.00 27.09  ? 731  GLU A O     1 
ATOM   5985 C  CB    . GLU A 1 731 ? -18.088 40.120 26.641  1.00 32.69  ? 731  GLU A CB    1 
ATOM   5986 C  CG    . GLU A 1 731 ? -18.829 41.427 26.894  1.00 28.70  ? 731  GLU A CG    1 
ATOM   5987 C  CD    . GLU A 1 731 ? -19.226 42.153 25.620  1.00 35.97  ? 731  GLU A CD    1 
ATOM   5988 O  OE1   . GLU A 1 731 ? -19.108 41.565 24.524  1.00 33.67  ? 731  GLU A OE1   1 
ATOM   5989 O  OE2   . GLU A 1 731 ? -19.662 43.321 25.716  1.00 42.15  ? 731  GLU A OE2   1 
ATOM   5990 N  N     . THR A 1 732 ? -15.592 38.184 25.552  1.00 27.34  ? 732  THR A N     1 
ATOM   5991 C  CA    . THR A 1 732 ? -14.728 37.031 25.774  1.00 27.68  ? 732  THR A CA    1 
ATOM   5992 C  C     . THR A 1 732 ? -13.296 37.452 26.099  1.00 28.41  ? 732  THR A C     1 
ATOM   5993 O  O     . THR A 1 732 ? -12.548 36.701 26.722  1.00 29.05  ? 732  THR A O     1 
ATOM   5994 C  CB    . THR A 1 732 ? -14.694 36.118 24.536  1.00 28.53  ? 732  THR A CB    1 
ATOM   5995 O  OG1   . THR A 1 732 ? -14.428 36.910 23.371  1.00 31.03  ? 732  THR A OG1   1 
ATOM   5996 C  CG2   . THR A 1 732 ? -16.024 35.414 24.360  1.00 28.89  ? 732  THR A CG2   1 
ATOM   5997 N  N     . GLN A 1 733 ? -12.926 38.659 25.679  1.00 27.34  ? 733  GLN A N     1 
ATOM   5998 C  CA    . GLN A 1 733 ? -11.550 39.132 25.796  1.00 27.23  ? 733  GLN A CA    1 
ATOM   5999 C  C     . GLN A 1 733 ? -11.331 40.012 27.024  1.00 31.97  ? 733  GLN A C     1 
ATOM   6000 O  O     . GLN A 1 733 ? -10.210 40.437 27.298  1.00 31.58  ? 733  GLN A O     1 
ATOM   6001 C  CB    . GLN A 1 733 ? -11.156 39.902 24.532  1.00 25.49  ? 733  GLN A CB    1 
ATOM   6002 C  CG    . GLN A 1 733 ? -11.463 39.155 23.241  1.00 24.59  ? 733  GLN A CG    1 
ATOM   6003 C  CD    . GLN A 1 733 ? -10.916 37.742 23.254  1.00 34.39  ? 733  GLN A CD    1 
ATOM   6004 O  OE1   . GLN A 1 733 ? -11.673 36.773 23.313  1.00 33.50  ? 733  GLN A OE1   1 
ATOM   6005 N  NE2   . GLN A 1 733 ? -9.593  37.617 23.204  1.00 30.76  ? 733  GLN A NE2   1 
ATOM   6006 N  N     . LYS A 1 734 ? -12.401 40.284 27.763  1.00 30.88  ? 734  LYS A N     1 
ATOM   6007 C  CA    . LYS A 1 734 ? -12.314 41.198 28.896  1.00 30.46  ? 734  LYS A CA    1 
ATOM   6008 C  C     . LYS A 1 734 ? -12.163 40.474 30.232  1.00 28.65  ? 734  LYS A C     1 
ATOM   6009 O  O     . LYS A 1 734 ? -12.890 39.526 30.523  1.00 26.64  ? 734  LYS A O     1 
ATOM   6010 C  CB    . LYS A 1 734 ? -13.529 42.125 28.933  1.00 30.76  ? 734  LYS A CB    1 
ATOM   6011 C  CG    . LYS A 1 734 ? -13.562 43.153 27.816  1.00 38.93  ? 734  LYS A CG    1 
ATOM   6012 C  CD    . LYS A 1 734 ? -14.520 44.284 28.151  1.00 44.55  ? 734  LYS A CD    1 
ATOM   6013 C  CE    . LYS A 1 734 ? -14.291 45.483 27.253  1.00 53.27  ? 734  LYS A CE    1 
ATOM   6014 N  NZ    . LYS A 1 734 ? -15.000 46.696 27.755  1.00 61.20  ? 734  LYS A NZ    1 
ATOM   6015 N  N     . SER A 1 735 ? -11.217 40.939 31.044  1.00 28.04  ? 735  SER A N     1 
ATOM   6016 C  CA    . SER A 1 735 ? -10.973 40.362 32.364  1.00 28.29  ? 735  SER A CA    1 
ATOM   6017 C  C     . SER A 1 735 ? -12.132 40.607 33.326  1.00 30.55  ? 735  SER A C     1 
ATOM   6018 O  O     . SER A 1 735 ? -12.244 39.941 34.354  1.00 30.57  ? 735  SER A O     1 
ATOM   6019 C  CB    . SER A 1 735 ? -9.687  40.930 32.962  1.00 27.54  ? 735  SER A CB    1 
ATOM   6020 O  OG    . SER A 1 735 ? -9.735  42.346 33.014  1.00 28.81  ? 735  SER A OG    1 
ATOM   6021 N  N     . SER A 1 736 ? -12.987 41.570 32.993  1.00 30.64  ? 736  SER A N     1 
ATOM   6022 C  CA    . SER A 1 736 ? -14.137 41.897 33.831  1.00 33.53  ? 736  SER A CA    1 
ATOM   6023 C  C     . SER A 1 736 ? -15.284 40.902 33.657  1.00 32.14  ? 736  SER A C     1 
ATOM   6024 O  O     . SER A 1 736 ? -16.126 40.750 34.543  1.00 33.80  ? 736  SER A O     1 
ATOM   6025 C  CB    . SER A 1 736 ? -14.618 43.321 33.542  1.00 30.23  ? 736  SER A CB    1 
ATOM   6026 O  OG    . SER A 1 736 ? -14.756 43.540 32.148  1.00 32.11  ? 736  SER A OG    1 
ATOM   6027 N  N     . THR A 1 737 ? -15.308 40.229 32.512  1.00 32.45  ? 737  THR A N     1 
ATOM   6028 C  CA    . THR A 1 737 ? -16.322 39.216 32.219  1.00 26.47  ? 737  THR A CA    1 
ATOM   6029 C  C     . THR A 1 737 ? -16.049 37.938 33.016  1.00 25.41  ? 737  THR A C     1 
ATOM   6030 O  O     . THR A 1 737 ? -14.905 37.483 33.086  1.00 25.48  ? 737  THR A O     1 
ATOM   6031 C  CB    . THR A 1 737 ? -16.342 38.895 30.707  1.00 28.13  ? 737  THR A CB    1 
ATOM   6032 O  OG1   . THR A 1 737 ? -16.563 40.102 29.966  1.00 32.48  ? 737  THR A OG1   1 
ATOM   6033 C  CG2   . THR A 1 737 ? -17.433 37.889 30.362  1.00 22.10  ? 737  THR A CG2   1 
ATOM   6034 N  N     . PRO A 1 738 ? -17.094 37.363 33.635  1.00 26.05  ? 738  PRO A N     1 
ATOM   6035 C  CA    . PRO A 1 738 ? -16.927 36.138 34.427  1.00 23.58  ? 738  PRO A CA    1 
ATOM   6036 C  C     . PRO A 1 738 ? -16.299 35.009 33.610  1.00 27.92  ? 738  PRO A C     1 
ATOM   6037 O  O     . PRO A 1 738 ? -16.586 34.891 32.418  1.00 28.73  ? 738  PRO A O     1 
ATOM   6038 C  CB    . PRO A 1 738 ? -18.362 35.775 34.811  1.00 26.65  ? 738  PRO A CB    1 
ATOM   6039 C  CG    . PRO A 1 738 ? -19.100 37.067 34.788  1.00 23.86  ? 738  PRO A CG    1 
ATOM   6040 C  CD    . PRO A 1 738 ? -18.481 37.864 33.675  1.00 23.11  ? 738  PRO A CD    1 
ATOM   6041 N  N     . LYS A 1 739 ? -15.449 34.206 34.247  1.00 28.01  ? 739  LYS A N     1 
ATOM   6042 C  CA    . LYS A 1 739 ? -14.735 33.125 33.561  1.00 33.42  ? 739  LYS A CA    1 
ATOM   6043 C  C     . LYS A 1 739 ? -15.653 32.206 32.759  1.00 32.36  ? 739  LYS A C     1 
ATOM   6044 O  O     . LYS A 1 739 ? -15.416 31.959 31.576  1.00 32.95  ? 739  LYS A O     1 
ATOM   6045 C  CB    . LYS A 1 739 ? -13.925 32.297 34.560  1.00 38.96  ? 739  LYS A CB    1 
ATOM   6046 C  CG    . LYS A 1 739 ? -12.677 32.987 35.068  1.00 46.93  ? 739  LYS A CG    1 
ATOM   6047 C  CD    . LYS A 1 739 ? -11.664 33.178 33.949  1.00 55.67  ? 739  LYS A CD    1 
ATOM   6048 C  CE    . LYS A 1 739 ? -10.388 33.815 34.470  1.00 62.69  ? 739  LYS A CE    1 
ATOM   6049 N  NZ    . LYS A 1 739 ? -9.366  34.005 33.404  1.00 64.16  ? 739  LYS A NZ    1 
ATOM   6050 N  N     . ALA A 1 740 ? -16.702 31.710 33.407  1.00 33.80  ? 740  ALA A N     1 
ATOM   6051 C  CA    . ALA A 1 740 ? -17.636 30.788 32.765  1.00 35.48  ? 740  ALA A CA    1 
ATOM   6052 C  C     . ALA A 1 740 ? -18.421 31.455 31.635  1.00 36.14  ? 740  ALA A C     1 
ATOM   6053 O  O     . ALA A 1 740 ? -18.840 30.791 30.686  1.00 36.10  ? 740  ALA A O     1 
ATOM   6054 C  CB    . ALA A 1 740 ? -18.583 30.189 33.794  1.00 36.42  ? 740  ALA A CB    1 
ATOM   6055 N  N     . VAL A 1 741 ? -18.618 32.765 31.741  1.00 32.89  ? 741  VAL A N     1 
ATOM   6056 C  CA    . VAL A 1 741 ? -19.326 33.514 30.707  1.00 32.99  ? 741  VAL A CA    1 
ATOM   6057 C  C     . VAL A 1 741 ? -18.436 33.716 29.481  1.00 31.39  ? 741  VAL A C     1 
ATOM   6058 O  O     . VAL A 1 741 ? -18.905 33.635 28.345  1.00 33.91  ? 741  VAL A O     1 
ATOM   6059 C  CB    . VAL A 1 741 ? -19.843 34.871 31.237  1.00 36.82  ? 741  VAL A CB    1 
ATOM   6060 C  CG1   . VAL A 1 741 ? -20.396 35.724 30.102  1.00 35.97  ? 741  VAL A CG1   1 
ATOM   6061 C  CG2   . VAL A 1 741 ? -20.905 34.650 32.303  1.00 39.77  ? 741  VAL A CG2   1 
ATOM   6062 N  N     . GLN A 1 742 ? -17.152 33.972 29.719  1.00 27.41  ? 742  GLN A N     1 
ATOM   6063 C  CA    . GLN A 1 742 ? -16.168 34.044 28.646  1.00 30.12  ? 742  GLN A CA    1 
ATOM   6064 C  C     . GLN A 1 742 ? -16.211 32.747 27.850  1.00 32.33  ? 742  GLN A C     1 
ATOM   6065 O  O     . GLN A 1 742 ? -16.324 32.754 26.624  1.00 32.15  ? 742  GLN A O     1 
ATOM   6066 C  CB    . GLN A 1 742 ? -14.759 34.221 29.218  1.00 28.34  ? 742  GLN A CB    1 
ATOM   6067 C  CG    . GLN A 1 742 ? -14.455 35.589 29.817  1.00 24.23  ? 742  GLN A CG    1 
ATOM   6068 C  CD    . GLN A 1 742 ? -13.058 35.651 30.410  1.00 27.53  ? 742  GLN A CD    1 
ATOM   6069 O  OE1   . GLN A 1 742 ? -12.459 34.621 30.716  1.00 31.02  ? 742  GLN A OE1   1 
ATOM   6070 N  NE2   . GLN A 1 742 ? -12.531 36.857 30.570  1.00 27.88  ? 742  GLN A NE2   1 
ATOM   6071 N  N     . LYS A 1 743 ? -16.125 31.639 28.577  1.00 29.15  ? 743  LYS A N     1 
ATOM   6072 C  CA    . LYS A 1 743 ? -16.110 30.302 27.998  1.00 34.91  ? 743  LYS A CA    1 
ATOM   6073 C  C     . LYS A 1 743 ? -17.368 30.030 27.183  1.00 33.96  ? 743  LYS A C     1 
ATOM   6074 O  O     . LYS A 1 743 ? -17.294 29.531 26.061  1.00 35.71  ? 743  LYS A O     1 
ATOM   6075 C  CB    . LYS A 1 743 ? -15.964 29.266 29.114  1.00 35.92  ? 743  LYS A CB    1 
ATOM   6076 C  CG    . LYS A 1 743 ? -15.972 27.823 28.659  1.00 40.30  ? 743  LYS A CG    1 
ATOM   6077 C  CD    . LYS A 1 743 ? -15.801 26.894 29.853  1.00 44.17  ? 743  LYS A CD    1 
ATOM   6078 C  CE    . LYS A 1 743 ? -15.889 25.433 29.446  1.00 49.41  ? 743  LYS A CE    1 
ATOM   6079 N  NZ    . LYS A 1 743 ? -14.826 25.067 28.473  1.00 52.18  ? 743  LYS A NZ    1 
ATOM   6080 N  N     . ALA A 1 744 ? -18.519 30.377 27.749  1.00 29.05  ? 744  ALA A N     1 
ATOM   6081 C  CA    . ALA A 1 744 ? -19.801 30.152 27.094  1.00 31.84  ? 744  ALA A CA    1 
ATOM   6082 C  C     . ALA A 1 744 ? -19.977 31.030 25.860  1.00 38.09  ? 744  ALA A C     1 
ATOM   6083 O  O     . ALA A 1 744 ? -20.445 30.563 24.820  1.00 39.13  ? 744  ALA A O     1 
ATOM   6084 C  CB    . ALA A 1 744 ? -20.936 30.388 28.069  1.00 32.84  ? 744  ALA A CB    1 
ATOM   6085 N  N     . LEU A 1 745 ? -19.614 32.304 25.985  1.00 32.37  ? 745  LEU A N     1 
ATOM   6086 C  CA    . LEU A 1 745 ? -19.717 33.242 24.873  1.00 34.53  ? 745  LEU A CA    1 
ATOM   6087 C  C     . LEU A 1 745 ? -18.778 32.850 23.736  1.00 33.55  ? 745  LEU A C     1 
ATOM   6088 O  O     . LEU A 1 745 ? -19.118 32.998 22.562  1.00 35.27  ? 745  LEU A O     1 
ATOM   6089 C  CB    . LEU A 1 745 ? -19.415 34.671 25.334  1.00 35.91  ? 745  LEU A CB    1 
ATOM   6090 C  CG    . LEU A 1 745 ? -20.501 35.412 26.117  1.00 35.31  ? 745  LEU A CG    1 
ATOM   6091 C  CD1   . LEU A 1 745 ? -20.025 36.807 26.504  1.00 31.58  ? 745  LEU A CD1   1 
ATOM   6092 C  CD2   . LEU A 1 745 ? -21.787 35.489 25.309  1.00 37.96  ? 745  LEU A CD2   1 
ATOM   6093 N  N     . LYS A 1 746 ? -17.600 32.348 24.091  1.00 29.16  ? 746  LYS A N     1 
ATOM   6094 C  CA    . LYS A 1 746 ? -16.621 31.930 23.095  1.00 31.52  ? 746  LYS A CA    1 
ATOM   6095 C  C     . LYS A 1 746 ? -17.144 30.740 22.302  1.00 36.55  ? 746  LYS A C     1 
ATOM   6096 O  O     . LYS A 1 746 ? -17.008 30.689 21.080  1.00 39.11  ? 746  LYS A O     1 
ATOM   6097 C  CB    . LYS A 1 746 ? -15.286 31.583 23.755  1.00 30.11  ? 746  LYS A CB    1 
ATOM   6098 C  CG    . LYS A 1 746 ? -14.125 31.438 22.779  1.00 36.17  ? 746  LYS A CG    1 
ATOM   6099 C  CD    . LYS A 1 746 ? -12.825 31.140 23.516  1.00 43.85  ? 746  LYS A CD    1 
ATOM   6100 C  CE    . LYS A 1 746 ? -11.609 31.319 22.617  1.00 46.31  ? 746  LYS A CE    1 
ATOM   6101 N  NZ    . LYS A 1 746 ? -11.594 30.361 21.482  1.00 49.69  ? 746  LYS A NZ    1 
ATOM   6102 N  N     . GLU A 1 747 ? -17.750 29.786 23.003  1.00 35.44  ? 747  GLU A N     1 
ATOM   6103 C  CA    . GLU A 1 747 ? -18.323 28.621 22.343  1.00 33.98  ? 747  GLU A CA    1 
ATOM   6104 C  C     . GLU A 1 747 ? -19.519 29.026 21.490  1.00 33.96  ? 747  GLU A C     1 
ATOM   6105 O  O     . GLU A 1 747 ? -19.758 28.446 20.430  1.00 36.89  ? 747  GLU A O     1 
ATOM   6106 C  CB    . GLU A 1 747 ? -18.710 27.544 23.363  1.00 35.66  ? 747  GLU A CB    1 
ATOM   6107 C  CG    . GLU A 1 747 ? -19.398 26.316 22.767  1.00 39.60  ? 747  GLU A CG    1 
ATOM   6108 C  CD    . GLU A 1 747 ? -18.497 25.497 21.850  1.00 42.72  ? 747  GLU A CD    1 
ATOM   6109 O  OE1   . GLU A 1 747 ? -19.010 24.552 21.213  1.00 43.28  ? 747  GLU A OE1   1 
ATOM   6110 O  OE2   . GLU A 1 747 ? -17.283 25.784 21.765  1.00 43.59  ? 747  GLU A OE2   1 
ATOM   6111 N  N     . CYS A 1 748 ? -20.262 30.030 21.951  1.00 32.54  ? 748  CYS A N     1 
ATOM   6112 C  CA    . CYS A 1 748 ? -21.338 30.603 21.151  1.00 37.84  ? 748  CYS A CA    1 
ATOM   6113 C  C     . CYS A 1 748 ? -20.770 31.170 19.859  1.00 37.67  ? 748  CYS A C     1 
ATOM   6114 O  O     . CYS A 1 748 ? -21.307 30.936 18.780  1.00 39.79  ? 748  CYS A O     1 
ATOM   6115 C  CB    . CYS A 1 748 ? -22.068 31.708 21.919  1.00 39.56  ? 748  CYS A CB    1 
ATOM   6116 S  SG    . CYS A 1 748 ? -23.288 31.130 23.118  1.00 39.86  ? 748  CYS A SG    1 
ATOM   6117 N  N     . ILE A 1 749 ? -19.675 31.913 19.980  1.00 35.02  ? 749  ILE A N     1 
ATOM   6118 C  CA    . ILE A 1 749 ? -19.021 32.502 18.820  1.00 36.98  ? 749  ILE A CA    1 
ATOM   6119 C  C     . ILE A 1 749 ? -18.447 31.434 17.892  1.00 35.21  ? 749  ILE A C     1 
ATOM   6120 O  O     . ILE A 1 749 ? -18.599 31.522 16.673  1.00 38.17  ? 749  ILE A O     1 
ATOM   6121 C  CB    . ILE A 1 749 ? -17.918 33.497 19.236  1.00 35.09  ? 749  ILE A CB    1 
ATOM   6122 C  CG1   . ILE A 1 749 ? -18.545 34.731 19.889  1.00 33.75  ? 749  ILE A CG1   1 
ATOM   6123 C  CG2   . ILE A 1 749 ? -17.081 33.908 18.034  1.00 33.56  ? 749  ILE A CG2   1 
ATOM   6124 C  CD1   . ILE A 1 749 ? -17.538 35.738 20.392  1.00 30.72  ? 749  ILE A CD1   1 
ATOM   6125 N  N     . ARG A 1 750 ? -17.800 30.423 18.469  1.00 34.60  ? 750  ARG A N     1 
ATOM   6126 C  CA    . ARG A 1 750 ? -17.238 29.331 17.679  1.00 36.48  ? 750  ARG A CA    1 
ATOM   6127 C  C     . ARG A 1 750 ? -18.304 28.668 16.816  1.00 39.50  ? 750  ARG A C     1 
ATOM   6128 O  O     . ARG A 1 750 ? -18.088 28.421 15.629  1.00 42.90  ? 750  ARG A O     1 
ATOM   6129 C  CB    . ARG A 1 750 ? -16.581 28.275 18.572  1.00 34.14  ? 750  ARG A CB    1 
ATOM   6130 C  CG    . ARG A 1 750 ? -15.833 27.208 17.782  1.00 36.39  ? 750  ARG A CG    1 
ATOM   6131 C  CD    . ARG A 1 750 ? -15.540 25.964 18.612  1.00 42.32  ? 750  ARG A CD    1 
ATOM   6132 N  NE    . ARG A 1 750 ? -16.753 25.228 18.963  1.00 43.68  ? 750  ARG A NE    1 
ATOM   6133 C  CZ    . ARG A 1 750 ? -17.414 24.430 18.129  1.00 45.55  ? 750  ARG A CZ    1 
ATOM   6134 N  NH1   . ARG A 1 750 ? -16.991 24.268 16.881  1.00 44.85  ? 750  ARG A NH1   1 
ATOM   6135 N  NH2   . ARG A 1 750 ? -18.506 23.797 18.540  1.00 44.19  ? 750  ARG A NH2   1 
ATOM   6136 N  N     . ARG A 1 751 ? -19.456 28.391 17.418  1.00 37.03  ? 751  ARG A N     1 
ATOM   6137 C  CA    . ARG A 1 751 ? -20.547 27.726 16.712  1.00 42.85  ? 751  ARG A CA    1 
ATOM   6138 C  C     . ARG A 1 751 ? -21.118 28.592 15.592  1.00 44.19  ? 751  ARG A C     1 
ATOM   6139 O  O     . ARG A 1 751 ? -21.440 28.086 14.517  1.00 43.93  ? 751  ARG A O     1 
ATOM   6140 C  CB    . ARG A 1 751 ? -21.650 27.309 17.688  1.00 42.67  ? 751  ARG A CB    1 
ATOM   6141 C  CG    . ARG A 1 751 ? -21.246 26.168 18.613  1.00 45.49  ? 751  ARG A CG    1 
ATOM   6142 C  CD    . ARG A 1 751 ? -22.366 25.810 19.577  1.00 47.94  ? 751  ARG A CD    1 
ATOM   6143 N  NE    . ARG A 1 751 ? -22.034 24.659 20.414  1.00 46.65  ? 751  ARG A NE    1 
ATOM   6144 C  CZ    . ARG A 1 751 ? -22.641 23.478 20.341  1.00 49.22  ? 751  ARG A CZ    1 
ATOM   6145 N  NH1   . ARG A 1 751 ? -23.624 23.283 19.471  1.00 40.34  ? 751  ARG A NH1   1 
ATOM   6146 N  NH2   . ARG A 1 751 ? -22.270 22.490 21.144  1.00 52.23  ? 751  ARG A NH2   1 
ATOM   6147 N  N     . MET A 1 752 ? -21.237 29.892 15.844  1.00 43.59  ? 752  MET A N     1 
ATOM   6148 C  CA    . MET A 1 752 ? -21.721 30.828 14.831  1.00 40.63  ? 752  MET A CA    1 
ATOM   6149 C  C     . MET A 1 752 ? -20.816 30.834 13.604  1.00 40.01  ? 752  MET A C     1 
ATOM   6150 O  O     . MET A 1 752 ? -21.288 30.739 12.470  1.00 43.52  ? 752  MET A O     1 
ATOM   6151 C  CB    . MET A 1 752 ? -21.801 32.248 15.395  1.00 34.33  ? 752  MET A CB    1 
ATOM   6152 C  CG    . MET A 1 752 ? -22.838 32.450 16.485  1.00 42.91  ? 752  MET A CG    1 
ATOM   6153 S  SD    . MET A 1 752 ? -22.662 34.062 17.284  1.00 43.36  ? 752  MET A SD    1 
ATOM   6154 C  CE    . MET A 1 752 ? -23.026 35.160 15.918  1.00 36.27  ? 752  MET A CE    1 
ATOM   6155 N  N     . LEU A 1 753 ? -19.512 30.944 13.842  1.00 38.03  ? 753  LEU A N     1 
ATOM   6156 C  CA    . LEU A 1 753 ? -18.544 31.115 12.762  1.00 41.10  ? 753  LEU A CA    1 
ATOM   6157 C  C     . LEU A 1 753 ? -18.203 29.809 12.048  1.00 44.17  ? 753  LEU A C     1 
ATOM   6158 O  O     . LEU A 1 753 ? -17.842 29.817 10.871  1.00 45.26  ? 753  LEU A O     1 
ATOM   6159 C  CB    . LEU A 1 753 ? -17.256 31.761 13.288  1.00 37.90  ? 753  LEU A CB    1 
ATOM   6160 C  CG    . LEU A 1 753 ? -17.347 33.058 14.103  1.00 36.18  ? 753  LEU A CG    1 
ATOM   6161 C  CD1   . LEU A 1 753 ? -15.973 33.679 14.246  1.00 34.41  ? 753  LEU A CD1   1 
ATOM   6162 C  CD2   . LEU A 1 753 ? -18.309 34.047 13.477  1.00 35.04  ? 753  LEU A CD2   1 
ATOM   6163 N  N     . GLN A 1 754 ? -18.313 28.691 12.759  1.00 43.66  ? 754  GLN A N     1 
ATOM   6164 C  CA    . GLN A 1 754 ? -17.882 27.407 12.213  1.00 45.29  ? 754  GLN A CA    1 
ATOM   6165 C  C     . GLN A 1 754 ? -19.031 26.471 11.848  1.00 49.03  ? 754  GLN A C     1 
ATOM   6166 O  O     . GLN A 1 754 ? -18.912 25.671 10.918  1.00 53.96  ? 754  GLN A O     1 
ATOM   6167 C  CB    . GLN A 1 754 ? -16.945 26.692 13.192  1.00 44.90  ? 754  GLN A CB    1 
ATOM   6168 C  CG    . GLN A 1 754 ? -15.638 27.413 13.470  1.00 42.39  ? 754  GLN A CG    1 
ATOM   6169 C  CD    . GLN A 1 754 ? -14.732 26.621 14.395  1.00 44.47  ? 754  GLN A CD    1 
ATOM   6170 O  OE1   . GLN A 1 754 ? -15.102 25.548 14.872  1.00 45.35  ? 754  GLN A OE1   1 
ATOM   6171 N  NE2   . GLN A 1 754 ? -13.540 27.145 14.651  1.00 46.43  ? 754  GLN A NE2   1 
ATOM   6172 N  N     . GLU A 1 755 ? -20.139 26.562 12.577  1.00 46.44  ? 755  GLU A N     1 
ATOM   6173 C  CA    . GLU A 1 755 ? -21.194 25.559 12.453  1.00 50.11  ? 755  GLU A CA    1 
ATOM   6174 C  C     . GLU A 1 755 ? -22.556 26.106 12.030  1.00 53.31  ? 755  GLU A C     1 
ATOM   6175 O  O     . GLU A 1 755 ? -23.308 25.426 11.334  1.00 58.89  ? 755  GLU A O     1 
ATOM   6176 C  CB    . GLU A 1 755 ? -21.311 24.755 13.750  1.00 49.16  ? 755  GLU A CB    1 
ATOM   6177 C  CG    . GLU A 1 755 ? -20.037 24.010 14.110  1.00 51.10  ? 755  GLU A CG    1 
ATOM   6178 C  CD    . GLU A 1 755 ? -20.157 23.227 15.399  1.00 53.75  ? 755  GLU A CD    1 
ATOM   6179 O  OE1   . GLU A 1 755 ? -21.198 23.348 16.076  1.00 57.85  ? 755  GLU A OE1   1 
ATOM   6180 O  OE2   . GLU A 1 755 ? -19.209 22.488 15.734  1.00 54.00  ? 755  GLU A OE2   1 
ATOM   6181 N  N     . GLY A 1 756 ? -22.883 27.323 12.453  1.00 51.36  ? 756  GLY A N     1 
ATOM   6182 C  CA    . GLY A 1 756 ? -24.123 27.946 12.023  1.00 49.99  ? 756  GLY A CA    1 
ATOM   6183 C  C     . GLY A 1 756 ? -25.136 28.228 13.117  1.00 47.88  ? 756  GLY A C     1 
ATOM   6184 O  O     . GLY A 1 756 ? -24.897 27.958 14.295  1.00 46.98  ? 756  GLY A O     1 
ATOM   6185 N  N     . GLU A 1 757 ? -26.282 28.763 12.707  1.00 48.31  ? 757  GLU A N     1 
ATOM   6186 C  CA    . GLU A 1 757 ? -27.320 29.228 13.624  1.00 52.37  ? 757  GLU A CA    1 
ATOM   6187 C  C     . GLU A 1 757 ? -27.912 28.125 14.494  1.00 55.09  ? 757  GLU A C     1 
ATOM   6188 O  O     . GLU A 1 757 ? -28.096 28.308 15.699  1.00 51.74  ? 757  GLU A O     1 
ATOM   6189 C  CB    . GLU A 1 757 ? -28.445 29.904 12.840  1.00 55.50  ? 757  GLU A CB    1 
ATOM   6190 C  CG    . GLU A 1 757 ? -29.495 30.573 13.708  1.00 57.67  ? 757  GLU A CG    1 
ATOM   6191 C  CD    . GLU A 1 757 ? -30.588 31.233 12.891  1.00 59.32  ? 757  GLU A CD    1 
ATOM   6192 O  OE1   . GLU A 1 757 ? -31.140 32.255 13.350  1.00 56.33  ? 757  GLU A OE1   1 
ATOM   6193 O  OE2   . GLU A 1 757 ? -30.895 30.728 11.790  1.00 63.13  ? 757  GLU A OE2   1 
ATOM   6194 N  N     . GLU A 1 758 ? -28.222 26.989 13.875  1.00 56.69  ? 758  GLU A N     1 
ATOM   6195 C  CA    . GLU A 1 758 ? -28.857 25.881 14.580  1.00 58.49  ? 758  GLU A CA    1 
ATOM   6196 C  C     . GLU A 1 758 ? -27.977 25.353 15.711  1.00 53.92  ? 758  GLU A C     1 
ATOM   6197 O  O     . GLU A 1 758 ? -28.472 25.017 16.787  1.00 52.77  ? 758  GLU A O     1 
ATOM   6198 C  CB    . GLU A 1 758 ? -29.209 24.755 13.604  1.00 62.04  ? 758  GLU A CB    1 
ATOM   6199 C  CG    . GLU A 1 758 ? -29.972 23.604 14.236  1.00 68.81  ? 758  GLU A CG    1 
ATOM   6200 C  CD    . GLU A 1 758 ? -30.428 22.577 13.216  1.00 78.22  ? 758  GLU A CD    1 
ATOM   6201 O  OE1   . GLU A 1 758 ? -30.335 22.858 12.002  1.00 82.61  ? 758  GLU A OE1   1 
ATOM   6202 O  OE2   . GLU A 1 758 ? -30.877 21.486 13.628  1.00 80.23  ? 758  GLU A OE2   1 
ATOM   6203 N  N     . SER A 1 759 ? -26.674 25.290 15.462  1.00 50.22  ? 759  SER A N     1 
ATOM   6204 C  CA    . SER A 1 759 ? -25.722 24.850 16.474  1.00 50.81  ? 759  SER A CA    1 
ATOM   6205 C  C     . SER A 1 759 ? -25.679 25.824 17.648  1.00 50.60  ? 759  SER A C     1 
ATOM   6206 O  O     . SER A 1 759 ? -25.577 25.413 18.804  1.00 49.40  ? 759  SER A O     1 
ATOM   6207 C  CB    . SER A 1 759 ? -24.327 24.698 15.866  1.00 52.61  ? 759  SER A CB    1 
ATOM   6208 O  OG    . SER A 1 759 ? -23.383 24.304 16.847  1.00 50.43  ? 759  SER A OG    1 
ATOM   6209 N  N     . LEU A 1 760 ? -25.758 27.116 17.340  1.00 50.05  ? 760  LEU A N     1 
ATOM   6210 C  CA    . LEU A 1 760 ? -25.773 28.157 18.364  1.00 45.02  ? 760  LEU A CA    1 
ATOM   6211 C  C     . LEU A 1 760 ? -26.989 28.024 19.272  1.00 44.68  ? 760  LEU A C     1 
ATOM   6212 O  O     . LEU A 1 760 ? -26.882 28.146 20.492  1.00 41.07  ? 760  LEU A O     1 
ATOM   6213 C  CB    . LEU A 1 760 ? -25.770 29.543 17.717  1.00 41.62  ? 760  LEU A CB    1 
ATOM   6214 C  CG    . LEU A 1 760 ? -26.175 30.707 18.624  1.00 41.52  ? 760  LEU A CG    1 
ATOM   6215 C  CD1   . LEU A 1 760 ? -25.153 30.923 19.735  1.00 38.45  ? 760  LEU A CD1   1 
ATOM   6216 C  CD2   . LEU A 1 760 ? -26.378 31.981 17.816  1.00 45.27  ? 760  LEU A CD2   1 
ATOM   6217 N  N     . GLN A 1 761 ? -28.144 27.772 18.665  1.00 47.78  ? 761  GLN A N     1 
ATOM   6218 C  CA    . GLN A 1 761 ? -29.400 27.689 19.401  1.00 48.78  ? 761  GLN A CA    1 
ATOM   6219 C  C     . GLN A 1 761 ? -29.456 26.473 20.322  1.00 48.70  ? 761  GLN A C     1 
ATOM   6220 O  O     . GLN A 1 761 ? -30.047 26.533 21.399  1.00 51.01  ? 761  GLN A O     1 
ATOM   6221 C  CB    . GLN A 1 761 ? -30.586 27.705 18.434  1.00 49.46  ? 761  GLN A CB    1 
ATOM   6222 C  CG    . GLN A 1 761 ? -30.692 29.004 17.643  1.00 49.75  ? 761  GLN A CG    1 
ATOM   6223 C  CD    . GLN A 1 761 ? -31.790 28.975 16.597  1.00 52.76  ? 761  GLN A CD    1 
ATOM   6224 O  OE1   . GLN A 1 761 ? -32.422 27.944 16.370  1.00 52.13  ? 761  GLN A OE1   1 
ATOM   6225 N  NE2   . GLN A 1 761 ? -32.022 30.114 15.954  1.00 53.46  ? 761  GLN A NE2   1 
ATOM   6226 N  N     . GLU A 1 762 ? -28.833 25.376 19.901  1.00 46.86  ? 762  GLU A N     1 
ATOM   6227 C  CA    . GLU A 1 762 ? -28.734 24.187 20.741  1.00 51.45  ? 762  GLU A CA    1 
ATOM   6228 C  C     . GLU A 1 762 ? -27.925 24.486 22.000  1.00 49.17  ? 762  GLU A C     1 
ATOM   6229 O  O     . GLU A 1 762 ? -28.365 24.210 23.116  1.00 48.28  ? 762  GLU A O     1 
ATOM   6230 C  CB    . GLU A 1 762 ? -28.076 23.036 19.979  1.00 57.64  ? 762  GLU A CB    1 
ATOM   6231 C  CG    . GLU A 1 762 ? -28.875 22.516 18.799  1.00 70.30  ? 762  GLU A CG    1 
ATOM   6232 C  CD    . GLU A 1 762 ? -28.209 21.325 18.138  1.00 80.50  ? 762  GLU A CD    1 
ATOM   6233 O  OE1   . GLU A 1 762 ? -27.233 20.797 18.714  1.00 83.73  ? 762  GLU A OE1   1 
ATOM   6234 O  OE2   . GLU A 1 762 ? -28.657 20.917 17.045  1.00 83.90  ? 762  GLU A OE2   1 
ATOM   6235 N  N     . TYR A 1 763 ? -26.739 25.056 21.810  1.00 44.87  ? 763  TYR A N     1 
ATOM   6236 C  CA    . TYR A 1 763 ? -25.839 25.337 22.921  1.00 43.65  ? 763  TYR A CA    1 
ATOM   6237 C  C     . TYR A 1 763 ? -26.419 26.358 23.890  1.00 45.56  ? 763  TYR A C     1 
ATOM   6238 O  O     . TYR A 1 763 ? -26.270 26.218 25.104  1.00 45.40  ? 763  TYR A O     1 
ATOM   6239 C  CB    . TYR A 1 763 ? -24.480 25.817 22.408  1.00 42.98  ? 763  TYR A CB    1 
ATOM   6240 C  CG    . TYR A 1 763 ? -23.473 26.058 23.507  1.00 41.83  ? 763  TYR A CG    1 
ATOM   6241 C  CD1   . TYR A 1 763 ? -23.178 27.346 23.934  1.00 40.14  ? 763  TYR A CD1   1 
ATOM   6242 C  CD2   . TYR A 1 763 ? -22.825 24.996 24.127  1.00 43.65  ? 763  TYR A CD2   1 
ATOM   6243 C  CE1   . TYR A 1 763 ? -22.262 27.572 24.942  1.00 43.33  ? 763  TYR A CE1   1 
ATOM   6244 C  CE2   . TYR A 1 763 ? -21.907 25.211 25.137  1.00 45.96  ? 763  TYR A CE2   1 
ATOM   6245 C  CZ    . TYR A 1 763 ? -21.629 26.501 25.541  1.00 46.52  ? 763  TYR A CZ    1 
ATOM   6246 O  OH    . TYR A 1 763 ? -20.715 26.726 26.544  1.00 50.21  ? 763  TYR A OH    1 
ATOM   6247 N  N     . PHE A 1 764 ? -27.076 27.385 23.357  1.00 46.14  ? 764  PHE A N     1 
ATOM   6248 C  CA    . PHE A 1 764 ? -27.671 28.413 24.204  1.00 40.06  ? 764  PHE A CA    1 
ATOM   6249 C  C     . PHE A 1 764 ? -28.720 27.831 25.139  1.00 40.63  ? 764  PHE A C     1 
ATOM   6250 O  O     . PHE A 1 764 ? -28.714 28.109 26.339  1.00 41.64  ? 764  PHE A O     1 
ATOM   6251 C  CB    . PHE A 1 764 ? -28.309 29.529 23.378  1.00 40.36  ? 764  PHE A CB    1 
ATOM   6252 C  CG    . PHE A 1 764 ? -29.074 30.522 24.209  1.00 42.47  ? 764  PHE A CG    1 
ATOM   6253 C  CD1   . PHE A 1 764 ? -28.411 31.536 24.878  1.00 41.13  ? 764  PHE A CD1   1 
ATOM   6254 C  CD2   . PHE A 1 764 ? -30.452 30.431 24.336  1.00 47.25  ? 764  PHE A CD2   1 
ATOM   6255 C  CE1   . PHE A 1 764 ? -29.106 32.449 25.650  1.00 42.34  ? 764  PHE A CE1   1 
ATOM   6256 C  CE2   . PHE A 1 764 ? -31.152 31.340 25.109  1.00 49.43  ? 764  PHE A CE2   1 
ATOM   6257 C  CZ    . PHE A 1 764 ? -30.476 32.350 25.766  1.00 45.85  ? 764  PHE A CZ    1 
ATOM   6258 N  N     . LYS A 1 765 ? -29.627 27.041 24.575  1.00 42.61  ? 765  LYS A N     1 
ATOM   6259 C  CA    . LYS A 1 765 ? -30.691 26.411 25.346  1.00 49.18  ? 765  LYS A CA    1 
ATOM   6260 C  C     . LYS A 1 765 ? -30.112 25.568 26.472  1.00 52.68  ? 765  LYS A C     1 
ATOM   6261 O  O     . LYS A 1 765 ? -30.627 25.570 27.590  1.00 58.71  ? 765  LYS A O     1 
ATOM   6262 C  CB    . LYS A 1 765 ? -31.569 25.546 24.440  1.00 47.52  ? 765  LYS A CB    1 
ATOM   6263 C  CG    . LYS A 1 765 ? -32.691 24.829 25.170  1.00 52.04  ? 765  LYS A CG    1 
ATOM   6264 N  N     . GLU A 1 766 ? -29.030 24.858 26.173  1.00 50.63  ? 766  GLU A N     1 
ATOM   6265 C  CA    . GLU A 1 766 ? -28.380 24.010 27.162  1.00 49.83  ? 766  GLU A CA    1 
ATOM   6266 C  C     . GLU A 1 766 ? -27.730 24.841 28.262  1.00 46.75  ? 766  GLU A C     1 
ATOM   6267 O  O     . GLU A 1 766 ? -27.845 24.515 29.444  1.00 48.17  ? 766  GLU A O     1 
ATOM   6268 C  CB    . GLU A 1 766 ? -27.337 23.110 26.500  1.00 52.04  ? 766  GLU A CB    1 
ATOM   6269 C  CG    . GLU A 1 766 ? -27.043 21.843 27.284  1.00 55.91  ? 766  GLU A CG    1 
ATOM   6270 C  CD    . GLU A 1 766 ? -28.261 20.948 27.409  1.00 60.91  ? 766  GLU A CD    1 
ATOM   6271 O  OE1   . GLU A 1 766 ? -28.702 20.397 26.379  1.00 63.68  ? 766  GLU A OE1   1 
ATOM   6272 O  OE2   . GLU A 1 766 ? -28.782 20.802 28.535  1.00 65.09  ? 766  GLU A OE2   1 
ATOM   6273 N  N     . PHE A 1 767 ? -27.050 25.916 27.875  1.00 42.17  ? 767  PHE A N     1 
ATOM   6274 C  CA    . PHE A 1 767 ? -26.382 26.769 28.852  1.00 43.19  ? 767  PHE A CA    1 
ATOM   6275 C  C     . PHE A 1 767 ? -27.387 27.439 29.781  1.00 45.39  ? 767  PHE A C     1 
ATOM   6276 O  O     . PHE A 1 767 ? -27.132 27.589 30.974  1.00 44.84  ? 767  PHE A O     1 
ATOM   6277 C  CB    . PHE A 1 767 ? -25.506 27.825 28.173  1.00 40.81  ? 767  PHE A CB    1 
ATOM   6278 C  CG    . PHE A 1 767 ? -24.701 28.648 29.140  1.00 43.24  ? 767  PHE A CG    1 
ATOM   6279 C  CD1   . PHE A 1 767 ? -25.138 29.899 29.542  1.00 44.37  ? 767  PHE A CD1   1 
ATOM   6280 C  CD2   . PHE A 1 767 ? -23.516 28.159 29.664  1.00 45.06  ? 767  PHE A CD2   1 
ATOM   6281 C  CE1   . PHE A 1 767 ? -24.403 30.651 30.439  1.00 46.17  ? 767  PHE A CE1   1 
ATOM   6282 C  CE2   . PHE A 1 767 ? -22.778 28.904 30.564  1.00 44.80  ? 767  PHE A CE2   1 
ATOM   6283 C  CZ    . PHE A 1 767 ? -23.221 30.153 30.950  1.00 45.42  ? 767  PHE A CZ    1 
ATOM   6284 N  N     . GLU A 1 768 ? -28.531 27.834 29.230  1.00 47.25  ? 768  GLU A N     1 
ATOM   6285 C  CA    . GLU A 1 768 ? -29.565 28.498 30.015  1.00 48.60  ? 768  GLU A CA    1 
ATOM   6286 C  C     . GLU A 1 768 ? -30.124 27.569 31.087  1.00 46.79  ? 768  GLU A C     1 
ATOM   6287 O  O     . GLU A 1 768 ? -30.386 27.992 32.212  1.00 49.13  ? 768  GLU A O     1 
ATOM   6288 C  CB    . GLU A 1 768 ? -30.694 28.998 29.110  1.00 51.05  ? 768  GLU A CB    1 
ATOM   6289 C  CG    . GLU A 1 768 ? -31.691 29.902 29.817  1.00 56.96  ? 768  GLU A CG    1 
ATOM   6290 C  CD    . GLU A 1 768 ? -32.784 30.409 28.893  1.00 62.43  ? 768  GLU A CD    1 
ATOM   6291 O  OE1   . GLU A 1 768 ? -33.039 29.760 27.855  1.00 62.65  ? 768  GLU A OE1   1 
ATOM   6292 O  OE2   . GLU A 1 768 ? -33.384 31.459 29.205  1.00 64.17  ? 768  GLU A OE2   1 
ATOM   6293 N  N     . LYS A 1 769 ? -30.294 26.299 30.734  1.00 44.85  ? 769  LYS A N     1 
ATOM   6294 C  CA    . LYS A 1 769 ? -30.840 25.312 31.657  1.00 48.13  ? 769  LYS A CA    1 
ATOM   6295 C  C     . LYS A 1 769 ? -29.908 25.006 32.827  1.00 49.21  ? 769  LYS A C     1 
ATOM   6296 O  O     . LYS A 1 769 ? -30.360 24.841 33.959  1.00 49.47  ? 769  LYS A O     1 
ATOM   6297 C  CB    . LYS A 1 769 ? -31.159 24.006 30.923  1.00 51.74  ? 769  LYS A CB    1 
ATOM   6298 C  CG    . LYS A 1 769 ? -32.299 24.094 29.924  1.00 56.41  ? 769  LYS A CG    1 
ATOM   6299 C  CD    . LYS A 1 769 ? -32.615 22.725 29.331  1.00 58.08  ? 769  LYS A CD    1 
ATOM   6300 N  N     . GLU A 1 770 ? -28.609 24.936 32.550  1.00 49.35  ? 770  GLU A N     1 
ATOM   6301 C  CA    . GLU A 1 770 ? -27.658 24.353 33.494  1.00 49.22  ? 770  GLU A CA    1 
ATOM   6302 C  C     . GLU A 1 770 ? -26.770 25.351 34.240  1.00 46.35  ? 770  GLU A C     1 
ATOM   6303 O  O     . GLU A 1 770 ? -26.061 24.967 35.170  1.00 48.02  ? 770  GLU A O     1 
ATOM   6304 C  CB    . GLU A 1 770 ? -26.765 23.336 32.772  1.00 47.39  ? 770  GLU A CB    1 
ATOM   6305 C  CG    . GLU A 1 770 ? -27.521 22.249 32.023  1.00 49.41  ? 770  GLU A CG    1 
ATOM   6306 C  CD    . GLU A 1 770 ? -28.261 21.307 32.951  1.00 55.10  ? 770  GLU A CD    1 
ATOM   6307 O  OE1   . GLU A 1 770 ? -29.273 20.718 32.517  1.00 58.88  ? 770  GLU A OE1   1 
ATOM   6308 O  OE2   . GLU A 1 770 ? -27.828 21.153 34.113  1.00 56.31  ? 770  GLU A OE2   1 
ATOM   6309 N  N     . PHE A 1 771 ? -26.809 26.621 33.850  1.00 40.59  ? 771  PHE A N     1 
ATOM   6310 C  CA    . PHE A 1 771 ? -25.824 27.587 34.341  1.00 44.18  ? 771  PHE A CA    1 
ATOM   6311 C  C     . PHE A 1 771 ? -25.862 27.867 35.848  1.00 44.61  ? 771  PHE A C     1 
ATOM   6312 O  O     . PHE A 1 771 ? -24.875 28.329 36.418  1.00 42.57  ? 771  PHE A O     1 
ATOM   6313 C  CB    . PHE A 1 771 ? -25.901 28.901 33.555  1.00 48.18  ? 771  PHE A CB    1 
ATOM   6314 C  CG    . PHE A 1 771 ? -26.850 29.906 34.138  1.00 51.88  ? 771  PHE A CG    1 
ATOM   6315 C  CD1   . PHE A 1 771 ? -26.378 30.952 34.915  1.00 51.78  ? 771  PHE A CD1   1 
ATOM   6316 C  CD2   . PHE A 1 771 ? -28.210 29.809 33.906  1.00 59.25  ? 771  PHE A CD2   1 
ATOM   6317 C  CE1   . PHE A 1 771 ? -27.246 31.882 35.453  1.00 54.77  ? 771  PHE A CE1   1 
ATOM   6318 C  CE2   . PHE A 1 771 ? -29.085 30.737 34.442  1.00 63.85  ? 771  PHE A CE2   1 
ATOM   6319 C  CZ    . PHE A 1 771 ? -28.602 31.774 35.218  1.00 59.94  ? 771  PHE A CZ    1 
ATOM   6320 N  N     A ARG A 1 772 ? -26.997 27.589 36.483  0.44 46.55  ? 772  ARG A N     1 
ATOM   6321 N  N     B ARG A 1 772 ? -26.992 27.579 36.486  0.56 46.60  ? 772  ARG A N     1 
ATOM   6322 C  CA    A ARG A 1 772 ? -27.151 27.839 37.915  0.44 46.73  ? 772  ARG A CA    1 
ATOM   6323 C  CA    B ARG A 1 772 ? -27.145 27.844 37.915  0.56 46.65  ? 772  ARG A CA    1 
ATOM   6324 C  C     A ARG A 1 772 ? -26.258 26.935 38.762  0.44 47.28  ? 772  ARG A C     1 
ATOM   6325 C  C     B ARG A 1 772 ? -26.347 26.870 38.779  0.56 47.43  ? 772  ARG A C     1 
ATOM   6326 O  O     A ARG A 1 772 ? -26.082 27.169 39.959  0.44 49.11  ? 772  ARG A O     1 
ATOM   6327 O  O     B ARG A 1 772 ? -26.324 26.992 40.005  0.56 50.04  ? 772  ARG A O     1 
ATOM   6328 C  CB    A ARG A 1 772 ? -28.613 27.677 38.341  0.44 49.41  ? 772  ARG A CB    1 
ATOM   6329 C  CB    B ARG A 1 772 ? -28.623 27.824 38.309  0.56 49.50  ? 772  ARG A CB    1 
ATOM   6330 C  CG    A ARG A 1 772 ? -29.517 28.830 37.931  0.44 49.71  ? 772  ARG A CG    1 
ATOM   6331 C  CG    B ARG A 1 772 ? -29.441 28.911 37.635  0.56 49.77  ? 772  ARG A CG    1 
ATOM   6332 C  CD    A ARG A 1 772 ? -30.967 28.550 38.290  0.44 51.46  ? 772  ARG A CD    1 
ATOM   6333 C  CD    B ARG A 1 772 ? -30.926 28.620 37.708  0.56 51.35  ? 772  ARG A CD    1 
ATOM   6334 N  NE    A ARG A 1 772 ? -31.812 29.728 38.116  0.44 52.59  ? 772  ARG A NE    1 
ATOM   6335 N  NE    B ARG A 1 772 ? -31.678 29.452 36.774  0.56 51.85  ? 772  ARG A NE    1 
ATOM   6336 C  CZ    A ARG A 1 772 ? -32.201 30.523 39.108  0.44 51.46  ? 772  ARG A CZ    1 
ATOM   6337 C  CZ    B ARG A 1 772 ? -31.815 29.181 35.481  0.56 51.71  ? 772  ARG A CZ    1 
ATOM   6338 N  NH1   A ARG A 1 772 ? -31.827 30.263 40.354  0.44 48.90  ? 772  ARG A NH1   1 
ATOM   6339 N  NH1   B ARG A 1 772 ? -31.246 28.098 34.966  0.56 48.41  ? 772  ARG A NH1   1 
ATOM   6340 N  NH2   A ARG A 1 772 ? -32.968 31.574 38.856  0.44 50.64  ? 772  ARG A NH2   1 
ATOM   6341 N  NH2   B ARG A 1 772 ? -32.516 29.992 34.701  0.56 52.94  ? 772  ARG A NH2   1 
ATOM   6342 N  N     . GLN A 1 773 ? -25.692 25.908 38.137  1.00 43.89  ? 773  GLN A N     1 
ATOM   6343 C  CA    . GLN A 1 773 ? -24.849 24.953 38.848  1.00 46.05  ? 773  GLN A CA    1 
ATOM   6344 C  C     . GLN A 1 773 ? -23.371 25.319 38.773  1.00 43.87  ? 773  GLN A C     1 
ATOM   6345 O  O     . GLN A 1 773 ? -22.530 24.666 39.391  1.00 48.50  ? 773  GLN A O     1 
ATOM   6346 C  CB    . GLN A 1 773 ? -25.076 23.538 38.316  1.00 49.62  ? 773  GLN A CB    1 
ATOM   6347 C  CG    . GLN A 1 773 ? -26.479 23.031 38.563  1.00 52.19  ? 773  GLN A CG    1 
ATOM   6348 C  CD    . GLN A 1 773 ? -26.891 23.177 40.014  1.00 55.83  ? 773  GLN A CD    1 
ATOM   6349 O  OE1   . GLN A 1 773 ? -26.223 22.670 40.917  1.00 54.68  ? 773  GLN A OE1   1 
ATOM   6350 N  NE2   . GLN A 1 773 ? -27.988 23.886 40.247  1.00 57.36  ? 773  GLN A NE2   1 
ATOM   6351 N  N     . LEU A 1 774 ? -23.062 26.364 38.015  1.00 41.73  ? 774  LEU A N     1 
ATOM   6352 C  CA    . LEU A 1 774 ? -21.690 26.840 37.896  1.00 42.69  ? 774  LEU A CA    1 
ATOM   6353 C  C     . LEU A 1 774 ? -21.193 27.407 39.224  1.00 41.06  ? 774  LEU A C     1 
ATOM   6354 O  O     . LEU A 1 774 ? -21.947 28.052 39.952  1.00 41.38  ? 774  LEU A O     1 
ATOM   6355 C  CB    . LEU A 1 774 ? -21.588 27.899 36.798  1.00 37.46  ? 774  LEU A CB    1 
ATOM   6356 C  CG    . LEU A 1 774 ? -21.843 27.416 35.369  1.00 37.08  ? 774  LEU A CG    1 
ATOM   6357 C  CD1   . LEU A 1 774 ? -22.003 28.596 34.430  1.00 35.06  ? 774  LEU A CD1   1 
ATOM   6358 C  CD2   . LEU A 1 774 ? -20.715 26.513 34.900  1.00 36.04  ? 774  LEU A CD2   1 
ATOM   6359 N  N     . ASN A 1 775 ? -19.926 27.151 39.534  1.00 37.69  ? 775  ASN A N     1 
ATOM   6360 C  CA    . ASN A 1 775 ? -19.306 27.679 40.744  1.00 36.32  ? 775  ASN A CA    1 
ATOM   6361 C  C     . ASN A 1 775 ? -19.402 29.204 40.798  1.00 36.02  ? 775  ASN A C     1 
ATOM   6362 O  O     . ASN A 1 775 ? -19.247 29.880 39.778  1.00 32.99  ? 775  ASN A O     1 
ATOM   6363 C  CB    . ASN A 1 775 ? -17.851 27.217 40.834  1.00 39.69  ? 775  ASN A CB    1 
ATOM   6364 C  CG    . ASN A 1 775 ? -17.124 27.806 42.024  1.00 45.68  ? 775  ASN A CG    1 
ATOM   6365 O  OD1   . ASN A 1 775 ? -16.399 28.792 41.894  1.00 48.15  ? 775  ASN A OD1   1 
ATOM   6366 N  ND2   . ASN A 1 775 ? -17.318 27.208 43.193  1.00 47.96  ? 775  ASN A ND2   1 
ATOM   6367 N  N     . TYR A 1 776 ? -19.672 29.738 41.985  1.00 31.01  ? 776  TYR A N     1 
ATOM   6368 C  CA    . TYR A 1 776 ? -19.963 31.162 42.135  1.00 30.11  ? 776  TYR A CA    1 
ATOM   6369 C  C     . TYR A 1 776 ? -18.813 32.065 41.691  1.00 30.94  ? 776  TYR A C     1 
ATOM   6370 O  O     . TYR A 1 776 ? -19.043 33.161 41.183  1.00 35.47  ? 776  TYR A O     1 
ATOM   6371 C  CB    . TYR A 1 776 ? -20.382 31.485 43.573  1.00 34.42  ? 776  TYR A CB    1 
ATOM   6372 C  CG    . TYR A 1 776 ? -19.245 31.547 44.571  1.00 35.83  ? 776  TYR A CG    1 
ATOM   6373 C  CD1   . TYR A 1 776 ? -18.808 32.765 45.074  1.00 36.89  ? 776  TYR A CD1   1 
ATOM   6374 C  CD2   . TYR A 1 776 ? -18.616 30.390 45.014  1.00 38.24  ? 776  TYR A CD2   1 
ATOM   6375 C  CE1   . TYR A 1 776 ? -17.776 32.832 45.990  1.00 36.98  ? 776  TYR A CE1   1 
ATOM   6376 C  CE2   . TYR A 1 776 ? -17.578 30.446 45.929  1.00 42.07  ? 776  TYR A CE2   1 
ATOM   6377 C  CZ    . TYR A 1 776 ? -17.163 31.672 46.413  1.00 39.51  ? 776  TYR A CZ    1 
ATOM   6378 O  OH    . TYR A 1 776 ? -16.135 31.742 47.325  1.00 38.99  ? 776  TYR A OH    1 
ATOM   6379 N  N     . ILE A 1 777 ? -17.581 31.601 41.873  1.00 31.85  ? 777  ILE A N     1 
ATOM   6380 C  CA    . ILE A 1 777 ? -16.416 32.358 41.428  1.00 32.09  ? 777  ILE A CA    1 
ATOM   6381 C  C     . ILE A 1 777 ? -16.376 32.462 39.902  1.00 29.64  ? 777  ILE A C     1 
ATOM   6382 O  O     . ILE A 1 777 ? -16.068 33.518 39.348  1.00 29.05  ? 777  ILE A O     1 
ATOM   6383 C  CB    . ILE A 1 777 ? -15.105 31.742 41.964  1.00 35.89  ? 777  ILE A CB    1 
ATOM   6384 C  CG1   . ILE A 1 777 ? -14.987 31.990 43.470  1.00 41.08  ? 777  ILE A CG1   1 
ATOM   6385 C  CG2   . ILE A 1 777 ? -13.900 32.319 41.247  1.00 38.13  ? 777  ILE A CG2   1 
ATOM   6386 C  CD1   . ILE A 1 777 ? -13.741 31.396 44.093  1.00 43.82  ? 777  ILE A CD1   1 
ATOM   6387 N  N     . SER A 1 778 ? -16.722 31.371 39.226  1.00 29.99  ? 778  SER A N     1 
ATOM   6388 C  CA    . SER A 1 778 ? -16.673 31.326 37.768  1.00 30.74  ? 778  SER A CA    1 
ATOM   6389 C  C     . SER A 1 778 ? -17.714 32.225 37.101  1.00 28.80  ? 778  SER A C     1 
ATOM   6390 O  O     . SER A 1 778 ? -17.596 32.538 35.917  1.00 29.65  ? 778  SER A O     1 
ATOM   6391 C  CB    . SER A 1 778 ? -16.826 29.888 37.262  1.00 32.13  ? 778  SER A CB    1 
ATOM   6392 O  OG    . SER A 1 778 ? -18.177 29.467 37.322  1.00 35.77  ? 778  SER A OG    1 
ATOM   6393 N  N     . ILE A 1 779 ? -18.732 32.637 37.851  1.00 29.41  ? 779  ILE A N     1 
ATOM   6394 C  CA    . ILE A 1 779 ? -19.762 33.517 37.295  1.00 30.38  ? 779  ILE A CA    1 
ATOM   6395 C  C     . ILE A 1 779 ? -19.762 34.914 37.922  1.00 31.15  ? 779  ILE A C     1 
ATOM   6396 O  O     . ILE A 1 779 ? -20.653 35.723 37.662  1.00 30.30  ? 779  ILE A O     1 
ATOM   6397 C  CB    . ILE A 1 779 ? -21.175 32.894 37.375  1.00 33.17  ? 779  ILE A CB    1 
ATOM   6398 C  CG1   . ILE A 1 779 ? -21.475 32.403 38.792  1.00 33.83  ? 779  ILE A CG1   1 
ATOM   6399 C  CG2   . ILE A 1 779 ? -21.310 31.757 36.378  1.00 36.36  ? 779  ILE A CG2   1 
ATOM   6400 C  CD1   . ILE A 1 779 ? -22.801 31.681 38.905  1.00 34.77  ? 779  ILE A CD1   1 
ATOM   6401 N  N     . ALA A 1 780 ? -18.752 35.196 38.736  1.00 28.75  ? 780  ALA A N     1 
ATOM   6402 C  CA    . ALA A 1 780 ? -18.598 36.524 39.311  1.00 30.13  ? 780  ALA A CA    1 
ATOM   6403 C  C     . ALA A 1 780 ? -17.900 37.467 38.332  1.00 29.10  ? 780  ALA A C     1 
ATOM   6404 O  O     . ALA A 1 780 ? -16.939 37.083 37.660  1.00 29.16  ? 780  ALA A O     1 
ATOM   6405 C  CB    . ALA A 1 780 ? -17.826 36.448 40.623  1.00 30.26  ? 780  ALA A CB    1 
ATOM   6406 N  N     . SER A 1 781 ? -18.392 38.698 38.246  1.00 25.68  ? 781  SER A N     1 
ATOM   6407 C  CA    . SER A 1 781 ? -17.739 39.719 37.440  1.00 28.62  ? 781  SER A CA    1 
ATOM   6408 C  C     . SER A 1 781 ? -16.499 40.200 38.177  1.00 26.46  ? 781  SER A C     1 
ATOM   6409 O  O     . SER A 1 781 ? -16.326 39.916 39.360  1.00 25.05  ? 781  SER A O     1 
ATOM   6410 C  CB    . SER A 1 781 ? -18.685 40.891 37.173  1.00 27.51  ? 781  SER A CB    1 
ATOM   6411 O  OG    . SER A 1 781 ? -19.848 40.454 36.489  1.00 35.67  ? 781  SER A OG    1 
ATOM   6412 N  N     . VAL A 1 782 ? -15.632 40.922 37.478  1.00 26.03  ? 782  VAL A N     1 
ATOM   6413 C  CA    . VAL A 1 782 ? -14.406 41.429 38.083  1.00 29.48  ? 782  VAL A CA    1 
ATOM   6414 C  C     . VAL A 1 782 ? -14.266 42.920 37.794  1.00 30.22  ? 782  VAL A C     1 
ATOM   6415 O  O     . VAL A 1 782 ? -14.629 43.380 36.715  1.00 28.43  ? 782  VAL A O     1 
ATOM   6416 C  CB    . VAL A 1 782 ? -13.162 40.677 37.553  1.00 27.82  ? 782  VAL A CB    1 
ATOM   6417 C  CG1   . VAL A 1 782 ? -11.891 41.225 38.176  1.00 29.80  ? 782  VAL A CG1   1 
ATOM   6418 C  CG2   . VAL A 1 782 ? -13.283 39.187 37.829  1.00 30.52  ? 782  VAL A CG2   1 
ATOM   6419 N  N     . SER A 1 783 ? -13.756 43.677 38.761  1.00 31.54  ? 783  SER A N     1 
ATOM   6420 C  CA    . SER A 1 783 ? -13.501 45.095 38.543  1.00 30.90  ? 783  SER A CA    1 
ATOM   6421 C  C     . SER A 1 783 ? -12.397 45.641 39.447  1.00 34.84  ? 783  SER A C     1 
ATOM   6422 O  O     . SER A 1 783 ? -12.190 45.154 40.558  1.00 35.12  ? 783  SER A O     1 
ATOM   6423 C  CB    . SER A 1 783 ? -14.784 45.905 38.739  1.00 25.94  ? 783  SER A CB    1 
ATOM   6424 O  OG    . SER A 1 783 ? -14.579 47.254 38.366  1.00 30.51  ? 783  SER A OG    1 
ATOM   6425 N  N     . SER A 1 784 ? -11.688 46.653 38.957  1.00 36.39  ? 784  SER A N     1 
ATOM   6426 C  CA    . SER A 1 784 ? -10.715 47.367 39.771  1.00 33.37  ? 784  SER A CA    1 
ATOM   6427 C  C     . SER A 1 784 ? -11.467 48.186 40.809  1.00 33.95  ? 784  SER A C     1 
ATOM   6428 O  O     . SER A 1 784 ? -12.567 48.660 40.546  1.00 38.39  ? 784  SER A O     1 
ATOM   6429 C  CB    . SER A 1 784 ? -9.848  48.284 38.906  1.00 28.87  ? 784  SER A CB    1 
ATOM   6430 O  OG    . SER A 1 784 ? -9.027  47.535 38.029  1.00 31.29  ? 784  SER A OG    1 
ATOM   6431 N  N     . ALA A 1 785 ? -10.869 48.355 41.983  1.00 33.14  ? 785  ALA A N     1 
ATOM   6432 C  CA    . ALA A 1 785 ? -11.532 49.039 43.087  1.00 39.51  ? 785  ALA A CA    1 
ATOM   6433 C  C     . ALA A 1 785 ? -10.871 50.376 43.405  1.00 37.14  ? 785  ALA A C     1 
ATOM   6434 O  O     . ALA A 1 785 ? -10.106 50.482 44.362  1.00 39.79  ? 785  ALA A O     1 
ATOM   6435 C  CB    . ALA A 1 785 ? -11.533 48.155 44.313  1.00 43.69  ? 785  ALA A CB    1 
ATOM   6436 N  N     . ASN A 1 786 ? -11.174 51.395 42.607  1.00 35.06  ? 786  ASN A N     1 
ATOM   6437 C  CA    . ASN A 1 786 ? -10.555 52.705 42.780  1.00 40.67  ? 786  ASN A CA    1 
ATOM   6438 C  C     . ASN A 1 786 ? -11.452 53.701 43.510  1.00 42.91  ? 786  ASN A C     1 
ATOM   6439 O  O     . ASN A 1 786 ? -12.667 53.728 43.301  1.00 45.37  ? 786  ASN A O     1 
ATOM   6440 C  CB    . ASN A 1 786 ? -10.118 53.277 41.428  1.00 42.73  ? 786  ASN A CB    1 
ATOM   6441 C  CG    . ASN A 1 786 ? -9.032  52.447 40.770  1.00 44.68  ? 786  ASN A CG    1 
ATOM   6442 O  OD1   . ASN A 1 786 ? -8.110  51.974 41.435  1.00 48.87  ? 786  ASN A OD1   1 
ATOM   6443 N  ND2   . ASN A 1 786 ? -9.141  52.259 39.458  1.00 39.63  ? 786  ASN A ND2   1 
ATOM   6444 N  N     . ASN A 1 787 ? -10.838 54.510 44.370  1.00 43.22  ? 787  ASN A N     1 
ATOM   6445 C  CA    . ASN A 1 787 ? -11.539 55.559 45.107  1.00 45.28  ? 787  ASN A CA    1 
ATOM   6446 C  C     . ASN A 1 787 ? -12.733 55.046 45.908  1.00 46.30  ? 787  ASN A C     1 
ATOM   6447 O  O     . ASN A 1 787 ? -13.849 55.548 45.765  1.00 47.68  ? 787  ASN A O     1 
ATOM   6448 C  CB    . ASN A 1 787 ? -11.979 56.674 44.157  1.00 47.93  ? 787  ASN A CB    1 
ATOM   6449 C  CG    . ASN A 1 787 ? -10.813 57.298 43.416  1.00 52.65  ? 787  ASN A CG    1 
ATOM   6450 O  OD1   . ASN A 1 787 ? -9.822  57.704 44.024  1.00 55.06  ? 787  ASN A OD1   1 
ATOM   6451 N  ND2   . ASN A 1 787 ? -10.919 57.364 42.093  1.00 49.68  ? 787  ASN A ND2   1 
ATOM   6452 N  N     . ILE A 1 788 ? -12.495 54.043 46.746  1.00 46.05  ? 788  ILE A N     1 
ATOM   6453 C  CA    . ILE A 1 788 ? -13.552 53.477 47.579  1.00 46.68  ? 788  ILE A CA    1 
ATOM   6454 C  C     . ILE A 1 788 ? -14.052 54.506 48.592  1.00 44.96  ? 788  ILE A C     1 
ATOM   6455 O  O     . ILE A 1 788 ? -15.258 54.697 48.755  1.00 44.52  ? 788  ILE A O     1 
ATOM   6456 C  CB    . ILE A 1 788 ? -13.070 52.213 48.316  1.00 48.89  ? 788  ILE A CB    1 
ATOM   6457 C  CG1   . ILE A 1 788 ? -12.654 51.135 47.311  1.00 47.68  ? 788  ILE A CG1   1 
ATOM   6458 C  CG2   . ILE A 1 788 ? -14.156 51.683 49.243  1.00 47.14  ? 788  ILE A CG2   1 
ATOM   6459 C  CD1   . ILE A 1 788 ? -11.941 49.959 47.939  1.00 45.65  ? 788  ILE A CD1   1 
ATOM   6460 N  N     . ALA A 1 789 ? -13.115 55.175 49.258  1.00 45.05  ? 789  ALA A N     1 
ATOM   6461 C  CA    . ALA A 1 789 ? -13.445 56.166 50.278  1.00 48.75  ? 789  ALA A CA    1 
ATOM   6462 C  C     . ALA A 1 789 ? -14.198 57.354 49.690  1.00 50.72  ? 789  ALA A C     1 
ATOM   6463 O  O     . ALA A 1 789 ? -15.027 57.967 50.362  1.00 56.30  ? 789  ALA A O     1 
ATOM   6464 C  CB    . ALA A 1 789 ? -12.183 56.635 50.989  1.00 49.38  ? 789  ALA A CB    1 
ATOM   6465 N  N     . LYS A 1 790 ? -13.901 57.669 48.433  1.00 50.93  ? 790  LYS A N     1 
ATOM   6466 C  CA    . LYS A 1 790 ? -14.541 58.778 47.732  1.00 52.76  ? 790  LYS A CA    1 
ATOM   6467 C  C     . LYS A 1 790 ? -16.058 58.618 47.687  1.00 50.43  ? 790  LYS A C     1 
ATOM   6468 O  O     . LYS A 1 790 ? -16.799 59.602 47.736  1.00 50.47  ? 790  LYS A O     1 
ATOM   6469 C  CB    . LYS A 1 790 ? -13.983 58.888 46.310  1.00 54.28  ? 790  LYS A CB    1 
ATOM   6470 C  CG    . LYS A 1 790 ? -14.566 60.023 45.481  1.00 56.13  ? 790  LYS A CG    1 
ATOM   6471 C  CD    . LYS A 1 790 ? -14.043 59.978 44.051  1.00 58.27  ? 790  LYS A CD    1 
ATOM   6472 C  CE    . LYS A 1 790 ? -14.623 61.103 43.206  1.00 60.74  ? 790  LYS A CE    1 
ATOM   6473 N  NZ    . LYS A 1 790 ? -14.161 61.034 41.790  1.00 59.91  ? 790  LYS A NZ    1 
ATOM   6474 N  N     . TYR A 1 791 ? -16.515 57.372 47.605  1.00 45.73  ? 791  TYR A N     1 
ATOM   6475 C  CA    . TYR A 1 791 ? -17.942 57.085 47.509  1.00 44.09  ? 791  TYR A CA    1 
ATOM   6476 C  C     . TYR A 1 791 ? -18.507 56.474 48.792  1.00 47.27  ? 791  TYR A C     1 
ATOM   6477 O  O     . TYR A 1 791 ? -19.630 55.971 48.806  1.00 45.36  ? 791  TYR A O     1 
ATOM   6478 C  CB    . TYR A 1 791 ? -18.222 56.172 46.313  1.00 43.64  ? 791  TYR A CB    1 
ATOM   6479 C  CG    . TYR A 1 791 ? -17.898 56.805 44.975  1.00 41.75  ? 791  TYR A CG    1 
ATOM   6480 C  CD1   . TYR A 1 791 ? -16.729 56.487 44.294  1.00 38.00  ? 791  TYR A CD1   1 
ATOM   6481 C  CD2   . TYR A 1 791 ? -18.760 57.728 44.399  1.00 42.09  ? 791  TYR A CD2   1 
ATOM   6482 C  CE1   . TYR A 1 791 ? -16.433 57.068 43.071  1.00 36.88  ? 791  TYR A CE1   1 
ATOM   6483 C  CE2   . TYR A 1 791 ? -18.474 58.314 43.181  1.00 43.42  ? 791  TYR A CE2   1 
ATOM   6484 C  CZ    . TYR A 1 791 ? -17.310 57.982 42.521  1.00 42.65  ? 791  TYR A CZ    1 
ATOM   6485 O  OH    . TYR A 1 791 ? -17.032 58.570 41.308  1.00 41.44  ? 791  TYR A OH    1 
ATOM   6486 N  N     . ASP A 1 792 ? -17.728 56.532 49.869  1.00 51.96  ? 792  ASP A N     1 
ATOM   6487 C  CA    . ASP A 1 792 ? -18.146 55.981 51.155  1.00 55.25  ? 792  ASP A CA    1 
ATOM   6488 C  C     . ASP A 1 792 ? -18.730 57.066 52.059  1.00 57.05  ? 792  ASP A C     1 
ATOM   6489 O  O     . ASP A 1 792 ? -18.000 57.891 52.606  1.00 59.95  ? 792  ASP A O     1 
ATOM   6490 C  CB    . ASP A 1 792 ? -16.959 55.302 51.849  1.00 57.21  ? 792  ASP A CB    1 
ATOM   6491 C  CG    . ASP A 1 792 ? -17.380 54.422 53.018  1.00 59.26  ? 792  ASP A CG    1 
ATOM   6492 O  OD1   . ASP A 1 792 ? -16.633 53.475 53.343  1.00 59.03  ? 792  ASP A OD1   1 
ATOM   6493 O  OD2   . ASP A 1 792 ? -18.450 54.667 53.614  1.00 63.73  ? 792  ASP A OD2   1 
ATOM   6494 N  N     . VAL A 1 793 ? -20.049 57.055 52.217  1.00 56.54  ? 793  VAL A N     1 
ATOM   6495 C  CA    . VAL A 1 793 ? -20.717 57.983 53.122  1.00 59.31  ? 793  VAL A CA    1 
ATOM   6496 C  C     . VAL A 1 793 ? -21.357 57.220 54.279  1.00 60.83  ? 793  VAL A C     1 
ATOM   6497 O  O     . VAL A 1 793 ? -22.503 56.777 54.190  1.00 61.60  ? 793  VAL A O     1 
ATOM   6498 C  CB    . VAL A 1 793 ? -21.782 58.825 52.393  1.00 58.89  ? 793  VAL A CB    1 
ATOM   6499 C  CG1   . VAL A 1 793 ? -22.435 59.809 53.355  1.00 61.16  ? 793  VAL A CG1   1 
ATOM   6500 C  CG2   . VAL A 1 793 ? -21.157 59.564 51.219  1.00 57.57  ? 793  VAL A CG2   1 
ATOM   6501 N  N     . GLY A 1 794 ? -20.600 57.059 55.360  1.00 61.01  ? 794  GLY A N     1 
ATOM   6502 C  CA    . GLY A 1 794 ? -21.076 56.351 56.534  1.00 60.14  ? 794  GLY A CA    1 
ATOM   6503 C  C     . GLY A 1 794 ? -21.338 54.878 56.281  1.00 59.38  ? 794  GLY A C     1 
ATOM   6504 O  O     . GLY A 1 794 ? -22.281 54.307 56.828  1.00 60.95  ? 794  GLY A O     1 
ATOM   6505 N  N     . GLY A 1 795 ? -20.505 54.262 55.448  1.00 56.09  ? 795  GLY A N     1 
ATOM   6506 C  CA    . GLY A 1 795 ? -20.645 52.851 55.132  1.00 53.58  ? 795  GLY A CA    1 
ATOM   6507 C  C     . GLY A 1 795 ? -21.641 52.585 54.018  1.00 52.41  ? 795  GLY A C     1 
ATOM   6508 O  O     . GLY A 1 795 ? -21.876 51.436 53.643  1.00 51.93  ? 795  GLY A O     1 
ATOM   6509 N  N     . PHE A 1 796 ? -22.224 53.654 53.486  1.00 50.60  ? 796  PHE A N     1 
ATOM   6510 C  CA    . PHE A 1 796 ? -23.228 53.542 52.434  1.00 49.02  ? 796  PHE A CA    1 
ATOM   6511 C  C     . PHE A 1 796 ? -22.809 54.327 51.190  1.00 46.60  ? 796  PHE A C     1 
ATOM   6512 O  O     . PHE A 1 796 ? -22.041 55.281 51.289  1.00 48.70  ? 796  PHE A O     1 
ATOM   6513 C  CB    . PHE A 1 796 ? -24.588 54.014 52.956  1.00 52.41  ? 796  PHE A CB    1 
ATOM   6514 C  CG    . PHE A 1 796 ? -25.187 53.103 53.993  1.00 54.62  ? 796  PHE A CG    1 
ATOM   6515 C  CD1   . PHE A 1 796 ? -25.993 52.039 53.617  1.00 53.08  ? 796  PHE A CD1   1 
ATOM   6516 C  CD2   . PHE A 1 796 ? -24.941 53.306 55.341  1.00 56.92  ? 796  PHE A CD2   1 
ATOM   6517 C  CE1   . PHE A 1 796 ? -26.544 51.198 54.565  1.00 54.69  ? 796  PHE A CE1   1 
ATOM   6518 C  CE2   . PHE A 1 796 ? -25.490 52.467 56.295  1.00 58.66  ? 796  PHE A CE2   1 
ATOM   6519 C  CZ    . PHE A 1 796 ? -26.293 51.413 55.906  1.00 57.72  ? 796  PHE A CZ    1 
ATOM   6520 N  N     . PRO A 1 797 ? -23.300 53.915 50.009  1.00 46.89  ? 797  PRO A N     1 
ATOM   6521 C  CA    . PRO A 1 797 ? -22.896 54.549 48.747  1.00 48.69  ? 797  PRO A CA    1 
ATOM   6522 C  C     . PRO A 1 797 ? -23.302 56.016 48.626  1.00 53.96  ? 797  PRO A C     1 
ATOM   6523 O  O     . PRO A 1 797 ? -24.477 56.352 48.770  1.00 56.67  ? 797  PRO A O     1 
ATOM   6524 C  CB    . PRO A 1 797 ? -23.618 53.708 47.685  1.00 47.38  ? 797  PRO A CB    1 
ATOM   6525 C  CG    . PRO A 1 797 ? -24.731 53.034 48.410  1.00 49.54  ? 797  PRO A CG    1 
ATOM   6526 C  CD    . PRO A 1 797 ? -24.198 52.770 49.780  1.00 48.38  ? 797  PRO A CD    1 
ATOM   6527 N  N     . GLY A 1 798 ? -22.325 56.876 48.356  1.00 54.40  ? 798  GLY A N     1 
ATOM   6528 C  CA    . GLY A 1 798 ? -22.592 58.280 48.103  1.00 53.88  ? 798  GLY A CA    1 
ATOM   6529 C  C     . GLY A 1 798 ? -23.098 58.484 46.689  1.00 52.90  ? 798  GLY A C     1 
ATOM   6530 O  O     . GLY A 1 798 ? -23.321 57.514 45.965  1.00 51.27  ? 798  GLY A O     1 
ATOM   6531 N  N     . PRO A 1 799 ? -23.284 59.749 46.284  1.00 54.74  ? 799  PRO A N     1 
ATOM   6532 C  CA    . PRO A 1 799 ? -23.790 60.062 44.943  1.00 53.37  ? 799  PRO A CA    1 
ATOM   6533 C  C     . PRO A 1 799 ? -22.905 59.510 43.825  1.00 52.23  ? 799  PRO A C     1 
ATOM   6534 O  O     . PRO A 1 799 ? -21.679 59.617 43.889  1.00 50.39  ? 799  PRO A O     1 
ATOM   6535 C  CB    . PRO A 1 799 ? -23.806 61.598 44.918  1.00 54.02  ? 799  PRO A CB    1 
ATOM   6536 C  CG    . PRO A 1 799 ? -22.912 62.022 46.042  1.00 56.51  ? 799  PRO A CG    1 
ATOM   6537 C  CD    . PRO A 1 799 ? -23.057 60.963 47.084  1.00 56.41  ? 799  PRO A CD    1 
ATOM   6538 N  N     . LYS A 1 800 ? -23.543 58.911 42.823  1.00 52.06  ? 800  LYS A N     1 
ATOM   6539 C  CA    . LYS A 1 800 ? -22.863 58.356 41.653  1.00 51.78  ? 800  LYS A CA    1 
ATOM   6540 C  C     . LYS A 1 800 ? -21.867 57.247 42.005  1.00 47.85  ? 800  LYS A C     1 
ATOM   6541 O  O     . LYS A 1 800 ? -20.886 57.029 41.295  1.00 45.40  ? 800  LYS A O     1 
ATOM   6542 C  CB    . LYS A 1 800 ? -22.190 59.465 40.834  1.00 55.67  ? 800  LYS A CB    1 
ATOM   6543 C  CG    . LYS A 1 800 ? -22.075 59.161 39.347  1.00 59.87  ? 800  LYS A CG    1 
ATOM   6544 C  CD    . LYS A 1 800 ? -21.638 60.388 38.561  1.00 65.22  ? 800  LYS A CD    1 
ATOM   6545 C  CE    . LYS A 1 800 ? -21.516 60.076 37.078  1.00 65.21  ? 800  LYS A CE    1 
ATOM   6546 N  NZ    . LYS A 1 800 ? -22.785 59.540 36.513  1.00 65.53  ? 800  LYS A NZ    1 
ATOM   6547 N  N     . CYS A 1 801 ? -22.130 56.544 43.102  1.00 45.71  ? 801  CYS A N     1 
ATOM   6548 C  CA    . CYS A 1 801 ? -21.299 55.415 43.497  1.00 40.42  ? 801  CYS A CA    1 
ATOM   6549 C  C     . CYS A 1 801 ? -21.403 54.299 42.464  1.00 37.94  ? 801  CYS A C     1 
ATOM   6550 O  O     . CYS A 1 801 ? -22.497 53.807 42.186  1.00 37.03  ? 801  CYS A O     1 
ATOM   6551 C  CB    . CYS A 1 801 ? -21.716 54.898 44.874  1.00 41.87  ? 801  CYS A CB    1 
ATOM   6552 S  SG    . CYS A 1 801 ? -20.790 53.448 45.445  1.00 40.74  ? 801  CYS A SG    1 
ATOM   6553 N  N     . PRO A 1 802 ? -20.259 53.911 41.878  1.00 35.73  ? 802  PRO A N     1 
ATOM   6554 C  CA    . PRO A 1 802 ? -20.209 52.836 40.882  1.00 37.43  ? 802  PRO A CA    1 
ATOM   6555 C  C     . PRO A 1 802 ? -20.720 51.515 41.446  1.00 35.58  ? 802  PRO A C     1 
ATOM   6556 O  O     . PRO A 1 802 ? -20.658 51.297 42.657  1.00 39.33  ? 802  PRO A O     1 
ATOM   6557 C  CB    . PRO A 1 802 ? -18.716 52.734 40.557  1.00 36.69  ? 802  PRO A CB    1 
ATOM   6558 C  CG    . PRO A 1 802 ? -18.175 54.089 40.866  1.00 34.82  ? 802  PRO A CG    1 
ATOM   6559 C  CD    . PRO A 1 802 ? -18.943 54.545 42.067  1.00 34.58  ? 802  PRO A CD    1 
ATOM   6560 N  N     . PHE A 1 803 ? -21.219 50.656 40.563  1.00 35.71  ? 803  PHE A N     1 
ATOM   6561 C  CA    . PHE A 1 803 ? -21.812 49.373 40.937  1.00 35.46  ? 803  PHE A CA    1 
ATOM   6562 C  C     . PHE A 1 803 ? -20.873 48.519 41.785  1.00 33.59  ? 803  PHE A C     1 
ATOM   6563 O  O     . PHE A 1 803 ? -21.257 48.027 42.845  1.00 37.17  ? 803  PHE A O     1 
ATOM   6564 C  CB    . PHE A 1 803 ? -22.219 48.609 39.673  1.00 33.60  ? 803  PHE A CB    1 
ATOM   6565 C  CG    . PHE A 1 803 ? -23.064 47.392 39.933  1.00 32.71  ? 803  PHE A CG    1 
ATOM   6566 C  CD1   . PHE A 1 803 ? -24.435 47.510 40.109  1.00 34.06  ? 803  PHE A CD1   1 
ATOM   6567 C  CD2   . PHE A 1 803 ? -22.494 46.129 39.970  1.00 30.41  ? 803  PHE A CD2   1 
ATOM   6568 C  CE1   . PHE A 1 803 ? -25.219 46.392 40.335  1.00 33.55  ? 803  PHE A CE1   1 
ATOM   6569 C  CE2   . PHE A 1 803 ? -23.271 45.006 40.195  1.00 32.63  ? 803  PHE A CE2   1 
ATOM   6570 C  CZ    . PHE A 1 803 ? -24.638 45.137 40.379  1.00 32.73  ? 803  PHE A CZ    1 
ATOM   6571 N  N     . HIS A 1 804 ? -19.641 48.350 41.319  1.00 31.59  ? 804  HIS A N     1 
ATOM   6572 C  CA    . HIS A 1 804 ? -18.676 47.510 42.021  1.00 32.93  ? 804  HIS A CA    1 
ATOM   6573 C  C     . HIS A 1 804 ? -18.237 48.112 43.356  1.00 32.82  ? 804  HIS A C     1 
ATOM   6574 O  O     . HIS A 1 804 ? -17.883 47.385 44.284  1.00 29.96  ? 804  HIS A O     1 
ATOM   6575 C  CB    . HIS A 1 804 ? -17.461 47.217 41.137  1.00 28.85  ? 804  HIS A CB    1 
ATOM   6576 C  CG    . HIS A 1 804 ? -16.701 48.438 40.724  1.00 30.18  ? 804  HIS A CG    1 
ATOM   6577 N  ND1   . HIS A 1 804 ? -17.194 49.355 39.820  1.00 31.95  ? 804  HIS A ND1   1 
ATOM   6578 C  CD2   . HIS A 1 804 ? -15.472 48.886 41.080  1.00 28.92  ? 804  HIS A CD2   1 
ATOM   6579 C  CE1   . HIS A 1 804 ? -16.308 50.319 39.645  1.00 31.10  ? 804  HIS A CE1   1 
ATOM   6580 N  NE2   . HIS A 1 804 ? -15.253 50.056 40.395  1.00 33.02  ? 804  HIS A NE2   1 
ATOM   6581 N  N     . ILE A 1 805 ? -18.259 49.438 43.450  1.00 33.22  ? 805  ILE A N     1 
ATOM   6582 C  CA    . ILE A 1 805 ? -17.919 50.110 44.700  1.00 31.59  ? 805  ILE A CA    1 
ATOM   6583 C  C     . ILE A 1 805 ? -19.049 49.918 45.709  1.00 34.43  ? 805  ILE A C     1 
ATOM   6584 O  O     . ILE A 1 805 ? -18.804 49.714 46.898  1.00 36.94  ? 805  ILE A O     1 
ATOM   6585 C  CB    . ILE A 1 805 ? -17.649 51.613 44.487  1.00 34.53  ? 805  ILE A CB    1 
ATOM   6586 C  CG1   . ILE A 1 805 ? -16.568 51.814 43.422  1.00 33.45  ? 805  ILE A CG1   1 
ATOM   6587 C  CG2   . ILE A 1 805 ? -17.231 52.275 45.793  1.00 35.88  ? 805  ILE A CG2   1 
ATOM   6588 C  CD1   . ILE A 1 805 ? -15.229 51.191 43.780  1.00 29.52  ? 805  ILE A CD1   1 
ATOM   6589 N  N     . ARG A 1 806 ? -20.286 49.973 45.222  1.00 30.48  ? 806  ARG A N     1 
ATOM   6590 C  CA    . ARG A 1 806 ? -21.452 49.677 46.049  1.00 38.44  ? 806  ARG A CA    1 
ATOM   6591 C  C     . ARG A 1 806 ? -21.328 48.282 46.652  1.00 38.47  ? 806  ARG A C     1 
ATOM   6592 O  O     . ARG A 1 806 ? -21.655 48.067 47.820  1.00 38.04  ? 806  ARG A O     1 
ATOM   6593 C  CB    . ARG A 1 806 ? -22.738 49.776 45.224  1.00 35.88  ? 806  ARG A CB    1 
ATOM   6594 C  CG    . ARG A 1 806 ? -23.984 49.260 45.938  1.00 36.52  ? 806  ARG A CG    1 
ATOM   6595 C  CD    . ARG A 1 806 ? -25.214 49.366 45.049  1.00 38.22  ? 806  ARG A CD    1 
ATOM   6596 N  NE    . ARG A 1 806 ? -25.485 50.751 44.672  1.00 38.82  ? 806  ARG A NE    1 
ATOM   6597 C  CZ    . ARG A 1 806 ? -26.257 51.575 45.373  1.00 41.56  ? 806  ARG A CZ    1 
ATOM   6598 N  NH1   . ARG A 1 806 ? -26.845 51.151 46.485  1.00 39.09  ? 806  ARG A NH1   1 
ATOM   6599 N  NH2   . ARG A 1 806 ? -26.444 52.822 44.960  1.00 36.95  ? 806  ARG A NH2   1 
ATOM   6600 N  N     . GLY A 1 807 ? -20.833 47.344 45.850  1.00 36.58  ? 807  GLY A N     1 
ATOM   6601 C  CA    . GLY A 1 807 ? -20.650 45.972 46.290  1.00 35.61  ? 807  GLY A CA    1 
ATOM   6602 C  C     . GLY A 1 807 ? -19.604 45.834 47.378  1.00 33.50  ? 807  GLY A C     1 
ATOM   6603 O  O     . GLY A 1 807 ? -19.717 44.978 48.255  1.00 32.68  ? 807  GLY A O     1 
ATOM   6604 N  N     . ILE A 1 808 ? -18.579 46.677 47.322  1.00 31.21  ? 808  ILE A N     1 
ATOM   6605 C  CA    . ILE A 1 808 ? -17.529 46.666 48.334  1.00 34.77  ? 808  ILE A CA    1 
ATOM   6606 C  C     . ILE A 1 808 ? -18.049 47.209 49.662  1.00 35.81  ? 808  ILE A C     1 
ATOM   6607 O  O     . ILE A 1 808 ? -17.740 46.676 50.731  1.00 40.37  ? 808  ILE A O     1 
ATOM   6608 C  CB    . ILE A 1 808 ? -16.311 47.480 47.875  1.00 37.02  ? 808  ILE A CB    1 
ATOM   6609 C  CG1   . ILE A 1 808 ? -15.626 46.778 46.703  1.00 35.83  ? 808  ILE A CG1   1 
ATOM   6610 C  CG2   . ILE A 1 808 ? -15.331 47.681 49.023  1.00 37.92  ? 808  ILE A CG2   1 
ATOM   6611 C  CD1   . ILE A 1 808 ? -14.491 47.566 46.112  1.00 36.48  ? 808  ILE A CD1   1 
ATOM   6612 N  N     . LEU A 1 809 ? -18.851 48.265 49.587  1.00 33.95  ? 809  LEU A N     1 
ATOM   6613 C  CA    . LEU A 1 809 ? -19.452 48.852 50.778  1.00 36.17  ? 809  LEU A CA    1 
ATOM   6614 C  C     . LEU A 1 809 ? -20.391 47.857 51.454  1.00 38.32  ? 809  LEU A C     1 
ATOM   6615 O  O     . LEU A 1 809 ? -20.460 47.788 52.680  1.00 39.53  ? 809  LEU A O     1 
ATOM   6616 C  CB    . LEU A 1 809 ? -20.195 50.139 50.420  1.00 35.65  ? 809  LEU A CB    1 
ATOM   6617 C  CG    . LEU A 1 809 ? -19.312 51.214 49.783  1.00 39.68  ? 809  LEU A CG    1 
ATOM   6618 C  CD1   . LEU A 1 809 ? -20.094 52.492 49.560  1.00 42.26  ? 809  LEU A CD1   1 
ATOM   6619 C  CD2   . LEU A 1 809 ? -18.083 51.480 50.643  1.00 40.52  ? 809  LEU A CD2   1 
ATOM   6620 N  N     . THR A 1 810 ? -21.105 47.084 50.642  1.00 37.85  ? 810  THR A N     1 
ATOM   6621 C  CA    . THR A 1 810 ? -21.985 46.036 51.146  1.00 36.65  ? 810  THR A CA    1 
ATOM   6622 C  C     . THR A 1 810 ? -21.172 44.998 51.913  1.00 41.69  ? 810  THR A C     1 
ATOM   6623 O  O     . THR A 1 810 ? -21.587 44.516 52.969  1.00 41.91  ? 810  THR A O     1 
ATOM   6624 C  CB    . THR A 1 810 ? -22.724 45.340 49.992  1.00 34.82  ? 810  THR A CB    1 
ATOM   6625 O  OG1   . THR A 1 810 ? -23.450 46.315 49.231  1.00 35.19  ? 810  THR A OG1   1 
ATOM   6626 C  CG2   . THR A 1 810 ? -23.687 44.289 50.525  1.00 34.82  ? 810  THR A CG2   1 
ATOM   6627 N  N     . TYR A 1 811 ? -20.002 44.671 51.372  1.00 41.48  ? 811  TYR A N     1 
ATOM   6628 C  CA    . TYR A 1 811 ? -19.097 43.710 51.988  1.00 40.32  ? 811  TYR A CA    1 
ATOM   6629 C  C     . TYR A 1 811 ? -18.577 44.211 53.328  1.00 41.07  ? 811  TYR A C     1 
ATOM   6630 O  O     . TYR A 1 811 ? -18.578 43.476 54.317  1.00 44.87  ? 811  TYR A O     1 
ATOM   6631 C  CB    . TYR A 1 811 ? -17.927 43.432 51.047  1.00 37.18  ? 811  TYR A CB    1 
ATOM   6632 C  CG    . TYR A 1 811 ? -16.867 42.503 51.598  1.00 34.81  ? 811  TYR A CG    1 
ATOM   6633 C  CD1   . TYR A 1 811 ? -17.097 41.138 51.708  1.00 33.42  ? 811  TYR A CD1   1 
ATOM   6634 C  CD2   . TYR A 1 811 ? -15.625 42.990 51.983  1.00 37.39  ? 811  TYR A CD2   1 
ATOM   6635 C  CE1   . TYR A 1 811 ? -16.124 40.285 52.203  1.00 35.72  ? 811  TYR A CE1   1 
ATOM   6636 C  CE2   . TYR A 1 811 ? -14.646 42.150 52.478  1.00 38.65  ? 811  TYR A CE2   1 
ATOM   6637 C  CZ    . TYR A 1 811 ? -14.900 40.799 52.588  1.00 38.15  ? 811  TYR A CZ    1 
ATOM   6638 O  OH    . TYR A 1 811 ? -13.924 39.962 53.080  1.00 36.56  ? 811  TYR A OH    1 
ATOM   6639 N  N     . ASN A 1 812 ? -18.135 45.464 53.351  1.00 39.83  ? 812  ASN A N     1 
ATOM   6640 C  CA    . ASN A 1 812 ? -17.593 46.068 54.564  1.00 40.45  ? 812  ASN A CA    1 
ATOM   6641 C  C     . ASN A 1 812 ? -18.601 46.081 55.711  1.00 44.93  ? 812  ASN A C     1 
ATOM   6642 O  O     . ASN A 1 812 ? -18.236 45.870 56.868  1.00 46.57  ? 812  ASN A O     1 
ATOM   6643 C  CB    . ASN A 1 812 ? -17.083 47.486 54.286  1.00 40.92  ? 812  ASN A CB    1 
ATOM   6644 C  CG    . ASN A 1 812 ? -15.889 47.506 53.341  1.00 42.39  ? 812  ASN A CG    1 
ATOM   6645 O  OD1   . ASN A 1 812 ? -15.228 46.487 53.133  1.00 42.51  ? 812  ASN A OD1   1 
ATOM   6646 N  ND2   . ASN A 1 812 ? -15.604 48.671 52.772  1.00 42.14  ? 812  ASN A ND2   1 
ATOM   6647 N  N     . ARG A 1 813 ? -19.867 46.324 55.387  1.00 39.37  ? 813  ARG A N     1 
ATOM   6648 C  CA    . ARG A 1 813 ? -20.924 46.293 56.393  1.00 41.94  ? 813  ARG A CA    1 
ATOM   6649 C  C     . ARG A 1 813 ? -21.133 44.876 56.920  1.00 45.67  ? 813  ARG A C     1 
ATOM   6650 O  O     . ARG A 1 813 ? -21.380 44.674 58.110  1.00 48.33  ? 813  ARG A O     1 
ATOM   6651 C  CB    . ARG A 1 813 ? -22.239 46.834 55.823  1.00 43.31  ? 813  ARG A CB    1 
ATOM   6652 C  CG    . ARG A 1 813 ? -22.178 48.282 55.359  1.00 45.13  ? 813  ARG A CG    1 
ATOM   6653 C  CD    . ARG A 1 813 ? -23.574 48.881 55.222  1.00 47.32  ? 813  ARG A CD    1 
ATOM   6654 N  NE    . ARG A 1 813 ? -24.422 48.115 54.313  1.00 43.10  ? 813  ARG A NE    1 
ATOM   6655 C  CZ    . ARG A 1 813 ? -24.477 48.312 53.000  1.00 43.72  ? 813  ARG A CZ    1 
ATOM   6656 N  NH1   . ARG A 1 813 ? -23.727 49.249 52.435  1.00 38.80  ? 813  ARG A NH1   1 
ATOM   6657 N  NH2   . ARG A 1 813 ? -25.279 47.567 52.251  1.00 43.89  ? 813  ARG A NH2   1 
ATOM   6658 N  N     . ALA A 1 814 ? -21.021 43.898 56.026  1.00 43.54  ? 814  ALA A N     1 
ATOM   6659 C  CA    . ALA A 1 814 ? -21.269 42.505 56.374  1.00 43.43  ? 814  ALA A CA    1 
ATOM   6660 C  C     . ALA A 1 814 ? -20.174 41.911 57.259  1.00 46.28  ? 814  ALA A C     1 
ATOM   6661 O  O     . ALA A 1 814 ? -20.429 40.995 58.040  1.00 50.66  ? 814  ALA A O     1 
ATOM   6662 C  CB    . ALA A 1 814 ? -21.449 41.670 55.110  1.00 42.04  ? 814  ALA A CB    1 
ATOM   6663 N  N     . ILE A 1 815 ? -18.956 42.431 57.136  1.00 48.00  ? 815  ILE A N     1 
ATOM   6664 C  CA    . ILE A 1 815 ? -17.829 41.918 57.910  1.00 50.47  ? 815  ILE A CA    1 
ATOM   6665 C  C     . ILE A 1 815 ? -17.398 42.874 59.017  1.00 54.18  ? 815  ILE A C     1 
ATOM   6666 O  O     . ILE A 1 815 ? -16.395 42.636 59.689  1.00 58.38  ? 815  ILE A O     1 
ATOM   6667 C  CB    . ILE A 1 815 ? -16.604 41.642 57.020  1.00 47.25  ? 815  ILE A CB    1 
ATOM   6668 C  CG1   . ILE A 1 815 ? -16.104 42.946 56.395  1.00 45.62  ? 815  ILE A CG1   1 
ATOM   6669 C  CG2   . ILE A 1 815 ? -16.938 40.607 55.956  1.00 46.10  ? 815  ILE A CG2   1 
ATOM   6670 C  CD1   . ILE A 1 815 ? -14.679 42.879 55.893  1.00 44.49  ? 815  ILE A CD1   1 
ATOM   6671 N  N     . LYS A 1 816 ? -18.153 43.954 59.194  1.00 56.23  ? 816  LYS A N     1 
ATOM   6672 C  CA    . LYS A 1 816 ? -17.842 44.959 60.207  1.00 62.70  ? 816  LYS A CA    1 
ATOM   6673 C  C     . LYS A 1 816 ? -17.739 44.336 61.595  1.00 67.83  ? 816  LYS A C     1 
ATOM   6674 O  O     . LYS A 1 816 ? -18.660 43.659 62.051  1.00 70.90  ? 816  LYS A O     1 
ATOM   6675 C  CB    . LYS A 1 816 ? -18.901 46.064 60.203  1.00 65.52  ? 816  LYS A CB    1 
ATOM   6676 C  CG    . LYS A 1 816 ? -18.654 47.167 61.218  1.00 68.31  ? 816  LYS A CG    1 
ATOM   6677 N  N     . GLY A 1 817 ? -16.608 44.557 62.256  1.00 69.29  ? 817  GLY A N     1 
ATOM   6678 C  CA    . GLY A 1 817 ? -16.394 44.026 63.590  1.00 74.23  ? 817  GLY A CA    1 
ATOM   6679 C  C     . GLY A 1 817 ? -15.594 42.738 63.597  1.00 76.84  ? 817  GLY A C     1 
ATOM   6680 O  O     . GLY A 1 817 ? -15.341 42.162 64.656  1.00 81.08  ? 817  GLY A O     1 
ATOM   6681 N  N     . ASN A 1 818 ? -15.201 42.279 62.414  1.00 74.19  ? 818  ASN A N     1 
ATOM   6682 C  CA    . ASN A 1 818 ? -14.353 41.097 62.297  1.00 74.77  ? 818  ASN A CA    1 
ATOM   6683 C  C     . ASN A 1 818 ? -12.937 41.468 61.879  1.00 74.80  ? 818  ASN A C     1 
ATOM   6684 O  O     . ASN A 1 818 ? -12.674 41.724 60.704  1.00 71.87  ? 818  ASN A O     1 
ATOM   6685 C  CB    . ASN A 1 818 ? -14.945 40.090 61.309  1.00 75.75  ? 818  ASN A CB    1 
ATOM   6686 C  CG    . ASN A 1 818 ? -16.166 39.379 61.860  1.00 82.05  ? 818  ASN A CG    1 
ATOM   6687 O  OD1   . ASN A 1 818 ? -16.049 38.354 62.533  1.00 84.55  ? 818  ASN A OD1   1 
ATOM   6688 N  ND2   . ASN A 1 818 ? -17.346 39.916 61.572  1.00 83.33  ? 818  ASN A ND2   1 
ATOM   6689 N  N     . ILE A 1 819 ? -12.027 41.493 62.848  1.00 77.59  ? 819  ILE A N     1 
ATOM   6690 C  CA    . ILE A 1 819 ? -10.638 41.856 62.589  1.00 77.79  ? 819  ILE A CA    1 
ATOM   6691 C  C     . ILE A 1 819 ? -9.921  40.803 61.746  1.00 77.76  ? 819  ILE A C     1 
ATOM   6692 O  O     . ILE A 1 819 ? -8.857  41.064 61.186  1.00 78.17  ? 819  ILE A O     1 
ATOM   6693 C  CB    . ILE A 1 819 ? -9.858  42.067 63.902  1.00 79.47  ? 819  ILE A CB    1 
ATOM   6694 N  N     . ASP A 1 820 ? -10.511 39.615 61.658  1.00 77.26  ? 820  ASP A N     1 
ATOM   6695 C  CA    . ASP A 1 820 ? -9.909  38.511 60.919  1.00 75.25  ? 820  ASP A CA    1 
ATOM   6696 C  C     . ASP A 1 820 ? -10.284 38.527 59.438  1.00 70.29  ? 820  ASP A C     1 
ATOM   6697 O  O     . ASP A 1 820 ? -9.518  38.061 58.594  1.00 71.63  ? 820  ASP A O     1 
ATOM   6698 C  CB    . ASP A 1 820 ? -10.311 37.173 61.546  1.00 77.84  ? 820  ASP A CB    1 
ATOM   6699 N  N     . ALA A 1 821 ? -11.461 39.065 59.131  1.00 63.78  ? 821  ALA A N     1 
ATOM   6700 C  CA    . ALA A 1 821 ? -11.990 39.062 57.767  1.00 55.99  ? 821  ALA A CA    1 
ATOM   6701 C  C     . ALA A 1 821 ? -11.094 39.806 56.778  1.00 54.03  ? 821  ALA A C     1 
ATOM   6702 O  O     . ALA A 1 821 ? -10.554 40.864 57.098  1.00 55.15  ? 821  ALA A O     1 
ATOM   6703 C  CB    . ALA A 1 821 ? -13.397 39.645 57.748  1.00 55.33  ? 821  ALA A CB    1 
ATOM   6704 N  N     . PRO A 1 822 ? -10.937 39.248 55.566  1.00 51.00  ? 822  PRO A N     1 
ATOM   6705 C  CA    . PRO A 1 822 ? -10.118 39.844 54.504  1.00 50.56  ? 822  PRO A CA    1 
ATOM   6706 C  C     . PRO A 1 822 ? -10.641 41.211 54.069  1.00 48.41  ? 822  PRO A C     1 
ATOM   6707 O  O     . PRO A 1 822 ? -11.818 41.346 53.734  1.00 48.30  ? 822  PRO A O     1 
ATOM   6708 C  CB    . PRO A 1 822 ? -10.257 38.844 53.351  1.00 48.40  ? 822  PRO A CB    1 
ATOM   6709 C  CG    . PRO A 1 822 ? -10.638 37.560 54.000  1.00 50.82  ? 822  PRO A CG    1 
ATOM   6710 C  CD    . PRO A 1 822 ? -11.496 37.946 55.163  1.00 50.47  ? 822  PRO A CD    1 
ATOM   6711 N  N     . GLN A 1 823 ? -9.767  42.212 54.072  1.00 44.59  ? 823  GLN A N     1 
ATOM   6712 C  CA    . GLN A 1 823 ? -10.155 43.564 53.688  1.00 42.59  ? 823  GLN A CA    1 
ATOM   6713 C  C     . GLN A 1 823 ? -9.882  43.815 52.210  1.00 41.89  ? 823  GLN A C     1 
ATOM   6714 O  O     . GLN A 1 823 ? -8.877  43.355 51.669  1.00 38.03  ? 823  GLN A O     1 
ATOM   6715 C  CB    . GLN A 1 823 ? -9.405  44.596 54.533  1.00 42.76  ? 823  GLN A CB    1 
ATOM   6716 C  CG    . GLN A 1 823 ? -9.593  44.426 56.031  1.00 46.82  ? 823  GLN A CG    1 
ATOM   6717 C  CD    . GLN A 1 823 ? -11.021 44.674 56.471  1.00 50.33  ? 823  GLN A CD    1 
ATOM   6718 O  OE1   . GLN A 1 823 ? -11.702 45.555 55.944  1.00 49.07  ? 823  GLN A OE1   1 
ATOM   6719 N  NE2   . GLN A 1 823 ? -11.485 43.895 57.441  1.00 55.46  ? 823  GLN A NE2   1 
ATOM   6720 N  N     . VAL A 1 824 ? -10.785 44.544 51.562  1.00 43.05  ? 824  VAL A N     1 
ATOM   6721 C  CA    . VAL A 1 824 ? -10.595 44.940 50.173  1.00 40.17  ? 824  VAL A CA    1 
ATOM   6722 C  C     . VAL A 1 824 ? -9.546  46.042 50.099  1.00 42.43  ? 824  VAL A C     1 
ATOM   6723 O  O     . VAL A 1 824 ? -9.647  47.052 50.795  1.00 46.95  ? 824  VAL A O     1 
ATOM   6724 C  CB    . VAL A 1 824 ? -11.909 45.449 49.546  1.00 37.86  ? 824  VAL A CB    1 
ATOM   6725 C  CG1   . VAL A 1 824 ? -11.657 45.995 48.148  1.00 31.60  ? 824  VAL A CG1   1 
ATOM   6726 C  CG2   . VAL A 1 824 ? -12.950 44.342 49.517  1.00 36.74  ? 824  VAL A CG2   1 
ATOM   6727 N  N     . VAL A 1 825 ? -8.539  45.844 49.257  1.00 40.58  ? 825  VAL A N     1 
ATOM   6728 C  CA    . VAL A 1 825 ? -7.460  46.817 49.121  1.00 43.73  ? 825  VAL A CA    1 
ATOM   6729 C  C     . VAL A 1 825 ? -7.753  47.830 48.018  1.00 42.02  ? 825  VAL A C     1 
ATOM   6730 O  O     . VAL A 1 825 ? -8.085  47.456 46.891  1.00 38.42  ? 825  VAL A O     1 
ATOM   6731 C  CB    . VAL A 1 825 ? -6.110  46.127 48.840  1.00 45.86  ? 825  VAL A CB    1 
ATOM   6732 C  CG1   . VAL A 1 825 ? -5.011  47.161 48.627  1.00 45.04  ? 825  VAL A CG1   1 
ATOM   6733 C  CG2   . VAL A 1 825 ? -5.752  45.186 49.983  1.00 49.05  ? 825  VAL A CG2   1 
ATOM   6734 N  N     . GLU A 1 826 ? -7.640  49.110 48.361  1.00 40.23  ? 826  GLU A N     1 
ATOM   6735 C  CA    . GLU A 1 826 ? -7.799  50.197 47.401  1.00 41.71  ? 826  GLU A CA    1 
ATOM   6736 C  C     . GLU A 1 826 ? -6.875  50.016 46.200  1.00 39.08  ? 826  GLU A C     1 
ATOM   6737 O  O     . GLU A 1 826 ? -5.669  49.832 46.358  1.00 39.38  ? 826  GLU A O     1 
ATOM   6738 C  CB    . GLU A 1 826 ? -7.510  51.541 48.076  1.00 45.34  ? 826  GLU A CB    1 
ATOM   6739 C  CG    . GLU A 1 826 ? -7.237  52.686 47.110  1.00 47.16  ? 826  GLU A CG    1 
ATOM   6740 C  CD    . GLU A 1 826 ? -8.489  53.170 46.403  1.00 48.83  ? 826  GLU A CD    1 
ATOM   6741 O  OE1   . GLU A 1 826 ? -9.589  53.030 46.976  1.00 46.91  ? 826  GLU A OE1   1 
ATOM   6742 O  OE2   . GLU A 1 826 ? -8.370  53.692 45.273  1.00 50.41  ? 826  GLU A OE2   1 
ATOM   6743 N  N     . GLY A 1 827 ? -7.447  50.059 45.003  1.00 37.46  ? 827  GLY A N     1 
ATOM   6744 C  CA    . GLY A 1 827 ? -6.665  49.953 43.785  1.00 38.32  ? 827  GLY A CA    1 
ATOM   6745 C  C     . GLY A 1 827 ? -6.593  48.547 43.218  1.00 41.15  ? 827  GLY A C     1 
ATOM   6746 O  O     . GLY A 1 827 ? -6.365  48.368 42.022  1.00 43.51  ? 827  GLY A O     1 
ATOM   6747 N  N     . GLU A 1 828 ? -6.783  47.545 44.071  1.00 37.07  ? 828  GLU A N     1 
ATOM   6748 C  CA    . GLU A 1 828 ? -6.745  46.158 43.617  1.00 40.48  ? 828  GLU A CA    1 
ATOM   6749 C  C     . GLU A 1 828 ? -8.093  45.727 43.036  1.00 40.04  ? 828  GLU A C     1 
ATOM   6750 O  O     . GLU A 1 828 ? -8.986  46.554 42.852  1.00 46.49  ? 828  GLU A O     1 
ATOM   6751 C  CB    . GLU A 1 828 ? -6.280  45.223 44.739  1.00 44.67  ? 828  GLU A CB    1 
ATOM   6752 C  CG    . GLU A 1 828 ? -4.841  45.489 45.179  1.00 51.80  ? 828  GLU A CG    1 
ATOM   6753 C  CD    . GLU A 1 828 ? -4.245  44.363 46.009  1.00 59.31  ? 828  GLU A CD    1 
ATOM   6754 O  OE1   . GLU A 1 828 ? -5.009  43.514 46.515  1.00 61.07  ? 828  GLU A OE1   1 
ATOM   6755 O  OE2   . GLU A 1 828 ? -3.004  44.326 46.150  1.00 61.58  ? 828  GLU A OE2   1 
ATOM   6756 N  N     . LYS A 1 829 ? -8.239  44.441 42.739  1.00 33.36  ? 829  LYS A N     1 
ATOM   6757 C  CA    . LYS A 1 829 ? -9.429  43.971 42.032  1.00 34.24  ? 829  LYS A CA    1 
ATOM   6758 C  C     . LYS A 1 829 ? -10.398 43.163 42.891  1.00 30.48  ? 829  LYS A C     1 
ATOM   6759 O  O     . LYS A 1 829 ? -9.998  42.496 43.845  1.00 31.50  ? 829  LYS A O     1 
ATOM   6760 C  CB    . LYS A 1 829 ? -9.034  43.185 40.780  1.00 36.54  ? 829  LYS A CB    1 
ATOM   6761 C  CG    . LYS A 1 829 ? -8.348  44.045 39.727  1.00 37.97  ? 829  LYS A CG    1 
ATOM   6762 C  CD    . LYS A 1 829 ? -8.172  43.299 38.418  1.00 35.98  ? 829  LYS A CD    1 
ATOM   6763 C  CE    . LYS A 1 829 ? -7.542  44.189 37.358  1.00 31.77  ? 829  LYS A CE    1 
ATOM   6764 N  NZ    . LYS A 1 829 ? -7.430  43.484 36.049  1.00 29.64  ? 829  LYS A NZ    1 
ATOM   6765 N  N     . VAL A 1 830 ? -11.678 43.231 42.540  1.00 29.22  ? 830  VAL A N     1 
ATOM   6766 C  CA    . VAL A 1 830 ? -12.718 42.539 43.291  1.00 27.57  ? 830  VAL A CA    1 
ATOM   6767 C  C     . VAL A 1 830 ? -13.602 41.682 42.393  1.00 30.66  ? 830  VAL A C     1 
ATOM   6768 O  O     . VAL A 1 830 ? -13.835 42.016 41.232  1.00 29.44  ? 830  VAL A O     1 
ATOM   6769 C  CB    . VAL A 1 830 ? -13.614 43.529 44.068  1.00 31.72  ? 830  VAL A CB    1 
ATOM   6770 C  CG1   . VAL A 1 830 ? -12.802 44.283 45.112  1.00 35.89  ? 830  VAL A CG1   1 
ATOM   6771 C  CG2   . VAL A 1 830 ? -14.295 44.506 43.114  1.00 32.14  ? 830  VAL A CG2   1 
ATOM   6772 N  N     . TYR A 1 831 ? -14.076 40.565 42.938  1.00 32.68  ? 831  TYR A N     1 
ATOM   6773 C  CA    . TYR A 1 831 ? -15.148 39.800 42.318  1.00 28.35  ? 831  TYR A CA    1 
ATOM   6774 C  C     . TYR A 1 831 ? -16.442 40.505 42.690  1.00 32.77  ? 831  TYR A C     1 
ATOM   6775 O  O     . TYR A 1 831 ? -16.552 41.037 43.789  1.00 34.65  ? 831  TYR A O     1 
ATOM   6776 C  CB    . TYR A 1 831 ? -15.181 38.373 42.866  1.00 28.12  ? 831  TYR A CB    1 
ATOM   6777 C  CG    . TYR A 1 831 ? -14.121 37.442 42.316  1.00 30.13  ? 831  TYR A CG    1 
ATOM   6778 C  CD1   . TYR A 1 831 ? -13.859 37.379 40.954  1.00 31.87  ? 831  TYR A CD1   1 
ATOM   6779 C  CD2   . TYR A 1 831 ? -13.393 36.616 43.162  1.00 34.29  ? 831  TYR A CD2   1 
ATOM   6780 C  CE1   . TYR A 1 831 ? -12.894 36.521 40.450  1.00 32.13  ? 831  TYR A CE1   1 
ATOM   6781 C  CE2   . TYR A 1 831 ? -12.430 35.754 42.669  1.00 33.26  ? 831  TYR A CE2   1 
ATOM   6782 C  CZ    . TYR A 1 831 ? -12.181 35.713 41.313  1.00 35.32  ? 831  TYR A CZ    1 
ATOM   6783 O  OH    . TYR A 1 831 ? -11.219 34.858 40.820  1.00 36.28  ? 831  TYR A OH    1 
ATOM   6784 N  N     . VAL A 1 832 ? -17.416 40.517 41.786  1.00 30.42  ? 832  VAL A N     1 
ATOM   6785 C  CA    . VAL A 1 832 ? -18.694 41.173 42.057  1.00 29.90  ? 832  VAL A CA    1 
ATOM   6786 C  C     . VAL A 1 832 ? -19.865 40.262 41.706  1.00 28.30  ? 832  VAL A C     1 
ATOM   6787 O  O     . VAL A 1 832 ? -19.894 39.666 40.628  1.00 27.95  ? 832  VAL A O     1 
ATOM   6788 C  CB    . VAL A 1 832 ? -18.838 42.498 41.267  1.00 31.83  ? 832  VAL A CB    1 
ATOM   6789 C  CG1   . VAL A 1 832 ? -20.163 43.177 41.593  1.00 33.28  ? 832  VAL A CG1   1 
ATOM   6790 C  CG2   . VAL A 1 832 ? -17.675 43.435 41.567  1.00 27.96  ? 832  VAL A CG2   1 
ATOM   6791 N  N     . LEU A 1 833 ? -20.826 40.154 42.619  1.00 27.69  ? 833  LEU A N     1 
ATOM   6792 C  CA    . LEU A 1 833 ? -22.031 39.362 42.384  1.00 30.47  ? 833  LEU A CA    1 
ATOM   6793 C  C     . LEU A 1 833 ? -23.291 40.146 42.733  1.00 34.89  ? 833  LEU A C     1 
ATOM   6794 O  O     . LEU A 1 833 ? -23.327 40.847 43.742  1.00 33.35  ? 833  LEU A O     1 
ATOM   6795 C  CB    . LEU A 1 833 ? -21.999 38.072 43.205  1.00 27.50  ? 833  LEU A CB    1 
ATOM   6796 C  CG    . LEU A 1 833 ? -21.166 36.907 42.671  1.00 35.08  ? 833  LEU A CG    1 
ATOM   6797 C  CD1   . LEU A 1 833 ? -21.151 35.769 43.682  1.00 33.44  ? 833  LEU A CD1   1 
ATOM   6798 C  CD2   . LEU A 1 833 ? -21.696 36.427 41.322  1.00 26.69  ? 833  LEU A CD2   1 
ATOM   6799 N  N     . PRO A 1 834 ? -24.334 40.025 41.897  1.00 37.53  ? 834  PRO A N     1 
ATOM   6800 C  CA    . PRO A 1 834 ? -25.635 40.636 42.184  1.00 38.24  ? 834  PRO A CA    1 
ATOM   6801 C  C     . PRO A 1 834 ? -26.407 39.816 43.214  1.00 38.73  ? 834  PRO A C     1 
ATOM   6802 O  O     . PRO A 1 834 ? -26.264 38.593 43.256  1.00 37.07  ? 834  PRO A O     1 
ATOM   6803 C  CB    . PRO A 1 834 ? -26.345 40.584 40.830  1.00 37.82  ? 834  PRO A CB    1 
ATOM   6804 C  CG    . PRO A 1 834 ? -25.756 39.398 40.152  1.00 36.32  ? 834  PRO A CG    1 
ATOM   6805 C  CD    . PRO A 1 834 ? -24.316 39.349 40.587  1.00 38.77  ? 834  PRO A CD    1 
ATOM   6806 N  N     . LEU A 1 835 ? -27.216 40.482 44.030  1.00 38.32  ? 835  LEU A N     1 
ATOM   6807 C  CA    . LEU A 1 835 ? -27.971 39.804 45.078  1.00 39.40  ? 835  LEU A CA    1 
ATOM   6808 C  C     . LEU A 1 835 ? -29.473 39.947 44.862  1.00 40.44  ? 835  LEU A C     1 
ATOM   6809 O  O     . LEU A 1 835 ? -29.953 41.018 44.492  1.00 42.49  ? 835  LEU A O     1 
ATOM   6810 C  CB    . LEU A 1 835 ? -27.581 40.350 46.453  1.00 39.85  ? 835  LEU A CB    1 
ATOM   6811 C  CG    . LEU A 1 835 ? -26.124 40.146 46.873  1.00 40.76  ? 835  LEU A CG    1 
ATOM   6812 C  CD1   . LEU A 1 835 ? -25.794 40.983 48.101  1.00 40.32  ? 835  LEU A CD1   1 
ATOM   6813 C  CD2   . LEU A 1 835 ? -25.843 38.672 47.135  1.00 36.69  ? 835  LEU A CD2   1 
ATOM   6814 N  N     . ARG A 1 836 ? -30.211 38.866 45.099  1.00 40.96  ? 836  ARG A N     1 
ATOM   6815 C  CA    . ARG A 1 836 ? -31.660 38.878 44.926  1.00 44.84  ? 836  ARG A CA    1 
ATOM   6816 C  C     . ARG A 1 836 ? -32.345 39.856 45.875  1.00 46.60  ? 836  ARG A C     1 
ATOM   6817 O  O     . ARG A 1 836 ? -31.816 40.188 46.937  1.00 44.97  ? 836  ARG A O     1 
ATOM   6818 C  CB    . ARG A 1 836 ? -32.247 37.474 45.098  1.00 48.85  ? 836  ARG A CB    1 
ATOM   6819 C  CG    . ARG A 1 836 ? -32.008 36.557 43.911  1.00 51.16  ? 836  ARG A CG    1 
ATOM   6820 C  CD    . ARG A 1 836 ? -32.773 35.247 44.039  1.00 55.45  ? 836  ARG A CD    1 
ATOM   6821 N  NE    . ARG A 1 836 ? -32.234 34.378 45.083  1.00 57.89  ? 836  ARG A NE    1 
ATOM   6822 C  CZ    . ARG A 1 836 ? -32.780 34.223 46.284  1.00 60.33  ? 836  ARG A CZ    1 
ATOM   6823 N  NH1   . ARG A 1 836 ? -33.887 34.879 46.601  1.00 65.20  ? 836  ARG A NH1   1 
ATOM   6824 N  NH2   . ARG A 1 836 ? -32.222 33.408 47.169  1.00 59.51  ? 836  ARG A NH2   1 
ATOM   6825 N  N     . GLU A 1 837 ? -33.526 40.313 45.471  1.00 47.47  ? 837  GLU A N     1 
ATOM   6826 C  CA    . GLU A 1 837 ? -34.315 41.259 46.250  1.00 48.51  ? 837  GLU A CA    1 
ATOM   6827 C  C     . GLU A 1 837 ? -34.691 40.693 47.616  1.00 52.36  ? 837  GLU A C     1 
ATOM   6828 O  O     . GLU A 1 837 ? -35.179 39.568 47.720  1.00 54.86  ? 837  GLU A O     1 
ATOM   6829 C  CB    . GLU A 1 837 ? -35.578 41.634 45.472  1.00 51.42  ? 837  GLU A CB    1 
ATOM   6830 C  CG    . GLU A 1 837 ? -36.567 42.494 46.236  1.00 56.45  ? 837  GLU A CG    1 
ATOM   6831 C  CD    . GLU A 1 837 ? -37.841 42.742 45.448  1.00 63.11  ? 837  GLU A CD    1 
ATOM   6832 O  OE1   . GLU A 1 837 ? -37.910 43.762 44.730  1.00 66.66  ? 837  GLU A OE1   1 
ATOM   6833 O  OE2   . GLU A 1 837 ? -38.771 41.916 45.544  1.00 65.23  ? 837  GLU A OE2   1 
ATOM   6834 N  N     . GLY A 1 838 ? -34.457 41.478 48.663  1.00 52.24  ? 838  GLY A N     1 
ATOM   6835 C  CA    . GLY A 1 838 ? -34.804 41.069 50.011  1.00 50.96  ? 838  GLY A CA    1 
ATOM   6836 C  C     . GLY A 1 838 ? -33.685 40.334 50.725  1.00 50.27  ? 838  GLY A C     1 
ATOM   6837 O  O     . GLY A 1 838 ? -33.901 39.734 51.777  1.00 52.20  ? 838  GLY A O     1 
ATOM   6838 N  N     . ASN A 1 839 ? -32.486 40.377 50.150  1.00 47.41  ? 839  ASN A N     1 
ATOM   6839 C  CA    . ASN A 1 839 ? -31.322 39.739 50.756  1.00 45.55  ? 839  ASN A CA    1 
ATOM   6840 C  C     . ASN A 1 839 ? -30.925 40.415 52.070  1.00 48.41  ? 839  ASN A C     1 
ATOM   6841 O  O     . ASN A 1 839 ? -31.154 41.611 52.247  1.00 49.09  ? 839  ASN A O     1 
ATOM   6842 C  CB    . ASN A 1 839 ? -30.145 39.750 49.778  1.00 43.83  ? 839  ASN A CB    1 
ATOM   6843 C  CG    . ASN A 1 839 ? -29.616 41.143 49.523  1.00 44.60  ? 839  ASN A CG    1 
ATOM   6844 O  OD1   . ASN A 1 839 ? -28.826 41.671 50.305  1.00 45.60  ? 839  ASN A OD1   1 
ATOM   6845 N  ND2   . ASN A 1 839 ? -30.047 41.748 48.422  1.00 44.78  ? 839  ASN A ND2   1 
ATOM   6846 N  N     . PRO A 1 840 ? -30.323 39.652 52.996  1.00 52.10  ? 840  PRO A N     1 
ATOM   6847 C  CA    . PRO A 1 840 ? -29.963 40.195 54.312  1.00 54.48  ? 840  PRO A CA    1 
ATOM   6848 C  C     . PRO A 1 840 ? -28.766 41.146 54.288  1.00 51.71  ? 840  PRO A C     1 
ATOM   6849 O  O     . PRO A 1 840 ? -28.402 41.680 55.336  1.00 52.35  ? 840  PRO A O     1 
ATOM   6850 C  CB    . PRO A 1 840 ? -29.619 38.941 55.121  1.00 55.48  ? 840  PRO A CB    1 
ATOM   6851 C  CG    . PRO A 1 840 ? -29.157 37.962 54.101  1.00 55.72  ? 840  PRO A CG    1 
ATOM   6852 C  CD    . PRO A 1 840 ? -30.017 38.214 52.895  1.00 53.59  ? 840  PRO A CD    1 
ATOM   6853 N  N     . PHE A 1 841 ? -28.167 41.358 53.120  1.00 47.69  ? 841  PHE A N     1 
ATOM   6854 C  CA    . PHE A 1 841 ? -27.019 42.257 53.013  1.00 46.95  ? 841  PHE A CA    1 
ATOM   6855 C  C     . PHE A 1 841 ? -27.443 43.709 52.804  1.00 48.03  ? 841  PHE A C     1 
ATOM   6856 O  O     . PHE A 1 841 ? -26.630 44.626 52.932  1.00 48.21  ? 841  PHE A O     1 
ATOM   6857 C  CB    . PHE A 1 841 ? -26.071 41.807 51.899  1.00 44.47  ? 841  PHE A CB    1 
ATOM   6858 C  CG    . PHE A 1 841 ? -25.458 40.457 52.137  1.00 47.34  ? 841  PHE A CG    1 
ATOM   6859 C  CD1   . PHE A 1 841 ? -24.404 40.307 53.024  1.00 47.51  ? 841  PHE A CD1   1 
ATOM   6860 C  CD2   . PHE A 1 841 ? -25.936 39.338 51.477  1.00 50.37  ? 841  PHE A CD2   1 
ATOM   6861 C  CE1   . PHE A 1 841 ? -23.839 39.066 53.247  1.00 51.70  ? 841  PHE A CE1   1 
ATOM   6862 C  CE2   . PHE A 1 841 ? -25.375 38.095 51.695  1.00 52.74  ? 841  PHE A CE2   1 
ATOM   6863 C  CZ    . PHE A 1 841 ? -24.326 37.959 52.581  1.00 53.33  ? 841  PHE A CZ    1 
ATOM   6864 N  N     . GLY A 1 842 ? -28.716 43.911 52.478  1.00 49.24  ? 842  GLY A N     1 
ATOM   6865 C  CA    . GLY A 1 842 ? -29.276 45.246 52.374  1.00 49.48  ? 842  GLY A CA    1 
ATOM   6866 C  C     . GLY A 1 842 ? -28.908 46.017 51.120  1.00 50.67  ? 842  GLY A C     1 
ATOM   6867 O  O     . GLY A 1 842 ? -29.092 47.232 51.063  1.00 54.88  ? 842  GLY A O     1 
ATOM   6868 N  N     . ASP A 1 843 ? -28.391 45.322 50.112  1.00 47.81  ? 843  ASP A N     1 
ATOM   6869 C  CA    . ASP A 1 843 ? -28.065 45.969 48.844  1.00 46.25  ? 843  ASP A CA    1 
ATOM   6870 C  C     . ASP A 1 843 ? -28.119 44.996 47.667  1.00 45.00  ? 843  ASP A C     1 
ATOM   6871 O  O     . ASP A 1 843 ? -28.234 43.785 47.854  1.00 46.29  ? 843  ASP A O     1 
ATOM   6872 C  CB    . ASP A 1 843 ? -26.702 46.659 48.918  1.00 47.39  ? 843  ASP A CB    1 
ATOM   6873 C  CG    . ASP A 1 843 ? -26.726 48.058 48.328  1.00 49.69  ? 843  ASP A CG    1 
ATOM   6874 O  OD1   . ASP A 1 843 ? -27.447 48.273 47.330  1.00 47.95  ? 843  ASP A OD1   1 
ATOM   6875 O  OD2   . ASP A 1 843 ? -26.030 48.944 48.868  1.00 52.31  ? 843  ASP A OD2   1 
ATOM   6876 N  N     . LYS A 1 844 ? -28.031 45.537 46.455  1.00 43.42  ? 844  LYS A N     1 
ATOM   6877 C  CA    . LYS A 1 844 ? -28.269 44.758 45.240  1.00 42.26  ? 844  LYS A CA    1 
ATOM   6878 C  C     . LYS A 1 844 ? -27.035 44.029 44.708  1.00 40.80  ? 844  LYS A C     1 
ATOM   6879 O  O     . LYS A 1 844 ? -27.114 43.324 43.702  1.00 39.29  ? 844  LYS A O     1 
ATOM   6880 C  CB    . LYS A 1 844 ? -28.853 45.654 44.145  1.00 42.05  ? 844  LYS A CB    1 
ATOM   6881 C  CG    . LYS A 1 844 ? -27.943 46.801 43.738  1.00 45.08  ? 844  LYS A CG    1 
ATOM   6882 C  CD    . LYS A 1 844 ? -28.553 47.618 42.608  1.00 45.18  ? 844  LYS A CD    1 
ATOM   6883 C  CE    . LYS A 1 844 ? -27.605 48.713 42.141  1.00 42.78  ? 844  LYS A CE    1 
ATOM   6884 N  NZ    . LYS A 1 844 ? -28.178 49.495 41.014  1.00 39.97  ? 844  LYS A NZ    1 
ATOM   6885 N  N     . CYS A 1 845 ? -25.899 44.201 45.375  1.00 38.71  ? 845  CYS A N     1 
ATOM   6886 C  CA    . CYS A 1 845 ? -24.679 43.507 44.976  1.00 38.64  ? 845  CYS A CA    1 
ATOM   6887 C  C     . CYS A 1 845 ? -23.671 43.452 46.116  1.00 36.70  ? 845  CYS A C     1 
ATOM   6888 O  O     . CYS A 1 845 ? -23.803 44.164 47.111  1.00 38.59  ? 845  CYS A O     1 
ATOM   6889 C  CB    . CYS A 1 845 ? -24.044 44.183 43.758  1.00 40.23  ? 845  CYS A CB    1 
ATOM   6890 S  SG    . CYS A 1 845 ? -23.455 45.863 44.063  1.00 37.12  ? 845  CYS A SG    1 
ATOM   6891 N  N     . ILE A 1 846 ? -22.665 42.598 45.961  1.00 30.98  ? 846  ILE A N     1 
ATOM   6892 C  CA    . ILE A 1 846 ? -21.596 42.484 46.943  1.00 31.07  ? 846  ILE A CA    1 
ATOM   6893 C  C     . ILE A 1 846 ? -20.276 42.179 46.232  1.00 34.10  ? 846  ILE A C     1 
ATOM   6894 O  O     . ILE A 1 846 ? -20.263 41.563 45.165  1.00 35.57  ? 846  ILE A O     1 
ATOM   6895 C  CB    . ILE A 1 846 ? -21.912 41.406 48.011  1.00 39.46  ? 846  ILE A CB    1 
ATOM   6896 C  CG1   . ILE A 1 846 ? -20.983 41.554 49.222  1.00 39.59  ? 846  ILE A CG1   1 
ATOM   6897 C  CG2   . ILE A 1 846 ? -21.838 40.001 47.411  1.00 37.44  ? 846  ILE A CG2   1 
ATOM   6898 C  CD1   . ILE A 1 846 ? -21.238 40.545 50.323  1.00 38.42  ? 846  ILE A CD1   1 
ATOM   6899 N  N     . ALA A 1 847 ? -19.171 42.636 46.811  1.00 31.73  ? 847  ALA A N     1 
ATOM   6900 C  CA    . ALA A 1 847 ? -17.856 42.422 46.218  1.00 32.77  ? 847  ALA A CA    1 
ATOM   6901 C  C     . ALA A 1 847 ? -16.843 41.984 47.265  1.00 36.50  ? 847  ALA A C     1 
ATOM   6902 O  O     . ALA A 1 847 ? -16.962 42.333 48.432  1.00 41.02  ? 847  ALA A O     1 
ATOM   6903 C  CB    . ALA A 1 847 ? -17.379 43.682 45.516  1.00 28.48  ? 847  ALA A CB    1 
ATOM   6904 N  N     . TRP A 1 848 ? -15.847 41.213 46.844  1.00 34.14  ? 848  TRP A N     1 
ATOM   6905 C  CA    . TRP A 1 848 ? -14.800 40.758 47.751  1.00 31.58  ? 848  TRP A CA    1 
ATOM   6906 C  C     . TRP A 1 848 ? -13.488 40.634 46.973  1.00 29.89  ? 848  TRP A C     1 
ATOM   6907 O  O     . TRP A 1 848 ? -13.516 40.565 45.745  1.00 28.87  ? 848  TRP A O     1 
ATOM   6908 C  CB    . TRP A 1 848 ? -15.211 39.439 48.428  1.00 32.33  ? 848  TRP A CB    1 
ATOM   6909 C  CG    . TRP A 1 848 ? -15.219 38.237 47.532  1.00 34.50  ? 848  TRP A CG    1 
ATOM   6910 C  CD1   . TRP A 1 848 ? -14.258 37.271 47.452  1.00 34.61  ? 848  TRP A CD1   1 
ATOM   6911 C  CD2   . TRP A 1 848 ? -16.242 37.864 46.600  1.00 29.20  ? 848  TRP A CD2   1 
ATOM   6912 N  NE1   . TRP A 1 848 ? -14.616 36.323 46.526  1.00 34.45  ? 848  TRP A NE1   1 
ATOM   6913 C  CE2   . TRP A 1 848 ? -15.829 36.664 45.988  1.00 33.09  ? 848  TRP A CE2   1 
ATOM   6914 C  CE3   . TRP A 1 848 ? -17.464 38.429 46.222  1.00 32.52  ? 848  TRP A CE3   1 
ATOM   6915 C  CZ2   . TRP A 1 848 ? -16.595 36.017 45.018  1.00 32.60  ? 848  TRP A CZ2   1 
ATOM   6916 C  CZ3   . TRP A 1 848 ? -18.223 37.787 45.258  1.00 31.07  ? 848  TRP A CZ3   1 
ATOM   6917 C  CH2   . TRP A 1 848 ? -17.785 36.595 44.667  1.00 31.59  ? 848  TRP A CH2   1 
ATOM   6918 N  N     . PRO A 1 849 ? -12.337 40.641 47.677  1.00 31.28  ? 849  PRO A N     1 
ATOM   6919 C  CA    . PRO A 1 849 ? -11.035 40.590 46.998  1.00 30.83  ? 849  PRO A CA    1 
ATOM   6920 C  C     . PRO A 1 849 ? -10.930 39.455 45.984  1.00 31.74  ? 849  PRO A C     1 
ATOM   6921 O  O     . PRO A 1 849 ? -11.168 38.293 46.316  1.00 35.77  ? 849  PRO A O     1 
ATOM   6922 C  CB    . PRO A 1 849 ? -10.049 40.363 48.149  1.00 32.93  ? 849  PRO A CB    1 
ATOM   6923 C  CG    . PRO A 1 849 ? -10.706 40.992 49.321  1.00 33.86  ? 849  PRO A CG    1 
ATOM   6924 C  CD    . PRO A 1 849 ? -12.184 40.761 49.139  1.00 33.75  ? 849  PRO A CD    1 
ATOM   6925 N  N     . SER A 1 850 ? -10.581 39.803 44.751  1.00 30.09  ? 850  SER A N     1 
ATOM   6926 C  CA    . SER A 1 850 ? -10.489 38.828 43.672  1.00 32.71  ? 850  SER A CA    1 
ATOM   6927 C  C     . SER A 1 850 ? -9.408  37.791 43.950  1.00 36.00  ? 850  SER A C     1 
ATOM   6928 O  O     . SER A 1 850 ? -8.518  38.011 44.773  1.00 32.40  ? 850  SER A O     1 
ATOM   6929 C  CB    . SER A 1 850 ? -10.199 39.531 42.348  1.00 33.78  ? 850  SER A CB    1 
ATOM   6930 O  OG    . SER A 1 850 ? -8.879  40.041 42.333  1.00 34.64  ? 850  SER A OG    1 
ATOM   6931 N  N     . GLY A 1 851 ? -9.499  36.658 43.261  1.00 38.46  ? 851  GLY A N     1 
ATOM   6932 C  CA    . GLY A 1 851 ? -8.545  35.575 43.419  1.00 40.14  ? 851  GLY A CA    1 
ATOM   6933 C  C     . GLY A 1 851 ? -8.707  34.815 44.721  1.00 43.44  ? 851  GLY A C     1 
ATOM   6934 O  O     . GLY A 1 851 ? -7.870  33.982 45.069  1.00 43.52  ? 851  GLY A O     1 
ATOM   6935 N  N     . THR A 1 852 ? -9.784  35.099 45.447  1.00 40.74  ? 852  THR A N     1 
ATOM   6936 C  CA    . THR A 1 852 ? -10.011 34.464 46.740  1.00 39.59  ? 852  THR A CA    1 
ATOM   6937 C  C     . THR A 1 852 ? -11.431 33.935 46.880  1.00 39.55  ? 852  THR A C     1 
ATOM   6938 O  O     . THR A 1 852 ? -12.357 34.419 46.228  1.00 30.86  ? 852  THR A O     1 
ATOM   6939 C  CB    . THR A 1 852 ? -9.785  35.451 47.909  1.00 36.05  ? 852  THR A CB    1 
ATOM   6940 O  OG1   . THR A 1 852 ? -10.863 36.397 47.949  1.00 36.70  ? 852  THR A OG1   1 
ATOM   6941 C  CG2   . THR A 1 852 ? -8.456  36.188 47.767  1.00 35.16  ? 852  THR A CG2   1 
ATOM   6942 N  N     . GLU A 1 853 ? -11.594 32.937 47.743  1.00 43.91  ? 853  GLU A N     1 
ATOM   6943 C  CA    . GLU A 1 853 ? -12.914 32.535 48.195  1.00 44.70  ? 853  GLU A CA    1 
ATOM   6944 C  C     . GLU A 1 853 ? -13.407 33.634 49.121  1.00 44.31  ? 853  GLU A C     1 
ATOM   6945 O  O     . GLU A 1 853 ? -12.631 34.174 49.911  1.00 45.04  ? 853  GLU A O     1 
ATOM   6946 C  CB    . GLU A 1 853 ? -12.841 31.214 48.964  1.00 49.89  ? 853  GLU A CB    1 
ATOM   6947 C  CG    . GLU A 1 853 ? -12.460 30.006 48.122  1.00 55.08  ? 853  GLU A CG    1 
ATOM   6948 C  CD    . GLU A 1 853 ? -13.631 29.453 47.330  1.00 57.61  ? 853  GLU A CD    1 
ATOM   6949 O  OE1   . GLU A 1 853 ? -14.773 29.902 47.560  1.00 56.88  ? 853  GLU A OE1   1 
ATOM   6950 O  OE2   . GLU A 1 853 ? -13.409 28.568 46.479  1.00 60.66  ? 853  GLU A OE2   1 
ATOM   6951 N  N     . ILE A 1 854 ? -14.685 33.980 49.023  1.00 42.97  ? 854  ILE A N     1 
ATOM   6952 C  CA    . ILE A 1 854 ? -15.254 34.948 49.947  1.00 43.99  ? 854  ILE A CA    1 
ATOM   6953 C  C     . ILE A 1 854 ? -15.253 34.326 51.345  1.00 45.58  ? 854  ILE A C     1 
ATOM   6954 O  O     . ILE A 1 854 ? -15.420 33.114 51.489  1.00 47.94  ? 854  ILE A O     1 
ATOM   6955 C  CB    . ILE A 1 854 ? -16.666 35.406 49.506  1.00 46.49  ? 854  ILE A CB    1 
ATOM   6956 C  CG1   . ILE A 1 854 ? -17.080 36.680 50.244  1.00 50.21  ? 854  ILE A CG1   1 
ATOM   6957 C  CG2   . ILE A 1 854 ? -17.689 34.293 49.684  1.00 47.89  ? 854  ILE A CG2   1 
ATOM   6958 C  CD1   . ILE A 1 854 ? -18.333 37.324 49.687  1.00 50.99  ? 854  ILE A CD1   1 
ATOM   6959 N  N     . THR A 1 855 ? -15.023 35.152 52.363  1.00 43.71  ? 855  THR A N     1 
ATOM   6960 C  CA    . THR A 1 855 ? -14.870 34.668 53.735  1.00 44.57  ? 855  THR A CA    1 
ATOM   6961 C  C     . THR A 1 855 ? -16.033 33.791 54.200  1.00 44.93  ? 855  THR A C     1 
ATOM   6962 O  O     . THR A 1 855 ? -17.184 34.027 53.832  1.00 41.45  ? 855  THR A O     1 
ATOM   6963 C  CB    . THR A 1 855 ? -14.681 35.831 54.728  1.00 43.96  ? 855  THR A CB    1 
ATOM   6964 O  OG1   . THR A 1 855 ? -14.797 35.338 56.067  1.00 48.46  ? 855  THR A OG1   1 
ATOM   6965 C  CG2   . THR A 1 855 ? -15.732 36.908 54.498  1.00 41.65  ? 855  THR A CG2   1 
ATOM   6966 N  N     . ASP A 1 856 ? -15.720 32.778 55.007  1.00 45.80  ? 856  ASP A N     1 
ATOM   6967 C  CA    . ASP A 1 856 ? -16.723 31.827 55.487  1.00 51.51  ? 856  ASP A CA    1 
ATOM   6968 C  C     . ASP A 1 856 ? -17.783 32.485 56.364  1.00 52.37  ? 856  ASP A C     1 
ATOM   6969 O  O     . ASP A 1 856 ? -18.853 31.915 56.587  1.00 52.82  ? 856  ASP A O     1 
ATOM   6970 C  CB    . ASP A 1 856 ? -16.067 30.667 56.246  1.00 55.48  ? 856  ASP A CB    1 
ATOM   6971 C  CG    . ASP A 1 856 ? -15.462 29.629 55.318  1.00 58.23  ? 856  ASP A CG    1 
ATOM   6972 O  OD1   . ASP A 1 856 ? -14.609 28.840 55.781  1.00 61.04  ? 856  ASP A OD1   1 
ATOM   6973 O  OD2   . ASP A 1 856 ? -15.837 29.602 54.126  1.00 54.65  ? 856  ASP A OD2   1 
ATOM   6974 N  N     . LEU A 1 857 ? -17.475 33.677 56.864  1.00 51.42  ? 857  LEU A N     1 
ATOM   6975 C  CA    . LEU A 1 857 ? -18.413 34.444 57.675  1.00 54.06  ? 857  LEU A CA    1 
ATOM   6976 C  C     . LEU A 1 857 ? -19.737 34.650 56.946  1.00 52.08  ? 857  LEU A C     1 
ATOM   6977 O  O     . LEU A 1 857 ? -20.807 34.562 57.547  1.00 55.90  ? 857  LEU A O     1 
ATOM   6978 C  CB    . LEU A 1 857 ? -17.816 35.808 58.031  1.00 55.52  ? 857  LEU A CB    1 
ATOM   6979 C  CG    . LEU A 1 857 ? -16.535 35.847 58.866  1.00 60.17  ? 857  LEU A CG    1 
ATOM   6980 C  CD1   . LEU A 1 857 ? -16.016 37.273 58.962  1.00 60.21  ? 857  LEU A CD1   1 
ATOM   6981 C  CD2   . LEU A 1 857 ? -16.779 35.270 60.254  1.00 61.37  ? 857  LEU A CD2   1 
ATOM   6982 N  N     . ILE A 1 858 ? -19.657 34.917 55.646  1.00 47.31  ? 858  ILE A N     1 
ATOM   6983 C  CA    . ILE A 1 858 ? -20.838 35.274 54.868  1.00 47.84  ? 858  ILE A CA    1 
ATOM   6984 C  C     . ILE A 1 858 ? -21.008 34.445 53.595  1.00 48.90  ? 858  ILE A C     1 
ATOM   6985 O  O     . ILE A 1 858 ? -21.934 34.689 52.820  1.00 48.28  ? 858  ILE A O     1 
ATOM   6986 C  CB    . ILE A 1 858 ? -20.804 36.762 54.460  1.00 43.10  ? 858  ILE A CB    1 
ATOM   6987 C  CG1   . ILE A 1 858 ? -19.610 37.032 53.542  1.00 39.04  ? 858  ILE A CG1   1 
ATOM   6988 C  CG2   . ILE A 1 858 ? -20.750 37.659 55.689  1.00 45.31  ? 858  ILE A CG2   1 
ATOM   6989 C  CD1   . ILE A 1 858 ? -19.537 38.456 53.034  1.00 39.43  ? 858  ILE A CD1   1 
ATOM   6990 N  N     . LYS A 1 859 ? -20.126 33.470 53.377  1.00 46.18  ? 859  LYS A N     1 
ATOM   6991 C  CA    . LYS A 1 859 ? -20.131 32.711 52.124  1.00 44.93  ? 859  LYS A CA    1 
ATOM   6992 C  C     . LYS A 1 859 ? -21.450 31.990 51.841  1.00 44.30  ? 859  LYS A C     1 
ATOM   6993 O  O     . LYS A 1 859 ? -22.003 32.112 50.747  1.00 38.70  ? 859  LYS A O     1 
ATOM   6994 C  CB    . LYS A 1 859 ? -18.972 31.712 52.066  1.00 44.12  ? 859  LYS A CB    1 
ATOM   6995 C  CG    . LYS A 1 859 ? -18.906 30.960 50.740  1.00 42.28  ? 859  LYS A CG    1 
ATOM   6996 C  CD    . LYS A 1 859 ? -17.732 29.994 50.680  1.00 47.98  ? 859  LYS A CD    1 
ATOM   6997 C  CE    . LYS A 1 859 ? -17.734 29.222 49.366  1.00 51.43  ? 859  LYS A CE    1 
ATOM   6998 N  NZ    . LYS A 1 859 ? -16.635 28.217 49.286  1.00 54.55  ? 859  LYS A NZ    1 
ATOM   6999 N  N     . ASP A 1 860 ? -21.945 31.241 52.823  1.00 44.17  ? 860  ASP A N     1 
ATOM   7000 C  CA    . ASP A 1 860 ? -23.196 30.502 52.662  1.00 48.51  ? 860  ASP A CA    1 
ATOM   7001 C  C     . ASP A 1 860 ? -24.379 31.433 52.392  1.00 49.65  ? 860  ASP A C     1 
ATOM   7002 O  O     . ASP A 1 860 ? -25.288 31.087 51.639  1.00 50.39  ? 860  ASP A O     1 
ATOM   7003 C  CB    . ASP A 1 860 ? -23.476 29.623 53.884  1.00 46.65  ? 860  ASP A CB    1 
ATOM   7004 C  CG    . ASP A 1 860 ? -22.485 28.480 54.021  1.00 49.57  ? 860  ASP A CG    1 
ATOM   7005 O  OD1   . ASP A 1 860 ? -22.358 27.928 55.135  1.00 51.73  ? 860  ASP A OD1   1 
ATOM   7006 O  OD2   . ASP A 1 860 ? -21.830 28.134 53.014  1.00 49.36  ? 860  ASP A OD2   1 
ATOM   7007 N  N     . ASP A 1 861 ? -24.358 32.612 53.006  1.00 47.75  ? 861  ASP A N     1 
ATOM   7008 C  CA    . ASP A 1 861 ? -25.406 33.606 52.793  1.00 46.72  ? 861  ASP A CA    1 
ATOM   7009 C  C     . ASP A 1 861 ? -25.347 34.193 51.385  1.00 47.80  ? 861  ASP A C     1 
ATOM   7010 O  O     . ASP A 1 861 ? -26.381 34.417 50.755  1.00 49.26  ? 861  ASP A O     1 
ATOM   7011 C  CB    . ASP A 1 861 ? -25.308 34.722 53.835  1.00 48.16  ? 861  ASP A CB    1 
ATOM   7012 C  CG    . ASP A 1 861 ? -26.025 34.379 55.130  1.00 58.41  ? 861  ASP A CG    1 
ATOM   7013 O  OD1   . ASP A 1 861 ? -26.152 35.274 55.992  1.00 63.80  ? 861  ASP A OD1   1 
ATOM   7014 O  OD2   . ASP A 1 861 ? -26.472 33.222 55.282  1.00 60.60  ? 861  ASP A OD2   1 
ATOM   7015 N  N     . VAL A 1 862 ? -24.134 34.440 50.899  1.00 45.14  ? 862  VAL A N     1 
ATOM   7016 C  CA    . VAL A 1 862 ? -23.941 34.981 49.559  1.00 42.40  ? 862  VAL A CA    1 
ATOM   7017 C  C     . VAL A 1 862 ? -24.385 33.981 48.494  1.00 41.65  ? 862  VAL A C     1 
ATOM   7018 O  O     . VAL A 1 862 ? -25.079 34.344 47.544  1.00 40.13  ? 862  VAL A O     1 
ATOM   7019 C  CB    . VAL A 1 862 ? -22.470 35.386 49.317  1.00 41.78  ? 862  VAL A CB    1 
ATOM   7020 C  CG1   . VAL A 1 862 ? -22.233 35.701 47.847  1.00 35.05  ? 862  VAL A CG1   1 
ATOM   7021 C  CG2   . VAL A 1 862 ? -22.093 36.576 50.191  1.00 41.76  ? 862  VAL A CG2   1 
ATOM   7022 N  N     . LEU A 1 863 ? -23.986 32.724 48.665  1.00 39.27  ? 863  LEU A N     1 
ATOM   7023 C  CA    . LEU A 1 863 ? -24.367 31.651 47.749  1.00 42.12  ? 863  LEU A CA    1 
ATOM   7024 C  C     . LEU A 1 863 ? -25.882 31.482 47.669  1.00 43.55  ? 863  LEU A C     1 
ATOM   7025 O  O     . LEU A 1 863 ? -26.429 31.171 46.611  1.00 41.61  ? 863  LEU A O     1 
ATOM   7026 C  CB    . LEU A 1 863 ? -23.729 30.328 48.182  1.00 42.21  ? 863  LEU A CB    1 
ATOM   7027 C  CG    . LEU A 1 863 ? -22.225 30.178 47.946  1.00 43.46  ? 863  LEU A CG    1 
ATOM   7028 C  CD1   . LEU A 1 863 ? -21.676 28.973 48.695  1.00 43.79  ? 863  LEU A CD1   1 
ATOM   7029 C  CD2   . LEU A 1 863 ? -21.950 30.048 46.465  1.00 39.64  ? 863  LEU A CD2   1 
ATOM   7030 N  N     . HIS A 1 864 ? -26.553 31.689 48.796  1.00 42.30  ? 864  HIS A N     1 
ATOM   7031 C  CA    . HIS A 1 864 ? -27.999 31.533 48.863  1.00 47.04  ? 864  HIS A CA    1 
ATOM   7032 C  C     . HIS A 1 864 ? -28.722 32.675 48.155  1.00 48.33  ? 864  HIS A C     1 
ATOM   7033 O  O     . HIS A 1 864 ? -29.796 32.480 47.586  1.00 50.81  ? 864  HIS A O     1 
ATOM   7034 C  CB    . HIS A 1 864 ? -28.453 31.449 50.324  1.00 51.07  ? 864  HIS A CB    1 
ATOM   7035 C  CG    . HIS A 1 864 ? -29.897 31.094 50.491  1.00 54.53  ? 864  HIS A CG    1 
ATOM   7036 N  ND1   . HIS A 1 864 ? -30.861 32.022 50.818  1.00 56.35  ? 864  HIS A ND1   1 
ATOM   7037 C  CD2   . HIS A 1 864 ? -30.543 29.906 50.381  1.00 55.82  ? 864  HIS A CD2   1 
ATOM   7038 C  CE1   . HIS A 1 864 ? -32.037 31.426 50.901  1.00 57.21  ? 864  HIS A CE1   1 
ATOM   7039 N  NE2   . HIS A 1 864 ? -31.870 30.141 50.639  1.00 57.82  ? 864  HIS A NE2   1 
ATOM   7040 N  N     . TRP A 1 865 ? -28.127 33.864 48.182  1.00 43.02  ? 865  TRP A N     1 
ATOM   7041 C  CA    . TRP A 1 865 ? -28.814 35.059 47.699  1.00 43.69  ? 865  TRP A CA    1 
ATOM   7042 C  C     . TRP A 1 865 ? -28.296 35.611 46.373  1.00 44.89  ? 865  TRP A C     1 
ATOM   7043 O  O     . TRP A 1 865 ? -28.699 36.697 45.954  1.00 44.53  ? 865  TRP A O     1 
ATOM   7044 C  CB    . TRP A 1 865 ? -28.809 36.150 48.773  1.00 42.30  ? 865  TRP A CB    1 
ATOM   7045 C  CG    . TRP A 1 865 ? -29.749 35.856 49.900  1.00 44.66  ? 865  TRP A CG    1 
ATOM   7046 C  CD1   . TRP A 1 865 ? -29.441 35.269 51.093  1.00 48.11  ? 865  TRP A CD1   1 
ATOM   7047 C  CD2   . TRP A 1 865 ? -31.157 36.116 49.931  1.00 46.31  ? 865  TRP A CD2   1 
ATOM   7048 N  NE1   . TRP A 1 865 ? -30.571 35.154 51.869  1.00 50.72  ? 865  TRP A NE1   1 
ATOM   7049 C  CE2   . TRP A 1 865 ? -31.637 35.668 51.178  1.00 50.99  ? 865  TRP A CE2   1 
ATOM   7050 C  CE3   . TRP A 1 865 ? -32.058 36.687 49.027  1.00 46.46  ? 865  TRP A CE3   1 
ATOM   7051 C  CZ2   . TRP A 1 865 ? -32.979 35.776 51.546  1.00 54.09  ? 865  TRP A CZ2   1 
ATOM   7052 C  CZ3   . TRP A 1 865 ? -33.389 36.794 49.394  1.00 49.72  ? 865  TRP A CZ3   1 
ATOM   7053 C  CH2   . TRP A 1 865 ? -33.837 36.340 50.641  1.00 53.40  ? 865  TRP A CH2   1 
ATOM   7054 N  N     . MET A 1 866 ? -27.412 34.864 45.716  1.00 46.69  ? 866  MET A N     1 
ATOM   7055 C  CA    . MET A 1 866 ? -26.937 35.233 44.385  1.00 47.19  ? 866  MET A CA    1 
ATOM   7056 C  C     . MET A 1 866 ? -28.110 35.404 43.433  1.00 44.96  ? 866  MET A C     1 
ATOM   7057 O  O     . MET A 1 866 ? -29.055 34.618 43.459  1.00 46.97  ? 866  MET A O     1 
ATOM   7058 C  CB    . MET A 1 866 ? -26.023 34.149 43.821  1.00 47.88  ? 866  MET A CB    1 
ATOM   7059 C  CG    . MET A 1 866 ? -24.681 34.024 44.488  1.00 47.06  ? 866  MET A CG    1 
ATOM   7060 S  SD    . MET A 1 866 ? -23.825 32.585 43.836  1.00 47.29  ? 866  MET A SD    1 
ATOM   7061 C  CE    . MET A 1 866 ? -23.877 32.948 42.085  1.00 54.35  ? 866  MET A CE    1 
ATOM   7062 N  N     . ASP A 1 867 ? -28.047 36.426 42.589  1.00 41.79  ? 867  ASP A N     1 
ATOM   7063 C  CA    . ASP A 1 867 ? -29.084 36.621 41.586  1.00 42.28  ? 867  ASP A CA    1 
ATOM   7064 C  C     . ASP A 1 867 ? -28.634 36.034 40.253  1.00 40.68  ? 867  ASP A C     1 
ATOM   7065 O  O     . ASP A 1 867 ? -28.007 36.719 39.444  1.00 35.69  ? 867  ASP A O     1 
ATOM   7066 C  CB    . ASP A 1 867 ? -29.423 38.104 41.433  1.00 40.05  ? 867  ASP A CB    1 
ATOM   7067 C  CG    . ASP A 1 867 ? -30.793 38.327 40.818  1.00 41.20  ? 867  ASP A CG    1 
ATOM   7068 O  OD1   . ASP A 1 867 ? -31.228 37.488 40.003  1.00 39.89  ? 867  ASP A OD1   1 
ATOM   7069 O  OD2   . ASP A 1 867 ? -31.436 39.341 41.154  1.00 47.55  ? 867  ASP A OD2   1 
ATOM   7070 N  N     . TYR A 1 868 ? -28.956 34.760 40.039  1.00 41.52  ? 868  TYR A N     1 
ATOM   7071 C  CA    . TYR A 1 868 ? -28.595 34.063 38.808  1.00 43.35  ? 868  TYR A CA    1 
ATOM   7072 C  C     . TYR A 1 868 ? -29.297 34.667 37.597  1.00 43.30  ? 868  TYR A C     1 
ATOM   7073 O  O     . TYR A 1 868 ? -28.738 34.706 36.501  1.00 44.35  ? 868  TYR A O     1 
ATOM   7074 C  CB    . TYR A 1 868 ? -28.936 32.573 38.908  1.00 43.23  ? 868  TYR A CB    1 
ATOM   7075 C  CG    . TYR A 1 868 ? -28.083 31.796 39.886  1.00 42.75  ? 868  TYR A CG    1 
ATOM   7076 C  CD1   . TYR A 1 868 ? -26.849 31.284 39.505  1.00 42.54  ? 868  TYR A CD1   1 
ATOM   7077 C  CD2   . TYR A 1 868 ? -28.517 31.561 41.183  1.00 43.97  ? 868  TYR A CD2   1 
ATOM   7078 C  CE1   . TYR A 1 868 ? -26.066 30.570 40.391  1.00 43.49  ? 868  TYR A CE1   1 
ATOM   7079 C  CE2   . TYR A 1 868 ? -27.743 30.847 42.079  1.00 46.87  ? 868  TYR A CE2   1 
ATOM   7080 C  CZ    . TYR A 1 868 ? -26.518 30.354 41.678  1.00 48.51  ? 868  TYR A CZ    1 
ATOM   7081 O  OH    . TYR A 1 868 ? -25.744 29.642 42.565  1.00 52.06  ? 868  TYR A OH    1 
ATOM   7082 N  N     . THR A 1 869 ? -30.526 35.132 37.801  1.00 42.95  ? 869  THR A N     1 
ATOM   7083 C  CA    . THR A 1 869 ? -31.315 35.719 36.723  1.00 42.15  ? 869  THR A CA    1 
ATOM   7084 C  C     . THR A 1 869 ? -30.649 36.978 36.175  1.00 42.58  ? 869  THR A C     1 
ATOM   7085 O  O     . THR A 1 869 ? -30.460 37.115 34.965  1.00 40.13  ? 869  THR A O     1 
ATOM   7086 C  CB    . THR A 1 869 ? -32.746 36.050 37.190  1.00 48.47  ? 869  THR A CB    1 
ATOM   7087 O  OG1   . THR A 1 869 ? -33.366 34.866 37.710  1.00 53.26  ? 869  THR A OG1   1 
ATOM   7088 C  CG2   . THR A 1 869 ? -33.577 36.584 36.032  1.00 47.25  ? 869  THR A CG2   1 
ATOM   7089 N  N     . VAL A 1 870 ? -30.290 37.892 37.073  1.00 40.08  ? 870  VAL A N     1 
ATOM   7090 C  CA    . VAL A 1 870 ? -29.593 39.111 36.689  1.00 39.02  ? 870  VAL A CA    1 
ATOM   7091 C  C     . VAL A 1 870 ? -28.227 38.769 36.097  1.00 43.49  ? 870  VAL A C     1 
ATOM   7092 O  O     . VAL A 1 870 ? -27.798 39.365 35.109  1.00 42.55  ? 870  VAL A O     1 
ATOM   7093 C  CB    . VAL A 1 870 ? -29.431 40.071 37.889  1.00 40.87  ? 870  VAL A CB    1 
ATOM   7094 C  CG1   . VAL A 1 870 ? -28.393 41.143 37.592  1.00 42.57  ? 870  VAL A CG1   1 
ATOM   7095 C  CG2   . VAL A 1 870 ? -30.768 40.702 38.247  1.00 43.51  ? 870  VAL A CG2   1 
ATOM   7096 N  N     . LEU A 1 871 ? -27.562 37.790 36.701  1.00 49.79  ? 871  LEU A N     1 
ATOM   7097 C  CA    . LEU A 1 871 ? -26.253 37.342 36.244  1.00 48.86  ? 871  LEU A CA    1 
ATOM   7098 C  C     . LEU A 1 871 ? -26.306 36.883 34.788  1.00 42.83  ? 871  LEU A C     1 
ATOM   7099 O  O     . LEU A 1 871 ? -25.452 37.249 33.981  1.00 44.64  ? 871  LEU A O     1 
ATOM   7100 C  CB    . LEU A 1 871 ? -25.749 36.209 37.142  1.00 56.97  ? 871  LEU A CB    1 
ATOM   7101 C  CG    . LEU A 1 871 ? -24.242 36.056 37.358  1.00 63.01  ? 871  LEU A CG    1 
ATOM   7102 C  CD1   . LEU A 1 871 ? -23.982 35.205 38.592  1.00 65.94  ? 871  LEU A CD1   1 
ATOM   7103 C  CD2   . LEU A 1 871 ? -23.562 35.452 36.135  1.00 64.48  ? 871  LEU A CD2   1 
ATOM   7104 N  N     . LEU A 1 872 ? -27.318 36.091 34.456  1.00 45.19  ? 872  LEU A N     1 
ATOM   7105 C  CA    . LEU A 1 872 ? -27.469 35.563 33.105  1.00 47.49  ? 872  LEU A CA    1 
ATOM   7106 C  C     . LEU A 1 872 ? -27.768 36.658 32.084  1.00 48.31  ? 872  LEU A C     1 
ATOM   7107 O  O     . LEU A 1 872 ? -27.070 36.785 31.080  1.00 48.76  ? 872  LEU A O     1 
ATOM   7108 C  CB    . LEU A 1 872 ? -28.575 34.508 33.063  1.00 46.91  ? 872  LEU A CB    1 
ATOM   7109 C  CG    . LEU A 1 872 ? -28.758 33.802 31.719  1.00 49.05  ? 872  LEU A CG    1 
ATOM   7110 C  CD1   . LEU A 1 872 ? -27.516 32.992 31.380  1.00 49.95  ? 872  LEU A CD1   1 
ATOM   7111 C  CD2   . LEU A 1 872 ? -29.992 32.919 31.735  1.00 50.05  ? 872  LEU A CD2   1 
ATOM   7112 N  N     . GLU A 1 873 ? -28.808 37.442 32.344  1.00 47.13  ? 873  GLU A N     1 
ATOM   7113 C  CA    . GLU A 1 873 ? -29.242 38.478 31.411  1.00 50.76  ? 873  GLU A CA    1 
ATOM   7114 C  C     . GLU A 1 873 ? -28.208 39.581 31.201  1.00 49.20  ? 873  GLU A C     1 
ATOM   7115 O  O     . GLU A 1 873 ? -28.002 40.038 30.078  1.00 51.81  ? 873  GLU A O     1 
ATOM   7116 C  CB    . GLU A 1 873 ? -30.578 39.079 31.856  1.00 56.25  ? 873  GLU A CB    1 
ATOM   7117 C  CG    . GLU A 1 873 ? -31.787 38.367 31.274  1.00 65.04  ? 873  GLU A CG    1 
ATOM   7118 C  CD    . GLU A 1 873 ? -32.826 38.020 32.320  1.00 71.85  ? 873  GLU A CD    1 
ATOM   7119 O  OE1   . GLU A 1 873 ? -32.695 38.487 33.471  1.00 76.34  ? 873  GLU A OE1   1 
ATOM   7120 O  OE2   . GLU A 1 873 ? -33.772 37.275 31.991  1.00 73.41  ? 873  GLU A OE2   1 
ATOM   7121 N  N     . LYS A 1 874 ? -27.551 39.997 32.277  1.00 47.81  ? 874  LYS A N     1 
ATOM   7122 C  CA    . LYS A 1 874 ? -26.621 41.118 32.209  1.00 48.27  ? 874  LYS A CA    1 
ATOM   7123 C  C     . LYS A 1 874 ? -25.264 40.745 31.611  1.00 49.21  ? 874  LYS A C     1 
ATOM   7124 O  O     . LYS A 1 874 ? -24.746 41.457 30.750  1.00 49.83  ? 874  LYS A O     1 
ATOM   7125 C  CB    . LYS A 1 874 ? -26.437 41.742 33.594  1.00 53.28  ? 874  LYS A CB    1 
ATOM   7126 C  CG    . LYS A 1 874 ? -26.826 43.208 33.669  1.00 58.19  ? 874  LYS A CG    1 
ATOM   7127 C  CD    . LYS A 1 874 ? -26.887 43.692 35.108  1.00 61.10  ? 874  LYS A CD    1 
ATOM   7128 C  CE    . LYS A 1 874 ? -25.661 43.252 35.891  1.00 60.77  ? 874  LYS A CE    1 
ATOM   7129 N  NZ    . LYS A 1 874 ? -25.571 43.942 37.208  1.00 63.51  ? 874  LYS A NZ    1 
ATOM   7130 N  N     . THR A 1 875 ? -24.690 39.634 32.061  1.00 43.33  ? 875  THR A N     1 
ATOM   7131 C  CA    . THR A 1 875 ? -23.341 39.264 31.639  1.00 42.22  ? 875  THR A CA    1 
ATOM   7132 C  C     . THR A 1 875 ? -23.318 38.364 30.406  1.00 39.67  ? 875  THR A C     1 
ATOM   7133 O  O     . THR A 1 875 ? -22.338 38.358 29.661  1.00 41.70  ? 875  THR A O     1 
ATOM   7134 C  CB    . THR A 1 875 ? -22.552 38.571 32.774  1.00 44.43  ? 875  THR A CB    1 
ATOM   7135 O  OG1   . THR A 1 875 ? -23.044 37.237 32.962  1.00 49.27  ? 875  THR A OG1   1 
ATOM   7136 C  CG2   . THR A 1 875 ? -22.684 39.350 34.073  1.00 41.93  ? 875  THR A CG2   1 
ATOM   7137 N  N     . PHE A 1 876 ? -24.390 37.609 30.187  1.00 33.25  ? 876  PHE A N     1 
ATOM   7138 C  CA    . PHE A 1 876 ? -24.400 36.629 29.100  1.00 32.48  ? 876  PHE A CA    1 
ATOM   7139 C  C     . PHE A 1 876 ? -25.342 36.980 27.951  1.00 32.63  ? 876  PHE A C     1 
ATOM   7140 O  O     . PHE A 1 876 ? -24.905 37.140 26.812  1.00 36.80  ? 876  PHE A O     1 
ATOM   7141 C  CB    . PHE A 1 876 ? -24.711 35.225 29.633  1.00 33.35  ? 876  PHE A CB    1 
ATOM   7142 C  CG    . PHE A 1 876 ? -24.679 34.156 28.579  1.00 32.98  ? 876  PHE A CG    1 
ATOM   7143 C  CD1   . PHE A 1 876 ? -23.481 33.784 27.989  1.00 32.85  ? 876  PHE A CD1   1 
ATOM   7144 C  CD2   . PHE A 1 876 ? -25.841 33.515 28.184  1.00 34.18  ? 876  PHE A CD2   1 
ATOM   7145 C  CE1   . PHE A 1 876 ? -23.445 32.797 27.016  1.00 42.43  ? 876  PHE A CE1   1 
ATOM   7146 C  CE2   . PHE A 1 876 ? -25.813 32.524 27.214  1.00 36.18  ? 876  PHE A CE2   1 
ATOM   7147 C  CZ    . PHE A 1 876 ? -24.614 32.165 26.630  1.00 33.63  ? 876  PHE A CZ    1 
ATOM   7148 N  N     . ILE A 1 877 ? -26.630 37.100 28.251  1.00 35.66  ? 877  ILE A N     1 
ATOM   7149 C  CA    . ILE A 1 877 ? -27.637 37.318 27.216  1.00 37.91  ? 877  ILE A CA    1 
ATOM   7150 C  C     . ILE A 1 877 ? -27.471 38.647 26.470  1.00 38.10  ? 877  ILE A C     1 
ATOM   7151 O  O     . ILE A 1 877 ? -27.553 38.687 25.241  1.00 38.65  ? 877  ILE A O     1 
ATOM   7152 C  CB    . ILE A 1 877 ? -29.067 37.192 27.785  1.00 39.36  ? 877  ILE A CB    1 
ATOM   7153 C  CG1   . ILE A 1 877 ? -29.328 35.752 28.236  1.00 38.82  ? 877  ILE A CG1   1 
ATOM   7154 C  CG2   . ILE A 1 877 ? -30.100 37.617 26.751  1.00 38.71  ? 877  ILE A CG2   1 
ATOM   7155 C  CD1   . ILE A 1 877 ? -30.719 35.523 28.782  1.00 39.74  ? 877  ILE A CD1   1 
ATOM   7156 N  N     . LYS A 1 878 ? -27.230 39.725 27.207  1.00 39.06  ? 878  LYS A N     1 
ATOM   7157 C  CA    . LYS A 1 878 ? -27.083 41.046 26.594  1.00 43.00  ? 878  LYS A CA    1 
ATOM   7158 C  C     . LYS A 1 878 ? -25.941 41.136 25.561  1.00 42.71  ? 878  LYS A C     1 
ATOM   7159 O  O     . LYS A 1 878 ? -26.158 41.620 24.451  1.00 47.02  ? 878  LYS A O     1 
ATOM   7160 C  CB    . LYS A 1 878 ? -26.973 42.145 27.661  1.00 48.02  ? 878  LYS A CB    1 
ATOM   7161 C  CG    . LYS A 1 878 ? -27.311 43.537 27.158  1.00 52.81  ? 878  LYS A CG    1 
ATOM   7162 C  CD    . LYS A 1 878 ? -27.279 44.552 28.290  1.00 54.90  ? 878  LYS A CD    1 
ATOM   7163 N  N     . PRO A 1 879 ? -24.727 40.664 25.907  1.00 41.02  ? 879  PRO A N     1 
ATOM   7164 C  CA    . PRO A 1 879 ? -23.705 40.695 24.852  1.00 39.45  ? 879  PRO A CA    1 
ATOM   7165 C  C     . PRO A 1 879 ? -23.938 39.667 23.740  1.00 38.10  ? 879  PRO A C     1 
ATOM   7166 O  O     . PRO A 1 879 ? -23.563 39.925 22.596  1.00 33.68  ? 879  PRO A O     1 
ATOM   7167 C  CB    . PRO A 1 879 ? -22.406 40.394 25.606  1.00 38.36  ? 879  PRO A CB    1 
ATOM   7168 C  CG    . PRO A 1 879 ? -22.828 39.683 26.828  1.00 39.33  ? 879  PRO A CG    1 
ATOM   7169 C  CD    . PRO A 1 879 ? -24.156 40.266 27.206  1.00 38.53  ? 879  PRO A CD    1 
ATOM   7170 N  N     . LEU A 1 880 ? -24.543 38.526 24.061  1.00 33.75  ? 880  LEU A N     1 
ATOM   7171 C  CA    . LEU A 1 880 ? -24.857 37.538 23.031  1.00 35.55  ? 880  LEU A CA    1 
ATOM   7172 C  C     . LEU A 1 880 ? -25.859 38.121 22.035  1.00 39.70  ? 880  LEU A C     1 
ATOM   7173 O  O     . LEU A 1 880 ? -25.766 37.882 20.829  1.00 42.71  ? 880  LEU A O     1 
ATOM   7174 C  CB    . LEU A 1 880 ? -25.403 36.246 23.643  1.00 33.93  ? 880  LEU A CB    1 
ATOM   7175 C  CG    . LEU A 1 880 ? -25.810 35.184 22.615  1.00 37.21  ? 880  LEU A CG    1 
ATOM   7176 C  CD1   . LEU A 1 880 ? -24.616 34.770 21.764  1.00 35.08  ? 880  LEU A CD1   1 
ATOM   7177 C  CD2   . LEU A 1 880 ? -26.442 33.976 23.285  1.00 36.11  ? 880  LEU A CD2   1 
ATOM   7178 N  N     . GLU A 1 881 ? -26.810 38.892 22.551  1.00 39.31  ? 881  GLU A N     1 
ATOM   7179 C  CA    . GLU A 1 881 ? -27.769 39.599 21.712  1.00 43.37  ? 881  GLU A CA    1 
ATOM   7180 C  C     . GLU A 1 881 ? -27.045 40.547 20.762  1.00 42.80  ? 881  GLU A C     1 
ATOM   7181 O  O     . GLU A 1 881 ? -27.428 40.692 19.603  1.00 40.95  ? 881  GLU A O     1 
ATOM   7182 C  CB    . GLU A 1 881 ? -28.767 40.370 22.580  1.00 46.29  ? 881  GLU A CB    1 
ATOM   7183 C  CG    . GLU A 1 881 ? -29.483 41.511 21.865  1.00 55.59  ? 881  GLU A CG    1 
ATOM   7184 C  CD    . GLU A 1 881 ? -30.397 41.033 20.753  1.00 60.03  ? 881  GLU A CD    1 
ATOM   7185 O  OE1   . GLU A 1 881 ? -30.913 39.898 20.848  1.00 61.43  ? 881  GLU A OE1   1 
ATOM   7186 O  OE2   . GLU A 1 881 ? -30.597 41.794 19.783  1.00 60.11  ? 881  GLU A OE2   1 
ATOM   7187 N  N     . GLY A 1 882 ? -25.986 41.181 21.256  1.00 39.87  ? 882  GLY A N     1 
ATOM   7188 C  CA    . GLY A 1 882 ? -25.193 42.082 20.442  1.00 37.28  ? 882  GLY A CA    1 
ATOM   7189 C  C     . GLY A 1 882 ? -24.450 41.360 19.334  1.00 39.29  ? 882  GLY A C     1 
ATOM   7190 O  O     . GLY A 1 882 ? -24.393 41.843 18.203  1.00 43.10  ? 882  GLY A O     1 
ATOM   7191 N  N     . PHE A 1 883 ? -23.875 40.204 19.660  1.00 35.66  ? 883  PHE A N     1 
ATOM   7192 C  CA    . PHE A 1 883 ? -23.167 39.390 18.674  1.00 39.17  ? 883  PHE A CA    1 
ATOM   7193 C  C     . PHE A 1 883 ? -24.113 38.963 17.557  1.00 40.46  ? 883  PHE A C     1 
ATOM   7194 O  O     . PHE A 1 883 ? -23.816 39.135 16.374  1.00 41.90  ? 883  PHE A O     1 
ATOM   7195 C  CB    . PHE A 1 883 ? -22.583 38.119 19.308  1.00 38.24  ? 883  PHE A CB    1 
ATOM   7196 C  CG    . PHE A 1 883 ? -21.601 38.369 20.422  1.00 37.28  ? 883  PHE A CG    1 
ATOM   7197 C  CD1   . PHE A 1 883 ? -21.035 39.618 20.617  1.00 37.52  ? 883  PHE A CD1   1 
ATOM   7198 C  CD2   . PHE A 1 883 ? -21.236 37.335 21.270  1.00 36.11  ? 883  PHE A CD2   1 
ATOM   7199 C  CE1   . PHE A 1 883 ? -20.137 39.834 21.644  1.00 35.23  ? 883  PHE A CE1   1 
ATOM   7200 C  CE2   . PHE A 1 883 ? -20.335 37.544 22.296  1.00 37.42  ? 883  PHE A CE2   1 
ATOM   7201 C  CZ    . PHE A 1 883 ? -19.786 38.794 22.484  1.00 34.99  ? 883  PHE A CZ    1 
ATOM   7202 N  N     . THR A 1 884 ? -25.252 38.402 17.951  1.00 38.88  ? 884  THR A N     1 
ATOM   7203 C  CA    . THR A 1 884 ? -26.190 37.788 17.015  1.00 41.09  ? 884  THR A CA    1 
ATOM   7204 C  C     . THR A 1 884 ? -26.949 38.801 16.159  1.00 42.86  ? 884  THR A C     1 
ATOM   7205 O  O     . THR A 1 884 ? -27.211 38.547 14.982  1.00 45.79  ? 884  THR A O     1 
ATOM   7206 C  CB    . THR A 1 884 ? -27.189 36.861 17.741  1.00 37.55  ? 884  THR A CB    1 
ATOM   7207 O  OG1   . THR A 1 884 ? -27.891 37.601 18.746  1.00 37.09  ? 884  THR A OG1   1 
ATOM   7208 C  CG2   . THR A 1 884 ? -26.455 35.699 18.398  1.00 36.74  ? 884  THR A CG2   1 
ATOM   7209 N  N     A SER A 1 885 ? -27.301 39.939 16.751  0.55 42.50  ? 885  SER A N     1 
ATOM   7210 N  N     B SER A 1 885 ? -27.306 39.938 16.752  0.45 42.58  ? 885  SER A N     1 
ATOM   7211 C  CA    A SER A 1 885 ? -27.976 41.002 16.014  0.55 45.01  ? 885  SER A CA    1 
ATOM   7212 C  CA    B SER A 1 885 ? -27.974 41.007 16.014  0.45 45.04  ? 885  SER A CA    1 
ATOM   7213 C  C     A SER A 1 885 ? -27.093 41.514 14.883  0.55 47.75  ? 885  SER A C     1 
ATOM   7214 C  C     B SER A 1 885 ? -27.090 41.503 14.879  0.45 47.69  ? 885  SER A C     1 
ATOM   7215 O  O     A SER A 1 885 ? -27.552 41.696 13.756  0.55 49.78  ? 885  SER A O     1 
ATOM   7216 O  O     B SER A 1 885 ? -27.547 41.666 13.748  0.45 49.73  ? 885  SER A O     1 
ATOM   7217 C  CB    A SER A 1 885 ? -28.351 42.156 16.946  0.55 44.80  ? 885  SER A CB    1 
ATOM   7218 C  CB    B SER A 1 885 ? -28.331 42.175 16.937  0.45 44.84  ? 885  SER A CB    1 
ATOM   7219 O  OG    A SER A 1 885 ? -28.925 43.227 16.218  0.55 47.21  ? 885  SER A OG    1 
ATOM   7220 O  OG    B SER A 1 885 ? -29.395 41.836 17.809  0.45 44.76  ? 885  SER A OG    1 
ATOM   7221 N  N     . ALA A 1 886 ? -25.820 41.738 15.195  1.00 47.82  ? 886  ALA A N     1 
ATOM   7222 C  CA    . ALA A 1 886 ? -24.852 42.191 14.208  1.00 48.51  ? 886  ALA A CA    1 
ATOM   7223 C  C     . ALA A 1 886 ? -24.679 41.141 13.119  1.00 45.73  ? 886  ALA A C     1 
ATOM   7224 O  O     . ALA A 1 886 ? -24.668 41.461 11.933  1.00 44.89  ? 886  ALA A O     1 
ATOM   7225 C  CB    . ALA A 1 886 ? -23.515 42.490 14.877  1.00 47.55  ? 886  ALA A CB    1 
ATOM   7226 N  N     . ALA A 1 887 ? -24.563 39.882 13.528  1.00 44.52  ? 887  ALA A N     1 
ATOM   7227 C  CA    . ALA A 1 887 ? -24.373 38.785 12.585  1.00 44.82  ? 887  ALA A CA    1 
ATOM   7228 C  C     . ALA A 1 887 ? -25.667 38.414 11.865  1.00 46.86  ? 887  ALA A C     1 
ATOM   7229 O  O     . ALA A 1 887 ? -25.660 37.576 10.963  1.00 48.42  ? 887  ALA A O     1 
ATOM   7230 C  CB    . ALA A 1 887 ? -23.801 37.573 13.299  1.00 41.90  ? 887  ALA A CB    1 
ATOM   7231 N  N     . LYS A 1 888 ? -26.767 39.043 12.272  1.00 47.57  ? 888  LYS A N     1 
ATOM   7232 C  CA    . LYS A 1 888 ? -28.093 38.775 11.710  1.00 49.85  ? 888  LYS A CA    1 
ATOM   7233 C  C     . LYS A 1 888 ? -28.516 37.320 11.905  1.00 51.52  ? 888  LYS A C     1 
ATOM   7234 O  O     . LYS A 1 888 ? -28.902 36.633 10.958  1.00 48.98  ? 888  LYS A O     1 
ATOM   7235 C  CB    . LYS A 1 888 ? -28.165 39.188 10.235  1.00 50.44  ? 888  LYS A CB    1 
ATOM   7236 C  CG    . LYS A 1 888 ? -28.015 40.686 10.023  1.00 53.55  ? 888  LYS A CG    1 
ATOM   7237 C  CD    . LYS A 1 888 ? -28.143 41.065 8.558   1.00 58.71  ? 888  LYS A CD    1 
ATOM   7238 C  CE    . LYS A 1 888 ? -28.271 42.572 8.394   1.00 60.77  ? 888  LYS A CE    1 
ATOM   7239 N  NZ    . LYS A 1 888 ? -27.120 43.303 8.989   1.00 59.79  ? 888  LYS A NZ    1 
ATOM   7240 N  N     . LEU A 1 889 ? -28.432 36.869 13.153  1.00 53.50  ? 889  LEU A N     1 
ATOM   7241 C  CA    . LEU A 1 889 ? -28.824 35.522 13.540  1.00 51.05  ? 889  LEU A CA    1 
ATOM   7242 C  C     . LEU A 1 889 ? -29.716 35.590 14.769  1.00 47.37  ? 889  LEU A C     1 
ATOM   7243 O  O     . LEU A 1 889 ? -29.882 36.653 15.368  1.00 45.72  ? 889  LEU A O     1 
ATOM   7244 C  CB    . LEU A 1 889 ? -27.588 34.683 13.869  1.00 53.72  ? 889  LEU A CB    1 
ATOM   7245 C  CG    . LEU A 1 889 ? -26.747 34.176 12.700  1.00 55.94  ? 889  LEU A CG    1 
ATOM   7246 C  CD1   . LEU A 1 889 ? -25.459 33.550 13.199  1.00 51.88  ? 889  LEU A CD1   1 
ATOM   7247 C  CD2   . LEU A 1 889 ? -27.543 33.176 11.881  1.00 63.66  ? 889  LEU A CD2   1 
ATOM   7248 N  N     . ASP A 1 890 ? -30.283 34.450 15.145  1.00 43.13  ? 890  ASP A N     1 
ATOM   7249 C  CA    . ASP A 1 890 ? -31.049 34.348 16.380  1.00 45.53  ? 890  ASP A CA    1 
ATOM   7250 C  C     . ASP A 1 890 ? -30.460 33.261 17.272  1.00 48.03  ? 890  ASP A C     1 
ATOM   7251 O  O     . ASP A 1 890 ? -30.047 32.206 16.789  1.00 47.15  ? 890  ASP A O     1 
ATOM   7252 C  CB    . ASP A 1 890 ? -32.521 34.052 16.085  1.00 50.52  ? 890  ASP A CB    1 
ATOM   7253 C  CG    . ASP A 1 890 ? -33.258 35.256 15.527  1.00 53.20  ? 890  ASP A CG    1 
ATOM   7254 O  OD1   . ASP A 1 890 ? -33.030 36.379 16.026  1.00 53.49  ? 890  ASP A OD1   1 
ATOM   7255 O  OD2   . ASP A 1 890 ? -34.064 35.079 14.588  1.00 54.26  ? 890  ASP A OD2   1 
ATOM   7256 N  N     . TYR A 1 891 ? -30.410 33.525 18.573  1.00 49.60  ? 891  TYR A N     1 
ATOM   7257 C  CA    . TYR A 1 891 ? -29.913 32.535 19.522  1.00 48.74  ? 891  TYR A CA    1 
ATOM   7258 C  C     . TYR A 1 891 ? -31.064 31.708 20.084  1.00 46.06  ? 891  TYR A C     1 
ATOM   7259 O  O     . TYR A 1 891 ? -30.850 30.713 20.774  1.00 45.12  ? 891  TYR A O     1 
ATOM   7260 C  CB    . TYR A 1 891 ? -29.102 33.194 20.644  1.00 42.21  ? 891  TYR A CB    1 
ATOM   7261 C  CG    . TYR A 1 891 ? -29.871 34.183 21.492  1.00 41.27  ? 891  TYR A CG    1 
ATOM   7262 C  CD1   . TYR A 1 891 ? -29.818 35.545 21.226  1.00 45.54  ? 891  TYR A CD1   1 
ATOM   7263 C  CD2   . TYR A 1 891 ? -30.634 33.758 22.572  1.00 42.25  ? 891  TYR A CD2   1 
ATOM   7264 C  CE1   . TYR A 1 891 ? -30.513 36.455 22.003  1.00 47.03  ? 891  TYR A CE1   1 
ATOM   7265 C  CE2   . TYR A 1 891 ? -31.334 34.659 23.354  1.00 44.60  ? 891  TYR A CE2   1 
ATOM   7266 C  CZ    . TYR A 1 891 ? -31.268 36.005 23.066  1.00 45.34  ? 891  TYR A CZ    1 
ATOM   7267 O  OH    . TYR A 1 891 ? -31.962 36.901 23.845  1.00 44.68  ? 891  TYR A OH    1 
ATOM   7268 N  N     . GLU A 1 892 ? -32.284 32.142 19.786  1.00 48.89  ? 892  GLU A N     1 
ATOM   7269 C  CA    . GLU A 1 892 ? -33.491 31.397 20.126  1.00 54.00  ? 892  GLU A CA    1 
ATOM   7270 C  C     . GLU A 1 892 ? -34.357 31.250 18.885  1.00 56.62  ? 892  GLU A C     1 
ATOM   7271 O  O     . GLU A 1 892 ? -34.392 32.143 18.038  1.00 58.25  ? 892  GLU A O     1 
ATOM   7272 C  CB    . GLU A 1 892 ? -34.285 32.116 21.217  1.00 58.86  ? 892  GLU A CB    1 
ATOM   7273 C  CG    . GLU A 1 892 ? -33.947 31.686 22.633  1.00 64.29  ? 892  GLU A CG    1 
ATOM   7274 C  CD    . GLU A 1 892 ? -34.748 32.443 23.675  1.00 68.18  ? 892  GLU A CD    1 
ATOM   7275 O  OE1   . GLU A 1 892 ? -35.040 31.861 24.741  1.00 69.75  ? 892  GLU A OE1   1 
ATOM   7276 O  OE2   . GLU A 1 892 ? -35.081 33.622 23.428  1.00 71.41  ? 892  GLU A OE2   1 
ATOM   7277 N  N     . LYS A 1 893 ? -35.053 30.123 18.775  1.00 58.66  ? 893  LYS A N     1 
ATOM   7278 C  CA    . LYS A 1 893 ? -35.975 29.909 17.668  1.00 59.63  ? 893  LYS A CA    1 
ATOM   7279 C  C     . LYS A 1 893 ? -37.120 30.914 17.739  1.00 59.82  ? 893  LYS A C     1 
ATOM   7280 O  O     . LYS A 1 893 ? -37.791 31.030 18.765  1.00 58.16  ? 893  LYS A O     1 
ATOM   7281 C  CB    . LYS A 1 893 ? -36.523 28.480 17.689  1.00 61.73  ? 893  LYS A CB    1 
ATOM   7282 N  N     . LYS A 1 894 ? -37.330 31.647 16.651  1.00 62.59  ? 894  LYS A N     1 
ATOM   7283 C  CA    . LYS A 1 894 ? -38.391 32.645 16.599  1.00 64.56  ? 894  LYS A CA    1 
ATOM   7284 C  C     . LYS A 1 894 ? -39.742 31.983 16.359  1.00 65.45  ? 894  LYS A C     1 
ATOM   7285 O  O     . LYS A 1 894 ? -39.811 30.817 15.971  1.00 62.81  ? 894  LYS A O     1 
ATOM   7286 C  CB    . LYS A 1 894 ? -38.106 33.678 15.506  1.00 66.74  ? 894  LYS A CB    1 
ATOM   7287 N  N     . ALA A 1 895 ? -40.814 32.734 16.594  1.00 67.51  ? 895  ALA A N     1 
ATOM   7288 C  CA    . ALA A 1 895 ? -42.164 32.221 16.395  1.00 67.47  ? 895  ALA A CA    1 
ATOM   7289 C  C     . ALA A 1 895 ? -42.623 32.437 14.957  1.00 69.82  ? 895  ALA A C     1 
ATOM   7290 O  O     . ALA A 1 895 ? -42.369 33.486 14.365  1.00 69.35  ? 895  ALA A O     1 
ATOM   7291 C  CB    . ALA A 1 895 ? -43.130 32.879 17.367  1.00 65.77  ? 895  ALA A CB    1 
ATOM   7292 N  N     . SER A 1 896 ? -43.300 31.437 14.402  1.00 71.48  ? 896  SER A N     1 
ATOM   7293 C  CA    . SER A 1 896 ? -43.787 31.509 13.030  1.00 71.64  ? 896  SER A CA    1 
ATOM   7294 C  C     . SER A 1 896 ? -45.194 30.937 12.915  1.00 69.88  ? 896  SER A C     1 
ATOM   7295 O  O     . SER A 1 896 ? -45.768 30.465 13.897  1.00 67.90  ? 896  SER A O     1 
ATOM   7296 C  CB    . SER A 1 896 ? -42.848 30.751 12.090  1.00 73.88  ? 896  SER A CB    1 
ATOM   7297 O  OG    . SER A 1 896 ? -42.951 29.350 12.291  1.00 74.18  ? 896  SER A OG    1 
ATOM   7298 N  N     . LEU A 1 897 ? -45.742 30.973 11.704  1.00 69.73  ? 897  LEU A N     1 
ATOM   7299 C  CA    . LEU A 1 897 ? -47.061 30.411 11.442  1.00 70.67  ? 897  LEU A CA    1 
ATOM   7300 C  C     . LEU A 1 897 ? -47.019 28.886 11.499  1.00 70.39  ? 897  LEU A C     1 
ATOM   7301 O  O     . LEU A 1 897 ? -48.054 28.229 11.602  1.00 70.92  ? 897  LEU A O     1 
ATOM   7302 C  CB    . LEU A 1 897 ? -47.582 30.877 10.081  1.00 72.29  ? 897  LEU A CB    1 
ATOM   7303 N  N     . PHE A 1 898 ? -45.813 28.331 11.436  1.00 70.46  ? 898  PHE A N     1 
ATOM   7304 C  CA    . PHE A 1 898 ? -45.624 26.886 11.490  1.00 73.60  ? 898  PHE A CA    1 
ATOM   7305 C  C     . PHE A 1 898 ? -45.873 26.321 12.887  1.00 71.38  ? 898  PHE A C     1 
ATOM   7306 O  O     . PHE A 1 898 ? -46.017 25.110 13.058  1.00 69.26  ? 898  PHE A O     1 
ATOM   7307 C  CB    . PHE A 1 898 ? -44.212 26.518 11.027  1.00 77.08  ? 898  PHE A CB    1 
ATOM   7308 C  CG    . PHE A 1 898 ? -43.999 26.677 9.550   1.00 82.76  ? 898  PHE A CG    1 
ATOM   7309 C  CD1   . PHE A 1 898 ? -44.183 25.605 8.695   1.00 83.78  ? 898  PHE A CD1   1 
ATOM   7310 C  CD2   . PHE A 1 898 ? -43.616 27.897 9.015   1.00 85.77  ? 898  PHE A CD2   1 
ATOM   7311 C  CE1   . PHE A 1 898 ? -43.989 25.743 7.337   1.00 86.46  ? 898  PHE A CE1   1 
ATOM   7312 C  CE2   . PHE A 1 898 ? -43.421 28.042 7.654   1.00 88.60  ? 898  PHE A CE2   1 
ATOM   7313 C  CZ    . PHE A 1 898 ? -43.608 26.962 6.815   1.00 88.13  ? 898  PHE A CZ    1 
ATOM   7314 N  N     . ASP A 1 899 ? -45.927 27.203 13.881  1.00 70.13  ? 899  ASP A N     1 
ATOM   7315 C  CA    . ASP A 1 899 ? -46.092 26.791 15.272  1.00 69.91  ? 899  ASP A CA    1 
ATOM   7316 C  C     . ASP A 1 899 ? -47.437 26.123 15.555  1.00 75.04  ? 899  ASP A C     1 
ATOM   7317 O  O     . ASP A 1 899 ? -47.614 25.494 16.598  1.00 78.74  ? 899  ASP A O     1 
ATOM   7318 C  CB    . ASP A 1 899 ? -45.899 27.981 16.215  1.00 67.20  ? 899  ASP A CB    1 
ATOM   7319 C  CG    . ASP A 1 899 ? -44.461 28.458 16.268  1.00 69.24  ? 899  ASP A CG    1 
ATOM   7320 O  OD1   . ASP A 1 899 ? -44.243 29.671 16.474  1.00 72.30  ? 899  ASP A OD1   1 
ATOM   7321 O  OD2   . ASP A 1 899 ? -43.546 27.622 16.105  1.00 65.85  ? 899  ASP A OD2   1 
ATOM   7322 N  N     . MET A 1 900 ? -48.383 26.258 14.632  1.00 74.49  ? 900  MET A N     1 
ATOM   7323 C  CA    . MET A 1 900 ? -49.713 25.695 14.840  1.00 77.97  ? 900  MET A CA    1 
ATOM   7324 C  C     . MET A 1 900 ? -49.903 24.349 14.143  1.00 80.06  ? 900  MET A C     1 
ATOM   7325 O  O     . MET A 1 900 ? -51.031 23.901 13.936  1.00 83.13  ? 900  MET A O     1 
ATOM   7326 C  CB    . MET A 1 900 ? -50.801 26.692 14.432  1.00 80.38  ? 900  MET A CB    1 
ATOM   7327 C  CG    . MET A 1 900 ? -50.797 27.081 12.966  1.00 81.02  ? 900  MET A CG    1 
ATOM   7328 S  SD    . MET A 1 900 ? -51.525 28.713 12.717  1.00 125.23 ? 900  MET A SD    1 
ATOM   7329 C  CE    . MET A 1 900 ? -52.820 28.704 13.955  1.00 91.78  ? 900  MET A CE    1 
ATOM   7330 N  N     . PHE A 1 901 ? -48.792 23.713 13.782  1.00 79.78  ? 901  PHE A N     1 
ATOM   7331 C  CA    . PHE A 1 901 ? -48.818 22.335 13.306  1.00 83.44  ? 901  PHE A CA    1 
ATOM   7332 C  C     . PHE A 1 901 ? -48.229 21.422 14.377  1.00 85.26  ? 901  PHE A C     1 
ATOM   7333 O  O     . PHE A 1 901 ? -47.291 21.805 15.079  1.00 83.92  ? 901  PHE A O     1 
ATOM   7334 C  CB    . PHE A 1 901 ? -48.050 22.186 11.989  1.00 82.13  ? 901  PHE A CB    1 
ATOM   7335 C  CG    . PHE A 1 901 ? -48.764 22.767 10.800  1.00 81.14  ? 901  PHE A CG    1 
ATOM   7336 C  CD1   . PHE A 1 901 ? -49.852 22.116 10.241  1.00 81.30  ? 901  PHE A CD1   1 
ATOM   7337 C  CD2   . PHE A 1 901 ? -48.343 23.960 10.237  1.00 80.03  ? 901  PHE A CD2   1 
ATOM   7338 C  CE1   . PHE A 1 901 ? -50.511 22.647 9.147   1.00 82.81  ? 901  PHE A CE1   1 
ATOM   7339 C  CE2   . PHE A 1 901 ? -48.997 24.496 9.143   1.00 81.18  ? 901  PHE A CE2   1 
ATOM   7340 C  CZ    . PHE A 1 901 ? -50.082 23.839 8.597   1.00 82.40  ? 901  PHE A CZ    1 
ATOM   7341 N  N     . ASP A 1 902 ? -48.787 20.220 14.499  1.00 87.28  ? 902  ASP A N     1 
ATOM   7342 C  CA    . ASP A 1 902 ? -48.396 19.278 15.547  1.00 86.47  ? 902  ASP A CA    1 
ATOM   7343 C  C     . ASP A 1 902 ? -46.904 18.950 15.529  1.00 84.91  ? 902  ASP A C     1 
ATOM   7344 O  O     . ASP A 1 902 ? -46.426 18.223 14.659  1.00 86.19  ? 902  ASP A O     1 
ATOM   7345 C  CB    . ASP A 1 902 ? -49.219 17.992 15.442  1.00 87.75  ? 902  ASP A CB    1 
ATOM   7346 O  "O5'" . DA  B 2 1   ? 4.303   62.569 39.235  1.00 85.32  ? 1    DA  T "O5'" 1 
ATOM   7347 C  "C5'" . DA  B 2 1   ? 3.518   63.363 38.350  1.00 83.39  ? 1    DA  T "C5'" 1 
ATOM   7348 C  "C4'" . DA  B 2 1   ? 4.169   63.459 36.981  1.00 80.58  ? 1    DA  T "C4'" 1 
ATOM   7349 O  "O4'" . DA  B 2 1   ? 5.485   64.058 37.114  1.00 82.05  ? 1    DA  T "O4'" 1 
ATOM   7350 C  "C3'" . DA  B 2 1   ? 4.371   62.126 36.266  1.00 76.22  ? 1    DA  T "C3'" 1 
ATOM   7351 O  "O3'" . DA  B 2 1   ? 4.067   62.271 34.879  1.00 73.58  ? 1    DA  T "O3'" 1 
ATOM   7352 C  "C2'" . DA  B 2 1   ? 5.850   61.827 36.494  1.00 76.47  ? 1    DA  T "C2'" 1 
ATOM   7353 C  "C1'" . DA  B 2 1   ? 6.450   63.228 36.501  1.00 79.39  ? 1    DA  T "C1'" 1 
ATOM   7354 N  N9    . DA  B 2 1   ? 7.696   63.332 37.255  1.00 80.12  ? 1    DA  T N9    1 
ATOM   7355 C  C8    . DA  B 2 1   ? 8.928   63.663 36.762  1.00 79.46  ? 1    DA  T C8    1 
ATOM   7356 N  N7    . DA  B 2 1   ? 9.875   63.682 37.671  1.00 82.11  ? 1    DA  T N7    1 
ATOM   7357 C  C5    . DA  B 2 1   ? 9.218   63.339 38.841  1.00 83.32  ? 1    DA  T C5    1 
ATOM   7358 C  C6    . DA  B 2 1   ? 9.662   63.182 40.170  1.00 85.49  ? 1    DA  T C6    1 
ATOM   7359 N  N6    . DA  B 2 1   ? 10.932  63.361 40.546  1.00 86.85  ? 1    DA  T N6    1 
ATOM   7360 N  N1    . DA  B 2 1   ? 8.747   62.833 41.098  1.00 87.12  ? 1    DA  T N1    1 
ATOM   7361 C  C2    . DA  B 2 1   ? 7.476   62.655 40.718  1.00 84.52  ? 1    DA  T C2    1 
ATOM   7362 N  N3    . DA  B 2 1   ? 6.940   62.773 39.504  1.00 80.33  ? 1    DA  T N3    1 
ATOM   7363 C  C4    . DA  B 2 1   ? 7.873   63.120 38.603  1.00 81.48  ? 1    DA  T C4    1 
ATOM   7364 P  P     . DC  B 2 2   ? 3.771   60.977 33.971  1.00 68.37  ? 2    DC  T P     1 
ATOM   7365 O  OP1   . DC  B 2 2   ? 3.243   61.448 32.670  1.00 56.68  ? 2    DC  T OP1   1 
ATOM   7366 O  OP2   . DC  B 2 2   ? 2.983   60.025 34.787  1.00 72.25  ? 2    DC  T OP2   1 
ATOM   7367 O  "O5'" . DC  B 2 2   ? 5.218   60.338 33.730  1.00 57.56  ? 2    DC  T "O5'" 1 
ATOM   7368 C  "C5'" . DC  B 2 2   ? 6.148   61.017 32.899  1.00 52.64  ? 2    DC  T "C5'" 1 
ATOM   7369 C  "C4'" . DC  B 2 2   ? 7.527   60.408 33.035  1.00 52.08  ? 2    DC  T "C4'" 1 
ATOM   7370 O  "O4'" . DC  B 2 2   ? 8.114   60.805 34.293  1.00 57.17  ? 2    DC  T "O4'" 1 
ATOM   7371 C  "C3'" . DC  B 2 2   ? 7.539   58.891 33.081  1.00 47.63  ? 2    DC  T "C3'" 1 
ATOM   7372 O  "O3'" . DC  B 2 2   ? 7.507   58.413 31.745  1.00 40.06  ? 2    DC  T "O3'" 1 
ATOM   7373 C  "C2'" . DC  B 2 2   ? 8.862   58.607 33.790  1.00 53.83  ? 2    DC  T "C2'" 1 
ATOM   7374 C  "C1'" . DC  B 2 2   ? 9.084   59.845 34.662  1.00 61.62  ? 2    DC  T "C1'" 1 
ATOM   7375 N  N1    . DC  B 2 2   ? 8.950   59.598 36.132  1.00 72.18  ? 2    DC  T N1    1 
ATOM   7376 C  C2    . DC  B 2 2   ? 9.895   60.137 37.013  1.00 76.42  ? 2    DC  T C2    1 
ATOM   7377 O  O2    . DC  B 2 2   ? 10.830  60.808 36.559  1.00 76.32  ? 2    DC  T O2    1 
ATOM   7378 N  N3    . DC  B 2 2   ? 9.760   59.907 38.344  1.00 81.18  ? 2    DC  T N3    1 
ATOM   7379 C  C4    . DC  B 2 2   ? 8.737   59.179 38.797  1.00 81.75  ? 2    DC  T C4    1 
ATOM   7380 N  N4    . DC  B 2 2   ? 8.645   58.980 40.116  1.00 85.92  ? 2    DC  T N4    1 
ATOM   7381 C  C5    . DC  B 2 2   ? 7.763   58.623 37.917  1.00 78.42  ? 2    DC  T C5    1 
ATOM   7382 C  C6    . DC  B 2 2   ? 7.907   58.856 36.608  1.00 74.92  ? 2    DC  T C6    1 
ATOM   7383 P  P     . DA  B 2 3   ? 7.635   56.843 31.430  1.00 29.89  ? 3    DA  T P     1 
ATOM   7384 O  OP1   . DA  B 2 3   ? 6.726   56.114 32.340  1.00 34.91  ? 3    DA  T OP1   1 
ATOM   7385 O  OP2   . DA  B 2 3   ? 9.080   56.512 31.413  1.00 30.58  ? 3    DA  T OP2   1 
ATOM   7386 O  "O5'" . DA  B 2 3   ? 7.085   56.711 29.935  1.00 30.30  ? 3    DA  T "O5'" 1 
ATOM   7387 C  "C5'" . DA  B 2 3   ? 5.710   56.927 29.641  1.00 26.60  ? 3    DA  T "C5'" 1 
ATOM   7388 C  "C4'" . DA  B 2 3   ? 5.543   57.318 28.182  1.00 31.86  ? 3    DA  T "C4'" 1 
ATOM   7389 O  "O4'" . DA  B 2 3   ? 6.087   56.281 27.323  1.00 28.66  ? 3    DA  T "O4'" 1 
ATOM   7390 C  "C3'" . DA  B 2 3   ? 4.107   57.489 27.703  1.00 29.62  ? 3    DA  T "C3'" 1 
ATOM   7391 O  "O3'" . DA  B 2 3   ? 3.636   58.791 28.006  1.00 32.63  ? 3    DA  T "O3'" 1 
ATOM   7392 C  "C2'" . DA  B 2 3   ? 4.281   57.304 26.201  1.00 28.99  ? 3    DA  T "C2'" 1 
ATOM   7393 C  "C1'" . DA  B 2 3   ? 5.279   56.152 26.165  1.00 30.27  ? 3    DA  T "C1'" 1 
ATOM   7394 N  N9    . DA  B 2 3   ? 4.609   54.855 26.175  1.00 29.62  ? 3    DA  T N9    1 
ATOM   7395 C  C8    . DA  B 2 3   ? 4.502   53.977 27.218  1.00 26.83  ? 3    DA  T C8    1 
ATOM   7396 N  N7    . DA  B 2 3   ? 3.826   52.891 26.923  1.00 28.11  ? 3    DA  T N7    1 
ATOM   7397 C  C5    . DA  B 2 3   ? 3.463   53.071 25.598  1.00 29.66  ? 3    DA  T C5    1 
ATOM   7398 C  C6    . DA  B 2 3   ? 2.733   52.276 24.692  1.00 30.66  ? 3    DA  T C6    1 
ATOM   7399 N  N6    . DA  B 2 3   ? 2.218   51.085 25.008  1.00 30.85  ? 3    DA  T N6    1 
ATOM   7400 N  N1    . DA  B 2 3   ? 2.550   52.752 23.441  1.00 29.72  ? 3    DA  T N1    1 
ATOM   7401 C  C2    . DA  B 2 3   ? 3.066   53.945 23.123  1.00 28.75  ? 3    DA  T C2    1 
ATOM   7402 N  N3    . DA  B 2 3   ? 3.769   54.778 23.888  1.00 30.53  ? 3    DA  T N3    1 
ATOM   7403 C  C4    . DA  B 2 3   ? 3.935   54.278 25.123  1.00 29.82  ? 3    DA  T C4    1 
ATOM   7404 P  P     . DG  B 2 4   ? 2.060   59.058 28.185  1.00 28.44  ? 4    DG  T P     1 
ATOM   7405 O  OP1   . DG  B 2 4   ? 1.904   60.394 28.802  1.00 32.59  ? 4    DG  T OP1   1 
ATOM   7406 O  OP2   . DG  B 2 4   ? 1.467   57.869 28.829  1.00 31.87  ? 4    DG  T OP2   1 
ATOM   7407 O  "O5'" . DG  B 2 4   ? 1.505   59.105 26.689  1.00 28.93  ? 4    DG  T "O5'" 1 
ATOM   7408 C  "C5'" . DG  B 2 4   ? 1.983   60.083 25.776  1.00 29.96  ? 4    DG  T "C5'" 1 
ATOM   7409 C  "C4'" . DG  B 2 4   ? 1.422   59.814 24.392  1.00 29.51  ? 4    DG  T "C4'" 1 
ATOM   7410 O  "O4'" . DG  B 2 4   ? 1.885   58.519 23.933  1.00 30.23  ? 4    DG  T "O4'" 1 
ATOM   7411 C  "C3'" . DG  B 2 4   ? -0.095  59.712 24.321  1.00 27.55  ? 4    DG  T "C3'" 1 
ATOM   7412 O  "O3'" . DG  B 2 4   ? -0.678  61.006 24.198  1.00 26.80  ? 4    DG  T "O3'" 1 
ATOM   7413 C  "C2'" . DG  B 2 4   ? -0.282  58.885 23.053  1.00 26.27  ? 4    DG  T "C2'" 1 
ATOM   7414 C  "C1'" . DG  B 2 4   ? 0.889   57.913 23.130  1.00 29.36  ? 4    DG  T "C1'" 1 
ATOM   7415 N  N9    . DG  B 2 4   ? 0.513   56.631 23.718  1.00 30.38  ? 4    DG  T N9    1 
ATOM   7416 C  C8    . DG  B 2 4   ? 0.738   56.200 25.002  1.00 27.12  ? 4    DG  T C8    1 
ATOM   7417 N  N7    . DG  B 2 4   ? 0.278   55.000 25.229  1.00 25.41  ? 4    DG  T N7    1 
ATOM   7418 C  C5    . DG  B 2 4   ? -0.284  54.610 24.018  1.00 31.89  ? 4    DG  T C5    1 
ATOM   7419 C  C6    . DG  B 2 4   ? -0.935  53.407 23.650  1.00 32.10  ? 4    DG  T C6    1 
ATOM   7420 O  O6    . DG  B 2 4   ? -1.143  52.413 24.356  1.00 30.61  ? 4    DG  T O6    1 
ATOM   7421 N  N1    . DG  B 2 4   ? -1.360  53.427 22.321  1.00 28.78  ? 4    DG  T N1    1 
ATOM   7422 C  C2    . DG  B 2 4   ? -1.173  54.486 21.461  1.00 31.29  ? 4    DG  T C2    1 
ATOM   7423 N  N2    . DG  B 2 4   ? -1.641  54.353 20.210  1.00 29.64  ? 4    DG  T N2    1 
ATOM   7424 N  N3    . DG  B 2 4   ? -0.563  55.612 21.796  1.00 31.90  ? 4    DG  T N3    1 
ATOM   7425 C  C4    . DG  B 2 4   ? -0.149  55.606 23.082  1.00 30.07  ? 4    DG  T C4    1 
ATOM   7426 P  P     . DG  B 2 5   ? -2.264  61.199 24.363  1.00 32.22  ? 5    DG  T P     1 
ATOM   7427 O  OP1   . DG  B 2 5   ? -2.537  62.654 24.328  1.00 35.53  ? 5    DG  T OP1   1 
ATOM   7428 O  OP2   . DG  B 2 5   ? -2.701  60.385 25.518  1.00 37.84  ? 5    DG  T OP2   1 
ATOM   7429 O  "O5'" . DG  B 2 5   ? -2.882  60.520 23.052  1.00 30.41  ? 5    DG  T "O5'" 1 
ATOM   7430 C  "C5'" . DG  B 2 5   ? -2.760  61.148 21.779  1.00 31.26  ? 5    DG  T "C5'" 1 
ATOM   7431 C  "C4'" . DG  B 2 5   ? -3.585  60.421 20.732  1.00 30.34  ? 5    DG  T "C4'" 1 
ATOM   7432 O  "O4'" . DG  B 2 5   ? -3.385  58.990 20.856  1.00 30.05  ? 5    DG  T "O4'" 1 
ATOM   7433 C  "C3'" . DG  B 2 5   ? -5.095  60.632 20.822  1.00 30.08  ? 5    DG  T "C3'" 1 
ATOM   7434 O  "O3'" . DG  B 2 5   ? -5.651  60.517 19.526  1.00 31.09  ? 5    DG  T "O3'" 1 
ATOM   7435 C  "C2'" . DG  B 2 5   ? -5.533  59.463 21.693  1.00 28.06  ? 5    DG  T "C2'" 1 
ATOM   7436 C  "C1'" . DG  B 2 5   ? -4.615  58.366 21.169  1.00 29.33  ? 5    DG  T "C1'" 1 
ATOM   7437 N  N9    . DG  B 2 5   ? -4.381  57.310 22.147  1.00 32.86  ? 5    DG  T N9    1 
ATOM   7438 C  C8    . DG  B 2 5   ? -3.800  57.443 23.387  1.00 31.27  ? 5    DG  T C8    1 
ATOM   7439 N  N7    . DG  B 2 5   ? -3.730  56.318 24.045  1.00 29.52  ? 5    DG  T N7    1 
ATOM   7440 C  C5    . DG  B 2 5   ? -4.302  55.384 23.188  1.00 29.37  ? 5    DG  T C5    1 
ATOM   7441 C  C6    . DG  B 2 5   ? -4.509  53.993 23.357  1.00 29.51  ? 5    DG  T C6    1 
ATOM   7442 O  O6    . DG  B 2 5   ? -4.214  53.287 24.331  1.00 32.00  ? 5    DG  T O6    1 
ATOM   7443 N  N1    . DG  B 2 5   ? -5.123  53.418 22.247  1.00 29.29  ? 5    DG  T N1    1 
ATOM   7444 C  C2    . DG  B 2 5   ? -5.495  54.103 21.115  1.00 34.66  ? 5    DG  T C2    1 
ATOM   7445 N  N2    . DG  B 2 5   ? -6.077  53.376 20.148  1.00 36.13  ? 5    DG  T N2    1 
ATOM   7446 N  N3    . DG  B 2 5   ? -5.309  55.407 20.943  1.00 30.84  ? 5    DG  T N3    1 
ATOM   7447 C  C4    . DG  B 2 5   ? -4.710  55.979 22.016  1.00 30.10  ? 5    DG  T C4    1 
ATOM   7448 P  P     . DT  B 2 6   ? -7.227  60.718 19.290  1.00 32.81  ? 6    DT  T P     1 
ATOM   7449 O  OP1   . DT  B 2 6   ? -7.365  61.331 17.949  1.00 33.61  ? 6    DT  T OP1   1 
ATOM   7450 O  OP2   . DT  B 2 6   ? -7.806  61.374 20.482  1.00 34.21  ? 6    DT  T OP2   1 
ATOM   7451 O  "O5'" . DT  B 2 6   ? -7.810  59.230 19.240  1.00 36.11  ? 6    DT  T "O5'" 1 
ATOM   7452 C  "C5'" . DT  B 2 6   ? -7.479  58.368 18.161  1.00 32.41  ? 6    DT  T "C5'" 1 
ATOM   7453 C  "C4'" . DT  B 2 6   ? -8.382  57.145 18.157  1.00 29.78  ? 6    DT  T "C4'" 1 
ATOM   7454 O  "O4'" . DT  B 2 6   ? -8.019  56.256 19.245  1.00 28.61  ? 6    DT  T "O4'" 1 
ATOM   7455 C  "C3'" . DT  B 2 6   ? -9.871  57.437 18.316  1.00 27.26  ? 6    DT  T "C3'" 1 
ATOM   7456 O  "O3'" . DT  B 2 6   ? -10.579 56.659 17.359  1.00 31.16  ? 6    DT  T "O3'" 1 
ATOM   7457 C  "C2'" . DT  B 2 6   ? -10.178 57.012 19.752  1.00 26.52  ? 6    DT  T "C2'" 1 
ATOM   7458 C  "C1'" . DT  B 2 6   ? -9.172  55.887 19.972  1.00 26.71  ? 6    DT  T "C1'" 1 
ATOM   7459 N  N1    . DT  B 2 6   ? -8.763  55.660 21.397  1.00 26.91  ? 6    DT  T N1    1 
ATOM   7460 C  C2    . DT  B 2 6   ? -8.809  54.381 21.906  1.00 28.79  ? 6    DT  T C2    1 
ATOM   7461 O  O2    . DT  B 2 6   ? -9.172  53.416 21.262  1.00 28.47  ? 6    DT  T O2    1 
ATOM   7462 N  N3    . DT  B 2 6   ? -8.409  54.263 23.211  1.00 33.65  ? 6    DT  T N3    1 
ATOM   7463 C  C4    . DT  B 2 6   ? -7.974  55.274 24.045  1.00 31.95  ? 6    DT  T C4    1 
ATOM   7464 O  O4    . DT  B 2 6   ? -7.637  55.065 25.205  1.00 31.57  ? 6    DT  T O4    1 
ATOM   7465 C  C5    . DT  B 2 6   ? -7.945  56.589 23.456  1.00 30.14  ? 6    DT  T C5    1 
ATOM   7466 C  C7    . DT  B 2 6   ? -7.487  57.758 24.280  1.00 27.61  ? 6    DT  T C7    1 
ATOM   7467 C  C6    . DT  B 2 6   ? -8.334  56.719 22.176  1.00 30.39  ? 6    DT  T C6    1 
ATOM   7468 P  P     . DA  B 2 7   ? -12.151 56.887 17.121  1.00 33.43  ? 7    DA  T P     1 
ATOM   7469 O  OP1   . DA  B 2 7   ? -12.436 56.476 15.727  1.00 34.35  ? 7    DA  T OP1   1 
ATOM   7470 O  OP2   . DA  B 2 7   ? -12.504 58.246 17.581  1.00 33.22  ? 7    DA  T OP2   1 
ATOM   7471 O  "O5'" . DA  B 2 7   ? -12.845 55.851 18.121  1.00 34.82  ? 7    DA  T "O5'" 1 
ATOM   7472 C  "C5'" . DA  B 2 7   ? -12.492 54.478 18.051  1.00 34.55  ? 7    DA  T "C5'" 1 
ATOM   7473 C  "C4'" . DA  B 2 7   ? -13.176 53.692 19.151  1.00 36.78  ? 7    DA  T "C4'" 1 
ATOM   7474 O  "O4'" . DA  B 2 7   ? -12.351 53.711 20.347  1.00 35.73  ? 7    DA  T "O4'" 1 
ATOM   7475 C  "C3'" . DA  B 2 7   ? -14.551 54.216 19.564  1.00 37.29  ? 7    DA  T "C3'" 1 
ATOM   7476 O  "O3'" . DA  B 2 7   ? -15.454 53.124 19.602  1.00 41.76  ? 7    DA  T "O3'" 1 
ATOM   7477 C  "C2'" . DA  B 2 7   ? -14.306 54.763 20.967  1.00 38.32  ? 7    DA  T "C2'" 1 
ATOM   7478 C  "C1'" . DA  B 2 7   ? -13.226 53.801 21.447  1.00 37.04  ? 7    DA  T "C1'" 1 
ATOM   7479 N  N9    . DA  B 2 7   ? -12.520 54.255 22.643  1.00 37.07  ? 7    DA  T N9    1 
ATOM   7480 C  C8    . DA  B 2 7   ? -12.011 55.501 22.885  1.00 35.15  ? 7    DA  T C8    1 
ATOM   7481 N  N7    . DA  B 2 7   ? -11.438 55.620 24.061  1.00 34.94  ? 7    DA  T N7    1 
ATOM   7482 C  C5    . DA  B 2 7   ? -11.584 54.363 24.631  1.00 35.67  ? 7    DA  T C5    1 
ATOM   7483 C  C6    . DA  B 2 7   ? -11.192 53.828 25.878  1.00 33.54  ? 7    DA  T C6    1 
ATOM   7484 N  N6    . DA  B 2 7   ? -10.540 54.528 26.811  1.00 33.88  ? 7    DA  T N6    1 
ATOM   7485 N  N1    . DA  B 2 7   ? -11.496 52.540 26.133  1.00 34.62  ? 7    DA  T N1    1 
ATOM   7486 C  C2    . DA  B 2 7   ? -12.149 51.836 25.199  1.00 34.67  ? 7    DA  T C2    1 
ATOM   7487 N  N3    . DA  B 2 7   ? -12.565 52.227 23.994  1.00 32.95  ? 7    DA  T N3    1 
ATOM   7488 C  C4    . DA  B 2 7   ? -12.251 53.512 23.770  1.00 34.86  ? 7    DA  T C4    1 
ATOM   7489 P  P     . DA  B 2 8   ? -17.036 53.355 19.441  1.00 35.46  ? 8    DA  T P     1 
ATOM   7490 O  OP1   . DA  B 2 8   ? -17.343 53.264 17.996  1.00 35.39  ? 8    DA  T OP1   1 
ATOM   7491 O  OP2   . DA  B 2 8   ? -17.434 54.556 20.207  1.00 35.44  ? 8    DA  T OP2   1 
ATOM   7492 O  "O5'" . DA  B 2 8   ? -17.669 52.078 20.163  1.00 37.22  ? 8    DA  T "O5'" 1 
ATOM   7493 C  "C5'" . DA  B 2 8   ? -17.105 50.799 19.891  1.00 35.00  ? 8    DA  T "C5'" 1 
ATOM   7494 C  "C4'" . DA  B 2 8   ? -16.997 49.993 21.169  1.00 40.11  ? 8    DA  T "C4'" 1 
ATOM   7495 O  "O4'" . DA  B 2 8   ? -15.918 50.518 21.971  1.00 43.96  ? 8    DA  T "O4'" 1 
ATOM   7496 C  "C3'" . DA  B 2 8   ? -18.228 50.082 22.054  1.00 43.59  ? 8    DA  T "C3'" 1 
ATOM   7497 O  "O3'" . DA  B 2 8   ? -19.098 49.011 21.734  1.00 42.16  ? 8    DA  T "O3'" 1 
ATOM   7498 C  "C2'" . DA  B 2 8   ? -17.670 49.940 23.466  1.00 47.42  ? 8    DA  T "C2'" 1 
ATOM   7499 C  "C1'" . DA  B 2 8   ? -16.200 50.315 23.341  1.00 45.86  ? 8    DA  T "C1'" 1 
ATOM   7500 N  N9    . DA  B 2 8   ? -15.866 51.531 24.077  1.00 45.98  ? 8    DA  T N9    1 
ATOM   7501 C  C8    . DA  B 2 8   ? -15.915 52.819 23.617  1.00 38.08  ? 8    DA  T C8    1 
ATOM   7502 N  N7    . DA  B 2 8   ? -15.555 53.707 24.512  1.00 40.52  ? 8    DA  T N7    1 
ATOM   7503 C  C5    . DA  B 2 8   ? -15.252 52.955 25.635  1.00 39.71  ? 8    DA  T C5    1 
ATOM   7504 C  C6    . DA  B 2 8   ? -14.805 53.302 26.927  1.00 35.79  ? 8    DA  T C6    1 
ATOM   7505 N  N6    . DA  B 2 8   ? -14.574 54.558 27.322  1.00 26.98  ? 8    DA  T N6    1 
ATOM   7506 N  N1    . DA  B 2 8   ? -14.603 52.300 27.809  1.00 41.71  ? 8    DA  T N1    1 
ATOM   7507 C  C2    . DA  B 2 8   ? -14.829 51.040 27.420  1.00 41.71  ? 8    DA  T C2    1 
ATOM   7508 N  N3    . DA  B 2 8   ? -15.247 50.593 26.237  1.00 40.10  ? 8    DA  T N3    1 
ATOM   7509 C  C4    . DA  B 2 8   ? -15.442 51.610 25.384  1.00 41.93  ? 8    DA  T C4    1 
ATOM   7510 P  P     . DG  B 2 9   ? -20.605 48.999 22.284  1.00 46.24  ? 9    DG  T P     1 
ATOM   7511 O  OP1   . DG  B 2 9   ? -21.330 47.927 21.568  1.00 46.25  ? 9    DG  T OP1   1 
ATOM   7512 O  OP2   . DG  B 2 9   ? -21.114 50.387 22.234  1.00 54.48  ? 9    DG  T OP2   1 
ATOM   7513 O  "O5'" . DG  B 2 9   ? -20.447 48.601 23.824  1.00 40.71  ? 9    DG  T "O5'" 1 
ATOM   7514 C  "C5'" . DG  B 2 9   ? -19.929 47.338 24.214  1.00 38.22  ? 9    DG  T "C5'" 1 
ATOM   7515 C  "C4'" . DG  B 2 9   ? -20.086 47.179 25.714  1.00 37.74  ? 9    DG  T "C4'" 1 
ATOM   7516 O  "O4'" . DG  B 2 9   ? -19.220 48.132 26.382  1.00 39.26  ? 9    DG  T "O4'" 1 
ATOM   7517 C  "C3'" . DG  B 2 9   ? -21.495 47.442 26.235  1.00 40.63  ? 9    DG  T "C3'" 1 
ATOM   7518 O  "O3'" . DG  B 2 9   ? -21.805 46.492 27.245  1.00 48.69  ? 9    DG  T "O3'" 1 
ATOM   7519 C  "C2'" . DG  B 2 9   ? -21.420 48.860 26.796  1.00 40.69  ? 9    DG  T "C2'" 1 
ATOM   7520 C  "C1'" . DG  B 2 9   ? -19.969 48.952 27.256  1.00 39.37  ? 9    DG  T "C1'" 1 
ATOM   7521 N  N9    . DG  B 2 9   ? -19.438 50.311 27.196  1.00 42.66  ? 9    DG  T N9    1 
ATOM   7522 C  C8    . DG  B 2 9   ? -19.491 51.174 26.128  1.00 42.15  ? 9    DG  T C8    1 
ATOM   7523 N  N7    . DG  B 2 9   ? -18.933 52.328 26.366  1.00 42.48  ? 9    DG  T N7    1 
ATOM   7524 C  C5    . DG  B 2 9   ? -18.482 52.228 27.676  1.00 39.11  ? 9    DG  T C5    1 
ATOM   7525 C  C6    . DG  B 2 9   ? -17.797 53.169 28.483  1.00 38.35  ? 9    DG  T C6    1 
ATOM   7526 O  O6    . DG  B 2 9   ? -17.442 54.320 28.190  1.00 41.92  ? 9    DG  T O6    1 
ATOM   7527 N  N1    . DG  B 2 9   ? -17.529 52.663 29.752  1.00 36.67  ? 9    DG  T N1    1 
ATOM   7528 C  C2    . DG  B 2 9   ? -17.874 51.405 30.185  1.00 40.29  ? 9    DG  T C2    1 
ATOM   7529 N  N2    . DG  B 2 9   ? -17.529 51.090 31.443  1.00 40.64  ? 9    DG  T N2    1 
ATOM   7530 N  N3    . DG  B 2 9   ? -18.513 50.514 29.439  1.00 43.72  ? 9    DG  T N3    1 
ATOM   7531 C  C4    . DG  B 2 9   ? -18.786 50.992 28.200  1.00 43.00  ? 9    DG  T C4    1 
ATOM   7532 P  P     . DC  B 2 10  ? -23.253 46.487 27.943  1.00 53.78  ? 10   DC  T P     1 
ATOM   7533 O  OP1   . DC  B 2 10  ? -23.643 45.071 28.132  1.00 56.91  ? 10   DC  T OP1   1 
ATOM   7534 O  OP2   . DC  B 2 10  ? -24.139 47.401 27.187  1.00 60.22  ? 10   DC  T OP2   1 
ATOM   7535 O  "O5'" . DC  B 2 10  ? -22.987 47.133 29.379  1.00 42.96  ? 10   DC  T "O5'" 1 
ATOM   7536 C  "C5'" . DC  B 2 10  ? -21.822 46.755 30.096  1.00 42.05  ? 10   DC  T "C5'" 1 
ATOM   7537 C  "C4'" . DC  B 2 10  ? -21.875 47.214 31.542  1.00 41.01  ? 10   DC  T "C4'" 1 
ATOM   7538 O  "O4'" . DC  B 2 10  ? -21.180 48.480 31.673  1.00 35.82  ? 10   DC  T "O4'" 1 
ATOM   7539 C  "C3'" . DC  B 2 10  ? -23.265 47.433 32.127  1.00 42.44  ? 10   DC  T "C3'" 1 
ATOM   7540 O  "O3'" . DC  B 2 10  ? -23.241 47.032 33.492  1.00 47.14  ? 10   DC  T "O3'" 1 
ATOM   7541 C  "C2'" . DC  B 2 10  ? -23.483 48.936 31.969  1.00 38.95  ? 10   DC  T "C2'" 1 
ATOM   7542 C  "C1'" . DC  B 2 10  ? -22.069 49.496 32.093  1.00 36.59  ? 10   DC  T "C1'" 1 
ATOM   7543 N  N1    . DC  B 2 10  ? -21.798 50.704 31.248  1.00 36.97  ? 10   DC  T N1    1 
ATOM   7544 C  C2    . DC  B 2 10  ? -21.095 51.781 31.800  1.00 39.06  ? 10   DC  T C2    1 
ATOM   7545 O  O2    . DC  B 2 10  ? -20.717 51.716 32.975  1.00 46.09  ? 10   DC  T O2    1 
ATOM   7546 N  N3    . DC  B 2 10  ? -20.845 52.870 31.034  1.00 35.61  ? 10   DC  T N3    1 
ATOM   7547 C  C4    . DC  B 2 10  ? -21.265 52.911 29.770  1.00 38.88  ? 10   DC  T C4    1 
ATOM   7548 N  N4    . DC  B 2 10  ? -20.990 54.015 29.065  1.00 38.62  ? 10   DC  T N4    1 
ATOM   7549 C  C5    . DC  B 2 10  ? -21.986 51.825 29.186  1.00 38.35  ? 10   DC  T C5    1 
ATOM   7550 C  C6    . DC  B 2 10  ? -22.224 50.751 29.952  1.00 39.00  ? 10   DC  T C6    1 
ATOM   7551 P  P     . DA  B 2 11  ? -24.589 47.013 34.367  1.00 54.13  ? 11   DA  T P     1 
ATOM   7552 O  OP1   . DA  B 2 11  ? -24.365 46.048 35.464  1.00 58.69  ? 11   DA  T OP1   1 
ATOM   7553 O  OP2   . DA  B 2 11  ? -25.747 46.862 33.457  1.00 53.15  ? 11   DA  T OP2   1 
ATOM   7554 O  "O5'" . DA  B 2 11  ? -24.640 48.467 35.020  1.00 50.57  ? 11   DA  T "O5'" 1 
ATOM   7555 C  "C5'" . DA  B 2 11  ? -23.640 48.782 35.976  1.00 47.62  ? 11   DA  T "C5'" 1 
ATOM   7556 C  "C4'" . DA  B 2 11  ? -23.765 50.214 36.453  1.00 41.29  ? 11   DA  T "C4'" 1 
ATOM   7557 O  "O4'" . DA  B 2 11  ? -23.395 51.111 35.380  1.00 39.04  ? 11   DA  T "O4'" 1 
ATOM   7558 C  "C3'" . DA  B 2 11  ? -25.157 50.626 36.919  1.00 44.66  ? 11   DA  T "C3'" 1 
ATOM   7559 O  "O3'" . DA  B 2 11  ? -25.012 51.081 38.259  1.00 44.82  ? 11   DA  T "O3'" 1 
ATOM   7560 C  "C2'" . DA  B 2 11  ? -25.579 51.724 35.937  1.00 43.24  ? 11   DA  T "C2'" 1 
ATOM   7561 C  "C1'" . DA  B 2 11  ? -24.247 52.234 35.404  1.00 41.61  ? 11   DA  T "C1'" 1 
ATOM   7562 N  N9    . DA  B 2 11  ? -24.288 52.767 34.045  1.00 44.64  ? 11   DA  T N9    1 
ATOM   7563 C  C8    . DA  B 2 11  ? -24.846 52.187 32.940  1.00 46.27  ? 11   DA  T C8    1 
ATOM   7564 N  N7    . DA  B 2 11  ? -24.719 52.900 31.846  1.00 46.00  ? 11   DA  T N7    1 
ATOM   7565 C  C5    . DA  B 2 11  ? -24.024 54.025 32.260  1.00 43.55  ? 11   DA  T C5    1 
ATOM   7566 C  C6    . DA  B 2 11  ? -23.572 55.173 31.576  1.00 41.24  ? 11   DA  T C6    1 
ATOM   7567 N  N6    . DA  B 2 11  ? -23.763 55.378 30.269  1.00 41.60  ? 11   DA  T N6    1 
ATOM   7568 N  N1    . DA  B 2 11  ? -22.914 56.107 32.292  1.00 39.53  ? 11   DA  T N1    1 
ATOM   7569 C  C2    . DA  B 2 11  ? -22.721 55.903 33.600  1.00 36.23  ? 11   DA  T C2    1 
ATOM   7570 N  N3    . DA  B 2 11  ? -23.095 54.868 34.350  1.00 40.15  ? 11   DA  T N3    1 
ATOM   7571 C  C4    . DA  B 2 11  ? -23.749 53.957 33.613  1.00 43.05  ? 11   DA  T C4    1 
ATOM   7572 P  P     . DG  B 2 12  ? -26.258 51.683 39.072  1.00 50.80  ? 12   DG  T P     1 
ATOM   7573 O  OP1   . DG  B 2 12  ? -26.102 51.239 40.474  1.00 50.63  ? 12   DG  T OP1   1 
ATOM   7574 O  OP2   . DG  B 2 12  ? -27.513 51.379 38.349  1.00 55.66  ? 12   DG  T OP2   1 
ATOM   7575 O  "O5'" . DG  B 2 12  ? -26.007 53.258 39.020  1.00 46.06  ? 12   DG  T "O5'" 1 
ATOM   7576 C  "C5'" . DG  B 2 12  ? -24.825 53.789 39.600  1.00 44.54  ? 12   DG  T "C5'" 1 
ATOM   7577 C  "C4'" . DG  B 2 12  ? -24.887 55.304 39.672  1.00 45.01  ? 12   DG  T "C4'" 1 
ATOM   7578 O  "O4'" . DG  B 2 12  ? -24.688 55.863 38.349  1.00 44.37  ? 12   DG  T "O4'" 1 
ATOM   7579 C  "C3'" . DG  B 2 12  ? -26.199 55.887 40.182  1.00 48.54  ? 12   DG  T "C3'" 1 
ATOM   7580 O  "O3'" . DG  B 2 12  ? -25.887 57.026 40.972  1.00 54.01  ? 12   DG  T "O3'" 1 
ATOM   7581 C  "C2'" . DG  B 2 12  ? -26.949 56.256 38.902  1.00 47.27  ? 12   DG  T "C2'" 1 
ATOM   7582 C  "C1'" . DG  B 2 12  ? -25.810 56.634 37.961  1.00 47.62  ? 12   DG  T "C1'" 1 
ATOM   7583 N  N9    . DG  B 2 12  ? -26.051 56.340 36.551  1.00 48.32  ? 12   DG  T N9    1 
ATOM   7584 C  C8    . DG  B 2 12  ? -26.482 55.154 36.006  1.00 48.37  ? 12   DG  T C8    1 
ATOM   7585 N  N7    . DG  B 2 12  ? -26.593 55.191 34.707  1.00 45.91  ? 12   DG  T N7    1 
ATOM   7586 C  C5    . DG  B 2 12  ? -26.206 56.482 34.367  1.00 44.64  ? 12   DG  T C5    1 
ATOM   7587 C  C6    . DG  B 2 12  ? -26.119 57.111 33.102  1.00 45.51  ? 12   DG  T C6    1 
ATOM   7588 O  O6    . DG  B 2 12  ? -26.376 56.637 31.987  1.00 48.41  ? 12   DG  T O6    1 
ATOM   7589 N  N1    . DG  B 2 12  ? -25.681 58.430 33.208  1.00 47.23  ? 12   DG  T N1    1 
ATOM   7590 C  C2    . DG  B 2 12  ? -25.364 59.060 34.388  1.00 48.64  ? 12   DG  T C2    1 
ATOM   7591 N  N2    . DG  B 2 12  ? -24.958 60.335 34.295  1.00 47.49  ? 12   DG  T N2    1 
ATOM   7592 N  N3    . DG  B 2 12  ? -25.441 58.481 35.579  1.00 51.20  ? 12   DG  T N3    1 
ATOM   7593 C  C4    . DG  B 2 12  ? -25.867 57.198 35.492  1.00 47.59  ? 12   DG  T C4    1 
ATOM   7594 P  P     . DT  B 2 13  ? -27.045 57.827 41.746  1.00 61.82  ? 13   DT  T P     1 
ATOM   7595 O  OP1   . DT  B 2 13  ? -26.458 58.337 43.003  1.00 66.39  ? 13   DT  T OP1   1 
ATOM   7596 O  OP2   . DT  B 2 13  ? -28.255 56.977 41.784  1.00 87.37  ? 13   DT  T OP2   1 
ATOM   7597 O  "O5'" . DT  B 2 13  ? -27.344 59.074 40.793  1.00 61.37  ? 13   DT  T "O5'" 1 
ATOM   7598 C  "C5'" . DT  B 2 13  ? -26.311 60.020 40.574  1.00 63.09  ? 13   DT  T "C5'" 1 
ATOM   7599 C  "C4'" . DT  B 2 13  ? -26.774 61.161 39.685  1.00 62.79  ? 13   DT  T "C4'" 1 
ATOM   7600 O  "O4'" . DT  B 2 13  ? -26.896 60.702 38.315  1.00 61.37  ? 13   DT  T "O4'" 1 
ATOM   7601 C  "C3'" . DT  B 2 13  ? -28.117 61.790 40.045  1.00 71.70  ? 13   DT  T "C3'" 1 
ATOM   7602 O  "O3'" . DT  B 2 13  ? -27.948 63.197 39.972  1.00 74.87  ? 13   DT  T "O3'" 1 
ATOM   7603 C  "C2'" . DT  B 2 13  ? -29.062 61.264 38.964  1.00 59.66  ? 13   DT  T "C2'" 1 
ATOM   7604 C  "C1'" . DT  B 2 13  ? -28.113 61.171 37.775  1.00 61.68  ? 13   DT  T "C1'" 1 
ATOM   7605 N  N1    . DT  B 2 13  ? -28.502 60.216 36.698  1.00 59.59  ? 13   DT  T N1    1 
ATOM   7606 C  C2    . DT  B 2 13  ? -28.382 60.614 35.385  1.00 58.56  ? 13   DT  T C2    1 
ATOM   7607 O  O2    . DT  B 2 13  ? -27.988 61.720 35.058  1.00 60.62  ? 13   DT  T O2    1 
ATOM   7608 N  N3    . DT  B 2 13  ? -28.747 59.668 34.461  1.00 57.30  ? 13   DT  T N3    1 
ATOM   7609 C  C4    . DT  B 2 13  ? -29.206 58.389 34.718  1.00 58.54  ? 13   DT  T C4    1 
ATOM   7610 O  O4    . DT  B 2 13  ? -29.511 57.606 33.823  1.00 58.23  ? 13   DT  T O4    1 
ATOM   7611 C  C5    . DT  B 2 13  ? -29.302 58.036 36.112  1.00 58.71  ? 13   DT  T C5    1 
ATOM   7612 C  C7    . DT  B 2 13  ? -29.789 56.673 36.507  1.00 54.22  ? 13   DT  T C7    1 
ATOM   7613 C  C6    . DT  B 2 13  ? -28.947 58.951 37.024  1.00 58.69  ? 13   DT  T C6    1 
ATOM   7614 P  P     . DC  B 2 14  ? -29.043 64.190 40.601  1.00 74.33  ? 14   DC  T P     1 
ATOM   7615 O  OP1   . DC  B 2 14  ? -28.321 65.134 41.484  1.00 76.33  ? 14   DC  T OP1   1 
ATOM   7616 O  OP2   . DC  B 2 14  ? -30.160 63.382 41.140  1.00 75.78  ? 14   DC  T OP2   1 
ATOM   7617 O  "O5'" . DC  B 2 14  ? -29.584 64.997 39.334  1.00 67.89  ? 14   DC  T "O5'" 1 
ATOM   7618 C  "C5'" . DC  B 2 14  ? -28.671 65.292 38.288  1.00 67.37  ? 14   DC  T "C5'" 1 
ATOM   7619 C  "C4'" . DC  B 2 14  ? -29.402 65.635 37.005  1.00 68.36  ? 14   DC  T "C4'" 1 
ATOM   7620 O  "O4'" . DC  B 2 14  ? -29.619 64.433 36.223  1.00 65.36  ? 14   DC  T "O4'" 1 
ATOM   7621 C  "C3'" . DC  B 2 14  ? -30.772 66.274 37.196  1.00 70.87  ? 14   DC  T "C3'" 1 
ATOM   7622 O  "O3'" . DC  B 2 14  ? -30.877 67.365 36.296  1.00 76.12  ? 14   DC  T "O3'" 1 
ATOM   7623 C  "C2'" . DC  B 2 14  ? -31.740 65.145 36.842  1.00 66.90  ? 14   DC  T "C2'" 1 
ATOM   7624 C  "C1'" . DC  B 2 14  ? -30.952 64.424 35.759  1.00 63.36  ? 14   DC  T "C1'" 1 
ATOM   7625 N  N1    . DC  B 2 14  ? -31.349 63.006 35.528  1.00 59.04  ? 14   DC  T N1    1 
ATOM   7626 C  C2    . DC  B 2 14  ? -31.406 62.521 34.217  1.00 58.71  ? 14   DC  T C2    1 
ATOM   7627 O  O2    . DC  B 2 14  ? -31.133 63.284 33.282  1.00 59.64  ? 14   DC  T O2    1 
ATOM   7628 N  N3    . DC  B 2 14  ? -31.762 61.230 34.009  1.00 53.75  ? 14   DC  T N3    1 
ATOM   7629 C  C4    . DC  B 2 14  ? -32.050 60.442 35.045  1.00 57.35  ? 14   DC  T C4    1 
ATOM   7630 N  N4    . DC  B 2 14  ? -32.394 59.176 34.785  1.00 55.67  ? 14   DC  T N4    1 
ATOM   7631 C  C5    . DC  B 2 14  ? -31.996 60.917 36.390  1.00 57.87  ? 14   DC  T C5    1 
ATOM   7632 C  C6    . DC  B 2 14  ? -31.643 62.193 36.583  1.00 58.44  ? 14   DC  T C6    1 
ATOM   7633 P  P     . DC  B 2 15  ? -31.920 68.556 36.571  1.00 85.16  ? 15   DC  T P     1 
ATOM   7634 O  OP1   . DC  B 2 15  ? -31.128 69.760 36.907  1.00 88.80  ? 15   DC  T OP1   1 
ATOM   7635 O  OP2   . DC  B 2 15  ? -32.959 68.071 37.507  1.00 82.76  ? 15   DC  T OP2   1 
ATOM   7636 O  "O5'" . DC  B 2 15  ? -32.614 68.777 35.150  1.00 72.11  ? 15   DC  T "O5'" 1 
ATOM   7637 C  "C5'" . DC  B 2 15  ? -31.947 68.308 33.988  1.00 72.05  ? 15   DC  T "C5'" 1 
ATOM   7638 C  "C4'" . DC  B 2 15  ? -32.933 68.083 32.860  1.00 72.58  ? 15   DC  T "C4'" 1 
ATOM   7639 O  "O4'" . DC  B 2 15  ? -33.157 66.659 32.691  1.00 70.83  ? 15   DC  T "O4'" 1 
ATOM   7640 C  "C3'" . DC  B 2 15  ? -34.299 68.722 33.074  1.00 74.92  ? 15   DC  T "C3'" 1 
ATOM   7641 O  "O3'" . DC  B 2 15  ? -34.695 69.340 31.857  1.00 78.96  ? 15   DC  T "O3'" 1 
ATOM   7642 C  "C2'" . DC  B 2 15  ? -35.189 67.543 33.461  1.00 70.33  ? 15   DC  T "C2'" 1 
ATOM   7643 C  "C1'" . DC  B 2 15  ? -34.541 66.377 32.729  1.00 68.73  ? 15   DC  T "C1'" 1 
ATOM   7644 N  N1    . DC  B 2 15  ? -34.739 65.079 33.432  1.00 65.18  ? 15   DC  T N1    1 
ATOM   7645 C  C2    . DC  B 2 15  ? -34.885 63.902 32.689  1.00 60.35  ? 15   DC  T C2    1 
ATOM   7646 O  O2    . DC  B 2 15  ? -34.848 63.958 31.453  1.00 56.89  ? 15   DC  T O2    1 
ATOM   7647 N  N3    . DC  B 2 15  ? -35.063 62.730 33.350  1.00 58.64  ? 15   DC  T N3    1 
ATOM   7648 C  C4    . DC  B 2 15  ? -35.098 62.712 34.685  1.00 58.58  ? 15   DC  T C4    1 
ATOM   7649 N  N4    . DC  B 2 15  ? -35.275 61.534 35.292  1.00 56.47  ? 15   DC  T N4    1 
ATOM   7650 C  C5    . DC  B 2 15  ? -34.951 63.902 35.458  1.00 60.01  ? 15   DC  T C5    1 
ATOM   7651 C  C6    . DC  B 2 15  ? -34.776 65.050 34.796  1.00 62.97  ? 15   DC  T C6    1 
ATOM   7652 P  P     . DG  B 2 16  ? -36.089 70.131 31.746  1.00 74.08  ? 16   DG  T P     1 
ATOM   7653 O  OP1   . DG  B 2 16  ? -35.787 71.438 31.123  1.00 79.94  ? 16   DG  T OP1   1 
ATOM   7654 O  OP2   . DG  B 2 16  ? -36.790 70.095 33.049  1.00 73.10  ? 16   DG  T OP2   1 
ATOM   7655 O  "O5'" . DG  B 2 16  ? -36.924 69.260 30.699  1.00 61.08  ? 16   DG  T "O5'" 1 
ATOM   7656 C  "C5'" . DG  B 2 16  ? -36.291 68.883 29.483  1.00 61.22  ? 16   DG  T "C5'" 1 
ATOM   7657 C  "C4'" . DG  B 2 16  ? -37.138 67.923 28.665  1.00 58.52  ? 16   DG  T "C4'" 1 
ATOM   7658 O  "O4'" . DG  B 2 16  ? -37.155 66.623 29.306  1.00 55.39  ? 16   DG  T "O4'" 1 
ATOM   7659 C  "C3'" . DG  B 2 16  ? -38.595 68.326 28.471  1.00 61.69  ? 16   DG  T "C3'" 1 
ATOM   7660 O  "O3'" . DG  B 2 16  ? -38.997 67.974 27.150  1.00 63.27  ? 16   DG  T "O3'" 1 
ATOM   7661 C  "C2'" . DG  B 2 16  ? -39.332 67.514 29.534  1.00 56.80  ? 16   DG  T "C2'" 1 
ATOM   7662 C  "C1'" . DG  B 2 16  ? -38.475 66.257 29.650  1.00 54.37  ? 16   DG  T "C1'" 1 
ATOM   7663 N  N9    . DG  B 2 16  ? -38.436 65.689 30.995  1.00 55.16  ? 16   DG  T N9    1 
ATOM   7664 C  C8    . DG  B 2 16  ? -38.342 66.376 32.183  1.00 54.77  ? 16   DG  T C8    1 
ATOM   7665 N  N7    . DG  B 2 16  ? -38.326 65.601 33.233  1.00 52.59  ? 16   DG  T N7    1 
ATOM   7666 C  C5    . DG  B 2 16  ? -38.411 64.317 32.708  1.00 51.10  ? 16   DG  T C5    1 
ATOM   7667 C  C6    . DG  B 2 16  ? -38.437 63.064 33.366  1.00 51.01  ? 16   DG  T C6    1 
ATOM   7668 O  O6    . DG  B 2 16  ? -38.385 62.832 34.582  1.00 55.18  ? 16   DG  T O6    1 
ATOM   7669 N  N1    . DG  B 2 16  ? -38.531 62.011 32.461  1.00 46.77  ? 16   DG  T N1    1 
ATOM   7670 C  C2    . DG  B 2 16  ? -38.595 62.151 31.096  1.00 46.47  ? 16   DG  T C2    1 
ATOM   7671 N  N2    . DG  B 2 16  ? -38.682 61.014 30.391  1.00 45.51  ? 16   DG  T N2    1 
ATOM   7672 N  N3    . DG  B 2 16  ? -38.573 63.319 30.467  1.00 47.09  ? 16   DG  T N3    1 
ATOM   7673 C  C4    . DG  B 2 16  ? -38.479 64.354 31.333  1.00 48.73  ? 16   DG  T C4    1 
ATOM   7674 P  P     . DC  B 2 17  ? -40.473 68.331 26.624  1.00 65.64  ? 17   DC  T P     1 
ATOM   7675 O  OP1   . DC  B 2 17  ? -40.428 68.330 25.146  1.00 65.08  ? 17   DC  T OP1   1 
ATOM   7676 O  OP2   . DC  B 2 17  ? -40.933 69.536 27.349  1.00 66.95  ? 17   DC  T OP2   1 
ATOM   7677 O  "O5'" . DC  B 2 17  ? -41.360 67.088 27.098  1.00 51.94  ? 17   DC  T "O5'" 1 
ATOM   7678 C  "C5'" . DC  B 2 17  ? -41.203 65.839 26.441  1.00 50.23  ? 17   DC  T "C5'" 1 
ATOM   7679 C  "C4'" . DC  B 2 17  ? -42.009 64.753 27.128  1.00 49.30  ? 17   DC  T "C4'" 1 
ATOM   7680 O  "O4'" . DC  B 2 17  ? -41.492 64.529 28.466  1.00 48.33  ? 17   DC  T "O4'" 1 
ATOM   7681 C  "C3'" . DC  B 2 17  ? -43.498 65.055 27.294  1.00 51.15  ? 17   DC  T "C3'" 1 
ATOM   7682 O  "O3'" . DC  B 2 17  ? -44.238 63.912 26.895  1.00 53.44  ? 17   DC  T "O3'" 1 
ATOM   7683 C  "C2'" . DC  B 2 17  ? -43.635 65.300 28.794  1.00 52.12  ? 17   DC  T "C2'" 1 
ATOM   7684 C  "C1'" . DC  B 2 17  ? -42.606 64.300 29.299  1.00 49.13  ? 17   DC  T "C1'" 1 
ATOM   7685 N  N1    . DC  B 2 17  ? -42.237 64.460 30.734  1.00 47.26  ? 17   DC  T N1    1 
ATOM   7686 C  C2    . DC  B 2 17  ? -41.978 63.318 31.497  1.00 48.78  ? 17   DC  T C2    1 
ATOM   7687 O  O2    . DC  B 2 17  ? -42.050 62.205 30.959  1.00 46.81  ? 17   DC  T O2    1 
ATOM   7688 N  N3    . DC  B 2 17  ? -41.647 63.461 32.803  1.00 50.98  ? 17   DC  T N3    1 
ATOM   7689 C  C4    . DC  B 2 17  ? -41.578 64.678 33.344  1.00 53.64  ? 17   DC  T C4    1 
ATOM   7690 N  N4    . DC  B 2 17  ? -41.249 64.770 34.637  1.00 56.80  ? 17   DC  T N4    1 
ATOM   7691 C  C5    . DC  B 2 17  ? -41.841 65.856 32.583  1.00 53.60  ? 17   DC  T C5    1 
ATOM   7692 C  C6    . DC  B 2 17  ? -42.166 65.701 31.295  1.00 51.70  ? 17   DC  T C6    1 
ATOM   7693 P  P     . DG  B 2 18  ? -45.742 64.065 26.354  1.00 50.29  ? 18   DG  T P     1 
ATOM   7694 O  OP1   . DG  B 2 18  ? -46.361 62.721 26.368  1.00 49.50  ? 18   DG  T OP1   1 
ATOM   7695 O  OP2   . DG  B 2 18  ? -45.684 64.844 25.096  1.00 51.17  ? 18   DG  T OP2   1 
ATOM   7696 O  "O5'" . DG  B 2 18  ? -46.459 64.971 27.459  1.00 49.88  ? 18   DG  T "O5'" 1 
ATOM   7697 C  "C5'" . DG  B 2 18  ? -47.877 65.061 27.515  1.00 45.49  ? 18   DG  T "C5'" 1 
ATOM   7698 C  "C4'" . DG  B 2 18  ? -48.332 64.913 28.953  1.00 40.52  ? 18   DG  T "C4'" 1 
ATOM   7699 O  "O4'" . DG  B 2 18  ? -49.613 65.564 29.142  1.00 40.53  ? 18   DG  T "O4'" 1 
ATOM   7700 C  "C3'" . DG  B 2 18  ? -48.527 63.473 29.409  1.00 40.71  ? 18   DG  T "C3'" 1 
ATOM   7701 O  "O3'" . DG  B 2 18  ? -48.188 63.387 30.783  1.00 41.47  ? 18   DG  T "O3'" 1 
ATOM   7702 C  "C2'" . DG  B 2 18  ? -50.021 63.256 29.181  1.00 37.17  ? 18   DG  T "C2'" 1 
ATOM   7703 C  "C1'" . DG  B 2 18  ? -50.561 64.619 29.602  1.00 38.95  ? 18   DG  T "C1'" 1 
ATOM   7704 N  N9    . DG  B 2 18  ? -51.857 64.973 29.030  1.00 38.40  ? 18   DG  T N9    1 
ATOM   7705 C  C8    . DG  B 2 18  ? -53.003 65.287 29.724  1.00 39.21  ? 18   DG  T C8    1 
ATOM   7706 N  N7    . DG  B 2 18  ? -54.015 65.578 28.954  1.00 39.20  ? 18   DG  T N7    1 
ATOM   7707 C  C5    . DG  B 2 18  ? -53.506 65.449 27.665  1.00 41.98  ? 18   DG  T C5    1 
ATOM   7708 C  C6    . DG  B 2 18  ? -54.138 65.640 26.413  1.00 41.37  ? 18   DG  T C6    1 
ATOM   7709 O  O6    . DG  B 2 18  ? -55.311 65.967 26.187  1.00 42.82  ? 18   DG  T O6    1 
ATOM   7710 N  N1    . DG  B 2 18  ? -53.267 65.409 25.352  1.00 38.90  ? 18   DG  T N1    1 
ATOM   7711 C  C2    . DG  B 2 18  ? -51.949 65.045 25.483  1.00 40.44  ? 18   DG  T C2    1 
ATOM   7712 N  N2    . DG  B 2 18  ? -51.268 64.870 24.342  1.00 40.66  ? 18   DG  T N2    1 
ATOM   7713 N  N3    . DG  B 2 18  ? -51.343 64.863 26.649  1.00 40.31  ? 18   DG  T N3    1 
ATOM   7714 C  C4    . DG  B 2 18  ? -52.179 65.081 27.694  1.00 40.47  ? 18   DG  T C4    1 
ATOM   7715 C  "C4'" . DG  C 3 1   ? -43.499 54.361 36.876  1.00 73.57  ? 102  DG  P "C4'" 1 
ATOM   7716 O  "O4'" . DG  C 3 1   ? -43.503 55.636 36.184  1.00 73.55  ? 102  DG  P "O4'" 1 
ATOM   7717 C  "C3'" . DG  C 3 1   ? -42.093 53.809 36.682  1.00 70.60  ? 102  DG  P "C3'" 1 
ATOM   7718 O  "O3'" . DG  C 3 1   ? -42.020 53.100 35.450  1.00 69.79  ? 102  DG  P "O3'" 1 
ATOM   7719 C  "C2'" . DG  C 3 1   ? -41.256 55.084 36.652  1.00 68.94  ? 102  DG  P "C2'" 1 
ATOM   7720 C  "C1'" . DG  C 3 1   ? -42.177 56.037 35.896  1.00 69.55  ? 102  DG  P "C1'" 1 
ATOM   7721 N  N9    . DG  C 3 1   ? -42.029 57.438 36.281  1.00 68.19  ? 102  DG  P N9    1 
ATOM   7722 C  C8    . DG  C 3 1   ? -41.981 57.947 37.557  1.00 68.30  ? 102  DG  P C8    1 
ATOM   7723 N  N7    . DG  C 3 1   ? -41.847 59.245 37.595  1.00 66.24  ? 102  DG  P N7    1 
ATOM   7724 C  C5    . DG  C 3 1   ? -41.804 59.622 36.259  1.00 67.40  ? 102  DG  P C5    1 
ATOM   7725 C  C6    . DG  C 3 1   ? -41.669 60.906 35.675  1.00 67.74  ? 102  DG  P C6    1 
ATOM   7726 O  O6    . DG  C 3 1   ? -41.555 62.002 36.243  1.00 66.73  ? 102  DG  P O6    1 
ATOM   7727 N  N1    . DG  C 3 1   ? -41.671 60.843 34.283  1.00 67.18  ? 102  DG  P N1    1 
ATOM   7728 C  C2    . DG  C 3 1   ? -41.789 59.686 33.548  1.00 67.78  ? 102  DG  P C2    1 
ATOM   7729 N  N2    . DG  C 3 1   ? -41.772 59.822 32.214  1.00 60.53  ? 102  DG  P N2    1 
ATOM   7730 N  N3    . DG  C 3 1   ? -41.916 58.478 34.083  1.00 68.06  ? 102  DG  P N3    1 
ATOM   7731 C  C4    . DG  C 3 1   ? -41.915 58.521 35.438  1.00 67.65  ? 102  DG  P C4    1 
ATOM   7732 P  P     . DC  C 3 2   ? -40.781 52.122 35.147  1.00 78.90  ? 103  DC  P P     1 
ATOM   7733 O  OP1   . DC  C 3 2   ? -41.325 50.865 34.586  1.00 84.11  ? 103  DC  P OP1   1 
ATOM   7734 O  OP2   . DC  C 3 2   ? -39.930 52.074 36.356  1.00 75.05  ? 103  DC  P OP2   1 
ATOM   7735 O  "O5'" . DC  C 3 2   ? -39.965 52.881 34.000  1.00 76.08  ? 103  DC  P "O5'" 1 
ATOM   7736 C  "C5'" . DC  C 3 2   ? -40.609 53.258 32.786  1.00 76.01  ? 103  DC  P "C5'" 1 
ATOM   7737 C  "C4'" . DC  C 3 2   ? -39.703 54.117 31.920  1.00 74.17  ? 103  DC  P "C4'" 1 
ATOM   7738 O  "O4'" . DC  C 3 2   ? -39.783 55.501 32.353  1.00 70.87  ? 103  DC  P "O4'" 1 
ATOM   7739 C  "C3'" . DC  C 3 2   ? -38.217 53.763 31.954  1.00 74.22  ? 103  DC  P "C3'" 1 
ATOM   7740 O  "O3'" . DC  C 3 2   ? -37.629 54.029 30.688  1.00 78.08  ? 103  DC  P "O3'" 1 
ATOM   7741 C  "C2'" . DC  C 3 2   ? -37.679 54.754 32.977  1.00 69.89  ? 103  DC  P "C2'" 1 
ATOM   7742 C  "C1'" . DC  C 3 2   ? -38.467 55.979 32.533  1.00 68.34  ? 103  DC  P "C1'" 1 
ATOM   7743 N  N1    . DC  C 3 2   ? -38.460 57.099 33.513  1.00 63.89  ? 103  DC  P N1    1 
ATOM   7744 C  C2    . DC  C 3 2   ? -38.522 58.416 33.045  1.00 61.09  ? 103  DC  P C2    1 
ATOM   7745 O  O2    . DC  C 3 2   ? -38.589 58.621 31.827  1.00 59.00  ? 103  DC  P O2    1 
ATOM   7746 N  N3    . DC  C 3 2   ? -38.511 59.431 33.943  1.00 58.91  ? 103  DC  P N3    1 
ATOM   7747 C  C4    . DC  C 3 2   ? -38.439 59.165 35.248  1.00 59.13  ? 103  DC  P C4    1 
ATOM   7748 N  N4    . DC  C 3 2   ? -38.430 60.198 36.095  1.00 58.85  ? 103  DC  P N4    1 
ATOM   7749 C  C5    . DC  C 3 2   ? -38.373 57.829 35.743  1.00 61.77  ? 103  DC  P C5    1 
ATOM   7750 C  C6    . DC  C 3 2   ? -38.384 56.835 34.849  1.00 62.48  ? 103  DC  P C6    1 
ATOM   7751 P  P     . DG  C 3 3   ? -37.457 52.860 29.599  1.00 71.96  ? 104  DG  P P     1 
ATOM   7752 O  OP1   . DG  C 3 3   ? -38.737 52.120 29.527  1.00 77.35  ? 104  DG  P OP1   1 
ATOM   7753 O  OP2   . DG  C 3 3   ? -36.200 52.141 29.902  1.00 66.56  ? 104  DG  P OP2   1 
ATOM   7754 O  "O5'" . DG  C 3 3   ? -37.249 53.654 28.225  1.00 72.64  ? 104  DG  P "O5'" 1 
ATOM   7755 C  "C5'" . DG  C 3 3   ? -38.138 54.722 27.914  1.00 71.72  ? 104  DG  P "C5'" 1 
ATOM   7756 C  "C4'" . DG  C 3 3   ? -37.564 55.722 26.920  1.00 70.74  ? 104  DG  P "C4'" 1 
ATOM   7757 O  "O4'" . DG  C 3 3   ? -37.288 56.977 27.592  1.00 69.20  ? 104  DG  P "O4'" 1 
ATOM   7758 C  "C3'" . DG  C 3 3   ? -36.251 55.368 26.240  1.00 70.14  ? 104  DG  P "C3'" 1 
ATOM   7759 O  "O3'" . DG  C 3 3   ? -36.201 56.105 25.024  1.00 68.40  ? 104  DG  P "O3'" 1 
ATOM   7760 C  "C2'" . DG  C 3 3   ? -35.222 55.863 27.254  1.00 69.05  ? 104  DG  P "C2'" 1 
ATOM   7761 C  "C1'" . DG  C 3 3   ? -35.895 57.115 27.811  1.00 69.34  ? 104  DG  P "C1'" 1 
ATOM   7762 N  N9    . DG  C 3 3   ? -35.708 57.311 29.244  1.00 68.83  ? 104  DG  P N9    1 
ATOM   7763 C  C8    . DG  C 3 3   ? -35.626 56.345 30.216  1.00 68.49  ? 104  DG  P C8    1 
ATOM   7764 N  N7    . DG  C 3 3   ? -35.465 56.830 31.417  1.00 66.47  ? 104  DG  P N7    1 
ATOM   7765 C  C5    . DG  C 3 3   ? -35.446 58.206 31.230  1.00 64.00  ? 104  DG  P C5    1 
ATOM   7766 C  C6    . DG  C 3 3   ? -35.301 59.256 32.167  1.00 59.63  ? 104  DG  P C6    1 
ATOM   7767 O  O6    . DG  C 3 3   ? -35.158 59.178 33.395  1.00 56.69  ? 104  DG  P O6    1 
ATOM   7768 N  N1    . DG  C 3 3   ? -35.335 60.505 31.551  1.00 58.25  ? 104  DG  P N1    1 
ATOM   7769 C  C2    . DG  C 3 3   ? -35.489 60.713 30.200  1.00 59.84  ? 104  DG  P C2    1 
ATOM   7770 N  N2    . DG  C 3 3   ? -35.497 61.989 29.789  1.00 60.70  ? 104  DG  P N2    1 
ATOM   7771 N  N3    . DG  C 3 3   ? -35.626 59.738 29.312  1.00 62.07  ? 104  DG  P N3    1 
ATOM   7772 C  C4    . DG  C 3 3   ? -35.595 58.517 29.897  1.00 65.54  ? 104  DG  P C4    1 
ATOM   7773 P  P     . DG  C 3 4   ? -35.000 55.890 23.979  1.00 93.87  ? 105  DG  P P     1 
ATOM   7774 O  OP1   . DG  C 3 4   ? -35.606 55.839 22.630  1.00 95.38  ? 105  DG  P OP1   1 
ATOM   7775 O  OP2   . DG  C 3 4   ? -34.154 54.771 24.451  1.00 93.31  ? 105  DG  P OP2   1 
ATOM   7776 O  "O5'" . DG  C 3 4   ? -34.149 57.237 24.096  1.00 77.38  ? 105  DG  P "O5'" 1 
ATOM   7777 C  "C5'" . DG  C 3 4   ? -34.831 58.479 24.175  1.00 75.16  ? 105  DG  P "C5'" 1 
ATOM   7778 C  "C4'" . DG  C 3 4   ? -33.871 59.609 24.500  1.00 73.21  ? 105  DG  P "C4'" 1 
ATOM   7779 O  "O4'" . DG  C 3 4   ? -33.753 59.746 25.939  1.00 69.94  ? 105  DG  P "O4'" 1 
ATOM   7780 C  "C3'" . DG  C 3 4   ? -32.455 59.442 23.959  1.00 76.19  ? 105  DG  P "C3'" 1 
ATOM   7781 O  "O3'" . DG  C 3 4   ? -32.055 60.688 23.398  1.00 78.35  ? 105  DG  P "O3'" 1 
ATOM   7782 C  "C2'" . DG  C 3 4   ? -31.640 59.055 25.194  1.00 73.47  ? 105  DG  P "C2'" 1 
ATOM   7783 C  "C1'" . DG  C 3 4   ? -32.391 59.764 26.313  1.00 69.87  ? 105  DG  P "C1'" 1 
ATOM   7784 N  N9    . DG  C 3 4   ? -32.278 59.111 27.614  1.00 64.66  ? 105  DG  P N9    1 
ATOM   7785 C  C8    . DG  C 3 4   ? -32.250 57.761 27.871  1.00 62.40  ? 105  DG  P C8    1 
ATOM   7786 N  N7    . DG  C 3 4   ? -32.146 57.478 29.140  1.00 59.99  ? 105  DG  P N7    1 
ATOM   7787 C  C5    . DG  C 3 4   ? -32.106 58.720 29.765  1.00 58.95  ? 105  DG  P C5    1 
ATOM   7788 C  C6    . DG  C 3 4   ? -32.000 59.053 31.138  1.00 57.75  ? 105  DG  P C6    1 
ATOM   7789 O  O6    . DG  C 3 4   ? -31.916 58.291 32.112  1.00 57.10  ? 105  DG  P O6    1 
ATOM   7790 N  N1    . DG  C 3 4   ? -31.992 60.432 31.334  1.00 56.39  ? 105  DG  P N1    1 
ATOM   7791 C  C2    . DG  C 3 4   ? -32.077 61.371 30.333  1.00 60.36  ? 105  DG  P C2    1 
ATOM   7792 N  N2    . DG  C 3 4   ? -32.055 62.656 30.717  1.00 60.89  ? 105  DG  P N2    1 
ATOM   7793 N  N3    . DG  C 3 4   ? -32.178 61.072 29.044  1.00 61.08  ? 105  DG  P N3    1 
ATOM   7794 C  C4    . DG  C 3 4   ? -32.186 59.733 28.837  1.00 60.21  ? 105  DG  P C4    1 
ATOM   7795 P  P     . DA  C 3 5   ? -30.596 60.874 22.750  1.00 81.63  ? 106  DA  P P     1 
ATOM   7796 O  OP1   . DA  C 3 5   ? -30.775 61.679 21.522  1.00 83.15  ? 106  DA  P OP1   1 
ATOM   7797 O  OP2   . DA  C 3 5   ? -29.925 59.557 22.666  1.00 81.68  ? 106  DA  P OP2   1 
ATOM   7798 O  "O5'" . DA  C 3 5   ? -29.818 61.763 23.826  1.00 70.51  ? 106  DA  P "O5'" 1 
ATOM   7799 C  "C5'" . DA  C 3 5   ? -30.366 63.017 24.215  1.00 66.99  ? 106  DA  P "C5'" 1 
ATOM   7800 C  "C4'" . DA  C 3 5   ? -29.504 63.709 25.258  1.00 64.25  ? 106  DA  P "C4'" 1 
ATOM   7801 O  "O4'" . DA  C 3 5   ? -29.656 63.041 26.535  1.00 62.96  ? 106  DA  P "O4'" 1 
ATOM   7802 C  "C3'" . DA  C 3 5   ? -28.007 63.733 24.970  1.00 64.62  ? 106  DA  P "C3'" 1 
ATOM   7803 O  "O3'" . DA  C 3 5   ? -27.467 64.970 25.410  1.00 65.37  ? 106  DA  P "O3'" 1 
ATOM   7804 C  "C2'" . DA  C 3 5   ? -27.470 62.578 25.807  1.00 64.04  ? 106  DA  P "C2'" 1 
ATOM   7805 C  "C1'" . DA  C 3 5   ? -28.391 62.640 27.020  1.00 62.55  ? 106  DA  P "C1'" 1 
ATOM   7806 N  N9    . DA  C 3 5   ? -28.549 61.357 27.695  1.00 62.06  ? 106  DA  P N9    1 
ATOM   7807 C  C8    . DA  C 3 5   ? -28.705 60.131 27.111  1.00 61.96  ? 106  DA  P C8    1 
ATOM   7808 N  N7    . DA  C 3 5   ? -28.826 59.148 27.971  1.00 62.64  ? 106  DA  P N7    1 
ATOM   7809 C  C5    . DA  C 3 5   ? -28.742 59.773 29.204  1.00 62.53  ? 106  DA  P C5    1 
ATOM   7810 C  C6    . DA  C 3 5   ? -28.798 59.284 30.525  1.00 61.53  ? 106  DA  P C6    1 
ATOM   7811 N  N6    . DA  C 3 5   ? -28.960 57.991 30.823  1.00 63.30  ? 106  DA  P N6    1 
ATOM   7812 N  N1    . DA  C 3 5   ? -28.683 60.178 31.529  1.00 59.32  ? 106  DA  P N1    1 
ATOM   7813 C  C2    . DA  C 3 5   ? -28.522 61.472 31.229  1.00 58.85  ? 106  DA  P C2    1 
ATOM   7814 N  N3    . DA  C 3 5   ? -28.455 62.048 30.029  1.00 61.64  ? 106  DA  P N3    1 
ATOM   7815 C  C4    . DA  C 3 5   ? -28.572 61.135 29.052  1.00 62.84  ? 106  DA  P C4    1 
ATOM   7816 P  P     . DC  C 3 6   ? -25.968 65.385 25.011  1.00 78.20  ? 107  DC  P P     1 
ATOM   7817 O  OP1   . DC  C 3 6   ? -25.970 66.841 24.747  1.00 85.18  ? 107  DC  P OP1   1 
ATOM   7818 O  OP2   . DC  C 3 6   ? -25.502 64.443 23.970  1.00 78.53  ? 107  DC  P OP2   1 
ATOM   7819 O  "O5'" . DC  C 3 6   ? -25.123 65.106 26.342  1.00 82.92  ? 107  DC  P "O5'" 1 
ATOM   7820 C  "C5'" . DC  C 3 6   ? -25.441 65.816 27.534  1.00 80.56  ? 107  DC  P "C5'" 1 
ATOM   7821 C  "C4'" . DC  C 3 6   ? -24.829 65.153 28.754  1.00 71.24  ? 107  DC  P "C4'" 1 
ATOM   7822 O  "O4'" . DC  C 3 6   ? -25.454 63.862 28.979  1.00 63.71  ? 107  DC  P "O4'" 1 
ATOM   7823 C  "C3'" . DC  C 3 6   ? -23.326 64.890 28.660  1.00 69.02  ? 107  DC  P "C3'" 1 
ATOM   7824 O  "O3'" . DC  C 3 6   ? -22.630 65.642 29.651  1.00 70.42  ? 107  DC  P "O3'" 1 
ATOM   7825 C  "C2'" . DC  C 3 6   ? -23.190 63.389 28.911  1.00 63.62  ? 107  DC  P "C2'" 1 
ATOM   7826 C  "C1'" . DC  C 3 6   ? -24.495 63.048 29.614  1.00 60.44  ? 107  DC  P "C1'" 1 
ATOM   7827 N  N1    . DC  C 3 6   ? -24.866 61.612 29.482  1.00 56.30  ? 107  DC  P N1    1 
ATOM   7828 C  C2    . DC  C 3 6   ? -25.107 60.863 30.637  1.00 53.77  ? 107  DC  P C2    1 
ATOM   7829 O  O2    . DC  C 3 6   ? -25.015 61.418 31.739  1.00 53.61  ? 107  DC  P O2    1 
ATOM   7830 N  N3    . DC  C 3 6   ? -25.436 59.552 30.514  1.00 49.04  ? 107  DC  P N3    1 
ATOM   7831 C  C4    . DC  C 3 6   ? -25.526 58.997 29.303  1.00 50.21  ? 107  DC  P C4    1 
ATOM   7832 N  N4    . DC  C 3 6   ? -25.858 57.702 29.230  1.00 47.69  ? 107  DC  P N4    1 
ATOM   7833 C  C5    . DC  C 3 6   ? -25.281 59.746 28.114  1.00 50.88  ? 107  DC  P C5    1 
ATOM   7834 C  C6    . DC  C 3 6   ? -24.955 61.035 28.249  1.00 54.94  ? 107  DC  P C6    1 
ATOM   7835 P  P     . DT  C 3 7   ? -21.025 65.748 29.617  1.00 87.01  ? 108  DT  P P     1 
ATOM   7836 O  OP1   . DT  C 3 7   ? -20.682 67.181 29.739  1.00 89.76  ? 108  DT  P OP1   1 
ATOM   7837 O  OP2   . DT  C 3 7   ? -20.519 64.969 28.464  1.00 84.25  ? 108  DT  P OP2   1 
ATOM   7838 O  "O5'" . DT  C 3 7   ? -20.560 64.985 30.943  1.00 70.92  ? 108  DT  P "O5'" 1 
ATOM   7839 C  "C5'" . DT  C 3 7   ? -21.294 65.123 32.154  1.00 69.79  ? 108  DT  P "C5'" 1 
ATOM   7840 C  "C4'" . DT  C 3 7   ? -20.936 64.000 33.110  1.00 65.68  ? 108  DT  P "C4'" 1 
ATOM   7841 O  "O4'" . DT  C 3 7   ? -21.697 62.824 32.744  1.00 64.83  ? 108  DT  P "O4'" 1 
ATOM   7842 C  "C3'" . DT  C 3 7   ? -19.464 63.598 33.078  1.00 64.24  ? 108  DT  P "C3'" 1 
ATOM   7843 O  "O3'" . DT  C 3 7   ? -18.832 63.922 34.315  1.00 66.54  ? 108  DT  P "O3'" 1 
ATOM   7844 C  "C2'" . DT  C 3 7   ? -19.462 62.090 32.826  1.00 59.77  ? 108  DT  P "C2'" 1 
ATOM   7845 C  "C1'" . DT  C 3 7   ? -20.920 61.669 32.965  1.00 61.57  ? 108  DT  P "C1'" 1 
ATOM   7846 N  N1    . DT  C 3 7   ? -21.317 60.636 31.965  1.00 57.96  ? 108  DT  P N1    1 
ATOM   7847 C  C2    . DT  C 3 7   ? -21.795 59.417 32.399  1.00 52.71  ? 108  DT  P C2    1 
ATOM   7848 O  O2    . DT  C 3 7   ? -21.920 59.127 33.576  1.00 48.47  ? 108  DT  P O2    1 
ATOM   7849 N  N3    . DT  C 3 7   ? -22.124 58.543 31.393  1.00 48.50  ? 108  DT  P N3    1 
ATOM   7850 C  C4    . DT  C 3 7   ? -22.024 58.763 30.032  1.00 50.29  ? 108  DT  P C4    1 
ATOM   7851 O  O4    . DT  C 3 7   ? -22.347 57.919 29.202  1.00 50.61  ? 108  DT  P O4    1 
ATOM   7852 C  C5    . DT  C 3 7   ? -21.515 60.056 29.649  1.00 55.82  ? 108  DT  P C5    1 
ATOM   7853 C  C7    . DT  C 3 7   ? -21.362 60.400 28.197  1.00 58.17  ? 108  DT  P C7    1 
ATOM   7854 C  C6    . DT  C 3 7   ? -21.189 60.918 30.620  1.00 57.74  ? 108  DT  P C6    1 
ATOM   7855 P  P     . DG  C 3 8   ? -17.253 63.682 34.506  1.00 74.84  ? 109  DG  P P     1 
ATOM   7856 O  OP1   . DG  C 3 8   ? -16.756 64.722 35.432  1.00 77.66  ? 109  DG  P OP1   1 
ATOM   7857 O  OP2   . DG  C 3 8   ? -16.639 63.546 33.166  1.00 72.49  ? 109  DG  P OP2   1 
ATOM   7858 O  "O5'" . DG  C 3 8   ? -17.167 62.257 35.230  1.00 59.78  ? 109  DG  P "O5'" 1 
ATOM   7859 C  "C5'" . DG  C 3 8   ? -18.076 61.947 36.282  1.00 56.24  ? 109  DG  P "C5'" 1 
ATOM   7860 C  "C4'" . DG  C 3 8   ? -17.828 60.565 36.867  1.00 53.27  ? 109  DG  P "C4'" 1 
ATOM   7861 O  "O4'" . DG  C 3 8   ? -18.501 59.562 36.063  1.00 49.28  ? 109  DG  P "O4'" 1 
ATOM   7862 C  "C3'" . DG  C 3 8   ? -16.370 60.126 36.957  1.00 50.14  ? 109  DG  P "C3'" 1 
ATOM   7863 O  "O3'" . DG  C 3 8   ? -16.193 59.381 38.159  1.00 49.32  ? 109  DG  P "O3'" 1 
ATOM   7864 C  "C2'" . DG  C 3 8   ? -16.192 59.265 35.708  1.00 46.10  ? 109  DG  P "C2'" 1 
ATOM   7865 C  "C1'" . DG  C 3 8   ? -17.569 58.627 35.561  1.00 47.26  ? 109  DG  P "C1'" 1 
ATOM   7866 N  N9    . DG  C 3 8   ? -17.952 58.326 34.183  1.00 47.61  ? 109  DG  P N9    1 
ATOM   7867 C  C8    . DG  C 3 8   ? -17.787 59.128 33.079  1.00 47.55  ? 109  DG  P C8    1 
ATOM   7868 N  N7    . DG  C 3 8   ? -18.234 58.592 31.977  1.00 47.67  ? 109  DG  P N7    1 
ATOM   7869 C  C5    . DG  C 3 8   ? -18.725 57.354 32.373  1.00 43.22  ? 109  DG  P C5    1 
ATOM   7870 C  C6    . DG  C 3 8   ? -19.331 56.323 31.613  1.00 41.25  ? 109  DG  P C6    1 
ATOM   7871 O  O6    . DG  C 3 8   ? -19.565 56.296 30.397  1.00 41.61  ? 109  DG  P O6    1 
ATOM   7872 N  N1    . DG  C 3 8   ? -19.680 55.236 32.409  1.00 39.98  ? 109  DG  P N1    1 
ATOM   7873 C  C2    . DG  C 3 8   ? -19.470 55.152 33.765  1.00 41.48  ? 109  DG  P C2    1 
ATOM   7874 N  N2    . DG  C 3 8   ? -19.877 54.021 34.362  1.00 40.14  ? 109  DG  P N2    1 
ATOM   7875 N  N3    . DG  C 3 8   ? -18.905 56.110 34.487  1.00 42.19  ? 109  DG  P N3    1 
ATOM   7876 C  C4    . DG  C 3 8   ? -18.560 57.177 33.728  1.00 43.25  ? 109  DG  P C4    1 
ATOM   7877 P  P     . DC  C 3 9   ? -14.768 58.724 38.511  1.00 50.15  ? 110  DC  P P     1 
ATOM   7878 O  OP1   . DC  C 3 9   ? -14.714 58.540 39.978  1.00 50.63  ? 110  DC  P OP1   1 
ATOM   7879 O  OP2   . DC  C 3 9   ? -13.715 59.506 37.827  1.00 54.08  ? 110  DC  P OP2   1 
ATOM   7880 O  "O5'" . DC  C 3 9   ? -14.837 57.283 37.831  1.00 46.89  ? 110  DC  P "O5'" 1 
ATOM   7881 C  "C5'" . DC  C 3 9   ? -15.858 56.387 38.231  1.00 40.49  ? 110  DC  P "C5'" 1 
ATOM   7882 C  "C4'" . DC  C 3 9   ? -15.674 55.039 37.563  1.00 39.75  ? 110  DC  P "C4'" 1 
ATOM   7883 O  "O4'" . DC  C 3 9   ? -16.148 55.112 36.199  1.00 41.77  ? 110  DC  P "O4'" 1 
ATOM   7884 C  "C3'" . DC  C 3 9   ? -14.237 54.532 37.493  1.00 40.05  ? 110  DC  P "C3'" 1 
ATOM   7885 O  "O3'" . DC  C 3 9   ? -14.223 53.244 38.089  1.00 33.89  ? 110  DC  P "O3'" 1 
ATOM   7886 C  "C2'" . DC  C 3 9   ? -13.916 54.494 35.996  1.00 41.74  ? 110  DC  P "C2'" 1 
ATOM   7887 C  "C1'" . DC  C 3 9   ? -15.300 54.343 35.380  1.00 39.79  ? 110  DC  P "C1'" 1 
ATOM   7888 N  N1    . DC  C 3 9   ? -15.462 54.855 33.985  1.00 41.20  ? 110  DC  P N1    1 
ATOM   7889 C  C2    . DC  C 3 9   ? -16.073 54.037 33.027  1.00 37.90  ? 110  DC  P C2    1 
ATOM   7890 O  O2    . DC  C 3 9   ? -16.448 52.907 33.357  1.00 37.45  ? 110  DC  P O2    1 
ATOM   7891 N  N3    . DC  C 3 9   ? -16.232 54.500 31.763  1.00 36.88  ? 110  DC  P N3    1 
ATOM   7892 C  C4    . DC  C 3 9   ? -15.814 55.726 31.448  1.00 44.02  ? 110  DC  P C4    1 
ATOM   7893 N  N4    . DC  C 3 9   ? -15.992 56.136 30.188  1.00 41.36  ? 110  DC  P N4    1 
ATOM   7894 C  C5    . DC  C 3 9   ? -15.193 56.578 32.411  1.00 43.61  ? 110  DC  P C5    1 
ATOM   7895 C  C6    . DC  C 3 9   ? -15.041 56.110 33.657  1.00 39.95  ? 110  DC  P C6    1 
ATOM   7896 P  P     . DT  C 3 10  ? -12.836 52.483 38.364  1.00 35.04  ? 111  DT  P P     1 
ATOM   7897 O  OP1   . DT  C 3 10  ? -12.975 51.794 39.668  1.00 30.41  ? 111  DT  P OP1   1 
ATOM   7898 O  OP2   . DT  C 3 10  ? -11.718 53.428 38.144  1.00 37.25  ? 111  DT  P OP2   1 
ATOM   7899 O  "O5'" . DT  C 3 10  ? -12.773 51.389 37.203  1.00 34.13  ? 111  DT  P "O5'" 1 
ATOM   7900 C  "C5'" . DT  C 3 10  ? -13.914 50.582 36.947  1.00 32.81  ? 111  DT  P "C5'" 1 
ATOM   7901 C  "C4'" . DT  C 3 10  ? -13.782 49.888 35.604  1.00 33.34  ? 111  DT  P "C4'" 1 
ATOM   7902 O  "O4'" . DT  C 3 10  ? -14.084 50.817 34.534  1.00 33.95  ? 111  DT  P "O4'" 1 
ATOM   7903 C  "C3'" . DT  C 3 10  ? -12.389 49.339 35.307  1.00 30.30  ? 111  DT  P "C3'" 1 
ATOM   7904 O  "O3'" . DT  C 3 10  ? -12.454 47.920 35.320  1.00 31.68  ? 111  DT  P "O3'" 1 
ATOM   7905 C  "C2'" . DT  C 3 10  ? -12.036 49.881 33.919  1.00 29.20  ? 111  DT  P "C2'" 1 
ATOM   7906 C  "C1'" . DT  C 3 10  ? -13.373 50.397 33.392  1.00 34.82  ? 111  DT  P "C1'" 1 
ATOM   7907 N  N1    . DT  C 3 10  ? -13.264 51.555 32.457  1.00 37.06  ? 111  DT  P N1    1 
ATOM   7908 C  C2    . DT  C 3 10  ? -13.818 51.455 31.200  1.00 37.89  ? 111  DT  P C2    1 
ATOM   7909 O  O2    . DT  C 3 10  ? -14.397 50.460 30.805  1.00 38.86  ? 111  DT  P O2    1 
ATOM   7910 N  N3    . DT  C 3 10  ? -13.666 52.573 30.416  1.00 36.61  ? 111  DT  P N3    1 
ATOM   7911 C  C4    . DT  C 3 10  ? -13.032 53.753 30.761  1.00 36.28  ? 111  DT  P C4    1 
ATOM   7912 O  O4    . DT  C 3 10  ? -12.949 54.701 29.987  1.00 35.54  ? 111  DT  P O4    1 
ATOM   7913 C  C5    . DT  C 3 10  ? -12.474 53.789 32.091  1.00 35.05  ? 111  DT  P C5    1 
ATOM   7914 C  C7    . DT  C 3 10  ? -11.755 55.014 32.577  1.00 28.58  ? 111  DT  P C7    1 
ATOM   7915 C  C6    . DT  C 3 10  ? -12.617 52.704 32.864  1.00 35.48  ? 111  DT  P C6    1 
ATOM   7916 P  P     . DT  C 3 11  ? -11.112 47.044 35.217  1.00 33.09  ? 112  DT  P P     1 
ATOM   7917 O  OP1   . DT  C 3 11  ? -11.356 45.772 35.932  1.00 37.23  ? 112  DT  P OP1   1 
ATOM   7918 O  OP2   . DT  C 3 11  ? -9.971  47.898 35.612  1.00 35.22  ? 112  DT  P OP2   1 
ATOM   7919 O  "O5'" . DT  C 3 11  ? -10.981 46.741 33.654  1.00 30.67  ? 112  DT  P "O5'" 1 
ATOM   7920 C  "C5'" . DT  C 3 11  ? -12.104 46.225 32.953  1.00 31.13  ? 112  DT  P "C5'" 1 
ATOM   7921 C  "C4'" . DT  C 3 11  ? -11.856 46.268 31.458  1.00 34.15  ? 112  DT  P "C4'" 1 
ATOM   7922 O  "O4'" . DT  C 3 11  ? -12.038 47.625 30.970  1.00 34.07  ? 112  DT  P "O4'" 1 
ATOM   7923 C  "C3'" . DT  C 3 11  ? -10.449 45.839 31.042  1.00 34.59  ? 112  DT  P "C3'" 1 
ATOM   7924 O  "O3'" . DT  C 3 11  ? -10.535 44.913 29.970  1.00 36.88  ? 112  DT  P "O3'" 1 
ATOM   7925 C  "C2'" . DT  C 3 11  ? -9.804  47.146 30.594  1.00 35.95  ? 112  DT  P "C2'" 1 
ATOM   7926 C  "C1'" . DT  C 3 11  ? -11.015 47.879 30.034  1.00 35.73  ? 112  DT  P "C1'" 1 
ATOM   7927 N  N1    . DT  C 3 11  ? -10.781 49.342 29.871  1.00 32.42  ? 112  DT  P N1    1 
ATOM   7928 C  C2    . DT  C 3 11  ? -11.262 49.978 28.745  1.00 31.47  ? 112  DT  P C2    1 
ATOM   7929 O  O2    . DT  C 3 11  ? -11.891 49.410 27.869  1.00 29.55  ? 112  DT  P O2    1 
ATOM   7930 N  N3    . DT  C 3 11  ? -10.979 51.320 28.683  1.00 27.41  ? 112  DT  P N3    1 
ATOM   7931 C  C4    . DT  C 3 11  ? -10.280 52.067 29.610  1.00 27.92  ? 112  DT  P C4    1 
ATOM   7932 O  O4    . DT  C 3 11  ? -10.075 53.266 29.466  1.00 31.93  ? 112  DT  P O4    1 
ATOM   7933 C  C5    . DT  C 3 11  ? -9.800  51.341 30.758  1.00 32.33  ? 112  DT  P C5    1 
ATOM   7934 C  C7    . DT  C 3 11  ? -9.026  52.058 31.825  1.00 30.94  ? 112  DT  P C7    1 
ATOM   7935 C  C6    . DT  C 3 11  ? -10.067 50.029 30.832  1.00 32.94  ? 112  DT  P C6    1 
ATOM   7936 P  P     . DA  C 3 12  ? -9.276  43.994 29.574  1.00 32.67  ? 113  DA  P P     1 
ATOM   7937 O  OP1   . DA  C 3 12  ? -9.267  42.820 30.470  1.00 32.99  ? 113  DA  P OP1   1 
ATOM   7938 O  OP2   . DA  C 3 12  ? -8.065  44.835 29.489  1.00 32.10  ? 113  DA  P OP2   1 
ATOM   7939 O  "O5'" . DA  C 3 12  ? -9.629  43.502 28.098  1.00 35.17  ? 113  DA  P "O5'" 1 
ATOM   7940 C  "C5'" . DA  C 3 12  ? -8.982  44.108 26.994  1.00 36.61  ? 113  DA  P "C5'" 1 
ATOM   7941 C  "C4'" . DA  C 3 12  ? -9.988  44.772 26.076  1.00 36.34  ? 113  DA  P "C4'" 1 
ATOM   7942 O  "O4'" . DA  C 3 12  ? -10.396 46.045 26.630  1.00 38.54  ? 113  DA  P "O4'" 1 
ATOM   7943 C  "C3'" . DA  C 3 12  ? -9.431  45.084 24.698  1.00 36.95  ? 113  DA  P "C3'" 1 
ATOM   7944 O  "O3'" . DA  C 3 12  ? -9.728  44.009 23.830  1.00 30.88  ? 113  DA  P "O3'" 1 
ATOM   7945 C  "C2'" . DA  C 3 12  ? -10.163 46.356 24.278  1.00 36.14  ? 113  DA  P "C2'" 1 
ATOM   7946 C  "C1'" . DA  C 3 12  ? -10.498 47.022 25.609  1.00 37.81  ? 113  DA  P "C1'" 1 
ATOM   7947 N  N9    . DA  C 3 12  ? -9.648  48.157 25.973  1.00 35.33  ? 113  DA  P N9    1 
ATOM   7948 C  C8    . DA  C 3 12  ? -8.945  48.298 27.137  1.00 34.26  ? 113  DA  P C8    1 
ATOM   7949 N  N7    . DA  C 3 12  ? -8.274  49.421 27.221  1.00 34.40  ? 113  DA  P N7    1 
ATOM   7950 C  C5    . DA  C 3 12  ? -8.562  50.069 26.029  1.00 34.85  ? 113  DA  P C5    1 
ATOM   7951 C  C6    . DA  C 3 12  ? -8.159  51.314 25.506  1.00 32.39  ? 113  DA  P C6    1 
ATOM   7952 N  N6    . DA  C 3 12  ? -7.343  52.152 26.152  1.00 35.25  ? 113  DA  P N6    1 
ATOM   7953 N  N1    . DA  C 3 12  ? -8.623  51.665 24.290  1.00 30.71  ? 113  DA  P N1    1 
ATOM   7954 C  C2    . DA  C 3 12  ? -9.435  50.821 23.642  1.00 29.41  ? 113  DA  P C2    1 
ATOM   7955 N  N3    . DA  C 3 12  ? -9.886  49.631 24.035  1.00 27.95  ? 113  DA  P N3    1 
ATOM   7956 C  C4    . DA  C 3 12  ? -9.409  49.305 25.247  1.00 30.80  ? 113  DA  P C4    1 
ATOM   7957 P  P     . DC  C 3 13  ? -8.638  43.521 22.761  1.00 30.55  ? 114  DC  P P     1 
ATOM   7958 O  OP1   . DC  C 3 13  ? -9.245  42.407 21.998  1.00 30.40  ? 114  DC  P OP1   1 
ATOM   7959 O  OP2   . DC  C 3 13  ? -7.357  43.329 23.471  1.00 35.50  ? 114  DC  P OP2   1 
ATOM   7960 O  "O5'" . DC  C 3 13  ? -8.455  44.789 21.801  1.00 31.09  ? 114  DC  P "O5'" 1 
ATOM   7961 C  "C5'" . DC  C 3 13  ? -9.536  45.210 20.978  1.00 31.64  ? 114  DC  P "C5'" 1 
ATOM   7962 C  "C4'" . DC  C 3 13  ? -9.057  46.251 19.985  1.00 33.76  ? 114  DC  P "C4'" 1 
ATOM   7963 O  "O4'" . DC  C 3 13  ? -8.768  47.489 20.685  1.00 30.62  ? 114  DC  P "O4'" 1 
ATOM   7964 C  "C3'" . DC  C 3 13  ? -7.789  45.868 19.230  1.00 34.81  ? 114  DC  P "C3'" 1 
ATOM   7965 O  "O3'" . DC  C 3 13  ? -7.972  46.153 17.852  1.00 38.47  ? 114  DC  P "O3'" 1 
ATOM   7966 C  "C2'" . DC  C 3 13  ? -6.707  46.751 19.850  1.00 34.04  ? 114  DC  P "C2'" 1 
ATOM   7967 C  "C1'" . DC  C 3 13  ? -7.498  47.973 20.304  1.00 28.61  ? 114  DC  P "C1'" 1 
ATOM   7968 N  N1    . DC  C 3 13  ? -6.894  48.656 21.484  1.00 28.06  ? 114  DC  P N1    1 
ATOM   7969 C  C2    . DC  C 3 13  ? -6.593  50.021 21.425  1.00 28.08  ? 114  DC  P C2    1 
ATOM   7970 O  O2    . DC  C 3 13  ? -6.833  50.655 20.388  1.00 29.62  ? 114  DC  P O2    1 
ATOM   7971 N  N3    . DC  C 3 13  ? -6.041  50.616 22.511  1.00 29.38  ? 114  DC  P N3    1 
ATOM   7972 C  C4    . DC  C 3 13  ? -5.798  49.905 23.611  1.00 30.41  ? 114  DC  P C4    1 
ATOM   7973 N  N4    . DC  C 3 13  ? -5.254  50.541 24.652  1.00 24.67  ? 114  DC  P N4    1 
ATOM   7974 C  C5    . DC  C 3 13  ? -6.102  48.513 23.694  1.00 29.99  ? 114  DC  P C5    1 
ATOM   7975 C  C6    . DC  C 3 13  ? -6.641  47.937 22.615  1.00 27.79  ? 114  DC  P C6    1 
ATOM   7976 P  P     . DC  C 3 14  ? -7.010  45.491 16.750  1.00 37.17  ? 115  DC  P P     1 
ATOM   7977 O  OP1   . DC  C 3 14  ? -7.773  45.474 15.480  1.00 33.90  ? 115  DC  P OP1   1 
ATOM   7978 O  OP2   . DC  C 3 14  ? -6.471  44.231 17.301  1.00 40.78  ? 115  DC  P OP2   1 
ATOM   7979 O  "O5'" . DC  C 3 14  ? -5.794  46.527 16.632  1.00 37.20  ? 115  DC  P "O5'" 1 
ATOM   7980 C  "C5'" . DC  C 3 14  ? -6.057  47.815 16.101  1.00 34.41  ? 115  DC  P "C5'" 1 
ATOM   7981 C  "C4'" . DC  C 3 14  ? -5.077  48.871 16.587  1.00 33.39  ? 115  DC  P "C4'" 1 
ATOM   7982 O  "O4'" . DC  C 3 14  ? -5.107  49.028 18.026  1.00 29.01  ? 115  DC  P "O4'" 1 
ATOM   7983 C  "C3'" . DC  C 3 14  ? -3.603  48.608 16.326  1.00 33.45  ? 115  DC  P "C3'" 1 
ATOM   7984 O  "O3'" . DC  C 3 14  ? -3.283  48.900 14.973  1.00 32.72  ? 115  DC  P "O3'" 1 
ATOM   7985 C  "C2'" . DC  C 3 14  ? -2.951  49.609 17.279  1.00 32.51  ? 115  DC  P "C2'" 1 
ATOM   7986 C  "C1'" . DC  C 3 14  ? -4.053  49.930 18.291  1.00 29.41  ? 115  DC  P "C1'" 1 
ATOM   7987 N  N1    . DC  C 3 14  ? -3.574  49.832 19.702  1.00 27.36  ? 115  DC  P N1    1 
ATOM   7988 C  C2    . DC  C 3 14  ? -3.118  50.999 20.318  1.00 27.78  ? 115  DC  P C2    1 
ATOM   7989 O  O2    . DC  C 3 14  ? -3.139  52.057 19.675  1.00 25.92  ? 115  DC  P O2    1 
ATOM   7990 N  N3    . DC  C 3 14  ? -2.668  50.938 21.595  1.00 28.20  ? 115  DC  P N3    1 
ATOM   7991 C  C4    . DC  C 3 14  ? -2.659  49.774 22.246  1.00 28.21  ? 115  DC  P C4    1 
ATOM   7992 N  N4    . DC  C 3 14  ? -2.204  49.778 23.504  1.00 26.44  ? 115  DC  P N4    1 
ATOM   7993 C  C5    . DC  C 3 14  ? -3.118  48.567 21.634  1.00 26.10  ? 115  DC  P C5    1 
ATOM   7994 C  C6    . DC  C 3 14  ? -3.559  48.641 20.371  1.00 26.18  ? 115  DC  P C6    1 
HETATM 7995 CA CA    . CA  D 4 .   ? 1.394   46.689 12.531  1.00 33.47  ? 1001 CA  A CA    1 
HETATM 7996 CA CA    . CA  E 4 .   ? 19.351  31.171 70.938  1.00 46.43  ? 1003 CA  A CA    1 
HETATM 7997 CA CA    . CA  F 4 .   ? 3.624   9.389  13.270  1.00 78.96  ? 1004 CA  A CA    1 
HETATM 7998 O  O4    . DUP G 5 .   ? 0.915   49.761 22.502  1.00 28.00  ? 1005 DUP A O4    1 
HETATM 7999 C  C4    . DUP G 5 .   ? 0.846   50.298 21.411  1.00 27.18  ? 1005 DUP A C4    1 
HETATM 8000 C  C5    . DUP G 5 .   ? 0.399   49.576 20.280  1.00 27.16  ? 1005 DUP A C5    1 
HETATM 8001 C  C6    . DUP G 5 .   ? 0.330   50.202 19.082  1.00 26.93  ? 1005 DUP A C6    1 
HETATM 8002 N  N3    . DUP G 5 .   ? 1.195   51.592 21.268  1.00 27.73  ? 1005 DUP A N3    1 
HETATM 8003 C  C2    . DUP G 5 .   ? 1.120   52.190 20.065  1.00 25.71  ? 1005 DUP A C2    1 
HETATM 8004 O  O2    . DUP G 5 .   ? 1.442   53.358 19.967  1.00 27.88  ? 1005 DUP A O2    1 
HETATM 8005 N  N1    . DUP G 5 .   ? 0.693   51.521 18.977  1.00 24.72  ? 1005 DUP A N1    1 
HETATM 8006 C  "C1'" . DUP G 5 .   ? 0.638   52.203 17.677  1.00 25.23  ? 1005 DUP A "C1'" 1 
HETATM 8007 C  "C2'" . DUP G 5 .   ? 2.067   52.250 17.084  1.00 28.51  ? 1005 DUP A "C2'" 1 
HETATM 8008 C  "C3'" . DUP G 5 .   ? 2.079   50.968 16.234  1.00 28.55  ? 1005 DUP A "C3'" 1 
HETATM 8009 O  "O3'" . DUP G 5 .   ? 3.116   50.978 15.250  1.00 30.89  ? 1005 DUP A "O3'" 1 
HETATM 8010 O  "O4'" . DUP G 5 .   ? -0.165  51.470 16.712  1.00 31.82  ? 1005 DUP A "O4'" 1 
HETATM 8011 C  "C4'" . DUP G 5 .   ? 0.678   51.055 15.605  1.00 30.95  ? 1005 DUP A "C4'" 1 
HETATM 8012 C  "C5'" . DUP G 5 .   ? 0.243   49.693 15.056  1.00 30.57  ? 1005 DUP A "C5'" 1 
HETATM 8013 O  "O5'" . DUP G 5 .   ? -0.129  48.859 16.155  1.00 34.78  ? 1005 DUP A "O5'" 1 
HETATM 8014 P  PA    . DUP G 5 .   ? 0.336   47.370 15.860  1.00 31.54  ? 1005 DUP A PA    1 
HETATM 8015 O  O1A   . DUP G 5 .   ? 0.117   46.961 14.451  1.00 31.23  ? 1005 DUP A O1A   1 
HETATM 8016 O  O2A   . DUP G 5 .   ? -0.595  46.456 16.793  1.00 31.67  ? 1005 DUP A O2A   1 
HETATM 8017 N  N3A   . DUP G 5 .   ? 1.943   47.148 16.339  1.00 35.86  ? 1005 DUP A N3A   1 
HETATM 8018 P  PB    . DUP G 5 .   ? 3.172   47.561 15.249  1.00 30.44  ? 1005 DUP A PB    1 
HETATM 8019 O  O1B   . DUP G 5 .   ? 4.046   48.592 15.850  1.00 32.12  ? 1005 DUP A O1B   1 
HETATM 8020 O  O2B   . DUP G 5 .   ? 2.587   48.068 13.838  1.00 29.88  ? 1005 DUP A O2B   1 
HETATM 8021 O  O3B   . DUP G 5 .   ? 4.089   46.270 14.991  1.00 35.58  ? 1005 DUP A O3B   1 
HETATM 8022 P  PG    . DUP G 5 .   ? 3.892   44.895 14.185  1.00 33.82  ? 1005 DUP A PG    1 
HETATM 8023 O  O2G   . DUP G 5 .   ? 5.101   44.765 13.137  1.00 32.08  ? 1005 DUP A O2G   1 
HETATM 8024 O  O1G   . DUP G 5 .   ? 3.911   43.759 15.135  1.00 34.88  ? 1005 DUP A O1G   1 
HETATM 8025 O  O3G   . DUP G 5 .   ? 2.474   44.907 13.432  1.00 28.52  ? 1005 DUP A O3G   1 
HETATM 8026 NA NA    . NA  H 6 .   ? 4.220   34.984 51.540  1.00 62.60  ? 1006 NA  A NA    1 
HETATM 8027 NA NA    . NA  I 6 .   ? -0.699  15.302 43.992  1.00 71.38  ? 1007 NA  A NA    1 
HETATM 8028 NA NA    . NA  J 6 .   ? 9.244   52.458 63.558  1.00 68.39  ? 1008 NA  A NA    1 
HETATM 8029 NA NA    . NA  K 6 .   ? -14.265 47.947 -14.828 1.00 96.41  ? 1002 NA  A NA    1 
HETATM 8030 NA NA    . NA  L 6 .   ? -2.390  46.694 13.425  1.00 41.90  ? 1009 NA  A NA    1 
HETATM 8031 NA NA    . NA  M 6 .   ? 0.869   40.990 13.469  1.00 41.25  ? 1010 NA  A NA    1 
HETATM 8032 NA NA    . NA  N 6 .   ? 3.239   41.034 9.731   1.00 59.84  ? 1011 NA  A NA    1 
HETATM 8033 NA NA    . NA  O 6 .   ? 5.280   42.212 1.079   1.00 70.36  ? 1012 NA  A NA    1 
HETATM 8034 O  O     . HOH P 7 .   ? 15.110  35.751 32.749  1.00 26.87  ? 1101 HOH A O     1 
HETATM 8035 O  O     . HOH P 7 .   ? 19.233  52.179 19.804  1.00 36.83  ? 1102 HOH A O     1 
HETATM 8036 O  O     . HOH P 7 .   ? 13.894  38.088 27.492  1.00 26.90  ? 1103 HOH A O     1 
HETATM 8037 O  O     . HOH P 7 .   ? 3.341   41.041 18.277  1.00 30.15  ? 1104 HOH A O     1 
HETATM 8038 O  O     . HOH P 7 .   ? -7.065  53.112 17.094  1.00 32.48  ? 1105 HOH A O     1 
HETATM 8039 O  O     . HOH P 7 .   ? -15.210 34.933 37.067  1.00 29.91  ? 1106 HOH A O     1 
HETATM 8040 O  O     . HOH P 7 .   ? -4.277  53.413 17.442  1.00 29.28  ? 1107 HOH A O     1 
HETATM 8041 O  O     . HOH P 7 .   ? 20.437  50.757 42.115  1.00 31.11  ? 1108 HOH A O     1 
HETATM 8042 O  O     . HOH P 7 .   ? 24.302  56.284 30.205  1.00 29.50  ? 1109 HOH A O     1 
HETATM 8043 O  O     . HOH P 7 .   ? 0.239   36.588 46.676  1.00 26.95  ? 1110 HOH A O     1 
HETATM 8044 O  O     . HOH P 7 .   ? 6.777   48.828 16.461  1.00 26.48  ? 1111 HOH A O     1 
HETATM 8045 O  O     . HOH P 7 .   ? -9.781  47.545 15.693  1.00 29.89  ? 1112 HOH A O     1 
HETATM 8046 O  O     . HOH P 7 .   ? 29.572  64.377 32.867  1.00 32.16  ? 1113 HOH A O     1 
HETATM 8047 O  O     . HOH P 7 .   ? 21.177  69.879 21.767  1.00 33.98  ? 1114 HOH A O     1 
HETATM 8048 O  O     . HOH P 7 .   ? 5.937   36.552 26.843  1.00 29.65  ? 1115 HOH A O     1 
HETATM 8049 O  O     . HOH P 7 .   ? -24.164 51.320 42.409  1.00 41.52  ? 1116 HOH A O     1 
HETATM 8050 O  O     . HOH P 7 .   ? 7.749   29.583 61.438  1.00 33.71  ? 1117 HOH A O     1 
HETATM 8051 O  O     . HOH P 7 .   ? 6.995   37.917 50.707  1.00 30.25  ? 1118 HOH A O     1 
HETATM 8052 O  O     . HOH P 7 .   ? 1.222   67.129 25.542  1.00 30.80  ? 1119 HOH A O     1 
HETATM 8053 O  O     . HOH P 7 .   ? 33.235  65.171 32.825  1.00 32.98  ? 1120 HOH A O     1 
HETATM 8054 O  O     . HOH P 7 .   ? 31.592  64.713 42.519  1.00 39.99  ? 1121 HOH A O     1 
HETATM 8055 O  O     . HOH P 7 .   ? -2.104  57.015 12.624  1.00 30.19  ? 1122 HOH A O     1 
HETATM 8056 O  O     . HOH P 7 .   ? 27.063  65.564 33.244  1.00 32.95  ? 1123 HOH A O     1 
HETATM 8057 O  O     . HOH P 7 .   ? 2.117   46.718 18.946  1.00 33.95  ? 1124 HOH A O     1 
HETATM 8058 O  O     . HOH P 7 .   ? 21.962  50.874 39.851  1.00 30.14  ? 1125 HOH A O     1 
HETATM 8059 O  O     . HOH P 7 .   ? 4.287   36.751 63.416  1.00 33.40  ? 1126 HOH A O     1 
HETATM 8060 O  O     . HOH P 7 .   ? 11.881  68.607 18.681  1.00 29.94  ? 1127 HOH A O     1 
HETATM 8061 O  O     . HOH P 7 .   ? -14.343 54.138 41.088  1.00 33.15  ? 1128 HOH A O     1 
HETATM 8062 O  O     . HOH P 7 .   ? 19.289  75.709 34.471  1.00 46.98  ? 1129 HOH A O     1 
HETATM 8063 O  O     . HOH P 7 .   ? 11.577  65.759 18.910  1.00 30.91  ? 1130 HOH A O     1 
HETATM 8064 O  O     . HOH P 7 .   ? -4.083  55.680 11.262  1.00 25.89  ? 1131 HOH A O     1 
HETATM 8065 O  O     . HOH P 7 .   ? 36.575  56.419 30.919  1.00 35.62  ? 1132 HOH A O     1 
HETATM 8066 O  O     . HOH P 7 .   ? -25.054 54.414 43.245  1.00 37.50  ? 1133 HOH A O     1 
HETATM 8067 O  O     . HOH P 7 .   ? 2.257   42.656 12.093  1.00 43.96  ? 1134 HOH A O     1 
HETATM 8068 O  O     . HOH P 7 .   ? 19.011  54.720 35.205  1.00 28.81  ? 1135 HOH A O     1 
HETATM 8069 O  O     . HOH P 7 .   ? 21.718  36.881 47.622  1.00 28.54  ? 1136 HOH A O     1 
HETATM 8070 O  O     . HOH P 7 .   ? 35.318  73.424 25.491  1.00 34.64  ? 1137 HOH A O     1 
HETATM 8071 O  O     . HOH P 7 .   ? -12.656 35.889 36.800  1.00 27.15  ? 1138 HOH A O     1 
HETATM 8072 O  O     . HOH P 7 .   ? -14.995 27.633 3.132   1.00 51.15  ? 1139 HOH A O     1 
HETATM 8073 O  O     . HOH P 7 .   ? 15.151  27.337 39.127  1.00 44.97  ? 1140 HOH A O     1 
HETATM 8074 O  O     . HOH P 7 .   ? -9.843  29.102 19.230  1.00 28.03  ? 1141 HOH A O     1 
HETATM 8075 O  O     . HOH P 7 .   ? 0.096   70.344 -0.379  1.00 45.79  ? 1142 HOH A O     1 
HETATM 8076 O  O     . HOH P 7 .   ? 21.697  48.455 38.197  1.00 33.44  ? 1143 HOH A O     1 
HETATM 8077 O  O     . HOH P 7 .   ? 16.060  49.612 43.315  1.00 39.41  ? 1144 HOH A O     1 
HETATM 8078 O  O     . HOH P 7 .   ? 0.860   64.258 26.957  1.00 37.93  ? 1145 HOH A O     1 
HETATM 8079 O  O     . HOH P 7 .   ? -15.577 55.758 8.635   1.00 39.75  ? 1146 HOH A O     1 
HETATM 8080 O  O     . HOH P 7 .   ? -17.934 47.722 6.514   1.00 45.10  ? 1147 HOH A O     1 
HETATM 8081 O  O     . HOH P 7 .   ? 15.208  39.801 25.652  1.00 31.83  ? 1148 HOH A O     1 
HETATM 8082 O  O     . HOH P 7 .   ? -0.757  41.949 33.753  1.00 31.28  ? 1149 HOH A O     1 
HETATM 8083 O  O     . HOH P 7 .   ? 20.498  56.685 54.902  1.00 52.70  ? 1150 HOH A O     1 
HETATM 8084 O  O     . HOH P 7 .   ? 11.903  69.161 27.227  1.00 39.12  ? 1151 HOH A O     1 
HETATM 8085 O  O     . HOH P 7 .   ? 2.182   49.925 55.721  1.00 41.96  ? 1152 HOH A O     1 
HETATM 8086 O  O     . HOH P 7 .   ? 4.361   32.279 10.682  1.00 40.24  ? 1153 HOH A O     1 
HETATM 8087 O  O     . HOH P 7 .   ? -20.834 51.769 37.761  1.00 41.03  ? 1154 HOH A O     1 
HETATM 8088 O  O     . HOH P 7 .   ? 26.870  40.008 41.383  1.00 32.74  ? 1155 HOH A O     1 
HETATM 8089 O  O     . HOH P 7 .   ? 1.094   72.839 0.053   1.00 32.04  ? 1156 HOH A O     1 
HETATM 8090 O  O     . HOH P 7 .   ? 26.070  51.029 43.619  1.00 33.56  ? 1157 HOH A O     1 
HETATM 8091 O  O     . HOH P 7 .   ? 26.445  78.597 20.318  1.00 44.14  ? 1158 HOH A O     1 
HETATM 8092 O  O     . HOH P 7 .   ? 8.907   7.313  24.458  1.00 62.74  ? 1159 HOH A O     1 
HETATM 8093 O  O     . HOH P 7 .   ? -13.707 50.579 1.761   1.00 41.81  ? 1160 HOH A O     1 
HETATM 8094 O  O     . HOH P 7 .   ? 10.624  50.172 11.730  1.00 34.09  ? 1161 HOH A O     1 
HETATM 8095 O  O     . HOH P 7 .   ? 18.382  68.827 31.670  1.00 41.35  ? 1162 HOH A O     1 
HETATM 8096 O  O     . HOH P 7 .   ? 2.175   44.367 29.613  1.00 40.03  ? 1163 HOH A O     1 
HETATM 8097 O  O     . HOH P 7 .   ? 13.432  35.888 26.011  1.00 28.14  ? 1164 HOH A O     1 
HETATM 8098 O  O     . HOH P 7 .   ? 17.191  34.514 41.551  1.00 34.70  ? 1165 HOH A O     1 
HETATM 8099 O  O     . HOH P 7 .   ? -20.883 27.815 43.927  1.00 31.93  ? 1166 HOH A O     1 
HETATM 8100 O  O     . HOH P 7 .   ? 16.935  18.421 44.306  1.00 52.95  ? 1167 HOH A O     1 
HETATM 8101 O  O     . HOH P 7 .   ? 0.371   47.116 23.165  1.00 34.05  ? 1168 HOH A O     1 
HETATM 8102 O  O     . HOH P 7 .   ? -1.931  56.804 17.684  1.00 31.02  ? 1169 HOH A O     1 
HETATM 8103 O  O     . HOH P 7 .   ? -29.698 32.578 44.767  1.00 49.94  ? 1170 HOH A O     1 
HETATM 8104 O  O     . HOH P 7 .   ? -13.379 30.477 37.920  1.00 34.33  ? 1171 HOH A O     1 
HETATM 8105 O  O     . HOH P 7 .   ? -28.136 43.612 41.177  1.00 36.27  ? 1172 HOH A O     1 
HETATM 8106 O  O     . HOH P 7 .   ? 4.974   39.277 26.750  1.00 32.21  ? 1173 HOH A O     1 
HETATM 8107 O  O     . HOH P 7 .   ? 20.550  52.845 12.549  1.00 39.13  ? 1174 HOH A O     1 
HETATM 8108 O  O     . HOH P 7 .   ? 6.492   66.185 -0.808  1.00 37.58  ? 1175 HOH A O     1 
HETATM 8109 O  O     . HOH P 7 .   ? -9.587  55.713 1.993   1.00 44.80  ? 1176 HOH A O     1 
HETATM 8110 O  O     . HOH P 7 .   ? 2.408   72.127 10.412  1.00 43.76  ? 1177 HOH A O     1 
HETATM 8111 O  O     . HOH P 7 .   ? 3.731   44.038 0.741   1.00 67.46  ? 1178 HOH A O     1 
HETATM 8112 O  O     . HOH P 7 .   ? -11.146 31.686 38.119  1.00 31.73  ? 1179 HOH A O     1 
HETATM 8113 O  O     . HOH P 7 .   ? 29.304  38.061 44.009  1.00 36.26  ? 1180 HOH A O     1 
HETATM 8114 O  O     . HOH P 7 .   ? 19.185  62.331 25.703  1.00 30.85  ? 1181 HOH A O     1 
HETATM 8115 O  O     . HOH P 7 .   ? 3.637   26.519 30.686  1.00 53.47  ? 1182 HOH A O     1 
HETATM 8116 O  O     . HOH P 7 .   ? 9.983   47.388 26.851  1.00 31.87  ? 1183 HOH A O     1 
HETATM 8117 O  O     . HOH P 7 .   ? -11.224 37.140 50.370  1.00 35.26  ? 1184 HOH A O     1 
HETATM 8118 O  O     . HOH P 7 .   ? 17.372  61.539 32.326  1.00 36.80  ? 1185 HOH A O     1 
HETATM 8119 O  O     . HOH P 7 .   ? -5.427  34.006 14.878  1.00 37.90  ? 1186 HOH A O     1 
HETATM 8120 O  O     . HOH P 7 .   ? 14.630  30.108 25.956  1.00 54.85  ? 1187 HOH A O     1 
HETATM 8121 O  O     . HOH P 7 .   ? 2.267   45.506 61.221  1.00 36.91  ? 1188 HOH A O     1 
HETATM 8122 O  O     . HOH P 7 .   ? -0.459  35.560 1.935   1.00 44.02  ? 1189 HOH A O     1 
HETATM 8123 O  O     . HOH P 7 .   ? 24.092  45.078 63.318  1.00 35.93  ? 1190 HOH A O     1 
HETATM 8124 O  O     . HOH P 7 .   ? -23.632 49.338 49.605  1.00 49.67  ? 1191 HOH A O     1 
HETATM 8125 O  O     . HOH P 7 .   ? 3.622   47.567 1.388   1.00 41.69  ? 1192 HOH A O     1 
HETATM 8126 O  O     . HOH P 7 .   ? -20.692 50.349 13.085  1.00 45.26  ? 1193 HOH A O     1 
HETATM 8127 O  O     . HOH P 7 .   ? 10.421  48.795 49.078  1.00 37.73  ? 1194 HOH A O     1 
HETATM 8128 O  O     . HOH P 7 .   ? -5.699  39.719 29.208  1.00 49.66  ? 1195 HOH A O     1 
HETATM 8129 O  O     . HOH P 7 .   ? 3.497   20.917 61.701  1.00 38.47  ? 1196 HOH A O     1 
HETATM 8130 O  O     . HOH P 7 .   ? -17.116 44.266 36.285  1.00 38.47  ? 1197 HOH A O     1 
HETATM 8131 O  O     . HOH P 7 .   ? 16.210  67.568 2.301   1.00 40.48  ? 1198 HOH A O     1 
HETATM 8132 O  O     . HOH P 7 .   ? 34.751  49.354 35.051  1.00 45.43  ? 1199 HOH A O     1 
HETATM 8133 O  O     . HOH P 7 .   ? -15.625 46.505 23.327  1.00 36.40  ? 1200 HOH A O     1 
HETATM 8134 O  O     . HOH P 7 .   ? 0.151   31.536 60.541  1.00 40.49  ? 1201 HOH A O     1 
HETATM 8135 O  O     . HOH P 7 .   ? 18.584  77.255 32.462  1.00 37.45  ? 1202 HOH A O     1 
HETATM 8136 O  O     . HOH P 7 .   ? 18.399  73.007 2.885   1.00 36.72  ? 1203 HOH A O     1 
HETATM 8137 O  O     . HOH P 7 .   ? 24.680  45.708 25.791  1.00 35.89  ? 1204 HOH A O     1 
HETATM 8138 O  O     . HOH P 7 .   ? -15.311 46.099 32.168  1.00 37.48  ? 1205 HOH A O     1 
HETATM 8139 O  O     . HOH P 7 .   ? 2.705   64.563 28.823  1.00 33.56  ? 1206 HOH A O     1 
HETATM 8140 O  O     . HOH P 7 .   ? 3.526   48.330 21.394  1.00 35.36  ? 1207 HOH A O     1 
HETATM 8141 O  O     . HOH P 7 .   ? 23.219  34.695 38.457  1.00 38.09  ? 1208 HOH A O     1 
HETATM 8142 O  O     . HOH P 7 .   ? -14.439 56.930 11.580  1.00 44.34  ? 1209 HOH A O     1 
HETATM 8143 O  O     . HOH P 7 .   ? -0.207  30.379 63.099  1.00 40.42  ? 1210 HOH A O     1 
HETATM 8144 O  O     . HOH P 7 .   ? -9.586  38.395 29.890  1.00 43.00  ? 1211 HOH A O     1 
HETATM 8145 O  O     . HOH P 7 .   ? 14.354  55.468 36.267  1.00 32.10  ? 1212 HOH A O     1 
HETATM 8146 O  O     . HOH P 7 .   ? 4.621   47.690 35.919  1.00 37.80  ? 1213 HOH A O     1 
HETATM 8147 O  O     . HOH P 7 .   ? 35.687  45.938 46.345  1.00 37.92  ? 1214 HOH A O     1 
HETATM 8148 O  O     . HOH P 7 .   ? -3.520  62.049 13.452  1.00 35.14  ? 1215 HOH A O     1 
HETATM 8149 O  O     . HOH P 7 .   ? 40.413  40.964 40.135  1.00 52.42  ? 1216 HOH A O     1 
HETATM 8150 O  O     . HOH P 7 .   ? 9.061   27.370 33.931  1.00 37.29  ? 1217 HOH A O     1 
HETATM 8151 O  O     . HOH P 7 .   ? -6.502  45.427 13.152  1.00 33.27  ? 1218 HOH A O     1 
HETATM 8152 O  O     . HOH P 7 .   ? 23.373  53.266 25.165  1.00 33.26  ? 1219 HOH A O     1 
HETATM 8153 O  O     . HOH P 7 .   ? 19.701  79.971 26.245  1.00 35.65  ? 1220 HOH A O     1 
HETATM 8154 O  O     . HOH P 7 .   ? 1.441   34.041 57.676  1.00 46.86  ? 1221 HOH A O     1 
HETATM 8155 O  O     . HOH P 7 .   ? 13.531  29.473 10.133  1.00 53.21  ? 1222 HOH A O     1 
HETATM 8156 O  O     . HOH P 7 .   ? -15.284 27.271 22.524  1.00 39.12  ? 1223 HOH A O     1 
HETATM 8157 O  O     . HOH P 7 .   ? -3.708  24.348 15.641  1.00 40.29  ? 1224 HOH A O     1 
HETATM 8158 O  O     . HOH P 7 .   ? -9.250  21.389 4.605   1.00 57.61  ? 1225 HOH A O     1 
HETATM 8159 O  O     . HOH P 7 .   ? -0.200  52.461 -7.230  1.00 49.26  ? 1226 HOH A O     1 
HETATM 8160 O  O     . HOH P 7 .   ? 13.934  14.916 51.422  1.00 44.43  ? 1227 HOH A O     1 
HETATM 8161 O  O     . HOH P 7 .   ? 3.392   47.823 29.193  1.00 34.89  ? 1228 HOH A O     1 
HETATM 8162 O  O     . HOH P 7 .   ? 6.281   40.103 49.210  1.00 35.53  ? 1229 HOH A O     1 
HETATM 8163 O  O     . HOH P 7 .   ? -15.359 58.045 53.390  1.00 56.01  ? 1230 HOH A O     1 
HETATM 8164 O  O     . HOH P 7 .   ? 2.138   74.089 8.197   1.00 46.22  ? 1231 HOH A O     1 
HETATM 8165 O  O     . HOH P 7 .   ? 4.975   26.664 19.553  1.00 40.48  ? 1232 HOH A O     1 
HETATM 8166 O  O     . HOH P 7 .   ? -18.775 45.015 38.309  1.00 37.11  ? 1233 HOH A O     1 
HETATM 8167 O  O     . HOH P 7 .   ? 9.136   48.829 7.776   1.00 36.67  ? 1234 HOH A O     1 
HETATM 8168 O  O     . HOH P 7 .   ? 29.137  55.143 26.284  1.00 40.92  ? 1235 HOH A O     1 
HETATM 8169 O  O     . HOH P 7 .   ? 24.323  66.911 42.575  1.00 41.37  ? 1236 HOH A O     1 
HETATM 8170 O  O     . HOH P 7 .   ? -15.963 46.530 57.762  1.00 44.17  ? 1237 HOH A O     1 
HETATM 8171 O  O     . HOH P 7 .   ? 2.792   35.800 55.572  1.00 44.51  ? 1238 HOH A O     1 
HETATM 8172 O  O     . HOH P 7 .   ? 20.890  47.392 13.298  1.00 45.25  ? 1239 HOH A O     1 
HETATM 8173 O  O     . HOH P 7 .   ? -5.302  25.833 8.901   1.00 45.21  ? 1240 HOH A O     1 
HETATM 8174 O  O     . HOH P 7 .   ? 21.288  57.501 43.292  1.00 36.34  ? 1241 HOH A O     1 
HETATM 8175 O  O     . HOH P 7 .   ? 3.897   24.761 10.465  1.00 49.63  ? 1242 HOH A O     1 
HETATM 8176 O  O     . HOH P 7 .   ? 22.838  55.342 61.249  1.00 58.46  ? 1243 HOH A O     1 
HETATM 8177 O  O     . HOH P 7 .   ? 13.906  19.096 22.118  1.00 48.50  ? 1244 HOH A O     1 
HETATM 8178 O  O     . HOH P 7 .   ? 25.224  37.005 30.077  1.00 35.31  ? 1245 HOH A O     1 
HETATM 8179 O  O     . HOH P 7 .   ? 15.605  49.687 46.654  1.00 34.76  ? 1246 HOH A O     1 
HETATM 8180 O  O     . HOH P 7 .   ? -2.005  44.168 42.080  1.00 37.00  ? 1247 HOH A O     1 
HETATM 8181 O  O     . HOH P 7 .   ? 4.907   34.643 64.316  1.00 42.60  ? 1248 HOH A O     1 
HETATM 8182 O  O     . HOH P 7 .   ? 14.978  33.689 37.485  1.00 33.13  ? 1249 HOH A O     1 
HETATM 8183 O  O     . HOH P 7 .   ? -24.609 44.608 18.220  1.00 50.33  ? 1250 HOH A O     1 
HETATM 8184 O  O     . HOH P 7 .   ? 1.876   35.586 51.425  1.00 53.34  ? 1251 HOH A O     1 
HETATM 8185 O  O     . HOH P 7 .   ? 20.882  69.641 30.789  1.00 34.02  ? 1252 HOH A O     1 
HETATM 8186 O  O     . HOH P 7 .   ? -5.428  31.205 37.696  1.00 46.75  ? 1253 HOH A O     1 
HETATM 8187 O  O     . HOH P 7 .   ? 2.186   46.188 41.447  1.00 45.78  ? 1254 HOH A O     1 
HETATM 8188 O  O     . HOH P 7 .   ? 9.405   49.850 27.494  1.00 31.63  ? 1255 HOH A O     1 
HETATM 8189 O  O     . HOH P 7 .   ? -0.443  74.798 7.005   1.00 41.31  ? 1256 HOH A O     1 
HETATM 8190 O  O     . HOH P 7 .   ? -8.645  43.533 47.399  1.00 49.29  ? 1257 HOH A O     1 
HETATM 8191 O  O     . HOH P 7 .   ? -7.256  50.959 37.923  1.00 39.35  ? 1258 HOH A O     1 
HETATM 8192 O  O     . HOH P 7 .   ? -10.921 34.554 38.104  1.00 34.01  ? 1259 HOH A O     1 
HETATM 8193 O  O     . HOH P 7 .   ? -16.848 42.447 30.962  1.00 36.45  ? 1260 HOH A O     1 
HETATM 8194 O  O     . HOH P 7 .   ? -10.103 36.703 27.989  1.00 35.55  ? 1261 HOH A O     1 
HETATM 8195 O  O     . HOH P 7 .   ? 22.145  79.527 25.528  1.00 40.47  ? 1262 HOH A O     1 
HETATM 8196 O  O     . HOH P 7 .   ? -3.272  66.296 12.320  1.00 43.09  ? 1263 HOH A O     1 
HETATM 8197 O  O     . HOH P 7 .   ? 4.506   45.770 22.199  1.00 29.56  ? 1264 HOH A O     1 
HETATM 8198 O  O     . HOH P 7 .   ? 10.077  30.157 27.632  1.00 37.44  ? 1265 HOH A O     1 
HETATM 8199 O  O     . HOH P 7 .   ? -12.443 22.235 7.016   1.00 45.54  ? 1266 HOH A O     1 
HETATM 8200 O  O     . HOH P 7 .   ? -12.375 31.649 29.942  1.00 40.39  ? 1267 HOH A O     1 
HETATM 8201 O  O     . HOH P 7 .   ? -24.107 43.987 54.145  1.00 40.45  ? 1268 HOH A O     1 
HETATM 8202 O  O     . HOH P 7 .   ? 16.159  85.012 38.255  1.00 43.35  ? 1269 HOH A O     1 
HETATM 8203 O  O     . HOH P 7 .   ? -25.402 39.442 6.046   1.00 54.71  ? 1270 HOH A O     1 
HETATM 8204 O  O     . HOH P 7 .   ? 13.751  70.364 17.749  1.00 29.50  ? 1271 HOH A O     1 
HETATM 8205 O  O     . HOH P 7 .   ? 5.307   70.541 21.296  1.00 39.87  ? 1272 HOH A O     1 
HETATM 8206 O  O     . HOH P 7 .   ? -29.613 25.907 35.848  1.00 49.03  ? 1273 HOH A O     1 
HETATM 8207 O  O     . HOH P 7 .   ? -13.870 53.955 52.741  1.00 56.16  ? 1274 HOH A O     1 
HETATM 8208 O  O     . HOH P 7 .   ? -18.929 48.015 37.878  1.00 40.22  ? 1275 HOH A O     1 
HETATM 8209 O  O     . HOH P 7 .   ? 10.839  35.048 68.764  1.00 43.78  ? 1276 HOH A O     1 
HETATM 8210 O  O     . HOH P 7 .   ? 23.112  44.258 37.188  1.00 35.65  ? 1277 HOH A O     1 
HETATM 8211 O  O     . HOH P 7 .   ? -11.819 26.067 16.673  1.00 45.57  ? 1278 HOH A O     1 
HETATM 8212 O  O     . HOH P 7 .   ? 29.826  37.250 41.137  1.00 38.40  ? 1279 HOH A O     1 
HETATM 8213 O  O     . HOH P 7 .   ? 23.795  78.348 27.217  1.00 36.97  ? 1280 HOH A O     1 
HETATM 8214 O  O     . HOH P 7 .   ? -14.520 35.848 7.841   1.00 43.67  ? 1281 HOH A O     1 
HETATM 8215 O  O     . HOH P 7 .   ? -8.113  38.158 31.905  1.00 49.68  ? 1282 HOH A O     1 
HETATM 8216 O  O     . HOH P 7 .   ? 2.406   17.912 55.183  1.00 41.75  ? 1283 HOH A O     1 
HETATM 8217 O  O     . HOH P 7 .   ? -25.893 29.505 45.064  1.00 49.60  ? 1284 HOH A O     1 
HETATM 8218 O  O     . HOH P 7 .   ? -13.422 47.278 22.075  1.00 38.14  ? 1285 HOH A O     1 
HETATM 8219 O  O     . HOH P 7 .   ? 18.359  30.524 67.368  1.00 49.28  ? 1286 HOH A O     1 
HETATM 8220 O  O     . HOH P 7 .   ? 15.198  35.432 24.075  1.00 38.89  ? 1287 HOH A O     1 
HETATM 8221 O  O     . HOH P 7 .   ? -12.295 33.824 26.041  1.00 43.21  ? 1288 HOH A O     1 
HETATM 8222 O  O     . HOH P 7 .   ? -23.012 32.858 55.534  1.00 47.44  ? 1289 HOH A O     1 
HETATM 8223 O  O     . HOH P 7 .   ? -0.289  45.833 61.209  1.00 42.09  ? 1290 HOH A O     1 
HETATM 8224 O  O     . HOH P 7 .   ? -21.784 44.383 5.283   1.00 46.87  ? 1291 HOH A O     1 
HETATM 8225 O  O     . HOH P 7 .   ? 14.102  62.505 28.634  1.00 43.39  ? 1292 HOH A O     1 
HETATM 8226 O  O     . HOH P 7 .   ? 14.307  31.317 36.930  1.00 35.23  ? 1293 HOH A O     1 
HETATM 8227 O  O     . HOH P 7 .   ? 6.017   50.195 35.660  1.00 54.75  ? 1294 HOH A O     1 
HETATM 8228 O  O     . HOH P 7 .   ? 29.401  33.198 39.202  1.00 46.93  ? 1295 HOH A O     1 
HETATM 8229 O  O     . HOH P 7 .   ? -12.638 46.047 53.115  1.00 43.05  ? 1296 HOH A O     1 
HETATM 8230 O  O     . HOH P 7 .   ? 2.365   17.905 57.842  1.00 46.54  ? 1297 HOH A O     1 
HETATM 8231 O  O     . HOH P 7 .   ? 1.792   30.725 64.768  1.00 41.07  ? 1298 HOH A O     1 
HETATM 8232 O  O     . HOH P 7 .   ? -30.427 41.593 13.358  1.00 48.93  ? 1299 HOH A O     1 
HETATM 8233 O  O     . HOH P 7 .   ? -22.010 43.915 24.560  1.00 39.37  ? 1300 HOH A O     1 
HETATM 8234 O  O     . HOH P 7 .   ? 10.469  67.893 28.975  1.00 53.61  ? 1301 HOH A O     1 
HETATM 8235 O  O     . HOH P 7 .   ? -0.586  44.608 32.755  1.00 56.27  ? 1302 HOH A O     1 
HETATM 8236 O  O     . HOH P 7 .   ? 19.109  87.556 33.175  1.00 44.93  ? 1303 HOH A O     1 
HETATM 8237 O  O     . HOH P 7 .   ? 25.797  48.557 25.863  1.00 42.21  ? 1304 HOH A O     1 
HETATM 8238 O  O     . HOH P 7 .   ? -12.944 32.239 55.679  1.00 46.66  ? 1305 HOH A O     1 
HETATM 8239 O  O     . HOH P 7 .   ? 20.433  46.199 16.002  1.00 42.78  ? 1306 HOH A O     1 
HETATM 8240 O  O     . HOH P 7 .   ? 13.018  72.778 16.827  1.00 45.03  ? 1307 HOH A O     1 
HETATM 8241 O  O     . HOH P 7 .   ? 20.481  43.642 15.403  1.00 54.87  ? 1308 HOH A O     1 
HETATM 8242 O  O     . HOH P 7 .   ? 3.431   75.472 1.320   1.00 46.98  ? 1309 HOH A O     1 
HETATM 8243 O  O     . HOH P 7 .   ? -0.487  40.391 44.397  1.00 34.10  ? 1310 HOH A O     1 
HETATM 8244 O  O     . HOH P 7 .   ? 2.605   71.226 25.108  1.00 38.38  ? 1311 HOH A O     1 
HETATM 8245 O  O     . HOH P 7 .   ? -24.697 43.992 30.418  1.00 33.62  ? 1312 HOH A O     1 
HETATM 8246 O  O     . HOH P 7 .   ? 3.896   34.846 25.553  1.00 31.81  ? 1313 HOH A O     1 
HETATM 8247 O  O     . HOH P 7 .   ? -0.800  27.349 20.395  1.00 51.80  ? 1314 HOH A O     1 
HETATM 8248 O  O     . HOH P 7 .   ? -18.614 44.289 29.834  1.00 39.68  ? 1315 HOH A O     1 
HETATM 8249 O  O     . HOH P 7 .   ? -21.163 40.050 4.449   1.00 45.05  ? 1316 HOH A O     1 
HETATM 8250 O  O     . HOH P 7 .   ? -2.929  57.914 -6.303  1.00 57.29  ? 1317 HOH A O     1 
HETATM 8251 O  O     . HOH P 7 .   ? 11.799  50.853 28.963  1.00 36.61  ? 1318 HOH A O     1 
HETATM 8252 O  O     . HOH P 7 .   ? 3.600   73.237 -0.678  1.00 43.66  ? 1319 HOH A O     1 
HETATM 8253 O  O     . HOH P 7 .   ? -10.486 55.843 -6.151  1.00 50.37  ? 1320 HOH A O     1 
HETATM 8254 O  O     . HOH P 7 .   ? 3.532   60.140 -6.293  1.00 54.09  ? 1321 HOH A O     1 
HETATM 8255 O  O     . HOH P 7 .   ? 22.521  44.392 26.099  1.00 33.66  ? 1322 HOH A O     1 
HETATM 8256 O  O     . HOH P 7 .   ? 2.835   41.582 14.714  1.00 37.93  ? 1323 HOH A O     1 
HETATM 8257 O  O     . HOH P 7 .   ? 9.524   37.170 67.997  1.00 44.74  ? 1324 HOH A O     1 
HETATM 8258 O  O     . HOH P 7 .   ? -16.882 51.005 54.115  1.00 44.78  ? 1325 HOH A O     1 
HETATM 8259 O  O     . HOH P 7 .   ? -2.950  71.528 -2.532  1.00 50.81  ? 1326 HOH A O     1 
HETATM 8260 O  O     . HOH P 7 .   ? 2.755   65.774 33.600  1.00 42.15  ? 1327 HOH A O     1 
HETATM 8261 O  O     . HOH P 7 .   ? 2.565   33.467 27.543  1.00 34.48  ? 1328 HOH A O     1 
HETATM 8262 O  O     . HOH P 7 .   ? 0.972   33.893 13.771  1.00 36.82  ? 1329 HOH A O     1 
HETATM 8263 O  O     . HOH P 7 .   ? 17.396  33.628 38.908  1.00 40.36  ? 1330 HOH A O     1 
HETATM 8264 O  O     . HOH P 7 .   ? 3.398   33.659 20.268  1.00 46.03  ? 1331 HOH A O     1 
HETATM 8265 O  O     . HOH P 7 .   ? 10.039  72.805 -0.304  1.00 49.28  ? 1332 HOH A O     1 
HETATM 8266 O  O     . HOH P 7 .   ? -41.757 28.854 14.928  1.00 52.62  ? 1333 HOH A O     1 
HETATM 8267 O  O     . HOH P 7 .   ? 16.301  72.955 25.901  1.00 41.49  ? 1334 HOH A O     1 
HETATM 8268 O  O     . HOH P 7 .   ? -16.595 39.243 3.592   1.00 48.55  ? 1335 HOH A O     1 
HETATM 8269 O  O     . HOH P 7 .   ? -6.799  53.318 43.233  1.00 44.57  ? 1336 HOH A O     1 
HETATM 8270 O  O     . HOH P 7 .   ? 36.619  53.018 46.421  1.00 45.70  ? 1337 HOH A O     1 
HETATM 8271 O  O     . HOH P 7 .   ? 0.594   36.519 27.633  1.00 51.92  ? 1338 HOH A O     1 
HETATM 8272 O  O     . HOH P 7 .   ? -15.329 28.005 25.028  1.00 37.10  ? 1339 HOH A O     1 
HETATM 8273 O  O     . HOH P 7 .   ? -12.913 31.538 27.445  1.00 33.19  ? 1340 HOH A O     1 
HETATM 8274 O  O     . HOH P 7 .   ? -12.261 48.618 52.015  1.00 49.69  ? 1341 HOH A O     1 
HETATM 8275 O  O     . HOH P 7 .   ? -1.165  46.496 34.505  1.00 55.90  ? 1342 HOH A O     1 
HETATM 8276 O  O     . HOH P 7 .   ? -12.685 29.063 31.582  1.00 51.75  ? 1343 HOH A O     1 
HETATM 8277 O  O     . HOH P 7 .   ? 13.524  32.265 21.114  1.00 36.23  ? 1344 HOH A O     1 
HETATM 8278 O  O     . HOH P 7 .   ? 10.322  46.769 41.034  1.00 35.64  ? 1345 HOH A O     1 
HETATM 8279 O  O     . HOH P 7 .   ? 7.461   51.388 62.339  1.00 46.35  ? 1346 HOH A O     1 
HETATM 8280 O  O     . HOH P 7 .   ? 13.800  26.855 37.150  1.00 45.11  ? 1347 HOH A O     1 
HETATM 8281 O  O     . HOH P 7 .   ? 15.512  57.230 8.151   1.00 41.84  ? 1348 HOH A O     1 
HETATM 8282 O  O     . HOH P 7 .   ? 7.145   51.178 27.647  1.00 30.48  ? 1349 HOH A O     1 
HETATM 8283 O  O     . HOH P 7 .   ? 14.502  34.791 21.334  1.00 42.78  ? 1350 HOH A O     1 
HETATM 8284 O  O     . HOH P 7 .   ? -24.886 20.484 20.146  1.00 52.15  ? 1351 HOH A O     1 
HETATM 8285 O  O     . HOH P 7 .   ? 8.611   25.181 10.648  1.00 45.48  ? 1352 HOH A O     1 
HETATM 8286 O  O     . HOH P 7 .   ? 14.389  19.221 57.491  1.00 41.58  ? 1353 HOH A O     1 
HETATM 8287 O  O     . HOH P 7 .   ? 23.333  54.393 22.531  1.00 44.02  ? 1354 HOH A O     1 
HETATM 8288 O  O     . HOH P 7 .   ? -12.377 20.599 4.182   1.00 56.35  ? 1355 HOH A O     1 
HETATM 8289 O  O     . HOH P 7 .   ? -25.376 56.826 44.740  1.00 42.59  ? 1356 HOH A O     1 
HETATM 8290 O  O     . HOH P 7 .   ? 36.340  58.247 29.599  1.00 51.85  ? 1357 HOH A O     1 
HETATM 8291 O  O     . HOH P 7 .   ? 30.494  34.759 40.945  1.00 49.93  ? 1358 HOH A O     1 
HETATM 8292 O  O     . HOH P 7 .   ? -9.276  32.116 49.127  1.00 50.74  ? 1359 HOH A O     1 
HETATM 8293 O  O     . HOH P 7 .   ? 28.144  32.998 46.302  1.00 44.52  ? 1360 HOH A O     1 
HETATM 8294 O  O     . HOH P 7 .   ? 9.606   55.535 -3.662  1.00 59.67  ? 1361 HOH A O     1 
HETATM 8295 O  O     . HOH P 7 .   ? 5.573   49.398 7.676   1.00 38.42  ? 1362 HOH A O     1 
HETATM 8296 O  O     . HOH P 7 .   ? -19.466 49.886 53.967  1.00 43.87  ? 1363 HOH A O     1 
HETATM 8297 O  O     . HOH P 7 .   ? 17.198  33.692 21.102  1.00 43.63  ? 1364 HOH A O     1 
HETATM 8298 O  O     . HOH P 7 .   ? 7.531   73.278 0.325   1.00 42.44  ? 1365 HOH A O     1 
HETATM 8299 O  O     . HOH P 7 .   ? -14.829 28.709 33.429  1.00 38.69  ? 1366 HOH A O     1 
HETATM 8300 O  O     . HOH P 7 .   ? 33.560  73.144 40.393  1.00 52.45  ? 1367 HOH A O     1 
HETATM 8301 O  O     . HOH P 7 .   ? -9.887  31.007 40.419  1.00 44.84  ? 1368 HOH A O     1 
HETATM 8302 O  O     . HOH P 7 .   ? 17.038  74.481 35.835  1.00 51.80  ? 1369 HOH A O     1 
HETATM 8303 O  O     . HOH P 7 .   ? 12.272  49.735 44.660  1.00 46.14  ? 1370 HOH A O     1 
HETATM 8304 O  O     . HOH P 7 .   ? -9.898  32.857 42.127  1.00 39.57  ? 1371 HOH A O     1 
HETATM 8305 O  O     . HOH P 7 .   ? 23.129  23.602 41.850  1.00 44.46  ? 1372 HOH A O     1 
HETATM 8306 O  O     . HOH P 7 .   ? -3.735  67.277 6.122   1.00 41.96  ? 1373 HOH A O     1 
HETATM 8307 O  O     . HOH P 7 .   ? 14.090  48.001 7.169   1.00 44.88  ? 1374 HOH A O     1 
HETATM 8308 O  O     . HOH P 7 .   ? 25.517  68.912 15.681  1.00 40.11  ? 1375 HOH A O     1 
HETATM 8309 O  O     . HOH P 7 .   ? -0.917  33.501 46.662  1.00 46.58  ? 1376 HOH A O     1 
HETATM 8310 O  O     . HOH P 7 .   ? 16.027  33.573 31.168  1.00 43.73  ? 1377 HOH A O     1 
HETATM 8311 O  O     . HOH P 7 .   ? 12.408  48.577 47.125  1.00 46.26  ? 1378 HOH A O     1 
HETATM 8312 O  O     . HOH P 7 .   ? -5.127  51.932 -8.318  1.00 57.10  ? 1379 HOH A O     1 
HETATM 8313 O  O     . HOH P 7 .   ? 10.540  53.135 57.714  1.00 45.55  ? 1380 HOH A O     1 
HETATM 8314 O  O     . HOH P 7 .   ? -7.809  39.826 25.998  1.00 53.97  ? 1381 HOH A O     1 
HETATM 8315 O  O     . HOH P 7 .   ? -15.541 40.514 -2.019  1.00 51.93  ? 1382 HOH A O     1 
HETATM 8316 O  O     . HOH P 7 .   ? 14.209  15.449 40.707  1.00 51.88  ? 1383 HOH A O     1 
HETATM 8317 O  O     . HOH P 7 .   ? -19.200 56.776 12.829  1.00 49.20  ? 1384 HOH A O     1 
HETATM 8318 O  O     . HOH P 7 .   ? -21.503 38.621 37.661  1.00 41.10  ? 1385 HOH A O     1 
HETATM 8319 O  O     . HOH P 7 .   ? 2.021   26.829 17.178  1.00 54.94  ? 1386 HOH A O     1 
HETATM 8320 O  O     . HOH P 7 .   ? 17.575  63.994 33.826  1.00 45.70  ? 1387 HOH A O     1 
HETATM 8321 O  O     . HOH P 7 .   ? -6.987  37.692 26.321  1.00 45.37  ? 1388 HOH A O     1 
HETATM 8322 O  O     . HOH P 7 .   ? 16.570  55.979 6.063   1.00 53.73  ? 1389 HOH A O     1 
HETATM 8323 O  O     . HOH P 7 .   ? -27.956 44.073 55.974  1.00 50.96  ? 1390 HOH A O     1 
HETATM 8324 O  O     . HOH P 7 .   ? -13.637 47.264 56.150  1.00 56.45  ? 1391 HOH A O     1 
HETATM 8325 O  O     . HOH P 7 .   ? 11.336  50.356 68.369  1.00 65.65  ? 1392 HOH A O     1 
HETATM 8326 O  O     . HOH P 7 .   ? -10.571 50.444 -10.175 1.00 54.84  ? 1393 HOH A O     1 
HETATM 8327 O  O     . HOH P 7 .   ? 8.287   39.158 69.635  1.00 47.02  ? 1394 HOH A O     1 
HETATM 8328 O  O     . HOH P 7 .   ? 15.422  15.377 25.777  1.00 61.42  ? 1395 HOH A O     1 
HETATM 8329 O  O     . HOH P 7 .   ? -25.663 28.350 50.964  1.00 52.08  ? 1396 HOH A O     1 
HETATM 8330 O  O     . HOH P 7 .   ? -13.731 28.627 35.754  1.00 50.30  ? 1397 HOH A O     1 
HETATM 8331 O  O     . HOH P 7 .   ? 2.565   76.604 9.541   1.00 44.90  ? 1398 HOH A O     1 
HETATM 8332 O  O     . HOH P 7 .   ? 20.633  75.835 19.573  1.00 46.49  ? 1399 HOH A O     1 
HETATM 8333 O  O     . HOH P 7 .   ? 14.560  30.692 23.056  1.00 44.12  ? 1400 HOH A O     1 
HETATM 8334 O  O     . HOH P 7 .   ? 2.569   48.156 34.088  1.00 38.00  ? 1401 HOH A O     1 
HETATM 8335 O  O     . HOH P 7 .   ? 15.084  35.859 13.114  1.00 40.63  ? 1402 HOH A O     1 
HETATM 8336 O  O     . HOH P 7 .   ? 20.027  27.742 62.740  1.00 49.88  ? 1403 HOH A O     1 
HETATM 8337 O  O     . HOH P 7 .   ? 20.423  37.819 30.524  1.00 47.17  ? 1404 HOH A O     1 
HETATM 8338 O  O     . HOH P 7 .   ? -3.662  44.839 35.531  1.00 47.76  ? 1405 HOH A O     1 
HETATM 8339 O  O     . HOH P 7 .   ? 6.930   75.293 2.394   1.00 53.42  ? 1406 HOH A O     1 
HETATM 8340 O  O     . HOH P 7 .   ? -30.489 44.289 19.942  1.00 54.90  ? 1407 HOH A O     1 
HETATM 8341 O  O     . HOH P 7 .   ? 21.124  50.398 12.039  1.00 50.84  ? 1408 HOH A O     1 
HETATM 8342 O  O     . HOH P 7 .   ? 28.937  33.516 49.252  1.00 49.91  ? 1409 HOH A O     1 
HETATM 8343 O  O     . HOH P 7 .   ? 29.571  75.694 40.560  1.00 56.45  ? 1410 HOH A O     1 
HETATM 8344 O  O     . HOH P 7 .   ? -23.855 46.259 16.248  1.00 44.64  ? 1411 HOH A O     1 
HETATM 8345 O  O     . HOH P 7 .   ? 26.032  53.039 24.397  1.00 51.08  ? 1412 HOH A O     1 
HETATM 8346 O  O     . HOH P 7 .   ? 3.451   29.773 53.757  1.00 35.66  ? 1413 HOH A O     1 
HETATM 8347 O  O     . HOH P 7 .   ? 3.512   2.483  15.741  1.00 52.00  ? 1414 HOH A O     1 
HETATM 8348 O  O     . HOH P 7 .   ? -19.697 38.283 3.800   1.00 50.57  ? 1415 HOH A O     1 
HETATM 8349 O  O     . HOH P 7 .   ? 12.092  58.364 34.235  1.00 46.24  ? 1416 HOH A O     1 
HETATM 8350 O  O     . HOH P 7 .   ? 12.493  68.659 21.582  1.00 45.24  ? 1417 HOH A O     1 
HETATM 8351 O  O     . HOH P 7 .   ? 19.267  21.910 54.900  1.00 48.45  ? 1418 HOH A O     1 
HETATM 8352 O  O     . HOH P 7 .   ? 18.540  20.140 51.062  1.00 46.58  ? 1419 HOH A O     1 
HETATM 8353 O  O     . HOH P 7 .   ? 32.500  37.607 40.914  1.00 49.90  ? 1420 HOH A O     1 
HETATM 8354 O  O     . HOH P 7 .   ? -6.618  47.471 38.880  1.00 46.14  ? 1421 HOH A O     1 
HETATM 8355 O  O     . HOH P 7 .   ? -18.737 28.441 53.807  1.00 61.23  ? 1422 HOH A O     1 
HETATM 8356 O  O     . HOH P 7 .   ? -13.978 28.818 40.072  1.00 46.07  ? 1423 HOH A O     1 
HETATM 8357 O  O     . HOH P 7 .   ? 18.826  69.512 36.491  1.00 53.82  ? 1424 HOH A O     1 
HETATM 8358 O  O     . HOH P 7 .   ? 12.501  72.705 20.627  1.00 50.45  ? 1425 HOH A O     1 
HETATM 8359 O  O     . HOH P 7 .   ? -13.690 37.694 51.561  1.00 33.03  ? 1426 HOH A O     1 
HETATM 8360 O  O     . HOH P 7 .   ? -23.065 33.069 5.907   1.00 48.15  ? 1427 HOH A O     1 
HETATM 8361 O  O     . HOH P 7 .   ? -5.086  43.499 41.923  1.00 39.85  ? 1428 HOH A O     1 
HETATM 8362 O  O     . HOH P 7 .   ? 27.028  40.180 45.721  1.00 36.95  ? 1429 HOH A O     1 
HETATM 8363 O  O     . HOH P 7 .   ? 35.740  61.813 37.407  1.00 49.16  ? 1430 HOH A O     1 
HETATM 8364 O  O     . HOH P 7 .   ? 38.798  69.239 31.086  1.00 44.36  ? 1431 HOH A O     1 
HETATM 8365 O  O     . HOH P 7 .   ? -7.184  57.251 43.673  1.00 51.10  ? 1432 HOH A O     1 
HETATM 8366 O  O     . HOH P 7 .   ? -15.441 27.714 45.277  1.00 41.55  ? 1433 HOH A O     1 
HETATM 8367 O  O     . HOH P 7 .   ? -12.223 53.535 -1.972  1.00 51.07  ? 1434 HOH A O     1 
HETATM 8368 O  O     . HOH P 7 .   ? -13.041 58.930 12.598  1.00 40.85  ? 1435 HOH A O     1 
HETATM 8369 O  O     . HOH P 7 .   ? -31.734 43.613 50.954  1.00 53.10  ? 1436 HOH A O     1 
HETATM 8370 O  O     . HOH P 7 .   ? 1.799   31.772 46.753  1.00 43.67  ? 1437 HOH A O     1 
HETATM 8371 O  O     . HOH P 7 .   ? 10.140  69.013 -9.027  1.00 55.94  ? 1438 HOH A O     1 
HETATM 8372 O  O     . HOH P 7 .   ? 17.825  82.384 26.045  1.00 63.70  ? 1439 HOH A O     1 
HETATM 8373 O  O     . HOH P 7 .   ? 2.481   29.916 49.359  1.00 50.85  ? 1440 HOH A O     1 
HETATM 8374 O  O     . HOH P 7 .   ? 14.449  69.769 25.923  1.00 47.81  ? 1441 HOH A O     1 
HETATM 8375 O  O     . HOH P 7 .   ? -0.028  43.247 13.694  1.00 56.42  ? 1442 HOH A O     1 
HETATM 8376 O  O     . HOH P 7 .   ? 20.606  29.649 69.573  1.00 50.32  ? 1443 HOH A O     1 
HETATM 8377 O  O     . HOH P 7 .   ? -12.490 37.338 34.436  1.00 29.99  ? 1444 HOH A O     1 
HETATM 8378 O  O     . HOH P 7 .   ? 4.675   22.008 64.723  1.00 34.11  ? 1445 HOH A O     1 
HETATM 8379 O  O     . HOH P 7 .   ? 16.108  24.784 40.698  1.00 50.96  ? 1446 HOH A O     1 
HETATM 8380 O  O     . HOH P 7 .   ? 5.817   54.616 1.450   1.00 39.38  ? 1447 HOH A O     1 
HETATM 8381 O  O     . HOH P 7 .   ? -31.184 44.914 47.720  1.00 45.36  ? 1448 HOH A O     1 
HETATM 8382 O  O     . HOH P 7 .   ? 4.061   40.033 16.503  1.00 35.84  ? 1449 HOH A O     1 
HETATM 8383 O  O     . HOH P 7 .   ? 12.591  34.519 73.555  1.00 45.82  ? 1450 HOH A O     1 
HETATM 8384 O  O     . HOH P 7 .   ? 23.844  30.979 38.064  1.00 63.55  ? 1451 HOH A O     1 
HETATM 8385 O  O     . HOH P 7 .   ? 2.790   39.271 8.157   1.00 67.16  ? 1452 HOH A O     1 
HETATM 8386 O  O     . HOH P 7 .   ? 2.547   43.076 8.645   1.00 77.40  ? 1453 HOH A O     1 
HETATM 8387 O  O     . HOH P 7 .   ? 21.614  43.591 23.859  1.00 45.20  ? 1454 HOH A O     1 
HETATM 8388 O  O     . HOH P 7 .   ? 18.292  34.919 34.969  1.00 49.15  ? 1455 HOH A O     1 
HETATM 8389 O  O     . HOH P 7 .   ? 19.498  34.250 31.112  1.00 53.03  ? 1456 HOH A O     1 
HETATM 8390 O  O     . HOH P 7 .   ? 19.024  35.524 32.939  1.00 56.86  ? 1457 HOH A O     1 
HETATM 8391 O  O     . HOH P 7 .   ? 21.419  32.209 71.503  1.00 39.18  ? 1458 HOH A O     1 
HETATM 8392 O  O     . HOH P 7 .   ? 10.155  71.847 21.078  1.00 59.63  ? 1459 HOH A O     1 
HETATM 8393 O  O     . HOH P 7 .   ? 12.851  67.236 30.679  1.00 48.46  ? 1460 HOH A O     1 
HETATM 8394 O  O     . HOH P 7 .   ? 14.881  66.089 30.376  1.00 50.94  ? 1461 HOH A O     1 
HETATM 8395 O  O     . HOH P 7 .   ? -21.051 34.530 6.182   1.00 42.58  ? 1462 HOH A O     1 
HETATM 8396 O  O     . HOH P 7 .   ? 3.373   32.789 51.007  1.00 52.78  ? 1463 HOH A O     1 
HETATM 8397 O  O     . HOH P 7 .   ? 4.464   37.376 51.873  1.00 67.73  ? 1464 HOH A O     1 
HETATM 8398 O  O     . HOH P 7 .   ? 3.697   35.032 49.188  1.00 69.33  ? 1465 HOH A O     1 
HETATM 8399 O  O     . HOH P 7 .   ? 29.737  44.674 45.866  1.00 58.16  ? 1466 HOH A O     1 
HETATM 8400 O  O     . HOH P 7 .   ? 28.790  41.994 49.686  1.00 54.07  ? 1467 HOH A O     1 
HETATM 8401 O  O     . HOH P 7 .   ? 28.279  40.295 48.085  1.00 59.71  ? 1468 HOH A O     1 
HETATM 8402 O  O     . HOH P 7 .   ? 9.485   42.618 12.398  1.00 29.07  ? 1469 HOH A O     1 
HETATM 8403 O  O     . HOH P 7 .   ? -32.335 35.430 19.171  1.00 53.80  ? 1470 HOH A O     1 
HETATM 8404 O  O     . HOH P 7 .   ? 2.369   7.333  13.185  1.00 94.55  ? 1471 HOH A O     1 
HETATM 8405 O  O     . HOH P 7 .   ? 2.618   9.371  11.109  1.00 62.58  ? 1472 HOH A O     1 
HETATM 8406 O  O     . HOH P 7 .   ? -9.440  59.459 14.499  1.00 44.63  ? 1473 HOH A O     1 
HETATM 8407 O  O     . HOH P 7 .   ? 6.825   21.618 61.623  1.00 50.10  ? 1474 HOH A O     1 
HETATM 8408 O  O     . HOH P 7 .   ? 14.678  23.970 38.796  1.00 58.94  ? 1475 HOH A O     1 
HETATM 8409 O  O     . HOH P 7 .   ? 12.611  25.501 35.761  1.00 62.83  ? 1476 HOH A O     1 
HETATM 8410 O  O     . HOH P 7 .   ? 16.718  26.869 40.870  1.00 55.45  ? 1477 HOH A O     1 
HETATM 8411 O  O     . HOH P 7 .   ? -11.493 55.983 4.832   1.00 74.44  ? 1478 HOH A O     1 
HETATM 8412 O  O     . HOH P 7 .   ? -6.395  34.332 17.589  1.00 50.27  ? 1479 HOH A O     1 
HETATM 8413 O  O     . HOH P 7 .   ? -11.005 34.410 23.219  1.00 56.00  ? 1480 HOH A O     1 
HETATM 8414 O  O     . HOH P 7 .   ? -10.379 36.456 32.626  1.00 48.48  ? 1481 HOH A O     1 
HETATM 8415 O  O     . HOH P 7 .   ? -6.628  35.765 32.347  1.00 54.61  ? 1482 HOH A O     1 
HETATM 8416 O  O     . HOH P 7 .   ? 23.188  51.769 21.897  1.00 70.76  ? 1483 HOH A O     1 
HETATM 8417 O  O     . HOH P 7 .   ? 25.220  50.397 23.821  1.00 52.31  ? 1484 HOH A O     1 
HETATM 8418 O  O     . HOH P 7 .   ? 28.884  51.903 23.060  1.00 46.14  ? 1485 HOH A O     1 
HETATM 8419 O  O     . HOH P 7 .   ? 25.051  53.845 21.027  1.00 64.06  ? 1486 HOH A O     1 
HETATM 8420 O  O     . HOH P 7 .   ? -5.050  40.571 43.300  1.00 50.57  ? 1487 HOH A O     1 
HETATM 8421 O  O     . HOH P 7 .   ? -7.356  41.405 44.262  1.00 47.75  ? 1488 HOH A O     1 
HETATM 8422 O  O     . HOH P 7 .   ? 17.335  86.745 30.887  1.00 44.75  ? 1489 HOH A O     1 
HETATM 8423 O  O     . HOH P 7 .   ? 19.513  44.172 23.348  1.00 58.09  ? 1490 HOH A O     1 
HETATM 8424 O  O     . HOH P 7 .   ? 9.787   72.438 -2.961  1.00 46.63  ? 1491 HOH A O     1 
HETATM 8425 O  O     . HOH P 7 .   ? -3.628  67.980 9.347   1.00 60.46  ? 1492 HOH A O     1 
HETATM 8426 O  O     . HOH P 7 .   ? -8.078  67.460 7.393   1.00 50.42  ? 1493 HOH A O     1 
HETATM 8427 O  O     . HOH P 7 .   ? -31.329 43.134 45.373  1.00 51.98  ? 1494 HOH A O     1 
HETATM 8428 O  O     . HOH P 7 .   ? -26.482 43.493 11.536  1.00 49.72  ? 1495 HOH A O     1 
HETATM 8429 O  O     . HOH P 7 .   ? 28.462  53.613 58.408  1.00 49.95  ? 1496 HOH A O     1 
HETATM 8430 O  O     . HOH P 7 .   ? -14.523 30.497 52.103  1.00 52.46  ? 1497 HOH A O     1 
HETATM 8431 O  O     . HOH P 7 .   ? 13.546  37.764 69.747  1.00 41.29  ? 1498 HOH A O     1 
HETATM 8432 O  O     . HOH P 7 .   ? 9.205   53.670 61.443  1.00 56.83  ? 1499 HOH A O     1 
HETATM 8433 O  O     . HOH P 7 .   ? -23.048 21.842 40.860  1.00 56.23  ? 1500 HOH A O     1 
HETATM 8434 O  O     . HOH P 7 .   ? -3.730  28.426 31.935  1.00 67.65  ? 1501 HOH A O     1 
HETATM 8435 O  O     . HOH P 7 .   ? -6.287  29.846 34.083  1.00 45.73  ? 1502 HOH A O     1 
HETATM 8436 O  O     . HOH P 7 .   ? 35.302  59.519 36.205  1.00 54.99  ? 1503 HOH A O     1 
HETATM 8437 O  O     . HOH P 7 .   ? 24.929  29.195 39.810  1.00 58.20  ? 1504 HOH A O     1 
HETATM 8438 O  O     . HOH P 7 .   ? 22.600  25.097 58.650  1.00 58.25  ? 1505 HOH A O     1 
HETATM 8439 O  O     . HOH P 7 .   ? 15.696  54.691 57.821  1.00 60.19  ? 1506 HOH A O     1 
HETATM 8440 O  O     . HOH P 7 .   ? -3.434  22.314 56.278  1.00 43.54  ? 1507 HOH A O     1 
HETATM 8441 O  O     . HOH P 7 .   ? -24.832 42.140 57.046  1.00 61.56  ? 1508 HOH A O     1 
HETATM 8442 O  O     . HOH P 7 .   ? 35.564  63.268 34.658  1.00 48.47  ? 1509 HOH A O     1 
HETATM 8443 O  O     . HOH P 7 .   ? -7.068  41.724 55.288  1.00 47.53  ? 1510 HOH A O     1 
HETATM 8444 O  O     . HOH P 7 .   ? -8.086  38.251 50.464  1.00 52.82  ? 1511 HOH A O     1 
HETATM 8445 O  O     . HOH P 7 .   ? -4.844  45.507 39.482  1.00 59.34  ? 1512 HOH A O     1 
HETATM 8446 O  O     . HOH P 7 .   ? 11.659  69.265 33.139  1.00 61.74  ? 1513 HOH A O     1 
HETATM 8447 O  O     . HOH P 7 .   ? 8.055   69.082 32.105  1.00 78.08  ? 1514 HOH A O     1 
HETATM 8448 O  O     . HOH P 7 .   ? 16.673  19.904 56.675  1.00 50.13  ? 1515 HOH A O     1 
HETATM 8449 O  O     . HOH P 7 .   ? -28.437 27.309 42.454  1.00 60.73  ? 1516 HOH A O     1 
HETATM 8450 O  O     . HOH P 7 .   ? -16.366 62.075 48.505  1.00 55.15  ? 1517 HOH A O     1 
HETATM 8451 O  O     . HOH P 7 .   ? -16.495 60.864 51.119  1.00 78.76  ? 1518 HOH A O     1 
HETATM 8452 O  O     . HOH P 7 .   ? 5.254   48.133 42.785  1.00 62.31  ? 1519 HOH A O     1 
HETATM 8453 O  O     . HOH P 7 .   ? 5.753   48.832 44.934  1.00 62.09  ? 1520 HOH A O     1 
HETATM 8454 O  O     . HOH P 7 .   ? -6.142  20.207 8.589   1.00 61.33  ? 1521 HOH A O     1 
HETATM 8455 O  O     . HOH P 7 .   ? -13.682 50.940 -8.692  1.00 56.93  ? 1522 HOH A O     1 
HETATM 8456 O  O     . HOH P 7 .   ? 8.489   34.686 45.667  1.00 51.81  ? 1523 HOH A O     1 
HETATM 8457 O  O     . HOH P 7 .   ? 7.345   47.382 -0.807  1.00 51.02  ? 1524 HOH A O     1 
HETATM 8458 O  O     . HOH P 7 .   ? -17.787 22.668 10.924  1.00 56.29  ? 1525 HOH A O     1 
HETATM 8459 O  O     . HOH P 7 .   ? 26.097  40.503 26.710  1.00 51.03  ? 1526 HOH A O     1 
HETATM 8460 O  O     . HOH P 7 .   ? 5.359   45.723 44.299  1.00 43.77  ? 1527 HOH A O     1 
HETATM 8461 O  O     . HOH P 7 .   ? 3.993   33.482 23.401  1.00 51.75  ? 1528 HOH A O     1 
HETATM 8462 O  O     . HOH P 7 .   ? -31.955 33.801 41.121  1.00 44.38  ? 1529 HOH A O     1 
HETATM 8463 O  O     . HOH P 7 .   ? 5.976   42.593 12.143  1.00 50.23  ? 1530 HOH A O     1 
HETATM 8464 O  O     . HOH P 7 .   ? 20.786  68.308 11.221  1.00 59.65  ? 1531 HOH A O     1 
HETATM 8465 O  O     . HOH P 7 .   ? 15.563  70.912 21.882  1.00 56.20  ? 1532 HOH A O     1 
HETATM 8466 O  O     . HOH P 7 .   ? 16.022  73.038 23.431  1.00 58.29  ? 1533 HOH A O     1 
HETATM 8467 O  O     . HOH P 7 .   ? 26.144  67.046 46.322  1.00 56.53  ? 1534 HOH A O     1 
HETATM 8468 O  O     . HOH P 7 .   ? 16.348  78.847 29.238  1.00 62.49  ? 1535 HOH A O     1 
HETATM 8469 O  O     . HOH P 7 .   ? -6.477  44.121 57.382  1.00 62.60  ? 1536 HOH A O     1 
HETATM 8470 O  O     . HOH P 7 .   ? 0.310   48.020 52.430  1.00 51.56  ? 1537 HOH A O     1 
HETATM 8471 O  O     . HOH P 7 .   ? 22.484  29.184 61.464  1.00 53.21  ? 1538 HOH A O     1 
HETATM 8472 O  O     . HOH P 7 .   ? 11.493  53.204 63.973  1.00 60.09  ? 1539 HOH A O     1 
HETATM 8473 O  O     . HOH P 7 .   ? 10.173  51.392 61.596  1.00 97.87  ? 1540 HOH A O     1 
HETATM 8474 O  O     . HOH P 7 .   ? 3.138   47.739 38.315  1.00 52.93  ? 1541 HOH A O     1 
HETATM 8475 O  O     . HOH P 7 .   ? -4.895  27.251 59.141  1.00 49.21  ? 1542 HOH A O     1 
HETATM 8476 O  O     . HOH P 7 .   ? -29.143 32.979 9.056   1.00 69.74  ? 1543 HOH A O     1 
HETATM 8477 O  O     . HOH P 7 .   ? -31.616 34.641 10.892  1.00 78.84  ? 1544 HOH A O     1 
HETATM 8478 O  O     . HOH P 7 .   ? 5.126   41.032 8.250   1.00 64.93  ? 1545 HOH A O     1 
HETATM 8479 O  O     . HOH P 7 .   ? 15.141  48.382 4.274   1.00 57.95  ? 1546 HOH A O     1 
HETATM 8480 O  O     . HOH P 7 .   ? 17.386  52.308 7.781   1.00 63.58  ? 1547 HOH A O     1 
HETATM 8481 O  O     . HOH P 7 .   ? 19.479  55.652 6.695   1.00 58.09  ? 1548 HOH A O     1 
HETATM 8482 O  O     . HOH P 7 .   ? -0.870  65.795 -7.428  1.00 63.41  ? 1549 HOH A O     1 
HETATM 8483 O  O     . HOH P 7 .   ? 0.133   62.069 -7.170  1.00 56.42  ? 1550 HOH A O     1 
HETATM 8484 O  O     . HOH P 7 .   ? 19.386  74.487 5.309   1.00 57.81  ? 1551 HOH A O     1 
HETATM 8485 O  O     . HOH P 7 .   ? 22.188  74.857 6.495   1.00 69.10  ? 1552 HOH A O     1 
HETATM 8486 O  O     . HOH P 7 .   ? 8.846   34.524 9.763   1.00 54.36  ? 1553 HOH A O     1 
HETATM 8487 O  O     . HOH P 7 .   ? 4.347   10.255 15.422  1.00 54.30  ? 1554 HOH A O     1 
HETATM 8488 O  O     . HOH P 7 .   ? 11.446  8.642  26.805  1.00 72.05  ? 1555 HOH A O     1 
HETATM 8489 O  O     . HOH P 7 .   ? 5.934   17.948 28.824  1.00 72.64  ? 1556 HOH A O     1 
HETATM 8490 O  O     . HOH P 7 .   ? 15.327  70.685 33.264  1.00 58.06  ? 1557 HOH A O     1 
HETATM 8491 O  O     . HOH P 7 .   ? 14.986  68.678 34.393  1.00 65.54  ? 1558 HOH A O     1 
HETATM 8492 O  O     . HOH P 7 .   ? 16.011  75.594 29.498  1.00 67.15  ? 1559 HOH A O     1 
HETATM 8493 O  O     . HOH P 7 .   ? 15.993  75.875 27.113  1.00 64.67  ? 1560 HOH A O     1 
HETATM 8494 O  O     . HOH P 7 .   ? 14.700  75.540 32.340  1.00 60.69  ? 1561 HOH A O     1 
HETATM 8495 O  O     . HOH P 7 .   ? 16.422  78.078 40.151  1.00 75.74  ? 1562 HOH A O     1 
HETATM 8496 O  O     . HOH P 7 .   ? 18.467  85.010 26.082  1.00 48.44  ? 1563 HOH A O     1 
HETATM 8497 O  O     . HOH P 7 .   ? 11.565  69.256 23.644  1.00 49.42  ? 1564 HOH A O     1 
HETATM 8498 O  O     . HOH P 7 .   ? 18.796  73.832 22.700  1.00 81.26  ? 1565 HOH A O     1 
HETATM 8499 O  O     . HOH P 7 .   ? 0.069   42.638 -8.661  1.00 49.95  ? 1566 HOH A O     1 
HETATM 8500 O  O     . HOH P 7 .   ? -0.377  36.982 -11.547 1.00 61.65  ? 1567 HOH A O     1 
HETATM 8501 O  O     . HOH P 7 .   ? 6.472   40.248 1.760   1.00 64.88  ? 1568 HOH A O     1 
HETATM 8502 O  O     . HOH P 7 .   ? 6.925   45.003 1.208   1.00 75.72  ? 1569 HOH A O     1 
HETATM 8503 O  O     . HOH P 7 .   ? 7.210   42.797 3.528   1.00 62.39  ? 1570 HOH A O     1 
HETATM 8504 O  O     . HOH P 7 .   ? 4.803   52.870 -7.818  1.00 52.70  ? 1571 HOH A O     1 
HETATM 8505 O  O     . HOH P 7 .   ? 4.879   58.295 -8.503  1.00 63.14  ? 1572 HOH A O     1 
HETATM 8506 O  O     . HOH P 7 .   ? 5.092   60.818 -10.275 1.00 82.82  ? 1573 HOH A O     1 
HETATM 8507 O  O     . HOH P 7 .   ? 6.929   59.374 -10.834 1.00 77.87  ? 1574 HOH A O     1 
HETATM 8508 O  O     . HOH P 7 .   ? 16.327  54.113 8.963   1.00 60.26  ? 1575 HOH A O     1 
HETATM 8509 O  O     . HOH P 7 .   ? -16.296 56.605 16.196  1.00 53.96  ? 1576 HOH A O     1 
HETATM 8510 O  O     . HOH P 7 .   ? -5.249  19.425 10.519  1.00 67.42  ? 1577 HOH A O     1 
HETATM 8511 O  O     . HOH P 7 .   ? -20.971 43.252 28.611  1.00 45.49  ? 1578 HOH A O     1 
HETATM 8512 O  O     . HOH P 7 .   ? -8.594  36.683 20.171  1.00 55.74  ? 1579 HOH A O     1 
HETATM 8513 O  O     . HOH P 7 .   ? -5.127  41.243 27.256  1.00 61.45  ? 1580 HOH A O     1 
HETATM 8514 O  O     . HOH P 7 .   ? -16.405 48.058 36.568  1.00 51.13  ? 1581 HOH A O     1 
HETATM 8515 O  O     . HOH P 7 .   ? -22.555 19.539 19.764  1.00 65.15  ? 1582 HOH A O     1 
HETATM 8516 O  O     . HOH P 7 .   ? -33.032 26.703 28.094  1.00 56.61  ? 1583 HOH A O     1 
HETATM 8517 O  O     . HOH P 7 .   ? -34.526 35.448 21.521  1.00 64.24  ? 1584 HOH A O     1 
HETATM 8518 O  O     . HOH P 7 .   ? -34.121 35.609 25.683  1.00 68.59  ? 1585 HOH A O     1 
HETATM 8519 O  O     . HOH P 7 .   ? -29.881 24.109 38.094  1.00 46.99  ? 1586 HOH A O     1 
HETATM 8520 O  O     . HOH P 7 .   ? -21.872 42.876 61.842  1.00 77.23  ? 1587 HOH A O     1 
HETATM 8521 O  O     . HOH P 7 .   ? -25.058 41.953 60.815  1.00 66.27  ? 1588 HOH A O     1 
HETATM 8522 O  O     . HOH P 7 .   ? 18.869  18.624 42.352  1.00 61.77  ? 1589 HOH A O     1 
HETATM 8523 O  O     . HOH P 7 .   ? 25.494  80.264 27.438  1.00 41.96  ? 1590 HOH A O     1 
HETATM 8524 O  O     . HOH P 7 .   ? 6.577   18.364 60.443  1.00 58.52  ? 1591 HOH A O     1 
HETATM 8525 O  O     . HOH P 7 .   ? -6.656  65.989 19.559  1.00 57.82  ? 1592 HOH A O     1 
HETATM 8526 O  O     . HOH P 7 .   ? 18.800  30.793 38.697  1.00 53.79  ? 1593 HOH A O     1 
HETATM 8527 O  O     . HOH P 7 .   ? 10.906  57.807 -3.193  1.00 63.92  ? 1594 HOH A O     1 
HETATM 8528 O  O     . HOH Q 7 .   ? -4.672  56.136 18.182  1.00 26.55  ? 101  HOH T O     1 
HETATM 8529 O  O     . HOH Q 7 .   ? -1.112  57.557 20.184  1.00 24.57  ? 102  HOH T O     1 
HETATM 8530 O  O     . HOH Q 7 .   ? -11.057 57.451 13.725  1.00 25.09  ? 103  HOH T O     1 
HETATM 8531 O  O     . HOH Q 7 .   ? -5.482  59.968 25.885  1.00 41.50  ? 104  HOH T O     1 
HETATM 8532 O  O     . HOH Q 7 .   ? -4.905  63.604 23.324  1.00 31.19  ? 105  HOH T O     1 
HETATM 8533 O  O     . HOH Q 7 .   ? -18.471 51.483 16.544  1.00 34.69  ? 106  HOH T O     1 
HETATM 8534 O  O     . HOH Q 7 .   ? -3.080  56.172 26.779  1.00 38.00  ? 107  HOH T O     1 
HETATM 8535 O  O     . HOH Q 7 .   ? -20.634 50.171 17.840  1.00 41.55  ? 108  HOH T O     1 
HETATM 8536 O  O     . HOH Q 7 .   ? 5.835   53.556 30.819  1.00 42.29  ? 109  HOH T O     1 
HETATM 8537 O  O     . HOH Q 7 .   ? -1.471  57.531 28.310  1.00 51.88  ? 110  HOH T O     1 
HETATM 8538 O  O     . HOH Q 7 .   ? -48.541 64.140 23.821  1.00 38.15  ? 111  HOH T O     1 
HETATM 8539 O  O     . HOH Q 7 .   ? -1.552  64.643 25.769  1.00 33.15  ? 112  HOH T O     1 
HETATM 8540 O  O     . HOH Q 7 .   ? -20.642 47.372 19.176  1.00 40.94  ? 113  HOH T O     1 
HETATM 8541 O  O     . HOH Q 7 .   ? -2.165  60.525 27.957  1.00 40.43  ? 114  HOH T O     1 
HETATM 8542 O  O     . HOH Q 7 .   ? -21.908 53.945 37.176  1.00 38.19  ? 115  HOH T O     1 
HETATM 8543 O  O     . HOH Q 7 .   ? -27.976 53.095 33.120  1.00 50.95  ? 116  HOH T O     1 
HETATM 8544 O  O     . HOH Q 7 .   ? -9.079  60.269 22.489  1.00 45.80  ? 117  HOH T O     1 
HETATM 8545 O  O     . HOH Q 7 .   ? -19.891 50.250 34.951  1.00 40.47  ? 118  HOH T O     1 
HETATM 8546 O  O     . HOH Q 7 .   ? 7.575   54.408 34.332  1.00 40.48  ? 119  HOH T O     1 
HETATM 8547 O  O     . HOH Q 7 .   ? -27.520 54.762 31.144  1.00 45.34  ? 120  HOH T O     1 
HETATM 8548 O  O     . HOH Q 7 .   ? -14.108 59.302 15.660  1.00 44.68  ? 121  HOH T O     1 
HETATM 8549 O  O     . HOH Q 7 .   ? -41.669 61.138 28.471  1.00 61.14  ? 122  HOH T O     1 
HETATM 8550 O  O     . HOH Q 7 .   ? -17.065 57.089 19.992  1.00 46.44  ? 123  HOH T O     1 
HETATM 8551 O  O     . HOH Q 7 .   ? -7.004  63.667 21.396  1.00 40.58  ? 124  HOH T O     1 
HETATM 8552 O  O     . HOH Q 7 .   ? 2.111   64.174 31.672  1.00 40.19  ? 125  HOH T O     1 
HETATM 8553 O  O     . HOH Q 7 .   ? 2.944   53.528 30.593  1.00 47.01  ? 126  HOH T O     1 
HETATM 8554 O  O     . HOH Q 7 .   ? -0.054  62.336 28.300  1.00 44.88  ? 127  HOH T O     1 
HETATM 8555 O  O     . HOH Q 7 .   ? -11.004 58.001 25.483  1.00 42.10  ? 128  HOH T O     1 
HETATM 8556 O  O     . HOH Q 7 .   ? -7.422  61.326 24.952  1.00 50.12  ? 129  HOH T O     1 
HETATM 8557 O  O     . HOH Q 7 .   ? -18.174 55.080 16.494  1.00 40.25  ? 130  HOH T O     1 
HETATM 8558 O  O     . HOH Q 7 .   ? -17.938 56.459 26.547  1.00 49.17  ? 131  HOH T O     1 
HETATM 8559 O  O     . HOH Q 7 .   ? -1.642  52.083 26.939  1.00 56.72  ? 132  HOH T O     1 
HETATM 8560 O  O     . HOH Q 7 .   ? -18.580 48.084 32.605  1.00 54.01  ? 133  HOH T O     1 
HETATM 8561 O  O     . HOH Q 7 .   ? -13.084 58.371 21.635  1.00 46.42  ? 134  HOH T O     1 
HETATM 8562 O  O     . HOH Q 7 .   ? 4.657   58.523 36.457  1.00 56.43  ? 135  HOH T O     1 
HETATM 8563 O  O     . HOH Q 7 .   ? -30.582 54.824 32.874  1.00 58.22  ? 136  HOH T O     1 
HETATM 8564 O  O     . HOH Q 7 .   ? -32.041 53.995 30.856  1.00 53.59  ? 137  HOH T O     1 
HETATM 8565 O  O     . HOH Q 7 .   ? -38.272 64.135 37.321  1.00 57.47  ? 138  HOH T O     1 
HETATM 8566 O  O     . HOH Q 7 .   ? -18.786 55.217 24.713  1.00 65.72  ? 139  HOH T O     1 
HETATM 8567 O  O     . HOH Q 7 .   ? -38.401 63.093 27.789  1.00 58.15  ? 140  HOH T O     1 
HETATM 8568 O  O     . HOH Q 7 .   ? -15.475 56.293 24.768  1.00 59.39  ? 141  HOH T O     1 
HETATM 8569 O  O     . HOH R 7 .   ? -10.274 43.440 35.402  1.00 36.83  ? 201  HOH P O     1 
HETATM 8570 O  O     . HOH R 7 .   ? -42.926 49.620 36.112  1.00 43.70  ? 202  HOH P O     1 
HETATM 8571 O  O     . HOH R 7 .   ? -13.157 56.527 40.793  1.00 40.33  ? 203  HOH P O     1 
HETATM 8572 O  O     . HOH R 7 .   ? -7.646  46.874 34.436  1.00 41.85  ? 204  HOH P O     1 
HETATM 8573 O  O     . HOH R 7 .   ? -12.258 49.439 22.544  1.00 37.86  ? 205  HOH P O     1 
HETATM 8574 O  O     . HOH R 7 .   ? -10.608 52.896 35.732  1.00 37.39  ? 206  HOH P O     1 
HETATM 8575 O  O     . HOH R 7 .   ? -3.475  45.380 24.015  1.00 43.05  ? 207  HOH P O     1 
HETATM 8576 O  O     . HOH R 7 .   ? -8.165  40.034 22.233  1.00 40.93  ? 208  HOH P O     1 
HETATM 8577 O  O     . HOH R 7 .   ? -17.269 50.971 35.179  1.00 37.67  ? 209  HOH P O     1 
HETATM 8578 O  O     . HOH R 7 .   ? -5.829  52.461 28.777  1.00 42.57  ? 210  HOH P O     1 
HETATM 8579 O  O     . HOH R 7 .   ? -6.468  49.720 29.285  1.00 41.86  ? 211  HOH P O     1 
HETATM 8580 O  O     . HOH R 7 .   ? -8.045  54.771 30.000  1.00 42.73  ? 212  HOH P O     1 
HETATM 8581 O  O     . HOH R 7 .   ? -12.984 58.162 35.450  1.00 47.35  ? 213  HOH P O     1 
HETATM 8582 O  O     . HOH R 7 .   ? -19.224 55.197 37.335  1.00 50.04  ? 214  HOH P O     1 
HETATM 8583 O  O     . HOH R 7 .   ? -15.234 47.941 30.420  1.00 41.99  ? 215  HOH P O     1 
HETATM 8584 O  O     . HOH R 7 .   ? -2.009  47.399 24.865  1.00 41.94  ? 216  HOH P O     1 
HETATM 8585 O  O     . HOH R 7 .   ? -4.555  48.905 27.151  1.00 45.20  ? 217  HOH P O     1 
HETATM 8586 O  O     . HOH R 7 .   ? -10.968 55.769 38.781  1.00 32.47  ? 218  HOH P O     1 
HETATM 8587 O  O     . HOH R 7 .   ? -18.177 52.429 36.995  1.00 47.63  ? 219  HOH P O     1 
HETATM 8588 O  O     . HOH R 7 .   ? -10.716 56.901 35.872  1.00 46.26  ? 220  HOH P O     1 
HETATM 8589 O  O     . HOH R 7 .   ? -12.072 57.130 29.757  1.00 36.82  ? 221  HOH P O     1 
HETATM 8590 O  O     . HOH R 7 .   ? -6.895  49.039 31.958  1.00 52.11  ? 222  HOH P O     1 
HETATM 8591 O  O     . HOH R 7 .   ? -17.720 59.781 29.483  1.00 50.14  ? 223  HOH P O     1 
HETATM 8592 O  O     . HOH R 7 .   ? -41.764 56.859 32.258  1.00 50.49  ? 224  HOH P O     1 
HETATM 8593 O  O     . HOH R 7 .   ? -18.861 57.661 28.248  1.00 51.12  ? 225  HOH P O     1 
HETATM 8594 O  O     . HOH R 7 .   ? -5.898  45.584 25.374  1.00 51.06  ? 226  HOH P O     1 
HETATM 8595 O  O     . HOH R 7 .   ? -32.605 65.369 30.143  1.00 69.48  ? 227  HOH P O     1 
HETATM 8596 O  O     . HOH R 7 .   ? -32.566 63.777 27.522  1.00 60.52  ? 228  HOH P O     1 
HETATM 8597 O  O     . HOH R 7 .   ? -32.715 66.127 27.993  1.00 51.53  ? 229  HOH P O     1 
HETATM 8598 O  O     . HOH R 7 .   ? -5.139  44.269 22.322  1.00 62.21  ? 230  HOH P O     1 
HETATM 8599 O  O     . HOH R 7 .   ? -2.470  43.213 25.342  1.00 53.54  ? 231  HOH P O     1 
HETATM 8600 O  O     . HOH R 7 .   ? -8.723  50.294 35.574  1.00 48.11  ? 232  HOH P O     1 
HETATM 8601 O  O     . HOH R 7 .   ? -5.633  44.783 28.265  1.00 58.17  ? 233  HOH P O     1 
HETATM 8602 O  O     . HOH R 7 .   ? -33.273 55.540 32.671  1.00 57.86  ? 234  HOH P O     1 
HETATM 8603 O  O     . HOH R 7 .   ? -8.149  40.619 29.251  1.00 41.08  ? 235  HOH P O     1 
HETATM 8604 O  O     . HOH R 7 .   ? -4.778  42.864 15.437  1.00 60.31  ? 236  HOH P O     1 
HETATM 8605 O  O     . HOH R 7 .   ? -4.523  44.227 18.921  1.00 49.39  ? 237  HOH P O     1 
HETATM 8606 O  O     . HOH R 7 .   ? -3.009  40.944 14.423  1.00 62.70  ? 238  HOH P O     1 
HETATM 8607 O  O     . HOH R 7 .   ? -5.739  39.680 22.241  1.00 53.10  ? 239  HOH P O     1 
HETATM 8608 O  O     . HOH R 7 .   ? -17.207 59.479 26.832  1.00 74.53  ? 240  HOH P O     1 
HETATM 8609 O  O     . HOH R 7 .   ? -16.404 63.292 30.605  1.00 66.19  ? 241  HOH P O     1 
HETATM 8610 O  O     . HOH R 7 .   ? -41.862 55.642 29.832  1.00 61.89  ? 242  HOH P O     1 
HETATM 8611 O  O     . HOH R 7 .   ? -39.445 49.504 32.332  1.00 67.00  ? 243  HOH P O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 1   ? 0.8368 0.7440 1.2532 0.2206  0.2104  0.1461  1   MET A N     
2    C CA    . MET A 1   ? 0.8319 0.7181 1.1789 0.2042  0.2098  0.1276  1   MET A CA    
3    C C     . MET A 1   ? 0.7624 0.6959 1.1394 0.1895  0.1961  0.1280  1   MET A C     
4    O O     . MET A 1   ? 0.7149 0.6954 1.1596 0.1882  0.1795  0.1415  1   MET A O     
5    C CB    . MET A 1   ? 0.8723 0.7343 1.1559 0.1862  0.1811  0.1152  1   MET A CB    
6    C CG    . MET A 1   ? 0.8661 0.7635 1.1838 0.1747  0.1422  0.1222  1   MET A CG    
7    S SD    . MET A 1   ? 1.1645 1.0407 1.4086 0.1496  0.1105  0.1073  1   MET A SD    
8    C CE    . MET A 1   ? 0.6294 0.4374 0.8138 0.1617  0.1294  0.1026  1   MET A CE    
9    N N     . LYS A 2   ? 0.7394 0.6573 1.0643 0.1777  0.2018  0.1142  2   LYS A N     
10   C CA    . LYS A 2   ? 0.6630 0.6192 1.0065 0.1629  0.1884  0.1126  2   LYS A CA    
11   C C     . LYS A 2   ? 0.5519 0.5325 0.8921 0.1429  0.1479  0.1089  2   LYS A C     
12   O O     . LYS A 2   ? 0.5516 0.5092 0.8450 0.1343  0.1334  0.1005  2   LYS A O     
13   C CB    . LYS A 2   ? 0.7152 0.6437 1.0011 0.1560  0.2046  0.1000  2   LYS A CB    
14   C CG    . LYS A 2   ? 0.7803 0.6824 1.0642 0.1734  0.2471  0.1031  2   LYS A CG    
15   C CD    . LYS A 2   ? 0.7730 0.7205 1.1344 0.1818  0.2588  0.1173  2   LYS A CD    
16   C CE    . LYS A 2   ? 0.7250 0.7055 1.0931 0.1635  0.2398  0.1137  2   LYS A CE    
17   N NZ    . LYS A 2   ? 0.6893 0.7091 1.1233 0.1668  0.2483  0.1274  2   LYS A NZ    
18   N N     . GLU A 3   ? 0.4592 0.4835 0.8468 0.1347  0.1307  0.1156  3   GLU A N     
19   C CA    . GLU A 3   ? 0.4500 0.4936 0.8327 0.1159  0.0956  0.1123  3   GLU A CA    
20   C C     . GLU A 3   ? 0.4317 0.4633 0.7571 0.1003  0.0891  0.0964  3   GLU A C     
21   O O     . GLU A 3   ? 0.4221 0.4437 0.7265 0.1010  0.1064  0.0905  3   GLU A O     
22   C CB    . GLU A 3   ? 0.4409 0.5266 0.8828 0.1103  0.0800  0.1239  3   GLU A CB    
23   C CG    . GLU A 3   ? 0.5249 0.6293 1.0353 0.1243  0.0837  0.1440  3   GLU A CG    
24   C CD    . GLU A 3   ? 0.5586 0.7016 1.1226 0.1132  0.0589  0.1573  3   GLU A CD    
25   O OE1   . GLU A 3   ? 0.6481 0.8092 1.2688 0.1196  0.0562  0.1757  3   GLU A OE1   
26   O OE2   . GLU A 3   ? 0.5676 0.7182 1.1100 0.0955  0.0415  0.1490  3   GLU A OE2   
27   N N     . PHE A 4   ? 0.3864 0.4186 0.6879 0.0862  0.0645  0.0909  4   PHE A N     
28   C CA    . PHE A 4   ? 0.3820 0.4102 0.6410 0.0713  0.0568  0.0790  4   PHE A CA    
29   C C     . PHE A 4   ? 0.3384 0.3833 0.5972 0.0563  0.0306  0.0773  4   PHE A C     
30   O O     . PHE A 4   ? 0.3593 0.4044 0.6275 0.0548  0.0159  0.0825  4   PHE A O     
31   C CB    . PHE A 4   ? 0.3687 0.3599 0.5717 0.0703  0.0648  0.0710  4   PHE A CB    
32   C CG    . PHE A 4   ? 0.3978 0.3699 0.5807 0.0689  0.0536  0.0715  4   PHE A CG    
33   C CD1   . PHE A 4   ? 0.4398 0.3945 0.6347 0.0838  0.0636  0.0782  4   PHE A CD1   
34   C CD2   . PHE A 4   ? 0.3818 0.3521 0.5343 0.0533  0.0349  0.0660  4   PHE A CD2   
35   C CE1   . PHE A 4   ? 0.4563 0.3904 0.6305 0.0825  0.0525  0.0789  4   PHE A CE1   
36   C CE2   . PHE A 4   ? 0.4006 0.3517 0.5322 0.0507  0.0244  0.0668  4   PHE A CE2   
37   C CZ    . PHE A 4   ? 0.4251 0.3571 0.5659 0.0649  0.0321  0.0729  4   PHE A CZ    
38   N N     . TYR A 5   ? 0.3034 0.3594 0.5501 0.0454  0.0258  0.0706  5   TYR A N     
39   C CA    . TYR A 5   ? 0.3177 0.3850 0.5599 0.0318  0.0061  0.0681  5   TYR A CA    
40   C C     . TYR A 5   ? 0.3370 0.3880 0.5402 0.0234  -0.0023 0.0629  5   TYR A C     
41   O O     . TYR A 5   ? 0.3166 0.3491 0.4923 0.0253  0.0057  0.0597  5   TYR A O     
42   C CB    . TYR A 5   ? 0.3298 0.4116 0.5729 0.0252  0.0073  0.0632  5   TYR A CB    
43   C CG    . TYR A 5   ? 0.3209 0.3948 0.5340 0.0227  0.0164  0.0559  5   TYR A CG    
44   C CD1   . TYR A 5   ? 0.3377 0.4052 0.5488 0.0297  0.0321  0.0559  5   TYR A CD1   
45   C CD2   . TYR A 5   ? 0.2820 0.3543 0.4698 0.0123  0.0088  0.0508  5   TYR A CD2   
46   C CE1   . TYR A 5   ? 0.3035 0.3618 0.4865 0.0250  0.0361  0.0515  5   TYR A CE1   
47   C CE2   . TYR A 5   ? 0.2735 0.3417 0.4410 0.0090  0.0141  0.0477  5   TYR A CE2   
48   C CZ    . TYR A 5   ? 0.3333 0.3939 0.4978 0.0146  0.0258  0.0484  5   TYR A CZ    
49   O OH    . TYR A 5   ? 0.3270 0.3814 0.4703 0.0091  0.0270  0.0474  5   TYR A OH    
50   N N     . LEU A 6   ? 0.3519 0.4064 0.5498 0.0127  -0.0187 0.0626  6   LEU A N     
51   C CA    . LEU A 6   ? 0.3351 0.3772 0.4977 0.0026  -0.0260 0.0582  6   LEU A CA    
52   C C     . LEU A 6   ? 0.3602 0.4125 0.5110 -0.0078 -0.0265 0.0521  6   LEU A C     
53   O O     . LEU A 6   ? 0.3356 0.3867 0.4673 -0.0118 -0.0208 0.0483  6   LEU A O     
54   C CB    . LEU A 6   ? 0.3428 0.3757 0.5034 -0.0019 -0.0425 0.0632  6   LEU A CB    
55   C CG    . LEU A 6   ? 0.3662 0.3874 0.5406 0.0097  -0.0423 0.0709  6   LEU A CG    
56   C CD1   . LEU A 6   ? 0.3659 0.3815 0.5457 0.0042  -0.0625 0.0783  6   LEU A CD1   
57   C CD2   . LEU A 6   ? 0.3679 0.3669 0.5107 0.0130  -0.0329 0.0672  6   LEU A CD2   
58   N N     . THR A 7   ? 0.3335 0.3939 0.4961 -0.0126 -0.0335 0.0525  7   THR A N     
59   C CA    . THR A 7   ? 0.3515 0.4175 0.5036 -0.0202 -0.0307 0.0467  7   THR A CA    
60   C C     . THR A 7   ? 0.3512 0.4264 0.5256 -0.0187 -0.0311 0.0476  7   THR A C     
61   O O     . THR A 7   ? 0.3566 0.4344 0.5542 -0.0158 -0.0387 0.0543  7   THR A O     
62   C CB    . THR A 7   ? 0.3683 0.4218 0.4934 -0.0327 -0.0396 0.0446  7   THR A CB    
63   O OG1   . THR A 7   ? 0.3591 0.4035 0.4882 -0.0372 -0.0555 0.0495  7   THR A OG1   
64   C CG2   . THR A 7   ? 0.3344 0.3788 0.4369 -0.0363 -0.0402 0.0447  7   THR A CG2   
65   N N     . VAL A 8   ? 0.3317 0.4118 0.5015 -0.0209 -0.0233 0.0424  8   VAL A N     
66   C CA    . VAL A 8   ? 0.3318 0.4153 0.5154 -0.0218 -0.0247 0.0425  8   VAL A CA    
67   C C     . VAL A 8   ? 0.3649 0.4396 0.5258 -0.0289 -0.0203 0.0357  8   VAL A C     
68   O O     . VAL A 8   ? 0.3373 0.4141 0.4862 -0.0282 -0.0096 0.0318  8   VAL A O     
69   C CB    . VAL A 8   ? 0.4157 0.5135 0.6249 -0.0120 -0.0142 0.0442  8   VAL A CB    
70   C CG1   . VAL A 8   ? 0.3687 0.4714 0.5691 -0.0091 -0.0011 0.0394  8   VAL A CG1   
71   C CG2   . VAL A 8   ? 0.4308 0.5317 0.6575 -0.0142 -0.0187 0.0466  8   VAL A CG2   
72   N N     . GLU A 9   ? 0.3698 0.4323 0.5243 -0.0363 -0.0286 0.0354  9   GLU A N     
73   C CA    . GLU A 9   ? 0.4017 0.4474 0.5291 -0.0423 -0.0218 0.0285  9   GLU A CA    
74   C C     . GLU A 9   ? 0.4719 0.5092 0.6034 -0.0457 -0.0268 0.0288  9   GLU A C     
75   O O     . GLU A 9   ? 0.4697 0.5107 0.6206 -0.0485 -0.0415 0.0361  9   GLU A O     
76   C CB    . GLU A 9   ? 0.4363 0.4567 0.5265 -0.0543 -0.0290 0.0264  9   GLU A CB    
77   C CG    . GLU A 9   ? 0.4753 0.5002 0.5571 -0.0539 -0.0263 0.0269  9   GLU A CG    
78   C CD    . GLU A 9   ? 0.4727 0.5056 0.5492 -0.0496 -0.0060 0.0225  9   GLU A CD    
79   O OE1   . GLU A 9   ? 0.4529 0.4886 0.5345 -0.0449 0.0072  0.0190  9   GLU A OE1   
80   O OE2   . GLU A 9   ? 0.4752 0.5118 0.5446 -0.0513 -0.0040 0.0238  9   GLU A OE2   
81   N N     . GLN A 10  ? 0.4755 0.5012 0.5908 -0.0454 -0.0143 0.0221  10  GLN A N     
82   C CA    . GLN A 10  ? 0.4618 0.4690 0.5685 -0.0517 -0.0201 0.0213  10  GLN A CA    
83   C C     . GLN A 10  ? 0.5226 0.4893 0.5793 -0.0639 -0.0211 0.0154  10  GLN A C     
84   O O     . GLN A 10  ? 0.5550 0.5101 0.5890 -0.0606 -0.0022 0.0082  10  GLN A O     
85   C CB    . GLN A 10  ? 0.4269 0.4437 0.5491 -0.0420 -0.0051 0.0185  10  GLN A CB    
86   C CG    . GLN A 10  ? 0.4844 0.4763 0.5915 -0.0497 -0.0109 0.0171  10  GLN A CG    
87   C CD    . GLN A 10  ? 0.5062 0.5009 0.6217 -0.0402 0.0052  0.0134  10  GLN A CD    
88   O OE1   . GLN A 10  ? 0.4694 0.4889 0.6082 -0.0280 0.0182  0.0137  10  GLN A OE1   
89   N NE2   . GLN A 10  ? 0.5364 0.5022 0.6304 -0.0469 0.0026  0.0107  10  GLN A NE2   
90   N N     . ILE A 11  ? 0.5764 0.5196 0.6156 -0.0787 -0.0430 0.0196  11  ILE A N     
91   C CA    . ILE A 11  ? 0.6490 0.5434 0.6306 -0.0937 -0.0465 0.0142  11  ILE A CA    
92   C C     . ILE A 11  ? 0.6988 0.5674 0.6673 -0.1049 -0.0605 0.0163  11  ILE A C     
93   O O     . ILE A 11  ? 0.7232 0.5887 0.7003 -0.1177 -0.0880 0.0266  11  ILE A O     
94   C CB    . ILE A 11  ? 0.6779 0.5561 0.6361 -0.1070 -0.0653 0.0187  11  ILE A CB    
95   C CG1   . ILE A 11  ? 0.6500 0.5547 0.6236 -0.0968 -0.0538 0.0181  11  ILE A CG1   
96   C CG2   . ILE A 11  ? 0.7248 0.5446 0.6130 -0.1238 -0.0665 0.0123  11  ILE A CG2   
97   C CD1   . ILE A 11  ? 0.6893 0.5771 0.6386 -0.1091 -0.0709 0.0223  11  ILE A CD1   
98   N N     . GLY A 12  ? 0.7283 0.5783 0.6782 -0.1003 -0.0423 0.0079  12  GLY A N     
99   C CA    . GLY A 12  ? 0.7239 0.5482 0.6605 -0.1102 -0.0537 0.0093  12  GLY A CA    
100  C C     . GLY A 12  ? 0.6684 0.5352 0.6653 -0.1047 -0.0645 0.0195  12  GLY A C     
101  O O     . GLY A 12  ? 0.6411 0.5460 0.6781 -0.0873 -0.0481 0.0188  12  GLY A O     
102  N N     . ASP A 13  ? 0.6526 0.5115 0.6555 -0.1207 -0.0926 0.0303  13  ASP A N     
103  C CA    . ASP A 13  ? 0.6390 0.5372 0.7010 -0.1170 -0.1022 0.0421  13  ASP A CA    
104  C C     . ASP A 13  ? 0.5847 0.5230 0.6949 -0.1130 -0.1134 0.0540  13  ASP A C     
105  O O     . ASP A 13  ? 0.5172 0.4859 0.6775 -0.1118 -0.1229 0.0666  13  ASP A O     
106  C CB    . ASP A 13  ? 0.6921 0.5641 0.7431 -0.1367 -0.1261 0.0503  13  ASP A CB    
107  C CG    . ASP A 13  ? 0.7620 0.5961 0.7717 -0.1377 -0.1126 0.0391  13  ASP A CG    
108  O OD1   . ASP A 13  ? 0.7381 0.5856 0.7554 -0.1189 -0.0846 0.0293  13  ASP A OD1   
109  O OD2   . ASP A 13  ? 0.8619 0.6504 0.8307 -0.1579 -0.1311 0.0411  13  ASP A OD2   
110  N N     . SER A 14  ? 0.6194 0.5563 0.7145 -0.1104 -0.1103 0.0504  14  SER A N     
111  C CA    . SER A 14  ? 0.5765 0.5451 0.7117 -0.1055 -0.1196 0.0609  14  SER A CA    
112  C C     . SER A 14  ? 0.5148 0.5112 0.6663 -0.0859 -0.0956 0.0542  14  SER A C     
113  O O     . SER A 14  ? 0.4650 0.4491 0.5847 -0.0815 -0.0784 0.0423  14  SER A O     
114  C CB    . SER A 14  ? 0.6097 0.5516 0.7155 -0.1222 -0.1436 0.0664  14  SER A CB    
115  O OG    . SER A 14  ? 0.6475 0.5771 0.7604 -0.1407 -0.1741 0.0806  14  SER A OG    
116  N N     . ILE A 15  ? 0.4893 0.5213 0.6905 -0.0748 -0.0941 0.0629  15  ILE A N     
117  C CA    . ILE A 15  ? 0.4265 0.4785 0.6387 -0.0598 -0.0774 0.0591  15  ILE A CA    
118  C C     . ILE A 15  ? 0.4135 0.4641 0.6273 -0.0632 -0.0919 0.0660  15  ILE A C     
119  O O     . ILE A 15  ? 0.4454 0.5069 0.6926 -0.0655 -0.1079 0.0796  15  ILE A O     
120  C CB    . ILE A 15  ? 0.3923 0.4754 0.6488 -0.0451 -0.0639 0.0635  15  ILE A CB    
121  C CG1   . ILE A 15  ? 0.3727 0.4565 0.6232 -0.0402 -0.0475 0.0555  15  ILE A CG1   
122  C CG2   . ILE A 15  ? 0.3420 0.4385 0.6065 -0.0329 -0.0527 0.0626  15  ILE A CG2   
123  C CD1   . ILE A 15  ? 0.3603 0.4352 0.5795 -0.0357 -0.0322 0.0435  15  ILE A CD1   
124  N N     . PHE A 16  ? 0.3792 0.4163 0.5591 -0.0640 -0.0867 0.0580  16  PHE A N     
125  C CA    . PHE A 16  ? 0.4133 0.4471 0.5910 -0.0665 -0.0991 0.0637  16  PHE A CA    
126  C C     . PHE A 16  ? 0.4089 0.4637 0.6062 -0.0507 -0.0838 0.0629  16  PHE A C     
127  O O     . PHE A 16  ? 0.3942 0.4502 0.5740 -0.0453 -0.0665 0.0534  16  PHE A O     
128  C CB    . PHE A 16  ? 0.4531 0.4542 0.5766 -0.0796 -0.1039 0.0567  16  PHE A CB    
129  C CG    . PHE A 16  ? 0.5427 0.5123 0.6384 -0.0989 -0.1258 0.0605  16  PHE A CG    
130  C CD1   . PHE A 16  ? 0.5832 0.5412 0.6786 -0.1108 -0.1533 0.0723  16  PHE A CD1   
131  C CD2   . PHE A 16  ? 0.5961 0.5438 0.6633 -0.1058 -0.1203 0.0531  16  PHE A CD2   
132  C CE1   . PHE A 16  ? 0.6508 0.5748 0.7155 -0.1318 -0.1773 0.0774  16  PHE A CE1   
133  C CE2   . PHE A 16  ? 0.6402 0.5508 0.6729 -0.1260 -0.1417 0.0565  16  PHE A CE2   
134  C CZ    . PHE A 16  ? 0.6722 0.5703 0.7023 -0.1401 -0.1715 0.0689  16  PHE A CZ    
135  N N     . GLU A 17  ? 0.3831 0.4526 0.6169 -0.0437 -0.0901 0.0740  17  GLU A N     
136  C CA    . GLU A 17  ? 0.3338 0.4152 0.5807 -0.0290 -0.0752 0.0734  17  GLU A CA    
137  C C     . GLU A 17  ? 0.3761 0.4507 0.6250 -0.0283 -0.0869 0.0807  17  GLU A C     
138  O O     . GLU A 17  ? 0.3946 0.4702 0.6669 -0.0322 -0.1052 0.0932  17  GLU A O     
139  C CB    . GLU A 17  ? 0.3368 0.4393 0.6256 -0.0159 -0.0625 0.0791  17  GLU A CB    
140  C CG    . GLU A 17  ? 0.3368 0.4425 0.6297 -0.0014 -0.0451 0.0778  17  GLU A CG    
141  C CD    . GLU A 17  ? 0.3721 0.4928 0.7055 0.0116  -0.0318 0.0857  17  GLU A CD    
142  O OE1   . GLU A 17  ? 0.4019 0.5187 0.7302 0.0229  -0.0137 0.0829  17  GLU A OE1   
143  O OE2   . GLU A 17  ? 0.3382 0.4723 0.7068 0.0097  -0.0391 0.0956  17  GLU A OE2   
144  N N     . ARG A 18  ? 0.3638 0.4309 0.5889 -0.0243 -0.0778 0.0743  18  ARG A N     
145  C CA    . ARG A 18  ? 0.3583 0.4184 0.5870 -0.0197 -0.0840 0.0808  18  ARG A CA    
146  C C     . ARG A 18  ? 0.3382 0.4067 0.5874 -0.0023 -0.0645 0.0816  18  ARG A C     
147  O O     . ARG A 18  ? 0.3311 0.4021 0.5678 0.0015  -0.0477 0.0732  18  ARG A O     
148  C CB    . ARG A 18  ? 0.3668 0.4078 0.5505 -0.0285 -0.0872 0.0737  18  ARG A CB    
149  C CG    . ARG A 18  ? 0.3999 0.4252 0.5530 -0.0463 -0.1020 0.0714  18  ARG A CG    
150  C CD    . ARG A 18  ? 0.4402 0.4492 0.5493 -0.0543 -0.0983 0.0636  18  ARG A CD    
151  N NE    . ARG A 18  ? 0.3878 0.3847 0.4895 -0.0545 -0.1087 0.0693  18  ARG A NE    
152  C CZ    . ARG A 18  ? 0.5482 0.5332 0.6181 -0.0593 -0.1049 0.0648  18  ARG A CZ    
153  N NH1   . ARG A 18  ? 0.3937 0.3812 0.4418 -0.0638 -0.0903 0.0561  18  ARG A NH1   
154  N NH2   . ARG A 18  ? 0.4139 0.3851 0.4766 -0.0595 -0.1157 0.0706  18  ARG A NH2   
155  N N     . TYR A 19  ? 0.3203 0.3907 0.6003 0.0080  -0.0662 0.0927  19  TYR A N     
156  C CA    . TYR A 19  ? 0.3190 0.3908 0.6150 0.0254  -0.0442 0.0938  19  TYR A CA    
157  C C     . TYR A 19  ? 0.3287 0.3906 0.6418 0.0368  -0.0448 0.1038  19  TYR A C     
158  O O     . TYR A 19  ? 0.3796 0.4411 0.7071 0.0322  -0.0652 0.1136  19  TYR A O     
159  C CB    . TYR A 19  ? 0.3407 0.4332 0.6758 0.0323  -0.0328 0.0986  19  TYR A CB    
160  C CG    . TYR A 19  ? 0.3240 0.4337 0.7121 0.0338  -0.0456 0.1154  19  TYR A CG    
161  C CD1   . TYR A 19  ? 0.2976 0.4126 0.6905 0.0177  -0.0711 0.1204  19  TYR A CD1   
162  C CD2   . TYR A 19  ? 0.3564 0.4747 0.7894 0.0508  -0.0320 0.1277  19  TYR A CD2   
163  C CE1   . TYR A 19  ? 0.3161 0.4467 0.7590 0.0162  -0.0872 0.1386  19  TYR A CE1   
164  C CE2   . TYR A 19  ? 0.3797 0.5184 0.8702 0.0519  -0.0448 0.1466  19  TYR A CE2   
165  C CZ    . TYR A 19  ? 0.3651 0.5109 0.8613 0.0335  -0.0747 0.1527  19  TYR A CZ    
166  O OH    . TYR A 19  ? 0.4105 0.5763 0.9651 0.0317  -0.0918 0.1741  19  TYR A OH    
167  N N     . ILE A 20  ? 0.3372 0.3871 0.6452 0.0515  -0.0225 0.1016  20  ILE A N     
168  C CA    . ILE A 20  ? 0.3577 0.3949 0.6838 0.0667  -0.0160 0.1110  20  ILE A CA    
169  C C     . ILE A 20  ? 0.4002 0.4546 0.7808 0.0832  0.0022  0.1221  20  ILE A C     
170  O O     . ILE A 20  ? 0.3679 0.4234 0.7445 0.0887  0.0240  0.1165  20  ILE A O     
171  C CB    . ILE A 20  ? 0.3878 0.3914 0.6656 0.0722  -0.0002 0.1014  20  ILE A CB    
172  C CG1   . ILE A 20  ? 0.3854 0.3748 0.6135 0.0550  -0.0176 0.0924  20  ILE A CG1   
173  C CG2   . ILE A 20  ? 0.4117 0.3964 0.7060 0.0906  0.0108  0.1106  20  ILE A CG2   
174  C CD1   . ILE A 20  ? 0.3966 0.3809 0.6285 0.0493  -0.0406 0.1000  20  ILE A CD1   
175  N N     . ASP A 21  ? 0.4308 0.4988 0.8639 0.0904  -0.0069 0.1394  21  ASP A N     
176  C CA    . ASP A 21  ? 0.4150 0.5055 0.9106 0.1053  0.0099  0.1536  21  ASP A CA    
177  C C     . ASP A 21  ? 0.4422 0.5125 0.9436 0.1294  0.0439  0.1559  21  ASP A C     
178  O O     . ASP A 21  ? 0.4495 0.4844 0.8996 0.1333  0.0537  0.1450  21  ASP A O     
179  C CB    . ASP A 21  ? 0.3627 0.4812 0.9216 0.1014  -0.0157 0.1749  21  ASP A CB    
180  C CG    . ASP A 21  ? 0.3720 0.4781 0.9420 0.1064  -0.0312 0.1862  21  ASP A CG    
181  O OD1   . ASP A 21  ? 0.3924 0.4703 0.9361 0.1199  -0.0139 0.1806  21  ASP A OD1   
182  O OD2   . ASP A 21  ? 0.3669 0.4884 0.9700 0.0958  -0.0623 0.2015  21  ASP A OD2   
183  N N     . SER A 22  ? 0.4243 0.5151 0.9876 0.1448  0.0624  0.1710  22  SER A N     
184  C CA    . SER A 22  ? 0.4783 0.5481 1.0485 0.1692  0.1012  0.1737  22  SER A CA    
185  C C     . SER A 22  ? 0.5268 0.5740 1.0980 0.1811  0.1009  0.1803  22  SER A C     
186  O O     . SER A 22  ? 0.5888 0.6045 1.1394 0.1975  0.1320  0.1770  22  SER A O     
187  C CB    . SER A 22  ? 0.4926 0.5879 1.1052 0.1700  0.1184  0.1833  22  SER A CB    
188  O OG    . SER A 22  ? 0.4952 0.6217 1.1624 0.1615  0.0937  0.2010  22  SER A OG    
189  N N     . ASN A 23  ? 0.5138 0.5733 1.1043 0.1717  0.0655  0.1897  23  ASN A N     
190  C CA    . ASN A 23  ? 0.5548 0.5921 1.1443 0.1811  0.0601  0.1964  23  ASN A CA    
191  C C     . ASN A 23  ? 0.5785 0.5820 1.0977 0.1690  0.0415  0.1818  23  ASN A C     
192  O O     . ASN A 23  ? 0.4854 0.4709 0.9996 0.1716  0.0275  0.1875  23  ASN A O     
193  C CB    . ASN A 23  ? 0.5594 0.6284 1.2057 0.1729  0.0328  0.2156  23  ASN A CB    
194  C CG    . ASN A 23  ? 0.5608 0.6601 1.2616 0.1762  0.0504  0.2278  23  ASN A CG    
195  O OD1   . ASN A 23  ? 0.5753 0.6631 1.2773 0.1930  0.0880  0.2261  23  ASN A OD1   
196  N ND2   . ASN A 23  ? 0.5450 0.6784 1.2870 0.1587  0.0231  0.2408  23  ASN A ND2   
197  N N     . GLY A 24  ? 0.5437 0.5396 1.0047 0.1525  0.0407  0.1622  24  GLY A N     
198  C CA    . GLY A 24  ? 0.5407 0.5060 0.9285 0.1376  0.0273  0.1464  24  GLY A CA    
199  C C     . GLY A 24  ? 0.5247 0.5018 0.9061 0.1164  -0.0116 0.1483  24  GLY A C     
200  O O     . GLY A 24  ? 0.5251 0.4768 0.8550 0.1058  -0.0238 0.1398  24  GLY A O     
201  N N     . ARG A 25  ? 0.4999 0.5121 0.9297 0.1086  -0.0311 0.1600  25  ARG A N     
202  C CA    . ARG A 25  ? 0.5291 0.5468 0.9491 0.0872  -0.0681 0.1630  25  ARG A CA    
203  C C     . ARG A 25  ? 0.4840 0.5141 0.8749 0.0664  -0.0772 0.1504  25  ARG A C     
204  O O     . ARG A 25  ? 0.4739 0.5250 0.8863 0.0681  -0.0654 0.1491  25  ARG A O     
205  C CB    . ARG A 25  ? 0.6123 0.6527 1.1006 0.0896  -0.0894 0.1871  25  ARG A CB    
206  C CG    . ARG A 25  ? 0.6908 0.7322 1.1663 0.0650  -0.1298 0.1921  25  ARG A CG    
207  C CD    . ARG A 25  ? 0.7652 0.8227 1.3067 0.0674  -0.1543 0.2192  25  ARG A CD    
208  N NE    . ARG A 25  ? 0.8369 0.8937 1.3648 0.0405  -0.1944 0.2252  25  ARG A NE    
209  C CZ    . ARG A 25  ? 0.9004 0.9654 1.4730 0.0343  -0.2264 0.2493  25  ARG A CZ    
210  N NH1   . ARG A 25  ? 0.9242 1.0006 1.5485 0.0500  -0.2139 0.2625  25  ARG A NH1   
211  N NH2   . ARG A 25  ? 0.9330 0.9888 1.4794 0.0067  -0.2629 0.2529  25  ARG A NH2   
212  N N     . GLU A 26  ? 0.4579 0.4731 0.7996 0.0474  -0.0965 0.1416  26  GLU A N     
213  C CA    . GLU A 26  ? 0.4708 0.4939 0.7836 0.0290  -0.1032 0.1302  26  GLU A CA    
214  C C     . GLU A 26  ? 0.4493 0.4906 0.7931 0.0169  -0.1263 0.1412  26  GLU A C     
215  O O     . GLU A 26  ? 0.4008 0.4374 0.7577 0.0098  -0.1519 0.1544  26  GLU A O     
216  C CB    . GLU A 26  ? 0.5018 0.5021 0.7528 0.0130  -0.1123 0.1182  26  GLU A CB    
217  C CG    . GLU A 26  ? 0.4966 0.5028 0.7210 -0.0052 -0.1185 0.1086  26  GLU A CG    
218  C CD    . GLU A 26  ? 0.5473 0.5338 0.7153 -0.0194 -0.1217 0.0977  26  GLU A CD    
219  O OE1   . GLU A 26  ? 0.5596 0.5311 0.7053 -0.0149 -0.1137 0.0940  26  GLU A OE1   
220  O OE2   . GLU A 26  ? 0.5343 0.5179 0.6788 -0.0356 -0.1313 0.0934  26  GLU A OE2   
221  N N     . ARG A 27  ? 0.4334 0.4922 0.7861 0.0132  -0.1192 0.1366  27  ARG A N     
222  C CA    . ARG A 27  ? 0.4373 0.5086 0.8119 -0.0008 -0.1413 0.1460  27  ARG A CA    
223  C C     . ARG A 27  ? 0.4107 0.4796 0.7478 -0.0148 -0.1386 0.1312  27  ARG A C     
224  O O     . ARG A 27  ? 0.4063 0.4739 0.7176 -0.0098 -0.1165 0.1164  27  ARG A O     
225  C CB    . ARG A 27  ? 0.4680 0.5674 0.9132 0.0114  -0.1369 0.1629  27  ARG A CB    
226  C CG    . ARG A 27  ? 0.5188 0.6225 1.0113 0.0264  -0.1397 0.1812  27  ARG A CG    
227  C CD    . ARG A 27  ? 0.5726 0.7080 1.1429 0.0367  -0.1367 0.2016  27  ARG A CD    
228  N NE    . ARG A 27  ? 0.6199 0.7603 1.2411 0.0540  -0.1360 0.2206  27  ARG A NE    
229  C CZ    . ARG A 27  ? 0.6309 0.7711 1.2756 0.0446  -0.1659 0.2383  27  ARG A CZ    
230  N NH1   . ARG A 27  ? 0.6410 0.7755 1.2658 0.0188  -0.2023 0.2419  27  ARG A NH1   
231  N NH2   . ARG A 27  ? 0.6213 0.7612 1.2986 0.0585  -0.1567 0.2498  27  ARG A NH2   
232  N N     . THR A 28  ? 0.4223 0.4874 0.7550 -0.0327 -0.1620 0.1363  28  THR A N     
233  C CA    . THR A 28  ? 0.4371 0.4954 0.7348 -0.0454 -0.1594 0.1237  28  THR A CA    
234  C C     . THR A 28  ? 0.4537 0.5252 0.7861 -0.0525 -0.1723 0.1348  28  THR A C     
235  O O     . THR A 28  ? 0.4495 0.5227 0.8102 -0.0604 -0.1982 0.1526  28  THR A O     
236  C CB    . THR A 28  ? 0.5135 0.5400 0.7508 -0.0649 -0.1745 0.1161  28  THR A CB    
237  O OG1   . THR A 28  ? 0.6503 0.6661 0.8570 -0.0599 -0.1629 0.1070  28  THR A OG1   
238  C CG2   . THR A 28  ? 0.4684 0.4843 0.6700 -0.0758 -0.1678 0.1033  28  THR A CG2   
239  N N     . ARG A 29  ? 0.4420 0.5227 0.7737 -0.0505 -0.1561 0.1261  29  ARG A N     
240  C CA    . ARG A 29  ? 0.4604 0.5513 0.8205 -0.0590 -0.1681 0.1360  29  ARG A CA    
241  C C     . ARG A 29  ? 0.4742 0.5495 0.7923 -0.0697 -0.1627 0.1216  29  ARG A C     
242  O O     . ARG A 29  ? 0.4354 0.5057 0.7222 -0.0632 -0.1405 0.1050  29  ARG A O     
243  C CB    . ARG A 29  ? 0.4503 0.5750 0.8748 -0.0417 -0.1522 0.1466  29  ARG A CB    
244  C CG    . ARG A 29  ? 0.4529 0.5862 0.8706 -0.0248 -0.1177 0.1322  29  ARG A CG    
245  C CD    . ARG A 29  ? 0.4367 0.5974 0.9139 -0.0082 -0.1007 0.1440  29  ARG A CD    
246  N NE    . ARG A 29  ? 0.3972 0.5586 0.8617 0.0077  -0.0688 0.1316  29  ARG A NE    
247  C CZ    . ARG A 29  ? 0.3900 0.5640 0.8898 0.0253  -0.0470 0.1382  29  ARG A CZ    
248  N NH1   . ARG A 29  ? 0.4516 0.6441 1.0099 0.0315  -0.0512 0.1579  29  ARG A NH1   
249  N NH2   . ARG A 29  ? 0.3616 0.5279 0.8380 0.0363  -0.0205 0.1263  29  ARG A NH2   
250  N N     . GLU A 30  ? 0.5430 0.6088 0.8612 -0.0867 -0.1843 0.1296  30  GLU A N     
251  C CA    . GLU A 30  ? 0.5864 0.6338 0.8675 -0.0965 -0.1796 0.1179  30  GLU A CA    
252  C C     . GLU A 30  ? 0.5113 0.5832 0.8387 -0.0929 -0.1758 0.1262  30  GLU A C     
253  O O     . GLU A 30  ? 0.5352 0.6180 0.9024 -0.1014 -0.1977 0.1451  30  GLU A O     
254  C CB    . GLU A 30  ? 0.6748 0.6810 0.9064 -0.1218 -0.2073 0.1193  30  GLU A CB    
255  C CG    . GLU A 30  ? 0.7311 0.7091 0.9165 -0.1319 -0.2010 0.1066  30  GLU A CG    
256  C CD    . GLU A 30  ? 0.8212 0.7487 0.9477 -0.1582 -0.2272 0.1077  30  GLU A CD    
257  O OE1   . GLU A 30  ? 0.8471 0.7646 0.9736 -0.1705 -0.2546 0.1207  30  GLU A OE1   
258  O OE2   . GLU A 30  ? 0.8658 0.7597 0.9429 -0.1668 -0.2202 0.0958  30  GLU A OE2   
259  N N     . VAL A 31  ? 0.4803 0.5614 0.8045 -0.0810 -0.1490 0.1137  31  VAL A N     
260  C CA    . VAL A 31  ? 0.4493 0.5529 0.8144 -0.0767 -0.1418 0.1204  31  VAL A CA    
261  C C     . VAL A 31  ? 0.4347 0.5170 0.7639 -0.0863 -0.1394 0.1099  31  VAL A C     
262  O O     . VAL A 31  ? 0.4363 0.5045 0.7265 -0.0809 -0.1212 0.0930  31  VAL A O     
263  C CB    . VAL A 31  ? 0.4448 0.5762 0.8404 -0.0540 -0.1119 0.1172  31  VAL A CB    
264  C CG1   . VAL A 31  ? 0.4514 0.6033 0.8857 -0.0506 -0.1030 0.1243  31  VAL A CG1   
265  C CG2   . VAL A 31  ? 0.4258 0.5728 0.8541 -0.0427 -0.1110 0.1272  31  VAL A CG2   
266  N N     . GLU A 32  ? 0.4581 0.5373 0.8023 -0.1007 -0.1582 0.1214  32  GLU A N     
267  C CA    . GLU A 32  ? 0.4977 0.5550 0.8108 -0.1091 -0.1554 0.1128  32  GLU A CA    
268  C C     . GLU A 32  ? 0.4252 0.5100 0.7700 -0.0929 -0.1299 0.1100  32  GLU A C     
269  O O     . GLU A 32  ? 0.4387 0.5400 0.8211 -0.0965 -0.1345 0.1220  32  GLU A O     
270  C CB    . GLU A 32  ? 0.5460 0.5857 0.8595 -0.1331 -0.1874 0.1273  32  GLU A CB    
271  C CG    . GLU A 32  ? 0.6449 0.6467 0.9086 -0.1452 -0.1877 0.1167  32  GLU A CG    
272  N N     . TYR A 33  ? 0.3817 0.4703 0.7104 -0.0766 -0.1041 0.0954  33  TYR A N     
273  C CA    . TYR A 33  ? 0.3605 0.4720 0.7136 -0.0610 -0.0798 0.0926  33  TYR A CA    
274  C C     . TYR A 33  ? 0.3521 0.4537 0.6968 -0.0662 -0.0769 0.0897  33  TYR A C     
275  O O     . TYR A 33  ? 0.3498 0.4211 0.6506 -0.0734 -0.0791 0.0793  33  TYR A O     
276  C CB    . TYR A 33  ? 0.3713 0.4826 0.7013 -0.0467 -0.0588 0.0787  33  TYR A CB    
277  C CG    . TYR A 33  ? 0.3418 0.4704 0.6882 -0.0323 -0.0359 0.0759  33  TYR A CG    
278  C CD1   . TYR A 33  ? 0.3034 0.4554 0.6911 -0.0239 -0.0276 0.0862  33  TYR A CD1   
279  C CD2   . TYR A 33  ? 0.3229 0.4420 0.6423 -0.0273 -0.0220 0.0640  33  TYR A CD2   
280  C CE1   . TYR A 33  ? 0.2634 0.4237 0.6568 -0.0127 -0.0065 0.0833  33  TYR A CE1   
281  C CE2   . TYR A 33  ? 0.2541 0.3850 0.5842 -0.0166 -0.0045 0.0627  33  TYR A CE2   
282  C CZ    . TYR A 33  ? 0.2382 0.3870 0.6009 -0.0102 0.0029  0.0717  33  TYR A CZ    
283  O OH    . TYR A 33  ? 0.2718 0.4250 0.6360 -0.0015 0.0202  0.0702  33  TYR A OH    
284  N N     . LYS A 34  ? 0.3377 0.4626 0.7236 -0.0622 -0.0704 0.0993  34  LYS A N     
285  C CA    . LYS A 34  ? 0.3501 0.4678 0.7316 -0.0663 -0.0665 0.0978  34  LYS A CA    
286  C C     . LYS A 34  ? 0.3172 0.4443 0.6973 -0.0500 -0.0400 0.0889  34  LYS A C     
287  O O     . LYS A 34  ? 0.3248 0.4755 0.7387 -0.0408 -0.0268 0.0957  34  LYS A O     
288  C CB    . LYS A 34  ? 0.3718 0.5075 0.7997 -0.0760 -0.0786 0.1166  34  LYS A CB    
289  C CG    . LYS A 34  ? 0.4378 0.5587 0.8633 -0.0973 -0.1108 0.1277  34  LYS A CG    
290  C CD    . LYS A 34  ? 0.5081 0.6595 0.9976 -0.1045 -0.1235 0.1518  34  LYS A CD    
291  C CE    . LYS A 34  ? 0.5354 0.7196 1.0720 -0.0907 -0.1160 0.1620  34  LYS A CE    
292  N N     . PRO A 35  ? 0.2928 0.3992 0.6331 -0.0466 -0.0318 0.0745  35  PRO A N     
293  C CA    . PRO A 35  ? 0.3124 0.4254 0.6489 -0.0329 -0.0109 0.0674  35  PRO A CA    
294  C C     . PRO A 35  ? 0.3265 0.4394 0.6722 -0.0338 -0.0053 0.0703  35  PRO A C     
295  O O     . PRO A 35  ? 0.3585 0.4593 0.7028 -0.0455 -0.0172 0.0742  35  PRO A O     
296  C CB    . PRO A 35  ? 0.3044 0.3958 0.6010 -0.0307 -0.0073 0.0544  35  PRO A CB    
297  C CG    . PRO A 35  ? 0.3490 0.4129 0.6218 -0.0447 -0.0224 0.0532  35  PRO A CG    
298  C CD    . PRO A 35  ? 0.3585 0.4314 0.6547 -0.0559 -0.0413 0.0656  35  PRO A CD    
299  N N     . SER A 36  ? 0.3177 0.4404 0.6691 -0.0232 0.0113  0.0690  36  SER A N     
300  C CA    . SER A 36  ? 0.3256 0.4448 0.6797 -0.0237 0.0175  0.0708  36  SER A CA    
301  C C     . SER A 36  ? 0.3601 0.4674 0.6891 -0.0157 0.0269  0.0615  36  SER A C     
302  O O     . SER A 36  ? 0.3402 0.4520 0.6611 -0.0076 0.0336  0.0573  36  SER A O     
303  C CB    . SER A 36  ? 0.3327 0.4712 0.7170 -0.0203 0.0287  0.0807  36  SER A CB    
304  O OG    . SER A 36  ? 0.4047 0.5569 0.8221 -0.0282 0.0201  0.0929  36  SER A OG    
305  N N     . LEU A 37  ? 0.3436 0.4352 0.6621 -0.0185 0.0260  0.0599  37  LEU A N     
306  C CA    . LEU A 37  ? 0.3389 0.4220 0.6429 -0.0103 0.0345  0.0550  37  LEU A CA    
307  C C     . LEU A 37  ? 0.3341 0.4137 0.6450 -0.0128 0.0373  0.0606  37  LEU A C     
308  O O     . LEU A 37  ? 0.3541 0.4383 0.6806 -0.0211 0.0334  0.0676  37  LEU A O     
309  C CB    . LEU A 37  ? 0.3285 0.3899 0.6089 -0.0089 0.0328  0.0467  37  LEU A CB    
310  C CG    . LEU A 37  ? 0.3561 0.4180 0.6254 -0.0069 0.0323  0.0410  37  LEU A CG    
311  C CD1   . LEU A 37  ? 0.4001 0.4344 0.6428 -0.0065 0.0341  0.0333  37  LEU A CD1   
312  C CD2   . LEU A 37  ? 0.3545 0.4344 0.6303 0.0024  0.0401  0.0412  37  LEU A CD2   
313  N N     . PHE A 38  ? 0.3252 0.3976 0.6270 -0.0065 0.0431  0.0593  38  PHE A N     
314  C CA    . PHE A 38  ? 0.3067 0.3750 0.6122 -0.0090 0.0462  0.0653  38  PHE A CA    
315  C C     . PHE A 38  ? 0.3242 0.3720 0.6164 -0.0063 0.0448  0.0632  38  PHE A C     
316  O O     . PHE A 38  ? 0.3368 0.3779 0.6203 0.0014  0.0458  0.0582  38  PHE A O     
317  C CB    . PHE A 38  ? 0.3245 0.4027 0.6317 -0.0049 0.0551  0.0695  38  PHE A CB    
318  C CG    . PHE A 38  ? 0.2594 0.3536 0.5791 -0.0055 0.0604  0.0722  38  PHE A CG    
319  C CD1   . PHE A 38  ? 0.3539 0.4563 0.6719 -0.0010 0.0595  0.0680  38  PHE A CD1   
320  C CD2   . PHE A 38  ? 0.2625 0.3629 0.5972 -0.0097 0.0679  0.0800  38  PHE A CD2   
321  C CE1   . PHE A 38  ? 0.3427 0.4573 0.6726 -0.0001 0.0649  0.0710  38  PHE A CE1   
322  C CE2   . PHE A 38  ? 0.3347 0.4492 0.6849 -0.0077 0.0759  0.0837  38  PHE A CE2   
323  C CZ    . PHE A 38  ? 0.3293 0.4499 0.6765 -0.0025 0.0738  0.0790  38  PHE A CZ    
324  N N     . ALA A 39  ? 0.3771 0.4149 0.6701 -0.0125 0.0434  0.0682  39  ALA A N     
325  C CA    . ALA A 39  ? 0.3743 0.3906 0.6555 -0.0096 0.0423  0.0678  39  ALA A CA    
326  C C     . ALA A 39  ? 0.3770 0.3922 0.6602 -0.0131 0.0449  0.0759  39  ALA A C     
327  O O     . ALA A 39  ? 0.3366 0.3615 0.6293 -0.0210 0.0477  0.0815  39  ALA A O     
328  C CB    . ALA A 39  ? 0.4037 0.3965 0.6735 -0.0162 0.0357  0.0646  39  ALA A CB    
329  N N     . HIS A 40  ? 0.3721 0.3750 0.6474 -0.0072 0.0445  0.0778  40  HIS A N     
330  C CA    . HIS A 40  ? 0.4039 0.3986 0.6744 -0.0120 0.0451  0.0858  40  HIS A CA    
331  C C     . HIS A 40  ? 0.4136 0.3966 0.6839 -0.0229 0.0430  0.0888  40  HIS A C     
332  O O     . HIS A 40  ? 0.4404 0.4098 0.7071 -0.0248 0.0375  0.0848  40  HIS A O     
333  C CB    . HIS A 40  ? 0.4111 0.3919 0.6751 -0.0043 0.0410  0.0889  40  HIS A CB    
334  C CG    . HIS A 40  ? 0.4296 0.4226 0.6955 0.0022  0.0404  0.0910  40  HIS A CG    
335  N ND1   . HIS A 40  ? 0.4536 0.4476 0.7277 0.0130  0.0372  0.0913  40  HIS A ND1   
336  C CD2   . HIS A 40  ? 0.4135 0.4158 0.6734 -0.0014 0.0426  0.0941  40  HIS A CD2   
337  C CE1   . HIS A 40  ? 0.4674 0.4738 0.7429 0.0141  0.0347  0.0955  40  HIS A CE1   
338  N NE2   . HIS A 40  ? 0.4438 0.4522 0.7066 0.0051  0.0375  0.0965  40  HIS A NE2   
339  N N     . CYS A 41  ? 0.4319 0.4173 0.7033 -0.0312 0.0479  0.0964  41  CYS A N     
340  C CA    . CYS A 41  ? 0.4481 0.4263 0.7238 -0.0435 0.0464  0.1019  41  CYS A CA    
341  C C     . CYS A 41  ? 0.4583 0.4214 0.7217 -0.0485 0.0495  0.1098  41  CYS A C     
342  O O     . CYS A 41  ? 0.4628 0.4234 0.7144 -0.0442 0.0536  0.1116  41  CYS A O     
343  C CB    . CYS A 41  ? 0.4590 0.4610 0.7572 -0.0507 0.0522  0.1059  41  CYS A CB    
344  S SG    . CYS A 41  ? 0.4550 0.4720 0.7579 -0.0500 0.0708  0.1126  41  CYS A SG    
345  N N     . PRO A 42  ? 0.4857 0.4353 0.7482 -0.0595 0.0460  0.1152  42  PRO A N     
346  C CA    . PRO A 42  ? 0.5187 0.4517 0.7670 -0.0660 0.0492  0.1234  42  PRO A CA    
347  C C     . PRO A 42  ? 0.5724 0.5175 0.8209 -0.0692 0.0650  0.1291  42  PRO A C     
348  O O     . PRO A 42  ? 0.5579 0.5267 0.8261 -0.0690 0.0745  0.1291  42  PRO A O     
349  C CB    . PRO A 42  ? 0.5037 0.4265 0.7569 -0.0797 0.0439  0.1288  42  PRO A CB    
350  C CG    . PRO A 42  ? 0.5103 0.4294 0.7673 -0.0778 0.0326  0.1213  42  PRO A CG    
351  C CD    . PRO A 42  ? 0.4381 0.3822 0.7079 -0.0682 0.0369  0.1147  42  PRO A CD    
352  N N     . GLU A 43  ? 0.6214 0.5468 0.8459 -0.0720 0.0684  0.1344  43  GLU A N     
353  C CA    . GLU A 43  ? 0.7241 0.6502 0.9373 -0.0755 0.0859  0.1391  43  GLU A CA    
354  C C     . GLU A 43  ? 0.7320 0.6668 0.9614 -0.0865 0.1015  0.1475  43  GLU A C     
355  O O     . GLU A 43  ? 0.7513 0.6924 0.9807 -0.0873 0.1220  0.1511  43  GLU A O     
356  C CB    . GLU A 43  ? 0.8573 0.7529 1.0326 -0.0778 0.0825  0.1431  43  GLU A CB    
357  C CG    . GLU A 43  ? 0.9597 0.8518 1.1251 -0.0675 0.0686  0.1386  43  GLU A CG    
358  C CD    . GLU A 43  ? 1.0518 0.9162 1.1792 -0.0723 0.0658  0.1448  43  GLU A CD    
359  O OE1   . GLU A 43  ? 1.0735 0.9386 1.1919 -0.0669 0.0595  0.1430  43  GLU A OE1   
360  O OE2   . GLU A 43  ? 1.0873 0.9269 1.1913 -0.0832 0.0687  0.1522  43  GLU A OE2   
361  N N     . SER A 44  ? 0.7299 0.6638 0.9735 -0.0951 0.0928  0.1515  44  SER A N     
362  C CA    . SER A 44  ? 0.8001 0.7462 1.0669 -0.1074 0.1048  0.1622  44  SER A CA    
363  C C     . SER A 44  ? 0.8062 0.7884 1.1148 -0.1052 0.1108  0.1634  44  SER A C     
364  O O     . SER A 44  ? 0.8443 0.8449 1.1823 -0.1130 0.1243  0.1746  44  SER A O     
365  C CB    . SER A 44  ? 0.8195 0.7507 1.0866 -0.1196 0.0898  0.1672  44  SER A CB    
366  O OG    . SER A 44  ? 0.8121 0.7446 1.0879 -0.1166 0.0700  0.1599  44  SER A OG    
367  N N     . GLN A 45  ? 0.8040 0.7967 1.1175 -0.0945 0.1005  0.1534  45  GLN A N     
368  C CA    . GLN A 45  ? 0.8120 0.8364 1.1625 -0.0921 0.1030  0.1546  45  GLN A CA    
369  C C     . GLN A 45  ? 0.8120 0.8491 1.1650 -0.0817 0.1241  0.1536  45  GLN A C     
370  O O     . GLN A 45  ? 0.8056 0.8326 1.1328 -0.0715 0.1234  0.1440  45  GLN A O     
371  C CB    . GLN A 45  ? 0.8221 0.8480 1.1735 -0.0876 0.0818  0.1447  45  GLN A CB    
372  C CG    . GLN A 45  ? 0.8610 0.9163 1.2447 -0.0845 0.0821  0.1453  45  GLN A CG    
373  C CD    . GLN A 45  ? 0.9301 0.9831 1.3179 -0.0892 0.0594  0.1411  45  GLN A CD    
374  O OE1   . GLN A 45  ? 0.9734 1.0002 1.3355 -0.0914 0.0460  0.1349  45  GLN A OE1   
375  N NE2   . GLN A 45  ? 0.9283 1.0053 1.3464 -0.0909 0.0554  0.1450  45  GLN A NE2   
376  N N     . ALA A 46  ? 0.7972 0.8551 1.1825 -0.0846 0.1432  0.1647  46  ALA A N     
377  C CA    . ALA A 46  ? 0.7782 0.8450 1.1671 -0.0739 0.1668  0.1646  46  ALA A CA    
378  C C     . ALA A 46  ? 0.7638 0.8484 1.1666 -0.0636 0.1567  0.1566  46  ALA A C     
379  O O     . ALA A 46  ? 0.7834 0.8870 1.2159 -0.0672 0.1390  0.1582  46  ALA A O     
380  C CB    . ALA A 46  ? 0.7738 0.8612 1.2025 -0.0778 0.1917  0.1803  46  ALA A CB    
381  N N     . THR A 47  ? 0.7118 0.7862 1.0886 -0.0526 0.1668  0.1485  47  THR A N     
382  C CA    . THR A 47  ? 0.6254 0.7136 1.0105 -0.0429 0.1589  0.1409  47  THR A CA    
383  C C     . THR A 47  ? 0.5509 0.6256 0.9094 -0.0329 0.1784  0.1364  47  THR A C     
384  O O     . THR A 47  ? 0.5871 0.6349 0.9100 -0.0345 0.1933  0.1369  47  THR A O     
385  C CB    . THR A 47  ? 0.6675 0.7470 1.0325 -0.0423 0.1324  0.1296  47  THR A CB    
386  O OG1   . THR A 47  ? 0.6748 0.7680 1.0483 -0.0342 0.1258  0.1230  47  THR A OG1   
387  C CG2   . THR A 47  ? 0.6895 0.7394 1.0084 -0.0408 0.1307  0.1236  47  THR A CG2   
388  N N     . LYS A 48  ? 0.4878 0.5765 0.8588 -0.0239 0.1776  0.1322  48  LYS A N     
389  C CA    . LYS A 48  ? 0.5432 0.6146 0.8841 -0.0149 0.1933  0.1270  48  LYS A CA    
390  C C     . LYS A 48  ? 0.5040 0.5633 0.8122 -0.0124 0.1733  0.1152  48  LYS A C     
391  O O     . LYS A 48  ? 0.5263 0.5668 0.8023 -0.0077 0.1803  0.1104  48  LYS A O     
392  C CB    . LYS A 48  ? 0.5843 0.6765 0.9609 -0.0057 0.2097  0.1320  48  LYS A CB    
393  C CG    . LYS A 48  ? 0.6263 0.7504 1.0448 -0.0047 0.1888  0.1325  48  LYS A CG    
394  C CD    . LYS A 48  ? 0.6836 0.8273 1.1397 0.0051  0.2046  0.1398  48  LYS A CD    
395  C CE    . LYS A 48  ? 0.7163 0.8904 1.2155 0.0030  0.1813  0.1435  48  LYS A CE    
396  N NZ    . LYS A 48  ? 0.7508 0.9347 1.2731 0.0137  0.1879  0.1486  48  LYS A NZ    
397  N N     . TYR A 49  ? 0.4556 0.5238 0.7716 -0.0160 0.1492  0.1114  49  TYR A N     
398  C CA    . TYR A 49  ? 0.4129 0.4747 0.7072 -0.0129 0.1315  0.1022  49  TYR A CA    
399  C C     . TYR A 49  ? 0.4016 0.4409 0.6651 -0.0174 0.1216  0.1012  49  TYR A C     
400  O O     . TYR A 49  ? 0.3630 0.3981 0.6308 -0.0233 0.1173  0.1049  49  TYR A O     
401  C CB    . TYR A 49  ? 0.4011 0.4838 0.7217 -0.0121 0.1140  0.0984  49  TYR A CB    
402  C CG    . TYR A 49  ? 0.3854 0.4908 0.7397 -0.0095 0.1182  0.1017  49  TYR A CG    
403  C CD1   . TYR A 49  ? 0.3679 0.4903 0.7578 -0.0157 0.1148  0.1097  49  TYR A CD1   
404  C CD2   . TYR A 49  ? 0.4016 0.5107 0.7530 -0.0018 0.1237  0.0985  49  TYR A CD2   
405  C CE1   . TYR A 49  ? 0.3939 0.5384 0.8195 -0.0142 0.1155  0.1156  49  TYR A CE1   
406  C CE2   . TYR A 49  ? 0.3854 0.5150 0.7703 0.0012  0.1263  0.1030  49  TYR A CE2   
407  C CZ    . TYR A 49  ? 0.3973 0.5458 0.8212 -0.0049 0.1216  0.1123  49  TYR A CZ    
408  O OH    . TYR A 49  ? 0.3930 0.5633 0.8550 -0.0028 0.1212  0.1197  49  TYR A OH    
409  N N     . PHE A 50  ? 0.4220 0.4464 0.6559 -0.0153 0.1163  0.0977  50  PHE A N     
410  C CA    . PHE A 50  ? 0.4122 0.4173 0.6215 -0.0192 0.1033  0.0992  50  PHE A CA    
411  C C     . PHE A 50  ? 0.4430 0.4521 0.6470 -0.0148 0.0888  0.0951  50  PHE A C     
412  O O     . PHE A 50  ? 0.4332 0.4471 0.6334 -0.0113 0.0924  0.0918  50  PHE A O     
413  C CB    . PHE A 50  ? 0.4264 0.3998 0.5963 -0.0260 0.1135  0.1045  50  PHE A CB    
414  C CG    . PHE A 50  ? 0.4829 0.4507 0.6562 -0.0305 0.1324  0.1096  50  PHE A CG    
415  C CD1   . PHE A 50  ? 0.4865 0.4578 0.6664 -0.0274 0.1559  0.1106  50  PHE A CD1   
416  C CD2   . PHE A 50  ? 0.5087 0.4675 0.6807 -0.0375 0.1278  0.1147  50  PHE A CD2   
417  C CE1   . PHE A 50  ? 0.4954 0.4646 0.6844 -0.0312 0.1759  0.1175  50  PHE A CE1   
418  C CE2   . PHE A 50  ? 0.5315 0.4863 0.7082 -0.0429 0.1457  0.1208  50  PHE A CE2   
419  C CZ    . PHE A 50  ? 0.5216 0.4831 0.7086 -0.0398 0.1705  0.1226  50  PHE A CZ    
420  N N     . ASP A 51  ? 0.4428 0.4501 0.6486 -0.0145 0.0731  0.0966  51  ASP A N     
421  C CA    . ASP A 51  ? 0.4145 0.4263 0.6183 -0.0110 0.0606  0.0960  51  ASP A CA    
422  C C     . ASP A 51  ? 0.4255 0.4137 0.5933 -0.0180 0.0574  0.1018  51  ASP A C     
423  O O     . ASP A 51  ? 0.4819 0.4469 0.6229 -0.0248 0.0666  0.1050  51  ASP A O     
424  C CB    . ASP A 51  ? 0.3825 0.4008 0.6048 -0.0065 0.0476  0.0976  51  ASP A CB    
425  C CG    . ASP A 51  ? 0.4102 0.4088 0.6210 -0.0112 0.0394  0.1064  51  ASP A CG    
426  O OD1   . ASP A 51  ? 0.4649 0.4421 0.6470 -0.0199 0.0406  0.1120  51  ASP A OD1   
427  O OD2   . ASP A 51  ? 0.4240 0.4251 0.6521 -0.0061 0.0321  0.1081  51  ASP A OD2   
428  N N     . ILE A 52  ? 0.3951 0.3863 0.5601 -0.0178 0.0445  0.1042  52  ILE A N     
429  C CA    . ILE A 52  ? 0.4282 0.3932 0.5545 -0.0273 0.0379  0.1104  52  ILE A CA    
430  C C     . ILE A 52  ? 0.4778 0.4160 0.5808 -0.0369 0.0272  0.1209  52  ILE A C     
431  O O     . ILE A 52  ? 0.5566 0.4623 0.6163 -0.0482 0.0226  0.1266  52  ILE A O     
432  C CB    . ILE A 52  ? 0.4115 0.3879 0.5437 -0.0271 0.0235  0.1129  52  ILE A CB    
433  C CG1   . ILE A 52  ? 0.3995 0.3921 0.5620 -0.0243 0.0061  0.1212  52  ILE A CG1   
434  C CG2   . ILE A 52  ? 0.3762 0.3761 0.5280 -0.0186 0.0333  0.1029  52  ILE A CG2   
435  C CD1   . ILE A 52  ? 0.4008 0.4087 0.5764 -0.0246 -0.0075 0.1267  52  ILE A CD1   
436  N N     . TYR A 53  ? 0.4412 0.3881 0.5683 -0.0333 0.0226  0.1235  53  TYR A N     
437  C CA    . TYR A 53  ? 0.4845 0.4064 0.5926 -0.0419 0.0110  0.1343  53  TYR A CA    
438  C C     . TYR A 53  ? 0.5082 0.4108 0.5972 -0.0466 0.0268  0.1323  53  TYR A C     
439  O O     . TYR A 53  ? 0.5328 0.4122 0.6035 -0.0544 0.0192  0.1406  53  TYR A O     
440  C CB    . TYR A 53  ? 0.4850 0.4238 0.6302 -0.0350 -0.0045 0.1408  53  TYR A CB    
441  C CG    . TYR A 53  ? 0.4776 0.4406 0.6507 -0.0287 -0.0161 0.1440  53  TYR A CG    
442  C CD1   . TYR A 53  ? 0.4239 0.4168 0.6348 -0.0152 -0.0082 0.1356  53  TYR A CD1   
443  C CD2   . TYR A 53  ? 0.4796 0.4330 0.6392 -0.0380 -0.0353 0.1564  53  TYR A CD2   
444  C CE1   . TYR A 53  ? 0.4162 0.4310 0.6530 -0.0096 -0.0157 0.1392  53  TYR A CE1   
445  C CE2   . TYR A 53  ? 0.4499 0.4285 0.6400 -0.0332 -0.0455 0.1615  53  TYR A CE2   
446  C CZ    . TYR A 53  ? 0.4134 0.4237 0.6432 -0.0182 -0.0339 0.1526  53  TYR A CZ    
447  O OH    . TYR A 53  ? 0.4412 0.4761 0.7014 -0.0135 -0.0410 0.1583  53  TYR A OH    
448  N N     . GLY A 54  ? 0.5060 0.4191 0.6019 -0.0422 0.0482  0.1230  54  GLY A N     
449  C CA    . GLY A 54  ? 0.5073 0.4057 0.5899 -0.0469 0.0663  0.1229  54  GLY A CA    
450  C C     . GLY A 54  ? 0.5050 0.4213 0.6218 -0.0430 0.0688  0.1216  54  GLY A C     
451  O O     . GLY A 54  ? 0.5824 0.4883 0.6924 -0.0484 0.0817  0.1238  54  GLY A O     
452  N N     . LYS A 55  ? 0.4775 0.4177 0.6283 -0.0345 0.0573  0.1184  55  LYS A N     
453  C CA    . LYS A 55  ? 0.4799 0.4305 0.6568 -0.0319 0.0576  0.1166  55  LYS A CA    
454  C C     . LYS A 55  ? 0.3961 0.3693 0.5972 -0.0289 0.0705  0.1098  55  LYS A C     
455  O O     . LYS A 55  ? 0.3748 0.3654 0.5875 -0.0228 0.0716  0.1041  55  LYS A O     
456  C CB    . LYS A 55  ? 0.4880 0.4462 0.6848 -0.0240 0.0418  0.1166  55  LYS A CB    
457  C CG    . LYS A 55  ? 0.5424 0.4823 0.7256 -0.0264 0.0263  0.1267  55  LYS A CG    
458  N N     . PRO A 56  ? 0.4019 0.3747 0.6117 -0.0343 0.0785  0.1120  56  PRO A N     
459  C CA    . PRO A 56  ? 0.4148 0.4094 0.6516 -0.0340 0.0884  0.1096  56  PRO A CA    
460  C C     . PRO A 56  ? 0.3825 0.3939 0.6425 -0.0286 0.0773  0.1031  56  PRO A C     
461  O O     . PRO A 56  ? 0.4033 0.4062 0.6618 -0.0264 0.0656  0.1012  56  PRO A O     
462  C CB    . PRO A 56  ? 0.4113 0.3989 0.6523 -0.0435 0.0951  0.1167  56  PRO A CB    
463  C CG    . PRO A 56  ? 0.4308 0.3951 0.6524 -0.0465 0.0828  0.1194  56  PRO A CG    
464  C CD    . PRO A 56  ? 0.4277 0.3795 0.6246 -0.0423 0.0766  0.1189  56  PRO A CD    
465  N N     . CYS A 57  ? 0.3408 0.3724 0.6199 -0.0263 0.0820  0.1002  57  CYS A N     
466  C CA    . CYS A 57  ? 0.4597 0.5028 0.7552 -0.0238 0.0720  0.0944  57  CYS A CA    
467  C C     . CYS A 57  ? 0.4488 0.5081 0.7705 -0.0301 0.0748  0.0985  57  CYS A C     
468  O O     . CYS A 57  ? 0.4184 0.4873 0.7517 -0.0319 0.0880  0.1049  57  CYS A O     
469  C CB    . CYS A 57  ? 0.4667 0.5190 0.7593 -0.0153 0.0700  0.0877  57  CYS A CB    
470  S SG    . CYS A 57  ? 0.5045 0.5446 0.7756 -0.0089 0.0644  0.0865  57  CYS A SG    
471  N N     . THR A 58  ? 0.4290 0.4891 0.7597 -0.0338 0.0625  0.0960  58  THR A N     
472  C CA    . THR A 58  ? 0.4323 0.5094 0.7902 -0.0409 0.0594  0.1014  58  THR A CA    
473  C C     . THR A 58  ? 0.3813 0.4669 0.7410 -0.0362 0.0525  0.0947  58  THR A C     
474  O O     . THR A 58  ? 0.4013 0.4746 0.7405 -0.0309 0.0466  0.0854  58  THR A O     
475  C CB    . THR A 58  ? 0.4530 0.5198 0.8158 -0.0538 0.0466  0.1059  58  THR A CB    
476  O OG1   . THR A 58  ? 0.5236 0.5670 0.8609 -0.0525 0.0349  0.0964  58  THR A OG1   
477  C CG2   . THR A 58  ? 0.4912 0.5502 0.8537 -0.0602 0.0531  0.1139  58  THR A CG2   
478  N N     . ARG A 59  ? 0.3458 0.4523 0.7318 -0.0378 0.0543  0.1006  59  ARG A N     
479  C CA    . ARG A 59  ? 0.3493 0.4633 0.7375 -0.0348 0.0467  0.0959  59  ARG A CA    
480  C C     . ARG A 59  ? 0.3210 0.4269 0.7102 -0.0464 0.0274  0.0967  59  ARG A C     
481  O O     . ARG A 59  ? 0.3389 0.4493 0.7488 -0.0582 0.0199  0.1073  59  ARG A O     
482  C CB    . ARG A 59  ? 0.3474 0.4848 0.7636 -0.0305 0.0567  0.1030  59  ARG A CB    
483  C CG    . ARG A 59  ? 0.3315 0.4759 0.7492 -0.0272 0.0486  0.0989  59  ARG A CG    
484  C CD    . ARG A 59  ? 0.3006 0.4650 0.7451 -0.0203 0.0608  0.1061  59  ARG A CD    
485  N NE    . ARG A 59  ? 0.2804 0.4636 0.7680 -0.0264 0.0629  0.1217  59  ARG A NE    
486  C CZ    . ARG A 59  ? 0.3075 0.5036 0.8246 -0.0355 0.0458  0.1312  59  ARG A CZ    
487  N NH1   . ARG A 59  ? 0.3018 0.4890 0.8022 -0.0399 0.0261  0.1249  59  ARG A NH1   
488  N NH2   . ARG A 59  ? 0.3167 0.5337 0.8800 -0.0412 0.0479  0.1485  59  ARG A NH2   
489  N N     . LYS A 60  ? 0.3685 0.4597 0.7329 -0.0442 0.0192  0.0864  60  LYS A N     
490  C CA    . LYS A 60  ? 0.4600 0.5348 0.8137 -0.0562 0.0010  0.0858  60  LYS A CA    
491  C C     . LYS A 60  ? 0.4542 0.5416 0.8176 -0.0568 -0.0062 0.0869  60  LYS A C     
492  O O     . LYS A 60  ? 0.4113 0.4983 0.7596 -0.0471 -0.0006 0.0780  60  LYS A O     
493  C CB    . LYS A 60  ? 0.5620 0.6037 0.8749 -0.0534 -0.0002 0.0732  60  LYS A CB    
494  C CG    . LYS A 60  ? 0.6447 0.6709 0.9465 -0.0505 0.0065  0.0718  60  LYS A CG    
495  C CD    . LYS A 60  ? 0.7004 0.6978 0.9866 -0.0649 -0.0065 0.0741  60  LYS A CD    
496  C CE    . LYS A 60  ? 0.7282 0.6921 0.9781 -0.0693 -0.0155 0.0650  60  LYS A CE    
497  N NZ    . LYS A 60  ? 0.8106 0.7380 1.0367 -0.0855 -0.0296 0.0670  60  LYS A NZ    
498  N N     . LEU A 61  ? 0.4794 0.5788 0.8702 -0.0689 -0.0197 0.0995  61  LEU A N     
499  C CA    . LEU A 61  ? 0.4920 0.5998 0.8914 -0.0714 -0.0309 0.1023  61  LEU A CA    
500  C C     . LEU A 61  ? 0.5018 0.5757 0.8640 -0.0852 -0.0513 0.0972  61  LEU A C     
501  O O     . LEU A 61  ? 0.4897 0.5425 0.8403 -0.0997 -0.0646 0.1009  61  LEU A O     
502  C CB    . LEU A 61  ? 0.5136 0.6525 0.9664 -0.0770 -0.0364 0.1211  61  LEU A CB    
503  C CG    . LEU A 61  ? 0.5158 0.6664 0.9835 -0.0773 -0.0472 0.1260  61  LEU A CG    
504  C CD1   . LEU A 61  ? 0.4608 0.6236 0.9268 -0.0583 -0.0272 0.1178  61  LEU A CD1   
505  C CD2   . LEU A 61  ? 0.5359 0.7137 1.0602 -0.0868 -0.0594 0.1485  61  LEU A CD2   
506  N N     . PHE A 62  ? 0.4949 0.5594 0.8339 -0.0817 -0.0535 0.0887  62  PHE A N     
507  C CA    . PHE A 62  ? 0.5042 0.5299 0.7987 -0.0944 -0.0695 0.0824  62  PHE A CA    
508  C C     . PHE A 62  ? 0.5265 0.5562 0.8314 -0.1068 -0.0913 0.0923  62  PHE A C     
509  O O     . PHE A 62  ? 0.5204 0.5817 0.8594 -0.0988 -0.0881 0.0984  62  PHE A O     
510  C CB    . PHE A 62  ? 0.4650 0.4697 0.7180 -0.0821 -0.0537 0.0649  62  PHE A CB    
511  C CG    . PHE A 62  ? 0.4664 0.4651 0.7108 -0.0705 -0.0354 0.0573  62  PHE A CG    
512  C CD1   . PHE A 62  ? 0.4180 0.4451 0.6856 -0.0544 -0.0177 0.0564  62  PHE A CD1   
513  C CD2   . PHE A 62  ? 0.4772 0.4378 0.6879 -0.0766 -0.0373 0.0521  62  PHE A CD2   
514  C CE1   . PHE A 62  ? 0.4135 0.4344 0.6745 -0.0452 -0.0044 0.0517  62  PHE A CE1   
515  C CE2   . PHE A 62  ? 0.4924 0.4474 0.6985 -0.0652 -0.0216 0.0467  62  PHE A CE2   
516  C CZ    . PHE A 62  ? 0.4463 0.4331 0.6795 -0.0498 -0.0062 0.0472  62  PHE A CZ    
517  N N     . ALA A 63  ? 0.5522 0.5458 0.8248 -0.1270 -0.1143 0.0945  63  ALA A N     
518  C CA    . ALA A 63  ? 0.5894 0.5809 0.8675 -0.1427 -0.1407 0.1061  63  ALA A CA    
519  C C     . ALA A 63  ? 0.6087 0.5940 0.8624 -0.1349 -0.1356 0.0961  63  ALA A C     
520  O O     . ALA A 63  ? 0.6138 0.6126 0.8874 -0.1401 -0.1511 0.1064  63  ALA A O     
521  C CB    . ALA A 63  ? 0.6527 0.5973 0.8905 -0.1693 -0.1684 0.1104  63  ALA A CB    
522  N N     . ASN A 64  ? 0.5916 0.5572 0.8048 -0.1224 -0.1140 0.0776  64  ASN A N     
523  C CA    . ASN A 64  ? 0.5451 0.5051 0.7342 -0.1145 -0.1057 0.0678  64  ASN A CA    
524  C C     . ASN A 64  ? 0.5273 0.4857 0.6986 -0.0954 -0.0761 0.0520  64  ASN A C     
525  O O     . ASN A 64  ? 0.5323 0.4847 0.7006 -0.0901 -0.0644 0.0477  64  ASN A O     
526  C CB    . ASN A 64  ? 0.5975 0.5087 0.7311 -0.1338 -0.1251 0.0652  64  ASN A CB    
527  C CG    . ASN A 64  ? 0.6758 0.5349 0.7565 -0.1453 -0.1268 0.0577  64  ASN A CG    
528  O OD1   . ASN A 64  ? 0.6894 0.5264 0.7364 -0.1340 -0.1034 0.0427  64  ASN A OD1   
529  N ND2   . ASN A 64  ? 0.7060 0.5437 0.7798 -0.1682 -0.1550 0.0694  64  ASN A ND2   
530  N N     . MET A 65  ? 0.5090 0.4733 0.6709 -0.0860 -0.0654 0.0451  65  MET A N     
531  C CA    . MET A 65  ? 0.4720 0.4419 0.6267 -0.0684 -0.0394 0.0338  65  MET A CA    
532  C C     . MET A 65  ? 0.5392 0.4674 0.6477 -0.0687 -0.0280 0.0225  65  MET A C     
533  O O     . MET A 65  ? 0.5513 0.4849 0.6643 -0.0547 -0.0082 0.0170  65  MET A O     
534  C CB    . MET A 65  ? 0.4347 0.4198 0.5904 -0.0610 -0.0331 0.0311  65  MET A CB    
535  C CG    . MET A 65  ? 0.3990 0.4249 0.6009 -0.0543 -0.0356 0.0403  65  MET A CG    
536  S SD    . MET A 65  ? 0.4243 0.4625 0.6227 -0.0474 -0.0303 0.0375  65  MET A SD    
537  C CE    . MET A 65  ? 0.4137 0.4269 0.5880 -0.0654 -0.0548 0.0418  65  MET A CE    
538  N N     . ARG A 66  ? 0.5880 0.4716 0.6508 -0.0848 -0.0404 0.0201  66  ARG A N     
539  C CA    . ARG A 66  ? 0.6278 0.4620 0.6391 -0.0855 -0.0275 0.0091  66  ARG A CA    
540  C C     . ARG A 66  ? 0.6220 0.4491 0.6407 -0.0835 -0.0247 0.0099  66  ARG A C     
541  O O     . ARG A 66  ? 0.6208 0.4324 0.6257 -0.0711 -0.0033 0.0018  66  ARG A O     
542  C CB    . ARG A 66  ? 0.7128 0.4923 0.6651 -0.1067 -0.0440 0.0071  66  ARG A CB    
543  N N     . ASP A 67  ? 0.6120 0.4511 0.6550 -0.0957 -0.0462 0.0210  67  ASP A N     
544  C CA    . ASP A 67  ? 0.6505 0.4846 0.7026 -0.0962 -0.0460 0.0236  67  ASP A CA    
545  C C     . ASP A 67  ? 0.6364 0.5086 0.7278 -0.0748 -0.0247 0.0224  67  ASP A C     
546  O O     . ASP A 67  ? 0.6602 0.5182 0.7452 -0.0687 -0.0143 0.0191  67  ASP A O     
547  C CB    . ASP A 67  ? 0.6512 0.4986 0.7309 -0.1142 -0.0731 0.0388  67  ASP A CB    
548  C CG    . ASP A 67  ? 0.7341 0.5321 0.7678 -0.1398 -0.0988 0.0419  67  ASP A CG    
549  O OD1   . ASP A 67  ? 0.8103 0.5546 0.7814 -0.1434 -0.0926 0.0300  67  ASP A OD1   
550  O OD2   . ASP A 67  ? 0.7295 0.5404 0.7891 -0.1570 -0.1251 0.0574  67  ASP A OD2   
551  N N     . ALA A 68  ? 0.5587 0.4753 0.6875 -0.0645 -0.0194 0.0257  68  ALA A N     
552  C CA    . ALA A 68  ? 0.5259 0.4753 0.6867 -0.0468 -0.0021 0.0256  68  ALA A CA    
553  C C     . ALA A 68  ? 0.5637 0.4981 0.7042 -0.0328 0.0188  0.0158  68  ALA A C     
554  O O     . ALA A 68  ? 0.5412 0.4795 0.6926 -0.0221 0.0302  0.0155  68  ALA A O     
555  C CB    . ALA A 68  ? 0.3665 0.3579 0.5628 -0.0413 -0.0025 0.0314  68  ALA A CB    
556  N N     . SER A 69  ? 0.5759 0.4933 0.6888 -0.0330 0.0238  0.0092  69  SER A N     
557  C CA    . SER A 69  ? 0.5860 0.4900 0.6833 -0.0196 0.0462  0.0016  69  SER A CA    
558  C C     . SER A 69  ? 0.6460 0.5071 0.7136 -0.0180 0.0553  -0.0038 69  SER A C     
559  O O     . SER A 69  ? 0.6640 0.5265 0.7417 -0.0027 0.0736  -0.0052 69  SER A O     
560  C CB    . SER A 69  ? 0.6057 0.4952 0.6748 -0.0227 0.0506  -0.0038 69  SER A CB    
561  O OG    . SER A 69  ? 0.6286 0.5556 0.7240 -0.0226 0.0435  0.0010  69  SER A OG    
562  N N     . GLN A 70  ? 0.6495 0.4703 0.6802 -0.0346 0.0414  -0.0056 70  GLN A N     
563  C CA    . GLN A 70  ? 0.7112 0.4814 0.7042 -0.0357 0.0482  -0.0112 70  GLN A CA    
564  C C     . GLN A 70  ? 0.6463 0.4320 0.6696 -0.0293 0.0479  -0.0059 70  GLN A C     
565  O O     . GLN A 70  ? 0.6718 0.4287 0.6795 -0.0202 0.0622  -0.0100 70  GLN A O     
566  C CB    . GLN A 70  ? 0.8090 0.5298 0.7519 -0.0594 0.0279  -0.0125 70  GLN A CB    
567  C CG    . GLN A 70  ? 0.9445 0.6325 0.8408 -0.0673 0.0297  -0.0191 70  GLN A CG    
568  C CD    . GLN A 70  ? 1.1136 0.7555 0.9625 -0.0948 0.0022  -0.0171 70  GLN A CD    
569  O OE1   . GLN A 70  ? 1.1549 0.7938 1.0114 -0.1085 -0.0194 -0.0094 70  GLN A OE1   
570  N NE2   . GLN A 70  ? 1.1803 0.7849 0.9795 -0.1048 0.0015  -0.0225 70  GLN A NE2   
571  N N     . TRP A 71  ? 0.5594 0.3882 0.6249 -0.0337 0.0329  0.0037  71  TRP A N     
572  C CA    . TRP A 71  ? 0.5260 0.3707 0.6197 -0.0293 0.0324  0.0098  71  TRP A CA    
573  C C     . TRP A 71  ? 0.5240 0.3910 0.6427 -0.0081 0.0520  0.0094  71  TRP A C     
574  O O     . TRP A 71  ? 0.5495 0.4057 0.6714 -0.0007 0.0587  0.0104  71  TRP A O     
575  C CB    . TRP A 71  ? 0.4705 0.3546 0.6021 -0.0387 0.0157  0.0206  71  TRP A CB    
576  C CG    . TRP A 71  ? 0.4668 0.3659 0.6242 -0.0357 0.0163  0.0273  71  TRP A CG    
577  C CD1   . TRP A 71  ? 0.4993 0.3743 0.6460 -0.0455 0.0082  0.0303  71  TRP A CD1   
578  C CD2   . TRP A 71  ? 0.4168 0.3540 0.6100 -0.0240 0.0246  0.0322  71  TRP A CD2   
579  N NE1   . TRP A 71  ? 0.4701 0.3676 0.6454 -0.0399 0.0121  0.0368  71  TRP A NE1   
580  C CE2   . TRP A 71  ? 0.4552 0.3892 0.6572 -0.0270 0.0220  0.0380  71  TRP A CE2   
581  C CE3   . TRP A 71  ? 0.4077 0.3773 0.6219 -0.0130 0.0327  0.0328  71  TRP A CE3   
582  C CZ2   . TRP A 71  ? 0.3843 0.3443 0.6125 -0.0194 0.0279  0.0439  71  TRP A CZ2   
583  C CZ3   . TRP A 71  ? 0.3891 0.3828 0.6280 -0.0062 0.0373  0.0388  71  TRP A CZ3   
584  C CH2   . TRP A 71  ? 0.3538 0.3417 0.5982 -0.0095 0.0352  0.0442  71  TRP A CH2   
585  N N     . ILE A 72  ? 0.5242 0.4212 0.6610 0.0002  0.0591  0.0095  72  ILE A N     
586  C CA    . ILE A 72  ? 0.5174 0.4366 0.6795 0.0179  0.0747  0.0116  72  ILE A CA    
587  C C     . ILE A 72  ? 0.5636 0.4484 0.7061 0.0297  0.0934  0.0063  72  ILE A C     
588  O O     . ILE A 72  ? 0.5624 0.4518 0.7246 0.0419  0.1017  0.0106  72  ILE A O     
589  C CB    . ILE A 72  ? 0.4737 0.4233 0.6507 0.0218  0.0781  0.0123  72  ILE A CB    
590  C CG1   . ILE A 72  ? 0.4649 0.4483 0.6647 0.0141  0.0635  0.0184  72  ILE A CG1   
591  C CG2   . ILE A 72  ? 0.4631 0.4312 0.6645 0.0381  0.0931  0.0162  72  ILE A CG2   
592  C CD1   . ILE A 72  ? 0.4434 0.4528 0.6543 0.0168  0.0651  0.0193  72  ILE A CD1   
593  N N     . LYS A 73  ? 0.6092 0.4563 0.7113 0.0258  0.1005  -0.0024 73  LYS A N     
594  C CA    . LYS A 73  ? 0.6686 0.4747 0.7450 0.0376  0.1231  -0.0086 73  LYS A CA    
595  C C     . LYS A 73  ? 0.6532 0.4252 0.7150 0.0378  0.1219  -0.0090 73  LYS A C     
596  O O     . LYS A 73  ? 0.6454 0.4064 0.7161 0.0545  0.1397  -0.0080 73  LYS A O     
597  C CB    . LYS A 73  ? 0.7789 0.5420 0.8029 0.0296  0.1302  -0.0186 73  LYS A CB    
598  C CG    . LYS A 73  ? 0.9157 0.6311 0.9078 0.0433  0.1598  -0.0258 73  LYS A CG    
599  C CD    . LYS A 73  ? 1.0538 0.6976 0.9795 0.0302  0.1566  -0.0347 73  LYS A CD    
600  C CE    . LYS A 73  ? 1.1552 0.7425 1.0396 0.0441  0.1906  -0.0435 73  LYS A CE    
601  N NZ    . LYS A 73  ? 1.1539 0.7534 1.0777 0.0691  0.2124  -0.0384 73  LYS A NZ    
602  N N     . ARG A 74  ? 0.6662 0.4222 0.7084 0.0191  0.1005  -0.0089 74  ARG A N     
603  C CA    . ARG A 74  ? 0.7227 0.4453 0.7489 0.0161  0.0963  -0.0085 74  ARG A CA    
604  C C     . ARG A 74  ? 0.6818 0.4395 0.7546 0.0272  0.0960  0.0008  74  ARG A C     
605  O O     . ARG A 74  ? 0.6941 0.4266 0.7619 0.0366  0.1048  0.0011  74  ARG A O     
606  C CB    . ARG A 74  ? 0.7636 0.4657 0.7638 -0.0092 0.0706  -0.0076 74  ARG A CB    
607  C CG    . ARG A 74  ? 0.8426 0.4846 0.7787 -0.0230 0.0687  -0.0166 74  ARG A CG    
608  C CD    . ARG A 74  ? 0.8711 0.4831 0.7802 -0.0484 0.0418  -0.0130 74  ARG A CD    
609  N NE    . ARG A 74  ? 0.8342 0.4987 0.7870 -0.0616 0.0182  -0.0016 74  ARG A NE    
610  C CZ    . ARG A 74  ? 0.8246 0.5042 0.7789 -0.0742 0.0037  0.0011  74  ARG A CZ    
611  N NH1   . ARG A 74  ? 0.8783 0.5234 0.7886 -0.0773 0.0087  -0.0073 74  ARG A NH1   
612  N NH2   . ARG A 74  ? 0.7440 0.4715 0.7435 -0.0832 -0.0144 0.0127  74  ARG A NH2   
613  N N     . MET A 75  ? 0.5352 0.3466 0.6493 0.0257  0.0860  0.0085  75  MET A N     
614  C CA    . MET A 75  ? 0.5226 0.3650 0.6756 0.0339  0.0844  0.0179  75  MET A CA    
615  C C     . MET A 75  ? 0.5323 0.3790 0.7045 0.0553  0.1031  0.0203  75  MET A C     
616  O O     . MET A 75  ? 0.5011 0.3501 0.6922 0.0636  0.1039  0.0273  75  MET A O     
617  C CB    . MET A 75  ? 0.5013 0.3928 0.6858 0.0278  0.0729  0.0247  75  MET A CB    
618  C CG    . MET A 75  ? 0.4686 0.3632 0.6496 0.0093  0.0555  0.0274  75  MET A CG    
619  S SD    . MET A 75  ? 0.5215 0.4050 0.7068 0.0037  0.0481  0.0344  75  MET A SD    
620  C CE    . MET A 75  ? 0.4106 0.3378 0.6338 0.0117  0.0498  0.0440  75  MET A CE    
621  N N     . GLU A 76  ? 0.5354 0.3837 0.7052 0.0638  0.1178  0.0161  76  GLU A N     
622  C CA    . GLU A 76  ? 0.5709 0.4235 0.7634 0.0845  0.1381  0.0201  76  GLU A CA    
623  C C     . GLU A 76  ? 0.6188 0.4199 0.7859 0.0945  0.1538  0.0156  76  GLU A C     
624  O O     . GLU A 76  ? 0.5876 0.3909 0.7815 0.1107  0.1633  0.0233  76  GLU A O     
625  C CB    . GLU A 76  ? 0.6097 0.4749 0.8042 0.0895  0.1519  0.0170  76  GLU A CB    
626  C CG    . GLU A 76  ? 0.7194 0.5917 0.9433 0.1112  0.1756  0.0233  76  GLU A CG    
627  C CD    . GLU A 76  ? 0.7988 0.6823 1.0233 0.1146  0.1909  0.0208  76  GLU A CD    
628  O OE1   . GLU A 76  ? 0.8624 0.7392 1.1004 0.1318  0.2167  0.0235  76  GLU A OE1   
629  O OE2   . GLU A 76  ? 0.8329 0.7317 1.0459 0.1005  0.1783  0.0170  76  GLU A OE2   
630  N N     . ASP A 77  ? 0.6778 0.4295 0.7914 0.0840  0.1551  0.0040  77  ASP A N     
631  C CA    . ASP A 77  ? 0.8071 0.4982 0.8835 0.0911  0.1702  -0.0022 77  ASP A CA    
632  C C     . ASP A 77  ? 0.8254 0.5079 0.9095 0.0896  0.1575  0.0038  77  ASP A C     
633  O O     . ASP A 77  ? 0.9139 0.5562 0.9841 0.1016  0.1714  0.0027  77  ASP A O     
634  C CB    . ASP A 77  ? 0.8883 0.5229 0.8969 0.0746  0.1689  -0.0153 77  ASP A CB    
635  C CG    . ASP A 77  ? 0.9410 0.5708 0.9316 0.0770  0.1854  -0.0220 77  ASP A CG    
636  O OD1   . ASP A 77  ? 0.9162 0.5764 0.9442 0.0957  0.2054  -0.0175 77  ASP A OD1   
637  O OD2   . ASP A 77  ? 0.9960 0.5907 0.9352 0.0589  0.1773  -0.0306 77  ASP A OD2   
638  N N     . ILE A 78  ? 0.7486 0.4667 0.8535 0.0750  0.1328  0.0103  78  ILE A N     
639  C CA    . ILE A 78  ? 0.7112 0.4253 0.8247 0.0714  0.1199  0.0172  78  ILE A CA    
640  C C     . ILE A 78  ? 0.6847 0.4370 0.8498 0.0874  0.1225  0.0298  78  ILE A C     
641  O O     . ILE A 78  ? 0.7322 0.4681 0.9036 0.0951  0.1230  0.0355  78  ILE A O     
642  C CB    . ILE A 78  ? 0.6588 0.3908 0.7702 0.0476  0.0946  0.0197  78  ILE A CB    
643  C CG1   . ILE A 78  ? 0.6712 0.3645 0.7344 0.0289  0.0869  0.0106  78  ILE A CG1   
644  C CG2   . ILE A 78  ? 0.6305 0.3595 0.7513 0.0433  0.0832  0.0278  78  ILE A CG2   
645  C CD1   . ILE A 78  ? 0.6278 0.3427 0.6973 0.0060  0.0628  0.0158  78  ILE A CD1   
646  N N     . GLY A 79  ? 0.6412 0.4420 0.8413 0.0914  0.1223  0.0351  79  GLY A N     
647  C CA    . GLY A 79  ? 0.5566 0.3937 0.8039 0.1029  0.1204  0.0490  79  GLY A CA    
648  C C     . GLY A 79  ? 0.5235 0.3938 0.7857 0.0886  0.0988  0.0565  79  GLY A C     
649  O O     . GLY A 79  ? 0.5064 0.3892 0.7918 0.0918  0.0909  0.0682  79  GLY A O     
650  N N     . LEU A 80  ? 0.4903 0.3721 0.7378 0.0727  0.0900  0.0506  80  LEU A N     
651  C CA    . LEU A 80  ? 0.4768 0.3871 0.7355 0.0599  0.0743  0.0569  80  LEU A CA    
652  C C     . LEU A 80  ? 0.4555 0.3999 0.7254 0.0567  0.0731  0.0561  80  LEU A C     
653  O O     . LEU A 80  ? 0.4572 0.3990 0.7165 0.0574  0.0800  0.0481  80  LEU A O     
654  C CB    . LEU A 80  ? 0.4483 0.3410 0.6840 0.0431  0.0645  0.0535  80  LEU A CB    
655  C CG    . LEU A 80  ? 0.4794 0.3404 0.7031 0.0416  0.0611  0.0564  80  LEU A CG    
656  C CD1   . LEU A 80  ? 0.5157 0.3593 0.7166 0.0228  0.0514  0.0531  80  LEU A CD1   
657  C CD2   . LEU A 80  ? 0.4653 0.3421 0.7100 0.0436  0.0546  0.0684  80  LEU A CD2   
658  N N     . GLU A 81  ? 0.4353 0.4066 0.7214 0.0522  0.0642  0.0643  81  GLU A N     
659  C CA    . GLU A 81  ? 0.4035 0.4037 0.6980 0.0493  0.0625  0.0645  81  GLU A CA    
660  C C     . GLU A 81  ? 0.3805 0.3827 0.6600 0.0375  0.0599  0.0568  81  GLU A C     
661  O O     . GLU A 81  ? 0.3441 0.3391 0.6158 0.0274  0.0543  0.0571  81  GLU A O     
662  C CB    . GLU A 81  ? 0.4063 0.4249 0.7132 0.0461  0.0535  0.0754  81  GLU A CB    
663  C CG    . GLU A 81  ? 0.4146 0.4574 0.7257 0.0428  0.0515  0.0761  81  GLU A CG    
664  C CD    . GLU A 81  ? 0.4363 0.4875 0.7497 0.0378  0.0419  0.0869  81  GLU A CD    
665  O OE1   . GLU A 81  ? 0.4551 0.4940 0.7661 0.0356  0.0364  0.0938  81  GLU A OE1   
666  O OE2   . GLU A 81  ? 0.4061 0.4720 0.7195 0.0348  0.0392  0.0887  81  GLU A OE2   
667  N N     . ALA A 82  ? 0.3294 0.3423 0.6078 0.0386  0.0636  0.0516  82  ALA A N     
668  C CA    . ALA A 82  ? 0.3280 0.3470 0.5977 0.0282  0.0591  0.0469  82  ALA A CA    
669  C C     . ALA A 82  ? 0.2982 0.3445 0.5795 0.0270  0.0568  0.0508  82  ALA A C     
670  O O     . ALA A 82  ? 0.3044 0.3624 0.5902 0.0321  0.0599  0.0501  82  ALA A O     
671  C CB    . ALA A 82  ? 0.3773 0.3812 0.6299 0.0284  0.0636  0.0380  82  ALA A CB    
672  N N     . LEU A 83  ? 0.2844 0.3382 0.5687 0.0201  0.0526  0.0553  83  LEU A N     
673  C CA    . LEU A 83  ? 0.3057 0.3767 0.5940 0.0190  0.0521  0.0593  83  LEU A CA    
674  C C     . LEU A 83  ? 0.3289 0.4106 0.6172 0.0150  0.0521  0.0557  83  LEU A C     
675  O O     . LEU A 83  ? 0.3049 0.3826 0.5933 0.0100  0.0499  0.0527  83  LEU A O     
676  C CB    . LEU A 83  ? 0.2810 0.3488 0.5675 0.0146  0.0515  0.0663  83  LEU A CB    
677  C CG    . LEU A 83  ? 0.3317 0.3885 0.6172 0.0170  0.0485  0.0726  83  LEU A CG    
678  C CD1   . LEU A 83  ? 0.3603 0.4007 0.6449 0.0159  0.0482  0.0717  83  LEU A CD1   
679  C CD2   . LEU A 83  ? 0.3694 0.4232 0.6450 0.0117  0.0472  0.0801  83  LEU A CD2   
680  N N     . GLY A 84  ? 0.3037 0.3966 0.5912 0.0162  0.0529  0.0571  84  GLY A N     
681  C CA    . GLY A 84  ? 0.2940 0.3959 0.5823 0.0138  0.0532  0.0549  84  GLY A CA    
682  C C     . GLY A 84  ? 0.3034 0.4114 0.5878 0.0167  0.0520  0.0511  84  GLY A C     
683  O O     . GLY A 84  ? 0.2502 0.3569 0.5342 0.0208  0.0526  0.0500  84  GLY A O     
684  N N     . MET A 85  ? 0.2782 0.3929 0.5617 0.0150  0.0515  0.0500  85  MET A N     
685  C CA    . MET A 85  ? 0.2698 0.3892 0.5477 0.0160  0.0498  0.0467  85  MET A CA    
686  C C     . MET A 85  ? 0.2614 0.3745 0.5355 0.0146  0.0480  0.0410  85  MET A C     
687  O O     . MET A 85  ? 0.2453 0.3544 0.5198 0.0097  0.0434  0.0397  85  MET A O     
688  C CB    . MET A 85  ? 0.2920 0.4162 0.5680 0.0147  0.0495  0.0476  85  MET A CB    
689  C CG    . MET A 85  ? 0.2637 0.3910 0.5324 0.0142  0.0463  0.0444  85  MET A CG    
690  S SD    . MET A 85  ? 0.3147 0.4456 0.5782 0.0160  0.0468  0.0457  85  MET A SD    
691  C CE    . MET A 85  ? 0.2137 0.3417 0.4698 0.0147  0.0457  0.0526  85  MET A CE    
692  N N     . ASP A 86  ? 0.2769 0.3870 0.5467 0.0184  0.0518  0.0387  86  ASP A N     
693  C CA    . ASP A 86  ? 0.3444 0.4399 0.6018 0.0173  0.0540  0.0325  86  ASP A CA    
694  C C     . ASP A 86  ? 0.3659 0.4623 0.6122 0.0143  0.0528  0.0291  86  ASP A C     
695  O O     . ASP A 86  ? 0.3690 0.4482 0.5974 0.0107  0.0534  0.0237  86  ASP A O     
696  C CB    . ASP A 86  ? 0.3873 0.4749 0.6459 0.0248  0.0636  0.0320  86  ASP A CB    
697  C CG    . ASP A 86  ? 0.4594 0.5645 0.7327 0.0309  0.0678  0.0380  86  ASP A CG    
698  O OD1   . ASP A 86  ? 0.5645 0.6672 0.8416 0.0373  0.0779  0.0381  86  ASP A OD1   
699  O OD2   . ASP A 86  ? 0.4105 0.5298 0.6912 0.0288  0.0614  0.0436  86  ASP A OD2   
700  N N     . ASP A 87  ? 0.3452 0.4570 0.5971 0.0147  0.0508  0.0325  87  ASP A N     
701  C CA    . ASP A 87  ? 0.3014 0.4136 0.5426 0.0107  0.0475  0.0303  87  ASP A CA    
702  C C     . ASP A 87  ? 0.3145 0.4268 0.5580 0.0059  0.0383  0.0314  87  ASP A C     
703  O O     . ASP A 87  ? 0.2692 0.3911 0.5216 0.0076  0.0372  0.0355  87  ASP A O     
704  C CB    . ASP A 87  ? 0.3467 0.4726 0.5917 0.0125  0.0488  0.0343  87  ASP A CB    
705  C CG    . ASP A 87  ? 0.3723 0.4969 0.6042 0.0080  0.0463  0.0321  87  ASP A CG    
706  O OD1   . ASP A 87  ? 0.3389 0.4531 0.5598 0.0033  0.0409  0.0285  87  ASP A OD1   
707  O OD2   . ASP A 87  ? 0.3544 0.4878 0.5874 0.0080  0.0480  0.0355  87  ASP A OD2   
708  N N     . PHE A 88  ? 0.2764 0.3757 0.5112 -0.0004 0.0318  0.0289  88  PHE A N     
709  C CA    . PHE A 88  ? 0.2954 0.3972 0.5414 -0.0053 0.0214  0.0334  88  PHE A CA    
710  C C     . PHE A 88  ? 0.3090 0.4195 0.5593 -0.0052 0.0168  0.0364  88  PHE A C     
711  O O     . PHE A 88  ? 0.3278 0.4468 0.5974 -0.0048 0.0129  0.0426  88  PHE A O     
712  C CB    . PHE A 88  ? 0.3325 0.4150 0.5658 -0.0152 0.0113  0.0321  88  PHE A CB    
713  C CG    . PHE A 88  ? 0.3706 0.4386 0.5961 -0.0155 0.0158  0.0291  88  PHE A CG    
714  C CD1   . PHE A 88  ? 0.3389 0.4173 0.5838 -0.0108 0.0205  0.0327  88  PHE A CD1   
715  C CD2   . PHE A 88  ? 0.4129 0.4524 0.6075 -0.0203 0.0169  0.0225  88  PHE A CD2   
716  C CE1   . PHE A 88  ? 0.3539 0.4170 0.5910 -0.0109 0.0240  0.0303  88  PHE A CE1   
717  C CE2   . PHE A 88  ? 0.4134 0.4349 0.5982 -0.0194 0.0224  0.0195  88  PHE A CE2   
718  C CZ    . PHE A 88  ? 0.3753 0.4097 0.5830 -0.0146 0.0250  0.0237  88  PHE A CZ    
719  N N     . LYS A 89  ? 0.2934 0.4015 0.5276 -0.0051 0.0186  0.0330  89  LYS A N     
720  C CA    . LYS A 89  ? 0.3277 0.4405 0.5619 -0.0048 0.0145  0.0355  89  LYS A CA    
721  C C     . LYS A 89  ? 0.2874 0.4106 0.5344 0.0024  0.0212  0.0394  89  LYS A C     
722  O O     . LYS A 89  ? 0.3210 0.4464 0.5777 0.0047  0.0195  0.0437  89  LYS A O     
723  C CB    . LYS A 89  ? 0.3633 0.4709 0.5762 -0.0073 0.0161  0.0316  89  LYS A CB    
724  C CG    . LYS A 89  ? 0.4420 0.5320 0.6329 -0.0151 0.0123  0.0272  89  LYS A CG    
725  C CD    . LYS A 89  ? 0.4490 0.5344 0.6200 -0.0181 0.0151  0.0248  89  LYS A CD    
726  C CE    . LYS A 89  ? 0.4358 0.5340 0.6129 -0.0123 0.0279  0.0251  89  LYS A CE    
727  N NZ    . LYS A 89  ? 0.3671 0.4627 0.5471 -0.0082 0.0392  0.0226  89  LYS A NZ    
728  N N     . LEU A 90  ? 0.2830 0.4091 0.5283 0.0058  0.0292  0.0386  90  LEU A N     
729  C CA    . LEU A 90  ? 0.2662 0.3939 0.5134 0.0101  0.0351  0.0421  90  LEU A CA    
730  C C     . LEU A 90  ? 0.3027 0.4321 0.5670 0.0132  0.0392  0.0459  90  LEU A C     
731  O O     . LEU A 90  ? 0.3345 0.4606 0.5998 0.0172  0.0453  0.0492  90  LEU A O     
732  C CB    . LEU A 90  ? 0.2179 0.3468 0.4596 0.0106  0.0387  0.0427  90  LEU A CB    
733  C CG    . LEU A 90  ? 0.2955 0.4272 0.5278 0.0078  0.0365  0.0423  90  LEU A CG    
734  C CD1   . LEU A 90  ? 0.3103 0.4458 0.5446 0.0080  0.0376  0.0473  90  LEU A CD1   
735  C CD2   . LEU A 90  ? 0.3046 0.4318 0.5237 0.0051  0.0325  0.0426  90  LEU A CD2   
736  N N     . ALA A 91  ? 0.2546 0.3864 0.5305 0.0111  0.0372  0.0459  91  ALA A N     
737  C CA    . ALA A 91  ? 0.2708 0.4069 0.5673 0.0122  0.0405  0.0512  91  ALA A CA    
738  C C     . ALA A 91  ? 0.2945 0.4361 0.6092 0.0126  0.0367  0.0568  91  ALA A C     
739  O O     . ALA A 91  ? 0.3136 0.4598 0.6460 0.0176  0.0455  0.0630  91  ALA A O     
740  C CB    . ALA A 91  ? 0.2525 0.3871 0.5545 0.0075  0.0362  0.0506  91  ALA A CB    
741  N N     . TYR A 92  ? 0.2959 0.4358 0.6065 0.0075  0.0244  0.0555  92  TYR A N     
742  C CA    . TYR A 92  ? 0.3074 0.4524 0.6370 0.0072  0.0170  0.0626  92  TYR A CA    
743  C C     . TYR A 92  ? 0.2712 0.4156 0.6010 0.0163  0.0269  0.0645  92  TYR A C     
744  O O     . TYR A 92  ? 0.2441 0.3952 0.6004 0.0221  0.0321  0.0729  92  TYR A O     
745  C CB    . TYR A 92  ? 0.3592 0.4959 0.6741 -0.0019 0.0005  0.0603  92  TYR A CB    
746  C CG    . TYR A 92  ? 0.3473 0.4876 0.6799 -0.0027 -0.0104 0.0688  92  TYR A CG    
747  C CD1   . TYR A 92  ? 0.3311 0.4664 0.6512 0.0010  -0.0101 0.0673  92  TYR A CD1   
748  C CD2   . TYR A 92  ? 0.3409 0.4895 0.7049 -0.0079 -0.0225 0.0802  92  TYR A CD2   
749  C CE1   . TYR A 92  ? 0.3418 0.4793 0.6798 0.0013  -0.0205 0.0762  92  TYR A CE1   
750  C CE2   . TYR A 92  ? 0.3566 0.5103 0.7429 -0.0084 -0.0342 0.0908  92  TYR A CE2   
751  C CZ    . TYR A 92  ? 0.3604 0.5080 0.7333 -0.0029 -0.0327 0.0883  92  TYR A CZ    
752  O OH    . TYR A 92  ? 0.4217 0.5732 0.8181 -0.0024 -0.0448 0.0998  92  TYR A OH    
753  N N     . LEU A 93  ? 0.3155 0.4501 0.6161 0.0173  0.0301  0.0576  93  LEU A N     
754  C CA    . LEU A 93  ? 0.3262 0.4520 0.6163 0.0241  0.0385  0.0583  93  LEU A CA    
755  C C     . LEU A 93  ? 0.3239 0.4455 0.6192 0.0316  0.0559  0.0614  93  LEU A C     
756  O O     . LEU A 93  ? 0.3118 0.4266 0.6130 0.0396  0.0663  0.0657  93  LEU A O     
757  C CB    . LEU A 93  ? 0.3248 0.4404 0.5815 0.0204  0.0364  0.0518  93  LEU A CB    
758  C CG    . LEU A 93  ? 0.3140 0.4284 0.5594 0.0140  0.0237  0.0492  93  LEU A CG    
759  C CD1   . LEU A 93  ? 0.2978 0.4049 0.5155 0.0104  0.0238  0.0454  93  LEU A CD1   
760  C CD2   . LEU A 93  ? 0.2998 0.4116 0.5556 0.0166  0.0181  0.0541  93  LEU A CD2   
761  N N     . SER A 94  ? 0.3277 0.4501 0.6187 0.0294  0.0604  0.0595  94  SER A N     
762  C CA    . SER A 94  ? 0.3547 0.4691 0.6443 0.0344  0.0771  0.0623  94  SER A CA    
763  C C     . SER A 94  ? 0.3701 0.4961 0.6975 0.0399  0.0859  0.0709  94  SER A C     
764  O O     . SER A 94  ? 0.3939 0.5104 0.7231 0.0478  0.1045  0.0749  94  SER A O     
765  C CB    . SER A 94  ? 0.3688 0.4819 0.6473 0.0295  0.0766  0.0597  94  SER A CB    
766  O OG    . SER A 94  ? 0.3802 0.4803 0.6499 0.0325  0.0921  0.0624  94  SER A OG    
767  N N     . ASP A 95  ? 0.3612 0.5057 0.7180 0.0351  0.0731  0.0749  95  ASP A N     
768  C CA    . ASP A 95  ? 0.3454 0.5061 0.7463 0.0378  0.0769  0.0865  95  ASP A CA    
769  C C     . ASP A 95  ? 0.4125 0.5767 0.8350 0.0456  0.0790  0.0938  95  ASP A C     
770  O O     . ASP A 95  ? 0.4210 0.5917 0.8746 0.0546  0.0950  0.1038  95  ASP A O     
771  C CB    . ASP A 95  ? 0.3448 0.5194 0.7659 0.0268  0.0576  0.0898  95  ASP A CB    
772  C CG    . ASP A 95  ? 0.3845 0.5569 0.7967 0.0213  0.0594  0.0865  95  ASP A CG    
773  O OD1   . ASP A 95  ? 0.3535 0.5273 0.7656 0.0115  0.0437  0.0854  95  ASP A OD1   
774  O OD2   . ASP A 95  ? 0.4163 0.5816 0.8179 0.0262  0.0764  0.0852  95  ASP A OD2   
775  N N     . THR A 96  ? 0.3894 0.5488 0.7966 0.0426  0.0639  0.0897  96  THR A N     
776  C CA    . THR A 96  ? 0.3721 0.5339 0.7998 0.0490  0.0614  0.0974  96  THR A CA    
777  C C     . THR A 96  ? 0.3667 0.5087 0.7755 0.0618  0.0830  0.0951  96  THR A C     
778  O O     . THR A 96  ? 0.3499 0.4932 0.7855 0.0728  0.0929  0.1044  96  THR A O     
779  C CB    . THR A 96  ? 0.3361 0.4949 0.7481 0.0399  0.0374  0.0938  96  THR A CB    
780  O OG1   . THR A 96  ? 0.3007 0.4672 0.7154 0.0267  0.0194  0.0933  96  THR A OG1   
781  C CG2   . THR A 96  ? 0.2923 0.4561 0.7334 0.0449  0.0300  0.1049  96  THR A CG2   
782  N N     . TYR A 97  ? 0.3809 0.5020 0.7428 0.0601  0.0899  0.0840  97  TYR A N     
783  C CA    . TYR A 97  ? 0.4055 0.4983 0.7360 0.0687  0.1077  0.0808  97  TYR A CA    
784  C C     . TYR A 97  ? 0.4371 0.5119 0.7423 0.0701  0.1274  0.0776  97  TYR A C     
785  O O     . TYR A 97  ? 0.4146 0.4687 0.6746 0.0638  0.1253  0.0697  97  TYR A O     
786  C CB    . TYR A 97  ? 0.3683 0.4451 0.6587 0.0625  0.0938  0.0726  97  TYR A CB    
787  C CG    . TYR A 97  ? 0.3623 0.4517 0.6728 0.0607  0.0756  0.0763  97  TYR A CG    
788  C CD1   . TYR A 97  ? 0.2682 0.3727 0.5807 0.0487  0.0541  0.0737  97  TYR A CD1   
789  C CD2   . TYR A 97  ? 0.3743 0.4573 0.7009 0.0710  0.0806  0.0833  97  TYR A CD2   
790  C CE1   . TYR A 97  ? 0.3062 0.4167 0.6307 0.0449  0.0366  0.0775  97  TYR A CE1   
791  C CE2   . TYR A 97  ? 0.3631 0.4558 0.7074 0.0681  0.0614  0.0882  97  TYR A CE2   
792  C CZ    . TYR A 97  ? 0.3329 0.4383 0.6739 0.0540  0.0386  0.0852  97  TYR A CZ    
793  O OH    . TYR A 97  ? 0.3447 0.4540 0.6965 0.0491  0.0186  0.0904  97  TYR A OH    
794  N N     . ASN A 98  ? 0.4409 0.5235 0.7768 0.0774  0.1459  0.0854  98  ASN A N     
795  C CA    . ASN A 98  ? 0.4956 0.5600 0.8086 0.0779  0.1659  0.0837  98  ASN A CA    
796  C C     . ASN A 98  ? 0.5143 0.5372 0.7877 0.0871  0.1913  0.0817  98  ASN A C     
797  O O     . ASN A 98  ? 0.5678 0.5777 0.8436 0.0948  0.2184  0.0861  98  ASN A O     
798  C CB    . ASN A 98  ? 0.5992 0.6884 0.9605 0.0803  0.1761  0.0937  98  ASN A CB    
799  C CG    . ASN A 98  ? 0.7212 0.8298 1.1385 0.0922  0.1860  0.1069  98  ASN A CG    
800  O OD1   . ASN A 98  ? 0.8038 0.8945 1.2161 0.1044  0.2024  0.1087  98  ASN A OD1   
801  N ND2   . ASN A 98  ? 0.7498 0.8938 1.2213 0.0882  0.1751  0.1174  98  ASN A ND2   
802  N N     . TYR A 99  ? 0.5152 0.5140 0.7490 0.0853  0.1834  0.0752  99  TYR A N     
803  C CA    . TYR A 99  ? 0.5636 0.5141 0.7486 0.0919  0.2047  0.0721  99  TYR A CA    
804  C C     . TYR A 99  ? 0.5782 0.5041 0.7110 0.0813  0.1855  0.0641  99  TYR A C     
805  O O     . TYR A 99  ? 0.5497 0.5007 0.6934 0.0720  0.1592  0.0620  99  TYR A O     
806  C CB    . TYR A 99  ? 0.5692 0.5172 0.7855 0.1099  0.2253  0.0795  99  TYR A CB    
807  C CG    . TYR A 99  ? 0.5186 0.4983 0.7778 0.1119  0.2039  0.0839  99  TYR A CG    
808  C CD1   . TYR A 99  ? 0.4658 0.4916 0.7930 0.1137  0.1949  0.0941  99  TYR A CD1   
809  C CD2   . TYR A 99  ? 0.5335 0.4937 0.7620 0.1101  0.1909  0.0790  99  TYR A CD2   
810  C CE1   . TYR A 99  ? 0.4386 0.4880 0.7992 0.1132  0.1728  0.0992  99  TYR A CE1   
811  C CE2   . TYR A 99  ? 0.5065 0.4918 0.7697 0.1106  0.1708  0.0834  99  TYR A CE2   
812  C CZ    . TYR A 99  ? 0.4695 0.4982 0.7973 0.1120  0.1615  0.0935  99  TYR A CZ    
813  O OH    . TYR A 99  ? 0.4104 0.4590 0.7673 0.1102  0.1391  0.0989  99  TYR A OH    
814  N N     . GLU A 100 ? 0.7261 0.5046 0.7112 0.0191  0.1673  0.1087  100 GLU A N     
815  C CA    . GLU A 100 ? 0.7387 0.5183 0.6994 0.0260  0.1509  0.1011  100 GLU A CA    
816  C C     . GLU A 100 ? 0.6791 0.4959 0.6864 0.0286  0.1437  0.0994  100 GLU A C     
817  O O     . GLU A 100 ? 0.6841 0.5088 0.7176 0.0295  0.1627  0.1017  100 GLU A O     
818  C CB    . GLU A 100 ? 0.8218 0.5670 0.7345 0.0282  0.1677  0.0981  100 GLU A CB    
819  C CG    . GLU A 100 ? 0.8881 0.6326 0.7731 0.0332  0.1501  0.0901  100 GLU A CG    
820  C CD    . GLU A 100 ? 1.0313 0.7379 0.8639 0.0333  0.1656  0.0868  100 GLU A CD    
821  O OE1   . GLU A 100 ? 1.0583 0.7637 0.8703 0.0355  0.1548  0.0801  100 GLU A OE1   
822  O OE2   . GLU A 100 ? 1.1146 0.7913 0.9251 0.0300  0.1888  0.0909  100 GLU A OE2   
823  N N     . ILE A 101 ? 0.6083 0.4466 0.6256 0.0304  0.1169  0.0958  101 ILE A N     
824  C CA    . ILE A 101 ? 0.5417 0.4138 0.6006 0.0322  0.1076  0.0949  101 ILE A CA    
825  C C     . ILE A 101 ? 0.6316 0.5012 0.6784 0.0375  0.1124  0.0898  101 ILE A C     
826  O O     . ILE A 101 ? 0.7062 0.5633 0.7154 0.0401  0.1015  0.0832  101 ILE A O     
827  C CB    . ILE A 101 ? 0.4909 0.3823 0.5578 0.0322  0.0792  0.0918  101 ILE A CB    
828  C CG1   . ILE A 101 ? 0.4915 0.3879 0.5783 0.0256  0.0750  0.0970  101 ILE A CG1   
829  C CG2   . ILE A 101 ? 0.4585 0.3791 0.5577 0.0345  0.0691  0.0900  101 ILE A CG2   
830  C CD1   . ILE A 101 ? 0.4801 0.3891 0.5691 0.0253  0.0495  0.0936  101 ILE A CD1   
831  N N     . LYS A 102 ? 0.6213 0.5026 0.7013 0.0390  0.1288  0.0932  102 LYS A N     
832  C CA    . LYS A 102 ? 0.6514 0.5329 0.7269 0.0440  0.1326  0.0888  102 LYS A CA    
833  C C     . LYS A 102 ? 0.5804 0.4967 0.6987 0.0457  0.1166  0.0899  102 LYS A C     
834  O O     . LYS A 102 ? 0.5360 0.4744 0.7010 0.0448  0.1202  0.0972  102 LYS A O     
835  C CB    . LYS A 102 ? 0.7242 0.5892 0.8023 0.0462  0.1644  0.0918  102 LYS A CB    
836  C CG    . LYS A 102 ? 0.8466 0.6719 0.8756 0.0438  0.1820  0.0905  102 LYS A CG    
837  C CD    . LYS A 102 ? 0.9609 0.7594 0.9632 0.0470  0.2049  0.0868  102 LYS A CD    
838  C CE    . LYS A 102 ? 0.9730 0.7699 0.9505 0.0489  0.1880  0.0782  102 LYS A CE    
839  N NZ    . LYS A 102 ? 1.0307 0.7979 0.9788 0.0508  0.2100  0.0739  102 LYS A NZ    
840  N N     . TYR A 103 ? 0.5784 0.4995 0.6806 0.0474  0.0981  0.0830  103 TYR A N     
841  C CA    . TYR A 103 ? 0.5127 0.4631 0.6478 0.0483  0.0809  0.0836  103 TYR A CA    
842  C C     . TYR A 103 ? 0.4883 0.4403 0.6272 0.0528  0.0864  0.0813  103 TYR A C     
843  O O     . TYR A 103 ? 0.4752 0.4044 0.5817 0.0544  0.0978  0.0763  103 TYR A O     
844  C CB    . TYR A 103 ? 0.5073 0.4646 0.6262 0.0463  0.0550  0.0781  103 TYR A CB    
845  C CG    . TYR A 103 ? 0.5047 0.4474 0.5815 0.0478  0.0480  0.0693  103 TYR A CG    
846  C CD1   . TYR A 103 ? 0.4865 0.4047 0.5235 0.0472  0.0511  0.0666  103 TYR A CD1   
847  C CD2   . TYR A 103 ? 0.4661 0.4196 0.5433 0.0490  0.0375  0.0643  103 TYR A CD2   
848  C CE1   . TYR A 103 ? 0.5095 0.4170 0.5106 0.0477  0.0422  0.0593  103 TYR A CE1   
849  C CE2   . TYR A 103 ? 0.4807 0.4236 0.5231 0.0488  0.0304  0.0564  103 TYR A CE2   
850  C CZ    . TYR A 103 ? 0.5190 0.4403 0.5248 0.0481  0.0319  0.0540  103 TYR A CZ    
851  O OH    . TYR A 103 ? 0.5750 0.4883 0.5486 0.0470  0.0226  0.0469  103 TYR A OH    
852  N N     . ASP A 104 ? 0.4816 0.4585 0.6583 0.0543  0.0778  0.0853  104 ASP A N     
853  C CA    . ASP A 104 ? 0.4628 0.4420 0.6457 0.0589  0.0809  0.0841  104 ASP A CA    
854  C C     . ASP A 104 ? 0.4656 0.4584 0.6433 0.0571  0.0564  0.0792  104 ASP A C     
855  O O     . ASP A 104 ? 0.4619 0.4764 0.6674 0.0556  0.0416  0.0834  104 ASP A O     
856  C CB    . ASP A 104 ? 0.4662 0.4628 0.6988 0.0633  0.0916  0.0944  104 ASP A CB    
857  C CG    . ASP A 104 ? 0.5034 0.4960 0.7406 0.0699  0.1003  0.0944  104 ASP A CG    
858  O OD1   . ASP A 104 ? 0.4548 0.4367 0.6612 0.0693  0.0927  0.0863  104 ASP A OD1   
859  O OD2   . ASP A 104 ? 0.5706 0.5710 0.8439 0.0759  0.1151  0.1029  104 ASP A OD2   
860  N N     . HIS A 105 ? 0.4646 0.4435 0.6059 0.0563  0.0525  0.0703  105 HIS A N     
861  C CA    . HIS A 105 ? 0.4895 0.4800 0.6233 0.0540  0.0313  0.0647  105 HIS A CA    
862  C C     . HIS A 105 ? 0.4228 0.4287 0.5832 0.0559  0.0261  0.0683  105 HIS A C     
863  O O     . HIS A 105 ? 0.3828 0.4029 0.5483 0.0536  0.0083  0.0669  105 HIS A O     
864  C CB    . HIS A 105 ? 0.5158 0.4902 0.6083 0.0518  0.0290  0.0549  105 HIS A CB    
865  C CG    . HIS A 105 ? 0.5644 0.5262 0.6466 0.0527  0.0398  0.0519  105 HIS A CG    
866  N ND1   . HIS A 105 ? 0.6272 0.5644 0.6911 0.0540  0.0603  0.0512  105 HIS A ND1   
867  C CD2   . HIS A 105 ? 0.5604 0.5279 0.6453 0.0521  0.0339  0.0493  105 HIS A CD2   
868  C CE1   . HIS A 105 ? 0.6329 0.5604 0.6887 0.0543  0.0665  0.0480  105 HIS A CE1   
869  N NE2   . HIS A 105 ? 0.5789 0.5250 0.6478 0.0530  0.0504  0.0470  105 HIS A NE2   
870  N N     . THR A 106 ? 0.4027 0.4036 0.5787 0.0607  0.0423  0.0732  106 THR A N     
871  C CA    . THR A 106 ? 0.4047 0.4176 0.6055 0.0640  0.0380  0.0780  106 THR A CA    
872  C C     . THR A 106 ? 0.3734 0.4112 0.6123 0.0634  0.0244  0.0869  106 THR A C     
873  O O     . THR A 106 ? 0.3586 0.4081 0.6143 0.0644  0.0137  0.0908  106 THR A O     
874  C CB    . THR A 106 ? 0.4519 0.4523 0.6628 0.0712  0.0601  0.0824  106 THR A CB    
875  O OG1   . THR A 106 ? 0.4818 0.4873 0.7220 0.0749  0.0745  0.0909  106 THR A OG1   
876  C CG2   . THR A 106 ? 0.4424 0.4136 0.6106 0.0701  0.0738  0.0730  106 THR A CG2   
877  N N     . LYS A 107 ? 0.3558 0.3997 0.6058 0.0606  0.0242  0.0900  107 LYS A N     
878  C CA    . LYS A 107 ? 0.3540 0.4199 0.6377 0.0575  0.0104  0.0978  107 LYS A CA    
879  C C     . LYS A 107 ? 0.3404 0.4107 0.6065 0.0508  -0.0111 0.0921  107 LYS A C     
880  O O     . LYS A 107 ? 0.3531 0.4382 0.6389 0.0466  -0.0263 0.0968  107 LYS A O     
881  C CB    . LYS A 107 ? 0.3935 0.4629 0.7000 0.0567  0.0227  0.1045  107 LYS A CB    
882  C CG    . LYS A 107 ? 0.4324 0.4981 0.7604 0.0640  0.0471  0.1108  107 LYS A CG    
883  C CD    . LYS A 107 ? 0.4290 0.5138 0.7982 0.0693  0.0434  0.1206  107 LYS A CD    
884  C CE    . LYS A 107 ? 0.4742 0.5572 0.8711 0.0780  0.0696  0.1282  107 LYS A CE    
885  N NZ    . LYS A 107 ? 0.4702 0.5759 0.9150 0.0841  0.0645  0.1401  107 LYS A NZ    
886  N N     . ILE A 108 ? 0.3209 0.3776 0.5498 0.0497  -0.0125 0.0822  108 ILE A N     
887  C CA    . ILE A 108 ? 0.3396 0.3986 0.5510 0.0451  -0.0297 0.0763  108 ILE A CA    
888  C C     . ILE A 108 ? 0.3492 0.4126 0.5515 0.0443  -0.0418 0.0720  108 ILE A C     
889  O O     . ILE A 108 ? 0.3631 0.4187 0.5474 0.0462  -0.0368 0.0666  108 ILE A O     
890  C CB    . ILE A 108 ? 0.3584 0.4026 0.5371 0.0450  -0.0260 0.0688  108 ILE A CB    
891  C CG1   . ILE A 108 ? 0.3644 0.3993 0.5466 0.0455  -0.0116 0.0731  108 ILE A CG1   
892  C CG2   . ILE A 108 ? 0.3536 0.4007 0.5183 0.0421  -0.0423 0.0637  108 ILE A CG2   
893  C CD1   . ILE A 108 ? 0.3364 0.3542 0.4843 0.0456  -0.0091 0.0672  108 ILE A CD1   
894  N N     . ARG A 109 ? 0.2648 0.3388 0.4775 0.0405  -0.0573 0.0743  109 ARG A N     
895  C CA    . ARG A 109 ? 0.2763 0.3526 0.4792 0.0391  -0.0679 0.0708  109 ARG A CA    
896  C C     . ARG A 109 ? 0.3253 0.3959 0.4983 0.0378  -0.0722 0.0602  109 ARG A C     
897  O O     . ARG A 109 ? 0.2901 0.3614 0.4559 0.0352  -0.0810 0.0574  109 ARG A O     
898  C CB    . ARG A 109 ? 0.2722 0.3583 0.4915 0.0347  -0.0833 0.0768  109 ARG A CB    
899  C CG    . ARG A 109 ? 0.3246 0.4107 0.5360 0.0337  -0.0917 0.0759  109 ARG A CG    
900  C CD    . ARG A 109 ? 0.3333 0.4265 0.5587 0.0289  -0.1079 0.0831  109 ARG A CD    
901  N NE    . ARG A 109 ? 0.3360 0.4401 0.5967 0.0307  -0.1071 0.0949  109 ARG A NE    
902  C CZ    . ARG A 109 ? 0.3249 0.4330 0.6036 0.0357  -0.1045 0.1027  109 ARG A CZ    
903  N NH1   . ARG A 109 ? 0.2755 0.3748 0.5369 0.0385  -0.1022 0.0996  109 ARG A NH1   
904  N NH2   . ARG A 109 ? 0.2854 0.4062 0.6009 0.0381  -0.1034 0.1140  109 ARG A NH2   
905  N N     . VAL A 110 ? 0.3555 0.4204 0.5121 0.0394  -0.0657 0.0544  110 VAL A N     
906  C CA    . VAL A 110 ? 0.3107 0.3743 0.4441 0.0381  -0.0700 0.0450  110 VAL A CA    
907  C C     . VAL A 110 ? 0.3491 0.4162 0.4775 0.0352  -0.0763 0.0420  110 VAL A C     
908  O O     . VAL A 110 ? 0.3378 0.4018 0.4668 0.0351  -0.0713 0.0430  110 VAL A O     
909  C CB    . VAL A 110 ? 0.3546 0.4097 0.4711 0.0396  -0.0602 0.0399  110 VAL A CB    
910  C CG1   . VAL A 110 ? 0.3368 0.3949 0.4345 0.0382  -0.0667 0.0311  110 VAL A CG1   
911  C CG2   . VAL A 110 ? 0.3494 0.3968 0.4667 0.0422  -0.0521 0.0433  110 VAL A CG2   
912  N N     . ALA A 111 ? 0.3352 0.4064 0.4570 0.0329  -0.0861 0.0383  111 ALA A N     
913  C CA    . ALA A 111 ? 0.3098 0.3823 0.4244 0.0295  -0.0910 0.0354  111 ALA A CA    
914  C C     . ALA A 111 ? 0.3266 0.4021 0.4254 0.0286  -0.0902 0.0259  111 ALA A C     
915  O O     . ALA A 111 ? 0.3150 0.3934 0.4089 0.0306  -0.0927 0.0219  111 ALA A O     
916  C CB    . ALA A 111 ? 0.2864 0.3591 0.4040 0.0265  -0.1017 0.0388  111 ALA A CB    
917  N N     A ASN A 112 ? 0.3410 0.4159 0.4334 0.0256  -0.0863 0.0228  112 ASN A N     
918  N N     B ASN A 112 ? 0.3396 0.4146 0.4318 0.0256  -0.0865 0.0227  112 ASN A N     
919  C CA    A ASN A 112 ? 0.3442 0.4249 0.4257 0.0230  -0.0857 0.0142  112 ASN A CA    
920  C CA    B ASN A 112 ? 0.3442 0.4252 0.4257 0.0232  -0.0858 0.0141  112 ASN A CA    
921  C C     A ASN A 112 ? 0.3561 0.4359 0.4325 0.0187  -0.0883 0.0131  112 ASN A C     
922  C C     B ASN A 112 ? 0.3540 0.4344 0.4298 0.0185  -0.0877 0.0123  112 ASN A C     
923  O O     A ASN A 112 ? 0.3468 0.4195 0.4221 0.0159  -0.0869 0.0168  112 ASN A O     
924  O O     B ASN A 112 ? 0.3539 0.4277 0.4276 0.0153  -0.0850 0.0149  112 ASN A O     
925  C CB    A ASN A 112 ? 0.3227 0.4015 0.3984 0.0205  -0.0785 0.0108  112 ASN A CB    
926  C CB    B ASN A 112 ? 0.3438 0.4236 0.4197 0.0213  -0.0789 0.0105  112 ASN A CB    
927  C CG    A ASN A 112 ? 0.3439 0.4221 0.4171 0.0235  -0.0763 0.0096  112 ASN A CG    
928  C CG    B ASN A 112 ? 0.3815 0.4720 0.4511 0.0186  -0.0800 0.0021  112 ASN A CG    
929  O OD1   A ASN A 112 ? 0.3593 0.4307 0.4371 0.0272  -0.0734 0.0150  112 ASN A OD1   
930  O OD1   B ASN A 112 ? 0.4007 0.4944 0.4667 0.0130  -0.0783 -0.0020 112 ASN A OD1   
931  N ND2   A ASN A 112 ? 0.3281 0.4135 0.3939 0.0214  -0.0775 0.0029  112 ASN A ND2   
932  N ND2   B ASN A 112 ? 0.3896 0.4858 0.4588 0.0225  -0.0830 0.0001  112 ASN A ND2   
933  N N     . PHE A 113 ? 0.3485 0.4334 0.4201 0.0185  -0.0913 0.0081  113 PHE A N     
934  C CA    . PHE A 113 ? 0.3231 0.4040 0.3855 0.0138  -0.0917 0.0064  113 PHE A CA    
935  C C     . PHE A 113 ? 0.2883 0.3781 0.3460 0.0126  -0.0880 -0.0021 113 PHE A C     
936  O O     . PHE A 113 ? 0.2388 0.3393 0.3021 0.0170  -0.0877 -0.0061 113 PHE A O     
937  C CB    . PHE A 113 ? 0.3789 0.4500 0.4384 0.0134  -0.0994 0.0118  113 PHE A CB    
938  C CG    . PHE A 113 ? 0.3912 0.4619 0.4459 0.0157  -0.1025 0.0082  113 PHE A CG    
939  C CD1   . PHE A 113 ? 0.4321 0.4934 0.4721 0.0121  -0.1043 0.0061  113 PHE A CD1   
940  C CD2   . PHE A 113 ? 0.3773 0.4535 0.4392 0.0215  -0.1029 0.0072  113 PHE A CD2   
941  C CE1   . PHE A 113 ? 0.4393 0.4961 0.4723 0.0144  -0.1055 0.0023  113 PHE A CE1   
942  C CE2   . PHE A 113 ? 0.4074 0.4800 0.4636 0.0243  -0.1050 0.0041  113 PHE A CE2   
943  C CZ    . PHE A 113 ? 0.4190 0.4817 0.4610 0.0210  -0.1058 0.0014  113 PHE A CZ    
944  N N     . ASP A 114 ? 0.2836 0.3685 0.3314 0.0070  -0.0849 -0.0041 114 ASP A N     
945  C CA    . ASP A 114 ? 0.2699 0.3634 0.3152 0.0049  -0.0787 -0.0118 114 ASP A CA    
946  C C     . ASP A 114 ? 0.3349 0.4143 0.3637 -0.0005 -0.0764 -0.0117 114 ASP A C     
947  O O     . ASP A 114 ? 0.3182 0.3845 0.3380 -0.0050 -0.0782 -0.0065 114 ASP A O     
948  C CB    . ASP A 114 ? 0.2913 0.3962 0.3426 0.0004  -0.0728 -0.0159 114 ASP A CB    
949  C CG    . ASP A 114 ? 0.3886 0.5085 0.4447 -0.0016 -0.0663 -0.0236 114 ASP A CG    
950  O OD1   . ASP A 114 ? 0.4063 0.5405 0.4736 0.0048  -0.0679 -0.0265 114 ASP A OD1   
951  O OD2   . ASP A 114 ? 0.4284 0.5459 0.4780 -0.0095 -0.0592 -0.0262 114 ASP A OD2   
952  N N     . ILE A 115 ? 0.3352 0.4152 0.3583 0.0004  -0.0722 -0.0170 115 ILE A N     
953  C CA    . ILE A 115 ? 0.3364 0.3994 0.3385 -0.0053 -0.0687 -0.0177 115 ILE A CA    
954  C C     . ILE A 115 ? 0.3810 0.4523 0.3826 -0.0092 -0.0555 -0.0251 115 ILE A C     
955  O O     . ILE A 115 ? 0.3874 0.4801 0.4078 -0.0059 -0.0508 -0.0301 115 ILE A O     
956  C CB    . ILE A 115 ? 0.3587 0.4078 0.3480 -0.0022 -0.0729 -0.0177 115 ILE A CB    
957  C CG1   . ILE A 115 ? 0.3326 0.3918 0.3282 0.0041  -0.0648 -0.0253 115 ILE A CG1   
958  C CG2   . ILE A 115 ? 0.3624 0.4080 0.3578 0.0015  -0.0855 -0.0109 115 ILE A CG2   
959  C CD1   . ILE A 115 ? 0.3822 0.4230 0.3611 0.0068  -0.0666 -0.0264 115 ILE A CD1   
960  N N     . GLU A 116 ? 0.3811 0.4355 0.3618 -0.0168 -0.0499 -0.0254 116 GLU A N     
961  C CA    . GLU A 116 ? 0.4188 0.4787 0.3976 -0.0215 -0.0351 -0.0324 116 GLU A CA    
962  C C     . GLU A 116 ? 0.4394 0.4789 0.3937 -0.0223 -0.0292 -0.0349 116 GLU A C     
963  O O     . GLU A 116 ? 0.4340 0.4486 0.3640 -0.0248 -0.0371 -0.0301 116 GLU A O     
964  C CB    . GLU A 116 ? 0.4340 0.4895 0.4064 -0.0316 -0.0295 -0.0313 116 GLU A CB    
965  C CG    . GLU A 116 ? 0.4711 0.5428 0.4634 -0.0322 -0.0333 -0.0300 116 GLU A CG    
966  C CD    . GLU A 116 ? 0.4860 0.5879 0.5053 -0.0295 -0.0294 -0.0364 116 GLU A CD    
967  O OE1   . GLU A 116 ? 0.5081 0.6212 0.5338 -0.0299 -0.0194 -0.0424 116 GLU A OE1   
968  O OE2   . GLU A 116 ? 0.5418 0.6559 0.5760 -0.0268 -0.0364 -0.0352 116 GLU A OE2   
969  N N     . VAL A 117 ? 0.3936 0.4436 0.3549 -0.0200 -0.0155 -0.0424 117 VAL A N     
970  C CA    . VAL A 117 ? 0.4137 0.4424 0.3503 -0.0203 -0.0060 -0.0462 117 VAL A CA    
971  C C     . VAL A 117 ? 0.4476 0.4847 0.3880 -0.0245 0.0146  -0.0531 117 VAL A C     
972  O O     . VAL A 117 ? 0.4124 0.4781 0.3834 -0.0187 0.0225  -0.0578 117 VAL A O     
973  C CB    . VAL A 117 ? 0.4390 0.4684 0.3807 -0.0092 -0.0084 -0.0486 117 VAL A CB    
974  C CG1   . VAL A 117 ? 0.4328 0.4365 0.3457 -0.0099 0.0040  -0.0536 117 VAL A CG1   
975  C CG2   . VAL A 117 ? 0.4261 0.4470 0.3649 -0.0063 -0.0276 -0.0418 117 VAL A CG2   
976  N N     . THR A 118 ? 0.4841 0.4971 0.3947 -0.0347 0.0231  -0.0532 118 THR A N     
977  C CA    . THR A 118 ? 0.4580 0.4754 0.3692 -0.0399 0.0453  -0.0597 118 THR A CA    
978  C C     . THR A 118 ? 0.5458 0.5543 0.4484 -0.0331 0.0591  -0.0659 118 THR A C     
979  O O     . THR A 118 ? 0.5716 0.5479 0.4401 -0.0326 0.0553  -0.0651 118 THR A O     
980  C CB    . THR A 118 ? 0.4950 0.4846 0.3721 -0.0536 0.0516  -0.0574 118 THR A CB    
981  O OG1   . THR A 118 ? 0.5212 0.5206 0.4097 -0.0594 0.0429  -0.0525 118 THR A OG1   
982  C CG2   . THR A 118 ? 0.5195 0.5097 0.3937 -0.0595 0.0773  -0.0645 118 THR A CG2   
983  N N     . SER A 119 ? 0.5764 0.6131 0.5106 -0.0280 0.0749  -0.0720 119 SER A N     
984  C CA    . SER A 119 ? 0.6669 0.6969 0.5974 -0.0197 0.0915  -0.0781 119 SER A CA    
985  C C     . SER A 119 ? 0.7580 0.8079 0.7095 -0.0222 0.1169  -0.0842 119 SER A C     
986  O O     . SER A 119 ? 0.7588 0.8500 0.7555 -0.0197 0.1182  -0.0851 119 SER A O     
987  C CB    . SER A 119 ? 0.6749 0.7231 0.6318 -0.0040 0.0822  -0.0781 119 SER A CB    
988  O OG    . SER A 119 ? 0.7511 0.7950 0.7091 0.0057  0.1005  -0.0841 119 SER A OG    
989  N N     . PRO A 120 ? 0.8263 0.8464 0.7443 -0.0280 0.1373  -0.0883 120 PRO A N     
990  C CA    . PRO A 120 ? 0.8773 0.9132 0.8133 -0.0313 0.1652  -0.0943 120 PRO A CA    
991  C C     . PRO A 120 ? 0.9125 0.9727 0.8836 -0.0155 0.1801  -0.0995 120 PRO A C     
992  O O     . PRO A 120 ? 0.9335 1.0272 0.9435 -0.0151 0.1975  -0.1028 120 PRO A O     
993  C CB    . PRO A 120 ? 0.8998 0.8863 0.7784 -0.0419 0.1808  -0.0963 120 PRO A CB    
994  C CG    . PRO A 120 ? 0.9240 0.8722 0.7610 -0.0380 0.1647  -0.0939 120 PRO A CG    
995  C CD    . PRO A 120 ? 0.8632 0.8313 0.7222 -0.0336 0.1347  -0.0871 120 PRO A CD    
996  N N     . ASP A 121 ? 0.9075 0.9516 0.8668 -0.0027 0.1732  -0.0997 121 ASP A N     
997  C CA    . ASP A 121 ? 0.9428 1.0035 0.9308 0.0142  0.1883  -0.1041 121 ASP A CA    
998  C C     . ASP A 121 ? 0.8606 0.9578 0.8929 0.0284  0.1688  -0.1004 121 ASP A C     
999  O O     . ASP A 121 ? 0.8623 0.9524 0.8959 0.0433  0.1683  -0.1012 121 ASP A O     
1000 C CB    . ASP A 121 ? 1.0684 1.0803 1.0091 0.0193  0.2004  -0.1084 121 ASP A CB    
1001 C CG    . ASP A 121 ? 1.1465 1.1280 1.0533 0.0203  0.1749  -0.1044 121 ASP A CG    
1002 O OD1   . ASP A 121 ? 1.1447 1.1318 1.0505 0.0125  0.1508  -0.0981 121 ASP A OD1   
1003 O OD2   . ASP A 121 ? 1.2092 1.1610 1.0913 0.0286  0.1799  -0.1075 121 ASP A OD2   
1004 N N     . GLY A 122 ? 0.7987 0.9320 0.8644 0.0234  0.1533  -0.0963 122 GLY A N     
1005 C CA    . GLY A 122 ? 0.7737 0.9427 0.8808 0.0354  0.1354  -0.0926 122 GLY A CA    
1006 C C     . GLY A 122 ? 0.7547 0.9088 0.8430 0.0355  0.1079  -0.0869 122 GLY A C     
1007 O O     . GLY A 122 ? 0.7448 0.8692 0.7956 0.0241  0.0996  -0.0847 122 GLY A O     
1008 N N     . PHE A 123 ? 0.7284 0.9038 0.8440 0.0488  0.0941  -0.0838 123 PHE A N     
1009 C CA    . PHE A 123 ? 0.7015 0.8669 0.8050 0.0498  0.0695  -0.0782 123 PHE A CA    
1010 C C     . PHE A 123 ? 0.6801 0.7990 0.7376 0.0502  0.0668  -0.0780 123 PHE A C     
1011 O O     . PHE A 123 ? 0.7297 0.8302 0.7754 0.0593  0.0791  -0.0816 123 PHE A O     
1012 C CB    . PHE A 123 ? 0.6774 0.8727 0.8176 0.0647  0.0581  -0.0752 123 PHE A CB    
1013 C CG    . PHE A 123 ? 0.6473 0.8321 0.7760 0.0665  0.0353  -0.0695 123 PHE A CG    
1014 C CD1   . PHE A 123 ? 0.6291 0.8266 0.7635 0.0571  0.0196  -0.0655 123 PHE A CD1   
1015 C CD2   . PHE A 123 ? 0.6616 0.8226 0.7735 0.0772  0.0311  -0.0682 123 PHE A CD2   
1016 C CE1   . PHE A 123 ? 0.6239 0.8115 0.7486 0.0589  0.0013  -0.0603 123 PHE A CE1   
1017 C CE2   . PHE A 123 ? 0.6555 0.8075 0.7584 0.0780  0.0118  -0.0628 123 PHE A CE2   
1018 C CZ    . PHE A 123 ? 0.6381 0.8041 0.7482 0.0691  -0.0025 -0.0587 123 PHE A CZ    
1019 N N     . PRO A 124 ? 0.6276 0.7271 0.6595 0.0400  0.0506  -0.0737 124 PRO A N     
1020 C CA    . PRO A 124 ? 0.5985 0.6561 0.5882 0.0376  0.0444  -0.0725 124 PRO A CA    
1021 C C     . PRO A 124 ? 0.5367 0.5911 0.5310 0.0488  0.0308  -0.0695 124 PRO A C     
1022 O O     . PRO A 124 ? 0.5459 0.6087 0.5483 0.0473  0.0128  -0.0638 124 PRO A O     
1023 C CB    . PRO A 124 ? 0.6025 0.6494 0.5736 0.0231  0.0310  -0.0675 124 PRO A CB    
1024 C CG    . PRO A 124 ? 0.5929 0.6745 0.5957 0.0187  0.0307  -0.0665 124 PRO A CG    
1025 C CD    . PRO A 124 ? 0.5712 0.6877 0.6143 0.0304  0.0366  -0.0691 124 PRO A CD    
1026 N N     . GLU A 125 ? 0.4977 0.5382 0.4859 0.0598  0.0410  -0.0733 125 GLU A N     
1027 C CA    . GLU A 125 ? 0.5271 0.5602 0.5166 0.0705  0.0302  -0.0706 125 GLU A CA    
1028 C C     . GLU A 125 ? 0.5599 0.5638 0.5181 0.0610  0.0131  -0.0664 125 GLU A C     
1029 O O     . GLU A 125 ? 0.5788 0.5487 0.4994 0.0520  0.0157  -0.0685 125 GLU A O     
1030 C CB    . GLU A 125 ? 0.6325 0.6487 0.6151 0.0834  0.0468  -0.0759 125 GLU A CB    
1031 C CG    . GLU A 125 ? 0.7262 0.7768 0.7497 0.0971  0.0617  -0.0783 125 GLU A CG    
1032 C CD    . GLU A 125 ? 0.7670 0.8528 0.8300 0.1081  0.0473  -0.0727 125 GLU A CD    
1033 O OE1   . GLU A 125 ? 0.7678 0.8443 0.8224 0.1081  0.0295  -0.0678 125 GLU A OE1   
1034 O OE2   . GLU A 125 ? 0.7872 0.9096 0.8895 0.1161  0.0537  -0.0729 125 GLU A OE2   
1035 N N     . PRO A 126 ? 0.5316 0.5488 0.5052 0.0625  -0.0046 -0.0602 126 PRO A N     
1036 C CA    . PRO A 126 ? 0.5255 0.5213 0.4780 0.0540  -0.0212 -0.0551 126 PRO A CA    
1037 C C     . PRO A 126 ? 0.5689 0.5270 0.4898 0.0545  -0.0209 -0.0572 126 PRO A C     
1038 O O     . PRO A 126 ? 0.5804 0.5146 0.4752 0.0432  -0.0313 -0.0547 126 PRO A O     
1039 C CB    . PRO A 126 ? 0.4933 0.5132 0.4738 0.0596  -0.0345 -0.0492 126 PRO A CB    
1040 C CG    . PRO A 126 ? 0.5175 0.5642 0.5276 0.0732  -0.0261 -0.0515 126 PRO A CG    
1041 C CD    . PRO A 126 ? 0.4996 0.5539 0.5123 0.0714  -0.0096 -0.0573 126 PRO A CD    
1042 N N     . SER A 127 ? 0.5561 0.5084 0.4793 0.0673  -0.0096 -0.0615 127 SER A N     
1043 C CA    . SER A 127 ? 0.6371 0.5497 0.5275 0.0678  -0.0075 -0.0643 127 SER A CA    
1044 C C     . SER A 127 ? 0.6953 0.5745 0.5455 0.0569  0.0018  -0.0699 127 SER A C     
1045 O O     . SER A 127 ? 0.7556 0.5976 0.5695 0.0490  -0.0034 -0.0709 127 SER A O     
1046 C CB    . SER A 127 ? 0.6943 0.6070 0.5968 0.0859  0.0046  -0.0675 127 SER A CB    
1047 O OG    . SER A 127 ? 0.7582 0.6773 0.6672 0.0931  0.0257  -0.0737 127 SER A OG    
1048 N N     . GLN A 128 ? 0.6941 0.5852 0.5488 0.0553  0.0155  -0.0733 128 GLN A N     
1049 C CA    . GLN A 128 ? 0.7581 0.6166 0.5721 0.0445  0.0260  -0.0783 128 GLN A CA    
1050 C C     . GLN A 128 ? 0.7230 0.5794 0.5230 0.0278  0.0114  -0.0732 128 GLN A C     
1051 O O     . GLN A 128 ? 0.7553 0.5761 0.5138 0.0155  0.0051  -0.0733 128 GLN A O     
1052 C CB    . GLN A 128 ? 0.8294 0.6983 0.6535 0.0515  0.0519  -0.0849 128 GLN A CB    
1053 C CG    . GLN A 128 ? 0.8996 0.7702 0.7392 0.0699  0.0682  -0.0895 128 GLN A CG    
1054 C CD    . GLN A 128 ? 1.0480 0.8707 0.8465 0.0708  0.0702  -0.0933 128 GLN A CD    
1055 O OE1   . GLN A 128 ? 1.0868 0.9077 0.8950 0.0812  0.0643  -0.0915 128 GLN A OE1   
1056 N NE2   . GLN A 128 ? 1.1231 0.9037 0.8724 0.0591  0.0783  -0.0984 128 GLN A NE2   
1057 N N     . ALA A 129 ? 0.6289 0.5222 0.4627 0.0275  0.0054  -0.0685 129 ALA A N     
1058 C CA    . ALA A 129 ? 0.6147 0.5095 0.4412 0.0141  -0.0077 -0.0626 129 ALA A CA    
1059 C C     . ALA A 129 ? 0.6379 0.5011 0.4224 0.0022  0.0002  -0.0655 129 ALA A C     
1060 O O     . ALA A 129 ? 0.7184 0.5582 0.4740 -0.0096 -0.0144 -0.0610 129 ALA A O     
1061 C CB    . ALA A 129 ? 0.5742 0.4631 0.3984 0.0092  -0.0313 -0.0550 129 ALA A CB    
1062 N N     . LYS A 130 ? 0.5931 0.4557 0.3746 0.0052  0.0232  -0.0724 130 LYS A N     
1063 C CA    . LYS A 130 ? 0.6669 0.4942 0.4032 -0.0055 0.0348  -0.0763 130 LYS A CA    
1064 C C     . LYS A 130 ? 0.6221 0.4581 0.3576 -0.0158 0.0349  -0.0727 130 LYS A C     
1065 O O     . LYS A 130 ? 0.6803 0.4858 0.3758 -0.0261 0.0429  -0.0745 130 LYS A O     
1066 C CB    . LYS A 130 ? 0.7341 0.5503 0.4628 0.0025  0.0631  -0.0860 130 LYS A CB    
1067 C CG    . LYS A 130 ? 0.7320 0.5919 0.5105 0.0136  0.0798  -0.0885 130 LYS A CG    
1068 C CD    . LYS A 130 ? 0.7745 0.6239 0.5491 0.0234  0.1084  -0.0973 130 LYS A CD    
1069 N N     . HIS A 131 ? 0.5945 0.4686 0.3707 -0.0136 0.0264  -0.0676 131 HIS A N     
1070 C CA    . HIS A 131 ? 0.6068 0.4888 0.3838 -0.0230 0.0263  -0.0639 131 HIS A CA    
1071 C C     . HIS A 131 ? 0.5731 0.4564 0.3514 -0.0286 0.0010  -0.0540 131 HIS A C     
1072 O O     . HIS A 131 ? 0.5325 0.4314 0.3338 -0.0224 -0.0136 -0.0503 131 HIS A O     
1073 C CB    . HIS A 131 ? 0.6043 0.5273 0.4255 -0.0177 0.0394  -0.0666 131 HIS A CB    
1074 C CG    . HIS A 131 ? 0.6606 0.5896 0.4908 -0.0105 0.0644  -0.0753 131 HIS A CG    
1075 N ND1   . HIS A 131 ? 0.7398 0.6460 0.5415 -0.0169 0.0857  -0.0806 131 HIS A ND1   
1076 C CD2   . HIS A 131 ? 0.6495 0.6046 0.5149 0.0033  0.0720  -0.0790 131 HIS A CD2   
1077 C CE1   . HIS A 131 ? 0.7463 0.6659 0.5681 -0.0070 0.1068  -0.0875 131 HIS A CE1   
1078 N NE2   . HIS A 131 ? 0.7030 0.6529 0.5643 0.0058  0.0981  -0.0863 131 HIS A NE2   
1079 N N     . PRO A 132 ? 0.6250 0.4911 0.3786 -0.0397 -0.0032 -0.0493 132 PRO A N     
1080 C CA    . PRO A 132 ? 0.6004 0.4668 0.3558 -0.0442 -0.0260 -0.0389 132 PRO A CA    
1081 C C     . PRO A 132 ? 0.5822 0.4872 0.3843 -0.0380 -0.0315 -0.0354 132 PRO A C     
1082 O O     . PRO A 132 ? 0.5804 0.5084 0.4056 -0.0358 -0.0177 -0.0396 132 PRO A O     
1083 C CB    . PRO A 132 ? 0.6078 0.4503 0.3301 -0.0556 -0.0232 -0.0357 132 PRO A CB    
1084 C CG    . PRO A 132 ? 0.6687 0.4845 0.3560 -0.0593 -0.0035 -0.0441 132 PRO A CG    
1085 C CD    . PRO A 132 ? 0.6497 0.4911 0.3689 -0.0485 0.0138  -0.0530 132 PRO A CD    
1086 N N     . ILE A 133 ? 0.5723 0.4834 0.3874 -0.0359 -0.0510 -0.0279 133 ILE A N     
1087 C CA    . ILE A 133 ? 0.5186 0.4585 0.3696 -0.0318 -0.0568 -0.0234 133 ILE A CA    
1088 C C     . ILE A 133 ? 0.5160 0.4471 0.3562 -0.0395 -0.0600 -0.0170 133 ILE A C     
1089 O O     . ILE A 133 ? 0.5599 0.4704 0.3795 -0.0443 -0.0737 -0.0093 133 ILE A O     
1090 C CB    . ILE A 133 ? 0.4733 0.4205 0.3412 -0.0268 -0.0743 -0.0173 133 ILE A CB    
1091 C CG1   . ILE A 133 ? 0.4548 0.4046 0.3281 -0.0196 -0.0717 -0.0230 133 ILE A CG1   
1092 C CG2   . ILE A 133 ? 0.4220 0.3951 0.3232 -0.0227 -0.0780 -0.0130 133 ILE A CG2   
1093 C CD1   . ILE A 133 ? 0.4603 0.4148 0.3480 -0.0161 -0.0873 -0.0174 133 ILE A CD1   
1094 N N     . ASP A 134 ? 0.4755 0.4214 0.3292 -0.0409 -0.0479 -0.0197 134 ASP A N     
1095 C CA    . ASP A 134 ? 0.4895 0.4230 0.3292 -0.0485 -0.0478 -0.0143 134 ASP A CA    
1096 C C     . ASP A 134 ? 0.4793 0.4299 0.3452 -0.0461 -0.0541 -0.0086 134 ASP A C     
1097 O O     . ASP A 134 ? 0.5217 0.4621 0.3784 -0.0513 -0.0528 -0.0042 134 ASP A O     
1098 C CB    . ASP A 134 ? 0.5161 0.4433 0.3410 -0.0556 -0.0276 -0.0211 134 ASP A CB    
1099 C CG    . ASP A 134 ? 0.4681 0.4263 0.3244 -0.0518 -0.0128 -0.0300 134 ASP A CG    
1100 O OD1   . ASP A 134 ? 0.4388 0.4231 0.3274 -0.0462 -0.0184 -0.0295 134 ASP A OD1   
1101 O OD2   . ASP A 134 ? 0.4872 0.4434 0.3357 -0.0547 0.0045  -0.0373 134 ASP A OD2   
1102 N N     . ALA A 135 ? 0.4432 0.4164 0.3389 -0.0381 -0.0599 -0.0088 135 ALA A N     
1103 C CA    . ALA A 135 ? 0.4538 0.4394 0.3714 -0.0351 -0.0657 -0.0034 135 ALA A CA    
1104 C C     . ALA A 135 ? 0.4634 0.4661 0.4056 -0.0264 -0.0743 -0.0022 135 ALA A C     
1105 O O     . ALA A 135 ? 0.4439 0.4600 0.3966 -0.0220 -0.0706 -0.0086 135 ALA A O     
1106 C CB    . ALA A 135 ? 0.3743 0.3732 0.3031 -0.0388 -0.0527 -0.0086 135 ALA A CB    
1107 N N     . ILE A 136 ? 0.4583 0.4597 0.4098 -0.0235 -0.0850 0.0065  136 ILE A N     
1108 C CA    . ILE A 136 ? 0.4171 0.4343 0.3930 -0.0161 -0.0906 0.0082  136 ILE A CA    
1109 C C     . ILE A 136 ? 0.4122 0.4333 0.4025 -0.0141 -0.0911 0.0141  136 ILE A C     
1110 O O     . ILE A 136 ? 0.4301 0.4385 0.4152 -0.0152 -0.0964 0.0224  136 ILE A O     
1111 C CB    . ILE A 136 ? 0.4042 0.4148 0.3791 -0.0138 -0.1038 0.0138  136 ILE A CB    
1112 C CG1   . ILE A 136 ? 0.4234 0.4226 0.3773 -0.0167 -0.1033 0.0083  136 ILE A CG1   
1113 C CG2   . ILE A 136 ? 0.3398 0.3660 0.3391 -0.0068 -0.1069 0.0149  136 ILE A CG2   
1114 C CD1   . ILE A 136 ? 0.4375 0.4271 0.3868 -0.0169 -0.1169 0.0130  136 ILE A CD1   
1115 N N     . THR A 137 ? 0.4142 0.4509 0.4212 -0.0107 -0.0856 0.0100  137 THR A N     
1116 C CA    . THR A 137 ? 0.3630 0.4010 0.3828 -0.0077 -0.0851 0.0151  137 THR A CA    
1117 C C     . THR A 137 ? 0.3233 0.3715 0.3606 -0.0007 -0.0898 0.0172  137 THR A C     
1118 O O     . THR A 137 ? 0.3463 0.4060 0.3886 0.0016  -0.0884 0.0112  137 THR A O     
1119 C CB    . THR A 137 ? 0.3648 0.4072 0.3847 -0.0115 -0.0745 0.0091  137 THR A CB    
1120 O OG1   . THR A 137 ? 0.3994 0.4298 0.4026 -0.0190 -0.0692 0.0081  137 THR A OG1   
1121 C CG2   . THR A 137 ? 0.3492 0.3886 0.3784 -0.0080 -0.0725 0.0136  137 THR A CG2   
1122 N N     . HIS A 138 ? 0.3114 0.3551 0.3586 0.0030  -0.0950 0.0264  138 HIS A N     
1123 C CA    . HIS A 138 ? 0.3305 0.3819 0.3943 0.0087  -0.0989 0.0297  138 HIS A CA    
1124 C C     . HIS A 138 ? 0.3131 0.3636 0.3906 0.0129  -0.0937 0.0354  138 HIS A C     
1125 O O     . HIS A 138 ? 0.3049 0.3486 0.3882 0.0143  -0.0961 0.0440  138 HIS A O     
1126 C CB    . HIS A 138 ? 0.3092 0.3569 0.3743 0.0081  -0.1108 0.0360  138 HIS A CB    
1127 C CG    . HIS A 138 ? 0.3821 0.4368 0.4649 0.0122  -0.1149 0.0400  138 HIS A CG    
1128 N ND1   . HIS A 138 ? 0.3635 0.4187 0.4434 0.0112  -0.1213 0.0380  138 HIS A ND1   
1129 C CD2   . HIS A 138 ? 0.3950 0.4545 0.4975 0.0168  -0.1123 0.0462  138 HIS A CD2   
1130 C CE1   . HIS A 138 ? 0.3722 0.4328 0.4695 0.0142  -0.1229 0.0427  138 HIS A CE1   
1131 N NE2   . HIS A 138 ? 0.3650 0.4290 0.4770 0.0178  -0.1171 0.0478  138 HIS A NE2   
1132 N N     . TYR A 139 ? 0.2615 0.3174 0.3429 0.0153  -0.0864 0.0308  139 TYR A N     
1133 C CA    . TYR A 139 ? 0.2825 0.3340 0.3734 0.0194  -0.0789 0.0352  139 TYR A CA    
1134 C C     . TYR A 139 ? 0.3225 0.3790 0.4311 0.0248  -0.0809 0.0413  139 TYR A C     
1135 O O     . TYR A 139 ? 0.3030 0.3659 0.4118 0.0254  -0.0834 0.0379  139 TYR A O     
1136 C CB    . TYR A 139 ? 0.2955 0.3460 0.3765 0.0174  -0.0696 0.0271  139 TYR A CB    
1137 C CG    . TYR A 139 ? 0.3297 0.3718 0.4154 0.0215  -0.0600 0.0302  139 TYR A CG    
1138 C CD1   . TYR A 139 ? 0.3189 0.3639 0.4089 0.0251  -0.0575 0.0297  139 TYR A CD1   
1139 C CD2   . TYR A 139 ? 0.3045 0.3331 0.3884 0.0220  -0.0522 0.0338  139 TYR A CD2   
1140 C CE1   . TYR A 139 ? 0.3467 0.3810 0.4380 0.0286  -0.0465 0.0323  139 TYR A CE1   
1141 C CE2   . TYR A 139 ? 0.3432 0.3613 0.4299 0.0264  -0.0410 0.0363  139 TYR A CE2   
1142 C CZ    . TYR A 139 ? 0.3820 0.4029 0.4720 0.0294  -0.0377 0.0353  139 TYR A CZ    
1143 O OH    . TYR A 139 ? 0.3876 0.3952 0.4776 0.0335  -0.0243 0.0374  139 TYR A OH    
1144 N N     . ASP A 140 ? 0.3187 0.3719 0.4430 0.0288  -0.0792 0.0507  140 ASP A N     
1145 C CA    . ASP A 140 ? 0.3191 0.3779 0.4644 0.0334  -0.0788 0.0575  140 ASP A CA    
1146 C C     . ASP A 140 ? 0.3253 0.3777 0.4753 0.0382  -0.0636 0.0584  140 ASP A C     
1147 O O     . ASP A 140 ? 0.3316 0.3749 0.4823 0.0407  -0.0560 0.0613  140 ASP A O     
1148 C CB    . ASP A 140 ? 0.3431 0.4059 0.5080 0.0346  -0.0883 0.0689  140 ASP A CB    
1149 C CG    . ASP A 140 ? 0.3768 0.4488 0.5675 0.0375  -0.0889 0.0762  140 ASP A CG    
1150 O OD1   . ASP A 140 ? 0.3421 0.4135 0.5489 0.0433  -0.0771 0.0809  140 ASP A OD1   
1151 O OD2   . ASP A 140 ? 0.4130 0.4914 0.6073 0.0336  -0.1002 0.0771  140 ASP A OD2   
1152 N N     . SER A 141 ? 0.3044 0.3583 0.4552 0.0397  -0.0584 0.0560  141 SER A N     
1153 C CA    . SER A 141 ? 0.3030 0.3465 0.4505 0.0431  -0.0428 0.0550  141 SER A CA    
1154 C C     . SER A 141 ? 0.3266 0.3684 0.4989 0.0496  -0.0335 0.0655  141 SER A C     
1155 O O     . SER A 141 ? 0.3672 0.3959 0.5357 0.0532  -0.0183 0.0655  141 SER A O     
1156 C CB    . SER A 141 ? 0.3503 0.3934 0.4879 0.0425  -0.0404 0.0501  141 SER A CB    
1157 O OG    . SER A 141 ? 0.3489 0.3998 0.5058 0.0444  -0.0432 0.0566  141 SER A OG    
1158 N N     . ILE A 142 ? 0.3225 0.3773 0.5207 0.0509  -0.0424 0.0743  142 ILE A N     
1159 C CA    . ILE A 142 ? 0.3399 0.3986 0.5692 0.0575  -0.0352 0.0857  142 ILE A CA    
1160 C C     . ILE A 142 ? 0.3679 0.4216 0.6027 0.0615  -0.0350 0.0912  142 ILE A C     
1161 O O     . ILE A 142 ? 0.3335 0.3794 0.5798 0.0688  -0.0204 0.0962  142 ILE A O     
1162 C CB    . ILE A 142 ? 0.3130 0.3894 0.5708 0.0560  -0.0466 0.0939  142 ILE A CB    
1163 C CG1   . ILE A 142 ? 0.2910 0.3681 0.5446 0.0534  -0.0423 0.0899  142 ILE A CG1   
1164 C CG2   . ILE A 142 ? 0.3418 0.4272 0.6380 0.0628  -0.0418 0.1071  142 ILE A CG2   
1165 C CD1   . ILE A 142 ? 0.3516 0.4435 0.6286 0.0494  -0.0537 0.0963  142 ILE A CD1   
1166 N N     . ASP A 143 ? 0.3699 0.4255 0.5946 0.0570  -0.0501 0.0904  143 ASP A N     
1167 C CA    . ASP A 143 ? 0.3405 0.3880 0.5644 0.0600  -0.0512 0.0955  143 ASP A CA    
1168 C C     . ASP A 143 ? 0.3171 0.3449 0.5122 0.0590  -0.0382 0.0866  143 ASP A C     
1169 O O     . ASP A 143 ? 0.3927 0.4078 0.5870 0.0633  -0.0317 0.0907  143 ASP A O     
1170 C CB    . ASP A 143 ? 0.3868 0.4392 0.6040 0.0542  -0.0711 0.0973  143 ASP A CB    
1171 C CG    . ASP A 143 ? 0.4553 0.5247 0.6993 0.0536  -0.0862 0.1069  143 ASP A CG    
1172 O OD1   . ASP A 143 ? 0.3976 0.4772 0.6728 0.0591  -0.0810 0.1148  143 ASP A OD1   
1173 O OD2   . ASP A 143 ? 0.5245 0.5963 0.7579 0.0469  -0.1029 0.1065  143 ASP A OD2   
1174 N N     . ASP A 144 ? 0.3417 0.3664 0.5132 0.0529  -0.0353 0.0747  144 ASP A N     
1175 C CA    . ASP A 144 ? 0.3499 0.3584 0.4923 0.0485  -0.0267 0.0650  144 ASP A CA    
1176 C C     . ASP A 144 ? 0.3665 0.3695 0.4971 0.0445  -0.0340 0.0651  144 ASP A C     
1177 O O     . ASP A 144 ? 0.4087 0.3945 0.5280 0.0449  -0.0251 0.0648  144 ASP A O     
1178 C CB    . ASP A 144 ? 0.3757 0.3660 0.5160 0.0540  -0.0072 0.0658  144 ASP A CB    
1179 C CG    . ASP A 144 ? 0.4432 0.4154 0.5504 0.0471  0.0012  0.0544  144 ASP A CG    
1180 O OD1   . ASP A 144 ? 0.4119 0.3908 0.5023 0.0387  -0.0067 0.0452  144 ASP A OD1   
1181 O OD2   . ASP A 144 ? 0.4577 0.4088 0.5564 0.0499  0.0157  0.0548  144 ASP A OD2   
1182 N N     . ARG A 145 ? 0.3505 0.3653 0.4813 0.0402  -0.0494 0.0654  145 ARG A N     
1183 C CA    . ARG A 145 ? 0.3719 0.3805 0.4900 0.0360  -0.0568 0.0664  145 ARG A CA    
1184 C C     . ARG A 145 ? 0.3632 0.3793 0.4646 0.0273  -0.0655 0.0575  145 ARG A C     
1185 O O     . ARG A 145 ? 0.3406 0.3696 0.4480 0.0267  -0.0723 0.0554  145 ARG A O     
1186 C CB    . ARG A 145 ? 0.2957 0.3076 0.4329 0.0410  -0.0676 0.0798  145 ARG A CB    
1187 C CG    . ARG A 145 ? 0.3491 0.3538 0.5059 0.0511  -0.0589 0.0903  145 ARG A CG    
1188 C CD    . ARG A 145 ? 0.3618 0.3437 0.4987 0.0512  -0.0481 0.0887  145 ARG A CD    
1189 N NE    . ARG A 145 ? 0.4204 0.3932 0.5763 0.0627  -0.0397 0.0999  145 ARG A NE    
1190 C CZ    . ARG A 145 ? 0.4295 0.3940 0.5921 0.0691  -0.0218 0.0991  145 ARG A CZ    
1191 N NH1   . ARG A 145 ? 0.4102 0.3736 0.5595 0.0642  -0.0122 0.0877  145 ARG A NH1   
1192 N NH2   . ARG A 145 ? 0.4078 0.3637 0.5895 0.0809  -0.0132 0.1100  145 ARG A NH2   
1193 N N     . PHE A 146 ? 0.3638 0.3705 0.4444 0.0208  -0.0641 0.0524  146 PHE A N     
1194 C CA    . PHE A 146 ? 0.3695 0.3826 0.4358 0.0131  -0.0703 0.0448  146 PHE A CA    
1195 C C     . PHE A 146 ? 0.4035 0.4117 0.4649 0.0116  -0.0814 0.0515  146 PHE A C     
1196 O O     . PHE A 146 ? 0.4231 0.4167 0.4737 0.0101  -0.0801 0.0555  146 PHE A O     
1197 C CB    . PHE A 146 ? 0.3427 0.3494 0.3898 0.0053  -0.0614 0.0350  146 PHE A CB    
1198 C CG    . PHE A 146 ? 0.3383 0.3482 0.3851 0.0046  -0.0529 0.0277  146 PHE A CG    
1199 C CD1   . PHE A 146 ? 0.3341 0.3302 0.3805 0.0075  -0.0428 0.0298  146 PHE A CD1   
1200 C CD2   . PHE A 146 ? 0.3093 0.3340 0.3547 0.0011  -0.0550 0.0189  146 PHE A CD2   
1201 C CE1   . PHE A 146 ? 0.3092 0.3043 0.3499 0.0055  -0.0356 0.0228  146 PHE A CE1   
1202 C CE2   . PHE A 146 ? 0.3329 0.3593 0.3754 -0.0002 -0.0495 0.0129  146 PHE A CE2   
1203 C CZ    . PHE A 146 ? 0.2960 0.3067 0.3342 0.0012  -0.0401 0.0146  146 PHE A CZ    
1204 N N     . TYR A 147 ? 0.3215 0.3393 0.3881 0.0115  -0.0924 0.0528  147 TYR A N     
1205 C CA    . TYR A 147 ? 0.3358 0.3468 0.3933 0.0085  -0.1045 0.0586  147 TYR A CA    
1206 C C     . TYR A 147 ? 0.3335 0.3400 0.3661 0.0004  -0.1032 0.0493  147 TYR A C     
1207 O O     . TYR A 147 ? 0.3274 0.3437 0.3587 -0.0012 -0.1022 0.0412  147 TYR A O     
1208 C CB    . TYR A 147 ? 0.3141 0.3345 0.3878 0.0110  -0.1174 0.0650  147 TYR A CB    
1209 C CG    . TYR A 147 ? 0.3183 0.3446 0.4205 0.0188  -0.1183 0.0758  147 TYR A CG    
1210 C CD1   . TYR A 147 ? 0.3121 0.3489 0.4329 0.0237  -0.1100 0.0741  147 TYR A CD1   
1211 C CD2   . TYR A 147 ? 0.3367 0.3575 0.4472 0.0217  -0.1269 0.0883  147 TYR A CD2   
1212 C CE1   . TYR A 147 ? 0.3435 0.3856 0.4916 0.0310  -0.1079 0.0838  147 TYR A CE1   
1213 C CE2   . TYR A 147 ? 0.3499 0.3785 0.4913 0.0300  -0.1263 0.0988  147 TYR A CE2   
1214 C CZ    . TYR A 147 ? 0.3582 0.3976 0.5188 0.0345  -0.1157 0.0962  147 TYR A CZ    
1215 O OH    . TYR A 147 ? 0.4043 0.4513 0.5968 0.0429  -0.1123 0.1065  147 TYR A OH    
1216 N N     . VAL A 148 ? 0.3621 0.3528 0.3751 -0.0042 -0.1020 0.0510  148 VAL A N     
1217 C CA    . VAL A 148 ? 0.3972 0.3822 0.3866 -0.0124 -0.0968 0.0421  148 VAL A CA    
1218 C C     . VAL A 148 ? 0.4706 0.4413 0.4391 -0.0168 -0.1071 0.0462  148 VAL A C     
1219 O O     . VAL A 148 ? 0.5328 0.4878 0.4917 -0.0171 -0.1136 0.0557  148 VAL A O     
1220 C CB    . VAL A 148 ? 0.4182 0.3931 0.3958 -0.0171 -0.0842 0.0385  148 VAL A CB    
1221 C CG1   . VAL A 148 ? 0.3780 0.3506 0.3358 -0.0261 -0.0768 0.0290  148 VAL A CG1   
1222 C CG2   . VAL A 148 ? 0.3737 0.3589 0.3674 -0.0142 -0.0750 0.0343  148 VAL A CG2   
1223 N N     . PHE A 149 ? 0.4320 0.4061 0.3914 -0.0200 -0.1084 0.0393  149 PHE A N     
1224 C CA    . PHE A 149 ? 0.4597 0.4171 0.3939 -0.0255 -0.1172 0.0414  149 PHE A CA    
1225 C C     . PHE A 149 ? 0.4933 0.4401 0.4015 -0.0329 -0.1045 0.0324  149 PHE A C     
1226 O O     . PHE A 149 ? 0.4785 0.4365 0.3895 -0.0334 -0.0950 0.0221  149 PHE A O     
1227 C CB    . PHE A 149 ? 0.4619 0.4261 0.4016 -0.0241 -0.1266 0.0400  149 PHE A CB    
1228 C CG    . PHE A 149 ? 0.4208 0.3964 0.3876 -0.0182 -0.1382 0.0489  149 PHE A CG    
1229 C CD1   . PHE A 149 ? 0.4060 0.4004 0.4007 -0.0115 -0.1319 0.0473  149 PHE A CD1   
1230 C CD2   . PHE A 149 ? 0.4599 0.4271 0.4242 -0.0201 -0.1555 0.0592  149 PHE A CD2   
1231 C CE1   . PHE A 149 ? 0.4042 0.4087 0.4245 -0.0064 -0.1400 0.0555  149 PHE A CE1   
1232 C CE2   . PHE A 149 ? 0.4404 0.4211 0.4343 -0.0152 -0.1653 0.0678  149 PHE A CE2   
1233 C CZ    . PHE A 149 ? 0.4175 0.4167 0.4398 -0.0082 -0.1562 0.0658  149 PHE A CZ    
1234 N N     . ASP A 150 ? 0.4340 0.3591 0.3177 -0.0383 -0.1040 0.0369  150 ASP A N     
1235 C CA    . ASP A 150 ? 0.5611 0.4754 0.4216 -0.0462 -0.0890 0.0291  150 ASP A CA    
1236 C C     . ASP A 150 ? 0.6117 0.4995 0.4342 -0.0532 -0.0927 0.0303  150 ASP A C     
1237 O O     . ASP A 150 ? 0.6803 0.5475 0.4845 -0.0548 -0.1052 0.0406  150 ASP A O     
1238 C CB    . ASP A 150 ? 0.5632 0.4702 0.4224 -0.0483 -0.0808 0.0321  150 ASP A CB    
1239 C CG    . ASP A 150 ? 0.5787 0.4754 0.4163 -0.0580 -0.0639 0.0243  150 ASP A CG    
1240 O OD1   . ASP A 150 ? 0.5899 0.4929 0.4225 -0.0614 -0.0554 0.0150  150 ASP A OD1   
1241 O OD2   . ASP A 150 ? 0.5377 0.4197 0.3645 -0.0620 -0.0580 0.0277  150 ASP A OD2   
1242 N N     . LEU A 151 ? 0.5682 0.4556 0.3783 -0.0570 -0.0817 0.0199  151 LEU A N     
1243 C CA    . LEU A 151 ? 0.6036 0.4626 0.3731 -0.0644 -0.0816 0.0190  151 LEU A CA    
1244 C C     . LEU A 151 ? 0.6107 0.4499 0.3528 -0.0730 -0.0665 0.0172  151 LEU A C     
1245 O O     . LEU A 151 ? 0.5741 0.4249 0.3239 -0.0756 -0.0473 0.0077  151 LEU A O     
1246 C CB    . LEU A 151 ? 0.6404 0.5049 0.4079 -0.0635 -0.0748 0.0087  151 LEU A CB    
1247 C CG    . LEU A 151 ? 0.7203 0.5522 0.4422 -0.0712 -0.0718 0.0059  151 LEU A CG    
1248 C CD1   . LEU A 151 ? 0.7212 0.5284 0.4178 -0.0747 -0.0946 0.0170  151 LEU A CD1   
1249 C CD2   . LEU A 151 ? 0.7079 0.5454 0.4314 -0.0683 -0.0626 -0.0047 151 LEU A CD2   
1250 N N     . LEU A 152 ? 0.6291 0.4386 0.3396 -0.0778 -0.0756 0.0267  152 LEU A N     
1251 C CA    . LEU A 152 ? 0.6684 0.4538 0.3481 -0.0866 -0.0617 0.0264  152 LEU A CA    
1252 C C     . LEU A 152 ? 0.7416 0.5029 0.3813 -0.0950 -0.0502 0.0193  152 LEU A C     
1253 O O     . LEU A 152 ? 0.7558 0.5082 0.3805 -0.1023 -0.0295 0.0132  152 LEU A O     
1254 C CB    . LEU A 152 ? 0.6758 0.4368 0.3367 -0.0873 -0.0759 0.0407  152 LEU A CB    
1255 C CG    . LEU A 152 ? 0.6776 0.4565 0.3742 -0.0787 -0.0837 0.0485  152 LEU A CG    
1256 C CD1   . LEU A 152 ? 0.7023 0.4527 0.3764 -0.0793 -0.0933 0.0624  152 LEU A CD1   
1257 C CD2   . LEU A 152 ? 0.6336 0.4362 0.3587 -0.0785 -0.0646 0.0392  152 LEU A CD2   
1258 N N     . ASN A 153 ? 0.7405 0.4899 0.3624 -0.0947 -0.0625 0.0198  153 ASN A N     
1259 C CA    . ASN A 153 ? 0.7751 0.4953 0.3529 -0.1027 -0.0517 0.0132  153 ASN A CA    
1260 C C     . ASN A 153 ? 0.7887 0.5234 0.3786 -0.0987 -0.0436 0.0019  153 ASN A C     
1261 O O     . ASN A 153 ? 0.7944 0.5360 0.3948 -0.0938 -0.0600 0.0036  153 ASN A O     
1262 C CB    . ASN A 153 ? 0.8353 0.5158 0.3652 -0.1089 -0.0715 0.0232  153 ASN A CB    
1263 C CG    . ASN A 153 ? 0.9072 0.5666 0.4172 -0.1129 -0.0768 0.0346  153 ASN A CG    
1264 O OD1   . ASN A 153 ? 0.9616 0.6175 0.4676 -0.1168 -0.0573 0.0316  153 ASN A OD1   
1265 N ND2   . ASN A 153 ? 0.9353 0.5808 0.4339 -0.1121 -0.1037 0.0482  153 ASN A ND2   
1266 N N     . SER A 154 ? 0.7900 0.5284 0.3789 -0.1009 -0.0176 -0.0093 154 SER A N     
1267 C CA    . SER A 154 ? 0.7820 0.5344 0.3847 -0.0955 -0.0059 -0.0202 154 SER A CA    
1268 C C     . SER A 154 ? 0.8309 0.5565 0.3959 -0.1026 0.0186  -0.0287 154 SER A C     
1269 O O     . SER A 154 ? 0.8722 0.5809 0.4148 -0.1111 0.0312  -0.0278 154 SER A O     
1270 C CB    . SER A 154 ? 0.7372 0.5366 0.3970 -0.0870 0.0028  -0.0254 154 SER A CB    
1271 O OG    . SER A 154 ? 0.7230 0.5363 0.3971 -0.0813 0.0180  -0.0359 154 SER A OG    
1272 N N     . PRO A 155 ? 0.8650 0.5843 0.4213 -0.0992 0.0270  -0.0370 155 PRO A N     
1273 C CA    . PRO A 155 ? 0.8930 0.5898 0.4191 -0.1041 0.0552  -0.0464 155 PRO A CA    
1274 C C     . PRO A 155 ? 0.8494 0.5786 0.4131 -0.1027 0.0807  -0.0528 155 PRO A C     
1275 O O     . PRO A 155 ? 0.9122 0.6254 0.4547 -0.1088 0.1064  -0.0590 155 PRO A O     
1276 C CB    . PRO A 155 ? 0.9208 0.6128 0.4438 -0.0970 0.0578  -0.0539 155 PRO A CB    
1277 C CG    . PRO A 155 ? 0.8644 0.5897 0.4315 -0.0870 0.0357  -0.0499 155 PRO A CG    
1278 C CD    . PRO A 155 ? 0.8315 0.5577 0.3997 -0.0914 0.0117  -0.0378 155 PRO A CD    
1279 N N     . TYR A 156 ? 0.7820 0.5554 0.4001 -0.0957 0.0737  -0.0512 156 TYR A N     
1280 C CA    . TYR A 156 ? 0.8008 0.6092 0.4592 -0.0955 0.0936  -0.0567 156 TYR A CA    
1281 C C     . TYR A 156 ? 0.8428 0.6509 0.5005 -0.1050 0.0924  -0.0508 156 TYR A C     
1282 O O     . TYR A 156 ? 0.8507 0.6887 0.5431 -0.1068 0.1048  -0.0541 156 TYR A O     
1283 C CB    . TYR A 156 ? 0.7750 0.6305 0.4909 -0.0830 0.0874  -0.0593 156 TYR A CB    
1284 C CG    . TYR A 156 ? 0.8289 0.6857 0.5488 -0.0724 0.0905  -0.0652 156 TYR A CG    
1285 C CD1   . TYR A 156 ? 0.9126 0.7414 0.5998 -0.0740 0.1105  -0.0719 156 TYR A CD1   
1286 C CD2   . TYR A 156 ? 0.7986 0.6810 0.5520 -0.0609 0.0747  -0.0640 156 TYR A CD2   
1287 C CE1   . TYR A 156 ? 0.9398 0.7660 0.6284 -0.0638 0.1147  -0.0774 156 TYR A CE1   
1288 C CE2   . TYR A 156 ? 0.8259 0.7062 0.5809 -0.0510 0.0779  -0.0690 156 TYR A CE2   
1289 C CZ    . TYR A 156 ? 0.8987 0.7507 0.6216 -0.0523 0.0979  -0.0758 156 TYR A CZ    
1290 O OH    . TYR A 156 ? 0.9311 0.7774 0.6536 -0.0420 0.1024  -0.0809 156 TYR A OH    
1291 N N     . GLY A 157 ? 0.8700 0.6436 0.4881 -0.1111 0.0770  -0.0417 157 GLY A N     
1292 C CA    . GLY A 157 ? 0.8678 0.6328 0.4777 -0.1200 0.0771  -0.0354 157 GLY A CA    
1293 C C     . GLY A 157 ? 0.8301 0.5820 0.4298 -0.1187 0.0496  -0.0228 157 GLY A C     
1294 O O     . GLY A 157 ? 0.8128 0.5843 0.4391 -0.1094 0.0299  -0.0193 157 GLY A O     
1295 N N     . ASN A 158 ? 0.8226 0.5406 0.3841 -0.1277 0.0490  -0.0156 158 ASN A N     
1296 C CA    . ASN A 158 ? 0.8105 0.5159 0.3644 -0.1261 0.0249  -0.0024 158 ASN A CA    
1297 C C     . ASN A 158 ? 0.7990 0.5202 0.3788 -0.1276 0.0299  0.0001  158 ASN A C     
1298 O O     . ASN A 158 ? 0.8379 0.5513 0.4077 -0.1372 0.0505  -0.0038 158 ASN A O     
1299 C CB    . ASN A 158 ? 0.8829 0.5370 0.3750 -0.1341 0.0181  0.0058  158 ASN A CB    
1300 C CG    . ASN A 158 ? 0.9466 0.5805 0.4085 -0.1335 0.0077  0.0047  158 ASN A CG    
1301 O OD1   . ASN A 158 ? 0.9532 0.6100 0.4399 -0.1268 0.0078  -0.0026 158 ASN A OD1   
1302 N ND2   . ASN A 158 ? 1.0288 0.6169 0.4342 -0.1410 -0.0019 0.0122  158 ASN A ND2   
1303 N N     . VAL A 159 ? 0.7621 0.5042 0.3745 -0.1190 0.0122  0.0062  159 VAL A N     
1304 C CA    . VAL A 159 ? 0.7393 0.4964 0.3775 -0.1198 0.0168  0.0075  159 VAL A CA    
1305 C C     . VAL A 159 ? 0.7598 0.5017 0.3931 -0.1149 -0.0026 0.0213  159 VAL A C     
1306 O O     . VAL A 159 ? 0.7766 0.5070 0.3988 -0.1090 -0.0230 0.0300  159 VAL A O     
1307 C CB    . VAL A 159 ? 0.7162 0.5194 0.4072 -0.1133 0.0196  -0.0007 159 VAL A CB    
1308 C CG1   . VAL A 159 ? 0.7315 0.5533 0.4335 -0.1173 0.0402  -0.0135 159 VAL A CG1   
1309 C CG2   . VAL A 159 ? 0.6559 0.4751 0.3681 -0.1008 -0.0016 0.0033  159 VAL A CG2   
1310 N N     . GLU A 160 ? 0.7264 0.4683 0.3691 -0.1175 0.0040  0.0233  160 GLU A N     
1311 C CA    . GLU A 160 ? 0.7568 0.4846 0.3985 -0.1114 -0.0109 0.0362  160 GLU A CA    
1312 C C     . GLU A 160 ? 0.7059 0.4666 0.3930 -0.0995 -0.0226 0.0370  160 GLU A C     
1313 O O     . GLU A 160 ? 0.6710 0.4639 0.3882 -0.0976 -0.0174 0.0271  160 GLU A O     
1314 C CB    . GLU A 160 ? 0.8269 0.5359 0.4559 -0.1197 0.0034  0.0375  160 GLU A CB    
1315 C CG    . GLU A 160 ? 0.9598 0.6339 0.5425 -0.1327 0.0178  0.0369  160 GLU A CG    
1316 C CD    . GLU A 160 ? 1.0835 0.7465 0.6605 -0.1437 0.0373  0.0340  160 GLU A CD    
1317 O OE1   . GLU A 160 ? 1.0755 0.7630 0.6871 -0.1427 0.0417  0.0292  160 GLU A OE1   
1318 O OE2   . GLU A 160 ? 1.1968 0.8243 0.7325 -0.1542 0.0482  0.0365  160 GLU A OE2   
1319 N N     . GLU A 161 ? 0.7086 0.4603 0.4002 -0.0910 -0.0378 0.0494  161 GLU A N     
1320 C CA    . GLU A 161 ? 0.6890 0.4681 0.4215 -0.0794 -0.0475 0.0513  161 GLU A CA    
1321 C C     . GLU A 161 ? 0.6542 0.4530 0.4124 -0.0813 -0.0326 0.0423  161 GLU A C     
1322 O O     . GLU A 161 ? 0.6673 0.4526 0.4122 -0.0903 -0.0180 0.0392  161 GLU A O     
1323 C CB    . GLU A 161 ? 0.7401 0.5043 0.4734 -0.0697 -0.0640 0.0672  161 GLU A CB    
1324 C CG    . GLU A 161 ? 0.8136 0.5645 0.5292 -0.0668 -0.0845 0.0774  161 GLU A CG    
1325 C CD    . GLU A 161 ? 0.8711 0.6182 0.6013 -0.0552 -0.1027 0.0935  161 GLU A CD    
1326 O OE1   . GLU A 161 ? 0.8971 0.6528 0.6531 -0.0478 -0.0975 0.0958  161 GLU A OE1   
1327 O OE2   . GLU A 161 ? 0.8879 0.6230 0.6039 -0.0534 -0.1221 0.1040  161 GLU A OE2   
1328 N N     . TRP A 162 ? 0.6417 0.4712 0.4349 -0.0738 -0.0370 0.0383  162 TRP A N     
1329 C CA    . TRP A 162 ? 0.6075 0.4550 0.4248 -0.0745 -0.0270 0.0312  162 TRP A CA    
1330 C C     . TRP A 162 ? 0.6059 0.4350 0.4226 -0.0697 -0.0279 0.0402  162 TRP A C     
1331 O O     . TRP A 162 ? 0.6329 0.4523 0.4510 -0.0597 -0.0409 0.0522  162 TRP A O     
1332 C CB    . TRP A 162 ? 0.5872 0.4676 0.4371 -0.0665 -0.0336 0.0264  162 TRP A CB    
1333 C CG    . TRP A 162 ? 0.5432 0.4399 0.4171 -0.0646 -0.0283 0.0217  162 TRP A CG    
1334 C CD1   . TRP A 162 ? 0.4970 0.4102 0.3804 -0.0726 -0.0172 0.0104  162 TRP A CD1   
1335 C CD2   . TRP A 162 ? 0.4948 0.3926 0.3856 -0.0544 -0.0343 0.0282  162 TRP A CD2   
1336 N NE1   . TRP A 162 ? 0.4845 0.4060 0.3851 -0.0688 -0.0170 0.0092  162 TRP A NE1   
1337 C CE2   . TRP A 162 ? 0.4581 0.3694 0.3629 -0.0574 -0.0259 0.0197  162 TRP A CE2   
1338 C CE3   . TRP A 162 ? 0.5095 0.3986 0.4058 -0.0434 -0.0458 0.0405  162 TRP A CE3   
1339 C CZ2   . TRP A 162 ? 0.4331 0.3453 0.3525 -0.0496 -0.0267 0.0227  162 TRP A CZ2   
1340 C CZ3   . TRP A 162 ? 0.5006 0.3941 0.4168 -0.0348 -0.0455 0.0438  162 TRP A CZ3   
1341 C CH2   . TRP A 162 ? 0.4440 0.3471 0.3693 -0.0380 -0.0352 0.0346  162 TRP A CH2   
1342 N N     . SER A 163 ? 0.6245 0.4482 0.4396 -0.0771 -0.0140 0.0346  163 SER A N     
1343 C CA    . SER A 163 ? 0.6342 0.4360 0.4456 -0.0731 -0.0115 0.0419  163 SER A CA    
1344 C C     . SER A 163 ? 0.6034 0.4225 0.4409 -0.0687 -0.0083 0.0369  163 SER A C     
1345 O O     . SER A 163 ? 0.5928 0.4272 0.4374 -0.0779 0.0008  0.0251  163 SER A O     
1346 C CB    . SER A 163 ? 0.6631 0.4363 0.4455 -0.0860 0.0029  0.0402  163 SER A CB    
1347 O OG    . SER A 163 ? 0.6666 0.4205 0.4475 -0.0836 0.0090  0.0436  163 SER A OG    
1348 N N     . ILE A 164 ? 0.5774 0.3936 0.4289 -0.0550 -0.0156 0.0461  164 ILE A N     
1349 C CA    . ILE A 164 ? 0.5679 0.3959 0.4404 -0.0500 -0.0116 0.0422  164 ILE A CA    
1350 C C     . ILE A 164 ? 0.6175 0.4226 0.4752 -0.0578 0.0034  0.0379  164 ILE A C     
1351 O O     . ILE A 164 ? 0.6229 0.4366 0.4891 -0.0611 0.0100  0.0295  164 ILE A O     
1352 C CB    . ILE A 164 ? 0.5805 0.4113 0.4737 -0.0329 -0.0211 0.0537  164 ILE A CB    
1353 C CG1   . ILE A 164 ? 0.5862 0.4329 0.5008 -0.0284 -0.0165 0.0479  164 ILE A CG1   
1354 C CG2   . ILE A 164 ? 0.5810 0.3805 0.4633 -0.0254 -0.0202 0.0667  164 ILE A CG2   
1355 C CD1   . ILE A 164 ? 0.5746 0.4329 0.5151 -0.0129 -0.0254 0.0574  164 ILE A CD1   
1356 N N     . GLU A 165 ? 0.5783 0.3520 0.4109 -0.0618 0.0085  0.0437  165 GLU A N     
1357 C CA    . GLU A 165 ? 0.6660 0.4124 0.4799 -0.0706 0.0235  0.0400  165 GLU A CA    
1358 C C     . GLU A 165 ? 0.6454 0.4049 0.4546 -0.0897 0.0326  0.0248  165 GLU A C     
1359 O O     . GLU A 165 ? 0.6425 0.3993 0.4514 -0.0973 0.0414  0.0166  165 GLU A O     
1360 C CB    . GLU A 165 ? 0.7982 0.5060 0.5839 -0.0706 0.0264  0.0505  165 GLU A CB    
1361 C CG    . GLU A 165 ? 0.8787 0.5708 0.6703 -0.0514 0.0179  0.0669  165 GLU A CG    
1362 C CD    . GLU A 165 ? 0.9605 0.6726 0.7659 -0.0417 -0.0007 0.0755  165 GLU A CD    
1363 O OE1   . GLU A 165 ? 0.9454 0.6708 0.7434 -0.0508 -0.0052 0.0703  165 GLU A OE1   
1364 O OE2   . GLU A 165 ? 1.0275 0.7417 0.8516 -0.0255 -0.0101 0.0872  165 GLU A OE2   
1365 N N     . ILE A 166 ? 0.6627 0.4364 0.4687 -0.0976 0.0305  0.0213  166 ILE A N     
1366 C CA    . ILE A 166 ? 0.6786 0.4699 0.4861 -0.1149 0.0389  0.0079  166 ILE A CA    
1367 C C     . ILE A 166 ? 0.6263 0.4558 0.4629 -0.1132 0.0335  -0.0009 166 ILE A C     
1368 O O     . ILE A 166 ? 0.6117 0.4542 0.4542 -0.1256 0.0394  -0.0114 166 ILE A O     
1369 C CB    . ILE A 166 ? 0.7076 0.5008 0.5029 -0.1226 0.0408  0.0073  166 ILE A CB    
1370 C CG1   . ILE A 166 ? 0.7806 0.5316 0.5415 -0.1279 0.0484  0.0149  166 ILE A CG1   
1371 C CG2   . ILE A 166 ? 0.6261 0.4467 0.4330 -0.1381 0.0491  -0.0062 166 ILE A CG2   
1372 C CD1   . ILE A 166 ? 0.8084 0.5534 0.5504 -0.1347 0.0510  0.0159  166 ILE A CD1   
1373 N N     . ALA A 167 ? 0.5668 0.4134 0.4212 -0.0981 0.0214  0.0040  167 ALA A N     
1374 C CA    . ALA A 167 ? 0.5611 0.4402 0.4407 -0.0944 0.0155  -0.0026 167 ALA A CA    
1375 C C     . ALA A 167 ? 0.5937 0.4673 0.4752 -0.0966 0.0201  -0.0071 167 ALA A C     
1376 O O     . ALA A 167 ? 0.5714 0.4668 0.4644 -0.1031 0.0195  -0.0164 167 ALA A O     
1377 C CB    . ALA A 167 ? 0.4799 0.3714 0.3748 -0.0781 0.0028  0.0048  167 ALA A CB    
1378 N N     . ALA A 168 ? 0.5619 0.4045 0.4305 -0.0909 0.0247  0.0000  168 ALA A N     
1379 C CA    . ALA A 168 ? 0.5877 0.4179 0.4534 -0.0915 0.0307  -0.0035 168 ALA A CA    
1380 C C     . ALA A 168 ? 0.6207 0.4376 0.4686 -0.1110 0.0414  -0.0134 168 ALA A C     
1381 O O     . ALA A 168 ? 0.6785 0.4927 0.5237 -0.1166 0.0446  -0.0204 168 ALA A O     
1382 C CB    . ALA A 168 ? 0.5747 0.3753 0.4345 -0.0770 0.0338  0.0079  168 ALA A CB    
1383 N N     . LYS A 169 ? 0.6152 0.4222 0.4492 -0.1225 0.0469  -0.0141 169 LYS A N     
1384 C CA    . LYS A 169 ? 0.6752 0.4681 0.4923 -0.1431 0.0577  -0.0229 169 LYS A CA    
1385 C C     . LYS A 169 ? 0.6483 0.4758 0.4817 -0.1567 0.0544  -0.0355 169 LYS A C     
1386 O O     . LYS A 169 ? 0.6341 0.4979 0.4908 -0.1519 0.0452  -0.0372 169 LYS A O     
1387 C CB    . LYS A 169 ? 0.6973 0.4724 0.4964 -0.1526 0.0653  -0.0202 169 LYS A CB    
1388 C CG    . LYS A 169 ? 0.7964 0.5306 0.5737 -0.1419 0.0691  -0.0076 169 LYS A CG    
1389 C CD    . LYS A 169 ? 0.9045 0.6175 0.6588 -0.1535 0.0773  -0.0055 169 LYS A CD    
1390 C CE    . LYS A 169 ? 0.9958 0.6673 0.7275 -0.1417 0.0789  0.0086  169 LYS A CE    
1391 N NZ    . LYS A 169 ? 1.0561 0.6945 0.7754 -0.1381 0.0866  0.0105  169 LYS A NZ    
1392 N N     . LEU A 170 ? 0.6475 0.4623 0.4680 -0.1739 0.0613  -0.0438 170 LEU A N     
1393 C CA    . LEU A 170 ? 0.6298 0.4760 0.4649 -0.1899 0.0572  -0.0553 170 LEU A CA    
1394 C C     . LEU A 170 ? 0.6601 0.5344 0.5107 -0.1993 0.0582  -0.0581 170 LEU A C     
1395 O O     . LEU A 170 ? 0.5855 0.4433 0.4242 -0.2003 0.0661  -0.0532 170 LEU A O     
1396 C CB    . LEU A 170 ? 0.6855 0.5062 0.4986 -0.2098 0.0650  -0.0631 170 LEU A CB    
1397 C CG    . LEU A 170 ? 0.7474 0.5414 0.5427 -0.2068 0.0657  -0.0648 170 LEU A CG    
1398 C CD1   . LEU A 170 ? 0.8048 0.5613 0.5844 -0.1873 0.0726  -0.0541 170 LEU A CD1   
1399 C CD2   . LEU A 170 ? 0.7486 0.5203 0.5213 -0.2315 0.0729  -0.0746 170 LEU A CD2   
1400 N N     . GLN A 171 ? 0.5487 0.4646 0.4253 -0.2059 0.0507  -0.0655 171 GLN A N     
1401 C CA    . GLN A 171 ? 0.6322 0.5772 0.5272 -0.2154 0.0540  -0.0691 171 GLN A CA    
1402 C C     . GLN A 171 ? 0.6455 0.5722 0.5250 -0.2385 0.0674  -0.0737 171 GLN A C     
1403 O O     . GLN A 171 ? 0.5812 0.5117 0.4623 -0.2452 0.0768  -0.0733 171 GLN A O     
1404 C CB    . GLN A 171 ? 0.6877 0.6814 0.6166 -0.2171 0.0431  -0.0756 171 GLN A CB    
1405 C CG    . GLN A 171 ? 0.7919 0.8050 0.7370 -0.1948 0.0312  -0.0709 171 GLN A CG    
1406 C CD    . GLN A 171 ? 0.8860 0.9464 0.8656 -0.1932 0.0252  -0.0746 171 GLN A CD    
1407 O OE1   . GLN A 171 ? 0.9494 1.0356 0.9468 -0.2084 0.0246  -0.0816 171 GLN A OE1   
1408 N NE2   . GLN A 171 ? 0.8804 0.9523 0.8704 -0.1749 0.0205  -0.0697 171 GLN A NE2   
1409 N N     . GLU A 172 ? 0.6692 0.5728 0.5308 -0.2512 0.0694  -0.0781 172 GLU A N     
1410 C CA    . GLU A 172 ? 0.7131 0.5932 0.5558 -0.2745 0.0823  -0.0826 172 GLU A CA    
1411 C C     . GLU A 172 ? 0.7298 0.5643 0.5415 -0.2697 0.0951  -0.0741 172 GLU A C     
1412 O O     . GLU A 172 ? 0.7710 0.5830 0.5649 -0.2874 0.1080  -0.0761 172 GLU A O     
1413 C CB    . GLU A 172 ? 0.7748 0.6364 0.6015 -0.2890 0.0805  -0.0896 172 GLU A CB    
1414 C CG    . GLU A 172 ? 0.7996 0.7043 0.6534 -0.3008 0.0676  -0.0986 172 GLU A CG    
1415 C CD    . GLU A 172 ? 0.8391 0.7677 0.7096 -0.2806 0.0520  -0.0964 172 GLU A CD    
1416 O OE1   . GLU A 172 ? 0.8403 0.8095 0.7373 -0.2860 0.0396  -0.1018 172 GLU A OE1   
1417 O OE2   . GLU A 172 ? 0.8632 0.7703 0.7214 -0.2594 0.0519  -0.0889 172 GLU A OE2   
1418 N N     . GLN A 173 ? 0.7009 0.5216 0.5062 -0.2460 0.0908  -0.0643 173 GLN A N     
1419 C CA    . GLN A 173 ? 0.7131 0.4943 0.4918 -0.2383 0.0992  -0.0542 173 GLN A CA    
1420 C C     . GLN A 173 ? 0.7028 0.5022 0.4917 -0.2297 0.0979  -0.0491 173 GLN A C     
1421 O O     . GLN A 173 ? 0.7501 0.5202 0.5172 -0.2227 0.1023  -0.0399 173 GLN A O     
1422 C CB    . GLN A 173 ? 0.7336 0.4851 0.4984 -0.2180 0.0951  -0.0453 173 GLN A CB    
1423 C CG    . GLN A 173 ? 0.8105 0.5326 0.5571 -0.2247 0.0998  -0.0495 173 GLN A CG    
1424 C CD    . GLN A 173 ? 0.8382 0.5293 0.5727 -0.2030 0.0992  -0.0396 173 GLN A CD    
1425 O OE1   . GLN A 173 ? 0.7930 0.5012 0.5441 -0.1879 0.0901  -0.0380 173 GLN A OE1   
1426 N NE2   . GLN A 173 ? 0.9057 0.5509 0.6122 -0.2011 0.1096  -0.0322 173 GLN A NE2   
1427 N N     . GLY A 174 ? 0.6534 0.4994 0.4737 -0.2300 0.0917  -0.0547 174 GLY A N     
1428 C CA    . GLY A 174 ? 0.6121 0.4752 0.4414 -0.2213 0.0910  -0.0510 174 GLY A CA    
1429 C C     . GLY A 174 ? 0.5848 0.4544 0.4219 -0.1971 0.0772  -0.0435 174 GLY A C     
1430 O O     . GLY A 174 ? 0.5829 0.4567 0.4199 -0.1875 0.0750  -0.0386 174 GLY A O     
1431 N N     . GLY A 175 ? 0.5734 0.4420 0.4156 -0.1884 0.0686  -0.0429 175 GLY A N     
1432 C CA    . GLY A 175 ? 0.5638 0.4387 0.4153 -0.1668 0.0562  -0.0359 175 GLY A CA    
1433 C C     . GLY A 175 ? 0.5197 0.4383 0.4024 -0.1615 0.0461  -0.0413 175 GLY A C     
1434 O O     . GLY A 175 ? 0.5036 0.4503 0.4030 -0.1732 0.0482  -0.0498 175 GLY A O     
1435 N N     . ASP A 176 ? 0.5084 0.4331 0.4003 -0.1436 0.0353  -0.0360 176 ASP A N     
1436 C CA    . ASP A 176 ? 0.4877 0.4499 0.4065 -0.1362 0.0254  -0.0395 176 ASP A CA    
1437 C C     . ASP A 176 ? 0.5310 0.5006 0.4584 -0.1324 0.0183  -0.0421 176 ASP A C     
1438 O O     . ASP A 176 ? 0.5345 0.5337 0.4824 -0.1275 0.0098  -0.0453 176 ASP A O     
1439 C CB    . ASP A 176 ? 0.4406 0.4061 0.3634 -0.1200 0.0182  -0.0319 176 ASP A CB    
1440 C CG    . ASP A 176 ? 0.5160 0.4732 0.4266 -0.1240 0.0246  -0.0299 176 ASP A CG    
1441 O OD1   . ASP A 176 ? 0.4907 0.4591 0.4041 -0.1374 0.0336  -0.0369 176 ASP A OD1   
1442 O OD2   . ASP A 176 ? 0.5506 0.4900 0.4486 -0.1144 0.0206  -0.0212 176 ASP A OD2   
1443 N N     . GLU A 177 ? 0.5936 0.5336 0.5029 -0.1344 0.0226  -0.0405 177 GLU A N     
1444 C CA    . GLU A 177 ? 0.6377 0.5765 0.5477 -0.1319 0.0186  -0.0431 177 GLU A CA    
1445 C C     . GLU A 177 ? 0.6116 0.5643 0.5366 -0.1135 0.0088  -0.0381 177 GLU A C     
1446 O O     . GLU A 177 ? 0.6555 0.6240 0.5893 -0.1126 0.0024  -0.0423 177 GLU A O     
1447 C CB    . GLU A 177 ? 0.6700 0.6298 0.5872 -0.1482 0.0163  -0.0540 177 GLU A CB    
1448 C CG    . GLU A 177 ? 0.7801 0.7128 0.6746 -0.1657 0.0250  -0.0594 177 GLU A CG    
1449 C CD    . GLU A 177 ? 0.8366 0.7940 0.7409 -0.1852 0.0215  -0.0698 177 GLU A CD    
1450 O OE1   . GLU A 177 ? 0.8774 0.8636 0.7991 -0.1828 0.0099  -0.0731 177 GLU A OE1   
1451 O OE2   . GLU A 177 ? 0.8484 0.7965 0.7437 -0.2032 0.0298  -0.0741 177 GLU A OE2   
1452 N N     . VAL A 178 ? 0.5299 0.4758 0.4567 -0.1000 0.0070  -0.0289 178 VAL A N     
1453 C CA    . VAL A 178 ? 0.5081 0.4607 0.4471 -0.0834 -0.0007 -0.0229 178 VAL A CA    
1454 C C     . VAL A 178 ? 0.5725 0.5029 0.5016 -0.0802 0.0041  -0.0218 178 VAL A C     
1455 O O     . VAL A 178 ? 0.5724 0.4727 0.4856 -0.0807 0.0128  -0.0180 178 VAL A O     
1456 C CB    . VAL A 178 ? 0.5059 0.4508 0.4465 -0.0716 -0.0039 -0.0123 178 VAL A CB    
1457 C CG1   . VAL A 178 ? 0.5083 0.4578 0.4625 -0.0560 -0.0106 -0.0056 178 VAL A CG1   
1458 C CG2   . VAL A 178 ? 0.4805 0.4434 0.4263 -0.0744 -0.0076 -0.0139 178 VAL A CG2   
1459 N N     . PRO A 179 ? 0.5175 0.4605 0.4540 -0.0769 -0.0004 -0.0252 179 PRO A N     
1460 C CA    . PRO A 179 ? 0.5383 0.4597 0.4624 -0.0754 0.0055  -0.0260 179 PRO A CA    
1461 C C     . PRO A 179 ? 0.5234 0.4163 0.4422 -0.0636 0.0139  -0.0162 179 PRO A C     
1462 O O     . PRO A 179 ? 0.4989 0.3985 0.4328 -0.0505 0.0095  -0.0071 179 PRO A O     
1463 C CB    . PRO A 179 ? 0.5632 0.5059 0.5005 -0.0678 -0.0030 -0.0269 179 PRO A CB    
1464 C CG    . PRO A 179 ? 0.5240 0.4997 0.4759 -0.0732 -0.0129 -0.0317 179 PRO A CG    
1465 C CD    . PRO A 179 ? 0.4929 0.4696 0.4482 -0.0741 -0.0112 -0.0283 179 PRO A CD    
1466 N N     . SER A 180 ? 0.5650 0.4258 0.4626 -0.0685 0.0256  -0.0180 180 SER A N     
1467 C CA    . SER A 180 ? 0.6034 0.4344 0.4959 -0.0572 0.0354  -0.0085 180 SER A CA    
1468 C C     . SER A 180 ? 0.5910 0.4258 0.5011 -0.0392 0.0353  -0.0002 180 SER A C     
1469 O O     . SER A 180 ? 0.6319 0.4558 0.5511 -0.0264 0.0384  0.0107  180 SER A O     
1470 C CB    . SER A 180 ? 0.6820 0.4752 0.5461 -0.0661 0.0497  -0.0134 180 SER A CB    
1471 O OG    . SER A 180 ? 0.7164 0.5035 0.5700 -0.0693 0.0533  -0.0205 180 SER A OG    
1472 N N     . GLU A 181 ? 0.5638 0.4143 0.4796 -0.0384 0.0315  -0.0048 181 GLU A N     
1473 C CA    . GLU A 181 ? 0.5744 0.4269 0.5056 -0.0230 0.0337  0.0022  181 GLU A CA    
1474 C C     . GLU A 181 ? 0.5361 0.4160 0.4962 -0.0121 0.0219  0.0110  181 GLU A C     
1475 O O     . GLU A 181 ? 0.5856 0.4691 0.5626 0.0002  0.0234  0.0182  181 GLU A O     
1476 C CB    . GLU A 181 ? 0.5930 0.4468 0.5148 -0.0264 0.0352  -0.0053 181 GLU A CB    
1477 C CG    . GLU A 181 ? 0.5749 0.4606 0.5035 -0.0332 0.0203  -0.0116 181 GLU A CG    
1478 C CD    . GLU A 181 ? 0.6492 0.5371 0.5608 -0.0511 0.0164  -0.0224 181 GLU A CD    
1479 O OE1   . GLU A 181 ? 0.6724 0.5399 0.5686 -0.0596 0.0238  -0.0247 181 GLU A OE1   
1480 O OE2   . GLU A 181 ? 0.6538 0.5644 0.5686 -0.0568 0.0058  -0.0283 181 GLU A OE2   
1481 N N     . ILE A 182 ? 0.4583 0.3560 0.4231 -0.0174 0.0110  0.0103  182 ILE A N     
1482 C CA    . ILE A 182 ? 0.4332 0.3524 0.4203 -0.0088 -0.0005 0.0181  182 ILE A CA    
1483 C C     . ILE A 182 ? 0.4484 0.3603 0.4357 -0.0072 -0.0039 0.0259  182 ILE A C     
1484 O O     . ILE A 182 ? 0.4688 0.3941 0.4712 -0.0008 -0.0142 0.0332  182 ILE A O     
1485 C CB    . ILE A 182 ? 0.3986 0.3465 0.3922 -0.0139 -0.0120 0.0115  182 ILE A CB    
1486 C CG1   . ILE A 182 ? 0.3783 0.3310 0.3612 -0.0260 -0.0146 0.0052  182 ILE A CG1   
1487 C CG2   . ILE A 182 ? 0.4547 0.4088 0.4453 -0.0159 -0.0108 0.0044  182 ILE A CG2   
1488 C CD1   . ILE A 182 ? 0.3514 0.3322 0.3436 -0.0289 -0.0245 -0.0001 182 ILE A CD1   
1489 N N     . ILE A 183 ? 0.4765 0.3651 0.4444 -0.0137 0.0043  0.0246  183 ILE A N     
1490 C CA    . ILE A 183 ? 0.4913 0.3678 0.4536 -0.0131 0.0018  0.0322  183 ILE A CA    
1491 C C     . ILE A 183 ? 0.5063 0.3796 0.4866 0.0025  -0.0025 0.0469  183 ILE A C     
1492 O O     . ILE A 183 ? 0.5329 0.4130 0.5187 0.0051  -0.0139 0.0542  183 ILE A O     
1493 C CB    . ILE A 183 ? 0.5590 0.4051 0.4956 -0.0219 0.0139  0.0291  183 ILE A CB    
1494 C CG1   . ILE A 183 ? 0.5505 0.4045 0.4725 -0.0397 0.0144  0.0165  183 ILE A CG1   
1495 C CG2   . ILE A 183 ? 0.5727 0.3990 0.5029 -0.0170 0.0127  0.0404  183 ILE A CG2   
1496 C CD1   . ILE A 183 ? 0.5038 0.3753 0.4284 -0.0440 0.0048  0.0168  183 ILE A CD1   
1497 N N     . ASP A 184 ? 0.4778 0.3409 0.4676 0.0125  0.0066  0.0512  184 ASP A N     
1498 C CA    . ASP A 184 ? 0.4891 0.3520 0.5021 0.0280  0.0036  0.0659  184 ASP A CA    
1499 C C     . ASP A 184 ? 0.5070 0.4002 0.5474 0.0338  -0.0088 0.0698  184 ASP A C     
1500 O O     . ASP A 184 ? 0.5189 0.4184 0.5833 0.0451  -0.0144 0.0822  184 ASP A O     
1501 C CB    . ASP A 184 ? 0.5557 0.3971 0.5718 0.0376  0.0206  0.0692  184 ASP A CB    
1502 C CG    . ASP A 184 ? 0.6814 0.4875 0.6705 0.0338  0.0331  0.0678  184 ASP A CG    
1503 O OD1   . ASP A 184 ? 0.7242 0.5225 0.6978 0.0269  0.0271  0.0687  184 ASP A OD1   
1504 O OD2   . ASP A 184 ? 0.7429 0.5263 0.7241 0.0373  0.0499  0.0656  184 ASP A OD2   
1505 N N     . LYS A 185 ? 0.4450 0.3569 0.4825 0.0257  -0.0136 0.0596  185 LYS A N     
1506 C CA    . LYS A 185 ? 0.4641 0.4016 0.5238 0.0298  -0.0241 0.0620  185 LYS A CA    
1507 C C     . LYS A 185 ? 0.4303 0.3820 0.4871 0.0239  -0.0398 0.0614  185 LYS A C     
1508 O O     . LYS A 185 ? 0.4443 0.4151 0.5146 0.0252  -0.0493 0.0619  185 LYS A O     
1509 C CB    . LYS A 185 ? 0.4598 0.4062 0.5182 0.0270  -0.0184 0.0521  185 LYS A CB    
1510 C CG    . LYS A 185 ? 0.5112 0.4400 0.5668 0.0316  -0.0016 0.0513  185 LYS A CG    
1511 C CD    . LYS A 185 ? 0.5276 0.4643 0.5800 0.0290  0.0018  0.0430  185 LYS A CD    
1512 C CE    . LYS A 185 ? 0.5848 0.5000 0.6303 0.0333  0.0197  0.0423  185 LYS A CE    
1513 N NZ    . LYS A 185 ? 0.5912 0.5119 0.6318 0.0314  0.0222  0.0358  185 LYS A NZ    
1514 N N     . ILE A 186 ? 0.4213 0.3607 0.4579 0.0170  -0.0411 0.0602  186 ILE A N     
1515 C CA    . ILE A 186 ? 0.4310 0.3788 0.4591 0.0106  -0.0530 0.0587  186 ILE A CA    
1516 C C     . ILE A 186 ? 0.4360 0.3793 0.4693 0.0158  -0.0655 0.0719  186 ILE A C     
1517 O O     . ILE A 186 ? 0.4384 0.3632 0.4668 0.0195  -0.0637 0.0803  186 ILE A O     
1518 C CB    . ILE A 186 ? 0.4745 0.4119 0.4761 -0.0015 -0.0469 0.0496  186 ILE A CB    
1519 C CG1   . ILE A 186 ? 0.4489 0.3961 0.4478 -0.0082 -0.0386 0.0365  186 ILE A CG1   
1520 C CG2   . ILE A 186 ? 0.4689 0.4105 0.4595 -0.0073 -0.0567 0.0490  186 ILE A CG2   
1521 C CD1   . ILE A 186 ? 0.4443 0.3853 0.4227 -0.0212 -0.0320 0.0274  186 ILE A CD1   
1522 N N     . ILE A 187 ? 0.4231 0.3819 0.4654 0.0158  -0.0790 0.0740  187 ILE A N     
1523 C CA    . ILE A 187 ? 0.4588 0.4141 0.5026 0.0180  -0.0944 0.0856  187 ILE A CA    
1524 C C     . ILE A 187 ? 0.4772 0.4289 0.4954 0.0078  -0.1017 0.0800  187 ILE A C     
1525 O O     . ILE A 187 ? 0.4470 0.4122 0.4664 0.0044  -0.1060 0.0735  187 ILE A O     
1526 C CB    . ILE A 187 ? 0.4566 0.4299 0.5315 0.0254  -0.1050 0.0941  187 ILE A CB    
1527 C CG1   . ILE A 187 ? 0.4854 0.4599 0.5859 0.0363  -0.0950 0.1007  187 ILE A CG1   
1528 C CG2   . ILE A 187 ? 0.4239 0.3950 0.4987 0.0250  -0.1243 0.1055  187 ILE A CG2   
1529 C CD1   . ILE A 187 ? 0.5001 0.4937 0.6358 0.0435  -0.1028 0.1098  187 ILE A CD1   
1530 N N     . TYR A 188 ? 0.5307 0.4614 0.5241 0.0034  -0.1014 0.0827  188 TYR A N     
1531 C CA    . TYR A 188 ? 0.5224 0.4447 0.4864 -0.0072 -0.1025 0.0760  188 TYR A CA    
1532 C C     . TYR A 188 ? 0.5275 0.4408 0.4787 -0.0088 -0.1202 0.0849  188 TYR A C     
1533 O O     . TYR A 188 ? 0.4875 0.3882 0.4381 -0.0044 -0.1295 0.0978  188 TYR A O     
1534 C CB    . TYR A 188 ? 0.4952 0.3971 0.4350 -0.0137 -0.0891 0.0721  188 TYR A CB    
1535 C CG    . TYR A 188 ? 0.5048 0.3948 0.4132 -0.0247 -0.0875 0.0663  188 TYR A CG    
1536 C CD1   . TYR A 188 ? 0.4705 0.3746 0.3763 -0.0314 -0.0810 0.0534  188 TYR A CD1   
1537 C CD2   . TYR A 188 ? 0.5517 0.4149 0.4325 -0.0281 -0.0916 0.0743  188 TYR A CD2   
1538 C CE1   . TYR A 188 ? 0.5131 0.4060 0.3916 -0.0410 -0.0766 0.0480  188 TYR A CE1   
1539 C CE2   . TYR A 188 ? 0.5385 0.3879 0.3877 -0.0387 -0.0879 0.0689  188 TYR A CE2   
1540 C CZ    . TYR A 188 ? 0.5658 0.4306 0.4149 -0.0451 -0.0794 0.0554  188 TYR A CZ    
1541 O OH    . TYR A 188 ? 0.6034 0.4544 0.4226 -0.0552 -0.0728 0.0498  188 TYR A OH    
1542 N N     . MET A 189 ? 0.5632 0.4816 0.5031 -0.0151 -0.1251 0.0781  189 MET A N     
1543 C CA    . MET A 189 ? 0.5637 0.4712 0.4864 -0.0187 -0.1423 0.0849  189 MET A CA    
1544 C C     . MET A 189 ? 0.5615 0.4543 0.4477 -0.0293 -0.1374 0.0755  189 MET A C     
1545 O O     . MET A 189 ? 0.5412 0.4453 0.4281 -0.0321 -0.1315 0.0645  189 MET A O     
1546 C CB    . MET A 189 ? 0.5579 0.4844 0.5049 -0.0152 -0.1558 0.0877  189 MET A CB    
1547 C CG    . MET A 189 ? 0.5853 0.5255 0.5692 -0.0051 -0.1622 0.0993  189 MET A CG    
1548 S SD    . MET A 189 ? 0.5697 0.5369 0.5873 -0.0020 -0.1688 0.0981  189 MET A SD    
1549 C CE    . MET A 189 ? 0.4044 0.3828 0.4253 -0.0013 -0.1470 0.0820  189 MET A CE    
1550 N N     . PRO A 190 ? 0.5992 0.4651 0.4525 -0.0348 -0.1388 0.0802  190 PRO A N     
1551 C CA    . PRO A 190 ? 0.6547 0.5019 0.4694 -0.0454 -0.1326 0.0725  190 PRO A CA    
1552 C C     . PRO A 190 ? 0.6718 0.5063 0.4647 -0.0497 -0.1504 0.0765  190 PRO A C     
1553 O O     . PRO A 190 ? 0.6607 0.4941 0.4616 -0.0462 -0.1703 0.0889  190 PRO A O     
1554 C CB    . PRO A 190 ? 0.6895 0.5102 0.4780 -0.0491 -0.1262 0.0776  190 PRO A CB    
1555 C CG    . PRO A 190 ? 0.6762 0.4944 0.4808 -0.0402 -0.1408 0.0932  190 PRO A CG    
1556 C CD    . PRO A 190 ? 0.6046 0.4544 0.4551 -0.0307 -0.1432 0.0930  190 PRO A CD    
1557 N N     . PHE A 191 ? 0.6592 0.4842 0.4254 -0.0574 -0.1431 0.0662  191 PHE A N     
1558 C CA    . PHE A 191 ? 0.6791 0.4876 0.4187 -0.0632 -0.1583 0.0680  191 PHE A CA    
1559 C C     . PHE A 191 ? 0.7390 0.5160 0.4282 -0.0737 -0.1480 0.0617  191 PHE A C     
1560 O O     . PHE A 191 ? 0.7520 0.5304 0.4365 -0.0761 -0.1256 0.0512  191 PHE A O     
1561 C CB    . PHE A 191 ? 0.6349 0.4646 0.3963 -0.0606 -0.1606 0.0607  191 PHE A CB    
1562 C CG    . PHE A 191 ? 0.5738 0.4312 0.3809 -0.0516 -0.1715 0.0676  191 PHE A CG    
1563 C CD1   . PHE A 191 ? 0.5053 0.3883 0.3478 -0.0440 -0.1583 0.0630  191 PHE A CD1   
1564 C CD2   . PHE A 191 ? 0.5754 0.4327 0.3896 -0.0517 -0.1947 0.0787  191 PHE A CD2   
1565 C CE1   . PHE A 191 ? 0.4986 0.4041 0.3802 -0.0360 -0.1658 0.0691  191 PHE A CE1   
1566 C CE2   . PHE A 191 ? 0.5481 0.4315 0.4065 -0.0437 -0.2024 0.0851  191 PHE A CE2   
1567 C CZ    . PHE A 191 ? 0.5166 0.4230 0.4075 -0.0355 -0.1868 0.0802  191 PHE A CZ    
1568 N N     . ASP A 192 ? 0.7516 0.4999 0.4030 -0.0806 -0.1643 0.0683  192 ASP A N     
1569 C CA    . ASP A 192 ? 0.8299 0.5419 0.4267 -0.0912 -0.1547 0.0635  192 ASP A CA    
1570 C C     . ASP A 192 ? 0.8499 0.5547 0.4269 -0.0963 -0.1469 0.0508  192 ASP A C     
1571 O O     . ASP A 192 ? 0.9228 0.5981 0.4553 -0.1048 -0.1343 0.0446  192 ASP A O     
1572 C CB    . ASP A 192 ? 0.8954 0.5729 0.4525 -0.0971 -0.1751 0.0774  192 ASP A CB    
1573 C CG    . ASP A 192 ? 0.9442 0.6240 0.5070 -0.0970 -0.2057 0.0872  192 ASP A CG    
1574 O OD1   . ASP A 192 ? 0.9109 0.6028 0.4843 -0.0978 -0.2089 0.0802  192 ASP A OD1   
1575 O OD2   . ASP A 192 ? 0.9728 0.6420 0.5300 -0.0964 -0.2270 0.1025  192 ASP A OD2   
1576 N N     . ASN A 193 ? 0.8005 0.5298 0.4088 -0.0911 -0.1534 0.0474  193 ASN A N     
1577 C CA    . ASN A 193 ? 0.8462 0.5735 0.4447 -0.0929 -0.1418 0.0342  193 ASN A CA    
1578 C C     . ASN A 193 ? 0.7909 0.5526 0.4358 -0.0841 -0.1451 0.0309  193 ASN A C     
1579 O O     . ASN A 193 ? 0.7586 0.5413 0.4377 -0.0787 -0.1608 0.0398  193 ASN A O     
1580 C CB    . ASN A 193 ? 0.9672 0.6544 0.5110 -0.1037 -0.1519 0.0339  193 ASN A CB    
1581 C CG    . ASN A 193 ? 1.0335 0.7136 0.5734 -0.1070 -0.1845 0.0473  193 ASN A CG    
1582 O OD1   . ASN A 193 ? 1.0513 0.7536 0.6238 -0.1031 -0.1982 0.0495  193 ASN A OD1   
1583 N ND2   . ASN A 193 ? 1.0716 0.7203 0.5713 -0.1148 -0.1975 0.0568  193 ASN A ND2   
1584 N N     . GLU A 194 ? 0.7492 0.5153 0.3948 -0.0824 -0.1292 0.0183  194 GLU A N     
1585 C CA    . GLU A 194 ? 0.6887 0.4861 0.3763 -0.0733 -0.1278 0.0139  194 GLU A CA    
1586 C C     . GLU A 194 ? 0.6650 0.4646 0.3622 -0.0737 -0.1511 0.0204  194 GLU A C     
1587 O O     . GLU A 194 ? 0.6504 0.4787 0.3893 -0.0664 -0.1566 0.0235  194 GLU A O     
1588 C CB    . GLU A 194 ? 0.7124 0.5088 0.3935 -0.0711 -0.1063 -0.0001 194 GLU A CB    
1589 C CG    . GLU A 194 ? 0.6447 0.4725 0.3677 -0.0607 -0.1028 -0.0048 194 GLU A CG    
1590 C CD    . GLU A 194 ? 0.6754 0.4988 0.3901 -0.0573 -0.0840 -0.0171 194 GLU A CD    
1591 O OE1   . GLU A 194 ? 0.6568 0.5056 0.4047 -0.0479 -0.0785 -0.0213 194 GLU A OE1   
1592 O OE2   . GLU A 194 ? 0.6905 0.4837 0.3646 -0.0637 -0.0742 -0.0222 194 GLU A OE2   
1593 N N     . LYS A 195 ? 0.7342 0.5024 0.3914 -0.0834 -0.1644 0.0223  195 LYS A N     
1594 C CA    . LYS A 195 ? 0.7480 0.5160 0.4112 -0.0867 -0.1875 0.0283  195 LYS A CA    
1595 C C     . LYS A 195 ? 0.7383 0.5298 0.4388 -0.0834 -0.2068 0.0425  195 LYS A C     
1596 O O     . LYS A 195 ? 0.7278 0.5404 0.4620 -0.0801 -0.2172 0.0460  195 LYS A O     
1597 C CB    . LYS A 195 ? 0.7889 0.5153 0.3969 -0.1002 -0.2003 0.0286  195 LYS A CB    
1598 C CG    . LYS A 195 ? 0.8695 0.5707 0.4426 -0.1032 -0.1829 0.0144  195 LYS A CG    
1599 N N     . GLU A 196 ? 0.7292 0.5159 0.4237 -0.0838 -0.2100 0.0508  196 GLU A N     
1600 C CA    . GLU A 196 ? 0.7055 0.5126 0.4354 -0.0788 -0.2258 0.0649  196 GLU A CA    
1601 C C     . GLU A 196 ? 0.6397 0.4827 0.4201 -0.0666 -0.2122 0.0631  196 GLU A C     
1602 O O     . GLU A 196 ? 0.6218 0.4874 0.4408 -0.0612 -0.2229 0.0716  196 GLU A O     
1603 C CB    . GLU A 196 ? 0.6826 0.4704 0.3885 -0.0817 -0.2319 0.0745  196 GLU A CB    
1604 C CG    . GLU A 196 ? 0.7557 0.5073 0.4115 -0.0942 -0.2512 0.0797  196 GLU A CG    
1605 C CD    . GLU A 196 ? 0.8186 0.5451 0.4420 -0.0971 -0.2536 0.0878  196 GLU A CD    
1606 O OE1   . GLU A 196 ? 0.7898 0.5313 0.4406 -0.0889 -0.2532 0.0966  196 GLU A OE1   
1607 O OE2   . GLU A 196 ? 0.8796 0.5696 0.4500 -0.1074 -0.2534 0.0848  196 GLU A OE2   
1608 N N     . LEU A 197 ? 0.5926 0.4402 0.3724 -0.0628 -0.1885 0.0521  197 LEU A N     
1609 C CA    . LEU A 197 ? 0.5380 0.4164 0.3597 -0.0528 -0.1755 0.0489  197 LEU A CA    
1610 C C     . LEU A 197 ? 0.5209 0.4174 0.3686 -0.0490 -0.1795 0.0462  197 LEU A C     
1611 O O     . LEU A 197 ? 0.4870 0.4058 0.3717 -0.0426 -0.1840 0.0520  197 LEU A O     
1612 C CB    . LEU A 197 ? 0.5022 0.3818 0.3161 -0.0516 -0.1513 0.0371  197 LEU A CB    
1613 C CG    . LEU A 197 ? 0.5324 0.4407 0.3828 -0.0432 -0.1374 0.0327  197 LEU A CG    
1614 C CD1   . LEU A 197 ? 0.5128 0.4179 0.3519 -0.0455 -0.1184 0.0259  197 LEU A CD1   
1615 C CD2   . LEU A 197 ? 0.4824 0.4088 0.3531 -0.0379 -0.1329 0.0250  197 LEU A CD2   
1616 N N     . LEU A 198 ? 0.6325 0.4972 0.3719 -0.0787 -0.1916 0.0569  198 LEU A N     
1617 C CA    . LEU A 198 ? 0.5661 0.4624 0.3519 -0.0705 -0.1820 0.0466  198 LEU A CA    
1618 C C     . LEU A 198 ? 0.5591 0.4741 0.3785 -0.0622 -0.2038 0.0549  198 LEU A C     
1619 O O     . LEU A 198 ? 0.5112 0.4512 0.3779 -0.0485 -0.1988 0.0535  198 LEU A O     
1620 C CB    . LEU A 198 ? 0.5720 0.4678 0.3375 -0.0870 -0.1663 0.0286  198 LEU A CB    
1621 C CG    . LEU A 198 ? 0.5484 0.4435 0.3004 -0.0911 -0.1400 0.0164  198 LEU A CG    
1622 C CD1   . LEU A 198 ? 0.5599 0.4545 0.2933 -0.1046 -0.1242 -0.0025 198 LEU A CD1   
1623 C CD2   . LEU A 198 ? 0.4915 0.4092 0.2885 -0.0718 -0.1266 0.0159  198 LEU A CD2   
1624 N N     . MET A 199 ? 0.6196 0.5247 0.4136 -0.0726 -0.2282 0.0636  199 MET A N     
1625 C CA    . MET A 199 ? 0.6680 0.5983 0.4950 -0.0670 -0.2518 0.0719  199 MET A CA    
1626 C C     . MET A 199 ? 0.6315 0.5776 0.5025 -0.0404 -0.2599 0.0849  199 MET A C     
1627 O O     . MET A 199 ? 0.5555 0.5362 0.4774 -0.0297 -0.2632 0.0847  199 MET A O     
1628 C CB    . MET A 199 ? 0.7093 0.6284 0.5034 -0.0822 -0.2698 0.0778  199 MET A CB    
1629 C CG    . MET A 199 ? 0.7838 0.7374 0.6168 -0.0776 -0.2877 0.0835  199 MET A CG    
1630 S SD    . MET A 199 ? 1.1009 1.0893 0.9759 -0.0827 -0.2800 0.0697  199 MET A SD    
1631 C CE    . MET A 199 ? 0.9733 0.9311 0.7914 -0.1138 -0.2670 0.0520  199 MET A CE    
1632 N N     . GLU A 200 ? 0.6340 0.5526 0.4836 -0.0310 -0.2597 0.0943  200 GLU A N     
1633 C CA    . GLU A 200 ? 0.6602 0.5855 0.5468 -0.0044 -0.2610 0.1039  200 GLU A CA    
1634 C C     . GLU A 200 ? 0.6351 0.5792 0.5610 0.0057  -0.2372 0.0943  200 GLU A C     
1635 O O     . GLU A 200 ? 0.4637 0.4332 0.4387 0.0240  -0.2377 0.0968  200 GLU A O     
1636 C CB    . GLU A 200 ? 0.7639 0.6450 0.6092 0.0002  -0.2617 0.1140  200 GLU A CB    
1637 C CG    . GLU A 200 ? 0.8775 0.7565 0.7544 0.0282  -0.2600 0.1223  200 GLU A CG    
1638 C CD    . GLU A 200 ? 0.9632 0.8807 0.8932 0.0480  -0.2738 0.1276  200 GLU A CD    
1639 O OE1   . GLU A 200 ? 0.9900 0.9297 0.9683 0.0687  -0.2659 0.1264  200 GLU A OE1   
1640 O OE2   . GLU A 200 ? 0.9674 0.8947 0.8901 0.0416  -0.2917 0.1323  200 GLU A OE2   
1641 N N     . TYR A 201 ? 0.4707 0.4051 0.3764 -0.0068 -0.2136 0.0820  201 TYR A N     
1642 C CA    . TYR A 201 ? 0.4513 0.4024 0.3893 0.0003  -0.1899 0.0728  201 TYR A CA    
1643 C C     . TYR A 201 ? 0.4637 0.4498 0.4459 0.0018  -0.1900 0.0667  201 TYR A C     
1644 O O     . TYR A 201 ? 0.4500 0.4541 0.4697 0.0127  -0.1796 0.0649  201 TYR A O     
1645 C CB    . TYR A 201 ? 0.4504 0.3898 0.3597 -0.0127 -0.1682 0.0616  201 TYR A CB    
1646 C CG    . TYR A 201 ? 0.4323 0.3871 0.3700 -0.0054 -0.1470 0.0549  201 TYR A CG    
1647 C CD1   . TYR A 201 ? 0.4215 0.3685 0.3651 0.0041  -0.1386 0.0596  201 TYR A CD1   
1648 C CD2   . TYR A 201 ? 0.4258 0.3984 0.3803 -0.0088 -0.1360 0.0444  201 TYR A CD2   
1649 C CE1   . TYR A 201 ? 0.4115 0.3720 0.3765 0.0075  -0.1207 0.0542  201 TYR A CE1   
1650 C CE2   . TYR A 201 ? 0.4258 0.4103 0.4023 -0.0027 -0.1198 0.0406  201 TYR A CE2   
1651 C CZ    . TYR A 201 ? 0.4238 0.4042 0.4053 0.0041  -0.1126 0.0455  201 TYR A CZ    
1652 O OH    . TYR A 201 ? 0.4324 0.4240 0.4312 0.0069  -0.0977 0.0423  201 TYR A OH    
1653 N N     . LEU A 202 ? 0.4930 0.4853 0.4654 -0.0123 -0.2009 0.0630  202 LEU A N     
1654 C CA    . LEU A 202 ? 0.4540 0.4743 0.4599 -0.0162 -0.2018 0.0569  202 LEU A CA    
1655 C C     . LEU A 202 ? 0.3991 0.4507 0.4493 -0.0045 -0.2179 0.0653  202 LEU A C     
1656 O O     . LEU A 202 ? 0.3971 0.4749 0.4866 -0.0016 -0.2099 0.0606  202 LEU A O     
1657 C CB    . LEU A 202 ? 0.4796 0.4931 0.4569 -0.0374 -0.2091 0.0499  202 LEU A CB    
1658 C CG    . LEU A 202 ? 0.5121 0.5055 0.4627 -0.0469 -0.1876 0.0360  202 LEU A CG    
1659 C CD1   . LEU A 202 ? 0.5142 0.4972 0.4356 -0.0678 -0.1938 0.0279  202 LEU A CD1   
1660 C CD2   . LEU A 202 ? 0.4687 0.4723 0.4499 -0.0385 -0.1688 0.0295  202 LEU A CD2   
1661 N N     . ASN A 203 ? 0.4120 0.4615 0.4554 0.0022  -0.2406 0.0778  203 ASN A N     
1662 C CA    . ASN A 203 ? 0.5006 0.5839 0.5903 0.0184  -0.2547 0.0855  203 ASN A CA    
1663 C C     . ASN A 203 ? 0.4889 0.5776 0.6138 0.0405  -0.2399 0.0863  203 ASN A C     
1664 O O     . ASN A 203 ? 0.4205 0.5462 0.5951 0.0499  -0.2362 0.0835  203 ASN A O     
1665 C CB    . ASN A 203 ? 0.6068 0.6799 0.6748 0.0239  -0.2732 0.0969  203 ASN A CB    
1666 C CG    . ASN A 203 ? 0.7000 0.7763 0.7411 0.0011  -0.2881 0.0954  203 ASN A CG    
1667 O OD1   . ASN A 203 ? 0.6582 0.7525 0.7069 -0.0167 -0.2857 0.0856  203 ASN A OD1   
1668 N ND2   . ASN A 203 ? 0.7600 0.8153 0.7662 -0.0002 -0.3033 0.1052  203 ASN A ND2   
1669 N N     . PHE A 204 ? 0.4899 0.5407 0.5837 0.0456  -0.2254 0.0873  204 PHE A N     
1670 C CA    . PHE A 204 ? 0.4336 0.4799 0.5476 0.0615  -0.2054 0.0855  204 PHE A CA    
1671 C C     . PHE A 204 ? 0.4387 0.5070 0.5791 0.0538  -0.1833 0.0730  204 PHE A C     
1672 O O     . PHE A 204 ? 0.4658 0.5544 0.6450 0.0644  -0.1726 0.0700  204 PHE A O     
1673 C CB    . PHE A 204 ? 0.4429 0.4422 0.5079 0.0601  -0.1949 0.0881  204 PHE A CB    
1674 C CG    . PHE A 204 ? 0.4181 0.4084 0.4904 0.0660  -0.1692 0.0825  204 PHE A CG    
1675 C CD1   . PHE A 204 ? 0.4567 0.4374 0.5453 0.0860  -0.1655 0.0871  204 PHE A CD1   
1676 C CD2   . PHE A 204 ? 0.3980 0.3872 0.4580 0.0517  -0.1492 0.0727  204 PHE A CD2   
1677 C CE1   . PHE A 204 ? 0.4352 0.4041 0.5241 0.0875  -0.1409 0.0810  204 PHE A CE1   
1678 C CE2   . PHE A 204 ? 0.4005 0.3825 0.4633 0.0539  -0.1279 0.0685  204 PHE A CE2   
1679 C CZ    . PHE A 204 ? 0.3987 0.3693 0.4736 0.0697  -0.1230 0.0721  204 PHE A CZ    
1680 N N     . TRP A 205 ? 0.3924 0.4538 0.5092 0.0355  -0.1763 0.0654  205 TRP A N     
1681 C CA    . TRP A 205 ? 0.3674 0.4410 0.4997 0.0272  -0.1582 0.0553  205 TRP A CA    
1682 C C     . TRP A 205 ? 0.3840 0.4951 0.5595 0.0247  -0.1628 0.0522  205 TRP A C     
1683 O O     . TRP A 205 ? 0.3787 0.5027 0.5780 0.0241  -0.1470 0.0466  205 TRP A O     
1684 C CB    . TRP A 205 ? 0.3709 0.4275 0.4690 0.0115  -0.1540 0.0487  205 TRP A CB    
1685 C CG    . TRP A 205 ? 0.3599 0.4179 0.4645 0.0056  -0.1366 0.0405  205 TRP A CG    
1686 C CD1   . TRP A 205 ? 0.3508 0.4230 0.4740 -0.0032 -0.1353 0.0354  205 TRP A CD1   
1687 C CD2   . TRP A 205 ? 0.3742 0.4171 0.4631 0.0067  -0.1197 0.0373  205 TRP A CD2   
1688 N NE1   . TRP A 205 ? 0.3360 0.3967 0.4529 -0.0058 -0.1192 0.0305  205 TRP A NE1   
1689 C CE2   . TRP A 205 ? 0.3554 0.4013 0.4540 0.0014  -0.1106 0.0320  205 TRP A CE2   
1690 C CE3   . TRP A 205 ? 0.3465 0.3745 0.4129 0.0102  -0.1121 0.0388  205 TRP A CE3   
1691 C CZ2   . TRP A 205 ? 0.3649 0.4008 0.4537 0.0028  -0.0968 0.0298  205 TRP A CZ2   
1692 C CZ3   . TRP A 205 ? 0.3742 0.3991 0.4344 0.0095  -0.0974 0.0350  205 TRP A CZ3   
1693 C CH2   . TRP A 205 ? 0.3723 0.4017 0.4449 0.0075  -0.0912 0.0314  205 TRP A CH2   
1694 N N     . GLN A 206 ? 0.3476 0.4775 0.5311 0.0204  -0.1844 0.0556  206 GLN A N     
1695 C CA    . GLN A 206 ? 0.4439 0.6166 0.6695 0.0142  -0.1900 0.0518  206 GLN A CA    
1696 C C     . GLN A 206 ? 0.4156 0.6205 0.6916 0.0334  -0.1873 0.0538  206 GLN A C     
1697 O O     . GLN A 206 ? 0.3913 0.6285 0.7037 0.0279  -0.1772 0.0463  206 GLN A O     
1698 C CB    . GLN A 206 ? 0.5497 0.7377 0.7689 0.0017  -0.2158 0.0551  206 GLN A CB    
1699 C CG    . GLN A 206 ? 0.6557 0.8170 0.8309 -0.0217 -0.2140 0.0482  206 GLN A CG    
1700 C CD    . GLN A 206 ? 0.7351 0.9135 0.9033 -0.0398 -0.2376 0.0492  206 GLN A CD    
1701 O OE1   . GLN A 206 ? 0.7534 0.9121 0.8882 -0.0614 -0.2356 0.0416  206 GLN A OE1   
1702 N NE2   . GLN A 206 ? 0.7582 0.9708 0.9543 -0.0301 -0.2565 0.0574  206 GLN A NE2   
1703 N N     . GLN A 207 ? 0.3952 0.5883 0.6707 0.0552  -0.1949 0.0631  207 GLN A N     
1704 C CA    . GLN A 207 ? 0.4173 0.6336 0.7385 0.0782  -0.1899 0.0642  207 GLN A CA    
1705 C C     . GLN A 207 ? 0.3609 0.5635 0.6848 0.0792  -0.1587 0.0555  207 GLN A C     
1706 O O     . GLN A 207 ? 0.3696 0.6023 0.7367 0.0861  -0.1457 0.0488  207 GLN A O     
1707 C CB    . GLN A 207 ? 0.5140 0.7047 0.8177 0.1012  -0.2016 0.0759  207 GLN A CB    
1708 C CG    . GLN A 207 ? 0.6385 0.8398 0.9297 0.1013  -0.2262 0.0839  207 GLN A CG    
1709 C CD    . GLN A 207 ? 0.7909 0.9618 1.0615 0.1244  -0.2354 0.0963  207 GLN A CD    
1710 O OE1   . GLN A 207 ? 0.8306 0.9680 1.0925 0.1393  -0.2226 0.0981  207 GLN A OE1   
1711 N NE2   . GLN A 207 ? 0.8659 1.0454 1.1260 0.1265  -0.2578 0.1052  207 GLN A NE2   
1712 N N     . LYS A 208 ? 0.3551 0.5148 0.6325 0.0711  -0.1467 0.0551  208 LYS A N     
1713 C CA    . LYS A 208 ? 0.3572 0.4999 0.6286 0.0702  -0.1201 0.0489  208 LYS A CA    
1714 C C     . LYS A 208 ? 0.3609 0.4900 0.6044 0.0491  -0.1097 0.0436  208 LYS A C     
1715 O O     . LYS A 208 ? 0.3596 0.4578 0.5672 0.0460  -0.1016 0.0447  208 LYS A O     
1716 C CB    . LYS A 208 ? 0.3724 0.4753 0.6146 0.0836  -0.1153 0.0547  208 LYS A CB    
1717 C CG    . LYS A 208 ? 0.4017 0.5059 0.6639 0.1085  -0.1279 0.0621  208 LYS A CG    
1718 C CD    . LYS A 208 ? 0.4072 0.4598 0.6265 0.1175  -0.1249 0.0689  208 LYS A CD    
1719 C CE    . LYS A 208 ? 0.4262 0.4702 0.6559 0.1434  -0.1434 0.0795  208 LYS A CE    
1720 N NZ    . LYS A 208 ? 0.3773 0.4486 0.6618 0.1658  -0.1338 0.0745  208 LYS A NZ    
1721 N N     . THR A 209 ? 0.2932 0.4458 0.5531 0.0347  -0.1104 0.0380  209 THR A N     
1722 C CA    . THR A 209 ? 0.3168 0.4523 0.5496 0.0173  -0.1032 0.0339  209 THR A CA    
1723 C C     . THR A 209 ? 0.3186 0.4412 0.5449 0.0140  -0.0815 0.0306  209 THR A C     
1724 O O     . THR A 209 ? 0.3385 0.4788 0.5903 0.0108  -0.0694 0.0258  209 THR A O     
1725 C CB    . THR A 209 ? 0.3369 0.4932 0.5828 0.0005  -0.1093 0.0288  209 THR A CB    
1726 O OG1   . THR A 209 ? 0.3783 0.5495 0.6290 0.0008  -0.1313 0.0321  209 THR A OG1   
1727 C CG2   . THR A 209 ? 0.2376 0.3655 0.4494 -0.0140 -0.1032 0.0255  209 THR A CG2   
1728 N N     . PRO A 210 ? 0.3366 0.4310 0.5283 0.0133  -0.0765 0.0328  210 PRO A N     
1729 C CA    . PRO A 210 ? 0.3430 0.4245 0.5226 0.0089  -0.0594 0.0317  210 PRO A CA    
1730 C C     . PRO A 210 ? 0.3169 0.4025 0.5018 -0.0053 -0.0518 0.0276  210 PRO A C     
1731 O O     . PRO A 210 ? 0.3078 0.3924 0.4885 -0.0133 -0.0597 0.0262  210 PRO A O     
1732 C CB    . PRO A 210 ? 0.3281 0.3884 0.4733 0.0091  -0.0619 0.0345  210 PRO A CB    
1733 C CG    . PRO A 210 ? 0.3161 0.3739 0.4538 0.0158  -0.0758 0.0371  210 PRO A CG    
1734 C CD    . PRO A 210 ? 0.3498 0.4265 0.5119 0.0148  -0.0875 0.0360  210 PRO A CD    
1735 N N     . VAL A 211 ? 0.2811 0.3670 0.4702 -0.0107 -0.0360 0.0255  211 VAL A N     
1736 C CA    . VAL A 211 ? 0.2855 0.3655 0.4672 -0.0272 -0.0278 0.0233  211 VAL A CA    
1737 C C     . VAL A 211 ? 0.3098 0.3639 0.4573 -0.0288 -0.0259 0.0289  211 VAL A C     
1738 O O     . VAL A 211 ? 0.3212 0.3593 0.4502 -0.0333 -0.0315 0.0314  211 VAL A O     
1739 C CB    . VAL A 211 ? 0.2686 0.3637 0.4708 -0.0358 -0.0105 0.0171  211 VAL A CB    
1740 C CG1   . VAL A 211 ? 0.2897 0.3684 0.4705 -0.0560 -0.0010 0.0168  211 VAL A CG1   
1741 C CG2   . VAL A 211 ? 0.2241 0.3545 0.4677 -0.0345 -0.0131 0.0107  211 VAL A CG2   
1742 N N     . ILE A 212 ? 0.2955 0.3457 0.4345 -0.0246 -0.0184 0.0308  212 ILE A N     
1743 C CA    . ILE A 212 ? 0.3095 0.3448 0.4201 -0.0249 -0.0194 0.0364  212 ILE A CA    
1744 C C     . ILE A 212 ? 0.3439 0.3802 0.4483 -0.0128 -0.0280 0.0380  212 ILE A C     
1745 O O     . ILE A 212 ? 0.3324 0.3717 0.4429 -0.0069 -0.0260 0.0366  212 ILE A O     
1746 C CB    . ILE A 212 ? 0.3224 0.3526 0.4207 -0.0340 -0.0052 0.0368  212 ILE A CB    
1747 C CG1   . ILE A 212 ? 0.3019 0.3304 0.4037 -0.0494 0.0061  0.0336  212 ILE A CG1   
1748 C CG2   . ILE A 212 ? 0.3541 0.3765 0.4253 -0.0360 -0.0094 0.0435  212 ILE A CG2   
1749 C CD1   . ILE A 212 ? 0.2972 0.3125 0.3843 -0.0579 -0.0011 0.0380  212 ILE A CD1   
1750 N N     . LEU A 213 ? 0.3346 0.3664 0.4255 -0.0091 -0.0366 0.0405  213 LEU A N     
1751 C CA    . LEU A 213 ? 0.3039 0.3381 0.3858 -0.0014 -0.0425 0.0403  213 LEU A CA    
1752 C C     . LEU A 213 ? 0.3451 0.3822 0.4099 -0.0027 -0.0403 0.0432  213 LEU A C     
1753 O O     . LEU A 213 ? 0.3400 0.3761 0.4004 -0.0015 -0.0433 0.0459  213 LEU A O     
1754 C CB    . LEU A 213 ? 0.2717 0.3036 0.3547 0.0038  -0.0528 0.0377  213 LEU A CB    
1755 C CG    . LEU A 213 ? 0.3357 0.3692 0.4074 0.0087  -0.0578 0.0357  213 LEU A CG    
1756 C CD1   . LEU A 213 ? 0.3126 0.3460 0.3851 0.0090  -0.0581 0.0369  213 LEU A CD1   
1757 C CD2   . LEU A 213 ? 0.3724 0.4002 0.4418 0.0106  -0.0659 0.0314  213 LEU A CD2   
1758 N N     . THR A 214 ? 0.3192 0.3596 0.3735 -0.0055 -0.0357 0.0431  214 THR A N     
1759 C CA    . THR A 214 ? 0.3273 0.3779 0.3669 -0.0106 -0.0335 0.0452  214 THR A CA    
1760 C C     . THR A 214 ? 0.3291 0.3855 0.3553 -0.0127 -0.0326 0.0423  214 THR A C     
1761 O O     . THR A 214 ? 0.3225 0.3706 0.3473 -0.0089 -0.0353 0.0397  214 THR A O     
1762 C CB    . THR A 214 ? 0.3552 0.4026 0.3858 -0.0230 -0.0246 0.0482  214 THR A CB    
1763 O OG1   . THR A 214 ? 0.3637 0.4267 0.3810 -0.0295 -0.0260 0.0514  214 THR A OG1   
1764 C CG2   . THR A 214 ? 0.3273 0.3614 0.3520 -0.0285 -0.0139 0.0450  214 THR A CG2   
1765 N N     . GLY A 215 ? 0.3394 0.4108 0.3533 -0.0213 -0.0295 0.0431  215 GLY A N     
1766 C CA    . GLY A 215 ? 0.3372 0.4186 0.3360 -0.0278 -0.0273 0.0393  215 GLY A CA    
1767 C C     . GLY A 215 ? 0.3030 0.4179 0.3060 -0.0288 -0.0300 0.0391  215 GLY A C     
1768 O O     . GLY A 215 ? 0.3213 0.4456 0.3339 -0.0251 -0.0344 0.0443  215 GLY A O     
1769 N N     . TRP A 216 ? 0.2879 0.4220 0.2836 -0.0340 -0.0279 0.0334  216 TRP A N     
1770 C CA    . TRP A 216 ? 0.3038 0.4800 0.3095 -0.0343 -0.0299 0.0318  216 TRP A CA    
1771 C C     . TRP A 216 ? 0.2916 0.4849 0.3157 -0.0174 -0.0330 0.0252  216 TRP A C     
1772 O O     . TRP A 216 ? 0.2926 0.4828 0.3077 -0.0209 -0.0282 0.0172  216 TRP A O     
1773 C CB    . TRP A 216 ? 0.3008 0.4957 0.2857 -0.0575 -0.0221 0.0281  216 TRP A CB    
1774 C CG    . TRP A 216 ? 0.2981 0.5427 0.2955 -0.0620 -0.0257 0.0292  216 TRP A CG    
1775 C CD1   . TRP A 216 ? 0.2718 0.5638 0.2846 -0.0605 -0.0255 0.0220  216 TRP A CD1   
1776 C CD2   . TRP A 216 ? 0.2560 0.5115 0.2529 -0.0688 -0.0309 0.0379  216 TRP A CD2   
1777 N NE1   . TRP A 216 ? 0.2735 0.6096 0.3000 -0.0637 -0.0322 0.0266  216 TRP A NE1   
1778 C CE2   . TRP A 216 ? 0.2861 0.5983 0.2999 -0.0700 -0.0366 0.0373  216 TRP A CE2   
1779 C CE3   . TRP A 216 ? 0.3175 0.5419 0.3009 -0.0752 -0.0308 0.0456  216 TRP A CE3   
1780 C CZ2   . TRP A 216 ? 0.3071 0.6446 0.3226 -0.0774 -0.0455 0.0462  216 TRP A CZ2   
1781 C CZ3   . TRP A 216 ? 0.3705 0.6152 0.3509 -0.0850 -0.0370 0.0533  216 TRP A CZ3   
1782 C CH2   . TRP A 216 ? 0.3553 0.6555 0.3506 -0.0861 -0.0460 0.0546  216 TRP A CH2   
1783 N N     . ASN A 217 ? 0.2751 0.4821 0.3213 0.0003  -0.0405 0.0285  217 ASN A N     
1784 C CA    . ASN A 217 ? 0.2561 0.4708 0.3196 0.0203  -0.0420 0.0217  217 ASN A CA    
1785 C C     . ASN A 217 ? 0.2672 0.4431 0.3237 0.0256  -0.0413 0.0177  217 ASN A C     
1786 O O     . ASN A 217 ? 0.3127 0.4900 0.3731 0.0345  -0.0384 0.0083  217 ASN A O     
1787 C CB    . ASN A 217 ? 0.2949 0.5524 0.3656 0.0176  -0.0351 0.0105  217 ASN A CB    
1788 C CG    . ASN A 217 ? 0.4008 0.7087 0.4930 0.0227  -0.0397 0.0134  217 ASN A CG    
1789 O OD1   . ASN A 217 ? 0.4955 0.8407 0.5847 0.0049  -0.0351 0.0100  217 ASN A OD1   
1790 N ND2   . ASN A 217 ? 0.3907 0.6991 0.5027 0.0462  -0.0498 0.0202  217 ASN A ND2   
1791 N N     . VAL A 218 ? 0.2705 0.4141 0.3172 0.0192  -0.0435 0.0240  218 VAL A N     
1792 C CA    . VAL A 218 ? 0.3064 0.4195 0.3480 0.0215  -0.0452 0.0212  218 VAL A CA    
1793 C C     . VAL A 218 ? 0.3391 0.4394 0.3904 0.0372  -0.0491 0.0187  218 VAL A C     
1794 O O     . VAL A 218 ? 0.3921 0.4770 0.4375 0.0386  -0.0488 0.0118  218 VAL A O     
1795 C CB    . VAL A 218 ? 0.2962 0.3855 0.3329 0.0135  -0.0468 0.0278  218 VAL A CB    
1796 C CG1   . VAL A 218 ? 0.2817 0.3698 0.3018 -0.0002 -0.0418 0.0281  218 VAL A CG1   
1797 C CG2   . VAL A 218 ? 0.3119 0.3983 0.3561 0.0145  -0.0483 0.0358  218 VAL A CG2   
1798 N N     . GLU A 219 ? 0.3295 0.4320 0.3910 0.0478  -0.0530 0.0246  219 GLU A N     
1799 C CA    . GLU A 219 ? 0.3972 0.4774 0.4618 0.0628  -0.0563 0.0232  219 GLU A CA    
1800 C C     . GLU A 219 ? 0.3837 0.4770 0.4550 0.0777  -0.0518 0.0123  219 GLU A C     
1801 O O     . GLU A 219 ? 0.4045 0.4725 0.4703 0.0853  -0.0500 0.0051  219 GLU A O     
1802 C CB    . GLU A 219 ? 0.4390 0.5096 0.5062 0.0695  -0.0631 0.0345  219 GLU A CB    
1803 C CG    . GLU A 219 ? 0.5676 0.6038 0.6305 0.0841  -0.0664 0.0343  219 GLU A CG    
1804 C CD    . GLU A 219 ? 0.6590 0.6751 0.7151 0.0863  -0.0741 0.0474  219 GLU A CD    
1805 O OE1   . GLU A 219 ? 0.6544 0.6791 0.7162 0.1032  -0.0805 0.0533  219 GLU A OE1   
1806 O OE2   . GLU A 219 ? 0.7163 0.7093 0.7613 0.0709  -0.0742 0.0518  219 GLU A OE2   
1807 N N     . SER A 220 ? 0.3334 0.4677 0.4161 0.0802  -0.0485 0.0095  220 SER A N     
1808 C CA    . SER A 220 ? 0.3574 0.5135 0.4527 0.0956  -0.0418 -0.0027 220 SER A CA    
1809 C C     . SER A 220 ? 0.3487 0.5154 0.4332 0.0819  -0.0307 -0.0166 220 SER A C     
1810 O O     . SER A 220 ? 0.3635 0.5386 0.4530 0.0915  -0.0217 -0.0303 220 SER A O     
1811 C CB    . SER A 220 ? 0.3977 0.6010 0.5169 0.1075  -0.0448 0.0008  220 SER A CB    
1812 O OG    . SER A 220 ? 0.4391 0.6759 0.5557 0.0866  -0.0434 0.0034  220 SER A OG    
1813 N N     . PHE A 221 ? 0.3722 0.5353 0.4393 0.0594  -0.0307 -0.0135 221 PHE A N     
1814 C CA    . PHE A 221 ? 0.3912 0.5570 0.4398 0.0437  -0.0221 -0.0244 221 PHE A CA    
1815 C C     . PHE A 221 ? 0.3802 0.5074 0.4036 0.0292  -0.0270 -0.0208 221 PHE A C     
1816 O O     . PHE A 221 ? 0.4255 0.5309 0.4360 0.0281  -0.0259 -0.0282 221 PHE A O     
1817 C CB    . PHE A 221 ? 0.3845 0.5893 0.4314 0.0285  -0.0156 -0.0266 221 PHE A CB    
1818 C CG    . PHE A 221 ? 0.3837 0.5865 0.4046 0.0091  -0.0062 -0.0375 221 PHE A CG    
1819 C CD1   . PHE A 221 ? 0.3554 0.5359 0.3464 -0.0122 -0.0085 -0.0314 221 PHE A CD1   
1820 C CD2   . PHE A 221 ? 0.3912 0.6101 0.4146 0.0124  0.0055  -0.0539 221 PHE A CD2   
1821 C CE1   . PHE A 221 ? 0.4039 0.5754 0.3638 -0.0315 -0.0015 -0.0395 221 PHE A CE1   
1822 C CE2   . PHE A 221 ? 0.3947 0.6083 0.3878 -0.0092 0.0149  -0.0641 221 PHE A CE2   
1823 C CZ    . PHE A 221 ? 0.3840 0.5724 0.3432 -0.0321 0.0102  -0.0558 221 PHE A CZ    
1824 N N     . ALA A 222 ? 0.3526 0.4725 0.3692 0.0184  -0.0325 -0.0099 222 ALA A N     
1825 C CA    . ALA A 222 ? 0.3873 0.4775 0.3842 0.0071  -0.0384 -0.0055 222 ALA A CA    
1826 C C     . ALA A 222 ? 0.3801 0.4436 0.3786 0.0131  -0.0459 -0.0052 222 ALA A C     
1827 O O     . ALA A 222 ? 0.3649 0.4123 0.3455 0.0057  -0.0486 -0.0096 222 ALA A O     
1828 C CB    . ALA A 222 ? 0.3144 0.3999 0.3099 0.0005  -0.0415 0.0057  222 ALA A CB    
1829 N N     . ILE A 223 ? 0.3143 0.3724 0.3305 0.0234  -0.0497 0.0001  223 ILE A N     
1830 C CA    . ILE A 223 ? 0.3505 0.3837 0.3664 0.0251  -0.0559 -0.0001 223 ILE A CA    
1831 C C     . ILE A 223 ? 0.3809 0.4020 0.3857 0.0281  -0.0520 -0.0122 223 ILE A C     
1832 O O     . ILE A 223 ? 0.4260 0.4296 0.4152 0.0185  -0.0565 -0.0157 223 ILE A O     
1833 C CB    . ILE A 223 ? 0.3472 0.3731 0.3784 0.0316  -0.0589 0.0074  223 ILE A CB    
1834 C CG1   . ILE A 223 ? 0.3280 0.3621 0.3669 0.0255  -0.0605 0.0171  223 ILE A CG1   
1835 C CG2   . ILE A 223 ? 0.3494 0.3498 0.3766 0.0287  -0.0639 0.0055  223 ILE A CG2   
1836 C CD1   . ILE A 223 ? 0.3111 0.3400 0.3602 0.0281  -0.0609 0.0240  223 ILE A CD1   
1837 N N     . PRO A 224 ? 0.3960 0.4267 0.4084 0.0417  -0.0436 -0.0192 224 PRO A N     
1838 C CA    . PRO A 224 ? 0.4174 0.4321 0.4173 0.0450  -0.0366 -0.0331 224 PRO A CA    
1839 C C     . PRO A 224 ? 0.4423 0.4622 0.4208 0.0303  -0.0311 -0.0431 224 PRO A C     
1840 O O     . PRO A 224 ? 0.4397 0.4370 0.3980 0.0240  -0.0284 -0.0530 224 PRO A O     
1841 C CB    . PRO A 224 ? 0.3912 0.4209 0.4094 0.0669  -0.0284 -0.0380 224 PRO A CB    
1842 C CG    . PRO A 224 ? 0.4024 0.4682 0.4388 0.0685  -0.0307 -0.0286 224 PRO A CG    
1843 C CD    . PRO A 224 ? 0.3649 0.4197 0.3972 0.0554  -0.0407 -0.0153 224 PRO A CD    
1844 N N     . TYR A 225 ? 0.3843 0.4293 0.3614 0.0219  -0.0290 -0.0407 225 TYR A N     
1845 C CA    . TYR A 225 ? 0.4363 0.4803 0.3856 0.0043  -0.0241 -0.0490 225 TYR A CA    
1846 C C     . TYR A 225 ? 0.4583 0.4733 0.3836 -0.0108 -0.0377 -0.0421 225 TYR A C     
1847 O O     . TYR A 225 ? 0.4916 0.4888 0.3900 -0.0228 -0.0370 -0.0504 225 TYR A O     
1848 C CB    . TYR A 225 ? 0.3887 0.4613 0.3353 -0.0050 -0.0179 -0.0483 225 TYR A CB    
1849 C CG    . TYR A 225 ? 0.4260 0.5003 0.3430 -0.0226 -0.0070 -0.0616 225 TYR A CG    
1850 C CD1   . TYR A 225 ? 0.4427 0.4883 0.3217 -0.0428 -0.0147 -0.0582 225 TYR A CD1   
1851 C CD2   . TYR A 225 ? 0.4281 0.5331 0.3546 -0.0192 0.0108  -0.0780 225 TYR A CD2   
1852 C CE1   . TYR A 225 ? 0.4787 0.5208 0.3233 -0.0625 -0.0046 -0.0701 225 TYR A CE1   
1853 C CE2   . TYR A 225 ? 0.4906 0.5977 0.3879 -0.0386 0.0237  -0.0923 225 TYR A CE2   
1854 C CZ    . TYR A 225 ? 0.5257 0.5984 0.3785 -0.0620 0.0161  -0.0881 225 TYR A CZ    
1855 O OH    . TYR A 225 ? 0.5801 0.6503 0.3967 -0.0849 0.0290  -0.1020 225 TYR A OH    
1856 N N     . VAL A 226 ? 0.4511 0.4633 0.3867 -0.0103 -0.0502 -0.0273 226 VAL A N     
1857 C CA    . VAL A 226 ? 0.4467 0.4393 0.3685 -0.0206 -0.0656 -0.0191 226 VAL A CA    
1858 C C     . VAL A 226 ? 0.4345 0.4088 0.3523 -0.0225 -0.0708 -0.0241 226 VAL A C     
1859 O O     . VAL A 226 ? 0.4533 0.4125 0.3460 -0.0365 -0.0790 -0.0257 226 VAL A O     
1860 C CB    . VAL A 226 ? 0.4255 0.4227 0.3676 -0.0153 -0.0750 -0.0045 226 VAL A CB    
1861 C CG1   . VAL A 226 ? 0.4051 0.3898 0.3437 -0.0209 -0.0920 0.0031  226 VAL A CG1   
1862 C CG2   . VAL A 226 ? 0.4615 0.4670 0.3964 -0.0184 -0.0704 0.0003  226 VAL A CG2   
1863 N N     . TYR A 227 ? 0.4526 0.4253 0.3905 -0.0106 -0.0664 -0.0263 227 TYR A N     
1864 C CA    . TYR A 227 ? 0.4428 0.3929 0.3733 -0.0147 -0.0696 -0.0316 227 TYR A CA    
1865 C C     . TYR A 227 ? 0.4719 0.4044 0.3719 -0.0233 -0.0609 -0.0471 227 TYR A C     
1866 O O     . TYR A 227 ? 0.5157 0.4297 0.3926 -0.0393 -0.0684 -0.0502 227 TYR A O     
1867 C CB    . TYR A 227 ? 0.4538 0.3974 0.4039 -0.0006 -0.0644 -0.0311 227 TYR A CB    
1868 C CG    . TYR A 227 ? 0.5368 0.4506 0.4741 -0.0079 -0.0666 -0.0364 227 TYR A CG    
1869 C CD1   . TYR A 227 ? 0.5412 0.4534 0.4827 -0.0210 -0.0795 -0.0292 227 TYR A CD1   
1870 C CD2   . TYR A 227 ? 0.6202 0.5076 0.5409 -0.0024 -0.0547 -0.0497 227 TYR A CD2   
1871 C CE1   . TYR A 227 ? 0.6041 0.4900 0.5306 -0.0327 -0.0811 -0.0349 227 TYR A CE1   
1872 C CE2   . TYR A 227 ? 0.6851 0.5379 0.5871 -0.0122 -0.0554 -0.0553 227 TYR A CE2   
1873 C CZ    . TYR A 227 ? 0.6891 0.5416 0.5925 -0.0295 -0.0689 -0.0477 227 TYR A CZ    
1874 O OH    . TYR A 227 ? 0.7545 0.5738 0.6364 -0.0441 -0.0694 -0.0539 227 TYR A OH    
1875 N N     . ASN A 228 ? 0.4330 0.3744 0.3334 -0.0137 -0.0445 -0.0577 228 ASN A N     
1876 C CA    . ASN A 228 ? 0.5142 0.4405 0.3877 -0.0203 -0.0311 -0.0758 228 ASN A CA    
1877 C C     . ASN A 228 ? 0.5431 0.4678 0.3824 -0.0434 -0.0338 -0.0785 228 ASN A C     
1878 O O     . ASN A 228 ? 0.5788 0.4807 0.3852 -0.0585 -0.0295 -0.0904 228 ASN A O     
1879 C CB    . ASN A 228 ? 0.5122 0.4553 0.4033 -0.0003 -0.0115 -0.0876 228 ASN A CB    
1880 C CG    . ASN A 228 ? 0.5441 0.4703 0.4530 0.0214  -0.0075 -0.0894 228 ASN A CG    
1881 O OD1   . ASN A 228 ? 0.5941 0.4831 0.4836 0.0173  -0.0064 -0.0961 228 ASN A OD1   
1882 N ND2   . ASN A 228 ? 0.4949 0.4449 0.4362 0.0427  -0.0064 -0.0826 228 ASN A ND2   
1883 N N     . ARG A 229 ? 0.5064 0.4500 0.3482 -0.0478 -0.0408 -0.0673 229 ARG A N     
1884 C CA    . ARG A 229 ? 0.4915 0.4269 0.2951 -0.0703 -0.0460 -0.0665 229 ARG A CA    
1885 C C     . ARG A 229 ? 0.5120 0.4249 0.2954 -0.0847 -0.0674 -0.0577 229 ARG A C     
1886 O O     . ARG A 229 ? 0.5531 0.4465 0.2961 -0.1053 -0.0699 -0.0638 229 ARG A O     
1887 C CB    . ARG A 229 ? 0.5353 0.4878 0.3428 -0.0711 -0.0494 -0.0549 229 ARG A CB    
1888 C CG    . ARG A 229 ? 0.5511 0.4890 0.3122 -0.0949 -0.0531 -0.0538 229 ARG A CG    
1889 C CD    . ARG A 229 ? 0.5767 0.5158 0.3110 -0.1084 -0.0313 -0.0747 229 ARG A CD    
1890 N NE    . ARG A 229 ? 0.6080 0.5284 0.2900 -0.1357 -0.0341 -0.0737 229 ARG A NE    
1891 C CZ    . ARG A 229 ? 0.6511 0.5670 0.2978 -0.1555 -0.0162 -0.0916 229 ARG A CZ    
1892 N NH1   . ARG A 229 ? 0.6588 0.5900 0.3221 -0.1475 0.0066  -0.1129 229 ARG A NH1   
1893 N NH2   . ARG A 229 ? 0.6737 0.5673 0.2668 -0.1831 -0.0206 -0.0884 229 ARG A NH2   
1894 N N     . ILE A 230 ? 0.5676 0.4860 0.3793 -0.0752 -0.0828 -0.0439 230 ILE A N     
1895 C CA    . ILE A 230 ? 0.5748 0.4830 0.3778 -0.0870 -0.1046 -0.0351 230 ILE A CA    
1896 C C     . ILE A 230 ? 0.6476 0.5352 0.4325 -0.0983 -0.1008 -0.0483 230 ILE A C     
1897 O O     . ILE A 230 ? 0.6850 0.5589 0.4394 -0.1191 -0.1142 -0.0480 230 ILE A O     
1898 C CB    . ILE A 230 ? 0.5180 0.4437 0.3617 -0.0739 -0.1181 -0.0199 230 ILE A CB    
1899 C CG1   . ILE A 230 ? 0.4774 0.4150 0.3303 -0.0657 -0.1230 -0.0070 230 ILE A CG1   
1900 C CG2   . ILE A 230 ? 0.5304 0.4551 0.3730 -0.0859 -0.1396 -0.0134 230 ILE A CG2   
1901 C CD1   . ILE A 230 ? 0.4141 0.3685 0.3060 -0.0528 -0.1336 0.0061  230 ILE A CD1   
1902 N N     . LYS A 231 ? 0.6058 0.4882 0.4058 -0.0854 -0.0833 -0.0593 231 LYS A N     
1903 C CA    . LYS A 231 ? 0.6473 0.5010 0.4254 -0.0950 -0.0759 -0.0737 231 LYS A CA    
1904 C C     . LYS A 231 ? 0.7016 0.5355 0.4332 -0.1137 -0.0657 -0.0891 231 LYS A C     
1905 O O     . LYS A 231 ? 0.7181 0.5285 0.4154 -0.1361 -0.0716 -0.0950 231 LYS A O     
1906 C CB    . LYS A 231 ? 0.6074 0.4524 0.4068 -0.0734 -0.0579 -0.0822 231 LYS A CB    
1907 C CG    . LYS A 231 ? 0.7772 0.5822 0.5489 -0.0822 -0.0481 -0.0977 231 LYS A CG    
1908 C CD    . LYS A 231 ? 0.8518 0.6410 0.6368 -0.0569 -0.0275 -0.1082 231 LYS A CD    
1909 C CE    . LYS A 231 ? 0.8962 0.6845 0.7102 -0.0427 -0.0344 -0.0958 231 LYS A CE    
1910 N NZ    . LYS A 231 ? 0.9639 0.7273 0.7834 -0.0181 -0.0176 -0.1043 231 LYS A NZ    
1911 N N     . ASN A 232 ? 0.6891 0.5341 0.4177 -0.1075 -0.0496 -0.0965 232 ASN A N     
1912 C CA    . ASN A 232 ? 0.7847 0.6133 0.4694 -0.1261 -0.0349 -0.1139 232 ASN A CA    
1913 C C     . ASN A 232 ? 0.8063 0.6251 0.4478 -0.1557 -0.0540 -0.1056 232 ASN A C     
1914 O O     . ASN A 232 ? 0.8569 0.6514 0.4510 -0.1797 -0.0477 -0.1188 232 ASN A O     
1915 C CB    . ASN A 232 ? 0.7868 0.6379 0.4841 -0.1131 -0.0116 -0.1247 232 ASN A CB    
1916 C CG    . ASN A 232 ? 0.7769 0.6335 0.5086 -0.0847 0.0086  -0.1369 232 ASN A CG    
1917 O OD1   . ASN A 232 ? 0.8391 0.6740 0.5788 -0.0755 0.0064  -0.1374 232 ASN A OD1   
1918 N ND2   . ASN A 232 ? 0.7387 0.6244 0.4901 -0.0710 0.0273  -0.1461 232 ASN A ND2   
1919 N N     . ILE A 233 ? 0.7580 0.5931 0.4139 -0.1536 -0.0774 -0.0837 233 ILE A N     
1920 C CA    . ILE A 233 ? 0.7803 0.6052 0.3973 -0.1769 -0.0998 -0.0716 233 ILE A CA    
1921 C C     . ILE A 233 ? 0.7723 0.5903 0.3836 -0.1895 -0.1261 -0.0619 233 ILE A C     
1922 O O     . ILE A 233 ? 0.8463 0.6447 0.4114 -0.2163 -0.1366 -0.0636 233 ILE A O     
1923 C CB    . ILE A 233 ? 0.8119 0.6529 0.4427 -0.1673 -0.1121 -0.0527 233 ILE A CB    
1924 C CG1   . ILE A 233 ? 0.7844 0.6322 0.4084 -0.1652 -0.0875 -0.0630 233 ILE A CG1   
1925 C CG2   . ILE A 233 ? 0.8747 0.7006 0.4677 -0.1864 -0.1407 -0.0362 233 ILE A CG2   
1926 C CD1   . ILE A 233 ? 0.7924 0.6496 0.4239 -0.1584 -0.0960 -0.0463 233 ILE A CD1   
1927 N N     . PHE A 234 ? 0.7392 0.5761 0.3976 -0.1723 -0.1362 -0.0521 234 PHE A N     
1928 C CA    .