data_4KHS
# 
_entry.id   4KHS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4KHS         
NDB   NA2391       
RCSB  RCSB079355   
WWPDB D_1000079355 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4KHS . unspecified 
PDB 4KHU . unspecified 
PDB 4KHW . unspecified 
PDB 4KHY . unspecified 
PDB 4KI4 . unspecified 
PDB 4KI6 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4KHS 
_pdbx_database_status.recvd_initial_deposition_date   2013-05-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Clausen, A.R.'  1 
'Pedersen, L.C.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structure-function analysis of ribonucleotide bypass by B family DNA replicases.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            110 
_citation.page_first                16802 
_citation.page_last                 16807 
_citation.year                      2013 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24082122 
_citation.pdbx_database_id_DOI      10.1073/pnas.1309119110 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Clausen, A.R.'  1 
primary 'Murray, M.S.'   2 
primary 'Passer, A.R.'   3 
primary 'Pedersen, L.C.' 4 
primary 'Kunkel, T.A.'   5 
# 
_cell.entry_id           4KHS 
_cell.length_a           80.699 
_cell.length_b           119.572 
_cell.length_c           127.800 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4KHS 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase'                                                                   104689.156 1   2.7.7.7 
'D327A, D222A, L415F' ? ? 
2 polymer     syn 
;DNA (5'-D(*GP*CP*GP*GP*AP*CP*TP*GP*CP*TP*TP*AP*CP*C)-3')
;
4256.766   1   ?       ?                     ? ? 
3 polymer     syn 
;DNA/RNA (5'-D(*AP*C)-R(P*A)-D(P*GP*GP*TP*AP*AP*GP*CP*AP*GP*TP*CP*CP*GP*CP*G)-3')
;
5566.604   1   ?       ?                     ? ? 
4 non-polymer syn 'CALCIUM ION'                                                                      40.078     3   ?       ? ? ? 
5 non-polymer syn "THYMIDINE-5'-TRIPHOSPHATE"                                                        482.168    1   ?       ? ? ? 
6 non-polymer syn 'SODIUM ION'                                                                       22.990     4   ?       ? ? ? 
7 non-polymer syn 'CHLORIDE ION'                                                                     35.453     1   ?       ? ? ? 
8 water       nat water                                                                              18.015     664 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Gp43 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'                                    no no 
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSFYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSFYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
A ? 
2 polydeoxyribonucleotide                             no no '(DG)(DC)(DG)(DG)(DA)(DC)(DT)(DG)(DC)(DT)(DT)(DA)(DC)(DC)' 
GCGGACTGCTTACC P ? 
3 'polydeoxyribonucleotide/polyribonucleotide hybrid' no no 
'(DA)(DC)A(DG)(DG)(DT)(DA)(DA)(DG)(DC)(DA)(DG)(DT)(DC)(DC)(DG)(DC)(DG)' ACAGGTAAGCAGTCCGCG T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   GLU n 
1 4   PHE n 
1 5   TYR n 
1 6   LEU n 
1 7   THR n 
1 8   VAL n 
1 9   GLU n 
1 10  GLN n 
1 11  ILE n 
1 12  GLY n 
1 13  ASP n 
1 14  SER n 
1 15  ILE n 
1 16  PHE n 
1 17  GLU n 
1 18  ARG n 
1 19  TYR n 
1 20  ILE n 
1 21  ASP n 
1 22  SER n 
1 23  ASN n 
1 24  GLY n 
1 25  ARG n 
1 26  GLU n 
1 27  ARG n 
1 28  THR n 
1 29  ARG n 
1 30  GLU n 
1 31  VAL n 
1 32  GLU n 
1 33  TYR n 
1 34  LYS n 
1 35  PRO n 
1 36  SER n 
1 37  LEU n 
1 38  PHE n 
1 39  ALA n 
1 40  HIS n 
1 41  CYS n 
1 42  PRO n 
1 43  GLU n 
1 44  SER n 
1 45  GLN n 
1 46  ALA n 
1 47  THR n 
1 48  LYS n 
1 49  TYR n 
1 50  PHE n 
1 51  ASP n 
1 52  ILE n 
1 53  TYR n 
1 54  GLY n 
1 55  LYS n 
1 56  PRO n 
1 57  CYS n 
1 58  THR n 
1 59  ARG n 
1 60  LYS n 
1 61  LEU n 
1 62  PHE n 
1 63  ALA n 
1 64  ASN n 
1 65  MET n 
1 66  ARG n 
1 67  ASP n 
1 68  ALA n 
1 69  SER n 
1 70  GLN n 
1 71  TRP n 
1 72  ILE n 
1 73  LYS n 
1 74  ARG n 
1 75  MET n 
1 76  GLU n 
1 77  ASP n 
1 78  ILE n 
1 79  GLY n 
1 80  LEU n 
1 81  GLU n 
1 82  ALA n 
1 83  LEU n 
1 84  GLY n 
1 85  MET n 
1 86  ASP n 
1 87  ASP n 
1 88  PHE n 
1 89  LYS n 
1 90  LEU n 
1 91  ALA n 
1 92  TYR n 
1 93  LEU n 
1 94  SER n 
1 95  ASP n 
1 96  THR n 
1 97  TYR n 
1 98  ASN n 
1 99  TYR n 
1 100 GLU n 
1 101 ILE n 
1 102 LYS n 
1 103 TYR n 
1 104 ASP n 
1 105 HIS n 
1 106 THR n 
1 107 LYS n 
1 108 ILE n 
1 109 ARG n 
1 110 VAL n 
1 111 ALA n 
1 112 ASN n 
1 113 PHE n 
1 114 ASP n 
1 115 ILE n 
1 116 GLU n 
1 117 VAL n 
1 118 THR n 
1 119 SER n 
1 120 PRO n 
1 121 ASP n 
1 122 GLY n 
1 123 PHE n 
1 124 PRO n 
1 125 GLU n 
1 126 PRO n 
1 127 SER n 
1 128 GLN n 
1 129 ALA n 
1 130 LYS n 
1 131 HIS n 
1 132 PRO n 
1 133 ILE n 
1 134 ASP n 
1 135 ALA n 
1 136 ILE n 
1 137 THR n 
1 138 HIS n 
1 139 TYR n 
1 140 ASP n 
1 141 SER n 
1 142 ILE n 
1 143 ASP n 
1 144 ASP n 
1 145 ARG n 
1 146 PHE n 
1 147 TYR n 
1 148 VAL n 
1 149 PHE n 
1 150 ASP n 
1 151 LEU n 
1 152 LEU n 
1 153 ASN n 
1 154 SER n 
1 155 PRO n 
1 156 TYR n 
1 157 GLY n 
1 158 ASN n 
1 159 VAL n 
1 160 GLU n 
1 161 GLU n 
1 162 TRP n 
1 163 SER n 
1 164 ILE n 
1 165 GLU n 
1 166 ILE n 
1 167 ALA n 
1 168 ALA n 
1 169 LYS n 
1 170 LEU n 
1 171 GLN n 
1 172 GLU n 
1 173 GLN n 
1 174 GLY n 
1 175 GLY n 
1 176 ASP n 
1 177 GLU n 
1 178 VAL n 
1 179 PRO n 
1 180 SER n 
1 181 GLU n 
1 182 ILE n 
1 183 ILE n 
1 184 ASP n 
1 185 LYS n 
1 186 ILE n 
1 187 ILE n 
1 188 TYR n 
1 189 MET n 
1 190 PRO n 
1 191 PHE n 
1 192 ASP n 
1 193 ASN n 
1 194 GLU n 
1 195 LYS n 
1 196 GLU n 
1 197 LEU n 
1 198 LEU n 
1 199 MET n 
1 200 GLU n 
1 201 TYR n 
1 202 LEU n 
1 203 ASN n 
1 204 PHE n 
1 205 TRP n 
1 206 GLN n 
1 207 GLN n 
1 208 LYS n 
1 209 THR n 
1 210 PRO n 
1 211 VAL n 
1 212 ILE n 
1 213 LEU n 
1 214 THR n 
1 215 GLY n 
1 216 TRP n 
1 217 ASN n 
1 218 VAL n 
1 219 GLU n 
1 220 SER n 
1 221 PHE n 
1 222 ALA n 
1 223 ILE n 
1 224 PRO n 
1 225 TYR n 
1 226 VAL n 
1 227 TYR n 
1 228 ASN n 
1 229 ARG n 
1 230 ILE n 
1 231 LYS n 
1 232 ASN n 
1 233 ILE n 
1 234 PHE n 
1 235 GLY n 
1 236 GLU n 
1 237 SER n 
1 238 THR n 
1 239 ALA n 
1 240 LYS n 
1 241 ARG n 
1 242 LEU n 
1 243 SER n 
1 244 PRO n 
1 245 HIS n 
1 246 ARG n 
1 247 LYS n 
1 248 THR n 
1 249 ARG n 
1 250 VAL n 
1 251 LYS n 
1 252 VAL n 
1 253 ILE n 
1 254 GLU n 
1 255 ASN n 
1 256 MET n 
1 257 TYR n 
1 258 GLY n 
1 259 SER n 
1 260 ARG n 
1 261 GLU n 
1 262 ILE n 
1 263 ILE n 
1 264 THR n 
1 265 LEU n 
1 266 PHE n 
1 267 GLY n 
1 268 ILE n 
1 269 SER n 
1 270 VAL n 
1 271 LEU n 
1 272 ASP n 
1 273 TYR n 
1 274 ILE n 
1 275 ASP n 
1 276 LEU n 
1 277 TYR n 
1 278 LYS n 
1 279 LYS n 
1 280 PHE n 
1 281 SER n 
1 282 PHE n 
1 283 THR n 
1 284 ASN n 
1 285 GLN n 
1 286 PRO n 
1 287 SER n 
1 288 TYR n 
1 289 SER n 
1 290 LEU n 
1 291 ASP n 
1 292 TYR n 
1 293 ILE n 
1 294 SER n 
1 295 GLU n 
1 296 PHE n 
1 297 GLU n 
1 298 LEU n 
1 299 ASN n 
1 300 VAL n 
1 301 GLY n 
1 302 LYS n 
1 303 LEU n 
1 304 LYS n 
1 305 TYR n 
1 306 ASP n 
1 307 GLY n 
1 308 PRO n 
1 309 ILE n 
1 310 SER n 
1 311 LYS n 
1 312 LEU n 
1 313 ARG n 
1 314 GLU n 
1 315 SER n 
1 316 ASN n 
1 317 HIS n 
1 318 GLN n 
1 319 ARG n 
1 320 TYR n 
1 321 ILE n 
1 322 SER n 
1 323 TYR n 
1 324 ASN n 
1 325 ILE n 
1 326 ILE n 
1 327 ALA n 
1 328 VAL n 
1 329 TYR n 
1 330 ARG n 
1 331 VAL n 
1 332 LEU n 
1 333 GLN n 
1 334 ILE n 
1 335 ASP n 
1 336 ALA n 
1 337 LYS n 
1 338 ARG n 
1 339 GLN n 
1 340 PHE n 
1 341 ILE n 
1 342 ASN n 
1 343 LEU n 
1 344 SER n 
1 345 LEU n 
1 346 ASP n 
1 347 MET n 
1 348 GLY n 
1 349 TYR n 
1 350 TYR n 
1 351 ALA n 
1 352 LYS n 
1 353 ILE n 
1 354 GLN n 
1 355 ILE n 
1 356 GLN n 
1 357 SER n 
1 358 VAL n 
1 359 PHE n 
1 360 SER n 
1 361 PRO n 
1 362 ILE n 
1 363 LYS n 
1 364 THR n 
1 365 TRP n 
1 366 ASP n 
1 367 ALA n 
1 368 ILE n 
1 369 ILE n 
1 370 PHE n 
1 371 ASN n 
1 372 SER n 
1 373 LEU n 
1 374 LYS n 
1 375 GLU n 
1 376 GLN n 
1 377 ASN n 
1 378 LYS n 
1 379 VAL n 
1 380 ILE n 
1 381 PRO n 
1 382 GLN n 
1 383 GLY n 
1 384 ARG n 
1 385 SER n 
1 386 HIS n 
1 387 PRO n 
1 388 VAL n 
1 389 GLN n 
1 390 PRO n 
1 391 TYR n 
1 392 PRO n 
1 393 GLY n 
1 394 ALA n 
1 395 PHE n 
1 396 VAL n 
1 397 LYS n 
1 398 GLU n 
1 399 PRO n 
1 400 ILE n 
1 401 PRO n 
1 402 ASN n 
1 403 ARG n 
1 404 TYR n 
1 405 LYS n 
1 406 TYR n 
1 407 VAL n 
1 408 MET n 
1 409 SER n 
1 410 PHE n 
1 411 ASP n 
1 412 LEU n 
1 413 THR n 
1 414 SER n 
1 415 PHE n 
1 416 TYR n 
1 417 PRO n 
1 418 SER n 
1 419 ILE n 
1 420 ILE n 
1 421 ARG n 
1 422 GLN n 
1 423 VAL n 
1 424 ASN n 
1 425 ILE n 
1 426 SER n 
1 427 PRO n 
1 428 GLU n 
1 429 THR n 
1 430 ILE n 
1 431 ALA n 
1 432 GLY n 
1 433 THR n 
1 434 PHE n 
1 435 LYS n 
1 436 VAL n 
1 437 ALA n 
1 438 PRO n 
1 439 LEU n 
1 440 HIS n 
1 441 ASP n 
1 442 TYR n 
1 443 ILE n 
1 444 ASN n 
1 445 ALA n 
1 446 VAL n 
1 447 ALA n 
1 448 GLU n 
1 449 ARG n 
1 450 PRO n 
1 451 SER n 
1 452 ASP n 
1 453 VAL n 
1 454 TYR n 
1 455 SER n 
1 456 CYS n 
1 457 SER n 
1 458 PRO n 
1 459 ASN n 
1 460 GLY n 
1 461 MET n 
1 462 MET n 
1 463 TYR n 
1 464 TYR n 
1 465 LYS n 
1 466 ASP n 
1 467 ARG n 
1 468 ASP n 
1 469 GLY n 
1 470 VAL n 
1 471 VAL n 
1 472 PRO n 
1 473 THR n 
1 474 GLU n 
1 475 ILE n 
1 476 THR n 
1 477 LYS n 
1 478 VAL n 
1 479 PHE n 
1 480 ASN n 
1 481 GLN n 
1 482 ARG n 
1 483 LYS n 
1 484 GLU n 
1 485 HIS n 
1 486 LYS n 
1 487 GLY n 
1 488 TYR n 
1 489 MET n 
1 490 LEU n 
1 491 ALA n 
1 492 ALA n 
1 493 GLN n 
1 494 ARG n 
1 495 ASN n 
1 496 GLY n 
1 497 GLU n 
1 498 ILE n 
1 499 ILE n 
1 500 LYS n 
1 501 GLU n 
1 502 ALA n 
1 503 LEU n 
1 504 HIS n 
1 505 ASN n 
1 506 PRO n 
1 507 ASN n 
1 508 LEU n 
1 509 SER n 
1 510 VAL n 
1 511 ASP n 
1 512 GLU n 
1 513 PRO n 
1 514 LEU n 
1 515 ASP n 
1 516 VAL n 
1 517 ASP n 
1 518 TYR n 
1 519 ARG n 
1 520 PHE n 
1 521 ASP n 
1 522 PHE n 
1 523 SER n 
1 524 ASP n 
1 525 GLU n 
1 526 ILE n 
1 527 LYS n 
1 528 GLU n 
1 529 LYS n 
1 530 ILE n 
1 531 LYS n 
1 532 LYS n 
1 533 LEU n 
1 534 SER n 
1 535 ALA n 
1 536 LYS n 
1 537 SER n 
1 538 LEU n 
1 539 ASN n 
1 540 GLU n 
1 541 MET n 
1 542 LEU n 
1 543 PHE n 
1 544 ARG n 
1 545 ALA n 
1 546 GLN n 
1 547 ARG n 
1 548 THR n 
1 549 GLU n 
1 550 VAL n 
1 551 ALA n 
1 552 GLY n 
1 553 MET n 
1 554 THR n 
1 555 ALA n 
1 556 GLN n 
1 557 ILE n 
1 558 ASN n 
1 559 ARG n 
1 560 LYS n 
1 561 LEU n 
1 562 LEU n 
1 563 ILE n 
1 564 ASN n 
1 565 SER n 
1 566 LEU n 
1 567 TYR n 
1 568 GLY n 
1 569 ALA n 
1 570 LEU n 
1 571 GLY n 
1 572 ASN n 
1 573 VAL n 
1 574 TRP n 
1 575 PHE n 
1 576 ARG n 
1 577 TYR n 
1 578 TYR n 
1 579 ASP n 
1 580 LEU n 
1 581 ARG n 
1 582 ASN n 
1 583 ALA n 
1 584 THR n 
1 585 ALA n 
1 586 ILE n 
1 587 THR n 
1 588 THR n 
1 589 PHE n 
1 590 GLY n 
1 591 GLN n 
1 592 MET n 
1 593 ALA n 
1 594 LEU n 
1 595 GLN n 
1 596 TRP n 
1 597 ILE n 
1 598 GLU n 
1 599 ARG n 
1 600 LYS n 
1 601 VAL n 
1 602 ASN n 
1 603 GLU n 
1 604 TYR n 
1 605 LEU n 
1 606 ASN n 
1 607 GLU n 
1 608 VAL n 
1 609 CYS n 
1 610 GLY n 
1 611 THR n 
1 612 GLU n 
1 613 GLY n 
1 614 GLU n 
1 615 ALA n 
1 616 PHE n 
1 617 VAL n 
1 618 LEU n 
1 619 TYR n 
1 620 GLY n 
1 621 ASP n 
1 622 THR n 
1 623 ASP n 
1 624 SER n 
1 625 ILE n 
1 626 TYR n 
1 627 VAL n 
1 628 SER n 
1 629 ALA n 
1 630 ASP n 
1 631 LYS n 
1 632 ILE n 
1 633 ILE n 
1 634 ASP n 
1 635 LYS n 
1 636 VAL n 
1 637 GLY n 
1 638 GLU n 
1 639 SER n 
1 640 LYS n 
1 641 PHE n 
1 642 ARG n 
1 643 ASP n 
1 644 THR n 
1 645 ASN n 
1 646 HIS n 
1 647 TRP n 
1 648 VAL n 
1 649 ASP n 
1 650 PHE n 
1 651 LEU n 
1 652 ASP n 
1 653 LYS n 
1 654 PHE n 
1 655 ALA n 
1 656 ARG n 
1 657 GLU n 
1 658 ARG n 
1 659 MET n 
1 660 GLU n 
1 661 PRO n 
1 662 ALA n 
1 663 ILE n 
1 664 ASP n 
1 665 ARG n 
1 666 GLY n 
1 667 PHE n 
1 668 ARG n 
1 669 GLU n 
1 670 MET n 
1 671 CYS n 
1 672 GLU n 
1 673 TYR n 
1 674 MET n 
1 675 ASN n 
1 676 ASN n 
1 677 LYS n 
1 678 GLN n 
1 679 HIS n 
1 680 LEU n 
1 681 MET n 
1 682 PHE n 
1 683 MET n 
1 684 ASP n 
1 685 ARG n 
1 686 GLU n 
1 687 ALA n 
1 688 ILE n 
1 689 ALA n 
1 690 GLY n 
1 691 PRO n 
1 692 PRO n 
1 693 LEU n 
1 694 GLY n 
1 695 SER n 
1 696 LYS n 
1 697 GLY n 
1 698 ILE n 
1 699 GLY n 
1 700 GLY n 
1 701 PHE n 
1 702 TRP n 
1 703 THR n 
1 704 GLY n 
1 705 LYS n 
1 706 LYS n 
1 707 ARG n 
1 708 TYR n 
1 709 ALA n 
1 710 LEU n 
1 711 ASN n 
1 712 VAL n 
1 713 TRP n 
1 714 ASP n 
1 715 MET n 
1 716 GLU n 
1 717 GLY n 
1 718 THR n 
1 719 ARG n 
1 720 TYR n 
1 721 ALA n 
1 722 GLU n 
1 723 PRO n 
1 724 LYS n 
1 725 LEU n 
1 726 LYS n 
1 727 ILE n 
1 728 MET n 
1 729 GLY n 
1 730 LEU n 
1 731 GLU n 
1 732 THR n 
1 733 GLN n 
1 734 LYS n 
1 735 SER n 
1 736 SER n 
1 737 THR n 
1 738 PRO n 
1 739 LYS n 
1 740 ALA n 
1 741 VAL n 
1 742 GLN n 
1 743 LYS n 
1 744 ALA n 
1 745 LEU n 
1 746 LYS n 
1 747 GLU n 
1 748 CYS n 
1 749 ILE n 
1 750 ARG n 
1 751 ARG n 
1 752 MET n 
1 753 LEU n 
1 754 GLN n 
1 755 GLU n 
1 756 GLY n 
1 757 GLU n 
1 758 GLU n 
1 759 SER n 
1 760 LEU n 
1 761 GLN n 
1 762 GLU n 
1 763 TYR n 
1 764 PHE n 
1 765 LYS n 
1 766 GLU n 
1 767 PHE n 
1 768 GLU n 
1 769 LYS n 
1 770 GLU n 
1 771 PHE n 
1 772 ARG n 
1 773 GLN n 
1 774 LEU n 
1 775 ASN n 
1 776 TYR n 
1 777 ILE n 
1 778 SER n 
1 779 ILE n 
1 780 ALA n 
1 781 SER n 
1 782 VAL n 
1 783 SER n 
1 784 SER n 
1 785 ALA n 
1 786 ASN n 
1 787 ASN n 
1 788 ILE n 
1 789 ALA n 
1 790 LYS n 
1 791 TYR n 
1 792 ASP n 
1 793 VAL n 
1 794 GLY n 
1 795 GLY n 
1 796 PHE n 
1 797 PRO n 
1 798 GLY n 
1 799 PRO n 
1 800 LYS n 
1 801 CYS n 
1 802 PRO n 
1 803 PHE n 
1 804 HIS n 
1 805 ILE n 
1 806 ARG n 
1 807 GLY n 
1 808 ILE n 
1 809 LEU n 
1 810 THR n 
1 811 TYR n 
1 812 ASN n 
1 813 ARG n 
1 814 ALA n 
1 815 ILE n 
1 816 LYS n 
1 817 GLY n 
1 818 ASN n 
1 819 ILE n 
1 820 ASP n 
1 821 ALA n 
1 822 PRO n 
1 823 GLN n 
1 824 VAL n 
1 825 VAL n 
1 826 GLU n 
1 827 GLY n 
1 828 GLU n 
1 829 LYS n 
1 830 VAL n 
1 831 TYR n 
1 832 VAL n 
1 833 LEU n 
1 834 PRO n 
1 835 LEU n 
1 836 ARG n 
1 837 GLU n 
1 838 GLY n 
1 839 ASN n 
1 840 PRO n 
1 841 PHE n 
1 842 GLY n 
1 843 ASP n 
1 844 LYS n 
1 845 CYS n 
1 846 ILE n 
1 847 ALA n 
1 848 TRP n 
1 849 PRO n 
1 850 SER n 
1 851 GLY n 
1 852 THR n 
1 853 GLU n 
1 854 ILE n 
1 855 THR n 
1 856 ASP n 
1 857 LEU n 
1 858 ILE n 
1 859 LYS n 
1 860 ASP n 
1 861 ASP n 
1 862 VAL n 
1 863 LEU n 
1 864 HIS n 
1 865 TRP n 
1 866 MET n 
1 867 ASP n 
1 868 TYR n 
1 869 THR n 
1 870 VAL n 
1 871 LEU n 
1 872 LEU n 
1 873 GLU n 
1 874 LYS n 
1 875 THR n 
1 876 PHE n 
1 877 ILE n 
1 878 LYS n 
1 879 PRO n 
1 880 LEU n 
1 881 GLU n 
1 882 GLY n 
1 883 PHE n 
1 884 THR n 
1 885 SER n 
1 886 ALA n 
1 887 ALA n 
1 888 LYS n 
1 889 LEU n 
1 890 ASP n 
1 891 TYR n 
1 892 GLU n 
1 893 LYS n 
1 894 LYS n 
1 895 ALA n 
1 896 SER n 
1 897 LEU n 
1 898 PHE n 
1 899 ASP n 
1 900 MET n 
1 901 PHE n 
1 902 ASP n 
1 903 PHE n 
2 1   DG  n 
2 2   DC  n 
2 3   DG  n 
2 4   DG  n 
2 5   DA  n 
2 6   DC  n 
2 7   DT  n 
2 8   DG  n 
2 9   DC  n 
2 10  DT  n 
2 11  DT  n 
2 12  DA  n 
2 13  DC  n 
2 14  DC  n 
3 1   DA  n 
3 2   DC  n 
3 3   A   n 
3 4   DG  n 
3 5   DG  n 
3 6   DT  n 
3 7   DA  n 
3 8   DA  n 
3 9   DG  n 
3 10  DC  n 
3 11  DA  n 
3 12  DG  n 
3 13  DT  n 
3 14  DC  n 
3 15  DC  n 
3 16  DG  n 
3 17  DC  n 
3 18  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 43 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage RB69' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     12353 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPR69 Q38087 1 
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFDIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIDVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
1 ? 
2 PDB 4KHS       4KHS   2 ? ? ? 
3 PDB 4KHS       4KHS   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4KHS A 1 ? 903 ? Q38087 1   ? 903 ? 1   903 
2 2 4KHS P 1 ? 14  ? 4KHS   102 ? 115 ? 102 115 
3 3 4KHS T 1 ? 18  ? 4KHS   1   ? 18  ? 1   18  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4KHS ALA A 222 ? UNP Q38087 ASP 222 'ENGINEERED MUTATION' 222 1 
1 4KHS ALA A 327 ? UNP Q38087 ASP 327 'ENGINEERED MUTATION' 327 2 
1 4KHS PHE A 415 ? UNP Q38087 LEU 415 'ENGINEERED MUTATION' 415 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'              40.078  
CL  non-polymer         . 'CHLORIDE ION'                       ? 'Cl -1'             35.453  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
NA  non-polymer         . 'SODIUM ION'                         ? 'Na 1'              22.990  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TTP non-polymer         . "THYMIDINE-5'-TRIPHOSPHATE"          ? 'C10 H17 N2 O14 P3' 482.168 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4KHS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.69 
_exptl_crystal.density_percent_sol   54.31 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'50 MM TRIS-HCL, 10% PEG350, 220 MM CALCIUM CHLORIDE, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 295K, pH 7.5, temperature 298K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 300 mm plate' 
_diffrn_detector.pdbx_collection_date   2010-04-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    MIRRORS 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4KHS 
_reflns.observed_criterion_sigma_I   3.100 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.100 
_reflns.number_obs                   66285 
_reflns.number_all                   66285 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.14 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4KHS 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     59378 
_refine.ls_number_reflns_all                     66285 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.077 
_refine.ls_d_res_high                            2.120 
_refine.ls_percent_reflns_obs                    98.25 
_refine.ls_R_factor_obs                          0.1801 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1762 
_refine.ls_R_factor_R_free                       0.2164 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.71 
_refine.ls_number_reflns_R_free                  6358 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -1.03410 
_refine.aniso_B[2][2]                            -3.85110 
_refine.aniso_B[3][3]                            4.88510 
_refine.aniso_B[1][2]                            -0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             1.10 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.23 
_refine.pdbx_overall_phase_error                 23.08 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7147 
_refine_hist.pdbx_number_atoms_nucleic_acid   647 
_refine_hist.pdbx_number_atoms_ligand         37 
_refine_hist.number_atoms_solvent             664 
_refine_hist.number_atoms_total               8495 
_refine_hist.d_res_high                       2.120 
_refine_hist.d_res_low                        27.077 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.009  ? ? 8219  'X-RAY DIFFRACTION' ? 
f_angle_d          0.815  ? ? 11341 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 11.606 ? ? 2741  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.056  ? ? 1200  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 1349  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.1203 2.1444  1100 0.2707 52.00  0.3084 . . 123 . . . . 
'X-RAY DIFFRACTION' . 2.1444 2.1696  2069 0.2554 98.00  0.3068 . . 205 . . . . 
'X-RAY DIFFRACTION' . 2.1696 2.1960  2107 0.2384 100.00 0.3208 . . 228 . . . . 
'X-RAY DIFFRACTION' . 2.1960 2.2238  2107 0.2455 100.00 0.2837 . . 232 . . . . 
'X-RAY DIFFRACTION' . 2.2238 2.2531  2075 0.2783 100.00 0.3219 . . 244 . . . . 
'X-RAY DIFFRACTION' . 2.2531 2.2839  2090 0.2385 100.00 0.2649 . . 218 . . . . 
'X-RAY DIFFRACTION' . 2.2839 2.3165  2116 0.2250 100.00 0.2729 . . 214 . . . . 
'X-RAY DIFFRACTION' . 2.3165 2.3511  2109 0.2191 100.00 0.3316 . . 224 . . . . 
'X-RAY DIFFRACTION' . 2.3511 2.3878  2082 0.2045 100.00 0.2564 . . 235 . . . . 
'X-RAY DIFFRACTION' . 2.3878 2.4269  2097 0.1933 100.00 0.2972 . . 237 . . . . 
'X-RAY DIFFRACTION' . 2.4269 2.4687  2115 0.1934 100.00 0.2347 . . 212 . . . . 
'X-RAY DIFFRACTION' . 2.4687 2.5136  2123 0.1909 100.00 0.2285 . . 223 . . . . 
'X-RAY DIFFRACTION' . 2.5136 2.5619  2075 0.1954 100.00 0.2585 . . 246 . . . . 
'X-RAY DIFFRACTION' . 2.5619 2.6142  2161 0.1873 100.00 0.2603 . . 201 . . . . 
'X-RAY DIFFRACTION' . 2.6142 2.6710  2093 0.1898 100.00 0.2528 . . 248 . . . . 
'X-RAY DIFFRACTION' . 2.6710 2.7330  2091 0.1900 100.00 0.2489 . . 228 . . . . 
'X-RAY DIFFRACTION' . 2.7330 2.8013  2144 0.1896 100.00 0.2725 . . 225 . . . . 
'X-RAY DIFFRACTION' . 2.8013 2.8770  2115 0.1930 100.00 0.2335 . . 230 . . . . 
'X-RAY DIFFRACTION' . 2.8770 2.9615  2098 0.1948 100.00 0.2504 . . 229 . . . . 
'X-RAY DIFFRACTION' . 2.9615 3.0570  2149 0.1967 100.00 0.2281 . . 207 . . . . 
'X-RAY DIFFRACTION' . 3.0570 3.1661  2101 0.1966 100.00 0.2418 . . 239 . . . . 
'X-RAY DIFFRACTION' . 3.1661 3.2927  2113 0.1909 100.00 0.2407 . . 263 . . . . 
'X-RAY DIFFRACTION' . 3.2927 3.4422  2141 0.1748 100.00 0.2129 . . 238 . . . . 
'X-RAY DIFFRACTION' . 3.4422 3.6233  2114 0.1693 100.00 0.1911 . . 244 . . . . 
'X-RAY DIFFRACTION' . 3.6233 3.8497  2156 0.1611 100.00 0.1874 . . 216 . . . . 
'X-RAY DIFFRACTION' . 3.8497 4.1460  2158 0.1418 100.00 0.1627 . . 221 . . . . 
'X-RAY DIFFRACTION' . 4.1460 4.5614  2173 0.1310 100.00 0.1734 . . 222 . . . . 
'X-RAY DIFFRACTION' . 4.5614 5.2174  2171 0.1284 100.00 0.1560 . . 241 . . . . 
'X-RAY DIFFRACTION' . 5.2174 6.5579  2222 0.1606 100.00 0.1797 . . 221 . . . . 
'X-RAY DIFFRACTION' . 6.5579 27.0789 2294 0.1721 99.00  0.1988 . . 235 . . . . 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    4KHS 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  4KHS 
_struct.title                     'Ternary complex of RB69 mutant L415F with a ribonucleotide at 0 position' 
_struct.pdbx_descriptor           'DNA polymerase (E.C.2.7.7.7), dna,rna' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4KHS 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'RIBONUCLEOTIDE, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 4 ? 
I N N 6 ? 
J N N 4 ? 
K N N 7 ? 
L N N 6 ? 
M N N 8 ? 
N N N 8 ? 
O N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 64  ? GLY A 79  ? ASN A 64  GLY A 79  1 ? 16 
HELX_P HELX_P2  2  ASP A 87  ? TYR A 97  ? ASP A 87  TYR A 97  1 ? 11 
HELX_P HELX_P3  3  ASP A 104 ? ILE A 108 ? ASP A 104 ILE A 108 5 ? 5  
HELX_P HELX_P4  4  SER A 163 ? LYS A 169 ? SER A 163 LYS A 169 1 ? 7  
HELX_P HELX_P5  5  LEU A 170 ? GLY A 174 ? LEU A 170 GLY A 174 5 ? 5  
HELX_P HELX_P6  6  PRO A 179 ? ASP A 184 ? PRO A 179 ASP A 184 1 ? 6  
HELX_P HELX_P7  7  ASN A 193 ? LYS A 208 ? ASN A 193 LYS A 208 1 ? 16 
HELX_P HELX_P8  8  PHE A 221 ? GLY A 235 ? PHE A 221 GLY A 235 1 ? 15 
HELX_P HELX_P9  9  GLY A 235 ? LYS A 240 ? GLY A 235 LYS A 240 1 ? 6  
HELX_P HELX_P10 10 ARG A 241 ? SER A 243 ? ARG A 241 SER A 243 5 ? 3  
HELX_P HELX_P11 11 ASP A 272 ? SER A 281 ? ASP A 272 SER A 281 1 ? 10 
HELX_P HELX_P12 12 SER A 289 ? ASN A 299 ? SER A 289 ASN A 299 1 ? 11 
HELX_P HELX_P13 13 PRO A 308 ? SER A 310 ? PRO A 308 SER A 310 5 ? 3  
HELX_P HELX_P14 14 LYS A 311 ? GLN A 339 ? LYS A 311 GLN A 339 1 ? 29 
HELX_P HELX_P15 15 GLN A 339 ? LYS A 352 ? GLN A 339 LYS A 352 1 ? 14 
HELX_P HELX_P16 16 GLN A 354 ? PHE A 359 ? GLN A 354 PHE A 359 5 ? 6  
HELX_P HELX_P17 17 SER A 360 ? GLU A 375 ? SER A 360 GLU A 375 1 ? 16 
HELX_P HELX_P18 18 SER A 414 ? ASN A 424 ? SER A 414 ASN A 424 1 ? 11 
HELX_P HELX_P19 19 PRO A 438 ? ASN A 444 ? PRO A 438 ASN A 444 1 ? 7  
HELX_P HELX_P20 20 GLY A 469 ? ALA A 502 ? GLY A 469 ALA A 502 1 ? 34 
HELX_P HELX_P21 21 LEU A 503 ? ASN A 505 ? LEU A 503 ASN A 505 5 ? 3  
HELX_P HELX_P22 22 SER A 523 ? LYS A 531 ? SER A 523 LYS A 531 1 ? 9  
HELX_P HELX_P23 23 SER A 534 ? LEU A 570 ? SER A 534 LEU A 570 1 ? 37 
HELX_P HELX_P24 24 ASP A 579 ? GLY A 610 ? ASP A 579 GLY A 610 1 ? 32 
HELX_P HELX_P25 25 ALA A 629 ? GLY A 637 ? ALA A 629 GLY A 637 1 ? 9  
HELX_P HELX_P26 26 GLU A 638 ? PHE A 641 ? GLU A 638 PHE A 641 5 ? 4  
HELX_P HELX_P27 27 ASP A 643 ? ARG A 658 ? ASP A 643 ARG A 658 1 ? 16 
HELX_P HELX_P28 28 ARG A 658 ? MET A 674 ? ARG A 658 MET A 674 1 ? 17 
HELX_P HELX_P29 29 LEU A 730 ? LYS A 734 ? LEU A 730 LYS A 734 5 ? 5  
HELX_P HELX_P30 30 PRO A 738 ? GLU A 755 ? PRO A 738 GLU A 755 1 ? 18 
HELX_P HELX_P31 31 GLY A 756 ? PHE A 771 ? GLY A 756 PHE A 771 1 ? 16 
HELX_P HELX_P32 32 ARG A 772 ? LEU A 774 ? ARG A 772 LEU A 774 5 ? 3  
HELX_P HELX_P33 33 ASN A 775 ? ALA A 780 ? ASN A 775 ALA A 780 5 ? 6  
HELX_P HELX_P34 34 ILE A 788 ? LYS A 790 ? ILE A 788 LYS A 790 5 ? 3  
HELX_P HELX_P35 35 PRO A 802 ? ILE A 815 ? PRO A 802 ILE A 815 1 ? 14 
HELX_P HELX_P36 36 ILE A 858 ? MET A 866 ? ILE A 858 MET A 866 1 ? 9  
HELX_P HELX_P37 37 ASP A 867 ? PHE A 876 ? ASP A 867 PHE A 876 1 ? 10 
HELX_P HELX_P38 38 PHE A 876 ? ALA A 887 ? PHE A 876 ALA A 887 1 ? 12 
HELX_P HELX_P39 39 SER A 896 ? PHE A 901 ? SER A 896 PHE A 901 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A LYS 531 O   ? ? ? 1_555 J CA  .  CA  ? ? A LYS 531  A CA  1007 1_555 ? ? ? ? ? ? ?            1.995 ? 
metalc2  metalc ? ? D CA  .   CA  ? ? ? 1_555 E TTP .  O2B ? ? A CA  1001 A TTP 1002 1_555 ? ? ? ? ? ? ?            2.085 ? 
metalc3  metalc ? ? D CA  .   CA  ? ? ? 1_555 E TTP .  O1G ? ? A CA  1001 A TTP 1002 1_555 ? ? ? ? ? ? ?            2.184 ? 
metalc4  metalc ? ? D CA  .   CA  ? ? ? 1_555 E TTP .  O2A ? ? A CA  1001 A TTP 1002 1_555 ? ? ? ? ? ? ?            2.237 ? 
metalc5  metalc ? ? A ASP 623 OD2 ? ? ? 1_555 D CA  .  CA  ? ? A ASP 623  A CA  1001 1_555 ? ? ? ? ? ? ?            2.284 ? 
metalc6  metalc ? ? A ASN 505 O   ? ? ? 1_555 J CA  .  CA  ? ? A ASN 505  A CA  1007 1_555 ? ? ? ? ? ? ?            2.308 ? 
metalc7  metalc ? ? A LEU 412 O   ? ? ? 1_555 D CA  .  CA  ? ? A LEU 412  A CA  1001 1_555 ? ? ? ? ? ? ?            2.364 ? 
metalc8  metalc ? ? J CA  .   CA  ? ? ? 1_555 M HOH .  O   ? ? A CA  1007 A HOH 1504 1_555 ? ? ? ? ? ? ?            2.377 ? 
metalc9  metalc ? ? I NA  .   NA  ? ? ? 1_555 M HOH .  O   ? ? A NA  1006 A HOH 1592 1_555 ? ? ? ? ? ? ?            2.381 ? 
metalc10 metalc ? ? H CA  .   CA  ? ? ? 1_555 M HOH .  O   ? ? A CA  1005 A HOH 1499 1_555 ? ? ? ? ? ? ?            2.385 ? 
metalc11 metalc ? ? A ASN 232 OD1 ? ? ? 1_555 I NA  .  NA  ? ? A ASN 232  A NA  1006 1_555 ? ? ? ? ? ? ?            2.394 ? 
metalc12 metalc ? ? L NA  .   NA  ? ? ? 1_555 M HOH .  O   ? ? A NA  1009 A HOH 1616 1_555 ? ? ? ? ? ? ?            2.396 ? 
metalc13 metalc ? ? F NA  .   NA  ? ? ? 1_555 M HOH .  O   ? ? A NA  1003 A HOH 1672 1_555 ? ? ? ? ? ? ?            2.398 ? 
metalc14 metalc ? ? H CA  .   CA  ? ? ? 1_555 M HOH .  O   ? ? A CA  1005 A HOH 1500 1_555 ? ? ? ? ? ? ?            2.405 ? 
metalc15 metalc ? ? G NA  .   NA  ? ? ? 1_555 M HOH .  O   ? ? A NA  1004 A HOH 1607 1_555 ? ? ? ? ? ? ?            2.410 ? 
metalc16 metalc ? ? A ASP 411 OD1 ? ? ? 1_555 D CA  .  CA  ? ? A ASP 411  A CA  1001 1_555 ? ? ? ? ? ? ?            2.410 ? 
metalc17 metalc ? ? L NA  .   NA  ? ? ? 1_555 M HOH .  O   ? ? A NA  1009 A HOH 1468 1_555 ? ? ? ? ? ? ?            2.412 ? 
metalc18 metalc ? ? J CA  .   CA  ? ? ? 1_555 M HOH .  O   ? ? A CA  1007 A HOH 1505 1_555 ? ? ? ? ? ? ?            2.412 ? 
metalc19 metalc ? ? I NA  .   NA  ? ? ? 1_555 M HOH .  O   ? ? A NA  1006 A HOH 1587 1_555 ? ? ? ? ? ? ?            2.412 ? 
metalc20 metalc ? ? A GLU 177 OE2 ? ? ? 1_555 G NA  .  NA  ? ? A GLU 177  A NA  1004 1_555 ? ? ? ? ? ? ?            2.413 ? 
metalc21 metalc ? ? F NA  .   NA  ? ? ? 1_555 M HOH .  O   ? ? A NA  1003 A HOH 1497 1_555 ? ? ? ? ? ? ?            2.415 ? 
metalc22 metalc ? ? G NA  .   NA  ? ? ? 1_555 M HOH .  O   ? ? A NA  1004 A HOH 1608 1_555 ? ? ? ? ? ? ?            2.415 ? 
metalc23 metalc ? ? I NA  .   NA  ? ? ? 1_555 M HOH .  O   ? ? A NA  1006 A HOH 1328 1_555 ? ? ? ? ? ? ?            2.419 ? 
metalc24 metalc ? ? J CA  .   CA  ? ? ? 1_555 M HOH .  O   ? ? A CA  1007 A HOH 1646 1_555 ? ? ? ? ? ? ?            2.422 ? 
metalc25 metalc ? ? J CA  .   CA  ? ? ? 1_555 M HOH .  O   ? ? A CA  1007 A HOH 1506 1_555 ? ? ? ? ? ? ?            2.425 ? 
metalc26 metalc ? ? F NA  .   NA  ? ? ? 1_555 M HOH .  O   ? ? A NA  1003 A HOH 1606 1_555 ? ? ? ? ? ? ?            2.429 ? 
metalc27 metalc ? ? A ASN 507 OD1 ? ? ? 1_555 J CA  .  CA  ? ? A ASN 507  A CA  1007 1_555 ? ? ? ? ? ? ?            2.434 ? 
metalc28 metalc ? ? A GLU 196 OE2 ? ? ? 1_555 H CA  .  CA  ? ? A GLU 196  A CA  1005 1_555 ? ? ? ? ? ? ?            2.435 ? 
metalc29 metalc ? ? G NA  .   NA  ? ? ? 1_555 M HOH .  O   ? ? A NA  1004 A HOH 1523 1_555 ? ? ? ? ? ? ?            2.439 ? 
metalc30 metalc ? ? A ASP 411 OD2 ? ? ? 1_555 D CA  .  CA  ? ? A ASP 411  A CA  1001 1_555 ? ? ? ? ? ? ?            2.444 ? 
metalc31 metalc ? ? F NA  .   NA  ? ? ? 1_555 M HOH .  O   ? ? A NA  1003 A HOH 1613 1_555 ? ? ? ? ? ? ?            2.444 ? 
metalc32 metalc ? ? A GLU 716 OE1 ? ? ? 1_555 L NA  .  NA  ? ? A GLU 716  A NA  1009 1_555 ? ? ? ? ? ? ?            2.460 ? 
metalc33 metalc ? ? A ASP 192 OD2 ? ? ? 1_555 H CA  .  CA  ? ? A ASP 192  A CA  1005 1_555 ? ? ? ? ? ? ?            2.471 ? 
metalc34 metalc ? ? A GLU 172 OE2 ? ? ? 1_555 G NA  .  NA  ? ? A GLU 172  A NA  1004 1_555 ? ? ? ? ? ? ?            2.483 ? 
metalc35 metalc ? ? A GLU 196 OE1 ? ? ? 1_555 H CA  .  CA  ? ? A GLU 196  A CA  1005 1_555 ? ? ? ? ? ? ?            2.491 ? 
metalc36 metalc ? ? A ASP 192 OD1 ? ? ? 1_555 H CA  .  CA  ? ? A ASP 192  A CA  1005 1_555 ? ? ? ? ? ? ?            2.497 ? 
metalc37 metalc ? ? A ASP 114 OD2 ? ? ? 1_555 F NA  .  NA  ? ? A ASP 114  A NA  1003 1_555 ? ? ? ? ? ? ?            2.503 ? 
metalc38 metalc ? ? A GLU 116 OE2 ? ? ? 1_555 F NA  .  NA  ? ? A GLU 116  A NA  1003 1_555 ? ? ? ? ? ? ?            2.507 ? 
metalc39 metalc ? ? A GLU 686 OE1 ? ? ? 1_555 L NA  .  NA  ? ? A GLU 686  A NA  1009 1_555 ? ? ? ? ? ? ?            2.552 ? 
metalc40 metalc ? ? A ILE 115 O   ? ? ? 1_555 F NA  .  NA  ? ? A ILE 115  A NA  1003 1_555 ? ? ? ? ? ? ?            2.722 ? 
metalc41 metalc ? ? A GLU 172 OE1 ? ? ? 1_555 G NA  .  NA  ? ? A GLU 172  A NA  1004 1_555 ? ? ? ? ? ? ?            3.102 ? 
hydrog1  hydrog ? ? B DG  1   N1  ? ? ? 1_555 C DC  17 N3  ? ? P DG  102  T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  1   N2  ? ? ? 1_555 C DC  17 O2  ? ? P DG  102  T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  1   O6  ? ? ? 1_555 C DC  17 N4  ? ? P DG  102  T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DC  2   N3  ? ? ? 1_555 C DG  16 N1  ? ? P DC  103  T DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DC  2   N4  ? ? ? 1_555 C DG  16 O6  ? ? P DC  103  T DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DC  2   O2  ? ? ? 1_555 C DG  16 N2  ? ? P DC  103  T DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  3   N1  ? ? ? 1_555 C DC  15 N3  ? ? P DG  104  T DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  3   N2  ? ? ? 1_555 C DC  15 O2  ? ? P DG  104  T DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  3   O6  ? ? ? 1_555 C DC  15 N4  ? ? P DG  104  T DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DG  4   N1  ? ? ? 1_555 C DC  14 N3  ? ? P DG  105  T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  4   N2  ? ? ? 1_555 C DC  14 O2  ? ? P DG  105  T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  4   O6  ? ? ? 1_555 C DC  14 N4  ? ? P DG  105  T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DA  5   N1  ? ? ? 1_555 C DT  13 N3  ? ? P DA  106  T DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DA  5   N6  ? ? ? 1_555 C DT  13 O4  ? ? P DA  106  T DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DC  6   N3  ? ? ? 1_555 C DG  12 N1  ? ? P DC  107  T DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  6   N4  ? ? ? 1_555 C DG  12 O6  ? ? P DC  107  T DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  6   O2  ? ? ? 1_555 C DG  12 N2  ? ? P DC  107  T DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DT  7   N3  ? ? ? 1_555 C DA  11 N1  ? ? P DT  108  T DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  7   O4  ? ? ? 1_555 C DA  11 N6  ? ? P DT  108  T DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DG  8   N1  ? ? ? 1_555 C DC  10 N3  ? ? P DG  109  T DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DG  8   N2  ? ? ? 1_555 C DC  10 O2  ? ? P DG  109  T DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DG  8   O6  ? ? ? 1_555 C DC  10 N4  ? ? P DG  109  T DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DC  9   N3  ? ? ? 1_555 C DG  9  N1  ? ? P DC  110  T DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DC  9   N4  ? ? ? 1_555 C DG  9  O6  ? ? P DC  110  T DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DC  9   O2  ? ? ? 1_555 C DG  9  N2  ? ? P DC  110  T DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DT  10  N3  ? ? ? 1_555 C DA  8  N1  ? ? P DT  111  T DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DT  10  O4  ? ? ? 1_555 C DA  8  N6  ? ? P DT  111  T DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DT  11  N3  ? ? ? 1_555 C DA  7  N1  ? ? P DT  112  T DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DT  11  O4  ? ? ? 1_555 C DA  7  N6  ? ? P DT  112  T DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DA  12  N1  ? ? ? 1_555 C DT  6  N3  ? ? P DA  113  T DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DA  12  N6  ? ? ? 1_555 C DT  6  O4  ? ? P DA  113  T DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DC  13  N3  ? ? ? 1_555 C DG  5  N1  ? ? P DC  114  T DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DC  13  N4  ? ? ? 1_555 C DG  5  O6  ? ? P DC  114  T DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DC  13  O2  ? ? ? 1_555 C DG  5  N2  ? ? P DC  114  T DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? B DC  14  N3  ? ? ? 1_555 C DG  4  N1  ? ? P DC  115  T DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? B DC  14  N4  ? ? ? 1_555 C DG  4  O6  ? ? P DC  115  T DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? B DC  14  O2  ? ? ? 1_555 C DG  4  N2  ? ? P DC  115  T DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 2 ? 
D ? 6 ? 
E ? 2 ? 
F ? 2 ? 
G ? 7 ? 
H ? 4 ? 
I ? 3 ? 
J ? 3 ? 
K ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
G 6 7 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 4   ? ILE A 11  ? PHE A 4   ILE A 11  
A 2 SER A 14  ? ILE A 20  ? SER A 14  ILE A 20  
A 3 GLU A 26  ? VAL A 31  ? GLU A 26  VAL A 31  
B 1 SER A 36  ? HIS A 40  ? SER A 36  HIS A 40  
B 2 CYS A 57  ? LEU A 61  ? CYS A 57  LEU A 61  
C 1 PHE A 50  ? ASP A 51  ? PHE A 50  ASP A 51  
C 2 LYS A 378 ? VAL A 379 ? LYS A 378 VAL A 379 
D 1 ILE A 186 ? PHE A 191 ? ILE A 186 PHE A 191 
D 2 ARG A 145 ? LEU A 151 ? ARG A 145 LEU A 151 
D 3 ILE A 133 ? ASP A 140 ? ILE A 133 ASP A 140 
D 4 VAL A 110 ? VAL A 117 ? VAL A 110 VAL A 117 
D 5 ILE A 212 ? THR A 214 ? ILE A 212 THR A 214 
D 6 SER A 269 ? VAL A 270 ? SER A 269 VAL A 270 
E 1 ASN A 153 ? SER A 154 ? ASN A 153 SER A 154 
E 2 GLY A 157 ? ASN A 158 ? GLY A 157 ASN A 158 
F 1 THR A 248 ? ARG A 249 ? THR A 248 ARG A 249 
F 2 THR A 264 ? LEU A 265 ? THR A 264 LEU A 265 
G 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
G 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
G 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
G 4 MET A 683 ? ALA A 689 ? MET A 683 ALA A 689 
G 5 VAL A 407 ? LEU A 412 ? VAL A 407 LEU A 412 
G 6 SER A 624 ? SER A 628 ? SER A 624 SER A 628 
G 7 VAL A 617 ? ASP A 621 ? VAL A 617 ASP A 621 
H 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
H 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
H 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
H 4 THR A 718 ? MET A 728 ? THR A 718 MET A 728 
I 1 ILE A 430 ? THR A 433 ? ILE A 430 THR A 433 
I 2 MET A 461 ? TYR A 463 ? MET A 461 TYR A 463 
I 3 SER A 455 ? CYS A 456 ? SER A 455 CYS A 456 
J 1 SER A 781 ? SER A 784 ? SER A 781 SER A 784 
J 2 LYS A 829 ? PRO A 834 ? LYS A 829 PRO A 834 
J 3 CYS A 845 ? PRO A 849 ? CYS A 845 PRO A 849 
K 1 ASP A 792 ? VAL A 793 ? ASP A 792 VAL A 793 
K 2 PHE A 796 ? PRO A 797 ? PHE A 796 PRO A 797 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 6   ? N LEU A 6   O ARG A 18  ? O ARG A 18  
A 2 3 N TYR A 19  ? N TYR A 19  O ARG A 27  ? O ARG A 27  
B 1 2 N LEU A 37  ? N LEU A 37  O LYS A 60  ? O LYS A 60  
C 1 2 N PHE A 50  ? N PHE A 50  O VAL A 379 ? O VAL A 379 
D 1 2 O ILE A 187 ? O ILE A 187 N PHE A 146 ? N PHE A 146 
D 2 3 O PHE A 149 ? O PHE A 149 N ILE A 136 ? N ILE A 136 
D 3 4 O TYR A 139 ? O TYR A 139 N ASN A 112 ? N ASN A 112 
D 4 5 N ALA A 111 ? N ALA A 111 O THR A 214 ? O THR A 214 
D 5 6 N LEU A 213 ? N LEU A 213 O SER A 269 ? O SER A 269 
E 1 2 N SER A 154 ? N SER A 154 O GLY A 157 ? O GLY A 157 
F 1 2 N ARG A 249 ? N ARG A 249 O THR A 264 ? O THR A 264 
G 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
G 2 3 N THR A 703 ? N THR A 703 O ARG A 707 ? O ARG A 707 
G 3 4 O TRP A 713 ? O TRP A 713 N ILE A 688 ? N ILE A 688 
G 4 5 O ALA A 689 ? O ALA A 689 N VAL A 407 ? N VAL A 407 
G 5 6 N MET A 408 ? N MET A 408 O VAL A 627 ? O VAL A 627 
G 6 7 O TYR A 626 ? O TYR A 626 N TYR A 619 ? N TYR A 619 
H 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
H 2 3 N THR A 703 ? N THR A 703 O ARG A 707 ? O ARG A 707 
H 3 4 N LEU A 710 ? N LEU A 710 O LYS A 726 ? O LYS A 726 
I 1 2 N ALA A 431 ? N ALA A 431 O MET A 462 ? O MET A 462 
I 2 3 O TYR A 463 ? O TYR A 463 N SER A 455 ? N SER A 455 
J 1 2 N SER A 783 ? N SER A 783 O VAL A 830 ? O VAL A 830 
J 2 3 N TYR A 831 ? N TYR A 831 O TRP A 848 ? O TRP A 848 
K 1 2 N VAL A 793 ? N VAL A 793 O PHE A 796 ? O PHE A 796 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 1001'  
AC2 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE TTP A 1002' 
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NA A 1003'  
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 1004'  
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 1005'  
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 1006'  
AC7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 1007'  
AC8 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL A 1008'  
AC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 1009'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ASP A 411 ? ASP A 411  . ? 1_555 ? 
2  AC1 4  LEU A 412 ? LEU A 412  . ? 1_555 ? 
3  AC1 4  ASP A 623 ? ASP A 623  . ? 1_555 ? 
4  AC1 4  TTP E .   ? TTP A 1002 . ? 1_555 ? 
5  AC2 21 ASP A 411 ? ASP A 411  . ? 1_555 ? 
6  AC2 21 LEU A 412 ? LEU A 412  . ? 1_555 ? 
7  AC2 21 THR A 413 ? THR A 413  . ? 1_555 ? 
8  AC2 21 SER A 414 ? SER A 414  . ? 1_555 ? 
9  AC2 21 PHE A 415 ? PHE A 415  . ? 1_555 ? 
10 AC2 21 TYR A 416 ? TYR A 416  . ? 1_555 ? 
11 AC2 21 ARG A 482 ? ARG A 482  . ? 1_555 ? 
12 AC2 21 LYS A 486 ? LYS A 486  . ? 1_555 ? 
13 AC2 21 LYS A 560 ? LYS A 560  . ? 1_555 ? 
14 AC2 21 ASN A 564 ? ASN A 564  . ? 1_555 ? 
15 AC2 21 ASP A 623 ? ASP A 623  . ? 1_555 ? 
16 AC2 21 CA  D .   ? CA  A 1001 . ? 1_555 ? 
17 AC2 21 HOH M .   ? HOH A 1108 . ? 1_555 ? 
18 AC2 21 HOH M .   ? HOH A 1137 . ? 1_555 ? 
19 AC2 21 HOH M .   ? HOH A 1193 . ? 1_555 ? 
20 AC2 21 HOH M .   ? HOH A 1363 . ? 1_555 ? 
21 AC2 21 HOH M .   ? HOH A 1473 . ? 1_555 ? 
22 AC2 21 HOH M .   ? HOH A 1654 . ? 1_555 ? 
23 AC2 21 DC  B 14  ? DC  P 115  . ? 1_555 ? 
24 AC2 21 A   C 3   ? A   T 3    . ? 1_555 ? 
25 AC2 21 DG  C 4   ? DG  T 4    . ? 1_555 ? 
26 AC3 7  ASP A 114 ? ASP A 114  . ? 1_555 ? 
27 AC3 7  ILE A 115 ? ILE A 115  . ? 1_555 ? 
28 AC3 7  GLU A 116 ? GLU A 116  . ? 1_555 ? 
29 AC3 7  HOH M .   ? HOH A 1497 . ? 1_555 ? 
30 AC3 7  HOH M .   ? HOH A 1606 . ? 1_555 ? 
31 AC3 7  HOH M .   ? HOH A 1613 . ? 1_555 ? 
32 AC3 7  HOH M .   ? HOH A 1672 . ? 1_555 ? 
33 AC4 5  GLU A 172 ? GLU A 172  . ? 1_555 ? 
34 AC4 5  GLU A 177 ? GLU A 177  . ? 1_555 ? 
35 AC4 5  HOH M .   ? HOH A 1523 . ? 1_555 ? 
36 AC4 5  HOH M .   ? HOH A 1607 . ? 1_555 ? 
37 AC4 5  HOH M .   ? HOH A 1608 . ? 1_555 ? 
38 AC5 6  ASP A 192 ? ASP A 192  . ? 1_555 ? 
39 AC5 6  GLU A 196 ? GLU A 196  . ? 1_555 ? 
40 AC5 6  ASP A 860 ? ASP A 860  . ? 4_545 ? 
41 AC5 6  HOH M .   ? HOH A 1486 . ? 4_545 ? 
42 AC5 6  HOH M .   ? HOH A 1499 . ? 1_555 ? 
43 AC5 6  HOH M .   ? HOH A 1500 . ? 1_555 ? 
44 AC6 4  ASN A 232 ? ASN A 232  . ? 1_555 ? 
45 AC6 4  HOH M .   ? HOH A 1328 . ? 1_555 ? 
46 AC6 4  HOH M .   ? HOH A 1587 . ? 1_555 ? 
47 AC6 4  HOH M .   ? HOH A 1592 . ? 1_555 ? 
48 AC7 7  ASN A 505 ? ASN A 505  . ? 1_555 ? 
49 AC7 7  ASN A 507 ? ASN A 507  . ? 1_555 ? 
50 AC7 7  LYS A 531 ? LYS A 531  . ? 1_555 ? 
51 AC7 7  HOH M .   ? HOH A 1504 . ? 1_555 ? 
52 AC7 7  HOH M .   ? HOH A 1505 . ? 1_555 ? 
53 AC7 7  HOH M .   ? HOH A 1506 . ? 1_555 ? 
54 AC7 7  HOH M .   ? HOH A 1646 . ? 1_555 ? 
55 AC8 1  ARG A 482 ? ARG A 482  . ? 1_555 ? 
56 AC9 4  GLU A 686 ? GLU A 686  . ? 1_555 ? 
57 AC9 4  GLU A 716 ? GLU A 716  . ? 1_555 ? 
58 AC9 4  HOH M .   ? HOH A 1468 . ? 1_555 ? 
59 AC9 4  HOH M .   ? HOH A 1616 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4KHS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4KHS 
_atom_sites.fract_transf_matrix[1][1]   0.012392 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008363 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007825 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? 37.689  -20.581 -33.361 1.00 71.48  ? 1    MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? 36.491  -20.107 -34.032 1.00 70.17  ? 1    MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? 36.361  -18.599 -33.899 1.00 67.11  ? 1    MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? 37.039  -17.973 -33.084 1.00 66.11  ? 1    MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? 35.249  -20.785 -33.453 1.00 73.26  ? 1    MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? 35.121  -20.646 -31.940 1.00 75.59  ? 1    MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? 33.504  -21.120 -31.290 1.00 101.02 ? 1    MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? 33.425  -22.855 -31.743 1.00 59.53  ? 1    MET A CE    1 
ATOM   9    N  N     . LYS A 1 2   ? 35.483  -18.019 -34.710 1.00 64.43  ? 2    LYS A N     1 
ATOM   10   C  CA    . LYS A 1 2   ? 35.177  -16.596 -34.611 1.00 61.36  ? 2    LYS A CA    1 
ATOM   11   C  C     . LYS A 1 2   ? 34.383  -16.309 -33.340 1.00 52.99  ? 2    LYS A C     1 
ATOM   12   O  O     . LYS A 1 2   ? 33.478  -17.060 -32.983 1.00 51.88  ? 2    LYS A O     1 
ATOM   13   C  CB    . LYS A 1 2   ? 34.409  -16.112 -35.845 1.00 64.81  ? 2    LYS A CB    1 
ATOM   14   C  CG    . LYS A 1 2   ? 35.294  -15.485 -36.914 1.00 69.48  ? 2    LYS A CG    1 
ATOM   15   C  CD    . LYS A 1 2   ? 35.959  -14.216 -36.389 1.00 72.79  ? 2    LYS A CD    1 
ATOM   16   C  CE    . LYS A 1 2   ? 36.884  -13.579 -37.422 1.00 76.54  ? 2    LYS A CE    1 
ATOM   17   N  NZ    . LYS A 1 2   ? 36.149  -13.093 -38.623 1.00 77.50  ? 2    LYS A NZ    1 
ATOM   18   N  N     . GLU A 1 3   ? 34.734  -15.223 -32.658 1.00 49.01  ? 3    GLU A N     1 
ATOM   19   C  CA    . GLU A 1 3   ? 34.089  -14.870 -31.400 1.00 47.54  ? 3    GLU A CA    1 
ATOM   20   C  C     . GLU A 1 3   ? 32.665  -14.366 -31.614 1.00 40.97  ? 3    GLU A C     1 
ATOM   21   O  O     . GLU A 1 3   ? 32.337  -13.826 -32.671 1.00 39.67  ? 3    GLU A O     1 
ATOM   22   C  CB    . GLU A 1 3   ? 34.908  -13.812 -30.666 1.00 50.30  ? 3    GLU A CB    1 
ATOM   23   C  CG    . GLU A 1 3   ? 36.387  -14.133 -30.609 1.00 60.98  ? 3    GLU A CG    1 
ATOM   24   C  CD    . GLU A 1 3   ? 37.168  -13.133 -29.791 1.00 68.82  ? 3    GLU A CD    1 
ATOM   25   O  OE1   . GLU A 1 3   ? 38.391  -13.007 -30.014 1.00 77.28  ? 3    GLU A OE1   1 
ATOM   26   O  OE2   . GLU A 1 3   ? 36.560  -12.479 -28.919 1.00 68.38  ? 3    GLU A OE2   1 
ATOM   27   N  N     . PHE A 1 4   ? 31.813  -14.558 -30.613 1.00 39.71  ? 4    PHE A N     1 
ATOM   28   C  CA    . PHE A 1 4   ? 30.457  -14.020 -30.668 1.00 33.94  ? 4    PHE A CA    1 
ATOM   29   C  C     . PHE A 1 4   ? 29.941  -13.650 -29.284 1.00 35.32  ? 4    PHE A C     1 
ATOM   30   O  O     . PHE A 1 4   ? 30.295  -14.281 -28.291 1.00 35.19  ? 4    PHE A O     1 
ATOM   31   C  CB    . PHE A 1 4   ? 29.498  -14.971 -31.400 1.00 32.40  ? 4    PHE A CB    1 
ATOM   32   C  CG    . PHE A 1 4   ? 29.301  -16.302 -30.720 1.00 35.58  ? 4    PHE A CG    1 
ATOM   33   C  CD1   . PHE A 1 4   ? 28.189  -16.529 -29.922 1.00 32.47  ? 4    PHE A CD1   1 
ATOM   34   C  CD2   . PHE A 1 4   ? 30.211  -17.332 -30.899 1.00 36.95  ? 4    PHE A CD2   1 
ATOM   35   C  CE1   . PHE A 1 4   ? 27.993  -17.753 -29.303 1.00 31.79  ? 4    PHE A CE1   1 
ATOM   36   C  CE2   . PHE A 1 4   ? 30.022  -18.562 -30.280 1.00 36.75  ? 4    PHE A CE2   1 
ATOM   37   C  CZ    . PHE A 1 4   ? 28.907  -18.771 -29.483 1.00 33.13  ? 4    PHE A CZ    1 
ATOM   38   N  N     . TYR A 1 5   ? 29.117  -12.609 -29.226 1.00 34.17  ? 5    TYR A N     1 
ATOM   39   C  CA    . TYR A 1 5   ? 28.580  -12.141 -27.959 1.00 33.74  ? 5    TYR A CA    1 
ATOM   40   C  C     . TYR A 1 5   ? 27.473  -13.064 -27.466 1.00 34.35  ? 5    TYR A C     1 
ATOM   41   O  O     . TYR A 1 5   ? 26.895  -13.830 -28.236 1.00 29.59  ? 5    TYR A O     1 
ATOM   42   C  CB    . TYR A 1 5   ? 28.069  -10.699 -28.073 1.00 35.81  ? 5    TYR A CB    1 
ATOM   43   C  CG    . TYR A 1 5   ? 26.845  -10.533 -28.956 1.00 34.43  ? 5    TYR A CG    1 
ATOM   44   C  CD1   . TYR A 1 5   ? 25.566  -10.550 -28.418 1.00 28.07  ? 5    TYR A CD1   1 
ATOM   45   C  CD2   . TYR A 1 5   ? 26.976  -10.347 -30.324 1.00 33.27  ? 5    TYR A CD2   1 
ATOM   46   C  CE1   . TYR A 1 5   ? 24.445  -10.397 -29.221 1.00 27.31  ? 5    TYR A CE1   1 
ATOM   47   C  CE2   . TYR A 1 5   ? 25.868  -10.192 -31.133 1.00 31.03  ? 5    TYR A CE2   1 
ATOM   48   C  CZ    . TYR A 1 5   ? 24.607  -10.220 -30.579 1.00 31.35  ? 5    TYR A CZ    1 
ATOM   49   O  OH    . TYR A 1 5   ? 23.516  -10.068 -31.396 1.00 27.86  ? 5    TYR A OH    1 
ATOM   50   N  N     . LEU A 1 6   ? 27.194  -12.986 -26.169 1.00 34.31  ? 6    LEU A N     1 
ATOM   51   C  CA    . LEU A 1 6   ? 26.084  -13.710 -25.568 1.00 29.22  ? 6    LEU A CA    1 
ATOM   52   C  C     . LEU A 1 6   ? 25.032  -12.707 -25.118 1.00 31.75  ? 6    LEU A C     1 
ATOM   53   O  O     . LEU A 1 6   ? 23.880  -12.764 -25.541 1.00 27.57  ? 6    LEU A O     1 
ATOM   54   C  CB    . LEU A 1 6   ? 26.570  -14.533 -24.376 1.00 30.02  ? 6    LEU A CB    1 
ATOM   55   C  CG    . LEU A 1 6   ? 27.516  -15.682 -24.720 1.00 33.47  ? 6    LEU A CG    1 
ATOM   56   C  CD1   . LEU A 1 6   ? 28.133  -16.269 -23.458 1.00 36.99  ? 6    LEU A CD1   1 
ATOM   57   C  CD2   . LEU A 1 6   ? 26.771  -16.750 -25.504 1.00 32.90  ? 6    LEU A CD2   1 
ATOM   58   N  N     . THR A 1 7   ? 25.443  -11.791 -24.248 1.00 32.03  ? 7    THR A N     1 
ATOM   59   C  CA    . THR A 1 7   ? 24.575  -10.727 -23.763 1.00 31.91  ? 7    THR A CA    1 
ATOM   60   C  C     . THR A 1 7   ? 25.374  -9.431  -23.702 1.00 33.96  ? 7    THR A C     1 
ATOM   61   O  O     . THR A 1 7   ? 26.600  -9.453  -23.585 1.00 34.39  ? 7    THR A O     1 
ATOM   62   C  CB    . THR A 1 7   ? 24.039  -11.024 -22.345 1.00 30.42  ? 7    THR A CB    1 
ATOM   63   O  OG1   . THR A 1 7   ? 25.137  -11.108 -21.430 1.00 33.18  ? 7    THR A OG1   1 
ATOM   64   C  CG2   . THR A 1 7   ? 23.258  -12.336 -22.313 1.00 28.54  ? 7    THR A CG2   1 
ATOM   65   N  N     . VAL A 1 8   ? 24.677  -8.304  -23.781 1.00 32.06  ? 8    VAL A N     1 
ATOM   66   C  CA    . VAL A 1 8   ? 25.310  -7.008  -23.601 1.00 32.44  ? 8    VAL A CA    1 
ATOM   67   C  C     . VAL A 1 8   ? 24.371  -6.105  -22.807 1.00 36.05  ? 8    VAL A C     1 
ATOM   68   O  O     . VAL A 1 8   ? 23.153  -6.204  -22.942 1.00 33.20  ? 8    VAL A O     1 
ATOM   69   C  CB    . VAL A 1 8   ? 25.690  -6.364  -24.958 1.00 34.94  ? 8    VAL A CB    1 
ATOM   70   C  CG1   . VAL A 1 8   ? 24.447  -5.940  -25.736 1.00 32.43  ? 8    VAL A CG1   1 
ATOM   71   C  CG2   . VAL A 1 8   ? 26.616  -5.186  -24.746 1.00 38.57  ? 8    VAL A CG2   1 
ATOM   72   N  N     . GLU A 1 9   ? 24.937  -5.259  -21.950 1.00 35.49  ? 9    GLU A N     1 
ATOM   73   C  CA    . GLU A 1 9   ? 24.158  -4.292  -21.182 1.00 35.36  ? 9    GLU A CA    1 
ATOM   74   C  C     . GLU A 1 9   ? 24.941  -2.996  -21.039 1.00 39.26  ? 9    GLU A C     1 
ATOM   75   O  O     . GLU A 1 9   ? 26.169  -2.987  -21.144 1.00 38.09  ? 9    GLU A O     1 
ATOM   76   C  CB    . GLU A 1 9   ? 23.845  -4.819  -19.776 1.00 38.46  ? 9    GLU A CB    1 
ATOM   77   C  CG    . GLU A 1 9   ? 23.165  -6.175  -19.712 1.00 42.15  ? 9    GLU A CG    1 
ATOM   78   C  CD    . GLU A 1 9   ? 21.680  -6.117  -20.021 1.00 43.81  ? 9    GLU A CD    1 
ATOM   79   O  OE1   . GLU A 1 9   ? 21.170  -5.025  -20.360 1.00 41.84  ? 9    GLU A OE1   1 
ATOM   80   O  OE2   . GLU A 1 9   ? 21.023  -7.175  -19.921 1.00 43.03  ? 9    GLU A OE2   1 
ATOM   81   N  N     . GLN A 1 10  ? 24.226  -1.903  -20.791 1.00 37.38  ? 10   GLN A N     1 
ATOM   82   C  CA    . GLN A 1 10  ? 24.864  -0.645  -20.428 1.00 37.98  ? 10   GLN A CA    1 
ATOM   83   C  C     . GLN A 1 10  ? 24.524  -0.315  -18.984 1.00 39.86  ? 10   GLN A C     1 
ATOM   84   O  O     . GLN A 1 10  ? 23.354  -0.265  -18.612 1.00 42.95  ? 10   GLN A O     1 
ATOM   85   C  CB    . GLN A 1 10  ? 24.415  0.498   -21.342 1.00 37.17  ? 10   GLN A CB    1 
ATOM   86   C  CG    . GLN A 1 10  ? 25.002  1.847   -20.943 1.00 38.69  ? 10   GLN A CG    1 
ATOM   87   C  CD    . GLN A 1 10  ? 24.384  3.019   -21.694 1.00 42.92  ? 10   GLN A CD    1 
ATOM   88   O  OE1   . GLN A 1 10  ? 23.677  2.838   -22.685 1.00 42.83  ? 10   GLN A OE1   1 
ATOM   89   N  NE2   . GLN A 1 10  ? 24.648  4.230   -21.215 1.00 43.44  ? 10   GLN A NE2   1 
ATOM   90   N  N     . ILE A 1 11  ? 25.551  -0.106  -18.170 1.00 42.22  ? 11   ILE A N     1 
ATOM   91   C  CA    . ILE A 1 11  ? 25.364  0.296   -16.782 1.00 44.97  ? 11   ILE A CA    1 
ATOM   92   C  C     . ILE A 1 11  ? 26.277  1.479   -16.489 1.00 48.00  ? 11   ILE A C     1 
ATOM   93   O  O     . ILE A 1 11  ? 27.481  1.313   -16.288 1.00 48.19  ? 11   ILE A O     1 
ATOM   94   C  CB    . ILE A 1 11  ? 25.679  -0.855  -15.803 1.00 46.36  ? 11   ILE A CB    1 
ATOM   95   C  CG1   . ILE A 1 11  ? 24.829  -2.085  -16.129 1.00 45.04  ? 11   ILE A CG1   1 
ATOM   96   C  CG2   . ILE A 1 11  ? 25.442  -0.411  -14.368 1.00 47.33  ? 11   ILE A CG2   1 
ATOM   97   C  CD1   . ILE A 1 11  ? 25.148  -3.292  -15.278 1.00 48.21  ? 11   ILE A CD1   1 
ATOM   98   N  N     . GLY A 1 12  ? 25.703  2.676   -16.475 1.00 51.99  ? 12   GLY A N     1 
ATOM   99   C  CA    . GLY A 1 12  ? 26.493  3.885   -16.338 1.00 50.37  ? 12   GLY A CA    1 
ATOM   100  C  C     . GLY A 1 12  ? 27.380  4.073   -17.553 1.00 46.85  ? 12   GLY A C     1 
ATOM   101  O  O     . GLY A 1 12  ? 26.907  4.018   -18.689 1.00 46.97  ? 12   GLY A O     1 
ATOM   102  N  N     . ASP A 1 13  ? 28.671  4.283   -17.315 1.00 44.90  ? 13   ASP A N     1 
ATOM   103  C  CA    . ASP A 1 13  ? 29.629  4.475   -18.397 1.00 46.39  ? 13   ASP A CA    1 
ATOM   104  C  C     . ASP A 1 13  ? 30.272  3.165   -18.835 1.00 45.26  ? 13   ASP A C     1 
ATOM   105  O  O     . ASP A 1 13  ? 31.239  3.162   -19.593 1.00 44.90  ? 13   ASP A O     1 
ATOM   106  C  CB    . ASP A 1 13  ? 30.712  5.477   -17.986 1.00 51.06  ? 13   ASP A CB    1 
ATOM   107  C  CG    . ASP A 1 13  ? 30.165  6.876   -17.790 1.00 55.39  ? 13   ASP A CG    1 
ATOM   108  O  OD1   . ASP A 1 13  ? 29.098  7.183   -18.365 1.00 54.42  ? 13   ASP A OD1   1 
ATOM   109  O  OD2   . ASP A 1 13  ? 30.804  7.670   -17.067 1.00 60.20  ? 13   ASP A OD2   1 
ATOM   110  N  N     . SER A 1 14  ? 29.729  2.049   -18.366 1.00 45.76  ? 14   SER A N     1 
ATOM   111  C  CA    . SER A 1 14  ? 30.302  0.751   -18.691 1.00 45.60  ? 14   SER A CA    1 
ATOM   112  C  C     . SER A 1 14  ? 29.394  -0.096  -19.574 1.00 43.64  ? 14   SER A C     1 
ATOM   113  O  O     . SER A 1 14  ? 28.173  -0.116  -19.404 1.00 40.57  ? 14   SER A O     1 
ATOM   114  C  CB    . SER A 1 14  ? 30.647  -0.021  -17.416 1.00 46.51  ? 14   SER A CB    1 
ATOM   115  O  OG    . SER A 1 14  ? 31.888  0.399   -16.885 1.00 48.96  ? 14   SER A OG    1 
ATOM   116  N  N     . ILE A 1 15  ? 30.008  -0.784  -20.529 1.00 41.57  ? 15   ILE A N     1 
ATOM   117  C  CA    . ILE A 1 15  ? 29.327  -1.829  -21.269 1.00 38.08  ? 15   ILE A CA    1 
ATOM   118  C  C     . ILE A 1 15  ? 29.731  -3.160  -20.660 1.00 38.18  ? 15   ILE A C     1 
ATOM   119  O  O     . ILE A 1 15  ? 30.918  -3.487  -20.597 1.00 42.95  ? 15   ILE A O     1 
ATOM   120  C  CB    . ILE A 1 15  ? 29.708  -1.822  -22.757 1.00 38.60  ? 15   ILE A CB    1 
ATOM   121  C  CG1   . ILE A 1 15  ? 29.093  -0.613  -23.459 1.00 35.62  ? 15   ILE A CG1   1 
ATOM   122  C  CG2   . ILE A 1 15  ? 29.249  -3.107  -23.426 1.00 39.18  ? 15   ILE A CG2   1 
ATOM   123  C  CD1   . ILE A 1 15  ? 27.583  -0.571  -23.401 1.00 35.39  ? 15   ILE A CD1   1 
ATOM   124  N  N     . PHE A 1 16  ? 28.746  -3.911  -20.184 1.00 35.00  ? 16   PHE A N     1 
ATOM   125  C  CA    . PHE A 1 16  ? 28.990  -5.240  -19.645 1.00 35.51  ? 16   PHE A CA    1 
ATOM   126  C  C     . PHE A 1 16  ? 28.629  -6.291  -20.686 1.00 36.88  ? 16   PHE A C     1 
ATOM   127  O  O     . PHE A 1 16  ? 27.475  -6.388  -21.108 1.00 33.32  ? 16   PHE A O     1 
ATOM   128  C  CB    . PHE A 1 16  ? 28.183  -5.456  -18.363 1.00 37.71  ? 16   PHE A CB    1 
ATOM   129  C  CG    . PHE A 1 16  ? 28.813  -4.848  -17.140 1.00 45.01  ? 16   PHE A CG    1 
ATOM   130  C  CD1   . PHE A 1 16  ? 29.562  -5.626  -16.271 1.00 48.34  ? 16   PHE A CD1   1 
ATOM   131  C  CD2   . PHE A 1 16  ? 28.661  -3.500  -16.863 1.00 47.68  ? 16   PHE A CD2   1 
ATOM   132  C  CE1   . PHE A 1 16  ? 30.144  -5.072  -15.145 1.00 50.98  ? 16   PHE A CE1   1 
ATOM   133  C  CE2   . PHE A 1 16  ? 29.243  -2.939  -15.738 1.00 50.66  ? 16   PHE A CE2   1 
ATOM   134  C  CZ    . PHE A 1 16  ? 29.984  -3.727  -14.879 1.00 52.02  ? 16   PHE A CZ    1 
ATOM   135  N  N     . GLU A 1 17  ? 29.618  -7.072  -21.107 1.00 37.40  ? 17   GLU A N     1 
ATOM   136  C  CA    . GLU A 1 17  ? 29.386  -8.078  -22.131 1.00 36.09  ? 17   GLU A CA    1 
ATOM   137  C  C     . GLU A 1 17  ? 29.794  -9.478  -21.698 1.00 36.34  ? 17   GLU A C     1 
ATOM   138  O  O     . GLU A 1 17  ? 30.897  -9.694  -21.200 1.00 38.01  ? 17   GLU A O     1 
ATOM   139  C  CB    . GLU A 1 17  ? 30.120  -7.733  -23.428 1.00 37.96  ? 17   GLU A CB    1 
ATOM   140  C  CG    . GLU A 1 17  ? 29.915  -8.792  -24.507 1.00 37.36  ? 17   GLU A CG    1 
ATOM   141  C  CD    . GLU A 1 17  ? 30.885  -8.681  -25.662 1.00 39.37  ? 17   GLU A CD    1 
ATOM   142  O  OE1   . GLU A 1 17  ? 31.908  -7.977  -25.528 1.00 38.34  ? 17   GLU A OE1   1 
ATOM   143  O  OE2   . GLU A 1 17  ? 30.622  -9.314  -26.706 1.00 42.07  ? 17   GLU A OE2   1 
ATOM   144  N  N     . ARG A 1 18  ? 28.886  -10.427 -21.896 1.00 33.70  ? 18   ARG A N     1 
ATOM   145  C  CA    . ARG A 1 18  ? 29.225  -11.837 -21.812 1.00 33.60  ? 18   ARG A CA    1 
ATOM   146  C  C     . ARG A 1 18  ? 29.422  -12.321 -23.239 1.00 32.85  ? 18   ARG A C     1 
ATOM   147  O  O     . ARG A 1 18  ? 28.656  -11.952 -24.130 1.00 32.32  ? 18   ARG A O     1 
ATOM   148  C  CB    . ARG A 1 18  ? 28.105  -12.616 -21.126 1.00 32.19  ? 18   ARG A CB    1 
ATOM   149  C  CG    . ARG A 1 18  ? 27.825  -12.145 -19.705 1.00 37.19  ? 18   ARG A CG    1 
ATOM   150  C  CD    . ARG A 1 18  ? 26.565  -12.776 -19.143 1.00 35.91  ? 18   ARG A CD    1 
ATOM   151  N  NE    . ARG A 1 18  ? 26.692  -14.221 -18.972 1.00 34.12  ? 18   ARG A NE    1 
ATOM   152  C  CZ    . ARG A 1 18  ? 25.661  -15.042 -18.795 1.00 38.20  ? 18   ARG A CZ    1 
ATOM   153  N  NH1   . ARG A 1 18  ? 24.424  -14.558 -18.778 1.00 30.48  ? 18   ARG A NH1   1 
ATOM   154  N  NH2   . ARG A 1 18  ? 25.862  -16.346 -18.644 1.00 31.91  ? 18   ARG A NH2   1 
ATOM   155  N  N     . TYR A 1 19  ? 30.458  -13.123 -23.466 1.00 33.72  ? 19   TYR A N     1 
ATOM   156  C  CA    . TYR A 1 19  ? 30.768  -13.579 -24.815 1.00 33.76  ? 19   TYR A CA    1 
ATOM   157  C  C     . TYR A 1 19  ? 31.531  -14.899 -24.836 1.00 37.69  ? 19   TYR A C     1 
ATOM   158  O  O     . TYR A 1 19  ? 32.056  -15.345 -23.817 1.00 38.59  ? 19   TYR A O     1 
ATOM   159  C  CB    . TYR A 1 19  ? 31.566  -12.511 -25.569 1.00 35.32  ? 19   TYR A CB    1 
ATOM   160  C  CG    . TYR A 1 19  ? 32.980  -12.317 -25.065 1.00 37.51  ? 19   TYR A CG    1 
ATOM   161  C  CD1   . TYR A 1 19  ? 34.063  -12.831 -25.766 1.00 40.76  ? 19   TYR A CD1   1 
ATOM   162  C  CD2   . TYR A 1 19  ? 33.234  -11.618 -23.889 1.00 38.29  ? 19   TYR A CD2   1 
ATOM   163  C  CE1   . TYR A 1 19  ? 35.363  -12.651 -25.315 1.00 44.08  ? 19   TYR A CE1   1 
ATOM   164  C  CE2   . TYR A 1 19  ? 34.532  -11.438 -23.427 1.00 41.74  ? 19   TYR A CE2   1 
ATOM   165  C  CZ    . TYR A 1 19  ? 35.588  -11.953 -24.145 1.00 44.91  ? 19   TYR A CZ    1 
ATOM   166  O  OH    . TYR A 1 19  ? 36.875  -11.776 -23.691 1.00 50.78  ? 19   TYR A OH    1 
ATOM   167  N  N     . ILE A 1 20  ? 31.576  -15.515 -26.012 1.00 34.97  ? 20   ILE A N     1 
ATOM   168  C  CA    . ILE A 1 20  ? 32.370  -16.712 -26.240 1.00 38.51  ? 20   ILE A CA    1 
ATOM   169  C  C     . ILE A 1 20  ? 33.624  -16.316 -27.011 1.00 42.66  ? 20   ILE A C     1 
ATOM   170  O  O     . ILE A 1 20  ? 33.530  -15.709 -28.080 1.00 42.36  ? 20   ILE A O     1 
ATOM   171  C  CB    . ILE A 1 20  ? 31.583  -17.746 -27.066 1.00 37.21  ? 20   ILE A CB    1 
ATOM   172  C  CG1   . ILE A 1 20  ? 30.322  -18.188 -26.316 1.00 34.47  ? 20   ILE A CG1   1 
ATOM   173  C  CG2   . ILE A 1 20  ? 32.463  -18.940 -27.406 1.00 37.30  ? 20   ILE A CG2   1 
ATOM   174  C  CD1   . ILE A 1 20  ? 30.602  -18.925 -25.029 1.00 35.28  ? 20   ILE A CD1   1 
ATOM   175  N  N     . ASP A 1 21  ? 34.797  -16.648 -26.475 1.00 45.51  ? 21   ASP A N     1 
ATOM   176  C  CA    . ASP A 1 21  ? 36.051  -16.230 -27.103 1.00 45.78  ? 21   ASP A CA    1 
ATOM   177  C  C     . ASP A 1 21  ? 36.512  -17.145 -28.242 1.00 48.24  ? 21   ASP A C     1 
ATOM   178  O  O     . ASP A 1 21  ? 35.818  -18.090 -28.619 1.00 47.11  ? 21   ASP A O     1 
ATOM   179  C  CB    . ASP A 1 21  ? 37.171  -16.023 -26.066 1.00 43.19  ? 21   ASP A CB    1 
ATOM   180  C  CG    . ASP A 1 21  ? 37.578  -17.308 -25.346 1.00 44.23  ? 21   ASP A CG    1 
ATOM   181  O  OD1   . ASP A 1 21  ? 37.363  -18.418 -25.876 1.00 45.61  ? 21   ASP A OD1   1 
ATOM   182  O  OD2   . ASP A 1 21  ? 38.138  -17.200 -24.236 1.00 45.99  ? 21   ASP A OD2   1 
ATOM   183  N  N     . SER A 1 22  ? 37.696  -16.856 -28.770 1.00 49.10  ? 22   SER A N     1 
ATOM   184  C  CA    . SER A 1 22  ? 38.236  -17.577 -29.915 1.00 52.96  ? 22   SER A CA    1 
ATOM   185  C  C     . SER A 1 22  ? 38.551  -19.039 -29.604 1.00 53.71  ? 22   SER A C     1 
ATOM   186  O  O     . SER A 1 22  ? 38.760  -19.841 -30.513 1.00 55.46  ? 22   SER A O     1 
ATOM   187  C  CB    . SER A 1 22  ? 39.488  -16.871 -30.433 1.00 58.46  ? 22   SER A CB    1 
ATOM   188  O  OG    . SER A 1 22  ? 40.439  -16.718 -29.394 1.00 64.41  ? 22   SER A OG    1 
ATOM   189  N  N     . ASN A 1 23  ? 38.587  -19.384 -28.321 1.00 52.48  ? 23   ASN A N     1 
ATOM   190  C  CA    . ASN A 1 23  ? 38.813  -20.767 -27.913 1.00 55.46  ? 23   ASN A CA    1 
ATOM   191  C  C     . ASN A 1 23  ? 37.538  -21.432 -27.400 1.00 53.74  ? 23   ASN A C     1 
ATOM   192  O  O     . ASN A 1 23  ? 37.581  -22.517 -26.824 1.00 53.16  ? 23   ASN A O     1 
ATOM   193  C  CB    . ASN A 1 23  ? 39.929  -20.853 -26.868 1.00 57.37  ? 23   ASN A CB    1 
ATOM   194  C  CG    . ASN A 1 23  ? 41.256  -20.337 -27.393 1.00 59.18  ? 23   ASN A CG    1 
ATOM   195  O  OD1   . ASN A 1 23  ? 41.816  -19.374 -26.867 1.00 56.50  ? 23   ASN A OD1   1 
ATOM   196  N  ND2   . ASN A 1 23  ? 41.763  -20.973 -28.443 1.00 62.70  ? 23   ASN A ND2   1 
ATOM   197  N  N     . GLY A 1 24  ? 36.405  -20.768 -27.613 1.00 50.07  ? 24   GLY A N     1 
ATOM   198  C  CA    . GLY A 1 24  ? 35.110  -21.343 -27.293 1.00 47.10  ? 24   GLY A CA    1 
ATOM   199  C  C     . GLY A 1 24  ? 34.720  -21.263 -25.829 1.00 46.54  ? 24   GLY A C     1 
ATOM   200  O  O     . GLY A 1 24  ? 33.801  -21.951 -25.392 1.00 47.31  ? 24   GLY A O     1 
ATOM   201  N  N     . ARG A 1 25  ? 35.408  -20.417 -25.070 1.00 47.14  ? 25   ARG A N     1 
ATOM   202  C  CA    . ARG A 1 25  ? 35.145  -20.288 -23.641 1.00 49.37  ? 25   ARG A CA    1 
ATOM   203  C  C     . ARG A 1 25  ? 34.315  -19.047 -23.316 1.00 44.54  ? 25   ARG A C     1 
ATOM   204  O  O     . ARG A 1 25  ? 34.557  -17.967 -23.858 1.00 42.66  ? 25   ARG A O     1 
ATOM   205  C  CB    . ARG A 1 25  ? 36.463  -20.270 -22.864 1.00 58.26  ? 25   ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 25  ? 36.325  -19.957 -21.385 1.00 65.48  ? 25   ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 25  ? 37.598  -20.317 -20.633 1.00 75.60  ? 25   ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 25  ? 37.654  -19.685 -19.319 1.00 81.27  ? 25   ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 25  ? 38.614  -19.902 -18.427 1.00 86.65  ? 25   ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 25  ? 39.599  -20.747 -18.703 1.00 89.26  ? 25   ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 25  ? 38.587  -19.278 -17.257 1.00 88.18  ? 25   ARG A NH2   1 
ATOM   212  N  N     . GLU A 1 26  ? 33.334  -19.203 -22.432 1.00 41.74  ? 26   GLU A N     1 
ATOM   213  C  CA    . GLU A 1 26  ? 32.513  -18.073 -22.011 1.00 41.58  ? 26   GLU A CA    1 
ATOM   214  C  C     . GLU A 1 26  ? 33.294  -17.141 -21.098 1.00 41.18  ? 26   GLU A C     1 
ATOM   215  O  O     . GLU A 1 26  ? 33.892  -17.575 -20.115 1.00 40.55  ? 26   GLU A O     1 
ATOM   216  C  CB    . GLU A 1 26  ? 31.232  -18.532 -21.306 1.00 40.64  ? 26   GLU A CB    1 
ATOM   217  C  CG    . GLU A 1 26  ? 30.421  -17.370 -20.731 1.00 40.61  ? 26   GLU A CG    1 
ATOM   218  C  CD    . GLU A 1 26  ? 29.084  -17.791 -20.138 1.00 42.16  ? 26   GLU A CD    1 
ATOM   219  O  OE1   . GLU A 1 26  ? 28.534  -18.837 -20.552 1.00 37.53  ? 26   GLU A OE1   1 
ATOM   220  O  OE2   . GLU A 1 26  ? 28.581  -17.066 -19.253 1.00 43.05  ? 26   GLU A OE2   1 
ATOM   221  N  N     . ARG A 1 27  ? 33.281  -15.854 -21.427 1.00 38.56  ? 27   ARG A N     1 
ATOM   222  C  CA    . ARG A 1 27  ? 33.940  -14.851 -20.604 1.00 43.85  ? 27   ARG A CA    1 
ATOM   223  C  C     . ARG A 1 27  ? 33.055  -13.630 -20.421 1.00 40.66  ? 27   ARG A C     1 
ATOM   224  O  O     . ARG A 1 27  ? 32.048  -13.466 -21.111 1.00 39.68  ? 27   ARG A O     1 
ATOM   225  C  CB    . ARG A 1 27  ? 35.292  -14.454 -21.204 1.00 47.69  ? 27   ARG A CB    1 
ATOM   226  C  CG    . ARG A 1 27  ? 36.293  -15.598 -21.238 1.00 54.34  ? 27   ARG A CG    1 
ATOM   227  C  CD    . ARG A 1 27  ? 37.672  -15.134 -21.657 1.00 60.70  ? 27   ARG A CD    1 
ATOM   228  N  NE    . ARG A 1 27  ? 38.591  -16.258 -21.809 1.00 64.70  ? 27   ARG A NE    1 
ATOM   229  C  CZ    . ARG A 1 27  ? 39.394  -16.708 -20.849 1.00 65.73  ? 27   ARG A CZ    1 
ATOM   230  N  NH1   . ARG A 1 27  ? 39.401  -16.130 -19.656 1.00 65.34  ? 27   ARG A NH1   1 
ATOM   231  N  NH2   . ARG A 1 27  ? 40.194  -17.737 -21.085 1.00 66.58  ? 27   ARG A NH2   1 
ATOM   232  N  N     . THR A 1 28  ? 33.428  -12.787 -19.470 1.00 40.98  ? 28   THR A N     1 
ATOM   233  C  CA    . THR A 1 28  ? 32.704  -11.555 -19.209 1.00 41.01  ? 28   THR A CA    1 
ATOM   234  C  C     . THR A 1 28  ? 33.714  -10.425 -19.106 1.00 44.02  ? 28   THR A C     1 
ATOM   235  O  O     . THR A 1 28  ? 34.776  -10.589 -18.504 1.00 46.59  ? 28   THR A O     1 
ATOM   236  C  CB    . THR A 1 28  ? 31.884  -11.646 -17.906 1.00 43.89  ? 28   THR A CB    1 
ATOM   237  O  OG1   . THR A 1 28  ? 30.921  -12.701 -18.019 1.00 51.14  ? 28   THR A OG1   1 
ATOM   238  C  CG2   . THR A 1 28  ? 31.154  -10.339 -17.630 1.00 41.22  ? 28   THR A CG2   1 
ATOM   239  N  N     . ARG A 1 29  ? 33.392  -9.288  -19.712 1.00 42.93  ? 29   ARG A N     1 
ATOM   240  C  CA    . ARG A 1 29  ? 34.250  -8.115  -19.629 1.00 46.80  ? 29   ARG A CA    1 
ATOM   241  C  C     . ARG A 1 29  ? 33.440  -6.842  -19.446 1.00 47.68  ? 29   ARG A C     1 
ATOM   242  O  O     . ARG A 1 29  ? 32.334  -6.706  -19.974 1.00 45.20  ? 29   ARG A O     1 
ATOM   243  C  CB    . ARG A 1 29  ? 35.144  -7.998  -20.866 1.00 48.53  ? 29   ARG A CB    1 
ATOM   244  C  CG    . ARG A 1 29  ? 34.393  -7.874  -22.183 1.00 47.38  ? 29   ARG A CG    1 
ATOM   245  C  CD    . ARG A 1 29  ? 35.357  -7.969  -23.358 1.00 48.75  ? 29   ARG A CD    1 
ATOM   246  N  NE    . ARG A 1 29  ? 34.660  -8.180  -24.623 1.00 48.27  ? 29   ARG A NE    1 
ATOM   247  C  CZ    . ARG A 1 29  ? 35.243  -8.629  -25.730 1.00 46.04  ? 29   ARG A CZ    1 
ATOM   248  N  NH1   . ARG A 1 29  ? 36.535  -8.923  -25.728 1.00 47.55  ? 29   ARG A NH1   1 
ATOM   249  N  NH2   . ARG A 1 29  ? 34.533  -8.795  -26.837 1.00 42.81  ? 29   ARG A NH2   1 
ATOM   250  N  N     . GLU A 1 30  ? 33.996  -5.921  -18.668 1.00 48.62  ? 30   GLU A N     1 
ATOM   251  C  CA    . GLU A 1 30  ? 33.421  -4.599  -18.505 1.00 50.12  ? 30   GLU A CA    1 
ATOM   252  C  C     . GLU A 1 30  ? 34.243  -3.640  -19.346 1.00 49.22  ? 30   GLU A C     1 
ATOM   253  O  O     . GLU A 1 30  ? 35.462  -3.562  -19.202 1.00 50.04  ? 30   GLU A O     1 
ATOM   254  C  CB    . GLU A 1 30  ? 33.442  -4.176  -17.037 1.00 55.64  ? 30   GLU A CB    1 
ATOM   255  C  CG    . GLU A 1 30  ? 32.928  -2.766  -16.793 1.00 58.99  ? 30   GLU A CG    1 
ATOM   256  C  CD    . GLU A 1 30  ? 33.080  -2.329  -15.346 1.00 63.94  ? 30   GLU A CD    1 
ATOM   257  O  OE1   . GLU A 1 30  ? 33.598  -3.122  -14.531 1.00 63.77  ? 30   GLU A OE1   1 
ATOM   258  O  OE2   . GLU A 1 30  ? 32.681  -1.188  -15.026 1.00 65.93  ? 30   GLU A OE2   1 
ATOM   259  N  N     . VAL A 1 31  ? 33.575  -2.923  -20.240 1.00 48.28  ? 31   VAL A N     1 
ATOM   260  C  CA    . VAL A 1 31  ? 34.268  -2.036  -21.162 1.00 47.92  ? 31   VAL A CA    1 
ATOM   261  C  C     . VAL A 1 31  ? 33.802  -0.587  -21.023 1.00 47.32  ? 31   VAL A C     1 
ATOM   262  O  O     . VAL A 1 31  ? 32.618  -0.285  -21.171 1.00 45.46  ? 31   VAL A O     1 
ATOM   263  C  CB    . VAL A 1 31  ? 34.099  -2.492  -22.625 1.00 47.31  ? 31   VAL A CB    1 
ATOM   264  C  CG1   . VAL A 1 31  ? 34.716  -1.475  -23.565 1.00 49.13  ? 31   VAL A CG1   1 
ATOM   265  C  CG2   . VAL A 1 31  ? 34.735  -3.864  -22.844 1.00 44.57  ? 31   VAL A CG2   1 
ATOM   266  N  N     . GLU A 1 32  ? 34.742  0.306   -20.729 1.00 47.74  ? 32   GLU A N     1 
ATOM   267  C  CA    . GLU A 1 32  ? 34.435  1.727   -20.659 1.00 48.56  ? 32   GLU A CA    1 
ATOM   268  C  C     . GLU A 1 32  ? 34.336  2.265   -22.086 1.00 44.05  ? 32   GLU A C     1 
ATOM   269  O  O     . GLU A 1 32  ? 35.251  2.916   -22.587 1.00 47.14  ? 32   GLU A O     1 
ATOM   270  C  CB    . GLU A 1 32  ? 35.507  2.469   -19.859 1.00 52.20  ? 32   GLU A CB    1 
ATOM   271  C  CG    . GLU A 1 32  ? 35.001  3.714   -19.148 1.00 57.47  ? 32   GLU A CG    1 
ATOM   272  N  N     . TYR A 1 33  ? 33.212  1.970   -22.732 1.00 39.62  ? 33   TYR A N     1 
ATOM   273  C  CA    . TYR A 1 33  ? 33.017  2.247   -24.150 1.00 38.18  ? 33   TYR A CA    1 
ATOM   274  C  C     . TYR A 1 33  ? 32.996  3.740   -24.469 1.00 41.03  ? 33   TYR A C     1 
ATOM   275  O  O     . TYR A 1 33  ? 32.358  4.531   -23.770 1.00 39.46  ? 33   TYR A O     1 
ATOM   276  C  CB    . TYR A 1 33  ? 31.717  1.591   -24.613 1.00 35.94  ? 33   TYR A CB    1 
ATOM   277  C  CG    . TYR A 1 33  ? 31.407  1.731   -26.087 1.00 36.30  ? 33   TYR A CG    1 
ATOM   278  C  CD1   . TYR A 1 33  ? 32.279  1.246   -27.058 1.00 37.67  ? 33   TYR A CD1   1 
ATOM   279  C  CD2   . TYR A 1 33  ? 30.222  2.315   -26.504 1.00 33.43  ? 33   TYR A CD2   1 
ATOM   280  C  CE1   . TYR A 1 33  ? 31.972  1.359   -28.414 1.00 35.77  ? 33   TYR A CE1   1 
ATOM   281  C  CE2   . TYR A 1 33  ? 29.910  2.429   -27.836 1.00 35.80  ? 33   TYR A CE2   1 
ATOM   282  C  CZ    . TYR A 1 33  ? 30.775  1.955   -28.787 1.00 35.64  ? 33   TYR A CZ    1 
ATOM   283  O  OH    . TYR A 1 33  ? 30.428  2.098   -30.112 1.00 32.55  ? 33   TYR A OH    1 
ATOM   284  N  N     . LYS A 1 34  ? 33.701  4.109   -25.533 1.00 40.97  ? 34   LYS A N     1 
ATOM   285  C  CA    . LYS A 1 34  ? 33.737  5.486   -26.005 1.00 42.48  ? 34   LYS A CA    1 
ATOM   286  C  C     . LYS A 1 34  ? 32.945  5.604   -27.300 1.00 38.78  ? 34   LYS A C     1 
ATOM   287  O  O     . LYS A 1 34  ? 33.436  5.257   -28.375 1.00 38.71  ? 34   LYS A O     1 
ATOM   288  C  CB    . LYS A 1 34  ? 35.182  5.947   -26.213 1.00 45.89  ? 34   LYS A CB    1 
ATOM   289  C  CG    . LYS A 1 34  ? 35.983  6.061   -24.923 1.00 52.89  ? 34   LYS A CG    1 
ATOM   290  C  CD    . LYS A 1 34  ? 37.474  6.240   -25.192 1.00 61.42  ? 34   LYS A CD    1 
ATOM   291  C  CE    . LYS A 1 34  ? 38.115  4.940   -25.664 1.00 66.25  ? 34   LYS A CE    1 
ATOM   292  N  N     . PRO A 1 35  ? 31.703  6.090   -27.197 1.00 38.49  ? 35   PRO A N     1 
ATOM   293  C  CA    . PRO A 1 35  ? 30.814  6.146   -28.358 1.00 38.21  ? 35   PRO A CA    1 
ATOM   294  C  C     . PRO A 1 35  ? 31.096  7.358   -29.227 1.00 39.09  ? 35   PRO A C     1 
ATOM   295  O  O     . PRO A 1 35  ? 31.713  8.317   -28.765 1.00 42.02  ? 35   PRO A O     1 
ATOM   296  C  CB    . PRO A 1 35  ? 29.429  6.269   -27.722 1.00 34.82  ? 35   PRO A CB    1 
ATOM   297  C  CG    . PRO A 1 35  ? 29.682  7.014   -26.453 1.00 37.53  ? 35   PRO A CG    1 
ATOM   298  C  CD    . PRO A 1 35  ? 31.047  6.577   -25.970 1.00 39.79  ? 35   PRO A CD    1 
ATOM   299  N  N     . SER A 1 36  ? 30.657  7.303   -30.478 1.00 38.45  ? 36   SER A N     1 
ATOM   300  C  CA    . SER A 1 36  ? 30.752  8.446   -31.371 1.00 38.28  ? 36   SER A CA    1 
ATOM   301  C  C     . SER A 1 36  ? 29.359  8.855   -31.840 1.00 38.77  ? 36   SER A C     1 
ATOM   302  O  O     . SER A 1 36  ? 28.512  8.008   -32.107 1.00 37.44  ? 36   SER A O     1 
ATOM   303  C  CB    . SER A 1 36  ? 31.629  8.117   -32.580 1.00 40.70  ? 36   SER A CB    1 
ATOM   304  O  OG    . SER A 1 36  ? 33.003  8.045   -32.226 1.00 43.28  ? 36   SER A OG    1 
ATOM   305  N  N     . LEU A 1 37  ? 29.118  10.158  -31.917 1.00 39.70  ? 37   LEU A N     1 
ATOM   306  C  CA    . LEU A 1 37  ? 27.914  10.667  -32.560 1.00 39.02  ? 37   LEU A CA    1 
ATOM   307  C  C     . LEU A 1 37  ? 28.357  11.713  -33.566 1.00 37.98  ? 37   LEU A C     1 
ATOM   308  O  O     . LEU A 1 37  ? 29.544  12.030  -33.645 1.00 38.15  ? 37   LEU A O     1 
ATOM   309  C  CB    . LEU A 1 37  ? 26.935  11.248  -31.538 1.00 34.25  ? 37   LEU A CB    1 
ATOM   310  C  CG    . LEU A 1 37  ? 26.367  10.235  -30.547 1.00 33.61  ? 37   LEU A CG    1 
ATOM   311  C  CD1   . LEU A 1 37  ? 25.668  10.937  -29.395 1.00 38.92  ? 37   LEU A CD1   1 
ATOM   312  C  CD2   . LEU A 1 37  ? 25.419  9.259   -31.247 1.00 33.70  ? 37   LEU A CD2   1 
ATOM   313  N  N     . PHE A 1 38  ? 27.416  12.246  -34.338 1.00 38.30  ? 38   PHE A N     1 
ATOM   314  C  CA    . PHE A 1 38  ? 27.776  13.088  -35.471 1.00 35.32  ? 38   PHE A CA    1 
ATOM   315  C  C     . PHE A 1 38  ? 26.946  14.359  -35.537 1.00 36.57  ? 38   PHE A C     1 
ATOM   316  O  O     . PHE A 1 38  ? 25.804  14.392  -35.084 1.00 36.57  ? 38   PHE A O     1 
ATOM   317  C  CB    . PHE A 1 38  ? 27.630  12.303  -36.779 1.00 34.81  ? 38   PHE A CB    1 
ATOM   318  C  CG    . PHE A 1 38  ? 28.452  11.042  -36.830 1.00 34.48  ? 38   PHE A CG    1 
ATOM   319  C  CD1   . PHE A 1 38  ? 29.679  11.025  -37.470 1.00 35.66  ? 38   PHE A CD1   1 
ATOM   320  C  CD2   . PHE A 1 38  ? 27.991  9.871   -36.245 1.00 33.84  ? 38   PHE A CD2   1 
ATOM   321  C  CE1   . PHE A 1 38  ? 30.440  9.862   -37.520 1.00 35.81  ? 38   PHE A CE1   1 
ATOM   322  C  CE2   . PHE A 1 38  ? 28.744  8.712   -36.288 1.00 36.08  ? 38   PHE A CE2   1 
ATOM   323  C  CZ    . PHE A 1 38  ? 29.968  8.706   -36.929 1.00 35.69  ? 38   PHE A CZ    1 
ATOM   324  N  N     . ALA A 1 39  ? 27.536  15.409  -36.098 1.00 40.32  ? 39   ALA A N     1 
ATOM   325  C  CA    . ALA A 1 39  ? 26.819  16.649  -36.355 1.00 37.44  ? 39   ALA A CA    1 
ATOM   326  C  C     . ALA A 1 39  ? 27.129  17.098  -37.773 1.00 40.16  ? 39   ALA A C     1 
ATOM   327  O  O     . ALA A 1 39  ? 28.230  16.867  -38.269 1.00 38.12  ? 39   ALA A O     1 
ATOM   328  C  CB    . ALA A 1 39  ? 27.233  17.718  -35.359 1.00 38.44  ? 39   ALA A CB    1 
ATOM   329  N  N     . HIS A 1 40  ? 26.156  17.724  -38.428 1.00 38.18  ? 40   HIS A N     1 
ATOM   330  C  CA    . HIS A 1 40  ? 26.381  18.296  -39.749 1.00 42.24  ? 40   HIS A CA    1 
ATOM   331  C  C     . HIS A 1 40  ? 27.492  19.337  -39.686 1.00 43.43  ? 40   HIS A C     1 
ATOM   332  O  O     . HIS A 1 40  ? 27.606  20.075  -38.708 1.00 43.17  ? 40   HIS A O     1 
ATOM   333  C  CB    . HIS A 1 40  ? 25.097  18.926  -40.292 1.00 43.87  ? 40   HIS A CB    1 
ATOM   334  C  CG    . HIS A 1 40  ? 24.051  17.926  -40.681 1.00 46.59  ? 40   HIS A CG    1 
ATOM   335  N  ND1   . HIS A 1 40  ? 22.756  17.988  -40.222 1.00 47.91  ? 40   HIS A ND1   1 
ATOM   336  C  CD2   . HIS A 1 40  ? 24.117  16.842  -41.491 1.00 47.33  ? 40   HIS A CD2   1 
ATOM   337  C  CE1   . HIS A 1 40  ? 22.063  16.981  -40.731 1.00 48.53  ? 40   HIS A CE1   1 
ATOM   338  N  NE2   . HIS A 1 40  ? 22.865  16.274  -41.503 1.00 47.22  ? 40   HIS A NE2   1 
ATOM   339  N  N     . CYS A 1 41  ? 28.312  19.386  -40.730 1.00 40.34  ? 41   CYS A N     1 
ATOM   340  C  CA    . CYS A 1 41  ? 29.441  20.314  -40.789 1.00 41.71  ? 41   CYS A CA    1 
ATOM   341  C  C     . CYS A 1 41  ? 29.475  20.994  -42.159 1.00 43.00  ? 41   CYS A C     1 
ATOM   342  O  O     . CYS A 1 41  ? 28.826  20.521  -43.090 1.00 43.72  ? 41   CYS A O     1 
ATOM   343  C  CB    . CYS A 1 41  ? 30.747  19.560  -40.532 1.00 43.27  ? 41   CYS A CB    1 
ATOM   344  S  SG    . CYS A 1 41  ? 31.202  18.391  -41.838 1.00 45.15  ? 41   CYS A SG    1 
ATOM   345  N  N     . PRO A 1 42  ? 30.223  22.109  -42.291 1.00 44.70  ? 42   PRO A N     1 
ATOM   346  C  CA    . PRO A 1 42  ? 30.261  22.790  -43.593 1.00 47.89  ? 42   PRO A CA    1 
ATOM   347  C  C     . PRO A 1 42  ? 30.792  21.886  -44.703 1.00 48.52  ? 42   PRO A C     1 
ATOM   348  O  O     . PRO A 1 42  ? 31.561  20.961  -44.427 1.00 44.38  ? 42   PRO A O     1 
ATOM   349  C  CB    . PRO A 1 42  ? 31.232  23.956  -43.357 1.00 49.38  ? 42   PRO A CB    1 
ATOM   350  C  CG    . PRO A 1 42  ? 31.193  24.198  -41.894 1.00 50.50  ? 42   PRO A CG    1 
ATOM   351  C  CD    . PRO A 1 42  ? 30.995  22.838  -41.268 1.00 46.62  ? 42   PRO A CD    1 
ATOM   352  N  N     . GLU A 1 43  ? 30.385  22.158  -45.940 1.00 52.73  ? 43   GLU A N     1 
ATOM   353  C  CA    . GLU A 1 43  ? 30.796  21.355  -47.090 1.00 57.11  ? 43   GLU A CA    1 
ATOM   354  C  C     . GLU A 1 43  ? 32.298  21.457  -47.353 1.00 60.53  ? 43   GLU A C     1 
ATOM   355  O  O     . GLU A 1 43  ? 32.888  20.582  -47.989 1.00 61.79  ? 43   GLU A O     1 
ATOM   356  C  CB    . GLU A 1 43  ? 30.016  21.775  -48.338 1.00 59.32  ? 43   GLU A CB    1 
ATOM   357  N  N     . SER A 1 44  ? 32.912  22.524  -46.851 1.00 60.72  ? 44   SER A N     1 
ATOM   358  C  CA    . SER A 1 44  ? 34.338  22.758  -47.047 1.00 65.57  ? 44   SER A CA    1 
ATOM   359  C  C     . SER A 1 44  ? 35.181  22.013  -46.016 1.00 68.80  ? 44   SER A C     1 
ATOM   360  O  O     . SER A 1 44  ? 36.374  22.276  -45.871 1.00 71.59  ? 44   SER A O     1 
ATOM   361  C  CB    . SER A 1 44  ? 34.646  24.257  -46.988 1.00 63.80  ? 44   SER A CB    1 
ATOM   362  N  N     . GLN A 1 45  ? 34.558  21.084  -45.301 1.00 69.29  ? 45   GLN A N     1 
ATOM   363  C  CA    . GLN A 1 45  ? 35.256  20.333  -44.267 1.00 73.09  ? 45   GLN A CA    1 
ATOM   364  C  C     . GLN A 1 45  ? 35.495  18.886  -44.685 1.00 72.08  ? 45   GLN A C     1 
ATOM   365  O  O     . GLN A 1 45  ? 34.551  18.119  -44.877 1.00 71.18  ? 45   GLN A O     1 
ATOM   366  C  CB    . GLN A 1 45  ? 34.485  20.389  -42.947 1.00 75.88  ? 45   GLN A CB    1 
ATOM   367  C  CG    . GLN A 1 45  ? 35.184  19.691  -41.794 1.00 79.47  ? 45   GLN A CG    1 
ATOM   368  C  CD    . GLN A 1 45  ? 34.864  20.328  -40.457 1.00 83.84  ? 45   GLN A CD    1 
ATOM   369  O  OE1   . GLN A 1 45  ? 35.280  19.838  -39.407 1.00 84.96  ? 45   GLN A OE1   1 
ATOM   370  N  NE2   . GLN A 1 45  ? 34.129  21.435  -40.490 1.00 85.57  ? 45   GLN A NE2   1 
ATOM   371  N  N     . ALA A 1 46  ? 36.769  18.527  -44.826 1.00 71.36  ? 46   ALA A N     1 
ATOM   372  C  CA    . ALA A 1 46  ? 37.155  17.178  -45.218 1.00 68.92  ? 46   ALA A CA    1 
ATOM   373  C  C     . ALA A 1 46  ? 36.674  16.149  -44.201 1.00 67.34  ? 46   ALA A C     1 
ATOM   374  O  O     . ALA A 1 46  ? 36.992  16.232  -43.013 1.00 68.43  ? 46   ALA A O     1 
ATOM   375  C  CB    . ALA A 1 46  ? 38.666  17.087  -45.398 1.00 68.08  ? 46   ALA A CB    1 
ATOM   376  N  N     . THR A 1 47  ? 35.901  15.180  -44.677 1.00 62.75  ? 47   THR A N     1 
ATOM   377  C  CA    . THR A 1 47  ? 35.395  14.118  -43.822 1.00 58.30  ? 47   THR A CA    1 
ATOM   378  C  C     . THR A 1 47  ? 35.082  12.881  -44.652 1.00 54.28  ? 47   THR A C     1 
ATOM   379  O  O     . THR A 1 47  ? 34.899  12.970  -45.866 1.00 54.82  ? 47   THR A O     1 
ATOM   380  C  CB    . THR A 1 47  ? 34.129  14.569  -43.061 1.00 61.82  ? 47   THR A CB    1 
ATOM   381  O  OG1   . THR A 1 47  ? 33.536  13.448  -42.394 1.00 61.28  ? 47   THR A OG1   1 
ATOM   382  C  CG2   . THR A 1 47  ? 33.116  15.174  -44.023 1.00 63.04  ? 47   THR A CG2   1 
ATOM   383  N  N     . LYS A 1 48  ? 35.032  11.727  -43.995 1.00 52.03  ? 48   LYS A N     1 
ATOM   384  C  CA    . LYS A 1 48  ? 34.644  10.490  -44.659 1.00 53.39  ? 48   LYS A CA    1 
ATOM   385  C  C     . LYS A 1 48  ? 33.215  10.114  -44.281 1.00 50.84  ? 48   LYS A C     1 
ATOM   386  O  O     . LYS A 1 48  ? 32.678  9.116   -44.761 1.00 48.61  ? 48   LYS A O     1 
ATOM   387  C  CB    . LYS A 1 48  ? 35.601  9.351   -44.295 1.00 55.49  ? 48   LYS A CB    1 
ATOM   388  C  CG    . LYS A 1 48  ? 35.498  8.882   -42.851 1.00 56.10  ? 48   LYS A CG    1 
ATOM   389  C  CD    . LYS A 1 48  ? 36.514  7.786   -42.555 1.00 58.12  ? 48   LYS A CD    1 
ATOM   390  N  N     . TYR A 1 49  ? 32.602  10.924  -43.422 1.00 48.67  ? 49   TYR A N     1 
ATOM   391  C  CA    . TYR A 1 49  ? 31.249  10.656  -42.949 1.00 43.09  ? 49   TYR A CA    1 
ATOM   392  C  C     . TYR A 1 49  ? 30.199  11.551  -43.603 1.00 41.88  ? 49   TYR A C     1 
ATOM   393  O  O     . TYR A 1 49  ? 30.331  12.777  -43.646 1.00 39.56  ? 49   TYR A O     1 
ATOM   394  C  CB    . TYR A 1 49  ? 31.171  10.811  -41.433 1.00 42.21  ? 49   TYR A CB    1 
ATOM   395  C  CG    . TYR A 1 49  ? 32.204  10.013  -40.680 1.00 40.43  ? 49   TYR A CG    1 
ATOM   396  C  CD1   . TYR A 1 49  ? 32.069  8.640   -40.523 1.00 42.05  ? 49   TYR A CD1   1 
ATOM   397  C  CD2   . TYR A 1 49  ? 33.307  10.634  -40.114 1.00 39.13  ? 49   TYR A CD2   1 
ATOM   398  C  CE1   . TYR A 1 49  ? 33.007  7.907   -39.829 1.00 42.18  ? 49   TYR A CE1   1 
ATOM   399  C  CE2   . TYR A 1 49  ? 34.255  9.909   -39.420 1.00 44.28  ? 49   TYR A CE2   1 
ATOM   400  C  CZ    . TYR A 1 49  ? 34.098  8.547   -39.279 1.00 43.95  ? 49   TYR A CZ    1 
ATOM   401  O  OH    . TYR A 1 49  ? 35.036  7.821   -38.587 1.00 47.42  ? 49   TYR A OH    1 
ATOM   402  N  N     . PHE A 1 50  ? 29.143  10.919  -44.098 1.00 40.74  ? 50   PHE A N     1 
ATOM   403  C  CA    . PHE A 1 50  ? 28.035  11.629  -44.709 1.00 39.80  ? 50   PHE A CA    1 
ATOM   404  C  C     . PHE A 1 50  ? 26.735  11.028  -44.193 1.00 40.23  ? 50   PHE A C     1 
ATOM   405  O  O     . PHE A 1 50  ? 26.685  9.834   -43.888 1.00 39.13  ? 50   PHE A O     1 
ATOM   406  C  CB    . PHE A 1 50  ? 28.109  11.496  -46.229 1.00 40.22  ? 50   PHE A CB    1 
ATOM   407  C  CG    . PHE A 1 50  ? 29.356  12.083  -46.829 1.00 45.48  ? 50   PHE A CG    1 
ATOM   408  C  CD1   . PHE A 1 50  ? 29.370  13.391  -47.287 1.00 47.92  ? 50   PHE A CD1   1 
ATOM   409  C  CD2   . PHE A 1 50  ? 30.516  11.330  -46.932 1.00 46.67  ? 50   PHE A CD2   1 
ATOM   410  C  CE1   . PHE A 1 50  ? 30.516  13.937  -47.836 1.00 48.42  ? 50   PHE A CE1   1 
ATOM   411  C  CE2   . PHE A 1 50  ? 31.665  11.872  -47.479 1.00 45.84  ? 50   PHE A CE2   1 
ATOM   412  C  CZ    . PHE A 1 50  ? 31.663  13.177  -47.933 1.00 48.12  ? 50   PHE A CZ    1 
ATOM   413  N  N     . ASP A 1 51  ? 25.687  11.840  -44.078 1.00 38.77  ? 51   ASP A N     1 
ATOM   414  C  CA    . ASP A 1 51  ? 24.378  11.283  -43.753 1.00 38.63  ? 51   ASP A CA    1 
ATOM   415  C  C     . ASP A 1 51  ? 23.810  10.589  -44.990 1.00 38.60  ? 51   ASP A C     1 
ATOM   416  O  O     . ASP A 1 51  ? 24.434  10.612  -46.050 1.00 41.13  ? 51   ASP A O     1 
ATOM   417  C  CB    . ASP A 1 51  ? 23.415  12.329  -43.154 1.00 36.36  ? 51   ASP A CB    1 
ATOM   418  C  CG    . ASP A 1 51  ? 22.937  13.376  -44.163 1.00 40.24  ? 51   ASP A CG    1 
ATOM   419  O  OD1   . ASP A 1 51  ? 23.110  13.209  -45.389 1.00 39.98  ? 51   ASP A OD1   1 
ATOM   420  O  OD2   . ASP A 1 51  ? 22.355  14.387  -43.711 1.00 44.99  ? 51   ASP A OD2   1 
ATOM   421  N  N     . ILE A 1 52  ? 22.634  9.986   -44.865 1.00 36.48  ? 52   ILE A N     1 
ATOM   422  C  CA    . ILE A 1 52  ? 22.074  9.208   -45.967 1.00 38.37  ? 52   ILE A CA    1 
ATOM   423  C  C     . ILE A 1 52  ? 21.688  10.076  -47.170 1.00 43.23  ? 52   ILE A C     1 
ATOM   424  O  O     . ILE A 1 52  ? 21.523  9.570   -48.279 1.00 47.63  ? 52   ILE A O     1 
ATOM   425  C  CB    . ILE A 1 52  ? 20.863  8.369   -45.516 1.00 39.90  ? 52   ILE A CB    1 
ATOM   426  C  CG1   . ILE A 1 52  ? 19.711  9.275   -45.082 1.00 34.80  ? 52   ILE A CG1   1 
ATOM   427  C  CG2   . ILE A 1 52  ? 21.259  7.420   -44.393 1.00 37.40  ? 52   ILE A CG2   1 
ATOM   428  C  CD1   . ILE A 1 52  ? 18.452  8.510   -44.707 1.00 39.50  ? 52   ILE A CD1   1 
ATOM   429  N  N     . TYR A 1 53  ? 21.552  11.380  -46.946 1.00 39.12  ? 53   TYR A N     1 
ATOM   430  C  CA    . TYR A 1 53  ? 21.209  12.307  -48.018 1.00 42.48  ? 53   TYR A CA    1 
ATOM   431  C  C     . TYR A 1 53  ? 22.455  12.939  -48.633 1.00 42.51  ? 53   TYR A C     1 
ATOM   432  O  O     . TYR A 1 53  ? 22.359  13.733  -49.565 1.00 42.02  ? 53   TYR A O     1 
ATOM   433  C  CB    . TYR A 1 53  ? 20.246  13.386  -47.514 1.00 42.64  ? 53   TYR A CB    1 
ATOM   434  C  CG    . TYR A 1 53  ? 19.060  12.818  -46.769 1.00 42.14  ? 53   TYR A CG    1 
ATOM   435  C  CD1   . TYR A 1 53  ? 17.994  12.245  -47.454 1.00 41.14  ? 53   TYR A CD1   1 
ATOM   436  C  CD2   . TYR A 1 53  ? 19.011  12.842  -45.379 1.00 40.38  ? 53   TYR A CD2   1 
ATOM   437  C  CE1   . TYR A 1 53  ? 16.909  11.716  -46.779 1.00 41.10  ? 53   TYR A CE1   1 
ATOM   438  C  CE2   . TYR A 1 53  ? 17.926  12.315  -44.692 1.00 41.74  ? 53   TYR A CE2   1 
ATOM   439  C  CZ    . TYR A 1 53  ? 16.880  11.753  -45.397 1.00 41.97  ? 53   TYR A CZ    1 
ATOM   440  O  OH    . TYR A 1 53  ? 15.803  11.223  -44.720 1.00 41.91  ? 53   TYR A OH    1 
ATOM   441  N  N     . GLY A 1 54  ? 23.624  12.580  -48.110 1.00 43.07  ? 54   GLY A N     1 
ATOM   442  C  CA    . GLY A 1 54  ? 24.882  13.018  -48.694 1.00 43.32  ? 54   GLY A CA    1 
ATOM   443  C  C     . GLY A 1 54  ? 25.486  14.274  -48.092 1.00 42.45  ? 54   GLY A C     1 
ATOM   444  O  O     . GLY A 1 54  ? 26.482  14.790  -48.597 1.00 44.46  ? 54   GLY A O     1 
ATOM   445  N  N     . LYS A 1 55  ? 24.888  14.777  -47.018 1.00 44.15  ? 55   LYS A N     1 
ATOM   446  C  CA    . LYS A 1 55  ? 25.436  15.937  -46.322 1.00 44.87  ? 55   LYS A CA    1 
ATOM   447  C  C     . LYS A 1 55  ? 26.566  15.498  -45.396 1.00 38.71  ? 55   LYS A C     1 
ATOM   448  O  O     . LYS A 1 55  ? 26.429  14.506  -44.679 1.00 37.75  ? 55   LYS A O     1 
ATOM   449  C  CB    . LYS A 1 55  ? 24.342  16.647  -45.525 1.00 45.24  ? 55   LYS A CB    1 
ATOM   450  C  CG    . LYS A 1 55  ? 23.144  17.063  -46.361 1.00 46.89  ? 55   LYS A CG    1 
ATOM   451  N  N     . PRO A 1 56  ? 27.691  16.230  -45.415 1.00 39.46  ? 56   PRO A N     1 
ATOM   452  C  CA    . PRO A 1 56  ? 28.851  15.855  -44.599 1.00 39.27  ? 56   PRO A CA    1 
ATOM   453  C  C     . PRO A 1 56  ? 28.605  16.026  -43.102 1.00 41.85  ? 56   PRO A C     1 
ATOM   454  O  O     . PRO A 1 56  ? 27.875  16.931  -42.690 1.00 42.67  ? 56   PRO A O     1 
ATOM   455  C  CB    . PRO A 1 56  ? 29.944  16.822  -45.073 1.00 40.50  ? 56   PRO A CB    1 
ATOM   456  C  CG    . PRO A 1 56  ? 29.203  18.004  -45.587 1.00 41.16  ? 56   PRO A CG    1 
ATOM   457  C  CD    . PRO A 1 56  ? 27.936  17.454  -46.196 1.00 40.67  ? 56   PRO A CD    1 
ATOM   458  N  N     . CYS A 1 57  ? 29.215  15.149  -42.310 1.00 38.17  ? 57   CYS A N     1 
ATOM   459  C  CA    . CYS A 1 57  ? 29.140  15.212  -40.856 1.00 45.02  ? 57   CYS A CA    1 
ATOM   460  C  C     . CYS A 1 57  ? 30.539  15.112  -40.275 1.00 44.11  ? 57   CYS A C     1 
ATOM   461  O  O     . CYS A 1 57  ? 31.439  14.563  -40.907 1.00 38.98  ? 57   CYS A O     1 
ATOM   462  C  CB    . CYS A 1 57  ? 28.327  14.037  -40.305 1.00 44.08  ? 57   CYS A CB    1 
ATOM   463  S  SG    . CYS A 1 57  ? 26.626  13.923  -40.872 1.00 48.33  ? 57   CYS A SG    1 
ATOM   464  N  N     A THR A 1 58  ? 30.726  15.651  -39.075 0.50 45.23  ? 58   THR A N     1 
ATOM   465  N  N     B THR A 1 58  ? 30.715  15.639  -39.068 0.50 45.22  ? 58   THR A N     1 
ATOM   466  C  CA    A THR A 1 58  ? 31.958  15.418  -38.330 0.50 45.74  ? 58   THR A CA    1 
ATOM   467  C  CA    B THR A 1 58  ? 31.952  15.444  -38.321 0.50 45.97  ? 58   THR A CA    1 
ATOM   468  C  C     A THR A 1 58  ? 31.682  14.481  -37.165 0.50 44.26  ? 58   THR A C     1 
ATOM   469  C  C     B THR A 1 58  ? 31.691  14.499  -37.150 0.50 44.27  ? 58   THR A C     1 
ATOM   470  O  O     A THR A 1 58  ? 30.625  14.547  -36.538 0.50 43.41  ? 58   THR A O     1 
ATOM   471  O  O     B THR A 1 58  ? 30.638  14.564  -36.514 0.50 43.45  ? 58   THR A O     1 
ATOM   472  C  CB    A THR A 1 58  ? 32.592  16.718  -37.793 0.50 48.13  ? 58   THR A CB    1 
ATOM   473  C  CB    B THR A 1 58  ? 32.546  16.781  -37.818 0.50 48.66  ? 58   THR A CB    1 
ATOM   474  O  OG1   A THR A 1 58  ? 31.605  17.493  -37.102 0.50 50.20  ? 58   THR A OG1   1 
ATOM   475  O  OG1   B THR A 1 58  ? 33.676  16.522  -36.975 0.50 48.93  ? 58   THR A OG1   1 
ATOM   476  C  CG2   A THR A 1 58  ? 33.175  17.537  -38.925 0.50 47.95  ? 58   THR A CG2   1 
ATOM   477  C  CG2   B THR A 1 58  ? 31.511  17.575  -37.036 0.50 50.63  ? 58   THR A CG2   1 
ATOM   478  N  N     . ARG A 1 59  ? 32.639  13.606  -36.884 1.00 42.69  ? 59   ARG A N     1 
ATOM   479  C  CA    . ARG A 1 59  ? 32.499  12.659  -35.794 1.00 42.35  ? 59   ARG A CA    1 
ATOM   480  C  C     . ARG A 1 59  ? 32.969  13.282  -34.491 1.00 44.96  ? 59   ARG A C     1 
ATOM   481  O  O     . ARG A 1 59  ? 34.046  13.871  -34.428 1.00 49.95  ? 59   ARG A O     1 
ATOM   482  C  CB    . ARG A 1 59  ? 33.303  11.389  -36.074 1.00 42.70  ? 59   ARG A CB    1 
ATOM   483  C  CG    . ARG A 1 59  ? 33.127  10.315  -35.014 1.00 38.05  ? 59   ARG A CG    1 
ATOM   484  C  CD    . ARG A 1 59  ? 33.878  9.034   -35.372 1.00 39.04  ? 59   ARG A CD    1 
ATOM   485  N  NE    . ARG A 1 59  ? 35.325  9.227   -35.397 1.00 43.40  ? 59   ARG A NE    1 
ATOM   486  C  CZ    . ARG A 1 59  ? 36.111  9.126   -34.330 1.00 48.53  ? 59   ARG A CZ    1 
ATOM   487  N  NH1   . ARG A 1 59  ? 35.587  8.836   -33.146 1.00 50.13  ? 59   ARG A NH1   1 
ATOM   488  N  NH2   . ARG A 1 59  ? 37.420  9.316   -34.443 1.00 50.18  ? 59   ARG A NH2   1 
ATOM   489  N  N     . LYS A 1 60  ? 32.154  13.157  -33.453 1.00 43.73  ? 60   LYS A N     1 
ATOM   490  C  CA    . LYS A 1 60  ? 32.561  13.575  -32.123 1.00 46.39  ? 60   LYS A CA    1 
ATOM   491  C  C     . LYS A 1 60  ? 32.764  12.355  -31.234 1.00 45.34  ? 60   LYS A C     1 
ATOM   492  O  O     . LYS A 1 60  ? 31.833  11.583  -31.000 1.00 41.42  ? 60   LYS A O     1 
ATOM   493  C  CB    . LYS A 1 60  ? 31.517  14.508  -31.510 1.00 51.23  ? 60   LYS A CB    1 
ATOM   494  C  CG    . LYS A 1 60  ? 31.397  15.850  -32.217 1.00 56.57  ? 60   LYS A CG    1 
ATOM   495  C  CD    . LYS A 1 60  ? 30.387  16.742  -31.518 1.00 57.35  ? 60   LYS A CD    1 
ATOM   496  C  CE    . LYS A 1 60  ? 30.817  17.053  -30.092 1.00 59.59  ? 60   LYS A CE    1 
ATOM   497  N  NZ    . LYS A 1 60  ? 31.946  18.023  -30.060 1.00 64.04  ? 60   LYS A NZ    1 
ATOM   498  N  N     . LEU A 1 61  ? 33.987  12.173  -30.752 1.00 46.34  ? 61   LEU A N     1 
ATOM   499  C  CA    . LEU A 1 61  ? 34.268  11.096  -29.815 1.00 50.48  ? 61   LEU A CA    1 
ATOM   500  C  C     . LEU A 1 61  ? 34.000  11.600  -28.404 1.00 51.42  ? 61   LEU A C     1 
ATOM   501  O  O     . LEU A 1 61  ? 34.362  12.723  -28.059 1.00 52.08  ? 61   LEU A O     1 
ATOM   502  C  CB    . LEU A 1 61  ? 35.721  10.626  -29.945 1.00 54.11  ? 61   LEU A CB    1 
ATOM   503  C  CG    . LEU A 1 61  ? 36.106  9.350   -29.185 1.00 56.17  ? 61   LEU A CG    1 
ATOM   504  C  CD1   . LEU A 1 61  ? 35.481  8.123   -29.830 1.00 55.23  ? 61   LEU A CD1   1 
ATOM   505  C  CD2   . LEU A 1 61  ? 37.621  9.194   -29.087 1.00 57.21  ? 61   LEU A CD2   1 
ATOM   506  N  N     . PHE A 1 62  ? 33.356  10.772  -27.592 1.00 51.24  ? 62   PHE A N     1 
ATOM   507  C  CA    . PHE A 1 62  ? 33.062  11.147  -26.216 1.00 49.82  ? 62   PHE A CA    1 
ATOM   508  C  C     . PHE A 1 62  ? 33.863  10.304  -25.225 1.00 51.00  ? 62   PHE A C     1 
ATOM   509  O  O     . PHE A 1 62  ? 34.099  9.117   -25.456 1.00 51.07  ? 62   PHE A O     1 
ATOM   510  C  CB    . PHE A 1 62  ? 31.560  11.037  -25.948 1.00 44.61  ? 62   PHE A CB    1 
ATOM   511  C  CG    . PHE A 1 62  ? 30.729  11.947  -26.813 1.00 44.06  ? 62   PHE A CG    1 
ATOM   512  C  CD1   . PHE A 1 62  ? 30.513  13.266  -26.444 1.00 46.55  ? 62   PHE A CD1   1 
ATOM   513  C  CD2   . PHE A 1 62  ? 30.181  11.489  -28.001 1.00 41.27  ? 62   PHE A CD2   1 
ATOM   514  C  CE1   . PHE A 1 62  ? 29.759  14.111  -27.240 1.00 45.86  ? 62   PHE A CE1   1 
ATOM   515  C  CE2   . PHE A 1 62  ? 29.424  12.327  -28.800 1.00 42.08  ? 62   PHE A CE2   1 
ATOM   516  C  CZ    . PHE A 1 62  ? 29.214  13.640  -28.420 1.00 42.90  ? 62   PHE A CZ    1 
ATOM   517  N  N     . ALA A 1 63  ? 34.284  10.926  -24.128 1.00 48.27  ? 63   ALA A N     1 
ATOM   518  C  CA    . ALA A 1 63  ? 35.075  10.241  -23.112 1.00 50.74  ? 63   ALA A CA    1 
ATOM   519  C  C     . ALA A 1 63  ? 34.291  9.099   -22.478 1.00 53.25  ? 63   ALA A C     1 
ATOM   520  O  O     . ALA A 1 63  ? 34.866  8.100   -22.047 1.00 56.39  ? 63   ALA A O     1 
ATOM   521  C  CB    . ALA A 1 63  ? 35.543  11.226  -22.049 1.00 54.82  ? 63   ALA A CB    1 
ATOM   522  N  N     . ASN A 1 64  ? 32.971  9.252   -22.434 1.00 52.42  ? 64   ASN A N     1 
ATOM   523  C  CA    . ASN A 1 64  ? 32.091  8.232   -21.878 1.00 47.75  ? 64   ASN A CA    1 
ATOM   524  C  C     . ASN A 1 64  ? 30.671  8.375   -22.417 1.00 45.73  ? 64   ASN A C     1 
ATOM   525  O  O     . ASN A 1 64  ? 30.333  9.378   -23.050 1.00 46.26  ? 64   ASN A O     1 
ATOM   526  C  CB    . ASN A 1 64  ? 32.092  8.294   -20.348 1.00 47.78  ? 64   ASN A CB    1 
ATOM   527  C  CG    . ASN A 1 64  ? 31.877  9.703   -19.822 1.00 49.49  ? 64   ASN A CG    1 
ATOM   528  O  OD1   . ASN A 1 64  ? 30.765  10.230  -19.862 1.00 47.93  ? 64   ASN A OD1   1 
ATOM   529  N  ND2   . ASN A 1 64  ? 32.946  10.320  -19.324 1.00 48.67  ? 64   ASN A ND2   1 
ATOM   530  N  N     . MET A 1 65  ? 29.841  7.370   -22.162 1.00 43.92  ? 65   MET A N     1 
ATOM   531  C  CA    . MET A 1 65  ? 28.484  7.349   -22.696 1.00 41.89  ? 65   MET A CA    1 
ATOM   532  C  C     . MET A 1 65  ? 27.602  8.450   -22.103 1.00 42.60  ? 65   MET A C     1 
ATOM   533  O  O     . MET A 1 65  ? 26.687  8.943   -22.762 1.00 40.09  ? 65   MET A O     1 
ATOM   534  C  CB    . MET A 1 65  ? 27.859  5.961   -22.518 1.00 39.18  ? 65   MET A CB    1 
ATOM   535  C  CG    . MET A 1 65  ? 28.494  4.901   -23.420 1.00 38.33  ? 65   MET A CG    1 
ATOM   536  S  SD    . MET A 1 65  ? 27.817  3.231   -23.243 1.00 40.47  ? 65   MET A SD    1 
ATOM   537  C  CE    . MET A 1 65  ? 28.468  2.753   -21.647 1.00 44.90  ? 65   MET A CE    1 
ATOM   538  N  N     . ARG A 1 66  ? 27.893  8.848   -20.869 1.00 47.65  ? 66   ARG A N     1 
ATOM   539  C  CA    . ARG A 1 66  ? 27.166  9.943   -20.234 1.00 48.42  ? 66   ARG A CA    1 
ATOM   540  C  C     . ARG A 1 66  ? 27.391  11.262  -20.974 1.00 46.22  ? 66   ARG A C     1 
ATOM   541  O  O     . ARG A 1 66  ? 26.446  12.012  -21.217 1.00 43.70  ? 66   ARG A O     1 
ATOM   542  C  CB    . ARG A 1 66  ? 27.576  10.087  -18.767 1.00 52.60  ? 66   ARG A CB    1 
ATOM   543  C  CG    . ARG A 1 66  ? 26.931  11.270  -18.053 1.00 53.52  ? 66   ARG A CG    1 
ATOM   544  N  N     . ASP A 1 67  ? 28.643  11.539  -21.331 1.00 46.01  ? 67   ASP A N     1 
ATOM   545  C  CA    . ASP A 1 67  ? 28.975  12.761  -22.061 1.00 48.68  ? 67   ASP A CA    1 
ATOM   546  C  C     . ASP A 1 67  ? 28.284  12.803  -23.421 1.00 48.26  ? 67   ASP A C     1 
ATOM   547  O  O     . ASP A 1 67  ? 27.914  13.873  -23.904 1.00 52.45  ? 67   ASP A O     1 
ATOM   548  C  CB    . ASP A 1 67  ? 30.488  12.907  -22.239 1.00 50.03  ? 67   ASP A CB    1 
ATOM   549  C  CG    . ASP A 1 67  ? 31.195  13.296  -20.952 1.00 55.22  ? 67   ASP A CG    1 
ATOM   550  O  OD1   . ASP A 1 67  ? 30.513  13.746  -20.007 1.00 58.92  ? 67   ASP A OD1   1 
ATOM   551  O  OD2   . ASP A 1 67  ? 32.436  13.158  -20.891 1.00 54.45  ? 67   ASP A OD2   1 
ATOM   552  N  N     . ALA A 1 68  ? 28.115  11.636  -24.033 1.00 42.59  ? 68   ALA A N     1 
ATOM   553  C  CA    . ALA A 1 68  ? 27.436  11.544  -25.318 1.00 42.44  ? 68   ALA A CA    1 
ATOM   554  C  C     . ALA A 1 68  ? 25.953  11.872  -25.177 1.00 45.31  ? 68   ALA A C     1 
ATOM   555  O  O     . ALA A 1 68  ? 25.401  12.636  -25.973 1.00 48.07  ? 68   ALA A O     1 
ATOM   556  C  CB    . ALA A 1 68  ? 27.618  10.162  -25.920 1.00 35.79  ? 68   ALA A CB    1 
ATOM   557  N  N     A SER A 1 69  ? 25.311  11.298  -24.165 0.50 43.49  ? 69   SER A N     1 
ATOM   558  N  N     B SER A 1 69  ? 25.316  11.289  -24.164 0.50 43.48  ? 69   SER A N     1 
ATOM   559  C  CA    A SER A 1 69  ? 23.887  11.529  -23.940 0.50 42.78  ? 69   SER A CA    1 
ATOM   560  C  CA    B SER A 1 69  ? 23.898  11.520  -23.908 0.50 42.71  ? 69   SER A CA    1 
ATOM   561  C  C     A SER A 1 69  ? 23.608  12.962  -23.487 0.50 44.49  ? 69   SER A C     1 
ATOM   562  C  C     B SER A 1 69  ? 23.641  12.976  -23.536 0.50 44.48  ? 69   SER A C     1 
ATOM   563  O  O     A SER A 1 69  ? 22.562  13.528  -23.805 0.50 44.92  ? 69   SER A O     1 
ATOM   564  O  O     B SER A 1 69  ? 22.647  13.568  -23.955 0.50 44.81  ? 69   SER A O     1 
ATOM   565  C  CB    A SER A 1 69  ? 23.322  10.517  -22.936 0.50 41.76  ? 69   SER A CB    1 
ATOM   566  C  CB    B SER A 1 69  ? 23.394  10.601  -22.791 0.50 41.90  ? 69   SER A CB    1 
ATOM   567  O  OG    A SER A 1 69  ? 24.124  10.450  -21.770 0.50 43.09  ? 69   SER A OG    1 
ATOM   568  O  OG    B SER A 1 69  ? 23.565  9.236   -23.127 0.50 39.55  ? 69   SER A OG    1 
ATOM   569  N  N     . GLN A 1 70  ? 24.545  13.547  -22.747 1.00 45.30  ? 70   GLN A N     1 
ATOM   570  C  CA    . GLN A 1 70  ? 24.419  14.937  -22.322 1.00 45.47  ? 70   GLN A CA    1 
ATOM   571  C  C     . GLN A 1 70  ? 24.553  15.868  -23.519 1.00 44.61  ? 70   GLN A C     1 
ATOM   572  O  O     . GLN A 1 70  ? 23.923  16.924  -23.566 1.00 45.24  ? 70   GLN A O     1 
ATOM   573  C  CB    . GLN A 1 70  ? 25.462  15.284  -21.256 1.00 48.91  ? 70   GLN A CB    1 
ATOM   574  C  CG    . GLN A 1 70  ? 25.203  14.648  -19.896 1.00 50.36  ? 70   GLN A CG    1 
ATOM   575  N  N     . TRP A 1 71  ? 25.373  15.467  -24.486 1.00 42.67  ? 71   TRP A N     1 
ATOM   576  C  CA    . TRP A 1 71  ? 25.548  16.243  -25.709 1.00 42.43  ? 71   TRP A CA    1 
ATOM   577  C  C     . TRP A 1 71  ? 24.275  16.224  -26.543 1.00 39.07  ? 71   TRP A C     1 
ATOM   578  O  O     . TRP A 1 71  ? 23.904  17.233  -27.140 1.00 39.65  ? 71   TRP A O     1 
ATOM   579  C  CB    . TRP A 1 71  ? 26.725  15.712  -26.530 1.00 39.27  ? 71   TRP A CB    1 
ATOM   580  C  CG    . TRP A 1 71  ? 26.956  16.466  -27.805 1.00 44.92  ? 71   TRP A CG    1 
ATOM   581  C  CD1   . TRP A 1 71  ? 27.526  17.701  -27.936 1.00 40.59  ? 71   TRP A CD1   1 
ATOM   582  C  CD2   . TRP A 1 71  ? 26.624  16.036  -29.130 1.00 38.33  ? 71   TRP A CD2   1 
ATOM   583  N  NE1   . TRP A 1 71  ? 27.569  18.065  -29.260 1.00 40.35  ? 71   TRP A NE1   1 
ATOM   584  C  CE2   . TRP A 1 71  ? 27.023  17.060  -30.013 1.00 39.00  ? 71   TRP A CE2   1 
ATOM   585  C  CE3   . TRP A 1 71  ? 26.031  14.885  -29.656 1.00 39.19  ? 71   TRP A CE3   1 
ATOM   586  C  CZ2   . TRP A 1 71  ? 26.845  16.967  -31.393 1.00 40.40  ? 71   TRP A CZ2   1 
ATOM   587  C  CZ3   . TRP A 1 71  ? 25.857  14.794  -31.028 1.00 37.20  ? 71   TRP A CZ3   1 
ATOM   588  C  CH2   . TRP A 1 71  ? 26.265  15.827  -31.879 1.00 37.20  ? 71   TRP A CH2   1 
ATOM   589  N  N     . ILE A 1 72  ? 23.614  15.070  -26.579 1.00 41.40  ? 72   ILE A N     1 
ATOM   590  C  CA    . ILE A 1 72  ? 22.345  14.929  -27.288 1.00 40.13  ? 72   ILE A CA    1 
ATOM   591  C  C     . ILE A 1 72  ? 21.320  15.925  -26.753 1.00 42.62  ? 72   ILE A C     1 
ATOM   592  O  O     . ILE A 1 72  ? 20.646  16.611  -27.524 1.00 43.31  ? 72   ILE A O     1 
ATOM   593  C  CB    . ILE A 1 72  ? 21.790  13.494  -27.167 1.00 40.74  ? 72   ILE A CB    1 
ATOM   594  C  CG1   . ILE A 1 72  ? 22.716  12.504  -27.877 1.00 39.95  ? 72   ILE A CG1   1 
ATOM   595  C  CG2   . ILE A 1 72  ? 20.385  13.406  -27.743 1.00 39.29  ? 72   ILE A CG2   1 
ATOM   596  C  CD1   . ILE A 1 72  ? 22.327  11.047  -27.683 1.00 41.08  ? 72   ILE A CD1   1 
ATOM   597  N  N     . LYS A 1 73  ? 21.221  16.012  -25.428 1.00 44.24  ? 73   LYS A N     1 
ATOM   598  C  CA    . LYS A 1 73  ? 20.307  16.954  -24.783 1.00 46.89  ? 73   LYS A CA    1 
ATOM   599  C  C     . LYS A 1 73  ? 20.661  18.403  -25.109 1.00 46.12  ? 73   LYS A C     1 
ATOM   600  O  O     . LYS A 1 73  ? 19.776  19.216  -25.368 1.00 42.72  ? 73   LYS A O     1 
ATOM   601  C  CB    . LYS A 1 73  ? 20.296  16.749  -23.267 1.00 49.50  ? 73   LYS A CB    1 
ATOM   602  N  N     . ARG A 1 74  ? 21.952  18.727  -25.096 1.00 44.89  ? 74   ARG A N     1 
ATOM   603  C  CA    . ARG A 1 74  ? 22.378  20.090  -25.406 1.00 48.38  ? 74   ARG A CA    1 
ATOM   604  C  C     . ARG A 1 74  ? 22.064  20.463  -26.849 1.00 47.74  ? 74   ARG A C     1 
ATOM   605  O  O     . ARG A 1 74  ? 21.653  21.592  -27.128 1.00 48.18  ? 74   ARG A O     1 
ATOM   606  C  CB    . ARG A 1 74  ? 23.864  20.306  -25.102 1.00 52.28  ? 74   ARG A CB    1 
ATOM   607  C  CG    . ARG A 1 74  ? 24.168  20.482  -23.618 1.00 55.63  ? 74   ARG A CG    1 
ATOM   608  C  CD    . ARG A 1 74  ? 25.532  21.113  -23.381 1.00 56.03  ? 74   ARG A CD    1 
ATOM   609  N  NE    . ARG A 1 74  ? 26.615  20.352  -23.995 1.00 56.98  ? 74   ARG A NE    1 
ATOM   610  C  CZ    . ARG A 1 74  ? 27.173  19.273  -23.453 1.00 58.32  ? 74   ARG A CZ    1 
ATOM   611  N  NH1   . ARG A 1 74  ? 26.744  18.819  -22.282 1.00 60.46  ? 74   ARG A NH1   1 
ATOM   612  N  NH2   . ARG A 1 74  ? 28.157  18.643  -24.082 1.00 55.56  ? 74   ARG A NH2   1 
ATOM   613  N  N     . MET A 1 75  ? 22.246  19.511  -27.760 1.00 41.53  ? 75   MET A N     1 
ATOM   614  C  CA    . MET A 1 75  ? 21.943  19.741  -29.170 1.00 45.61  ? 75   MET A CA    1 
ATOM   615  C  C     . MET A 1 75  ? 20.453  19.989  -29.367 1.00 41.50  ? 75   MET A C     1 
ATOM   616  O  O     . MET A 1 75  ? 20.053  20.766  -30.233 1.00 42.09  ? 75   MET A O     1 
ATOM   617  C  CB    . MET A 1 75  ? 22.403  18.558  -30.025 1.00 44.59  ? 75   MET A CB    1 
ATOM   618  C  CG    . MET A 1 75  ? 23.917  18.451  -30.162 1.00 43.41  ? 75   MET A CG    1 
ATOM   619  S  SD    . MET A 1 75  ? 24.627  19.742  -31.210 1.00 45.51  ? 75   MET A SD    1 
ATOM   620  C  CE    . MET A 1 75  ? 24.158  19.146  -32.836 1.00 39.54  ? 75   MET A CE    1 
ATOM   621  N  N     . GLU A 1 76  ? 19.641  19.318  -28.555 1.00 44.80  ? 76   GLU A N     1 
ATOM   622  C  CA    . GLU A 1 76  ? 18.198  19.518  -28.553 1.00 48.25  ? 76   GLU A CA    1 
ATOM   623  C  C     . GLU A 1 76  ? 17.854  20.933  -28.090 1.00 48.41  ? 76   GLU A C     1 
ATOM   624  O  O     . GLU A 1 76  ? 16.965  21.576  -28.643 1.00 50.72  ? 76   GLU A O     1 
ATOM   625  C  CB    . GLU A 1 76  ? 17.527  18.481  -27.646 1.00 52.72  ? 76   GLU A CB    1 
ATOM   626  C  CG    . GLU A 1 76  ? 16.008  18.560  -27.597 1.00 58.80  ? 76   GLU A CG    1 
ATOM   627  C  CD    . GLU A 1 76  ? 15.395  17.464  -26.735 1.00 63.19  ? 76   GLU A CD    1 
ATOM   628  O  OE1   . GLU A 1 76  ? 16.132  16.545  -26.317 1.00 62.47  ? 76   GLU A OE1   1 
ATOM   629  O  OE2   . GLU A 1 76  ? 14.175  17.520  -26.474 1.00 67.31  ? 76   GLU A OE2   1 
ATOM   630  N  N     . ASP A 1 77  ? 18.576  21.417  -27.082 1.00 50.50  ? 77   ASP A N     1 
ATOM   631  C  CA    . ASP A 1 77  ? 18.362  22.762  -26.552 1.00 54.97  ? 77   ASP A CA    1 
ATOM   632  C  C     . ASP A 1 77  ? 18.802  23.841  -27.538 1.00 52.84  ? 77   ASP A C     1 
ATOM   633  O  O     . ASP A 1 77  ? 18.309  24.970  -27.496 1.00 54.92  ? 77   ASP A O     1 
ATOM   634  C  CB    . ASP A 1 77  ? 19.103  22.941  -25.225 1.00 59.07  ? 77   ASP A CB    1 
ATOM   635  C  CG    . ASP A 1 77  ? 18.615  21.989  -24.152 1.00 61.06  ? 77   ASP A CG    1 
ATOM   636  O  OD1   . ASP A 1 77  ? 17.470  21.500  -24.266 1.00 59.62  ? 77   ASP A OD1   1 
ATOM   637  O  OD2   . ASP A 1 77  ? 19.375  21.735  -23.192 1.00 63.08  ? 77   ASP A OD2   1 
ATOM   638  N  N     . ILE A 1 78  ? 19.737  23.490  -28.416 1.00 48.67  ? 78   ILE A N     1 
ATOM   639  C  CA    . ILE A 1 78  ? 20.213  24.411  -29.444 1.00 48.86  ? 78   ILE A CA    1 
ATOM   640  C  C     . ILE A 1 78  ? 19.280  24.380  -30.653 1.00 50.06  ? 78   ILE A C     1 
ATOM   641  O  O     . ILE A 1 78  ? 19.061  25.397  -31.303 1.00 53.26  ? 78   ILE A O     1 
ATOM   642  C  CB    . ILE A 1 78  ? 21.656  24.075  -29.888 1.00 47.46  ? 78   ILE A CB    1 
ATOM   643  C  CG1   . ILE A 1 78  ? 22.619  24.180  -28.704 1.00 50.33  ? 78   ILE A CG1   1 
ATOM   644  C  CG2   . ILE A 1 78  ? 22.112  25.005  -31.002 1.00 46.31  ? 78   ILE A CG2   1 
ATOM   645  C  CD1   . ILE A 1 78  ? 24.059  23.836  -29.048 1.00 45.66  ? 78   ILE A CD1   1 
ATOM   646  N  N     . GLY A 1 79  ? 18.722  23.208  -30.942 1.00 51.82  ? 79   GLY A N     1 
ATOM   647  C  CA    . GLY A 1 79  ? 17.836  23.050  -32.081 1.00 44.79  ? 79   GLY A CA    1 
ATOM   648  C  C     . GLY A 1 79  ? 18.532  22.466  -33.297 1.00 46.03  ? 79   GLY A C     1 
ATOM   649  O  O     . GLY A 1 79  ? 18.166  22.767  -34.431 1.00 47.57  ? 79   GLY A O     1 
ATOM   650  N  N     . LEU A 1 80  ? 19.538  21.626  -33.062 1.00 43.56  ? 80   LEU A N     1 
ATOM   651  C  CA    . LEU A 1 80  ? 20.279  20.991  -34.148 1.00 43.29  ? 80   LEU A CA    1 
ATOM   652  C  C     . LEU A 1 80  ? 20.245  19.473  -34.028 1.00 42.76  ? 80   LEU A C     1 
ATOM   653  O  O     . LEU A 1 80  ? 20.225  18.929  -32.925 1.00 43.93  ? 80   LEU A O     1 
ATOM   654  C  CB    . LEU A 1 80  ? 21.729  21.472  -34.167 1.00 41.56  ? 80   LEU A CB    1 
ATOM   655  C  CG    . LEU A 1 80  ? 21.998  22.917  -34.581 1.00 42.99  ? 80   LEU A CG    1 
ATOM   656  C  CD1   . LEU A 1 80  ? 23.465  23.256  -34.342 1.00 43.27  ? 80   LEU A CD1   1 
ATOM   657  C  CD2   . LEU A 1 80  ? 21.621  23.142  -36.037 1.00 43.11  ? 80   LEU A CD2   1 
ATOM   658  N  N     . GLU A 1 81  ? 20.255  18.797  -35.172 1.00 43.25  ? 81   GLU A N     1 
ATOM   659  C  CA    . GLU A 1 81  ? 20.196  17.342  -35.206 1.00 42.79  ? 81   GLU A CA    1 
ATOM   660  C  C     . GLU A 1 81  ? 21.466  16.704  -34.638 1.00 41.71  ? 81   GLU A C     1 
ATOM   661  O  O     . GLU A 1 81  ? 22.583  17.101  -34.972 1.00 37.26  ? 81   GLU A O     1 
ATOM   662  C  CB    . GLU A 1 81  ? 19.948  16.849  -36.637 1.00 45.24  ? 81   GLU A CB    1 
ATOM   663  C  CG    . GLU A 1 81  ? 19.639  15.359  -36.737 1.00 45.32  ? 81   GLU A CG    1 
ATOM   664  C  CD    . GLU A 1 81  ? 19.358  14.898  -38.161 1.00 45.66  ? 81   GLU A CD    1 
ATOM   665  O  OE1   . GLU A 1 81  ? 19.373  15.741  -39.082 1.00 44.32  ? 81   GLU A OE1   1 
ATOM   666  O  OE2   . GLU A 1 81  ? 19.124  13.684  -38.360 1.00 44.27  ? 81   GLU A OE2   1 
ATOM   667  N  N     . ALA A 1 82  ? 21.280  15.720  -33.766 1.00 41.58  ? 82   ALA A N     1 
ATOM   668  C  CA    . ALA A 1 82  ? 22.387  14.921  -33.262 1.00 37.00  ? 82   ALA A CA    1 
ATOM   669  C  C     . ALA A 1 82  ? 22.317  13.557  -33.929 1.00 35.70  ? 82   ALA A C     1 
ATOM   670  O  O     . ALA A 1 82  ? 21.456  12.744  -33.601 1.00 34.27  ? 82   ALA A O     1 
ATOM   671  C  CB    . ALA A 1 82  ? 22.300  14.782  -31.754 1.00 35.75  ? 82   ALA A CB    1 
ATOM   672  N  N     . LEU A 1 83  ? 23.218  13.313  -34.874 1.00 34.32  ? 83   LEU A N     1 
ATOM   673  C  CA    . LEU A 1 83  ? 23.151  12.110  -35.700 1.00 35.99  ? 83   LEU A CA    1 
ATOM   674  C  C     . LEU A 1 83  ? 23.947  10.933  -35.131 1.00 35.64  ? 83   LEU A C     1 
ATOM   675  O  O     . LEU A 1 83  ? 24.886  11.117  -34.355 1.00 34.34  ? 83   LEU A O     1 
ATOM   676  C  CB    . LEU A 1 83  ? 23.611  12.417  -37.129 1.00 33.84  ? 83   LEU A CB    1 
ATOM   677  C  CG    . LEU A 1 83  ? 22.762  13.379  -37.965 1.00 35.62  ? 83   LEU A CG    1 
ATOM   678  C  CD1   . LEU A 1 83  ? 23.176  14.840  -37.740 1.00 36.22  ? 83   LEU A CD1   1 
ATOM   679  C  CD2   . LEU A 1 83  ? 22.852  13.011  -39.439 1.00 36.50  ? 83   LEU A CD2   1 
ATOM   680  N  N     . GLY A 1 84  ? 23.559  9.724   -35.526 1.00 34.20  ? 84   GLY A N     1 
ATOM   681  C  CA    . GLY A 1 84  ? 24.262  8.521   -35.117 1.00 31.53  ? 84   GLY A CA    1 
ATOM   682  C  C     . GLY A 1 84  ? 23.420  7.603   -34.248 1.00 37.10  ? 84   GLY A C     1 
ATOM   683  O  O     . GLY A 1 84  ? 22.308  7.953   -33.850 1.00 30.84  ? 84   GLY A O     1 
ATOM   684  N  N     . MET A 1 85  ? 23.959  6.422   -33.954 1.00 34.14  ? 85   MET A N     1 
ATOM   685  C  CA    . MET A 1 85  ? 23.274  5.437   -33.125 1.00 33.67  ? 85   MET A CA    1 
ATOM   686  C  C     . MET A 1 85  ? 23.280  5.867   -31.660 1.00 34.47  ? 85   MET A C     1 
ATOM   687  O  O     . MET A 1 85  ? 24.333  5.965   -31.027 1.00 30.46  ? 85   MET A O     1 
ATOM   688  C  CB    . MET A 1 85  ? 23.920  4.055   -33.291 1.00 32.97  ? 85   MET A CB    1 
ATOM   689  C  CG    . MET A 1 85  ? 23.341  2.974   -32.386 1.00 31.54  ? 85   MET A CG    1 
ATOM   690  S  SD    . MET A 1 85  ? 21.536  2.874   -32.431 1.00 34.34  ? 85   MET A SD    1 
ATOM   691  C  CE    . MET A 1 85  ? 21.268  2.274   -34.097 1.00 28.11  ? 85   MET A CE    1 
ATOM   692  N  N     . ASP A 1 86  ? 22.093  6.133   -31.130 1.00 32.35  ? 86   ASP A N     1 
ATOM   693  C  CA    . ASP A 1 86  ? 21.962  6.619   -29.765 1.00 36.76  ? 86   ASP A CA    1 
ATOM   694  C  C     . ASP A 1 86  ? 21.798  5.475   -28.767 1.00 35.59  ? 86   ASP A C     1 
ATOM   695  O  O     . ASP A 1 86  ? 21.927  5.678   -27.563 1.00 35.22  ? 86   ASP A O     1 
ATOM   696  C  CB    . ASP A 1 86  ? 20.798  7.604   -29.658 1.00 44.07  ? 86   ASP A CB    1 
ATOM   697  C  CG    . ASP A 1 86  ? 19.509  7.040   -30.218 1.00 52.08  ? 86   ASP A CG    1 
ATOM   698  O  OD1   . ASP A 1 86  ? 18.465  7.157   -29.543 1.00 59.04  ? 86   ASP A OD1   1 
ATOM   699  O  OD2   . ASP A 1 86  ? 19.541  6.480   -31.334 1.00 50.09  ? 86   ASP A OD2   1 
ATOM   700  N  N     . ASP A 1 87  ? 21.507  4.275   -29.265 1.00 35.33  ? 87   ASP A N     1 
ATOM   701  C  CA    . ASP A 1 87  ? 21.544  3.077   -28.425 1.00 33.25  ? 87   ASP A CA    1 
ATOM   702  C  C     . ASP A 1 87  ? 22.982  2.579   -28.444 1.00 32.76  ? 87   ASP A C     1 
ATOM   703  O  O     . ASP A 1 87  ? 23.401  1.900   -29.385 1.00 30.85  ? 87   ASP A O     1 
ATOM   704  C  CB    . ASP A 1 87  ? 20.589  2.003   -28.959 1.00 36.94  ? 87   ASP A CB    1 
ATOM   705  C  CG    . ASP A 1 87  ? 20.420  0.821   -28.000 1.00 39.97  ? 87   ASP A CG    1 
ATOM   706  O  OD1   . ASP A 1 87  ? 21.293  0.602   -27.132 1.00 38.88  ? 87   ASP A OD1   1 
ATOM   707  O  OD2   . ASP A 1 87  ? 19.407  0.102   -28.123 1.00 39.47  ? 87   ASP A OD2   1 
ATOM   708  N  N     . PHE A 1 88  ? 23.738  2.927   -27.406 1.00 33.24  ? 88   PHE A N     1 
ATOM   709  C  CA    . PHE A 1 88  ? 25.182  2.693   -27.395 1.00 34.61  ? 88   PHE A CA    1 
ATOM   710  C  C     . PHE A 1 88  ? 25.578  1.218   -27.399 1.00 33.57  ? 88   PHE A C     1 
ATOM   711  O  O     . PHE A 1 88  ? 26.636  0.865   -27.914 1.00 37.54  ? 88   PHE A O     1 
ATOM   712  C  CB    . PHE A 1 88  ? 25.840  3.424   -26.220 1.00 34.97  ? 88   PHE A CB    1 
ATOM   713  C  CG    . PHE A 1 88  ? 25.616  4.905   -26.237 1.00 35.97  ? 88   PHE A CG    1 
ATOM   714  C  CD1   . PHE A 1 88  ? 25.797  5.631   -27.403 1.00 35.26  ? 88   PHE A CD1   1 
ATOM   715  C  CD2   . PHE A 1 88  ? 25.198  5.569   -25.096 1.00 36.49  ? 88   PHE A CD2   1 
ATOM   716  C  CE1   . PHE A 1 88  ? 25.580  6.995   -27.429 1.00 33.14  ? 88   PHE A CE1   1 
ATOM   717  C  CE2   . PHE A 1 88  ? 24.979  6.935   -25.116 1.00 37.64  ? 88   PHE A CE2   1 
ATOM   718  C  CZ    . PHE A 1 88  ? 25.170  7.647   -26.284 1.00 36.02  ? 88   PHE A CZ    1 
ATOM   719  N  N     . LYS A 1 89  ? 24.742  0.349   -26.842 1.00 33.48  ? 89   LYS A N     1 
ATOM   720  C  CA    . LYS A 1 89  ? 25.085  -1.070  -26.872 1.00 36.76  ? 89   LYS A CA    1 
ATOM   721  C  C     . LYS A 1 89  ? 24.966  -1.668  -28.277 1.00 33.04  ? 89   LYS A C     1 
ATOM   722  O  O     . LYS A 1 89  ? 25.720  -2.570  -28.627 1.00 31.98  ? 89   LYS A O     1 
ATOM   723  C  CB    . LYS A 1 89  ? 24.334  -1.886  -25.813 1.00 36.04  ? 89   LYS A CB    1 
ATOM   724  C  CG    . LYS A 1 89  ? 22.837  -1.828  -25.873 1.00 40.11  ? 89   LYS A CG    1 
ATOM   725  C  CD    . LYS A 1 89  ? 22.246  -2.450  -24.615 1.00 42.09  ? 89   LYS A CD    1 
ATOM   726  C  CE    . LYS A 1 89  ? 20.771  -2.141  -24.491 1.00 41.12  ? 89   LYS A CE    1 
ATOM   727  N  NZ    . LYS A 1 89  ? 20.520  -0.684  -24.617 1.00 38.53  ? 89   LYS A NZ    1 
ATOM   728  N  N     . LEU A 1 90  ? 24.051  -1.147  -29.091 1.00 28.89  ? 90   LEU A N     1 
ATOM   729  C  CA    . LEU A 1 90  ? 24.013  -1.531  -30.502 1.00 28.97  ? 90   LEU A CA    1 
ATOM   730  C  C     . LEU A 1 90  ? 25.271  -1.051  -31.229 1.00 35.01  ? 90   LEU A C     1 
ATOM   731  O  O     . LEU A 1 90  ? 25.810  -1.751  -32.091 1.00 34.26  ? 90   LEU A O     1 
ATOM   732  C  CB    . LEU A 1 90  ? 22.772  -0.980  -31.200 1.00 27.36  ? 90   LEU A CB    1 
ATOM   733  C  CG    . LEU A 1 90  ? 21.411  -1.517  -30.757 1.00 29.15  ? 90   LEU A CG    1 
ATOM   734  C  CD1   . LEU A 1 90  ? 20.331  -1.084  -31.751 1.00 29.26  ? 90   LEU A CD1   1 
ATOM   735  C  CD2   . LEU A 1 90  ? 21.449  -3.027  -30.612 1.00 30.50  ? 90   LEU A CD2   1 
ATOM   736  N  N     . ALA A 1 91  ? 25.731  0.146   -30.879 1.00 28.89  ? 91   ALA A N     1 
ATOM   737  C  CA    . ALA A 1 91  ? 26.962  0.684   -31.449 1.00 32.89  ? 91   ALA A CA    1 
ATOM   738  C  C     . ALA A 1 91  ? 28.158  -0.155  -31.009 1.00 31.53  ? 91   ALA A C     1 
ATOM   739  O  O     . ALA A 1 91  ? 29.033  -0.485  -31.812 1.00 33.37  ? 91   ALA A O     1 
ATOM   740  C  CB    . ALA A 1 91  ? 27.146  2.142   -31.036 1.00 30.19  ? 91   ALA A CB    1 
ATOM   741  N  N     . TYR A 1 92  ? 28.188  -0.501  -29.727 1.00 31.81  ? 92   TYR A N     1 
ATOM   742  C  CA    . TYR A 1 92  ? 29.236  -1.363  -29.195 1.00 33.82  ? 92   TYR A CA    1 
ATOM   743  C  C     . TYR A 1 92  ? 29.293  -2.708  -29.924 1.00 35.41  ? 92   TYR A C     1 
ATOM   744  O  O     . TYR A 1 92  ? 30.366  -3.139  -30.346 1.00 33.22  ? 92   TYR A O     1 
ATOM   745  C  CB    . TYR A 1 92  ? 29.041  -1.598  -27.695 1.00 37.09  ? 92   TYR A CB    1 
ATOM   746  C  CG    . TYR A 1 92  ? 29.990  -2.632  -27.135 1.00 38.12  ? 92   TYR A CG    1 
ATOM   747  C  CD1   . TYR A 1 92  ? 31.293  -2.288  -26.799 1.00 39.24  ? 92   TYR A CD1   1 
ATOM   748  C  CD2   . TYR A 1 92  ? 29.593  -3.953  -26.959 1.00 34.57  ? 92   TYR A CD2   1 
ATOM   749  C  CE1   . TYR A 1 92  ? 32.171  -3.224  -26.296 1.00 40.47  ? 92   TYR A CE1   1 
ATOM   750  C  CE2   . TYR A 1 92  ? 30.470  -4.901  -26.455 1.00 35.26  ? 92   TYR A CE2   1 
ATOM   751  C  CZ    . TYR A 1 92  ? 31.756  -4.528  -26.125 1.00 37.42  ? 92   TYR A CZ    1 
ATOM   752  O  OH    . TYR A 1 92  ? 32.641  -5.456  -25.624 1.00 41.41  ? 92   TYR A OH    1 
ATOM   753  N  N     . LEU A 1 93  ? 28.145  -3.372  -30.059 1.00 34.66  ? 93   LEU A N     1 
ATOM   754  C  CA    . LEU A 1 93  ? 28.099  -4.661  -30.756 1.00 35.19  ? 93   LEU A CA    1 
ATOM   755  C  C     . LEU A 1 93  ? 28.602  -4.527  -32.190 1.00 36.56  ? 93   LEU A C     1 
ATOM   756  O  O     . LEU A 1 93  ? 29.344  -5.379  -32.682 1.00 33.92  ? 93   LEU A O     1 
ATOM   757  C  CB    . LEU A 1 93  ? 26.683  -5.248  -30.758 1.00 30.22  ? 93   LEU A CB    1 
ATOM   758  C  CG    . LEU A 1 93  ? 26.143  -5.856  -29.462 1.00 28.30  ? 93   LEU A CG    1 
ATOM   759  C  CD1   . LEU A 1 93  ? 24.747  -6.432  -29.678 1.00 27.43  ? 93   LEU A CD1   1 
ATOM   760  C  CD2   . LEU A 1 93  ? 27.084  -6.922  -28.934 1.00 29.09  ? 93   LEU A CD2   1 
ATOM   761  N  N     . SER A 1 94  ? 28.195  -3.448  -32.854 1.00 35.73  ? 94   SER A N     1 
ATOM   762  C  CA    . SER A 1 94  ? 28.586  -3.211  -34.237 1.00 37.56  ? 94   SER A CA    1 
ATOM   763  C  C     . SER A 1 94  ? 30.090  -3.001  -34.397 1.00 38.48  ? 94   SER A C     1 
ATOM   764  O  O     . SER A 1 94  ? 30.675  -3.418  -35.398 1.00 40.08  ? 94   SER A O     1 
ATOM   765  C  CB    . SER A 1 94  ? 27.835  -2.007  -34.804 1.00 38.26  ? 94   SER A CB    1 
ATOM   766  O  OG    . SER A 1 94  ? 28.202  -1.787  -36.151 1.00 39.30  ? 94   SER A OG    1 
ATOM   767  N  N     . ASP A 1 95  ? 30.706  -2.340  -33.419 1.00 37.80  ? 95   ASP A N     1 
ATOM   768  C  CA    . ASP A 1 95  ? 32.146  -2.100  -33.435 1.00 41.78  ? 95   ASP A CA    1 
ATOM   769  C  C     . ASP A 1 95  ? 32.914  -3.366  -33.102 1.00 44.73  ? 95   ASP A C     1 
ATOM   770  O  O     . ASP A 1 95  ? 33.948  -3.653  -33.702 1.00 46.63  ? 95   ASP A O     1 
ATOM   771  C  CB    . ASP A 1 95  ? 32.532  -1.021  -32.421 1.00 42.01  ? 95   ASP A CB    1 
ATOM   772  C  CG    . ASP A 1 95  ? 32.184  0.375   -32.888 1.00 44.23  ? 95   ASP A CG    1 
ATOM   773  O  OD1   . ASP A 1 95  ? 31.959  0.561   -34.102 1.00 44.11  ? 95   ASP A OD1   1 
ATOM   774  O  OD2   . ASP A 1 95  ? 32.147  1.288   -32.037 1.00 43.48  ? 95   ASP A OD2   1 
ATOM   775  N  N     . THR A 1 96  ? 32.401  -4.115  -32.131 1.00 40.96  ? 96   THR A N     1 
ATOM   776  C  CA    . THR A 1 96  ? 33.093  -5.290  -31.620 1.00 40.22  ? 96   THR A CA    1 
ATOM   777  C  C     . THR A 1 96  ? 32.966  -6.465  -32.583 1.00 40.11  ? 96   THR A C     1 
ATOM   778  O  O     . THR A 1 96  ? 33.895  -7.256  -32.731 1.00 41.14  ? 96   THR A O     1 
ATOM   779  C  CB    . THR A 1 96  ? 32.552  -5.691  -30.232 1.00 37.89  ? 96   THR A CB    1 
ATOM   780  O  OG1   . THR A 1 96  ? 32.473  -4.530  -29.394 1.00 34.46  ? 96   THR A OG1   1 
ATOM   781  C  CG2   . THR A 1 96  ? 33.458  -6.727  -29.575 1.00 36.57  ? 96   THR A CG2   1 
ATOM   782  N  N     . TYR A 1 97  ? 31.818  -6.569  -33.246 1.00 40.67  ? 97   TYR A N     1 
ATOM   783  C  CA    . TYR A 1 97  ? 31.572  -7.675  -34.168 1.00 39.79  ? 97   TYR A CA    1 
ATOM   784  C  C     . TYR A 1 97  ? 31.357  -7.192  -35.598 1.00 41.82  ? 97   TYR A C     1 
ATOM   785  O  O     . TYR A 1 97  ? 30.260  -7.285  -36.142 1.00 38.51  ? 97   TYR A O     1 
ATOM   786  C  CB    . TYR A 1 97  ? 30.409  -8.537  -33.662 1.00 33.15  ? 97   TYR A CB    1 
ATOM   787  C  CG    . TYR A 1 97  ? 30.714  -9.077  -32.288 1.00 35.79  ? 97   TYR A CG    1 
ATOM   788  C  CD1   . TYR A 1 97  ? 31.586  -10.149 -32.128 1.00 34.63  ? 97   TYR A CD1   1 
ATOM   789  C  CD2   . TYR A 1 97  ? 30.192  -8.478  -31.147 1.00 31.53  ? 97   TYR A CD2   1 
ATOM   790  C  CE1   . TYR A 1 97  ? 31.900  -10.636 -30.878 1.00 35.92  ? 97   TYR A CE1   1 
ATOM   791  C  CE2   . TYR A 1 97  ? 30.506  -8.957  -29.884 1.00 31.91  ? 97   TYR A CE2   1 
ATOM   792  C  CZ    . TYR A 1 97  ? 31.365  -10.039 -29.762 1.00 36.56  ? 97   TYR A CZ    1 
ATOM   793  O  OH    . TYR A 1 97  ? 31.689  -10.533 -28.523 1.00 37.84  ? 97   TYR A OH    1 
ATOM   794  N  N     . ASN A 1 98  ? 32.432  -6.686  -36.199 1.00 44.09  ? 98   ASN A N     1 
ATOM   795  C  CA    . ASN A 1 98  ? 32.387  -6.102  -37.538 1.00 45.36  ? 98   ASN A CA    1 
ATOM   796  C  C     . ASN A 1 98  ? 32.488  -7.140  -38.652 1.00 44.06  ? 98   ASN A C     1 
ATOM   797  O  O     . ASN A 1 98  ? 33.258  -6.983  -39.598 1.00 49.18  ? 98   ASN A O     1 
ATOM   798  C  CB    . ASN A 1 98  ? 33.485  -5.045  -37.697 1.00 50.90  ? 98   ASN A CB    1 
ATOM   799  C  CG    . ASN A 1 98  ? 34.878  -5.607  -37.461 1.00 59.13  ? 98   ASN A CG    1 
ATOM   800  O  OD1   . ASN A 1 98  ? 35.064  -6.530  -36.666 1.00 63.39  ? 98   ASN A OD1   1 
ATOM   801  N  ND2   . ASN A 1 98  ? 35.867  -5.049  -38.153 1.00 61.30  ? 98   ASN A ND2   1 
ATOM   802  N  N     . TYR A 1 99  ? 31.706  -8.204  -38.525 1.00 46.96  ? 99   TYR A N     1 
ATOM   803  C  CA    . TYR A 1 99  ? 31.663  -9.261  -39.524 1.00 46.98  ? 99   TYR A CA    1 
ATOM   804  C  C     . TYR A 1 99  ? 30.353  -10.015 -39.374 1.00 45.18  ? 99   TYR A C     1 
ATOM   805  O  O     . TYR A 1 99  ? 29.612  -9.784  -38.419 1.00 46.18  ? 99   TYR A O     1 
ATOM   806  C  CB    . TYR A 1 99  ? 32.847  -10.218 -39.355 1.00 47.30  ? 99   TYR A CB    1 
ATOM   807  C  CG    . TYR A 1 99  ? 33.081  -10.682 -37.930 1.00 44.46  ? 99   TYR A CG    1 
ATOM   808  C  CD1   . TYR A 1 99  ? 32.375  -11.757 -37.400 1.00 44.49  ? 99   TYR A CD1   1 
ATOM   809  C  CD2   . TYR A 1 99  ? 34.020  -10.053 -37.121 1.00 45.82  ? 99   TYR A CD2   1 
ATOM   810  C  CE1   . TYR A 1 99  ? 32.593  -12.187 -36.099 1.00 45.24  ? 99   TYR A CE1   1 
ATOM   811  C  CE2   . TYR A 1 99  ? 34.245  -10.474 -35.820 1.00 44.09  ? 99   TYR A CE2   1 
ATOM   812  C  CZ    . TYR A 1 99  ? 33.531  -11.541 -35.315 1.00 45.54  ? 99   TYR A CZ    1 
ATOM   813  O  OH    . TYR A 1 99  ? 33.759  -11.964 -34.022 1.00 45.31  ? 99   TYR A OH    1 
ATOM   814  N  N     . GLU A 1 100 ? 30.059  -10.908 -40.312 1.00 47.20  ? 100  GLU A N     1 
ATOM   815  C  CA    . GLU A 1 100 ? 28.871  -11.744 -40.191 1.00 49.82  ? 100  GLU A CA    1 
ATOM   816  C  C     . GLU A 1 100 ? 29.076  -12.751 -39.069 1.00 47.94  ? 100  GLU A C     1 
ATOM   817  O  O     . GLU A 1 100 ? 29.951  -13.613 -39.143 1.00 47.93  ? 100  GLU A O     1 
ATOM   818  C  CB    . GLU A 1 100 ? 28.557  -12.463 -41.503 1.00 57.34  ? 100  GLU A CB    1 
ATOM   819  C  CG    . GLU A 1 100 ? 27.270  -13.273 -41.453 1.00 63.28  ? 100  GLU A CG    1 
ATOM   820  C  CD    . GLU A 1 100 ? 27.026  -14.080 -42.715 1.00 71.55  ? 100  GLU A CD    1 
ATOM   821  O  OE1   . GLU A 1 100 ? 27.738  -13.857 -43.718 1.00 76.33  ? 100  GLU A OE1   1 
ATOM   822  O  OE2   . GLU A 1 100 ? 26.120  -14.941 -42.701 1.00 72.16  ? 100  GLU A OE2   1 
ATOM   823  N  N     . ILE A 1 101 ? 28.269  -12.633 -38.024 1.00 43.24  ? 101  ILE A N     1 
ATOM   824  C  CA    . ILE A 1 101 ? 28.414  -13.495 -36.863 1.00 41.89  ? 101  ILE A CA    1 
ATOM   825  C  C     . ILE A 1 101 ? 28.028  -14.944 -37.152 1.00 42.08  ? 101  ILE A C     1 
ATOM   826  O  O     . ILE A 1 101 ? 26.893  -15.243 -37.521 1.00 42.73  ? 101  ILE A O     1 
ATOM   827  C  CB    . ILE A 1 101 ? 27.598  -12.974 -35.666 1.00 40.69  ? 101  ILE A CB    1 
ATOM   828  C  CG1   . ILE A 1 101 ? 28.198  -11.664 -35.154 1.00 41.57  ? 101  ILE A CG1   1 
ATOM   829  C  CG2   . ILE A 1 101 ? 27.565  -14.014 -34.549 1.00 40.84  ? 101  ILE A CG2   1 
ATOM   830  C  CD1   . ILE A 1 101 ? 27.401  -11.029 -34.049 1.00 40.93  ? 101  ILE A CD1   1 
ATOM   831  N  N     . LYS A 1 102 ? 28.995  -15.838 -36.994 1.00 42.10  ? 102  LYS A N     1 
ATOM   832  C  CA    . LYS A 1 102 ? 28.727  -17.264 -37.014 1.00 46.22  ? 102  LYS A CA    1 
ATOM   833  C  C     . LYS A 1 102 ? 28.797  -17.739 -35.571 1.00 45.53  ? 102  LYS A C     1 
ATOM   834  O  O     . LYS A 1 102 ? 29.820  -17.585 -34.906 1.00 48.42  ? 102  LYS A O     1 
ATOM   835  C  CB    . LYS A 1 102 ? 29.748  -17.997 -37.884 1.00 50.54  ? 102  LYS A CB    1 
ATOM   836  C  CG    . LYS A 1 102 ? 29.686  -17.617 -39.357 1.00 51.83  ? 102  LYS A CG    1 
ATOM   837  N  N     . TYR A 1 103 ? 27.699  -18.287 -35.072 1.00 44.82  ? 103  TYR A N     1 
ATOM   838  C  CA    . TYR A 1 103 ? 27.639  -18.662 -33.669 1.00 43.32  ? 103  TYR A CA    1 
ATOM   839  C  C     . TYR A 1 103 ? 27.486  -20.164 -33.491 1.00 41.74  ? 103  TYR A C     1 
ATOM   840  O  O     . TYR A 1 103 ? 27.014  -20.860 -34.389 1.00 40.07  ? 103  TYR A O     1 
ATOM   841  C  CB    . TYR A 1 103 ? 26.503  -17.921 -32.963 1.00 39.21  ? 103  TYR A CB    1 
ATOM   842  C  CG    . TYR A 1 103 ? 25.119  -18.304 -33.444 1.00 39.21  ? 103  TYR A CG    1 
ATOM   843  C  CD1   . TYR A 1 103 ? 24.367  -19.260 -32.769 1.00 36.63  ? 103  TYR A CD1   1 
ATOM   844  C  CD2   . TYR A 1 103 ? 24.561  -17.706 -34.569 1.00 37.41  ? 103  TYR A CD2   1 
ATOM   845  C  CE1   . TYR A 1 103 ? 23.104  -19.612 -33.200 1.00 34.99  ? 103  TYR A CE1   1 
ATOM   846  C  CE2   . TYR A 1 103 ? 23.296  -18.051 -35.008 1.00 35.08  ? 103  TYR A CE2   1 
ATOM   847  C  CZ    . TYR A 1 103 ? 22.573  -19.006 -34.319 1.00 35.82  ? 103  TYR A CZ    1 
ATOM   848  O  OH    . TYR A 1 103 ? 21.315  -19.361 -34.745 1.00 37.18  ? 103  TYR A OH    1 
ATOM   849  N  N     . ASP A 1 104 ? 27.900  -20.650 -32.326 1.00 41.88  ? 104  ASP A N     1 
ATOM   850  C  CA    . ASP A 1 104 ? 27.772  -22.059 -31.977 1.00 40.54  ? 104  ASP A CA    1 
ATOM   851  C  C     . ASP A 1 104 ? 26.764  -22.185 -30.841 1.00 37.84  ? 104  ASP A C     1 
ATOM   852  O  O     . ASP A 1 104 ? 27.068  -21.854 -29.696 1.00 40.33  ? 104  ASP A O     1 
ATOM   853  C  CB    . ASP A 1 104 ? 29.128  -22.620 -31.543 1.00 42.85  ? 104  ASP A CB    1 
ATOM   854  C  CG    . ASP A 1 104 ? 29.119  -24.133 -31.378 1.00 47.70  ? 104  ASP A CG    1 
ATOM   855  O  OD1   . ASP A 1 104 ? 28.025  -24.738 -31.309 1.00 45.25  ? 104  ASP A OD1   1 
ATOM   856  O  OD2   . ASP A 1 104 ? 30.218  -24.720 -31.310 1.00 54.08  ? 104  ASP A OD2   1 
ATOM   857  N  N     . HIS A 1 105 ? 25.568  -22.670 -31.160 1.00 37.00  ? 105  HIS A N     1 
ATOM   858  C  CA    . HIS A 1 105 ? 24.490  -22.733 -30.176 1.00 38.67  ? 105  HIS A CA    1 
ATOM   859  C  C     . HIS A 1 105 ? 24.814  -23.655 -29.000 1.00 35.16  ? 105  HIS A C     1 
ATOM   860  O  O     . HIS A 1 105 ? 24.333  -23.436 -27.890 1.00 34.87  ? 105  HIS A O     1 
ATOM   861  C  CB    . HIS A 1 105 ? 23.164  -23.134 -30.832 1.00 40.21  ? 105  HIS A CB    1 
ATOM   862  C  CG    . HIS A 1 105 ? 23.096  -24.574 -31.233 1.00 45.96  ? 105  HIS A CG    1 
ATOM   863  N  ND1   . HIS A 1 105 ? 22.695  -25.569 -30.367 1.00 49.23  ? 105  HIS A ND1   1 
ATOM   864  C  CD2   . HIS A 1 105 ? 23.374  -25.188 -32.407 1.00 50.60  ? 105  HIS A CD2   1 
ATOM   865  C  CE1   . HIS A 1 105 ? 22.732  -26.733 -30.988 1.00 49.81  ? 105  HIS A CE1   1 
ATOM   866  N  NE2   . HIS A 1 105 ? 23.141  -26.531 -32.229 1.00 52.90  ? 105  HIS A NE2   1 
ATOM   867  N  N     . THR A 1 106 ? 25.644  -24.669 -29.235 1.00 34.98  ? 106  THR A N     1 
ATOM   868  C  CA    . THR A 1 106 ? 26.011  -25.600 -28.168 1.00 35.83  ? 106  THR A CA    1 
ATOM   869  C  C     . THR A 1 106 ? 26.820  -24.910 -27.067 1.00 35.99  ? 106  THR A C     1 
ATOM   870  O  O     . THR A 1 106 ? 26.924  -25.423 -25.952 1.00 32.93  ? 106  THR A O     1 
ATOM   871  C  CB    . THR A 1 106 ? 26.797  -26.819 -28.700 1.00 38.11  ? 106  THR A CB    1 
ATOM   872  O  OG1   . THR A 1 106 ? 28.093  -26.404 -29.150 1.00 39.52  ? 106  THR A OG1   1 
ATOM   873  C  CG2   . THR A 1 106 ? 26.042  -27.484 -29.846 1.00 36.93  ? 106  THR A CG2   1 
ATOM   874  N  N     . LYS A 1 107 ? 27.375  -23.742 -27.383 1.00 34.33  ? 107  LYS A N     1 
ATOM   875  C  CA    . LYS A 1 107 ? 28.163  -22.973 -26.423 1.00 35.36  ? 107  LYS A CA    1 
ATOM   876  C  C     . LYS A 1 107 ? 27.291  -22.001 -25.636 1.00 35.10  ? 107  LYS A C     1 
ATOM   877  O  O     . LYS A 1 107 ? 27.739  -21.406 -24.657 1.00 36.89  ? 107  LYS A O     1 
ATOM   878  C  CB    . LYS A 1 107 ? 29.266  -22.190 -27.136 1.00 38.03  ? 107  LYS A CB    1 
ATOM   879  C  CG    . LYS A 1 107 ? 30.298  -23.045 -27.861 1.00 45.30  ? 107  LYS A CG    1 
ATOM   880  C  CD    . LYS A 1 107 ? 31.121  -23.870 -26.894 1.00 49.41  ? 107  LYS A CD    1 
ATOM   881  C  CE    . LYS A 1 107 ? 32.314  -24.506 -27.595 1.00 54.71  ? 107  LYS A CE    1 
ATOM   882  N  NZ    . LYS A 1 107 ? 33.157  -25.278 -26.644 1.00 56.43  ? 107  LYS A NZ    1 
ATOM   883  N  N     . ILE A 1 108 ? 26.048  -21.836 -26.075 1.00 32.79  ? 108  ILE A N     1 
ATOM   884  C  CA    . ILE A 1 108 ? 25.134  -20.888 -25.450 1.00 31.78  ? 108  ILE A CA    1 
ATOM   885  C  C     . ILE A 1 108 ? 24.292  -21.577 -24.390 1.00 31.68  ? 108  ILE A C     1 
ATOM   886  O  O     . ILE A 1 108 ? 23.604  -22.556 -24.678 1.00 29.68  ? 108  ILE A O     1 
ATOM   887  C  CB    . ILE A 1 108 ? 24.195  -20.262 -26.488 1.00 31.27  ? 108  ILE A CB    1 
ATOM   888  C  CG1   . ILE A 1 108 ? 25.005  -19.631 -27.625 1.00 31.35  ? 108  ILE A CG1   1 
ATOM   889  C  CG2   . ILE A 1 108 ? 23.268  -19.239 -25.829 1.00 32.22  ? 108  ILE A CG2   1 
ATOM   890  C  CD1   . ILE A 1 108 ? 24.154  -18.945 -28.678 1.00 28.06  ? 108  ILE A CD1   1 
ATOM   891  N  N     . ARG A 1 109 ? 24.341  -21.072 -23.162 1.00 28.37  ? 109  ARG A N     1 
ATOM   892  C  CA    . ARG A 1 109 ? 23.614  -21.718 -22.077 1.00 28.61  ? 109  ARG A CA    1 
ATOM   893  C  C     . ARG A 1 109 ? 22.138  -21.333 -22.097 1.00 29.38  ? 109  ARG A C     1 
ATOM   894  O  O     . ARG A 1 109 ? 21.771  -20.232 -21.700 1.00 27.28  ? 109  ARG A O     1 
ATOM   895  C  CB    . ARG A 1 109 ? 24.248  -21.395 -20.719 1.00 28.51  ? 109  ARG A CB    1 
ATOM   896  C  CG    . ARG A 1 109 ? 23.749  -22.290 -19.586 1.00 30.28  ? 109  ARG A CG    1 
ATOM   897  C  CD    . ARG A 1 109 ? 24.525  -22.065 -18.296 1.00 30.15  ? 109  ARG A CD    1 
ATOM   898  N  NE    . ARG A 1 109 ? 25.961  -22.292 -18.461 1.00 31.48  ? 109  ARG A NE    1 
ATOM   899  C  CZ    . ARG A 1 109 ? 26.576  -23.450 -18.228 1.00 32.20  ? 109  ARG A CZ    1 
ATOM   900  N  NH1   . ARG A 1 109 ? 25.886  -24.506 -17.817 1.00 30.19  ? 109  ARG A NH1   1 
ATOM   901  N  NH2   . ARG A 1 109 ? 27.886  -23.553 -18.409 1.00 31.13  ? 109  ARG A NH2   1 
ATOM   902  N  N     . VAL A 1 110 ? 21.297  -22.247 -22.572 1.00 29.75  ? 110  VAL A N     1 
ATOM   903  C  CA    . VAL A 1 110 ? 19.857  -22.029 -22.582 1.00 25.93  ? 110  VAL A CA    1 
ATOM   904  C  C     . VAL A 1 110 ? 19.227  -22.770 -21.411 1.00 29.33  ? 110  VAL A C     1 
ATOM   905  O  O     . VAL A 1 110 ? 19.349  -23.996 -21.300 1.00 28.83  ? 110  VAL A O     1 
ATOM   906  C  CB    . VAL A 1 110 ? 19.219  -22.517 -23.892 1.00 25.55  ? 110  VAL A CB    1 
ATOM   907  C  CG1   . VAL A 1 110 ? 17.724  -22.189 -23.918 1.00 23.02  ? 110  VAL A CG1   1 
ATOM   908  C  CG2   . VAL A 1 110 ? 19.928  -21.898 -25.084 1.00 24.77  ? 110  VAL A CG2   1 
ATOM   909  N  N     . ALA A 1 111 ? 18.564  -22.023 -20.533 1.00 26.97  ? 111  ALA A N     1 
ATOM   910  C  CA    . ALA A 1 111 ? 17.969  -22.599 -19.337 1.00 23.94  ? 111  ALA A CA    1 
ATOM   911  C  C     . ALA A 1 111 ? 16.453  -22.569 -19.419 1.00 24.31  ? 111  ALA A C     1 
ATOM   912  O  O     . ALA A 1 111 ? 15.862  -21.538 -19.719 1.00 27.24  ? 111  ALA A O     1 
ATOM   913  C  CB    . ALA A 1 111 ? 18.444  -21.862 -18.091 1.00 21.75  ? 111  ALA A CB    1 
ATOM   914  N  N     . ASN A 1 112 ? 15.842  -23.720 -19.162 1.00 28.16  ? 112  ASN A N     1 
ATOM   915  C  CA    . ASN A 1 112 ? 14.396  -23.862 -19.111 1.00 30.55  ? 112  ASN A CA    1 
ATOM   916  C  C     . ASN A 1 112 ? 14.003  -24.199 -17.685 1.00 29.64  ? 112  ASN A C     1 
ATOM   917  O  O     . ASN A 1 112 ? 14.435  -25.221 -17.159 1.00 27.88  ? 112  ASN A O     1 
ATOM   918  C  CB    . ASN A 1 112 ? 13.958  -25.023 -20.008 1.00 34.18  ? 112  ASN A CB    1 
ATOM   919  C  CG    . ASN A 1 112 ? 13.788  -24.618 -21.456 1.00 39.94  ? 112  ASN A CG    1 
ATOM   920  O  OD1   . ASN A 1 112 ? 14.760  -24.324 -22.156 1.00 44.92  ? 112  ASN A OD1   1 
ATOM   921  N  ND2   . ASN A 1 112 ? 12.547  -24.625 -21.923 1.00 35.33  ? 112  ASN A ND2   1 
ATOM   922  N  N     . PHE A 1 113 ? 13.189  -23.363 -17.051 1.00 27.77  ? 113  PHE A N     1 
ATOM   923  C  CA    . PHE A 1 113 ? 12.786  -23.669 -15.683 1.00 25.04  ? 113  PHE A CA    1 
ATOM   924  C  C     . PHE A 1 113 ? 11.317  -23.401 -15.376 1.00 25.85  ? 113  PHE A C     1 
ATOM   925  O  O     . PHE A 1 113 ? 10.610  -22.730 -16.132 1.00 24.00  ? 113  PHE A O     1 
ATOM   926  C  CB    . PHE A 1 113 ? 13.724  -23.005 -14.655 1.00 31.13  ? 113  PHE A CB    1 
ATOM   927  C  CG    . PHE A 1 113 ? 13.371  -21.580 -14.315 1.00 31.24  ? 113  PHE A CG    1 
ATOM   928  C  CD1   . PHE A 1 113 ? 13.074  -21.224 -13.007 1.00 34.10  ? 113  PHE A CD1   1 
ATOM   929  C  CD2   . PHE A 1 113 ? 13.349  -20.599 -15.291 1.00 29.72  ? 113  PHE A CD2   1 
ATOM   930  C  CE1   . PHE A 1 113 ? 12.757  -19.912 -12.677 1.00 33.37  ? 113  PHE A CE1   1 
ATOM   931  C  CE2   . PHE A 1 113 ? 13.029  -19.284 -14.971 1.00 31.86  ? 113  PHE A CE2   1 
ATOM   932  C  CZ    . PHE A 1 113 ? 12.731  -18.943 -13.662 1.00 31.80  ? 113  PHE A CZ    1 
ATOM   933  N  N     . ASP A 1 114 ? 10.866  -23.975 -14.269 1.00 23.68  ? 114  ASP A N     1 
ATOM   934  C  CA    . ASP A 1 114 ? 9.496   -23.846 -13.813 1.00 23.32  ? 114  ASP A CA    1 
ATOM   935  C  C     . ASP A 1 114 ? 9.501   -24.072 -12.312 1.00 25.82  ? 114  ASP A C     1 
ATOM   936  O  O     . ASP A 1 114 ? 10.231  -24.926 -11.810 1.00 22.91  ? 114  ASP A O     1 
ATOM   937  C  CB    . ASP A 1 114 ? 8.603   -24.888 -14.486 1.00 27.60  ? 114  ASP A CB    1 
ATOM   938  C  CG    . ASP A 1 114 ? 7.128   -24.689 -14.165 1.00 37.52  ? 114  ASP A CG    1 
ATOM   939  O  OD1   . ASP A 1 114 ? 6.504   -23.801 -14.785 1.00 40.28  ? 114  ASP A OD1   1 
ATOM   940  O  OD2   . ASP A 1 114 ? 6.590   -25.415 -13.297 1.00 42.30  ? 114  ASP A OD2   1 
ATOM   941  N  N     . ILE A 1 115 ? 8.692   -23.309 -11.593 1.00 23.44  ? 115  ILE A N     1 
ATOM   942  C  CA    . ILE A 1 115 ? 8.647   -23.442 -10.150 1.00 24.69  ? 115  ILE A CA    1 
ATOM   943  C  C     . ILE A 1 115 ? 7.260   -23.871 -9.718  1.00 27.68  ? 115  ILE A C     1 
ATOM   944  O  O     . ILE A 1 115 ? 6.296   -23.732 -10.470 1.00 27.73  ? 115  ILE A O     1 
ATOM   945  C  CB    . ILE A 1 115 ? 9.024   -22.125 -9.436  1.00 26.55  ? 115  ILE A CB    1 
ATOM   946  C  CG1   . ILE A 1 115 ? 7.912   -21.085 -9.583  1.00 25.04  ? 115  ILE A CG1   1 
ATOM   947  C  CG2   . ILE A 1 115 ? 10.345  -21.580 -9.973  1.00 26.97  ? 115  ILE A CG2   1 
ATOM   948  C  CD1   . ILE A 1 115 ? 8.144   -19.837 -8.742  1.00 26.16  ? 115  ILE A CD1   1 
ATOM   949  N  N     . GLU A 1 116 ? 7.167   -24.414 -8.511  1.00 25.60  ? 116  GLU A N     1 
ATOM   950  C  CA    . GLU A 1 116 ? 5.875   -24.722 -7.927  1.00 29.77  ? 116  GLU A CA    1 
ATOM   951  C  C     . GLU A 1 116 ? 5.749   -23.949 -6.625  1.00 29.93  ? 116  GLU A C     1 
ATOM   952  O  O     . GLU A 1 116 ? 6.715   -23.834 -5.871  1.00 30.29  ? 116  GLU A O     1 
ATOM   953  C  CB    . GLU A 1 116 ? 5.730   -26.224 -7.677  1.00 32.13  ? 116  GLU A CB    1 
ATOM   954  C  CG    . GLU A 1 116 ? 5.827   -27.080 -8.932  1.00 36.50  ? 116  GLU A CG    1 
ATOM   955  C  CD    . GLU A 1 116 ? 4.746   -26.762 -9.954  1.00 41.23  ? 116  GLU A CD    1 
ATOM   956  O  OE1   . GLU A 1 116 ? 3.606   -26.453 -9.548  1.00 41.92  ? 116  GLU A OE1   1 
ATOM   957  O  OE2   . GLU A 1 116 ? 5.039   -26.819 -11.167 1.00 44.20  ? 116  GLU A OE2   1 
ATOM   958  N  N     . VAL A 1 117 ? 4.564   -23.394 -6.389  1.00 29.04  ? 117  VAL A N     1 
ATOM   959  C  CA    . VAL A 1 117 ? 4.264   -22.672 -5.157  1.00 29.72  ? 117  VAL A CA    1 
ATOM   960  C  C     . VAL A 1 117 ? 2.881   -23.071 -4.645  1.00 32.66  ? 117  VAL A C     1 
ATOM   961  O  O     . VAL A 1 117 ? 1.863   -22.735 -5.250  1.00 30.12  ? 117  VAL A O     1 
ATOM   962  C  CB    . VAL A 1 117 ? 4.278   -21.137 -5.370  1.00 29.57  ? 117  VAL A CB    1 
ATOM   963  C  CG1   . VAL A 1 117 ? 3.907   -20.420 -4.079  1.00 27.38  ? 117  VAL A CG1   1 
ATOM   964  C  CG2   . VAL A 1 117 ? 5.639   -20.665 -5.865  1.00 27.72  ? 117  VAL A CG2   1 
ATOM   965  N  N     . THR A 1 118 ? 2.841   -23.794 -3.532  1.00 35.64  ? 118  THR A N     1 
ATOM   966  C  CA    . THR A 1 118 ? 1.567   -24.134 -2.912  1.00 34.53  ? 118  THR A CA    1 
ATOM   967  C  C     . THR A 1 118 ? 0.976   -22.900 -2.246  1.00 37.14  ? 118  THR A C     1 
ATOM   968  O  O     . THR A 1 118 ? 1.634   -22.244 -1.436  1.00 36.71  ? 118  THR A O     1 
ATOM   969  C  CB    . THR A 1 118 ? 1.717   -25.262 -1.878  1.00 34.54  ? 118  THR A CB    1 
ATOM   970  O  OG1   . THR A 1 118 ? 2.039   -26.483 -2.554  1.00 32.70  ? 118  THR A OG1   1 
ATOM   971  C  CG2   . THR A 1 118 ? 0.421   -25.456 -1.101  1.00 37.63  ? 118  THR A CG2   1 
ATOM   972  N  N     . SER A 1 119 ? -0.260  -22.577 -2.609  1.00 42.57  ? 119  SER A N     1 
ATOM   973  C  CA    . SER A 1 119 ? -0.964  -21.447 -2.021  1.00 50.09  ? 119  SER A CA    1 
ATOM   974  C  C     . SER A 1 119 ? -2.385  -21.836 -1.633  1.00 56.82  ? 119  SER A C     1 
ATOM   975  O  O     . SER A 1 119 ? -3.190  -22.196 -2.491  1.00 58.12  ? 119  SER A O     1 
ATOM   976  C  CB    . SER A 1 119 ? -0.999  -20.272 -2.994  1.00 52.79  ? 119  SER A CB    1 
ATOM   977  O  OG    . SER A 1 119 ? -1.830  -19.239 -2.495  1.00 57.12  ? 119  SER A OG    1 
ATOM   978  N  N     . PRO A 1 120 ? -2.696  -21.766 -0.332  1.00 61.07  ? 120  PRO A N     1 
ATOM   979  C  CA    . PRO A 1 120 ? -4.033  -22.109 0.163   1.00 65.96  ? 120  PRO A CA    1 
ATOM   980  C  C     . PRO A 1 120 ? -5.044  -20.980 -0.028  1.00 69.46  ? 120  PRO A C     1 
ATOM   981  O  O     . PRO A 1 120 ? -6.242  -21.210 0.128   1.00 71.26  ? 120  PRO A O     1 
ATOM   982  C  CB    . PRO A 1 120 ? -3.793  -22.352 1.654   1.00 66.37  ? 120  PRO A CB    1 
ATOM   983  C  CG    . PRO A 1 120 ? -2.644  -21.466 1.986   1.00 66.22  ? 120  PRO A CG    1 
ATOM   984  C  CD    . PRO A 1 120 ? -1.761  -21.457 0.764   1.00 62.75  ? 120  PRO A CD    1 
ATOM   985  N  N     . ASP A 1 121 ? -4.570  -19.784 -0.366  1.00 71.62  ? 121  ASP A N     1 
ATOM   986  C  CA    . ASP A 1 121 ? -5.453  -18.626 -0.484  1.00 77.05  ? 121  ASP A CA    1 
ATOM   987  C  C     . ASP A 1 121 ? -5.397  -17.952 -1.856  1.00 74.45  ? 121  ASP A C     1 
ATOM   988  O  O     . ASP A 1 121 ? -5.151  -16.750 -1.956  1.00 75.74  ? 121  ASP A O     1 
ATOM   989  C  CB    . ASP A 1 121 ? -5.149  -17.606 0.619   1.00 84.49  ? 121  ASP A CB    1 
ATOM   990  C  CG    . ASP A 1 121 ? -3.697  -17.163 0.620   1.00 89.21  ? 121  ASP A CG    1 
ATOM   991  O  OD1   . ASP A 1 121 ? -2.835  -17.945 0.167   1.00 90.42  ? 121  ASP A OD1   1 
ATOM   992  O  OD2   . ASP A 1 121 ? -3.418  -16.032 1.074   1.00 91.75  ? 121  ASP A OD2   1 
ATOM   993  N  N     . GLY A 1 122 ? -5.633  -18.726 -2.911  1.00 71.19  ? 122  GLY A N     1 
ATOM   994  C  CA    . GLY A 1 122 ? -5.680  -18.178 -4.256  1.00 69.48  ? 122  GLY A CA    1 
ATOM   995  C  C     . GLY A 1 122 ? -4.330  -18.123 -4.947  1.00 64.83  ? 122  GLY A C     1 
ATOM   996  O  O     . GLY A 1 122 ? -3.340  -18.647 -4.439  1.00 61.67  ? 122  GLY A O     1 
ATOM   997  N  N     . PHE A 1 123 ? -4.298  -17.486 -6.115  1.00 63.74  ? 123  PHE A N     1 
ATOM   998  C  CA    . PHE A 1 123 ? -3.075  -17.366 -6.906  1.00 60.93  ? 123  PHE A CA    1 
ATOM   999  C  C     . PHE A 1 123 ? -1.995  -16.586 -6.158  1.00 55.78  ? 123  PHE A C     1 
ATOM   1000 O  O     . PHE A 1 123 ? -2.239  -15.478 -5.680  1.00 58.79  ? 123  PHE A O     1 
ATOM   1001 C  CB    . PHE A 1 123 ? -3.376  -16.698 -8.249  1.00 61.87  ? 123  PHE A CB    1 
ATOM   1002 C  CG    . PHE A 1 123 ? -2.159  -16.450 -9.092  1.00 62.70  ? 123  PHE A CG    1 
ATOM   1003 C  CD1   . PHE A 1 123 ? -1.607  -17.469 -9.851  1.00 63.54  ? 123  PHE A CD1   1 
ATOM   1004 C  CD2   . PHE A 1 123 ? -1.573  -15.194 -9.137  1.00 62.97  ? 123  PHE A CD2   1 
ATOM   1005 C  CE1   . PHE A 1 123 ? -0.487  -17.245 -10.632 1.00 62.40  ? 123  PHE A CE1   1 
ATOM   1006 C  CE2   . PHE A 1 123 ? -0.455  -14.963 -9.915  1.00 62.26  ? 123  PHE A CE2   1 
ATOM   1007 C  CZ    . PHE A 1 123 ? 0.089   -15.991 -10.664 1.00 61.84  ? 123  PHE A CZ    1 
ATOM   1008 N  N     . PRO A 1 124 ? -0.794  -17.172 -6.051  1.00 47.75  ? 124  PRO A N     1 
ATOM   1009 C  CA    . PRO A 1 124 ? 0.313   -16.542 -5.324  1.00 45.84  ? 124  PRO A CA    1 
ATOM   1010 C  C     . PRO A 1 124 ? 0.922   -15.379 -6.103  1.00 42.39  ? 124  PRO A C     1 
ATOM   1011 O  O     . PRO A 1 124 ? 1.705   -15.606 -7.027  1.00 44.35  ? 124  PRO A O     1 
ATOM   1012 C  CB    . PRO A 1 124 ? 1.328   -17.680 -5.185  1.00 42.96  ? 124  PRO A CB    1 
ATOM   1013 C  CG    . PRO A 1 124 ? 1.050   -18.577 -6.342  1.00 40.75  ? 124  PRO A CG    1 
ATOM   1014 C  CD    . PRO A 1 124 ? -0.428  -18.494 -6.592  1.00 43.80  ? 124  PRO A CD    1 
ATOM   1015 N  N     . GLU A 1 125 ? 0.571   -14.153 -5.727  1.00 38.02  ? 125  GLU A N     1 
ATOM   1016 C  CA    . GLU A 1 125 ? 1.071   -12.960 -6.410  1.00 39.81  ? 125  GLU A CA    1 
ATOM   1017 C  C     . GLU A 1 125 ? 2.589   -12.826 -6.317  1.00 39.67  ? 125  GLU A C     1 
ATOM   1018 O  O     . GLU A 1 125 ? 3.145   -12.786 -5.220  1.00 39.45  ? 125  GLU A O     1 
ATOM   1019 C  CB    . GLU A 1 125 ? 0.400   -11.701 -5.860  1.00 47.03  ? 125  GLU A CB    1 
ATOM   1020 C  CG    . GLU A 1 125 ? -1.053  -11.545 -6.279  1.00 56.95  ? 125  GLU A CG    1 
ATOM   1021 C  CD    . GLU A 1 125 ? -1.223  -11.483 -7.791  1.00 63.94  ? 125  GLU A CD    1 
ATOM   1022 O  OE1   . GLU A 1 125 ? -0.318  -10.957 -8.478  1.00 65.49  ? 125  GLU A OE1   1 
ATOM   1023 O  OE2   . GLU A 1 125 ? -2.260  -11.967 -8.292  1.00 65.12  ? 125  GLU A OE2   1 
ATOM   1024 N  N     . PRO A 1 126 ? 3.262   -12.756 -7.478  1.00 38.46  ? 126  PRO A N     1 
ATOM   1025 C  CA    . PRO A 1 126 ? 4.725   -12.651 -7.545  1.00 38.85  ? 126  PRO A CA    1 
ATOM   1026 C  C     . PRO A 1 126 ? 5.270   -11.430 -6.801  1.00 41.84  ? 126  PRO A C     1 
ATOM   1027 O  O     . PRO A 1 126 ? 6.358   -11.500 -6.233  1.00 41.55  ? 126  PRO A O     1 
ATOM   1028 C  CB    . PRO A 1 126 ? 5.001   -12.523 -9.048  1.00 38.47  ? 126  PRO A CB    1 
ATOM   1029 C  CG    . PRO A 1 126 ? 3.822   -13.151 -9.706  1.00 39.49  ? 126  PRO A CG    1 
ATOM   1030 C  CD    . PRO A 1 126 ? 2.650   -12.852 -8.816  1.00 38.48  ? 126  PRO A CD    1 
ATOM   1031 N  N     . SER A 1 127 ? 4.523   -10.330 -6.798  1.00 43.38  ? 127  SER A N     1 
ATOM   1032 C  CA    . SER A 1 127 ? 4.980   -9.115  -6.131  1.00 43.16  ? 127  SER A CA    1 
ATOM   1033 C  C     . SER A 1 127 ? 5.004   -9.282  -4.614  1.00 47.06  ? 127  SER A C     1 
ATOM   1034 O  O     . SER A 1 127 ? 5.776   -8.619  -3.924  1.00 51.84  ? 127  SER A O     1 
ATOM   1035 C  CB    . SER A 1 127 ? 4.111   -7.917  -6.518  1.00 45.26  ? 127  SER A CB    1 
ATOM   1036 O  OG    . SER A 1 127 ? 2.795   -8.057  -6.016  1.00 47.10  ? 127  SER A OG    1 
ATOM   1037 N  N     . GLN A 1 128 ? 4.159   -10.169 -4.097  1.00 46.60  ? 128  GLN A N     1 
ATOM   1038 C  CA    . GLN A 1 128 ? 4.126   -10.430 -2.663  1.00 50.23  ? 128  GLN A CA    1 
ATOM   1039 C  C     . GLN A 1 128 ? 5.038   -11.592 -2.293  1.00 47.32  ? 128  GLN A C     1 
ATOM   1040 O  O     . GLN A 1 128 ? 5.796   -11.509 -1.326  1.00 48.16  ? 128  GLN A O     1 
ATOM   1041 C  CB    . GLN A 1 128 ? 2.697   -10.704 -2.188  1.00 54.80  ? 128  GLN A CB    1 
ATOM   1042 C  CG    . GLN A 1 128 ? 1.748   -9.541  -2.416  1.00 61.16  ? 128  GLN A CG    1 
ATOM   1043 C  CD    . GLN A 1 128 ? 2.352   -8.217  -1.992  1.00 68.44  ? 128  GLN A CD    1 
ATOM   1044 O  OE1   . GLN A 1 128 ? 2.610   -7.345  -2.824  1.00 70.71  ? 128  GLN A OE1   1 
ATOM   1045 N  NE2   . GLN A 1 128 ? 2.583   -8.059  -0.692  1.00 71.76  ? 128  GLN A NE2   1 
ATOM   1046 N  N     . ALA A 1 129 ? 4.960   -12.665 -3.079  1.00 41.44  ? 129  ALA A N     1 
ATOM   1047 C  CA    . ALA A 1 129 ? 5.750   -13.872 -2.859  1.00 37.12  ? 129  ALA A CA    1 
ATOM   1048 C  C     . ALA A 1 129 ? 5.681   -14.331 -1.405  1.00 36.83  ? 129  ALA A C     1 
ATOM   1049 O  O     . ALA A 1 129 ? 6.706   -14.583 -0.775  1.00 40.84  ? 129  ALA A O     1 
ATOM   1050 C  CB    . ALA A 1 129 ? 7.200   -13.651 -3.288  1.00 33.56  ? 129  ALA A CB    1 
ATOM   1051 N  N     . LYS A 1 130 ? 4.469   -14.428 -0.874  1.00 36.24  ? 130  LYS A N     1 
ATOM   1052 C  CA    . LYS A 1 130 ? 4.299   -14.706 0.545   1.00 39.64  ? 130  LYS A CA    1 
ATOM   1053 C  C     . LYS A 1 130 ? 4.256   -16.198 0.863   1.00 38.29  ? 130  LYS A C     1 
ATOM   1054 O  O     . LYS A 1 130 ? 4.233   -16.583 2.030   1.00 40.04  ? 130  LYS A O     1 
ATOM   1055 C  CB    . LYS A 1 130 ? 3.056   -13.997 1.094   1.00 45.13  ? 130  LYS A CB    1 
ATOM   1056 C  CG    . LYS A 1 130 ? 1.747   -14.430 0.466   1.00 46.63  ? 130  LYS A CG    1 
ATOM   1057 C  CD    . LYS A 1 130 ? 0.580   -13.657 1.061   1.00 49.58  ? 130  LYS A CD    1 
ATOM   1058 N  N     . HIS A 1 131 ? 4.252   -17.032 -0.173  1.00 33.41  ? 131  HIS A N     1 
ATOM   1059 C  CA    . HIS A 1 131 ? 4.222   -18.481 0.018   1.00 34.91  ? 131  HIS A CA    1 
ATOM   1060 C  C     . HIS A 1 131 ? 5.549   -19.132 -0.370  1.00 32.83  ? 131  HIS A C     1 
ATOM   1061 O  O     . HIS A 1 131 ? 6.227   -18.675 -1.291  1.00 33.18  ? 131  HIS A O     1 
ATOM   1062 C  CB    . HIS A 1 131 ? 3.082   -19.113 -0.784  1.00 33.94  ? 131  HIS A CB    1 
ATOM   1063 C  CG    . HIS A 1 131 ? 1.743   -18.502 -0.517  1.00 37.54  ? 131  HIS A CG    1 
ATOM   1064 N  ND1   . HIS A 1 131 ? 1.197   -17.530 -1.325  1.00 38.94  ? 131  HIS A ND1   1 
ATOM   1065 C  CD2   . HIS A 1 131 ? 0.841   -18.726 0.467   1.00 43.68  ? 131  HIS A CD2   1 
ATOM   1066 C  CE1   . HIS A 1 131 ? 0.014   -17.179 -0.850  1.00 44.45  ? 131  HIS A CE1   1 
ATOM   1067 N  NE2   . HIS A 1 131 ? -0.225  -17.890 0.236   1.00 47.49  ? 131  HIS A NE2   1 
ATOM   1068 N  N     . PRO A 1 132 ? 5.922   -20.208 0.334   1.00 33.52  ? 132  PRO A N     1 
ATOM   1069 C  CA    . PRO A 1 132 ? 7.178   -20.911 0.052   1.00 35.19  ? 132  PRO A CA    1 
ATOM   1070 C  C     . PRO A 1 132 ? 7.236   -21.479 -1.364  1.00 36.01  ? 132  PRO A C     1 
ATOM   1071 O  O     . PRO A 1 132 ? 6.235   -21.969 -1.887  1.00 36.09  ? 132  PRO A O     1 
ATOM   1072 C  CB    . PRO A 1 132 ? 7.168   -22.059 1.068   1.00 35.67  ? 132  PRO A CB    1 
ATOM   1073 C  CG    . PRO A 1 132 ? 6.294   -21.572 2.178   1.00 37.79  ? 132  PRO A CG    1 
ATOM   1074 C  CD    . PRO A 1 132 ? 5.228   -20.764 1.509   1.00 36.22  ? 132  PRO A CD    1 
ATOM   1075 N  N     . ILE A 1 133 ? 8.408   -21.394 -1.980  1.00 31.08  ? 133  ILE A N     1 
ATOM   1076 C  CA    . ILE A 1 133 ? 8.667   -22.104 -3.218  1.00 29.90  ? 133  ILE A CA    1 
ATOM   1077 C  C     . ILE A 1 133 ? 9.021   -23.535 -2.844  1.00 32.16  ? 133  ILE A C     1 
ATOM   1078 O  O     . ILE A 1 133 ? 10.026  -23.771 -2.169  1.00 33.08  ? 133  ILE A O     1 
ATOM   1079 C  CB    . ILE A 1 133 ? 9.835   -21.470 -3.984  1.00 28.80  ? 133  ILE A CB    1 
ATOM   1080 C  CG1   . ILE A 1 133 ? 9.503   -20.023 -4.346  1.00 28.02  ? 133  ILE A CG1   1 
ATOM   1081 C  CG2   . ILE A 1 133 ? 10.163  -22.275 -5.238  1.00 27.22  ? 133  ILE A CG2   1 
ATOM   1082 C  CD1   . ILE A 1 133 ? 10.657  -19.276 -4.953  1.00 26.78  ? 133  ILE A CD1   1 
ATOM   1083 N  N     . ASP A 1 134 ? 8.194   -24.490 -3.257  1.00 29.53  ? 134  ASP A N     1 
ATOM   1084 C  CA    . ASP A 1 134 ? 8.395   -25.871 -2.825  1.00 30.44  ? 134  ASP A CA    1 
ATOM   1085 C  C     . ASP A 1 134 ? 8.906   -26.808 -3.918  1.00 29.89  ? 134  ASP A C     1 
ATOM   1086 O  O     . ASP A 1 134 ? 9.118   -27.995 -3.672  1.00 33.55  ? 134  ASP A O     1 
ATOM   1087 C  CB    . ASP A 1 134 ? 7.137   -26.438 -2.153  1.00 32.56  ? 134  ASP A CB    1 
ATOM   1088 C  CG    . ASP A 1 134 ? 5.882   -26.201 -2.959  1.00 33.08  ? 134  ASP A CG    1 
ATOM   1089 O  OD1   . ASP A 1 134 ? 5.940   -26.272 -4.202  1.00 32.02  ? 134  ASP A OD1   1 
ATOM   1090 O  OD2   . ASP A 1 134 ? 4.830   -25.946 -2.339  1.00 37.79  ? 134  ASP A OD2   1 
ATOM   1091 N  N     . ALA A 1 135 ? 9.105   -26.274 -5.118  1.00 27.46  ? 135  ALA A N     1 
ATOM   1092 C  CA    . ALA A 1 135 ? 9.743   -27.043 -6.178  1.00 27.15  ? 135  ALA A CA    1 
ATOM   1093 C  C     . ALA A 1 135 ? 10.328  -26.141 -7.253  1.00 29.57  ? 135  ALA A C     1 
ATOM   1094 O  O     . ALA A 1 135 ? 9.727   -25.135 -7.630  1.00 30.05  ? 135  ALA A O     1 
ATOM   1095 C  CB    . ALA A 1 135 ? 8.762   -28.035 -6.797  1.00 23.98  ? 135  ALA A CB    1 
ATOM   1096 N  N     . ILE A 1 136 ? 11.515  -26.500 -7.729  1.00 27.88  ? 136  ILE A N     1 
ATOM   1097 C  CA    . ILE A 1 136 ? 12.077  -25.885 -8.921  1.00 28.79  ? 136  ILE A CA    1 
ATOM   1098 C  C     . ILE A 1 136 ? 12.713  -26.962 -9.787  1.00 28.56  ? 136  ILE A C     1 
ATOM   1099 O  O     . ILE A 1 136 ? 13.559  -27.720 -9.318  1.00 28.50  ? 136  ILE A O     1 
ATOM   1100 C  CB    . ILE A 1 136 ? 13.167  -24.851 -8.593  1.00 27.76  ? 136  ILE A CB    1 
ATOM   1101 C  CG1   . ILE A 1 136 ? 12.636  -23.759 -7.656  1.00 27.35  ? 136  ILE A CG1   1 
ATOM   1102 C  CG2   . ILE A 1 136 ? 13.709  -24.238 -9.879  1.00 23.24  ? 136  ILE A CG2   1 
ATOM   1103 C  CD1   . ILE A 1 136 ? 13.718  -22.828 -7.132  1.00 27.56  ? 136  ILE A CD1   1 
ATOM   1104 N  N     . THR A 1 137 ? 12.298  -27.037 -11.046 1.00 25.40  ? 137  THR A N     1 
ATOM   1105 C  CA    . THR A 1 137 ? 13.013  -27.845 -12.026 1.00 24.41  ? 137  THR A CA    1 
ATOM   1106 C  C     . THR A 1 137 ? 13.669  -26.925 -13.039 1.00 22.98  ? 137  THR A C     1 
ATOM   1107 O  O     . THR A 1 137 ? 13.025  -26.050 -13.612 1.00 25.89  ? 137  THR A O     1 
ATOM   1108 C  CB    . THR A 1 137 ? 12.097  -28.855 -12.737 1.00 27.25  ? 137  THR A CB    1 
ATOM   1109 O  OG1   . THR A 1 137 ? 11.602  -29.799 -11.782 1.00 29.53  ? 137  THR A OG1   1 
ATOM   1110 C  CG2   . THR A 1 137 ? 12.869  -29.611 -13.823 1.00 25.57  ? 137  THR A CG2   1 
ATOM   1111 N  N     . HIS A 1 138 ? 14.963  -27.120 -13.247 1.00 23.76  ? 138  HIS A N     1 
ATOM   1112 C  CA    . HIS A 1 138 ? 15.745  -26.210 -14.065 1.00 25.64  ? 138  HIS A CA    1 
ATOM   1113 C  C     . HIS A 1 138 ? 16.581  -27.044 -15.021 1.00 24.49  ? 138  HIS A C     1 
ATOM   1114 O  O     . HIS A 1 138 ? 17.494  -27.752 -14.602 1.00 25.93  ? 138  HIS A O     1 
ATOM   1115 C  CB    . HIS A 1 138 ? 16.617  -25.351 -13.143 1.00 25.48  ? 138  HIS A CB    1 
ATOM   1116 C  CG    . HIS A 1 138 ? 17.546  -24.407 -13.850 1.00 29.29  ? 138  HIS A CG    1 
ATOM   1117 N  ND1   . HIS A 1 138 ? 17.568  -23.063 -13.582 1.00 25.89  ? 138  HIS A ND1   1 
ATOM   1118 C  CD2   . HIS A 1 138 ? 18.525  -24.640 -14.758 1.00 31.61  ? 138  HIS A CD2   1 
ATOM   1119 C  CE1   . HIS A 1 138 ? 18.510  -22.488 -14.324 1.00 25.25  ? 138  HIS A CE1   1 
ATOM   1120 N  NE2   . HIS A 1 138 ? 19.096  -23.420 -15.040 1.00 27.45  ? 138  HIS A NE2   1 
ATOM   1121 N  N     . TYR A 1 139 ? 16.249  -26.977 -16.305 1.00 23.01  ? 139  TYR A N     1 
ATOM   1122 C  CA    . TYR A 1 139 ? 16.994  -27.709 -17.327 1.00 25.42  ? 139  TYR A CA    1 
ATOM   1123 C  C     . TYR A 1 139 ? 18.094  -26.843 -17.925 1.00 28.10  ? 139  TYR A C     1 
ATOM   1124 O  O     . TYR A 1 139 ? 17.846  -25.708 -18.331 1.00 27.21  ? 139  TYR A O     1 
ATOM   1125 C  CB    . TYR A 1 139 ? 16.066  -28.208 -18.441 1.00 23.63  ? 139  TYR A CB    1 
ATOM   1126 C  CG    . TYR A 1 139 ? 16.820  -28.821 -19.600 1.00 24.31  ? 139  TYR A CG    1 
ATOM   1127 C  CD1   . TYR A 1 139 ? 17.244  -30.146 -19.555 1.00 23.20  ? 139  TYR A CD1   1 
ATOM   1128 C  CD2   . TYR A 1 139 ? 17.117  -28.073 -20.735 1.00 24.93  ? 139  TYR A CD2   1 
ATOM   1129 C  CE1   . TYR A 1 139 ? 17.942  -30.707 -20.607 1.00 27.14  ? 139  TYR A CE1   1 
ATOM   1130 C  CE2   . TYR A 1 139 ? 17.818  -28.625 -21.792 1.00 26.84  ? 139  TYR A CE2   1 
ATOM   1131 C  CZ    . TYR A 1 139 ? 18.228  -29.942 -21.725 1.00 29.87  ? 139  TYR A CZ    1 
ATOM   1132 O  OH    . TYR A 1 139 ? 18.926  -30.495 -22.780 1.00 29.64  ? 139  TYR A OH    1 
ATOM   1133 N  N     . ASP A 1 140 ? 19.305  -27.392 -17.980 1.00 28.37  ? 140  ASP A N     1 
ATOM   1134 C  CA    . ASP A 1 140 ? 20.457  -26.705 -18.555 1.00 30.16  ? 140  ASP A CA    1 
ATOM   1135 C  C     . ASP A 1 140 ? 20.850  -27.346 -19.888 1.00 31.91  ? 140  ASP A C     1 
ATOM   1136 O  O     . ASP A 1 140 ? 21.168  -28.533 -19.936 1.00 31.85  ? 140  ASP A O     1 
ATOM   1137 C  CB    . ASP A 1 140 ? 21.638  -26.779 -17.583 1.00 30.65  ? 140  ASP A CB    1 
ATOM   1138 C  CG    . ASP A 1 140 ? 22.815  -25.939 -18.029 1.00 34.92  ? 140  ASP A CG    1 
ATOM   1139 O  OD1   . ASP A 1 140 ? 23.008  -24.844 -17.457 1.00 34.56  ? 140  ASP A OD1   1 
ATOM   1140 O  OD2   . ASP A 1 140 ? 23.546  -26.374 -18.946 1.00 34.33  ? 140  ASP A OD2   1 
ATOM   1141 N  N     . SER A 1 141 ? 20.846  -26.560 -20.961 1.00 27.99  ? 141  SER A N     1 
ATOM   1142 C  CA    . SER A 1 141 ? 21.100  -27.090 -22.300 1.00 26.56  ? 141  SER A CA    1 
ATOM   1143 C  C     . SER A 1 141 ? 22.530  -27.587 -22.487 1.00 28.71  ? 141  SER A C     1 
ATOM   1144 O  O     . SER A 1 141 ? 22.783  -28.471 -23.302 1.00 31.76  ? 141  SER A O     1 
ATOM   1145 C  CB    . SER A 1 141 ? 20.804  -26.029 -23.356 1.00 27.89  ? 141  SER A CB    1 
ATOM   1146 O  OG    . SER A 1 141 ? 21.730  -24.959 -23.247 1.00 31.74  ? 141  SER A OG    1 
ATOM   1147 N  N     . ILE A 1 142 ? 23.466  -27.004 -21.746 1.00 29.80  ? 142  ILE A N     1 
ATOM   1148 C  CA    . ILE A 1 142 ? 24.864  -27.405 -21.837 1.00 34.08  ? 142  ILE A CA    1 
ATOM   1149 C  C     . ILE A 1 142 ? 25.105  -28.738 -21.122 1.00 37.37  ? 142  ILE A C     1 
ATOM   1150 O  O     . ILE A 1 142 ? 25.732  -29.643 -21.674 1.00 36.64  ? 142  ILE A O     1 
ATOM   1151 C  CB    . ILE A 1 142 ? 25.799  -26.301 -21.303 1.00 31.40  ? 142  ILE A CB    1 
ATOM   1152 C  CG1   . ILE A 1 142 ? 25.749  -25.084 -22.237 1.00 29.82  ? 142  ILE A CG1   1 
ATOM   1153 C  CG2   . ILE A 1 142 ? 27.221  -26.818 -21.170 1.00 32.70  ? 142  ILE A CG2   1 
ATOM   1154 C  CD1   . ILE A 1 142 ? 26.664  -23.951 -21.824 1.00 31.93  ? 142  ILE A CD1   1 
ATOM   1155 N  N     . ASP A 1 143 ? 24.586  -28.868 -19.905 1.00 36.33  ? 143  ASP A N     1 
ATOM   1156 C  CA    . ASP A 1 143 ? 24.693  -30.129 -19.174 1.00 35.50  ? 143  ASP A CA    1 
ATOM   1157 C  C     . ASP A 1 143 ? 23.734  -31.178 -19.715 1.00 32.86  ? 143  ASP A C     1 
ATOM   1158 O  O     . ASP A 1 143 ? 23.956  -32.371 -19.532 1.00 35.53  ? 143  ASP A O     1 
ATOM   1159 C  CB    . ASP A 1 143 ? 24.416  -29.923 -17.684 1.00 38.05  ? 143  ASP A CB    1 
ATOM   1160 C  CG    . ASP A 1 143 ? 25.455  -29.054 -17.013 1.00 45.78  ? 143  ASP A CG    1 
ATOM   1161 O  OD1   . ASP A 1 143 ? 26.529  -28.828 -17.614 1.00 43.81  ? 143  ASP A OD1   1 
ATOM   1162 O  OD2   . ASP A 1 143 ? 25.198  -28.602 -15.879 1.00 48.62  ? 143  ASP A OD2   1 
ATOM   1163 N  N     . ASP A 1 144 ? 22.666  -30.726 -20.370 1.00 31.35  ? 144  ASP A N     1 
ATOM   1164 C  CA    . ASP A 1 144 ? 21.578  -31.609 -20.785 1.00 29.14  ? 144  ASP A CA    1 
ATOM   1165 C  C     . ASP A 1 144 ? 21.060  -32.392 -19.578 1.00 29.99  ? 144  ASP A C     1 
ATOM   1166 O  O     . ASP A 1 144 ? 20.901  -33.614 -19.622 1.00 32.56  ? 144  ASP A O     1 
ATOM   1167 C  CB    . ASP A 1 144 ? 22.031  -32.550 -21.906 1.00 31.21  ? 144  ASP A CB    1 
ATOM   1168 C  CG    . ASP A 1 144 ? 20.882  -33.315 -22.524 1.00 33.13  ? 144  ASP A CG    1 
ATOM   1169 O  OD1   . ASP A 1 144 ? 19.740  -32.805 -22.489 1.00 32.20  ? 144  ASP A OD1   1 
ATOM   1170 O  OD2   . ASP A 1 144 ? 21.120  -34.429 -23.038 1.00 35.02  ? 144  ASP A OD2   1 
ATOM   1171 N  N     . ARG A 1 145 ? 20.822  -31.674 -18.488 1.00 27.71  ? 145  ARG A N     1 
ATOM   1172 C  CA    . ARG A 1 145 ? 20.358  -32.282 -17.250 1.00 28.85  ? 145  ARG A CA    1 
ATOM   1173 C  C     . ARG A 1 145 ? 19.190  -31.496 -16.671 1.00 29.56  ? 145  ARG A C     1 
ATOM   1174 O  O     . ARG A 1 145 ? 19.142  -30.276 -16.782 1.00 28.22  ? 145  ARG A O     1 
ATOM   1175 C  CB    . ARG A 1 145 ? 21.493  -32.328 -16.225 1.00 25.60  ? 145  ARG A CB    1 
ATOM   1176 C  CG    . ARG A 1 145 ? 22.642  -33.246 -16.601 1.00 29.39  ? 145  ARG A CG    1 
ATOM   1177 C  CD    . ARG A 1 145 ? 22.226  -34.712 -16.568 1.00 29.60  ? 145  ARG A CD    1 
ATOM   1178 N  NE    . ARG A 1 145 ? 23.366  -35.589 -16.820 1.00 36.65  ? 145  ARG A NE    1 
ATOM   1179 C  CZ    . ARG A 1 145 ? 23.714  -36.035 -18.023 1.00 37.94  ? 145  ARG A CZ    1 
ATOM   1180 N  NH1   . ARG A 1 145 ? 23.003  -35.698 -19.090 1.00 35.68  ? 145  ARG A NH1   1 
ATOM   1181 N  NH2   . ARG A 1 145 ? 24.771  -36.823 -18.159 1.00 39.57  ? 145  ARG A NH2   1 
ATOM   1182 N  N     . PHE A 1 146 ? 18.251  -32.203 -16.053 1.00 28.92  ? 146  PHE A N     1 
ATOM   1183 C  CA    . PHE A 1 146 ? 17.169  -31.558 -15.328 1.00 29.21  ? 146  PHE A CA    1 
ATOM   1184 C  C     . PHE A 1 146 ? 17.547  -31.493 -13.854 1.00 32.26  ? 146  PHE A C     1 
ATOM   1185 O  O     . PHE A 1 146 ? 17.619  -32.518 -13.181 1.00 33.78  ? 146  PHE A O     1 
ATOM   1186 C  CB    . PHE A 1 146 ? 15.862  -32.339 -15.489 1.00 25.61  ? 146  PHE A CB    1 
ATOM   1187 C  CG    . PHE A 1 146 ? 15.346  -32.390 -16.903 1.00 24.11  ? 146  PHE A CG    1 
ATOM   1188 C  CD1   . PHE A 1 146 ? 14.306  -31.567 -17.304 1.00 23.31  ? 146  PHE A CD1   1 
ATOM   1189 C  CD2   . PHE A 1 146 ? 15.891  -33.269 -17.825 1.00 24.79  ? 146  PHE A CD2   1 
ATOM   1190 C  CE1   . PHE A 1 146 ? 13.818  -31.617 -18.602 1.00 23.29  ? 146  PHE A CE1   1 
ATOM   1191 C  CE2   . PHE A 1 146 ? 15.414  -33.323 -19.127 1.00 26.51  ? 146  PHE A CE2   1 
ATOM   1192 C  CZ    . PHE A 1 146 ? 14.375  -32.495 -19.516 1.00 21.72  ? 146  PHE A CZ    1 
ATOM   1193 N  N     . TYR A 1 147 ? 17.797  -30.290 -13.353 1.00 29.38  ? 147  TYR A N     1 
ATOM   1194 C  CA    . TYR A 1 147 ? 18.124  -30.120 -11.943 1.00 27.47  ? 147  TYR A CA    1 
ATOM   1195 C  C     . TYR A 1 147 ? 16.859  -29.859 -11.129 1.00 28.97  ? 147  TYR A C     1 
ATOM   1196 O  O     . TYR A 1 147 ? 16.176  -28.853 -11.325 1.00 25.62  ? 147  TYR A O     1 
ATOM   1197 C  CB    . TYR A 1 147 ? 19.147  -29.000 -11.764 1.00 26.42  ? 147  TYR A CB    1 
ATOM   1198 C  CG    . TYR A 1 147 ? 20.483  -29.315 -12.406 1.00 28.96  ? 147  TYR A CG    1 
ATOM   1199 C  CD1   . TYR A 1 147 ? 21.484  -29.951 -11.686 1.00 31.31  ? 147  TYR A CD1   1 
ATOM   1200 C  CD2   . TYR A 1 147 ? 20.736  -28.987 -13.735 1.00 29.19  ? 147  TYR A CD2   1 
ATOM   1201 C  CE1   . TYR A 1 147 ? 22.703  -30.249 -12.265 1.00 33.11  ? 147  TYR A CE1   1 
ATOM   1202 C  CE2   . TYR A 1 147 ? 21.955  -29.276 -14.324 1.00 29.41  ? 147  TYR A CE2   1 
ATOM   1203 C  CZ    . TYR A 1 147 ? 22.933  -29.910 -13.584 1.00 30.83  ? 147  TYR A CZ    1 
ATOM   1204 O  OH    . TYR A 1 147 ? 24.147  -30.206 -14.157 1.00 32.58  ? 147  TYR A OH    1 
ATOM   1205 N  N     . VAL A 1 148 ? 16.541  -30.781 -10.227 1.00 28.45  ? 148  VAL A N     1 
ATOM   1206 C  CA    . VAL A 1 148 ? 15.279  -30.730 -9.499  1.00 27.87  ? 148  VAL A CA    1 
ATOM   1207 C  C     . VAL A 1 148 ? 15.484  -30.379 -8.030  1.00 29.53  ? 148  VAL A C     1 
ATOM   1208 O  O     . VAL A 1 148 ? 16.172  -31.092 -7.295  1.00 30.06  ? 148  VAL A O     1 
ATOM   1209 C  CB    . VAL A 1 148 ? 14.510  -32.060 -9.624  1.00 28.15  ? 148  VAL A CB    1 
ATOM   1210 C  CG1   . VAL A 1 148 ? 13.178  -31.982 -8.886  1.00 27.08  ? 148  VAL A CG1   1 
ATOM   1211 C  CG2   . VAL A 1 148 ? 14.296  -32.395 -11.087 1.00 25.78  ? 148  VAL A CG2   1 
ATOM   1212 N  N     . PHE A 1 149 ? 14.884  -29.266 -7.617  1.00 26.36  ? 149  PHE A N     1 
ATOM   1213 C  CA    . PHE A 1 149 ? 14.994  -28.784 -6.247  1.00 32.36  ? 149  PHE A CA    1 
ATOM   1214 C  C     . PHE A 1 149 ? 13.673  -29.016 -5.520  1.00 31.45  ? 149  PHE A C     1 
ATOM   1215 O  O     . PHE A 1 149 ? 12.661  -28.402 -5.849  1.00 30.89  ? 149  PHE A O     1 
ATOM   1216 C  CB    . PHE A 1 149 ? 15.366  -27.297 -6.231  1.00 33.01  ? 149  PHE A CB    1 
ATOM   1217 C  CG    . PHE A 1 149 ? 16.699  -26.995 -6.862  1.00 31.39  ? 149  PHE A CG    1 
ATOM   1218 C  CD1   . PHE A 1 149 ? 17.817  -26.763 -6.075  1.00 32.65  ? 149  PHE A CD1   1 
ATOM   1219 C  CD2   . PHE A 1 149 ? 16.835  -26.942 -8.244  1.00 28.44  ? 149  PHE A CD2   1 
ATOM   1220 C  CE1   . PHE A 1 149 ? 19.046  -26.484 -6.653  1.00 32.06  ? 149  PHE A CE1   1 
ATOM   1221 C  CE2   . PHE A 1 149 ? 18.059  -26.663 -8.827  1.00 26.15  ? 149  PHE A CE2   1 
ATOM   1222 C  CZ    . PHE A 1 149 ? 19.167  -26.432 -8.030  1.00 29.56  ? 149  PHE A CZ    1 
ATOM   1223 N  N     . ASP A 1 150 ? 13.693  -29.905 -4.532  1.00 31.99  ? 150  ASP A N     1 
ATOM   1224 C  CA    . ASP A 1 150 ? 12.465  -30.386 -3.906  1.00 35.03  ? 150  ASP A CA    1 
ATOM   1225 C  C     . ASP A 1 150 ? 12.423  -30.044 -2.418  1.00 35.82  ? 150  ASP A C     1 
ATOM   1226 O  O     . ASP A 1 150 ? 13.251  -30.516 -1.639  1.00 33.70  ? 150  ASP A O     1 
ATOM   1227 C  CB    . ASP A 1 150 ? 12.352  -31.902 -4.122  1.00 34.85  ? 150  ASP A CB    1 
ATOM   1228 C  CG    . ASP A 1 150 ? 11.043  -32.487 -3.609  1.00 34.48  ? 150  ASP A CG    1 
ATOM   1229 O  OD1   . ASP A 1 150 ? 10.116  -31.719 -3.266  1.00 32.02  ? 150  ASP A OD1   1 
ATOM   1230 O  OD2   . ASP A 1 150 ? 10.944  -33.735 -3.566  1.00 31.39  ? 150  ASP A OD2   1 
ATOM   1231 N  N     . LEU A 1 151 ? 11.456  -29.216 -2.030  1.00 32.81  ? 151  LEU A N     1 
ATOM   1232 C  CA    . LEU A 1 151 ? 11.277  -28.869 -0.625  1.00 33.83  ? 151  LEU A CA    1 
ATOM   1233 C  C     . LEU A 1 151 ? 10.461  -29.935 0.106   1.00 34.99  ? 151  LEU A C     1 
ATOM   1234 O  O     . LEU A 1 151 ? 9.270   -30.110 -0.158  1.00 33.39  ? 151  LEU A O     1 
ATOM   1235 C  CB    . LEU A 1 151 ? 10.610  -27.500 -0.480  1.00 35.13  ? 151  LEU A CB    1 
ATOM   1236 C  CG    . LEU A 1 151 ? 10.362  -27.030 0.957   1.00 39.15  ? 151  LEU A CG    1 
ATOM   1237 C  CD1   . LEU A 1 151 ? 11.661  -27.006 1.762   1.00 38.52  ? 151  LEU A CD1   1 
ATOM   1238 C  CD2   . LEU A 1 151 ? 9.691   -25.663 0.973   1.00 38.02  ? 151  LEU A CD2   1 
ATOM   1239 N  N     . LEU A 1 152 ? 11.106  -30.644 1.027   1.00 35.06  ? 152  LEU A N     1 
ATOM   1240 C  CA    . LEU A 1 152 ? 10.431  -31.693 1.782   1.00 36.63  ? 152  LEU A CA    1 
ATOM   1241 C  C     . LEU A 1 152 ? 9.625   -31.143 2.952   1.00 40.37  ? 152  LEU A C     1 
ATOM   1242 O  O     . LEU A 1 152 ? 8.597   -31.710 3.326   1.00 43.42  ? 152  LEU A O     1 
ATOM   1243 C  CB    . LEU A 1 152 ? 11.435  -32.725 2.296   1.00 38.18  ? 152  LEU A CB    1 
ATOM   1244 C  CG    . LEU A 1 152 ? 12.165  -33.570 1.253   1.00 38.14  ? 152  LEU A CG    1 
ATOM   1245 C  CD1   . LEU A 1 152 ? 12.852  -34.747 1.934   1.00 34.71  ? 152  LEU A CD1   1 
ATOM   1246 C  CD2   . LEU A 1 152 ? 11.210  -34.051 0.171   1.00 36.39  ? 152  LEU A CD2   1 
ATOM   1247 N  N     . ASN A 1 153 ? 10.096  -30.043 3.533   1.00 38.21  ? 153  ASN A N     1 
ATOM   1248 C  CA    . ASN A 1 153 ? 9.477   -29.490 4.735   1.00 43.04  ? 153  ASN A CA    1 
ATOM   1249 C  C     . ASN A 1 153 ? 8.949   -28.075 4.548   1.00 43.89  ? 153  ASN A C     1 
ATOM   1250 O  O     . ASN A 1 153 ? 9.706   -27.134 4.312   1.00 44.00  ? 153  ASN A O     1 
ATOM   1251 C  CB    . ASN A 1 153 ? 10.451  -29.535 5.913   1.00 46.05  ? 153  ASN A CB    1 
ATOM   1252 C  CG    . ASN A 1 153 ? 10.856  -30.948 6.278   1.00 51.54  ? 153  ASN A CG    1 
ATOM   1253 O  OD1   . ASN A 1 153 ? 10.023  -31.852 6.328   1.00 53.02  ? 153  ASN A OD1   1 
ATOM   1254 N  ND2   . ASN A 1 153 ? 12.143  -31.148 6.527   1.00 54.72  ? 153  ASN A ND2   1 
ATOM   1255 N  N     . SER A 1 154 ? 7.637   -27.937 4.675   1.00 44.16  ? 154  SER A N     1 
ATOM   1256 C  CA    . SER A 1 154 ? 6.967   -26.668 4.451   1.00 40.30  ? 154  SER A CA    1 
ATOM   1257 C  C     . SER A 1 154 ? 5.918   -26.457 5.530   1.00 43.24  ? 154  SER A C     1 
ATOM   1258 O  O     . SER A 1 154 ? 5.446   -27.420 6.130   1.00 44.66  ? 154  SER A O     1 
ATOM   1259 C  CB    . SER A 1 154 ? 6.307   -26.681 3.070   1.00 41.09  ? 154  SER A CB    1 
ATOM   1260 O  OG    . SER A 1 154 ? 5.430   -25.584 2.898   1.00 42.02  ? 154  SER A OG    1 
ATOM   1261 N  N     . PRO A 1 155 ? 5.552   -25.192 5.795   1.00 46.82  ? 155  PRO A N     1 
ATOM   1262 C  CA    . PRO A 1 155 ? 4.432   -24.932 6.703   1.00 48.25  ? 155  PRO A CA    1 
ATOM   1263 C  C     . PRO A 1 155 ? 3.121   -25.489 6.153   1.00 47.20  ? 155  PRO A C     1 
ATOM   1264 O  O     . PRO A 1 155 ? 2.141   -25.584 6.888   1.00 52.61  ? 155  PRO A O     1 
ATOM   1265 C  CB    . PRO A 1 155 ? 4.376   -23.399 6.761   1.00 50.85  ? 155  PRO A CB    1 
ATOM   1266 C  CG    . PRO A 1 155 ? 5.131   -22.930 5.549   1.00 50.54  ? 155  PRO A CG    1 
ATOM   1267 C  CD    . PRO A 1 155 ? 6.212   -23.946 5.370   1.00 46.97  ? 155  PRO A CD    1 
ATOM   1268 N  N     . TYR A 1 156 ? 3.112   -25.854 4.875   1.00 43.29  ? 156  TYR A N     1 
ATOM   1269 C  CA    . TYR A 1 156 ? 1.922   -26.414 4.245   1.00 47.23  ? 156  TYR A CA    1 
ATOM   1270 C  C     . TYR A 1 156 ? 1.982   -27.936 4.148   1.00 48.97  ? 156  TYR A C     1 
ATOM   1271 O  O     . TYR A 1 156 ? 1.152   -28.555 3.482   1.00 52.07  ? 156  TYR A O     1 
ATOM   1272 C  CB    . TYR A 1 156 ? 1.706   -25.794 2.863   1.00 47.49  ? 156  TYR A CB    1 
ATOM   1273 C  CG    . TYR A 1 156 ? 1.534   -24.292 2.912   1.00 50.35  ? 156  TYR A CG    1 
ATOM   1274 C  CD1   . TYR A 1 156 ? 0.918   -23.683 3.997   1.00 56.62  ? 156  TYR A CD1   1 
ATOM   1275 C  CD2   . TYR A 1 156 ? 1.998   -23.484 1.884   1.00 50.56  ? 156  TYR A CD2   1 
ATOM   1276 C  CE1   . TYR A 1 156 ? 0.761   -22.310 4.056   1.00 59.42  ? 156  TYR A CE1   1 
ATOM   1277 C  CE2   . TYR A 1 156 ? 1.846   -22.107 1.933   1.00 54.66  ? 156  TYR A CE2   1 
ATOM   1278 C  CZ    . TYR A 1 156 ? 1.226   -21.527 3.023   1.00 57.72  ? 156  TYR A CZ    1 
ATOM   1279 O  OH    . TYR A 1 156 ? 1.068   -20.162 3.084   1.00 58.33  ? 156  TYR A OH    1 
ATOM   1280 N  N     . GLY A 1 157 ? 2.963   -28.536 4.817   1.00 49.55  ? 157  GLY A N     1 
ATOM   1281 C  CA    . GLY A 1 157 ? 3.048   -29.984 4.897   1.00 49.45  ? 157  GLY A CA    1 
ATOM   1282 C  C     . GLY A 1 157 ? 4.443   -30.556 4.720   1.00 46.56  ? 157  GLY A C     1 
ATOM   1283 O  O     . GLY A 1 157 ? 5.213   -30.099 3.874   1.00 45.57  ? 157  GLY A O     1 
ATOM   1284 N  N     . ASN A 1 158 ? 4.767   -31.557 5.533   1.00 41.14  ? 158  ASN A N     1 
ATOM   1285 C  CA    . ASN A 1 158 ? 6.011   -32.302 5.384   1.00 40.17  ? 158  ASN A CA    1 
ATOM   1286 C  C     . ASN A 1 158 ? 5.766   -33.566 4.577   1.00 42.83  ? 158  ASN A C     1 
ATOM   1287 O  O     . ASN A 1 158 ? 4.840   -34.325 4.862   1.00 45.87  ? 158  ASN A O     1 
ATOM   1288 C  CB    . ASN A 1 158 ? 6.601   -32.663 6.748   1.00 40.87  ? 158  ASN A CB    1 
ATOM   1289 C  CG    . ASN A 1 158 ? 6.980   -31.442 7.561   1.00 43.95  ? 158  ASN A CG    1 
ATOM   1290 O  OD1   . ASN A 1 158 ? 7.144   -30.348 7.020   1.00 43.99  ? 158  ASN A OD1   1 
ATOM   1291 N  ND2   . ASN A 1 158 ? 7.128   -31.623 8.868   1.00 48.92  ? 158  ASN A ND2   1 
ATOM   1292 N  N     . VAL A 1 159 ? 6.602   -33.795 3.571   1.00 39.33  ? 159  VAL A N     1 
ATOM   1293 C  CA    . VAL A 1 159 ? 6.396   -34.907 2.658   1.00 40.53  ? 159  VAL A CA    1 
ATOM   1294 C  C     . VAL A 1 159 ? 7.646   -35.769 2.534   1.00 41.69  ? 159  VAL A C     1 
ATOM   1295 O  O     . VAL A 1 159 ? 8.735   -35.364 2.940   1.00 41.90  ? 159  VAL A O     1 
ATOM   1296 C  CB    . VAL A 1 159 ? 5.996   -34.404 1.261   1.00 41.60  ? 159  VAL A CB    1 
ATOM   1297 C  CG1   . VAL A 1 159 ? 4.673   -33.651 1.326   1.00 41.34  ? 159  VAL A CG1   1 
ATOM   1298 C  CG2   . VAL A 1 159 ? 7.086   -33.512 0.688   1.00 42.29  ? 159  VAL A CG2   1 
ATOM   1299 N  N     . GLU A 1 160 ? 7.475   -36.963 1.973   1.00 40.45  ? 160  GLU A N     1 
ATOM   1300 C  CA    . GLU A 1 160 ? 8.591   -37.860 1.700   1.00 44.41  ? 160  GLU A CA    1 
ATOM   1301 C  C     . GLU A 1 160 ? 9.270   -37.480 0.393   1.00 39.49  ? 160  GLU A C     1 
ATOM   1302 O  O     . GLU A 1 160 ? 8.702   -36.748 -0.419  1.00 39.38  ? 160  GLU A O     1 
ATOM   1303 C  CB    . GLU A 1 160 ? 8.101   -39.304 1.602   1.00 49.62  ? 160  GLU A CB    1 
ATOM   1304 C  CG    . GLU A 1 160 ? 7.563   -39.878 2.893   1.00 58.94  ? 160  GLU A CG    1 
ATOM   1305 C  CD    . GLU A 1 160 ? 7.102   -41.312 2.730   1.00 66.76  ? 160  GLU A CD    1 
ATOM   1306 O  OE1   . GLU A 1 160 ? 6.816   -41.714 1.580   1.00 68.91  ? 160  GLU A OE1   1 
ATOM   1307 O  OE2   . GLU A 1 160 ? 7.033   -42.036 3.746   1.00 71.98  ? 160  GLU A OE2   1 
ATOM   1308 N  N     . GLU A 1 161 ? 10.481  -37.991 0.189   1.00 38.14  ? 161  GLU A N     1 
ATOM   1309 C  CA    . GLU A 1 161 ? 11.222  -37.736 -1.040  1.00 38.50  ? 161  GLU A CA    1 
ATOM   1310 C  C     . GLU A 1 161 ? 10.493  -38.269 -2.264  1.00 36.72  ? 161  GLU A C     1 
ATOM   1311 O  O     . GLU A 1 161 ? 9.767   -39.261 -2.195  1.00 37.40  ? 161  GLU A O     1 
ATOM   1312 C  CB    . GLU A 1 161 ? 12.623  -38.352 -0.979  1.00 43.64  ? 161  GLU A CB    1 
ATOM   1313 C  CG    . GLU A 1 161 ? 13.562  -37.687 0.009   1.00 50.38  ? 161  GLU A CG    1 
ATOM   1314 C  CD    . GLU A 1 161 ? 14.983  -38.214 -0.094  1.00 54.90  ? 161  GLU A CD    1 
ATOM   1315 O  OE1   . GLU A 1 161 ? 15.739  -38.086 0.892   1.00 56.27  ? 161  GLU A OE1   1 
ATOM   1316 O  OE2   . GLU A 1 161 ? 15.342  -38.753 -1.164  1.00 55.96  ? 161  GLU A OE2   1 
ATOM   1317 N  N     . TRP A 1 162 ? 10.692  -37.585 -3.382  1.00 33.93  ? 162  TRP A N     1 
ATOM   1318 C  CA    . TRP A 1 162 ? 10.199  -38.024 -4.675  1.00 33.40  ? 162  TRP A CA    1 
ATOM   1319 C  C     . TRP A 1 162 ? 11.006  -39.231 -5.118  1.00 32.81  ? 162  TRP A C     1 
ATOM   1320 O  O     . TRP A 1 162 ? 12.225  -39.250 -4.970  1.00 35.46  ? 162  TRP A O     1 
ATOM   1321 C  CB    . TRP A 1 162 ? 10.360  -36.883 -5.677  1.00 31.97  ? 162  TRP A CB    1 
ATOM   1322 C  CG    . TRP A 1 162 ? 10.161  -37.234 -7.123  1.00 30.02  ? 162  TRP A CG    1 
ATOM   1323 C  CD1   . TRP A 1 162 ? 8.975   -37.312 -7.792  1.00 26.74  ? 162  TRP A CD1   1 
ATOM   1324 C  CD2   . TRP A 1 162 ? 11.183  -37.496 -8.090  1.00 29.00  ? 162  TRP A CD2   1 
ATOM   1325 N  NE1   . TRP A 1 162 ? 9.194   -37.623 -9.110  1.00 27.45  ? 162  TRP A NE1   1 
ATOM   1326 C  CE2   . TRP A 1 162 ? 10.544  -37.737 -9.320  1.00 27.47  ? 162  TRP A CE2   1 
ATOM   1327 C  CE3   . TRP A 1 162 ? 12.579  -37.555 -8.034  1.00 29.80  ? 162  TRP A CE3   1 
ATOM   1328 C  CZ2   . TRP A 1 162 ? 11.250  -38.033 -10.484 1.00 28.17  ? 162  TRP A CZ2   1 
ATOM   1329 C  CZ3   . TRP A 1 162 ? 13.277  -37.848 -9.189  1.00 29.30  ? 162  TRP A CZ3   1 
ATOM   1330 C  CH2   . TRP A 1 162 ? 12.613  -38.084 -10.397 1.00 28.54  ? 162  TRP A CH2   1 
ATOM   1331 N  N     . SER A 1 163 ? 10.322  -40.241 -5.646  1.00 33.52  ? 163  SER A N     1 
ATOM   1332 C  CA    . SER A 1 163 ? 10.985  -41.457 -6.107  1.00 35.31  ? 163  SER A CA    1 
ATOM   1333 C  C     . SER A 1 163 ? 11.095  -41.511 -7.629  1.00 34.58  ? 163  SER A C     1 
ATOM   1334 O  O     . SER A 1 163 ? 10.086  -41.483 -8.339  1.00 34.93  ? 163  SER A O     1 
ATOM   1335 C  CB    . SER A 1 163 ? 10.245  -42.695 -5.595  1.00 34.36  ? 163  SER A CB    1 
ATOM   1336 O  OG    . SER A 1 163 ? 10.589  -43.836 -6.359  1.00 35.64  ? 163  SER A OG    1 
ATOM   1337 N  N     . ILE A 1 164 ? 12.324  -41.595 -8.126  1.00 35.00  ? 164  ILE A N     1 
ATOM   1338 C  CA    . ILE A 1 164 ? 12.552  -41.652 -9.565  1.00 32.62  ? 164  ILE A CA    1 
ATOM   1339 C  C     . ILE A 1 164 ? 12.103  -42.998 -10.126 1.00 36.75  ? 164  ILE A C     1 
ATOM   1340 O  O     . ILE A 1 164 ? 11.757  -43.107 -11.304 1.00 39.56  ? 164  ILE A O     1 
ATOM   1341 C  CB    . ILE A 1 164 ? 14.034  -41.374 -9.927  1.00 37.36  ? 164  ILE A CB    1 
ATOM   1342 C  CG1   . ILE A 1 164 ? 14.181  -41.062 -11.421 1.00 35.18  ? 164  ILE A CG1   1 
ATOM   1343 C  CG2   . ILE A 1 164 ? 14.929  -42.536 -9.511  1.00 38.52  ? 164  ILE A CG2   1 
ATOM   1344 C  CD1   . ILE A 1 164 ? 15.531  -40.460 -11.791 1.00 33.30  ? 164  ILE A CD1   1 
ATOM   1345 N  N     . GLU A 1 165 ? 12.096  -44.020 -9.275  1.00 36.43  ? 165  GLU A N     1 
ATOM   1346 C  CA    . GLU A 1 165 ? 11.658  -45.347 -9.687  1.00 42.36  ? 165  GLU A CA    1 
ATOM   1347 C  C     . GLU A 1 165 ? 10.167  -45.333 -9.991  1.00 38.58  ? 165  GLU A C     1 
ATOM   1348 O  O     . GLU A 1 165 ? 9.729   -45.865 -11.010 1.00 38.58  ? 165  GLU A O     1 
ATOM   1349 C  CB    . GLU A 1 165 ? 11.966  -46.393 -8.607  1.00 50.01  ? 165  GLU A CB    1 
ATOM   1350 C  CG    . GLU A 1 165 ? 13.449  -46.666 -8.395  1.00 56.39  ? 165  GLU A CG    1 
ATOM   1351 C  CD    . GLU A 1 165 ? 14.133  -45.610 -7.543  1.00 62.86  ? 165  GLU A CD    1 
ATOM   1352 O  OE1   . GLU A 1 165 ? 13.427  -44.806 -6.895  1.00 62.53  ? 165  GLU A OE1   1 
ATOM   1353 O  OE2   . GLU A 1 165 ? 15.381  -45.587 -7.519  1.00 68.71  ? 165  GLU A OE2   1 
ATOM   1354 N  N     . ILE A 1 166 ? 9.392   -44.720 -9.102  1.00 34.31  ? 166  ILE A N     1 
ATOM   1355 C  CA    . ILE A 1 166 ? 7.950   -44.615 -9.294  1.00 35.68  ? 166  ILE A CA    1 
ATOM   1356 C  C     . ILE A 1 166 ? 7.609   -43.651 -10.435 1.00 33.73  ? 166  ILE A C     1 
ATOM   1357 O  O     . ILE A 1 166 ? 6.682   -43.890 -11.205 1.00 32.61  ? 166  ILE A O     1 
ATOM   1358 C  CB    . ILE A 1 166 ? 7.241   -44.191 -7.989  1.00 38.74  ? 166  ILE A CB    1 
ATOM   1359 C  CG1   . ILE A 1 166 ? 7.473   -45.248 -6.905  1.00 44.18  ? 166  ILE A CG1   1 
ATOM   1360 C  CG2   . ILE A 1 166 ? 5.750   -43.983 -8.225  1.00 37.88  ? 166  ILE A CG2   1 
ATOM   1361 C  CD1   . ILE A 1 166 ? 6.808   -44.938 -5.579  1.00 46.39  ? 166  ILE A CD1   1 
ATOM   1362 N  N     . ALA A 1 167 ? 8.375   -42.572 -10.556 1.00 32.16  ? 167  ALA A N     1 
ATOM   1363 C  CA    . ALA A 1 167 ? 8.135   -41.593 -11.614 1.00 34.05  ? 167  ALA A CA    1 
ATOM   1364 C  C     . ALA A 1 167 ? 8.215   -42.216 -13.008 1.00 34.32  ? 167  ALA A C     1 
ATOM   1365 O  O     . ALA A 1 167 ? 7.467   -41.836 -13.909 1.00 31.72  ? 167  ALA A O     1 
ATOM   1366 C  CB    . ALA A 1 167 ? 9.114   -40.444 -11.499 1.00 28.50  ? 167  ALA A CB    1 
ATOM   1367 N  N     . ALA A 1 168 ? 9.116   -43.179 -13.169 1.00 33.40  ? 168  ALA A N     1 
ATOM   1368 C  CA    . ALA A 1 168 ? 9.348   -43.820 -14.458 1.00 33.88  ? 168  ALA A CA    1 
ATOM   1369 C  C     . ALA A 1 168 ? 8.268   -44.839 -14.823 1.00 39.18  ? 168  ALA A C     1 
ATOM   1370 O  O     . ALA A 1 168 ? 8.051   -45.125 -16.000 1.00 40.93  ? 168  ALA A O     1 
ATOM   1371 C  CB    . ALA A 1 168 ? 10.725  -44.479 -14.478 1.00 33.70  ? 168  ALA A CB    1 
ATOM   1372 N  N     . LYS A 1 169 ? 7.598   -45.387 -13.813 1.00 39.93  ? 169  LYS A N     1 
ATOM   1373 C  CA    . LYS A 1 169 ? 6.561   -46.395 -14.037 1.00 40.08  ? 169  LYS A CA    1 
ATOM   1374 C  C     . LYS A 1 169 ? 5.363   -45.838 -14.804 1.00 37.59  ? 169  LYS A C     1 
ATOM   1375 O  O     . LYS A 1 169 ? 5.097   -44.638 -14.770 1.00 39.83  ? 169  LYS A O     1 
ATOM   1376 C  CB    . LYS A 1 169 ? 6.087   -46.984 -12.704 1.00 38.46  ? 169  LYS A CB    1 
ATOM   1377 C  CG    . LYS A 1 169 ? 7.065   -47.945 -12.061 1.00 44.95  ? 169  LYS A CG    1 
ATOM   1378 C  CD    . LYS A 1 169 ? 6.514   -48.497 -10.755 1.00 51.99  ? 169  LYS A CD    1 
ATOM   1379 C  CE    . LYS A 1 169 ? 7.291   -49.725 -10.306 1.00 60.16  ? 169  LYS A CE    1 
ATOM   1380 N  NZ    . LYS A 1 169 ? 8.757   -49.466 -10.237 1.00 63.76  ? 169  LYS A NZ    1 
ATOM   1381 N  N     . LEU A 1 170 ? 4.644   -46.720 -15.489 1.00 37.10  ? 170  LEU A N     1 
ATOM   1382 C  CA    . LEU A 1 170 ? 3.433   -46.341 -16.209 1.00 39.70  ? 170  LEU A CA    1 
ATOM   1383 C  C     . LEU A 1 170 ? 2.338   -45.905 -15.238 1.00 38.91  ? 170  LEU A C     1 
ATOM   1384 O  O     . LEU A 1 170 ? 2.327   -46.324 -14.079 1.00 37.91  ? 170  LEU A O     1 
ATOM   1385 C  CB    . LEU A 1 170 ? 2.920   -47.523 -17.035 1.00 44.00  ? 170  LEU A CB    1 
ATOM   1386 C  CG    . LEU A 1 170 ? 3.948   -48.365 -17.798 1.00 48.64  ? 170  LEU A CG    1 
ATOM   1387 C  CD1   . LEU A 1 170 ? 3.248   -49.475 -18.567 1.00 50.65  ? 170  LEU A CD1   1 
ATOM   1388 C  CD2   . LEU A 1 170 ? 4.791   -47.503 -18.727 1.00 51.48  ? 170  LEU A CD2   1 
ATOM   1389 N  N     . GLN A 1 171 ? 1.415   -45.074 -15.716 1.00 34.23  ? 171  GLN A N     1 
ATOM   1390 C  CA    . GLN A 1 171 ? 0.263   -44.661 -14.915 1.00 36.03  ? 171  GLN A CA    1 
ATOM   1391 C  C     . GLN A 1 171 ? -0.511  -45.878 -14.424 1.00 37.76  ? 171  GLN A C     1 
ATOM   1392 O  O     . GLN A 1 171 ? -1.016  -45.898 -13.299 1.00 35.81  ? 171  GLN A O     1 
ATOM   1393 C  CB    . GLN A 1 171 ? -0.662  -43.750 -15.727 1.00 41.54  ? 171  GLN A CB    1 
ATOM   1394 C  CG    . GLN A 1 171 ? -0.090  -42.367 -16.013 1.00 53.09  ? 171  GLN A CG    1 
ATOM   1395 C  CD    . GLN A 1 171 ? -0.213  -41.425 -14.829 1.00 60.72  ? 171  GLN A CD    1 
ATOM   1396 O  OE1   . GLN A 1 171 ? -0.786  -41.776 -13.796 1.00 68.65  ? 171  GLN A OE1   1 
ATOM   1397 N  NE2   . GLN A 1 171 ? 0.319   -40.216 -14.976 1.00 62.04  ? 171  GLN A NE2   1 
ATOM   1398 N  N     . GLU A 1 172 ? -0.581  -46.900 -15.274 1.00 36.66  ? 172  GLU A N     1 
ATOM   1399 C  CA    . GLU A 1 172 ? -1.295  -48.130 -14.963 1.00 38.73  ? 172  GLU A CA    1 
ATOM   1400 C  C     . GLU A 1 172 ? -0.584  -48.932 -13.870 1.00 41.36  ? 172  GLU A C     1 
ATOM   1401 O  O     . GLU A 1 172 ? -1.167  -49.837 -13.271 1.00 45.81  ? 172  GLU A O     1 
ATOM   1402 C  CB    . GLU A 1 172 ? -1.472  -48.977 -16.230 1.00 44.08  ? 172  GLU A CB    1 
ATOM   1403 C  CG    . GLU A 1 172 ? -2.251  -48.288 -17.353 1.00 48.09  ? 172  GLU A CG    1 
ATOM   1404 C  CD    . GLU A 1 172 ? -1.419  -47.289 -18.151 1.00 53.99  ? 172  GLU A CD    1 
ATOM   1405 O  OE1   . GLU A 1 172 ? -0.237  -47.072 -17.807 1.00 57.60  ? 172  GLU A OE1   1 
ATOM   1406 O  OE2   . GLU A 1 172 ? -1.952  -46.717 -19.127 1.00 54.67  ? 172  GLU A OE2   1 
ATOM   1407 N  N     . GLN A 1 173 ? 0.678   -48.598 -13.617 1.00 40.06  ? 173  GLN A N     1 
ATOM   1408 C  CA    . GLN A 1 173 ? 1.419   -49.185 -12.504 1.00 41.39  ? 173  GLN A CA    1 
ATOM   1409 C  C     . GLN A 1 173 ? 1.381   -48.264 -11.290 1.00 40.28  ? 173  GLN A C     1 
ATOM   1410 O  O     . GLN A 1 173 ? 2.000   -48.551 -10.265 1.00 42.03  ? 173  GLN A O     1 
ATOM   1411 C  CB    . GLN A 1 173 ? 2.877   -49.439 -12.890 1.00 45.70  ? 173  GLN A CB    1 
ATOM   1412 C  CG    . GLN A 1 173 ? 3.076   -50.366 -14.079 1.00 48.12  ? 173  GLN A CG    1 
ATOM   1413 C  CD    . GLN A 1 173 ? 4.544   -50.563 -14.414 1.00 47.87  ? 173  GLN A CD    1 
ATOM   1414 O  OE1   . GLN A 1 173 ? 5.142   -49.760 -15.134 1.00 46.92  ? 173  GLN A OE1   1 
ATOM   1415 N  NE2   . GLN A 1 173 ? 5.134   -51.630 -13.886 1.00 47.47  ? 173  GLN A NE2   1 
ATOM   1416 N  N     . GLY A 1 174 ? 0.663   -47.153 -11.406 1.00 38.14  ? 174  GLY A N     1 
ATOM   1417 C  CA    . GLY A 1 174 ? 0.601   -46.183 -10.328 1.00 35.88  ? 174  GLY A CA    1 
ATOM   1418 C  C     . GLY A 1 174 ? 1.781   -45.229 -10.371 1.00 35.00  ? 174  GLY A C     1 
ATOM   1419 O  O     . GLY A 1 174 ? 2.054   -44.513 -9.408  1.00 35.30  ? 174  GLY A O     1 
ATOM   1420 N  N     . GLY A 1 175 ? 2.490   -45.228 -11.494 1.00 33.67  ? 175  GLY A N     1 
ATOM   1421 C  CA    . GLY A 1 175 ? 3.625   -44.344 -11.676 1.00 32.16  ? 175  GLY A CA    1 
ATOM   1422 C  C     . GLY A 1 175 ? 3.206   -43.048 -12.336 1.00 32.03  ? 175  GLY A C     1 
ATOM   1423 O  O     . GLY A 1 175 ? 2.017   -42.799 -12.524 1.00 33.87  ? 175  GLY A O     1 
ATOM   1424 N  N     . ASP A 1 176 ? 4.184   -42.230 -12.705 1.00 31.19  ? 176  ASP A N     1 
ATOM   1425 C  CA    . ASP A 1 176 ? 3.910   -40.897 -13.232 1.00 31.72  ? 176  ASP A CA    1 
ATOM   1426 C  C     . ASP A 1 176 ? 4.170   -40.771 -14.736 1.00 35.04  ? 176  ASP A C     1 
ATOM   1427 O  O     . ASP A 1 176 ? 3.873   -39.738 -15.338 1.00 40.21  ? 176  ASP A O     1 
ATOM   1428 C  CB    . ASP A 1 176 ? 4.743   -39.867 -12.473 1.00 29.36  ? 176  ASP A CB    1 
ATOM   1429 C  CG    . ASP A 1 176 ? 4.496   -39.902 -10.973 1.00 34.61  ? 176  ASP A CG    1 
ATOM   1430 O  OD1   . ASP A 1 176 ? 3.337   -40.138 -10.561 1.00 34.04  ? 176  ASP A OD1   1 
ATOM   1431 O  OD2   . ASP A 1 176 ? 5.465   -39.693 -10.204 1.00 34.75  ? 176  ASP A OD2   1 
ATOM   1432 N  N     . GLU A 1 177 ? 4.730   -41.820 -15.331 1.00 35.24  ? 177  GLU A N     1 
ATOM   1433 C  CA    . GLU A 1 177 ? 5.047   -41.838 -16.760 1.00 39.20  ? 177  GLU A CA    1 
ATOM   1434 C  C     . GLU A 1 177 ? 5.947   -40.692 -17.212 1.00 37.37  ? 177  GLU A C     1 
ATOM   1435 O  O     . GLU A 1 177 ? 5.778   -40.160 -18.310 1.00 40.40  ? 177  GLU A O     1 
ATOM   1436 C  CB    . GLU A 1 177 ? 3.775   -41.877 -17.616 1.00 43.31  ? 177  GLU A CB    1 
ATOM   1437 C  CG    . GLU A 1 177 ? 3.381   -43.275 -18.061 1.00 51.47  ? 177  GLU A CG    1 
ATOM   1438 C  CD    . GLU A 1 177 ? 1.998   -43.325 -18.681 1.00 56.55  ? 177  GLU A CD    1 
ATOM   1439 O  OE1   . GLU A 1 177 ? 1.684   -42.452 -19.519 1.00 62.29  ? 177  GLU A OE1   1 
ATOM   1440 O  OE2   . GLU A 1 177 ? 1.221   -44.233 -18.324 1.00 56.02  ? 177  GLU A OE2   1 
ATOM   1441 N  N     . VAL A 1 178 ? 6.891   -40.306 -16.360 1.00 34.19  ? 178  VAL A N     1 
ATOM   1442 C  CA    . VAL A 1 178 ? 7.949   -39.399 -16.775 1.00 34.11  ? 178  VAL A CA    1 
ATOM   1443 C  C     . VAL A 1 178 ? 8.694   -40.091 -17.910 1.00 38.70  ? 178  VAL A C     1 
ATOM   1444 O  O     . VAL A 1 178 ? 9.163   -41.216 -17.739 1.00 34.85  ? 178  VAL A O     1 
ATOM   1445 C  CB    . VAL A 1 178 ? 8.917   -39.106 -15.624 1.00 33.24  ? 178  VAL A CB    1 
ATOM   1446 C  CG1   . VAL A 1 178 ? 10.124  -38.323 -16.123 1.00 33.50  ? 178  VAL A CG1   1 
ATOM   1447 C  CG2   . VAL A 1 178 ? 8.203   -38.351 -14.513 1.00 29.52  ? 178  VAL A CG2   1 
ATOM   1448 N  N     . PRO A 1 179 ? 8.776   -39.433 -19.081 1.00 35.12  ? 179  PRO A N     1 
ATOM   1449 C  CA    . PRO A 1 179 ? 9.340   -40.027 -20.300 1.00 35.84  ? 179  PRO A CA    1 
ATOM   1450 C  C     . PRO A 1 179 ? 10.700  -40.680 -20.061 1.00 33.09  ? 179  PRO A C     1 
ATOM   1451 O  O     . PRO A 1 179 ? 11.571  -40.088 -19.424 1.00 29.67  ? 179  PRO A O     1 
ATOM   1452 C  CB    . PRO A 1 179 ? 9.475   -38.826 -21.239 1.00 39.36  ? 179  PRO A CB    1 
ATOM   1453 C  CG    . PRO A 1 179 ? 8.378   -37.911 -20.810 1.00 38.16  ? 179  PRO A CG    1 
ATOM   1454 C  CD    . PRO A 1 179 ? 8.291   -38.061 -19.312 1.00 33.39  ? 179  PRO A CD    1 
ATOM   1455 N  N     . SER A 1 180 ? 10.863  -41.900 -20.563 1.00 34.44  ? 180  SER A N     1 
ATOM   1456 C  CA    . SER A 1 180 ? 12.068  -42.685 -20.319 1.00 34.74  ? 180  SER A CA    1 
ATOM   1457 C  C     . SER A 1 180 ? 13.346  -41.998 -20.805 1.00 35.08  ? 180  SER A C     1 
ATOM   1458 O  O     . SER A 1 180 ? 14.420  -42.215 -20.245 1.00 37.14  ? 180  SER A O     1 
ATOM   1459 C  CB    . SER A 1 180 ? 11.942  -44.072 -20.960 1.00 39.64  ? 180  SER A CB    1 
ATOM   1460 O  OG    . SER A 1 180 ? 11.908  -43.974 -22.372 1.00 44.19  ? 180  SER A OG    1 
ATOM   1461 N  N     . GLU A 1 181 ? 13.230  -41.161 -21.832 1.00 33.20  ? 181  GLU A N     1 
ATOM   1462 C  CA    . GLU A 1 181 ? 14.408  -40.527 -22.417 1.00 34.64  ? 181  GLU A CA    1 
ATOM   1463 C  C     . GLU A 1 181 ? 15.012  -39.408 -21.561 1.00 33.99  ? 181  GLU A C     1 
ATOM   1464 O  O     . GLU A 1 181 ? 16.091  -38.911 -21.875 1.00 39.66  ? 181  GLU A O     1 
ATOM   1465 C  CB    . GLU A 1 181 ? 14.132  -40.037 -23.850 1.00 38.05  ? 181  GLU A CB    1 
ATOM   1466 C  CG    . GLU A 1 181 ? 13.132  -38.891 -23.973 1.00 40.06  ? 181  GLU A CG    1 
ATOM   1467 C  CD    . GLU A 1 181 ? 11.683  -39.360 -24.057 1.00 45.63  ? 181  GLU A CD    1 
ATOM   1468 O  OE1   . GLU A 1 181 ? 11.403  -40.533 -23.726 1.00 44.52  ? 181  GLU A OE1   1 
ATOM   1469 O  OE2   . GLU A 1 181 ? 10.819  -38.548 -24.458 1.00 47.58  ? 181  GLU A OE2   1 
ATOM   1470 N  N     . ILE A 1 182 ? 14.335  -39.013 -20.484 1.00 28.29  ? 182  ILE A N     1 
ATOM   1471 C  CA    . ILE A 1 182 ? 14.906  -38.009 -19.579 1.00 27.39  ? 182  ILE A CA    1 
ATOM   1472 C  C     . ILE A 1 182 ? 15.180  -38.527 -18.165 1.00 28.48  ? 182  ILE A C     1 
ATOM   1473 O  O     . ILE A 1 182 ? 15.761  -37.810 -17.349 1.00 28.38  ? 182  ILE A O     1 
ATOM   1474 C  CB    . ILE A 1 182 ? 14.047  -36.718 -19.487 1.00 28.29  ? 182  ILE A CB    1 
ATOM   1475 C  CG1   . ILE A 1 182 ? 12.770  -36.965 -18.682 1.00 24.00  ? 182  ILE A CG1   1 
ATOM   1476 C  CG2   . ILE A 1 182 ? 13.747  -36.161 -20.879 1.00 27.16  ? 182  ILE A CG2   1 
ATOM   1477 C  CD1   . ILE A 1 182 ? 11.921  -35.704 -18.470 1.00 23.07  ? 182  ILE A CD1   1 
ATOM   1478 N  N     . ILE A 1 183 ? 14.768  -39.763 -17.883 1.00 30.03  ? 183  ILE A N     1 
ATOM   1479 C  CA    . ILE A 1 183 ? 14.972  -40.360 -16.563 1.00 31.56  ? 183  ILE A CA    1 
ATOM   1480 C  C     . ILE A 1 183 ? 16.431  -40.289 -16.110 1.00 31.77  ? 183  ILE A C     1 
ATOM   1481 O  O     . ILE A 1 183 ? 16.722  -39.876 -14.988 1.00 35.97  ? 183  ILE A O     1 
ATOM   1482 C  CB    . ILE A 1 183 ? 14.475  -41.825 -16.509 1.00 35.91  ? 183  ILE A CB    1 
ATOM   1483 C  CG1   . ILE A 1 183 ? 12.951  -41.864 -16.402 1.00 35.36  ? 183  ILE A CG1   1 
ATOM   1484 C  CG2   . ILE A 1 183 ? 15.086  -42.559 -15.324 1.00 39.11  ? 183  ILE A CG2   1 
ATOM   1485 C  CD1   . ILE A 1 183 ? 12.407  -41.108 -15.199 1.00 35.92  ? 183  ILE A CD1   1 
ATOM   1486 N  N     . ASP A 1 184 ? 17.346  -40.663 -16.996 1.00 28.11  ? 184  ASP A N     1 
ATOM   1487 C  CA    . ASP A 1 184 ? 18.771  -40.655 -16.671 1.00 33.28  ? 184  ASP A CA    1 
ATOM   1488 C  C     . ASP A 1 184 ? 19.391  -39.259 -16.704 1.00 33.61  ? 184  ASP A C     1 
ATOM   1489 O  O     . ASP A 1 184 ? 20.591  -39.100 -16.472 1.00 34.41  ? 184  ASP A O     1 
ATOM   1490 C  CB    . ASP A 1 184 ? 19.537  -41.586 -17.613 1.00 39.96  ? 184  ASP A CB    1 
ATOM   1491 C  CG    . ASP A 1 184 ? 19.121  -43.039 -17.459 1.00 48.09  ? 184  ASP A CG    1 
ATOM   1492 O  OD1   . ASP A 1 184 ? 18.639  -43.409 -16.366 1.00 51.94  ? 184  ASP A OD1   1 
ATOM   1493 O  OD2   . ASP A 1 184 ? 19.276  -43.810 -18.429 1.00 49.49  ? 184  ASP A OD2   1 
ATOM   1494 N  N     . LYS A 1 185 ? 18.576  -38.248 -16.986 1.00 29.68  ? 185  LYS A N     1 
ATOM   1495 C  CA    . LYS A 1 185 ? 19.070  -36.878 -17.074 1.00 33.16  ? 185  LYS A CA    1 
ATOM   1496 C  C     . LYS A 1 185 ? 18.618  -36.049 -15.880 1.00 31.92  ? 185  LYS A C     1 
ATOM   1497 O  O     . LYS A 1 185 ? 18.853  -34.844 -15.821 1.00 30.32  ? 185  LYS A O     1 
ATOM   1498 C  CB    . LYS A 1 185 ? 18.592  -36.220 -18.369 1.00 30.28  ? 185  LYS A CB    1 
ATOM   1499 C  CG    . LYS A 1 185 ? 19.061  -36.928 -19.625 1.00 35.09  ? 185  LYS A CG    1 
ATOM   1500 C  CD    . LYS A 1 185 ? 18.624  -36.171 -20.865 1.00 37.58  ? 185  LYS A CD    1 
ATOM   1501 C  CE    . LYS A 1 185 ? 19.135  -36.850 -22.127 1.00 40.85  ? 185  LYS A CE    1 
ATOM   1502 N  NZ    . LYS A 1 185 ? 18.898  -36.012 -23.335 1.00 39.89  ? 185  LYS A NZ    1 
ATOM   1503 N  N     . ILE A 1 186 ? 17.956  -36.699 -14.934 1.00 29.56  ? 186  ILE A N     1 
ATOM   1504 C  CA    . ILE A 1 186 ? 17.411  -35.995 -13.789 1.00 29.61  ? 186  ILE A CA    1 
ATOM   1505 C  C     . ILE A 1 186 ? 18.399  -36.006 -12.629 1.00 30.01  ? 186  ILE A C     1 
ATOM   1506 O  O     . ILE A 1 186 ? 18.918  -37.056 -12.247 1.00 29.95  ? 186  ILE A O     1 
ATOM   1507 C  CB    . ILE A 1 186 ? 16.066  -36.599 -13.347 1.00 30.34  ? 186  ILE A CB    1 
ATOM   1508 C  CG1   . ILE A 1 186 ? 15.020  -36.419 -14.455 1.00 30.18  ? 186  ILE A CG1   1 
ATOM   1509 C  CG2   . ILE A 1 186 ? 15.597  -35.957 -12.049 1.00 30.07  ? 186  ILE A CG2   1 
ATOM   1510 C  CD1   . ILE A 1 186 ? 13.753  -37.234 -14.249 1.00 28.78  ? 186  ILE A CD1   1 
ATOM   1511 N  N     . ILE A 1 187 ? 18.669  -34.825 -12.088 1.00 27.48  ? 187  ILE A N     1 
ATOM   1512 C  CA    . ILE A 1 187 ? 19.514  -34.697 -10.912 1.00 34.01  ? 187  ILE A CA    1 
ATOM   1513 C  C     . ILE A 1 187 ? 18.662  -34.150 -9.773  1.00 34.46  ? 187  ILE A C     1 
ATOM   1514 O  O     . ILE A 1 187 ? 18.287  -32.978 -9.764  1.00 32.20  ? 187  ILE A O     1 
ATOM   1515 C  CB    . ILE A 1 187 ? 20.739  -33.797 -11.193 1.00 34.75  ? 187  ILE A CB    1 
ATOM   1516 C  CG1   . ILE A 1 187 ? 21.594  -34.432 -12.297 1.00 37.89  ? 187  ILE A CG1   1 
ATOM   1517 C  CG2   . ILE A 1 187 ? 21.554  -33.585 -9.919  1.00 34.02  ? 187  ILE A CG2   1 
ATOM   1518 C  CD1   . ILE A 1 187 ? 22.878  -33.694 -12.597 1.00 40.97  ? 187  ILE A CD1   1 
ATOM   1519 N  N     . TYR A 1 188 ? 18.346  -35.025 -8.825  1.00 35.74  ? 188  TYR A N     1 
ATOM   1520 C  CA    . TYR A 1 188 ? 17.355  -34.746 -7.794  1.00 34.93  ? 188  TYR A CA    1 
ATOM   1521 C  C     . TYR A 1 188 ? 17.987  -34.300 -6.475  1.00 34.96  ? 188  TYR A C     1 
ATOM   1522 O  O     . TYR A 1 188 ? 18.907  -34.937 -5.971  1.00 33.36  ? 188  TYR A O     1 
ATOM   1523 C  CB    . TYR A 1 188 ? 16.481  -35.987 -7.574  1.00 34.15  ? 188  TYR A CB    1 
ATOM   1524 C  CG    . TYR A 1 188 ? 15.497  -35.863 -6.436  1.00 32.61  ? 188  TYR A CG    1 
ATOM   1525 C  CD1   . TYR A 1 188 ? 14.393  -35.028 -6.541  1.00 32.14  ? 188  TYR A CD1   1 
ATOM   1526 C  CD2   . TYR A 1 188 ? 15.667  -36.586 -5.261  1.00 32.75  ? 188  TYR A CD2   1 
ATOM   1527 C  CE1   . TYR A 1 188 ? 13.489  -34.908 -5.509  1.00 33.24  ? 188  TYR A CE1   1 
ATOM   1528 C  CE2   . TYR A 1 188 ? 14.766  -36.472 -4.217  1.00 34.11  ? 188  TYR A CE2   1 
ATOM   1529 C  CZ    . TYR A 1 188 ? 13.676  -35.630 -4.349  1.00 35.48  ? 188  TYR A CZ    1 
ATOM   1530 O  OH    . TYR A 1 188 ? 12.767  -35.504 -3.326  1.00 33.89  ? 188  TYR A OH    1 
ATOM   1531 N  N     . MET A 1 189 ? 17.479  -33.203 -5.919  1.00 36.98  ? 189  MET A N     1 
ATOM   1532 C  CA    . MET A 1 189 ? 18.019  -32.643 -4.683  1.00 36.99  ? 189  MET A CA    1 
ATOM   1533 C  C     . MET A 1 189 ? 16.911  -32.279 -3.694  1.00 33.56  ? 189  MET A C     1 
ATOM   1534 O  O     . MET A 1 189 ? 16.212  -31.286 -3.881  1.00 30.62  ? 189  MET A O     1 
ATOM   1535 C  CB    . MET A 1 189 ? 18.874  -31.408 -4.988  1.00 37.12  ? 189  MET A CB    1 
ATOM   1536 C  CG    . MET A 1 189 ? 20.134  -31.703 -5.800  1.00 40.43  ? 189  MET A CG    1 
ATOM   1537 S  SD    . MET A 1 189 ? 20.843  -30.237 -6.581  1.00 45.92  ? 189  MET A SD    1 
ATOM   1538 C  CE    . MET A 1 189 ? 19.670  -29.985 -7.909  1.00 37.83  ? 189  MET A CE    1 
ATOM   1539 N  N     . PRO A 1 190 ? 16.743  -33.093 -2.639  1.00 34.89  ? 190  PRO A N     1 
ATOM   1540 C  CA    . PRO A 1 190 ? 15.755  -32.801 -1.594  1.00 36.72  ? 190  PRO A CA    1 
ATOM   1541 C  C     . PRO A 1 190 ? 16.315  -31.825 -0.560  1.00 37.63  ? 190  PRO A C     1 
ATOM   1542 O  O     . PRO A 1 190 ? 17.522  -31.809 -0.331  1.00 40.99  ? 190  PRO A O     1 
ATOM   1543 C  CB    . PRO A 1 190 ? 15.518  -34.171 -0.956  1.00 37.47  ? 190  PRO A CB    1 
ATOM   1544 C  CG    . PRO A 1 190 ? 16.821  -34.875 -1.113  1.00 38.89  ? 190  PRO A CG    1 
ATOM   1545 C  CD    . PRO A 1 190 ? 17.419  -34.383 -2.417  1.00 37.25  ? 190  PRO A CD    1 
ATOM   1546 N  N     . PHE A 1 191 ? 15.450  -31.018 0.046   1.00 38.25  ? 191  PHE A N     1 
ATOM   1547 C  CA    . PHE A 1 191 ? 15.881  -30.043 1.040   1.00 38.08  ? 191  PHE A CA    1 
ATOM   1548 C  C     . PHE A 1 191 ? 14.938  -30.047 2.240   1.00 41.09  ? 191  PHE A C     1 
ATOM   1549 O  O     . PHE A 1 191 ? 13.741  -30.286 2.096   1.00 40.53  ? 191  PHE A O     1 
ATOM   1550 C  CB    . PHE A 1 191 ? 15.948  -28.642 0.429   1.00 38.89  ? 191  PHE A CB    1 
ATOM   1551 C  CG    . PHE A 1 191 ? 16.988  -28.494 -0.650  1.00 37.73  ? 191  PHE A CG    1 
ATOM   1552 C  CD1   . PHE A 1 191 ? 18.286  -28.129 -0.330  1.00 38.10  ? 191  PHE A CD1   1 
ATOM   1553 C  CD2   . PHE A 1 191 ? 16.666  -28.713 -1.982  1.00 34.60  ? 191  PHE A CD2   1 
ATOM   1554 C  CE1   . PHE A 1 191 ? 19.247  -27.988 -1.315  1.00 38.40  ? 191  PHE A CE1   1 
ATOM   1555 C  CE2   . PHE A 1 191 ? 17.622  -28.573 -2.974  1.00 34.07  ? 191  PHE A CE2   1 
ATOM   1556 C  CZ    . PHE A 1 191 ? 18.915  -28.208 -2.640  1.00 36.82  ? 191  PHE A CZ    1 
ATOM   1557 N  N     . ASP A 1 192 ? 15.483  -29.782 3.423   1.00 43.25  ? 192  ASP A N     1 
ATOM   1558 C  CA    . ASP A 1 192 ? 14.695  -29.807 4.656   1.00 46.61  ? 192  ASP A CA    1 
ATOM   1559 C  C     . ASP A 1 192 ? 14.180  -28.426 5.056   1.00 44.99  ? 192  ASP A C     1 
ATOM   1560 O  O     . ASP A 1 192 ? 13.386  -28.298 5.986   1.00 49.11  ? 192  ASP A O     1 
ATOM   1561 C  CB    . ASP A 1 192 ? 15.487  -30.456 5.806   1.00 48.45  ? 192  ASP A CB    1 
ATOM   1562 C  CG    . ASP A 1 192 ? 16.824  -29.767 6.071   1.00 53.06  ? 192  ASP A CG    1 
ATOM   1563 O  OD1   . ASP A 1 192 ? 16.933  -28.535 5.878   1.00 52.53  ? 192  ASP A OD1   1 
ATOM   1564 O  OD2   . ASP A 1 192 ? 17.776  -30.462 6.480   1.00 55.50  ? 192  ASP A OD2   1 
ATOM   1565 N  N     . ASN A 1 193 ? 14.647  -27.399 4.357   1.00 40.66  ? 193  ASN A N     1 
ATOM   1566 C  CA    . ASN A 1 193 ? 14.223  -26.036 4.625   1.00 41.93  ? 193  ASN A CA    1 
ATOM   1567 C  C     . ASN A 1 193 ? 14.214  -25.239 3.328   1.00 38.26  ? 193  ASN A C     1 
ATOM   1568 O  O     . ASN A 1 193 ? 15.040  -25.484 2.447   1.00 38.04  ? 193  ASN A O     1 
ATOM   1569 C  CB    . ASN A 1 193 ? 15.164  -25.371 5.640   1.00 49.65  ? 193  ASN A CB    1 
ATOM   1570 C  CG    . ASN A 1 193 ? 14.886  -25.800 7.073   1.00 61.58  ? 193  ASN A CG    1 
ATOM   1571 O  OD1   . ASN A 1 193 ? 13.744  -25.771 7.530   1.00 67.77  ? 193  ASN A OD1   1 
ATOM   1572 N  ND2   . ASN A 1 193 ? 15.931  -26.216 7.784   1.00 62.50  ? 193  ASN A ND2   1 
ATOM   1573 N  N     . GLU A 1 194 ? 13.289  -24.289 3.209   1.00 38.08  ? 194  GLU A N     1 
ATOM   1574 C  CA    . GLU A 1 194 ? 13.205  -23.461 2.008   1.00 37.83  ? 194  GLU A CA    1 
ATOM   1575 C  C     . GLU A 1 194 ? 14.447  -22.588 1.796   1.00 36.93  ? 194  GLU A C     1 
ATOM   1576 O  O     . GLU A 1 194 ? 14.898  -22.407 0.664   1.00 36.35  ? 194  GLU A O     1 
ATOM   1577 C  CB    . GLU A 1 194 ? 11.956  -22.575 2.037   1.00 38.55  ? 194  GLU A CB    1 
ATOM   1578 C  CG    . GLU A 1 194 ? 11.756  -21.772 0.760   1.00 36.20  ? 194  GLU A CG    1 
ATOM   1579 C  CD    . GLU A 1 194 ? 10.645  -20.752 0.870   1.00 40.78  ? 194  GLU A CD    1 
ATOM   1580 O  OE1   . GLU A 1 194 ? 10.156  -20.508 1.997   1.00 42.06  ? 194  GLU A OE1   1 
ATOM   1581 O  OE2   . GLU A 1 194 ? 10.269  -20.189 -0.182  1.00 39.40  ? 194  GLU A OE2   1 
ATOM   1582 N  N     . LYS A 1 195 ? 14.983  -22.036 2.881   1.00 39.37  ? 195  LYS A N     1 
ATOM   1583 C  CA    . LYS A 1 195 ? 16.165  -21.183 2.791   1.00 43.24  ? 195  LYS A CA    1 
ATOM   1584 C  C     . LYS A 1 195 ? 17.349  -21.938 2.195   1.00 43.75  ? 195  LYS A C     1 
ATOM   1585 O  O     . LYS A 1 195 ? 18.103  -21.396 1.388   1.00 43.82  ? 195  LYS A O     1 
ATOM   1586 C  CB    . LYS A 1 195 ? 16.530  -20.624 4.165   1.00 43.41  ? 195  LYS A CB    1 
ATOM   1587 C  CG    . LYS A 1 195 ? 15.570  -19.557 4.659   1.00 47.94  ? 195  LYS A CG    1 
ATOM   1588 N  N     . GLU A 1 196 ? 17.494  -23.199 2.589   1.00 42.06  ? 196  GLU A N     1 
ATOM   1589 C  CA    . GLU A 1 196 ? 18.577  -24.035 2.091   1.00 41.53  ? 196  GLU A CA    1 
ATOM   1590 C  C     . GLU A 1 196 ? 18.380  -24.372 0.614   1.00 37.11  ? 196  GLU A C     1 
ATOM   1591 O  O     . GLU A 1 196 ? 19.345  -24.418 -0.149  1.00 37.67  ? 196  GLU A O     1 
ATOM   1592 C  CB    . GLU A 1 196 ? 18.716  -25.304 2.943   1.00 39.61  ? 196  GLU A CB    1 
ATOM   1593 C  CG    . GLU A 1 196 ? 19.050  -25.007 4.402   1.00 45.20  ? 196  GLU A CG    1 
ATOM   1594 C  CD    . GLU A 1 196 ? 19.083  -26.253 5.280   1.00 45.43  ? 196  GLU A CD    1 
ATOM   1595 O  OE1   . GLU A 1 196 ? 19.408  -27.349 4.772   1.00 45.75  ? 196  GLU A OE1   1 
ATOM   1596 O  OE2   . GLU A 1 196 ? 18.780  -26.134 6.485   1.00 45.17  ? 196  GLU A OE2   1 
ATOM   1597 N  N     . LEU A 1 197 ? 17.129  -24.593 0.216   1.00 32.45  ? 197  LEU A N     1 
ATOM   1598 C  CA    . LEU A 1 197 ? 16.805  -24.819 -1.185  1.00 31.13  ? 197  LEU A CA    1 
ATOM   1599 C  C     . LEU A 1 197 ? 17.217  -23.605 -2.012  1.00 34.60  ? 197  LEU A C     1 
ATOM   1600 O  O     . LEU A 1 197 ? 17.943  -23.731 -2.996  1.00 33.27  ? 197  LEU A O     1 
ATOM   1601 C  CB    . LEU A 1 197 ? 15.303  -25.096 -1.359  1.00 30.63  ? 197  LEU A CB    1 
ATOM   1602 C  CG    . LEU A 1 197 ? 14.758  -25.414 -2.763  1.00 31.71  ? 197  LEU A CG    1 
ATOM   1603 C  CD1   . LEU A 1 197 ? 13.525  -26.310 -2.677  1.00 32.10  ? 197  LEU A CD1   1 
ATOM   1604 C  CD2   . LEU A 1 197 ? 14.421  -24.148 -3.560  1.00 30.37  ? 197  LEU A CD2   1 
ATOM   1605 N  N     . LEU A 1 198 ? 16.746  -22.430 -1.603  1.00 36.74  ? 198  LEU A N     1 
ATOM   1606 C  CA    . LEU A 1 198 ? 16.981  -21.203 -2.358  1.00 35.86  ? 198  LEU A CA    1 
ATOM   1607 C  C     . LEU A 1 198 ? 18.454  -20.805 -2.390  1.00 35.42  ? 198  LEU A C     1 
ATOM   1608 O  O     . LEU A 1 198 ? 18.953  -20.354 -3.421  1.00 32.75  ? 198  LEU A O     1 
ATOM   1609 C  CB    . LEU A 1 198 ? 16.118  -20.065 -1.813  1.00 36.31  ? 198  LEU A CB    1 
ATOM   1610 C  CG    . LEU A 1 198 ? 14.618  -20.232 -2.071  1.00 35.85  ? 198  LEU A CG    1 
ATOM   1611 C  CD1   . LEU A 1 198 ? 13.824  -19.134 -1.386  1.00 37.70  ? 198  LEU A CD1   1 
ATOM   1612 C  CD2   . LEU A 1 198 ? 14.336  -20.241 -3.562  1.00 34.57  ? 198  LEU A CD2   1 
ATOM   1613 N  N     . MET A 1 199 ? 19.141  -20.975 -1.262  1.00 39.16  ? 199  MET A N     1 
ATOM   1614 C  CA    . MET A 1 199 ? 20.578  -20.728 -1.190  1.00 44.70  ? 199  MET A CA    1 
ATOM   1615 C  C     . MET A 1 199 ? 21.325  -21.613 -2.181  1.00 41.86  ? 199  MET A C     1 
ATOM   1616 O  O     . MET A 1 199 ? 22.181  -21.142 -2.931  1.00 40.67  ? 199  MET A O     1 
ATOM   1617 C  CB    . MET A 1 199 ? 21.111  -20.978 0.227   1.00 52.31  ? 199  MET A CB    1 
ATOM   1618 C  CG    . MET A 1 199 ? 20.869  -19.832 1.203   1.00 58.67  ? 199  MET A CG    1 
ATOM   1619 S  SD    . MET A 1 199 ? 21.815  -19.964 2.741   1.00 124.29 ? 199  MET A SD    1 
ATOM   1620 C  CE    . MET A 1 199 ? 20.962  -21.291 3.593   1.00 42.70  ? 199  MET A CE    1 
ATOM   1621 N  N     . GLU A 1 200 ? 20.999  -22.900 -2.177  1.00 38.25  ? 200  GLU A N     1 
ATOM   1622 C  CA    . GLU A 1 200 ? 21.622  -23.831 -3.103  1.00 39.77  ? 200  GLU A CA    1 
ATOM   1623 C  C     . GLU A 1 200 ? 21.286  -23.478 -4.555  1.00 35.28  ? 200  GLU A C     1 
ATOM   1624 O  O     . GLU A 1 200 ? 22.141  -23.568 -5.436  1.00 34.24  ? 200  GLU A O     1 
ATOM   1625 C  CB    . GLU A 1 200 ? 21.204  -25.267 -2.788  1.00 46.15  ? 200  GLU A CB    1 
ATOM   1626 C  CG    . GLU A 1 200 ? 21.828  -26.299 -3.711  1.00 56.32  ? 200  GLU A CG    1 
ATOM   1627 C  CD    . GLU A 1 200 ? 23.338  -26.168 -3.796  1.00 65.23  ? 200  GLU A CD    1 
ATOM   1628 O  OE1   . GLU A 1 200 ? 23.987  -26.025 -2.735  1.00 67.56  ? 200  GLU A OE1   1 
ATOM   1629 O  OE2   . GLU A 1 200 ? 23.874  -26.200 -4.927  1.00 68.11  ? 200  GLU A OE2   1 
ATOM   1630 N  N     . TYR A 1 201 ? 20.046  -23.067 -4.799  1.00 29.82  ? 201  TYR A N     1 
ATOM   1631 C  CA    . TYR A 1 201 ? 19.635  -22.699 -6.149  1.00 32.16  ? 201  TYR A CA    1 
ATOM   1632 C  C     . TYR A 1 201 ? 20.442  -21.503 -6.650  1.00 33.48  ? 201  TYR A C     1 
ATOM   1633 O  O     . TYR A 1 201 ? 20.855  -21.469 -7.808  1.00 34.49  ? 201  TYR A O     1 
ATOM   1634 C  CB    . TYR A 1 201 ? 18.133  -22.402 -6.218  1.00 30.48  ? 201  TYR A CB    1 
ATOM   1635 C  CG    . TYR A 1 201 ? 17.649  -22.120 -7.626  1.00 30.14  ? 201  TYR A CG    1 
ATOM   1636 C  CD1   . TYR A 1 201 ? 17.599  -23.135 -8.572  1.00 28.51  ? 201  TYR A CD1   1 
ATOM   1637 C  CD2   . TYR A 1 201 ? 17.252  -20.842 -8.011  1.00 30.95  ? 201  TYR A CD2   1 
ATOM   1638 C  CE1   . TYR A 1 201 ? 17.168  -22.895 -9.856  1.00 27.88  ? 201  TYR A CE1   1 
ATOM   1639 C  CE2   . TYR A 1 201 ? 16.815  -20.589 -9.301  1.00 28.86  ? 201  TYR A CE2   1 
ATOM   1640 C  CZ    . TYR A 1 201 ? 16.776  -21.623 -10.220 1.00 30.36  ? 201  TYR A CZ    1 
ATOM   1641 O  OH    . TYR A 1 201 ? 16.348  -21.401 -11.511 1.00 29.23  ? 201  TYR A OH    1 
ATOM   1642 N  N     . LEU A 1 202 ? 20.681  -20.538 -5.766  1.00 31.96  ? 202  LEU A N     1 
ATOM   1643 C  CA    . LEU A 1 202 ? 21.511  -19.384 -6.102  1.00 33.86  ? 202  LEU A CA    1 
ATOM   1644 C  C     . LEU A 1 202 ? 22.954  -19.780 -6.398  1.00 33.35  ? 202  LEU A C     1 
ATOM   1645 O  O     . LEU A 1 202 ? 23.563  -19.261 -7.332  1.00 34.46  ? 202  LEU A O     1 
ATOM   1646 C  CB    . LEU A 1 202 ? 21.474  -18.342 -4.987  1.00 35.75  ? 202  LEU A CB    1 
ATOM   1647 C  CG    . LEU A 1 202 ? 20.215  -17.484 -4.935  1.00 39.17  ? 202  LEU A CG    1 
ATOM   1648 C  CD1   . LEU A 1 202 ? 20.278  -16.545 -3.751  1.00 39.07  ? 202  LEU A CD1   1 
ATOM   1649 C  CD2   . LEU A 1 202 ? 20.046  -16.699 -6.230  1.00 38.09  ? 202  LEU A CD2   1 
ATOM   1650 N  N     . ASN A 1 203 ? 23.500  -20.695 -5.604  1.00 32.29  ? 203  ASN A N     1 
ATOM   1651 C  CA    . ASN A 1 203 ? 24.853  -21.187 -5.846  1.00 37.65  ? 203  ASN A CA    1 
ATOM   1652 C  C     . ASN A 1 203 ? 24.933  -21.934 -7.174  1.00 36.54  ? 203  ASN A C     1 
ATOM   1653 O  O     . ASN A 1 203 ? 25.898  -21.791 -7.925  1.00 34.38  ? 203  ASN A O     1 
ATOM   1654 C  CB    . ASN A 1 203 ? 25.321  -22.083 -4.700  1.00 41.77  ? 203  ASN A CB    1 
ATOM   1655 C  CG    . ASN A 1 203 ? 25.542  -21.313 -3.411  1.00 52.35  ? 203  ASN A CG    1 
ATOM   1656 O  OD1   . ASN A 1 203 ? 25.650  -20.086 -3.415  1.00 49.78  ? 203  ASN A OD1   1 
ATOM   1657 N  ND2   . ASN A 1 203 ? 25.621  -22.036 -2.298  1.00 57.82  ? 203  ASN A ND2   1 
ATOM   1658 N  N     . PHE A 1 204 ? 23.903  -22.727 -7.450  1.00 35.43  ? 204  PHE A N     1 
ATOM   1659 C  CA    . PHE A 1 204 ? 23.751  -23.413 -8.726  1.00 34.62  ? 204  PHE A CA    1 
ATOM   1660 C  C     . PHE A 1 204 ? 23.686  -22.407 -9.875  1.00 35.35  ? 204  PHE A C     1 
ATOM   1661 O  O     . PHE A 1 204 ? 24.359  -22.565 -10.893 1.00 35.57  ? 204  PHE A O     1 
ATOM   1662 C  CB    . PHE A 1 204 ? 22.475  -24.256 -8.688  1.00 31.90  ? 204  PHE A CB    1 
ATOM   1663 C  CG    . PHE A 1 204 ? 22.034  -24.769 -10.026 1.00 31.27  ? 204  PHE A CG    1 
ATOM   1664 C  CD1   . PHE A 1 204 ? 22.604  -25.910 -10.566 1.00 34.15  ? 204  PHE A CD1   1 
ATOM   1665 C  CD2   . PHE A 1 204 ? 21.026  -24.130 -10.730 1.00 33.51  ? 204  PHE A CD2   1 
ATOM   1666 C  CE1   . PHE A 1 204 ? 22.189  -26.394 -11.789 1.00 33.71  ? 204  PHE A CE1   1 
ATOM   1667 C  CE2   . PHE A 1 204 ? 20.606  -24.607 -11.955 1.00 35.11  ? 204  PHE A CE2   1 
ATOM   1668 C  CZ    . PHE A 1 204 ? 21.190  -25.743 -12.487 1.00 34.78  ? 204  PHE A CZ    1 
ATOM   1669 N  N     . TRP A 1 205 ? 22.870  -21.373 -9.690  1.00 31.05  ? 205  TRP A N     1 
ATOM   1670 C  CA    . TRP A 1 205 ? 22.692  -20.310 -10.674 1.00 32.37  ? 205  TRP A CA    1 
ATOM   1671 C  C     . TRP A 1 205 ? 24.012  -19.605 -11.009 1.00 33.73  ? 205  TRP A C     1 
ATOM   1672 O  O     . TRP A 1 205 ? 24.307  -19.362 -12.177 1.00 33.01  ? 205  TRP A O     1 
ATOM   1673 C  CB    . TRP A 1 205 ? 21.660  -19.306 -10.152 1.00 29.51  ? 205  TRP A CB    1 
ATOM   1674 C  CG    . TRP A 1 205 ? 21.229  -18.244 -11.116 1.00 29.38  ? 205  TRP A CG    1 
ATOM   1675 C  CD1   . TRP A 1 205 ? 21.908  -17.102 -11.432 1.00 30.94  ? 205  TRP A CD1   1 
ATOM   1676 C  CD2   . TRP A 1 205 ? 20.001  -18.198 -11.856 1.00 29.14  ? 205  TRP A CD2   1 
ATOM   1677 N  NE1   . TRP A 1 205 ? 21.188  -16.357 -12.334 1.00 26.26  ? 205  TRP A NE1   1 
ATOM   1678 C  CE2   . TRP A 1 205 ? 20.013  -17.006 -12.611 1.00 29.51  ? 205  TRP A CE2   1 
ATOM   1679 C  CE3   . TRP A 1 205 ? 18.896  -19.050 -11.962 1.00 27.60  ? 205  TRP A CE3   1 
ATOM   1680 C  CZ2   . TRP A 1 205 ? 18.965  -16.643 -13.457 1.00 28.60  ? 205  TRP A CZ2   1 
ATOM   1681 C  CZ3   . TRP A 1 205 ? 17.855  -18.689 -12.807 1.00 31.11  ? 205  TRP A CZ3   1 
ATOM   1682 C  CH2   . TRP A 1 205 ? 17.899  -17.495 -13.543 1.00 30.27  ? 205  TRP A CH2   1 
ATOM   1683 N  N     A GLN A 1 206 ? 24.791  -19.288 -9.975  0.50 34.39  ? 206  GLN A N     1 
ATOM   1684 N  N     B GLN A 1 206 ? 24.803  -19.284 -9.991  0.50 34.39  ? 206  GLN A N     1 
ATOM   1685 C  CA    A GLN A 1 206 ? 26.084  -18.624 -10.137 0.50 38.48  ? 206  GLN A CA    1 
ATOM   1686 C  CA    B GLN A 1 206 ? 26.070  -18.592 -10.218 0.50 38.29  ? 206  GLN A CA    1 
ATOM   1687 C  C     A GLN A 1 206 ? 27.027  -19.461 -10.996 0.50 39.96  ? 206  GLN A C     1 
ATOM   1688 C  C     B GLN A 1 206 ? 27.074  -19.458 -10.979 0.50 39.99  ? 206  GLN A C     1 
ATOM   1689 O  O     A GLN A 1 206 ? 27.736  -18.938 -11.857 0.50 41.23  ? 206  GLN A O     1 
ATOM   1690 O  O     B GLN A 1 206 ? 27.878  -18.948 -11.759 0.50 41.55  ? 206  GLN A O     1 
ATOM   1691 C  CB    A GLN A 1 206 ? 26.726  -18.358 -8.767  0.50 40.86  ? 206  GLN A CB    1 
ATOM   1692 C  CB    B GLN A 1 206 ? 26.670  -18.097 -8.898  0.50 41.48  ? 206  GLN A CB    1 
ATOM   1693 C  CG    A GLN A 1 206 ? 28.077  -17.646 -8.829  0.50 42.98  ? 206  GLN A CG    1 
ATOM   1694 C  CG    B GLN A 1 206 ? 25.919  -16.921 -8.295  0.50 43.94  ? 206  GLN A CG    1 
ATOM   1695 C  CD    A GLN A 1 206 ? 28.714  -17.455 -7.458  0.50 45.87  ? 206  GLN A CD    1 
ATOM   1696 C  CD    B GLN A 1 206 ? 26.625  -16.331 -7.090  0.50 46.71  ? 206  GLN A CD    1 
ATOM   1697 O  OE1   A GLN A 1 206 ? 28.606  -18.314 -6.581  0.50 47.89  ? 206  GLN A OE1   1 
ATOM   1698 O  OE1   B GLN A 1 206 ? 26.296  -15.233 -6.640  0.50 45.83  ? 206  GLN A OE1   1 
ATOM   1699 N  NE2   A GLN A 1 206 ? 29.380  -16.321 -7.269  0.50 41.71  ? 206  GLN A NE2   1 
ATOM   1700 N  NE2   B GLN A 1 206 ? 27.600  -17.060 -6.558  0.50 48.84  ? 206  GLN A NE2   1 
ATOM   1701 N  N     . GLN A 1 207 ? 27.015  -20.766 -10.757 1.00 38.21  ? 207  GLN A N     1 
ATOM   1702 C  CA    . GLN A 1 207 ? 27.876  -21.703 -11.464 1.00 43.87  ? 207  GLN A CA    1 
ATOM   1703 C  C     . GLN A 1 207 ? 27.395  -21.955 -12.898 1.00 40.87  ? 207  GLN A C     1 
ATOM   1704 O  O     . GLN A 1 207 ? 28.199  -22.176 -13.804 1.00 43.87  ? 207  GLN A O     1 
ATOM   1705 C  CB    . GLN A 1 207 ? 27.938  -23.017 -10.678 1.00 50.50  ? 207  GLN A CB    1 
ATOM   1706 C  CG    . GLN A 1 207 ? 28.761  -24.118 -11.309 1.00 58.45  ? 207  GLN A CG    1 
ATOM   1707 C  CD    . GLN A 1 207 ? 28.892  -25.321 -10.393 1.00 68.17  ? 207  GLN A CD    1 
ATOM   1708 O  OE1   . GLN A 1 207 ? 28.558  -25.251 -9.209  1.00 71.91  ? 207  GLN A OE1   1 
ATOM   1709 N  NE2   . GLN A 1 207 ? 29.374  -26.432 -10.937 1.00 70.78  ? 207  GLN A NE2   1 
ATOM   1710 N  N     . LYS A 1 208 ? 26.082  -21.922 -13.097 1.00 37.31  ? 208  LYS A N     1 
ATOM   1711 C  CA    . LYS A 1 208 ? 25.496  -22.178 -14.413 1.00 34.44  ? 208  LYS A CA    1 
ATOM   1712 C  C     . LYS A 1 208 ? 24.542  -21.063 -14.812 1.00 34.21  ? 208  LYS A C     1 
ATOM   1713 O  O     . LYS A 1 208 ? 23.345  -21.291 -15.002 1.00 31.77  ? 208  LYS A O     1 
ATOM   1714 C  CB    . LYS A 1 208 ? 24.761  -23.520 -14.419 1.00 30.73  ? 208  LYS A CB    1 
ATOM   1715 C  CG    . LYS A 1 208 ? 25.651  -24.709 -14.067 1.00 34.12  ? 208  LYS A CG    1 
ATOM   1716 C  CD    . LYS A 1 208 ? 24.841  -25.987 -13.917 1.00 34.52  ? 208  LYS A CD    1 
ATOM   1717 C  CE    . LYS A 1 208 ? 25.665  -27.074 -13.234 1.00 38.42  ? 208  LYS A CE    1 
ATOM   1718 N  NZ    . LYS A 1 208 ? 26.845  -27.461 -14.050 1.00 34.55  ? 208  LYS A NZ    1 
ATOM   1719 N  N     . THR A 1 209 ? 25.079  -19.854 -14.939 1.00 32.73  ? 209  THR A N     1 
ATOM   1720 C  CA    . THR A 1 209 ? 24.255  -18.682 -15.201 1.00 30.17  ? 209  THR A CA    1 
ATOM   1721 C  C     . THR A 1 209 ? 23.708  -18.693 -16.614 1.00 30.46  ? 209  THR A C     1 
ATOM   1722 O  O     . THR A 1 209 ? 24.473  -18.677 -17.575 1.00 30.26  ? 209  THR A O     1 
ATOM   1723 C  CB    . THR A 1 209 ? 25.039  -17.387 -14.989 1.00 29.48  ? 209  THR A CB    1 
ATOM   1724 O  OG1   . THR A 1 209 ? 25.739  -17.457 -13.743 1.00 35.28  ? 209  THR A OG1   1 
ATOM   1725 C  CG2   . THR A 1 209 ? 24.092  -16.187 -14.986 1.00 28.09  ? 209  THR A CG2   1 
ATOM   1726 N  N     . PRO A 1 210 ? 22.374  -18.726 -16.739 1.00 31.72  ? 210  PRO A N     1 
ATOM   1727 C  CA    . PRO A 1 210 ? 21.690  -18.753 -18.034 1.00 31.39  ? 210  PRO A CA    1 
ATOM   1728 C  C     . PRO A 1 210 ? 22.085  -17.569 -18.904 1.00 30.66  ? 210  PRO A C     1 
ATOM   1729 O  O     . PRO A 1 210 ? 22.317  -16.476 -18.392 1.00 32.27  ? 210  PRO A O     1 
ATOM   1730 C  CB    . PRO A 1 210 ? 20.211  -18.632 -17.648 1.00 26.30  ? 210  PRO A CB    1 
ATOM   1731 C  CG    . PRO A 1 210 ? 20.142  -19.187 -16.264 1.00 26.12  ? 210  PRO A CG    1 
ATOM   1732 C  CD    . PRO A 1 210 ? 21.427  -18.770 -15.612 1.00 31.38  ? 210  PRO A CD    1 
ATOM   1733 N  N     . VAL A 1 211 ? 22.182  -17.801 -20.208 1.00 28.03  ? 211  VAL A N     1 
ATOM   1734 C  CA    . VAL A 1 211 ? 22.316  -16.718 -21.166 1.00 26.41  ? 211  VAL A CA    1 
ATOM   1735 C  C     . VAL A 1 211 ? 20.931  -16.453 -21.733 1.00 27.70  ? 211  VAL A C     1 
ATOM   1736 O  O     . VAL A 1 211 ? 20.425  -15.329 -21.683 1.00 27.84  ? 211  VAL A O     1 
ATOM   1737 C  CB    . VAL A 1 211 ? 23.291  -17.077 -22.297 1.00 26.29  ? 211  VAL A CB    1 
ATOM   1738 C  CG1   . VAL A 1 211 ? 23.174  -16.069 -23.441 1.00 23.83  ? 211  VAL A CG1   1 
ATOM   1739 C  CG2   . VAL A 1 211 ? 24.718  -17.124 -21.762 1.00 25.17  ? 211  VAL A CG2   1 
ATOM   1740 N  N     . ILE A 1 212 ? 20.318  -17.505 -22.265 1.00 23.64  ? 212  ILE A N     1 
ATOM   1741 C  CA    . ILE A 1 212 ? 18.915  -17.458 -22.638 1.00 24.69  ? 212  ILE A CA    1 
ATOM   1742 C  C     . ILE A 1 212 ? 18.107  -18.114 -21.526 1.00 27.90  ? 212  ILE A C     1 
ATOM   1743 O  O     . ILE A 1 212 ? 18.378  -19.252 -21.136 1.00 28.12  ? 212  ILE A O     1 
ATOM   1744 C  CB    . ILE A 1 212 ? 18.651  -18.201 -23.955 1.00 25.16  ? 212  ILE A CB    1 
ATOM   1745 C  CG1   . ILE A 1 212 ? 19.613  -17.713 -25.043 1.00 28.86  ? 212  ILE A CG1   1 
ATOM   1746 C  CG2   . ILE A 1 212 ? 17.196  -18.021 -24.379 1.00 23.61  ? 212  ILE A CG2   1 
ATOM   1747 C  CD1   . ILE A 1 212 ? 19.442  -16.252 -25.409 1.00 26.61  ? 212  ILE A CD1   1 
ATOM   1748 N  N     . LEU A 1 213 ? 17.128  -17.388 -21.002 1.00 28.19  ? 213  LEU A N     1 
ATOM   1749 C  CA    . LEU A 1 213 ? 16.284  -17.912 -19.936 1.00 26.07  ? 213  LEU A CA    1 
ATOM   1750 C  C     . LEU A 1 213 ? 14.858  -18.049 -20.446 1.00 26.96  ? 213  LEU A C     1 
ATOM   1751 O  O     . LEU A 1 213 ? 14.255  -17.075 -20.887 1.00 24.84  ? 213  LEU A O     1 
ATOM   1752 C  CB    . LEU A 1 213 ? 16.324  -16.989 -18.717 1.00 26.03  ? 213  LEU A CB    1 
ATOM   1753 C  CG    . LEU A 1 213 ? 15.567  -17.469 -17.476 1.00 27.66  ? 213  LEU A CG    1 
ATOM   1754 C  CD1   . LEU A 1 213 ? 16.045  -18.848 -17.074 1.00 26.79  ? 213  LEU A CD1   1 
ATOM   1755 C  CD2   . LEU A 1 213 ? 15.743  -16.479 -16.329 1.00 28.39  ? 213  LEU A CD2   1 
ATOM   1756 N  N     . THR A 1 214 ? 14.318  -19.260 -20.401 1.00 25.35  ? 214  THR A N     1 
ATOM   1757 C  CA    . THR A 1 214 ? 12.977  -19.478 -20.922 1.00 26.18  ? 214  THR A CA    1 
ATOM   1758 C  C     . THR A 1 214 ? 12.165  -20.417 -20.037 1.00 24.05  ? 214  THR A C     1 
ATOM   1759 O  O     . THR A 1 214 ? 12.587  -20.777 -18.937 1.00 24.13  ? 214  THR A O     1 
ATOM   1760 C  CB    . THR A 1 214 ? 13.007  -19.987 -22.392 1.00 30.37  ? 214  THR A CB    1 
ATOM   1761 O  OG1   . THR A 1 214 ? 11.677  -20.011 -22.928 1.00 27.61  ? 214  THR A OG1   1 
ATOM   1762 C  CG2   . THR A 1 214 ? 13.616  -21.369 -22.478 1.00 24.52  ? 214  THR A CG2   1 
ATOM   1763 N  N     . GLY A 1 215 ? 10.997  -20.801 -20.533 1.00 25.41  ? 215  GLY A N     1 
ATOM   1764 C  CA    . GLY A 1 215 ? 10.043  -21.581 -19.773 1.00 24.12  ? 215  GLY A CA    1 
ATOM   1765 C  C     . GLY A 1 215 ? 8.669   -21.030 -20.090 1.00 26.00  ? 215  GLY A C     1 
ATOM   1766 O  O     . GLY A 1 215 ? 8.529   -20.211 -20.991 1.00 27.80  ? 215  GLY A O     1 
ATOM   1767 N  N     . TRP A 1 216 ? 7.655   -21.460 -19.349 1.00 27.79  ? 216  TRP A N     1 
ATOM   1768 C  CA    . TRP A 1 216 ? 6.289   -21.042 -19.640 1.00 27.70  ? 216  TRP A CA    1 
ATOM   1769 C  C     . TRP A 1 216 ? 5.791   -20.028 -18.612 1.00 24.89  ? 216  TRP A C     1 
ATOM   1770 O  O     . TRP A 1 216 ? 5.675   -20.344 -17.430 1.00 27.70  ? 216  TRP A O     1 
ATOM   1771 C  CB    . TRP A 1 216 ? 5.364   -22.260 -19.697 1.00 28.35  ? 216  TRP A CB    1 
ATOM   1772 C  CG    . TRP A 1 216 ? 4.074   -21.983 -20.411 1.00 29.52  ? 216  TRP A CG    1 
ATOM   1773 C  CD1   . TRP A 1 216 ? 2.860   -21.725 -19.842 1.00 27.55  ? 216  TRP A CD1   1 
ATOM   1774 C  CD2   . TRP A 1 216 ? 3.873   -21.922 -21.828 1.00 26.51  ? 216  TRP A CD2   1 
ATOM   1775 N  NE1   . TRP A 1 216 ? 1.916   -21.512 -20.818 1.00 28.73  ? 216  TRP A NE1   1 
ATOM   1776 C  CE2   . TRP A 1 216 ? 2.513   -21.628 -22.044 1.00 30.34  ? 216  TRP A CE2   1 
ATOM   1777 C  CE3   . TRP A 1 216 ? 4.711   -22.091 -22.933 1.00 28.14  ? 216  TRP A CE3   1 
ATOM   1778 C  CZ2   . TRP A 1 216 ? 1.971   -21.497 -23.323 1.00 33.48  ? 216  TRP A CZ2   1 
ATOM   1779 C  CZ3   . TRP A 1 216 ? 4.170   -21.961 -24.201 1.00 32.81  ? 216  TRP A CZ3   1 
ATOM   1780 C  CH2   . TRP A 1 216 ? 2.814   -21.668 -24.385 1.00 33.08  ? 216  TRP A CH2   1 
ATOM   1781 N  N     . ASN A 1 217 ? 5.507   -18.811 -19.076 1.00 24.53  ? 217  ASN A N     1 
ATOM   1782 C  CA    . ASN A 1 217 ? 5.149   -17.691 -18.198 1.00 27.72  ? 217  ASN A CA    1 
ATOM   1783 C  C     . ASN A 1 217 ? 6.245   -17.287 -17.217 1.00 27.64  ? 217  ASN A C     1 
ATOM   1784 O  O     . ASN A 1 217 ? 5.958   -16.705 -16.170 1.00 29.11  ? 217  ASN A O     1 
ATOM   1785 C  CB    . ASN A 1 217 ? 3.847   -17.964 -17.430 1.00 32.19  ? 217  ASN A CB    1 
ATOM   1786 C  CG    . ASN A 1 217 ? 2.619   -17.670 -18.251 1.00 40.73  ? 217  ASN A CG    1 
ATOM   1787 O  OD1   . ASN A 1 217 ? 1.766   -18.535 -18.445 1.00 49.53  ? 217  ASN A OD1   1 
ATOM   1788 N  ND2   . ASN A 1 217 ? 2.519   -16.442 -18.739 1.00 40.40  ? 217  ASN A ND2   1 
ATOM   1789 N  N     . VAL A 1 218 ? 7.497   -17.585 -17.549 1.00 27.14  ? 218  VAL A N     1 
ATOM   1790 C  CA    . VAL A 1 218 ? 8.599   -17.263 -16.644 1.00 30.22  ? 218  VAL A CA    1 
ATOM   1791 C  C     . VAL A 1 218 ? 8.750   -15.762 -16.369 1.00 32.57  ? 218  VAL A C     1 
ATOM   1792 O  O     . VAL A 1 218 ? 9.142   -15.373 -15.273 1.00 32.69  ? 218  VAL A O     1 
ATOM   1793 C  CB    . VAL A 1 218 ? 9.949   -17.850 -17.120 1.00 28.39  ? 218  VAL A CB    1 
ATOM   1794 C  CG1   . VAL A 1 218 ? 9.932   -19.365 -16.991 1.00 26.38  ? 218  VAL A CG1   1 
ATOM   1795 C  CG2   . VAL A 1 218 ? 10.261  -17.416 -18.552 1.00 27.88  ? 218  VAL A CG2   1 
ATOM   1796 N  N     . GLU A 1 219 ? 8.430   -14.923 -17.349 1.00 31.91  ? 219  GLU A N     1 
ATOM   1797 C  CA    . GLU A 1 219 ? 8.607   -13.482 -17.178 1.00 36.14  ? 219  GLU A CA    1 
ATOM   1798 C  C     . GLU A 1 219 ? 7.546   -12.859 -16.269 1.00 34.43  ? 219  GLU A C     1 
ATOM   1799 O  O     . GLU A 1 219 ? 7.828   -11.919 -15.524 1.00 32.36  ? 219  GLU A O     1 
ATOM   1800 C  CB    . GLU A 1 219 ? 8.638   -12.765 -18.531 1.00 39.25  ? 219  GLU A CB    1 
ATOM   1801 C  CG    . GLU A 1 219 ? 8.803   -11.255 -18.417 1.00 47.24  ? 219  GLU A CG    1 
ATOM   1802 C  CD    . GLU A 1 219 ? 8.963   -10.576 -19.764 1.00 55.17  ? 219  GLU A CD    1 
ATOM   1803 O  OE1   . GLU A 1 219 ? 10.118  -10.431 -20.222 1.00 59.99  ? 219  GLU A OE1   1 
ATOM   1804 O  OE2   . GLU A 1 219 ? 7.938   -10.188 -20.363 1.00 55.20  ? 219  GLU A OE2   1 
ATOM   1805 N  N     . SER A 1 220 ? 6.330   -13.390 -16.324 1.00 28.89  ? 220  SER A N     1 
ATOM   1806 C  CA    . SER A 1 220 ? 5.236   -12.837 -15.536 1.00 33.62  ? 220  SER A CA    1 
ATOM   1807 C  C     . SER A 1 220 ? 5.040   -13.553 -14.199 1.00 34.55  ? 220  SER A C     1 
ATOM   1808 O  O     . SER A 1 220 ? 4.401   -13.015 -13.295 1.00 36.71  ? 220  SER A O     1 
ATOM   1809 C  CB    . SER A 1 220 ? 3.931   -12.857 -16.338 1.00 37.87  ? 220  SER A CB    1 
ATOM   1810 O  OG    . SER A 1 220 ? 3.509   -14.190 -16.581 1.00 44.31  ? 220  SER A OG    1 
ATOM   1811 N  N     . PHE A 1 221 ? 5.570   -14.766 -14.067 1.00 30.98  ? 221  PHE A N     1 
ATOM   1812 C  CA    . PHE A 1 221 ? 5.424   -15.483 -12.803 1.00 31.19  ? 221  PHE A CA    1 
ATOM   1813 C  C     . PHE A 1 221 ? 6.723   -15.974 -12.166 1.00 30.55  ? 221  PHE A C     1 
ATOM   1814 O  O     . PHE A 1 221 ? 7.131   -15.465 -11.125 1.00 32.63  ? 221  PHE A O     1 
ATOM   1815 C  CB    . PHE A 1 221 ? 4.433   -16.644 -12.913 1.00 30.60  ? 221  PHE A CB    1 
ATOM   1816 C  CG    . PHE A 1 221 ? 4.249   -17.381 -11.622 1.00 31.52  ? 221  PHE A CG    1 
ATOM   1817 C  CD1   . PHE A 1 221 ? 3.512   -16.816 -10.591 1.00 30.72  ? 221  PHE A CD1   1 
ATOM   1818 C  CD2   . PHE A 1 221 ? 4.841   -18.616 -11.420 1.00 30.12  ? 221  PHE A CD2   1 
ATOM   1819 C  CE1   . PHE A 1 221 ? 3.352   -17.480 -9.394  1.00 32.24  ? 221  PHE A CE1   1 
ATOM   1820 C  CE2   . PHE A 1 221 ? 4.685   -19.285 -10.221 1.00 31.31  ? 221  PHE A CE2   1 
ATOM   1821 C  CZ    . PHE A 1 221 ? 3.940   -18.720 -9.207  1.00 30.71  ? 221  PHE A CZ    1 
ATOM   1822 N  N     . ALA A 1 222 ? 7.356   -16.969 -12.783 1.00 28.39  ? 222  ALA A N     1 
ATOM   1823 C  CA    . ALA A 1 222 ? 8.505   -17.643 -12.178 1.00 28.22  ? 222  ALA A CA    1 
ATOM   1824 C  C     . ALA A 1 222 ? 9.639   -16.692 -11.784 1.00 26.77  ? 222  ALA A C     1 
ATOM   1825 O  O     . ALA A 1 222 ? 10.103  -16.708 -10.646 1.00 27.54  ? 222  ALA A O     1 
ATOM   1826 C  CB    . ALA A 1 222 ? 9.026   -18.750 -13.096 1.00 26.89  ? 222  ALA A CB    1 
ATOM   1827 N  N     . ILE A 1 223 ? 10.084  -15.868 -12.723 1.00 23.11  ? 223  ILE A N     1 
ATOM   1828 C  CA    . ILE A 1 223 ? 11.184  -14.954 -12.437 1.00 24.75  ? 223  ILE A CA    1 
ATOM   1829 C  C     . ILE A 1 223 ? 10.850  -13.945 -11.330 1.00 26.63  ? 223  ILE A C     1 
ATOM   1830 O  O     . ILE A 1 223 ? 11.578  -13.869 -10.341 1.00 28.32  ? 223  ILE A O     1 
ATOM   1831 C  CB    . ILE A 1 223 ? 11.722  -14.254 -13.710 1.00 25.53  ? 223  ILE A CB    1 
ATOM   1832 C  CG1   . ILE A 1 223 ? 12.294  -15.295 -14.677 1.00 27.94  ? 223  ILE A CG1   1 
ATOM   1833 C  CG2   . ILE A 1 223 ? 12.766  -13.207 -13.339 1.00 24.95  ? 223  ILE A CG2   1 
ATOM   1834 C  CD1   . ILE A 1 223 ? 12.546  -14.759 -16.072 1.00 30.86  ? 223  ILE A CD1   1 
ATOM   1835 N  N     . PRO A 1 224 ? 9.744   -13.182 -11.472 1.00 27.44  ? 224  PRO A N     1 
ATOM   1836 C  CA    . PRO A 1 224 ? 9.449   -12.261 -10.368 1.00 30.13  ? 224  PRO A CA    1 
ATOM   1837 C  C     . PRO A 1 224 ? 9.139   -12.965 -9.042  1.00 28.45  ? 224  PRO A C     1 
ATOM   1838 O  O     . PRO A 1 224 ? 9.459   -12.411 -7.988  1.00 29.80  ? 224  PRO A O     1 
ATOM   1839 C  CB    . PRO A 1 224 ? 8.229   -11.477 -10.870 1.00 29.68  ? 224  PRO A CB    1 
ATOM   1840 C  CG    . PRO A 1 224 ? 7.648   -12.306 -11.958 1.00 32.90  ? 224  PRO A CG    1 
ATOM   1841 C  CD    . PRO A 1 224 ? 8.801   -13.010 -12.593 1.00 27.84  ? 224  PRO A CD    1 
ATOM   1842 N  N     . TYR A 1 225 ? 8.538   -14.151 -9.078  1.00 24.58  ? 225  TYR A N     1 
ATOM   1843 C  CA    . TYR A 1 225 ? 8.272   -14.844 -7.825  1.00 28.65  ? 225  TYR A CA    1 
ATOM   1844 C  C     . TYR A 1 225 ? 9.579   -15.218 -7.131  1.00 29.61  ? 225  TYR A C     1 
ATOM   1845 O  O     . TYR A 1 225 ? 9.754   -14.941 -5.945  1.00 28.06  ? 225  TYR A O     1 
ATOM   1846 C  CB    . TYR A 1 225 ? 7.384   -16.083 -7.999  1.00 29.24  ? 225  TYR A CB    1 
ATOM   1847 C  CG    . TYR A 1 225 ? 6.714   -16.467 -6.699  1.00 31.78  ? 225  TYR A CG    1 
ATOM   1848 C  CD1   . TYR A 1 225 ? 5.391   -16.126 -6.450  1.00 30.19  ? 225  TYR A CD1   1 
ATOM   1849 C  CD2   . TYR A 1 225 ? 7.423   -17.119 -5.694  1.00 32.77  ? 225  TYR A CD2   1 
ATOM   1850 C  CE1   . TYR A 1 225 ? 4.786   -16.451 -5.250  1.00 32.91  ? 225  TYR A CE1   1 
ATOM   1851 C  CE2   . TYR A 1 225 ? 6.827   -17.446 -4.496  1.00 34.13  ? 225  TYR A CE2   1 
ATOM   1852 C  CZ    . TYR A 1 225 ? 5.510   -17.107 -4.276  1.00 35.78  ? 225  TYR A CZ    1 
ATOM   1853 O  OH    . TYR A 1 225 ? 4.917   -17.431 -3.078  1.00 40.55  ? 225  TYR A OH    1 
ATOM   1854 N  N     . VAL A 1 226 ? 10.489  -15.844 -7.876  1.00 28.22  ? 226  VAL A N     1 
ATOM   1855 C  CA    . VAL A 1 226 ? 11.786  -16.236 -7.326  1.00 28.44  ? 226  VAL A CA    1 
ATOM   1856 C  C     . VAL A 1 226 ? 12.554  -15.024 -6.798  1.00 29.65  ? 226  VAL A C     1 
ATOM   1857 O  O     . VAL A 1 226 ? 13.082  -15.047 -5.685  1.00 29.26  ? 226  VAL A O     1 
ATOM   1858 C  CB    . VAL A 1 226 ? 12.650  -16.979 -8.369  1.00 28.50  ? 226  VAL A CB    1 
ATOM   1859 C  CG1   . VAL A 1 226 ? 14.068  -17.171 -7.848  1.00 25.86  ? 226  VAL A CG1   1 
ATOM   1860 C  CG2   . VAL A 1 226 ? 12.022  -18.323 -8.722  1.00 31.28  ? 226  VAL A CG2   1 
ATOM   1861 N  N     . TYR A 1 227 ? 12.597  -13.961 -7.595  1.00 30.67  ? 227  TYR A N     1 
ATOM   1862 C  CA    . TYR A 1 227 ? 13.306  -12.743 -7.205  1.00 28.48  ? 227  TYR A CA    1 
ATOM   1863 C  C     . TYR A 1 227 ? 12.756  -12.146 -5.916  1.00 31.02  ? 227  TYR A C     1 
ATOM   1864 O  O     . TYR A 1 227 ? 13.515  -11.790 -5.013  1.00 31.24  ? 227  TYR A O     1 
ATOM   1865 C  CB    . TYR A 1 227 ? 13.242  -11.697 -8.316  1.00 26.05  ? 227  TYR A CB    1 
ATOM   1866 C  CG    . TYR A 1 227 ? 14.003  -10.428 -7.992  1.00 33.37  ? 227  TYR A CG    1 
ATOM   1867 C  CD1   . TYR A 1 227 ? 15.388  -10.390 -8.075  1.00 35.01  ? 227  TYR A CD1   1 
ATOM   1868 C  CD2   . TYR A 1 227 ? 13.338  -9.271  -7.604  1.00 36.49  ? 227  TYR A CD2   1 
ATOM   1869 C  CE1   . TYR A 1 227 ? 16.093  -9.240  -7.780  1.00 39.79  ? 227  TYR A CE1   1 
ATOM   1870 C  CE2   . TYR A 1 227 ? 14.037  -8.108  -7.305  1.00 38.54  ? 227  TYR A CE2   1 
ATOM   1871 C  CZ    . TYR A 1 227 ? 15.414  -8.101  -7.398  1.00 42.30  ? 227  TYR A CZ    1 
ATOM   1872 O  OH    . TYR A 1 227 ? 16.125  -6.957  -7.110  1.00 48.10  ? 227  TYR A OH    1 
ATOM   1873 N  N     . ASN A 1 228 ? 11.434  -12.032 -5.837  1.00 29.28  ? 228  ASN A N     1 
ATOM   1874 C  CA    . ASN A 1 228 ? 10.795  -11.433 -4.669  1.00 32.27  ? 228  ASN A CA    1 
ATOM   1875 C  C     . ASN A 1 228 ? 10.822  -12.314 -3.425  1.00 35.53  ? 228  ASN A C     1 
ATOM   1876 O  O     . ASN A 1 228 ? 10.869  -11.804 -2.302  1.00 39.91  ? 228  ASN A O     1 
ATOM   1877 C  CB    . ASN A 1 228 ? 9.366   -10.994 -4.995  1.00 30.93  ? 228  ASN A CB    1 
ATOM   1878 C  CG    . ASN A 1 228 ? 9.329   -9.678  -5.746  1.00 33.29  ? 228  ASN A CG    1 
ATOM   1879 O  OD1   . ASN A 1 228 ? 9.899   -8.690  -5.296  1.00 36.58  ? 228  ASN A OD1   1 
ATOM   1880 N  ND2   . ASN A 1 228 ? 8.681   -9.667  -6.908  1.00 30.64  ? 228  ASN A ND2   1 
ATOM   1881 N  N     . ARG A 1 229 ? 10.800  -13.631 -3.625  1.00 30.02  ? 229  ARG A N     1 
ATOM   1882 C  CA    . ARG A 1 229 ? 10.857  -14.561 -2.506  1.00 30.66  ? 229  ARG A CA    1 
ATOM   1883 C  C     . ARG A 1 229 ? 12.235  -14.488 -1.868  1.00 31.97  ? 229  ARG A C     1 
ATOM   1884 O  O     . ARG A 1 229 ? 12.359  -14.374 -0.648  1.00 30.88  ? 229  ARG A O     1 
ATOM   1885 C  CB    . ARG A 1 229 ? 10.556  -15.990 -2.968  1.00 30.23  ? 229  ARG A CB    1 
ATOM   1886 C  CG    . ARG A 1 229 ? 10.422  -16.993 -1.838  1.00 31.36  ? 229  ARG A CG    1 
ATOM   1887 C  CD    . ARG A 1 229 ? 9.246   -16.659 -0.924  1.00 34.50  ? 229  ARG A CD    1 
ATOM   1888 N  NE    . ARG A 1 229 ? 9.129   -17.602 0.190   1.00 33.81  ? 229  ARG A NE    1 
ATOM   1889 C  CZ    . ARG A 1 229 ? 8.295   -17.449 1.215   1.00 35.13  ? 229  ARG A CZ    1 
ATOM   1890 N  NH1   . ARG A 1 229 ? 7.501   -16.387 1.275   1.00 35.95  ? 229  ARG A NH1   1 
ATOM   1891 N  NH2   . ARG A 1 229 ? 8.260   -18.352 2.187   1.00 34.33  ? 229  ARG A NH2   1 
ATOM   1892 N  N     . ILE A 1 230 ? 13.266  -14.546 -2.704  1.00 31.80  ? 230  ILE A N     1 
ATOM   1893 C  CA    . ILE A 1 230 ? 14.641  -14.432 -2.239  1.00 33.23  ? 230  ILE A CA    1 
ATOM   1894 C  C     . ILE A 1 230 ? 14.903  -13.062 -1.609  1.00 37.16  ? 230  ILE A C     1 
ATOM   1895 O  O     . ILE A 1 230 ? 15.610  -12.958 -0.604  1.00 40.89  ? 230  ILE A O     1 
ATOM   1896 C  CB    . ILE A 1 230 ? 15.654  -14.700 -3.376  1.00 31.85  ? 230  ILE A CB    1 
ATOM   1897 C  CG1   . ILE A 1 230 ? 15.535  -16.146 -3.861  1.00 32.06  ? 230  ILE A CG1   1 
ATOM   1898 C  CG2   . ILE A 1 230 ? 17.079  -14.429 -2.908  1.00 30.72  ? 230  ILE A CG2   1 
ATOM   1899 C  CD1   . ILE A 1 230 ? 16.560  -16.527 -4.908  1.00 27.72  ? 230  ILE A CD1   1 
ATOM   1900 N  N     . LYS A 1 231 ? 14.323  -12.014 -2.186  1.00 37.26  ? 231  LYS A N     1 
ATOM   1901 C  CA    . LYS A 1 231 ? 14.493  -10.675 -1.626  1.00 39.74  ? 231  LYS A CA    1 
ATOM   1902 C  C     . LYS A 1 231 ? 13.850  -10.556 -0.242  1.00 42.18  ? 231  LYS A C     1 
ATOM   1903 O  O     . LYS A 1 231 ? 14.443  -9.996  0.680   1.00 44.34  ? 231  LYS A O     1 
ATOM   1904 C  CB    . LYS A 1 231 ? 13.941  -9.597  -2.560  1.00 39.95  ? 231  LYS A CB    1 
ATOM   1905 C  CG    . LYS A 1 231 ? 14.178  -8.186  -2.035  1.00 49.21  ? 231  LYS A CG    1 
ATOM   1906 C  CD    . LYS A 1 231 ? 14.002  -7.122  -3.106  1.00 54.57  ? 231  LYS A CD    1 
ATOM   1907 C  CE    . LYS A 1 231 ? 12.557  -6.682  -3.229  1.00 59.41  ? 231  LYS A CE    1 
ATOM   1908 N  NZ    . LYS A 1 231 ? 12.431  -5.523  -4.160  1.00 62.72  ? 231  LYS A NZ    1 
ATOM   1909 N  N     . ASN A 1 232 ? 12.643  -11.092 -0.101  1.00 39.46  ? 232  ASN A N     1 
ATOM   1910 C  CA    . ASN A 1 232 ? 11.933  -11.038 1.172   1.00 44.41  ? 232  ASN A CA    1 
ATOM   1911 C  C     . ASN A 1 232 ? 12.600  -11.862 2.271   1.00 48.07  ? 232  ASN A C     1 
ATOM   1912 O  O     . ASN A 1 232 ? 12.493  -11.535 3.452   1.00 51.98  ? 232  ASN A O     1 
ATOM   1913 C  CB    . ASN A 1 232 ? 10.475  -11.462 0.994   1.00 43.53  ? 232  ASN A CB    1 
ATOM   1914 C  CG    . ASN A 1 232 ? 9.655   -10.416 0.267   1.00 44.24  ? 232  ASN A CG    1 
ATOM   1915 O  OD1   . ASN A 1 232 ? 10.160  -9.345  -0.063  1.00 48.05  ? 232  ASN A OD1   1 
ATOM   1916 N  ND2   . ASN A 1 232 ? 8.392   -10.725 0.001   1.00 42.21  ? 232  ASN A ND2   1 
ATOM   1917 N  N     . ILE A 1 233 ? 13.298  -12.922 1.877   1.00 46.51  ? 233  ILE A N     1 
ATOM   1918 C  CA    . ILE A 1 233 ? 13.946  -13.808 2.839   1.00 47.82  ? 233  ILE A CA    1 
ATOM   1919 C  C     . ILE A 1 233 ? 15.384  -13.403 3.162   1.00 46.16  ? 233  ILE A C     1 
ATOM   1920 O  O     . ILE A 1 233 ? 15.761  -13.325 4.330   1.00 52.06  ? 233  ILE A O     1 
ATOM   1921 C  CB    . ILE A 1 233 ? 13.929  -15.273 2.355   1.00 50.58  ? 233  ILE A CB    1 
ATOM   1922 C  CG1   . ILE A 1 233 ? 12.497  -15.807 2.321   1.00 47.46  ? 233  ILE A CG1   1 
ATOM   1923 C  CG2   . ILE A 1 233 ? 14.798  -16.145 3.250   1.00 53.94  ? 233  ILE A CG2   1 
ATOM   1924 C  CD1   . ILE A 1 233 ? 12.392  -17.218 1.796   1.00 46.12  ? 233  ILE A CD1   1 
ATOM   1925 N  N     . PHE A 1 234 ? 16.184  -13.144 2.132   1.00 44.80  ? 234  PHE A N     1 
ATOM   1926 C  CA    . PHE A 1 234 ? 17.612  -12.885 2.319   1.00 46.07  ? 234  PHE A CA    1 
ATOM   1927 C  C     . PHE A 1 234 ? 18.002  -11.418 2.172   1.00 48.05  ? 234  PHE A C     1 
ATOM   1928 O  O     . PHE A 1 234 ? 19.064  -11.002 2.638   1.00 48.75  ? 234  PHE A O     1 
ATOM   1929 C  CB    . PHE A 1 234 ? 18.441  -13.717 1.341   1.00 45.03  ? 234  PHE A CB    1 
ATOM   1930 C  CG    . PHE A 1 234 ? 18.248  -15.196 1.484   1.00 45.35  ? 234  PHE A CG    1 
ATOM   1931 C  CD1   . PHE A 1 234 ? 18.925  -15.905 2.464   1.00 47.08  ? 234  PHE A CD1   1 
ATOM   1932 C  CD2   . PHE A 1 234 ? 17.401  -15.881 0.632   1.00 43.19  ? 234  PHE A CD2   1 
ATOM   1933 C  CE1   . PHE A 1 234 ? 18.752  -17.271 2.595   1.00 44.65  ? 234  PHE A CE1   1 
ATOM   1934 C  CE2   . PHE A 1 234 ? 17.224  -17.249 0.759   1.00 42.17  ? 234  PHE A CE2   1 
ATOM   1935 C  CZ    . PHE A 1 234 ? 17.902  -17.942 1.743   1.00 41.88  ? 234  PHE A CZ    1 
ATOM   1936 N  N     . GLY A 1 235 ? 17.155  -10.638 1.511   1.00 45.72  ? 235  GLY A N     1 
ATOM   1937 C  CA    . GLY A 1 235 ? 17.458  -9.238  1.274   1.00 43.79  ? 235  GLY A CA    1 
ATOM   1938 C  C     . GLY A 1 235 ? 17.827  -8.983  -0.175  1.00 43.92  ? 235  GLY A C     1 
ATOM   1939 O  O     . GLY A 1 235 ? 18.208  -9.904  -0.898  1.00 42.58  ? 235  GLY A O     1 
ATOM   1940 N  N     . GLU A 1 236 ? 17.726  -7.726  -0.593  1.00 44.93  ? 236  GLU A N     1 
ATOM   1941 C  CA    . GLU A 1 236 ? 17.908  -7.356  -1.995  1.00 47.95  ? 236  GLU A CA    1 
ATOM   1942 C  C     . GLU A 1 236 ? 19.280  -7.719  -2.568  1.00 43.04  ? 236  GLU A C     1 
ATOM   1943 O  O     . GLU A 1 236 ? 19.380  -8.154  -3.715  1.00 39.17  ? 236  GLU A O     1 
ATOM   1944 C  CB    . GLU A 1 236 ? 17.630  -5.863  -2.186  1.00 54.76  ? 236  GLU A CB    1 
ATOM   1945 C  CG    . GLU A 1 236 ? 17.679  -5.399  -3.628  1.00 62.80  ? 236  GLU A CG    1 
ATOM   1946 C  CD    . GLU A 1 236 ? 17.173  -3.980  -3.798  1.00 70.88  ? 236  GLU A CD    1 
ATOM   1947 O  OE1   . GLU A 1 236 ? 16.400  -3.516  -2.932  1.00 73.37  ? 236  GLU A OE1   1 
ATOM   1948 O  OE2   . GLU A 1 236 ? 17.549  -3.327  -4.795  1.00 73.94  ? 236  GLU A OE2   1 
ATOM   1949 N  N     . SER A 1 237 ? 20.330  -7.543  -1.770  1.00 44.47  ? 237  SER A N     1 
ATOM   1950 C  CA    . SER A 1 237 ? 21.693  -7.804  -2.226  1.00 44.98  ? 237  SER A CA    1 
ATOM   1951 C  C     . SER A 1 237 ? 21.870  -9.257  -2.664  1.00 43.82  ? 237  SER A C     1 
ATOM   1952 O  O     . SER A 1 237 ? 22.584  -9.548  -3.625  1.00 43.75  ? 237  SER A O     1 
ATOM   1953 C  CB    . SER A 1 237 ? 22.706  -7.449  -1.132  1.00 43.62  ? 237  SER A CB    1 
ATOM   1954 N  N     . THR A 1 238 ? 21.205  -10.163 -1.958  1.00 39.70  ? 238  THR A N     1 
ATOM   1955 C  CA    . THR A 1 238 ? 21.267  -11.581 -2.275  1.00 35.85  ? 238  THR A CA    1 
ATOM   1956 C  C     . THR A 1 238 ? 20.428  -11.893 -3.513  1.00 39.96  ? 238  THR A C     1 
ATOM   1957 O  O     . THR A 1 238 ? 20.827  -12.682 -4.370  1.00 32.74  ? 238  THR A O     1 
ATOM   1958 C  CB    . THR A 1 238 ? 20.797  -12.433 -1.076  1.00 37.53  ? 238  THR A CB    1 
ATOM   1959 O  OG1   . THR A 1 238 ? 21.772  -12.357 -0.028  1.00 40.74  ? 238  THR A OG1   1 
ATOM   1960 C  CG2   . THR A 1 238 ? 20.624  -13.884 -1.479  1.00 35.13  ? 238  THR A CG2   1 
ATOM   1961 N  N     . ALA A 1 239 ? 19.269  -11.250 -3.613  1.00 39.15  ? 239  ALA A N     1 
ATOM   1962 C  CA    . ALA A 1 239 ? 18.381  -11.451 -4.753  1.00 39.40  ? 239  ALA A CA    1 
ATOM   1963 C  C     . ALA A 1 239 ? 19.040  -10.995 -6.050  1.00 38.85  ? 239  ALA A C     1 
ATOM   1964 O  O     . ALA A 1 239 ? 18.752  -11.524 -7.121  1.00 34.70  ? 239  ALA A O     1 
ATOM   1965 C  CB    . ALA A 1 239 ? 17.065  -10.720 -4.538  1.00 42.11  ? 239  ALA A CB    1 
ATOM   1966 N  N     . LYS A 1 240 ? 19.940  -10.021 -5.946  1.00 36.86  ? 240  LYS A N     1 
ATOM   1967 C  CA    . LYS A 1 240 ? 20.641  -9.503  -7.118  1.00 38.80  ? 240  LYS A CA    1 
ATOM   1968 C  C     . LYS A 1 240 ? 21.670  -10.477 -7.683  1.00 37.99  ? 240  LYS A C     1 
ATOM   1969 O  O     . LYS A 1 240 ? 22.243  -10.228 -8.745  1.00 38.54  ? 240  LYS A O     1 
ATOM   1970 C  CB    . LYS A 1 240 ? 21.322  -8.171  -6.810  1.00 42.77  ? 240  LYS A CB    1 
ATOM   1971 C  CG    . LYS A 1 240 ? 20.364  -7.012  -6.639  1.00 48.24  ? 240  LYS A CG    1 
ATOM   1972 C  CD    . LYS A 1 240 ? 21.121  -5.704  -6.507  1.00 54.60  ? 240  LYS A CD    1 
ATOM   1973 C  CE    . LYS A 1 240 ? 20.191  -4.563  -6.132  1.00 62.17  ? 240  LYS A CE    1 
ATOM   1974 N  NZ    . LYS A 1 240 ? 19.081  -4.380  -7.113  1.00 62.61  ? 240  LYS A NZ    1 
ATOM   1975 N  N     . ARG A 1 241 ? 21.909  -11.575 -6.972  1.00 35.29  ? 241  ARG A N     1 
ATOM   1976 C  CA    . ARG A 1 241 ? 22.791  -12.629 -7.465  1.00 35.35  ? 241  ARG A CA    1 
ATOM   1977 C  C     . ARG A 1 241 ? 22.204  -13.306 -8.701  1.00 33.66  ? 241  ARG A C     1 
ATOM   1978 O  O     . ARG A 1 241 ? 22.917  -13.988 -9.442  1.00 34.83  ? 241  ARG A O     1 
ATOM   1979 C  CB    . ARG A 1 241 ? 23.091  -13.659 -6.366  1.00 34.38  ? 241  ARG A CB    1 
ATOM   1980 C  CG    . ARG A 1 241 ? 24.009  -13.136 -5.262  1.00 38.70  ? 241  ARG A CG    1 
ATOM   1981 C  CD    . ARG A 1 241 ? 24.213  -14.165 -4.139  1.00 40.92  ? 241  ARG A CD    1 
ATOM   1982 N  NE    . ARG A 1 241 ? 24.800  -15.404 -4.640  1.00 41.63  ? 241  ARG A NE    1 
ATOM   1983 C  CZ    . ARG A 1 241 ? 24.830  -16.554 -3.970  1.00 41.44  ? 241  ARG A CZ    1 
ATOM   1984 N  NH1   . ARG A 1 241 ? 24.309  -16.634 -2.751  1.00 38.02  ? 241  ARG A NH1   1 
ATOM   1985 N  NH2   . ARG A 1 241 ? 25.377  -17.628 -4.528  1.00 40.34  ? 241  ARG A NH2   1 
ATOM   1986 N  N     . LEU A 1 242 ? 20.904  -13.118 -8.922  1.00 31.38  ? 242  LEU A N     1 
ATOM   1987 C  CA    . LEU A 1 242 ? 20.252  -13.626 -10.131 1.00 32.08  ? 242  LEU A CA    1 
ATOM   1988 C  C     . LEU A 1 242 ? 20.757  -12.925 -11.395 1.00 32.26  ? 242  LEU A C     1 
ATOM   1989 O  O     . LEU A 1 242 ? 20.586  -13.429 -12.503 1.00 31.91  ? 242  LEU A O     1 
ATOM   1990 C  CB    . LEU A 1 242 ? 18.730  -13.489 -10.031 1.00 34.48  ? 242  LEU A CB    1 
ATOM   1991 C  CG    . LEU A 1 242 ? 18.047  -14.414 -9.016  1.00 39.18  ? 242  LEU A CG    1 
ATOM   1992 C  CD1   . LEU A 1 242 ? 16.552  -14.133 -8.944  1.00 39.56  ? 242  LEU A CD1   1 
ATOM   1993 C  CD2   . LEU A 1 242 ? 18.309  -15.870 -9.373  1.00 39.29  ? 242  LEU A CD2   1 
ATOM   1994 N  N     . SER A 1 243 ? 21.373  -11.761 -11.222 1.00 34.32  ? 243  SER A N     1 
ATOM   1995 C  CA    . SER A 1 243 ? 22.008  -11.054 -12.329 1.00 31.58  ? 243  SER A CA    1 
ATOM   1996 C  C     . SER A 1 243 ? 23.518  -11.253 -12.264 1.00 32.77  ? 243  SER A C     1 
ATOM   1997 O  O     . SER A 1 243 ? 24.123  -11.068 -11.209 1.00 34.13  ? 243  SER A O     1 
ATOM   1998 C  CB    . SER A 1 243 ? 21.681  -9.561  -12.263 1.00 34.42  ? 243  SER A CB    1 
ATOM   1999 O  OG    . SER A 1 243 ? 22.467  -8.816  -13.185 1.00 34.79  ? 243  SER A OG    1 
ATOM   2000 N  N     . PRO A 1 244 ? 24.135  -11.648 -13.390 1.00 33.64  ? 244  PRO A N     1 
ATOM   2001 C  CA    . PRO A 1 244 ? 25.595  -11.812 -13.444 1.00 35.62  ? 244  PRO A CA    1 
ATOM   2002 C  C     . PRO A 1 244 ? 26.367  -10.505 -13.234 1.00 35.56  ? 244  PRO A C     1 
ATOM   2003 O  O     . PRO A 1 244 ? 27.581  -10.545 -13.030 1.00 37.09  ? 244  PRO A O     1 
ATOM   2004 C  CB    . PRO A 1 244 ? 25.841  -12.353 -14.860 1.00 36.31  ? 244  PRO A CB    1 
ATOM   2005 C  CG    . PRO A 1 244 ? 24.596  -12.044 -15.627 1.00 36.51  ? 244  PRO A CG    1 
ATOM   2006 C  CD    . PRO A 1 244 ? 23.484  -12.105 -14.629 1.00 33.57  ? 244  PRO A CD    1 
ATOM   2007 N  N     . HIS A 1 245 ? 25.674  -9.370  -13.295 1.00 35.75  ? 245  HIS A N     1 
ATOM   2008 C  CA    . HIS A 1 245 ? 26.299  -8.079  -13.030 1.00 39.88  ? 245  HIS A CA    1 
ATOM   2009 C  C     . HIS A 1 245 ? 25.704  -7.451  -11.773 1.00 43.85  ? 245  HIS A C     1 
ATOM   2010 O  O     . HIS A 1 245 ? 25.927  -6.274  -11.496 1.00 46.30  ? 245  HIS A O     1 
ATOM   2011 C  CB    . HIS A 1 245 ? 26.140  -7.135  -14.225 1.00 37.90  ? 245  HIS A CB    1 
ATOM   2012 C  CG    . HIS A 1 245 ? 26.426  -7.778  -15.546 1.00 35.33  ? 245  HIS A CG    1 
ATOM   2013 N  ND1   . HIS A 1 245 ? 27.623  -8.402  -15.828 1.00 35.81  ? 245  HIS A ND1   1 
ATOM   2014 C  CD2   . HIS A 1 245 ? 25.670  -7.898  -16.663 1.00 31.41  ? 245  HIS A CD2   1 
ATOM   2015 C  CE1   . HIS A 1 245 ? 27.590  -8.879  -17.058 1.00 35.30  ? 245  HIS A CE1   1 
ATOM   2016 N  NE2   . HIS A 1 245 ? 26.415  -8.587  -17.588 1.00 33.76  ? 245  HIS A NE2   1 
ATOM   2017 N  N     . ARG A 1 246 ? 24.944  -8.248  -11.024 1.00 43.76  ? 246  ARG A N     1 
ATOM   2018 C  CA    . ARG A 1 246 ? 24.322  -7.809  -9.773  1.00 44.98  ? 246  ARG A CA    1 
ATOM   2019 C  C     . ARG A 1 246 ? 23.436  -6.577  -9.958  1.00 42.49  ? 246  ARG A C     1 
ATOM   2020 O  O     . ARG A 1 246 ? 23.269  -5.774  -9.040  1.00 44.33  ? 246  ARG A O     1 
ATOM   2021 C  CB    . ARG A 1 246 ? 25.382  -7.550  -8.692  1.00 46.58  ? 246  ARG A CB    1 
ATOM   2022 C  CG    . ARG A 1 246 ? 26.307  -8.728  -8.428  1.00 50.03  ? 246  ARG A CG    1 
ATOM   2023 C  CD    . ARG A 1 246 ? 25.535  -9.945  -7.936  1.00 56.09  ? 246  ARG A CD    1 
ATOM   2024 N  NE    . ARG A 1 246 ? 26.408  -11.082 -7.651  1.00 57.39  ? 246  ARG A NE    1 
ATOM   2025 C  CZ    . ARG A 1 246 ? 26.572  -12.124 -8.464  1.00 56.44  ? 246  ARG A CZ    1 
ATOM   2026 N  NH1   . ARG A 1 246 ? 25.917  -12.182 -9.618  1.00 46.38  ? 246  ARG A NH1   1 
ATOM   2027 N  NH2   . ARG A 1 246 ? 27.388  -13.112 -8.120  1.00 59.97  ? 246  ARG A NH2   1 
ATOM   2028 N  N     . LYS A 1 247 ? 22.875  -6.429  -11.152 1.00 41.86  ? 247  LYS A N     1 
ATOM   2029 C  CA    . LYS A 1 247 ? 21.959  -5.328  -11.414 1.00 44.76  ? 247  LYS A CA    1 
ATOM   2030 C  C     . LYS A 1 247 ? 20.611  -5.822  -11.917 1.00 48.56  ? 247  LYS A C     1 
ATOM   2031 O  O     . LYS A 1 247 ? 20.517  -6.545  -12.910 1.00 48.25  ? 247  LYS A O     1 
ATOM   2032 C  CB    . LYS A 1 247 ? 22.554  -4.320  -12.397 1.00 45.44  ? 247  LYS A CB    1 
ATOM   2033 C  CG    . LYS A 1 247 ? 21.631  -3.142  -12.674 1.00 51.70  ? 247  LYS A CG    1 
ATOM   2034 C  CD    . LYS A 1 247 ? 22.411  -1.889  -13.032 1.00 58.45  ? 247  LYS A CD    1 
ATOM   2035 C  CE    . LYS A 1 247 ? 21.485  -0.697  -13.235 1.00 62.62  ? 247  LYS A CE    1 
ATOM   2036 N  NZ    . LYS A 1 247 ? 20.667  -0.406  -12.023 1.00 66.07  ? 247  LYS A NZ    1 
ATOM   2037 N  N     . THR A 1 248 ? 19.566  -5.436  -11.204 1.00 50.37  ? 248  THR A N     1 
ATOM   2038 C  CA    . THR A 1 248 ? 18.218  -5.746  -11.627 1.00 49.80  ? 248  THR A CA    1 
ATOM   2039 C  C     . THR A 1 248 ? 17.455  -4.443  -11.732 1.00 51.32  ? 248  THR A C     1 
ATOM   2040 O  O     . THR A 1 248 ? 17.891  -3.414  -11.214 1.00 54.43  ? 248  THR A O     1 
ATOM   2041 C  CB    . THR A 1 248 ? 17.506  -6.659  -10.627 1.00 47.01  ? 248  THR A CB    1 
ATOM   2042 O  OG1   . THR A 1 248 ? 17.359  -5.974  -9.378  1.00 51.18  ? 248  THR A OG1   1 
ATOM   2043 C  CG2   . THR A 1 248 ? 18.302  -7.935  -10.409 1.00 45.89  ? 248  THR A CG2   1 
ATOM   2044 N  N     . ARG A 1 249 ? 16.319  -4.488  -12.414 1.00 46.61  ? 249  ARG A N     1 
ATOM   2045 C  CA    . ARG A 1 249 ? 15.429  -3.342  -12.479 1.00 48.93  ? 249  ARG A CA    1 
ATOM   2046 C  C     . ARG A 1 249 ? 13.993  -3.824  -12.327 1.00 46.64  ? 249  ARG A C     1 
ATOM   2047 O  O     . ARG A 1 249 ? 13.532  -4.680  -13.084 1.00 40.83  ? 249  ARG A O     1 
ATOM   2048 C  CB    . ARG A 1 249 ? 15.610  -2.598  -13.800 1.00 52.81  ? 249  ARG A CB    1 
ATOM   2049 C  CG    . ARG A 1 249 ? 14.807  -1.309  -13.905 1.00 60.28  ? 249  ARG A CG    1 
ATOM   2050 C  CD    . ARG A 1 249 ? 14.910  -0.732  -15.304 1.00 65.07  ? 249  ARG A CD    1 
ATOM   2051 N  NE    . ARG A 1 249 ? 14.641  -1.752  -16.316 1.00 67.83  ? 249  ARG A NE    1 
ATOM   2052 C  CZ    . ARG A 1 249 ? 14.605  -1.520  -17.624 1.00 70.66  ? 249  ARG A CZ    1 
ATOM   2053 N  NH1   . ARG A 1 249 ? 14.816  -0.294  -18.086 1.00 75.52  ? 249  ARG A NH1   1 
ATOM   2054 N  NH2   . ARG A 1 249 ? 14.354  -2.511  -18.471 1.00 66.53  ? 249  ARG A NH2   1 
ATOM   2055 N  N     . VAL A 1 250 ? 13.297  -3.292  -11.328 1.00 49.42  ? 250  VAL A N     1 
ATOM   2056 C  CA    . VAL A 1 250 ? 11.908  -3.655  -11.102 1.00 50.20  ? 250  VAL A CA    1 
ATOM   2057 C  C     . VAL A 1 250 ? 10.994  -2.721  -11.885 1.00 52.34  ? 250  VAL A C     1 
ATOM   2058 O  O     . VAL A 1 250 ? 10.924  -1.525  -11.600 1.00 53.71  ? 250  VAL A O     1 
ATOM   2059 C  CB    . VAL A 1 250 ? 11.540  -3.594  -9.612  1.00 53.46  ? 250  VAL A CB    1 
ATOM   2060 C  CG1   . VAL A 1 250 ? 10.099  -4.042  -9.411  1.00 55.15  ? 250  VAL A CG1   1 
ATOM   2061 C  CG2   . VAL A 1 250 ? 12.493  -4.456  -8.793  1.00 51.16  ? 250  VAL A CG2   1 
ATOM   2062 N  N     . LYS A 1 251 ? 10.302  -3.274  -12.876 1.00 51.95  ? 251  LYS A N     1 
ATOM   2063 N  N     . ARG A 1 260 ? 1.863   -6.708  -9.811  1.00 92.56  ? 260  ARG A N     1 
ATOM   2064 C  CA    . ARG A 1 260 ? 2.070   -6.757  -11.254 1.00 90.79  ? 260  ARG A CA    1 
ATOM   2065 C  C     . ARG A 1 260 ? 3.364   -6.050  -11.643 1.00 88.56  ? 260  ARG A C     1 
ATOM   2066 O  O     . ARG A 1 260 ? 3.360   -4.864  -11.977 1.00 91.26  ? 260  ARG A O     1 
ATOM   2067 C  CB    . ARG A 1 260 ? 0.885   -6.126  -11.988 1.00 91.87  ? 260  ARG A CB    1 
ATOM   2068 N  N     . GLU A 1 261 ? 4.471   -6.783  -11.596 1.00 82.39  ? 261  GLU A N     1 
ATOM   2069 C  CA    . GLU A 1 261 ? 5.770   -6.223  -11.947 1.00 76.93  ? 261  GLU A CA    1 
ATOM   2070 C  C     . GLU A 1 261 ? 6.609   -7.209  -12.753 1.00 68.66  ? 261  GLU A C     1 
ATOM   2071 O  O     . GLU A 1 261 ? 6.491   -8.426  -12.589 1.00 62.68  ? 261  GLU A O     1 
ATOM   2072 C  CB    . GLU A 1 261 ? 6.529   -5.798  -10.688 1.00 78.58  ? 261  GLU A CB    1 
ATOM   2073 N  N     . ILE A 1 262 ? 7.452   -6.672  -13.629 1.00 63.94  ? 262  ILE A N     1 
ATOM   2074 C  CA    . ILE A 1 262 ? 8.392   -7.487  -14.392 1.00 57.97  ? 262  ILE A CA    1 
ATOM   2075 C  C     . ILE A 1 262 ? 9.830   -7.120  -14.031 1.00 49.04  ? 262  ILE A C     1 
ATOM   2076 O  O     . ILE A 1 262 ? 10.199  -5.945  -14.017 1.00 47.51  ? 262  ILE A O     1 
ATOM   2077 C  CB    . ILE A 1 262 ? 8.170   -7.348  -15.912 1.00 60.29  ? 262  ILE A CB    1 
ATOM   2078 C  CG1   . ILE A 1 262 ? 6.883   -8.067  -16.324 1.00 62.36  ? 262  ILE A CG1   1 
ATOM   2079 C  CG2   . ILE A 1 262 ? 9.353   -7.914  -16.682 1.00 58.24  ? 262  ILE A CG2   1 
ATOM   2080 C  CD1   . ILE A 1 262 ? 6.639   -8.071  -17.817 1.00 65.74  ? 262  ILE A CD1   1 
ATOM   2081 N  N     . ILE A 1 263 ? 10.631  -8.133  -13.724 1.00 40.81  ? 263  ILE A N     1 
ATOM   2082 C  CA    . ILE A 1 263 ? 12.000  -7.919  -13.300 1.00 42.09  ? 263  ILE A CA    1 
ATOM   2083 C  C     . ILE A 1 263 ? 12.940  -8.028  -14.490 1.00 44.33  ? 263  ILE A C     1 
ATOM   2084 O  O     . ILE A 1 263 ? 12.877  -8.992  -15.255 1.00 48.99  ? 263  ILE A O     1 
ATOM   2085 C  CB    . ILE A 1 263 ? 12.433  -8.958  -12.241 1.00 42.41  ? 263  ILE A CB    1 
ATOM   2086 C  CG1   . ILE A 1 263 ? 11.454  -8.976  -11.064 1.00 42.72  ? 263  ILE A CG1   1 
ATOM   2087 C  CG2   . ILE A 1 263 ? 13.856  -8.677  -11.769 1.00 43.63  ? 263  ILE A CG2   1 
ATOM   2088 C  CD1   . ILE A 1 263 ? 11.340  -7.659  -10.341 1.00 43.52  ? 263  ILE A CD1   1 
ATOM   2089 N  N     . THR A 1 264 ? 13.804  -7.033  -14.652 1.00 37.41  ? 264  THR A N     1 
ATOM   2090 C  CA    . THR A 1 264 ? 14.843  -7.106  -15.667 1.00 37.48  ? 264  THR A CA    1 
ATOM   2091 C  C     . THR A 1 264 ? 16.146  -7.575  -15.027 1.00 36.50  ? 264  THR A C     1 
ATOM   2092 O  O     . THR A 1 264 ? 16.688  -6.918  -14.136 1.00 33.45  ? 264  THR A O     1 
ATOM   2093 C  CB    . THR A 1 264 ? 15.055  -5.749  -16.366 1.00 38.75  ? 264  THR A CB    1 
ATOM   2094 O  OG1   . THR A 1 264 ? 13.828  -5.328  -16.971 1.00 37.70  ? 264  THR A OG1   1 
ATOM   2095 C  CG2   . THR A 1 264 ? 16.128  -5.859  -17.443 1.00 39.42  ? 264  THR A CG2   1 
ATOM   2096 N  N     . LEU A 1 265 ? 16.633  -8.728  -15.468 1.00 33.13  ? 265  LEU A N     1 
ATOM   2097 C  CA    . LEU A 1 265 ? 17.900  -9.252  -14.981 1.00 35.23  ? 265  LEU A CA    1 
ATOM   2098 C  C     . LEU A 1 265 ? 18.997  -8.898  -15.978 1.00 35.47  ? 265  LEU A C     1 
ATOM   2099 O  O     . LEU A 1 265 ? 19.097  -9.513  -17.043 1.00 36.64  ? 265  LEU A O     1 
ATOM   2100 C  CB    . LEU A 1 265 ? 17.822  -10.771 -14.784 1.00 31.85  ? 265  LEU A CB    1 
ATOM   2101 C  CG    . LEU A 1 265 ? 16.744  -11.305 -13.833 1.00 32.44  ? 265  LEU A CG    1 
ATOM   2102 C  CD1   . LEU A 1 265 ? 16.755  -12.825 -13.828 1.00 34.03  ? 265  LEU A CD1   1 
ATOM   2103 C  CD2   . LEU A 1 265 ? 16.939  -10.769 -12.424 1.00 34.08  ? 265  LEU A CD2   1 
ATOM   2104 N  N     . PHE A 1 266 ? 19.805  -7.897  -15.636 1.00 29.95  ? 266  PHE A N     1 
ATOM   2105 C  CA    . PHE A 1 266 ? 20.884  -7.454  -16.510 1.00 31.01  ? 266  PHE A CA    1 
ATOM   2106 C  C     . PHE A 1 266 ? 21.865  -8.585  -16.758 1.00 30.13  ? 266  PHE A C     1 
ATOM   2107 O  O     . PHE A 1 266 ? 22.251  -9.288  -15.829 1.00 33.10  ? 266  PHE A O     1 
ATOM   2108 C  CB    . PHE A 1 266 ? 21.611  -6.242  -15.913 1.00 34.37  ? 266  PHE A CB    1 
ATOM   2109 C  CG    . PHE A 1 266 ? 20.899  -4.935  -16.132 1.00 42.52  ? 266  PHE A CG    1 
ATOM   2110 C  CD1   . PHE A 1 266 ? 21.458  -3.955  -16.936 1.00 47.52  ? 266  PHE A CD1   1 
ATOM   2111 C  CD2   . PHE A 1 266 ? 19.668  -4.690  -15.542 1.00 45.30  ? 266  PHE A CD2   1 
ATOM   2112 C  CE1   . PHE A 1 266 ? 20.806  -2.752  -17.142 1.00 50.22  ? 266  PHE A CE1   1 
ATOM   2113 C  CE2   . PHE A 1 266 ? 19.010  -3.491  -15.745 1.00 48.95  ? 266  PHE A CE2   1 
ATOM   2114 C  CZ    . PHE A 1 266 ? 19.581  -2.519  -16.547 1.00 50.62  ? 266  PHE A CZ    1 
ATOM   2115 N  N     . GLY A 1 267 ? 22.250  -8.765  -18.017 1.00 27.30  ? 267  GLY A N     1 
ATOM   2116 C  CA    . GLY A 1 267 ? 23.209  -9.790  -18.383 1.00 31.55  ? 267  GLY A CA    1 
ATOM   2117 C  C     . GLY A 1 267 ? 22.556  -11.119 -18.701 1.00 31.57  ? 267  GLY A C     1 
ATOM   2118 O  O     . GLY A 1 267 ? 23.237  -12.109 -18.959 1.00 31.71  ? 267  GLY A O     1 
ATOM   2119 N  N     . ILE A 1 268 ? 21.228  -11.142 -18.671 1.00 30.82  ? 268  ILE A N     1 
ATOM   2120 C  CA    . ILE A 1 268 ? 20.469  -12.329 -19.052 1.00 30.68  ? 268  ILE A CA    1 
ATOM   2121 C  C     . ILE A 1 268 ? 19.417  -11.949 -20.095 1.00 30.90  ? 268  ILE A C     1 
ATOM   2122 O  O     . ILE A 1 268 ? 18.803  -10.888 -20.003 1.00 31.48  ? 268  ILE A O     1 
ATOM   2123 C  CB    . ILE A 1 268 ? 19.801  -12.984 -17.822 1.00 31.76  ? 268  ILE A CB    1 
ATOM   2124 C  CG1   . ILE A 1 268 ? 20.871  -13.510 -16.863 1.00 35.58  ? 268  ILE A CG1   1 
ATOM   2125 C  CG2   . ILE A 1 268 ? 18.868  -14.116 -18.241 1.00 31.30  ? 268  ILE A CG2   1 
ATOM   2126 C  CD1   . ILE A 1 268 ? 20.324  -14.275 -15.694 1.00 36.88  ? 268  ILE A CD1   1 
ATOM   2127 N  N     . SER A 1 269 ? 19.238  -12.801 -21.101 1.00 29.11  ? 269  SER A N     1 
ATOM   2128 C  CA    . SER A 1 269 ? 18.228  -12.580 -22.127 1.00 29.21  ? 269  SER A CA    1 
ATOM   2129 C  C     . SER A 1 269 ? 17.019  -13.488 -21.905 1.00 29.66  ? 269  SER A C     1 
ATOM   2130 O  O     . SER A 1 269 ? 17.064  -14.687 -22.195 1.00 31.56  ? 269  SER A O     1 
ATOM   2131 C  CB    . SER A 1 269 ? 18.819  -12.814 -23.520 1.00 29.53  ? 269  SER A CB    1 
ATOM   2132 O  OG    . SER A 1 269 ? 19.642  -11.730 -23.923 1.00 32.30  ? 269  SER A OG    1 
ATOM   2133 N  N     . VAL A 1 270 ? 15.938  -12.911 -21.393 1.00 27.32  ? 270  VAL A N     1 
ATOM   2134 C  CA    . VAL A 1 270 ? 14.733  -13.676 -21.099 1.00 26.92  ? 270  VAL A CA    1 
ATOM   2135 C  C     . VAL A 1 270 ? 13.829  -13.790 -22.325 1.00 28.20  ? 270  VAL A C     1 
ATOM   2136 O  O     . VAL A 1 270 ? 13.356  -12.785 -22.852 1.00 30.39  ? 270  VAL A O     1 
ATOM   2137 C  CB    . VAL A 1 270 ? 13.941  -13.045 -19.928 1.00 30.14  ? 270  VAL A CB    1 
ATOM   2138 C  CG1   . VAL A 1 270 ? 12.596  -13.732 -19.759 1.00 29.46  ? 270  VAL A CG1   1 
ATOM   2139 C  CG2   . VAL A 1 270 ? 14.749  -13.124 -18.640 1.00 28.97  ? 270  VAL A CG2   1 
ATOM   2140 N  N     . LEU A 1 271 ? 13.609  -15.019 -22.785 1.00 26.18  ? 271  LEU A N     1 
ATOM   2141 C  CA    . LEU A 1 271 ? 12.680  -15.282 -23.880 1.00 25.98  ? 271  LEU A CA    1 
ATOM   2142 C  C     . LEU A 1 271 ? 11.561  -16.173 -23.376 1.00 25.92  ? 271  LEU A C     1 
ATOM   2143 O  O     . LEU A 1 271 ? 11.621  -17.387 -23.546 1.00 27.88  ? 271  LEU A O     1 
ATOM   2144 C  CB    . LEU A 1 271 ? 13.376  -16.002 -25.039 1.00 29.91  ? 271  LEU A CB    1 
ATOM   2145 C  CG    . LEU A 1 271 ? 14.536  -15.331 -25.779 1.00 34.05  ? 271  LEU A CG    1 
ATOM   2146 C  CD1   . LEU A 1 271 ? 15.082  -16.265 -26.852 1.00 33.76  ? 271  LEU A CD1   1 
ATOM   2147 C  CD2   . LEU A 1 271 ? 14.115  -14.006 -26.385 1.00 29.80  ? 271  LEU A CD2   1 
ATOM   2148 N  N     . ASP A 1 272 ? 10.548  -15.577 -22.755 1.00 27.33  ? 272  ASP A N     1 
ATOM   2149 C  CA    . ASP A 1 272 ? 9.420   -16.341 -22.239 1.00 28.25  ? 272  ASP A CA    1 
ATOM   2150 C  C     . ASP A 1 272 ? 8.774   -17.098 -23.394 1.00 26.77  ? 272  ASP A C     1 
ATOM   2151 O  O     . ASP A 1 272 ? 8.438   -16.502 -24.416 1.00 24.17  ? 272  ASP A O     1 
ATOM   2152 C  CB    . ASP A 1 272 ? 8.411   -15.404 -21.579 1.00 30.65  ? 272  ASP A CB    1 
ATOM   2153 C  CG    . ASP A 1 272 ? 7.412   -16.137 -20.707 1.00 33.99  ? 272  ASP A CG    1 
ATOM   2154 O  OD1   . ASP A 1 272 ? 7.134   -17.327 -20.973 1.00 35.26  ? 272  ASP A OD1   1 
ATOM   2155 O  OD2   . ASP A 1 272 ? 6.907   -15.518 -19.748 1.00 35.46  ? 272  ASP A OD2   1 
ATOM   2156 N  N     . TYR A 1 273 ? 8.615   -18.410 -23.249 1.00 24.66  ? 273  TYR A N     1 
ATOM   2157 C  CA    . TYR A 1 273 ? 8.132   -19.203 -24.376 1.00 22.53  ? 273  TYR A CA    1 
ATOM   2158 C  C     . TYR A 1 273 ? 6.695   -18.884 -24.792 1.00 21.85  ? 273  TYR A C     1 
ATOM   2159 O  O     . TYR A 1 273 ? 6.346   -19.021 -25.960 1.00 22.57  ? 273  TYR A O     1 
ATOM   2160 C  CB    . TYR A 1 273 ? 8.332   -20.713 -24.177 1.00 21.76  ? 273  TYR A CB    1 
ATOM   2161 C  CG    . TYR A 1 273 ? 8.685   -21.359 -25.489 1.00 21.79  ? 273  TYR A CG    1 
ATOM   2162 C  CD1   . TYR A 1 273 ? 10.011  -21.480 -25.887 1.00 24.03  ? 273  TYR A CD1   1 
ATOM   2163 C  CD2   . TYR A 1 273 ? 7.696   -21.781 -26.368 1.00 23.02  ? 273  TYR A CD2   1 
ATOM   2164 C  CE1   . TYR A 1 273 ? 10.340  -22.037 -27.106 1.00 23.40  ? 273  TYR A CE1   1 
ATOM   2165 C  CE2   . TYR A 1 273 ? 8.018   -22.336 -27.588 1.00 23.15  ? 273  TYR A CE2   1 
ATOM   2166 C  CZ    . TYR A 1 273 ? 9.340   -22.461 -27.951 1.00 25.51  ? 273  TYR A CZ    1 
ATOM   2167 O  OH    . TYR A 1 273 ? 9.669   -23.005 -29.170 1.00 28.16  ? 273  TYR A OH    1 
ATOM   2168 N  N     . ILE A 1 274 ? 5.872   -18.438 -23.851 1.00 21.22  ? 274  ILE A N     1 
ATOM   2169 C  CA    . ILE A 1 274 ? 4.510   -18.039 -24.195 1.00 22.98  ? 274  ILE A CA    1 
ATOM   2170 C  C     . ILE A 1 274 ? 4.508   -16.821 -25.125 1.00 24.17  ? 274  ILE A C     1 
ATOM   2171 O  O     . ILE A 1 274 ? 3.671   -16.714 -26.025 1.00 24.42  ? 274  ILE A O     1 
ATOM   2172 C  CB    . ILE A 1 274 ? 3.631   -17.800 -22.939 1.00 24.94  ? 274  ILE A CB    1 
ATOM   2173 C  CG1   . ILE A 1 274 ? 2.179   -17.537 -23.347 1.00 26.95  ? 274  ILE A CG1   1 
ATOM   2174 C  CG2   . ILE A 1 274 ? 4.183   -16.659 -22.088 1.00 29.14  ? 274  ILE A CG2   1 
ATOM   2175 C  CD1   . ILE A 1 274 ? 1.208   -17.528 -22.181 1.00 29.84  ? 274  ILE A CD1   1 
ATOM   2176 N  N     . ASP A 1 275 ? 5.473   -15.925 -24.936 1.00 24.52  ? 275  ASP A N     1 
ATOM   2177 C  CA    . ASP A 1 275 ? 5.595   -14.755 -25.801 1.00 23.25  ? 275  ASP A CA    1 
ATOM   2178 C  C     . ASP A 1 275 ? 6.181   -15.132 -27.162 1.00 22.42  ? 275  ASP A C     1 
ATOM   2179 O  O     . ASP A 1 275 ? 5.775   -14.585 -28.187 1.00 22.64  ? 275  ASP A O     1 
ATOM   2180 C  CB    . ASP A 1 275 ? 6.438   -13.660 -25.135 1.00 24.04  ? 275  ASP A CB    1 
ATOM   2181 C  CG    . ASP A 1 275 ? 5.784   -13.106 -23.883 1.00 30.40  ? 275  ASP A CG    1 
ATOM   2182 O  OD1   . ASP A 1 275 ? 4.536   -13.087 -23.817 1.00 29.06  ? 275  ASP A OD1   1 
ATOM   2183 O  OD2   . ASP A 1 275 ? 6.519   -12.697 -22.958 1.00 41.63  ? 275  ASP A OD2   1 
ATOM   2184 N  N     . LEU A 1 276 ? 7.137   -16.058 -27.171 1.00 20.15  ? 276  LEU A N     1 
ATOM   2185 C  CA    . LEU A 1 276 ? 7.657   -16.569 -28.437 1.00 24.78  ? 276  LEU A CA    1 
ATOM   2186 C  C     . LEU A 1 276 ? 6.528   -17.230 -29.220 1.00 22.65  ? 276  LEU A C     1 
ATOM   2187 O  O     . LEU A 1 276 ? 6.362   -16.997 -30.417 1.00 23.12  ? 276  LEU A O     1 
ATOM   2188 C  CB    . LEU A 1 276 ? 8.780   -17.587 -28.214 1.00 20.52  ? 276  LEU A CB    1 
ATOM   2189 C  CG    . LEU A 1 276 ? 10.134  -17.088 -27.722 1.00 23.93  ? 276  LEU A CG    1 
ATOM   2190 C  CD1   . LEU A 1 276 ? 11.073  -18.267 -27.479 1.00 21.48  ? 276  LEU A CD1   1 
ATOM   2191 C  CD2   . LEU A 1 276 ? 10.738  -16.112 -28.719 1.00 24.71  ? 276  LEU A CD2   1 
ATOM   2192 N  N     . TYR A 1 277 ? 5.747   -18.048 -28.526 1.00 22.84  ? 277  TYR A N     1 
ATOM   2193 C  CA    . TYR A 1 277 ? 4.667   -18.791 -29.159 1.00 21.11  ? 277  TYR A CA    1 
ATOM   2194 C  C     . TYR A 1 277 ? 3.602   -17.841 -29.721 1.00 23.34  ? 277  TYR A C     1 
ATOM   2195 O  O     . TYR A 1 277 ? 3.144   -18.004 -30.850 1.00 23.70  ? 277  TYR A O     1 
ATOM   2196 C  CB    . TYR A 1 277 ? 4.061   -19.783 -28.161 1.00 20.14  ? 277  TYR A CB    1 
ATOM   2197 C  CG    . TYR A 1 277 ? 3.025   -20.721 -28.745 1.00 21.29  ? 277  TYR A CG    1 
ATOM   2198 C  CD1   . TYR A 1 277 ? 3.382   -21.985 -29.193 1.00 22.27  ? 277  TYR A CD1   1 
ATOM   2199 C  CD2   . TYR A 1 277 ? 1.690   -20.346 -28.840 1.00 24.35  ? 277  TYR A CD2   1 
ATOM   2200 C  CE1   . TYR A 1 277 ? 2.441   -22.850 -29.725 1.00 25.03  ? 277  TYR A CE1   1 
ATOM   2201 C  CE2   . TYR A 1 277 ? 0.737   -21.207 -29.370 1.00 24.73  ? 277  TYR A CE2   1 
ATOM   2202 C  CZ    . TYR A 1 277 ? 1.120   -22.456 -29.811 1.00 24.92  ? 277  TYR A CZ    1 
ATOM   2203 O  OH    . TYR A 1 277 ? 0.182   -23.319 -30.334 1.00 25.01  ? 277  TYR A OH    1 
ATOM   2204 N  N     . LYS A 1 278 ? 3.225   -16.831 -28.946 1.00 22.61  ? 278  LYS A N     1 
ATOM   2205 C  CA    . LYS A 1 278 ? 2.205   -15.891 -29.402 1.00 24.90  ? 278  LYS A CA    1 
ATOM   2206 C  C     . LYS A 1 278 ? 2.670   -15.062 -30.596 1.00 26.31  ? 278  LYS A C     1 
ATOM   2207 O  O     . LYS A 1 278 ? 1.870   -14.704 -31.456 1.00 29.82  ? 278  LYS A O     1 
ATOM   2208 C  CB    . LYS A 1 278 ? 1.747   -14.973 -28.262 1.00 25.93  ? 278  LYS A CB    1 
ATOM   2209 C  CG    . LYS A 1 278 ? 0.866   -15.668 -27.241 1.00 29.94  ? 278  LYS A CG    1 
ATOM   2210 C  CD    . LYS A 1 278 ? 0.418   -14.718 -26.136 1.00 31.09  ? 278  LYS A CD    1 
ATOM   2211 C  CE    . LYS A 1 278 ? -0.481  -15.438 -25.143 1.00 34.07  ? 278  LYS A CE    1 
ATOM   2212 N  NZ    . LYS A 1 278 ? -0.868  -14.574 -23.991 1.00 37.02  ? 278  LYS A NZ    1 
ATOM   2213 N  N     . LYS A 1 279 ? 3.962   -14.760 -30.655 1.00 27.91  ? 279  LYS A N     1 
ATOM   2214 C  CA    . LYS A 1 279 ? 4.482   -13.959 -31.757 1.00 28.62  ? 279  LYS A CA    1 
ATOM   2215 C  C     . LYS A 1 279 ? 4.762   -14.773 -33.023 1.00 28.00  ? 279  LYS A C     1 
ATOM   2216 O  O     . LYS A 1 279 ? 4.536   -14.292 -34.134 1.00 29.15  ? 279  LYS A O     1 
ATOM   2217 C  CB    . LYS A 1 279 ? 5.744   -13.196 -31.344 1.00 28.16  ? 279  LYS A CB    1 
ATOM   2218 C  CG    . LYS A 1 279 ? 6.138   -12.108 -32.353 1.00 32.18  ? 279  LYS A CG    1 
ATOM   2219 C  CD    . LYS A 1 279 ? 7.431   -11.406 -31.978 1.00 37.52  ? 279  LYS A CD    1 
ATOM   2220 C  CE    . LYS A 1 279 ? 7.871   -10.427 -33.070 1.00 41.55  ? 279  LYS A CE    1 
ATOM   2221 N  NZ    . LYS A 1 279 ? 6.827   -9.395  -33.335 1.00 49.12  ? 279  LYS A NZ    1 
ATOM   2222 N  N     . PHE A 1 280 ? 5.238   -16.005 -32.857 1.00 23.32  ? 280  PHE A N     1 
ATOM   2223 C  CA    . PHE A 1 280 ? 5.795   -16.754 -33.985 1.00 22.86  ? 280  PHE A CA    1 
ATOM   2224 C  C     . PHE A 1 280 ? 5.006   -17.985 -34.455 1.00 25.35  ? 280  PHE A C     1 
ATOM   2225 O  O     . PHE A 1 280 ? 5.350   -18.578 -35.480 1.00 26.47  ? 280  PHE A O     1 
ATOM   2226 C  CB    . PHE A 1 280 ? 7.240   -17.165 -33.677 1.00 23.08  ? 280  PHE A CB    1 
ATOM   2227 C  CG    . PHE A 1 280 ? 8.166   -16.007 -33.417 1.00 26.72  ? 280  PHE A CG    1 
ATOM   2228 C  CD1   . PHE A 1 280 ? 8.119   -14.867 -34.205 1.00 29.74  ? 280  PHE A CD1   1 
ATOM   2229 C  CD2   . PHE A 1 280 ? 9.085   -16.060 -32.380 1.00 30.27  ? 280  PHE A CD2   1 
ATOM   2230 C  CE1   . PHE A 1 280 ? 8.972   -13.805 -33.970 1.00 33.29  ? 280  PHE A CE1   1 
ATOM   2231 C  CE2   . PHE A 1 280 ? 9.942   -14.999 -32.135 1.00 33.56  ? 280  PHE A CE2   1 
ATOM   2232 C  CZ    . PHE A 1 280 ? 9.886   -13.871 -32.931 1.00 37.69  ? 280  PHE A CZ    1 
ATOM   2233 N  N     . SER A 1 281 ? 3.958   -18.373 -33.728 1.00 22.39  ? 281  SER A N     1 
ATOM   2234 C  CA    . SER A 1 281 ? 3.266   -19.629 -34.037 1.00 23.05  ? 281  SER A CA    1 
ATOM   2235 C  C     . SER A 1 281 ? 2.160   -19.458 -35.064 1.00 25.83  ? 281  SER A C     1 
ATOM   2236 O  O     . SER A 1 281 ? 1.752   -20.428 -35.706 1.00 26.75  ? 281  SER A O     1 
ATOM   2237 C  CB    . SER A 1 281 ? 2.674   -20.261 -32.776 1.00 23.27  ? 281  SER A CB    1 
ATOM   2238 O  OG    . SER A 1 281 ? 1.550   -19.520 -32.334 1.00 25.88  ? 281  SER A OG    1 
ATOM   2239 N  N     . PHE A 1 282 ? 1.680   -18.225 -35.208 1.00 25.04  ? 282  PHE A N     1 
ATOM   2240 C  CA    . PHE A 1 282 ? 0.544   -17.919 -36.068 1.00 28.73  ? 282  PHE A CA    1 
ATOM   2241 C  C     . PHE A 1 282 ? -0.669  -18.785 -35.731 1.00 29.88  ? 282  PHE A C     1 
ATOM   2242 O  O     . PHE A 1 282 ? -1.273  -19.422 -36.594 1.00 28.83  ? 282  PHE A O     1 
ATOM   2243 C  CB    . PHE A 1 282 ? 0.937   -17.991 -37.548 1.00 31.50  ? 282  PHE A CB    1 
ATOM   2244 C  CG    . PHE A 1 282 ? 1.861   -16.887 -37.964 1.00 31.93  ? 282  PHE A CG    1 
ATOM   2245 C  CD1   . PHE A 1 282 ? 1.368   -15.750 -38.582 1.00 33.99  ? 282  PHE A CD1   1 
ATOM   2246 C  CD2   . PHE A 1 282 ? 3.218   -16.963 -37.690 1.00 28.83  ? 282  PHE A CD2   1 
ATOM   2247 C  CE1   . PHE A 1 282 ? 2.216   -14.720 -38.947 1.00 31.79  ? 282  PHE A CE1   1 
ATOM   2248 C  CE2   . PHE A 1 282 ? 4.072   -15.934 -38.050 1.00 30.23  ? 282  PHE A CE2   1 
ATOM   2249 C  CZ    . PHE A 1 282 ? 3.572   -14.814 -38.678 1.00 30.71  ? 282  PHE A CZ    1 
ATOM   2250 N  N     . THR A 1 283 ? -0.996  -18.803 -34.445 1.00 29.58  ? 283  THR A N     1 
ATOM   2251 C  CA    . THR A 1 283 ? -2.225  -19.401 -33.959 1.00 31.27  ? 283  THR A CA    1 
ATOM   2252 C  C     . THR A 1 283 ? -2.921  -18.360 -33.103 1.00 31.99  ? 283  THR A C     1 
ATOM   2253 O  O     . THR A 1 283 ? -2.321  -17.352 -32.725 1.00 34.25  ? 283  THR A O     1 
ATOM   2254 C  CB    . THR A 1 283 ? -1.937  -20.603 -33.065 1.00 34.51  ? 283  THR A CB    1 
ATOM   2255 O  OG1   . THR A 1 283 ? -1.192  -20.167 -31.919 1.00 34.45  ? 283  THR A OG1   1 
ATOM   2256 C  CG2   . THR A 1 283 ? -1.141  -21.661 -33.824 1.00 32.69  ? 283  THR A CG2   1 
ATOM   2257 N  N     . ASN A 1 284 ? -4.194  -18.589 -32.817 1.00 24.79  ? 284  ASN A N     1 
ATOM   2258 C  CA    . ASN A 1 284 ? -4.878  -17.846 -31.775 1.00 25.76  ? 284  ASN A CA    1 
ATOM   2259 C  C     . ASN A 1 284 ? -5.642  -18.873 -30.956 1.00 27.86  ? 284  ASN A C     1 
ATOM   2260 O  O     . ASN A 1 284 ? -6.649  -19.406 -31.409 1.00 30.24  ? 284  ASN A O     1 
ATOM   2261 C  CB    . ASN A 1 284 ? -5.808  -16.782 -32.368 1.00 25.67  ? 284  ASN A CB    1 
ATOM   2262 C  CG    . ASN A 1 284 ? -6.317  -15.799 -31.319 1.00 31.56  ? 284  ASN A CG    1 
ATOM   2263 O  OD1   . ASN A 1 284 ? -5.953  -15.879 -30.141 1.00 32.67  ? 284  ASN A OD1   1 
ATOM   2264 N  ND2   . ASN A 1 284 ? -7.156  -14.858 -31.747 1.00 28.41  ? 284  ASN A ND2   1 
ATOM   2265 N  N     . GLN A 1 285 ? -5.129  -19.176 -29.767 1.00 25.49  ? 285  GLN A N     1 
ATOM   2266 C  CA    . GLN A 1 285 ? -5.640  -20.289 -28.974 1.00 25.70  ? 285  GLN A CA    1 
ATOM   2267 C  C     . GLN A 1 285 ? -6.704  -19.863 -27.970 1.00 25.95  ? 285  GLN A C     1 
ATOM   2268 O  O     . GLN A 1 285 ? -6.649  -18.757 -27.431 1.00 26.24  ? 285  GLN A O     1 
ATOM   2269 C  CB    . GLN A 1 285 ? -4.483  -20.989 -28.247 1.00 24.88  ? 285  GLN A CB    1 
ATOM   2270 C  CG    . GLN A 1 285 ? -3.371  -21.473 -29.166 1.00 27.01  ? 285  GLN A CG    1 
ATOM   2271 C  CD    . GLN A 1 285 ? -3.727  -22.753 -29.905 1.00 29.85  ? 285  GLN A CD    1 
ATOM   2272 O  OE1   . GLN A 1 285 ? -4.889  -23.154 -29.959 1.00 31.47  ? 285  GLN A OE1   1 
ATOM   2273 N  NE2   . GLN A 1 285 ? -2.721  -23.403 -30.473 1.00 28.73  ? 285  GLN A NE2   1 
ATOM   2274 N  N     . PRO A 1 286 ? -7.676  -20.753 -27.704 1.00 26.39  ? 286  PRO A N     1 
ATOM   2275 C  CA    . PRO A 1 286 ? -8.707  -20.490 -26.695 1.00 28.17  ? 286  PRO A CA    1 
ATOM   2276 C  C     . PRO A 1 286 ? -8.113  -20.403 -25.291 1.00 29.18  ? 286  PRO A C     1 
ATOM   2277 O  O     . PRO A 1 286 ? -8.723  -19.817 -24.400 1.00 30.25  ? 286  PRO A O     1 
ATOM   2278 C  CB    . PRO A 1 286 ? -9.618  -21.720 -26.795 1.00 33.73  ? 286  PRO A CB    1 
ATOM   2279 C  CG    . PRO A 1 286 ? -9.334  -22.309 -28.133 1.00 31.52  ? 286  PRO A CG    1 
ATOM   2280 C  CD    . PRO A 1 286 ? -7.890  -22.038 -28.389 1.00 25.87  ? 286  PRO A CD    1 
ATOM   2281 N  N     . SER A 1 287 ? -6.935  -20.988 -25.103 1.00 28.47  ? 287  SER A N     1 
ATOM   2282 C  CA    . SER A 1 287 ? -6.276  -20.998 -23.803 1.00 31.47  ? 287  SER A CA    1 
ATOM   2283 C  C     . SER A 1 287 ? -4.767  -21.126 -23.975 1.00 28.65  ? 287  SER A C     1 
ATOM   2284 O  O     . SER A 1 287 ? -4.302  -21.743 -24.930 1.00 25.10  ? 287  SER A O     1 
ATOM   2285 C  CB    . SER A 1 287 ? -6.799  -22.162 -22.960 1.00 35.06  ? 287  SER A CB    1 
ATOM   2286 O  OG    . SER A 1 287 ? -5.922  -22.448 -21.887 1.00 36.02  ? 287  SER A OG    1 
ATOM   2287 N  N     . TYR A 1 288 ? -4.007  -20.549 -23.048 1.00 28.60  ? 288  TYR A N     1 
ATOM   2288 C  CA    . TYR A 1 288 ? -2.549  -20.631 -23.103 1.00 27.82  ? 288  TYR A CA    1 
ATOM   2289 C  C     . TYR A 1 288 ? -1.944  -21.294 -21.875 1.00 30.19  ? 288  TYR A C     1 
ATOM   2290 O  O     . TYR A 1 288 ? -0.816  -20.998 -21.495 1.00 31.50  ? 288  TYR A O     1 
ATOM   2291 C  CB    . TYR A 1 288 ? -1.920  -19.256 -23.351 1.00 27.90  ? 288  TYR A CB    1 
ATOM   2292 C  CG    . TYR A 1 288 ? -2.193  -18.759 -24.745 1.00 27.41  ? 288  TYR A CG    1 
ATOM   2293 C  CD1   . TYR A 1 288 ? -1.372  -19.127 -25.807 1.00 26.14  ? 288  TYR A CD1   1 
ATOM   2294 C  CD2   . TYR A 1 288 ? -3.294  -17.953 -25.009 1.00 25.33  ? 288  TYR A CD2   1 
ATOM   2295 C  CE1   . TYR A 1 288 ? -1.636  -18.689 -27.093 1.00 25.43  ? 288  TYR A CE1   1 
ATOM   2296 C  CE2   . TYR A 1 288 ? -3.562  -17.511 -26.287 1.00 25.60  ? 288  TYR A CE2   1 
ATOM   2297 C  CZ    . TYR A 1 288 ? -2.733  -17.884 -27.323 1.00 24.91  ? 288  TYR A CZ    1 
ATOM   2298 O  OH    . TYR A 1 288 ? -3.000  -17.447 -28.598 1.00 25.38  ? 288  TYR A OH    1 
ATOM   2299 N  N     . SER A 1 289 ? -2.695  -22.198 -21.258 1.00 29.40  ? 289  SER A N     1 
ATOM   2300 C  CA    . SER A 1 289 ? -2.113  -23.034 -20.225 1.00 31.24  ? 289  SER A CA    1 
ATOM   2301 C  C     . SER A 1 289 ? -1.181  -23.999 -20.944 1.00 31.43  ? 289  SER A C     1 
ATOM   2302 O  O     . SER A 1 289 ? -1.461  -24.403 -22.077 1.00 27.90  ? 289  SER A O     1 
ATOM   2303 C  CB    . SER A 1 289 ? -3.191  -23.799 -19.468 1.00 30.20  ? 289  SER A CB    1 
ATOM   2304 O  OG    . SER A 1 289 ? -3.668  -24.888 -20.237 1.00 36.19  ? 289  SER A OG    1 
ATOM   2305 N  N     . LEU A 1 290 ? -0.074  -24.352 -20.296 1.00 31.21  ? 290  LEU A N     1 
ATOM   2306 C  CA    . LEU A 1 290 ? 0.902   -25.271 -20.880 1.00 27.55  ? 290  LEU A CA    1 
ATOM   2307 C  C     . LEU A 1 290 ? 0.248   -26.598 -21.236 1.00 27.70  ? 290  LEU A C     1 
ATOM   2308 O  O     . LEU A 1 290 ? 0.581   -27.217 -22.243 1.00 32.52  ? 290  LEU A O     1 
ATOM   2309 C  CB    . LEU A 1 290 ? 2.069   -25.504 -19.915 1.00 23.91  ? 290  LEU A CB    1 
ATOM   2310 C  CG    . LEU A 1 290 ? 3.196   -26.374 -20.478 1.00 27.10  ? 290  LEU A CG    1 
ATOM   2311 C  CD1   . LEU A 1 290 ? 3.652   -25.838 -21.836 1.00 21.93  ? 290  LEU A CD1   1 
ATOM   2312 C  CD2   . LEU A 1 290 ? 4.357   -26.426 -19.505 1.00 29.96  ? 290  LEU A CD2   1 
ATOM   2313 N  N     . ASP A 1 291 ? -0.681  -27.020 -20.387 1.00 29.36  ? 291  ASP A N     1 
ATOM   2314 C  CA    . ASP A 1 291 ? -1.495  -28.210 -20.606 1.00 33.51  ? 291  ASP A CA    1 
ATOM   2315 C  C     . ASP A 1 291 ? -2.162  -28.174 -21.976 1.00 33.90  ? 291  ASP A C     1 
ATOM   2316 O  O     . ASP A 1 291 ? -2.076  -29.126 -22.757 1.00 32.94  ? 291  ASP A O     1 
ATOM   2317 C  CB    . ASP A 1 291 ? -2.592  -28.247 -19.543 1.00 44.26  ? 291  ASP A CB    1 
ATOM   2318 C  CG    . ASP A 1 291 ? -2.752  -29.605 -18.911 1.00 52.46  ? 291  ASP A CG    1 
ATOM   2319 O  OD1   . ASP A 1 291 ? -3.270  -29.661 -17.774 1.00 54.03  ? 291  ASP A OD1   1 
ATOM   2320 O  OD2   . ASP A 1 291 ? -2.359  -30.610 -19.543 1.00 58.83  ? 291  ASP A OD2   1 
ATOM   2321 N  N     . TYR A 1 292 ? -2.828  -27.060 -22.256 1.00 31.63  ? 292  TYR A N     1 
ATOM   2322 C  CA    . TYR A 1 292 ? -3.600  -26.905 -23.482 1.00 32.74  ? 292  TYR A CA    1 
ATOM   2323 C  C     . TYR A 1 292 ? -2.716  -26.864 -24.721 1.00 26.81  ? 292  TYR A C     1 
ATOM   2324 O  O     . TYR A 1 292 ? -3.014  -27.501 -25.731 1.00 26.31  ? 292  TYR A O     1 
ATOM   2325 C  CB    . TYR A 1 292 ? -4.440  -25.630 -23.414 1.00 32.45  ? 292  TYR A CB    1 
ATOM   2326 C  CG    . TYR A 1 292 ? -5.502  -25.563 -24.482 1.00 34.18  ? 292  TYR A CG    1 
ATOM   2327 C  CD1   . TYR A 1 292 ? -6.762  -26.099 -24.257 1.00 36.84  ? 292  TYR A CD1   1 
ATOM   2328 C  CD2   . TYR A 1 292 ? -5.245  -24.973 -25.716 1.00 31.23  ? 292  TYR A CD2   1 
ATOM   2329 C  CE1   . TYR A 1 292 ? -7.740  -26.050 -25.222 1.00 42.34  ? 292  TYR A CE1   1 
ATOM   2330 C  CE2   . TYR A 1 292 ? -6.223  -24.918 -26.695 1.00 36.87  ? 292  TYR A CE2   1 
ATOM   2331 C  CZ    . TYR A 1 292 ? -7.471  -25.460 -26.437 1.00 41.73  ? 292  TYR A CZ    1 
ATOM   2332 O  OH    . TYR A 1 292 ? -8.462  -25.419 -27.387 1.00 41.87  ? 292  TYR A OH    1 
ATOM   2333 N  N     . ILE A 1 293 ? -1.630  -26.105 -24.637 1.00 24.31  ? 293  ILE A N     1 
ATOM   2334 C  CA    . ILE A 1 293 ? -0.728  -25.936 -25.769 1.00 24.48  ? 293  ILE A CA    1 
ATOM   2335 C  C     . ILE A 1 293 ? 0.055   -27.218 -26.062 1.00 22.99  ? 293  ILE A C     1 
ATOM   2336 O  O     . ILE A 1 293 ? 0.292   -27.549 -27.224 1.00 27.76  ? 293  ILE A O     1 
ATOM   2337 C  CB    . ILE A 1 293 ? 0.225   -24.741 -25.546 1.00 25.32  ? 293  ILE A CB    1 
ATOM   2338 C  CG1   . ILE A 1 293 ? -0.586  -23.474 -25.273 1.00 26.17  ? 293  ILE A CG1   1 
ATOM   2339 C  CG2   . ILE A 1 293 ? 1.158   -24.545 -26.744 1.00 25.65  ? 293  ILE A CG2   1 
ATOM   2340 C  CD1   . ILE A 1 293 ? -1.481  -23.044 -26.440 1.00 26.95  ? 293  ILE A CD1   1 
ATOM   2341 N  N     . SER A 1 294 ? 0.430   -27.950 -25.015 1.00 24.65  ? 294  SER A N     1 
ATOM   2342 C  CA    . SER A 1 294 ? 1.140   -29.215 -25.193 1.00 26.62  ? 294  SER A CA    1 
ATOM   2343 C  C     . SER A 1 294 ? 0.267   -30.224 -25.919 1.00 28.33  ? 294  SER A C     1 
ATOM   2344 O  O     . SER A 1 294 ? 0.743   -30.971 -26.773 1.00 29.63  ? 294  SER A O     1 
ATOM   2345 C  CB    . SER A 1 294 ? 1.560   -29.800 -23.843 1.00 27.98  ? 294  SER A CB    1 
ATOM   2346 O  OG    . SER A 1 294 ? 2.507   -28.973 -23.196 1.00 29.50  ? 294  SER A OG    1 
ATOM   2347 N  N     . GLU A 1 295 ? -1.012  -30.249 -25.559 1.00 33.18  ? 295  GLU A N     1 
ATOM   2348 C  CA    . GLU A 1 295 ? -1.961  -31.165 -26.173 1.00 34.41  ? 295  GLU A CA    1 
ATOM   2349 C  C     . GLU A 1 295 ? -2.112  -30.799 -27.642 1.00 31.74  ? 295  GLU A C     1 
ATOM   2350 O  O     . GLU A 1 295 ? -2.107  -31.666 -28.511 1.00 30.09  ? 295  GLU A O     1 
ATOM   2351 C  CB    . GLU A 1 295 ? -3.314  -31.093 -25.456 1.00 41.12  ? 295  GLU A CB    1 
ATOM   2352 C  CG    . GLU A 1 295 ? -4.206  -32.314 -25.642 1.00 55.83  ? 295  GLU A CG    1 
ATOM   2353 C  CD    . GLU A 1 295 ? -4.816  -32.404 -27.033 1.00 67.74  ? 295  GLU A CD    1 
ATOM   2354 O  OE1   . GLU A 1 295 ? -5.700  -31.578 -27.355 1.00 71.01  ? 295  GLU A OE1   1 
ATOM   2355 O  OE2   . GLU A 1 295 ? -4.407  -33.302 -27.803 1.00 73.32  ? 295  GLU A OE2   1 
ATOM   2356 N  N     . PHE A 1 296 ? -2.236  -29.504 -27.914 1.00 28.91  ? 296  PHE A N     1 
ATOM   2357 C  CA    . PHE A 1 296 ? -2.387  -29.027 -29.281 1.00 26.17  ? 296  PHE A CA    1 
ATOM   2358 C  C     . PHE A 1 296 ? -1.139  -29.308 -30.120 1.00 24.19  ? 296  PHE A C     1 
ATOM   2359 O  O     . PHE A 1 296 ? -1.241  -29.773 -31.252 1.00 28.51  ? 296  PHE A O     1 
ATOM   2360 C  CB    . PHE A 1 296 ? -2.708  -27.530 -29.288 1.00 26.08  ? 296  PHE A CB    1 
ATOM   2361 C  CG    . PHE A 1 296 ? -2.825  -26.936 -30.669 1.00 30.84  ? 296  PHE A CG    1 
ATOM   2362 C  CD1   . PHE A 1 296 ? -4.054  -26.895 -31.318 1.00 34.08  ? 296  PHE A CD1   1 
ATOM   2363 C  CD2   . PHE A 1 296 ? -1.715  -26.404 -31.313 1.00 27.97  ? 296  PHE A CD2   1 
ATOM   2364 C  CE1   . PHE A 1 296 ? -4.174  -26.345 -32.584 1.00 33.84  ? 296  PHE A CE1   1 
ATOM   2365 C  CE2   . PHE A 1 296 ? -1.826  -25.852 -32.580 1.00 33.70  ? 296  PHE A CE2   1 
ATOM   2366 C  CZ    . PHE A 1 296 ? -3.057  -25.824 -33.218 1.00 34.70  ? 296  PHE A CZ    1 
ATOM   2367 N  N     . GLU A 1 297 ? 0.033   -29.020 -29.563 1.00 23.95  ? 297  GLU A N     1 
ATOM   2368 C  CA    . GLU A 1 297 ? 1.279   -29.087 -30.326 1.00 26.39  ? 297  GLU A CA    1 
ATOM   2369 C  C     . GLU A 1 297 ? 1.849   -30.497 -30.434 1.00 26.90  ? 297  GLU A C     1 
ATOM   2370 O  O     . GLU A 1 297 ? 2.388   -30.871 -31.473 1.00 26.39  ? 297  GLU A O     1 
ATOM   2371 C  CB    . GLU A 1 297 ? 2.333   -28.152 -29.721 1.00 23.72  ? 297  GLU A CB    1 
ATOM   2372 C  CG    . GLU A 1 297 ? 1.979   -26.672 -29.822 1.00 26.50  ? 297  GLU A CG    1 
ATOM   2373 C  CD    . GLU A 1 297 ? 2.143   -26.123 -31.227 1.00 27.56  ? 297  GLU A CD    1 
ATOM   2374 O  OE1   . GLU A 1 297 ? 3.025   -26.619 -31.961 1.00 29.17  ? 297  GLU A OE1   1 
ATOM   2375 O  OE2   . GLU A 1 297 ? 1.393   -25.193 -31.600 1.00 27.20  ? 297  GLU A OE2   1 
ATOM   2376 N  N     . LEU A 1 298 ? 1.734   -31.270 -29.358 1.00 24.53  ? 298  LEU A N     1 
ATOM   2377 C  CA    . LEU A 1 298 ? 2.405   -32.567 -29.269 1.00 26.65  ? 298  LEU A CA    1 
ATOM   2378 C  C     . LEU A 1 298 ? 1.438   -33.749 -29.252 1.00 29.86  ? 298  LEU A C     1 
ATOM   2379 O  O     . LEU A 1 298 ? 1.862   -34.899 -29.352 1.00 31.70  ? 298  LEU A O     1 
ATOM   2380 C  CB    . LEU A 1 298 ? 3.263   -32.624 -28.005 1.00 28.20  ? 298  LEU A CB    1 
ATOM   2381 C  CG    . LEU A 1 298 ? 4.179   -31.431 -27.730 1.00 26.93  ? 298  LEU A CG    1 
ATOM   2382 C  CD1   . LEU A 1 298 ? 4.755   -31.522 -26.320 1.00 23.75  ? 298  LEU A CD1   1 
ATOM   2383 C  CD2   . LEU A 1 298 ? 5.277   -31.380 -28.771 1.00 28.38  ? 298  LEU A CD2   1 
ATOM   2384 N  N     . ASN A 1 299 ? 0.146   -33.461 -29.111 1.00 30.88  ? 299  ASN A N     1 
ATOM   2385 C  CA    . ASN A 1 299 ? -0.875  -34.503 -28.979 1.00 41.52  ? 299  ASN A CA    1 
ATOM   2386 C  C     . ASN A 1 299 ? -0.649  -35.416 -27.773 1.00 44.32  ? 299  ASN A C     1 
ATOM   2387 O  O     . ASN A 1 299 ? -0.909  -36.617 -27.838 1.00 46.56  ? 299  ASN A O     1 
ATOM   2388 C  CB    . ASN A 1 299 ? -1.004  -35.333 -30.265 1.00 50.59  ? 299  ASN A CB    1 
ATOM   2389 C  CG    . ASN A 1 299 ? -1.197  -34.472 -31.501 1.00 58.25  ? 299  ASN A CG    1 
ATOM   2390 O  OD1   . ASN A 1 299 ? -2.285  -33.944 -31.742 1.00 61.56  ? 299  ASN A OD1   1 
ATOM   2391 N  ND2   . ASN A 1 299 ? -0.138  -34.328 -32.293 1.00 59.52  ? 299  ASN A ND2   1 
ATOM   2392 N  N     . VAL A 1 300 ? -0.151  -34.845 -26.680 1.00 43.55  ? 300  VAL A N     1 
ATOM   2393 C  CA    . VAL A 1 300 ? -0.024  -35.583 -25.427 1.00 45.86  ? 300  VAL A CA    1 
ATOM   2394 C  C     . VAL A 1 300 ? -1.246  -35.318 -24.560 1.00 51.13  ? 300  VAL A C     1 
ATOM   2395 O  O     . VAL A 1 300 ? -1.874  -34.263 -24.664 1.00 53.75  ? 300  VAL A O     1 
ATOM   2396 C  CB    . VAL A 1 300 ? 1.251   -35.197 -24.651 1.00 42.25  ? 300  VAL A CB    1 
ATOM   2397 C  CG1   . VAL A 1 300 ? 2.487   -35.714 -25.369 1.00 40.64  ? 300  VAL A CG1   1 
ATOM   2398 C  CG2   . VAL A 1 300 ? 1.327   -33.684 -24.457 1.00 41.49  ? 300  VAL A CG2   1 
ATOM   2399 N  N     . GLY A 1 301 ? -1.586  -36.277 -23.707 1.00 51.15  ? 301  GLY A N     1 
ATOM   2400 C  CA    . GLY A 1 301 ? -2.748  -36.146 -22.848 1.00 52.23  ? 301  GLY A CA    1 
ATOM   2401 C  C     . GLY A 1 301 ? -2.548  -35.128 -21.741 1.00 52.94  ? 301  GLY A C     1 
ATOM   2402 O  O     . GLY A 1 301 ? -1.418  -34.795 -21.383 1.00 49.20  ? 301  GLY A O     1 
ATOM   2403 N  N     . LYS A 1 302 ? -3.654  -34.629 -21.199 1.00 58.02  ? 302  LYS A N     1 
ATOM   2404 C  CA    . LYS A 1 302 ? -3.603  -33.726 -20.058 1.00 60.60  ? 302  LYS A CA    1 
ATOM   2405 C  C     . LYS A 1 302 ? -3.055  -34.454 -18.834 1.00 64.57  ? 302  LYS A C     1 
ATOM   2406 O  O     . LYS A 1 302 ? -3.416  -35.601 -18.569 1.00 64.83  ? 302  LYS A O     1 
ATOM   2407 C  CB    . LYS A 1 302 ? -4.994  -33.164 -19.757 1.00 62.43  ? 302  LYS A CB    1 
ATOM   2408 N  N     . LEU A 1 303 ? -2.169  -33.790 -18.099 1.00 67.20  ? 303  LEU A N     1 
ATOM   2409 C  CA    . LEU A 1 303 ? -1.634  -34.352 -16.866 1.00 70.38  ? 303  LEU A CA    1 
ATOM   2410 C  C     . LEU A 1 303 ? -2.735  -34.422 -15.811 1.00 72.99  ? 303  LEU A C     1 
ATOM   2411 O  O     . LEU A 1 303 ? -3.084  -33.414 -15.196 1.00 75.57  ? 303  LEU A O     1 
ATOM   2412 C  CB    . LEU A 1 303 ? -0.456  -33.518 -16.360 1.00 68.90  ? 303  LEU A CB    1 
ATOM   2413 C  CG    . LEU A 1 303 ? 0.807   -33.539 -17.223 1.00 68.52  ? 303  LEU A CG    1 
ATOM   2414 C  CD1   . LEU A 1 303 ? 1.856   -32.592 -16.666 1.00 68.85  ? 303  LEU A CD1   1 
ATOM   2415 C  CD2   . LEU A 1 303 ? 1.362   -34.951 -17.321 1.00 69.73  ? 303  LEU A CD2   1 
ATOM   2416 N  N     . LYS A 1 304 ? -3.280  -35.618 -15.609 1.00 72.05  ? 304  LYS A N     1 
ATOM   2417 C  CA    . LYS A 1 304 ? -4.415  -35.803 -14.710 1.00 73.44  ? 304  LYS A CA    1 
ATOM   2418 C  C     . LYS A 1 304 ? -4.005  -36.011 -13.252 1.00 74.08  ? 304  LYS A C     1 
ATOM   2419 O  O     . LYS A 1 304 ? -2.920  -36.517 -12.963 1.00 72.39  ? 304  LYS A O     1 
ATOM   2420 C  CB    . LYS A 1 304 ? -5.286  -36.970 -15.187 1.00 74.03  ? 304  LYS A CB    1 
ATOM   2421 C  CG    . LYS A 1 304 ? -4.529  -38.272 -15.389 1.00 73.45  ? 304  LYS A CG    1 
ATOM   2422 N  N     . TYR A 1 305 ? -4.889  -35.612 -12.343 1.00 75.93  ? 305  TYR A N     1 
ATOM   2423 C  CA    . TYR A 1 305 ? -4.685  -35.791 -10.909 1.00 78.19  ? 305  TYR A CA    1 
ATOM   2424 C  C     . TYR A 1 305 ? -6.011  -35.607 -10.181 1.00 78.37  ? 305  TYR A C     1 
ATOM   2425 O  O     . TYR A 1 305 ? -6.974  -35.098 -10.751 1.00 77.48  ? 305  TYR A O     1 
ATOM   2426 C  CB    . TYR A 1 305 ? -3.651  -34.797 -10.376 1.00 79.23  ? 305  TYR A CB    1 
ATOM   2427 C  CG    . TYR A 1 305 ? -3.945  -33.362 -10.746 1.00 80.37  ? 305  TYR A CG    1 
ATOM   2428 C  CD1   . TYR A 1 305 ? -4.707  -32.550 -9.916  1.00 82.02  ? 305  TYR A CD1   1 
ATOM   2429 C  CD2   . TYR A 1 305 ? -3.466  -32.822 -11.932 1.00 80.07  ? 305  TYR A CD2   1 
ATOM   2430 C  CE1   . TYR A 1 305 ? -4.982  -31.241 -10.256 1.00 82.55  ? 305  TYR A CE1   1 
ATOM   2431 C  CE2   . TYR A 1 305 ? -3.735  -31.516 -12.281 1.00 80.71  ? 305  TYR A CE2   1 
ATOM   2432 C  CZ    . TYR A 1 305 ? -4.493  -30.728 -11.440 1.00 81.91  ? 305  TYR A CZ    1 
ATOM   2433 O  OH    . TYR A 1 305 ? -4.764  -29.424 -11.786 1.00 80.67  ? 305  TYR A OH    1 
ATOM   2434 N  N     . ASP A 1 306 ? -6.056  -36.020 -8.920  1.00 80.67  ? 306  ASP A N     1 
ATOM   2435 C  CA    . ASP A 1 306 ? -7.269  -35.890 -8.124  1.00 82.66  ? 306  ASP A CA    1 
ATOM   2436 C  C     . ASP A 1 306 ? -7.168  -34.698 -7.180  1.00 80.87  ? 306  ASP A C     1 
ATOM   2437 O  O     . ASP A 1 306 ? -6.093  -34.390 -6.664  1.00 79.02  ? 306  ASP A O     1 
ATOM   2438 C  CB    . ASP A 1 306 ? -7.525  -37.172 -7.332  1.00 86.68  ? 306  ASP A CB    1 
ATOM   2439 C  CG    . ASP A 1 306 ? -7.448  -38.414 -8.196  1.00 88.73  ? 306  ASP A CG    1 
ATOM   2440 O  OD1   . ASP A 1 306 ? -7.635  -38.295 -9.425  1.00 87.92  ? 306  ASP A OD1   1 
ATOM   2441 O  OD2   . ASP A 1 306 ? -7.202  -39.509 -7.645  1.00 90.24  ? 306  ASP A OD2   1 
ATOM   2442 N  N     . GLY A 1 307 ? -8.295  -34.030 -6.957  1.00 80.17  ? 307  GLY A N     1 
ATOM   2443 C  CA    . GLY A 1 307 ? -8.329  -32.865 -6.095  1.00 77.68  ? 307  GLY A CA    1 
ATOM   2444 C  C     . GLY A 1 307 ? -7.809  -31.623 -6.792  1.00 73.65  ? 307  GLY A C     1 
ATOM   2445 O  O     . GLY A 1 307 ? -7.528  -31.651 -7.991  1.00 72.44  ? 307  GLY A O     1 
ATOM   2446 N  N     . PRO A 1 308 ? -7.676  -30.521 -6.039  1.00 72.25  ? 308  PRO A N     1 
ATOM   2447 C  CA    . PRO A 1 308 ? -7.179  -29.242 -6.555  1.00 68.93  ? 308  PRO A CA    1 
ATOM   2448 C  C     . PRO A 1 308 ? -5.658  -29.161 -6.504  1.00 67.99  ? 308  PRO A C     1 
ATOM   2449 O  O     . PRO A 1 308 ? -5.028  -29.946 -5.795  1.00 67.49  ? 308  PRO A O     1 
ATOM   2450 C  CB    . PRO A 1 308 ? -7.789  -28.213 -5.589  1.00 69.28  ? 308  PRO A CB    1 
ATOM   2451 C  CG    . PRO A 1 308 ? -8.453  -29.018 -4.471  1.00 70.03  ? 308  PRO A CG    1 
ATOM   2452 C  CD    . PRO A 1 308 ? -8.007  -30.433 -4.610  1.00 70.71  ? 308  PRO A CD    1 
ATOM   2453 N  N     . ILE A 1 309 ? -5.079  -28.220 -7.243  1.00 68.73  ? 309  ILE A N     1 
ATOM   2454 C  CA    . ILE A 1 309 ? -3.628  -28.056 -7.279  1.00 66.79  ? 309  ILE A CA    1 
ATOM   2455 C  C     . ILE A 1 309 ? -3.080  -27.631 -5.917  1.00 67.98  ? 309  ILE A C     1 
ATOM   2456 O  O     . ILE A 1 309 ? -1.990  -28.044 -5.520  1.00 68.69  ? 309  ILE A O     1 
ATOM   2457 C  CB    . ILE A 1 309 ? -3.189  -27.024 -8.343  1.00 66.77  ? 309  ILE A CB    1 
ATOM   2458 C  CG1   . ILE A 1 309 ? -3.794  -27.356 -9.710  1.00 67.55  ? 309  ILE A CG1   1 
ATOM   2459 C  CG2   . ILE A 1 309 ? -1.671  -26.970 -8.447  1.00 65.58  ? 309  ILE A CG2   1 
ATOM   2460 C  CD1   . ILE A 1 309 ? -5.103  -26.648 -10.011 1.00 68.47  ? 309  ILE A CD1   1 
ATOM   2461 N  N     . SER A 1 310 ? -3.853  -26.822 -5.195  1.00 66.02  ? 310  SER A N     1 
ATOM   2462 C  CA    . SER A 1 310 ? -3.429  -26.302 -3.897  1.00 66.42  ? 310  SER A CA    1 
ATOM   2463 C  C     . SER A 1 310 ? -3.283  -27.392 -2.838  1.00 70.30  ? 310  SER A C     1 
ATOM   2464 O  O     . SER A 1 310 ? -2.801  -27.134 -1.736  1.00 72.57  ? 310  SER A O     1 
ATOM   2465 C  CB    . SER A 1 310 ? -4.405  -25.230 -3.401  1.00 67.12  ? 310  SER A CB    1 
ATOM   2466 O  OG    . SER A 1 310 ? -5.691  -25.778 -3.168  1.00 67.64  ? 310  SER A OG    1 
ATOM   2467 N  N     . LYS A 1 311 ? -3.706  -28.608 -3.170  1.00 54.90  ? 311  LYS A N     1 
ATOM   2468 C  CA    . LYS A 1 311 ? -3.575  -29.730 -2.248  1.00 52.32  ? 311  LYS A CA    1 
ATOM   2469 C  C     . LYS A 1 311 ? -2.803  -30.896 -2.873  1.00 43.29  ? 311  LYS A C     1 
ATOM   2470 O  O     . LYS A 1 311 ? -2.629  -31.943 -2.245  1.00 43.34  ? 311  LYS A O     1 
ATOM   2471 C  CB    . LYS A 1 311 ? -4.954  -30.194 -1.768  1.00 53.42  ? 311  LYS A CB    1 
ATOM   2472 N  N     . LEU A 1 312 ? -2.333  -30.708 -4.102  1.00 38.07  ? 312  LEU A N     1 
ATOM   2473 C  CA    . LEU A 1 312 ? -1.638  -31.779 -4.815  1.00 38.29  ? 312  LEU A CA    1 
ATOM   2474 C  C     . LEU A 1 312 ? -0.350  -32.194 -4.115  1.00 37.45  ? 312  LEU A C     1 
ATOM   2475 O  O     . LEU A 1 312 ? -0.086  -33.386 -3.959  1.00 38.93  ? 312  LEU A O     1 
ATOM   2476 C  CB    . LEU A 1 312 ? -1.358  -31.395 -6.267  1.00 36.74  ? 312  LEU A CB    1 
ATOM   2477 C  CG    . LEU A 1 312 ? -0.681  -32.487 -7.104  1.00 38.88  ? 312  LEU A CG    1 
ATOM   2478 C  CD1   . LEU A 1 312 ? -1.460  -33.800 -7.035  1.00 40.78  ? 312  LEU A CD1   1 
ATOM   2479 C  CD2   . LEU A 1 312 ? -0.529  -32.041 -8.546  1.00 34.16  ? 312  LEU A CD2   1 
ATOM   2480 N  N     . ARG A 1 313 ? 0.444   -31.217 -3.689  1.00 36.24  ? 313  ARG A N     1 
ATOM   2481 C  CA    . ARG A 1 313 ? 1.681   -31.516 -2.979  1.00 37.72  ? 313  ARG A CA    1 
ATOM   2482 C  C     . ARG A 1 313 ? 1.389   -32.312 -1.708  1.00 42.14  ? 313  ARG A C     1 
ATOM   2483 O  O     . ARG A 1 313 ? 2.080   -33.284 -1.396  1.00 41.15  ? 313  ARG A O     1 
ATOM   2484 C  CB    . ARG A 1 313 ? 2.441   -30.233 -2.635  1.00 36.75  ? 313  ARG A CB    1 
ATOM   2485 C  CG    . ARG A 1 313 ? 3.705   -30.478 -1.830  1.00 36.58  ? 313  ARG A CG    1 
ATOM   2486 C  CD    . ARG A 1 313 ? 4.443   -29.185 -1.520  1.00 37.48  ? 313  ARG A CD    1 
ATOM   2487 N  NE    . ARG A 1 313 ? 5.641   -29.433 -0.727  1.00 31.95  ? 313  ARG A NE    1 
ATOM   2488 C  CZ    . ARG A 1 313 ? 5.648   -29.547 0.596   1.00 34.23  ? 313  ARG A CZ    1 
ATOM   2489 N  NH1   . ARG A 1 313 ? 4.515   -29.433 1.280   1.00 38.17  ? 313  ARG A NH1   1 
ATOM   2490 N  NH2   . ARG A 1 313 ? 6.787   -29.773 1.238   1.00 30.59  ? 313  ARG A NH2   1 
ATOM   2491 N  N     . GLU A 1 314 ? 0.349   -31.896 -0.990  1.00 44.54  ? 314  GLU A N     1 
ATOM   2492 C  CA    . GLU A 1 314 ? -0.035  -32.537 0.264   1.00 48.23  ? 314  GLU A CA    1 
ATOM   2493 C  C     . GLU A 1 314 ? -0.503  -33.976 0.053   1.00 45.88  ? 314  GLU A C     1 
ATOM   2494 O  O     . GLU A 1 314 ? -0.065  -34.889 0.753   1.00 50.39  ? 314  GLU A O     1 
ATOM   2495 C  CB    . GLU A 1 314 ? -1.132  -31.727 0.964   1.00 48.70  ? 314  GLU A CB    1 
ATOM   2496 N  N     . SER A 1 315 ? -1.388  -34.171 -0.916  1.00 42.60  ? 315  SER A N     1 
ATOM   2497 C  CA    . SER A 1 315 ? -1.971  -35.486 -1.175  1.00 47.08  ? 315  SER A CA    1 
ATOM   2498 C  C     . SER A 1 315 ? -1.072  -36.403 -2.012  1.00 45.11  ? 315  SER A C     1 
ATOM   2499 O  O     . SER A 1 315 ? -0.961  -37.598 -1.730  1.00 44.10  ? 315  SER A O     1 
ATOM   2500 C  CB    . SER A 1 315 ? -3.333  -35.331 -1.854  1.00 46.05  ? 315  SER A CB    1 
ATOM   2501 O  OG    . SER A 1 315 ? -3.229  -34.527 -3.014  1.00 45.06  ? 315  SER A OG    1 
ATOM   2502 N  N     . ASN A 1 316 ? -0.438  -35.845 -3.039  1.00 41.87  ? 316  ASN A N     1 
ATOM   2503 C  CA    . ASN A 1 316 ? 0.381   -36.642 -3.949  1.00 38.09  ? 316  ASN A CA    1 
ATOM   2504 C  C     . ASN A 1 316 ? 1.653   -35.914 -4.378  1.00 33.88  ? 316  ASN A C     1 
ATOM   2505 O  O     . ASN A 1 316 ? 1.787   -35.507 -5.530  1.00 31.14  ? 316  ASN A O     1 
ATOM   2506 C  CB    . ASN A 1 316 ? -0.429  -37.045 -5.184  1.00 36.93  ? 316  ASN A CB    1 
ATOM   2507 C  CG    . ASN A 1 316 ? 0.142   -38.264 -5.881  1.00 37.38  ? 316  ASN A CG    1 
ATOM   2508 O  OD1   . ASN A 1 316 ? 1.326   -38.570 -5.752  1.00 38.45  ? 316  ASN A OD1   1 
ATOM   2509 N  ND2   . ASN A 1 316 ? -0.703  -38.971 -6.618  1.00 37.89  ? 316  ASN A ND2   1 
ATOM   2510 N  N     . HIS A 1 317 ? 2.584   -35.771 -3.444  1.00 32.29  ? 317  HIS A N     1 
ATOM   2511 C  CA    . HIS A 1 317 ? 3.833   -35.063 -3.689  1.00 31.81  ? 317  HIS A CA    1 
ATOM   2512 C  C     . HIS A 1 317 ? 4.670   -35.749 -4.770  1.00 33.68  ? 317  HIS A C     1 
ATOM   2513 O  O     . HIS A 1 317 ? 5.388   -35.091 -5.524  1.00 34.18  ? 317  HIS A O     1 
ATOM   2514 C  CB    . HIS A 1 317 ? 4.614   -34.937 -2.382  1.00 31.39  ? 317  HIS A CB    1 
ATOM   2515 C  CG    . HIS A 1 317 ? 6.022   -34.470 -2.556  1.00 33.28  ? 317  HIS A CG    1 
ATOM   2516 N  ND1   . HIS A 1 317 ? 7.098   -35.334 -2.538  1.00 35.04  ? 317  HIS A ND1   1 
ATOM   2517 C  CD2   . HIS A 1 317 ? 6.538   -33.233 -2.734  1.00 34.33  ? 317  HIS A CD2   1 
ATOM   2518 C  CE1   . HIS A 1 317 ? 8.212   -34.647 -2.707  1.00 34.06  ? 317  HIS A CE1   1 
ATOM   2519 N  NE2   . HIS A 1 317 ? 7.901   -33.368 -2.823  1.00 33.55  ? 317  HIS A NE2   1 
ATOM   2520 N  N     . GLN A 1 318 ? 4.566   -37.072 -4.839  1.00 32.69  ? 318  GLN A N     1 
ATOM   2521 C  CA    . GLN A 1 318 ? 5.237   -37.847 -5.877  1.00 33.97  ? 318  GLN A CA    1 
ATOM   2522 C  C     . GLN A 1 318 ? 4.860   -37.318 -7.261  1.00 32.31  ? 318  GLN A C     1 
ATOM   2523 O  O     . GLN A 1 318 ? 5.726   -36.982 -8.077  1.00 32.02  ? 318  GLN A O     1 
ATOM   2524 C  CB    . GLN A 1 318 ? 4.855   -39.325 -5.746  1.00 34.44  ? 318  GLN A CB    1 
ATOM   2525 C  CG    . GLN A 1 318 ? 5.338   -40.204 -6.886  1.00 33.66  ? 318  GLN A CG    1 
ATOM   2526 C  CD    . GLN A 1 318 ? 6.848   -40.314 -6.941  1.00 34.12  ? 318  GLN A CD    1 
ATOM   2527 O  OE1   . GLN A 1 318 ? 7.522   -40.354 -5.908  1.00 34.23  ? 318  GLN A OE1   1 
ATOM   2528 N  NE2   . GLN A 1 318 ? 7.390   -40.356 -8.150  1.00 32.67  ? 318  GLN A NE2   1 
ATOM   2529 N  N     . ARG A 1 319 ? 3.556   -37.225 -7.502  1.00 27.36  ? 319  ARG A N     1 
ATOM   2530 C  CA    . ARG A 1 319 ? 3.019   -36.730 -8.762  1.00 29.91  ? 319  ARG A CA    1 
ATOM   2531 C  C     . ARG A 1 319 ? 3.307   -35.243 -8.953  1.00 28.69  ? 319  ARG A C     1 
ATOM   2532 O  O     . ARG A 1 319 ? 3.607   -34.796 -10.060 1.00 31.83  ? 319  ARG A O     1 
ATOM   2533 C  CB    . ARG A 1 319 ? 1.511   -36.982 -8.813  1.00 35.77  ? 319  ARG A CB    1 
ATOM   2534 C  CG    . ARG A 1 319 ? 0.834   -36.506 -10.082 1.00 44.10  ? 319  ARG A CG    1 
ATOM   2535 C  CD    . ARG A 1 319 ? -0.169  -37.538 -10.564 1.00 52.65  ? 319  ARG A CD    1 
ATOM   2536 N  NE    . ARG A 1 319 ? 0.483   -38.805 -10.884 1.00 58.77  ? 319  ARG A NE    1 
ATOM   2537 C  CZ    . ARG A 1 319 ? -0.153  -39.876 -11.345 1.00 65.23  ? 319  ARG A CZ    1 
ATOM   2538 N  NH1   . ARG A 1 319 ? -1.464  -39.837 -11.541 1.00 66.94  ? 319  ARG A NH1   1 
ATOM   2539 N  NH2   . ARG A 1 319 ? 0.521   -40.987 -11.608 1.00 66.20  ? 319  ARG A NH2   1 
ATOM   2540 N  N     . TYR A 1 320 ? 3.198   -34.491 -7.862  1.00 29.49  ? 320  TYR A N     1 
ATOM   2541 C  CA    . TYR A 1 320 ? 3.483   -33.060 -7.839  1.00 29.47  ? 320  TYR A CA    1 
ATOM   2542 C  C     . TYR A 1 320 ? 4.852   -32.740 -8.435  1.00 28.55  ? 320  TYR A C     1 
ATOM   2543 O  O     . TYR A 1 320 ? 4.972   -31.867 -9.292  1.00 25.12  ? 320  TYR A O     1 
ATOM   2544 C  CB    . TYR A 1 320 ? 3.423   -32.575 -6.394  1.00 31.88  ? 320  TYR A CB    1 
ATOM   2545 C  CG    . TYR A 1 320 ? 3.516   -31.078 -6.165  1.00 31.41  ? 320  TYR A CG    1 
ATOM   2546 C  CD1   . TYR A 1 320 ? 2.465   -30.232 -6.499  1.00 32.14  ? 320  TYR A CD1   1 
ATOM   2547 C  CD2   . TYR A 1 320 ? 4.631   -30.523 -5.549  1.00 32.86  ? 320  TYR A CD2   1 
ATOM   2548 C  CE1   . TYR A 1 320 ? 2.537   -28.869 -6.254  1.00 30.45  ? 320  TYR A CE1   1 
ATOM   2549 C  CE2   . TYR A 1 320 ? 4.715   -29.166 -5.300  1.00 33.26  ? 320  TYR A CE2   1 
ATOM   2550 C  CZ    . TYR A 1 320 ? 3.668   -28.344 -5.651  1.00 32.77  ? 320  TYR A CZ    1 
ATOM   2551 O  OH    . TYR A 1 320 ? 3.753   -26.998 -5.396  1.00 33.13  ? 320  TYR A OH    1 
ATOM   2552 N  N     . ILE A 1 321 ? 5.880   -33.447 -7.977  1.00 28.76  ? 321  ILE A N     1 
ATOM   2553 C  CA    . ILE A 1 321 ? 7.235   -33.220 -8.472  1.00 29.28  ? 321  ILE A CA    1 
ATOM   2554 C  C     . ILE A 1 321 ? 7.388   -33.721 -9.903  1.00 27.77  ? 321  ILE A C     1 
ATOM   2555 O  O     . ILE A 1 321 ? 7.966   -33.035 -10.752 1.00 24.99  ? 321  ILE A O     1 
ATOM   2556 C  CB    . ILE A 1 321 ? 8.295   -33.873 -7.555  1.00 30.03  ? 321  ILE A CB    1 
ATOM   2557 C  CG1   . ILE A 1 321 ? 8.259   -33.224 -6.173  1.00 30.58  ? 321  ILE A CG1   1 
ATOM   2558 C  CG2   . ILE A 1 321 ? 9.692   -33.729 -8.154  1.00 28.61  ? 321  ILE A CG2   1 
ATOM   2559 C  CD1   . ILE A 1 321 ? 8.521   -31.733 -6.203  1.00 29.78  ? 321  ILE A CD1   1 
ATOM   2560 N  N     . SER A 1 322 ? 6.845   -34.906 -10.175 1.00 28.72  ? 322  SER A N     1 
ATOM   2561 C  CA    . SER A 1 322 ? 6.887   -35.469 -11.522 1.00 26.82  ? 322  SER A CA    1 
ATOM   2562 C  C     . SER A 1 322 ? 6.258   -34.543 -12.559 1.00 25.48  ? 322  SER A C     1 
ATOM   2563 O  O     . SER A 1 322 ? 6.773   -34.411 -13.667 1.00 22.29  ? 322  SER A O     1 
ATOM   2564 C  CB    . SER A 1 322 ? 6.216   -36.843 -11.566 1.00 26.05  ? 322  SER A CB    1 
ATOM   2565 O  OG    . SER A 1 322 ? 7.031   -37.831 -10.949 1.00 26.69  ? 322  SER A OG    1 
ATOM   2566 N  N     . TYR A 1 323 ? 5.151   -33.900 -12.201 1.00 26.08  ? 323  TYR A N     1 
ATOM   2567 C  CA    . TYR A 1 323 ? 4.486   -32.993 -13.133 1.00 26.77  ? 323  TYR A CA    1 
ATOM   2568 C  C     . TYR A 1 323 ? 5.280   -31.703 -13.336 1.00 24.09  ? 323  TYR A C     1 
ATOM   2569 O  O     . TYR A 1 323 ? 5.214   -31.097 -14.399 1.00 27.55  ? 323  TYR A O     1 
ATOM   2570 C  CB    . TYR A 1 323 ? 3.048   -32.690 -12.692 1.00 33.66  ? 323  TYR A CB    1 
ATOM   2571 C  CG    . TYR A 1 323 ? 2.080   -33.818 -12.980 1.00 39.83  ? 323  TYR A CG    1 
ATOM   2572 C  CD1   . TYR A 1 323 ? 0.728   -33.697 -12.681 1.00 42.60  ? 323  TYR A CD1   1 
ATOM   2573 C  CD2   . TYR A 1 323 ? 2.522   -35.007 -13.545 1.00 44.73  ? 323  TYR A CD2   1 
ATOM   2574 C  CE1   . TYR A 1 323 ? -0.160  -34.731 -12.949 1.00 43.44  ? 323  TYR A CE1   1 
ATOM   2575 C  CE2   . TYR A 1 323 ? 1.646   -36.047 -13.810 1.00 47.23  ? 323  TYR A CE2   1 
ATOM   2576 C  CZ    . TYR A 1 323 ? 0.308   -35.902 -13.513 1.00 47.68  ? 323  TYR A CZ    1 
ATOM   2577 O  OH    . TYR A 1 323 ? -0.561  -36.936 -13.779 1.00 52.24  ? 323  TYR A OH    1 
ATOM   2578 N  N     . ASN A 1 324 ? 6.025   -31.289 -12.313 1.00 25.44  ? 324  ASN A N     1 
ATOM   2579 C  CA    . ASN A 1 324 ? 6.914   -30.130 -12.426 1.00 26.58  ? 324  ASN A CA    1 
ATOM   2580 C  C     . ASN A 1 324 ? 8.025   -30.401 -13.442 1.00 23.72  ? 324  ASN A C     1 
ATOM   2581 O  O     . ASN A 1 324 ? 8.307   -29.571 -14.311 1.00 24.68  ? 324  ASN A O     1 
ATOM   2582 C  CB    . ASN A 1 324 ? 7.494   -29.782 -11.050 1.00 26.80  ? 324  ASN A CB    1 
ATOM   2583 C  CG    . ASN A 1 324 ? 8.439   -28.583 -11.080 1.00 28.14  ? 324  ASN A CG    1 
ATOM   2584 O  OD1   . ASN A 1 324 ? 8.117   -27.524 -11.617 1.00 29.53  ? 324  ASN A OD1   1 
ATOM   2585 N  ND2   . ASN A 1 324 ? 9.597   -28.743 -10.463 1.00 21.09  ? 324  ASN A ND2   1 
ATOM   2586 N  N     . ILE A 1 325 ? 8.636   -31.578 -13.342 1.00 23.43  ? 325  ILE A N     1 
ATOM   2587 C  CA    . ILE A 1 325 ? 9.662   -31.991 -14.291 1.00 22.43  ? 325  ILE A CA    1 
ATOM   2588 C  C     . ILE A 1 325 ? 9.085   -32.103 -15.697 1.00 21.62  ? 325  ILE A C     1 
ATOM   2589 O  O     . ILE A 1 325 ? 9.689   -31.651 -16.666 1.00 22.71  ? 325  ILE A O     1 
ATOM   2590 C  CB    . ILE A 1 325 ? 10.287  -33.348 -13.892 1.00 24.57  ? 325  ILE A CB    1 
ATOM   2591 C  CG1   . ILE A 1 325 ? 10.997  -33.230 -12.541 1.00 25.40  ? 325  ILE A CG1   1 
ATOM   2592 C  CG2   . ILE A 1 325 ? 11.244  -33.839 -14.979 1.00 24.14  ? 325  ILE A CG2   1 
ATOM   2593 C  CD1   . ILE A 1 325 ? 11.358  -34.562 -11.913 1.00 25.29  ? 325  ILE A CD1   1 
ATOM   2594 N  N     . ILE A 1 326 ? 7.911   -32.712 -15.801 1.00 23.86  ? 326  ILE A N     1 
ATOM   2595 C  CA    . ILE A 1 326 ? 7.265   -32.894 -17.095 1.00 23.93  ? 326  ILE A CA    1 
ATOM   2596 C  C     . ILE A 1 326 ? 6.941   -31.553 -17.772 1.00 25.94  ? 326  ILE A C     1 
ATOM   2597 O  O     . ILE A 1 326 ? 7.135   -31.399 -18.981 1.00 27.72  ? 326  ILE A O     1 
ATOM   2598 C  CB    . ILE A 1 326 ? 6.002   -33.770 -16.965 1.00 25.15  ? 326  ILE A CB    1 
ATOM   2599 C  CG1   . ILE A 1 326 ? 6.405   -35.219 -16.669 1.00 28.86  ? 326  ILE A CG1   1 
ATOM   2600 C  CG2   . ILE A 1 326 ? 5.163   -33.687 -18.233 1.00 25.54  ? 326  ILE A CG2   1 
ATOM   2601 C  CD1   . ILE A 1 326 ? 5.248   -36.133 -16.263 1.00 29.74  ? 326  ILE A CD1   1 
ATOM   2602 N  N     . ALA A 1 327 ? 6.478   -30.587 -16.982 1.00 25.43  ? 327  ALA A N     1 
ATOM   2603 C  CA    . ALA A 1 327 ? 6.172   -29.248 -17.480 1.00 25.93  ? 327  ALA A CA    1 
ATOM   2604 C  C     . ALA A 1 327 ? 7.380   -28.600 -18.152 1.00 25.27  ? 327  ALA A C     1 
ATOM   2605 O  O     . ALA A 1 327 ? 7.256   -27.976 -19.203 1.00 25.88  ? 327  ALA A O     1 
ATOM   2606 C  CB    . ALA A 1 327 ? 5.658   -28.362 -16.344 1.00 24.25  ? 327  ALA A CB    1 
ATOM   2607 N  N     . VAL A 1 328 ? 8.549   -28.753 -17.544 1.00 24.03  ? 328  VAL A N     1 
ATOM   2608 C  CA    . VAL A 1 328 ? 9.774   -28.240 -18.142 1.00 24.92  ? 328  VAL A CA    1 
ATOM   2609 C  C     . VAL A 1 328 ? 10.062  -28.964 -19.454 1.00 23.05  ? 328  VAL A C     1 
ATOM   2610 O  O     . VAL A 1 328 ? 10.394  -28.341 -20.455 1.00 22.91  ? 328  VAL A O     1 
ATOM   2611 C  CB    . VAL A 1 328 ? 10.969  -28.374 -17.184 1.00 25.16  ? 328  VAL A CB    1 
ATOM   2612 C  CG1   . VAL A 1 328 ? 12.274  -28.040 -17.900 1.00 20.87  ? 328  VAL A CG1   1 
ATOM   2613 C  CG2   . VAL A 1 328 ? 10.774  -27.469 -15.982 1.00 25.07  ? 328  VAL A CG2   1 
ATOM   2614 N  N     . TYR A 1 329 ? 9.908   -30.283 -19.446 1.00 24.46  ? 329  TYR A N     1 
ATOM   2615 C  CA    . TYR A 1 329 ? 10.165  -31.078 -20.641 1.00 24.23  ? 329  TYR A CA    1 
ATOM   2616 C  C     . TYR A 1 329 ? 9.216   -30.757 -21.803 1.00 21.20  ? 329  TYR A C     1 
ATOM   2617 O  O     . TYR A 1 329 ? 9.628   -30.774 -22.957 1.00 22.52  ? 329  TYR A O     1 
ATOM   2618 C  CB    . TYR A 1 329 ? 10.121  -32.571 -20.315 1.00 21.89  ? 329  TYR A CB    1 
ATOM   2619 C  CG    . TYR A 1 329 ? 10.517  -33.453 -21.475 1.00 26.71  ? 329  TYR A CG    1 
ATOM   2620 C  CD1   . TYR A 1 329 ? 11.617  -33.137 -22.267 1.00 24.97  ? 329  TYR A CD1   1 
ATOM   2621 C  CD2   . TYR A 1 329 ? 9.803   -34.608 -21.773 1.00 28.42  ? 329  TYR A CD2   1 
ATOM   2622 C  CE1   . TYR A 1 329 ? 11.992  -33.948 -23.328 1.00 28.68  ? 329  TYR A CE1   1 
ATOM   2623 C  CE2   . TYR A 1 329 ? 10.169  -35.423 -22.834 1.00 32.34  ? 329  TYR A CE2   1 
ATOM   2624 C  CZ    . TYR A 1 329 ? 11.266  -35.086 -23.606 1.00 32.65  ? 329  TYR A CZ    1 
ATOM   2625 O  OH    . TYR A 1 329 ? 11.636  -35.890 -24.661 1.00 37.85  ? 329  TYR A OH    1 
ATOM   2626 N  N     A ARG A 1 330 ? 7.957   -30.468 -21.485 0.50 22.94  ? 330  ARG A N     1 
ATOM   2627 N  N     B ARG A 1 330 ? 7.956   -30.466 -21.498 0.50 22.95  ? 330  ARG A N     1 
ATOM   2628 C  CA    A ARG A 1 330 ? 6.959   -30.125 -22.500 0.50 23.87  ? 330  ARG A CA    1 
ATOM   2629 C  CA    B ARG A 1 330 ? 6.985   -30.138 -22.543 0.50 23.52  ? 330  ARG A CA    1 
ATOM   2630 C  C     A ARG A 1 330 ? 7.383   -28.911 -23.336 0.50 23.16  ? 330  ARG A C     1 
ATOM   2631 C  C     B ARG A 1 330 ? 7.403   -28.909 -23.355 0.50 23.08  ? 330  ARG A C     1 
ATOM   2632 O  O     A ARG A 1 330 ? 7.216   -28.897 -24.555 0.50 24.96  ? 330  ARG A O     1 
ATOM   2633 O  O     B ARG A 1 330 ? 7.246   -28.881 -24.575 0.50 24.81  ? 330  ARG A O     1 
ATOM   2634 C  CB    A ARG A 1 330 ? 5.585   -29.882 -21.853 0.50 24.93  ? 330  ARG A CB    1 
ATOM   2635 C  CB    B ARG A 1 330 ? 5.585   -29.940 -21.951 0.50 24.58  ? 330  ARG A CB    1 
ATOM   2636 C  CG    A ARG A 1 330 ? 4.952   -31.117 -21.196 0.50 26.04  ? 330  ARG A CG    1 
ATOM   2637 C  CG    B ARG A 1 330 ? 4.975   -31.197 -21.341 0.50 26.55  ? 330  ARG A CG    1 
ATOM   2638 C  CD    A ARG A 1 330 ? 3.850   -31.707 -22.065 0.50 29.13  ? 330  ARG A CD    1 
ATOM   2639 C  CD    B ARG A 1 330 ? 4.726   -32.271 -22.392 0.50 29.04  ? 330  ARG A CD    1 
ATOM   2640 N  NE    A ARG A 1 330 ? 3.272   -32.942 -21.534 0.50 31.52  ? 330  ARG A NE    1 
ATOM   2641 N  NE    B ARG A 1 330 ? 3.900   -33.360 -21.875 0.50 29.93  ? 330  ARG A NE    1 
ATOM   2642 C  CZ    A ARG A 1 330 ? 2.063   -33.041 -20.984 0.50 28.86  ? 330  ARG A CZ    1 
ATOM   2643 C  CZ    B ARG A 1 330 ? 4.260   -34.640 -21.849 0.50 24.86  ? 330  ARG A CZ    1 
ATOM   2644 N  NH1   A ARG A 1 330 ? 1.281   -31.976 -20.871 0.50 19.96  ? 330  ARG A NH1   1 
ATOM   2645 N  NH1   B ARG A 1 330 ? 5.441   -35.019 -22.319 0.50 21.82  ? 330  ARG A NH1   1 
ATOM   2646 N  NH2   A ARG A 1 330 ? 1.630   -34.215 -20.546 0.50 33.69  ? 330  ARG A NH2   1 
ATOM   2647 N  NH2   B ARG A 1 330 ? 3.432   -35.546 -21.352 0.50 23.61  ? 330  ARG A NH2   1 
ATOM   2648 N  N     . VAL A 1 331 ? 7.945   -27.899 -22.682 1.00 21.93  ? 331  VAL A N     1 
ATOM   2649 C  CA    . VAL A 1 331 ? 8.413   -26.706 -23.384 1.00 22.14  ? 331  VAL A CA    1 
ATOM   2650 C  C     . VAL A 1 331 ? 9.595   -27.049 -24.290 1.00 22.12  ? 331  VAL A C     1 
ATOM   2651 O  O     . VAL A 1 331 ? 9.666   -26.595 -25.431 1.00 22.61  ? 331  VAL A O     1 
ATOM   2652 C  CB    . VAL A 1 331 ? 8.803   -25.563 -22.413 1.00 27.74  ? 331  VAL A CB    1 
ATOM   2653 C  CG1   . VAL A 1 331 ? 9.284   -24.349 -23.191 1.00 29.33  ? 331  VAL A CG1   1 
ATOM   2654 C  CG2   . VAL A 1 331 ? 7.628   -25.189 -21.531 1.00 28.86  ? 331  VAL A CG2   1 
ATOM   2655 N  N     . LEU A 1 332 ? 10.516  -27.865 -23.787 1.00 22.77  ? 332  LEU A N     1 
ATOM   2656 C  CA    . LEU A 1 332 ? 11.615  -28.352 -24.614 1.00 22.93  ? 332  LEU A CA    1 
ATOM   2657 C  C     . LEU A 1 332 ? 11.095  -29.102 -25.842 1.00 21.51  ? 332  LEU A C     1 
ATOM   2658 O  O     . LEU A 1 332 ? 11.612  -28.931 -26.945 1.00 23.51  ? 332  LEU A O     1 
ATOM   2659 C  CB    . LEU A 1 332 ? 12.553  -29.250 -23.800 1.00 24.20  ? 332  LEU A CB    1 
ATOM   2660 C  CG    . LEU A 1 332 ? 13.281  -28.536 -22.656 1.00 27.08  ? 332  LEU A CG    1 
ATOM   2661 C  CD1   . LEU A 1 332 ? 13.927  -29.555 -21.734 1.00 26.17  ? 332  LEU A CD1   1 
ATOM   2662 C  CD2   . LEU A 1 332 ? 14.320  -27.551 -23.204 1.00 26.62  ? 332  LEU A CD2   1 
ATOM   2663 N  N     . GLN A 1 333 ? 10.067  -29.925 -25.651 1.00 21.21  ? 333  GLN A N     1 
ATOM   2664 C  CA    . GLN A 1 333 ? 9.493   -30.690 -26.756 1.00 20.37  ? 333  GLN A CA    1 
ATOM   2665 C  C     . GLN A 1 333 ? 8.795   -29.786 -27.768 1.00 18.84  ? 333  GLN A C     1 
ATOM   2666 O  O     . GLN A 1 333 ? 8.872   -30.015 -28.972 1.00 20.34  ? 333  GLN A O     1 
ATOM   2667 C  CB    . GLN A 1 333 ? 8.501   -31.731 -26.240 1.00 22.48  ? 333  GLN A CB    1 
ATOM   2668 C  CG    . GLN A 1 333 ? 9.124   -32.859 -25.444 1.00 24.44  ? 333  GLN A CG    1 
ATOM   2669 C  CD    . GLN A 1 333 ? 8.079   -33.842 -24.951 1.00 30.40  ? 333  GLN A CD    1 
ATOM   2670 O  OE1   . GLN A 1 333 ? 7.932   -34.941 -25.491 1.00 36.58  ? 333  GLN A OE1   1 
ATOM   2671 N  NE2   . GLN A 1 333 ? 7.347   -33.450 -23.920 1.00 23.94  ? 333  GLN A NE2   1 
ATOM   2672 N  N     . ILE A 1 334 ? 8.100   -28.770 -27.273 1.00 19.81  ? 334  ILE A N     1 
ATOM   2673 C  CA    . ILE A 1 334 ? 7.448   -27.809 -28.154 1.00 23.76  ? 334  ILE A CA    1 
ATOM   2674 C  C     . ILE A 1 334 ? 8.489   -27.047 -28.970 1.00 23.90  ? 334  ILE A C     1 
ATOM   2675 O  O     . ILE A 1 334 ? 8.309   -26.823 -30.169 1.00 25.84  ? 334  ILE A O     1 
ATOM   2676 C  CB    . ILE A 1 334 ? 6.556   -26.824 -27.365 1.00 23.23  ? 334  ILE A CB    1 
ATOM   2677 C  CG1   . ILE A 1 334 ? 5.299   -27.543 -26.874 1.00 23.82  ? 334  ILE A CG1   1 
ATOM   2678 C  CG2   . ILE A 1 334 ? 6.177   -25.627 -28.229 1.00 19.99  ? 334  ILE A CG2   1 
ATOM   2679 C  CD1   . ILE A 1 334 ? 4.474   -26.742 -25.896 1.00 23.54  ? 334  ILE A CD1   1 
ATOM   2680 N  N     . ASP A 1 335 ? 9.584   -26.658 -28.323 1.00 23.09  ? 335  ASP A N     1 
ATOM   2681 C  CA    . ASP A 1 335 ? 10.652  -25.963 -29.031 1.00 23.19  ? 335  ASP A CA    1 
ATOM   2682 C  C     . ASP A 1 335 ? 11.375  -26.872 -30.022 1.00 27.05  ? 335  ASP A C     1 
ATOM   2683 O  O     . ASP A 1 335 ? 11.847  -26.408 -31.053 1.00 25.85  ? 335  ASP A O     1 
ATOM   2684 C  CB    . ASP A 1 335 ? 11.668  -25.347 -28.074 1.00 23.42  ? 335  ASP A CB    1 
ATOM   2685 C  CG    . ASP A 1 335 ? 12.650  -24.430 -28.791 1.00 31.45  ? 335  ASP A CG    1 
ATOM   2686 O  OD1   . ASP A 1 335 ? 12.191  -23.474 -29.450 1.00 28.05  ? 335  ASP A OD1   1 
ATOM   2687 O  OD2   . ASP A 1 335 ? 13.874  -24.672 -28.721 1.00 33.53  ? 335  ASP A OD2   1 
ATOM   2688 N  N     . ALA A 1 336 ? 11.475  -28.160 -29.710 1.00 27.51  ? 336  ALA A N     1 
ATOM   2689 C  CA    . ALA A 1 336 ? 12.113  -29.091 -30.635 1.00 27.74  ? 336  ALA A CA    1 
ATOM   2690 C  C     . ALA A 1 336 ? 11.301  -29.152 -31.926 1.00 26.90  ? 336  ALA A C     1 
ATOM   2691 O  O     . ALA A 1 336 ? 11.848  -29.315 -33.009 1.00 24.90  ? 336  ALA A O     1 
ATOM   2692 C  CB    . ALA A 1 336 ? 12.248  -30.474 -30.011 1.00 29.12  ? 336  ALA A CB    1 
ATOM   2693 N  N     . LYS A 1 337 ? 9.988   -29.002 -31.797 1.00 25.68  ? 337  LYS A N     1 
ATOM   2694 C  CA    . LYS A 1 337 ? 9.103   -28.977 -32.952 1.00 28.57  ? 337  LYS A CA    1 
ATOM   2695 C  C     . LYS A 1 337 ? 9.100   -27.611 -33.644 1.00 28.70  ? 337  LYS A C     1 
ATOM   2696 O  O     . LYS A 1 337 ? 9.402   -27.512 -34.832 1.00 30.01  ? 337  LYS A O     1 
ATOM   2697 C  CB    . LYS A 1 337 ? 7.684   -29.348 -32.531 1.00 25.49  ? 337  LYS A CB    1 
ATOM   2698 C  CG    . LYS A 1 337 ? 6.670   -29.272 -33.648 1.00 25.86  ? 337  LYS A CG    1 
ATOM   2699 C  CD    . LYS A 1 337 ? 5.261   -29.402 -33.090 1.00 31.25  ? 337  LYS A CD    1 
ATOM   2700 C  CE    . LYS A 1 337 ? 4.217   -29.369 -34.191 1.00 35.13  ? 337  LYS A CE    1 
ATOM   2701 N  NZ    . LYS A 1 337 ? 2.853   -29.301 -33.603 1.00 36.02  ? 337  LYS A NZ    1 
ATOM   2702 N  N     . ARG A 1 338 ? 8.766   -26.565 -32.892 1.00 22.61  ? 338  ARG A N     1 
ATOM   2703 C  CA    . ARG A 1 338 ? 8.590   -25.226 -33.455 1.00 24.18  ? 338  ARG A CA    1 
ATOM   2704 C  C     . ARG A 1 338 ? 9.895   -24.475 -33.728 1.00 26.24  ? 338  ARG A C     1 
ATOM   2705 O  O     . ARG A 1 338 ? 9.971   -23.694 -34.675 1.00 28.39  ? 338  ARG A O     1 
ATOM   2706 C  CB    . ARG A 1 338 ? 7.690   -24.382 -32.546 1.00 28.50  ? 338  ARG A CB    1 
ATOM   2707 C  CG    . ARG A 1 338 ? 6.241   -24.868 -32.473 1.00 30.37  ? 338  ARG A CG    1 
ATOM   2708 C  CD    . ARG A 1 338 ? 5.486   -24.656 -33.791 1.00 28.70  ? 338  ARG A CD    1 
ATOM   2709 N  NE    . ARG A 1 338 ? 4.043   -24.657 -33.562 1.00 30.87  ? 338  ARG A NE    1 
ATOM   2710 C  CZ    . ARG A 1 338 ? 3.172   -23.879 -34.202 1.00 30.73  ? 338  ARG A CZ    1 
ATOM   2711 N  NH1   . ARG A 1 338 ? 3.589   -23.027 -35.132 1.00 27.89  ? 338  ARG A NH1   1 
ATOM   2712 N  NH2   . ARG A 1 338 ? 1.880   -23.950 -33.905 1.00 26.05  ? 338  ARG A NH2   1 
ATOM   2713 N  N     . GLN A 1 339 ? 10.903  -24.694 -32.889 1.00 22.77  ? 339  GLN A N     1 
ATOM   2714 C  CA    . GLN A 1 339 ? 12.235  -24.105 -33.089 1.00 24.77  ? 339  GLN A CA    1 
ATOM   2715 C  C     . GLN A 1 339 ? 12.259  -22.570 -33.044 1.00 23.73  ? 339  GLN A C     1 
ATOM   2716 O  O     . GLN A 1 339 ? 12.910  -21.916 -33.866 1.00 25.28  ? 339  GLN A O     1 
ATOM   2717 C  CB    . GLN A 1 339 ? 12.877  -24.652 -34.374 1.00 26.34  ? 339  GLN A CB    1 
ATOM   2718 C  CG    . GLN A 1 339 ? 12.913  -26.173 -34.391 1.00 33.44  ? 339  GLN A CG    1 
ATOM   2719 C  CD    . GLN A 1 339 ? 13.522  -26.762 -35.653 1.00 42.01  ? 339  GLN A CD    1 
ATOM   2720 O  OE1   . GLN A 1 339 ? 13.597  -27.983 -35.799 1.00 45.86  ? 339  GLN A OE1   1 
ATOM   2721 N  NE2   . GLN A 1 339 ? 13.960  -25.903 -36.567 1.00 42.90  ? 339  GLN A NE2   1 
ATOM   2722 N  N     . PHE A 1 340 ? 11.567  -22.007 -32.058 1.00 22.74  ? 340  PHE A N     1 
ATOM   2723 C  CA    . PHE A 1 340 ? 11.514  -20.563 -31.875 1.00 25.27  ? 340  PHE A CA    1 
ATOM   2724 C  C     . PHE A 1 340 ? 12.781  -20.018 -31.216 1.00 27.93  ? 340  PHE A C     1 
ATOM   2725 O  O     . PHE A 1 340 ? 13.139  -18.856 -31.425 1.00 25.47  ? 340  PHE A O     1 
ATOM   2726 C  CB    . PHE A 1 340 ? 10.279  -20.167 -31.059 1.00 24.04  ? 340  PHE A CB    1 
ATOM   2727 C  CG    . PHE A 1 340 ? 8.974   -20.455 -31.753 1.00 24.89  ? 340  PHE A CG    1 
ATOM   2728 C  CD1   . PHE A 1 340 ? 8.917   -20.544 -33.137 1.00 24.54  ? 340  PHE A CD1   1 
ATOM   2729 C  CD2   . PHE A 1 340 ? 7.810   -20.647 -31.024 1.00 24.05  ? 340  PHE A CD2   1 
ATOM   2730 C  CE1   . PHE A 1 340 ? 7.724   -20.804 -33.782 1.00 25.04  ? 340  PHE A CE1   1 
ATOM   2731 C  CE2   . PHE A 1 340 ? 6.609   -20.911 -31.664 1.00 24.47  ? 340  PHE A CE2   1 
ATOM   2732 C  CZ    . PHE A 1 340 ? 6.566   -20.988 -33.042 1.00 25.44  ? 340  PHE A CZ    1 
ATOM   2733 N  N     . ILE A 1 341 ? 13.453  -20.844 -30.414 1.00 25.96  ? 341  ILE A N     1 
ATOM   2734 C  CA    . ILE A 1 341 ? 14.723  -20.427 -29.823 1.00 25.48  ? 341  ILE A CA    1 
ATOM   2735 C  C     . ILE A 1 341 ? 15.757  -20.259 -30.932 1.00 24.16  ? 341  ILE A C     1 
ATOM   2736 O  O     . ILE A 1 341 ? 16.441  -19.242 -31.007 1.00 24.88  ? 341  ILE A O     1 
ATOM   2737 C  CB    . ILE A 1 341 ? 15.247  -21.417 -28.759 1.00 26.53  ? 341  ILE A CB    1 
ATOM   2738 C  CG1   . ILE A 1 341 ? 14.285  -21.489 -27.574 1.00 29.87  ? 341  ILE A CG1   1 
ATOM   2739 C  CG2   . ILE A 1 341 ? 16.624  -20.990 -28.270 1.00 25.85  ? 341  ILE A CG2   1 
ATOM   2740 C  CD1   . ILE A 1 341 ? 14.100  -20.165 -26.873 1.00 31.32  ? 341  ILE A CD1   1 
ATOM   2741 N  N     . ASN A 1 342 ? 15.847  -21.257 -31.804 1.00 26.70  ? 342  ASN A N     1 
ATOM   2742 C  CA    . ASN A 1 342 ? 16.743  -21.192 -32.951 1.00 28.08  ? 342  ASN A CA    1 
ATOM   2743 C  C     . ASN A 1 342 ? 16.464  -19.968 -33.814 1.00 25.05  ? 342  ASN A C     1 
ATOM   2744 O  O     . ASN A 1 342 ? 17.386  -19.309 -34.296 1.00 26.34  ? 342  ASN A O     1 
ATOM   2745 C  CB    . ASN A 1 342 ? 16.628  -22.469 -33.789 1.00 28.40  ? 342  ASN A CB    1 
ATOM   2746 C  CG    . ASN A 1 342 ? 17.423  -22.394 -35.075 1.00 30.63  ? 342  ASN A CG    1 
ATOM   2747 O  OD1   . ASN A 1 342 ? 18.646  -22.507 -35.064 1.00 33.77  ? 342  ASN A OD1   1 
ATOM   2748 N  ND2   . ASN A 1 342 ? 16.730  -22.212 -36.193 1.00 32.85  ? 342  ASN A ND2   1 
ATOM   2749 N  N     . LEU A 1 343 ? 15.184  -19.664 -34.001 1.00 26.23  ? 343  LEU A N     1 
ATOM   2750 C  CA    . LEU A 1 343 ? 14.778  -18.504 -34.785 1.00 24.51  ? 343  LEU A CA    1 
ATOM   2751 C  C     . LEU A 1 343 ? 15.246  -17.201 -34.130 1.00 25.20  ? 343  LEU A C     1 
ATOM   2752 O  O     . LEU A 1 343 ? 15.741  -16.305 -34.804 1.00 26.75  ? 343  LEU A O     1 
ATOM   2753 C  CB    . LEU A 1 343 ? 13.257  -18.495 -34.958 1.00 27.63  ? 343  LEU A CB    1 
ATOM   2754 C  CG    . LEU A 1 343 ? 12.614  -17.220 -35.511 1.00 27.18  ? 343  LEU A CG    1 
ATOM   2755 C  CD1   . LEU A 1 343 ? 12.997  -17.022 -36.964 1.00 27.83  ? 343  LEU A CD1   1 
ATOM   2756 C  CD2   . LEU A 1 343 ? 11.096  -17.276 -35.346 1.00 24.62  ? 343  LEU A CD2   1 
ATOM   2757 N  N     . SER A 1 344 ? 15.094  -17.110 -32.813 1.00 23.84  ? 344  SER A N     1 
ATOM   2758 C  CA    . SER A 1 344 ? 15.479  -15.910 -32.077 1.00 27.29  ? 344  SER A CA    1 
ATOM   2759 C  C     . SER A 1 344 ? 16.981  -15.658 -32.152 1.00 28.26  ? 344  SER A C     1 
ATOM   2760 O  O     . SER A 1 344 ? 17.420  -14.523 -32.367 1.00 29.17  ? 344  SER A O     1 
ATOM   2761 C  CB    . SER A 1 344 ? 15.038  -16.020 -30.615 1.00 26.82  ? 344  SER A CB    1 
ATOM   2762 O  OG    . SER A 1 344 ? 13.628  -16.149 -30.523 1.00 24.54  ? 344  SER A OG    1 
ATOM   2763 N  N     . LEU A 1 345 ? 17.759  -16.721 -31.974 1.00 23.92  ? 345  LEU A N     1 
ATOM   2764 C  CA    . LEU A 1 345 ? 19.215  -16.648 -32.063 1.00 22.51  ? 345  LEU A CA    1 
ATOM   2765 C  C     . LEU A 1 345 ? 19.660  -16.222 -33.456 1.00 24.43  ? 345  LEU A C     1 
ATOM   2766 O  O     . LEU A 1 345 ? 20.494  -15.328 -33.598 1.00 25.24  ? 345  LEU A O     1 
ATOM   2767 C  CB    . LEU A 1 345 ? 19.837  -17.999 -31.703 1.00 23.64  ? 345  LEU A CB    1 
ATOM   2768 C  CG    . LEU A 1 345 ? 19.622  -18.451 -30.259 1.00 27.44  ? 345  LEU A CG    1 
ATOM   2769 C  CD1   . LEU A 1 345 ? 20.211  -19.845 -30.032 1.00 25.86  ? 345  LEU A CD1   1 
ATOM   2770 C  CD2   . LEU A 1 345 ? 20.221  -17.441 -29.289 1.00 26.48  ? 345  LEU A CD2   1 
ATOM   2771 N  N     . ASP A 1 346 ? 19.099  -16.867 -34.479 1.00 26.95  ? 346  ASP A N     1 
ATOM   2772 C  CA    . ASP A 1 346 ? 19.372  -16.509 -35.872 1.00 30.85  ? 346  ASP A CA    1 
ATOM   2773 C  C     . ASP A 1 346 ? 19.126  -15.029 -36.153 1.00 31.58  ? 346  ASP A C     1 
ATOM   2774 O  O     . ASP A 1 346 ? 20.010  -14.325 -36.636 1.00 31.98  ? 346  ASP A O     1 
ATOM   2775 C  CB    . ASP A 1 346 ? 18.509  -17.342 -36.821 1.00 35.88  ? 346  ASP A CB    1 
ATOM   2776 C  CG    . ASP A 1 346 ? 19.178  -18.632 -37.240 1.00 46.01  ? 346  ASP A CG    1 
ATOM   2777 O  OD1   . ASP A 1 346 ? 18.624  -19.331 -38.115 1.00 50.86  ? 346  ASP A OD1   1 
ATOM   2778 O  OD2   . ASP A 1 346 ? 20.263  -18.943 -36.705 1.00 51.08  ? 346  ASP A OD2   1 
ATOM   2779 N  N     . MET A 1 347 ? 17.915  -14.570 -35.855 1.00 26.52  ? 347  MET A N     1 
ATOM   2780 C  CA    . MET A 1 347 ? 17.532  -13.186 -36.099 1.00 26.44  ? 347  MET A CA    1 
ATOM   2781 C  C     . MET A 1 347 ? 18.373  -12.211 -35.290 1.00 25.27  ? 347  MET A C     1 
ATOM   2782 O  O     . MET A 1 347 ? 18.815  -11.187 -35.805 1.00 29.36  ? 347  MET A O     1 
ATOM   2783 C  CB    . MET A 1 347 ? 16.061  -12.970 -35.752 1.00 27.62  ? 347  MET A CB    1 
ATOM   2784 C  CG    . MET A 1 347 ? 15.072  -13.585 -36.722 1.00 36.49  ? 347  MET A CG    1 
ATOM   2785 S  SD    . MET A 1 347 ? 13.381  -13.120 -36.284 1.00 79.43  ? 347  MET A SD    1 
ATOM   2786 C  CE    . MET A 1 347 ? 13.590  -11.366 -35.942 1.00 28.91  ? 347  MET A CE    1 
ATOM   2787 N  N     . GLY A 1 348 ? 18.580  -12.533 -34.018 1.00 26.37  ? 348  GLY A N     1 
ATOM   2788 C  CA    . GLY A 1 348 ? 19.315  -11.661 -33.122 1.00 28.40  ? 348  GLY A CA    1 
ATOM   2789 C  C     . GLY A 1 348 ? 20.741  -11.425 -33.574 1.00 28.19  ? 348  GLY A C     1 
ATOM   2790 O  O     . GLY A 1 348 ? 21.205  -10.284 -33.620 1.00 27.26  ? 348  GLY A O     1 
ATOM   2791 N  N     . TYR A 1 349 ? 21.439  -12.506 -33.909 1.00 27.52  ? 349  TYR A N     1 
ATOM   2792 C  CA    . TYR A 1 349 ? 22.824  -12.406 -34.349 1.00 30.53  ? 349  TYR A CA    1 
ATOM   2793 C  C     . TYR A 1 349 ? 22.933  -11.796 -35.742 1.00 32.67  ? 349  TYR A C     1 
ATOM   2794 O  O     . TYR A 1 349 ? 23.920  -11.132 -36.057 1.00 32.56  ? 349  TYR A O     1 
ATOM   2795 C  CB    . TYR A 1 349 ? 23.519  -13.771 -34.298 1.00 29.94  ? 349  TYR A CB    1 
ATOM   2796 C  CG    . TYR A 1 349 ? 23.863  -14.221 -32.896 1.00 28.94  ? 349  TYR A CG    1 
ATOM   2797 C  CD1   . TYR A 1 349 ? 24.719  -13.473 -32.100 1.00 31.28  ? 349  TYR A CD1   1 
ATOM   2798 C  CD2   . TYR A 1 349 ? 23.341  -15.398 -32.371 1.00 26.32  ? 349  TYR A CD2   1 
ATOM   2799 C  CE1   . TYR A 1 349 ? 25.040  -13.879 -30.817 1.00 31.51  ? 349  TYR A CE1   1 
ATOM   2800 C  CE2   . TYR A 1 349 ? 23.656  -15.813 -31.092 1.00 27.61  ? 349  TYR A CE2   1 
ATOM   2801 C  CZ    . TYR A 1 349 ? 24.507  -15.049 -30.319 1.00 30.94  ? 349  TYR A CZ    1 
ATOM   2802 O  OH    . TYR A 1 349 ? 24.829  -15.453 -29.044 1.00 32.40  ? 349  TYR A OH    1 
ATOM   2803 N  N     . TYR A 1 350 ? 21.923  -12.028 -36.575 1.00 33.94  ? 350  TYR A N     1 
ATOM   2804 C  CA    . TYR A 1 350 ? 21.882  -11.420 -37.900 1.00 34.29  ? 350  TYR A CA    1 
ATOM   2805 C  C     . TYR A 1 350 ? 21.803  -9.898  -37.788 1.00 32.77  ? 350  TYR A C     1 
ATOM   2806 O  O     . TYR A 1 350 ? 22.499  -9.180  -38.499 1.00 35.26  ? 350  TYR A O     1 
ATOM   2807 C  CB    . TYR A 1 350 ? 20.696  -11.949 -38.713 1.00 31.89  ? 350  TYR A CB    1 
ATOM   2808 C  CG    . TYR A 1 350 ? 20.605  -11.361 -40.106 1.00 35.40  ? 350  TYR A CG    1 
ATOM   2809 C  CD1   . TYR A 1 350 ? 21.400  -11.847 -41.138 1.00 37.15  ? 350  TYR A CD1   1 
ATOM   2810 C  CD2   . TYR A 1 350 ? 19.728  -10.316 -40.389 1.00 36.08  ? 350  TYR A CD2   1 
ATOM   2811 C  CE1   . TYR A 1 350 ? 21.326  -11.313 -42.413 1.00 40.92  ? 350  TYR A CE1   1 
ATOM   2812 C  CE2   . TYR A 1 350 ? 19.645  -9.773  -41.667 1.00 35.65  ? 350  TYR A CE2   1 
ATOM   2813 C  CZ    . TYR A 1 350 ? 20.445  -10.278 -42.674 1.00 38.58  ? 350  TYR A CZ    1 
ATOM   2814 O  OH    . TYR A 1 350 ? 20.375  -9.755  -43.946 1.00 35.49  ? 350  TYR A OH    1 
ATOM   2815 N  N     . ALA A 1 351 ? 20.962  -9.420  -36.878 1.00 29.49  ? 351  ALA A N     1 
ATOM   2816 C  CA    . ALA A 1 351 ? 20.748  -7.990  -36.690 1.00 29.37  ? 351  ALA A CA    1 
ATOM   2817 C  C     . ALA A 1 351 ? 21.811  -7.331  -35.809 1.00 30.45  ? 351  ALA A C     1 
ATOM   2818 O  O     . ALA A 1 351 ? 22.004  -6.114  -35.873 1.00 27.68  ? 351  ALA A O     1 
ATOM   2819 C  CB    . ALA A 1 351 ? 19.356  -7.743  -36.111 1.00 28.13  ? 351  ALA A CB    1 
ATOM   2820 N  N     . LYS A 1 352 ? 22.497  -8.144  -35.004 1.00 30.15  ? 352  LYS A N     1 
ATOM   2821 C  CA    . LYS A 1 352 ? 23.419  -7.667  -33.966 1.00 27.64  ? 352  LYS A CA    1 
ATOM   2822 C  C     . LYS A 1 352 ? 22.698  -6.866  -32.879 1.00 30.04  ? 352  LYS A C     1 
ATOM   2823 O  O     . LYS A 1 352 ? 23.023  -5.707  -32.608 1.00 25.99  ? 352  LYS A O     1 
ATOM   2824 C  CB    . LYS A 1 352 ? 24.601  -6.898  -34.564 1.00 28.19  ? 352  LYS A CB    1 
ATOM   2825 C  CG    . LYS A 1 352 ? 25.560  -7.800  -35.331 1.00 32.09  ? 352  LYS A CG    1 
ATOM   2826 C  CD    . LYS A 1 352 ? 26.532  -7.009  -36.191 1.00 34.34  ? 352  LYS A CD    1 
ATOM   2827 C  CE    . LYS A 1 352 ? 27.322  -7.949  -37.088 1.00 31.16  ? 352  LYS A CE    1 
ATOM   2828 N  NZ    . LYS A 1 352 ? 28.223  -7.222  -38.020 1.00 34.87  ? 352  LYS A NZ    1 
ATOM   2829 N  N     . ILE A 1 353 ? 21.706  -7.511  -32.270 1.00 26.86  ? 353  ILE A N     1 
ATOM   2830 C  CA    . ILE A 1 353 ? 20.940  -6.932  -31.179 1.00 23.11  ? 353  ILE A CA    1 
ATOM   2831 C  C     . ILE A 1 353 ? 20.991  -7.852  -29.978 1.00 23.45  ? 353  ILE A C     1 
ATOM   2832 O  O     . ILE A 1 353 ? 21.472  -8.984  -30.077 1.00 25.59  ? 353  ILE A O     1 
ATOM   2833 C  CB    . ILE A 1 353 ? 19.456  -6.788  -31.558 1.00 25.64  ? 353  ILE A CB    1 
ATOM   2834 C  CG1   . ILE A 1 353 ? 18.944  -8.092  -32.174 1.00 29.60  ? 353  ILE A CG1   1 
ATOM   2835 C  CG2   . ILE A 1 353 ? 19.261  -5.641  -32.513 1.00 25.61  ? 353  ILE A CG2   1 
ATOM   2836 C  CD1   . ILE A 1 353 ? 17.453  -8.085  -32.485 1.00 31.11  ? 353  ILE A CD1   1 
ATOM   2837 N  N     . GLN A 1 354 ? 20.488  -7.364  -28.848 1.00 23.40  ? 354  GLN A N     1 
ATOM   2838 C  CA    . GLN A 1 354 ? 20.195  -8.230  -27.721 1.00 29.87  ? 354  GLN A CA    1 
ATOM   2839 C  C     . GLN A 1 354 ? 19.175  -9.244  -28.205 1.00 31.22  ? 354  GLN A C     1 
ATOM   2840 O  O     . GLN A 1 354 ? 18.221  -8.883  -28.903 1.00 27.05  ? 354  GLN A O     1 
ATOM   2841 C  CB    . GLN A 1 354 ? 19.606  -7.436  -26.556 1.00 27.53  ? 354  GLN A CB    1 
ATOM   2842 C  CG    . GLN A 1 354 ? 20.573  -6.468  -25.892 1.00 30.09  ? 354  GLN A CG    1 
ATOM   2843 C  CD    . GLN A 1 354 ? 19.938  -5.752  -24.715 1.00 35.71  ? 354  GLN A CD    1 
ATOM   2844 O  OE1   . GLN A 1 354 ? 20.513  -5.678  -23.630 1.00 38.77  ? 354  GLN A OE1   1 
ATOM   2845 N  NE2   . GLN A 1 354 ? 18.740  -5.227  -24.925 1.00 32.97  ? 354  GLN A NE2   1 
ATOM   2846 N  N     . ILE A 1 355 ? 19.375  -10.508 -27.844 1.00 29.44  ? 355  ILE A N     1 
ATOM   2847 C  CA    . ILE A 1 355 ? 18.499  -11.574 -28.327 1.00 26.70  ? 355  ILE A CA    1 
ATOM   2848 C  C     . ILE A 1 355 ? 17.020  -11.306 -28.012 1.00 25.28  ? 355  ILE A C     1 
ATOM   2849 O  O     . ILE A 1 355 ? 16.154  -11.574 -28.840 1.00 25.62  ? 355  ILE A O     1 
ATOM   2850 C  CB    . ILE A 1 355 ? 18.923  -12.964 -27.806 1.00 26.87  ? 355  ILE A CB    1 
ATOM   2851 C  CG1   . ILE A 1 355 ? 20.384  -13.250 -28.160 1.00 27.17  ? 355  ILE A CG1   1 
ATOM   2852 C  CG2   . ILE A 1 355 ? 18.026  -14.049 -28.396 1.00 28.84  ? 355  ILE A CG2   1 
ATOM   2853 C  CD1   . ILE A 1 355 ? 20.708  -13.048 -29.633 1.00 29.21  ? 355  ILE A CD1   1 
ATOM   2854 N  N     . GLN A 1 356 ? 16.727  -10.743 -26.841 1.00 25.48  ? 356  GLN A N     1 
ATOM   2855 C  CA    . GLN A 1 356 ? 15.327  -10.462 -26.493 1.00 26.06  ? 356  GLN A CA    1 
ATOM   2856 C  C     . GLN A 1 356 ? 14.680  -9.380  -27.365 1.00 27.93  ? 356  GLN A C     1 
ATOM   2857 O  O     . GLN A 1 356 ? 13.461  -9.205  -27.335 1.00 28.52  ? 356  GLN A O     1 
ATOM   2858 C  CB    . GLN A 1 356 ? 15.163  -10.107 -25.008 1.00 26.33  ? 356  GLN A CB    1 
ATOM   2859 C  CG    . GLN A 1 356 ? 15.842  -8.809  -24.578 1.00 25.12  ? 356  GLN A CG    1 
ATOM   2860 C  CD    . GLN A 1 356 ? 17.253  -9.034  -24.072 1.00 30.86  ? 356  GLN A CD    1 
ATOM   2861 O  OE1   . GLN A 1 356 ? 17.961  -9.928  -24.547 1.00 29.24  ? 356  GLN A OE1   1 
ATOM   2862 N  NE2   . GLN A 1 356 ? 17.669  -8.228  -23.095 1.00 28.12  ? 356  GLN A NE2   1 
ATOM   2863 N  N     . SER A 1 357 ? 15.487  -8.660  -28.140 1.00 26.37  ? 357  SER A N     1 
ATOM   2864 C  CA    . SER A 1 357 ? 14.956  -7.623  -29.027 1.00 26.89  ? 357  SER A CA    1 
ATOM   2865 C  C     . SER A 1 357 ? 14.296  -8.197  -30.280 1.00 28.71  ? 357  SER A C     1 
ATOM   2866 O  O     . SER A 1 357 ? 13.753  -7.450  -31.095 1.00 29.17  ? 357  SER A O     1 
ATOM   2867 C  CB    . SER A 1 357 ? 16.036  -6.610  -29.418 1.00 27.00  ? 357  SER A CB    1 
ATOM   2868 O  OG    . SER A 1 357 ? 16.411  -5.809  -28.311 1.00 31.22  ? 357  SER A OG    1 
ATOM   2869 N  N     . VAL A 1 358 ? 14.315  -9.519  -30.435 1.00 26.49  ? 358  VAL A N     1 
ATOM   2870 C  CA    . VAL A 1 358 ? 13.602  -10.123 -31.558 1.00 26.59  ? 358  VAL A CA    1 
ATOM   2871 C  C     . VAL A 1 358 ? 12.081  -9.922  -31.455 1.00 24.18  ? 358  VAL A C     1 
ATOM   2872 O  O     . VAL A 1 358 ? 11.372  -10.074 -32.444 1.00 24.80  ? 358  VAL A O     1 
ATOM   2873 C  CB    . VAL A 1 358 ? 13.932  -11.618 -31.748 1.00 29.57  ? 358  VAL A CB    1 
ATOM   2874 C  CG1   . VAL A 1 358 ? 15.438  -11.805 -31.974 1.00 30.28  ? 358  VAL A CG1   1 
ATOM   2875 C  CG2   . VAL A 1 358 ? 13.430  -12.440 -30.560 1.00 27.74  ? 358  VAL A CG2   1 
ATOM   2876 N  N     . PHE A 1 359 ? 11.585  -9.574  -30.268 1.00 21.36  ? 359  PHE A N     1 
ATOM   2877 C  CA    . PHE A 1 359 ? 10.164  -9.264  -30.099 1.00 24.29  ? 359  PHE A CA    1 
ATOM   2878 C  C     . PHE A 1 359 ? 9.796   -7.916  -30.715 1.00 26.11  ? 359  PHE A C     1 
ATOM   2879 O  O     . PHE A 1 359 ? 8.622   -7.609  -30.884 1.00 29.41  ? 359  PHE A O     1 
ATOM   2880 C  CB    . PHE A 1 359 ? 9.760   -9.276  -28.620 1.00 27.75  ? 359  PHE A CB    1 
ATOM   2881 C  CG    . PHE A 1 359 ? 9.746   -10.644 -28.010 1.00 28.89  ? 359  PHE A CG    1 
ATOM   2882 C  CD1   . PHE A 1 359 ? 8.849   -11.602 -28.455 1.00 25.52  ? 359  PHE A CD1   1 
ATOM   2883 C  CD2   . PHE A 1 359 ? 10.624  -10.972 -26.990 1.00 27.13  ? 359  PHE A CD2   1 
ATOM   2884 C  CE1   . PHE A 1 359 ? 8.833   -12.863 -27.899 1.00 28.23  ? 359  PHE A CE1   1 
ATOM   2885 C  CE2   . PHE A 1 359 ? 10.614  -12.235 -26.426 1.00 26.72  ? 359  PHE A CE2   1 
ATOM   2886 C  CZ    . PHE A 1 359 ? 9.718   -13.182 -26.881 1.00 25.82  ? 359  PHE A CZ    1 
ATOM   2887 N  N     . SER A 1 360 ? 10.808  -7.117  -31.044 1.00 24.08  ? 360  SER A N     1 
ATOM   2888 C  CA    . SER A 1 360 ? 10.593  -5.792  -31.611 1.00 25.45  ? 360  SER A CA    1 
ATOM   2889 C  C     . SER A 1 360 ? 11.180  -5.697  -33.013 1.00 23.56  ? 360  SER A C     1 
ATOM   2890 O  O     . SER A 1 360 ? 12.392  -5.558  -33.175 1.00 23.86  ? 360  SER A O     1 
ATOM   2891 C  CB    . SER A 1 360 ? 11.216  -4.720  -30.708 1.00 24.64  ? 360  SER A CB    1 
ATOM   2892 O  OG    . SER A 1 360 ? 11.262  -3.463  -31.363 1.00 24.61  ? 360  SER A OG    1 
ATOM   2893 N  N     . PRO A 1 361 ? 10.322  -5.782  -34.037 1.00 25.26  ? 361  PRO A N     1 
ATOM   2894 C  CA    . PRO A 1 361 ? 10.797  -5.640  -35.417 1.00 24.74  ? 361  PRO A CA    1 
ATOM   2895 C  C     . PRO A 1 361 ? 11.381  -4.252  -35.675 1.00 25.61  ? 361  PRO A C     1 
ATOM   2896 O  O     . PRO A 1 361 ? 12.250  -4.104  -36.531 1.00 24.92  ? 361  PRO A O     1 
ATOM   2897 C  CB    . PRO A 1 361 ? 9.531   -5.857  -36.251 1.00 23.48  ? 361  PRO A CB    1 
ATOM   2898 C  CG    . PRO A 1 361 ? 8.390   -5.567  -35.313 1.00 23.21  ? 361  PRO A CG    1 
ATOM   2899 C  CD    . PRO A 1 361 ? 8.873   -6.035  -33.970 1.00 27.37  ? 361  PRO A CD    1 
ATOM   2900 N  N     . ILE A 1 362 ? 10.925  -3.250  -34.933 1.00 27.46  ? 362  ILE A N     1 
ATOM   2901 C  CA    . ILE A 1 362 ? 11.459  -1.902  -35.105 1.00 26.99  ? 362  ILE A CA    1 
ATOM   2902 C  C     . ILE A 1 362 ? 12.908  -1.814  -34.631 1.00 25.88  ? 362  ILE A C     1 
ATOM   2903 O  O     . ILE A 1 362 ? 13.772  -1.304  -35.349 1.00 29.35  ? 362  ILE A O     1 
ATOM   2904 C  CB    . ILE A 1 362 ? 10.576  -0.850  -34.423 1.00 29.31  ? 362  ILE A CB    1 
ATOM   2905 C  CG1   . ILE A 1 362 ? 9.299   -0.653  -35.245 1.00 28.90  ? 362  ILE A CG1   1 
ATOM   2906 C  CG2   . ILE A 1 362 ? 11.325  0.475   -34.270 1.00 27.55  ? 362  ILE A CG2   1 
ATOM   2907 C  CD1   . ILE A 1 362 ? 8.305   0.262   -34.602 1.00 36.36  ? 362  ILE A CD1   1 
ATOM   2908 N  N     . LYS A 1 363 ? 13.181  -2.329  -33.436 1.00 21.99  ? 363  LYS A N     1 
ATOM   2909 C  CA    . LYS A 1 363 ? 14.556  -2.382  -32.946 1.00 23.59  ? 363  LYS A CA    1 
ATOM   2910 C  C     . LYS A 1 363 ? 15.425  -3.227  -33.878 1.00 24.26  ? 363  LYS A C     1 
ATOM   2911 O  O     . LYS A 1 363 ? 16.566  -2.873  -34.169 1.00 24.18  ? 363  LYS A O     1 
ATOM   2912 C  CB    . LYS A 1 363 ? 14.608  -2.942  -31.523 1.00 23.89  ? 363  LYS A CB    1 
ATOM   2913 C  CG    . LYS A 1 363 ? 16.019  -3.146  -30.989 1.00 33.22  ? 363  LYS A CG    1 
ATOM   2914 C  CD    . LYS A 1 363 ? 16.802  -1.838  -30.907 1.00 38.34  ? 363  LYS A CD    1 
ATOM   2915 C  CE    . LYS A 1 363 ? 16.314  -0.964  -29.763 1.00 40.33  ? 363  LYS A CE    1 
ATOM   2916 N  NZ    . LYS A 1 363 ? 17.226  0.190   -29.514 1.00 42.33  ? 363  LYS A NZ    1 
ATOM   2917 N  N     . THR A 1 364 ? 14.867  -4.339  -34.346 1.00 23.73  ? 364  THR A N     1 
ATOM   2918 C  CA    . THR A 1 364 ? 15.583  -5.262  -35.219 1.00 23.31  ? 364  THR A CA    1 
ATOM   2919 C  C     . THR A 1 364 ? 16.011  -4.600  -36.525 1.00 28.74  ? 364  THR A C     1 
ATOM   2920 O  O     . THR A 1 364 ? 17.159  -4.731  -36.946 1.00 29.70  ? 364  THR A O     1 
ATOM   2921 C  CB    . THR A 1 364 ? 14.729  -6.508  -35.539 1.00 25.23  ? 364  THR A CB    1 
ATOM   2922 O  OG1   . THR A 1 364 ? 14.405  -7.196  -34.321 1.00 25.66  ? 364  THR A OG1   1 
ATOM   2923 C  CG2   . THR A 1 364 ? 15.481  -7.455  -36.466 1.00 24.32  ? 364  THR A CG2   1 
ATOM   2924 N  N     . TRP A 1 365 ? 15.087  -3.891  -37.166 1.00 28.26  ? 365  TRP A N     1 
ATOM   2925 C  CA    . TRP A 1 365 ? 15.392  -3.233  -38.433 1.00 28.79  ? 365  TRP A CA    1 
ATOM   2926 C  C     . TRP A 1 365 ? 16.290  -2.012  -38.271 1.00 26.98  ? 365  TRP A C     1 
ATOM   2927 O  O     . TRP A 1 365 ? 17.144  -1.755  -39.122 1.00 28.14  ? 365  TRP A O     1 
ATOM   2928 C  CB    . TRP A 1 365 ? 14.116  -2.873  -39.197 1.00 25.99  ? 365  TRP A CB    1 
ATOM   2929 C  CG    . TRP A 1 365 ? 13.555  -4.040  -39.947 1.00 24.96  ? 365  TRP A CG    1 
ATOM   2930 C  CD1   . TRP A 1 365 ? 12.369  -4.669  -39.722 1.00 24.05  ? 365  TRP A CD1   1 
ATOM   2931 C  CD2   . TRP A 1 365 ? 14.178  -4.733  -41.038 1.00 25.21  ? 365  TRP A CD2   1 
ATOM   2932 N  NE1   . TRP A 1 365 ? 12.210  -5.709  -40.612 1.00 23.79  ? 365  TRP A NE1   1 
ATOM   2933 C  CE2   . TRP A 1 365 ? 13.306  -5.765  -41.430 1.00 22.98  ? 365  TRP A CE2   1 
ATOM   2934 C  CE3   . TRP A 1 365 ? 15.387  -4.575  -41.723 1.00 26.31  ? 365  TRP A CE3   1 
ATOM   2935 C  CZ2   . TRP A 1 365 ? 13.602  -6.636  -42.478 1.00 24.46  ? 365  TRP A CZ2   1 
ATOM   2936 C  CZ3   . TRP A 1 365 ? 15.678  -5.436  -42.763 1.00 27.98  ? 365  TRP A CZ3   1 
ATOM   2937 C  CH2   . TRP A 1 365 ? 14.789  -6.456  -43.129 1.00 28.47  ? 365  TRP A CH2   1 
ATOM   2938 N  N     . ASP A 1 366 ? 16.098  -1.269  -37.183 1.00 27.34  ? 366  ASP A N     1 
ATOM   2939 C  CA    . ASP A 1 366 ? 16.976  -0.145  -36.868 1.00 29.06  ? 366  ASP A CA    1 
ATOM   2940 C  C     . ASP A 1 366 ? 18.426  -0.619  -36.831 1.00 30.37  ? 366  ASP A C     1 
ATOM   2941 O  O     . ASP A 1 366 ? 19.316  0.022   -37.396 1.00 29.50  ? 366  ASP A O     1 
ATOM   2942 C  CB    . ASP A 1 366 ? 16.596  0.488   -35.526 1.00 28.21  ? 366  ASP A CB    1 
ATOM   2943 C  CG    . ASP A 1 366 ? 17.221  1.865   -35.331 1.00 34.75  ? 366  ASP A CG    1 
ATOM   2944 O  OD1   . ASP A 1 366 ? 17.275  2.636   -36.313 1.00 33.18  ? 366  ASP A OD1   1 
ATOM   2945 O  OD2   . ASP A 1 366 ? 17.664  2.173   -34.200 1.00 34.67  ? 366  ASP A OD2   1 
ATOM   2946 N  N     . ALA A 1 367 ? 18.653  -1.762  -36.190 1.00 29.49  ? 367  ALA A N     1 
ATOM   2947 C  CA    . ALA A 1 367 ? 20.000  -2.302  -36.054 1.00 28.44  ? 367  ALA A CA    1 
ATOM   2948 C  C     . ALA A 1 367 ? 20.555  -2.826  -37.371 1.00 28.11  ? 367  ALA A C     1 
ATOM   2949 O  O     . ALA A 1 367 ? 21.736  -2.645  -37.666 1.00 28.36  ? 367  ALA A O     1 
ATOM   2950 C  CB    . ALA A 1 367 ? 20.024  -3.397  -35.009 1.00 27.09  ? 367  ALA A CB    1 
ATOM   2951 N  N     . ILE A 1 368 ? 19.709  -3.491  -38.153 1.00 28.95  ? 368  ILE A N     1 
ATOM   2952 C  CA    . ILE A 1 368 ? 20.134  -4.021  -39.448 1.00 29.30  ? 368  ILE A CA    1 
ATOM   2953 C  C     . ILE A 1 368 ? 20.539  -2.885  -40.384 1.00 26.90  ? 368  ILE A C     1 
ATOM   2954 O  O     . ILE A 1 368 ? 21.610  -2.912  -40.989 1.00 28.09  ? 368  ILE A O     1 
ATOM   2955 C  CB    . ILE A 1 368 ? 19.030  -4.879  -40.105 1.00 27.84  ? 368  ILE A CB    1 
ATOM   2956 C  CG1   . ILE A 1 368 ? 18.834  -6.182  -39.325 1.00 31.96  ? 368  ILE A CG1   1 
ATOM   2957 C  CG2   . ILE A 1 368 ? 19.388  -5.194  -41.544 1.00 26.47  ? 368  ILE A CG2   1 
ATOM   2958 C  CD1   . ILE A 1 368 ? 17.676  -7.037  -39.813 1.00 30.82  ? 368  ILE A CD1   1 
ATOM   2959 N  N     . ILE A 1 369 ? 19.684  -1.873  -40.478 1.00 27.01  ? 369  ILE A N     1 
ATOM   2960 C  CA    . ILE A 1 369 ? 19.952  -0.724  -41.332 1.00 27.74  ? 369  ILE A CA    1 
ATOM   2961 C  C     . ILE A 1 369 ? 21.178  0.054   -40.847 1.00 31.54  ? 369  ILE A C     1 
ATOM   2962 O  O     . ILE A 1 369 ? 22.028  0.447   -41.650 1.00 34.09  ? 369  ILE A O     1 
ATOM   2963 C  CB    . ILE A 1 369 ? 18.714  0.193   -41.428 1.00 25.08  ? 369  ILE A CB    1 
ATOM   2964 C  CG1   . ILE A 1 369 ? 17.584  -0.539  -42.159 1.00 27.14  ? 369  ILE A CG1   1 
ATOM   2965 C  CG2   . ILE A 1 369 ? 19.057  1.489   -42.145 1.00 25.21  ? 369  ILE A CG2   1 
ATOM   2966 C  CD1   . ILE A 1 369 ? 16.205  0.082   -41.961 1.00 30.67  ? 369  ILE A CD1   1 
ATOM   2967 N  N     . PHE A 1 370 ? 21.273  0.259   -39.534 1.00 34.00  ? 370  PHE A N     1 
ATOM   2968 C  CA    . PHE A 1 370 ? 22.423  0.944   -38.942 1.00 32.67  ? 370  PHE A CA    1 
ATOM   2969 C  C     . PHE A 1 370 ? 23.733  0.248   -39.304 1.00 30.31  ? 370  PHE A C     1 
ATOM   2970 O  O     . PHE A 1 370 ? 24.688  0.898   -39.709 1.00 29.94  ? 370  PHE A O     1 
ATOM   2971 C  CB    . PHE A 1 370 ? 22.281  1.055   -37.417 1.00 31.74  ? 370  PHE A CB    1 
ATOM   2972 C  CG    . PHE A 1 370 ? 23.591  1.226   -36.697 1.00 32.62  ? 370  PHE A CG    1 
ATOM   2973 C  CD1   . PHE A 1 370 ? 24.338  2.385   -36.849 1.00 32.97  ? 370  PHE A CD1   1 
ATOM   2974 C  CD2   . PHE A 1 370 ? 24.079  0.225   -35.873 1.00 32.53  ? 370  PHE A CD2   1 
ATOM   2975 C  CE1   . PHE A 1 370 ? 25.548  2.540   -36.195 1.00 35.22  ? 370  PHE A CE1   1 
ATOM   2976 C  CE2   . PHE A 1 370 ? 25.287  0.374   -35.214 1.00 35.41  ? 370  PHE A CE2   1 
ATOM   2977 C  CZ    . PHE A 1 370 ? 26.025  1.533   -35.377 1.00 36.41  ? 370  PHE A CZ    1 
ATOM   2978 N  N     . ASN A 1 371 ? 23.776  -1.072  -39.160 1.00 31.27  ? 371  ASN A N     1 
ATOM   2979 C  CA    . ASN A 1 371 ? 24.978  -1.815  -39.518 1.00 33.72  ? 371  ASN A CA    1 
ATOM   2980 C  C     . ASN A 1 371 ? 25.304  -1.720  -41.004 1.00 36.46  ? 371  ASN A C     1 
ATOM   2981 O  O     . ASN A 1 371 ? 26.468  -1.605  -41.384 1.00 37.77  ? 371  ASN A O     1 
ATOM   2982 C  CB    . ASN A 1 371 ? 24.876  -3.276  -39.079 1.00 34.28  ? 371  ASN A CB    1 
ATOM   2983 C  CG    . ASN A 1 371 ? 25.193  -3.458  -37.614 1.00 34.78  ? 371  ASN A CG    1 
ATOM   2984 O  OD1   . ASN A 1 371 ? 26.360  -3.481  -37.223 1.00 37.60  ? 371  ASN A OD1   1 
ATOM   2985 N  ND2   . ASN A 1 371 ? 24.156  -3.572  -36.790 1.00 29.20  ? 371  ASN A ND2   1 
ATOM   2986 N  N     . SER A 1 372 ? 24.271  -1.758  -41.838 1.00 35.89  ? 372  SER A N     1 
ATOM   2987 C  CA    . SER A 1 372 ? 24.453  -1.663  -43.280 1.00 40.16  ? 372  SER A CA    1 
ATOM   2988 C  C     . SER A 1 372 ? 25.025  -0.303  -43.672 1.00 38.72  ? 372  SER A C     1 
ATOM   2989 O  O     . SER A 1 372 ? 25.942  -0.214  -44.481 1.00 41.11  ? 372  SER A O     1 
ATOM   2990 C  CB    . SER A 1 372 ? 23.120  -1.891  -43.996 1.00 42.26  ? 372  SER A CB    1 
ATOM   2991 O  OG    . SER A 1 372 ? 23.305  -1.970  -45.399 1.00 47.27  ? 372  SER A OG    1 
ATOM   2992 N  N     . LEU A 1 373 ? 24.475  0.754   -43.088 1.00 39.20  ? 373  LEU A N     1 
ATOM   2993 C  CA    . LEU A 1 373 ? 24.909  2.112   -43.394 1.00 37.09  ? 373  LEU A CA    1 
ATOM   2994 C  C     . LEU A 1 373 ? 26.303  2.388   -42.846 1.00 35.50  ? 373  LEU A C     1 
ATOM   2995 O  O     . LEU A 1 373 ? 27.118  3.044   -43.498 1.00 33.67  ? 373  LEU A O     1 
ATOM   2996 C  CB    . LEU A 1 373 ? 23.907  3.126   -42.847 1.00 34.94  ? 373  LEU A CB    1 
ATOM   2997 C  CG    . LEU A 1 373 ? 22.595  3.205   -43.622 1.00 35.69  ? 373  LEU A CG    1 
ATOM   2998 C  CD1   . LEU A 1 373 ? 21.601  4.098   -42.904 1.00 35.02  ? 373  LEU A CD1   1 
ATOM   2999 C  CD2   . LEU A 1 373 ? 22.864  3.714   -45.031 1.00 39.15  ? 373  LEU A CD2   1 
ATOM   3000 N  N     . LYS A 1 374 ? 26.572  1.883   -41.646 1.00 37.68  ? 374  LYS A N     1 
ATOM   3001 C  CA    . LYS A 1 374 ? 27.888  2.031   -41.036 1.00 43.75  ? 374  LYS A CA    1 
ATOM   3002 C  C     . LYS A 1 374 ? 28.991  1.456   -41.921 1.00 47.04  ? 374  LYS A C     1 
ATOM   3003 O  O     . LYS A 1 374 ? 30.101  1.995   -41.970 1.00 46.65  ? 374  LYS A O     1 
ATOM   3004 C  CB    . LYS A 1 374 ? 27.928  1.364   -39.658 1.00 46.35  ? 374  LYS A CB    1 
ATOM   3005 C  CG    . LYS A 1 374 ? 29.302  1.420   -39.013 1.00 49.20  ? 374  LYS A CG    1 
ATOM   3006 C  CD    . LYS A 1 374 ? 29.359  0.654   -37.717 1.00 47.13  ? 374  LYS A CD    1 
ATOM   3007 C  CE    . LYS A 1 374 ? 30.796  0.511   -37.250 1.00 50.42  ? 374  LYS A CE    1 
ATOM   3008 N  NZ    . LYS A 1 374 ? 30.907  -0.409  -36.092 1.00 57.54  ? 374  LYS A NZ    1 
ATOM   3009 N  N     . GLU A 1 375 ? 28.679  0.372   -42.628 1.00 47.13  ? 375  GLU A N     1 
ATOM   3010 C  CA    . GLU A 1 375 ? 29.653  -0.279  -43.504 1.00 51.70  ? 375  GLU A CA    1 
ATOM   3011 C  C     . GLU A 1 375 ? 30.160  0.645   -44.603 1.00 49.06  ? 375  GLU A C     1 
ATOM   3012 O  O     . GLU A 1 375 ? 31.270  0.469   -45.100 1.00 49.76  ? 375  GLU A O     1 
ATOM   3013 C  CB    . GLU A 1 375 ? 29.067  -1.543  -44.139 1.00 58.26  ? 375  GLU A CB    1 
ATOM   3014 C  CG    . GLU A 1 375 ? 28.882  -2.700  -43.175 1.00 67.31  ? 375  GLU A CG    1 
ATOM   3015 C  CD    . GLU A 1 375 ? 30.201  -3.227  -42.648 1.00 79.01  ? 375  GLU A CD    1 
ATOM   3016 O  OE1   . GLU A 1 375 ? 31.224  -3.078  -43.351 1.00 84.31  ? 375  GLU A OE1   1 
ATOM   3017 O  OE2   . GLU A 1 375 ? 30.215  -3.796  -41.535 1.00 82.87  ? 375  GLU A OE2   1 
ATOM   3018 N  N     . GLN A 1 376 ? 29.345  1.625   -44.982 1.00 43.23  ? 376  GLN A N     1 
ATOM   3019 C  CA    . GLN A 1 376 ? 29.723  2.571   -46.027 1.00 45.52  ? 376  GLN A CA    1 
ATOM   3020 C  C     . GLN A 1 376 ? 30.114  3.922   -45.439 1.00 46.34  ? 376  GLN A C     1 
ATOM   3021 O  O     . GLN A 1 376 ? 30.129  4.927   -46.147 1.00 47.31  ? 376  GLN A O     1 
ATOM   3022 C  CB    . GLN A 1 376 ? 28.575  2.763   -47.020 1.00 48.62  ? 376  GLN A CB    1 
ATOM   3023 C  CG    . GLN A 1 376 ? 27.878  1.475   -47.423 1.00 52.12  ? 376  GLN A CG    1 
ATOM   3024 C  CD    . GLN A 1 376 ? 26.637  1.724   -48.263 1.00 57.03  ? 376  GLN A CD    1 
ATOM   3025 O  OE1   . GLN A 1 376 ? 25.546  1.277   -47.919 1.00 58.82  ? 376  GLN A OE1   1 
ATOM   3026 N  NE2   . GLN A 1 376 ? 26.800  2.445   -49.368 1.00 61.18  ? 376  GLN A NE2   1 
ATOM   3027 N  N     . ASN A 1 377 ? 30.424  3.936   -44.146 1.00 46.36  ? 377  ASN A N     1 
ATOM   3028 C  CA    . ASN A 1 377 ? 30.753  5.168   -43.426 1.00 47.63  ? 377  ASN A CA    1 
ATOM   3029 C  C     . ASN A 1 377 ? 29.625  6.196   -43.460 1.00 46.81  ? 377  ASN A C     1 
ATOM   3030 O  O     . ASN A 1 377 ? 29.870  7.400   -43.388 1.00 48.08  ? 377  ASN A O     1 
ATOM   3031 C  CB    . ASN A 1 377 ? 32.056  5.788   -43.944 1.00 49.84  ? 377  ASN A CB    1 
ATOM   3032 C  CG    . ASN A 1 377 ? 33.266  4.922   -43.660 1.00 52.18  ? 377  ASN A CG    1 
ATOM   3033 O  OD1   . ASN A 1 377 ? 33.333  4.247   -42.634 1.00 52.22  ? 377  ASN A OD1   1 
ATOM   3034 N  ND2   . ASN A 1 377 ? 34.231  4.937   -44.572 1.00 56.25  ? 377  ASN A ND2   1 
ATOM   3035 N  N     . LYS A 1 378 ? 28.391  5.718   -43.575 1.00 44.84  ? 378  LYS A N     1 
ATOM   3036 C  CA    . LYS A 1 378 ? 27.241  6.607   -43.600 1.00 42.95  ? 378  LYS A CA    1 
ATOM   3037 C  C     . LYS A 1 378 ? 26.665  6.785   -42.202 1.00 41.64  ? 378  LYS A C     1 
ATOM   3038 O  O     . LYS A 1 378 ? 26.838  5.930   -41.335 1.00 41.68  ? 378  LYS A O     1 
ATOM   3039 C  CB    . LYS A 1 378 ? 26.186  6.103   -44.587 1.00 44.33  ? 378  LYS A CB    1 
ATOM   3040 C  CG    . LYS A 1 378 ? 26.650  6.179   -46.032 1.00 49.15  ? 378  LYS A CG    1 
ATOM   3041 C  CD    . LYS A 1 378 ? 25.642  5.581   -46.995 1.00 54.54  ? 378  LYS A CD    1 
ATOM   3042 C  CE    . LYS A 1 378 ? 26.103  5.762   -48.437 1.00 59.73  ? 378  LYS A CE    1 
ATOM   3043 N  NZ    . LYS A 1 378 ? 25.157  5.150   -49.411 1.00 62.69  ? 378  LYS A NZ    1 
ATOM   3044 N  N     . VAL A 1 379 ? 25.984  7.907   -41.993 1.00 38.29  ? 379  VAL A N     1 
ATOM   3045 C  CA    . VAL A 1 379 ? 25.525  8.300   -40.667 1.00 35.74  ? 379  VAL A CA    1 
ATOM   3046 C  C     . VAL A 1 379 ? 24.001  8.351   -40.598 1.00 35.73  ? 379  VAL A C     1 
ATOM   3047 O  O     . VAL A 1 379 ? 23.363  9.032   -41.401 1.00 33.60  ? 379  VAL A O     1 
ATOM   3048 C  CB    . VAL A 1 379 ? 26.107  9.678   -40.280 1.00 36.36  ? 379  VAL A CB    1 
ATOM   3049 C  CG1   . VAL A 1 379 ? 25.641  10.085  -38.900 1.00 38.56  ? 379  VAL A CG1   1 
ATOM   3050 C  CG2   . VAL A 1 379 ? 27.630  9.642   -40.343 1.00 34.37  ? 379  VAL A CG2   1 
ATOM   3051 N  N     . ILE A 1 380 ? 23.422  7.631   -39.639 1.00 33.31  ? 380  ILE A N     1 
ATOM   3052 C  CA    . ILE A 1 380 ? 21.970  7.539   -39.523 1.00 31.77  ? 380  ILE A CA    1 
ATOM   3053 C  C     . ILE A 1 380 ? 21.372  8.817   -38.942 1.00 30.56  ? 380  ILE A C     1 
ATOM   3054 O  O     . ILE A 1 380 ? 22.022  9.513   -38.158 1.00 31.88  ? 380  ILE A O     1 
ATOM   3055 C  CB    . ILE A 1 380 ? 21.532  6.316   -38.676 1.00 35.55  ? 380  ILE A CB    1 
ATOM   3056 C  CG1   . ILE A 1 380 ? 21.873  6.518   -37.197 1.00 34.00  ? 380  ILE A CG1   1 
ATOM   3057 C  CG2   . ILE A 1 380 ? 22.153  5.036   -39.217 1.00 35.71  ? 380  ILE A CG2   1 
ATOM   3058 C  CD1   . ILE A 1 380 ? 21.499  5.334   -36.330 1.00 31.39  ? 380  ILE A CD1   1 
ATOM   3059 N  N     . PRO A 1 381 ? 20.129  9.135   -39.336 1.00 30.42  ? 381  PRO A N     1 
ATOM   3060 C  CA    . PRO A 1 381 ? 19.482  10.361  -38.856 1.00 29.11  ? 381  PRO A CA    1 
ATOM   3061 C  C     . PRO A 1 381 ? 19.023  10.220  -37.412 1.00 31.70  ? 381  PRO A C     1 
ATOM   3062 O  O     . PRO A 1 381 ? 18.927  9.102   -36.904 1.00 29.91  ? 381  PRO A O     1 
ATOM   3063 C  CB    . PRO A 1 381 ? 18.271  10.495  -39.782 1.00 29.20  ? 381  PRO A CB    1 
ATOM   3064 C  CG    . PRO A 1 381 ? 17.958  9.096   -40.178 1.00 27.56  ? 381  PRO A CG    1 
ATOM   3065 C  CD    . PRO A 1 381 ? 19.292  8.420   -40.316 1.00 27.49  ? 381  PRO A CD    1 
ATOM   3066 N  N     . GLN A 1 382 ? 18.746  11.341  -36.755 1.00 35.25  ? 382  GLN A N     1 
ATOM   3067 C  CA    . GLN A 1 382 ? 18.234  11.296  -35.395 1.00 36.44  ? 382  GLN A CA    1 
ATOM   3068 C  C     . GLN A 1 382 ? 16.767  10.915  -35.424 1.00 32.98  ? 382  GLN A C     1 
ATOM   3069 O  O     . GLN A 1 382 ? 16.027  11.348  -36.308 1.00 35.67  ? 382  GLN A O     1 
ATOM   3070 C  CB    . GLN A 1 382 ? 18.408  12.647  -34.697 1.00 40.01  ? 382  GLN A CB    1 
ATOM   3071 C  CG    . GLN A 1 382 ? 18.049  12.628  -33.217 1.00 40.22  ? 382  GLN A CG    1 
ATOM   3072 C  CD    . GLN A 1 382 ? 18.408  13.924  -32.507 1.00 43.32  ? 382  GLN A CD    1 
ATOM   3073 O  OE1   . GLN A 1 382 ? 18.489  14.984  -33.125 1.00 42.97  ? 382  GLN A OE1   1 
ATOM   3074 N  NE2   . GLN A 1 382 ? 18.634  13.838  -31.201 1.00 45.37  ? 382  GLN A NE2   1 
ATOM   3075 N  N     . GLY A 1 383 ? 16.352  10.093  -34.466 1.00 30.45  ? 383  GLY A N     1 
ATOM   3076 C  CA    . GLY A 1 383 ? 14.948  9.788   -34.290 1.00 30.93  ? 383  GLY A CA    1 
ATOM   3077 C  C     . GLY A 1 383 ? 14.180  11.069  -34.030 1.00 38.51  ? 383  GLY A C     1 
ATOM   3078 O  O     . GLY A 1 383 ? 14.681  11.976  -33.364 1.00 39.56  ? 383  GLY A O     1 
ATOM   3079 N  N     . ARG A 1 384 ? 12.974  11.155  -34.580 1.00 39.01  ? 384  ARG A N     1 
ATOM   3080 C  CA    . ARG A 1 384 ? 12.137  12.337  -34.411 1.00 40.22  ? 384  ARG A CA    1 
ATOM   3081 C  C     . ARG A 1 384 ? 10.755  11.964  -33.889 1.00 39.42  ? 384  ARG A C     1 
ATOM   3082 O  O     . ARG A 1 384 ? 10.284  10.842  -34.084 1.00 35.14  ? 384  ARG A O     1 
ATOM   3083 C  CB    . ARG A 1 384 ? 11.998  13.091  -35.731 1.00 46.29  ? 384  ARG A CB    1 
ATOM   3084 C  CG    . ARG A 1 384 ? 13.263  13.791  -36.196 1.00 52.99  ? 384  ARG A CG    1 
ATOM   3085 C  CD    . ARG A 1 384 ? 13.154  14.173  -37.662 1.00 58.68  ? 384  ARG A CD    1 
ATOM   3086 N  NE    . ARG A 1 384 ? 12.957  12.989  -38.495 1.00 65.52  ? 384  ARG A NE    1 
ATOM   3087 C  CZ    . ARG A 1 384 ? 12.243  12.968  -39.617 1.00 70.14  ? 384  ARG A CZ    1 
ATOM   3088 N  NH1   . ARG A 1 384 ? 11.645  14.071  -40.050 1.00 70.28  ? 384  ARG A NH1   1 
ATOM   3089 N  NH2   . ARG A 1 384 ? 12.122  11.838  -40.305 1.00 71.03  ? 384  ARG A NH2   1 
ATOM   3090 N  N     . SER A 1 385 ? 10.113  12.919  -33.226 1.00 43.54  ? 385  SER A N     1 
ATOM   3091 C  CA    . SER A 1 385 ? 8.770   12.732  -32.700 1.00 47.30  ? 385  SER A CA    1 
ATOM   3092 C  C     . SER A 1 385 ? 7.733   12.991  -33.787 1.00 43.88  ? 385  SER A C     1 
ATOM   3093 O  O     . SER A 1 385 ? 7.792   14.002  -34.483 1.00 42.59  ? 385  SER A O     1 
ATOM   3094 C  CB    . SER A 1 385 ? 8.540   13.674  -31.516 1.00 52.41  ? 385  SER A CB    1 
ATOM   3095 O  OG    . SER A 1 385 ? 7.234   13.536  -30.992 1.00 58.17  ? 385  SER A OG    1 
ATOM   3096 N  N     . HIS A 1 386 ? 6.787   12.070  -33.933 1.00 42.06  ? 386  HIS A N     1 
ATOM   3097 C  CA    . HIS A 1 386 ? 5.720   12.225  -34.915 1.00 39.51  ? 386  HIS A CA    1 
ATOM   3098 C  C     . HIS A 1 386 ? 4.373   11.887  -34.296 1.00 38.94  ? 386  HIS A C     1 
ATOM   3099 O  O     . HIS A 1 386 ? 4.269   10.950  -33.500 1.00 39.73  ? 386  HIS A O     1 
ATOM   3100 C  CB    . HIS A 1 386 ? 5.933   11.298  -36.115 1.00 38.11  ? 386  HIS A CB    1 
ATOM   3101 C  CG    . HIS A 1 386 ? 7.280   11.419  -36.756 1.00 40.27  ? 386  HIS A CG    1 
ATOM   3102 N  ND1   . HIS A 1 386 ? 7.576   12.390  -37.685 1.00 39.94  ? 386  HIS A ND1   1 
ATOM   3103 C  CD2   . HIS A 1 386 ? 8.398   10.666  -36.625 1.00 40.50  ? 386  HIS A CD2   1 
ATOM   3104 C  CE1   . HIS A 1 386 ? 8.827   12.242  -38.089 1.00 40.46  ? 386  HIS A CE1   1 
ATOM   3105 N  NE2   . HIS A 1 386 ? 9.345   11.202  -37.463 1.00 43.60  ? 386  HIS A NE2   1 
ATOM   3106 N  N     . PRO A 1 387 ? 3.331   12.639  -34.672 1.00 37.45  ? 387  PRO A N     1 
ATOM   3107 C  CA    . PRO A 1 387 ? 1.969   12.291  -34.261 1.00 38.65  ? 387  PRO A CA    1 
ATOM   3108 C  C     . PRO A 1 387 ? 1.454   11.114  -35.083 1.00 39.51  ? 387  PRO A C     1 
ATOM   3109 O  O     . PRO A 1 387 ? 1.796   10.998  -36.261 1.00 40.15  ? 387  PRO A O     1 
ATOM   3110 C  CB    . PRO A 1 387 ? 1.175   13.552  -34.598 1.00 38.29  ? 387  PRO A CB    1 
ATOM   3111 C  CG    . PRO A 1 387 ? 1.921   14.164  -35.739 1.00 37.51  ? 387  PRO A CG    1 
ATOM   3112 C  CD    . PRO A 1 387 ? 3.375   13.881  -35.464 1.00 36.50  ? 387  PRO A CD    1 
ATOM   3113 N  N     . VAL A 1 388 ? 0.650   10.254  -34.468 1.00 38.08  ? 388  VAL A N     1 
ATOM   3114 C  CA    . VAL A 1 388 ? 0.059   9.121   -35.172 1.00 36.39  ? 388  VAL A CA    1 
ATOM   3115 C  C     . VAL A 1 388 ? -1.007  9.601   -36.148 1.00 37.44  ? 388  VAL A C     1 
ATOM   3116 O  O     . VAL A 1 388 ? -1.877  10.385  -35.782 1.00 41.29  ? 388  VAL A O     1 
ATOM   3117 C  CB    . VAL A 1 388 ? -0.568  8.122   -34.190 1.00 34.60  ? 388  VAL A CB    1 
ATOM   3118 C  CG1   . VAL A 1 388 ? -1.279  7.000   -34.942 1.00 32.95  ? 388  VAL A CG1   1 
ATOM   3119 C  CG2   . VAL A 1 388 ? 0.494   7.560   -33.263 1.00 36.14  ? 388  VAL A CG2   1 
ATOM   3120 N  N     . GLN A 1 389 ? -0.927  9.136   -37.390 1.00 34.76  ? 389  GLN A N     1 
ATOM   3121 C  CA    . GLN A 1 389 ? -1.891  9.504   -38.419 1.00 34.67  ? 389  GLN A CA    1 
ATOM   3122 C  C     . GLN A 1 389 ? -2.317  8.265   -39.192 1.00 31.46  ? 389  GLN A C     1 
ATOM   3123 O  O     . GLN A 1 389 ? -1.497  7.386   -39.449 1.00 28.84  ? 389  GLN A O     1 
ATOM   3124 C  CB    . GLN A 1 389 ? -1.275  10.502  -39.399 1.00 42.38  ? 389  GLN A CB    1 
ATOM   3125 C  CG    . GLN A 1 389 ? -0.796  11.798  -38.784 1.00 53.48  ? 389  GLN A CG    1 
ATOM   3126 C  CD    . GLN A 1 389 ? -0.148  12.710  -39.808 1.00 62.72  ? 389  GLN A CD    1 
ATOM   3127 O  OE1   . GLN A 1 389 ? -0.310  12.519  -41.013 1.00 66.59  ? 389  GLN A OE1   1 
ATOM   3128 N  NE2   . GLN A 1 389 ? 0.595   13.704  -39.334 1.00 66.85  ? 389  GLN A NE2   1 
ATOM   3129 N  N     . PRO A 1 390 ? -3.600  8.195   -39.576 1.00 32.64  ? 390  PRO A N     1 
ATOM   3130 C  CA    . PRO A 1 390 ? -4.101  7.091   -40.400 1.00 31.63  ? 390  PRO A CA    1 
ATOM   3131 C  C     . PRO A 1 390 ? -3.560  7.199   -41.818 1.00 32.96  ? 390  PRO A C     1 
ATOM   3132 O  O     . PRO A 1 390 ? -3.185  8.287   -42.248 1.00 36.58  ? 390  PRO A O     1 
ATOM   3133 C  CB    . PRO A 1 390 ? -5.622  7.319   -40.414 1.00 35.69  ? 390  PRO A CB    1 
ATOM   3134 C  CG    . PRO A 1 390 ? -5.896  8.274   -39.295 1.00 40.10  ? 390  PRO A CG    1 
ATOM   3135 C  CD    . PRO A 1 390 ? -4.671  9.129   -39.196 1.00 38.17  ? 390  PRO A CD    1 
ATOM   3136 N  N     . TYR A 1 391 ? -3.507  6.082   -42.532 1.00 29.94  ? 391  TYR A N     1 
ATOM   3137 C  CA    . TYR A 1 391 ? -3.110  6.096   -43.936 1.00 27.32  ? 391  TYR A CA    1 
ATOM   3138 C  C     . TYR A 1 391 ? -3.722  4.877   -44.622 1.00 28.21  ? 391  TYR A C     1 
ATOM   3139 O  O     . TYR A 1 391 ? -4.028  3.892   -43.957 1.00 29.74  ? 391  TYR A O     1 
ATOM   3140 C  CB    . TYR A 1 391 ? -1.578  6.160   -44.088 1.00 23.07  ? 391  TYR A CB    1 
ATOM   3141 C  CG    . TYR A 1 391 ? -0.813  4.912   -43.691 1.00 23.60  ? 391  TYR A CG    1 
ATOM   3142 C  CD1   . TYR A 1 391 ? -0.493  3.944   -44.633 1.00 22.99  ? 391  TYR A CD1   1 
ATOM   3143 C  CD2   . TYR A 1 391 ? -0.384  4.720   -42.383 1.00 24.70  ? 391  TYR A CD2   1 
ATOM   3144 C  CE1   . TYR A 1 391 ? 0.215   2.812   -44.283 1.00 23.73  ? 391  TYR A CE1   1 
ATOM   3145 C  CE2   . TYR A 1 391 ? 0.323   3.588   -42.021 1.00 24.14  ? 391  TYR A CE2   1 
ATOM   3146 C  CZ    . TYR A 1 391 ? 0.620   2.637   -42.977 1.00 27.97  ? 391  TYR A CZ    1 
ATOM   3147 O  OH    . TYR A 1 391 ? 1.328   1.503   -42.629 1.00 32.03  ? 391  TYR A OH    1 
ATOM   3148 N  N     . PRO A 1 392 ? -3.931  4.947   -45.948 1.00 31.87  ? 392  PRO A N     1 
ATOM   3149 C  CA    . PRO A 1 392 ? -4.694  3.880   -46.605 1.00 30.60  ? 392  PRO A CA    1 
ATOM   3150 C  C     . PRO A 1 392 ? -3.881  2.610   -46.838 1.00 30.39  ? 392  PRO A C     1 
ATOM   3151 O  O     . PRO A 1 392 ? -2.660  2.665   -46.982 1.00 28.69  ? 392  PRO A O     1 
ATOM   3152 C  CB    . PRO A 1 392 ? -5.093  4.514   -47.940 1.00 30.83  ? 392  PRO A CB    1 
ATOM   3153 C  CG    . PRO A 1 392 ? -3.994  5.472   -48.228 1.00 33.97  ? 392  PRO A CG    1 
ATOM   3154 C  CD    . PRO A 1 392 ? -3.552  6.015   -46.891 1.00 33.04  ? 392  PRO A CD    1 
ATOM   3155 N  N     . GLY A 1 393 ? -4.573  1.476   -46.871 1.00 30.75  ? 393  GLY A N     1 
ATOM   3156 C  CA    . GLY A 1 393 ? -3.940  0.182   -47.049 1.00 28.10  ? 393  GLY A CA    1 
ATOM   3157 C  C     . GLY A 1 393 ? -4.383  -0.517  -48.323 1.00 29.02  ? 393  GLY A C     1 
ATOM   3158 O  O     . GLY A 1 393 ? -4.468  0.104   -49.380 1.00 25.71  ? 393  GLY A O     1 
ATOM   3159 N  N     . ALA A 1 394 ? -4.676  -1.811  -48.220 1.00 28.53  ? 394  ALA A N     1 
ATOM   3160 C  CA    . ALA A 1 394 ? -4.931  -2.635  -49.401 1.00 26.66  ? 394  ALA A CA    1 
ATOM   3161 C  C     . ALA A 1 394 ? -6.343  -2.479  -49.961 1.00 29.67  ? 394  ALA A C     1 
ATOM   3162 O  O     . ALA A 1 394 ? -7.228  -1.932  -49.309 1.00 31.71  ? 394  ALA A O     1 
ATOM   3163 C  CB    . ALA A 1 394 ? -4.651  -4.097  -49.089 1.00 23.02  ? 394  ALA A CB    1 
ATOM   3164 N  N     . PHE A 1 395 ? -6.536  -2.968  -51.181 1.00 30.20  ? 395  PHE A N     1 
ATOM   3165 C  CA    . PHE A 1 395 ? -7.856  -3.033  -51.789 1.00 29.69  ? 395  PHE A CA    1 
ATOM   3166 C  C     . PHE A 1 395 ? -8.414  -4.439  -51.638 1.00 30.43  ? 395  PHE A C     1 
ATOM   3167 O  O     . PHE A 1 395 ? -7.681  -5.418  -51.772 1.00 28.32  ? 395  PHE A O     1 
ATOM   3168 C  CB    . PHE A 1 395 ? -7.782  -2.670  -53.271 1.00 30.41  ? 395  PHE A CB    1 
ATOM   3169 C  CG    . PHE A 1 395 ? -9.083  -2.849  -54.008 1.00 36.04  ? 395  PHE A CG    1 
ATOM   3170 C  CD1   . PHE A 1 395 ? -10.093 -1.904  -53.900 1.00 38.04  ? 395  PHE A CD1   1 
ATOM   3171 C  CD2   . PHE A 1 395 ? -9.292  -3.954  -54.821 1.00 33.74  ? 395  PHE A CD2   1 
ATOM   3172 C  CE1   . PHE A 1 395 ? -11.290 -2.065  -54.579 1.00 40.13  ? 395  PHE A CE1   1 
ATOM   3173 C  CE2   . PHE A 1 395 ? -10.488 -4.119  -55.502 1.00 36.97  ? 395  PHE A CE2   1 
ATOM   3174 C  CZ    . PHE A 1 395 ? -11.487 -3.173  -55.381 1.00 37.87  ? 395  PHE A CZ    1 
ATOM   3175 N  N     . VAL A 1 396 ? -9.708  -4.530  -51.345 1.00 31.24  ? 396  VAL A N     1 
ATOM   3176 C  CA    . VAL A 1 396 ? -10.406 -5.807  -51.273 1.00 30.08  ? 396  VAL A CA    1 
ATOM   3177 C  C     . VAL A 1 396 ? -11.681 -5.719  -52.109 1.00 34.70  ? 396  VAL A C     1 
ATOM   3178 O  O     . VAL A 1 396 ? -12.537 -4.867  -51.862 1.00 34.77  ? 396  VAL A O     1 
ATOM   3179 C  CB    . VAL A 1 396 ? -10.771 -6.190  -49.818 1.00 30.26  ? 396  VAL A CB    1 
ATOM   3180 C  CG1   . VAL A 1 396 ? -11.440 -7.564  -49.770 1.00 29.08  ? 396  VAL A CG1   1 
ATOM   3181 C  CG2   . VAL A 1 396 ? -9.534  -6.181  -48.929 1.00 30.77  ? 396  VAL A CG2   1 
ATOM   3182 N  N     . LYS A 1 397 ? -11.797 -6.591  -53.104 1.00 32.59  ? 397  LYS A N     1 
ATOM   3183 C  CA    . LYS A 1 397 ? -12.969 -6.616  -53.970 1.00 35.48  ? 397  LYS A CA    1 
ATOM   3184 C  C     . LYS A 1 397 ? -14.189 -7.183  -53.245 1.00 36.14  ? 397  LYS A C     1 
ATOM   3185 O  O     . LYS A 1 397 ? -14.075 -8.134  -52.474 1.00 36.37  ? 397  LYS A O     1 
ATOM   3186 C  CB    . LYS A 1 397 ? -12.685 -7.450  -55.222 1.00 38.84  ? 397  LYS A CB    1 
ATOM   3187 C  CG    . LYS A 1 397 ? -13.817 -7.455  -56.239 1.00 44.15  ? 397  LYS A CG    1 
ATOM   3188 C  CD    . LYS A 1 397 ? -13.534 -8.437  -57.368 1.00 47.18  ? 397  LYS A CD    1 
ATOM   3189 C  CE    . LYS A 1 397 ? -14.697 -8.515  -58.340 1.00 47.13  ? 397  LYS A CE    1 
ATOM   3190 N  NZ    . LYS A 1 397 ? -14.923 -7.216  -59.033 1.00 48.82  ? 397  LYS A NZ    1 
ATOM   3191 N  N     . GLU A 1 398 ? -15.353 -6.597  -53.507 1.00 38.43  ? 398  GLU A N     1 
ATOM   3192 C  CA    . GLU A 1 398 ? -16.616 -7.092  -52.971 1.00 38.41  ? 398  GLU A CA    1 
ATOM   3193 C  C     . GLU A 1 398 ? -17.137 -8.242  -53.833 1.00 36.73  ? 398  GLU A C     1 
ATOM   3194 O  O     . GLU A 1 398 ? -17.573 -8.027  -54.958 1.00 40.29  ? 398  GLU A O     1 
ATOM   3195 C  CB    . GLU A 1 398 ? -17.648 -5.960  -52.932 1.00 39.72  ? 398  GLU A CB    1 
ATOM   3196 C  CG    . GLU A 1 398 ? -18.946 -6.308  -52.215 1.00 43.83  ? 398  GLU A CG    1 
ATOM   3197 C  CD    . GLU A 1 398 ? -18.795 -6.321  -50.702 1.00 43.88  ? 398  GLU A CD    1 
ATOM   3198 O  OE1   . GLU A 1 398 ? -18.489 -5.257  -50.120 1.00 41.49  ? 398  GLU A OE1   1 
ATOM   3199 O  OE2   . GLU A 1 398 ? -18.977 -7.397  -50.095 1.00 41.86  ? 398  GLU A OE2   1 
ATOM   3200 N  N     . PRO A 1 399 ? -17.095 -9.473  -53.307 1.00 35.09  ? 399  PRO A N     1 
ATOM   3201 C  CA    . PRO A 1 399 ? -17.543 -10.612 -54.111 1.00 34.83  ? 399  PRO A CA    1 
ATOM   3202 C  C     . PRO A 1 399 ? -19.059 -10.723 -54.126 1.00 35.07  ? 399  PRO A C     1 
ATOM   3203 O  O     . PRO A 1 399 ? -19.719 -10.340 -53.158 1.00 37.28  ? 399  PRO A O     1 
ATOM   3204 C  CB    . PRO A 1 399 ? -16.956 -11.806 -53.363 1.00 34.61  ? 399  PRO A CB    1 
ATOM   3205 C  CG    . PRO A 1 399 ? -16.968 -11.372 -51.942 1.00 36.78  ? 399  PRO A CG    1 
ATOM   3206 C  CD    . PRO A 1 399 ? -16.676 -9.885  -51.957 1.00 33.78  ? 399  PRO A CD    1 
ATOM   3207 N  N     . ILE A 1 400 ? -19.601 -11.237 -55.224 1.00 34.41  ? 400  ILE A N     1 
ATOM   3208 C  CA    . ILE A 1 400 ? -21.012 -11.585 -55.278 1.00 39.23  ? 400  ILE A CA    1 
ATOM   3209 C  C     . ILE A 1 400 ? -21.210 -12.877 -54.495 1.00 44.15  ? 400  ILE A C     1 
ATOM   3210 O  O     . ILE A 1 400 ? -20.655 -13.916 -54.860 1.00 43.87  ? 400  ILE A O     1 
ATOM   3211 C  CB    . ILE A 1 400 ? -21.482 -11.791 -56.721 1.00 38.81  ? 400  ILE A CB    1 
ATOM   3212 C  CG1   . ILE A 1 400 ? -21.274 -10.508 -57.534 1.00 38.38  ? 400  ILE A CG1   1 
ATOM   3213 C  CG2   . ILE A 1 400 ? -22.945 -12.221 -56.751 1.00 41.85  ? 400  ILE A CG2   1 
ATOM   3214 C  CD1   . ILE A 1 400 ? -21.620 -10.647 -59.000 1.00 40.60  ? 400  ILE A CD1   1 
ATOM   3215 N  N     . PRO A 1 401 ? -21.983 -12.812 -53.400 1.00 45.31  ? 401  PRO A N     1 
ATOM   3216 C  CA    . PRO A 1 401 ? -22.223 -14.009 -52.584 1.00 46.79  ? 401  PRO A CA    1 
ATOM   3217 C  C     . PRO A 1 401 ? -22.864 -15.092 -53.440 1.00 42.35  ? 401  PRO A C     1 
ATOM   3218 O  O     . PRO A 1 401 ? -23.903 -14.841 -54.048 1.00 42.67  ? 401  PRO A O     1 
ATOM   3219 C  CB    . PRO A 1 401 ? -23.206 -13.517 -51.516 1.00 45.99  ? 401  PRO A CB    1 
ATOM   3220 C  CG    . PRO A 1 401 ? -23.022 -12.029 -51.475 1.00 45.24  ? 401  PRO A CG    1 
ATOM   3221 C  CD    . PRO A 1 401 ? -22.691 -11.630 -52.880 1.00 44.80  ? 401  PRO A CD    1 
ATOM   3222 N  N     . ASN A 1 402 ? -22.240 -16.266 -53.496 1.00 39.43  ? 402  ASN A N     1 
ATOM   3223 C  CA    . ASN A 1 402 ? -22.680 -17.332 -54.388 1.00 38.58  ? 402  ASN A CA    1 
ATOM   3224 C  C     . ASN A 1 402 ? -21.816 -18.567 -54.196 1.00 41.41  ? 402  ASN A C     1 
ATOM   3225 O  O     . ASN A 1 402 ? -20.780 -18.517 -53.523 1.00 40.21  ? 402  ASN A O     1 
ATOM   3226 C  CB    . ASN A 1 402 ? -22.584 -16.871 -55.846 1.00 40.22  ? 402  ASN A CB    1 
ATOM   3227 C  CG    . ASN A 1 402 ? -23.621 -17.528 -56.744 1.00 47.26  ? 402  ASN A CG    1 
ATOM   3228 O  OD1   . ASN A 1 402 ? -24.417 -18.357 -56.299 1.00 45.57  ? 402  ASN A OD1   1 
ATOM   3229 N  ND2   . ASN A 1 402 ? -23.625 -17.140 -58.017 1.00 40.00  ? 402  ASN A ND2   1 
ATOM   3230 N  N     . ARG A 1 403 ? -22.250 -19.680 -54.776 1.00 39.13  ? 403  ARG A N     1 
ATOM   3231 C  CA    . ARG A 1 403 ? -21.399 -20.852 -54.888 1.00 37.56  ? 403  ARG A CA    1 
ATOM   3232 C  C     . ARG A 1 403 ? -20.483 -20.634 -56.085 1.00 40.10  ? 403  ARG A C     1 
ATOM   3233 O  O     . ARG A 1 403 ? -20.799 -19.851 -56.980 1.00 39.27  ? 403  ARG A O     1 
ATOM   3234 C  CB    . ARG A 1 403 ? -22.237 -22.118 -55.086 1.00 37.25  ? 403  ARG A CB    1 
ATOM   3235 C  CG    . ARG A 1 403 ? -23.086 -22.107 -56.350 1.00 43.51  ? 403  ARG A CG    1 
ATOM   3236 C  CD    . ARG A 1 403 ? -23.795 -23.443 -56.569 1.00 45.63  ? 403  ARG A CD    1 
ATOM   3237 N  NE    . ARG A 1 403 ? -24.821 -23.698 -55.561 1.00 47.37  ? 403  ARG A NE    1 
ATOM   3238 C  CZ    . ARG A 1 403 ? -25.628 -24.755 -55.565 1.00 51.73  ? 403  ARG A CZ    1 
ATOM   3239 N  NH1   . ARG A 1 403 ? -25.532 -25.664 -56.528 1.00 49.99  ? 403  ARG A NH1   1 
ATOM   3240 N  NH2   . ARG A 1 403 ? -26.533 -24.905 -54.608 1.00 52.07  ? 403  ARG A NH2   1 
ATOM   3241 N  N     . TYR A 1 404 ? -19.341 -21.309 -56.092 1.00 41.37  ? 404  TYR A N     1 
ATOM   3242 C  CA    . TYR A 1 404 ? -18.422 -21.244 -57.223 1.00 42.41  ? 404  TYR A CA    1 
ATOM   3243 C  C     . TYR A 1 404 ? -17.755 -22.605 -57.407 1.00 42.91  ? 404  TYR A C     1 
ATOM   3244 O  O     . TYR A 1 404 ? -16.926 -23.020 -56.588 1.00 39.02  ? 404  TYR A O     1 
ATOM   3245 C  CB    . TYR A 1 404 ? -17.374 -20.147 -57.010 1.00 42.86  ? 404  TYR A CB    1 
ATOM   3246 C  CG    . TYR A 1 404 ? -17.935 -18.739 -57.033 1.00 41.78  ? 404  TYR A CG    1 
ATOM   3247 C  CD1   . TYR A 1 404 ? -18.147 -18.072 -58.235 1.00 41.32  ? 404  TYR A CD1   1 
ATOM   3248 C  CD2   . TYR A 1 404 ? -18.247 -18.075 -55.852 1.00 40.41  ? 404  TYR A CD2   1 
ATOM   3249 C  CE1   . TYR A 1 404 ? -18.656 -16.784 -58.261 1.00 41.67  ? 404  TYR A CE1   1 
ATOM   3250 C  CE2   . TYR A 1 404 ? -18.753 -16.787 -55.867 1.00 38.62  ? 404  TYR A CE2   1 
ATOM   3251 C  CZ    . TYR A 1 404 ? -18.958 -16.147 -57.074 1.00 42.63  ? 404  TYR A CZ    1 
ATOM   3252 O  OH    . TYR A 1 404 ? -19.468 -14.867 -57.091 1.00 42.74  ? 404  TYR A OH    1 
ATOM   3253 N  N     . LYS A 1 405 ? -18.129 -23.286 -58.486 1.00 43.12  ? 405  LYS A N     1 
ATOM   3254 C  CA    . LYS A 1 405 ? -17.725 -24.665 -58.740 1.00 42.53  ? 405  LYS A CA    1 
ATOM   3255 C  C     . LYS A 1 405 ? -16.220 -24.845 -58.915 1.00 43.48  ? 405  LYS A C     1 
ATOM   3256 O  O     . LYS A 1 405 ? -15.564 -25.473 -58.085 1.00 43.23  ? 405  LYS A O     1 
ATOM   3257 C  CB    . LYS A 1 405 ? -18.461 -25.207 -59.967 1.00 46.86  ? 405  LYS A CB    1 
ATOM   3258 C  CG    . LYS A 1 405 ? -18.335 -26.709 -60.164 1.00 50.41  ? 405  LYS A CG    1 
ATOM   3259 C  CD    . LYS A 1 405 ? -19.189 -27.181 -61.332 1.00 56.71  ? 405  LYS A CD    1 
ATOM   3260 C  CE    . LYS A 1 405 ? -19.077 -28.686 -61.531 1.00 63.08  ? 405  LYS A CE    1 
ATOM   3261 N  N     . TYR A 1 406 ? -15.683 -24.301 -60.002 1.00 43.41  ? 406  TYR A N     1 
ATOM   3262 C  CA    . TYR A 1 406 ? -14.259 -24.417 -60.298 1.00 44.90  ? 406  TYR A CA    1 
ATOM   3263 C  C     . TYR A 1 406 ? -13.536 -23.093 -60.073 1.00 45.24  ? 406  TYR A C     1 
ATOM   3264 O  O     . TYR A 1 406 ? -13.880 -22.075 -60.677 1.00 46.54  ? 406  TYR A O     1 
ATOM   3265 C  CB    . TYR A 1 406 ? -14.041 -24.889 -61.741 1.00 44.65  ? 406  TYR A CB    1 
ATOM   3266 C  CG    . TYR A 1 406 ? -14.464 -26.321 -61.999 1.00 44.26  ? 406  TYR A CG    1 
ATOM   3267 C  CD1   . TYR A 1 406 ? -13.766 -27.383 -61.437 1.00 45.40  ? 406  TYR A CD1   1 
ATOM   3268 C  CD2   . TYR A 1 406 ? -15.550 -26.611 -62.816 1.00 48.51  ? 406  TYR A CD2   1 
ATOM   3269 C  CE1   . TYR A 1 406 ? -14.144 -28.697 -61.672 1.00 47.89  ? 406  TYR A CE1   1 
ATOM   3270 C  CE2   . TYR A 1 406 ? -15.936 -27.923 -63.062 1.00 50.49  ? 406  TYR A CE2   1 
ATOM   3271 C  CZ    . TYR A 1 406 ? -15.228 -28.961 -62.486 1.00 52.49  ? 406  TYR A CZ    1 
ATOM   3272 O  OH    . TYR A 1 406 ? -15.602 -30.267 -62.720 1.00 54.62  ? 406  TYR A OH    1 
ATOM   3273 N  N     . VAL A 1 407 ? -12.528 -23.115 -59.207 1.00 40.38  ? 407  VAL A N     1 
ATOM   3274 C  CA    . VAL A 1 407 ? -11.778 -21.910 -58.873 1.00 38.63  ? 407  VAL A CA    1 
ATOM   3275 C  C     . VAL A 1 407 ? -10.265 -22.129 -58.919 1.00 39.64  ? 407  VAL A C     1 
ATOM   3276 O  O     . VAL A 1 407 ? -9.748  -23.104 -58.366 1.00 39.05  ? 407  VAL A O     1 
ATOM   3277 C  CB    . VAL A 1 407 ? -12.161 -21.389 -57.464 1.00 38.67  ? 407  VAL A CB    1 
ATOM   3278 C  CG1   . VAL A 1 407 ? -11.189 -20.311 -57.003 1.00 37.65  ? 407  VAL A CG1   1 
ATOM   3279 C  CG2   . VAL A 1 407 ? -13.597 -20.869 -57.449 1.00 37.23  ? 407  VAL A CG2   1 
ATOM   3280 N  N     . MET A 1 408 ? -9.562  -21.222 -59.592 1.00 39.87  ? 408  MET A N     1 
ATOM   3281 C  CA    . MET A 1 408 ? -8.107  -21.156 -59.507 1.00 42.65  ? 408  MET A CA    1 
ATOM   3282 C  C     . MET A 1 408 ? -7.685  -19.821 -58.905 1.00 40.90  ? 408  MET A C     1 
ATOM   3283 O  O     . MET A 1 408 ? -8.170  -18.769 -59.321 1.00 41.63  ? 408  MET A O     1 
ATOM   3284 C  CB    . MET A 1 408 ? -7.468  -21.308 -60.887 1.00 46.76  ? 408  MET A CB    1 
ATOM   3285 C  CG    . MET A 1 408 ? -7.131  -22.732 -61.281 1.00 52.03  ? 408  MET A CG    1 
ATOM   3286 S  SD    . MET A 1 408 ? -6.182  -22.768 -62.814 1.00 85.21  ? 408  MET A SD    1 
ATOM   3287 C  CE    . MET A 1 408 ? -7.237  -21.783 -63.873 1.00 38.46  ? 408  MET A CE    1 
ATOM   3288 N  N     . SER A 1 409 ? -6.784  -19.854 -57.930 1.00 35.49  ? 409  SER A N     1 
ATOM   3289 C  CA    . SER A 1 409 ? -6.301  -18.611 -57.332 1.00 37.55  ? 409  SER A CA    1 
ATOM   3290 C  C     . SER A 1 409 ? -4.866  -18.291 -57.740 1.00 38.97  ? 409  SER A C     1 
ATOM   3291 O  O     . SER A 1 409 ? -4.105  -19.176 -58.133 1.00 42.77  ? 409  SER A O     1 
ATOM   3292 C  CB    . SER A 1 409 ? -6.431  -18.639 -55.805 1.00 31.02  ? 409  SER A CB    1 
ATOM   3293 O  OG    . SER A 1 409 ? -5.597  -19.631 -55.235 1.00 36.22  ? 409  SER A OG    1 
ATOM   3294 N  N     . PHE A 1 410 ? -4.513  -17.014 -57.647 1.00 36.76  ? 410  PHE A N     1 
ATOM   3295 C  CA    . PHE A 1 410 ? -3.170  -16.545 -57.960 1.00 37.71  ? 410  PHE A CA    1 
ATOM   3296 C  C     . PHE A 1 410 ? -2.732  -15.528 -56.911 1.00 38.36  ? 410  PHE A C     1 
ATOM   3297 O  O     . PHE A 1 410 ? -3.529  -14.705 -56.462 1.00 35.59  ? 410  PHE A O     1 
ATOM   3298 C  CB    . PHE A 1 410 ? -3.130  -15.907 -59.353 1.00 38.84  ? 410  PHE A CB    1 
ATOM   3299 C  CG    . PHE A 1 410 ? -3.388  -16.873 -60.476 1.00 41.49  ? 410  PHE A CG    1 
ATOM   3300 C  CD1   . PHE A 1 410 ? -2.333  -17.442 -61.173 1.00 44.10  ? 410  PHE A CD1   1 
ATOM   3301 C  CD2   . PHE A 1 410 ? -4.683  -17.209 -60.839 1.00 42.13  ? 410  PHE A CD2   1 
ATOM   3302 C  CE1   . PHE A 1 410 ? -2.563  -18.330 -62.211 1.00 44.25  ? 410  PHE A CE1   1 
ATOM   3303 C  CE2   . PHE A 1 410 ? -4.921  -18.096 -61.873 1.00 43.86  ? 410  PHE A CE2   1 
ATOM   3304 C  CZ    . PHE A 1 410 ? -3.860  -18.656 -62.561 1.00 44.69  ? 410  PHE A CZ    1 
ATOM   3305 N  N     . ASP A 1 411 ? -1.461  -15.587 -56.530 1.00 37.69  ? 411  ASP A N     1 
ATOM   3306 C  CA    . ASP A 1 411 ? -0.936  -14.730 -55.476 1.00 39.30  ? 411  ASP A CA    1 
ATOM   3307 C  C     . ASP A 1 411 ? 0.407   -14.155 -55.896 1.00 35.70  ? 411  ASP A C     1 
ATOM   3308 O  O     . ASP A 1 411 ? 1.179   -14.809 -56.594 1.00 36.33  ? 411  ASP A O     1 
ATOM   3309 C  CB    . ASP A 1 411 ? -0.783  -15.532 -54.173 1.00 44.61  ? 411  ASP A CB    1 
ATOM   3310 C  CG    . ASP A 1 411 ? -0.022  -14.773 -53.094 1.00 48.54  ? 411  ASP A CG    1 
ATOM   3311 O  OD1   . ASP A 1 411 ? -0.666  -14.129 -52.244 1.00 46.74  ? 411  ASP A OD1   1 
ATOM   3312 O  OD2   . ASP A 1 411 ? 1.226   -14.823 -53.090 1.00 55.12  ? 411  ASP A OD2   1 
ATOM   3313 N  N     . LEU A 1 412 ? 0.682   -12.928 -55.469 1.00 33.60  ? 412  LEU A N     1 
ATOM   3314 C  CA    . LEU A 1 412 ? 1.985   -12.322 -55.703 1.00 34.28  ? 412  LEU A CA    1 
ATOM   3315 C  C     . LEU A 1 412 ? 2.976   -12.711 -54.607 1.00 33.42  ? 412  LEU A C     1 
ATOM   3316 O  O     . LEU A 1 412 ? 2.635   -12.742 -53.429 1.00 33.60  ? 412  LEU A O     1 
ATOM   3317 C  CB    . LEU A 1 412 ? 1.858   -10.802 -55.810 1.00 35.96  ? 412  LEU A CB    1 
ATOM   3318 C  CG    . LEU A 1 412 ? 1.285   -10.318 -57.144 1.00 35.63  ? 412  LEU A CG    1 
ATOM   3319 C  CD1   . LEU A 1 412 ? 0.274   -9.210  -56.929 1.00 35.93  ? 412  LEU A CD1   1 
ATOM   3320 C  CD2   . LEU A 1 412 ? 2.413   -9.848  -58.044 1.00 34.45  ? 412  LEU A CD2   1 
ATOM   3321 N  N     . THR A 1 413 ? 4.205   -13.010 -55.010 1.00 33.13  ? 413  THR A N     1 
ATOM   3322 C  CA    . THR A 1 413 ? 5.249   -13.429 -54.082 1.00 34.50  ? 413  THR A CA    1 
ATOM   3323 C  C     . THR A 1 413 ? 5.784   -12.254 -53.264 1.00 34.27  ? 413  THR A C     1 
ATOM   3324 O  O     . THR A 1 413 ? 6.283   -11.281 -53.841 1.00 32.64  ? 413  THR A O     1 
ATOM   3325 C  CB    . THR A 1 413 ? 6.421   -14.073 -54.847 1.00 38.83  ? 413  THR A CB    1 
ATOM   3326 O  OG1   . THR A 1 413 ? 5.976   -15.287 -55.464 1.00 44.58  ? 413  THR A OG1   1 
ATOM   3327 C  CG2   . THR A 1 413 ? 7.575   -14.381 -53.907 1.00 39.36  ? 413  THR A CG2   1 
ATOM   3328 N  N     A SER A 1 414 ? 5.670   -12.351 -51.939 0.50 32.33  ? 414  SER A N     1 
ATOM   3329 N  N     B SER A 1 414 ? 5.694   -12.370 -51.937 0.50 32.30  ? 414  SER A N     1 
ATOM   3330 C  CA    A SER A 1 414 ? 6.182   -11.331 -51.019 0.50 32.07  ? 414  SER A CA    1 
ATOM   3331 C  CA    B SER A 1 414 ? 6.144   -11.333 -50.998 0.50 31.86  ? 414  SER A CA    1 
ATOM   3332 C  C     A SER A 1 414 ? 5.832   -9.922  -51.501 0.50 29.89  ? 414  SER A C     1 
ATOM   3333 C  C     B SER A 1 414 ? 5.826   -9.933  -51.506 0.50 29.90  ? 414  SER A C     1 
ATOM   3334 O  O     A SER A 1 414 ? 6.717   -9.139  -51.836 0.50 29.93  ? 414  SER A O     1 
ATOM   3335 O  O     B SER A 1 414 ? 6.721   -9.171  -51.862 0.50 29.79  ? 414  SER A O     1 
ATOM   3336 C  CB    A SER A 1 414 ? 7.699   -11.479 -50.860 0.50 33.39  ? 414  SER A CB    1 
ATOM   3337 C  CB    B SER A 1 414 ? 7.637   -11.476 -50.702 0.50 32.99  ? 414  SER A CB    1 
ATOM   3338 O  OG    A SER A 1 414 ? 8.226   -10.535 -49.946 0.50 32.01  ? 414  SER A OG    1 
ATOM   3339 O  OG    B SER A 1 414 ? 7.880   -12.641 -49.934 0.50 35.97  ? 414  SER A OG    1 
ATOM   3340 N  N     . PHE A 1 415 ? 4.535   -9.625  -51.539 1.00 28.05  ? 415  PHE A N     1 
ATOM   3341 C  CA    . PHE A 1 415 ? 4.004   -8.446  -52.226 1.00 26.34  ? 415  PHE A CA    1 
ATOM   3342 C  C     . PHE A 1 415 ? 4.599   -7.089  -51.848 1.00 28.21  ? 415  PHE A C     1 
ATOM   3343 O  O     . PHE A 1 415 ? 5.195   -6.417  -52.691 1.00 32.16  ? 415  PHE A O     1 
ATOM   3344 C  CB    . PHE A 1 415 ? 2.484   -8.424  -52.055 1.00 23.80  ? 415  PHE A CB    1 
ATOM   3345 C  CG    . PHE A 1 415 ? 1.777   -7.439  -52.938 1.00 24.44  ? 415  PHE A CG    1 
ATOM   3346 C  CD1   . PHE A 1 415 ? 2.092   -7.338  -54.284 1.00 25.43  ? 415  PHE A CD1   1 
ATOM   3347 C  CD2   . PHE A 1 415 ? 0.757   -6.649  -52.430 1.00 24.15  ? 415  PHE A CD2   1 
ATOM   3348 C  CE1   . PHE A 1 415 ? 1.419   -6.448  -55.103 1.00 28.64  ? 415  PHE A CE1   1 
ATOM   3349 C  CE2   . PHE A 1 415 ? 0.077   -5.758  -53.248 1.00 29.22  ? 415  PHE A CE2   1 
ATOM   3350 C  CZ    . PHE A 1 415 ? 0.412   -5.661  -54.585 1.00 28.39  ? 415  PHE A CZ    1 
ATOM   3351 N  N     . TYR A 1 416 ? 4.424   -6.669  -50.600 1.00 27.78  ? 416  TYR A N     1 
ATOM   3352 C  CA    . TYR A 1 416 ? 4.930   -5.355  -50.200 1.00 29.35  ? 416  TYR A CA    1 
ATOM   3353 C  C     . TYR A 1 416 ? 6.458   -5.222  -50.283 1.00 28.77  ? 416  TYR A C     1 
ATOM   3354 O  O     . TYR A 1 416 ? 6.948   -4.225  -50.801 1.00 26.38  ? 416  TYR A O     1 
ATOM   3355 C  CB    . TYR A 1 416 ? 4.385   -4.907  -48.837 1.00 29.05  ? 416  TYR A CB    1 
ATOM   3356 C  CG    . TYR A 1 416 ? 2.932   -4.471  -48.860 1.00 26.56  ? 416  TYR A CG    1 
ATOM   3357 C  CD1   . TYR A 1 416 ? 2.158   -4.607  -50.004 1.00 25.20  ? 416  TYR A CD1   1 
ATOM   3358 C  CD2   . TYR A 1 416 ? 2.341   -3.913  -47.735 1.00 28.09  ? 416  TYR A CD2   1 
ATOM   3359 C  CE1   . TYR A 1 416 ? 0.829   -4.213  -50.021 1.00 27.58  ? 416  TYR A CE1   1 
ATOM   3360 C  CE2   . TYR A 1 416 ? 1.020   -3.515  -47.739 1.00 26.16  ? 416  TYR A CE2   1 
ATOM   3361 C  CZ    . TYR A 1 416 ? 0.268   -3.666  -48.883 1.00 26.04  ? 416  TYR A CZ    1 
ATOM   3362 O  OH    . TYR A 1 416 ? -1.047  -3.261  -48.885 1.00 24.12  ? 416  TYR A OH    1 
ATOM   3363 N  N     . PRO A 1 417 ? 7.216   -6.226  -49.794 1.00 27.99  ? 417  PRO A N     1 
ATOM   3364 C  CA    . PRO A 1 417 ? 8.669   -6.160  -50.016 1.00 27.76  ? 417  PRO A CA    1 
ATOM   3365 C  C     . PRO A 1 417 ? 9.078   -6.122  -51.491 1.00 29.77  ? 417  PRO A C     1 
ATOM   3366 O  O     . PRO A 1 417 ? 10.065  -5.460  -51.827 1.00 26.76  ? 417  PRO A O     1 
ATOM   3367 C  CB    . PRO A 1 417 ? 9.180   -7.445  -49.364 1.00 27.38  ? 417  PRO A CB    1 
ATOM   3368 C  CG    . PRO A 1 417 ? 8.177   -7.734  -48.291 1.00 27.28  ? 417  PRO A CG    1 
ATOM   3369 C  CD    . PRO A 1 417 ? 6.856   -7.316  -48.865 1.00 27.35  ? 417  PRO A CD    1 
ATOM   3370 N  N     . SER A 1 418 ? 8.346   -6.817  -52.359 1.00 27.06  ? 418  SER A N     1 
ATOM   3371 C  CA    . SER A 1 418 ? 8.663   -6.786  -53.785 1.00 26.85  ? 418  SER A CA    1 
ATOM   3372 C  C     . SER A 1 418 ? 8.352   -5.414  -54.388 1.00 27.34  ? 418  SER A C     1 
ATOM   3373 O  O     . SER A 1 418 ? 9.046   -4.955  -55.295 1.00 30.10  ? 418  SER A O     1 
ATOM   3374 C  CB    . SER A 1 418 ? 7.918   -7.891  -54.541 1.00 32.21  ? 418  SER A CB    1 
ATOM   3375 O  OG    . SER A 1 418 ? 8.267   -9.172  -54.033 1.00 36.30  ? 418  SER A OG    1 
ATOM   3376 N  N     . ILE A 1 419 ? 7.311   -4.762  -53.880 1.00 25.54  ? 419  ILE A N     1 
ATOM   3377 C  CA    . ILE A 1 419 ? 6.989   -3.400  -54.303 1.00 29.73  ? 419  ILE A CA    1 
ATOM   3378 C  C     . ILE A 1 419 ? 8.113   -2.451  -53.903 1.00 29.42  ? 419  ILE A C     1 
ATOM   3379 O  O     . ILE A 1 419 ? 8.524   -1.593  -54.683 1.00 29.87  ? 419  ILE A O     1 
ATOM   3380 C  CB    . ILE A 1 419 ? 5.658   -2.911  -53.697 1.00 27.61  ? 419  ILE A CB    1 
ATOM   3381 C  CG1   . ILE A 1 419 ? 4.488   -3.692  -54.299 1.00 26.69  ? 419  ILE A CG1   1 
ATOM   3382 C  CG2   . ILE A 1 419 ? 5.473   -1.405  -53.932 1.00 23.40  ? 419  ILE A CG2   1 
ATOM   3383 C  CD1   . ILE A 1 419 ? 3.178   -3.493  -53.560 1.00 25.10  ? 419  ILE A CD1   1 
ATOM   3384 N  N     . ILE A 1 420 ? 8.612   -2.627  -52.684 1.00 30.38  ? 420  ILE A N     1 
ATOM   3385 C  CA    . ILE A 1 420 ? 9.728   -1.841  -52.172 1.00 32.03  ? 420  ILE A CA    1 
ATOM   3386 C  C     . ILE A 1 420 ? 10.944  -1.957  -53.083 1.00 35.77  ? 420  ILE A C     1 
ATOM   3387 O  O     . ILE A 1 420 ? 11.557  -0.955  -53.460 1.00 32.84  ? 420  ILE A O     1 
ATOM   3388 C  CB    . ILE A 1 420 ? 10.101  -2.291  -50.744 1.00 31.01  ? 420  ILE A CB    1 
ATOM   3389 C  CG1   . ILE A 1 420 ? 9.008   -1.862  -49.763 1.00 30.71  ? 420  ILE A CG1   1 
ATOM   3390 C  CG2   . ILE A 1 420 ? 11.460  -1.741  -50.331 1.00 27.23  ? 420  ILE A CG2   1 
ATOM   3391 C  CD1   . ILE A 1 420 ? 9.282   -2.244  -48.326 1.00 31.47  ? 420  ILE A CD1   1 
ATOM   3392 N  N     . ARG A 1 421 ? 11.272  -3.189  -53.453 1.00 32.92  ? 421  ARG A N     1 
ATOM   3393 C  CA    . ARG A 1 421 ? 12.423  -3.452  -54.299 1.00 34.07  ? 421  ARG A CA    1 
ATOM   3394 C  C     . ARG A 1 421 ? 12.206  -2.960  -55.733 1.00 38.17  ? 421  ARG A C     1 
ATOM   3395 O  O     . ARG A 1 421 ? 13.104  -2.374  -56.337 1.00 38.62  ? 421  ARG A O     1 
ATOM   3396 C  CB    . ARG A 1 421 ? 12.753  -4.946  -54.286 1.00 24.83  ? 421  ARG A CB    1 
ATOM   3397 C  CG    . ARG A 1 421 ? 13.096  -5.506  -52.914 1.00 25.36  ? 421  ARG A CG    1 
ATOM   3398 C  CD    . ARG A 1 421 ? 13.103  -7.029  -52.926 1.00 27.47  ? 421  ARG A CD    1 
ATOM   3399 N  NE    . ARG A 1 421 ? 14.026  -7.553  -53.929 1.00 32.95  ? 421  ARG A NE    1 
ATOM   3400 C  CZ    . ARG A 1 421 ? 13.872  -8.720  -54.544 1.00 35.18  ? 421  ARG A CZ    1 
ATOM   3401 N  NH1   . ARG A 1 421 ? 12.828  -9.486  -54.255 1.00 35.89  ? 421  ARG A NH1   1 
ATOM   3402 N  NH2   . ARG A 1 421 ? 14.758  -9.119  -55.447 1.00 33.46  ? 421  ARG A NH2   1 
ATOM   3403 N  N     . GLN A 1 422 ? 11.013  -3.195  -56.270 1.00 38.49  ? 422  GLN A N     1 
ATOM   3404 C  CA    . GLN A 1 422 ? 10.698  -2.795  -57.641 1.00 38.68  ? 422  GLN A CA    1 
ATOM   3405 C  C     . GLN A 1 422 ? 10.712  -1.277  -57.841 1.00 39.40  ? 422  GLN A C     1 
ATOM   3406 O  O     . GLN A 1 422 ? 11.346  -0.769  -58.767 1.00 41.41  ? 422  GLN A O     1 
ATOM   3407 C  CB    . GLN A 1 422 ? 9.347   -3.375  -58.072 1.00 33.88  ? 422  GLN A CB    1 
ATOM   3408 C  CG    . GLN A 1 422 ? 8.759   -2.727  -59.314 1.00 35.51  ? 422  GLN A CG    1 
ATOM   3409 C  CD    . GLN A 1 422 ? 7.786   -3.633  -60.043 1.00 35.43  ? 422  GLN A CD    1 
ATOM   3410 O  OE1   . GLN A 1 422 ? 7.771   -4.844  -59.830 1.00 37.57  ? 422  GLN A OE1   1 
ATOM   3411 N  NE2   . GLN A 1 422 ? 6.968   -3.048  -60.908 1.00 34.80  ? 422  GLN A NE2   1 
ATOM   3412 N  N     . VAL A 1 423 ? 10.010  -0.562  -56.970 1.00 38.31  ? 423  VAL A N     1 
ATOM   3413 C  CA    . VAL A 1 423 ? 9.905   0.890   -57.069 1.00 33.74  ? 423  VAL A CA    1 
ATOM   3414 C  C     . VAL A 1 423 ? 11.173  1.568   -56.541 1.00 34.79  ? 423  VAL A C     1 
ATOM   3415 O  O     . VAL A 1 423 ? 11.483  2.698   -56.922 1.00 37.66  ? 423  VAL A O     1 
ATOM   3416 C  CB    . VAL A 1 423 ? 8.651   1.405   -56.317 1.00 30.46  ? 423  VAL A CB    1 
ATOM   3417 C  CG1   . VAL A 1 423 ? 8.464   2.908   -56.520 1.00 30.96  ? 423  VAL A CG1   1 
ATOM   3418 C  CG2   . VAL A 1 423 ? 7.416   0.659   -56.795 1.00 27.03  ? 423  VAL A CG2   1 
ATOM   3419 N  N     . ASN A 1 424 ? 11.905  0.847   -55.689 1.00 29.94  ? 424  ASN A N     1 
ATOM   3420 C  CA    . ASN A 1 424 ? 13.122  1.339   -55.027 1.00 31.99  ? 424  ASN A CA    1 
ATOM   3421 C  C     . ASN A 1 424 ? 12.794  2.363   -53.944 1.00 31.41  ? 424  ASN A C     1 
ATOM   3422 O  O     . ASN A 1 424 ? 13.305  3.485   -53.945 1.00 32.48  ? 424  ASN A O     1 
ATOM   3423 C  CB    . ASN A 1 424 ? 14.155  1.886   -56.024 1.00 33.54  ? 424  ASN A CB    1 
ATOM   3424 C  CG    . ASN A 1 424 ? 15.550  1.962   -55.436 1.00 39.34  ? 424  ASN A CG    1 
ATOM   3425 O  OD1   . ASN A 1 424 ? 15.943  1.121   -54.626 1.00 41.38  ? 424  ASN A OD1   1 
ATOM   3426 N  ND2   . ASN A 1 424 ? 16.310  2.974   -55.842 1.00 40.38  ? 424  ASN A ND2   1 
ATOM   3427 N  N     . ILE A 1 425 ? 11.935  1.950   -53.017 1.00 27.20  ? 425  ILE A N     1 
ATOM   3428 C  CA    . ILE A 1 425 ? 11.439  2.822   -51.964 1.00 29.49  ? 425  ILE A CA    1 
ATOM   3429 C  C     . ILE A 1 425 ? 12.336  2.783   -50.727 1.00 29.11  ? 425  ILE A C     1 
ATOM   3430 O  O     . ILE A 1 425 ? 12.540  1.733   -50.124 1.00 28.90  ? 425  ILE A O     1 
ATOM   3431 C  CB    . ILE A 1 425 ? 9.989   2.456   -51.597 1.00 29.70  ? 425  ILE A CB    1 
ATOM   3432 C  CG1   . ILE A 1 425 ? 9.084   2.663   -52.815 1.00 32.82  ? 425  ILE A CG1   1 
ATOM   3433 C  CG2   . ILE A 1 425 ? 9.512   3.286   -50.422 1.00 30.31  ? 425  ILE A CG2   1 
ATOM   3434 C  CD1   . ILE A 1 425 ? 7.659   2.162   -52.634 1.00 33.49  ? 425  ILE A CD1   1 
ATOM   3435 N  N     . SER A 1 426 ? 12.871  3.943   -50.363 1.00 29.68  ? 426  SER A N     1 
ATOM   3436 C  CA    . SER A 1 426 ? 13.836  4.046   -49.277 1.00 29.70  ? 426  SER A CA    1 
ATOM   3437 C  C     . SER A 1 426 ? 13.855  5.505   -48.837 1.00 33.11  ? 426  SER A C     1 
ATOM   3438 O  O     . SER A 1 426 ? 13.496  6.385   -49.621 1.00 34.37  ? 426  SER A O     1 
ATOM   3439 C  CB    . SER A 1 426 ? 15.221  3.614   -49.777 1.00 32.20  ? 426  SER A CB    1 
ATOM   3440 O  OG    . SER A 1 426 ? 16.079  3.231   -48.716 1.00 32.99  ? 426  SER A OG    1 
ATOM   3441 N  N     . PRO A 1 427 ? 14.252  5.773   -47.579 1.00 29.57  ? 427  PRO A N     1 
ATOM   3442 C  CA    . PRO A 1 427 ? 14.320  7.166   -47.120 1.00 32.03  ? 427  PRO A CA    1 
ATOM   3443 C  C     . PRO A 1 427 ? 15.216  8.047   -47.993 1.00 35.77  ? 427  PRO A C     1 
ATOM   3444 O  O     . PRO A 1 427 ? 14.909  9.225   -48.175 1.00 36.72  ? 427  PRO A O     1 
ATOM   3445 C  CB    . PRO A 1 427 ? 14.905  7.048   -45.703 1.00 31.72  ? 427  PRO A CB    1 
ATOM   3446 C  CG    . PRO A 1 427 ? 15.461  5.650   -45.610 1.00 30.56  ? 427  PRO A CG    1 
ATOM   3447 C  CD    . PRO A 1 427 ? 14.591  4.827   -46.503 1.00 28.94  ? 427  PRO A CD    1 
ATOM   3448 N  N     . GLU A 1 428 ? 16.282  7.481   -48.552 1.00 34.51  ? 428  GLU A N     1 
ATOM   3449 C  CA    . GLU A 1 428 ? 17.260  8.284   -49.285 1.00 37.82  ? 428  GLU A CA    1 
ATOM   3450 C  C     . GLU A 1 428 ? 17.142  8.181   -50.807 1.00 38.02  ? 428  GLU A C     1 
ATOM   3451 O  O     . GLU A 1 428 ? 17.930  8.784   -51.532 1.00 37.01  ? 428  GLU A O     1 
ATOM   3452 C  CB    . GLU A 1 428 ? 18.688  7.937   -48.838 1.00 40.02  ? 428  GLU A CB    1 
ATOM   3453 C  CG    . GLU A 1 428 ? 19.295  6.698   -49.498 1.00 40.73  ? 428  GLU A CG    1 
ATOM   3454 C  CD    . GLU A 1 428 ? 18.806  5.381   -48.907 1.00 41.25  ? 428  GLU A CD    1 
ATOM   3455 O  OE1   . GLU A 1 428 ? 17.643  5.303   -48.454 1.00 38.56  ? 428  GLU A OE1   1 
ATOM   3456 O  OE2   . GLU A 1 428 ? 19.597  4.413   -48.902 1.00 43.60  ? 428  GLU A OE2   1 
ATOM   3457 N  N     . THR A 1 429 ? 16.168  7.424   -51.299 1.00 36.63  ? 429  THR A N     1 
ATOM   3458 C  CA    . THR A 1 429 ? 15.988  7.312   -52.744 1.00 35.69  ? 429  THR A CA    1 
ATOM   3459 C  C     . THR A 1 429 ? 14.833  8.165   -53.260 1.00 35.94  ? 429  THR A C     1 
ATOM   3460 O  O     . THR A 1 429 ? 14.497  8.103   -54.439 1.00 35.54  ? 429  THR A O     1 
ATOM   3461 C  CB    . THR A 1 429 ? 15.761  5.862   -53.196 1.00 32.55  ? 429  THR A CB    1 
ATOM   3462 O  OG1   . THR A 1 429 ? 14.636  5.316   -52.500 1.00 33.59  ? 429  THR A OG1   1 
ATOM   3463 C  CG2   . THR A 1 429 ? 16.998  5.011   -52.924 1.00 30.55  ? 429  THR A CG2   1 
ATOM   3464 N  N     . ILE A 1 430 ? 14.226  8.951   -52.376 1.00 33.35  ? 430  ILE A N     1 
ATOM   3465 C  CA    . ILE A 1 430 ? 13.162  9.873   -52.775 1.00 34.79  ? 430  ILE A CA    1 
ATOM   3466 C  C     . ILE A 1 430 ? 13.696  10.934  -53.742 1.00 36.84  ? 430  ILE A C     1 
ATOM   3467 O  O     . ILE A 1 430 ? 14.687  11.606  -53.452 1.00 38.95  ? 430  ILE A O     1 
ATOM   3468 C  CB    . ILE A 1 430 ? 12.516  10.547  -51.549 1.00 35.15  ? 430  ILE A CB    1 
ATOM   3469 C  CG1   . ILE A 1 430 ? 11.851  9.490   -50.664 1.00 37.02  ? 430  ILE A CG1   1 
ATOM   3470 C  CG2   . ILE A 1 430 ? 11.509  11.608  -51.983 1.00 35.59  ? 430  ILE A CG2   1 
ATOM   3471 C  CD1   . ILE A 1 430 ? 11.201  10.046  -49.411 1.00 40.44  ? 430  ILE A CD1   1 
ATOM   3472 N  N     . ALA A 1 431 ? 13.046  11.074  -54.895 1.00 36.22  ? 431  ALA A N     1 
ATOM   3473 C  CA    . ALA A 1 431 ? 13.539  11.970  -55.939 1.00 40.93  ? 431  ALA A CA    1 
ATOM   3474 C  C     . ALA A 1 431 ? 12.674  13.211  -56.130 1.00 42.47  ? 431  ALA A C     1 
ATOM   3475 O  O     . ALA A 1 431 ? 13.158  14.255  -56.564 1.00 46.53  ? 431  ALA A O     1 
ATOM   3476 C  CB    . ALA A 1 431 ? 13.681  11.218  -57.258 1.00 42.81  ? 431  ALA A CB    1 
ATOM   3477 N  N     . GLY A 1 432 ? 11.391  13.094  -55.816 1.00 40.98  ? 432  GLY A N     1 
ATOM   3478 C  CA    . GLY A 1 432 ? 10.465  14.192  -56.026 1.00 39.77  ? 432  GLY A CA    1 
ATOM   3479 C  C     . GLY A 1 432 ? 9.040   13.690  -56.100 1.00 39.62  ? 432  GLY A C     1 
ATOM   3480 O  O     . GLY A 1 432 ? 8.749   12.573  -55.672 1.00 36.70  ? 432  GLY A O     1 
ATOM   3481 N  N     . THR A 1 433 ? 8.148   14.514  -56.637 1.00 38.96  ? 433  THR A N     1 
ATOM   3482 C  CA    . THR A 1 433 ? 6.741   14.149  -56.750 1.00 42.16  ? 433  THR A CA    1 
ATOM   3483 C  C     . THR A 1 433 ? 6.203   14.455  -58.140 1.00 41.75  ? 433  THR A C     1 
ATOM   3484 O  O     . THR A 1 433 ? 6.814   15.209  -58.898 1.00 43.24  ? 433  THR A O     1 
ATOM   3485 C  CB    . THR A 1 433 ? 5.868   14.907  -55.728 1.00 43.35  ? 433  THR A CB    1 
ATOM   3486 O  OG1   . THR A 1 433 ? 5.920   16.314  -56.003 1.00 44.07  ? 433  THR A OG1   1 
ATOM   3487 C  CG2   . THR A 1 433 ? 6.345   14.646  -54.304 1.00 42.59  ? 433  THR A CG2   1 
ATOM   3488 N  N     . PHE A 1 434 ? 5.059   13.863  -58.470 1.00 37.30  ? 434  PHE A N     1 
ATOM   3489 C  CA    . PHE A 1 434 ? 4.332   14.219  -59.687 1.00 41.37  ? 434  PHE A CA    1 
ATOM   3490 C  C     . PHE A 1 434 ? 2.852   14.421  -59.374 1.00 43.39  ? 434  PHE A C     1 
ATOM   3491 O  O     . PHE A 1 434 ? 2.376   14.024  -58.308 1.00 39.49  ? 434  PHE A O     1 
ATOM   3492 C  CB    . PHE A 1 434 ? 4.517   13.162  -60.781 1.00 37.75  ? 434  PHE A CB    1 
ATOM   3493 C  CG    . PHE A 1 434 ? 3.974   11.801  -60.419 1.00 36.15  ? 434  PHE A CG    1 
ATOM   3494 C  CD1   . PHE A 1 434 ? 2.692   11.427  -60.793 1.00 36.45  ? 434  PHE A CD1   1 
ATOM   3495 C  CD2   . PHE A 1 434 ? 4.750   10.894  -59.718 1.00 34.34  ? 434  PHE A CD2   1 
ATOM   3496 C  CE1   . PHE A 1 434 ? 2.194   10.173  -60.467 1.00 34.16  ? 434  PHE A CE1   1 
ATOM   3497 C  CE2   . PHE A 1 434 ? 4.256   9.640   -59.389 1.00 38.07  ? 434  PHE A CE2   1 
ATOM   3498 C  CZ    . PHE A 1 434 ? 2.977   9.282   -59.766 1.00 32.71  ? 434  PHE A CZ    1 
ATOM   3499 N  N     . LYS A 1 435 ? 2.129   15.042  -60.301 1.00 45.27  ? 435  LYS A N     1 
ATOM   3500 C  CA    . LYS A 1 435 ? 0.709   15.315  -60.103 1.00 48.10  ? 435  LYS A CA    1 
ATOM   3501 C  C     . LYS A 1 435 ? -0.130  14.075  -60.382 1.00 46.80  ? 435  LYS A C     1 
ATOM   3502 O  O     . LYS A 1 435 ? -0.125  13.543  -61.493 1.00 47.97  ? 435  LYS A O     1 
ATOM   3503 C  CB    . LYS A 1 435 ? 0.248   16.479  -60.979 1.00 50.68  ? 435  LYS A CB    1 
ATOM   3504 C  CG    . LYS A 1 435 ? 0.947   17.795  -60.673 1.00 57.34  ? 435  LYS A CG    1 
ATOM   3505 N  N     . VAL A 1 436 ? -0.860  13.630  -59.366 1.00 43.46  ? 436  VAL A N     1 
ATOM   3506 C  CA    . VAL A 1 436 ? -1.583  12.365  -59.444 1.00 43.48  ? 436  VAL A CA    1 
ATOM   3507 C  C     . VAL A 1 436 ? -2.916  12.471  -60.179 1.00 47.00  ? 436  VAL A C     1 
ATOM   3508 O  O     . VAL A 1 436 ? -3.638  13.461  -60.058 1.00 52.80  ? 436  VAL A O     1 
ATOM   3509 C  CB    . VAL A 1 436 ? -1.806  11.746  -58.043 1.00 40.23  ? 436  VAL A CB    1 
ATOM   3510 C  CG1   . VAL A 1 436 ? -0.512  11.742  -57.275 1.00 38.70  ? 436  VAL A CG1   1 
ATOM   3511 C  CG2   . VAL A 1 436 ? -2.866  12.510  -57.264 1.00 44.34  ? 436  VAL A CG2   1 
ATOM   3512 N  N     . ALA A 1 437 ? -3.214  11.445  -60.967 1.00 46.04  ? 437  ALA A N     1 
ATOM   3513 C  CA    . ALA A 1 437 ? -4.528  11.280  -61.564 1.00 48.80  ? 437  ALA A CA    1 
ATOM   3514 C  C     . ALA A 1 437 ? -5.277  10.303  -60.667 1.00 47.61  ? 437  ALA A C     1 
ATOM   3515 O  O     . ALA A 1 437 ? -4.648  9.602   -59.876 1.00 43.17  ? 437  ALA A O     1 
ATOM   3516 C  CB    . ALA A 1 437 ? -4.397  10.724  -62.972 1.00 48.97  ? 437  ALA A CB    1 
ATOM   3517 N  N     . PRO A 1 438 ? -6.618  10.265  -60.767 1.00 46.89  ? 438  PRO A N     1 
ATOM   3518 C  CA    . PRO A 1 438 ? -7.393  9.271   -60.013 1.00 43.10  ? 438  PRO A CA    1 
ATOM   3519 C  C     . PRO A 1 438 ? -6.827  7.862   -60.208 1.00 43.53  ? 438  PRO A C     1 
ATOM   3520 O  O     . PRO A 1 438 ? -6.340  7.551   -61.297 1.00 42.53  ? 438  PRO A O     1 
ATOM   3521 C  CB    . PRO A 1 438 ? -8.783  9.379   -60.633 1.00 45.72  ? 438  PRO A CB    1 
ATOM   3522 C  CG    . PRO A 1 438 ? -8.877  10.814  -61.070 1.00 44.40  ? 438  PRO A CG    1 
ATOM   3523 C  CD    . PRO A 1 438 ? -7.488  11.203  -61.504 1.00 45.36  ? 438  PRO A CD    1 
ATOM   3524 N  N     . LEU A 1 439 ? -6.875  7.040   -59.163 1.00 39.04  ? 439  LEU A N     1 
ATOM   3525 C  CA    . LEU A 1 439 ? -6.243  5.722   -59.180 1.00 41.34  ? 439  LEU A CA    1 
ATOM   3526 C  C     . LEU A 1 439 ? -6.708  4.837   -60.338 1.00 41.99  ? 439  LEU A C     1 
ATOM   3527 O  O     . LEU A 1 439 ? -5.917  4.090   -60.915 1.00 42.26  ? 439  LEU A O     1 
ATOM   3528 C  CB    . LEU A 1 439 ? -6.467  4.999   -57.848 1.00 40.06  ? 439  LEU A CB    1 
ATOM   3529 C  CG    . LEU A 1 439 ? -5.623  3.740   -57.632 1.00 42.32  ? 439  LEU A CG    1 
ATOM   3530 C  CD1   . LEU A 1 439 ? -4.148  4.094   -57.604 1.00 41.51  ? 439  LEU A CD1   1 
ATOM   3531 C  CD2   . LEU A 1 439 ? -6.028  3.018   -56.354 1.00 43.59  ? 439  LEU A CD2   1 
ATOM   3532 N  N     . HIS A 1 440 ? -7.986  4.926   -60.683 1.00 43.39  ? 440  HIS A N     1 
ATOM   3533 C  CA    . HIS A 1 440 ? -8.528  4.095   -61.752 1.00 48.22  ? 440  HIS A CA    1 
ATOM   3534 C  C     . HIS A 1 440 ? -7.997  4.491   -63.130 1.00 46.13  ? 440  HIS A C     1 
ATOM   3535 O  O     . HIS A 1 440 ? -8.012  3.686   -64.061 1.00 47.64  ? 440  HIS A O     1 
ATOM   3536 C  CB    . HIS A 1 440 ? -10.056 4.088   -61.709 1.00 58.12  ? 440  HIS A CB    1 
ATOM   3537 C  CG    . HIS A 1 440 ? -10.611 3.450   -60.473 1.00 68.61  ? 440  HIS A CG    1 
ATOM   3538 N  ND1   . HIS A 1 440 ? -10.984 2.124   -60.422 1.00 71.94  ? 440  HIS A ND1   1 
ATOM   3539 C  CD2   . HIS A 1 440 ? -10.834 3.952   -59.235 1.00 72.18  ? 440  HIS A CD2   1 
ATOM   3540 C  CE1   . HIS A 1 440 ? -11.422 1.839   -59.208 1.00 71.81  ? 440  HIS A CE1   1 
ATOM   3541 N  NE2   . HIS A 1 440 ? -11.341 2.930   -58.469 1.00 72.00  ? 440  HIS A NE2   1 
ATOM   3542 N  N     . ASP A 1 441 ? -7.512  5.723   -63.252 1.00 43.44  ? 441  ASP A N     1 
ATOM   3543 C  CA    . ASP A 1 441 ? -6.846  6.155   -64.477 1.00 45.15  ? 441  ASP A CA    1 
ATOM   3544 C  C     . ASP A 1 441 ? -5.545  5.388   -64.711 1.00 43.79  ? 441  ASP A C     1 
ATOM   3545 O  O     . ASP A 1 441 ? -5.219  5.038   -65.846 1.00 42.79  ? 441  ASP A O     1 
ATOM   3546 C  CB    . ASP A 1 441 ? -6.576  7.661   -64.460 1.00 46.96  ? 441  ASP A CB    1 
ATOM   3547 C  CG    . ASP A 1 441 ? -7.824  8.477   -64.726 1.00 52.35  ? 441  ASP A CG    1 
ATOM   3548 O  OD1   . ASP A 1 441 ? -8.821  7.896   -65.207 1.00 52.08  ? 441  ASP A OD1   1 
ATOM   3549 O  OD2   . ASP A 1 441 ? -7.805  9.699   -64.463 1.00 56.40  ? 441  ASP A OD2   1 
ATOM   3550 N  N     . TYR A 1 442 ? -4.803  5.128   -63.638 1.00 40.77  ? 442  TYR A N     1 
ATOM   3551 C  CA    . TYR A 1 442 ? -3.578  4.341   -63.747 1.00 41.92  ? 442  TYR A CA    1 
ATOM   3552 C  C     . TYR A 1 442 ? -3.906  2.866   -63.956 1.00 41.95  ? 442  TYR A C     1 
ATOM   3553 O  O     . TYR A 1 442 ? -3.251  2.182   -64.742 1.00 41.50  ? 442  TYR A O     1 
ATOM   3554 C  CB    . TYR A 1 442 ? -2.681  4.534   -62.518 1.00 40.58  ? 442  TYR A CB    1 
ATOM   3555 C  CG    . TYR A 1 442 ? -2.167  5.948   -62.373 1.00 40.26  ? 442  TYR A CG    1 
ATOM   3556 C  CD1   . TYR A 1 442 ? -1.224  6.456   -63.257 1.00 40.39  ? 442  TYR A CD1   1 
ATOM   3557 C  CD2   . TYR A 1 442 ? -2.628  6.775   -61.358 1.00 38.85  ? 442  TYR A CD2   1 
ATOM   3558 C  CE1   . TYR A 1 442 ? -0.755  7.754   -63.138 1.00 40.05  ? 442  TYR A CE1   1 
ATOM   3559 C  CE2   . TYR A 1 442 ? -2.167  8.071   -61.229 1.00 41.31  ? 442  TYR A CE2   1 
ATOM   3560 C  CZ    . TYR A 1 442 ? -1.232  8.557   -62.122 1.00 40.79  ? 442  TYR A CZ    1 
ATOM   3561 O  OH    . TYR A 1 442 ? -0.774  9.847   -61.994 1.00 42.00  ? 442  TYR A OH    1 
ATOM   3562 N  N     . ILE A 1 443 ? -4.932  2.391   -63.253 1.00 45.05  ? 443  ILE A N     1 
ATOM   3563 C  CA    . ILE A 1 443 ? -5.394  1.010   -63.371 1.00 45.07  ? 443  ILE A CA    1 
ATOM   3564 C  C     . ILE A 1 443 ? -5.823  0.685   -64.800 1.00 48.24  ? 443  ILE A C     1 
ATOM   3565 O  O     . ILE A 1 443 ? -5.517  -0.390  -65.318 1.00 48.43  ? 443  ILE A O     1 
ATOM   3566 C  CB    . ILE A 1 443 ? -6.567  0.731   -62.398 1.00 45.11  ? 443  ILE A CB    1 
ATOM   3567 C  CG1   . ILE A 1 443 ? -6.075  0.769   -60.948 1.00 41.67  ? 443  ILE A CG1   1 
ATOM   3568 C  CG2   . ILE A 1 443 ? -7.212  -0.615  -62.694 1.00 43.93  ? 443  ILE A CG2   1 
ATOM   3569 C  CD1   . ILE A 1 443 ? -7.183  0.882   -59.926 1.00 41.03  ? 443  ILE A CD1   1 
ATOM   3570 N  N     . ASN A 1 444 ? -6.512  1.630   -65.438 1.00 48.80  ? 444  ASN A N     1 
ATOM   3571 C  CA    . ASN A 1 444 ? -7.022  1.433   -66.792 1.00 49.84  ? 444  ASN A CA    1 
ATOM   3572 C  C     . ASN A 1 444 ? -6.079  1.962   -67.869 1.00 51.24  ? 444  ASN A C     1 
ATOM   3573 O  O     . ASN A 1 444 ? -6.438  2.015   -69.050 1.00 52.35  ? 444  ASN A O     1 
ATOM   3574 C  CB    . ASN A 1 444 ? -8.407  2.068   -66.940 1.00 53.43  ? 444  ASN A CB    1 
ATOM   3575 C  CG    . ASN A 1 444 ? -9.443  1.419   -66.042 1.00 56.33  ? 444  ASN A CG    1 
ATOM   3576 O  OD1   . ASN A 1 444 ? -9.454  0.200   -65.869 1.00 58.46  ? 444  ASN A OD1   1 
ATOM   3577 N  ND2   . ASN A 1 444 ? -10.315 2.233   -65.459 1.00 56.47  ? 444  ASN A ND2   1 
ATOM   3578 N  N     . ALA A 1 445 ? -4.880  2.355   -67.448 1.00 47.55  ? 445  ALA A N     1 
ATOM   3579 C  CA    . ALA A 1 445 ? -3.827  2.805   -68.357 1.00 48.84  ? 445  ALA A CA    1 
ATOM   3580 C  C     . ALA A 1 445 ? -4.228  3.982   -69.249 1.00 53.37  ? 445  ALA A C     1 
ATOM   3581 O  O     . ALA A 1 445 ? -3.893  4.007   -70.431 1.00 54.86  ? 445  ALA A O     1 
ATOM   3582 C  CB    . ALA A 1 445 ? -3.320  1.638   -69.205 1.00 48.22  ? 445  ALA A CB    1 
ATOM   3583 N  N     . VAL A 1 446 ? -4.934  4.957   -68.684 1.00 54.64  ? 446  VAL A N     1 
ATOM   3584 C  CA    . VAL A 1 446 ? -5.315  6.148   -69.438 1.00 56.94  ? 446  VAL A CA    1 
ATOM   3585 C  C     . VAL A 1 446 ? -4.593  7.401   -68.937 1.00 54.55  ? 446  VAL A C     1 
ATOM   3586 O  O     . VAL A 1 446 ? -4.481  8.392   -69.657 1.00 55.17  ? 446  VAL A O     1 
ATOM   3587 C  CB    . VAL A 1 446 ? -6.843  6.382   -69.424 1.00 61.12  ? 446  VAL A CB    1 
ATOM   3588 C  CG1   . VAL A 1 446 ? -7.572  5.169   -69.988 1.00 60.88  ? 446  VAL A CG1   1 
ATOM   3589 C  CG2   . VAL A 1 446 ? -7.325  6.690   -68.018 1.00 60.64  ? 446  VAL A CG2   1 
ATOM   3590 N  N     . ALA A 1 447 ? -4.103  7.357   -67.702 1.00 51.78  ? 447  ALA A N     1 
ATOM   3591 C  CA    . ALA A 1 447 ? -3.360  8.484   -67.151 1.00 49.36  ? 447  ALA A CA    1 
ATOM   3592 C  C     . ALA A 1 447 ? -1.986  8.583   -67.798 1.00 47.57  ? 447  ALA A C     1 
ATOM   3593 O  O     . ALA A 1 447 ? -1.376  7.568   -68.138 1.00 47.27  ? 447  ALA A O     1 
ATOM   3594 C  CB    . ALA A 1 447 ? -3.224  8.349   -65.646 1.00 46.47  ? 447  ALA A CB    1 
ATOM   3595 N  N     . GLU A 1 448 ? -1.506  9.809   -67.968 1.00 48.52  ? 448  GLU A N     1 
ATOM   3596 C  CA    . GLU A 1 448 ? -0.188  10.035  -68.545 1.00 49.11  ? 448  GLU A CA    1 
ATOM   3597 C  C     . GLU A 1 448 ? 0.894   9.368   -67.700 1.00 47.69  ? 448  GLU A C     1 
ATOM   3598 O  O     . GLU A 1 448 ? 0.784   9.293   -66.474 1.00 46.59  ? 448  GLU A O     1 
ATOM   3599 C  CB    . GLU A 1 448 ? 0.092   11.534  -68.679 1.00 51.30  ? 448  GLU A CB    1 
ATOM   3600 C  CG    . GLU A 1 448 ? 0.068   12.285  -67.357 1.00 51.84  ? 448  GLU A CG    1 
ATOM   3601 N  N     . ARG A 1 449 ? 1.925   8.870   -68.371 1.00 42.46  ? 449  ARG A N     1 
ATOM   3602 C  CA    . ARG A 1 449 ? 3.067   8.259   -67.707 1.00 46.23  ? 449  ARG A CA    1 
ATOM   3603 C  C     . ARG A 1 449 ? 3.694   9.258   -66.735 1.00 45.98  ? 449  ARG A C     1 
ATOM   3604 O  O     . ARG A 1 449 ? 4.124   10.336  -67.143 1.00 50.15  ? 449  ARG A O     1 
ATOM   3605 C  CB    . ARG A 1 449 ? 4.085   7.816   -68.756 1.00 47.70  ? 449  ARG A CB    1 
ATOM   3606 C  CG    . ARG A 1 449 ? 5.165   6.887   -68.250 1.00 48.46  ? 449  ARG A CG    1 
ATOM   3607 C  CD    . ARG A 1 449 ? 5.829   6.171   -69.418 1.00 51.40  ? 449  ARG A CD    1 
ATOM   3608 N  NE    . ARG A 1 449 ? 6.819   5.195   -68.975 1.00 50.06  ? 449  ARG A NE    1 
ATOM   3609 C  CZ    . ARG A 1 449 ? 8.131   5.348   -69.117 1.00 49.51  ? 449  ARG A CZ    1 
ATOM   3610 N  NH1   . ARG A 1 449 ? 8.613   6.438   -69.700 1.00 48.07  ? 449  ARG A NH1   1 
ATOM   3611 N  NH2   . ARG A 1 449 ? 8.960   4.409   -68.682 1.00 46.78  ? 449  ARG A NH2   1 
ATOM   3612 N  N     . PRO A 1 450 ? 3.716   8.913   -65.437 1.00 42.36  ? 450  PRO A N     1 
ATOM   3613 C  CA    . PRO A 1 450 ? 4.202   9.818   -64.388 1.00 40.06  ? 450  PRO A CA    1 
ATOM   3614 C  C     . PRO A 1 450 ? 5.600   10.371  -64.660 1.00 43.70  ? 450  PRO A C     1 
ATOM   3615 O  O     . PRO A 1 450 ? 5.827   11.569  -64.478 1.00 50.22  ? 450  PRO A O     1 
ATOM   3616 C  CB    . PRO A 1 450 ? 4.217   8.940   -63.126 1.00 38.15  ? 450  PRO A CB    1 
ATOM   3617 C  CG    . PRO A 1 450 ? 3.682   7.588   -63.535 1.00 38.81  ? 450  PRO A CG    1 
ATOM   3618 C  CD    . PRO A 1 450 ? 3.053   7.725   -64.877 1.00 38.77  ? 450  PRO A CD    1 
ATOM   3619 N  N     . SER A 1 451 ? 6.518   9.517   -65.100 1.00 41.53  ? 451  SER A N     1 
ATOM   3620 C  CA    . SER A 1 451 ? 7.891   9.945   -65.329 1.00 43.99  ? 451  SER A CA    1 
ATOM   3621 C  C     . SER A 1 451 ? 8.641   9.019   -66.274 1.00 45.29  ? 451  SER A C     1 
ATOM   3622 O  O     . SER A 1 451 ? 8.438   7.807   -66.265 1.00 42.48  ? 451  SER A O     1 
ATOM   3623 C  CB    . SER A 1 451 ? 8.649   10.037  -64.003 1.00 41.52  ? 451  SER A CB    1 
ATOM   3624 O  OG    . SER A 1 451 ? 10.017  10.344  -64.221 1.00 43.41  ? 451  SER A OG    1 
ATOM   3625 N  N     . ASP A 1 452 ? 9.517   9.596   -67.088 1.00 47.80  ? 452  ASP A N     1 
ATOM   3626 C  CA    . ASP A 1 452 ? 10.381  8.799   -67.948 1.00 50.41  ? 452  ASP A CA    1 
ATOM   3627 C  C     . ASP A 1 452 ? 11.812  8.824   -67.421 1.00 46.51  ? 452  ASP A C     1 
ATOM   3628 O  O     . ASP A 1 452 ? 12.737  8.375   -68.093 1.00 47.47  ? 452  ASP A O     1 
ATOM   3629 C  CB    . ASP A 1 452 ? 10.312  9.286   -69.400 1.00 56.12  ? 452  ASP A CB    1 
ATOM   3630 C  CG    . ASP A 1 452 ? 10.814  10.709  -69.567 1.00 64.99  ? 452  ASP A CG    1 
ATOM   3631 O  OD1   . ASP A 1 452 ? 10.882  11.444  -68.558 1.00 67.91  ? 452  ASP A OD1   1 
ATOM   3632 O  OD2   . ASP A 1 452 ? 11.135  11.098  -70.712 1.00 69.17  ? 452  ASP A OD2   1 
ATOM   3633 N  N     . VAL A 1 453 ? 11.982  9.349   -66.211 1.00 43.02  ? 453  VAL A N     1 
ATOM   3634 C  CA    . VAL A 1 453 ? 13.304  9.459   -65.597 1.00 45.86  ? 453  VAL A CA    1 
ATOM   3635 C  C     . VAL A 1 453 ? 13.372  8.708   -64.265 1.00 44.57  ? 453  VAL A C     1 
ATOM   3636 O  O     . VAL A 1 453 ? 14.335  7.989   -63.997 1.00 43.50  ? 453  VAL A O     1 
ATOM   3637 C  CB    . VAL A 1 453 ? 13.701  10.935  -65.372 1.00 48.86  ? 453  VAL A CB    1 
ATOM   3638 C  CG1   . VAL A 1 453 ? 15.048  11.029  -64.672 1.00 44.43  ? 453  VAL A CG1   1 
ATOM   3639 C  CG2   . VAL A 1 453 ? 13.729  11.689  -66.701 1.00 50.12  ? 453  VAL A CG2   1 
ATOM   3640 N  N     . TYR A 1 454 ? 12.343  8.872   -63.438 1.00 39.31  ? 454  TYR A N     1 
ATOM   3641 C  CA    . TYR A 1 454 ? 12.324  8.260   -62.114 1.00 37.30  ? 454  TYR A CA    1 
ATOM   3642 C  C     . TYR A 1 454 ? 11.320  7.119   -62.004 1.00 38.68  ? 454  TYR A C     1 
ATOM   3643 O  O     . TYR A 1 454 ? 10.404  6.997   -62.818 1.00 39.53  ? 454  TYR A O     1 
ATOM   3644 C  CB    . TYR A 1 454 ? 12.035  9.312   -61.041 1.00 38.34  ? 454  TYR A CB    1 
ATOM   3645 C  CG    . TYR A 1 454 ? 12.937  10.522  -61.130 1.00 40.72  ? 454  TYR A CG    1 
ATOM   3646 C  CD1   . TYR A 1 454 ? 14.274  10.445  -60.760 1.00 41.11  ? 454  TYR A CD1   1 
ATOM   3647 C  CD2   . TYR A 1 454 ? 12.453  11.738  -61.592 1.00 44.25  ? 454  TYR A CD2   1 
ATOM   3648 C  CE1   . TYR A 1 454 ? 15.104  11.554  -60.846 1.00 45.49  ? 454  TYR A CE1   1 
ATOM   3649 C  CE2   . TYR A 1 454 ? 13.274  12.848  -61.681 1.00 46.93  ? 454  TYR A CE2   1 
ATOM   3650 C  CZ    . TYR A 1 454 ? 14.597  12.750  -61.305 1.00 47.86  ? 454  TYR A CZ    1 
ATOM   3651 O  OH    . TYR A 1 454 ? 15.414  13.855  -61.394 1.00 53.13  ? 454  TYR A OH    1 
ATOM   3652 N  N     . SER A 1 455 ? 11.508  6.291   -60.980 1.00 36.07  ? 455  SER A N     1 
ATOM   3653 C  CA    . SER A 1 455 ? 10.621  5.173   -60.690 1.00 34.36  ? 455  SER A CA    1 
ATOM   3654 C  C     . SER A 1 455 ? 9.485   5.642   -59.781 1.00 35.84  ? 455  SER A C     1 
ATOM   3655 O  O     . SER A 1 455 ? 9.727   6.264   -58.743 1.00 36.56  ? 455  SER A O     1 
ATOM   3656 C  CB    . SER A 1 455 ? 11.416  4.037   -60.039 1.00 32.13  ? 455  SER A CB    1 
ATOM   3657 O  OG    . SER A 1 455 ? 10.566  3.004   -59.584 1.00 30.55  ? 455  SER A OG    1 
ATOM   3658 N  N     . CYS A 1 456 ? 8.247   5.344   -60.169 1.00 31.22  ? 456  CYS A N     1 
ATOM   3659 C  CA    . CYS A 1 456 ? 7.089   5.974   -59.537 1.00 30.63  ? 456  CYS A CA    1 
ATOM   3660 C  C     . CYS A 1 456 ? 6.067   5.032   -58.912 1.00 35.94  ? 456  CYS A C     1 
ATOM   3661 O  O     . CYS A 1 456 ? 5.973   3.858   -59.264 1.00 33.67  ? 456  CYS A O     1 
ATOM   3662 C  CB    . CYS A 1 456 ? 6.365   6.872   -60.542 1.00 34.96  ? 456  CYS A CB    1 
ATOM   3663 S  SG    . CYS A 1 456 ? 7.442   8.033   -61.404 1.00 40.94  ? 456  CYS A SG    1 
ATOM   3664 N  N     . SER A 1 457 ? 5.293   5.590   -57.988 1.00 37.60  ? 457  SER A N     1 
ATOM   3665 C  CA    . SER A 1 457 ? 4.119   4.942   -57.424 1.00 34.02  ? 457  SER A CA    1 
ATOM   3666 C  C     . SER A 1 457 ? 2.930   5.869   -57.646 1.00 34.27  ? 457  SER A C     1 
ATOM   3667 O  O     . SER A 1 457 ? 3.085   7.091   -57.608 1.00 33.03  ? 457  SER A O     1 
ATOM   3668 C  CB    . SER A 1 457 ? 4.316   4.701   -55.928 1.00 33.73  ? 457  SER A CB    1 
ATOM   3669 O  OG    . SER A 1 457 ? 3.079   4.426   -55.294 1.00 32.27  ? 457  SER A OG    1 
ATOM   3670 N  N     . PRO A 1 458 ? 1.734   5.297   -57.873 1.00 31.85  ? 458  PRO A N     1 
ATOM   3671 C  CA    . PRO A 1 458 ? 0.532   6.097   -58.146 1.00 31.09  ? 458  PRO A CA    1 
ATOM   3672 C  C     . PRO A 1 458 ? 0.080   7.019   -57.004 1.00 35.76  ? 458  PRO A C     1 
ATOM   3673 O  O     . PRO A 1 458 ? -0.894  7.752   -57.185 1.00 39.69  ? 458  PRO A O     1 
ATOM   3674 C  CB    . PRO A 1 458 ? -0.536  5.039   -58.445 1.00 30.84  ? 458  PRO A CB    1 
ATOM   3675 C  CG    . PRO A 1 458 ? -0.032  3.786   -57.795 1.00 27.95  ? 458  PRO A CG    1 
ATOM   3676 C  CD    . PRO A 1 458 ? 1.458   3.851   -57.930 1.00 30.96  ? 458  PRO A CD    1 
ATOM   3677 N  N     . ASN A 1 459 ? 0.764   6.999   -55.863 1.00 31.06  ? 459  ASN A N     1 
ATOM   3678 C  CA    . ASN A 1 459 ? 0.478   7.971   -54.806 1.00 30.03  ? 459  ASN A CA    1 
ATOM   3679 C  C     . ASN A 1 459 ? 1.130   9.335   -55.066 1.00 33.83  ? 459  ASN A C     1 
ATOM   3680 O  O     . ASN A 1 459 ? 0.866   10.301  -54.350 1.00 35.96  ? 459  ASN A O     1 
ATOM   3681 C  CB    . ASN A 1 459 ? 0.890   7.437   -53.428 1.00 30.85  ? 459  ASN A CB    1 
ATOM   3682 C  CG    . ASN A 1 459 ? 2.385   7.578   -53.163 1.00 28.85  ? 459  ASN A CG    1 
ATOM   3683 O  OD1   . ASN A 1 459 ? 3.207   7.417   -54.062 1.00 29.19  ? 459  ASN A OD1   1 
ATOM   3684 N  ND2   . ASN A 1 459 ? 2.740   7.871   -51.917 1.00 28.40  ? 459  ASN A ND2   1 
ATOM   3685 N  N     . GLY A 1 460 ? 1.985   9.405   -56.085 1.00 36.37  ? 460  GLY A N     1 
ATOM   3686 C  CA    . GLY A 1 460 ? 2.639   10.651  -56.456 1.00 34.05  ? 460  GLY A CA    1 
ATOM   3687 C  C     . GLY A 1 460 ? 4.131   10.729  -56.179 1.00 34.93  ? 460  GLY A C     1 
ATOM   3688 O  O     . GLY A 1 460 ? 4.758   11.751  -56.444 1.00 33.50  ? 460  GLY A O     1 
ATOM   3689 N  N     . MET A 1 461 ? 4.709   9.656   -55.650 1.00 32.44  ? 461  MET A N     1 
ATOM   3690 C  CA    . MET A 1 461 ? 6.130   9.658   -55.304 1.00 34.19  ? 461  MET A CA    1 
ATOM   3691 C  C     . MET A 1 461 ? 7.030   9.163   -56.441 1.00 35.75  ? 461  MET A C     1 
ATOM   3692 O  O     . MET A 1 461 ? 6.672   8.246   -57.181 1.00 34.06  ? 461  MET A O     1 
ATOM   3693 C  CB    . MET A 1 461 ? 6.372   8.838   -54.035 1.00 30.48  ? 461  MET A CB    1 
ATOM   3694 C  CG    . MET A 1 461 ? 5.745   9.442   -52.792 1.00 28.97  ? 461  MET A CG    1 
ATOM   3695 S  SD    . MET A 1 461 ? 6.533   11.008  -52.362 1.00 36.23  ? 461  MET A SD    1 
ATOM   3696 C  CE    . MET A 1 461 ? 8.152   10.425  -51.873 1.00 31.33  ? 461  MET A CE    1 
ATOM   3697 N  N     . MET A 1 462 ? 8.195   9.793   -56.574 1.00 32.89  ? 462  MET A N     1 
ATOM   3698 C  CA    . MET A 1 462 ? 9.196   9.390   -57.554 1.00 32.26  ? 462  MET A CA    1 
ATOM   3699 C  C     . MET A 1 462 ? 10.477  9.021   -56.828 1.00 37.69  ? 462  MET A C     1 
ATOM   3700 O  O     . MET A 1 462 ? 10.863  9.679   -55.862 1.00 39.45  ? 462  MET A O     1 
ATOM   3701 C  CB    . MET A 1 462 ? 9.477   10.526  -58.543 1.00 38.90  ? 462  MET A CB    1 
ATOM   3702 C  CG    . MET A 1 462 ? 8.234   11.041  -59.258 1.00 34.88  ? 462  MET A CG    1 
ATOM   3703 S  SD    . MET A 1 462 ? 8.619   12.045  -60.705 1.00 41.19  ? 462  MET A SD    1 
ATOM   3704 C  CE    . MET A 1 462 ? 9.575   13.372  -59.968 1.00 38.55  ? 462  MET A CE    1 
ATOM   3705 N  N     . TYR A 1 463 ? 11.133  7.968   -57.296 1.00 33.92  ? 463  TYR A N     1 
ATOM   3706 C  CA    . TYR A 1 463 ? 12.352  7.485   -56.664 1.00 34.59  ? 463  TYR A CA    1 
ATOM   3707 C  C     . TYR A 1 463 ? 13.467  7.348   -57.692 1.00 37.97  ? 463  TYR A C     1 
ATOM   3708 O  O     . TYR A 1 463 ? 13.209  7.055   -58.862 1.00 37.77  ? 463  TYR A O     1 
ATOM   3709 C  CB    . TYR A 1 463 ? 12.091  6.147   -55.956 1.00 29.89  ? 463  TYR A CB    1 
ATOM   3710 C  CG    . TYR A 1 463 ? 11.016  6.240   -54.899 1.00 30.07  ? 463  TYR A CG    1 
ATOM   3711 C  CD1   . TYR A 1 463 ? 11.346  6.415   -53.559 1.00 29.97  ? 463  TYR A CD1   1 
ATOM   3712 C  CD2   . TYR A 1 463 ? 9.669   6.173   -55.240 1.00 30.19  ? 463  TYR A CD2   1 
ATOM   3713 C  CE1   . TYR A 1 463 ? 10.368  6.511   -52.588 1.00 27.12  ? 463  TYR A CE1   1 
ATOM   3714 C  CE2   . TYR A 1 463 ? 8.681   6.268   -54.272 1.00 29.20  ? 463  TYR A CE2   1 
ATOM   3715 C  CZ    . TYR A 1 463 ? 9.037   6.439   -52.948 1.00 28.51  ? 463  TYR A CZ    1 
ATOM   3716 O  OH    . TYR A 1 463 ? 8.059   6.535   -51.982 1.00 25.95  ? 463  TYR A OH    1 
ATOM   3717 N  N     . TYR A 1 464 ? 14.703  7.591   -57.262 1.00 40.77  ? 464  TYR A N     1 
ATOM   3718 C  CA    . TYR A 1 464 ? 15.858  7.407   -58.133 1.00 44.96  ? 464  TYR A CA    1 
ATOM   3719 C  C     . TYR A 1 464 ? 15.961  5.924   -58.455 1.00 48.32  ? 464  TYR A C     1 
ATOM   3720 O  O     . TYR A 1 464 ? 15.814  5.084   -57.567 1.00 44.04  ? 464  TYR A O     1 
ATOM   3721 C  CB    . TYR A 1 464 ? 17.146  7.887   -57.455 1.00 45.03  ? 464  TYR A CB    1 
ATOM   3722 C  CG    . TYR A 1 464 ? 17.198  9.375   -57.186 1.00 47.44  ? 464  TYR A CG    1 
ATOM   3723 C  CD1   . TYR A 1 464 ? 17.414  10.280  -58.217 1.00 50.52  ? 464  TYR A CD1   1 
ATOM   3724 C  CD2   . TYR A 1 464 ? 17.045  9.874   -55.899 1.00 48.92  ? 464  TYR A CD2   1 
ATOM   3725 C  CE1   . TYR A 1 464 ? 17.464  11.646  -57.976 1.00 51.81  ? 464  TYR A CE1   1 
ATOM   3726 C  CE2   . TYR A 1 464 ? 17.096  11.237  -55.647 1.00 51.18  ? 464  TYR A CE2   1 
ATOM   3727 C  CZ    . TYR A 1 464 ? 17.306  12.117  -56.688 1.00 52.87  ? 464  TYR A CZ    1 
ATOM   3728 O  OH    . TYR A 1 464 ? 17.356  13.470  -56.440 1.00 55.91  ? 464  TYR A OH    1 
ATOM   3729 N  N     . LYS A 1 465 ? 16.197  5.593   -59.721 1.00 51.90  ? 465  LYS A N     1 
ATOM   3730 C  CA    . LYS A 1 465 ? 16.248  4.187   -60.112 1.00 56.89  ? 465  LYS A CA    1 
ATOM   3731 C  C     . LYS A 1 465 ? 17.648  3.689   -60.454 1.00 61.82  ? 465  LYS A C     1 
ATOM   3732 O  O     . LYS A 1 465 ? 17.810  2.571   -60.939 1.00 66.06  ? 465  LYS A O     1 
ATOM   3733 C  CB    . LYS A 1 465 ? 15.271  3.893   -61.252 1.00 54.83  ? 465  LYS A CB    1 
ATOM   3734 C  CG    . LYS A 1 465 ? 15.374  4.830   -62.427 1.00 55.68  ? 465  LYS A CG    1 
ATOM   3735 C  CD    . LYS A 1 465 ? 14.353  4.471   -63.496 1.00 54.44  ? 465  LYS A CD    1 
ATOM   3736 C  CE    . LYS A 1 465 ? 14.634  3.103   -64.094 1.00 51.22  ? 465  LYS A CE    1 
ATOM   3737 N  NZ    . LYS A 1 465 ? 13.854  2.881   -65.344 1.00 49.16  ? 465  LYS A NZ    1 
ATOM   3738 N  N     . ASP A 1 466 ? 18.656  4.516   -60.192 1.00 61.99  ? 466  ASP A N     1 
ATOM   3739 C  CA    . ASP A 1 466 ? 20.046  4.098   -60.353 1.00 64.74  ? 466  ASP A CA    1 
ATOM   3740 C  C     . ASP A 1 466 ? 20.628  3.741   -58.994 1.00 66.35  ? 466  ASP A C     1 
ATOM   3741 O  O     . ASP A 1 466 ? 21.337  2.751   -58.847 1.00 68.90  ? 466  ASP A O     1 
ATOM   3742 C  CB    . ASP A 1 466 ? 20.883  5.211   -60.992 1.00 67.56  ? 466  ASP A CB    1 
ATOM   3743 C  CG    . ASP A 1 466 ? 20.053  6.434   -61.363 1.00 67.22  ? 466  ASP A CG    1 
ATOM   3744 O  OD1   . ASP A 1 466 ? 19.534  7.107   -60.438 1.00 60.23  ? 466  ASP A OD1   1 
ATOM   3745 O  OD2   . ASP A 1 466 ? 19.937  6.730   -62.578 1.00 69.40  ? 466  ASP A OD2   1 
ATOM   3746 N  N     . ARG A 1 467 ? 20.310  4.563   -58.001 1.00 65.12  ? 467  ARG A N     1 
ATOM   3747 C  CA    . ARG A 1 467 ? 20.860  4.424   -56.657 1.00 63.18  ? 467  ARG A CA    1 
ATOM   3748 C  C     . ARG A 1 467 ? 20.335  3.191   -55.928 1.00 57.64  ? 467  ARG A C     1 
ATOM   3749 O  O     . ARG A 1 467 ? 19.170  2.823   -56.062 1.00 50.09  ? 467  ARG A O     1 
ATOM   3750 C  CB    . ARG A 1 467 ? 20.556  5.682   -55.834 1.00 63.99  ? 467  ARG A CB    1 
ATOM   3751 C  CG    . ARG A 1 467 ? 20.915  6.978   -56.534 1.00 67.13  ? 467  ARG A CG    1 
ATOM   3752 C  CD    . ARG A 1 467 ? 20.558  8.183   -55.687 1.00 66.64  ? 467  ARG A CD    1 
ATOM   3753 N  NE    . ARG A 1 467 ? 20.919  9.438   -56.340 1.00 69.35  ? 467  ARG A NE    1 
ATOM   3754 C  CZ    . ARG A 1 467 ? 20.806  10.631  -55.766 1.00 70.56  ? 467  ARG A CZ    1 
ATOM   3755 N  NH1   . ARG A 1 467 ? 20.345  10.729  -54.526 1.00 70.49  ? 467  ARG A NH1   1 
ATOM   3756 N  NH2   . ARG A 1 467 ? 21.156  11.726  -56.428 1.00 72.93  ? 467  ARG A NH2   1 
ATOM   3757 N  N     . ASP A 1 468 ? 21.207  2.566   -55.146 1.00 60.23  ? 468  ASP A N     1 
ATOM   3758 C  CA    . ASP A 1 468 ? 20.810  1.448   -54.302 1.00 61.06  ? 468  ASP A CA    1 
ATOM   3759 C  C     . ASP A 1 468 ? 20.240  1.983   -52.993 1.00 55.45  ? 468  ASP A C     1 
ATOM   3760 O  O     . ASP A 1 468 ? 20.921  2.703   -52.263 1.00 60.54  ? 468  ASP A O     1 
ATOM   3761 C  CB    . ASP A 1 468 ? 22.009  0.542   -54.013 1.00 66.79  ? 468  ASP A CB    1 
ATOM   3762 C  CG    . ASP A 1 468 ? 22.672  0.025   -55.280 1.00 72.53  ? 468  ASP A CG    1 
ATOM   3763 O  OD1   . ASP A 1 468 ? 21.948  -0.285  -56.250 1.00 75.17  ? 468  ASP A OD1   1 
ATOM   3764 O  OD2   . ASP A 1 468 ? 23.918  -0.074  -55.304 1.00 73.43  ? 468  ASP A OD2   1 
ATOM   3765 N  N     . GLY A 1 469 ? 18.989  1.645   -52.704 1.00 46.88  ? 469  GLY A N     1 
ATOM   3766 C  CA    . GLY A 1 469 ? 18.373  2.049   -51.452 1.00 40.60  ? 469  GLY A CA    1 
ATOM   3767 C  C     . GLY A 1 469 ? 18.663  1.054   -50.344 1.00 39.65  ? 469  GLY A C     1 
ATOM   3768 O  O     . GLY A 1 469 ? 18.638  -0.156  -50.571 1.00 36.75  ? 469  GLY A O     1 
ATOM   3769 N  N     . VAL A 1 470 ? 18.930  1.561   -49.143 1.00 38.29  ? 470  VAL A N     1 
ATOM   3770 C  CA    . VAL A 1 470 ? 19.284  0.701   -48.017 1.00 34.32  ? 470  VAL A CA    1 
ATOM   3771 C  C     . VAL A 1 470 ? 18.106  -0.171  -47.554 1.00 31.41  ? 470  VAL A C     1 
ATOM   3772 O  O     . VAL A 1 470 ? 18.300  -1.303  -47.110 1.00 30.63  ? 470  VAL A O     1 
ATOM   3773 C  CB    . VAL A 1 470 ? 19.874  1.512   -46.835 1.00 33.49  ? 470  VAL A CB    1 
ATOM   3774 C  CG1   . VAL A 1 470 ? 18.797  2.363   -46.168 1.00 31.19  ? 470  VAL A CG1   1 
ATOM   3775 C  CG2   . VAL A 1 470 ? 20.542  0.579   -45.828 1.00 34.24  ? 470  VAL A CG2   1 
ATOM   3776 N  N     . VAL A 1 471 ? 16.887  0.342   -47.677 1.00 30.85  ? 471  VAL A N     1 
ATOM   3777 C  CA    . VAL A 1 471 ? 15.708  -0.470  -47.372 1.00 33.02  ? 471  VAL A CA    1 
ATOM   3778 C  C     . VAL A 1 471 ? 15.505  -1.598  -48.405 1.00 32.47  ? 471  VAL A C     1 
ATOM   3779 O  O     . VAL A 1 471 ? 15.348  -2.749  -48.017 1.00 30.08  ? 471  VAL A O     1 
ATOM   3780 C  CB    . VAL A 1 471 ? 14.426  0.382   -47.156 1.00 24.65  ? 471  VAL A CB    1 
ATOM   3781 C  CG1   . VAL A 1 471 ? 13.184  -0.504  -47.150 1.00 26.84  ? 471  VAL A CG1   1 
ATOM   3782 C  CG2   . VAL A 1 471 ? 14.530  1.171   -45.863 1.00 26.11  ? 471  VAL A CG2   1 
ATOM   3783 N  N     . PRO A 1 472 ? 15.529  -1.280  -49.717 1.00 32.02  ? 472  PRO A N     1 
ATOM   3784 C  CA    . PRO A 1 472 ? 15.511  -2.380  -50.693 1.00 29.74  ? 472  PRO A CA    1 
ATOM   3785 C  C     . PRO A 1 472 ? 16.676  -3.371  -50.549 1.00 33.57  ? 472  PRO A C     1 
ATOM   3786 O  O     . PRO A 1 472 ? 16.461  -4.578  -50.677 1.00 35.25  ? 472  PRO A O     1 
ATOM   3787 C  CB    . PRO A 1 472 ? 15.612  -1.650  -52.034 1.00 26.51  ? 472  PRO A CB    1 
ATOM   3788 C  CG    . PRO A 1 472 ? 14.936  -0.350  -51.786 1.00 28.33  ? 472  PRO A CG    1 
ATOM   3789 C  CD    . PRO A 1 472 ? 15.313  0.024   -50.373 1.00 29.16  ? 472  PRO A CD    1 
ATOM   3790 N  N     . THR A 1 473 ? 17.882  -2.869  -50.294 1.00 32.48  ? 473  THR A N     1 
ATOM   3791 C  CA    . THR A 1 473 ? 19.061  -3.726  -50.171 1.00 34.12  ? 473  THR A CA    1 
ATOM   3792 C  C     . THR A 1 473 ? 18.931  -4.721  -49.019 1.00 32.04  ? 473  THR A C     1 
ATOM   3793 O  O     . THR A 1 473 ? 19.193  -5.910  -49.187 1.00 32.47  ? 473  THR A O     1 
ATOM   3794 C  CB    . THR A 1 473 ? 20.363  -2.906  -49.982 1.00 35.93  ? 473  THR A CB    1 
ATOM   3795 O  OG1   . THR A 1 473 ? 20.608  -2.113  -51.149 1.00 41.31  ? 473  THR A OG1   1 
ATOM   3796 C  CG2   . THR A 1 473 ? 21.552  -3.826  -49.763 1.00 35.08  ? 473  THR A CG2   1 
ATOM   3797 N  N     . GLU A 1 474 ? 18.514  -4.237  -47.856 1.00 26.22  ? 474  GLU A N     1 
ATOM   3798 C  CA    . GLU A 1 474 ? 18.461  -5.086  -46.674 1.00 33.55  ? 474  GLU A CA    1 
ATOM   3799 C  C     . GLU A 1 474 ? 17.230  -5.985  -46.643 1.00 34.43  ? 474  GLU A C     1 
ATOM   3800 O  O     . GLU A 1 474 ? 17.266  -7.067  -46.058 1.00 31.09  ? 474  GLU A O     1 
ATOM   3801 C  CB    . GLU A 1 474 ? 18.557  -4.247  -45.398 1.00 30.28  ? 474  GLU A CB    1 
ATOM   3802 C  CG    . GLU A 1 474 ? 19.900  -3.552  -45.247 1.00 31.82  ? 474  GLU A CG    1 
ATOM   3803 C  CD    . GLU A 1 474 ? 21.065  -4.531  -45.269 1.00 35.94  ? 474  GLU A CD    1 
ATOM   3804 O  OE1   . GLU A 1 474 ? 20.953  -5.608  -44.640 1.00 37.00  ? 474  GLU A OE1   1 
ATOM   3805 O  OE2   . GLU A 1 474 ? 22.092  -4.227  -45.914 1.00 35.12  ? 474  GLU A OE2   1 
ATOM   3806 N  N     . ILE A 1 475 ? 16.144  -5.544  -47.272 1.00 35.39  ? 475  ILE A N     1 
ATOM   3807 C  CA    . ILE A 1 475 ? 14.935  -6.361  -47.325 1.00 37.02  ? 475  ILE A CA    1 
ATOM   3808 C  C     . ILE A 1 475 ? 15.133  -7.522  -48.303 1.00 34.84  ? 475  ILE A C     1 
ATOM   3809 O  O     . ILE A 1 475 ? 14.593  -8.610  -48.109 1.00 32.84  ? 475  ILE A O     1 
ATOM   3810 C  CB    . ILE A 1 475 ? 13.666  -5.526  -47.661 1.00 31.77  ? 475  ILE A CB    1 
ATOM   3811 C  CG1   . ILE A 1 475 ? 12.428  -6.134  -46.998 1.00 31.29  ? 475  ILE A CG1   1 
ATOM   3812 C  CG2   . ILE A 1 475 ? 13.476  -5.369  -49.169 1.00 31.97  ? 475  ILE A CG2   1 
ATOM   3813 C  CD1   . ILE A 1 475 ? 11.172  -5.280  -47.129 1.00 32.48  ? 475  ILE A CD1   1 
ATOM   3814 N  N     . THR A 1 476 ? 15.943  -7.295  -49.332 1.00 36.17  ? 476  THR A N     1 
ATOM   3815 C  CA    . THR A 1 476 ? 16.256  -8.332  -50.310 1.00 34.99  ? 476  THR A CA    1 
ATOM   3816 C  C     . THR A 1 476 ? 17.056  -9.477  -49.683 1.00 37.03  ? 476  THR A C     1 
ATOM   3817 O  O     . THR A 1 476 ? 16.858  -10.649 -50.024 1.00 34.72  ? 476  THR A O     1 
ATOM   3818 C  CB    . THR A 1 476 ? 17.035  -7.752  -51.511 1.00 34.59  ? 476  THR A CB    1 
ATOM   3819 O  OG1   . THR A 1 476 ? 16.259  -6.718  -52.128 1.00 34.76  ? 476  THR A OG1   1 
ATOM   3820 C  CG2   . THR A 1 476 ? 17.327  -8.836  -52.540 1.00 34.70  ? 476  THR A CG2   1 
ATOM   3821 N  N     . LYS A 1 477 ? 17.961  -9.137  -48.769 1.00 37.70  ? 477  LYS A N     1 
ATOM   3822 C  CA    . LYS A 1 477 ? 18.796  -10.144 -48.120 1.00 37.12  ? 477  LYS A CA    1 
ATOM   3823 C  C     . LYS A 1 477 ? 17.947  -11.089 -47.277 1.00 35.60  ? 477  LYS A C     1 
ATOM   3824 O  O     . LYS A 1 477 ? 18.100  -12.309 -47.356 1.00 36.84  ? 477  LYS A O     1 
ATOM   3825 C  CB    . LYS A 1 477 ? 19.885  -9.491  -47.266 1.00 38.55  ? 477  LYS A CB    1 
ATOM   3826 C  CG    . LYS A 1 477 ? 20.922  -8.713  -48.067 1.00 41.99  ? 477  LYS A CG    1 
ATOM   3827 C  CD    . LYS A 1 477 ? 21.946  -8.050  -47.154 1.00 45.70  ? 477  LYS A CD    1 
ATOM   3828 C  CE    . LYS A 1 477 ? 22.850  -7.100  -47.931 1.00 52.07  ? 477  LYS A CE    1 
ATOM   3829 N  NZ    . LYS A 1 477 ? 23.821  -6.379  -47.052 1.00 52.70  ? 477  LYS A NZ    1 
ATOM   3830 N  N     . VAL A 1 478 ? 17.047  -10.524 -46.477 1.00 33.80  ? 478  VAL A N     1 
ATOM   3831 C  CA    . VAL A 1 478 ? 16.162  -11.336 -45.653 1.00 33.05  ? 478  VAL A CA    1 
ATOM   3832 C  C     . VAL A 1 478 ? 15.157  -12.100 -46.519 1.00 33.90  ? 478  VAL A C     1 
ATOM   3833 O  O     . VAL A 1 478 ? 14.871  -13.268 -46.253 1.00 35.13  ? 478  VAL A O     1 
ATOM   3834 C  CB    . VAL A 1 478 ? 15.424  -10.506 -44.579 1.00 31.42  ? 478  VAL A CB    1 
ATOM   3835 C  CG1   . VAL A 1 478 ? 14.616  -11.426 -43.673 1.00 32.38  ? 478  VAL A CG1   1 
ATOM   3836 C  CG2   . VAL A 1 478 ? 16.415  -9.700  -43.755 1.00 29.13  ? 478  VAL A CG2   1 
ATOM   3837 N  N     . PHE A 1 479 ? 14.631  -11.449 -47.555 1.00 30.18  ? 479  PHE A N     1 
ATOM   3838 C  CA    . PHE A 1 479 ? 13.749  -12.134 -48.499 1.00 32.57  ? 479  PHE A CA    1 
ATOM   3839 C  C     . PHE A 1 479 ? 14.401  -13.378 -49.109 1.00 32.91  ? 479  PHE A C     1 
ATOM   3840 O  O     . PHE A 1 479 ? 13.740  -14.397 -49.307 1.00 37.12  ? 479  PHE A O     1 
ATOM   3841 C  CB    . PHE A 1 479 ? 13.297  -11.208 -49.627 1.00 32.51  ? 479  PHE A CB    1 
ATOM   3842 C  CG    . PHE A 1 479 ? 12.617  -11.935 -50.759 1.00 31.90  ? 479  PHE A CG    1 
ATOM   3843 C  CD1   . PHE A 1 479 ? 11.331  -12.430 -50.608 1.00 34.64  ? 479  PHE A CD1   1 
ATOM   3844 C  CD2   . PHE A 1 479 ? 13.268  -12.142 -51.963 1.00 34.23  ? 479  PHE A CD2   1 
ATOM   3845 C  CE1   . PHE A 1 479 ? 10.706  -13.109 -51.642 1.00 35.24  ? 479  PHE A CE1   1 
ATOM   3846 C  CE2   . PHE A 1 479 ? 12.646  -12.817 -53.001 1.00 35.72  ? 479  PHE A CE2   1 
ATOM   3847 C  CZ    . PHE A 1 479 ? 11.364  -13.301 -52.840 1.00 33.26  ? 479  PHE A CZ    1 
ATOM   3848 N  N     . ASN A 1 480 ? 15.689  -13.287 -49.420 1.00 33.04  ? 480  ASN A N     1 
ATOM   3849 C  CA    . ASN A 1 480 ? 16.403  -14.422 -49.996 1.00 37.41  ? 480  ASN A CA    1 
ATOM   3850 C  C     . ASN A 1 480 ? 16.506  -15.592 -49.015 1.00 36.52  ? 480  ASN A C     1 
ATOM   3851 O  O     . ASN A 1 480 ? 16.451  -16.752 -49.422 1.00 33.87  ? 480  ASN A O     1 
ATOM   3852 C  CB    . ASN A 1 480 ? 17.788  -14.007 -50.499 1.00 40.35  ? 480  ASN A CB    1 
ATOM   3853 C  CG    . ASN A 1 480 ? 17.727  -13.199 -51.785 1.00 41.81  ? 480  ASN A CG    1 
ATOM   3854 O  OD1   . ASN A 1 480 ? 16.792  -13.333 -52.573 1.00 42.34  ? 480  ASN A OD1   1 
ATOM   3855 N  ND2   . ASN A 1 480 ? 18.735  -12.361 -52.007 1.00 42.44  ? 480  ASN A ND2   1 
ATOM   3856 N  N     . GLN A 1 481 ? 16.649  -15.280 -47.727 1.00 36.91  ? 481  GLN A N     1 
ATOM   3857 C  CA    . GLN A 1 481 ? 16.659  -16.297 -46.676 1.00 43.22  ? 481  GLN A CA    1 
ATOM   3858 C  C     . GLN A 1 481 ? 15.293  -16.959 -46.570 1.00 43.74  ? 481  GLN A C     1 
ATOM   3859 O  O     . GLN A 1 481 ? 15.192  -18.179 -46.437 1.00 43.40  ? 481  GLN A O     1 
ATOM   3860 C  CB    . GLN A 1 481 ? 17.009  -15.683 -45.318 1.00 47.11  ? 481  GLN A CB    1 
ATOM   3861 C  CG    . GLN A 1 481 ? 18.438  -15.202 -45.171 1.00 52.58  ? 481  GLN A CG    1 
ATOM   3862 C  CD    . GLN A 1 481 ? 18.656  -14.465 -43.861 1.00 57.38  ? 481  GLN A CD    1 
ATOM   3863 O  OE1   . GLN A 1 481 ? 17.923  -14.667 -42.889 1.00 55.01  ? 481  GLN A OE1   1 
ATOM   3864 N  NE2   . GLN A 1 481 ? 19.655  -13.593 -43.832 1.00 61.97  ? 481  GLN A NE2   1 
ATOM   3865 N  N     . ARG A 1 482 ? 14.249  -16.136 -46.615 1.00 40.09  ? 482  ARG A N     1 
ATOM   3866 C  CA    . ARG A 1 482 ? 12.874  -16.616 -46.561 1.00 39.50  ? 482  ARG A CA    1 
ATOM   3867 C  C     . ARG A 1 482 ? 12.596  -17.611 -47.682 1.00 40.75  ? 482  ARG A C     1 
ATOM   3868 O  O     . ARG A 1 482 ? 12.067  -18.697 -47.440 1.00 43.00  ? 482  ARG A O     1 
ATOM   3869 C  CB    . ARG A 1 482 ? 11.902  -15.435 -46.644 1.00 36.32  ? 482  ARG A CB    1 
ATOM   3870 C  CG    . ARG A 1 482 ? 10.452  -15.782 -46.350 1.00 34.81  ? 482  ARG A CG    1 
ATOM   3871 C  CD    . ARG A 1 482 ? 9.657   -16.048 -47.616 1.00 35.28  ? 482  ARG A CD    1 
ATOM   3872 N  NE    . ARG A 1 482 ? 8.309   -16.523 -47.316 1.00 36.52  ? 482  ARG A NE    1 
ATOM   3873 C  CZ    . ARG A 1 482 ? 7.226   -16.189 -48.011 1.00 34.40  ? 482  ARG A CZ    1 
ATOM   3874 N  NH1   . ARG A 1 482 ? 7.326   -15.370 -49.052 1.00 35.03  ? 482  ARG A NH1   1 
ATOM   3875 N  NH2   . ARG A 1 482 ? 6.042   -16.679 -47.668 1.00 30.18  ? 482  ARG A NH2   1 
ATOM   3876 N  N     . LYS A 1 483 ? 12.971  -17.236 -48.901 1.00 38.91  ? 483  LYS A N     1 
ATOM   3877 C  CA    . LYS A 1 483 ? 12.716  -18.049 -50.087 1.00 42.53  ? 483  LYS A CA    1 
ATOM   3878 C  C     . LYS A 1 483 ? 13.374  -19.429 -50.012 1.00 42.77  ? 483  LYS A C     1 
ATOM   3879 O  O     . LYS A 1 483 ? 12.789  -20.432 -50.422 1.00 42.43  ? 483  LYS A O     1 
ATOM   3880 C  CB    . LYS A 1 483 ? 13.181  -17.306 -51.341 1.00 46.91  ? 483  LYS A CB    1 
ATOM   3881 C  CG    . LYS A 1 483 ? 12.984  -18.070 -52.635 1.00 53.07  ? 483  LYS A CG    1 
ATOM   3882 C  CD    . LYS A 1 483 ? 13.289  -17.189 -53.840 1.00 59.67  ? 483  LYS A CD    1 
ATOM   3883 C  CE    . LYS A 1 483 ? 14.667  -16.550 -53.723 1.00 63.03  ? 483  LYS A CE    1 
ATOM   3884 N  NZ    . LYS A 1 483 ? 14.923  -15.568 -54.815 1.00 67.15  ? 483  LYS A NZ    1 
ATOM   3885 N  N     . GLU A 1 484 ? 14.593  -19.474 -49.490 1.00 42.66  ? 484  GLU A N     1 
ATOM   3886 C  CA    . GLU A 1 484 ? 15.285  -20.739 -49.289 1.00 44.02  ? 484  GLU A CA    1 
ATOM   3887 C  C     . GLU A 1 484 ? 14.506  -21.651 -48.336 1.00 41.28  ? 484  GLU A C     1 
ATOM   3888 O  O     . GLU A 1 484 ? 14.297  -22.827 -48.622 1.00 40.44  ? 484  GLU A O     1 
ATOM   3889 C  CB    . GLU A 1 484 ? 16.695  -20.494 -48.748 1.00 49.77  ? 484  GLU A CB    1 
ATOM   3890 C  CG    . GLU A 1 484 ? 17.407  -21.753 -48.277 1.00 56.24  ? 484  GLU A CG    1 
ATOM   3891 C  CD    . GLU A 1 484 ? 18.702  -21.459 -47.543 1.00 63.64  ? 484  GLU A CD    1 
ATOM   3892 O  OE1   . GLU A 1 484 ? 19.247  -20.348 -47.710 1.00 67.83  ? 484  GLU A OE1   1 
ATOM   3893 O  OE2   . GLU A 1 484 ? 19.173  -22.340 -46.793 1.00 66.51  ? 484  GLU A OE2   1 
ATOM   3894 N  N     . HIS A 1 485 ? 14.068  -21.104 -47.206 1.00 40.14  ? 485  HIS A N     1 
ATOM   3895 C  CA    . HIS A 1 485 ? 13.384  -21.914 -46.204 1.00 40.66  ? 485  HIS A CA    1 
ATOM   3896 C  C     . HIS A 1 485 ? 11.984  -22.342 -46.637 1.00 39.82  ? 485  HIS A C     1 
ATOM   3897 O  O     . HIS A 1 485 ? 11.509  -23.409 -46.243 1.00 38.74  ? 485  HIS A O     1 
ATOM   3898 C  CB    . HIS A 1 485 ? 13.345  -21.202 -44.851 1.00 41.12  ? 485  HIS A CB    1 
ATOM   3899 C  CG    . HIS A 1 485 ? 14.670  -21.153 -44.161 1.00 42.85  ? 485  HIS A CG    1 
ATOM   3900 N  ND1   . HIS A 1 485 ? 15.253  -22.265 -43.587 1.00 45.34  ? 485  HIS A ND1   1 
ATOM   3901 C  CD2   . HIS A 1 485 ? 15.533  -20.131 -43.952 1.00 41.79  ? 485  HIS A CD2   1 
ATOM   3902 C  CE1   . HIS A 1 485 ? 16.409  -21.928 -43.054 1.00 46.60  ? 485  HIS A CE1   1 
ATOM   3903 N  NE2   . HIS A 1 485 ? 16.606  -20.637 -43.262 1.00 44.17  ? 485  HIS A NE2   1 
ATOM   3904 N  N     . LYS A 1 486 ? 11.328  -21.523 -47.455 1.00 34.92  ? 486  LYS A N     1 
ATOM   3905 C  CA    . LYS A 1 486 ? 10.017  -21.893 -47.972 1.00 34.56  ? 486  LYS A CA    1 
ATOM   3906 C  C     . LYS A 1 486 ? 10.141  -23.079 -48.915 1.00 35.32  ? 486  LYS A C     1 
ATOM   3907 O  O     . LYS A 1 486 ? 9.280   -23.962 -48.937 1.00 37.05  ? 486  LYS A O     1 
ATOM   3908 C  CB    . LYS A 1 486 ? 9.329   -20.719 -48.678 1.00 36.23  ? 486  LYS A CB    1 
ATOM   3909 C  CG    . LYS A 1 486 ? 7.925   -21.061 -49.166 1.00 39.40  ? 486  LYS A CG    1 
ATOM   3910 C  CD    . LYS A 1 486 ? 7.151   -19.831 -49.605 1.00 43.90  ? 486  LYS A CD    1 
ATOM   3911 C  CE    . LYS A 1 486 ? 5.707   -20.186 -49.924 1.00 47.69  ? 486  LYS A CE    1 
ATOM   3912 N  NZ    . LYS A 1 486 ? 4.871   -18.987 -50.226 1.00 49.50  ? 486  LYS A NZ    1 
ATOM   3913 N  N     . GLY A 1 487 ? 11.222  -23.094 -49.689 1.00 36.29  ? 487  GLY A N     1 
ATOM   3914 C  CA    . GLY A 1 487 ? 11.512  -24.204 -50.577 1.00 36.70  ? 487  GLY A CA    1 
ATOM   3915 C  C     . GLY A 1 487 ? 11.625  -25.515 -49.820 1.00 37.51  ? 487  GLY A C     1 
ATOM   3916 O  O     . GLY A 1 487 ? 11.049  -26.522 -50.227 1.00 38.40  ? 487  GLY A O     1 
ATOM   3917 N  N     . TYR A 1 488 ? 12.367  -25.500 -48.715 1.00 38.92  ? 488  TYR A N     1 
ATOM   3918 C  CA    . TYR A 1 488 ? 12.490  -26.677 -47.855 1.00 37.82  ? 488  TYR A CA    1 
ATOM   3919 C  C     . TYR A 1 488 ? 11.125  -27.105 -47.323 1.00 33.84  ? 488  TYR A C     1 
ATOM   3920 O  O     . TYR A 1 488 ? 10.826  -28.300 -47.239 1.00 31.94  ? 488  TYR A O     1 
ATOM   3921 C  CB    . TYR A 1 488 ? 13.402  -26.390 -46.661 1.00 40.42  ? 488  TYR A CB    1 
ATOM   3922 C  CG    . TYR A 1 488 ? 14.815  -25.987 -47.005 1.00 44.74  ? 488  TYR A CG    1 
ATOM   3923 C  CD1   . TYR A 1 488 ? 15.411  -26.386 -48.194 1.00 47.38  ? 488  TYR A CD1   1 
ATOM   3924 C  CD2   . TYR A 1 488 ? 15.559  -25.208 -46.126 1.00 46.02  ? 488  TYR A CD2   1 
ATOM   3925 C  CE1   . TYR A 1 488 ? 16.709  -26.013 -48.499 1.00 50.17  ? 488  TYR A CE1   1 
ATOM   3926 C  CE2   . TYR A 1 488 ? 16.852  -24.833 -46.421 1.00 46.65  ? 488  TYR A CE2   1 
ATOM   3927 C  CZ    . TYR A 1 488 ? 17.421  -25.235 -47.606 1.00 49.09  ? 488  TYR A CZ    1 
ATOM   3928 O  OH    . TYR A 1 488 ? 18.709  -24.857 -47.896 1.00 51.28  ? 488  TYR A OH    1 
ATOM   3929 N  N     . MET A 1 489 ? 10.310  -26.121 -46.949 1.00 33.36  ? 489  MET A N     1 
ATOM   3930 C  CA    . MET A 1 489 ? 8.991   -26.383 -46.381 1.00 31.00  ? 489  MET A CA    1 
ATOM   3931 C  C     . MET A 1 489 ? 8.077   -27.078 -47.382 1.00 34.34  ? 489  MET A C     1 
ATOM   3932 O  O     . MET A 1 489 ? 7.438   -28.082 -47.060 1.00 37.96  ? 489  MET A O     1 
ATOM   3933 C  CB    . MET A 1 489 ? 8.329   -25.087 -45.921 1.00 26.30  ? 489  MET A CB    1 
ATOM   3934 C  CG    . MET A 1 489 ? 6.984   -25.309 -45.246 1.00 28.83  ? 489  MET A CG    1 
ATOM   3935 S  SD    . MET A 1 489 ? 5.984   -23.823 -45.117 1.00 52.35  ? 489  MET A SD    1 
ATOM   3936 C  CE    . MET A 1 489 ? 5.582   -23.541 -46.841 1.00 43.67  ? 489  MET A CE    1 
ATOM   3937 N  N     . LEU A 1 490 ? 8.011   -26.528 -48.591 1.00 33.57  ? 490  LEU A N     1 
ATOM   3938 C  CA    . LEU A 1 490 ? 7.138   -27.062 -49.629 1.00 38.59  ? 490  LEU A CA    1 
ATOM   3939 C  C     . LEU A 1 490 ? 7.565   -28.455 -50.076 1.00 40.55  ? 490  LEU A C     1 
ATOM   3940 O  O     . LEU A 1 490 ? 6.719   -29.308 -50.344 1.00 42.46  ? 490  LEU A O     1 
ATOM   3941 C  CB    . LEU A 1 490 ? 7.071   -26.117 -50.830 1.00 38.42  ? 490  LEU A CB    1 
ATOM   3942 C  CG    . LEU A 1 490 ? 6.310   -24.807 -50.615 1.00 39.93  ? 490  LEU A CG    1 
ATOM   3943 C  CD1   . LEU A 1 490 ? 6.289   -23.988 -51.897 1.00 38.40  ? 490  LEU A CD1   1 
ATOM   3944 C  CD2   . LEU A 1 490 ? 4.895   -25.078 -50.117 1.00 36.41  ? 490  LEU A CD2   1 
ATOM   3945 N  N     . ALA A 1 491 ? 8.874   -28.680 -50.160 1.00 41.30  ? 491  ALA A N     1 
ATOM   3946 C  CA    . ALA A 1 491 ? 9.397   -29.998 -50.511 1.00 43.06  ? 491  ALA A CA    1 
ATOM   3947 C  C     . ALA A 1 491 ? 9.042   -31.030 -49.445 1.00 43.41  ? 491  ALA A C     1 
ATOM   3948 O  O     . ALA A 1 491 ? 8.687   -32.164 -49.765 1.00 41.72  ? 491  ALA A O     1 
ATOM   3949 C  CB    . ALA A 1 491 ? 10.908  -29.945 -50.718 1.00 43.96  ? 491  ALA A CB    1 
ATOM   3950 N  N     . ALA A 1 492 ? 9.138   -30.629 -48.179 1.00 42.25  ? 492  ALA A N     1 
ATOM   3951 C  CA    . ALA A 1 492 ? 8.794   -31.510 -47.067 1.00 44.15  ? 492  ALA A CA    1 
ATOM   3952 C  C     . ALA A 1 492 ? 7.315   -31.855 -47.142 1.00 43.36  ? 492  ALA A C     1 
ATOM   3953 O  O     . ALA A 1 492 ? 6.899   -32.974 -46.828 1.00 37.16  ? 492  ALA A O     1 
ATOM   3954 C  CB    . ALA A 1 492 ? 9.117   -30.840 -45.740 1.00 41.14  ? 492  ALA A CB    1 
ATOM   3955 N  N     . GLN A 1 493 ? 6.536   -30.870 -47.575 1.00 39.73  ? 493  GLN A N     1 
ATOM   3956 C  CA    . GLN A 1 493 ? 5.099   -31.007 -47.745 1.00 40.83  ? 493  GLN A CA    1 
ATOM   3957 C  C     . GLN A 1 493 ? 4.781   -31.966 -48.888 1.00 40.51  ? 493  GLN A C     1 
ATOM   3958 O  O     . GLN A 1 493 ? 3.911   -32.827 -48.759 1.00 42.79  ? 493  GLN A O     1 
ATOM   3959 C  CB    . GLN A 1 493 ? 4.500   -29.630 -48.029 1.00 40.34  ? 493  GLN A CB    1 
ATOM   3960 C  CG    . GLN A 1 493 ? 3.005   -29.512 -47.856 1.00 39.77  ? 493  GLN A CG    1 
ATOM   3961 C  CD    . GLN A 1 493 ? 2.544   -28.072 -48.020 1.00 42.32  ? 493  GLN A CD    1 
ATOM   3962 O  OE1   . GLN A 1 493 ? 2.321   -27.606 -49.135 1.00 42.78  ? 493  GLN A OE1   1 
ATOM   3963 N  NE2   . GLN A 1 493 ? 2.422   -27.356 -46.906 1.00 42.43  ? 493  GLN A NE2   1 
ATOM   3964 N  N     . ARG A 1 494 ? 5.488   -31.812 -50.007 1.00 37.03  ? 494  ARG A N     1 
ATOM   3965 C  CA    . ARG A 1 494 ? 5.306   -32.701 -51.151 1.00 38.39  ? 494  ARG A CA    1 
ATOM   3966 C  C     . ARG A 1 494 ? 5.755   -34.114 -50.800 1.00 41.97  ? 494  ARG A C     1 
ATOM   3967 O  O     . ARG A 1 494 ? 5.134   -35.094 -51.214 1.00 42.62  ? 494  ARG A O     1 
ATOM   3968 C  CB    . ARG A 1 494 ? 6.066   -32.189 -52.383 1.00 36.42  ? 494  ARG A CB    1 
ATOM   3969 C  CG    . ARG A 1 494 ? 5.494   -30.905 -52.980 1.00 38.66  ? 494  ARG A CG    1 
ATOM   3970 C  CD    . ARG A 1 494 ? 6.172   -30.547 -54.306 1.00 39.71  ? 494  ARG A CD    1 
ATOM   3971 N  NE    . ARG A 1 494 ? 7.593   -30.258 -54.139 1.00 39.14  ? 494  ARG A NE    1 
ATOM   3972 C  CZ    . ARG A 1 494 ? 8.092   -29.042 -53.931 1.00 42.34  ? 494  ARG A CZ    1 
ATOM   3973 N  NH1   . ARG A 1 494 ? 7.288   -27.989 -53.875 1.00 41.83  ? 494  ARG A NH1   1 
ATOM   3974 N  NH2   . ARG A 1 494 ? 9.400   -28.877 -53.785 1.00 43.30  ? 494  ARG A NH2   1 
ATOM   3975 N  N     . ASN A 1 495 ? 6.838   -34.211 -50.035 1.00 40.91  ? 495  ASN A N     1 
ATOM   3976 C  CA    . ASN A 1 495 ? 7.317   -35.503 -49.561 1.00 46.08  ? 495  ASN A CA    1 
ATOM   3977 C  C     . ASN A 1 495 ? 6.292   -36.162 -48.649 1.00 46.80  ? 495  ASN A C     1 
ATOM   3978 O  O     . ASN A 1 495 ? 6.171   -37.386 -48.621 1.00 46.74  ? 495  ASN A O     1 
ATOM   3979 C  CB    . ASN A 1 495 ? 8.655   -35.355 -48.832 1.00 45.68  ? 495  ASN A CB    1 
ATOM   3980 C  CG    . ASN A 1 495 ? 9.805   -35.075 -49.778 1.00 44.86  ? 495  ASN A CG    1 
ATOM   3981 O  OD1   . ASN A 1 495 ? 9.764   -35.447 -50.950 1.00 47.59  ? 495  ASN A OD1   1 
ATOM   3982 N  ND2   . ASN A 1 495 ? 10.843  -34.418 -49.271 1.00 44.08  ? 495  ASN A ND2   1 
ATOM   3983 N  N     . GLY A 1 496 ? 5.554   -35.336 -47.910 1.00 45.04  ? 496  GLY A N     1 
ATOM   3984 C  CA    . GLY A 1 496 ? 4.507   -35.814 -47.026 1.00 42.97  ? 496  GLY A CA    1 
ATOM   3985 C  C     . GLY A 1 496 ? 3.390   -36.532 -47.761 1.00 47.99  ? 496  GLY A C     1 
ATOM   3986 O  O     . GLY A 1 496 ? 2.955   -37.603 -47.339 1.00 49.23  ? 496  GLY A O     1 
ATOM   3987 N  N     . GLU A 1 497 ? 2.927   -35.946 -48.864 1.00 48.65  ? 497  GLU A N     1 
ATOM   3988 C  CA    . GLU A 1 497 ? 1.829   -36.522 -49.641 1.00 47.87  ? 497  GLU A CA    1 
ATOM   3989 C  C     . GLU A 1 497 ? 2.220   -37.841 -50.304 1.00 49.19  ? 497  GLU A C     1 
ATOM   3990 O  O     . GLU A 1 497 ? 1.406   -38.761 -50.391 1.00 51.96  ? 497  GLU A O     1 
ATOM   3991 C  CB    . GLU A 1 497 ? 1.313   -35.528 -50.687 1.00 47.30  ? 497  GLU A CB    1 
ATOM   3992 C  CG    . GLU A 1 497 ? 0.737   -34.242 -50.089 1.00 46.71  ? 497  GLU A CG    1 
ATOM   3993 C  CD    . GLU A 1 497 ? -0.384  -34.499 -49.091 1.00 48.92  ? 497  GLU A CD    1 
ATOM   3994 O  OE1   . GLU A 1 497 ? -1.293  -35.301 -49.395 1.00 53.58  ? 497  GLU A OE1   1 
ATOM   3995 O  OE2   . GLU A 1 497 ? -0.355  -33.903 -47.995 1.00 49.13  ? 497  GLU A OE2   1 
ATOM   3996 N  N     . ILE A 1 498 ? 3.463   -37.925 -50.772 1.00 45.81  ? 498  ILE A N     1 
ATOM   3997 C  CA    . ILE A 1 498 ? 3.994   -39.164 -51.329 1.00 50.29  ? 498  ILE A CA    1 
ATOM   3998 C  C     . ILE A 1 498 ? 3.880   -40.291 -50.308 1.00 53.58  ? 498  ILE A C     1 
ATOM   3999 O  O     . ILE A 1 498 ? 3.443   -41.394 -50.631 1.00 55.28  ? 498  ILE A O     1 
ATOM   4000 C  CB    . ILE A 1 498 ? 5.471   -39.009 -51.745 1.00 51.71  ? 498  ILE A CB    1 
ATOM   4001 C  CG1   . ILE A 1 498 ? 5.610   -37.993 -52.880 1.00 49.95  ? 498  ILE A CG1   1 
ATOM   4002 C  CG2   . ILE A 1 498 ? 6.060   -40.351 -52.159 1.00 54.00  ? 498  ILE A CG2   1 
ATOM   4003 C  CD1   . ILE A 1 498 ? 7.033   -37.810 -53.361 1.00 48.44  ? 498  ILE A CD1   1 
ATOM   4004 N  N     . ILE A 1 499 ? 4.263   -39.996 -49.070 1.00 51.78  ? 499  ILE A N     1 
ATOM   4005 C  CA    . ILE A 1 499 ? 4.195   -40.968 -47.983 1.00 54.74  ? 499  ILE A CA    1 
ATOM   4006 C  C     . ILE A 1 499 ? 2.750   -41.335 -47.650 1.00 55.34  ? 499  ILE A C     1 
ATOM   4007 O  O     . ILE A 1 499 ? 2.441   -42.501 -47.400 1.00 59.00  ? 499  ILE A O     1 
ATOM   4008 C  CB    . ILE A 1 499 ? 4.907   -40.443 -46.716 1.00 51.67  ? 499  ILE A CB    1 
ATOM   4009 C  CG1   . ILE A 1 499 ? 6.383   -40.166 -47.013 1.00 53.99  ? 499  ILE A CG1   1 
ATOM   4010 C  CG2   . ILE A 1 499 ? 4.773   -41.432 -45.572 1.00 49.23  ? 499  ILE A CG2   1 
ATOM   4011 C  CD1   . ILE A 1 499 ? 7.140   -39.543 -45.860 1.00 53.38  ? 499  ILE A CD1   1 
ATOM   4012 N  N     . LYS A 1 500 ? 1.869   -40.337 -47.658 1.00 51.54  ? 500  LYS A N     1 
ATOM   4013 C  CA    . LYS A 1 500 ? 0.452   -40.548 -47.368 1.00 51.00  ? 500  LYS A CA    1 
ATOM   4014 C  C     . LYS A 1 500 ? -0.219  -41.470 -48.383 1.00 57.20  ? 500  LYS A C     1 
ATOM   4015 O  O     . LYS A 1 500 ? -1.064  -42.291 -48.025 1.00 60.93  ? 500  LYS A O     1 
ATOM   4016 C  CB    . LYS A 1 500 ? -0.295  -39.215 -47.322 1.00 48.04  ? 500  LYS A CB    1 
ATOM   4017 C  CG    . LYS A 1 500 ? -0.002  -38.360 -46.103 1.00 46.07  ? 500  LYS A CG    1 
ATOM   4018 C  CD    . LYS A 1 500 ? -0.770  -37.048 -46.187 1.00 49.00  ? 500  LYS A CD    1 
ATOM   4019 C  CE    . LYS A 1 500 ? -0.493  -36.152 -44.993 1.00 49.86  ? 500  LYS A CE    1 
ATOM   4020 N  NZ    . LYS A 1 500 ? -1.249  -34.871 -45.084 1.00 47.61  ? 500  LYS A NZ    1 
ATOM   4021 N  N     . GLU A 1 501 ? 0.147   -41.326 -49.652 1.00 58.55  ? 501  GLU A N     1 
ATOM   4022 C  CA    . GLU A 1 501 ? -0.399  -42.195 -50.686 1.00 67.40  ? 501  GLU A CA    1 
ATOM   4023 C  C     . GLU A 1 501 ? 0.177   -43.607 -50.597 1.00 66.42  ? 501  GLU A C     1 
ATOM   4024 O  O     . GLU A 1 501 ? -0.476  -44.573 -50.983 1.00 70.21  ? 501  GLU A O     1 
ATOM   4025 C  CB    . GLU A 1 501 ? -0.179  -41.605 -52.080 1.00 72.36  ? 501  GLU A CB    1 
ATOM   4026 C  CG    . GLU A 1 501 ? -1.090  -40.432 -52.389 1.00 76.69  ? 501  GLU A CG    1 
ATOM   4027 C  CD    . GLU A 1 501 ? -1.435  -40.331 -53.861 1.00 82.70  ? 501  GLU A CD    1 
ATOM   4028 O  OE1   . GLU A 1 501 ? -0.684  -40.888 -54.690 1.00 87.94  ? 501  GLU A OE1   1 
ATOM   4029 O  OE2   . GLU A 1 501 ? -2.464  -39.702 -54.188 1.00 82.06  ? 501  GLU A OE2   1 
ATOM   4030 N  N     . ALA A 1 502 ? 1.395   -43.724 -50.079 1.00 65.01  ? 502  ALA A N     1 
ATOM   4031 C  CA    . ALA A 1 502 ? 2.026   -45.028 -49.903 1.00 69.03  ? 502  ALA A CA    1 
ATOM   4032 C  C     . ALA A 1 502 ? 1.448   -45.750 -48.693 1.00 72.15  ? 502  ALA A C     1 
ATOM   4033 O  O     . ALA A 1 502 ? 1.738   -46.924 -48.460 1.00 77.44  ? 502  ALA A O     1 
ATOM   4034 C  CB    . ALA A 1 502 ? 3.529   -44.882 -49.769 1.00 69.29  ? 502  ALA A CB    1 
ATOM   4035 N  N     . LEU A 1 503 ? 0.630   -45.039 -47.923 1.00 70.53  ? 503  LEU A N     1 
ATOM   4036 C  CA    . LEU A 1 503 ? -0.077  -45.635 -46.796 1.00 72.30  ? 503  LEU A CA    1 
ATOM   4037 C  C     . LEU A 1 503 ? -1.389  -46.267 -47.255 1.00 78.15  ? 503  LEU A C     1 
ATOM   4038 O  O     . LEU A 1 503 ? -2.196  -46.715 -46.441 1.00 79.43  ? 503  LEU A O     1 
ATOM   4039 C  CB    . LEU A 1 503 ? -0.331  -44.594 -45.703 1.00 66.08  ? 503  LEU A CB    1 
ATOM   4040 C  CG    . LEU A 1 503 ? 0.872   -44.267 -44.811 1.00 62.50  ? 503  LEU A CG    1 
ATOM   4041 C  CD1   . LEU A 1 503 ? 0.574   -43.090 -43.897 1.00 59.45  ? 503  LEU A CD1   1 
ATOM   4042 C  CD2   . LEU A 1 503 ? 1.279   -45.489 -43.998 1.00 63.21  ? 503  LEU A CD2   1 
ATOM   4043 N  N     . HIS A 1 504 ? -1.592  -46.298 -48.568 1.00 82.38  ? 504  HIS A N     1 
ATOM   4044 C  CA    . HIS A 1 504 ? -2.754  -46.954 -49.152 1.00 88.63  ? 504  HIS A CA    1 
ATOM   4045 C  C     . HIS A 1 504 ? -2.408  -48.389 -49.535 1.00 92.20  ? 504  HIS A C     1 
ATOM   4046 O  O     . HIS A 1 504 ? -3.292  -49.230 -49.700 1.00 97.95  ? 504  HIS A O     1 
ATOM   4047 C  CB    . HIS A 1 504 ? -3.249  -46.182 -50.376 1.00 92.17  ? 504  HIS A CB    1 
ATOM   4048 C  CG    . HIS A 1 504 ? -3.694  -44.785 -50.068 1.00 95.08  ? 504  HIS A CG    1 
ATOM   4049 N  ND1   . HIS A 1 504 ? -4.142  -44.405 -48.824 1.00 96.61  ? 504  HIS A ND1   1 
ATOM   4050 C  CD2   . HIS A 1 504 ? -3.752  -43.678 -50.847 1.00 95.22  ? 504  HIS A CD2   1 
ATOM   4051 C  CE1   . HIS A 1 504 ? -4.462  -43.121 -48.847 1.00 94.69  ? 504  HIS A CE1   1 
ATOM   4052 N  NE2   . HIS A 1 504 ? -4.234  -42.658 -50.061 1.00 94.48  ? 504  HIS A NE2   1 
ATOM   4053 N  N     . ASN A 1 505 ? -1.115  -48.663 -49.679 1.00 88.54  ? 505  ASN A N     1 
ATOM   4054 C  CA    . ASN A 1 505 ? -0.646  -50.017 -49.955 1.00 85.32  ? 505  ASN A CA    1 
ATOM   4055 C  C     . ASN A 1 505 ? 0.621   -50.374 -49.176 1.00 81.17  ? 505  ASN A C     1 
ATOM   4056 O  O     . ASN A 1 505 ? 1.670   -50.607 -49.771 1.00 81.05  ? 505  ASN A O     1 
ATOM   4057 C  CB    . ASN A 1 505 ? -0.410  -50.205 -51.456 1.00 84.83  ? 505  ASN A CB    1 
ATOM   4058 N  N     . PRO A 1 506 ? 0.528   -50.424 -47.836 1.00 76.67  ? 506  PRO A N     1 
ATOM   4059 C  CA    . PRO A 1 506 ? 1.718   -50.719 -47.033 1.00 76.76  ? 506  PRO A CA    1 
ATOM   4060 C  C     . PRO A 1 506 ? 2.028   -52.215 -46.992 1.00 80.97  ? 506  PRO A C     1 
ATOM   4061 O  O     . PRO A 1 506 ? 1.115   -53.037 -46.909 1.00 82.63  ? 506  PRO A O     1 
ATOM   4062 C  CB    . PRO A 1 506 ? 1.322   -50.223 -45.643 1.00 74.65  ? 506  PRO A CB    1 
ATOM   4063 C  CG    . PRO A 1 506 ? -0.151  -50.436 -45.593 1.00 75.45  ? 506  PRO A CG    1 
ATOM   4064 C  CD    . PRO A 1 506 ? -0.667  -50.222 -46.997 1.00 74.72  ? 506  PRO A CD    1 
ATOM   4065 N  N     . ASN A 1 507 ? 3.310   -52.558 -47.050 1.00 82.03  ? 507  ASN A N     1 
ATOM   4066 C  CA    . ASN A 1 507 ? 3.726   -53.954 -47.002 1.00 85.19  ? 507  ASN A CA    1 
ATOM   4067 C  C     . ASN A 1 507 ? 3.713   -54.502 -45.578 1.00 87.48  ? 507  ASN A C     1 
ATOM   4068 O  O     . ASN A 1 507 ? 3.857   -53.751 -44.614 1.00 83.78  ? 507  ASN A O     1 
ATOM   4069 C  CB    . ASN A 1 507 ? 5.118   -54.120 -47.613 1.00 85.23  ? 507  ASN A CB    1 
ATOM   4070 C  CG    . ASN A 1 507 ? 5.242   -53.457 -48.971 1.00 83.07  ? 507  ASN A CG    1 
ATOM   4071 O  OD1   . ASN A 1 507 ? 4.794   -52.327 -49.169 1.00 77.54  ? 507  ASN A OD1   1 
ATOM   4072 N  ND2   . ASN A 1 507 ? 5.849   -54.163 -49.920 1.00 85.95  ? 507  ASN A ND2   1 
ATOM   4073 N  N     . LEU A 1 508 ? 3.536   -55.813 -45.453 1.00 92.68  ? 508  LEU A N     1 
ATOM   4074 C  CA    . LEU A 1 508 ? 3.546   -56.465 -44.149 1.00 96.00  ? 508  LEU A CA    1 
ATOM   4075 C  C     . LEU A 1 508 ? 4.919   -57.047 -43.848 1.00 94.63  ? 508  LEU A C     1 
ATOM   4076 O  O     . LEU A 1 508 ? 5.144   -58.245 -44.026 1.00 99.14  ? 508  LEU A O     1 
ATOM   4077 C  CB    . LEU A 1 508 ? 2.493   -57.574 -44.093 1.00 102.75 ? 508  LEU A CB    1 
ATOM   4078 C  CG    . LEU A 1 508 ? 1.026   -57.153 -44.000 1.00 103.78 ? 508  LEU A CG    1 
ATOM   4079 C  CD1   . LEU A 1 508 ? 0.118   -58.371 -44.063 1.00 106.75 ? 508  LEU A CD1   1 
ATOM   4080 C  CD2   . LEU A 1 508 ? 0.780   -56.365 -42.723 1.00 101.97 ? 508  LEU A CD2   1 
ATOM   4081 N  N     . SER A 1 509 ? 5.837   -56.202 -43.390 1.00 87.11  ? 509  SER A N     1 
ATOM   4082 C  CA    . SER A 1 509 ? 7.189   -56.655 -43.085 1.00 87.51  ? 509  SER A CA    1 
ATOM   4083 C  C     . SER A 1 509 ? 7.841   -55.830 -41.983 1.00 84.19  ? 509  SER A C     1 
ATOM   4084 O  O     . SER A 1 509 ? 7.301   -54.815 -41.548 1.00 84.62  ? 509  SER A O     1 
ATOM   4085 C  CB    . SER A 1 509 ? 8.060   -56.628 -44.342 1.00 88.73  ? 509  SER A CB    1 
ATOM   4086 O  OG    . SER A 1 509 ? 8.196   -55.312 -44.844 1.00 87.42  ? 509  SER A OG    1 
ATOM   4087 N  N     . VAL A 1 510 ? 9.008   -56.279 -41.536 1.00 83.06  ? 510  VAL A N     1 
ATOM   4088 C  CA    . VAL A 1 510 ? 9.780   -55.554 -40.539 1.00 82.33  ? 510  VAL A CA    1 
ATOM   4089 C  C     . VAL A 1 510 ? 10.960  -54.858 -41.206 1.00 81.85  ? 510  VAL A C     1 
ATOM   4090 O  O     . VAL A 1 510 ? 11.883  -55.509 -41.695 1.00 83.44  ? 510  VAL A O     1 
ATOM   4091 C  CB    . VAL A 1 510 ? 10.293  -56.491 -39.427 1.00 86.17  ? 510  VAL A CB    1 
ATOM   4092 C  CG1   . VAL A 1 510 ? 11.177  -55.729 -38.448 1.00 83.83  ? 510  VAL A CG1   1 
ATOM   4093 C  CG2   . VAL A 1 510 ? 9.124   -57.143 -38.704 1.00 86.91  ? 510  VAL A CG2   1 
ATOM   4094 N  N     . ASP A 1 511 ? 10.915  -53.531 -41.238 1.00 78.28  ? 511  ASP A N     1 
ATOM   4095 C  CA    . ASP A 1 511 ? 11.990  -52.744 -41.827 1.00 78.02  ? 511  ASP A CA    1 
ATOM   4096 C  C     . ASP A 1 511 ? 12.209  -51.458 -41.043 1.00 75.25  ? 511  ASP A C     1 
ATOM   4097 O  O     . ASP A 1 511 ? 11.695  -51.302 -39.936 1.00 73.77  ? 511  ASP A O     1 
ATOM   4098 C  CB    . ASP A 1 511 ? 11.699  -52.440 -43.301 1.00 78.38  ? 511  ASP A CB    1 
ATOM   4099 C  CG    . ASP A 1 511 ? 10.277  -51.953 -43.535 1.00 77.30  ? 511  ASP A CG    1 
ATOM   4100 O  OD1   . ASP A 1 511 ? 9.741   -51.215 -42.682 1.00 71.24  ? 511  ASP A OD1   1 
ATOM   4101 O  OD2   . ASP A 1 511 ? 9.693   -52.312 -44.579 1.00 81.51  ? 511  ASP A OD2   1 
ATOM   4102 N  N     . GLU A 1 512 ? 12.974  -50.540 -41.622 1.00 76.24  ? 512  GLU A N     1 
ATOM   4103 C  CA    . GLU A 1 512 ? 13.268  -49.275 -40.967 1.00 77.55  ? 512  GLU A CA    1 
ATOM   4104 C  C     . GLU A 1 512 ? 12.893  -48.102 -41.865 1.00 75.31  ? 512  GLU A C     1 
ATOM   4105 O  O     . GLU A 1 512 ? 12.890  -48.232 -43.090 1.00 76.19  ? 512  GLU A O     1 
ATOM   4106 C  CB    . GLU A 1 512 ? 14.754  -49.198 -40.595 1.00 83.13  ? 512  GLU A CB    1 
ATOM   4107 C  CG    . GLU A 1 512 ? 15.223  -50.273 -39.620 1.00 91.54  ? 512  GLU A CG    1 
ATOM   4108 C  CD    . GLU A 1 512 ? 14.654  -50.098 -38.221 1.00 93.89  ? 512  GLU A CD    1 
ATOM   4109 O  OE1   . GLU A 1 512 ? 14.120  -49.010 -37.921 1.00 90.92  ? 512  GLU A OE1   1 
ATOM   4110 O  OE2   . GLU A 1 512 ? 14.741  -51.053 -37.419 1.00 98.62  ? 512  GLU A OE2   1 
ATOM   4111 N  N     . PRO A 1 513 ? 12.561  -46.952 -41.257 1.00 71.59  ? 513  PRO A N     1 
ATOM   4112 C  CA    . PRO A 1 513 ? 12.356  -45.740 -42.053 1.00 69.66  ? 513  PRO A CA    1 
ATOM   4113 C  C     . PRO A 1 513 ? 13.639  -45.372 -42.788 1.00 70.81  ? 513  PRO A C     1 
ATOM   4114 O  O     . PRO A 1 513 ? 14.730  -45.537 -42.239 1.00 71.71  ? 513  PRO A O     1 
ATOM   4115 C  CB    . PRO A 1 513 ? 12.015  -44.679 -41.000 1.00 67.74  ? 513  PRO A CB    1 
ATOM   4116 C  CG    . PRO A 1 513 ? 12.512  -45.234 -39.705 1.00 69.27  ? 513  PRO A CG    1 
ATOM   4117 C  CD    . PRO A 1 513 ? 12.342  -46.714 -39.821 1.00 70.72  ? 513  PRO A CD    1 
ATOM   4118 N  N     . LEU A 1 514 ? 13.507  -44.896 -44.021 1.00 69.30  ? 514  LEU A N     1 
ATOM   4119 C  CA    . LEU A 1 514 ? 14.661  -44.528 -44.831 1.00 70.75  ? 514  LEU A CA    1 
ATOM   4120 C  C     . LEU A 1 514 ? 15.361  -43.310 -44.240 1.00 70.33  ? 514  LEU A C     1 
ATOM   4121 O  O     . LEU A 1 514 ? 14.718  -42.442 -43.649 1.00 66.21  ? 514  LEU A O     1 
ATOM   4122 C  CB    . LEU A 1 514 ? 14.232  -44.230 -46.271 1.00 70.90  ? 514  LEU A CB    1 
ATOM   4123 C  CG    . LEU A 1 514 ? 14.083  -45.368 -47.287 1.00 74.82  ? 514  LEU A CG    1 
ATOM   4124 C  CD1   . LEU A 1 514 ? 13.232  -46.516 -46.764 1.00 74.68  ? 514  LEU A CD1   1 
ATOM   4125 C  CD2   . LEU A 1 514 ? 13.493  -44.816 -48.577 1.00 73.25  ? 514  LEU A CD2   1 
ATOM   4126 N  N     . ASP A 1 515 ? 16.679  -43.249 -44.394 1.00 74.44  ? 515  ASP A N     1 
ATOM   4127 C  CA    . ASP A 1 515 ? 17.431  -42.080 -43.955 1.00 79.28  ? 515  ASP A CA    1 
ATOM   4128 C  C     . ASP A 1 515 ? 17.542  -41.075 -45.097 1.00 75.72  ? 515  ASP A C     1 
ATOM   4129 O  O     . ASP A 1 515 ? 18.372  -41.230 -45.995 1.00 76.76  ? 515  ASP A O     1 
ATOM   4130 C  CB    . ASP A 1 515 ? 18.821  -42.479 -43.456 1.00 86.27  ? 515  ASP A CB    1 
ATOM   4131 C  CG    . ASP A 1 515 ? 19.601  -41.299 -42.904 1.00 89.61  ? 515  ASP A CG    1 
ATOM   4132 O  OD1   . ASP A 1 515 ? 18.967  -40.347 -42.400 1.00 87.10  ? 515  ASP A OD1   1 
ATOM   4133 O  OD2   . ASP A 1 515 ? 20.848  -41.325 -42.974 1.00 92.75  ? 515  ASP A OD2   1 
ATOM   4134 N  N     . VAL A 1 516 ? 16.690  -40.052 -45.064 1.00 70.29  ? 516  VAL A N     1 
ATOM   4135 C  CA    . VAL A 1 516 ? 16.645  -39.051 -46.126 1.00 67.14  ? 516  VAL A CA    1 
ATOM   4136 C  C     . VAL A 1 516 ? 16.504  -37.629 -45.580 1.00 62.98  ? 516  VAL A C     1 
ATOM   4137 O  O     . VAL A 1 516 ? 16.052  -37.424 -44.453 1.00 61.68  ? 516  VAL A O     1 
ATOM   4138 C  CB    . VAL A 1 516 ? 15.472  -39.310 -47.096 1.00 67.66  ? 516  VAL A CB    1 
ATOM   4139 C  CG1   . VAL A 1 516 ? 15.639  -40.648 -47.801 1.00 71.28  ? 516  VAL A CG1   1 
ATOM   4140 C  CG2   . VAL A 1 516 ? 14.146  -39.255 -46.351 1.00 66.06  ? 516  VAL A CG2   1 
ATOM   4141 N  N     . ASP A 1 517 ? 16.894  -36.651 -46.390 1.00 59.20  ? 517  ASP A N     1 
ATOM   4142 C  CA    . ASP A 1 517 ? 16.698  -35.249 -46.054 1.00 57.67  ? 517  ASP A CA    1 
ATOM   4143 C  C     . ASP A 1 517 ? 15.358  -34.810 -46.632 1.00 54.66  ? 517  ASP A C     1 
ATOM   4144 O  O     . ASP A 1 517 ? 15.228  -34.633 -47.844 1.00 57.09  ? 517  ASP A O     1 
ATOM   4145 C  CB    . ASP A 1 517 ? 17.832  -34.399 -46.633 1.00 59.07  ? 517  ASP A CB    1 
ATOM   4146 C  CG    . ASP A 1 517 ? 17.849  -32.981 -46.084 1.00 57.14  ? 517  ASP A CG    1 
ATOM   4147 O  OD1   . ASP A 1 517 ? 16.798  -32.496 -45.612 1.00 53.16  ? 517  ASP A OD1   1 
ATOM   4148 O  OD2   . ASP A 1 517 ? 18.922  -32.344 -46.133 1.00 57.69  ? 517  ASP A OD2   1 
ATOM   4149 N  N     . TYR A 1 518 ? 14.367  -34.636 -45.762 1.00 46.33  ? 518  TYR A N     1 
ATOM   4150 C  CA    . TYR A 1 518 ? 13.010  -34.311 -46.194 1.00 41.94  ? 518  TYR A CA    1 
ATOM   4151 C  C     . TYR A 1 518 ? 12.888  -32.906 -46.779 1.00 40.53  ? 518  TYR A C     1 
ATOM   4152 O  O     . TYR A 1 518 ? 11.858  -32.558 -47.353 1.00 41.45  ? 518  TYR A O     1 
ATOM   4153 C  CB    . TYR A 1 518 ? 12.020  -34.474 -45.039 1.00 39.43  ? 518  TYR A CB    1 
ATOM   4154 C  CG    . TYR A 1 518 ? 11.931  -35.880 -44.495 1.00 43.76  ? 518  TYR A CG    1 
ATOM   4155 C  CD1   . TYR A 1 518 ? 11.009  -36.788 -45.004 1.00 42.56  ? 518  TYR A CD1   1 
ATOM   4156 C  CD2   . TYR A 1 518 ? 12.765  -36.299 -43.465 1.00 43.70  ? 518  TYR A CD2   1 
ATOM   4157 C  CE1   . TYR A 1 518 ? 10.927  -38.076 -44.506 1.00 44.36  ? 518  TYR A CE1   1 
ATOM   4158 C  CE2   . TYR A 1 518 ? 12.689  -37.584 -42.963 1.00 45.93  ? 518  TYR A CE2   1 
ATOM   4159 C  CZ    . TYR A 1 518 ? 11.768  -38.466 -43.484 1.00 45.04  ? 518  TYR A CZ    1 
ATOM   4160 O  OH    . TYR A 1 518 ? 11.691  -39.741 -42.981 1.00 46.90  ? 518  TYR A OH    1 
ATOM   4161 N  N     . ARG A 1 519 ? 13.936  -32.100 -46.624 1.00 42.24  ? 519  ARG A N     1 
ATOM   4162 C  CA    . ARG A 1 519 ? 13.954  -30.744 -47.174 1.00 42.20  ? 519  ARG A CA    1 
ATOM   4163 C  C     . ARG A 1 519 ? 14.071  -30.729 -48.698 1.00 45.86  ? 519  ARG A C     1 
ATOM   4164 O  O     . ARG A 1 519 ? 13.873  -29.693 -49.333 1.00 45.81  ? 519  ARG A O     1 
ATOM   4165 C  CB    . ARG A 1 519 ? 15.102  -29.932 -46.572 1.00 42.36  ? 519  ARG A CB    1 
ATOM   4166 C  CG    . ARG A 1 519 ? 14.919  -29.560 -45.112 1.00 43.55  ? 519  ARG A CG    1 
ATOM   4167 C  CD    . ARG A 1 519 ? 16.149  -28.837 -44.597 1.00 45.26  ? 519  ARG A CD    1 
ATOM   4168 N  NE    . ARG A 1 519 ? 17.363  -29.616 -44.836 1.00 45.64  ? 519  ARG A NE    1 
ATOM   4169 C  CZ    . ARG A 1 519 ? 18.594  -29.115 -44.797 1.00 45.81  ? 519  ARG A CZ    1 
ATOM   4170 N  NH1   . ARG A 1 519 ? 18.779  -27.827 -44.532 1.00 44.41  ? 519  ARG A NH1   1 
ATOM   4171 N  NH2   . ARG A 1 519 ? 19.639  -29.898 -45.030 1.00 42.70  ? 519  ARG A NH2   1 
ATOM   4172 N  N     . PHE A 1 520 ? 14.407  -31.877 -49.279 1.00 48.57  ? 520  PHE A N     1 
ATOM   4173 C  CA    . PHE A 1 520 ? 14.555  -31.987 -50.726 1.00 53.24  ? 520  PHE A CA    1 
ATOM   4174 C  C     . PHE A 1 520 ? 13.635  -33.066 -51.283 1.00 52.43  ? 520  PHE A C     1 
ATOM   4175 O  O     . PHE A 1 520 ? 13.408  -34.088 -50.639 1.00 50.16  ? 520  PHE A O     1 
ATOM   4176 C  CB    . PHE A 1 520 ? 16.010  -32.290 -51.096 1.00 55.32  ? 520  PHE A CB    1 
ATOM   4177 C  CG    . PHE A 1 520 ? 16.989  -31.303 -50.537 1.00 57.00  ? 520  PHE A CG    1 
ATOM   4178 C  CD1   . PHE A 1 520 ? 17.225  -30.099 -51.181 1.00 56.73  ? 520  PHE A CD1   1 
ATOM   4179 C  CD2   . PHE A 1 520 ? 17.667  -31.573 -49.359 1.00 58.89  ? 520  PHE A CD2   1 
ATOM   4180 C  CE1   . PHE A 1 520 ? 18.123  -29.183 -50.662 1.00 57.70  ? 520  PHE A CE1   1 
ATOM   4181 C  CE2   . PHE A 1 520 ? 18.566  -30.661 -48.834 1.00 58.62  ? 520  PHE A CE2   1 
ATOM   4182 C  CZ    . PHE A 1 520 ? 18.796  -29.465 -49.488 1.00 58.19  ? 520  PHE A CZ    1 
ATOM   4183 N  N     . ASP A 1 521 ? 13.108  -32.827 -52.480 1.00 51.11  ? 521  ASP A N     1 
ATOM   4184 C  CA    . ASP A 1 521 ? 12.184  -33.761 -53.114 1.00 51.86  ? 521  ASP A CA    1 
ATOM   4185 C  C     . ASP A 1 521 ? 12.797  -35.147 -53.259 1.00 52.38  ? 521  ASP A C     1 
ATOM   4186 O  O     . ASP A 1 521 ? 13.926  -35.288 -53.731 1.00 50.93  ? 521  ASP A O     1 
ATOM   4187 C  CB    . ASP A 1 521 ? 11.745  -33.241 -54.484 1.00 54.20  ? 521  ASP A CB    1 
ATOM   4188 C  CG    . ASP A 1 521 ? 10.986  -31.935 -54.393 1.00 54.93  ? 521  ASP A CG    1 
ATOM   4189 O  OD1   . ASP A 1 521 ? 9.774   -31.970 -54.092 1.00 52.30  ? 521  ASP A OD1   1 
ATOM   4190 O  OD2   . ASP A 1 521 ? 11.605  -30.873 -54.621 1.00 56.99  ? 521  ASP A OD2   1 
ATOM   4191 N  N     . PHE A 1 522 ? 12.045  -36.160 -52.836 1.00 50.85  ? 522  PHE A N     1 
ATOM   4192 C  CA    . PHE A 1 522 ? 12.484  -37.547 -52.924 1.00 50.14  ? 522  PHE A CA    1 
ATOM   4193 C  C     . PHE A 1 522 ? 12.919  -37.899 -54.338 1.00 54.18  ? 522  PHE A C     1 
ATOM   4194 O  O     . PHE A 1 522 ? 12.266  -37.515 -55.308 1.00 54.24  ? 522  PHE A O     1 
ATOM   4195 C  CB    . PHE A 1 522 ? 11.355  -38.489 -52.503 1.00 50.21  ? 522  PHE A CB    1 
ATOM   4196 C  CG    . PHE A 1 522 ? 11.044  -38.453 -51.033 1.00 49.37  ? 522  PHE A CG    1 
ATOM   4197 C  CD1   . PHE A 1 522 ? 11.987  -38.010 -50.120 1.00 47.21  ? 522  PHE A CD1   1 
ATOM   4198 C  CD2   . PHE A 1 522 ? 9.809   -38.870 -50.565 1.00 48.60  ? 522  PHE A CD2   1 
ATOM   4199 C  CE1   . PHE A 1 522 ? 11.703  -37.984 -48.768 1.00 47.05  ? 522  PHE A CE1   1 
ATOM   4200 C  CE2   . PHE A 1 522 ? 9.518   -38.843 -49.217 1.00 46.66  ? 522  PHE A CE2   1 
ATOM   4201 C  CZ    . PHE A 1 522 ? 10.466  -38.402 -48.315 1.00 46.60  ? 522  PHE A CZ    1 
ATOM   4202 N  N     . SER A 1 523 ? 14.027  -38.625 -54.451 1.00 58.70  ? 523  SER A N     1 
ATOM   4203 C  CA    . SER A 1 523 ? 14.477  -39.128 -55.742 1.00 61.06  ? 523  SER A CA    1 
ATOM   4204 C  C     . SER A 1 523 ? 13.639  -40.341 -56.126 1.00 60.70  ? 523  SER A C     1 
ATOM   4205 O  O     . SER A 1 523 ? 12.911  -40.890 -55.295 1.00 60.69  ? 523  SER A O     1 
ATOM   4206 C  CB    . SER A 1 523 ? 15.960  -39.506 -55.691 1.00 64.39  ? 523  SER A CB    1 
ATOM   4207 O  OG    . SER A 1 523 ? 16.178  -40.615 -54.835 1.00 66.41  ? 523  SER A OG    1 
ATOM   4208 N  N     . ASP A 1 524 ? 13.742  -40.753 -57.384 1.00 60.67  ? 524  ASP A N     1 
ATOM   4209 C  CA    . ASP A 1 524 ? 13.008  -41.916 -57.871 1.00 65.20  ? 524  ASP A CA    1 
ATOM   4210 C  C     . ASP A 1 524 ? 13.387  -43.176 -57.097 1.00 66.16  ? 524  ASP A C     1 
ATOM   4211 O  O     . ASP A 1 524 ? 12.537  -44.028 -56.829 1.00 65.36  ? 524  ASP A O     1 
ATOM   4212 C  CB    . ASP A 1 524 ? 13.257  -42.118 -59.367 1.00 69.73  ? 524  ASP A CB    1 
ATOM   4213 C  CG    . ASP A 1 524 ? 12.918  -40.886 -60.182 1.00 70.92  ? 524  ASP A CG    1 
ATOM   4214 O  OD1   . ASP A 1 524 ? 12.144  -40.038 -59.686 1.00 67.56  ? 524  ASP A OD1   1 
ATOM   4215 O  OD2   . ASP A 1 524 ? 13.423  -40.765 -61.318 1.00 73.02  ? 524  ASP A OD2   1 
ATOM   4216 N  N     . GLU A 1 525 ? 14.664  -43.284 -56.738 1.00 67.31  ? 525  GLU A N     1 
ATOM   4217 C  CA    . GLU A 1 525 ? 15.149  -44.414 -55.950 1.00 69.21  ? 525  GLU A CA    1 
ATOM   4218 C  C     . GLU A 1 525 ? 14.471  -44.445 -54.585 1.00 66.40  ? 525  GLU A C     1 
ATOM   4219 O  O     . GLU A 1 525 ? 13.993  -45.489 -54.147 1.00 67.25  ? 525  GLU A O     1 
ATOM   4220 C  CB    . GLU A 1 525 ? 16.672  -44.356 -55.782 1.00 68.10  ? 525  GLU A CB    1 
ATOM   4221 C  CG    . GLU A 1 525 ? 17.467  -44.663 -57.047 1.00 71.03  ? 525  GLU A CG    1 
ATOM   4222 C  CD    . GLU A 1 525 ? 17.603  -43.464 -57.967 1.00 80.02  ? 525  GLU A CD    1 
ATOM   4223 O  OE1   . GLU A 1 525 ? 17.187  -42.352 -57.570 1.00 66.64  ? 525  GLU A OE1   1 
ATOM   4224 O  OE2   . GLU A 1 525 ? 18.130  -43.635 -59.086 1.00 72.13  ? 525  GLU A OE2   1 
ATOM   4225 N  N     . ILE A 1 526 ? 14.426  -43.293 -53.921 1.00 65.23  ? 526  ILE A N     1 
ATOM   4226 C  CA    . ILE A 1 526 ? 13.774  -43.188 -52.621 1.00 64.34  ? 526  ILE A CA    1 
ATOM   4227 C  C     . ILE A 1 526 ? 12.288  -43.519 -52.727 1.00 63.98  ? 526  ILE A C     1 
ATOM   4228 O  O     . ILE A 1 526 ? 11.756  -44.277 -51.914 1.00 59.44  ? 526  ILE A O     1 
ATOM   4229 C  CB    . ILE A 1 526 ? 13.948  -41.784 -52.013 1.00 60.39  ? 526  ILE A CB    1 
ATOM   4230 C  CG1   . ILE A 1 526 ? 15.429  -41.496 -51.745 1.00 61.76  ? 526  ILE A CG1   1 
ATOM   4231 C  CG2   . ILE A 1 526 ? 13.134  -41.648 -50.734 1.00 55.56  ? 526  ILE A CG2   1 
ATOM   4232 C  CD1   . ILE A 1 526 ? 15.709  -40.042 -51.387 1.00 63.79  ? 526  ILE A CD1   1 
ATOM   4233 N  N     . LYS A 1 527 ? 11.630  -42.956 -53.739 1.00 60.50  ? 527  LYS A N     1 
ATOM   4234 C  CA    . LYS A 1 527 ? 10.210  -43.212 -53.979 1.00 58.96  ? 527  LYS A CA    1 
ATOM   4235 C  C     . LYS A 1 527 ? 9.915   -44.693 -54.226 1.00 63.42  ? 527  LYS A C     1 
ATOM   4236 O  O     . LYS A 1 527 ? 8.901   -45.219 -53.763 1.00 63.64  ? 527  LYS A O     1 
ATOM   4237 C  CB    . LYS A 1 527 ? 9.688   -42.355 -55.139 1.00 58.67  ? 527  LYS A CB    1 
ATOM   4238 C  CG    . LYS A 1 527 ? 9.171   -40.986 -54.703 1.00 61.42  ? 527  LYS A CG    1 
ATOM   4239 C  CD    . LYS A 1 527 ? 8.647   -40.162 -55.876 1.00 63.68  ? 527  LYS A CD    1 
ATOM   4240 C  CE    . LYS A 1 527 ? 9.781   -39.586 -56.712 1.00 66.48  ? 527  LYS A CE    1 
ATOM   4241 N  NZ    . LYS A 1 527 ? 9.283   -38.581 -57.694 1.00 66.61  ? 527  LYS A NZ    1 
ATOM   4242 N  N     . GLU A 1 528 ? 10.808  -45.361 -54.949 1.00 64.04  ? 528  GLU A N     1 
ATOM   4243 C  CA    . GLU A 1 528 ? 10.658  -46.785 -55.210 1.00 69.76  ? 528  GLU A CA    1 
ATOM   4244 C  C     . GLU A 1 528 ? 10.716  -47.579 -53.907 1.00 71.03  ? 528  GLU A C     1 
ATOM   4245 O  O     . GLU A 1 528 ? 9.915   -48.490 -53.686 1.00 70.18  ? 528  GLU A O     1 
ATOM   4246 C  CB    . GLU A 1 528 ? 11.740  -47.271 -56.178 1.00 73.03  ? 528  GLU A CB    1 
ATOM   4247 N  N     . LYS A 1 529 ? 11.663  -47.225 -53.043 1.00 70.15  ? 529  LYS A N     1 
ATOM   4248 C  CA    . LYS A 1 529 ? 11.824  -47.908 -51.766 1.00 71.67  ? 529  LYS A CA    1 
ATOM   4249 C  C     . LYS A 1 529 ? 10.631  -47.666 -50.850 1.00 70.18  ? 529  LYS A C     1 
ATOM   4250 O  O     . LYS A 1 529 ? 10.257  -48.533 -50.060 1.00 65.72  ? 529  LYS A O     1 
ATOM   4251 C  CB    . LYS A 1 529 ? 13.121  -47.474 -51.078 1.00 72.29  ? 529  LYS A CB    1 
ATOM   4252 C  CG    . LYS A 1 529 ? 14.378  -48.054 -51.709 1.00 77.70  ? 529  LYS A CG    1 
ATOM   4253 C  CD    . LYS A 1 529 ? 15.613  -47.736 -50.883 1.00 78.41  ? 529  LYS A CD    1 
ATOM   4254 N  N     . ILE A 1 530 ? 10.035  -46.484 -50.965 1.00 69.52  ? 530  ILE A N     1 
ATOM   4255 C  CA    . ILE A 1 530 ? 8.891   -46.113 -50.137 1.00 67.80  ? 530  ILE A CA    1 
ATOM   4256 C  C     . ILE A 1 530 ? 7.693   -47.028 -50.390 1.00 69.94  ? 530  ILE A C     1 
ATOM   4257 O  O     . ILE A 1 530 ? 6.983   -47.411 -49.457 1.00 69.04  ? 530  ILE A O     1 
ATOM   4258 C  CB    . ILE A 1 530 ? 8.493   -44.631 -50.350 1.00 63.42  ? 530  ILE A CB    1 
ATOM   4259 C  CG1   . ILE A 1 530 ? 9.487   -43.709 -49.642 1.00 62.02  ? 530  ILE A CG1   1 
ATOM   4260 C  CG2   . ILE A 1 530 ? 7.092   -44.361 -49.834 1.00 61.14  ? 530  ILE A CG2   1 
ATOM   4261 C  CD1   . ILE A 1 530 ? 9.119   -42.247 -49.708 1.00 60.35  ? 530  ILE A CD1   1 
ATOM   4262 N  N     . LYS A 1 531 ? 7.493   -47.398 -51.652 1.00 72.47  ? 531  LYS A N     1 
ATOM   4263 C  CA    . LYS A 1 531 ? 6.366   -48.246 -52.038 1.00 73.81  ? 531  LYS A CA    1 
ATOM   4264 C  C     . LYS A 1 531 ? 6.471   -49.681 -51.514 1.00 73.39  ? 531  LYS A C     1 
ATOM   4265 O  O     . LYS A 1 531 ? 5.526   -50.458 -51.633 1.00 71.88  ? 531  LYS A O     1 
ATOM   4266 C  CB    . LYS A 1 531 ? 6.197   -48.254 -53.560 1.00 76.15  ? 531  LYS A CB    1 
ATOM   4267 C  CG    . LYS A 1 531 ? 5.841   -46.900 -54.152 1.00 75.57  ? 531  LYS A CG    1 
ATOM   4268 N  N     . LYS A 1 532 ? 7.615   -50.033 -50.937 1.00 73.29  ? 532  LYS A N     1 
ATOM   4269 C  CA    . LYS A 1 532 ? 7.811   -51.376 -50.403 1.00 77.29  ? 532  LYS A CA    1 
ATOM   4270 C  C     . LYS A 1 532 ? 8.002   -51.351 -48.890 1.00 75.31  ? 532  LYS A C     1 
ATOM   4271 O  O     . LYS A 1 532 ? 8.395   -52.348 -48.285 1.00 75.02  ? 532  LYS A O     1 
ATOM   4272 C  CB    . LYS A 1 532 ? 9.010   -52.049 -51.076 1.00 82.69  ? 532  LYS A CB    1 
ATOM   4273 C  CG    . LYS A 1 532 ? 8.809   -52.326 -52.556 1.00 85.66  ? 532  LYS A CG    1 
ATOM   4274 C  CD    . LYS A 1 532 ? 10.075  -52.858 -53.201 1.00 88.79  ? 532  LYS A CD    1 
ATOM   4275 C  CE    . LYS A 1 532 ? 9.860   -53.111 -54.683 1.00 91.61  ? 532  LYS A CE    1 
ATOM   4276 N  NZ    . LYS A 1 532 ? 11.126  -53.489 -55.367 1.00 96.12  ? 532  LYS A NZ    1 
ATOM   4277 N  N     . LEU A 1 533 ? 7.710   -50.207 -48.283 1.00 71.29  ? 533  LEU A N     1 
ATOM   4278 C  CA    . LEU A 1 533 ? 7.951   -50.016 -46.858 1.00 70.73  ? 533  LEU A CA    1 
ATOM   4279 C  C     . LEU A 1 533 ? 6.755   -50.427 -46.004 1.00 69.51  ? 533  LEU A C     1 
ATOM   4280 O  O     . LEU A 1 533 ? 5.613   -50.393 -46.460 1.00 68.89  ? 533  LEU A O     1 
ATOM   4281 C  CB    . LEU A 1 533 ? 8.314   -48.556 -46.582 1.00 66.93  ? 533  LEU A CB    1 
ATOM   4282 C  CG    . LEU A 1 533 ? 9.463   -48.340 -45.601 1.00 67.89  ? 533  LEU A CG    1 
ATOM   4283 C  CD1   . LEU A 1 533 ? 10.702  -49.086 -46.064 1.00 71.71  ? 533  LEU A CD1   1 
ATOM   4284 C  CD2   . LEU A 1 533 ? 9.753   -46.861 -45.457 1.00 64.69  ? 533  LEU A CD2   1 
ATOM   4285 N  N     . SER A 1 534 ? 7.026   -50.812 -44.760 1.00 69.65  ? 534  SER A N     1 
ATOM   4286 C  CA    . SER A 1 534 ? 5.972   -51.183 -43.821 1.00 68.69  ? 534  SER A CA    1 
ATOM   4287 C  C     . SER A 1 534 ? 5.199   -49.959 -43.332 1.00 68.31  ? 534  SER A C     1 
ATOM   4288 O  O     . SER A 1 534 ? 5.641   -48.820 -43.503 1.00 61.83  ? 534  SER A O     1 
ATOM   4289 C  CB    . SER A 1 534 ? 6.562   -51.934 -42.628 1.00 71.71  ? 534  SER A CB    1 
ATOM   4290 O  OG    . SER A 1 534 ? 7.456   -51.112 -41.898 1.00 69.18  ? 534  SER A OG    1 
ATOM   4291 N  N     . ALA A 1 535 ? 4.043   -50.204 -42.723 1.00 70.01  ? 535  ALA A N     1 
ATOM   4292 C  CA    . ALA A 1 535 ? 3.199   -49.130 -42.211 1.00 66.72  ? 535  ALA A CA    1 
ATOM   4293 C  C     . ALA A 1 535 ? 3.869   -48.409 -41.046 1.00 65.60  ? 535  ALA A C     1 
ATOM   4294 O  O     . ALA A 1 535 ? 3.740   -47.193 -40.899 1.00 61.45  ? 535  ALA A O     1 
ATOM   4295 C  CB    . ALA A 1 535 ? 1.844   -49.677 -41.791 1.00 65.71  ? 535  ALA A CB    1 
ATOM   4296 N  N     . LYS A 1 536 ? 4.582   -49.170 -40.220 1.00 65.65  ? 536  LYS A N     1 
ATOM   4297 C  CA    . LYS A 1 536 ? 5.288   -48.608 -39.075 1.00 64.90  ? 536  LYS A CA    1 
ATOM   4298 C  C     . LYS A 1 536 ? 6.367   -47.630 -39.528 1.00 63.02  ? 536  LYS A C     1 
ATOM   4299 O  O     . LYS A 1 536 ? 6.473   -46.521 -39.002 1.00 60.57  ? 536  LYS A O     1 
ATOM   4300 C  CB    . LYS A 1 536 ? 5.909   -49.719 -38.224 1.00 67.27  ? 536  LYS A CB    1 
ATOM   4301 N  N     . SER A 1 537 ? 7.162   -48.048 -40.509 1.00 63.74  ? 537  SER A N     1 
ATOM   4302 C  CA    . SER A 1 537 ? 8.229   -47.208 -41.040 1.00 62.54  ? 537  SER A CA    1 
ATOM   4303 C  C     . SER A 1 537 ? 7.671   -45.974 -41.749 1.00 60.35  ? 537  SER A C     1 
ATOM   4304 O  O     . SER A 1 537 ? 8.194   -44.871 -41.591 1.00 58.09  ? 537  SER A O     1 
ATOM   4305 C  CB    . SER A 1 537 ? 9.127   -48.007 -41.988 1.00 64.12  ? 537  SER A CB    1 
ATOM   4306 O  OG    . SER A 1 537 ? 9.977   -48.889 -41.272 1.00 65.47  ? 537  SER A OG    1 
ATOM   4307 N  N     . LEU A 1 538 ? 6.607   -46.168 -42.522 1.00 59.72  ? 538  LEU A N     1 
ATOM   4308 C  CA    . LEU A 1 538 ? 5.970   -45.070 -43.241 1.00 56.86  ? 538  LEU A CA    1 
ATOM   4309 C  C     . LEU A 1 538 ? 5.403   -44.016 -42.293 1.00 57.13  ? 538  LEU A C     1 
ATOM   4310 O  O     . LEU A 1 538 ? 5.593   -42.816 -42.505 1.00 51.98  ? 538  LEU A O     1 
ATOM   4311 C  CB    . LEU A 1 538 ? 4.874   -45.594 -44.170 1.00 56.91  ? 538  LEU A CB    1 
ATOM   4312 C  CG    . LEU A 1 538 ? 5.339   -46.255 -45.471 1.00 57.55  ? 538  LEU A CG    1 
ATOM   4313 C  CD1   . LEU A 1 538 ? 4.160   -46.853 -46.227 1.00 56.87  ? 538  LEU A CD1   1 
ATOM   4314 C  CD2   . LEU A 1 538 ? 6.093   -45.263 -46.349 1.00 54.16  ? 538  LEU A CD2   1 
ATOM   4315 N  N     . ASN A 1 539 ? 4.711   -44.461 -41.248 1.00 58.34  ? 539  ASN A N     1 
ATOM   4316 C  CA    . ASN A 1 539 ? 4.172   -43.531 -40.262 1.00 59.60  ? 539  ASN A CA    1 
ATOM   4317 C  C     . ASN A 1 539 ? 5.268   -42.737 -39.560 1.00 58.11  ? 539  ASN A C     1 
ATOM   4318 O  O     . ASN A 1 539 ? 5.082   -41.567 -39.228 1.00 55.10  ? 539  ASN A O     1 
ATOM   4319 C  CB    . ASN A 1 539 ? 3.288   -44.249 -39.240 1.00 60.19  ? 539  ASN A CB    1 
ATOM   4320 C  CG    . ASN A 1 539 ? 1.899   -44.533 -39.774 1.00 61.76  ? 539  ASN A CG    1 
ATOM   4321 O  OD1   . ASN A 1 539 ? 1.364   -45.628 -39.598 1.00 66.43  ? 539  ASN A OD1   1 
ATOM   4322 N  ND2   . ASN A 1 539 ? 1.307   -43.545 -40.435 1.00 58.28  ? 539  ASN A ND2   1 
ATOM   4323 N  N     . GLU A 1 540 ? 6.414   -43.374 -39.346 1.00 61.17  ? 540  GLU A N     1 
ATOM   4324 C  CA    . GLU A 1 540 ? 7.551   -42.688 -38.748 1.00 62.03  ? 540  GLU A CA    1 
ATOM   4325 C  C     . GLU A 1 540 ? 8.161   -41.697 -39.740 1.00 61.59  ? 540  GLU A C     1 
ATOM   4326 O  O     . GLU A 1 540 ? 8.647   -40.634 -39.349 1.00 59.77  ? 540  GLU A O     1 
ATOM   4327 C  CB    . GLU A 1 540 ? 8.599   -43.691 -38.258 1.00 62.97  ? 540  GLU A CB    1 
ATOM   4328 C  CG    . GLU A 1 540 ? 9.789   -43.053 -37.547 1.00 67.01  ? 540  GLU A CG    1 
ATOM   4329 C  CD    . GLU A 1 540 ? 9.382   -42.200 -36.351 1.00 68.76  ? 540  GLU A CD    1 
ATOM   4330 O  OE1   . GLU A 1 540 ? 8.498   -42.629 -35.575 1.00 72.76  ? 540  GLU A OE1   1 
ATOM   4331 O  OE2   . GLU A 1 540 ? 9.947   -41.096 -36.188 1.00 62.10  ? 540  GLU A OE2   1 
ATOM   4332 N  N     . MET A 1 541 ? 8.125   -42.041 -41.025 1.00 59.54  ? 541  MET A N     1 
ATOM   4333 C  CA    . MET A 1 541 ? 8.629   -41.140 -42.058 1.00 56.65  ? 541  MET A CA    1 
ATOM   4334 C  C     . MET A 1 541 ? 7.705   -39.942 -42.237 1.00 52.47  ? 541  MET A C     1 
ATOM   4335 O  O     . MET A 1 541 ? 8.167   -38.818 -42.431 1.00 48.51  ? 541  MET A O     1 
ATOM   4336 C  CB    . MET A 1 541 ? 8.812   -41.867 -43.392 1.00 57.27  ? 541  MET A CB    1 
ATOM   4337 C  CG    . MET A 1 541 ? 9.899   -42.928 -43.377 1.00 62.80  ? 541  MET A CG    1 
ATOM   4338 S  SD    . MET A 1 541 ? 10.412  -43.438 -45.027 1.00 55.46  ? 541  MET A SD    1 
ATOM   4339 C  CE    . MET A 1 541 ? 11.378  -42.020 -45.540 1.00 60.89  ? 541  MET A CE    1 
ATOM   4340 N  N     . LEU A 1 542 ? 6.401   -40.188 -42.169 1.00 48.57  ? 542  LEU A N     1 
ATOM   4341 C  CA    . LEU A 1 542 ? 5.416   -39.120 -42.284 1.00 44.60  ? 542  LEU A CA    1 
ATOM   4342 C  C     . LEU A 1 542 ? 5.576   -38.141 -41.128 1.00 42.92  ? 542  LEU A C     1 
ATOM   4343 O  O     . LEU A 1 542 ? 5.423   -36.930 -41.297 1.00 38.14  ? 542  LEU A O     1 
ATOM   4344 C  CB    . LEU A 1 542 ? 3.999   -39.695 -42.301 1.00 44.24  ? 542  LEU A CB    1 
ATOM   4345 C  CG    . LEU A 1 542 ? 2.860   -38.677 -42.397 1.00 48.26  ? 542  LEU A CG    1 
ATOM   4346 C  CD1   . LEU A 1 542 ? 2.957   -37.878 -43.689 1.00 51.25  ? 542  LEU A CD1   1 
ATOM   4347 C  CD2   . LEU A 1 542 ? 1.507   -39.358 -42.286 1.00 46.18  ? 542  LEU A CD2   1 
ATOM   4348 N  N     . PHE A 1 543 ? 5.897   -38.678 -39.954 1.00 43.13  ? 543  PHE A N     1 
ATOM   4349 C  CA    . PHE A 1 543 ? 6.121   -37.863 -38.769 1.00 41.42  ? 543  PHE A CA    1 
ATOM   4350 C  C     . PHE A 1 543 ? 7.329   -36.958 -38.961 1.00 39.13  ? 543  PHE A C     1 
ATOM   4351 O  O     . PHE A 1 543 ? 7.279   -35.766 -38.660 1.00 40.56  ? 543  PHE A O     1 
ATOM   4352 C  CB    . PHE A 1 543 ? 6.322   -38.750 -37.536 1.00 43.61  ? 543  PHE A CB    1 
ATOM   4353 C  CG    . PHE A 1 543 ? 6.550   -37.977 -36.264 1.00 48.29  ? 543  PHE A CG    1 
ATOM   4354 C  CD1   . PHE A 1 543 ? 5.490   -37.379 -35.601 1.00 47.18  ? 543  PHE A CD1   1 
ATOM   4355 C  CD2   . PHE A 1 543 ? 7.826   -37.849 -35.733 1.00 49.70  ? 543  PHE A CD2   1 
ATOM   4356 C  CE1   . PHE A 1 543 ? 5.696   -36.667 -34.432 1.00 47.70  ? 543  PHE A CE1   1 
ATOM   4357 C  CE2   . PHE A 1 543 ? 8.040   -37.139 -34.563 1.00 46.72  ? 543  PHE A CE2   1 
ATOM   4358 C  CZ    . PHE A 1 543 ? 6.973   -36.547 -33.912 1.00 47.40  ? 543  PHE A CZ    1 
ATOM   4359 N  N     . ARG A 1 544 ? 8.415   -37.532 -39.466 1.00 37.45  ? 544  ARG A N     1 
ATOM   4360 C  CA    . ARG A 1 544 ? 9.644   -36.781 -39.674 1.00 40.97  ? 544  ARG A CA    1 
ATOM   4361 C  C     . ARG A 1 544 ? 9.482   -35.774 -40.804 1.00 42.38  ? 544  ARG A C     1 
ATOM   4362 O  O     . ARG A 1 544 ? 10.084  -34.700 -40.781 1.00 44.82  ? 544  ARG A O     1 
ATOM   4363 C  CB    . ARG A 1 544 ? 10.810  -37.730 -39.953 1.00 43.45  ? 544  ARG A CB    1 
ATOM   4364 C  CG    . ARG A 1 544 ? 11.149  -38.623 -38.772 1.00 46.90  ? 544  ARG A CG    1 
ATOM   4365 C  CD    . ARG A 1 544 ? 12.137  -39.719 -39.146 1.00 49.46  ? 544  ARG A CD    1 
ATOM   4366 N  NE    . ARG A 1 544 ? 12.354  -40.634 -38.029 1.00 52.47  ? 544  ARG A NE    1 
ATOM   4367 C  CZ    . ARG A 1 544 ? 13.205  -41.655 -38.048 1.00 53.12  ? 544  ARG A CZ    1 
ATOM   4368 N  NH1   . ARG A 1 544 ? 13.928  -41.900 -39.132 1.00 53.36  ? 544  ARG A NH1   1 
ATOM   4369 N  NH2   . ARG A 1 544 ? 13.333  -42.428 -36.980 1.00 55.82  ? 544  ARG A NH2   1 
ATOM   4370 N  N     . ALA A 1 545 ? 8.653   -36.122 -41.783 1.00 41.67  ? 545  ALA A N     1 
ATOM   4371 C  CA    . ALA A 1 545 ? 8.369   -35.226 -42.895 1.00 35.28  ? 545  ALA A CA    1 
ATOM   4372 C  C     . ALA A 1 545 ? 7.622   -33.990 -42.403 1.00 35.49  ? 545  ALA A C     1 
ATOM   4373 O  O     . ALA A 1 545 ? 7.986   -32.860 -42.728 1.00 34.64  ? 545  ALA A O     1 
ATOM   4374 C  CB    . ALA A 1 545 ? 7.560   -35.942 -43.954 1.00 42.46  ? 545  ALA A CB    1 
ATOM   4375 N  N     . GLN A 1 546 ? 6.575   -34.219 -41.617 1.00 37.61  ? 546  GLN A N     1 
ATOM   4376 C  CA    . GLN A 1 546 ? 5.765   -33.137 -41.067 1.00 38.00  ? 546  GLN A CA    1 
ATOM   4377 C  C     . GLN A 1 546 ? 6.550   -32.281 -40.074 1.00 33.79  ? 546  GLN A C     1 
ATOM   4378 O  O     . GLN A 1 546 ? 6.321   -31.078 -39.974 1.00 33.66  ? 546  GLN A O     1 
ATOM   4379 C  CB    . GLN A 1 546 ? 4.495   -33.697 -40.419 1.00 40.02  ? 546  GLN A CB    1 
ATOM   4380 C  CG    . GLN A 1 546 ? 3.536   -34.324 -41.417 1.00 43.72  ? 546  GLN A CG    1 
ATOM   4381 C  CD    . GLN A 1 546 ? 2.371   -35.024 -40.751 1.00 46.76  ? 546  GLN A CD    1 
ATOM   4382 O  OE1   . GLN A 1 546 ? 2.439   -35.382 -39.576 1.00 51.74  ? 546  GLN A OE1   1 
ATOM   4383 N  NE2   . GLN A 1 546 ? 1.290   -35.221 -41.498 1.00 45.22  ? 546  GLN A NE2   1 
ATOM   4384 N  N     A ARG A 1 547 ? 7.468   -32.909 -39.344 0.50 34.77  ? 547  ARG A N     1 
ATOM   4385 N  N     B ARG A 1 547 ? 7.471   -32.904 -39.344 0.50 34.77  ? 547  ARG A N     1 
ATOM   4386 C  CA    A ARG A 1 547 ? 8.349   -32.182 -38.438 0.50 34.83  ? 547  ARG A CA    1 
ATOM   4387 C  CA    B ARG A 1 547 ? 8.336   -32.164 -38.432 0.50 34.79  ? 547  ARG A CA    1 
ATOM   4388 C  C     A ARG A 1 547 ? 9.289   -31.280 -39.226 0.50 35.33  ? 547  ARG A C     1 
ATOM   4389 C  C     B ARG A 1 547 ? 9.314   -31.287 -39.210 0.50 35.33  ? 547  ARG A C     1 
ATOM   4390 O  O     A ARG A 1 547 ? 9.539   -30.137 -38.841 0.50 34.71  ? 547  ARG A O     1 
ATOM   4391 O  O     B ARG A 1 547 ? 9.614   -30.165 -38.801 0.50 34.81  ? 547  ARG A O     1 
ATOM   4392 C  CB    A ARG A 1 547 ? 9.152   -33.150 -37.568 0.50 36.93  ? 547  ARG A CB    1 
ATOM   4393 C  CB    B ARG A 1 547 ? 9.090   -33.113 -37.496 0.50 37.06  ? 547  ARG A CB    1 
ATOM   4394 C  CG    A ARG A 1 547 ? 8.453   -33.541 -36.276 0.50 37.53  ? 547  ARG A CG    1 
ATOM   4395 C  CG    B ARG A 1 547 ? 8.290   -33.555 -36.275 0.50 37.60  ? 547  ARG A CG    1 
ATOM   4396 C  CD    A ARG A 1 547 ? 8.182   -32.308 -35.429 0.50 36.18  ? 547  ARG A CD    1 
ATOM   4397 C  CD    B ARG A 1 547 ? 7.782   -32.347 -35.496 0.50 35.92  ? 547  ARG A CD    1 
ATOM   4398 N  NE    A ARG A 1 547 ? 7.475   -32.627 -34.194 0.50 35.95  ? 547  ARG A NE    1 
ATOM   4399 N  NE    B ARG A 1 547 ? 7.501   -32.662 -34.097 0.50 36.04  ? 547  ARG A NE    1 
ATOM   4400 C  CZ    A ARG A 1 547 ? 8.073   -32.937 -33.049 0.50 34.53  ? 547  ARG A CZ    1 
ATOM   4401 C  CZ    B ARG A 1 547 ? 6.291   -32.920 -33.611 0.50 34.52  ? 547  ARG A CZ    1 
ATOM   4402 N  NH1   A ARG A 1 547 ? 9.398   -32.977 -32.976 0.50 33.46  ? 547  ARG A NH1   1 
ATOM   4403 N  NH1   B ARG A 1 547 ? 5.233   -32.903 -34.410 0.50 33.06  ? 547  ARG A NH1   1 
ATOM   4404 N  NH2   A ARG A 1 547 ? 7.345   -33.208 -31.975 0.50 31.34  ? 547  ARG A NH2   1 
ATOM   4405 N  NH2   B ARG A 1 547 ? 6.139   -33.193 -32.322 0.50 31.41  ? 547  ARG A NH2   1 
ATOM   4406 N  N     . THR A 1 548 ? 9.801   -31.804 -40.333 1.00 37.04  ? 548  THR A N     1 
ATOM   4407 C  CA    . THR A 1 548 ? 10.680  -31.045 -41.213 1.00 36.95  ? 548  THR A CA    1 
ATOM   4408 C  C     . THR A 1 548 ? 9.910   -29.880 -41.830 1.00 33.03  ? 548  THR A C     1 
ATOM   4409 O  O     . THR A 1 548 ? 10.436  -28.775 -41.966 1.00 33.85  ? 548  THR A O     1 
ATOM   4410 C  CB    . THR A 1 548 ? 11.269  -31.941 -42.320 1.00 39.13  ? 548  THR A CB    1 
ATOM   4411 O  OG1   . THR A 1 548 ? 12.036  -32.992 -41.722 1.00 42.07  ? 548  THR A OG1   1 
ATOM   4412 C  CG2   . THR A 1 548 ? 12.167  -31.140 -43.251 1.00 42.41  ? 548  THR A CG2   1 
ATOM   4413 N  N     . GLU A 1 549 ? 8.651   -30.125 -42.172 1.00 34.92  ? 549  GLU A N     1 
ATOM   4414 C  CA    . GLU A 1 549 ? 7.799   -29.075 -42.725 1.00 35.65  ? 549  GLU A CA    1 
ATOM   4415 C  C     . GLU A 1 549 ? 7.527   -27.955 -41.711 1.00 32.23  ? 549  GLU A C     1 
ATOM   4416 O  O     . GLU A 1 549 ? 7.525   -26.771 -42.065 1.00 33.12  ? 549  GLU A O     1 
ATOM   4417 C  CB    . GLU A 1 549 ? 6.484   -29.668 -43.229 1.00 38.32  ? 549  GLU A CB    1 
ATOM   4418 C  CG    . GLU A 1 549 ? 5.563   -28.648 -43.870 1.00 40.60  ? 549  GLU A CG    1 
ATOM   4419 C  CD    . GLU A 1 549 ? 4.177   -29.198 -44.144 1.00 44.12  ? 549  GLU A CD    1 
ATOM   4420 O  OE1   . GLU A 1 549 ? 4.033   -30.434 -44.263 1.00 44.85  ? 549  GLU A OE1   1 
ATOM   4421 O  OE2   . GLU A 1 549 ? 3.226   -28.389 -44.232 1.00 44.50  ? 549  GLU A OE2   1 
ATOM   4422 N  N     . VAL A 1 550 ? 7.299   -28.322 -40.455 1.00 30.16  ? 550  VAL A N     1 
ATOM   4423 C  CA    . VAL A 1 550 ? 7.051   -27.322 -39.410 1.00 30.94  ? 550  VAL A CA    1 
ATOM   4424 C  C     . VAL A 1 550 ? 8.298   -26.472 -39.155 1.00 32.06  ? 550  VAL A C     1 
ATOM   4425 O  O     . VAL A 1 550 ? 8.204   -25.258 -38.966 1.00 30.14  ? 550  VAL A O     1 
ATOM   4426 C  CB    . VAL A 1 550 ? 6.557   -27.970 -38.093 1.00 35.10  ? 550  VAL A CB    1 
ATOM   4427 C  CG1   . VAL A 1 550 ? 6.567   -26.957 -36.952 1.00 33.07  ? 550  VAL A CG1   1 
ATOM   4428 C  CG2   . VAL A 1 550 ? 5.161   -28.549 -38.276 1.00 32.60  ? 550  VAL A CG2   1 
ATOM   4429 N  N     . ALA A 1 551 ? 9.465   -27.115 -39.163 1.00 32.77  ? 551  ALA A N     1 
ATOM   4430 C  CA    . ALA A 1 551 ? 10.732  -26.407 -39.008 1.00 28.67  ? 551  ALA A CA    1 
ATOM   4431 C  C     . ALA A 1 551 ? 10.930  -25.390 -40.133 1.00 29.78  ? 551  ALA A C     1 
ATOM   4432 O  O     . ALA A 1 551 ? 11.358  -24.263 -39.891 1.00 33.13  ? 551  ALA A O     1 
ATOM   4433 C  CB    . ALA A 1 551 ? 11.905  -27.405 -38.969 1.00 29.59  ? 551  ALA A CB    1 
ATOM   4434 N  N     . GLY A 1 552 ? 10.615  -25.797 -41.359 1.00 29.16  ? 552  GLY A N     1 
ATOM   4435 C  CA    . GLY A 1 552 ? 10.691  -24.911 -42.508 1.00 29.55  ? 552  GLY A CA    1 
ATOM   4436 C  C     . GLY A 1 552 ? 9.672   -23.786 -42.419 1.00 30.27  ? 552  GLY A C     1 
ATOM   4437 O  O     . GLY A 1 552 ? 9.973   -22.627 -42.729 1.00 28.63  ? 552  GLY A O     1 
ATOM   4438 N  N     . MET A 1 553 ? 8.463   -24.133 -41.987 1.00 27.03  ? 553  MET A N     1 
ATOM   4439 C  CA    . MET A 1 553 ? 7.386   -23.160 -41.827 1.00 25.81  ? 553  MET A CA    1 
ATOM   4440 C  C     . MET A 1 553 ? 7.779   -22.055 -40.846 1.00 26.57  ? 553  MET A C     1 
ATOM   4441 O  O     . MET A 1 553 ? 7.623   -20.873 -41.139 1.00 27.04  ? 553  MET A O     1 
ATOM   4442 C  CB    . MET A 1 553 ? 6.103   -23.857 -41.363 1.00 24.84  ? 553  MET A CB    1 
ATOM   4443 C  CG    . MET A 1 553 ? 4.976   -22.900 -40.962 1.00 36.76  ? 553  MET A CG    1 
ATOM   4444 S  SD    . MET A 1 553 ? 4.354   -21.874 -42.316 1.00 41.04  ? 553  MET A SD    1 
ATOM   4445 C  CE    . MET A 1 553 ? 3.165   -22.963 -43.085 1.00 34.74  ? 553  MET A CE    1 
ATOM   4446 N  N     . THR A 1 554 ? 8.296   -22.448 -39.685 1.00 26.13  ? 554  THR A N     1 
ATOM   4447 C  CA    . THR A 1 554 ? 8.755   -21.484 -38.693 1.00 26.95  ? 554  THR A CA    1 
ATOM   4448 C  C     . THR A 1 554 ? 9.788   -20.529 -39.288 1.00 27.35  ? 554  THR A C     1 
ATOM   4449 O  O     . THR A 1 554 ? 9.684   -19.314 -39.133 1.00 26.41  ? 554  THR A O     1 
ATOM   4450 C  CB    . THR A 1 554 ? 9.376   -22.193 -37.483 1.00 27.53  ? 554  THR A CB    1 
ATOM   4451 O  OG1   . THR A 1 554 ? 8.345   -22.867 -36.751 1.00 30.99  ? 554  THR A OG1   1 
ATOM   4452 C  CG2   . THR A 1 554 ? 10.072  -21.194 -36.571 1.00 25.16  ? 554  THR A CG2   1 
ATOM   4453 N  N     . ALA A 1 555 ? 10.769  -21.096 -39.985 1.00 27.25  ? 555  ALA A N     1 
ATOM   4454 C  CA    . ALA A 1 555 ? 11.860  -20.325 -40.563 1.00 32.79  ? 555  ALA A CA    1 
ATOM   4455 C  C     . ALA A 1 555 ? 11.389  -19.360 -41.651 1.00 30.84  ? 555  ALA A C     1 
ATOM   4456 O  O     . ALA A 1 555 ? 11.833  -18.213 -41.703 1.00 30.20  ? 555  ALA A O     1 
ATOM   4457 C  CB    . ALA A 1 555 ? 12.937  -21.264 -41.112 1.00 34.19  ? 555  ALA A CB    1 
ATOM   4458 N  N     . GLN A 1 556 ? 10.488  -19.822 -42.513 1.00 27.03  ? 556  GLN A N     1 
ATOM   4459 C  CA    . GLN A 1 556 ? 10.053  -19.009 -43.647 1.00 30.35  ? 556  GLN A CA    1 
ATOM   4460 C  C     . GLN A 1 556 ? 8.984   -17.972 -43.289 1.00 31.40  ? 556  GLN A C     1 
ATOM   4461 O  O     . GLN A 1 556 ? 9.040   -16.831 -43.751 1.00 31.60  ? 556  GLN A O     1 
ATOM   4462 C  CB    . GLN A 1 556 ? 9.608   -19.890 -44.830 1.00 30.47  ? 556  GLN A CB    1 
ATOM   4463 C  CG    . GLN A 1 556 ? 8.249   -20.579 -44.691 1.00 27.96  ? 556  GLN A CG    1 
ATOM   4464 C  CD    . GLN A 1 556 ? 7.089   -19.687 -45.136 1.00 31.55  ? 556  GLN A CD    1 
ATOM   4465 O  OE1   . GLN A 1 556 ? 7.298   -18.610 -45.699 1.00 27.84  ? 556  GLN A OE1   1 
ATOM   4466 N  NE2   . GLN A 1 556 ? 5.864   -20.131 -44.873 1.00 29.98  ? 556  GLN A NE2   1 
ATOM   4467 N  N     . ILE A 1 557 ? 8.019   -18.355 -42.461 1.00 27.51  ? 557  ILE A N     1 
ATOM   4468 C  CA    . ILE A 1 557 ? 6.890   -17.470 -42.199 1.00 25.88  ? 557  ILE A CA    1 
ATOM   4469 C  C     . ILE A 1 557 ? 7.275   -16.330 -41.260 1.00 27.90  ? 557  ILE A C     1 
ATOM   4470 O  O     . ILE A 1 557 ? 6.648   -15.269 -41.271 1.00 25.99  ? 557  ILE A O     1 
ATOM   4471 C  CB    . ILE A 1 557 ? 5.658   -18.235 -41.662 1.00 27.59  ? 557  ILE A CB    1 
ATOM   4472 C  CG1   . ILE A 1 557 ? 4.376   -17.486 -42.039 1.00 28.03  ? 557  ILE A CG1   1 
ATOM   4473 C  CG2   . ILE A 1 557 ? 5.774   -18.471 -40.156 1.00 26.39  ? 557  ILE A CG2   1 
ATOM   4474 C  CD1   . ILE A 1 557 ? 3.107   -18.137 -41.547 1.00 30.72  ? 557  ILE A CD1   1 
ATOM   4475 N  N     . ASN A 1 558 ? 8.322   -16.537 -40.467 1.00 25.43  ? 558  ASN A N     1 
ATOM   4476 C  CA    . ASN A 1 558 ? 8.779   -15.487 -39.564 1.00 27.66  ? 558  ASN A CA    1 
ATOM   4477 C  C     . ASN A 1 558 ? 9.799   -14.528 -40.185 1.00 25.94  ? 558  ASN A C     1 
ATOM   4478 O  O     . ASN A 1 558 ? 9.959   -13.394 -39.724 1.00 28.67  ? 558  ASN A O     1 
ATOM   4479 C  CB    . ASN A 1 558 ? 9.256   -16.072 -38.233 1.00 25.51  ? 558  ASN A CB    1 
ATOM   4480 C  CG    . ASN A 1 558 ? 8.098   -16.569 -37.387 1.00 28.71  ? 558  ASN A CG    1 
ATOM   4481 O  OD1   . ASN A 1 558 ? 7.237   -15.785 -36.990 1.00 28.14  ? 558  ASN A OD1   1 
ATOM   4482 N  ND2   . ASN A 1 558 ? 8.055   -17.873 -37.130 1.00 26.14  ? 558  ASN A ND2   1 
ATOM   4483 N  N     . ARG A 1 559 ? 10.472  -14.979 -41.237 1.00 23.20  ? 559  ARG A N     1 
ATOM   4484 C  CA    . ARG A 1 559 ? 11.262  -14.073 -42.066 1.00 28.28  ? 559  ARG A CA    1 
ATOM   4485 C  C     . ARG A 1 559 ? 10.330  -13.246 -42.950 1.00 29.81  ? 559  ARG A C     1 
ATOM   4486 O  O     . ARG A 1 559 ? 10.580  -12.064 -43.201 1.00 31.10  ? 559  ARG A O     1 
ATOM   4487 C  CB    . ARG A 1 559 ? 12.287  -14.846 -42.899 1.00 24.21  ? 559  ARG A CB    1 
ATOM   4488 C  CG    . ARG A 1 559 ? 13.485  -15.298 -42.072 1.00 29.54  ? 559  ARG A CG    1 
ATOM   4489 C  CD    . ARG A 1 559 ? 14.327  -16.340 -42.783 1.00 30.10  ? 559  ARG A CD    1 
ATOM   4490 N  NE    . ARG A 1 559 ? 15.561  -16.640 -42.059 1.00 28.36  ? 559  ARG A NE    1 
ATOM   4491 C  CZ    . ARG A 1 559 ? 15.638  -17.430 -40.989 1.00 36.00  ? 559  ARG A CZ    1 
ATOM   4492 N  NH1   . ARG A 1 559 ? 14.546  -17.997 -40.494 1.00 32.25  ? 559  ARG A NH1   1 
ATOM   4493 N  NH2   . ARG A 1 559 ? 16.812  -17.651 -40.406 1.00 38.49  ? 559  ARG A NH2   1 
ATOM   4494 N  N     . LYS A 1 560 ? 9.253   -13.874 -43.414 1.00 27.23  ? 560  LYS A N     1 
ATOM   4495 C  CA    . LYS A 1 560 ? 8.180   -13.152 -44.093 1.00 28.86  ? 560  LYS A CA    1 
ATOM   4496 C  C     . LYS A 1 560 ? 7.588   -12.067 -43.184 1.00 26.38  ? 560  LYS A C     1 
ATOM   4497 O  O     . LYS A 1 560 ? 7.370   -10.930 -43.609 1.00 27.55  ? 560  LYS A O     1 
ATOM   4498 C  CB    . LYS A 1 560 ? 7.073   -14.113 -44.528 1.00 25.08  ? 560  LYS A CB    1 
ATOM   4499 C  CG    . LYS A 1 560 ? 5.748   -13.410 -44.799 1.00 29.84  ? 560  LYS A CG    1 
ATOM   4500 C  CD    . LYS A 1 560 ? 4.637   -14.389 -45.123 1.00 31.46  ? 560  LYS A CD    1 
ATOM   4501 C  CE    . LYS A 1 560 ? 3.322   -13.654 -45.315 1.00 31.00  ? 560  LYS A CE    1 
ATOM   4502 N  NZ    . LYS A 1 560 ? 2.271   -14.534 -45.895 1.00 33.43  ? 560  LYS A NZ    1 
ATOM   4503 N  N     . LEU A 1 561 ? 7.331   -12.427 -41.932 1.00 24.53  ? 561  LEU A N     1 
ATOM   4504 C  CA    . LEU A 1 561 ? 6.801   -11.484 -40.952 1.00 25.22  ? 561  LEU A CA    1 
ATOM   4505 C  C     . LEU A 1 561 ? 7.765   -10.324 -40.714 1.00 26.45  ? 561  LEU A C     1 
ATOM   4506 O  O     . LEU A 1 561 ? 7.345   -9.175  -40.578 1.00 26.65  ? 561  LEU A O     1 
ATOM   4507 C  CB    . LEU A 1 561 ? 6.510   -12.194 -39.629 1.00 23.54  ? 561  LEU A CB    1 
ATOM   4508 C  CG    . LEU A 1 561 ? 6.163   -11.303 -38.430 1.00 28.14  ? 561  LEU A CG    1 
ATOM   4509 C  CD1   . LEU A 1 561 ? 4.893   -10.509 -38.698 1.00 27.23  ? 561  LEU A CD1   1 
ATOM   4510 C  CD2   . LEU A 1 561 ? 6.027   -12.140 -37.158 1.00 26.76  ? 561  LEU A CD2   1 
ATOM   4511 N  N     . LEU A 1 562 ? 9.057   -10.631 -40.656 1.00 25.80  ? 562  LEU A N     1 
ATOM   4512 C  CA    . LEU A 1 562 ? 10.071  -9.604  -40.429 1.00 23.99  ? 562  LEU A CA    1 
ATOM   4513 C  C     . LEU A 1 562 ? 10.115  -8.592  -41.571 1.00 22.86  ? 562  LEU A C     1 
ATOM   4514 O  O     . LEU A 1 562 ? 10.144  -7.383  -41.330 1.00 25.29  ? 562  LEU A O     1 
ATOM   4515 C  CB    . LEU A 1 562 ? 11.455  -10.227 -40.215 1.00 23.58  ? 562  LEU A CB    1 
ATOM   4516 C  CG    . LEU A 1 562 ? 12.582  -9.252  -39.854 1.00 27.68  ? 562  LEU A CG    1 
ATOM   4517 C  CD1   . LEU A 1 562 ? 12.261  -8.481  -38.568 1.00 25.38  ? 562  LEU A CD1   1 
ATOM   4518 C  CD2   . LEU A 1 562 ? 13.920  -9.977  -39.727 1.00 28.49  ? 562  LEU A CD2   1 
ATOM   4519 N  N     . ILE A 1 563 ? 10.118  -9.073  -42.812 1.00 23.03  ? 563  ILE A N     1 
ATOM   4520 C  CA    . ILE A 1 563 ? 10.188  -8.150  -43.945 1.00 26.15  ? 563  ILE A CA    1 
ATOM   4521 C  C     . ILE A 1 563 ? 8.892   -7.362  -44.135 1.00 25.14  ? 563  ILE A C     1 
ATOM   4522 O  O     . ILE A 1 563 ? 8.925   -6.195  -44.521 1.00 26.14  ? 563  ILE A O     1 
ATOM   4523 C  CB    . ILE A 1 563 ? 10.640  -8.828  -45.266 1.00 26.94  ? 563  ILE A CB    1 
ATOM   4524 C  CG1   . ILE A 1 563 ? 9.674   -9.935  -45.688 1.00 25.36  ? 563  ILE A CG1   1 
ATOM   4525 C  CG2   . ILE A 1 563 ? 12.049  -9.371  -45.125 1.00 24.80  ? 563  ILE A CG2   1 
ATOM   4526 C  CD1   . ILE A 1 563 ? 10.095  -10.645 -46.969 1.00 26.06  ? 563  ILE A CD1   1 
ATOM   4527 N  N     . ASN A 1 564 ? 7.753   -7.988  -43.852 1.00 22.46  ? 564  ASN A N     1 
ATOM   4528 C  CA    . ASN A 1 564 ? 6.492   -7.261  -43.889 1.00 22.04  ? 564  ASN A CA    1 
ATOM   4529 C  C     . ASN A 1 564 ? 6.425   -6.229  -42.770 1.00 24.85  ? 564  ASN A C     1 
ATOM   4530 O  O     . ASN A 1 564 ? 5.799   -5.180  -42.919 1.00 24.78  ? 564  ASN A O     1 
ATOM   4531 C  CB    . ASN A 1 564 ? 5.293   -8.211  -43.821 1.00 22.01  ? 564  ASN A CB    1 
ATOM   4532 C  CG    . ASN A 1 564 ? 5.124   -9.024  -45.090 1.00 23.35  ? 564  ASN A CG    1 
ATOM   4533 O  OD1   . ASN A 1 564 ? 5.716   -8.711  -46.120 1.00 24.57  ? 564  ASN A OD1   1 
ATOM   4534 N  ND2   . ASN A 1 564 ? 4.309   -10.068 -45.023 1.00 21.33  ? 564  ASN A ND2   1 
ATOM   4535 N  N     . SER A 1 565 ? 7.076   -6.527  -41.651 1.00 21.82  ? 565  SER A N     1 
ATOM   4536 C  CA    . SER A 1 565 ? 7.134   -5.580  -40.543 1.00 23.79  ? 565  SER A CA    1 
ATOM   4537 C  C     . SER A 1 565 ? 8.054   -4.396  -40.856 1.00 25.09  ? 565  SER A C     1 
ATOM   4538 O  O     . SER A 1 565 ? 7.967   -3.360  -40.202 1.00 28.01  ? 565  SER A O     1 
ATOM   4539 C  CB    . SER A 1 565 ? 7.574   -6.268  -39.252 1.00 22.49  ? 565  SER A CB    1 
ATOM   4540 O  OG    . SER A 1 565 ? 6.582   -7.173  -38.807 1.00 24.83  ? 565  SER A OG    1 
ATOM   4541 N  N     . LEU A 1 566 ? 8.935   -4.552  -41.844 1.00 24.55  ? 566  LEU A N     1 
ATOM   4542 C  CA    . LEU A 1 566 ? 9.732   -3.425  -42.330 1.00 24.80  ? 566  LEU A CA    1 
ATOM   4543 C  C     . LEU A 1 566 ? 8.840   -2.473  -43.121 1.00 26.29  ? 566  LEU A C     1 
ATOM   4544 O  O     . LEU A 1 566 ? 8.958   -1.256  -42.988 1.00 27.21  ? 566  LEU A O     1 
ATOM   4545 C  CB    . LEU A 1 566 ? 10.925  -3.889  -43.174 1.00 26.68  ? 566  LEU A CB    1 
ATOM   4546 C  CG    . LEU A 1 566 ? 11.813  -2.815  -43.823 1.00 26.45  ? 566  LEU A CG    1 
ATOM   4547 C  CD1   . LEU A 1 566 ? 12.238  -1.733  -42.828 1.00 26.41  ? 566  LEU A CD1   1 
ATOM   4548 C  CD2   . LEU A 1 566 ? 13.042  -3.452  -44.455 1.00 26.28  ? 566  LEU A CD2   1 
ATOM   4549 N  N     . TYR A 1 567 ? 7.944   -3.021  -43.941 1.00 25.34  ? 567  TYR A N     1 
ATOM   4550 C  CA    . TYR A 1 567 ? 6.917   -2.190  -44.555 1.00 25.47  ? 567  TYR A CA    1 
ATOM   4551 C  C     . TYR A 1 567 ? 6.123   -1.501  -43.449 1.00 25.38  ? 567  TYR A C     1 
ATOM   4552 O  O     . TYR A 1 567 ? 5.900   -0.290  -43.492 1.00 27.27  ? 567  TYR A O     1 
ATOM   4553 C  CB    . TYR A 1 567 ? 5.938   -2.991  -45.431 1.00 25.58  ? 567  TYR A CB    1 
ATOM   4554 C  CG    . TYR A 1 567 ? 4.547   -2.396  -45.335 1.00 24.44  ? 567  TYR A CG    1 
ATOM   4555 C  CD1   . TYR A 1 567 ? 4.264   -1.156  -45.904 1.00 25.23  ? 567  TYR A CD1   1 
ATOM   4556 C  CD2   . TYR A 1 567 ? 3.539   -3.033  -44.618 1.00 25.05  ? 567  TYR A CD2   1 
ATOM   4557 C  CE1   . TYR A 1 567 ? 3.020   -0.578  -45.781 1.00 24.03  ? 567  TYR A CE1   1 
ATOM   4558 C  CE2   . TYR A 1 567 ? 2.281   -2.461  -44.492 1.00 25.09  ? 567  TYR A CE2   1 
ATOM   4559 C  CZ    . TYR A 1 567 ? 2.032   -1.232  -45.078 1.00 24.24  ? 567  TYR A CZ    1 
ATOM   4560 O  OH    . TYR A 1 567 ? 0.794   -0.647  -44.965 1.00 27.77  ? 567  TYR A OH    1 
ATOM   4561 N  N     . GLY A 1 568 ? 5.683   -2.285  -42.469 1.00 23.06  ? 568  GLY A N     1 
ATOM   4562 C  CA    . GLY A 1 568 ? 4.852   -1.762  -41.402 1.00 26.19  ? 568  GLY A CA    1 
ATOM   4563 C  C     . GLY A 1 568 ? 5.549   -0.665  -40.621 1.00 25.13  ? 568  GLY A C     1 
ATOM   4564 O  O     . GLY A 1 568 ? 4.926   0.331   -40.252 1.00 25.12  ? 568  GLY A O     1 
ATOM   4565 N  N     . ALA A 1 569 ? 6.842   -0.852  -40.373 1.00 23.77  ? 569  ALA A N     1 
ATOM   4566 C  CA    . ALA A 1 569 ? 7.631   0.116   -39.610 1.00 24.20  ? 569  ALA A CA    1 
ATOM   4567 C  C     . ALA A 1 569 ? 7.672   1.492   -40.272 1.00 24.34  ? 569  ALA A C     1 
ATOM   4568 O  O     . ALA A 1 569 ? 7.739   2.509   -39.585 1.00 26.20  ? 569  ALA A O     1 
ATOM   4569 C  CB    . ALA A 1 569 ? 9.043   -0.409  -39.383 1.00 23.64  ? 569  ALA A CB    1 
ATOM   4570 N  N     . LEU A 1 570 ? 7.625   1.527   -41.601 1.00 24.89  ? 570  LEU A N     1 
ATOM   4571 C  CA    . LEU A 1 570 ? 7.575   2.799   -42.331 1.00 24.99  ? 570  LEU A CA    1 
ATOM   4572 C  C     . LEU A 1 570 ? 6.331   3.605   -41.963 1.00 26.38  ? 570  LEU A C     1 
ATOM   4573 O  O     . LEU A 1 570 ? 6.295   4.827   -42.139 1.00 27.10  ? 570  LEU A O     1 
ATOM   4574 C  CB    . LEU A 1 570 ? 7.615   2.565   -43.843 1.00 25.39  ? 570  LEU A CB    1 
ATOM   4575 C  CG    . LEU A 1 570 ? 8.912   1.979   -44.405 1.00 29.76  ? 570  LEU A CG    1 
ATOM   4576 C  CD1   . LEU A 1 570 ? 8.712   1.529   -45.847 1.00 30.23  ? 570  LEU A CD1   1 
ATOM   4577 C  CD2   . LEU A 1 570 ? 10.062  2.983   -44.302 1.00 27.10  ? 570  LEU A CD2   1 
ATOM   4578 N  N     . GLY A 1 571 ? 5.315   2.911   -41.456 1.00 25.42  ? 571  GLY A N     1 
ATOM   4579 C  CA    . GLY A 1 571 ? 4.101   3.549   -40.978 1.00 22.98  ? 571  GLY A CA    1 
ATOM   4580 C  C     . GLY A 1 571 ? 3.997   3.575   -39.460 1.00 26.69  ? 571  GLY A C     1 
ATOM   4581 O  O     . GLY A 1 571 ? 2.906   3.744   -38.917 1.00 32.57  ? 571  GLY A O     1 
ATOM   4582 N  N     . ASN A 1 572 ? 5.126   3.408   -38.771 1.00 24.63  ? 572  ASN A N     1 
ATOM   4583 C  CA    . ASN A 1 572 ? 5.159   3.492   -37.308 1.00 24.55  ? 572  ASN A CA    1 
ATOM   4584 C  C     . ASN A 1 572 ? 5.995   4.680   -36.822 1.00 23.66  ? 572  ASN A C     1 
ATOM   4585 O  O     . ASN A 1 572 ? 7.179   4.786   -37.149 1.00 22.83  ? 572  ASN A O     1 
ATOM   4586 C  CB    . ASN A 1 572 ? 5.696   2.191   -36.707 1.00 29.69  ? 572  ASN A CB    1 
ATOM   4587 C  CG    . ASN A 1 572 ? 5.574   2.153   -35.198 1.00 35.06  ? 572  ASN A CG    1 
ATOM   4588 O  OD1   . ASN A 1 572 ? 6.273   2.879   -34.486 1.00 36.46  ? 572  ASN A OD1   1 
ATOM   4589 N  ND2   . ASN A 1 572 ? 4.697   1.287   -34.698 1.00 33.72  ? 572  ASN A ND2   1 
ATOM   4590 N  N     . VAL A 1 573 ? 5.379   5.561   -36.034 1.00 26.51  ? 573  VAL A N     1 
ATOM   4591 C  CA    . VAL A 1 573 ? 6.015   6.818   -35.626 1.00 28.24  ? 573  VAL A CA    1 
ATOM   4592 C  C     . VAL A 1 573 ? 7.270   6.634   -34.779 1.00 29.21  ? 573  VAL A C     1 
ATOM   4593 O  O     . VAL A 1 573 ? 8.052   7.570   -34.623 1.00 31.36  ? 573  VAL A O     1 
ATOM   4594 C  CB    . VAL A 1 573 ? 5.036   7.756   -34.863 1.00 27.86  ? 573  VAL A CB    1 
ATOM   4595 C  CG1   . VAL A 1 573 ? 3.822   8.095   -35.726 1.00 26.71  ? 573  VAL A CG1   1 
ATOM   4596 C  CG2   . VAL A 1 573 ? 4.607   7.135   -33.541 1.00 26.48  ? 573  VAL A CG2   1 
ATOM   4597 N  N     . TRP A 1 574 ? 7.462   5.435   -34.235 1.00 29.45  ? 574  TRP A N     1 
ATOM   4598 C  CA    . TRP A 1 574 ? 8.642   5.145   -33.420 1.00 28.72  ? 574  TRP A CA    1 
ATOM   4599 C  C     . TRP A 1 574 ? 9.830   4.665   -34.250 1.00 28.53  ? 574  TRP A C     1 
ATOM   4600 O  O     . TRP A 1 574 ? 10.925  4.480   -33.727 1.00 31.23  ? 574  TRP A O     1 
ATOM   4601 C  CB    . TRP A 1 574 ? 8.305   4.127   -32.326 1.00 26.42  ? 574  TRP A CB    1 
ATOM   4602 C  CG    . TRP A 1 574 ? 7.259   4.633   -31.395 1.00 33.86  ? 574  TRP A CG    1 
ATOM   4603 C  CD1   . TRP A 1 574 ? 5.970   4.198   -31.288 1.00 37.58  ? 574  TRP A CD1   1 
ATOM   4604 C  CD2   . TRP A 1 574 ? 7.401   5.707   -30.458 1.00 39.66  ? 574  TRP A CD2   1 
ATOM   4605 N  NE1   . TRP A 1 574 ? 5.305   4.925   -30.329 1.00 39.11  ? 574  TRP A NE1   1 
ATOM   4606 C  CE2   . TRP A 1 574 ? 6.162   5.860   -29.806 1.00 40.56  ? 574  TRP A CE2   1 
ATOM   4607 C  CE3   . TRP A 1 574 ? 8.460   6.551   -30.103 1.00 44.47  ? 574  TRP A CE3   1 
ATOM   4608 C  CZ2   . TRP A 1 574 ? 5.951   6.819   -28.817 1.00 43.96  ? 574  TRP A CZ2   1 
ATOM   4609 C  CZ3   . TRP A 1 574 ? 8.248   7.506   -29.120 1.00 49.00  ? 574  TRP A CZ3   1 
ATOM   4610 C  CH2   . TRP A 1 574 ? 7.003   7.631   -28.490 1.00 48.19  ? 574  TRP A CH2   1 
ATOM   4611 N  N     . PHE A 1 575 ? 9.608   4.474   -35.545 1.00 27.65  ? 575  PHE A N     1 
ATOM   4612 C  CA    . PHE A 1 575 ? 10.658  4.004   -36.444 1.00 26.12  ? 575  PHE A CA    1 
ATOM   4613 C  C     . PHE A 1 575 ? 11.502  5.183   -36.905 1.00 25.90  ? 575  PHE A C     1 
ATOM   4614 O  O     . PHE A 1 575 ? 10.966  6.240   -37.243 1.00 26.18  ? 575  PHE A O     1 
ATOM   4615 C  CB    . PHE A 1 575 ? 10.029  3.303   -37.650 1.00 24.95  ? 575  PHE A CB    1 
ATOM   4616 C  CG    . PHE A 1 575 ? 11.004  2.533   -38.502 1.00 26.39  ? 575  PHE A CG    1 
ATOM   4617 C  CD1   . PHE A 1 575 ? 11.913  1.658   -37.929 1.00 25.18  ? 575  PHE A CD1   1 
ATOM   4618 C  CD2   . PHE A 1 575 ? 10.980  2.658   -39.886 1.00 25.13  ? 575  PHE A CD2   1 
ATOM   4619 C  CE1   . PHE A 1 575 ? 12.797  0.936   -38.718 1.00 27.96  ? 575  PHE A CE1   1 
ATOM   4620 C  CE2   . PHE A 1 575 ? 11.854  1.937   -40.680 1.00 24.52  ? 575  PHE A CE2   1 
ATOM   4621 C  CZ    . PHE A 1 575 ? 12.768  1.078   -40.095 1.00 26.69  ? 575  PHE A CZ    1 
ATOM   4622 N  N     . ARG A 1 576 ? 12.819  5.000   -36.918 1.00 25.20  ? 576  ARG A N     1 
ATOM   4623 C  CA    . ARG A 1 576 ? 13.747  6.059   -37.310 1.00 28.22  ? 576  ARG A CA    1 
ATOM   4624 C  C     . ARG A 1 576 ? 13.500  6.539   -38.742 1.00 33.16  ? 576  ARG A C     1 
ATOM   4625 O  O     . ARG A 1 576 ? 13.773  7.694   -39.075 1.00 35.59  ? 576  ARG A O     1 
ATOM   4626 C  CB    . ARG A 1 576 ? 15.194  5.577   -37.149 1.00 27.08  ? 576  ARG A CB    1 
ATOM   4627 C  CG    . ARG A 1 576 ? 16.253  6.659   -37.334 1.00 27.90  ? 576  ARG A CG    1 
ATOM   4628 C  CD    . ARG A 1 576 ? 17.666  6.070   -37.276 1.00 26.43  ? 576  ARG A CD    1 
ATOM   4629 N  NE    . ARG A 1 576 ? 17.888  5.315   -36.048 1.00 25.52  ? 576  ARG A NE    1 
ATOM   4630 C  CZ    . ARG A 1 576 ? 18.357  5.840   -34.920 1.00 29.40  ? 576  ARG A CZ    1 
ATOM   4631 N  NH1   . ARG A 1 576 ? 18.673  7.131   -34.860 1.00 31.78  ? 576  ARG A NH1   1 
ATOM   4632 N  NH2   . ARG A 1 576 ? 18.517  5.070   -33.853 1.00 28.76  ? 576  ARG A NH2   1 
ATOM   4633 N  N     . TYR A 1 577 ? 12.962  5.655   -39.579 1.00 31.56  ? 577  TYR A N     1 
ATOM   4634 C  CA    . TYR A 1 577 ? 12.735  5.970   -40.988 1.00 29.13  ? 577  TYR A CA    1 
ATOM   4635 C  C     . TYR A 1 577 ? 11.247  6.027   -41.320 1.00 29.13  ? 577  TYR A C     1 
ATOM   4636 O  O     . TYR A 1 577 ? 10.835  5.767   -42.453 1.00 29.16  ? 577  TYR A O     1 
ATOM   4637 C  CB    . TYR A 1 577 ? 13.466  4.958   -41.874 1.00 28.00  ? 577  TYR A CB    1 
ATOM   4638 C  CG    . TYR A 1 577 ? 14.912  4.812   -41.471 1.00 27.53  ? 577  TYR A CG    1 
ATOM   4639 C  CD1   . TYR A 1 577 ? 15.861  5.749   -41.861 1.00 27.55  ? 577  TYR A CD1   1 
ATOM   4640 C  CD2   . TYR A 1 577 ? 15.320  3.761   -40.662 1.00 29.09  ? 577  TYR A CD2   1 
ATOM   4641 C  CE1   . TYR A 1 577 ? 17.183  5.630   -41.471 1.00 29.10  ? 577  TYR A CE1   1 
ATOM   4642 C  CE2   . TYR A 1 577 ? 16.631  3.631   -40.269 1.00 29.25  ? 577  TYR A CE2   1 
ATOM   4643 C  CZ    . TYR A 1 577 ? 17.560  4.565   -40.673 1.00 30.56  ? 577  TYR A CZ    1 
ATOM   4644 O  OH    . TYR A 1 577 ? 18.865  4.421   -40.275 1.00 30.76  ? 577  TYR A OH    1 
ATOM   4645 N  N     . TYR A 1 578 ? 10.449  6.349   -40.306 1.00 25.12  ? 578  TYR A N     1 
ATOM   4646 C  CA    . TYR A 1 578 ? 9.027   6.599   -40.477 1.00 26.73  ? 578  TYR A CA    1 
ATOM   4647 C  C     . TYR A 1 578 ? 8.816   7.612   -41.592 1.00 26.77  ? 578  TYR A C     1 
ATOM   4648 O  O     . TYR A 1 578 ? 9.472   8.650   -41.625 1.00 25.48  ? 578  TYR A O     1 
ATOM   4649 C  CB    . TYR A 1 578 ? 8.441   7.128   -39.167 1.00 26.92  ? 578  TYR A CB    1 
ATOM   4650 C  CG    . TYR A 1 578 ? 7.027   7.646   -39.264 1.00 27.77  ? 578  TYR A CG    1 
ATOM   4651 C  CD1   . TYR A 1 578 ? 5.951   6.772   -39.353 1.00 25.90  ? 578  TYR A CD1   1 
ATOM   4652 C  CD2   . TYR A 1 578 ? 6.763   9.014   -39.238 1.00 28.90  ? 578  TYR A CD2   1 
ATOM   4653 C  CE1   . TYR A 1 578 ? 4.650   7.239   -39.431 1.00 27.07  ? 578  TYR A CE1   1 
ATOM   4654 C  CE2   . TYR A 1 578 ? 5.460   9.493   -39.314 1.00 33.70  ? 578  TYR A CE2   1 
ATOM   4655 C  CZ    . TYR A 1 578 ? 4.409   8.597   -39.409 1.00 29.91  ? 578  TYR A CZ    1 
ATOM   4656 O  OH    . TYR A 1 578 ? 3.111   9.050   -39.484 1.00 29.94  ? 578  TYR A OH    1 
ATOM   4657 N  N     . ASP A 1 579 ? 7.920   7.291   -42.518 1.00 28.32  ? 579  ASP A N     1 
ATOM   4658 C  CA    . ASP A 1 579 ? 7.570   8.210   -43.593 1.00 27.99  ? 579  ASP A CA    1 
ATOM   4659 C  C     . ASP A 1 579 ? 6.302   7.736   -44.292 1.00 26.12  ? 579  ASP A C     1 
ATOM   4660 O  O     . ASP A 1 579 ? 6.331   6.762   -45.039 1.00 25.09  ? 579  ASP A O     1 
ATOM   4661 C  CB    . ASP A 1 579 ? 8.713   8.328   -44.606 1.00 28.67  ? 579  ASP A CB    1 
ATOM   4662 C  CG    . ASP A 1 579 ? 8.601   9.573   -45.470 1.00 30.66  ? 579  ASP A CG    1 
ATOM   4663 O  OD1   . ASP A 1 579 ? 7.465   10.023  -45.729 1.00 32.39  ? 579  ASP A OD1   1 
ATOM   4664 O  OD2   . ASP A 1 579 ? 9.650   10.105  -45.887 1.00 33.76  ? 579  ASP A OD2   1 
ATOM   4665 N  N     . LEU A 1 580 ? 5.192   8.427   -44.049 1.00 26.11  ? 580  LEU A N     1 
ATOM   4666 C  CA    . LEU A 1 580 ? 3.928   8.057   -44.670 1.00 29.76  ? 580  LEU A CA    1 
ATOM   4667 C  C     . LEU A 1 580 ? 3.953   8.207   -46.188 1.00 28.16  ? 580  LEU A C     1 
ATOM   4668 O  O     . LEU A 1 580 ? 3.114   7.639   -46.867 1.00 27.40  ? 580  LEU A O     1 
ATOM   4669 C  CB    . LEU A 1 580 ? 2.756   8.846   -44.075 1.00 30.96  ? 580  LEU A CB    1 
ATOM   4670 C  CG    . LEU A 1 580 ? 2.406   8.521   -42.623 1.00 32.91  ? 580  LEU A CG    1 
ATOM   4671 C  CD1   . LEU A 1 580 ? 1.106   9.200   -42.214 1.00 33.78  ? 580  LEU A CD1   1 
ATOM   4672 C  CD2   . LEU A 1 580 ? 2.321   7.019   -42.417 1.00 35.65  ? 580  LEU A CD2   1 
ATOM   4673 N  N     . ARG A 1 581 ? 4.909   8.965   -46.722 1.00 28.28  ? 581  ARG A N     1 
ATOM   4674 C  CA    . ARG A 1 581 ? 5.068   9.046   -48.173 1.00 30.08  ? 581  ARG A CA    1 
ATOM   4675 C  C     . ARG A 1 581 ? 5.492   7.693   -48.733 1.00 29.82  ? 581  ARG A C     1 
ATOM   4676 O  O     . ARG A 1 581 ? 4.997   7.256   -49.772 1.00 28.40  ? 581  ARG A O     1 
ATOM   4677 C  CB    . ARG A 1 581 ? 6.093   10.112  -48.571 1.00 30.58  ? 581  ARG A CB    1 
ATOM   4678 C  CG    . ARG A 1 581 ? 5.667   11.552  -48.295 1.00 33.34  ? 581  ARG A CG    1 
ATOM   4679 C  CD    . ARG A 1 581 ? 6.808   12.523  -48.620 1.00 30.09  ? 581  ARG A CD    1 
ATOM   4680 N  NE    . ARG A 1 581 ? 8.019   12.204  -47.864 1.00 30.50  ? 581  ARG A NE    1 
ATOM   4681 C  CZ    . ARG A 1 581 ? 9.174   12.850  -47.995 1.00 35.87  ? 581  ARG A CZ    1 
ATOM   4682 N  NH1   . ARG A 1 581 ? 9.275   13.849  -48.858 1.00 37.59  ? 581  ARG A NH1   1 
ATOM   4683 N  NH2   . ARG A 1 581 ? 10.229  12.499  -47.270 1.00 33.32  ? 581  ARG A NH2   1 
ATOM   4684 N  N     . ASN A 1 582 ? 6.420   7.040   -48.037 1.00 25.82  ? 582  ASN A N     1 
ATOM   4685 C  CA    . ASN A 1 582 ? 6.910   5.733   -48.451 1.00 28.16  ? 582  ASN A CA    1 
ATOM   4686 C  C     . ASN A 1 582 ? 5.906   4.626   -48.133 1.00 28.81  ? 582  ASN A C     1 
ATOM   4687 O  O     . ASN A 1 582 ? 5.718   3.701   -48.924 1.00 27.14  ? 582  ASN A O     1 
ATOM   4688 C  CB    . ASN A 1 582 ? 8.271   5.436   -47.808 1.00 26.72  ? 582  ASN A CB    1 
ATOM   4689 C  CG    . ASN A 1 582 ? 9.393   6.256   -48.420 1.00 30.60  ? 582  ASN A CG    1 
ATOM   4690 O  OD1   . ASN A 1 582 ? 9.262   6.765   -49.533 1.00 27.81  ? 582  ASN A OD1   1 
ATOM   4691 N  ND2   . ASN A 1 582 ? 10.504  6.384   -47.698 1.00 29.58  ? 582  ASN A ND2   1 
ATOM   4692 N  N     . ALA A 1 583 ? 5.248   4.735   -46.983 1.00 24.55  ? 583  ALA A N     1 
ATOM   4693 C  CA    . ALA A 1 583 ? 4.260   3.735   -46.599 1.00 27.06  ? 583  ALA A CA    1 
ATOM   4694 C  C     . ALA A 1 583 ? 3.094   3.728   -47.588 1.00 28.66  ? 583  ALA A C     1 
ATOM   4695 O  O     . ALA A 1 583 ? 2.669   2.667   -48.046 1.00 27.12  ? 583  ALA A O     1 
ATOM   4696 C  CB    . ALA A 1 583 ? 3.767   3.971   -45.169 1.00 23.88  ? 583  ALA A CB    1 
ATOM   4697 N  N     A THR A 1 584 ? 2.603   4.915   -47.924 0.50 26.45  ? 584  THR A N     1 
ATOM   4698 N  N     B THR A 1 584 ? 2.586   4.912   -47.927 0.50 26.43  ? 584  THR A N     1 
ATOM   4699 C  CA    A THR A 1 584 ? 1.479   5.054   -48.838 0.50 27.89  ? 584  THR A CA    1 
ATOM   4700 C  CA    B THR A 1 584 ? 1.463   5.019   -48.856 0.50 27.78  ? 584  THR A CA    1 
ATOM   4701 C  C     A THR A 1 584 ? 1.867   4.697   -50.273 0.50 27.87  ? 584  THR A C     1 
ATOM   4702 C  C     B THR A 1 584 ? 1.860   4.705   -50.294 0.50 27.88  ? 584  THR A C     1 
ATOM   4703 O  O     A THR A 1 584 ? 1.066   4.123   -51.012 0.50 28.13  ? 584  THR A O     1 
ATOM   4704 O  O     B THR A 1 584 ? 1.053   4.182   -51.062 0.50 28.25  ? 584  THR A O     1 
ATOM   4705 C  CB    A THR A 1 584 ? 0.894   6.478   -48.777 0.50 29.12  ? 584  THR A CB    1 
ATOM   4706 C  CB    B THR A 1 584 ? 0.789   6.408   -48.808 0.50 28.99  ? 584  THR A CB    1 
ATOM   4707 O  OG1   A THR A 1 584 ? 0.497   6.763   -47.429 0.50 27.41  ? 584  THR A OG1   1 
ATOM   4708 O  OG1   B THR A 1 584 ? 1.758   7.429   -49.083 0.50 31.90  ? 584  THR A OG1   1 
ATOM   4709 C  CG2   A THR A 1 584 ? -0.305  6.615   -49.696 0.50 26.07  ? 584  THR A CG2   1 
ATOM   4710 C  CG2   B THR A 1 584 ? 0.163   6.647   -47.442 0.50 28.09  ? 584  THR A CG2   1 
ATOM   4711 N  N     . ALA A 1 585 ? 3.098   5.029   -50.656 1.00 25.80  ? 585  ALA A N     1 
ATOM   4712 C  CA    . ALA A 1 585 ? 3.619   4.668   -51.974 1.00 27.71  ? 585  ALA A CA    1 
ATOM   4713 C  C     . ALA A 1 585 ? 3.500   3.165   -52.196 1.00 27.69  ? 585  ALA A C     1 
ATOM   4714 O  O     . ALA A 1 585 ? 3.134   2.717   -53.279 1.00 30.92  ? 585  ALA A O     1 
ATOM   4715 C  CB    . ALA A 1 585 ? 5.066   5.115   -52.129 1.00 24.05  ? 585  ALA A CB    1 
ATOM   4716 N  N     . ILE A 1 586 ? 3.789   2.399   -51.148 1.00 26.35  ? 586  ILE A N     1 
ATOM   4717 C  CA    . ILE A 1 586 ? 3.697   0.944   -51.191 1.00 26.05  ? 586  ILE A CA    1 
ATOM   4718 C  C     . ILE A 1 586 ? 2.255   0.450   -51.328 1.00 26.66  ? 586  ILE A C     1 
ATOM   4719 O  O     . ILE A 1 586 ? 1.937   -0.299  -52.251 1.00 25.23  ? 586  ILE A O     1 
ATOM   4720 C  CB    . ILE A 1 586 ? 4.341   0.322   -49.934 1.00 25.80  ? 586  ILE A CB    1 
ATOM   4721 C  CG1   . ILE A 1 586 ? 5.843   0.631   -49.908 1.00 26.23  ? 586  ILE A CG1   1 
ATOM   4722 C  CG2   . ILE A 1 586 ? 4.081   -1.177  -49.878 1.00 22.89  ? 586  ILE A CG2   1 
ATOM   4723 C  CD1   . ILE A 1 586 ? 6.505   0.391   -48.562 1.00 21.69  ? 586  ILE A CD1   1 
ATOM   4724 N  N     . THR A 1 587 ? 1.383   0.870   -50.414 1.00 27.05  ? 587  THR A N     1 
ATOM   4725 C  CA    . THR A 1 587 ? -0.002  0.394   -50.420 1.00 28.04  ? 587  THR A CA    1 
ATOM   4726 C  C     . THR A 1 587 ? -0.783  0.848   -51.653 1.00 29.23  ? 587  THR A C     1 
ATOM   4727 O  O     . THR A 1 587 ? -1.583  0.085   -52.191 1.00 28.52  ? 587  THR A O     1 
ATOM   4728 C  CB    . THR A 1 587 ? -0.780  0.799   -49.143 1.00 27.84  ? 587  THR A CB    1 
ATOM   4729 O  OG1   . THR A 1 587 ? -0.947  2.220   -49.103 1.00 27.48  ? 587  THR A OG1   1 
ATOM   4730 C  CG2   . THR A 1 587 ? -0.055  0.328   -47.884 1.00 24.42  ? 587  THR A CG2   1 
ATOM   4731 N  N     . THR A 1 588 ? -0.547  2.080   -52.099 1.00 28.16  ? 588  THR A N     1 
ATOM   4732 C  CA    . THR A 1 588 ? -1.239  2.605   -53.277 1.00 33.39  ? 588  THR A CA    1 
ATOM   4733 C  C     . THR A 1 588 ? -0.816  1.865   -54.548 1.00 31.96  ? 588  THR A C     1 
ATOM   4734 O  O     . THR A 1 588 ? -1.656  1.501   -55.370 1.00 29.84  ? 588  THR A O     1 
ATOM   4735 C  CB    . THR A 1 588 ? -1.007  4.120   -53.460 1.00 35.19  ? 588  THR A CB    1 
ATOM   4736 O  OG1   . THR A 1 588 ? -1.216  4.796   -52.212 1.00 33.02  ? 588  THR A OG1   1 
ATOM   4737 C  CG2   . THR A 1 588 ? -1.959  4.688   -54.505 1.00 35.27  ? 588  THR A CG2   1 
ATOM   4738 N  N     . PHE A 1 589 ? 0.489   1.656   -54.705 1.00 27.92  ? 589  PHE A N     1 
ATOM   4739 C  CA    . PHE A 1 589 ? 1.019   0.833   -55.787 1.00 28.91  ? 589  PHE A CA    1 
ATOM   4740 C  C     . PHE A 1 589 ? 0.387   -0.557  -55.722 1.00 30.32  ? 589  PHE A C     1 
ATOM   4741 O  O     . PHE A 1 589 ? 0.054   -1.148  -56.747 1.00 29.30  ? 589  PHE A O     1 
ATOM   4742 C  CB    . PHE A 1 589 ? 2.543   0.725   -55.662 1.00 30.90  ? 589  PHE A CB    1 
ATOM   4743 C  CG    . PHE A 1 589 ? 3.216   0.064   -56.837 1.00 32.14  ? 589  PHE A CG    1 
ATOM   4744 C  CD1   . PHE A 1 589 ? 3.770   0.829   -57.856 1.00 30.53  ? 589  PHE A CD1   1 
ATOM   4745 C  CD2   . PHE A 1 589 ? 3.315   -1.318  -56.913 1.00 31.28  ? 589  PHE A CD2   1 
ATOM   4746 C  CE1   . PHE A 1 589 ? 4.400   0.227   -58.935 1.00 28.90  ? 589  PHE A CE1   1 
ATOM   4747 C  CE2   . PHE A 1 589 ? 3.943   -1.925  -57.987 1.00 33.24  ? 589  PHE A CE2   1 
ATOM   4748 C  CZ    . PHE A 1 589 ? 4.487   -1.149  -59.002 1.00 31.57  ? 589  PHE A CZ    1 
ATOM   4749 N  N     . GLY A 1 590 ? 0.222   -1.067  -54.504 1.00 29.97  ? 590  GLY A N     1 
ATOM   4750 C  CA    . GLY A 1 590 ? -0.391  -2.364  -54.287 1.00 28.89  ? 590  GLY A CA    1 
ATOM   4751 C  C     . GLY A 1 590 ? -1.823  -2.404  -54.787 1.00 31.35  ? 590  GLY A C     1 
ATOM   4752 O  O     . GLY A 1 590 ? -2.224  -3.349  -55.468 1.00 34.42  ? 590  GLY A O     1 
ATOM   4753 N  N     . GLN A 1 591 ? -2.595  -1.375  -54.448 1.00 27.10  ? 591  GLN A N     1 
ATOM   4754 C  CA    . GLN A 1 591 ? -3.968  -1.264  -54.931 1.00 32.70  ? 591  GLN A CA    1 
ATOM   4755 C  C     . GLN A 1 591 ? -4.014  -1.197  -56.455 1.00 35.83  ? 591  GLN A C     1 
ATOM   4756 O  O     . GLN A 1 591 ? -4.881  -1.805  -57.088 1.00 35.22  ? 591  GLN A O     1 
ATOM   4757 C  CB    . GLN A 1 591 ? -4.666  -0.039  -54.335 1.00 34.69  ? 591  GLN A CB    1 
ATOM   4758 C  CG    . GLN A 1 591 ? -4.939  -0.139  -52.843 1.00 37.49  ? 591  GLN A CG    1 
ATOM   4759 C  CD    . GLN A 1 591 ? -6.138  0.694   -52.425 1.00 39.96  ? 591  GLN A CD    1 
ATOM   4760 O  OE1   . GLN A 1 591 ? -6.825  1.266   -53.267 1.00 41.24  ? 591  GLN A OE1   1 
ATOM   4761 N  NE2   . GLN A 1 591 ? -6.394  0.764   -51.124 1.00 38.27  ? 591  GLN A NE2   1 
ATOM   4762 N  N     . MET A 1 592 ? -3.078  -0.460  -57.045 1.00 31.17  ? 592  MET A N     1 
ATOM   4763 C  CA    . MET A 1 592 ? -3.008  -0.388  -58.499 1.00 32.21  ? 592  MET A CA    1 
ATOM   4764 C  C     . MET A 1 592 ? -2.678  -1.742  -59.116 1.00 32.16  ? 592  MET A C     1 
ATOM   4765 O  O     . MET A 1 592 ? -3.360  -2.186  -60.036 1.00 33.36  ? 592  MET A O     1 
ATOM   4766 C  CB    . MET A 1 592 ? -1.978  0.639   -58.962 1.00 29.17  ? 592  MET A CB    1 
ATOM   4767 C  CG    . MET A 1 592 ? -1.817  0.654   -60.474 1.00 31.67  ? 592  MET A CG    1 
ATOM   4768 S  SD    . MET A 1 592 ? -0.509  1.744   -61.044 1.00 42.53  ? 592  MET A SD    1 
ATOM   4769 C  CE    . MET A 1 592 ? 0.918   1.004   -60.254 1.00 33.59  ? 592  MET A CE    1 
ATOM   4770 N  N     . ALA A 1 593 ? -1.630  -2.386  -58.609 1.00 28.89  ? 593  ALA A N     1 
ATOM   4771 C  CA    . ALA A 1 593 ? -1.150  -3.646  -59.176 1.00 35.10  ? 593  ALA A CA    1 
ATOM   4772 C  C     . ALA A 1 593 ? -2.231  -4.724  -59.196 1.00 35.21  ? 593  ALA A C     1 
ATOM   4773 O  O     . ALA A 1 593 ? -2.407  -5.413  -60.199 1.00 33.93  ? 593  ALA A O     1 
ATOM   4774 C  CB    . ALA A 1 593 ? 0.088   -4.141  -58.423 1.00 31.36  ? 593  ALA A CB    1 
ATOM   4775 N  N     . LEU A 1 594 ? -2.955  -4.859  -58.087 1.00 35.01  ? 594  LEU A N     1 
ATOM   4776 C  CA    . LEU A 1 594 ? -4.025  -5.847  -57.988 1.00 35.34  ? 594  LEU A CA    1 
ATOM   4777 C  C     . LEU A 1 594 ? -5.126  -5.590  -59.008 1.00 36.90  ? 594  LEU A C     1 
ATOM   4778 O  O     . LEU A 1 594 ? -5.509  -6.483  -59.765 1.00 39.47  ? 594  LEU A O     1 
ATOM   4779 C  CB    . LEU A 1 594 ? -4.624  -5.859  -56.579 1.00 29.83  ? 594  LEU A CB    1 
ATOM   4780 C  CG    . LEU A 1 594 ? -5.935  -6.635  -56.444 1.00 32.27  ? 594  LEU A CG    1 
ATOM   4781 C  CD1   . LEU A 1 594 ? -5.725  -8.101  -56.804 1.00 34.40  ? 594  LEU A CD1   1 
ATOM   4782 C  CD2   . LEU A 1 594 ? -6.503  -6.502  -55.041 1.00 33.40  ? 594  LEU A CD2   1 
ATOM   4783 N  N     . GLN A 1 595 ? -5.638  -4.367  -59.026 1.00 36.38  ? 595  GLN A N     1 
ATOM   4784 C  CA    . GLN A 1 595 ? -6.739  -4.034  -59.924 1.00 38.82  ? 595  GLN A CA    1 
ATOM   4785 C  C     . GLN A 1 595 ? -6.304  -3.994  -61.392 1.00 38.73  ? 595  GLN A C     1 
ATOM   4786 O  O     . GLN A 1 595 ? -7.097  -4.288  -62.285 1.00 42.10  ? 595  GLN A O     1 
ATOM   4787 C  CB    . GLN A 1 595 ? -7.422  -2.737  -59.481 1.00 35.67  ? 595  GLN A CB    1 
ATOM   4788 C  CG    . GLN A 1 595 ? -8.136  -2.894  -58.138 1.00 36.20  ? 595  GLN A CG    1 
ATOM   4789 C  CD    . GLN A 1 595 ? -8.766  -1.610  -57.632 1.00 40.24  ? 595  GLN A CD    1 
ATOM   4790 O  OE1   . GLN A 1 595 ? -9.938  -1.337  -57.889 1.00 46.24  ? 595  GLN A OE1   1 
ATOM   4791 N  NE2   . GLN A 1 595 ? -7.994  -0.823  -56.891 1.00 40.53  ? 595  GLN A NE2   1 
ATOM   4792 N  N     . TRP A 1 596 ? -5.041  -3.649  -61.629 1.00 36.69  ? 596  TRP A N     1 
ATOM   4793 C  CA    . TRP A 1 596 ? -4.448  -3.713  -62.966 1.00 38.70  ? 596  TRP A CA    1 
ATOM   4794 C  C     . TRP A 1 596 ? -4.462  -5.145  -63.500 1.00 37.03  ? 596  TRP A C     1 
ATOM   4795 O  O     . TRP A 1 596 ? -4.862  -5.388  -64.635 1.00 37.84  ? 596  TRP A O     1 
ATOM   4796 C  CB    . TRP A 1 596 ? -3.010  -3.173  -62.931 1.00 39.29  ? 596  TRP A CB    1 
ATOM   4797 C  CG    . TRP A 1 596 ? -2.228  -3.307  -64.213 1.00 42.61  ? 596  TRP A CG    1 
ATOM   4798 C  CD1   . TRP A 1 596 ? -1.615  -4.432  -64.685 1.00 42.72  ? 596  TRP A CD1   1 
ATOM   4799 C  CD2   . TRP A 1 596 ? -1.940  -2.268  -65.160 1.00 41.53  ? 596  TRP A CD2   1 
ATOM   4800 N  NE1   . TRP A 1 596 ? -0.982  -4.165  -65.873 1.00 43.73  ? 596  TRP A NE1   1 
ATOM   4801 C  CE2   . TRP A 1 596 ? -1.164  -2.845  -66.188 1.00 44.31  ? 596  TRP A CE2   1 
ATOM   4802 C  CE3   . TRP A 1 596 ? -2.267  -0.910  -65.244 1.00 41.01  ? 596  TRP A CE3   1 
ATOM   4803 C  CZ2   . TRP A 1 596 ? -0.714  -2.112  -67.287 1.00 46.90  ? 596  TRP A CZ2   1 
ATOM   4804 C  CZ3   . TRP A 1 596 ? -1.819  -0.184  -66.336 1.00 45.87  ? 596  TRP A CZ3   1 
ATOM   4805 C  CH2   . TRP A 1 596 ? -1.049  -0.786  -67.342 1.00 46.83  ? 596  TRP A CH2   1 
ATOM   4806 N  N     . ILE A 1 597 ? -4.028  -6.095  -62.675 1.00 39.34  ? 597  ILE A N     1 
ATOM   4807 C  CA    . ILE A 1 597 ? -3.907  -7.476  -63.122 1.00 40.44  ? 597  ILE A CA    1 
ATOM   4808 C  C     . ILE A 1 597 ? -5.258  -8.189  -63.185 1.00 45.24  ? 597  ILE A C     1 
ATOM   4809 O  O     . ILE A 1 597 ? -5.407  -9.181  -63.898 1.00 46.71  ? 597  ILE A O     1 
ATOM   4810 C  CB    . ILE A 1 597 ? -2.917  -8.284  -62.260 1.00 35.61  ? 597  ILE A CB    1 
ATOM   4811 C  CG1   . ILE A 1 597 ? -2.281  -9.399  -63.094 1.00 35.35  ? 597  ILE A CG1   1 
ATOM   4812 C  CG2   . ILE A 1 597 ? -3.598  -8.845  -61.010 1.00 34.30  ? 597  ILE A CG2   1 
ATOM   4813 C  CD1   . ILE A 1 597 ? -1.522  -8.895  -64.303 1.00 36.59  ? 597  ILE A CD1   1 
ATOM   4814 N  N     . GLU A 1 598 ? -6.237  -7.684  -62.440 1.00 46.71  ? 598  GLU A N     1 
ATOM   4815 C  CA    . GLU A 1 598 ? -7.598  -8.194  -62.535 1.00 47.90  ? 598  GLU A CA    1 
ATOM   4816 C  C     . GLU A 1 598 ? -8.123  -7.911  -63.934 1.00 47.50  ? 598  GLU A C     1 
ATOM   4817 O  O     . GLU A 1 598 ? -8.753  -8.763  -64.561 1.00 48.74  ? 598  GLU A O     1 
ATOM   4818 C  CB    . GLU A 1 598 ? -8.505  -7.527  -61.500 1.00 44.02  ? 598  GLU A CB    1 
ATOM   4819 C  CG    . GLU A 1 598 ? -9.978  -7.877  -61.658 1.00 44.54  ? 598  GLU A CG    1 
ATOM   4820 C  CD    . GLU A 1 598 ? -10.880 -7.039  -60.771 1.00 46.39  ? 598  GLU A CD    1 
ATOM   4821 O  OE1   . GLU A 1 598 ? -10.403 -6.025  -60.218 1.00 47.63  ? 598  GLU A OE1   1 
ATOM   4822 O  OE2   . GLU A 1 598 ? -12.068 -7.392  -60.629 1.00 47.13  ? 598  GLU A OE2   1 
ATOM   4823 N  N     . ARG A 1 599 ? -7.854  -6.702  -64.415 1.00 46.97  ? 599  ARG A N     1 
ATOM   4824 C  CA    . ARG A 1 599 ? -8.246  -6.311  -65.761 1.00 46.61  ? 599  ARG A CA    1 
ATOM   4825 C  C     . ARG A 1 599 ? -7.537  -7.168  -66.806 1.00 47.64  ? 599  ARG A C     1 
ATOM   4826 O  O     . ARG A 1 599 ? -8.177  -7.725  -67.697 1.00 53.08  ? 599  ARG A O     1 
ATOM   4827 C  CB    . ARG A 1 599 ? -7.947  -4.829  -66.002 1.00 46.45  ? 599  ARG A CB    1 
ATOM   4828 C  CG    . ARG A 1 599 ? -8.228  -4.372  -67.425 1.00 46.45  ? 599  ARG A CG    1 
ATOM   4829 C  CD    . ARG A 1 599 ? -8.057  -2.868  -67.587 1.00 47.88  ? 599  ARG A CD    1 
ATOM   4830 N  NE    . ARG A 1 599 ? -6.697  -2.438  -67.285 1.00 47.74  ? 599  ARG A NE    1 
ATOM   4831 C  CZ    . ARG A 1 599 ? -5.683  -2.526  -68.139 1.00 49.72  ? 599  ARG A CZ    1 
ATOM   4832 N  NH1   . ARG A 1 599 ? -5.878  -3.032  -69.348 1.00 48.70  ? 599  ARG A NH1   1 
ATOM   4833 N  NH2   . ARG A 1 599 ? -4.475  -2.110  -67.784 1.00 52.08  ? 599  ARG A NH2   1 
ATOM   4834 N  N     . LYS A 1 600 ? -6.217  -7.275  -66.687 1.00 45.42  ? 600  LYS A N     1 
ATOM   4835 C  CA    . LYS A 1 600 ? -5.420  -8.064  -67.624 1.00 47.31  ? 600  LYS A CA    1 
ATOM   4836 C  C     . LYS A 1 600 ? -5.874  -9.525  -67.669 1.00 45.74  ? 600  LYS A C     1 
ATOM   4837 O  O     . LYS A 1 600 ? -5.956  -10.124 -68.739 1.00 47.92  ? 600  LYS A O     1 
ATOM   4838 C  CB    . LYS A 1 600 ? -3.933  -7.986  -67.267 1.00 47.08  ? 600  LYS A CB    1 
ATOM   4839 C  CG    . LYS A 1 600 ? -3.282  -6.638  -67.558 1.00 44.97  ? 600  LYS A CG    1 
ATOM   4840 C  CD    . LYS A 1 600 ? -3.165  -6.386  -69.056 1.00 43.37  ? 600  LYS A CD    1 
ATOM   4841 C  CE    . LYS A 1 600 ? -2.449  -5.074  -69.345 1.00 42.50  ? 600  LYS A CE    1 
ATOM   4842 N  NZ    . LYS A 1 600 ? -2.197  -4.889  -70.809 1.00 51.93  ? 600  LYS A NZ    1 
ATOM   4843 N  N     . VAL A 1 601 ? -6.175  -10.091 -66.506 1.00 44.62  ? 601  VAL A N     1 
ATOM   4844 C  CA    . VAL A 1 601 ? -6.617  -11.481 -66.433 1.00 45.63  ? 601  VAL A CA    1 
ATOM   4845 C  C     . VAL A 1 601 ? -7.993  -11.668 -67.070 1.00 46.77  ? 601  VAL A C     1 
ATOM   4846 O  O     . VAL A 1 601 ? -8.211  -12.619 -67.822 1.00 45.98  ? 601  VAL A O     1 
ATOM   4847 C  CB    . VAL A 1 601 ? -6.614  -12.010 -64.985 1.00 41.51  ? 601  VAL A CB    1 
ATOM   4848 C  CG1   . VAL A 1 601 ? -7.466  -13.270 -64.872 1.00 42.42  ? 601  VAL A CG1   1 
ATOM   4849 C  CG2   . VAL A 1 601 ? -5.183  -12.285 -64.531 1.00 39.74  ? 601  VAL A CG2   1 
ATOM   4850 N  N     . ASN A 1 602 ? -8.915  -10.756 -66.774 1.00 46.88  ? 602  ASN A N     1 
ATOM   4851 C  CA    . ASN A 1 602 ? -10.226 -10.775 -67.417 1.00 48.16  ? 602  ASN A CA    1 
ATOM   4852 C  C     . ASN A 1 602 ? -10.117 -10.673 -68.939 1.00 52.36  ? 602  ASN A C     1 
ATOM   4853 O  O     . ASN A 1 602 ? -10.776 -11.419 -69.669 1.00 55.81  ? 602  ASN A O     1 
ATOM   4854 C  CB    . ASN A 1 602 ? -11.131 -9.667  -66.867 1.00 46.90  ? 602  ASN A CB    1 
ATOM   4855 C  CG    . ASN A 1 602 ? -11.788 -10.049 -65.548 1.00 49.01  ? 602  ASN A CG    1 
ATOM   4856 O  OD1   . ASN A 1 602 ? -11.920 -11.232 -65.229 1.00 48.64  ? 602  ASN A OD1   1 
ATOM   4857 N  ND2   . ASN A 1 602 ? -12.213 -9.049  -64.782 1.00 45.64  ? 602  ASN A ND2   1 
ATOM   4858 N  N     . GLU A 1 603 ? -9.275  -9.759  -69.412 1.00 53.43  ? 603  GLU A N     1 
ATOM   4859 C  CA    . GLU A 1 603 ? -9.081  -9.559  -70.848 1.00 54.84  ? 603  GLU A CA    1 
ATOM   4860 C  C     . GLU A 1 603 ? -8.515  -10.806 -71.522 1.00 54.95  ? 603  GLU A C     1 
ATOM   4861 O  O     . GLU A 1 603 ? -9.039  -11.260 -72.539 1.00 57.75  ? 603  GLU A O     1 
ATOM   4862 C  CB    . GLU A 1 603 ? -8.158  -8.365  -71.109 1.00 60.26  ? 603  GLU A CB    1 
ATOM   4863 C  CG    . GLU A 1 603 ? -8.766  -7.005  -70.791 1.00 63.81  ? 603  GLU A CG    1 
ATOM   4864 C  CD    . GLU A 1 603 ? -7.752  -5.877  -70.891 1.00 66.79  ? 603  GLU A CD    1 
ATOM   4865 O  OE1   . GLU A 1 603 ? -8.137  -4.701  -70.704 1.00 66.73  ? 603  GLU A OE1   1 
ATOM   4866 O  OE2   . GLU A 1 603 ? -6.567  -6.171  -71.156 1.00 68.10  ? 603  GLU A OE2   1 
ATOM   4867 N  N     . TYR A 1 604 ? -7.448  -11.356 -70.950 1.00 52.90  ? 604  TYR A N     1 
ATOM   4868 C  CA    . TYR A 1 604 ? -6.790  -12.524 -71.528 1.00 53.76  ? 604  TYR A CA    1 
ATOM   4869 C  C     . TYR A 1 604 ? -7.710  -13.736 -71.597 1.00 55.69  ? 604  TYR A C     1 
ATOM   4870 O  O     . TYR A 1 604 ? -7.689  -14.486 -72.573 1.00 57.21  ? 604  TYR A O     1 
ATOM   4871 C  CB    . TYR A 1 604 ? -5.524  -12.892 -70.748 1.00 52.06  ? 604  TYR A CB    1 
ATOM   4872 C  CG    . TYR A 1 604 ? -4.898  -14.186 -71.223 1.00 54.48  ? 604  TYR A CG    1 
ATOM   4873 C  CD1   . TYR A 1 604 ? -4.164  -14.230 -72.402 1.00 55.42  ? 604  TYR A CD1   1 
ATOM   4874 C  CD2   . TYR A 1 604 ? -5.054  -15.368 -70.503 1.00 54.53  ? 604  TYR A CD2   1 
ATOM   4875 C  CE1   . TYR A 1 604 ? -3.596  -15.408 -72.850 1.00 57.98  ? 604  TYR A CE1   1 
ATOM   4876 C  CE2   . TYR A 1 604 ? -4.489  -16.554 -70.944 1.00 56.81  ? 604  TYR A CE2   1 
ATOM   4877 C  CZ    . TYR A 1 604 ? -3.760  -16.566 -72.119 1.00 59.43  ? 604  TYR A CZ    1 
ATOM   4878 O  OH    . TYR A 1 604 ? -3.192  -17.737 -72.573 1.00 59.56  ? 604  TYR A OH    1 
ATOM   4879 N  N     . LEU A 1 605 ? -8.511  -13.928 -70.555 1.00 55.40  ? 605  LEU A N     1 
ATOM   4880 C  CA    . LEU A 1 605 ? -9.382  -15.096 -70.482 1.00 55.45  ? 605  LEU A CA    1 
ATOM   4881 C  C     . LEU A 1 605 ? -10.564 -14.997 -71.442 1.00 56.66  ? 605  LEU A C     1 
ATOM   4882 O  O     . LEU A 1 605 ? -10.981 -15.999 -72.017 1.00 56.80  ? 605  LEU A O     1 
ATOM   4883 C  CB    . LEU A 1 605 ? -9.841  -15.352 -69.044 1.00 48.47  ? 605  LEU A CB    1 
ATOM   4884 C  CG    . LEU A 1 605 ? -8.718  -15.910 -68.165 1.00 51.19  ? 605  LEU A CG    1 
ATOM   4885 C  CD1   . LEU A 1 605 ? -9.155  -16.044 -66.715 1.00 49.77  ? 605  LEU A CD1   1 
ATOM   4886 C  CD2   . LEU A 1 605 ? -8.227  -17.251 -68.709 1.00 51.18  ? 605  LEU A CD2   1 
ATOM   4887 N  N     . ASN A 1 606 ? -11.094 -13.791 -71.621 1.00 57.04  ? 606  ASN A N     1 
ATOM   4888 C  CA    . ASN A 1 606 ? -12.112 -13.563 -72.642 1.00 60.20  ? 606  ASN A CA    1 
ATOM   4889 C  C     . ASN A 1 606 ? -11.572 -13.851 -74.041 1.00 63.53  ? 606  ASN A C     1 
ATOM   4890 O  O     . ASN A 1 606 ? -12.271 -14.408 -74.889 1.00 64.59  ? 606  ASN A O     1 
ATOM   4891 C  CB    . ASN A 1 606 ? -12.659 -12.134 -72.571 1.00 57.01  ? 606  ASN A CB    1 
ATOM   4892 C  CG    . ASN A 1 606 ? -13.733 -11.971 -71.508 1.00 54.04  ? 606  ASN A CG    1 
ATOM   4893 O  OD1   . ASN A 1 606 ? -14.889 -12.333 -71.721 1.00 55.73  ? 606  ASN A OD1   1 
ATOM   4894 N  ND2   . ASN A 1 606 ? -13.357 -11.416 -70.363 1.00 50.48  ? 606  ASN A ND2   1 
ATOM   4895 N  N     . GLU A 1 607 ? -10.318 -13.476 -74.271 1.00 63.84  ? 607  GLU A N     1 
ATOM   4896 C  CA    . GLU A 1 607 ? -9.690  -13.670 -75.573 1.00 64.81  ? 607  GLU A CA    1 
ATOM   4897 C  C     . GLU A 1 607 ? -9.475  -15.153 -75.888 1.00 67.43  ? 607  GLU A C     1 
ATOM   4898 O  O     . GLU A 1 607 ? -9.736  -15.598 -77.005 1.00 62.27  ? 607  GLU A O     1 
ATOM   4899 C  CB    . GLU A 1 607 ? -8.365  -12.906 -75.646 1.00 62.44  ? 607  GLU A CB    1 
ATOM   4900 C  CG    . GLU A 1 607 ? -7.710  -12.922 -77.016 1.00 65.84  ? 607  GLU A CG    1 
ATOM   4901 N  N     . VAL A 1 608 ? -9.004  -15.917 -74.906 1.00 67.95  ? 608  VAL A N     1 
ATOM   4902 C  CA    . VAL A 1 608 ? -8.742  -17.339 -75.125 1.00 69.60  ? 608  VAL A CA    1 
ATOM   4903 C  C     . VAL A 1 608 ? -10.023 -18.171 -75.118 1.00 67.56  ? 608  VAL A C     1 
ATOM   4904 O  O     . VAL A 1 608 ? -10.103 -19.195 -75.794 1.00 65.74  ? 608  VAL A O     1 
ATOM   4905 C  CB    . VAL A 1 608 ? -7.728  -17.923 -74.110 1.00 69.94  ? 608  VAL A CB    1 
ATOM   4906 C  CG1   . VAL A 1 608 ? -6.364  -17.272 -74.284 1.00 71.76  ? 608  VAL A CG1   1 
ATOM   4907 C  CG2   . VAL A 1 608 ? -8.232  -17.765 -72.687 1.00 66.84  ? 608  VAL A CG2   1 
ATOM   4908 N  N     . CYS A 1 609 ? -11.020 -17.728 -74.357 1.00 67.39  ? 609  CYS A N     1 
ATOM   4909 C  CA    . CYS A 1 609 ? -12.311 -18.410 -74.316 1.00 69.36  ? 609  CYS A CA    1 
ATOM   4910 C  C     . CYS A 1 609 ? -13.217 -17.954 -75.452 1.00 74.24  ? 609  CYS A C     1 
ATOM   4911 O  O     . CYS A 1 609 ? -14.276 -18.538 -75.687 1.00 76.00  ? 609  CYS A O     1 
ATOM   4912 C  CB    . CYS A 1 609 ? -13.002 -18.193 -72.969 1.00 66.93  ? 609  CYS A CB    1 
ATOM   4913 S  SG    . CYS A 1 609 ? -12.201 -19.040 -71.589 1.00 76.02  ? 609  CYS A SG    1 
ATOM   4914 N  N     . GLY A 1 610 ? -12.796 -16.903 -76.150 1.00 75.95  ? 610  GLY A N     1 
ATOM   4915 C  CA    . GLY A 1 610 ? -13.518 -16.409 -77.308 1.00 77.24  ? 610  GLY A CA    1 
ATOM   4916 C  C     . GLY A 1 610 ? -14.734 -15.569 -76.969 1.00 77.91  ? 610  GLY A C     1 
ATOM   4917 O  O     . GLY A 1 610 ? -15.488 -15.176 -77.857 1.00 82.12  ? 610  GLY A O     1 
ATOM   4918 N  N     . THR A 1 611 ? -14.926 -15.289 -75.685 1.00 76.89  ? 611  THR A N     1 
ATOM   4919 C  CA    . THR A 1 611 ? -16.071 -14.504 -75.238 1.00 77.66  ? 611  THR A CA    1 
ATOM   4920 C  C     . THR A 1 611 ? -15.720 -13.024 -75.104 1.00 74.99  ? 611  THR A C     1 
ATOM   4921 O  O     . THR A 1 611 ? -14.623 -12.600 -75.470 1.00 74.07  ? 611  THR A O     1 
ATOM   4922 C  CB    . THR A 1 611 ? -16.616 -15.022 -73.896 1.00 77.13  ? 611  THR A CB    1 
ATOM   4923 O  OG1   . THR A 1 611 ? -15.591 -14.940 -72.897 1.00 76.49  ? 611  THR A OG1   1 
ATOM   4924 C  CG2   . THR A 1 611 ? -17.072 -16.468 -74.032 1.00 78.88  ? 611  THR A CG2   1 
ATOM   4925 N  N     . GLU A 1 612 ? -16.657 -12.241 -74.578 1.00 72.51  ? 612  GLU A N     1 
ATOM   4926 C  CA    . GLU A 1 612 ? -16.448 -10.807 -74.412 1.00 70.05  ? 612  GLU A CA    1 
ATOM   4927 C  C     . GLU A 1 612 ? -17.209 -10.247 -73.214 1.00 69.96  ? 612  GLU A C     1 
ATOM   4928 O  O     . GLU A 1 612 ? -18.427 -10.397 -73.112 1.00 69.57  ? 612  GLU A O     1 
ATOM   4929 C  CB    . GLU A 1 612 ? -16.854 -10.055 -75.681 1.00 72.76  ? 612  GLU A CB    1 
ATOM   4930 N  N     . GLY A 1 613 ? -16.473 -9.613  -72.305 1.00 68.19  ? 613  GLY A N     1 
ATOM   4931 C  CA    . GLY A 1 613 ? -17.063 -8.884  -71.198 1.00 65.31  ? 613  GLY A CA    1 
ATOM   4932 C  C     . GLY A 1 613 ? -17.436 -9.721  -69.991 1.00 66.00  ? 613  GLY A C     1 
ATOM   4933 O  O     . GLY A 1 613 ? -18.114 -9.234  -69.083 1.00 64.89  ? 613  GLY A O     1 
ATOM   4934 N  N     . GLU A 1 614 ? -16.996 -10.975 -69.972 1.00 66.62  ? 614  GLU A N     1 
ATOM   4935 C  CA    . GLU A 1 614 ? -17.287 -11.865 -68.851 1.00 64.65  ? 614  GLU A CA    1 
ATOM   4936 C  C     . GLU A 1 614 ? -16.349 -11.585 -67.681 1.00 60.87  ? 614  GLU A C     1 
ATOM   4937 O  O     . GLU A 1 614 ? -15.172 -11.278 -67.882 1.00 60.24  ? 614  GLU A O     1 
ATOM   4938 C  CB    . GLU A 1 614 ? -17.187 -13.323 -69.285 1.00 66.43  ? 614  GLU A CB    1 
ATOM   4939 N  N     . ALA A 1 615 ? -16.874 -11.679 -66.462 1.00 59.25  ? 615  ALA A N     1 
ATOM   4940 C  CA    . ALA A 1 615 ? -16.065 -11.481 -65.262 1.00 57.64  ? 615  ALA A CA    1 
ATOM   4941 C  C     . ALA A 1 615 ? -15.474 -12.809 -64.808 1.00 57.47  ? 615  ALA A C     1 
ATOM   4942 O  O     . ALA A 1 615 ? -16.196 -13.688 -64.333 1.00 61.42  ? 615  ALA A O     1 
ATOM   4943 C  CB    . ALA A 1 615 ? -16.901 -10.862 -64.147 1.00 54.58  ? 615  ALA A CB    1 
ATOM   4944 N  N     . PHE A 1 616 ? -14.165 -12.959 -64.977 1.00 54.13  ? 616  PHE A N     1 
ATOM   4945 C  CA    . PHE A 1 616 ? -13.481 -14.179 -64.565 1.00 53.94  ? 616  PHE A CA    1 
ATOM   4946 C  C     . PHE A 1 616 ? -12.943 -14.060 -63.143 1.00 50.74  ? 616  PHE A C     1 
ATOM   4947 O  O     . PHE A 1 616 ? -12.941 -15.033 -62.388 1.00 52.46  ? 616  PHE A O     1 
ATOM   4948 C  CB    . PHE A 1 616 ? -12.363 -14.539 -65.548 1.00 54.58  ? 616  PHE A CB    1 
ATOM   4949 C  CG    . PHE A 1 616 ? -12.856 -15.163 -66.822 1.00 57.13  ? 616  PHE A CG    1 
ATOM   4950 C  CD1   . PHE A 1 616 ? -13.051 -16.534 -66.907 1.00 58.61  ? 616  PHE A CD1   1 
ATOM   4951 C  CD2   . PHE A 1 616 ? -13.129 -14.383 -67.934 1.00 56.72  ? 616  PHE A CD2   1 
ATOM   4952 C  CE1   . PHE A 1 616 ? -13.507 -17.112 -68.076 1.00 61.02  ? 616  PHE A CE1   1 
ATOM   4953 C  CE2   . PHE A 1 616 ? -13.585 -14.955 -69.105 1.00 58.91  ? 616  PHE A CE2   1 
ATOM   4954 C  CZ    . PHE A 1 616 ? -13.774 -16.322 -69.176 1.00 62.17  ? 616  PHE A CZ    1 
ATOM   4955 N  N     . VAL A 1 617 ? -12.488 -12.865 -62.780 1.00 46.36  ? 617  VAL A N     1 
ATOM   4956 C  CA    . VAL A 1 617 ? -12.026 -12.616 -61.421 1.00 44.80  ? 617  VAL A CA    1 
ATOM   4957 C  C     . VAL A 1 617 ? -13.213 -12.309 -60.514 1.00 43.36  ? 617  VAL A C     1 
ATOM   4958 O  O     . VAL A 1 617 ? -13.849 -11.263 -60.638 1.00 46.07  ? 617  VAL A O     1 
ATOM   4959 C  CB    . VAL A 1 617 ? -11.018 -11.456 -61.365 1.00 45.55  ? 617  VAL A CB    1 
ATOM   4960 C  CG1   . VAL A 1 617 ? -10.553 -11.226 -59.933 1.00 34.81  ? 617  VAL A CG1   1 
ATOM   4961 C  CG2   . VAL A 1 617 ? -9.837  -11.741 -62.280 1.00 45.66  ? 617  VAL A CG2   1 
ATOM   4962 N  N     . LEU A 1 618 ? -13.511 -13.229 -59.604 1.00 39.65  ? 618  LEU A N     1 
ATOM   4963 C  CA    . LEU A 1 618 ? -14.681 -13.101 -58.747 1.00 41.91  ? 618  LEU A CA    1 
ATOM   4964 C  C     . LEU A 1 618 ? -14.337 -12.434 -57.416 1.00 42.89  ? 618  LEU A C     1 
ATOM   4965 O  O     . LEU A 1 618 ? -15.211 -11.904 -56.729 1.00 45.49  ? 618  LEU A O     1 
ATOM   4966 C  CB    . LEU A 1 618 ? -15.310 -14.478 -58.509 1.00 41.22  ? 618  LEU A CB    1 
ATOM   4967 C  CG    . LEU A 1 618 ? -14.498 -15.476 -57.677 1.00 40.82  ? 618  LEU A CG    1 
ATOM   4968 C  CD1   . LEU A 1 618 ? -15.004 -15.505 -56.245 1.00 40.09  ? 618  LEU A CD1   1 
ATOM   4969 C  CD2   . LEU A 1 618 ? -14.549 -16.865 -58.292 1.00 43.03  ? 618  LEU A CD2   1 
ATOM   4970 N  N     . TYR A 1 619 ? -13.059 -12.464 -57.055 1.00 37.84  ? 619  TYR A N     1 
ATOM   4971 C  CA    . TYR A 1 619 ? -12.632 -11.956 -55.759 1.00 33.65  ? 619  TYR A CA    1 
ATOM   4972 C  C     . TYR A 1 619 ? -11.147 -11.637 -55.754 1.00 35.32  ? 619  TYR A C     1 
ATOM   4973 O  O     . TYR A 1 619 ? -10.383 -12.178 -56.552 1.00 34.89  ? 619  TYR A O     1 
ATOM   4974 C  CB    . TYR A 1 619 ? -12.957 -12.967 -54.657 1.00 32.35  ? 619  TYR A CB    1 
ATOM   4975 C  CG    . TYR A 1 619 ? -12.608 -12.496 -53.262 1.00 33.58  ? 619  TYR A CG    1 
ATOM   4976 C  CD1   . TYR A 1 619 ? -13.234 -11.389 -52.707 1.00 31.40  ? 619  TYR A CD1   1 
ATOM   4977 C  CD2   . TYR A 1 619 ? -11.653 -13.158 -52.503 1.00 31.27  ? 619  TYR A CD2   1 
ATOM   4978 C  CE1   . TYR A 1 619 ? -12.921 -10.954 -51.435 1.00 30.97  ? 619  TYR A CE1   1 
ATOM   4979 C  CE2   . TYR A 1 619 ? -11.332 -12.729 -51.223 1.00 29.92  ? 619  TYR A CE2   1 
ATOM   4980 C  CZ    . TYR A 1 619 ? -11.970 -11.626 -50.696 1.00 28.37  ? 619  TYR A CZ    1 
ATOM   4981 O  OH    . TYR A 1 619 ? -11.662 -11.189 -49.427 1.00 26.13  ? 619  TYR A OH    1 
ATOM   4982 N  N     . GLY A 1 620 ? -10.754 -10.745 -54.852 1.00 36.33  ? 620  GLY A N     1 
ATOM   4983 C  CA    . GLY A 1 620 ? -9.365  -10.372 -54.682 1.00 36.67  ? 620  GLY A CA    1 
ATOM   4984 C  C     . GLY A 1 620 ? -9.138  -9.623  -53.384 1.00 34.66  ? 620  GLY A C     1 
ATOM   4985 O  O     . GLY A 1 620 ? -9.960  -8.798  -52.986 1.00 34.90  ? 620  GLY A O     1 
ATOM   4986 N  N     . ASP A 1 621 ? -8.024  -9.918  -52.720 1.00 33.62  ? 621  ASP A N     1 
ATOM   4987 C  CA    . ASP A 1 621 ? -7.668  -9.259  -51.469 1.00 32.19  ? 621  ASP A CA    1 
ATOM   4988 C  C     . ASP A 1 621 ? -6.175  -8.953  -51.461 1.00 30.79  ? 621  ASP A C     1 
ATOM   4989 O  O     . ASP A 1 621 ? -5.346  -9.869  -51.404 1.00 29.81  ? 621  ASP A O     1 
ATOM   4990 C  CB    . ASP A 1 621 ? -8.036  -10.143 -50.269 1.00 30.36  ? 621  ASP A CB    1 
ATOM   4991 C  CG    . ASP A 1 621 ? -7.883  -9.424  -48.929 1.00 34.49  ? 621  ASP A CG    1 
ATOM   4992 O  OD1   . ASP A 1 621 ? -7.153  -8.409  -48.856 1.00 32.70  ? 621  ASP A OD1   1 
ATOM   4993 O  OD2   . ASP A 1 621 ? -8.493  -9.884  -47.933 1.00 35.46  ? 621  ASP A OD2   1 
ATOM   4994 N  N     . THR A 1 622 ? -5.852  -7.661  -51.520 1.00 28.15  ? 622  THR A N     1 
ATOM   4995 C  CA    . THR A 1 622 ? -4.474  -7.168  -51.451 1.00 27.06  ? 622  THR A CA    1 
ATOM   4996 C  C     . THR A 1 622 ? -3.633  -7.520  -52.684 1.00 29.56  ? 622  THR A C     1 
ATOM   4997 O  O     . THR A 1 622 ? -3.279  -6.643  -53.471 1.00 32.10  ? 622  THR A O     1 
ATOM   4998 C  CB    . THR A 1 622 ? -3.752  -7.643  -50.163 1.00 24.34  ? 622  THR A CB    1 
ATOM   4999 O  OG1   . THR A 1 622 ? -4.531  -7.285  -49.013 1.00 28.75  ? 622  THR A OG1   1 
ATOM   5000 C  CG2   . THR A 1 622 ? -2.370  -7.014  -50.054 1.00 23.87  ? 622  THR A CG2   1 
ATOM   5001 N  N     . ASP A 1 623 ? -3.321  -8.803  -52.849 1.00 31.19  ? 623  ASP A N     1 
ATOM   5002 C  CA    . ASP A 1 623 ? -2.420  -9.245  -53.909 1.00 35.00  ? 623  ASP A CA    1 
ATOM   5003 C  C     . ASP A 1 623 ? -2.859  -10.575 -54.525 1.00 38.26  ? 623  ASP A C     1 
ATOM   5004 O  O     . ASP A 1 623 ? -2.100  -11.209 -55.254 1.00 38.09  ? 623  ASP A O     1 
ATOM   5005 C  CB    . ASP A 1 623 ? -1.012  -9.413  -53.348 1.00 33.25  ? 623  ASP A CB    1 
ATOM   5006 C  CG    . ASP A 1 623 ? -0.930  -10.532 -52.326 1.00 37.34  ? 623  ASP A CG    1 
ATOM   5007 O  OD1   . ASP A 1 623 ? -1.950  -10.792 -51.650 1.00 37.00  ? 623  ASP A OD1   1 
ATOM   5008 O  OD2   . ASP A 1 623 ? 0.147   -11.154 -52.199 1.00 36.19  ? 623  ASP A OD2   1 
ATOM   5009 N  N     . SER A 1 624 ? -4.078  -11.002 -54.223 1.00 36.17  ? 624  SER A N     1 
ATOM   5010 C  CA    . SER A 1 624 ? -4.561  -12.281 -54.720 1.00 37.67  ? 624  SER A CA    1 
ATOM   5011 C  C     . SER A 1 624 ? -5.776  -12.106 -55.610 1.00 36.62  ? 624  SER A C     1 
ATOM   5012 O  O     . SER A 1 624 ? -6.556  -11.179 -55.425 1.00 36.43  ? 624  SER A O     1 
ATOM   5013 C  CB    . SER A 1 624 ? -4.927  -13.198 -53.552 1.00 39.17  ? 624  SER A CB    1 
ATOM   5014 O  OG    . SER A 1 624 ? -5.972  -12.626 -52.781 1.00 40.98  ? 624  SER A OG    1 
ATOM   5015 N  N     . ILE A 1 625 ? -5.934  -12.999 -56.580 1.00 34.26  ? 625  ILE A N     1 
ATOM   5016 C  CA    . ILE A 1 625 ? -7.157  -13.039 -57.369 1.00 37.05  ? 625  ILE A CA    1 
ATOM   5017 C  C     . ILE A 1 625 ? -7.716  -14.453 -57.415 1.00 37.96  ? 625  ILE A C     1 
ATOM   5018 O  O     . ILE A 1 625 ? -6.971  -15.432 -57.448 1.00 39.28  ? 625  ILE A O     1 
ATOM   5019 C  CB    . ILE A 1 625 ? -6.960  -12.528 -58.817 1.00 39.89  ? 625  ILE A CB    1 
ATOM   5020 C  CG1   . ILE A 1 625 ? -5.913  -13.370 -59.550 1.00 36.88  ? 625  ILE A CG1   1 
ATOM   5021 C  CG2   . ILE A 1 625 ? -6.587  -11.052 -58.827 1.00 43.01  ? 625  ILE A CG2   1 
ATOM   5022 C  CD1   . ILE A 1 625 ? -5.893  -13.146 -61.039 1.00 36.46  ? 625  ILE A CD1   1 
ATOM   5023 N  N     . TYR A 1 626 ? -9.037  -14.549 -57.406 1.00 36.97  ? 626  TYR A N     1 
ATOM   5024 C  CA    . TYR A 1 626 ? -9.708  -15.831 -57.520 1.00 38.23  ? 626  TYR A CA    1 
ATOM   5025 C  C     . TYR A 1 626 ? -10.463 -15.878 -58.836 1.00 44.52  ? 626  TYR A C     1 
ATOM   5026 O  O     . TYR A 1 626 ? -11.384 -15.091 -59.074 1.00 43.24  ? 626  TYR A O     1 
ATOM   5027 C  CB    . TYR A 1 626 ? -10.628 -16.070 -56.319 1.00 39.62  ? 626  TYR A CB    1 
ATOM   5028 C  CG    . TYR A 1 626 ? -9.852  -16.289 -55.041 1.00 38.45  ? 626  TYR A CG    1 
ATOM   5029 C  CD1   . TYR A 1 626 ? -9.630  -17.567 -54.553 1.00 41.61  ? 626  TYR A CD1   1 
ATOM   5030 C  CD2   . TYR A 1 626 ? -9.309  -15.216 -54.342 1.00 40.21  ? 626  TYR A CD2   1 
ATOM   5031 C  CE1   . TYR A 1 626 ? -8.907  -17.773 -53.389 1.00 41.78  ? 626  TYR A CE1   1 
ATOM   5032 C  CE2   . TYR A 1 626 ? -8.584  -15.410 -53.182 1.00 40.61  ? 626  TYR A CE2   1 
ATOM   5033 C  CZ    . TYR A 1 626 ? -8.387  -16.690 -52.710 1.00 41.81  ? 626  TYR A CZ    1 
ATOM   5034 O  OH    . TYR A 1 626 ? -7.667  -16.888 -51.556 1.00 42.98  ? 626  TYR A OH    1 
ATOM   5035 N  N     . VAL A 1 627 ? -10.041 -16.795 -59.698 1.00 45.21  ? 627  VAL A N     1 
ATOM   5036 C  CA    . VAL A 1 627 ? -10.569 -16.886 -61.043 1.00 46.71  ? 627  VAL A CA    1 
ATOM   5037 C  C     . VAL A 1 627 ? -11.571 -18.021 -61.172 1.00 44.02  ? 627  VAL A C     1 
ATOM   5038 O  O     . VAL A 1 627 ? -11.246 -19.179 -60.914 1.00 46.46  ? 627  VAL A O     1 
ATOM   5039 C  CB    . VAL A 1 627 ? -9.437  -17.116 -62.060 1.00 49.82  ? 627  VAL A CB    1 
ATOM   5040 C  CG1   . VAL A 1 627 ? -10.004 -17.238 -63.452 1.00 51.59  ? 627  VAL A CG1   1 
ATOM   5041 C  CG2   . VAL A 1 627 ? -8.414  -15.987 -61.981 1.00 52.10  ? 627  VAL A CG2   1 
ATOM   5042 N  N     . SER A 1 628 ? -12.791 -17.680 -61.570 1.00 42.95  ? 628  SER A N     1 
ATOM   5043 C  CA    . SER A 1 628 ? -13.803 -18.682 -61.880 1.00 48.37  ? 628  SER A CA    1 
ATOM   5044 C  C     . SER A 1 628 ? -13.375 -19.454 -63.122 1.00 51.00  ? 628  SER A C     1 
ATOM   5045 O  O     . SER A 1 628 ? -13.195 -18.872 -64.189 1.00 45.03  ? 628  SER A O     1 
ATOM   5046 C  CB    . SER A 1 628 ? -15.155 -18.012 -62.119 1.00 50.39  ? 628  SER A CB    1 
ATOM   5047 O  OG    . SER A 1 628 ? -16.108 -18.945 -62.590 1.00 55.88  ? 628  SER A OG    1 
ATOM   5048 N  N     . ALA A 1 629 ? -13.210 -20.765 -62.981 1.00 52.53  ? 629  ALA A N     1 
ATOM   5049 C  CA    . ALA A 1 629 ? -12.709 -21.585 -64.079 1.00 54.53  ? 629  ALA A CA    1 
ATOM   5050 C  C     . ALA A 1 629 ? -13.787 -22.472 -64.698 1.00 57.17  ? 629  ALA A C     1 
ATOM   5051 O  O     . ALA A 1 629 ? -13.478 -23.475 -65.346 1.00 59.29  ? 629  ALA A O     1 
ATOM   5052 C  CB    . ALA A 1 629 ? -11.526 -22.428 -63.615 1.00 55.18  ? 629  ALA A CB    1 
ATOM   5053 N  N     . ASP A 1 630 ? -15.048 -22.098 -64.500 1.00 56.24  ? 630  ASP A N     1 
ATOM   5054 C  CA    . ASP A 1 630 ? -16.165 -22.851 -65.066 1.00 58.60  ? 630  ASP A CA    1 
ATOM   5055 C  C     . ASP A 1 630 ? -16.095 -22.887 -66.589 1.00 61.11  ? 630  ASP A C     1 
ATOM   5056 O  O     . ASP A 1 630 ? -16.329 -23.925 -67.205 1.00 54.82  ? 630  ASP A O     1 
ATOM   5057 C  CB    . ASP A 1 630 ? -17.506 -22.253 -64.630 1.00 60.78  ? 630  ASP A CB    1 
ATOM   5058 C  CG    . ASP A 1 630 ? -17.766 -22.416 -63.145 1.00 62.16  ? 630  ASP A CG    1 
ATOM   5059 O  OD1   . ASP A 1 630 ? -16.796 -22.613 -62.382 1.00 62.39  ? 630  ASP A OD1   1 
ATOM   5060 O  OD2   . ASP A 1 630 ? -18.945 -22.338 -62.740 1.00 63.29  ? 630  ASP A OD2   1 
ATOM   5061 N  N     . LYS A 1 631 ? -15.762 -21.751 -67.193 1.00 57.47  ? 631  LYS A N     1 
ATOM   5062 C  CA    . LYS A 1 631 ? -15.756 -21.648 -68.650 1.00 61.57  ? 631  LYS A CA    1 
ATOM   5063 C  C     . LYS A 1 631 ? -14.517 -22.266 -69.292 1.00 60.74  ? 631  LYS A C     1 
ATOM   5064 O  O     . LYS A 1 631 ? -14.548 -22.654 -70.458 1.00 60.94  ? 631  LYS A O     1 
ATOM   5065 C  CB    . LYS A 1 631 ? -15.938 -20.194 -69.090 1.00 62.97  ? 631  LYS A CB    1 
ATOM   5066 C  CG    . LYS A 1 631 ? -17.330 -19.661 -68.809 1.00 66.15  ? 631  LYS A CG    1 
ATOM   5067 C  CD    . LYS A 1 631 ? -17.438 -18.176 -69.099 1.00 71.59  ? 631  LYS A CD    1 
ATOM   5068 C  CE    . LYS A 1 631 ? -18.842 -17.671 -68.811 1.00 76.54  ? 631  LYS A CE    1 
ATOM   5069 N  NZ    . LYS A 1 631 ? -18.946 -16.194 -68.954 1.00 79.25  ? 631  LYS A NZ    1 
ATOM   5070 N  N     . ILE A 1 632 ? -13.430 -22.358 -68.534 1.00 59.36  ? 632  ILE A N     1 
ATOM   5071 C  CA    . ILE A 1 632 ? -12.240 -23.051 -69.015 1.00 58.26  ? 632  ILE A CA    1 
ATOM   5072 C  C     . ILE A 1 632 ? -12.519 -24.551 -69.076 1.00 58.20  ? 632  ILE A C     1 
ATOM   5073 O  O     . ILE A 1 632 ? -12.203 -25.215 -70.068 1.00 58.07  ? 632  ILE A O     1 
ATOM   5074 C  CB    . ILE A 1 632 ? -11.020 -22.773 -68.122 1.00 57.01  ? 632  ILE A CB    1 
ATOM   5075 C  CG1   . ILE A 1 632 ? -10.684 -21.278 -68.141 1.00 57.93  ? 632  ILE A CG1   1 
ATOM   5076 C  CG2   . ILE A 1 632 ? -9.825  -23.595 -68.580 1.00 55.97  ? 632  ILE A CG2   1 
ATOM   5077 C  CD1   . ILE A 1 632 ? -9.579  -20.881 -67.185 1.00 55.07  ? 632  ILE A CD1   1 
ATOM   5078 N  N     . ILE A 1 633 ? -13.126 -25.075 -68.014 1.00 55.92  ? 633  ILE A N     1 
ATOM   5079 C  CA    . ILE A 1 633 ? -13.552 -26.471 -67.976 1.00 58.21  ? 633  ILE A CA    1 
ATOM   5080 C  C     . ILE A 1 633 ? -14.599 -26.757 -69.055 1.00 63.59  ? 633  ILE A C     1 
ATOM   5081 O  O     . ILE A 1 633 ? -14.545 -27.789 -69.724 1.00 68.45  ? 633  ILE A O     1 
ATOM   5082 C  CB    . ILE A 1 633 ? -14.129 -26.850 -66.592 1.00 55.78  ? 633  ILE A CB    1 
ATOM   5083 C  CG1   . ILE A 1 633 ? -13.047 -26.772 -65.508 1.00 54.34  ? 633  ILE A CG1   1 
ATOM   5084 C  CG2   . ILE A 1 633 ? -14.733 -28.249 -66.623 1.00 56.49  ? 633  ILE A CG2   1 
ATOM   5085 C  CD1   . ILE A 1 633 ? -12.016 -27.878 -65.588 1.00 53.10  ? 633  ILE A CD1   1 
ATOM   5086 N  N     . ASP A 1 634 ? -15.542 -25.834 -69.225 1.00 64.00  ? 634  ASP A N     1 
ATOM   5087 C  CA    . ASP A 1 634 ? -16.643 -26.009 -70.173 1.00 67.96  ? 634  ASP A CA    1 
ATOM   5088 C  C     . ASP A 1 634 ? -16.186 -26.046 -71.628 1.00 70.82  ? 634  ASP A C     1 
ATOM   5089 O  O     . ASP A 1 634 ? -16.694 -26.842 -72.420 1.00 73.12  ? 634  ASP A O     1 
ATOM   5090 C  CB    . ASP A 1 634 ? -17.693 -24.911 -69.991 1.00 71.36  ? 634  ASP A CB    1 
ATOM   5091 C  CG    . ASP A 1 634 ? -18.579 -25.149 -68.788 1.00 75.95  ? 634  ASP A CG    1 
ATOM   5092 O  OD1   . ASP A 1 634 ? -18.205 -25.971 -67.923 1.00 76.25  ? 634  ASP A OD1   1 
ATOM   5093 O  OD2   . ASP A 1 634 ? -19.648 -24.508 -68.706 1.00 79.06  ? 634  ASP A OD2   1 
ATOM   5094 N  N     . LYS A 1 635 ? -15.238 -25.179 -71.976 1.00 70.75  ? 635  LYS A N     1 
ATOM   5095 C  CA    . LYS A 1 635 ? -14.708 -25.124 -73.333 1.00 72.91  ? 635  LYS A CA    1 
ATOM   5096 C  C     . LYS A 1 635 ? -14.126 -26.471 -73.744 1.00 77.73  ? 635  LYS A C     1 
ATOM   5097 O  O     . LYS A 1 635 ? -14.224 -26.875 -74.903 1.00 81.42  ? 635  LYS A O     1 
ATOM   5098 C  CB    . LYS A 1 635 ? -13.642 -24.032 -73.449 1.00 70.24  ? 635  LYS A CB    1 
ATOM   5099 N  N     . VAL A 1 636 ? -13.521 -27.162 -72.783 1.00 78.15  ? 636  VAL A N     1 
ATOM   5100 C  CA    . VAL A 1 636 ? -12.958 -28.484 -73.025 1.00 81.95  ? 636  VAL A CA    1 
ATOM   5101 C  C     . VAL A 1 636 ? -14.002 -29.564 -72.754 1.00 86.11  ? 636  VAL A C     1 
ATOM   5102 O  O     . VAL A 1 636 ? -13.863 -30.708 -73.195 1.00 91.74  ? 636  VAL A O     1 
ATOM   5103 C  CB    . VAL A 1 636 ? -11.717 -28.734 -72.144 1.00 79.40  ? 636  VAL A CB    1 
ATOM   5104 N  N     . GLY A 1 637 ? -15.054 -29.189 -72.034 1.00 83.29  ? 637  GLY A N     1 
ATOM   5105 C  CA    . GLY A 1 637 ? -16.134 -30.108 -71.727 1.00 83.06  ? 637  GLY A CA    1 
ATOM   5106 C  C     . GLY A 1 637 ? -15.777 -31.062 -70.607 1.00 81.83  ? 637  GLY A C     1 
ATOM   5107 O  O     . GLY A 1 637 ? -14.752 -31.740 -70.661 1.00 81.39  ? 637  GLY A O     1 
ATOM   5108 N  N     . GLU A 1 638 ? -16.631 -31.114 -69.589 1.00 80.67  ? 638  GLU A N     1 
ATOM   5109 C  CA    . GLU A 1 638 ? -16.397 -31.964 -68.426 1.00 79.49  ? 638  GLU A CA    1 
ATOM   5110 C  C     . GLU A 1 638 ? -16.347 -33.447 -68.787 1.00 80.26  ? 638  GLU A C     1 
ATOM   5111 O  O     . GLU A 1 638 ? -15.704 -34.240 -68.098 1.00 80.00  ? 638  GLU A O     1 
ATOM   5112 C  CB    . GLU A 1 638 ? -17.474 -31.728 -67.365 1.00 78.54  ? 638  GLU A CB    1 
ATOM   5113 C  CG    . GLU A 1 638 ? -16.937 -31.244 -66.030 1.00 74.35  ? 638  GLU A CG    1 
ATOM   5114 C  CD    . GLU A 1 638 ? -17.978 -31.298 -64.930 1.00 73.54  ? 638  GLU A CD    1 
ATOM   5115 O  OE1   . GLU A 1 638 ? -17.799 -30.601 -63.909 1.00 71.71  ? 638  GLU A OE1   1 
ATOM   5116 O  OE2   . GLU A 1 638 ? -18.971 -32.040 -65.086 1.00 74.48  ? 638  GLU A OE2   1 
ATOM   5117 N  N     . SER A 1 639 ? -17.029 -33.809 -69.869 1.00 82.90  ? 639  SER A N     1 
ATOM   5118 C  CA    . SER A 1 639 ? -17.133 -35.200 -70.298 1.00 83.96  ? 639  SER A CA    1 
ATOM   5119 C  C     . SER A 1 639 ? -15.781 -35.806 -70.671 1.00 84.04  ? 639  SER A C     1 
ATOM   5120 O  O     . SER A 1 639 ? -15.562 -37.002 -70.487 1.00 84.65  ? 639  SER A O     1 
ATOM   5121 C  CB    . SER A 1 639 ? -18.105 -35.322 -71.477 1.00 87.03  ? 639  SER A CB    1 
ATOM   5122 N  N     . LYS A 1 640 ? -14.874 -34.978 -71.182 1.00 83.67  ? 640  LYS A N     1 
ATOM   5123 C  CA    . LYS A 1 640 ? -13.585 -35.465 -71.676 1.00 84.25  ? 640  LYS A CA    1 
ATOM   5124 C  C     . LYS A 1 640 ? -12.546 -35.763 -70.586 1.00 82.20  ? 640  LYS A C     1 
ATOM   5125 O  O     . LYS A 1 640 ? -11.398 -36.070 -70.893 1.00 85.64  ? 640  LYS A O     1 
ATOM   5126 C  CB    . LYS A 1 640 ? -13.006 -34.495 -72.711 1.00 83.18  ? 640  LYS A CB    1 
ATOM   5127 N  N     . PHE A 1 641 ? -12.944 -35.669 -69.322 1.00 74.05  ? 641  PHE A N     1 
ATOM   5128 C  CA    . PHE A 1 641 ? -12.030 -35.945 -68.217 1.00 68.65  ? 641  PHE A CA    1 
ATOM   5129 C  C     . PHE A 1 641 ? -12.283 -37.324 -67.619 1.00 69.86  ? 641  PHE A C     1 
ATOM   5130 O  O     . PHE A 1 641 ? -13.426 -37.733 -67.448 1.00 71.36  ? 641  PHE A O     1 
ATOM   5131 C  CB    . PHE A 1 641 ? -12.130 -34.860 -67.136 1.00 64.95  ? 641  PHE A CB    1 
ATOM   5132 C  CG    . PHE A 1 641 ? -11.668 -33.506 -67.594 1.00 63.83  ? 641  PHE A CG    1 
ATOM   5133 C  CD1   . PHE A 1 641 ? -12.581 -32.511 -67.897 1.00 64.19  ? 641  PHE A CD1   1 
ATOM   5134 C  CD2   . PHE A 1 641 ? -10.320 -33.238 -67.739 1.00 64.49  ? 641  PHE A CD2   1 
ATOM   5135 C  CE1   . PHE A 1 641 ? -12.154 -31.265 -68.325 1.00 63.77  ? 641  PHE A CE1   1 
ATOM   5136 C  CE2   . PHE A 1 641 ? -9.885  -32.001 -68.167 1.00 63.96  ? 641  PHE A CE2   1 
ATOM   5137 C  CZ    . PHE A 1 641 ? -10.801 -31.012 -68.463 1.00 63.32  ? 641  PHE A CZ    1 
ATOM   5138 N  N     . ARG A 1 642 ? -11.202 -38.040 -67.324 1.00 70.43  ? 642  ARG A N     1 
ATOM   5139 C  CA    . ARG A 1 642 ? -11.278 -39.391 -66.777 1.00 74.39  ? 642  ARG A CA    1 
ATOM   5140 C  C     . ARG A 1 642 ? -11.656 -39.366 -65.299 1.00 73.87  ? 642  ARG A C     1 
ATOM   5141 O  O     . ARG A 1 642 ? -12.563 -40.070 -64.865 1.00 76.38  ? 642  ARG A O     1 
ATOM   5142 C  CB    . ARG A 1 642 ? -9.940  -40.120 -66.962 1.00 76.52  ? 642  ARG A CB    1 
ATOM   5143 C  CG    . ARG A 1 642 ? -9.510  -40.296 -68.408 1.00 81.47  ? 642  ARG A CG    1 
ATOM   5144 C  CD    . ARG A 1 642 ? -8.146  -40.967 -68.499 1.00 85.08  ? 642  ARG A CD    1 
ATOM   5145 N  NE    . ARG A 1 642 ? -7.110  -40.207 -67.803 1.00 85.49  ? 642  ARG A NE    1 
ATOM   5146 C  CZ    . ARG A 1 642 ? -6.347  -39.284 -68.381 1.00 86.84  ? 642  ARG A CZ    1 
ATOM   5147 N  NH1   . ARG A 1 642 ? -6.502  -39.006 -69.668 1.00 89.16  ? 642  ARG A NH1   1 
ATOM   5148 N  NH2   . ARG A 1 642 ? -5.429  -38.639 -67.672 1.00 84.54  ? 642  ARG A NH2   1 
ATOM   5149 N  N     . ASP A 1 643 ? -10.942 -38.552 -64.531 1.00 68.53  ? 643  ASP A N     1 
ATOM   5150 C  CA    . ASP A 1 643 ? -11.182 -38.435 -63.098 1.00 67.25  ? 643  ASP A CA    1 
ATOM   5151 C  C     . ASP A 1 643 ? -10.921 -37.016 -62.594 1.00 61.31  ? 643  ASP A C     1 
ATOM   5152 O  O     . ASP A 1 643 ? -10.617 -36.114 -63.376 1.00 57.39  ? 643  ASP A O     1 
ATOM   5153 C  CB    . ASP A 1 643 ? -10.340 -39.451 -62.319 1.00 70.92  ? 643  ASP A CB    1 
ATOM   5154 C  CG    . ASP A 1 643 ? -8.886  -39.467 -62.750 1.00 74.73  ? 643  ASP A CG    1 
ATOM   5155 O  OD1   . ASP A 1 643 ? -8.421  -38.465 -63.330 1.00 75.45  ? 643  ASP A OD1   1 
ATOM   5156 O  OD2   . ASP A 1 643 ? -8.206  -40.487 -62.508 1.00 75.98  ? 643  ASP A OD2   1 
ATOM   5157 N  N     . THR A 1 644 ? -11.051 -36.824 -61.286 1.00 58.62  ? 644  THR A N     1 
ATOM   5158 C  CA    . THR A 1 644 ? -10.807 -35.521 -60.681 1.00 56.82  ? 644  THR A CA    1 
ATOM   5159 C  C     . THR A 1 644 ? -9.392  -35.049 -60.985 1.00 56.70  ? 644  THR A C     1 
ATOM   5160 O  O     . THR A 1 644 ? -9.190  -33.931 -61.456 1.00 54.55  ? 644  THR A O     1 
ATOM   5161 C  CB    . THR A 1 644 ? -11.007 -35.559 -59.157 1.00 55.70  ? 644  THR A CB    1 
ATOM   5162 O  OG1   . THR A 1 644 ? -12.376 -35.864 -58.863 1.00 51.56  ? 644  THR A OG1   1 
ATOM   5163 C  CG2   . THR A 1 644 ? -10.643 -34.220 -58.541 1.00 52.85  ? 644  THR A CG2   1 
ATOM   5164 N  N     . ASN A 1 645 ? -8.419  -35.920 -60.731 1.00 60.67  ? 645  ASN A N     1 
ATOM   5165 C  CA    . ASN A 1 645 ? -7.011  -35.586 -60.925 1.00 63.26  ? 645  ASN A CA    1 
ATOM   5166 C  C     . ASN A 1 645 ? -6.687  -35.179 -62.364 1.00 60.49  ? 645  ASN A C     1 
ATOM   5167 O  O     . ASN A 1 645 ? -5.728  -34.444 -62.608 1.00 58.81  ? 645  ASN A O     1 
ATOM   5168 C  CB    . ASN A 1 645 ? -6.118  -36.751 -60.481 1.00 66.48  ? 645  ASN A CB    1 
ATOM   5169 C  CG    . ASN A 1 645 ? -4.677  -36.329 -60.246 1.00 68.12  ? 645  ASN A CG    1 
ATOM   5170 O  OD1   . ASN A 1 645 ? -4.367  -35.676 -59.250 1.00 68.70  ? 645  ASN A OD1   1 
ATOM   5171 N  ND2   . ASN A 1 645 ? -3.789  -36.709 -61.159 1.00 69.57  ? 645  ASN A ND2   1 
ATOM   5172 N  N     . HIS A 1 646 ? -7.499  -35.648 -63.308 1.00 60.83  ? 646  HIS A N     1 
ATOM   5173 C  CA    . HIS A 1 646 ? -7.303  -35.314 -64.715 1.00 62.12  ? 646  HIS A CA    1 
ATOM   5174 C  C     . HIS A 1 646 ? -7.546  -33.829 -64.982 1.00 63.16  ? 646  HIS A C     1 
ATOM   5175 O  O     . HIS A 1 646 ? -6.737  -33.175 -65.642 1.00 56.36  ? 646  HIS A O     1 
ATOM   5176 C  CB    . HIS A 1 646 ? -8.196  -36.171 -65.616 1.00 63.67  ? 646  HIS A CB    1 
ATOM   5177 C  CG    . HIS A 1 646 ? -7.937  -35.981 -67.080 1.00 67.27  ? 646  HIS A CG    1 
ATOM   5178 N  ND1   . HIS A 1 646 ? -8.789  -36.459 -68.054 1.00 68.76  ? 646  HIS A ND1   1 
ATOM   5179 C  CD2   . HIS A 1 646 ? -6.922  -35.372 -67.735 1.00 67.34  ? 646  HIS A CD2   1 
ATOM   5180 C  CE1   . HIS A 1 646 ? -8.310  -36.146 -69.245 1.00 67.82  ? 646  HIS A CE1   1 
ATOM   5181 N  NE2   . HIS A 1 646 ? -7.179  -35.486 -69.081 1.00 65.84  ? 646  HIS A NE2   1 
ATOM   5182 N  N     . TRP A 1 647 ? -8.655  -33.292 -64.478 1.00 59.53  ? 647  TRP A N     1 
ATOM   5183 C  CA    . TRP A 1 647 ? -8.936  -31.877 -64.702 1.00 58.02  ? 647  TRP A CA    1 
ATOM   5184 C  C     . TRP A 1 647 ? -8.062  -30.972 -63.834 1.00 54.49  ? 647  TRP A C     1 
ATOM   5185 O  O     . TRP A 1 647 ? -7.827  -29.815 -64.179 1.00 52.85  ? 647  TRP A O     1 
ATOM   5186 C  CB    . TRP A 1 647 ? -10.433 -31.541 -64.575 1.00 55.65  ? 647  TRP A CB    1 
ATOM   5187 C  CG    . TRP A 1 647 ? -11.053 -31.697 -63.209 1.00 52.75  ? 647  TRP A CG    1 
ATOM   5188 C  CD1   . TRP A 1 647 ? -11.854 -32.718 -62.788 1.00 55.31  ? 647  TRP A CD1   1 
ATOM   5189 C  CD2   . TRP A 1 647 ? -10.955 -30.784 -62.104 1.00 50.20  ? 647  TRP A CD2   1 
ATOM   5190 N  NE1   . TRP A 1 647 ? -12.250 -32.505 -61.489 1.00 54.49  ? 647  TRP A NE1   1 
ATOM   5191 C  CE2   . TRP A 1 647 ? -11.711 -31.327 -61.047 1.00 50.87  ? 647  TRP A CE2   1 
ATOM   5192 C  CE3   . TRP A 1 647 ? -10.296 -29.567 -61.906 1.00 49.22  ? 647  TRP A CE3   1 
ATOM   5193 C  CZ2   . TRP A 1 647 ? -11.824 -30.696 -59.809 1.00 48.61  ? 647  TRP A CZ2   1 
ATOM   5194 C  CZ3   . TRP A 1 647 ? -10.410 -28.941 -60.674 1.00 47.88  ? 647  TRP A CZ3   1 
ATOM   5195 C  CH2   . TRP A 1 647 ? -11.169 -29.506 -59.643 1.00 47.41  ? 647  TRP A CH2   1 
ATOM   5196 N  N     . VAL A 1 648 ? -7.566  -31.507 -62.720 1.00 51.51  ? 648  VAL A N     1 
ATOM   5197 C  CA    . VAL A 1 648 ? -6.642  -30.760 -61.876 1.00 51.24  ? 648  VAL A CA    1 
ATOM   5198 C  C     . VAL A 1 648 ? -5.333  -30.533 -62.626 1.00 53.34  ? 648  VAL A C     1 
ATOM   5199 O  O     . VAL A 1 648 ? -4.810  -29.416 -62.654 1.00 52.22  ? 648  VAL A O     1 
ATOM   5200 C  CB    . VAL A 1 648 ? -6.365  -31.468 -60.530 1.00 50.84  ? 648  VAL A CB    1 
ATOM   5201 C  CG1   . VAL A 1 648 ? -5.290  -30.726 -59.750 1.00 47.16  ? 648  VAL A CG1   1 
ATOM   5202 C  CG2   . VAL A 1 648 ? -7.641  -31.574 -59.705 1.00 46.55  ? 648  VAL A CG2   1 
ATOM   5203 N  N     . ASP A 1 649 ? -4.813  -31.595 -63.239 1.00 53.29  ? 649  ASP A N     1 
ATOM   5204 C  CA    . ASP A 1 649 ? -3.620  -31.495 -64.076 1.00 56.15  ? 649  ASP A CA    1 
ATOM   5205 C  C     . ASP A 1 649 ? -3.837  -30.503 -65.214 1.00 55.89  ? 649  ASP A C     1 
ATOM   5206 O  O     . ASP A 1 649 ? -2.943  -29.724 -65.552 1.00 53.95  ? 649  ASP A O     1 
ATOM   5207 C  CB    . ASP A 1 649 ? -3.233  -32.865 -64.648 1.00 60.13  ? 649  ASP A CB    1 
ATOM   5208 C  CG    . ASP A 1 649 ? -2.403  -33.695 -63.681 1.00 63.76  ? 649  ASP A CG    1 
ATOM   5209 O  OD1   . ASP A 1 649 ? -1.725  -33.107 -62.811 1.00 62.20  ? 649  ASP A OD1   1 
ATOM   5210 O  OD2   . ASP A 1 649 ? -2.422  -34.938 -63.799 1.00 67.82  ? 649  ASP A OD2   1 
ATOM   5211 N  N     . PHE A 1 650 ? -5.034  -30.535 -65.792 1.00 54.29  ? 650  PHE A N     1 
ATOM   5212 C  CA    . PHE A 1 650 ? -5.389  -29.647 -66.893 1.00 56.26  ? 650  PHE A CA    1 
ATOM   5213 C  C     . PHE A 1 650 ? -5.346  -28.177 -66.478 1.00 55.09  ? 650  PHE A C     1 
ATOM   5214 O  O     . PHE A 1 650 ? -4.780  -27.340 -67.184 1.00 52.58  ? 650  PHE A O     1 
ATOM   5215 C  CB    . PHE A 1 650 ? -6.773  -30.004 -67.437 1.00 60.07  ? 650  PHE A CB    1 
ATOM   5216 C  CG    . PHE A 1 650 ? -7.286  -29.040 -68.463 1.00 63.33  ? 650  PHE A CG    1 
ATOM   5217 C  CD1   . PHE A 1 650 ? -6.688  -28.953 -69.709 1.00 67.42  ? 650  PHE A CD1   1 
ATOM   5218 C  CD2   . PHE A 1 650 ? -8.371  -28.227 -68.186 1.00 64.09  ? 650  PHE A CD2   1 
ATOM   5219 C  CE1   . PHE A 1 650 ? -7.159  -28.066 -70.659 1.00 69.73  ? 650  PHE A CE1   1 
ATOM   5220 C  CE2   . PHE A 1 650 ? -8.848  -27.339 -69.132 1.00 66.40  ? 650  PHE A CE2   1 
ATOM   5221 C  CZ    . PHE A 1 650 ? -8.240  -27.258 -70.370 1.00 68.59  ? 650  PHE A CZ    1 
ATOM   5222 N  N     . LEU A 1 651 ? -5.942  -27.868 -65.332 1.00 54.48  ? 651  LEU A N     1 
ATOM   5223 C  CA    . LEU A 1 651 ? -5.946  -26.502 -64.824 1.00 53.77  ? 651  LEU A CA    1 
ATOM   5224 C  C     . LEU A 1 651 ? -4.545  -26.094 -64.375 1.00 52.55  ? 651  LEU A C     1 
ATOM   5225 O  O     . LEU A 1 651 ? -4.132  -24.951 -64.568 1.00 50.34  ? 651  LEU A O     1 
ATOM   5226 C  CB    . LEU A 1 651 ? -6.949  -26.353 -63.677 1.00 53.70  ? 651  LEU A CB    1 
ATOM   5227 C  CG    . LEU A 1 651 ? -8.425  -26.503 -64.053 1.00 51.76  ? 651  LEU A CG    1 
ATOM   5228 C  CD1   . LEU A 1 651 ? -9.319  -26.182 -62.861 1.00 46.54  ? 651  LEU A CD1   1 
ATOM   5229 C  CD2   . LEU A 1 651 ? -8.766  -25.614 -65.239 1.00 52.57  ? 651  LEU A CD2   1 
ATOM   5230 N  N     . ASP A 1 652 ? -3.823  -27.043 -63.784 1.00 53.37  ? 652  ASP A N     1 
ATOM   5231 C  CA    . ASP A 1 652 ? -2.440  -26.831 -63.371 1.00 51.45  ? 652  ASP A CA    1 
ATOM   5232 C  C     . ASP A 1 652 ? -1.596  -26.428 -64.575 1.00 51.49  ? 652  ASP A C     1 
ATOM   5233 O  O     . ASP A 1 652 ? -0.801  -25.492 -64.504 1.00 49.40  ? 652  ASP A O     1 
ATOM   5234 C  CB    . ASP A 1 652 ? -1.876  -28.111 -62.746 1.00 52.47  ? 652  ASP A CB    1 
ATOM   5235 C  CG    . ASP A 1 652 ? -0.617  -27.865 -61.931 1.00 60.00  ? 652  ASP A CG    1 
ATOM   5236 O  OD1   . ASP A 1 652 ? 0.099   -26.877 -62.203 1.00 61.40  ? 652  ASP A OD1   1 
ATOM   5237 O  OD2   . ASP A 1 652 ? -0.344  -28.666 -61.009 1.00 64.65  ? 652  ASP A OD2   1 
ATOM   5238 N  N     . LYS A 1 653 ? -1.781  -27.142 -65.680 1.00 53.83  ? 653  LYS A N     1 
ATOM   5239 C  CA    . LYS A 1 653 ? -1.040  -26.878 -66.908 1.00 57.90  ? 653  LYS A CA    1 
ATOM   5240 C  C     . LYS A 1 653 ? -1.490  -25.570 -67.556 1.00 57.74  ? 653  LYS A C     1 
ATOM   5241 O  O     . LYS A 1 653 ? -0.667  -24.785 -68.032 1.00 51.15  ? 653  LYS A O     1 
ATOM   5242 C  CB    . LYS A 1 653 ? -1.207  -28.042 -67.889 1.00 60.04  ? 653  LYS A CB    1 
ATOM   5243 C  CG    . LYS A 1 653 ? -0.339  -27.941 -69.129 1.00 65.66  ? 653  LYS A CG    1 
ATOM   5244 N  N     . PHE A 1 654 ? -2.801  -25.345 -67.566 1.00 58.00  ? 654  PHE A N     1 
ATOM   5245 C  CA    . PHE A 1 654 ? -3.376  -24.138 -68.150 1.00 58.65  ? 654  PHE A CA    1 
ATOM   5246 C  C     . PHE A 1 654 ? -2.847  -22.883 -67.467 1.00 57.93  ? 654  PHE A C     1 
ATOM   5247 O  O     . PHE A 1 654 ? -2.425  -21.938 -68.127 1.00 57.31  ? 654  PHE A O     1 
ATOM   5248 C  CB    . PHE A 1 654 ? -4.905  -24.182 -68.066 1.00 51.28  ? 654  PHE A CB    1 
ATOM   5249 C  CG    . PHE A 1 654 ? -5.590  -23.077 -68.818 1.00 52.26  ? 654  PHE A CG    1 
ATOM   5250 C  CD1   . PHE A 1 654 ? -5.986  -23.258 -70.128 1.00 54.13  ? 654  PHE A CD1   1 
ATOM   5251 C  CD2   . PHE A 1 654 ? -5.847  -21.859 -68.209 1.00 55.60  ? 654  PHE A CD2   1 
ATOM   5252 C  CE1   . PHE A 1 654 ? -6.621  -22.247 -70.820 1.00 60.22  ? 654  PHE A CE1   1 
ATOM   5253 C  CE2   . PHE A 1 654 ? -6.479  -20.841 -68.900 1.00 55.24  ? 654  PHE A CE2   1 
ATOM   5254 C  CZ    . PHE A 1 654 ? -6.867  -21.037 -70.207 1.00 52.82  ? 654  PHE A CZ    1 
ATOM   5255 N  N     . ALA A 1 655 ? -2.874  -22.880 -66.140 1.00 57.50  ? 655  ALA A N     1 
ATOM   5256 C  CA    . ALA A 1 655 ? -2.407  -21.732 -65.379 1.00 56.41  ? 655  ALA A CA    1 
ATOM   5257 C  C     . ALA A 1 655 ? -0.920  -21.498 -65.616 1.00 58.75  ? 655  ALA A C     1 
ATOM   5258 O  O     . ALA A 1 655 ? -0.460  -20.362 -65.700 1.00 59.68  ? 655  ALA A O     1 
ATOM   5259 C  CB    . ALA A 1 655 ? -2.688  -21.932 -63.894 1.00 50.88  ? 655  ALA A CB    1 
ATOM   5260 N  N     . ARG A 1 656 ? -0.180  -22.591 -65.752 1.00 59.61  ? 656  ARG A N     1 
ATOM   5261 C  CA    . ARG A 1 656 ? 1.276   -22.547 -65.762 1.00 64.40  ? 656  ARG A CA    1 
ATOM   5262 C  C     . ARG A 1 656 ? 1.851   -22.200 -67.134 1.00 65.19  ? 656  ARG A C     1 
ATOM   5263 O  O     . ARG A 1 656 ? 2.871   -21.520 -67.233 1.00 66.16  ? 656  ARG A O     1 
ATOM   5264 C  CB    . ARG A 1 656 ? 1.821   -23.892 -65.276 1.00 71.33  ? 656  ARG A CB    1 
ATOM   5265 C  CG    . ARG A 1 656 ? 3.308   -23.934 -64.965 1.00 74.81  ? 656  ARG A CG    1 
ATOM   5266 C  CD    . ARG A 1 656 ? 3.641   -25.138 -64.091 1.00 76.62  ? 656  ARG A CD    1 
ATOM   5267 N  NE    . ARG A 1 656 ? 2.662   -26.217 -64.218 1.00 79.22  ? 656  ARG A NE    1 
ATOM   5268 C  CZ    . ARG A 1 656 ? 2.671   -27.132 -65.183 1.00 83.25  ? 656  ARG A CZ    1 
ATOM   5269 N  NH1   . ARG A 1 656 ? 3.609   -27.103 -66.117 1.00 85.68  ? 656  ARG A NH1   1 
ATOM   5270 N  NH2   . ARG A 1 656 ? 1.735   -28.071 -65.218 1.00 83.62  ? 656  ARG A NH2   1 
ATOM   5271 N  N     . GLU A 1 657 ? 1.187   -22.654 -68.192 1.00 64.12  ? 657  GLU A N     1 
ATOM   5272 C  CA    . GLU A 1 657 ? 1.701   -22.456 -69.545 1.00 68.05  ? 657  GLU A CA    1 
ATOM   5273 C  C     . GLU A 1 657 ? 1.001   -21.333 -70.311 1.00 63.34  ? 657  GLU A C     1 
ATOM   5274 O  O     . GLU A 1 657 ? 1.526   -20.838 -71.310 1.00 62.05  ? 657  GLU A O     1 
ATOM   5275 C  CB    . GLU A 1 657 ? 1.617   -23.760 -70.342 1.00 72.55  ? 657  GLU A CB    1 
ATOM   5276 C  CG    . GLU A 1 657 ? 2.392   -24.911 -69.724 1.00 76.29  ? 657  GLU A CG    1 
ATOM   5277 C  CD    . GLU A 1 657 ? 2.254   -26.193 -70.516 1.00 81.68  ? 657  GLU A CD    1 
ATOM   5278 O  OE1   . GLU A 1 657 ? 1.655   -26.158 -71.614 1.00 82.26  ? 657  GLU A OE1   1 
ATOM   5279 O  OE2   . GLU A 1 657 ? 2.738   -27.236 -70.031 1.00 85.35  ? 657  GLU A OE2   1 
ATOM   5280 N  N     A ARG A 1 658 ? -0.167  -20.917 -69.833 0.50 60.39  ? 658  ARG A N     1 
ATOM   5281 N  N     B ARG A 1 658 ? -0.184  -20.946 -69.850 0.50 60.46  ? 658  ARG A N     1 
ATOM   5282 C  CA    A ARG A 1 658 ? -0.952  -19.910 -70.539 0.50 60.37  ? 658  ARG A CA    1 
ATOM   5283 C  CA    B ARG A 1 658 ? -0.956  -19.911 -70.525 0.50 60.35  ? 658  ARG A CA    1 
ATOM   5284 C  C     A ARG A 1 658 ? -1.226  -18.655 -69.708 0.50 58.42  ? 658  ARG A C     1 
ATOM   5285 C  C     B ARG A 1 658 ? -1.138  -18.667 -69.663 0.50 58.35  ? 658  ARG A C     1 
ATOM   5286 O  O     A ARG A 1 658 ? -0.923  -17.542 -70.137 0.50 57.32  ? 658  ARG A O     1 
ATOM   5287 O  O     B ARG A 1 658 ? -0.691  -17.579 -70.026 0.50 56.90  ? 658  ARG A O     1 
ATOM   5288 C  CB    A ARG A 1 658 ? -2.261  -20.521 -71.045 0.50 61.93  ? 658  ARG A CB    1 
ATOM   5289 C  CB    B ARG A 1 658 ? -2.324  -20.448 -70.953 0.50 61.54  ? 658  ARG A CB    1 
ATOM   5290 C  CG    A ARG A 1 658 ? -2.060  -21.634 -72.064 0.50 65.10  ? 658  ARG A CG    1 
ATOM   5291 C  CG    B ARG A 1 658 ? -2.302  -21.315 -72.201 0.50 64.93  ? 658  ARG A CG    1 
ATOM   5292 C  CD    A ARG A 1 658 ? -1.391  -21.107 -73.329 0.50 65.79  ? 658  ARG A CD    1 
ATOM   5293 C  CD    B ARG A 1 658 ? -3.712  -21.531 -72.738 0.50 65.49  ? 658  ARG A CD    1 
ATOM   5294 N  NE    A ARG A 1 658 ? -0.978  -22.183 -74.226 0.50 66.45  ? 658  ARG A NE    1 
ATOM   5295 N  NE    B ARG A 1 658 ? -3.719  -22.238 -74.016 0.50 65.70  ? 658  ARG A NE    1 
ATOM   5296 C  CZ    A ARG A 1 658 ? -0.402  -21.993 -75.410 0.50 65.59  ? 658  ARG A CZ    1 
ATOM   5297 C  CZ    B ARG A 1 658 ? -3.680  -21.638 -75.201 0.50 65.82  ? 658  ARG A CZ    1 
ATOM   5298 N  NH1   A ARG A 1 658 ? -0.169  -20.764 -75.853 0.50 62.69  ? 658  ARG A NH1   1 
ATOM   5299 N  NH1   B ARG A 1 658 ? -3.632  -20.315 -75.277 0.50 65.06  ? 658  ARG A NH1   1 
ATOM   5300 N  NH2   A ARG A 1 658 ? -0.061  -23.035 -76.152 0.50 63.70  ? 658  ARG A NH2   1 
ATOM   5301 N  NH2   B ARG A 1 658 ? -3.691  -22.360 -76.312 0.50 67.16  ? 658  ARG A NH2   1 
ATOM   5302 N  N     . MET A 1 659 ? -1.798  -18.832 -68.522 1.00 57.91  ? 659  MET A N     1 
ATOM   5303 C  CA    . MET A 1 659 ? -2.158  -17.696 -67.678 1.00 56.74  ? 659  MET A CA    1 
ATOM   5304 C  C     . MET A 1 659 ? -0.964  -16.934 -67.106 1.00 54.52  ? 659  MET A C     1 
ATOM   5305 O  O     . MET A 1 659 ? -0.903  -15.711 -67.210 1.00 53.42  ? 659  MET A O     1 
ATOM   5306 C  CB    . MET A 1 659 ? -3.111  -18.130 -66.565 1.00 57.64  ? 659  MET A CB    1 
ATOM   5307 C  CG    . MET A 1 659 ? -4.446  -18.628 -67.083 1.00 60.09  ? 659  MET A CG    1 
ATOM   5308 S  SD    . MET A 1 659 ? -5.675  -18.822 -65.785 1.00 60.47  ? 659  MET A SD    1 
ATOM   5309 C  CE    . MET A 1 659 ? -5.870  -17.120 -65.262 1.00 64.28  ? 659  MET A CE    1 
ATOM   5310 N  N     . GLU A 1 660 ? -0.019  -17.654 -66.511 1.00 53.82  ? 660  GLU A N     1 
ATOM   5311 C  CA    . GLU A 1 660 ? 1.146   -17.019 -65.895 1.00 54.81  ? 660  GLU A CA    1 
ATOM   5312 C  C     . GLU A 1 660 ? 2.029   -16.199 -66.858 1.00 56.30  ? 660  GLU A C     1 
ATOM   5313 O  O     . GLU A 1 660 ? 2.456   -15.099 -66.504 1.00 57.56  ? 660  GLU A O     1 
ATOM   5314 C  CB    . GLU A 1 660 ? 1.975   -18.030 -65.094 1.00 52.57  ? 660  GLU A CB    1 
ATOM   5315 C  CG    . GLU A 1 660 ? 1.316   -18.484 -63.799 1.00 53.79  ? 660  GLU A CG    1 
ATOM   5316 C  CD    . GLU A 1 660 ? 2.147   -19.512 -63.060 1.00 57.84  ? 660  GLU A CD    1 
ATOM   5317 O  OE1   . GLU A 1 660 ? 1.632   -20.123 -62.098 1.00 59.47  ? 660  GLU A OE1   1 
ATOM   5318 O  OE2   . GLU A 1 660 ? 3.319   -19.710 -63.446 1.00 58.41  ? 660  GLU A OE2   1 
ATOM   5319 N  N     . PRO A 1 661 ? 2.316   -16.726 -68.065 1.00 55.64  ? 661  PRO A N     1 
ATOM   5320 C  CA    . PRO A 1 661 ? 3.038   -15.874 -69.020 1.00 57.15  ? 661  PRO A CA    1 
ATOM   5321 C  C     . PRO A 1 661 ? 2.262   -14.611 -69.400 1.00 58.00  ? 661  PRO A C     1 
ATOM   5322 O  O     . PRO A 1 661 ? 2.872   -13.562 -69.616 1.00 58.37  ? 661  PRO A O     1 
ATOM   5323 C  CB    . PRO A 1 661 ? 3.196   -16.781 -70.243 1.00 56.76  ? 661  PRO A CB    1 
ATOM   5324 C  CG    . PRO A 1 661 ? 3.202   -18.155 -69.680 1.00 55.53  ? 661  PRO A CG    1 
ATOM   5325 C  CD    . PRO A 1 661 ? 2.231   -18.121 -68.539 1.00 53.26  ? 661  PRO A CD    1 
ATOM   5326 N  N     . ALA A 1 662 ? 0.939   -14.711 -69.480 1.00 56.29  ? 662  ALA A N     1 
ATOM   5327 C  CA    . ALA A 1 662 ? 0.108   -13.554 -69.793 1.00 55.34  ? 662  ALA A CA    1 
ATOM   5328 C  C     . ALA A 1 662 ? 0.143   -12.552 -68.645 1.00 53.42  ? 662  ALA A C     1 
ATOM   5329 O  O     . ALA A 1 662 ? 0.209   -11.341 -68.864 1.00 54.08  ? 662  ALA A O     1 
ATOM   5330 C  CB    . ALA A 1 662 ? -1.320  -13.989 -70.075 1.00 55.22  ? 662  ALA A CB    1 
ATOM   5331 N  N     . ILE A 1 663 ? 0.099   -13.071 -67.422 1.00 50.83  ? 663  ILE A N     1 
ATOM   5332 C  CA    . ILE A 1 663 ? 0.183   -12.249 -66.222 1.00 48.65  ? 663  ILE A CA    1 
ATOM   5333 C  C     . ILE A 1 663 ? 1.530   -11.538 -66.159 1.00 46.91  ? 663  ILE A C     1 
ATOM   5334 O  O     . ILE A 1 663 ? 1.600   -10.354 -65.822 1.00 47.86  ? 663  ILE A O     1 
ATOM   5335 C  CB    . ILE A 1 663 ? -0.031  -13.095 -64.949 1.00 50.63  ? 663  ILE A CB    1 
ATOM   5336 C  CG1   . ILE A 1 663 ? -1.477  -13.592 -64.883 1.00 51.03  ? 663  ILE A CG1   1 
ATOM   5337 C  CG2   . ILE A 1 663 ? 0.313   -12.299 -63.700 1.00 48.30  ? 663  ILE A CG2   1 
ATOM   5338 C  CD1   . ILE A 1 663 ? -1.732  -14.573 -63.766 1.00 49.67  ? 663  ILE A CD1   1 
ATOM   5339 N  N     A ASP A 1 664 ? 2.596   -12.260 -66.493 0.50 49.02  ? 664  ASP A N     1 
ATOM   5340 N  N     B ASP A 1 664 ? 2.595   -12.266 -66.480 0.50 49.00  ? 664  ASP A N     1 
ATOM   5341 C  CA    A ASP A 1 664 ? 3.935   -11.683 -66.499 0.50 50.69  ? 664  ASP A CA    1 
ATOM   5342 C  CA    B ASP A 1 664 ? 3.935   -11.691 -66.505 0.50 50.70  ? 664  ASP A CA    1 
ATOM   5343 C  C     A ASP A 1 664 ? 4.031   -10.556 -67.523 0.50 51.87  ? 664  ASP A C     1 
ATOM   5344 C  C     B ASP A 1 664 ? 4.020   -10.554 -67.518 0.50 51.87  ? 664  ASP A C     1 
ATOM   5345 O  O     A ASP A 1 664 ? 4.657   -9.529  -67.266 0.50 51.94  ? 664  ASP A O     1 
ATOM   5346 O  O     B ASP A 1 664 ? 4.631   -9.520  -67.250 0.50 51.89  ? 664  ASP A O     1 
ATOM   5347 C  CB    A ASP A 1 664 ? 4.992   -12.755 -66.784 0.50 53.52  ? 664  ASP A CB    1 
ATOM   5348 C  CB    B ASP A 1 664 ? 4.986   -12.762 -66.817 0.50 53.57  ? 664  ASP A CB    1 
ATOM   5349 C  CG    A ASP A 1 664 ? 6.408   -12.256 -66.550 0.50 53.12  ? 664  ASP A CG    1 
ATOM   5350 C  CG    B ASP A 1 664 ? 5.196   -13.728 -65.665 0.50 54.10  ? 664  ASP A CG    1 
ATOM   5351 O  OD1   A ASP A 1 664 ? 6.897   -12.363 -65.404 0.50 49.97  ? 664  ASP A OD1   1 
ATOM   5352 O  OD1   B ASP A 1 664 ? 4.790   -13.403 -64.529 0.50 54.86  ? 664  ASP A OD1   1 
ATOM   5353 O  OD2   A ASP A 1 664 ? 7.033   -11.757 -67.512 0.50 55.23  ? 664  ASP A OD2   1 
ATOM   5354 O  OD2   B ASP A 1 664 ? 5.776   -14.810 -65.894 0.50 55.70  ? 664  ASP A OD2   1 
ATOM   5355 N  N     . ARG A 1 665 ? 3.398   -10.748 -68.678 1.00 52.74  ? 665  ARG A N     1 
ATOM   5356 C  CA    . ARG A 1 665 ? 3.360   -9.711  -69.708 1.00 53.87  ? 665  ARG A CA    1 
ATOM   5357 C  C     . ARG A 1 665 ? 2.616   -8.478  -69.200 1.00 51.39  ? 665  ARG A C     1 
ATOM   5358 O  O     . ARG A 1 665 ? 3.056   -7.349  -69.409 1.00 46.57  ? 665  ARG A O     1 
ATOM   5359 C  CB    . ARG A 1 665 ? 2.710   -10.227 -70.997 1.00 55.72  ? 665  ARG A CB    1 
ATOM   5360 C  CG    . ARG A 1 665 ? 3.509   -11.306 -71.717 1.00 57.91  ? 665  ARG A CG    1 
ATOM   5361 C  CD    . ARG A 1 665 ? 3.037   -11.501 -73.161 1.00 59.95  ? 665  ARG A CD    1 
ATOM   5362 N  NE    . ARG A 1 665 ? 1.643   -11.934 -73.251 1.00 60.40  ? 665  ARG A NE    1 
ATOM   5363 C  CZ    . ARG A 1 665 ? 1.247   -13.203 -73.197 1.00 60.59  ? 665  ARG A CZ    1 
ATOM   5364 N  NH1   . ARG A 1 665 ? 2.137   -14.174 -73.045 1.00 59.27  ? 665  ARG A NH1   1 
ATOM   5365 N  NH2   . ARG A 1 665 ? -0.042  -13.503 -73.290 1.00 60.12  ? 665  ARG A NH2   1 
ATOM   5366 N  N     . GLY A 1 666 ? 1.494   -8.706  -68.523 1.00 51.51  ? 666  GLY A N     1 
ATOM   5367 C  CA    . GLY A 1 666 ? 0.697   -7.623  -67.974 1.00 48.98  ? 666  GLY A CA    1 
ATOM   5368 C  C     . GLY A 1 666 ? 1.448   -6.786  -66.954 1.00 46.91  ? 666  GLY A C     1 
ATOM   5369 O  O     . GLY A 1 666 ? 1.356   -5.558  -66.955 1.00 44.98  ? 666  GLY A O     1 
ATOM   5370 N  N     . PHE A 1 667 ? 2.200   -7.453  -66.084 1.00 46.04  ? 667  PHE A N     1 
ATOM   5371 C  CA    . PHE A 1 667 ? 2.969   -6.767  -65.050 1.00 45.20  ? 667  PHE A CA    1 
ATOM   5372 C  C     . PHE A 1 667 ? 4.210   -6.069  -65.610 1.00 46.89  ? 667  PHE A C     1 
ATOM   5373 O  O     . PHE A 1 667 ? 4.583   -4.991  -65.147 1.00 46.02  ? 667  PHE A O     1 
ATOM   5374 C  CB    . PHE A 1 667 ? 3.342   -7.732  -63.917 1.00 35.57  ? 667  PHE A CB    1 
ATOM   5375 C  CG    . PHE A 1 667 ? 2.272   -7.871  -62.868 1.00 34.51  ? 667  PHE A CG    1 
ATOM   5376 C  CD1   . PHE A 1 667 ? 1.580   -6.757  -62.418 1.00 34.45  ? 667  PHE A CD1   1 
ATOM   5377 C  CD2   . PHE A 1 667 ? 1.950   -9.109  -62.336 1.00 35.48  ? 667  PHE A CD2   1 
ATOM   5378 C  CE1   . PHE A 1 667 ? 0.594   -6.872  -61.452 1.00 35.35  ? 667  PHE A CE1   1 
ATOM   5379 C  CE2   . PHE A 1 667 ? 0.960   -9.231  -61.371 1.00 32.97  ? 667  PHE A CE2   1 
ATOM   5380 C  CZ    . PHE A 1 667 ? 0.284   -8.110  -60.929 1.00 33.17  ? 667  PHE A CZ    1 
ATOM   5381 N  N     . ARG A 1 668 ? 4.843   -6.682  -66.606 1.00 50.93  ? 668  ARG A N     1 
ATOM   5382 C  CA    . ARG A 1 668 ? 5.980   -6.061  -67.281 1.00 49.85  ? 668  ARG A CA    1 
ATOM   5383 C  C     . ARG A 1 668 ? 5.575   -4.733  -67.910 1.00 48.24  ? 668  ARG A C     1 
ATOM   5384 O  O     . ARG A 1 668 ? 6.341   -3.768  -67.896 1.00 47.61  ? 668  ARG A O     1 
ATOM   5385 C  CB    . ARG A 1 668 ? 6.558   -6.989  -68.348 1.00 51.48  ? 668  ARG A CB    1 
ATOM   5386 C  CG    . ARG A 1 668 ? 7.444   -8.086  -67.792 1.00 56.80  ? 668  ARG A CG    1 
ATOM   5387 C  CD    . ARG A 1 668 ? 8.264   -8.751  -68.887 1.00 62.84  ? 668  ARG A CD    1 
ATOM   5388 N  NE    . ARG A 1 668 ? 9.262   -9.659  -68.331 1.00 68.87  ? 668  ARG A NE    1 
ATOM   5389 C  CZ    . ARG A 1 668 ? 10.431  -9.267  -67.832 1.00 73.47  ? 668  ARG A CZ    1 
ATOM   5390 N  NH1   . ARG A 1 668 ? 10.752  -7.980  -67.818 1.00 74.35  ? 668  ARG A NH1   1 
ATOM   5391 N  NH2   . ARG A 1 668 ? 11.278  -10.162 -67.343 1.00 75.47  ? 668  ARG A NH2   1 
ATOM   5392 N  N     . GLU A 1 669 ? 4.365   -4.692  -68.455 1.00 44.14  ? 669  GLU A N     1 
ATOM   5393 C  CA    . GLU A 1 669 ? 3.826   -3.462  -69.016 1.00 47.26  ? 669  GLU A CA    1 
ATOM   5394 C  C     . GLU A 1 669 ? 3.584   -2.426  -67.920 1.00 45.72  ? 669  GLU A C     1 
ATOM   5395 O  O     . GLU A 1 669 ? 3.842   -1.239  -68.113 1.00 44.98  ? 669  GLU A O     1 
ATOM   5396 C  CB    . GLU A 1 669 ? 2.532   -3.742  -69.780 1.00 52.31  ? 669  GLU A CB    1 
ATOM   5397 C  CG    . GLU A 1 669 ? 1.849   -2.493  -70.316 1.00 56.54  ? 669  GLU A CG    1 
ATOM   5398 C  CD    . GLU A 1 669 ? 0.574   -2.807  -71.071 1.00 62.52  ? 669  GLU A CD    1 
ATOM   5399 O  OE1   . GLU A 1 669 ? 0.529   -3.851  -71.753 1.00 67.01  ? 669  GLU A OE1   1 
ATOM   5400 O  OE2   . GLU A 1 669 ? -0.386  -2.013  -70.978 1.00 65.30  ? 669  GLU A OE2   1 
ATOM   5401 N  N     . MET A 1 670 ? 3.096   -2.883  -66.769 1.00 40.80  ? 670  MET A N     1 
ATOM   5402 C  CA    . MET A 1 670 ? 2.853   -1.992  -65.638 1.00 40.92  ? 670  MET A CA    1 
ATOM   5403 C  C     . MET A 1 670 ? 4.166   -1.421  -65.106 1.00 42.12  ? 670  MET A C     1 
ATOM   5404 O  O     . MET A 1 670 ? 4.232   -0.254  -64.716 1.00 42.04  ? 670  MET A O     1 
ATOM   5405 C  CB    . MET A 1 670 ? 2.112   -2.724  -64.517 1.00 40.36  ? 670  MET A CB    1 
ATOM   5406 C  CG    . MET A 1 670 ? 1.463   -1.792  -63.502 1.00 41.24  ? 670  MET A CG    1 
ATOM   5407 S  SD    . MET A 1 670 ? 0.787   -2.650  -62.069 1.00 45.08  ? 670  MET A SD    1 
ATOM   5408 C  CE    . MET A 1 670 ? 2.283   -3.010  -61.155 1.00 36.22  ? 670  MET A CE    1 
ATOM   5409 N  N     . CYS A 1 671 ? 5.203   -2.255  -65.093 1.00 41.80  ? 671  CYS A N     1 
ATOM   5410 C  CA    . CYS A 1 671 ? 6.531   -1.843  -64.654 1.00 41.42  ? 671  CYS A CA    1 
ATOM   5411 C  C     . CYS A 1 671 ? 7.095   -0.748  -65.554 1.00 42.91  ? 671  CYS A C     1 
ATOM   5412 O  O     . CYS A 1 671 ? 7.743   0.185   -65.080 1.00 42.34  ? 671  CYS A O     1 
ATOM   5413 C  CB    . CYS A 1 671 ? 7.479   -3.045  -64.627 1.00 42.95  ? 671  CYS A CB    1 
ATOM   5414 S  SG    . CYS A 1 671 ? 9.169   -2.670  -64.095 1.00 49.28  ? 671  CYS A SG    1 
ATOM   5415 N  N     . GLU A 1 672 ? 6.845   -0.865  -66.854 1.00 46.19  ? 672  GLU A N     1 
ATOM   5416 C  CA    . GLU A 1 672 ? 7.280   0.149   -67.810 1.00 50.57  ? 672  GLU A CA    1 
ATOM   5417 C  C     . GLU A 1 672 ? 6.444   1.418   -67.663 1.00 46.38  ? 672  GLU A C     1 
ATOM   5418 O  O     . GLU A 1 672 ? 6.959   2.531   -67.775 1.00 42.19  ? 672  GLU A O     1 
ATOM   5419 C  CB    . GLU A 1 672 ? 7.195   -0.388  -69.240 1.00 58.04  ? 672  GLU A CB    1 
ATOM   5420 C  CG    . GLU A 1 672 ? 7.658   0.595   -70.307 1.00 67.87  ? 672  GLU A CG    1 
ATOM   5421 C  CD    . GLU A 1 672 ? 7.808   -0.053  -71.673 1.00 78.99  ? 672  GLU A CD    1 
ATOM   5422 O  OE1   . GLU A 1 672 ? 7.951   -1.294  -71.730 1.00 82.94  ? 672  GLU A OE1   1 
ATOM   5423 O  OE2   . GLU A 1 672 ? 7.783   0.676   -72.689 1.00 84.38  ? 672  GLU A OE2   1 
ATOM   5424 N  N     . TYR A 1 673 ? 5.153   1.236   -67.400 1.00 44.75  ? 673  TYR A N     1 
ATOM   5425 C  CA    . TYR A 1 673 ? 4.223   2.340   -67.175 1.00 41.97  ? 673  TYR A CA    1 
ATOM   5426 C  C     . TYR A 1 673 ? 4.686   3.224   -66.012 1.00 39.64  ? 673  TYR A C     1 
ATOM   5427 O  O     . TYR A 1 673 ? 4.628   4.454   -66.090 1.00 37.84  ? 673  TYR A O     1 
ATOM   5428 C  CB    . TYR A 1 673 ? 2.835   1.775   -66.872 1.00 42.65  ? 673  TYR A CB    1 
ATOM   5429 C  CG    . TYR A 1 673 ? 1.710   2.784   -66.866 1.00 42.58  ? 673  TYR A CG    1 
ATOM   5430 C  CD1   . TYR A 1 673 ? 1.811   3.984   -67.560 1.00 44.20  ? 673  TYR A CD1   1 
ATOM   5431 C  CD2   . TYR A 1 673 ? 0.540   2.532   -66.160 1.00 42.24  ? 673  TYR A CD2   1 
ATOM   5432 C  CE1   . TYR A 1 673 ? 0.772   4.906   -67.553 1.00 43.63  ? 673  TYR A CE1   1 
ATOM   5433 C  CE2   . TYR A 1 673 ? -0.499  3.443   -66.146 1.00 42.92  ? 673  TYR A CE2   1 
ATOM   5434 C  CZ    . TYR A 1 673 ? -0.380  4.627   -66.843 1.00 42.33  ? 673  TYR A CZ    1 
ATOM   5435 O  OH    . TYR A 1 673 ? -1.421  5.527   -66.821 1.00 42.49  ? 673  TYR A OH    1 
ATOM   5436 N  N     . MET A 1 674 ? 5.145   2.584   -64.938 1.00 36.28  ? 674  MET A N     1 
ATOM   5437 C  CA    . MET A 1 674 ? 5.611   3.289   -63.747 1.00 35.55  ? 674  MET A CA    1 
ATOM   5438 C  C     . MET A 1 674 ? 7.117   3.557   -63.779 1.00 37.13  ? 674  MET A C     1 
ATOM   5439 O  O     . MET A 1 674 ? 7.671   4.084   -62.813 1.00 39.57  ? 674  MET A O     1 
ATOM   5440 C  CB    . MET A 1 674 ? 5.262   2.492   -62.481 1.00 35.18  ? 674  MET A CB    1 
ATOM   5441 C  CG    . MET A 1 674 ? 3.774   2.424   -62.159 1.00 33.84  ? 674  MET A CG    1 
ATOM   5442 S  SD    . MET A 1 674 ? 3.082   4.024   -61.701 1.00 39.80  ? 674  MET A SD    1 
ATOM   5443 C  CE    . MET A 1 674 ? 1.947   4.280   -63.059 1.00 42.12  ? 674  MET A CE    1 
ATOM   5444 N  N     . ASN A 1 675 ? 7.767   3.188   -64.883 1.00 37.74  ? 675  ASN A N     1 
ATOM   5445 C  CA    . ASN A 1 675 ? 9.215   3.357   -65.051 1.00 38.22  ? 675  ASN A CA    1 
ATOM   5446 C  C     . ASN A 1 675 ? 10.014  2.806   -63.869 1.00 40.65  ? 675  ASN A C     1 
ATOM   5447 O  O     . ASN A 1 675 ? 10.977  3.424   -63.417 1.00 42.45  ? 675  ASN A O     1 
ATOM   5448 C  CB    . ASN A 1 675 ? 9.563   4.833   -65.283 1.00 38.20  ? 675  ASN A CB    1 
ATOM   5449 C  CG    . ASN A 1 675 ? 10.968  5.030   -65.837 1.00 41.32  ? 675  ASN A CG    1 
ATOM   5450 O  OD1   . ASN A 1 675 ? 11.513  4.153   -66.508 1.00 40.05  ? 675  ASN A OD1   1 
ATOM   5451 N  ND2   . ASN A 1 675 ? 11.561  6.186   -65.550 1.00 40.54  ? 675  ASN A ND2   1 
ATOM   5452 N  N     . ASN A 1 676 ? 9.602   1.644   -63.367 1.00 37.54  ? 676  ASN A N     1 
ATOM   5453 C  CA    . ASN A 1 676 ? 10.209  1.064   -62.170 1.00 36.12  ? 676  ASN A CA    1 
ATOM   5454 C  C     . ASN A 1 676 ? 11.610  0.487   -62.386 1.00 38.49  ? 676  ASN A C     1 
ATOM   5455 O  O     . ASN A 1 676 ? 11.987  0.129   -63.502 1.00 42.66  ? 676  ASN A O     1 
ATOM   5456 C  CB    . ASN A 1 676 ? 9.296   0.001   -61.554 1.00 36.96  ? 676  ASN A CB    1 
ATOM   5457 C  CG    . ASN A 1 676 ? 7.993   0.578   -61.032 1.00 35.96  ? 676  ASN A CG    1 
ATOM   5458 O  OD1   . ASN A 1 676 ? 6.940   -0.043  -61.151 1.00 37.30  ? 676  ASN A OD1   1 
ATOM   5459 N  ND2   . ASN A 1 676 ? 8.059   1.775   -60.454 1.00 34.75  ? 676  ASN A ND2   1 
ATOM   5460 N  N     . LYS A 1 677 ? 12.370  0.396   -61.299 1.00 37.18  ? 677  LYS A N     1 
ATOM   5461 C  CA    . LYS A 1 677 ? 13.758  -0.048  -61.354 1.00 39.51  ? 677  LYS A CA    1 
ATOM   5462 C  C     . LYS A 1 677 ? 13.896  -1.498  -61.812 1.00 41.03  ? 677  LYS A C     1 
ATOM   5463 O  O     . LYS A 1 677 ? 14.798  -1.827  -62.578 1.00 40.04  ? 677  LYS A O     1 
ATOM   5464 C  CB    . LYS A 1 677 ? 14.432  0.137   -59.989 1.00 41.51  ? 677  LYS A CB    1 
ATOM   5465 C  CG    . LYS A 1 677 ? 15.889  -0.301  -59.958 1.00 45.40  ? 677  LYS A CG    1 
ATOM   5466 C  CD    . LYS A 1 677 ? 16.559  0.036   -58.636 1.00 47.56  ? 677  LYS A CD    1 
ATOM   5467 C  CE    . LYS A 1 677 ? 18.040  -0.329  -58.675 1.00 52.08  ? 677  LYS A CE    1 
ATOM   5468 N  NZ    . LYS A 1 677 ? 18.766  0.112   -57.453 1.00 53.40  ? 677  LYS A NZ    1 
ATOM   5469 N  N     . GLN A 1 678 ? 13.003  -2.364  -61.346 1.00 42.88  ? 678  GLN A N     1 
ATOM   5470 C  CA    . GLN A 1 678 ? 13.099  -3.787  -61.672 1.00 47.65  ? 678  GLN A CA    1 
ATOM   5471 C  C     . GLN A 1 678 ? 11.763  -4.514  -61.544 1.00 45.07  ? 678  GLN A C     1 
ATOM   5472 O  O     . GLN A 1 678 ? 11.098  -4.426  -60.516 1.00 40.80  ? 678  GLN A O     1 
ATOM   5473 C  CB    . GLN A 1 678 ? 14.140  -4.474  -60.781 1.00 47.51  ? 678  GLN A CB    1 
ATOM   5474 C  CG    . GLN A 1 678 ? 14.299  -5.959  -61.064 1.00 50.87  ? 678  GLN A CG    1 
ATOM   5475 C  CD    . GLN A 1 678 ? 15.312  -6.629  -60.155 1.00 52.45  ? 678  GLN A CD    1 
ATOM   5476 O  OE1   . GLN A 1 678 ? 15.748  -6.052  -59.158 1.00 50.73  ? 678  GLN A OE1   1 
ATOM   5477 N  NE2   . GLN A 1 678 ? 15.695  -7.853  -60.499 1.00 55.40  ? 678  GLN A NE2   1 
ATOM   5478 N  N     . HIS A 1 679 ? 11.387  -5.238  -62.595 1.00 44.88  ? 679  HIS A N     1 
ATOM   5479 C  CA    . HIS A 1 679 ? 10.173  -6.050  -62.587 1.00 43.88  ? 679  HIS A CA    1 
ATOM   5480 C  C     . HIS A 1 679 ? 10.249  -7.159  -61.539 1.00 42.79  ? 679  HIS A C     1 
ATOM   5481 O  O     . HIS A 1 679 ? 11.006  -8.118  -61.692 1.00 43.86  ? 679  HIS A O     1 
ATOM   5482 C  CB    . HIS A 1 679 ? 9.935   -6.655  -63.974 1.00 42.94  ? 679  HIS A CB    1 
ATOM   5483 C  CG    . HIS A 1 679 ? 8.887   -7.727  -63.995 1.00 42.21  ? 679  HIS A CG    1 
ATOM   5484 N  ND1   . HIS A 1 679 ? 7.636   -7.555  -63.449 1.00 41.27  ? 679  HIS A ND1   1 
ATOM   5485 C  CD2   . HIS A 1 679 ? 8.912   -8.983  -64.502 1.00 40.97  ? 679  HIS A CD2   1 
ATOM   5486 C  CE1   . HIS A 1 679 ? 6.931   -8.663  -63.614 1.00 43.33  ? 679  HIS A CE1   1 
ATOM   5487 N  NE2   . HIS A 1 679 ? 7.681   -9.542  -64.251 1.00 42.94  ? 679  HIS A NE2   1 
ATOM   5488 N  N     . LEU A 1 680 ? 9.465   -7.028  -60.472 1.00 37.30  ? 680  LEU A N     1 
ATOM   5489 C  CA    . LEU A 1 680 ? 9.457   -8.036  -59.413 1.00 38.06  ? 680  LEU A CA    1 
ATOM   5490 C  C     . LEU A 1 680 ? 8.051   -8.466  -58.998 1.00 37.05  ? 680  LEU A C     1 
ATOM   5491 O  O     . LEU A 1 680 ? 7.870   -9.094  -57.953 1.00 33.07  ? 680  LEU A O     1 
ATOM   5492 C  CB    . LEU A 1 680 ? 10.242  -7.546  -58.192 1.00 36.29  ? 680  LEU A CB    1 
ATOM   5493 C  CG    . LEU A 1 680 ? 11.742  -7.376  -58.426 1.00 41.52  ? 680  LEU A CG    1 
ATOM   5494 C  CD1   . LEU A 1 680 ? 12.409  -6.755  -57.220 1.00 38.49  ? 680  LEU A CD1   1 
ATOM   5495 C  CD2   . LEU A 1 680 ? 12.383  -8.719  -58.765 1.00 44.80  ? 680  LEU A CD2   1 
ATOM   5496 N  N     . MET A 1 681 ? 7.059   -8.127  -59.816 1.00 38.88  ? 681  MET A N     1 
ATOM   5497 C  CA    . MET A 1 681 ? 5.694   -8.584  -59.579 1.00 39.42  ? 681  MET A CA    1 
ATOM   5498 C  C     . MET A 1 681 ? 5.521   -9.998  -60.120 1.00 40.41  ? 681  MET A C     1 
ATOM   5499 O  O     . MET A 1 681 ? 5.161   -10.187 -61.282 1.00 41.93  ? 681  MET A O     1 
ATOM   5500 C  CB    . MET A 1 681 ? 4.681   -7.639  -60.230 1.00 39.40  ? 681  MET A CB    1 
ATOM   5501 C  CG    . MET A 1 681 ? 4.648   -6.231  -59.639 1.00 39.75  ? 681  MET A CG    1 
ATOM   5502 S  SD    . MET A 1 681 ? 4.067   -6.170  -57.928 1.00 33.66  ? 681  MET A SD    1 
ATOM   5503 C  CE    . MET A 1 681 ? 5.619   -6.160  -57.022 1.00 27.99  ? 681  MET A CE    1 
ATOM   5504 N  N     . PHE A 1 682 ? 5.786   -10.986 -59.269 1.00 40.14  ? 682  PHE A N     1 
ATOM   5505 C  CA    . PHE A 1 682 ? 5.715   -12.391 -59.662 1.00 43.25  ? 682  PHE A CA    1 
ATOM   5506 C  C     . PHE A 1 682 ? 4.464   -13.066 -59.100 1.00 41.63  ? 682  PHE A C     1 
ATOM   5507 O  O     . PHE A 1 682 ? 4.408   -13.430 -57.922 1.00 40.87  ? 682  PHE A O     1 
ATOM   5508 C  CB    . PHE A 1 682 ? 6.980   -13.137 -59.223 1.00 42.25  ? 682  PHE A CB    1 
ATOM   5509 C  CG    . PHE A 1 682 ? 8.257   -12.507 -59.715 1.00 44.43  ? 682  PHE A CG    1 
ATOM   5510 C  CD1   . PHE A 1 682 ? 8.302   -11.871 -60.946 1.00 43.01  ? 682  PHE A CD1   1 
ATOM   5511 C  CD2   . PHE A 1 682 ? 9.406   -12.538 -58.940 1.00 45.22  ? 682  PHE A CD2   1 
ATOM   5512 C  CE1   . PHE A 1 682 ? 9.471   -11.285 -61.401 1.00 45.99  ? 682  PHE A CE1   1 
ATOM   5513 C  CE2   . PHE A 1 682 ? 10.579  -11.952 -59.388 1.00 45.89  ? 682  PHE A CE2   1 
ATOM   5514 C  CZ    . PHE A 1 682 ? 10.610  -11.325 -60.620 1.00 46.01  ? 682  PHE A CZ    1 
ATOM   5515 N  N     . MET A 1 683 ? 3.462   -13.224 -59.957 1.00 40.50  ? 683  MET A N     1 
ATOM   5516 C  CA    . MET A 1 683 ? 2.187   -13.798 -59.555 1.00 46.16  ? 683  MET A CA    1 
ATOM   5517 C  C     . MET A 1 683 ? 2.001   -15.200 -60.128 1.00 50.13  ? 683  MET A C     1 
ATOM   5518 O  O     . MET A 1 683 ? 1.817   -15.373 -61.334 1.00 51.93  ? 683  MET A O     1 
ATOM   5519 C  CB    . MET A 1 683 ? 1.036   -12.881 -59.978 1.00 48.31  ? 683  MET A CB    1 
ATOM   5520 C  CG    . MET A 1 683 ? -0.340  -13.506 -59.863 1.00 50.42  ? 683  MET A CG    1 
ATOM   5521 S  SD    . MET A 1 683 ? -1.667  -12.320 -60.148 1.00 43.63  ? 683  MET A SD    1 
ATOM   5522 C  CE    . MET A 1 683 ? -1.911  -11.679 -58.495 1.00 154.09 ? 683  MET A CE    1 
ATOM   5523 N  N     . ASP A 1 684 ? 2.054   -16.196 -59.247 1.00 54.19  ? 684  ASP A N     1 
ATOM   5524 C  CA    . ASP A 1 684 ? 1.921   -17.592 -59.643 1.00 55.80  ? 684  ASP A CA    1 
ATOM   5525 C  C     . ASP A 1 684 ? 0.615   -18.178 -59.125 1.00 52.54  ? 684  ASP A C     1 
ATOM   5526 O  O     . ASP A 1 684 ? -0.041  -17.587 -58.262 1.00 51.93  ? 684  ASP A O     1 
ATOM   5527 C  CB    . ASP A 1 684 ? 3.106   -18.406 -59.117 1.00 62.06  ? 684  ASP A CB    1 
ATOM   5528 C  CG    . ASP A 1 684 ? 4.443   -17.829 -59.542 1.00 68.35  ? 684  ASP A CG    1 
ATOM   5529 O  OD1   . ASP A 1 684 ? 4.516   -17.240 -60.641 1.00 69.59  ? 684  ASP A OD1   1 
ATOM   5530 O  OD2   . ASP A 1 684 ? 5.421   -17.965 -58.775 1.00 71.43  ? 684  ASP A OD2   1 
ATOM   5531 N  N     . ARG A 1 685 ? 0.238   -19.343 -59.645 1.00 49.97  ? 685  ARG A N     1 
ATOM   5532 C  CA    . ARG A 1 685 ? -0.991  -19.988 -59.198 1.00 47.04  ? 685  ARG A CA    1 
ATOM   5533 C  C     . ARG A 1 685 ? -0.873  -20.489 -57.761 1.00 42.66  ? 685  ARG A C     1 
ATOM   5534 O  O     . ARG A 1 685 ? 0.157   -21.037 -57.361 1.00 37.57  ? 685  ARG A O     1 
ATOM   5535 C  CB    . ARG A 1 685 ? -1.400  -21.147 -60.115 1.00 50.53  ? 685  ARG A CB    1 
ATOM   5536 C  CG    . ARG A 1 685 ? -2.802  -21.656 -59.788 1.00 55.93  ? 685  ARG A CG    1 
ATOM   5537 C  CD    . ARG A 1 685 ? -2.954  -23.165 -59.964 1.00 60.30  ? 685  ARG A CD    1 
ATOM   5538 N  NE    . ARG A 1 685 ? -1.694  -23.897 -59.839 1.00 61.93  ? 685  ARG A NE    1 
ATOM   5539 C  CZ    . ARG A 1 685 ? -1.403  -24.763 -58.870 1.00 63.13  ? 685  ARG A CZ    1 
ATOM   5540 N  NH1   . ARG A 1 685 ? -2.277  -25.024 -57.906 1.00 60.17  ? 685  ARG A NH1   1 
ATOM   5541 N  NH2   . ARG A 1 685 ? -0.226  -25.377 -58.867 1.00 65.70  ? 685  ARG A NH2   1 
ATOM   5542 N  N     . GLU A 1 686 ? -1.934  -20.301 -56.986 1.00 43.53  ? 686  GLU A N     1 
ATOM   5543 C  CA    . GLU A 1 686 ? -1.954  -20.798 -55.620 1.00 43.17  ? 686  GLU A CA    1 
ATOM   5544 C  C     . GLU A 1 686 ? -2.776  -22.085 -55.559 1.00 38.12  ? 686  GLU A C     1 
ATOM   5545 O  O     . GLU A 1 686 ? -2.223  -23.180 -55.485 1.00 35.74  ? 686  GLU A O     1 
ATOM   5546 C  CB    . GLU A 1 686 ? -2.524  -19.743 -54.671 1.00 45.93  ? 686  GLU A CB    1 
ATOM   5547 C  CG    . GLU A 1 686 ? -2.148  -19.944 -53.206 1.00 53.95  ? 686  GLU A CG    1 
ATOM   5548 C  CD    . GLU A 1 686 ? -0.945  -19.107 -52.772 1.00 59.62  ? 686  GLU A CD    1 
ATOM   5549 O  OE1   . GLU A 1 686 ? 0.135   -19.208 -53.410 1.00 63.85  ? 686  GLU A OE1   1 
ATOM   5550 O  OE2   . GLU A 1 686 ? -1.095  -18.336 -51.796 1.00 59.02  ? 686  GLU A OE2   1 
ATOM   5551 N  N     . ALA A 1 687 ? -4.096  -21.952 -55.621 1.00 37.88  ? 687  ALA A N     1 
ATOM   5552 C  CA    . ALA A 1 687 ? -4.979  -23.091 -55.404 1.00 38.88  ? 687  ALA A CA    1 
ATOM   5553 C  C     . ALA A 1 687 ? -5.771  -23.509 -56.644 1.00 41.02  ? 687  ALA A C     1 
ATOM   5554 O  O     . ALA A 1 687 ? -6.209  -22.667 -57.430 1.00 36.05  ? 687  ALA A O     1 
ATOM   5555 C  CB    . ALA A 1 687 ? -5.929  -22.798 -54.255 1.00 35.05  ? 687  ALA A CB    1 
ATOM   5556 N  N     . ILE A 1 688 ? -5.945  -24.817 -56.809 1.00 36.55  ? 688  ILE A N     1 
ATOM   5557 C  CA    . ILE A 1 688 ? -6.924  -25.346 -57.752 1.00 41.78  ? 688  ILE A CA    1 
ATOM   5558 C  C     . ILE A 1 688 ? -8.043  -25.988 -56.946 1.00 42.51  ? 688  ILE A C     1 
ATOM   5559 O  O     . ILE A 1 688 ? -7.808  -26.934 -56.191 1.00 41.34  ? 688  ILE A O     1 
ATOM   5560 C  CB    . ILE A 1 688 ? -6.322  -26.399 -58.689 1.00 45.06  ? 688  ILE A CB    1 
ATOM   5561 C  CG1   . ILE A 1 688 ? -5.155  -25.810 -59.479 1.00 47.51  ? 688  ILE A CG1   1 
ATOM   5562 C  CG2   . ILE A 1 688 ? -7.383  -26.932 -59.644 1.00 40.51  ? 688  ILE A CG2   1 
ATOM   5563 C  CD1   . ILE A 1 688 ? -4.385  -26.827 -60.276 1.00 49.91  ? 688  ILE A CD1   1 
ATOM   5564 N  N     . ALA A 1 689 ? -9.256  -25.469 -57.100 1.00 36.89  ? 689  ALA A N     1 
ATOM   5565 C  CA    . ALA A 1 689 ? -10.384 -25.933 -56.307 1.00 37.70  ? 689  ALA A CA    1 
ATOM   5566 C  C     . ALA A 1 689 ? -11.550 -26.379 -57.179 1.00 40.35  ? 689  ALA A C     1 
ATOM   5567 O  O     . ALA A 1 689 ? -11.703 -25.925 -58.314 1.00 39.31  ? 689  ALA A O     1 
ATOM   5568 C  CB    . ALA A 1 689 ? -10.831 -24.846 -55.337 1.00 34.92  ? 689  ALA A CB    1 
ATOM   5569 N  N     . GLY A 1 690 ? -12.367 -27.278 -56.639 1.00 40.83  ? 690  GLY A N     1 
ATOM   5570 C  CA    . GLY A 1 690 ? -13.523 -27.787 -57.351 1.00 43.45  ? 690  GLY A CA    1 
ATOM   5571 C  C     . GLY A 1 690 ? -14.109 -29.010 -56.675 1.00 45.35  ? 690  GLY A C     1 
ATOM   5572 O  O     . GLY A 1 690 ? -13.475 -29.606 -55.806 1.00 43.51  ? 690  GLY A O     1 
ATOM   5573 N  N     . PRO A 1 691 ? -15.330 -29.392 -57.072 1.00 45.56  ? 691  PRO A N     1 
ATOM   5574 C  CA    . PRO A 1 691 ? -15.983 -30.584 -56.526 1.00 46.87  ? 691  PRO A CA    1 
ATOM   5575 C  C     . PRO A 1 691 ? -15.371 -31.848 -57.112 1.00 49.17  ? 691  PRO A C     1 
ATOM   5576 O  O     . PRO A 1 691 ? -14.760 -31.778 -58.179 1.00 48.15  ? 691  PRO A O     1 
ATOM   5577 C  CB    . PRO A 1 691 ? -17.421 -30.440 -57.022 1.00 48.98  ? 691  PRO A CB    1 
ATOM   5578 C  CG    . PRO A 1 691 ? -17.287 -29.701 -58.309 1.00 46.63  ? 691  PRO A CG    1 
ATOM   5579 C  CD    . PRO A 1 691 ? -16.156 -28.728 -58.097 1.00 43.33  ? 691  PRO A CD    1 
ATOM   5580 N  N     . PRO A 1 692 ? -15.519 -32.989 -56.418 1.00 47.88  ? 692  PRO A N     1 
ATOM   5581 C  CA    . PRO A 1 692 ? -15.096 -34.272 -56.987 1.00 48.53  ? 692  PRO A CA    1 
ATOM   5582 C  C     . PRO A 1 692 ? -15.853 -34.527 -58.282 1.00 52.88  ? 692  PRO A C     1 
ATOM   5583 O  O     . PRO A 1 692 ? -17.030 -34.174 -58.370 1.00 53.68  ? 692  PRO A O     1 
ATOM   5584 C  CB    . PRO A 1 692 ? -15.522 -35.284 -55.919 1.00 47.73  ? 692  PRO A CB    1 
ATOM   5585 C  CG    . PRO A 1 692 ? -15.558 -34.499 -54.650 1.00 46.40  ? 692  PRO A CG    1 
ATOM   5586 C  CD    . PRO A 1 692 ? -16.027 -33.130 -55.042 1.00 44.85  ? 692  PRO A CD    1 
ATOM   5587 N  N     . LEU A 1 693 ? -15.190 -35.112 -59.275 1.00 53.25  ? 693  LEU A N     1 
ATOM   5588 C  CA    . LEU A 1 693 ? -15.824 -35.359 -60.564 1.00 58.78  ? 693  LEU A CA    1 
ATOM   5589 C  C     . LEU A 1 693 ? -17.015 -36.301 -60.413 1.00 61.11  ? 693  LEU A C     1 
ATOM   5590 O  O     . LEU A 1 693 ? -16.920 -37.326 -59.739 1.00 63.92  ? 693  LEU A O     1 
ATOM   5591 C  CB    . LEU A 1 693 ? -14.816 -35.936 -61.560 1.00 60.01  ? 693  LEU A CB    1 
ATOM   5592 C  CG    . LEU A 1 693 ? -15.327 -36.093 -62.995 1.00 63.12  ? 693  LEU A CG    1 
ATOM   5593 C  CD1   . LEU A 1 693 ? -15.612 -34.734 -63.623 1.00 63.44  ? 693  LEU A CD1   1 
ATOM   5594 C  CD2   . LEU A 1 693 ? -14.345 -36.882 -63.842 1.00 63.98  ? 693  LEU A CD2   1 
ATOM   5595 N  N     . GLY A 1 694 ? -18.137 -35.939 -61.029 1.00 60.57  ? 694  GLY A N     1 
ATOM   5596 C  CA    . GLY A 1 694 ? -19.335 -36.758 -60.991 1.00 61.58  ? 694  GLY A CA    1 
ATOM   5597 C  C     . GLY A 1 694 ? -20.084 -36.689 -59.674 1.00 61.06  ? 694  GLY A C     1 
ATOM   5598 O  O     . GLY A 1 694 ? -20.950 -37.520 -59.402 1.00 62.59  ? 694  GLY A O     1 
ATOM   5599 N  N     . SER A 1 695 ? -19.754 -35.695 -58.855 1.00 57.61  ? 695  SER A N     1 
ATOM   5600 C  CA    . SER A 1 695 ? -20.393 -35.526 -57.553 1.00 56.83  ? 695  SER A CA    1 
ATOM   5601 C  C     . SER A 1 695 ? -21.410 -34.390 -57.576 1.00 55.29  ? 695  SER A C     1 
ATOM   5602 O  O     . SER A 1 695 ? -21.548 -33.687 -58.574 1.00 53.31  ? 695  SER A O     1 
ATOM   5603 C  CB    . SER A 1 695 ? -19.344 -35.240 -56.476 1.00 54.44  ? 695  SER A CB    1 
ATOM   5604 O  OG    . SER A 1 695 ? -18.800 -33.939 -56.640 1.00 53.60  ? 695  SER A OG    1 
ATOM   5605 N  N     . LYS A 1 696 ? -22.113 -34.211 -56.462 1.00 56.08  ? 696  LYS A N     1 
ATOM   5606 C  CA    . LYS A 1 696 ? -23.058 -33.108 -56.321 1.00 55.83  ? 696  LYS A CA    1 
ATOM   5607 C  C     . LYS A 1 696 ? -22.462 -31.988 -55.470 1.00 54.97  ? 696  LYS A C     1 
ATOM   5608 O  O     . LYS A 1 696 ? -23.177 -31.103 -54.998 1.00 52.49  ? 696  LYS A O     1 
ATOM   5609 C  CB    . LYS A 1 696 ? -24.371 -33.596 -55.707 1.00 55.93  ? 696  LYS A CB    1 
ATOM   5610 N  N     . GLY A 1 697 ? -21.149 -32.035 -55.271 1.00 54.34  ? 697  GLY A N     1 
ATOM   5611 C  CA    . GLY A 1 697 ? -20.462 -31.001 -54.519 1.00 51.31  ? 697  GLY A CA    1 
ATOM   5612 C  C     . GLY A 1 697 ? -20.459 -29.684 -55.271 1.00 48.73  ? 697  GLY A C     1 
ATOM   5613 O  O     . GLY A 1 697 ? -20.423 -29.668 -56.500 1.00 47.78  ? 697  GLY A O     1 
ATOM   5614 N  N     . ILE A 1 698 ? -20.500 -28.575 -54.537 1.00 47.17  ? 698  ILE A N     1 
ATOM   5615 C  CA    . ILE A 1 698 ? -20.536 -27.254 -55.163 1.00 44.27  ? 698  ILE A CA    1 
ATOM   5616 C  C     . ILE A 1 698 ? -19.139 -26.662 -55.333 1.00 41.77  ? 698  ILE A C     1 
ATOM   5617 O  O     . ILE A 1 698 ? -18.970 -25.632 -55.981 1.00 40.92  ? 698  ILE A O     1 
ATOM   5618 C  CB    . ILE A 1 698 ? -21.408 -26.269 -54.368 1.00 42.57  ? 698  ILE A CB    1 
ATOM   5619 C  CG1   . ILE A 1 698 ? -20.799 -26.016 -52.989 1.00 36.66  ? 698  ILE A CG1   1 
ATOM   5620 C  CG2   . ILE A 1 698 ? -22.826 -26.800 -54.242 1.00 44.96  ? 698  ILE A CG2   1 
ATOM   5621 C  CD1   . ILE A 1 698 ? -21.549 -24.995 -52.162 1.00 35.69  ? 698  ILE A CD1   1 
ATOM   5622 N  N     . GLY A 1 699 ? -18.142 -27.310 -54.742 1.00 39.42  ? 699  GLY A N     1 
ATOM   5623 C  CA    . GLY A 1 699 ? -16.761 -26.902 -54.927 1.00 41.84  ? 699  GLY A CA    1 
ATOM   5624 C  C     . GLY A 1 699 ? -16.296 -25.774 -54.028 1.00 41.13  ? 699  GLY A C     1 
ATOM   5625 O  O     . GLY A 1 699 ? -15.243 -25.870 -53.397 1.00 41.80  ? 699  GLY A O     1 
ATOM   5626 N  N     . GLY A 1 700 ? -17.072 -24.697 -53.970 1.00 37.88  ? 700  GLY A N     1 
ATOM   5627 C  CA    . GLY A 1 700 ? -16.697 -23.544 -53.170 1.00 35.92  ? 700  GLY A CA    1 
ATOM   5628 C  C     . GLY A 1 700 ? -17.817 -22.533 -53.034 1.00 36.62  ? 700  GLY A C     1 
ATOM   5629 O  O     . GLY A 1 700 ? -18.814 -22.612 -53.749 1.00 41.33  ? 700  GLY A O     1 
ATOM   5630 N  N     . PHE A 1 701 ? -17.662 -21.596 -52.101 1.00 33.38  ? 701  PHE A N     1 
ATOM   5631 C  CA    . PHE A 1 701 ? -18.600 -20.484 -51.964 1.00 35.24  ? 701  PHE A CA    1 
ATOM   5632 C  C     . PHE A 1 701 ? -17.989 -19.283 -51.245 1.00 36.44  ? 701  PHE A C     1 
ATOM   5633 O  O     . PHE A 1 701 ? -17.062 -19.429 -50.447 1.00 32.44  ? 701  PHE A O     1 
ATOM   5634 C  CB    . PHE A 1 701 ? -19.900 -20.922 -51.267 1.00 36.05  ? 701  PHE A CB    1 
ATOM   5635 C  CG    . PHE A 1 701 ? -19.737 -21.270 -49.809 1.00 35.46  ? 701  PHE A CG    1 
ATOM   5636 C  CD1   . PHE A 1 701 ? -19.780 -20.282 -48.833 1.00 34.40  ? 701  PHE A CD1   1 
ATOM   5637 C  CD2   . PHE A 1 701 ? -19.580 -22.589 -49.411 1.00 36.54  ? 701  PHE A CD2   1 
ATOM   5638 C  CE1   . PHE A 1 701 ? -19.643 -20.597 -47.492 1.00 30.32  ? 701  PHE A CE1   1 
ATOM   5639 C  CE2   . PHE A 1 701 ? -19.444 -22.914 -48.066 1.00 35.77  ? 701  PHE A CE2   1 
ATOM   5640 C  CZ    . PHE A 1 701 ? -19.475 -21.915 -47.107 1.00 34.00  ? 701  PHE A CZ    1 
ATOM   5641 N  N     . TRP A 1 702 ? -18.527 -18.103 -51.542 1.00 34.83  ? 702  TRP A N     1 
ATOM   5642 C  CA    . TRP A 1 702 ? -18.174 -16.863 -50.861 1.00 34.04  ? 702  TRP A CA    1 
ATOM   5643 C  C     . TRP A 1 702 ? -19.420 -16.297 -50.188 1.00 34.77  ? 702  TRP A C     1 
ATOM   5644 O  O     . TRP A 1 702 ? -20.513 -16.376 -50.746 1.00 34.50  ? 702  TRP A O     1 
ATOM   5645 C  CB    . TRP A 1 702 ? -17.657 -15.835 -51.869 1.00 36.49  ? 702  TRP A CB    1 
ATOM   5646 C  CG    . TRP A 1 702 ? -16.169 -15.766 -51.983 1.00 36.41  ? 702  TRP A CG    1 
ATOM   5647 C  CD1   . TRP A 1 702 ? -15.344 -14.853 -51.390 1.00 32.86  ? 702  TRP A CD1   1 
ATOM   5648 C  CD2   . TRP A 1 702 ? -15.323 -16.635 -52.747 1.00 35.85  ? 702  TRP A CD2   1 
ATOM   5649 N  NE1   . TRP A 1 702 ? -14.038 -15.103 -51.734 1.00 33.17  ? 702  TRP A NE1   1 
ATOM   5650 C  CE2   . TRP A 1 702 ? -13.997 -16.191 -52.565 1.00 33.95  ? 702  TRP A CE2   1 
ATOM   5651 C  CE3   . TRP A 1 702 ? -15.558 -17.747 -53.562 1.00 38.49  ? 702  TRP A CE3   1 
ATOM   5652 C  CZ2   . TRP A 1 702 ? -12.910 -16.820 -53.168 1.00 35.45  ? 702  TRP A CZ2   1 
ATOM   5653 C  CZ3   . TRP A 1 702 ? -14.478 -18.369 -54.161 1.00 40.64  ? 702  TRP A CZ3   1 
ATOM   5654 C  CH2   . TRP A 1 702 ? -13.169 -17.904 -53.960 1.00 39.45  ? 702  TRP A CH2   1 
ATOM   5655 N  N     . THR A 1 703 ? -19.264 -15.727 -48.997 1.00 35.09  ? 703  THR A N     1 
ATOM   5656 C  CA    . THR A 1 703 ? -20.378 -15.044 -48.343 1.00 32.07  ? 703  THR A CA    1 
ATOM   5657 C  C     . THR A 1 703 ? -20.162 -13.533 -48.353 1.00 32.22  ? 703  THR A C     1 
ATOM   5658 O  O     . THR A 1 703 ? -21.107 -12.761 -48.215 1.00 30.26  ? 703  THR A O     1 
ATOM   5659 C  CB    . THR A 1 703 ? -20.605 -15.531 -46.885 1.00 33.71  ? 703  THR A CB    1 
ATOM   5660 O  OG1   . THR A 1 703 ? -19.677 -14.891 -45.994 1.00 34.19  ? 703  THR A OG1   1 
ATOM   5661 C  CG2   . THR A 1 703 ? -20.463 -17.049 -46.787 1.00 30.04  ? 703  THR A CG2   1 
ATOM   5662 N  N     . GLY A 1 704 ? -18.911 -13.118 -48.525 1.00 37.93  ? 704  GLY A N     1 
ATOM   5663 C  CA    . GLY A 1 704 ? -18.561 -11.707 -48.526 1.00 37.39  ? 704  GLY A CA    1 
ATOM   5664 C  C     . GLY A 1 704 ? -17.055 -11.544 -48.480 1.00 34.17  ? 704  GLY A C     1 
ATOM   5665 O  O     . GLY A 1 704 ? -16.326 -12.517 -48.665 1.00 36.62  ? 704  GLY A O     1 
ATOM   5666 N  N     . LYS A 1 705 ? -16.583 -10.324 -48.241 1.00 30.07  ? 705  LYS A N     1 
ATOM   5667 C  CA    . LYS A 1 705 ? -15.148 -10.085 -48.114 1.00 28.33  ? 705  LYS A CA    1 
ATOM   5668 C  C     . LYS A 1 705 ? -14.563 -10.915 -46.975 1.00 29.68  ? 705  LYS A C     1 
ATOM   5669 O  O     . LYS A 1 705 ? -15.144 -10.991 -45.891 1.00 29.25  ? 705  LYS A O     1 
ATOM   5670 C  CB    . LYS A 1 705 ? -14.853 -8.602  -47.878 1.00 27.02  ? 705  LYS A CB    1 
ATOM   5671 C  CG    . LYS A 1 705 ? -15.133 -7.699  -49.071 1.00 28.19  ? 705  LYS A CG    1 
ATOM   5672 C  CD    . LYS A 1 705 ? -14.769 -6.252  -48.749 1.00 30.96  ? 705  LYS A CD    1 
ATOM   5673 C  CE    . LYS A 1 705 ? -15.077 -5.325  -49.915 1.00 29.42  ? 705  LYS A CE    1 
ATOM   5674 N  NZ    . LYS A 1 705 ? -14.646 -3.932  -49.624 1.00 31.31  ? 705  LYS A NZ    1 
ATOM   5675 N  N     . LYS A 1 706 ? -13.426 -11.550 -47.247 1.00 28.64  ? 706  LYS A N     1 
ATOM   5676 C  CA    . LYS A 1 706 ? -12.673 -12.300 -46.249 1.00 25.52  ? 706  LYS A CA    1 
ATOM   5677 C  C     . LYS A 1 706 ? -13.456 -13.483 -45.670 1.00 25.61  ? 706  LYS A C     1 
ATOM   5678 O  O     . LYS A 1 706 ? -13.145 -13.974 -44.588 1.00 24.43  ? 706  LYS A O     1 
ATOM   5679 C  CB    . LYS A 1 706 ? -12.162 -11.360 -45.144 1.00 26.33  ? 706  LYS A CB    1 
ATOM   5680 C  CG    . LYS A 1 706 ? -11.262 -10.231 -45.673 1.00 25.66  ? 706  LYS A CG    1 
ATOM   5681 C  CD    . LYS A 1 706 ? -10.838 -9.278  -44.569 1.00 28.75  ? 706  LYS A CD    1 
ATOM   5682 C  CE    . LYS A 1 706 ? -9.987  -8.124  -45.104 1.00 32.55  ? 706  LYS A CE    1 
ATOM   5683 N  NZ    . LYS A 1 706 ? -8.560  -8.492  -45.343 1.00 30.77  ? 706  LYS A NZ    1 
ATOM   5684 N  N     . ARG A 1 707 ? -14.459 -13.948 -46.409 1.00 28.32  ? 707  ARG A N     1 
ATOM   5685 C  CA    . ARG A 1 707 ? -15.281 -15.067 -45.961 1.00 27.53  ? 707  ARG A CA    1 
ATOM   5686 C  C     . ARG A 1 707 ? -15.602 -16.032 -47.099 1.00 26.13  ? 707  ARG A C     1 
ATOM   5687 O  O     . ARG A 1 707 ? -16.471 -15.763 -47.923 1.00 30.84  ? 707  ARG A O     1 
ATOM   5688 C  CB    . ARG A 1 707 ? -16.569 -14.554 -45.306 1.00 28.66  ? 707  ARG A CB    1 
ATOM   5689 C  CG    . ARG A 1 707 ? -16.353 -13.943 -43.921 1.00 28.99  ? 707  ARG A CG    1 
ATOM   5690 C  CD    . ARG A 1 707 ? -17.651 -13.423 -43.310 1.00 31.45  ? 707  ARG A CD    1 
ATOM   5691 N  NE    . ARG A 1 707 ? -18.659 -14.473 -43.163 1.00 37.37  ? 707  ARG A NE    1 
ATOM   5692 C  CZ    . ARG A 1 707 ? -18.781 -15.253 -42.092 1.00 41.30  ? 707  ARG A CZ    1 
ATOM   5693 N  NH1   . ARG A 1 707 ? -17.955 -15.112 -41.061 1.00 37.12  ? 707  ARG A NH1   1 
ATOM   5694 N  NH2   . ARG A 1 707 ? -19.732 -16.177 -42.052 1.00 42.98  ? 707  ARG A NH2   1 
ATOM   5695 N  N     . TYR A 1 708 ? -14.901 -17.161 -47.135 1.00 26.33  ? 708  TYR A N     1 
ATOM   5696 C  CA    . TYR A 1 708 ? -15.108 -18.136 -48.196 1.00 30.26  ? 708  TYR A CA    1 
ATOM   5697 C  C     . TYR A 1 708 ? -14.581 -19.525 -47.842 1.00 33.37  ? 708  TYR A C     1 
ATOM   5698 O  O     . TYR A 1 708 ? -13.797 -19.692 -46.900 1.00 29.24  ? 708  TYR A O     1 
ATOM   5699 C  CB    . TYR A 1 708 ? -14.491 -17.643 -49.514 1.00 30.20  ? 708  TYR A CB    1 
ATOM   5700 C  CG    . TYR A 1 708 ? -13.001 -17.366 -49.450 1.00 32.66  ? 708  TYR A CG    1 
ATOM   5701 C  CD1   . TYR A 1 708 ? -12.077 -18.335 -49.831 1.00 35.10  ? 708  TYR A CD1   1 
ATOM   5702 C  CD2   . TYR A 1 708 ? -12.519 -16.136 -49.020 1.00 28.23  ? 708  TYR A CD2   1 
ATOM   5703 C  CE1   . TYR A 1 708 ? -10.714 -18.088 -49.780 1.00 32.63  ? 708  TYR A CE1   1 
ATOM   5704 C  CE2   . TYR A 1 708 ? -11.158 -15.878 -48.965 1.00 28.91  ? 708  TYR A CE2   1 
ATOM   5705 C  CZ    . TYR A 1 708 ? -10.260 -16.857 -49.349 1.00 34.83  ? 708  TYR A CZ    1 
ATOM   5706 O  OH    . TYR A 1 708 ? -8.906  -16.609 -49.290 1.00 34.14  ? 708  TYR A OH    1 
ATOM   5707 N  N     . ALA A 1 709 ? -15.038 -20.519 -48.599 1.00 28.35  ? 709  ALA A N     1 
ATOM   5708 C  CA    . ALA A 1 709 ? -14.576 -21.892 -48.452 1.00 30.30  ? 709  ALA A CA    1 
ATOM   5709 C  C     . ALA A 1 709 ? -14.346 -22.503 -49.828 1.00 33.22  ? 709  ALA A C     1 
ATOM   5710 O  O     . ALA A 1 709 ? -15.121 -22.264 -50.754 1.00 35.15  ? 709  ALA A O     1 
ATOM   5711 C  CB    . ALA A 1 709 ? -15.586 -22.721 -47.665 1.00 29.88  ? 709  ALA A CB    1 
ATOM   5712 N  N     . LEU A 1 710 ? -13.274 -23.282 -49.956 1.00 32.87  ? 710  LEU A N     1 
ATOM   5713 C  CA    . LEU A 1 710 ? -12.924 -23.932 -51.215 1.00 34.74  ? 710  LEU A CA    1 
ATOM   5714 C  C     . LEU A 1 710 ? -12.460 -25.366 -50.986 1.00 36.19  ? 710  LEU A C     1 
ATOM   5715 O  O     . LEU A 1 710 ? -11.795 -25.661 -49.990 1.00 34.09  ? 710  LEU A O     1 
ATOM   5716 C  CB    . LEU A 1 710 ? -11.808 -23.164 -51.927 1.00 36.40  ? 710  LEU A CB    1 
ATOM   5717 C  CG    . LEU A 1 710 ? -12.073 -21.748 -52.443 1.00 37.71  ? 710  LEU A CG    1 
ATOM   5718 C  CD1   . LEU A 1 710 ? -10.765 -21.115 -52.885 1.00 38.93  ? 710  LEU A CD1   1 
ATOM   5719 C  CD2   . LEU A 1 710 ? -13.074 -21.770 -53.589 1.00 37.36  ? 710  LEU A CD2   1 
ATOM   5720 N  N     . ASN A 1 711 ? -12.805 -26.246 -51.921 1.00 34.10  ? 711  ASN A N     1 
ATOM   5721 C  CA    . ASN A 1 711 ? -12.343 -27.629 -51.903 1.00 37.71  ? 711  ASN A CA    1 
ATOM   5722 C  C     . ASN A 1 711 ? -11.092 -27.767 -52.764 1.00 40.57  ? 711  ASN A C     1 
ATOM   5723 O  O     . ASN A 1 711 ? -11.184 -27.947 -53.977 1.00 40.63  ? 711  ASN A O     1 
ATOM   5724 C  CB    . ASN A 1 711 ? -13.438 -28.565 -52.421 1.00 35.47  ? 711  ASN A CB    1 
ATOM   5725 C  CG    . ASN A 1 711 ? -13.128 -30.028 -52.158 1.00 36.44  ? 711  ASN A CG    1 
ATOM   5726 O  OD1   . ASN A 1 711 ? -12.764 -30.406 -51.048 1.00 36.10  ? 711  ASN A OD1   1 
ATOM   5727 N  ND2   . ASN A 1 711 ? -13.257 -30.855 -53.187 1.00 39.51  ? 711  ASN A ND2   1 
ATOM   5728 N  N     . VAL A 1 712 ? -9.926  -27.687 -52.133 1.00 39.55  ? 712  VAL A N     1 
ATOM   5729 C  CA    . VAL A 1 712 ? -8.659  -27.602 -52.858 1.00 38.97  ? 712  VAL A CA    1 
ATOM   5730 C  C     . VAL A 1 712 ? -8.028  -28.969 -53.131 1.00 39.93  ? 712  VAL A C     1 
ATOM   5731 O  O     . VAL A 1 712 ? -7.973  -29.821 -52.246 1.00 38.32  ? 712  VAL A O     1 
ATOM   5732 C  CB    . VAL A 1 712 ? -7.654  -26.723 -52.088 1.00 37.80  ? 712  VAL A CB    1 
ATOM   5733 C  CG1   . VAL A 1 712 ? -6.348  -26.595 -52.856 1.00 35.70  ? 712  VAL A CG1   1 
ATOM   5734 C  CG2   . VAL A 1 712 ? -8.260  -25.348 -51.811 1.00 32.47  ? 712  VAL A CG2   1 
ATOM   5735 N  N     . TRP A 1 713 ? -7.547  -29.161 -54.358 1.00 37.04  ? 713  TRP A N     1 
ATOM   5736 C  CA    . TRP A 1 713 ? -6.861  -30.390 -54.747 1.00 38.38  ? 713  TRP A CA    1 
ATOM   5737 C  C     . TRP A 1 713 ? -5.359  -30.176 -54.896 1.00 41.81  ? 713  TRP A C     1 
ATOM   5738 O  O     . TRP A 1 713 ? -4.567  -31.101 -54.709 1.00 40.10  ? 713  TRP A O     1 
ATOM   5739 C  CB    . TRP A 1 713 ? -7.443  -30.931 -56.052 1.00 43.70  ? 713  TRP A CB    1 
ATOM   5740 C  CG    . TRP A 1 713 ? -8.895  -31.260 -55.942 1.00 45.03  ? 713  TRP A CG    1 
ATOM   5741 C  CD1   . TRP A 1 713 ? -9.945  -30.415 -56.154 1.00 41.86  ? 713  TRP A CD1   1 
ATOM   5742 C  CD2   . TRP A 1 713 ? -9.464  -32.523 -55.572 1.00 48.45  ? 713  TRP A CD2   1 
ATOM   5743 N  NE1   . TRP A 1 713 ? -11.132 -31.075 -55.948 1.00 43.36  ? 713  TRP A NE1   1 
ATOM   5744 C  CE2   . TRP A 1 713 ? -10.864 -32.371 -55.589 1.00 46.51  ? 713  TRP A CE2   1 
ATOM   5745 C  CE3   . TRP A 1 713 ? -8.924  -33.769 -55.233 1.00 49.68  ? 713  TRP A CE3   1 
ATOM   5746 C  CZ2   . TRP A 1 713 ? -11.732 -33.413 -55.278 1.00 41.78  ? 713  TRP A CZ2   1 
ATOM   5747 C  CZ3   . TRP A 1 713 ? -9.788  -34.804 -54.927 1.00 48.20  ? 713  TRP A CZ3   1 
ATOM   5748 C  CH2   . TRP A 1 713 ? -11.176 -34.620 -54.951 1.00 42.65  ? 713  TRP A CH2   1 
ATOM   5749 N  N     . ASP A 1 714 ? -4.969  -28.952 -55.236 1.00 41.73  ? 714  ASP A N     1 
ATOM   5750 C  CA    . ASP A 1 714 ? -3.559  -28.610 -55.376 1.00 41.63  ? 714  ASP A CA    1 
ATOM   5751 C  C     . ASP A 1 714 ? -3.296  -27.219 -54.810 1.00 40.65  ? 714  ASP A C     1 
ATOM   5752 O  O     . ASP A 1 714 ? -4.020  -26.271 -55.110 1.00 37.55  ? 714  ASP A O     1 
ATOM   5753 C  CB    . ASP A 1 714 ? -3.127  -28.675 -56.846 1.00 43.52  ? 714  ASP A CB    1 
ATOM   5754 C  CG    . ASP A 1 714 ? -1.613  -28.676 -57.013 1.00 45.66  ? 714  ASP A CG    1 
ATOM   5755 O  OD1   . ASP A 1 714 ? -0.974  -27.630 -56.757 1.00 42.77  ? 714  ASP A OD1   1 
ATOM   5756 O  OD2   . ASP A 1 714 ? -1.061  -29.724 -57.408 1.00 49.51  ? 714  ASP A OD2   1 
ATOM   5757 N  N     . MET A 1 715 ? -2.255  -27.105 -53.992 1.00 40.31  ? 715  MET A N     1 
ATOM   5758 C  CA    . MET A 1 715 ? -1.890  -25.831 -53.390 1.00 40.42  ? 715  MET A CA    1 
ATOM   5759 C  C     . MET A 1 715 ? -0.397  -25.567 -53.555 1.00 43.59  ? 715  MET A C     1 
ATOM   5760 O  O     . MET A 1 715 ? 0.429   -26.230 -52.927 1.00 46.31  ? 715  MET A O     1 
ATOM   5761 C  CB    . MET A 1 715 ? -2.266  -25.816 -51.905 1.00 39.21  ? 715  MET A CB    1 
ATOM   5762 C  CG    . MET A 1 715 ? -1.906  -24.527 -51.191 1.00 41.32  ? 715  MET A CG    1 
ATOM   5763 S  SD    . MET A 1 715 ? -2.876  -23.121 -51.770 1.00 47.39  ? 715  MET A SD    1 
ATOM   5764 C  CE    . MET A 1 715 ? -4.464  -23.474 -51.021 1.00 51.77  ? 715  MET A CE    1 
ATOM   5765 N  N     . GLU A 1 716 ? -0.063  -24.599 -54.407 1.00 41.76  ? 716  GLU A N     1 
ATOM   5766 C  CA    . GLU A 1 716 ? 1.324   -24.205 -54.651 1.00 43.51  ? 716  GLU A CA    1 
ATOM   5767 C  C     . GLU A 1 716 ? 2.213   -25.371 -55.077 1.00 43.51  ? 716  GLU A C     1 
ATOM   5768 O  O     . GLU A 1 716 ? 3.368   -25.462 -54.663 1.00 45.43  ? 716  GLU A O     1 
ATOM   5769 C  CB    . GLU A 1 716 ? 1.923   -23.511 -53.423 1.00 46.92  ? 716  GLU A CB    1 
ATOM   5770 C  CG    . GLU A 1 716 ? 1.290   -22.173 -53.091 1.00 54.17  ? 716  GLU A CG    1 
ATOM   5771 C  CD    . GLU A 1 716 ? 1.997   -21.457 -51.954 1.00 59.46  ? 716  GLU A CD    1 
ATOM   5772 O  OE1   . GLU A 1 716 ? 2.680   -20.445 -52.223 1.00 63.00  ? 716  GLU A OE1   1 
ATOM   5773 O  OE2   . GLU A 1 716 ? 1.866   -21.901 -50.793 1.00 60.41  ? 716  GLU A OE2   1 
ATOM   5774 N  N     . GLY A 1 717 ? 1.669   -26.263 -55.897 1.00 42.38  ? 717  GLY A N     1 
ATOM   5775 C  CA    . GLY A 1 717 ? 2.440   -27.372 -56.427 1.00 42.71  ? 717  GLY A CA    1 
ATOM   5776 C  C     . GLY A 1 717 ? 2.348   -28.640 -55.600 1.00 45.65  ? 717  GLY A C     1 
ATOM   5777 O  O     . GLY A 1 717 ? 2.878   -29.680 -55.989 1.00 45.35  ? 717  GLY A O     1 
ATOM   5778 N  N     . THR A 1 718 ? 1.683   -28.559 -54.453 1.00 43.76  ? 718  THR A N     1 
ATOM   5779 C  CA    . THR A 1 718 ? 1.482   -29.741 -53.624 1.00 45.50  ? 718  THR A CA    1 
ATOM   5780 C  C     . THR A 1 718 ? 0.166   -30.421 -53.990 1.00 45.14  ? 718  THR A C     1 
ATOM   5781 O  O     . THR A 1 718 ? -0.912  -29.874 -53.752 1.00 40.36  ? 718  THR A O     1 
ATOM   5782 C  CB    . THR A 1 718 ? 1.491   -29.396 -52.123 1.00 44.43  ? 718  THR A CB    1 
ATOM   5783 O  OG1   . THR A 1 718 ? 2.730   -28.759 -51.781 1.00 45.19  ? 718  THR A OG1   1 
ATOM   5784 C  CG2   . THR A 1 718 ? 1.321   -30.653 -51.281 1.00 39.51  ? 718  THR A CG2   1 
ATOM   5785 N  N     . ARG A 1 719 ? 0.265   -31.610 -54.580 1.00 41.06  ? 719  ARG A N     1 
ATOM   5786 C  CA    . ARG A 1 719 ? -0.908  -32.386 -54.971 1.00 41.56  ? 719  ARG A CA    1 
ATOM   5787 C  C     . ARG A 1 719 ? -1.373  -33.252 -53.807 1.00 45.78  ? 719  ARG A C     1 
ATOM   5788 O  O     . ARG A 1 719 ? -0.722  -34.237 -53.457 1.00 48.08  ? 719  ARG A O     1 
ATOM   5789 C  CB    . ARG A 1 719 ? -0.587  -33.266 -56.183 1.00 48.43  ? 719  ARG A CB    1 
ATOM   5790 C  CG    . ARG A 1 719 ? -1.799  -33.959 -56.800 1.00 46.94  ? 719  ARG A CG    1 
ATOM   5791 C  CD    . ARG A 1 719 ? -2.769  -32.951 -57.413 1.00 43.63  ? 719  ARG A CD    1 
ATOM   5792 N  NE    . ARG A 1 719 ? -2.130  -32.117 -58.427 1.00 46.83  ? 719  ARG A NE    1 
ATOM   5793 C  CZ    . ARG A 1 719 ? -2.131  -32.388 -59.730 1.00 51.59  ? 719  ARG A CZ    1 
ATOM   5794 N  NH1   . ARG A 1 719 ? -2.743  -33.472 -60.185 1.00 53.09  ? 719  ARG A NH1   1 
ATOM   5795 N  NH2   . ARG A 1 719 ? -1.521  -31.573 -60.580 1.00 52.16  ? 719  ARG A NH2   1 
ATOM   5796 N  N     . TYR A 1 720 ? -2.501  -32.880 -53.211 1.00 43.71  ? 720  TYR A N     1 
ATOM   5797 C  CA    . TYR A 1 720 ? -3.011  -33.553 -52.020 1.00 45.51  ? 720  TYR A CA    1 
ATOM   5798 C  C     . TYR A 1 720 ? -3.454  -34.992 -52.290 1.00 48.90  ? 720  TYR A C     1 
ATOM   5799 O  O     . TYR A 1 720 ? -4.031  -35.292 -53.334 1.00 42.18  ? 720  TYR A O     1 
ATOM   5800 C  CB    . TYR A 1 720 ? -4.184  -32.762 -51.435 1.00 46.10  ? 720  TYR A CB    1 
ATOM   5801 C  CG    . TYR A 1 720 ? -3.810  -31.417 -50.845 1.00 47.34  ? 720  TYR A CG    1 
ATOM   5802 C  CD1   . TYR A 1 720 ? -2.682  -31.272 -50.046 1.00 48.72  ? 720  TYR A CD1   1 
ATOM   5803 C  CD2   . TYR A 1 720 ? -4.590  -30.293 -51.085 1.00 47.72  ? 720  TYR A CD2   1 
ATOM   5804 C  CE1   . TYR A 1 720 ? -2.341  -30.042 -49.502 1.00 47.62  ? 720  TYR A CE1   1 
ATOM   5805 C  CE2   . TYR A 1 720 ? -4.258  -29.059 -50.547 1.00 45.93  ? 720  TYR A CE2   1 
ATOM   5806 C  CZ    . TYR A 1 720 ? -3.133  -28.939 -49.757 1.00 47.19  ? 720  TYR A CZ    1 
ATOM   5807 O  OH    . TYR A 1 720 ? -2.798  -27.717 -49.217 1.00 48.53  ? 720  TYR A OH    1 
ATOM   5808 N  N     . ALA A 1 721 ? -3.184  -35.876 -51.334 1.00 51.35  ? 721  ALA A N     1 
ATOM   5809 C  CA    . ALA A 1 721 ? -3.657  -37.255 -51.403 1.00 57.77  ? 721  ALA A CA    1 
ATOM   5810 C  C     . ALA A 1 721 ? -5.169  -37.279 -51.230 1.00 56.91  ? 721  ALA A C     1 
ATOM   5811 O  O     . ALA A 1 721 ? -5.867  -38.082 -51.848 1.00 58.50  ? 721  ALA A O     1 
ATOM   5812 C  CB    . ALA A 1 721 ? -2.986  -38.098 -50.332 1.00 58.90  ? 721  ALA A CB    1 
ATOM   5813 N  N     . GLU A 1 722 ? -5.657  -36.390 -50.371 1.00 55.70  ? 722  GLU A N     1 
ATOM   5814 C  CA    . GLU A 1 722 ? -7.086  -36.184 -50.170 1.00 54.89  ? 722  GLU A CA    1 
ATOM   5815 C  C     . GLU A 1 722 ? -7.375  -34.688 -50.215 1.00 51.80  ? 722  GLU A C     1 
ATOM   5816 O  O     . GLU A 1 722 ? -6.560  -33.890 -49.753 1.00 50.23  ? 722  GLU A O     1 
ATOM   5817 C  CB    . GLU A 1 722 ? -7.530  -36.776 -48.831 1.00 59.14  ? 722  GLU A CB    1 
ATOM   5818 C  CG    . GLU A 1 722 ? -7.695  -38.286 -48.857 1.00 66.45  ? 722  GLU A CG    1 
ATOM   5819 C  CD    . GLU A 1 722 ? -8.838  -38.725 -49.752 1.00 73.34  ? 722  GLU A CD    1 
ATOM   5820 O  OE1   . GLU A 1 722 ? -9.963  -38.213 -49.571 1.00 75.27  ? 722  GLU A OE1   1 
ATOM   5821 O  OE2   . GLU A 1 722 ? -8.612  -39.574 -50.640 1.00 78.25  ? 722  GLU A OE2   1 
ATOM   5822 N  N     . PRO A 1 723 ? -8.536  -34.303 -50.772 1.00 50.37  ? 723  PRO A N     1 
ATOM   5823 C  CA    . PRO A 1 723 ? -8.861  -32.881 -50.917 1.00 47.97  ? 723  PRO A CA    1 
ATOM   5824 C  C     . PRO A 1 723 ? -8.897  -32.179 -49.568 1.00 46.60  ? 723  PRO A C     1 
ATOM   5825 O  O     . PRO A 1 723 ? -9.426  -32.724 -48.600 1.00 46.74  ? 723  PRO A O     1 
ATOM   5826 C  CB    . PRO A 1 723 ? -10.258 -32.903 -51.547 1.00 47.24  ? 723  PRO A CB    1 
ATOM   5827 C  CG    . PRO A 1 723 ? -10.823 -34.228 -51.172 1.00 47.08  ? 723  PRO A CG    1 
ATOM   5828 C  CD    . PRO A 1 723 ? -9.653  -35.166 -51.192 1.00 50.97  ? 723  PRO A CD    1 
ATOM   5829 N  N     . LYS A 1 724 ? -8.323  -30.982 -49.514 1.00 47.81  ? 724  LYS A N     1 
ATOM   5830 C  CA    . LYS A 1 724 ? -8.236  -30.218 -48.277 1.00 43.65  ? 724  LYS A CA    1 
ATOM   5831 C  C     . LYS A 1 724 ? -9.086  -28.955 -48.364 1.00 40.58  ? 724  LYS A C     1 
ATOM   5832 O  O     . LYS A 1 724 ? -9.012  -28.210 -49.341 1.00 39.79  ? 724  LYS A O     1 
ATOM   5833 C  CB    . LYS A 1 724 ? -6.776  -29.861 -47.994 1.00 46.99  ? 724  LYS A CB    1 
ATOM   5834 C  CG    . LYS A 1 724 ? -6.545  -29.068 -46.726 1.00 49.56  ? 724  LYS A CG    1 
ATOM   5835 C  CD    . LYS A 1 724 ? -5.064  -28.806 -46.526 1.00 55.57  ? 724  LYS A CD    1 
ATOM   5836 C  CE    . LYS A 1 724 ? -4.813  -27.969 -45.282 1.00 60.27  ? 724  LYS A CE    1 
ATOM   5837 N  NZ    . LYS A 1 724 ? -5.306  -28.645 -44.050 1.00 65.19  ? 724  LYS A NZ    1 
ATOM   5838 N  N     . LEU A 1 725 ? -9.900  -28.716 -47.342 1.00 33.93  ? 725  LEU A N     1 
ATOM   5839 C  CA    . LEU A 1 725 ? -10.742 -27.527 -47.326 1.00 35.93  ? 725  LEU A CA    1 
ATOM   5840 C  C     . LEU A 1 725 ? -9.904  -26.293 -47.025 1.00 35.80  ? 725  LEU A C     1 
ATOM   5841 O  O     . LEU A 1 725 ? -9.162  -26.259 -46.044 1.00 38.26  ? 725  LEU A O     1 
ATOM   5842 C  CB    . LEU A 1 725 ? -11.853 -27.657 -46.283 1.00 33.59  ? 725  LEU A CB    1 
ATOM   5843 C  CG    . LEU A 1 725 ? -12.795 -28.852 -46.406 1.00 35.68  ? 725  LEU A CG    1 
ATOM   5844 C  CD1   . LEU A 1 725 ? -13.829 -28.815 -45.290 1.00 33.64  ? 725  LEU A CD1   1 
ATOM   5845 C  CD2   . LEU A 1 725 ? -13.471 -28.862 -47.766 1.00 39.05  ? 725  LEU A CD2   1 
ATOM   5846 N  N     . LYS A 1 726 ? -10.006 -25.285 -47.880 1.00 33.50  ? 726  LYS A N     1 
ATOM   5847 C  CA    . LYS A 1 726 ? -9.421  -23.992 -47.571 1.00 34.49  ? 726  LYS A CA    1 
ATOM   5848 C  C     . LYS A 1 726 ? -10.550 -23.075 -47.135 1.00 33.55  ? 726  LYS A C     1 
ATOM   5849 O  O     . LYS A 1 726 ? -11.339 -22.608 -47.961 1.00 34.78  ? 726  LYS A O     1 
ATOM   5850 C  CB    . LYS A 1 726 ? -8.697  -23.402 -48.776 1.00 38.23  ? 726  LYS A CB    1 
ATOM   5851 C  CG    . LYS A 1 726 ? -8.083  -22.038 -48.502 1.00 39.60  ? 726  LYS A CG    1 
ATOM   5852 C  CD    . LYS A 1 726 ? -7.524  -21.414 -49.770 1.00 44.77  ? 726  LYS A CD    1 
ATOM   5853 C  CE    . LYS A 1 726 ? -6.920  -20.045 -49.487 1.00 47.90  ? 726  LYS A CE    1 
ATOM   5854 N  NZ    . LYS A 1 726 ? -5.839  -20.137 -48.465 1.00 51.27  ? 726  LYS A NZ    1 
ATOM   5855 N  N     . ILE A 1 727 ? -10.640 -22.840 -45.832 1.00 29.84  ? 727  ILE A N     1 
ATOM   5856 C  CA    . ILE A 1 727 ? -11.698 -22.000 -45.291 1.00 31.30  ? 727  ILE A CA    1 
ATOM   5857 C  C     . ILE A 1 727 ? -11.095 -20.759 -44.657 1.00 30.80  ? 727  ILE A C     1 
ATOM   5858 O  O     . ILE A 1 727 ? -10.198 -20.850 -43.820 1.00 29.98  ? 727  ILE A O     1 
ATOM   5859 C  CB    . ILE A 1 727 ? -12.544 -22.753 -44.252 1.00 31.54  ? 727  ILE A CB    1 
ATOM   5860 C  CG1   . ILE A 1 727 ? -12.953 -24.122 -44.799 1.00 29.89  ? 727  ILE A CG1   1 
ATOM   5861 C  CG2   . ILE A 1 727 ? -13.772 -21.935 -43.869 1.00 28.98  ? 727  ILE A CG2   1 
ATOM   5862 C  CD1   . ILE A 1 727 ? -13.639 -25.002 -43.780 1.00 28.65  ? 727  ILE A CD1   1 
ATOM   5863 N  N     . MET A 1 728 ? -11.585 -19.597 -45.071 1.00 30.61  ? 728  MET A N     1 
ATOM   5864 C  CA    . MET A 1 728 ? -11.085 -18.336 -44.550 1.00 28.34  ? 728  MET A CA    1 
ATOM   5865 C  C     . MET A 1 728 ? -12.215 -17.515 -43.940 1.00 26.56  ? 728  MET A C     1 
ATOM   5866 O  O     . MET A 1 728 ? -13.267 -17.343 -44.554 1.00 27.41  ? 728  MET A O     1 
ATOM   5867 C  CB    . MET A 1 728 ? -10.398 -17.537 -45.661 1.00 31.55  ? 728  MET A CB    1 
ATOM   5868 C  CG    . MET A 1 728 ? -9.390  -18.334 -46.477 1.00 35.12  ? 728  MET A CG    1 
ATOM   5869 S  SD    . MET A 1 728 ? -8.115  -19.137 -45.487 1.00 48.01  ? 728  MET A SD    1 
ATOM   5870 C  CE    . MET A 1 728 ? -7.388  -17.727 -44.660 1.00 35.95  ? 728  MET A CE    1 
ATOM   5871 N  N     . GLY A 1 729 ? -11.995 -17.018 -42.726 1.00 26.37  ? 729  GLY A N     1 
ATOM   5872 C  CA    . GLY A 1 729 ? -12.916 -16.079 -42.110 1.00 27.65  ? 729  GLY A CA    1 
ATOM   5873 C  C     . GLY A 1 729 ? -14.150 -16.685 -41.465 1.00 27.23  ? 729  GLY A C     1 
ATOM   5874 O  O     . GLY A 1 729 ? -14.677 -16.133 -40.498 1.00 25.95  ? 729  GLY A O     1 
ATOM   5875 N  N     . LEU A 1 730 ? -14.620 -17.813 -41.992 1.00 25.46  ? 730  LEU A N     1 
ATOM   5876 C  CA    . LEU A 1 730 ? -15.817 -18.452 -41.448 1.00 28.81  ? 730  LEU A CA    1 
ATOM   5877 C  C     . LEU A 1 730 ? -15.617 -18.897 -39.998 1.00 29.07  ? 730  LEU A C     1 
ATOM   5878 O  O     . LEU A 1 730 ? -14.487 -18.992 -39.518 1.00 30.51  ? 730  LEU A O     1 
ATOM   5879 C  CB    . LEU A 1 730 ? -16.259 -19.630 -42.321 1.00 23.39  ? 730  LEU A CB    1 
ATOM   5880 C  CG    . LEU A 1 730 ? -16.447 -19.329 -43.812 1.00 26.71  ? 730  LEU A CG    1 
ATOM   5881 C  CD1   . LEU A 1 730 ? -17.173 -20.478 -44.496 1.00 26.97  ? 730  LEU A CD1   1 
ATOM   5882 C  CD2   . LEU A 1 730 ? -17.193 -18.013 -44.025 1.00 23.77  ? 730  LEU A CD2   1 
ATOM   5883 N  N     . GLU A 1 731 ? -16.721 -19.168 -39.310 1.00 26.85  ? 731  GLU A N     1 
ATOM   5884 C  CA    . GLU A 1 731 ? -16.704 -19.450 -37.877 1.00 25.73  ? 731  GLU A CA    1 
ATOM   5885 C  C     . GLU A 1 731 ? -15.842 -20.650 -37.491 1.00 28.73  ? 731  GLU A C     1 
ATOM   5886 O  O     . GLU A 1 731 ? -15.353 -20.732 -36.360 1.00 24.74  ? 731  GLU A O     1 
ATOM   5887 C  CB    . GLU A 1 731 ? -18.134 -19.627 -37.354 1.00 29.21  ? 731  GLU A CB    1 
ATOM   5888 C  CG    . GLU A 1 731 ? -18.873 -18.316 -37.088 1.00 26.97  ? 731  GLU A CG    1 
ATOM   5889 C  CD    . GLU A 1 731 ? -19.276 -17.569 -38.356 1.00 34.39  ? 731  GLU A CD    1 
ATOM   5890 O  OE1   . GLU A 1 731 ? -19.076 -18.100 -39.469 1.00 32.66  ? 731  GLU A OE1   1 
ATOM   5891 O  OE2   . GLU A 1 731 ? -19.808 -16.443 -38.235 1.00 41.05  ? 731  GLU A OE2   1 
ATOM   5892 N  N     . THR A 1 732 ? -15.644 -21.566 -38.433 1.00 26.98  ? 732  THR A N     1 
ATOM   5893 C  CA    . THR A 1 732 ? -14.775 -22.719 -38.212 1.00 28.54  ? 732  THR A CA    1 
ATOM   5894 C  C     . THR A 1 732 ? -13.346 -22.290 -37.894 1.00 27.53  ? 732  THR A C     1 
ATOM   5895 O  O     . THR A 1 732 ? -12.588 -23.047 -37.291 1.00 26.64  ? 732  THR A O     1 
ATOM   5896 C  CB    . THR A 1 732 ? -14.739 -23.638 -39.449 1.00 31.25  ? 732  THR A CB    1 
ATOM   5897 O  OG1   . THR A 1 732 ? -14.424 -22.858 -40.611 1.00 33.13  ? 732  THR A OG1   1 
ATOM   5898 C  CG2   . THR A 1 732 ? -16.080 -24.303 -39.655 1.00 31.38  ? 732  THR A CG2   1 
ATOM   5899 N  N     . GLN A 1 733 ? -12.989 -21.070 -38.291 1.00 23.86  ? 733  GLN A N     1 
ATOM   5900 C  CA    . GLN A 1 733 ? -11.610 -20.601 -38.196 1.00 22.99  ? 733  GLN A CA    1 
ATOM   5901 C  C     . GLN A 1 733 ? -11.360 -19.728 -36.971 1.00 27.92  ? 733  GLN A C     1 
ATOM   5902 O  O     . GLN A 1 733 ? -10.235 -19.296 -36.732 1.00 29.03  ? 733  GLN A O     1 
ATOM   5903 C  CB    . GLN A 1 733 ? -11.246 -19.810 -39.455 1.00 21.70  ? 733  GLN A CB    1 
ATOM   5904 C  CG    . GLN A 1 733 ? -11.503 -20.562 -40.750 1.00 24.95  ? 733  GLN A CG    1 
ATOM   5905 C  CD    . GLN A 1 733 ? -10.920 -21.962 -40.721 1.00 29.18  ? 733  GLN A CD    1 
ATOM   5906 O  OE1   . GLN A 1 733 ? -11.655 -22.950 -40.668 1.00 29.56  ? 733  GLN A OE1   1 
ATOM   5907 N  NE2   . GLN A 1 733 ? -9.591  -22.055 -40.746 1.00 26.50  ? 733  GLN A NE2   1 
ATOM   5908 N  N     . LYS A 1 734 ? -12.411 -19.463 -36.202 1.00 24.71  ? 734  LYS A N     1 
ATOM   5909 C  CA    . LYS A 1 734 ? -12.321 -18.518 -35.097 1.00 26.84  ? 734  LYS A CA    1 
ATOM   5910 C  C     . LYS A 1 734 ? -12.180 -19.210 -33.747 1.00 23.22  ? 734  LYS A C     1 
ATOM   5911 O  O     . LYS A 1 734 ? -12.894 -20.166 -33.457 1.00 25.65  ? 734  LYS A O     1 
ATOM   5912 C  CB    . LYS A 1 734 ? -13.546 -17.600 -35.090 1.00 28.92  ? 734  LYS A CB    1 
ATOM   5913 C  CG    . LYS A 1 734 ? -13.575 -16.609 -36.236 1.00 37.95  ? 734  LYS A CG    1 
ATOM   5914 C  CD    . LYS A 1 734 ? -14.467 -15.425 -35.906 1.00 46.61  ? 734  LYS A CD    1 
ATOM   5915 C  CE    . LYS A 1 734 ? -14.055 -14.200 -36.694 1.00 56.44  ? 734  LYS A CE    1 
ATOM   5916 N  NZ    . LYS A 1 734 ? -14.047 -14.463 -38.161 1.00 61.84  ? 734  LYS A NZ    1 
ATOM   5917 N  N     . SER A 1 735 ? -11.263 -18.716 -32.921 1.00 25.22  ? 735  SER A N     1 
ATOM   5918 C  CA    . SER A 1 735 ? -11.041 -19.294 -31.598 1.00 25.30  ? 735  SER A CA    1 
ATOM   5919 C  C     . SER A 1 735 ? -12.229 -19.062 -30.673 1.00 25.26  ? 735  SER A C     1 
ATOM   5920 O  O     . SER A 1 735 ? -12.386 -19.757 -29.672 1.00 30.76  ? 735  SER A O     1 
ATOM   5921 C  CB    . SER A 1 735 ? -9.762  -18.729 -30.966 1.00 27.48  ? 735  SER A CB    1 
ATOM   5922 O  OG    . SER A 1 735 ? -9.805  -17.313 -30.890 1.00 25.94  ? 735  SER A OG    1 
ATOM   5923 N  N     . SER A 1 736 ? -13.068 -18.090 -31.017 1.00 24.26  ? 736  SER A N     1 
ATOM   5924 C  CA    . SER A 1 736 ? -14.237 -17.765 -30.205 1.00 27.98  ? 736  SER A CA    1 
ATOM   5925 C  C     . SER A 1 736 ? -15.372 -18.780 -30.374 1.00 26.83  ? 736  SER A C     1 
ATOM   5926 O  O     . SER A 1 736 ? -16.219 -18.925 -29.492 1.00 27.32  ? 736  SER A O     1 
ATOM   5927 C  CB    . SER A 1 736 ? -14.734 -16.350 -30.524 1.00 27.33  ? 736  SER A CB    1 
ATOM   5928 O  OG    . SER A 1 736 ? -14.860 -16.161 -31.923 1.00 28.70  ? 736  SER A OG    1 
ATOM   5929 N  N     . THR A 1 737 ? -15.378 -19.479 -31.505 1.00 25.45  ? 737  THR A N     1 
ATOM   5930 C  CA    . THR A 1 737 ? -16.383 -20.508 -31.788 1.00 24.61  ? 737  THR A CA    1 
ATOM   5931 C  C     . THR A 1 737 ? -16.123 -21.787 -30.982 1.00 26.34  ? 737  THR A C     1 
ATOM   5932 O  O     . THR A 1 737 ? -14.980 -22.243 -30.891 1.00 24.03  ? 737  THR A O     1 
ATOM   5933 C  CB    . THR A 1 737 ? -16.390 -20.850 -33.294 1.00 26.38  ? 737  THR A CB    1 
ATOM   5934 O  OG1   . THR A 1 737 ? -16.576 -19.650 -34.052 1.00 29.01  ? 737  THR A OG1   1 
ATOM   5935 C  CG2   . THR A 1 737 ? -17.498 -21.836 -33.641 1.00 24.61  ? 737  THR A CG2   1 
ATOM   5936 N  N     . PRO A 1 738 ? -17.183 -22.368 -30.387 1.00 23.85  ? 738  PRO A N     1 
ATOM   5937 C  CA    . PRO A 1 738 ? -17.025 -23.598 -29.601 1.00 20.45  ? 738  PRO A CA    1 
ATOM   5938 C  C     . PRO A 1 738 ? -16.368 -24.725 -30.403 1.00 23.11  ? 738  PRO A C     1 
ATOM   5939 O  O     . PRO A 1 738 ? -16.640 -24.855 -31.599 1.00 24.35  ? 738  PRO A O     1 
ATOM   5940 C  CB    . PRO A 1 738 ? -18.468 -23.973 -29.255 1.00 22.18  ? 738  PRO A CB    1 
ATOM   5941 C  CG    . PRO A 1 738 ? -19.207 -22.670 -29.260 1.00 23.46  ? 738  PRO A CG    1 
ATOM   5942 C  CD    . PRO A 1 738 ? -18.570 -21.860 -30.352 1.00 22.16  ? 738  PRO A CD    1 
ATOM   5943 N  N     . LYS A 1 739 ? -15.511 -25.514 -29.756 1.00 25.08  ? 739  LYS A N     1 
ATOM   5944 C  CA    . LYS A 1 739 ? -14.797 -26.605 -30.433 1.00 30.88  ? 739  LYS A CA    1 
ATOM   5945 C  C     . LYS A 1 739 ? -15.720 -27.521 -31.232 1.00 29.71  ? 739  LYS A C     1 
ATOM   5946 O  O     . LYS A 1 739 ? -15.462 -27.808 -32.401 1.00 27.46  ? 739  LYS A O     1 
ATOM   5947 C  CB    . LYS A 1 739 ? -13.998 -27.441 -29.432 1.00 32.54  ? 739  LYS A CB    1 
ATOM   5948 C  CG    . LYS A 1 739 ? -12.691 -26.815 -29.005 1.00 41.59  ? 739  LYS A CG    1 
ATOM   5949 C  CD    . LYS A 1 739 ? -11.802 -26.552 -30.210 1.00 51.33  ? 739  LYS A CD    1 
ATOM   5950 C  CE    . LYS A 1 739 ? -10.443 -26.017 -29.794 1.00 57.13  ? 739  LYS A CE    1 
ATOM   5951 N  NZ    . LYS A 1 739 ? -9.617  -25.629 -30.972 1.00 58.65  ? 739  LYS A NZ    1 
ATOM   5952 N  N     . ALA A 1 740 ? -16.797 -27.973 -30.599 1.00 31.07  ? 740  ALA A N     1 
ATOM   5953 C  CA    . ALA A 1 740 ? -17.714 -28.913 -31.238 1.00 31.35  ? 740  ALA A CA    1 
ATOM   5954 C  C     . ALA A 1 740 ? -18.492 -28.267 -32.384 1.00 28.70  ? 740  ALA A C     1 
ATOM   5955 O  O     . ALA A 1 740 ? -18.902 -28.945 -33.324 1.00 29.70  ? 740  ALA A O     1 
ATOM   5956 C  CB    . ALA A 1 740 ? -18.660 -29.520 -30.213 1.00 33.64  ? 740  ALA A CB    1 
ATOM   5957 N  N     . VAL A 1 741 ? -18.682 -26.953 -32.306 1.00 26.79  ? 741  VAL A N     1 
ATOM   5958 C  CA    . VAL A 1 741 ? -19.378 -26.213 -33.358 1.00 28.80  ? 741  VAL A CA    1 
ATOM   5959 C  C     . VAL A 1 741 ? -18.481 -26.006 -34.580 1.00 27.00  ? 741  VAL A C     1 
ATOM   5960 O  O     . VAL A 1 741 ? -18.942 -26.101 -35.719 1.00 29.57  ? 741  VAL A O     1 
ATOM   5961 C  CB    . VAL A 1 741 ? -19.919 -24.858 -32.839 1.00 30.13  ? 741  VAL A CB    1 
ATOM   5962 C  CG1   . VAL A 1 741 ? -20.443 -24.003 -33.984 1.00 27.08  ? 741  VAL A CG1   1 
ATOM   5963 C  CG2   . VAL A 1 741 ? -21.016 -25.096 -31.813 1.00 34.73  ? 741  VAL A CG2   1 
ATOM   5964 N  N     . GLN A 1 742 ? -17.202 -25.735 -34.337 1.00 24.88  ? 742  GLN A N     1 
ATOM   5965 C  CA    . GLN A 1 742 ? -16.213 -25.660 -35.408 1.00 28.27  ? 742  GLN A CA    1 
ATOM   5966 C  C     . GLN A 1 742 ? -16.231 -26.955 -36.207 1.00 28.81  ? 742  GLN A C     1 
ATOM   5967 O  O     . GLN A 1 742 ? -16.289 -26.948 -37.436 1.00 27.70  ? 742  GLN A O     1 
ATOM   5968 C  CB    . GLN A 1 742 ? -14.808 -25.468 -34.830 1.00 26.06  ? 742  GLN A CB    1 
ATOM   5969 C  CG    . GLN A 1 742 ? -14.511 -24.083 -34.262 1.00 25.65  ? 742  GLN A CG    1 
ATOM   5970 C  CD    . GLN A 1 742 ? -13.127 -24.015 -33.635 1.00 27.25  ? 742  GLN A CD    1 
ATOM   5971 O  OE1   . GLN A 1 742 ? -12.519 -25.043 -33.347 1.00 30.36  ? 742  GLN A OE1   1 
ATOM   5972 N  NE2   . GLN A 1 742 ? -12.625 -22.806 -33.423 1.00 26.79  ? 742  GLN A NE2   1 
ATOM   5973 N  N     . LYS A 1 743 ? -16.178 -28.064 -35.475 1.00 27.85  ? 743  LYS A N     1 
ATOM   5974 C  CA    . LYS A 1 743 ? -16.098 -29.402 -36.047 1.00 31.96  ? 743  LYS A CA    1 
ATOM   5975 C  C     . LYS A 1 743 ? -17.339 -29.688 -36.874 1.00 32.10  ? 743  LYS A C     1 
ATOM   5976 O  O     . LYS A 1 743 ? -17.248 -30.168 -38.003 1.00 32.09  ? 743  LYS A O     1 
ATOM   5977 C  CB    . LYS A 1 743 ? -15.969 -30.426 -34.917 1.00 33.42  ? 743  LYS A CB    1 
ATOM   5978 C  CG    . LYS A 1 743 ? -15.643 -31.842 -35.347 1.00 40.34  ? 743  LYS A CG    1 
ATOM   5979 C  CD    . LYS A 1 743 ? -15.717 -32.785 -34.153 1.00 42.51  ? 743  LYS A CD    1 
ATOM   5980 C  CE    . LYS A 1 743 ? -14.900 -34.049 -34.375 1.00 48.79  ? 743  LYS A CE    1 
ATOM   5981 N  NZ    . LYS A 1 743 ? -15.365 -34.823 -35.556 1.00 53.64  ? 743  LYS A NZ    1 
ATOM   5982 N  N     . ALA A 1 744 ? -18.497 -29.366 -36.307 1.00 28.50  ? 744  ALA A N     1 
ATOM   5983 C  CA    . ALA A 1 744 ? -19.769 -29.607 -36.965 1.00 31.27  ? 744  ALA A CA    1 
ATOM   5984 C  C     . ALA A 1 744 ? -19.970 -28.715 -38.184 1.00 31.86  ? 744  ALA A C     1 
ATOM   5985 O  O     . ALA A 1 744 ? -20.440 -29.177 -39.225 1.00 33.02  ? 744  ALA A O     1 
ATOM   5986 C  CB    . ALA A 1 744 ? -20.911 -29.421 -35.985 1.00 34.19  ? 744  ALA A CB    1 
ATOM   5987 N  N     . LEU A 1 745 ? -19.629 -27.437 -38.044 1.00 29.56  ? 745  LEU A N     1 
ATOM   5988 C  CA    . LEU A 1 745 ? -19.758 -26.489 -39.146 1.00 29.49  ? 745  LEU A CA    1 
ATOM   5989 C  C     . LEU A 1 745 ? -18.820 -26.875 -40.286 1.00 29.87  ? 745  LEU A C     1 
ATOM   5990 O  O     . LEU A 1 745 ? -19.168 -26.756 -41.460 1.00 32.00  ? 745  LEU A O     1 
ATOM   5991 C  CB    . LEU A 1 745 ? -19.460 -25.060 -38.681 1.00 30.73  ? 745  LEU A CB    1 
ATOM   5992 C  CG    . LEU A 1 745 ? -20.558 -24.298 -37.930 1.00 30.77  ? 745  LEU A CG    1 
ATOM   5993 C  CD1   . LEU A 1 745 ? -20.076 -22.906 -37.547 1.00 29.55  ? 745  LEU A CD1   1 
ATOM   5994 C  CD2   . LEU A 1 745 ? -21.813 -24.208 -38.776 1.00 31.36  ? 745  LEU A CD2   1 
ATOM   5995 N  N     . LYS A 1 746 ? -17.630 -27.347 -39.933 1.00 27.51  ? 746  LYS A N     1 
ATOM   5996 C  CA    . LYS A 1 746 ? -16.668 -27.770 -40.939 1.00 28.64  ? 746  LYS A CA    1 
ATOM   5997 C  C     . LYS A 1 746 ? -17.174 -28.993 -41.704 1.00 34.18  ? 746  LYS A C     1 
ATOM   5998 O  O     . LYS A 1 746 ? -17.001 -29.082 -42.921 1.00 36.96  ? 746  LYS A O     1 
ATOM   5999 C  CB    . LYS A 1 746 ? -15.301 -28.049 -40.308 1.00 24.64  ? 746  LYS A CB    1 
ATOM   6000 C  CG    . LYS A 1 746 ? -14.235 -28.415 -41.324 1.00 31.20  ? 746  LYS A CG    1 
ATOM   6001 C  CD    . LYS A 1 746 ? -12.844 -28.373 -40.723 1.00 38.20  ? 746  LYS A CD    1 
ATOM   6002 C  CE    . LYS A 1 746 ? -11.791 -28.636 -41.787 1.00 44.12  ? 746  LYS A CE    1 
ATOM   6003 N  NZ    . LYS A 1 746 ? -10.433 -28.263 -41.319 1.00 48.88  ? 746  LYS A NZ    1 
ATOM   6004 N  N     . GLU A 1 747 ? -17.807 -29.929 -41.000 1.00 30.97  ? 747  GLU A N     1 
ATOM   6005 C  CA    . GLU A 1 747 ? -18.369 -31.096 -41.676 1.00 32.20  ? 747  GLU A CA    1 
ATOM   6006 C  C     . GLU A 1 747 ? -19.535 -30.690 -42.568 1.00 33.36  ? 747  GLU A C     1 
ATOM   6007 O  O     . GLU A 1 747 ? -19.730 -31.264 -43.639 1.00 36.71  ? 747  GLU A O     1 
ATOM   6008 C  CB    . GLU A 1 747 ? -18.780 -32.191 -40.681 1.00 29.80  ? 747  GLU A CB    1 
ATOM   6009 C  CG    . GLU A 1 747 ? -19.430 -33.426 -41.321 1.00 32.02  ? 747  GLU A CG    1 
ATOM   6010 C  CD    . GLU A 1 747 ? -18.492 -34.212 -42.235 1.00 34.82  ? 747  GLU A CD    1 
ATOM   6011 O  OE1   . GLU A 1 747 ? -17.276 -33.928 -42.252 1.00 36.88  ? 747  GLU A OE1   1 
ATOM   6012 O  OE2   . GLU A 1 747 ? -18.974 -35.125 -42.941 1.00 38.03  ? 747  GLU A OE2   1 
ATOM   6013 N  N     . CYS A 1 748 ? -20.299 -29.691 -42.132 1.00 34.78  ? 748  CYS A N     1 
ATOM   6014 C  CA    . CYS A 1 748 ? -21.355 -29.120 -42.967 1.00 36.49  ? 748  CYS A CA    1 
ATOM   6015 C  C     . CYS A 1 748 ? -20.775 -28.552 -44.254 1.00 35.63  ? 748  CYS A C     1 
ATOM   6016 O  O     . CYS A 1 748 ? -21.321 -28.757 -45.337 1.00 37.64  ? 748  CYS A O     1 
ATOM   6017 C  CB    . CYS A 1 748 ? -22.105 -28.011 -42.226 1.00 36.70  ? 748  CYS A CB    1 
ATOM   6018 S  SG    . CYS A 1 748 ? -23.256 -28.581 -40.953 1.00 38.71  ? 748  CYS A SG    1 
ATOM   6019 N  N     . ILE A 1 749 ? -19.667 -27.832 -44.127 1.00 31.36  ? 749  ILE A N     1 
ATOM   6020 C  CA    . ILE A 1 749 ? -19.002 -27.239 -45.280 1.00 32.99  ? 749  ILE A CA    1 
ATOM   6021 C  C     . ILE A 1 749 ? -18.411 -28.317 -46.188 1.00 35.36  ? 749  ILE A C     1 
ATOM   6022 O  O     . ILE A 1 749 ? -18.560 -28.251 -47.408 1.00 39.07  ? 749  ILE A O     1 
ATOM   6023 C  CB    . ILE A 1 749 ? -17.902 -26.240 -44.847 1.00 30.73  ? 749  ILE A CB    1 
ATOM   6024 C  CG1   . ILE A 1 749 ? -18.534 -25.015 -44.183 1.00 28.83  ? 749  ILE A CG1   1 
ATOM   6025 C  CG2   . ILE A 1 749 ? -17.064 -25.813 -46.038 1.00 29.73  ? 749  ILE A CG2   1 
ATOM   6026 C  CD1   . ILE A 1 749 ? -17.532 -24.093 -43.506 1.00 26.24  ? 749  ILE A CD1   1 
ATOM   6027 N  N     . ARG A 1 750 ? -17.756 -29.315 -45.594 1.00 31.28  ? 750  ARG A N     1 
ATOM   6028 C  CA    . ARG A 1 750 ? -17.174 -30.406 -46.374 1.00 31.69  ? 750  ARG A CA    1 
ATOM   6029 C  C     . ARG A 1 750 ? -18.233 -31.089 -47.223 1.00 36.42  ? 750  ARG A C     1 
ATOM   6030 O  O     . ARG A 1 750 ? -18.012 -31.366 -48.401 1.00 39.68  ? 750  ARG A O     1 
ATOM   6031 C  CB    . ARG A 1 750 ? -16.508 -31.453 -45.475 1.00 30.87  ? 750  ARG A CB    1 
ATOM   6032 C  CG    . ARG A 1 750 ? -15.709 -32.489 -46.255 1.00 32.72  ? 750  ARG A CG    1 
ATOM   6033 C  CD    . ARG A 1 750 ? -15.429 -33.739 -45.437 1.00 39.68  ? 750  ARG A CD    1 
ATOM   6034 N  NE    . ARG A 1 750 ? -16.645 -34.494 -45.138 1.00 42.90  ? 750  ARG A NE    1 
ATOM   6035 C  CZ    . ARG A 1 750 ? -17.262 -35.295 -46.003 1.00 44.83  ? 750  ARG A CZ    1 
ATOM   6036 N  NH1   . ARG A 1 750 ? -16.789 -35.440 -47.236 1.00 43.10  ? 750  ARG A NH1   1 
ATOM   6037 N  NH2   . ARG A 1 750 ? -18.361 -35.948 -45.639 1.00 42.29  ? 750  ARG A NH2   1 
ATOM   6038 N  N     . ARG A 1 751 ? -19.384 -31.354 -46.614 1.00 35.63  ? 751  ARG A N     1 
ATOM   6039 C  CA    . ARG A 1 751 ? -20.479 -32.020 -47.306 1.00 39.28  ? 751  ARG A CA    1 
ATOM   6040 C  C     . ARG A 1 751 ? -21.044 -31.168 -48.444 1.00 40.47  ? 751  ARG A C     1 
ATOM   6041 O  O     . ARG A 1 751 ? -21.328 -31.683 -49.524 1.00 41.78  ? 751  ARG A O     1 
ATOM   6042 C  CB    . ARG A 1 751 ? -21.574 -32.424 -46.316 1.00 38.16  ? 751  ARG A CB    1 
ATOM   6043 C  CG    . ARG A 1 751 ? -21.173 -33.606 -45.436 1.00 42.16  ? 751  ARG A CG    1 
ATOM   6044 C  CD    . ARG A 1 751 ? -22.227 -33.927 -44.390 1.00 40.47  ? 751  ARG A CD    1 
ATOM   6045 N  NE    . ARG A 1 751 ? -21.885 -35.107 -43.598 1.00 38.75  ? 751  ARG A NE    1 
ATOM   6046 C  CZ    . ARG A 1 751 ? -22.556 -36.255 -43.641 1.00 42.26  ? 751  ARG A CZ    1 
ATOM   6047 N  NH1   . ARG A 1 751 ? -23.613 -36.382 -44.432 1.00 39.44  ? 751  ARG A NH1   1 
ATOM   6048 N  NH2   . ARG A 1 751 ? -22.177 -37.278 -42.887 1.00 45.01  ? 751  ARG A NH2   1 
ATOM   6049 N  N     . MET A 1 752 ? -21.196 -29.869 -48.198 1.00 39.34  ? 752  MET A N     1 
ATOM   6050 C  CA    . MET A 1 752 ? -21.646 -28.937 -49.233 1.00 38.81  ? 752  MET A CA    1 
ATOM   6051 C  C     . MET A 1 752 ? -20.710 -28.947 -50.440 1.00 38.68  ? 752  MET A C     1 
ATOM   6052 O  O     . MET A 1 752 ? -21.148 -29.103 -51.579 1.00 37.99  ? 752  MET A O     1 
ATOM   6053 C  CB    . MET A 1 752 ? -21.719 -27.511 -48.682 1.00 35.56  ? 752  MET A CB    1 
ATOM   6054 C  CG    . MET A 1 752 ? -22.803 -27.267 -47.647 1.00 37.03  ? 752  MET A CG    1 
ATOM   6055 S  SD    . MET A 1 752 ? -22.558 -25.690 -46.795 1.00 46.38  ? 752  MET A SD    1 
ATOM   6056 C  CE    . MET A 1 752 ? -22.996 -24.538 -48.100 1.00 32.16  ? 752  MET A CE    1 
ATOM   6057 N  N     . LEU A 1 753 ? -19.418 -28.777 -50.176 1.00 39.97  ? 753  LEU A N     1 
ATOM   6058 C  CA    . LEU A 1 753 ? -18.432 -28.612 -51.237 1.00 42.50  ? 753  LEU A CA    1 
ATOM   6059 C  C     . LEU A 1 753 ? -18.123 -29.915 -51.970 1.00 45.61  ? 753  LEU A C     1 
ATOM   6060 O  O     . LEU A 1 753 ? -17.803 -29.904 -53.160 1.00 48.04  ? 753  LEU A O     1 
ATOM   6061 C  CB    . LEU A 1 753 ? -17.138 -28.013 -50.678 1.00 40.80  ? 753  LEU A CB    1 
ATOM   6062 C  CG    . LEU A 1 753 ? -17.231 -26.698 -49.894 1.00 37.99  ? 753  LEU A CG    1 
ATOM   6063 C  CD1   . LEU A 1 753 ? -15.851 -26.101 -49.699 1.00 36.03  ? 753  LEU A CD1   1 
ATOM   6064 C  CD2   . LEU A 1 753 ? -18.145 -25.707 -50.579 1.00 35.29  ? 753  LEU A CD2   1 
ATOM   6065 N  N     . GLN A 1 754 ? -18.223 -31.035 -51.263 1.00 41.41  ? 754  GLN A N     1 
ATOM   6066 C  CA    . GLN A 1 754 ? -17.809 -32.318 -51.823 1.00 43.40  ? 754  GLN A CA    1 
ATOM   6067 C  C     . GLN A 1 754 ? -18.969 -33.246 -52.184 1.00 45.66  ? 754  GLN A C     1 
ATOM   6068 O  O     . GLN A 1 754 ? -18.841 -34.076 -53.087 1.00 49.81  ? 754  GLN A O     1 
ATOM   6069 C  CB    . GLN A 1 754 ? -16.858 -33.043 -50.863 1.00 43.95  ? 754  GLN A CB    1 
ATOM   6070 C  CG    . GLN A 1 754 ? -15.566 -32.298 -50.550 1.00 42.13  ? 754  GLN A CG    1 
ATOM   6071 C  CD    . GLN A 1 754 ? -14.633 -33.117 -49.675 1.00 44.30  ? 754  GLN A CD    1 
ATOM   6072 O  OE1   . GLN A 1 754 ? -14.996 -34.194 -49.205 1.00 45.39  ? 754  GLN A OE1   1 
ATOM   6073 N  NE2   . GLN A 1 754 ? -13.426 -32.612 -49.456 1.00 44.53  ? 754  GLN A NE2   1 
ATOM   6074 N  N     . GLU A 1 755 ? -20.093 -33.117 -51.484 1.00 43.97  ? 755  GLU A N     1 
ATOM   6075 C  CA    . GLU A 1 755 ? -21.167 -34.102 -51.621 1.00 47.81  ? 755  GLU A CA    1 
ATOM   6076 C  C     . GLU A 1 755 ? -22.525 -33.536 -52.039 1.00 49.38  ? 755  GLU A C     1 
ATOM   6077 O  O     . GLU A 1 755 ? -23.268 -34.190 -52.767 1.00 56.10  ? 755  GLU A O     1 
ATOM   6078 C  CB    . GLU A 1 755 ? -21.297 -34.928 -50.339 1.00 48.64  ? 755  GLU A CB    1 
ATOM   6079 C  CG    . GLU A 1 755 ? -20.063 -35.760 -50.031 1.00 53.06  ? 755  GLU A CG    1 
ATOM   6080 C  CD    . GLU A 1 755 ? -20.168 -36.511 -48.718 1.00 56.90  ? 755  GLU A CD    1 
ATOM   6081 O  OE1   . GLU A 1 755 ? -21.272 -36.557 -48.139 1.00 60.76  ? 755  GLU A OE1   1 
ATOM   6082 O  OE2   . GLU A 1 755 ? -19.141 -37.055 -48.263 1.00 58.02  ? 755  GLU A OE2   1 
ATOM   6083 N  N     . GLY A 1 756 ? -22.861 -32.336 -51.574 1.00 47.18  ? 756  GLY A N     1 
ATOM   6084 C  CA    . GLY A 1 756 ? -24.096 -31.699 -52.000 1.00 47.80  ? 756  GLY A CA    1 
ATOM   6085 C  C     . GLY A 1 756 ? -25.140 -31.470 -50.922 1.00 46.88  ? 756  GLY A C     1 
ATOM   6086 O  O     . GLY A 1 756 ? -24.941 -31.817 -49.758 1.00 46.01  ? 756  GLY A O     1 
ATOM   6087 N  N     . GLU A 1 757 ? -26.268 -30.895 -51.330 1.00 48.64  ? 757  GLU A N     1 
ATOM   6088 C  CA    . GLU A 1 757 ? -27.309 -30.448 -50.406 1.00 50.01  ? 757  GLU A CA    1 
ATOM   6089 C  C     . GLU A 1 757 ? -27.906 -31.566 -49.554 1.00 50.89  ? 757  GLU A C     1 
ATOM   6090 O  O     . GLU A 1 757 ? -28.102 -31.396 -48.348 1.00 47.63  ? 757  GLU A O     1 
ATOM   6091 C  CB    . GLU A 1 757 ? -28.423 -29.725 -51.170 1.00 52.65  ? 757  GLU A CB    1 
ATOM   6092 C  CG    . GLU A 1 757 ? -29.507 -29.146 -50.279 1.00 53.92  ? 757  GLU A CG    1 
ATOM   6093 C  CD    . GLU A 1 757 ? -30.528 -28.329 -51.051 1.00 55.47  ? 757  GLU A CD    1 
ATOM   6094 O  OE1   . GLU A 1 757 ? -30.823 -28.686 -52.211 1.00 60.44  ? 757  GLU A OE1   1 
ATOM   6095 O  OE2   . GLU A 1 757 ? -31.032 -27.328 -50.495 1.00 50.19  ? 757  GLU A OE2   1 
ATOM   6096 N  N     . GLU A 1 758 ? -28.199 -32.699 -50.186 1.00 52.14  ? 758  GLU A N     1 
ATOM   6097 C  CA    . GLU A 1 758 ? -28.788 -33.839 -49.490 1.00 53.40  ? 758  GLU A CA    1 
ATOM   6098 C  C     . GLU A 1 758 ? -27.905 -34.324 -48.344 1.00 52.26  ? 758  GLU A C     1 
ATOM   6099 O  O     . GLU A 1 758 ? -28.390 -34.594 -47.244 1.00 50.06  ? 758  GLU A O     1 
ATOM   6100 C  CB    . GLU A 1 758 ? -29.052 -34.986 -50.466 1.00 57.16  ? 758  GLU A CB    1 
ATOM   6101 C  CG    . GLU A 1 758 ? -29.599 -36.240 -49.804 1.00 60.02  ? 758  GLU A CG    1 
ATOM   6102 N  N     . SER A 1 759 ? -26.608 -34.433 -48.611 1.00 50.88  ? 759  SER A N     1 
ATOM   6103 C  CA    . SER A 1 759 ? -25.651 -34.871 -47.604 1.00 49.97  ? 759  SER A CA    1 
ATOM   6104 C  C     . SER A 1 759 ? -25.619 -33.904 -46.427 1.00 47.52  ? 759  SER A C     1 
ATOM   6105 O  O     . SER A 1 759 ? -25.566 -34.323 -45.271 1.00 46.67  ? 759  SER A O     1 
ATOM   6106 C  CB    . SER A 1 759 ? -24.256 -35.001 -48.214 1.00 50.69  ? 759  SER A CB    1 
ATOM   6107 O  OG    . SER A 1 759 ? -23.323 -35.456 -47.253 1.00 50.38  ? 759  SER A OG    1 
ATOM   6108 N  N     . LEU A 1 760 ? -25.656 -32.610 -46.732 1.00 46.96  ? 760  LEU A N     1 
ATOM   6109 C  CA    . LEU A 1 760 ? -25.698 -31.573 -45.706 1.00 43.59  ? 760  LEU A CA    1 
ATOM   6110 C  C     . LEU A 1 760 ? -26.924 -31.729 -44.817 1.00 42.58  ? 760  LEU A C     1 
ATOM   6111 O  O     . LEU A 1 760 ? -26.829 -31.659 -43.589 1.00 37.69  ? 760  LEU A O     1 
ATOM   6112 C  CB    . LEU A 1 760 ? -25.711 -30.185 -46.345 1.00 41.30  ? 760  LEU A CB    1 
ATOM   6113 C  CG    . LEU A 1 760 ? -26.128 -29.041 -45.412 1.00 39.64  ? 760  LEU A CG    1 
ATOM   6114 C  CD1   . LEU A 1 760 ? -25.116 -28.854 -44.292 1.00 34.33  ? 760  LEU A CD1   1 
ATOM   6115 C  CD2   . LEU A 1 760 ? -26.326 -27.747 -46.184 1.00 41.41  ? 760  LEU A CD2   1 
ATOM   6116 N  N     . GLN A 1 761 ? -28.072 -31.941 -45.452 1.00 43.87  ? 761  GLN A N     1 
ATOM   6117 C  CA    . GLN A 1 761 ? -29.337 -32.056 -44.738 1.00 45.50  ? 761  GLN A CA    1 
ATOM   6118 C  C     . GLN A 1 761 ? -29.381 -33.261 -43.799 1.00 44.48  ? 761  GLN A C     1 
ATOM   6119 O  O     . GLN A 1 761 ? -29.952 -33.179 -42.712 1.00 47.10  ? 761  GLN A O     1 
ATOM   6120 C  CB    . GLN A 1 761 ? -30.506 -32.067 -45.724 1.00 47.05  ? 761  GLN A CB    1 
ATOM   6121 C  CG    . GLN A 1 761 ? -30.681 -30.731 -46.438 1.00 46.79  ? 761  GLN A CG    1 
ATOM   6122 C  CD    . GLN A 1 761 ? -31.738 -30.766 -47.525 1.00 47.87  ? 761  GLN A CD    1 
ATOM   6123 O  OE1   . GLN A 1 761 ? -31.965 -29.771 -48.216 1.00 48.72  ? 761  GLN A OE1   1 
ATOM   6124 N  NE2   . GLN A 1 761 ? -32.390 -31.909 -47.682 1.00 45.56  ? 761  GLN A NE2   1 
ATOM   6125 N  N     . GLU A 1 762 ? -28.767 -34.366 -44.210 1.00 43.68  ? 762  GLU A N     1 
ATOM   6126 C  CA    . GLU A 1 762 ? -28.668 -35.545 -43.355 1.00 46.57  ? 762  GLU A CA    1 
ATOM   6127 C  C     . GLU A 1 762 ? -27.853 -35.244 -42.097 1.00 44.07  ? 762  GLU A C     1 
ATOM   6128 O  O     . GLU A 1 762 ? -28.267 -35.566 -40.982 1.00 42.25  ? 762  GLU A O     1 
ATOM   6129 C  CB    . GLU A 1 762 ? -28.017 -36.706 -44.107 1.00 51.72  ? 762  GLU A CB    1 
ATOM   6130 C  CG    . GLU A 1 762 ? -28.792 -37.198 -45.312 1.00 61.48  ? 762  GLU A CG    1 
ATOM   6131 C  CD    . GLU A 1 762 ? -28.054 -38.290 -46.059 1.00 70.20  ? 762  GLU A CD    1 
ATOM   6132 O  OE1   . GLU A 1 762 ? -26.890 -38.569 -45.698 1.00 72.01  ? 762  GLU A OE1   1 
ATOM   6133 O  OE2   . GLU A 1 762 ? -28.635 -38.867 -47.004 1.00 73.88  ? 762  GLU A OE2   1 
ATOM   6134 N  N     . TYR A 1 763 ? -26.689 -34.630 -42.283 1.00 40.80  ? 763  TYR A N     1 
ATOM   6135 C  CA    . TYR A 1 763 ? -25.796 -34.363 -41.167 1.00 39.38  ? 763  TYR A CA    1 
ATOM   6136 C  C     . TYR A 1 763 ? -26.416 -33.376 -40.190 1.00 41.52  ? 763  TYR A C     1 
ATOM   6137 O  O     . TYR A 1 763 ? -26.320 -33.556 -38.977 1.00 41.93  ? 763  TYR A O     1 
ATOM   6138 C  CB    . TYR A 1 763 ? -24.442 -33.848 -41.660 1.00 39.92  ? 763  TYR A CB    1 
ATOM   6139 C  CG    . TYR A 1 763 ? -23.452 -33.608 -40.545 1.00 40.62  ? 763  TYR A CG    1 
ATOM   6140 C  CD1   . TYR A 1 763 ? -22.792 -34.670 -39.933 1.00 43.90  ? 763  TYR A CD1   1 
ATOM   6141 C  CD2   . TYR A 1 763 ? -23.183 -32.323 -40.095 1.00 39.15  ? 763  TYR A CD2   1 
ATOM   6142 C  CE1   . TYR A 1 763 ? -21.887 -34.455 -38.906 1.00 45.61  ? 763  TYR A CE1   1 
ATOM   6143 C  CE2   . TYR A 1 763 ? -22.283 -32.098 -39.072 1.00 41.92  ? 763  TYR A CE2   1 
ATOM   6144 C  CZ    . TYR A 1 763 ? -21.637 -33.167 -38.480 1.00 45.95  ? 763  TYR A CZ    1 
ATOM   6145 O  OH    . TYR A 1 763 ? -20.739 -32.942 -37.460 1.00 48.98  ? 763  TYR A OH    1 
ATOM   6146 N  N     . PHE A 1 764 ? -27.059 -32.338 -40.721 1.00 39.75  ? 764  PHE A N     1 
ATOM   6147 C  CA    . PHE A 1 764 ? -27.678 -31.323 -39.877 1.00 37.21  ? 764  PHE A CA    1 
ATOM   6148 C  C     . PHE A 1 764 ? -28.766 -31.905 -38.983 1.00 39.30  ? 764  PHE A C     1 
ATOM   6149 O  O     . PHE A 1 764 ? -28.824 -31.607 -37.790 1.00 42.34  ? 764  PHE A O     1 
ATOM   6150 C  CB    . PHE A 1 764 ? -28.261 -30.180 -40.709 1.00 38.72  ? 764  PHE A CB    1 
ATOM   6151 C  CG    . PHE A 1 764 ? -29.089 -29.221 -39.902 1.00 40.47  ? 764  PHE A CG    1 
ATOM   6152 C  CD1   . PHE A 1 764 ? -28.484 -28.203 -39.186 1.00 41.62  ? 764  PHE A CD1   1 
ATOM   6153 C  CD2   . PHE A 1 764 ? -30.469 -29.348 -39.844 1.00 44.65  ? 764  PHE A CD2   1 
ATOM   6154 C  CE1   . PHE A 1 764 ? -29.238 -27.320 -38.432 1.00 42.55  ? 764  PHE A CE1   1 
ATOM   6155 C  CE2   . PHE A 1 764 ? -31.226 -28.473 -39.091 1.00 46.63  ? 764  PHE A CE2   1 
ATOM   6156 C  CZ    . PHE A 1 764 ? -30.609 -27.456 -38.384 1.00 44.44  ? 764  PHE A CZ    1 
ATOM   6157 N  N     . LYS A 1 765 ? -29.641 -32.710 -39.574 1.00 42.25  ? 765  LYS A N     1 
ATOM   6158 C  CA    . LYS A 1 765 ? -30.702 -33.365 -38.823 1.00 47.32  ? 765  LYS A CA    1 
ATOM   6159 C  C     . LYS A 1 765 ? -30.116 -34.173 -37.669 1.00 47.93  ? 765  LYS A C     1 
ATOM   6160 O  O     . LYS A 1 765 ? -30.623 -34.132 -36.551 1.00 49.07  ? 765  LYS A O     1 
ATOM   6161 C  CB    . LYS A 1 765 ? -31.526 -34.274 -39.738 1.00 47.50  ? 765  LYS A CB    1 
ATOM   6162 N  N     . GLU A 1 766 ? -29.035 -34.893 -37.947 1.00 48.24  ? 766  GLU A N     1 
ATOM   6163 C  CA    . GLU A 1 766 ? -28.394 -35.722 -36.936 1.00 47.75  ? 766  GLU A CA    1 
ATOM   6164 C  C     . GLU A 1 766 ? -27.760 -34.882 -35.836 1.00 45.09  ? 766  GLU A C     1 
ATOM   6165 O  O     . GLU A 1 766 ? -27.866 -35.215 -34.654 1.00 47.29  ? 766  GLU A O     1 
ATOM   6166 C  CB    . GLU A 1 766 ? -27.338 -36.628 -37.567 1.00 49.20  ? 766  GLU A CB    1 
ATOM   6167 C  CG    . GLU A 1 766 ? -27.020 -37.852 -36.727 1.00 49.53  ? 766  GLU A CG    1 
ATOM   6168 C  CD    . GLU A 1 766 ? -28.220 -38.760 -36.572 1.00 52.49  ? 766  GLU A CD    1 
ATOM   6169 O  OE1   . GLU A 1 766 ? -28.773 -39.196 -37.604 1.00 52.66  ? 766  GLU A OE1   1 
ATOM   6170 O  OE2   . GLU A 1 766 ? -28.622 -39.025 -35.420 1.00 54.87  ? 766  GLU A OE2   1 
ATOM   6171 N  N     . PHE A 1 767 ? -27.093 -33.800 -36.224 1.00 40.20  ? 767  PHE A N     1 
ATOM   6172 C  CA    . PHE A 1 767 ? -26.435 -32.942 -35.247 1.00 37.11  ? 767  PHE A CA    1 
ATOM   6173 C  C     . PHE A 1 767 ? -27.446 -32.311 -34.294 1.00 40.22  ? 767  PHE A C     1 
ATOM   6174 O  O     . PHE A 1 767 ? -27.237 -32.294 -33.081 1.00 40.24  ? 767  PHE A O     1 
ATOM   6175 C  CB    . PHE A 1 767 ? -25.593 -31.857 -35.922 1.00 36.34  ? 767  PHE A CB    1 
ATOM   6176 C  CG    . PHE A 1 767 ? -24.800 -31.029 -34.952 1.00 39.25  ? 767  PHE A CG    1 
ATOM   6177 C  CD1   . PHE A 1 767 ? -23.600 -31.495 -34.446 1.00 39.84  ? 767  PHE A CD1   1 
ATOM   6178 C  CD2   . PHE A 1 767 ? -25.266 -29.797 -34.527 1.00 40.01  ? 767  PHE A CD2   1 
ATOM   6179 C  CE1   . PHE A 1 767 ? -22.876 -30.746 -33.540 1.00 39.05  ? 767  PHE A CE1   1 
ATOM   6180 C  CE2   . PHE A 1 767 ? -24.545 -29.041 -33.625 1.00 39.38  ? 767  PHE A CE2   1 
ATOM   6181 C  CZ    . PHE A 1 767 ? -23.347 -29.518 -33.131 1.00 40.38  ? 767  PHE A CZ    1 
ATOM   6182 N  N     . GLU A 1 768 ? -28.543 -31.803 -34.849 1.00 41.89  ? 768  GLU A N     1 
ATOM   6183 C  CA    . GLU A 1 768 ? -29.582 -31.164 -34.051 1.00 44.65  ? 768  GLU A CA    1 
ATOM   6184 C  C     . GLU A 1 768 ? -30.155 -32.121 -33.009 1.00 44.98  ? 768  GLU A C     1 
ATOM   6185 O  O     . GLU A 1 768 ? -30.439 -31.727 -31.878 1.00 46.45  ? 768  GLU A O     1 
ATOM   6186 C  CB    . GLU A 1 768 ? -30.701 -30.640 -34.953 1.00 50.04  ? 768  GLU A CB    1 
ATOM   6187 C  CG    . GLU A 1 768 ? -31.760 -29.837 -34.219 1.00 55.75  ? 768  GLU A CG    1 
ATOM   6188 C  CD    . GLU A 1 768 ? -32.791 -29.233 -35.156 1.00 62.61  ? 768  GLU A CD    1 
ATOM   6189 O  OE1   . GLU A 1 768 ? -33.071 -29.839 -36.213 1.00 62.69  ? 768  GLU A OE1   1 
ATOM   6190 O  OE2   . GLU A 1 768 ? -33.317 -28.145 -34.834 1.00 65.95  ? 768  GLU A OE2   1 
ATOM   6191 N  N     . LYS A 1 769 ? -30.310 -33.381 -33.395 1.00 43.13  ? 769  LYS A N     1 
ATOM   6192 C  CA    . LYS A 1 769 ? -30.848 -34.393 -32.494 1.00 46.75  ? 769  LYS A CA    1 
ATOM   6193 C  C     . LYS A 1 769 ? -29.909 -34.726 -31.336 1.00 46.87  ? 769  LYS A C     1 
ATOM   6194 O  O     . LYS A 1 769 ? -30.361 -34.929 -30.209 1.00 47.35  ? 769  LYS A O     1 
ATOM   6195 C  CB    . LYS A 1 769 ? -31.178 -35.676 -33.261 1.00 50.42  ? 769  LYS A CB    1 
ATOM   6196 C  CG    . LYS A 1 769 ? -32.384 -35.567 -34.173 1.00 55.51  ? 769  LYS A CG    1 
ATOM   6197 N  N     . GLU A 1 770 ? -28.607 -34.777 -31.612 1.00 44.68  ? 770  GLU A N     1 
ATOM   6198 C  CA    . GLU A 1 770 ? -27.651 -35.349 -30.660 1.00 43.57  ? 770  GLU A CA    1 
ATOM   6199 C  C     . GLU A 1 770 ? -26.787 -34.347 -29.893 1.00 40.86  ? 770  GLU A C     1 
ATOM   6200 O  O     . GLU A 1 770 ? -26.081 -34.731 -28.960 1.00 41.29  ? 770  GLU A O     1 
ATOM   6201 C  CB    . GLU A 1 770 ? -26.738 -36.358 -31.370 1.00 43.17  ? 770  GLU A CB    1 
ATOM   6202 C  CG    . GLU A 1 770 ? -27.463 -37.573 -31.932 1.00 44.88  ? 770  GLU A CG    1 
ATOM   6203 C  CD    . GLU A 1 770 ? -28.136 -38.399 -30.850 1.00 50.48  ? 770  GLU A CD    1 
ATOM   6204 O  OE1   . GLU A 1 770 ? -27.589 -38.482 -29.730 1.00 53.59  ? 770  GLU A OE1   1 
ATOM   6205 O  OE2   . GLU A 1 770 ? -29.218 -38.961 -31.115 1.00 53.48  ? 770  GLU A OE2   1 
ATOM   6206 N  N     . PHE A 1 771 ? -26.839 -33.075 -30.269 1.00 35.81  ? 771  PHE A N     1 
ATOM   6207 C  CA    . PHE A 1 771 ? -25.857 -32.116 -29.764 1.00 40.90  ? 771  PHE A CA    1 
ATOM   6208 C  C     . PHE A 1 771 ? -25.897 -31.859 -28.250 1.00 40.77  ? 771  PHE A C     1 
ATOM   6209 O  O     . PHE A 1 771 ? -24.898 -31.443 -27.667 1.00 39.36  ? 771  PHE A O     1 
ATOM   6210 C  CB    . PHE A 1 771 ? -25.933 -30.795 -30.537 1.00 44.09  ? 771  PHE A CB    1 
ATOM   6211 C  CG    . PHE A 1 771 ? -26.953 -29.838 -30.004 1.00 47.76  ? 771  PHE A CG    1 
ATOM   6212 C  CD1   . PHE A 1 771 ? -26.567 -28.762 -29.219 1.00 47.59  ? 771  PHE A CD1   1 
ATOM   6213 C  CD2   . PHE A 1 771 ? -28.298 -30.008 -30.289 1.00 53.56  ? 771  PHE A CD2   1 
ATOM   6214 C  CE1   . PHE A 1 771 ? -27.502 -27.871 -28.725 1.00 49.36  ? 771  PHE A CE1   1 
ATOM   6215 C  CE2   . PHE A 1 771 ? -29.241 -29.120 -29.800 1.00 57.91  ? 771  PHE A CE2   1 
ATOM   6216 C  CZ    . PHE A 1 771 ? -28.842 -28.051 -29.013 1.00 53.99  ? 771  PHE A CZ    1 
ATOM   6217 N  N     A ARG A 1 772 ? -27.041 -32.113 -27.622 0.50 42.00  ? 772  ARG A N     1 
ATOM   6218 N  N     B ARG A 1 772 ? -27.044 -32.119 -27.627 0.50 42.00  ? 772  ARG A N     1 
ATOM   6219 C  CA    A ARG A 1 772 ? -27.185 -31.873 -26.187 0.50 42.72  ? 772  ARG A CA    1 
ATOM   6220 C  CA    B ARG A 1 772 ? -27.209 -31.888 -26.193 0.50 42.79  ? 772  ARG A CA    1 
ATOM   6221 C  C     A ARG A 1 772 ? -26.313 -32.806 -25.354 0.50 43.91  ? 772  ARG A C     1 
ATOM   6222 C  C     B ARG A 1 772 ? -26.389 -32.855 -25.342 0.50 44.00  ? 772  ARG A C     1 
ATOM   6223 O  O     A ARG A 1 772 ? -26.107 -32.577 -24.162 0.50 45.31  ? 772  ARG A O     1 
ATOM   6224 O  O     B ARG A 1 772 ? -26.296 -32.696 -24.125 0.50 45.92  ? 772  ARG A O     1 
ATOM   6225 C  CB    A ARG A 1 772 ? -28.649 -31.989 -25.761 0.50 44.58  ? 772  ARG A CB    1 
ATOM   6226 C  CB    B ARG A 1 772 ? -28.686 -31.953 -25.797 0.50 44.82  ? 772  ARG A CB    1 
ATOM   6227 C  CG    A ARG A 1 772 ? -29.524 -30.886 -26.322 0.50 45.24  ? 772  ARG A CG    1 
ATOM   6228 C  CG    B ARG A 1 772 ? -29.510 -30.779 -26.303 0.50 45.16  ? 772  ARG A CG    1 
ATOM   6229 C  CD    A ARG A 1 772 ? -30.996 -31.234 -26.243 0.50 47.54  ? 772  ARG A CD    1 
ATOM   6230 C  CD    B ARG A 1 772 ? -30.990 -30.965 -26.021 0.50 47.85  ? 772  ARG A CD    1 
ATOM   6231 N  NE    A ARG A 1 772 ? -31.792 -30.304 -27.036 0.50 48.71  ? 772  ARG A NE    1 
ATOM   6232 N  NE    B ARG A 1 772 ? -31.758 -29.774 -26.378 0.50 49.71  ? 772  ARG A NE    1 
ATOM   6233 C  CZ    A ARG A 1 772 ? -31.964 -30.407 -28.350 0.50 46.98  ? 772  ARG A CZ    1 
ATOM   6234 C  CZ    B ARG A 1 772 ? -32.203 -28.880 -25.500 0.50 49.10  ? 772  ARG A CZ    1 
ATOM   6235 N  NH1   A ARG A 1 772 ? -31.396 -31.405 -29.016 0.50 46.39  ? 772  ARG A NH1   1 
ATOM   6236 N  NH1   B ARG A 1 772 ? -31.968 -29.044 -24.205 0.50 49.58  ? 772  ARG A NH1   1 
ATOM   6237 N  NH2   A ARG A 1 772 ? -32.700 -29.515 -28.997 0.50 45.01  ? 772  ARG A NH2   1 
ATOM   6238 N  NH2   B ARG A 1 772 ? -32.890 -27.827 -25.917 0.50 47.80  ? 772  ARG A NH2   1 
ATOM   6239 N  N     . GLN A 1 773 ? -25.794 -33.852 -25.987 1.00 39.85  ? 773  GLN A N     1 
ATOM   6240 C  CA    . GLN A 1 773 ? -24.947 -34.812 -25.293 1.00 39.95  ? 773  GLN A CA    1 
ATOM   6241 C  C     . GLN A 1 773 ? -23.475 -34.427 -25.354 1.00 39.01  ? 773  GLN A C     1 
ATOM   6242 O  O     . GLN A 1 773 ? -22.633 -35.077 -24.738 1.00 41.72  ? 773  GLN A O     1 
ATOM   6243 C  CB    . GLN A 1 773 ? -25.157 -36.215 -25.860 1.00 42.61  ? 773  GLN A CB    1 
ATOM   6244 C  CG    . GLN A 1 773 ? -26.572 -36.716 -25.671 1.00 48.29  ? 773  GLN A CG    1 
ATOM   6245 C  CD    . GLN A 1 773 ? -27.042 -36.569 -24.239 1.00 53.54  ? 773  GLN A CD    1 
ATOM   6246 O  OE1   . GLN A 1 773 ? -26.361 -36.990 -23.302 1.00 54.94  ? 773  GLN A OE1   1 
ATOM   6247 N  NE2   . GLN A 1 773 ? -28.204 -35.955 -24.060 1.00 55.47  ? 773  GLN A NE2   1 
ATOM   6248 N  N     . LEU A 1 774 ? -23.168 -33.364 -26.091 1.00 37.11  ? 774  LEU A N     1 
ATOM   6249 C  CA    . LEU A 1 774 ? -21.792 -32.893 -26.198 1.00 37.64  ? 774  LEU A CA    1 
ATOM   6250 C  C     . LEU A 1 774 ? -21.298 -32.333 -24.867 1.00 37.06  ? 774  LEU A C     1 
ATOM   6251 O  O     . LEU A 1 774 ? -22.052 -31.688 -24.137 1.00 39.60  ? 774  LEU A O     1 
ATOM   6252 C  CB    . LEU A 1 774 ? -21.664 -31.843 -27.303 1.00 34.56  ? 774  LEU A CB    1 
ATOM   6253 C  CG    . LEU A 1 774 ? -21.858 -32.355 -28.733 1.00 36.07  ? 774  LEU A CG    1 
ATOM   6254 C  CD1   . LEU A 1 774 ? -22.047 -31.201 -29.700 1.00 33.45  ? 774  LEU A CD1   1 
ATOM   6255 C  CD2   . LEU A 1 774 ? -20.675 -33.210 -29.156 1.00 35.77  ? 774  LEU A CD2   1 
ATOM   6256 N  N     . ASN A 1 775 ? -20.033 -32.595 -24.554 1.00 32.05  ? 775  ASN A N     1 
ATOM   6257 C  CA    . ASN A 1 775 ? -19.417 -32.090 -23.334 1.00 33.26  ? 775  ASN A CA    1 
ATOM   6258 C  C     . ASN A 1 775 ? -19.491 -30.559 -23.271 1.00 32.75  ? 775  ASN A C     1 
ATOM   6259 O  O     . ASN A 1 775 ? -19.329 -29.875 -24.285 1.00 29.89  ? 775  ASN A O     1 
ATOM   6260 C  CB    . ASN A 1 775 ? -17.976 -32.595 -23.228 1.00 37.20  ? 775  ASN A CB    1 
ATOM   6261 C  CG    . ASN A 1 775 ? -17.206 -31.941 -22.101 1.00 45.17  ? 775  ASN A CG    1 
ATOM   6262 O  OD1   . ASN A 1 775 ? -16.564 -30.908 -22.293 1.00 49.61  ? 775  ASN A OD1   1 
ATOM   6263 N  ND2   . ASN A 1 775 ? -17.259 -32.542 -20.918 1.00 47.09  ? 775  ASN A ND2   1 
ATOM   6264 N  N     . TYR A 1 776 ? -19.756 -30.029 -22.081 1.00 28.65  ? 776  TYR A N     1 
ATOM   6265 C  CA    . TYR A 1 776 ? -20.029 -28.605 -21.921 1.00 27.92  ? 776  TYR A CA    1 
ATOM   6266 C  C     . TYR A 1 776 ? -18.870 -27.714 -22.376 1.00 28.33  ? 776  TYR A C     1 
ATOM   6267 O  O     . TYR A 1 776 ? -19.090 -26.637 -22.924 1.00 29.89  ? 776  TYR A O     1 
ATOM   6268 C  CB    . TYR A 1 776 ? -20.428 -28.290 -20.475 1.00 31.02  ? 776  TYR A CB    1 
ATOM   6269 C  CG    . TYR A 1 776 ? -19.282 -28.250 -19.487 1.00 31.96  ? 776  TYR A CG    1 
ATOM   6270 C  CD1   . TYR A 1 776 ? -18.799 -27.038 -19.009 1.00 32.90  ? 776  TYR A CD1   1 
ATOM   6271 C  CD2   . TYR A 1 776 ? -18.690 -29.421 -19.026 1.00 33.77  ? 776  TYR A CD2   1 
ATOM   6272 C  CE1   . TYR A 1 776 ? -17.758 -26.989 -18.107 1.00 35.45  ? 776  TYR A CE1   1 
ATOM   6273 C  CE2   . TYR A 1 776 ? -17.642 -29.384 -18.120 1.00 38.26  ? 776  TYR A CE2   1 
ATOM   6274 C  CZ    . TYR A 1 776 ? -17.181 -28.161 -17.664 1.00 40.11  ? 776  TYR A CZ    1 
ATOM   6275 O  OH    . TYR A 1 776 ? -16.145 -28.102 -16.761 1.00 40.79  ? 776  TYR A OH    1 
ATOM   6276 N  N     . ILE A 1 777 ? -17.640 -28.172 -22.163 1.00 27.02  ? 777  ILE A N     1 
ATOM   6277 C  CA    . ILE A 1 777 ? -16.470 -27.413 -22.594 1.00 30.26  ? 777  ILE A CA    1 
ATOM   6278 C  C     . ILE A 1 777 ? -16.427 -27.285 -24.119 1.00 28.69  ? 777  ILE A C     1 
ATOM   6279 O  O     . ILE A 1 777 ? -16.087 -26.228 -24.649 1.00 28.05  ? 777  ILE A O     1 
ATOM   6280 C  CB    . ILE A 1 777 ? -15.162 -28.024 -22.045 1.00 35.84  ? 777  ILE A CB    1 
ATOM   6281 C  CG1   . ILE A 1 777 ? -15.030 -27.713 -20.553 1.00 40.65  ? 777  ILE A CG1   1 
ATOM   6282 C  CG2   . ILE A 1 777 ? -13.949 -27.490 -22.792 1.00 36.21  ? 777  ILE A CG2   1 
ATOM   6283 C  CD1   . ILE A 1 777 ? -13.745 -28.220 -19.934 1.00 42.05  ? 777  ILE A CD1   1 
ATOM   6284 N  N     . SER A 1 778 ? -16.815 -28.351 -24.814 1.00 26.33  ? 778  SER A N     1 
ATOM   6285 C  CA    . SER A 1 778 ? -16.774 -28.382 -26.275 1.00 26.43  ? 778  SER A CA    1 
ATOM   6286 C  C     . SER A 1 778 ? -17.816 -27.487 -26.944 1.00 24.46  ? 778  SER A C     1 
ATOM   6287 O  O     . SER A 1 778 ? -17.693 -27.165 -28.126 1.00 27.85  ? 778  SER A O     1 
ATOM   6288 C  CB    . SER A 1 778 ? -16.916 -29.821 -26.786 1.00 29.57  ? 778  SER A CB    1 
ATOM   6289 O  OG    . SER A 1 778 ? -18.244 -30.291 -26.620 1.00 31.81  ? 778  SER A OG    1 
ATOM   6290 N  N     . ILE A 1 779 ? -18.843 -27.087 -26.203 1.00 25.84  ? 779  ILE A N     1 
ATOM   6291 C  CA    . ILE A 1 779 ? -19.873 -26.210 -26.767 1.00 26.14  ? 779  ILE A CA    1 
ATOM   6292 C  C     . ILE A 1 779 ? -19.832 -24.802 -26.161 1.00 26.43  ? 779  ILE A C     1 
ATOM   6293 O  O     . ILE A 1 779 ? -20.672 -23.954 -26.459 1.00 27.43  ? 779  ILE A O     1 
ATOM   6294 C  CB    . ILE A 1 779 ? -21.283 -26.819 -26.645 1.00 30.04  ? 779  ILE A CB    1 
ATOM   6295 C  CG1   . ILE A 1 779 ? -21.550 -27.274 -25.209 1.00 30.92  ? 779  ILE A CG1   1 
ATOM   6296 C  CG2   . ILE A 1 779 ? -21.432 -28.000 -27.591 1.00 30.48  ? 779  ILE A CG2   1 
ATOM   6297 C  CD1   . ILE A 1 779 ? -22.818 -28.076 -25.070 1.00 33.17  ? 779  ILE A CD1   1 
ATOM   6298 N  N     . ALA A 1 780 ? -18.831 -24.553 -25.325 1.00 24.86  ? 780  ALA A N     1 
ATOM   6299 C  CA    . ALA A 1 780 ? -18.640 -23.228 -24.760 1.00 24.03  ? 780  ALA A CA    1 
ATOM   6300 C  C     . ALA A 1 780 ? -17.961 -22.297 -25.761 1.00 25.31  ? 780  ALA A C     1 
ATOM   6301 O  O     . ALA A 1 780 ? -16.991 -22.678 -26.422 1.00 25.02  ? 780  ALA A O     1 
ATOM   6302 C  CB    . ALA A 1 780 ? -17.824 -23.313 -23.479 1.00 22.92  ? 780  ALA A CB    1 
ATOM   6303 N  N     . SER A 1 781 ? -18.471 -21.075 -25.865 1.00 23.04  ? 781  SER A N     1 
ATOM   6304 C  CA    . SER A 1 781 ? -17.820 -20.045 -26.663 1.00 22.60  ? 781  SER A CA    1 
ATOM   6305 C  C     . SER A 1 781 ? -16.589 -19.554 -25.910 1.00 21.85  ? 781  SER A C     1 
ATOM   6306 O  O     . SER A 1 781 ? -16.425 -19.845 -24.731 1.00 22.45  ? 781  SER A O     1 
ATOM   6307 C  CB    . SER A 1 781 ? -18.780 -18.884 -26.918 1.00 24.04  ? 781  SER A CB    1 
ATOM   6308 O  OG    . SER A 1 781 ? -19.961 -19.355 -27.546 1.00 31.08  ? 781  SER A OG    1 
ATOM   6309 N  N     . VAL A 1 782 ? -15.726 -18.813 -26.593 1.00 24.78  ? 782  VAL A N     1 
ATOM   6310 C  CA    . VAL A 1 782 ? -14.499 -18.320 -25.976 1.00 24.10  ? 782  VAL A CA    1 
ATOM   6311 C  C     . VAL A 1 782 ? -14.356 -16.833 -26.261 1.00 23.08  ? 782  VAL A C     1 
ATOM   6312 O  O     . VAL A 1 782 ? -14.698 -16.378 -27.346 1.00 22.06  ? 782  VAL A O     1 
ATOM   6313 C  CB    . VAL A 1 782 ? -13.255 -19.068 -26.515 1.00 22.09  ? 782  VAL A CB    1 
ATOM   6314 C  CG1   . VAL A 1 782 ? -11.985 -18.477 -25.941 1.00 23.20  ? 782  VAL A CG1   1 
ATOM   6315 C  CG2   . VAL A 1 782 ? -13.339 -20.551 -26.187 1.00 23.80  ? 782  VAL A CG2   1 
ATOM   6316 N  N     . SER A 1 783 ? -13.868 -16.074 -25.285 1.00 25.00  ? 783  SER A N     1 
ATOM   6317 C  CA    . SER A 1 783 ? -13.603 -14.660 -25.503 1.00 25.91  ? 783  SER A CA    1 
ATOM   6318 C  C     . SER A 1 783 ? -12.501 -14.123 -24.592 1.00 28.85  ? 783  SER A C     1 
ATOM   6319 O  O     . SER A 1 783 ? -12.258 -14.655 -23.514 1.00 30.23  ? 783  SER A O     1 
ATOM   6320 C  CB    . SER A 1 783 ? -14.883 -13.840 -25.323 1.00 24.71  ? 783  SER A CB    1 
ATOM   6321 O  OG    . SER A 1 783 ? -14.663 -12.496 -25.710 1.00 26.97  ? 783  SER A OG    1 
ATOM   6322 N  N     . SER A 1 784 ? -11.835 -13.064 -25.039 1.00 32.76  ? 784  SER A N     1 
ATOM   6323 C  CA    . SER A 1 784 ? -10.865 -12.371 -24.206 1.00 30.77  ? 784  SER A CA    1 
ATOM   6324 C  C     . SER A 1 784 ? -11.600 -11.542 -23.163 1.00 27.41  ? 784  SER A C     1 
ATOM   6325 O  O     . SER A 1 784 ? -12.664 -11.003 -23.437 1.00 31.55  ? 784  SER A O     1 
ATOM   6326 C  CB    . SER A 1 784 ? -9.970  -11.472 -25.059 1.00 30.71  ? 784  SER A CB    1 
ATOM   6327 O  OG    . SER A 1 784 ? -9.154  -12.243 -25.917 1.00 32.87  ? 784  SER A OG    1 
ATOM   6328 N  N     . ALA A 1 785 ? -11.026 -11.439 -21.971 1.00 31.21  ? 785  ALA A N     1 
ATOM   6329 C  CA    . ALA A 1 785 ? -11.668 -10.729 -20.867 1.00 36.61  ? 785  ALA A CA    1 
ATOM   6330 C  C     . ALA A 1 785 ? -11.002 -9.386  -20.589 1.00 34.59  ? 785  ALA A C     1 
ATOM   6331 O  O     . ALA A 1 785 ? -10.191 -9.270  -19.672 1.00 37.87  ? 785  ALA A O     1 
ATOM   6332 C  CB    . ALA A 1 785 ? -11.639 -11.586 -19.616 1.00 37.68  ? 785  ALA A CB    1 
ATOM   6333 N  N     . ASN A 1 786 ? -11.352 -8.371  -21.372 1.00 32.80  ? 786  ASN A N     1 
ATOM   6334 C  CA    . ASN A 1 786 ? -10.742 -7.052  -21.220 1.00 37.48  ? 786  ASN A CA    1 
ATOM   6335 C  C     . ASN A 1 786 ? -11.644 -6.059  -20.490 1.00 40.96  ? 786  ASN A C     1 
ATOM   6336 O  O     . ASN A 1 786 ? -12.859 -6.038  -20.700 1.00 42.37  ? 786  ASN A O     1 
ATOM   6337 C  CB    . ASN A 1 786 ? -10.331 -6.488  -22.583 1.00 38.76  ? 786  ASN A CB    1 
ATOM   6338 C  CG    . ASN A 1 786 ? -9.255  -7.317  -23.256 1.00 39.90  ? 786  ASN A CG    1 
ATOM   6339 O  OD1   . ASN A 1 786 ? -8.349  -7.826  -22.597 1.00 43.61  ? 786  ASN A OD1   1 
ATOM   6340 N  ND2   . ASN A 1 786 ? -9.351  -7.460  -24.577 1.00 35.62  ? 786  ASN A ND2   1 
ATOM   6341 N  N     . ASN A 1 787 ? -11.036 -5.246  -19.631 1.00 39.88  ? 787  ASN A N     1 
ATOM   6342 C  CA    . ASN A 1 787 ? -11.743 -4.193  -18.904 1.00 45.62  ? 787  ASN A CA    1 
ATOM   6343 C  C     . ASN A 1 787 ? -12.926 -4.686  -18.078 1.00 43.33  ? 787  ASN A C     1 
ATOM   6344 O  O     . ASN A 1 787 ? -14.023 -4.131  -18.158 1.00 40.96  ? 787  ASN A O     1 
ATOM   6345 C  CB    . ASN A 1 787 ? -12.198 -3.094  -19.866 1.00 50.80  ? 787  ASN A CB    1 
ATOM   6346 C  CG    . ASN A 1 787 ? -11.035 -2.365  -20.501 1.00 56.91  ? 787  ASN A CG    1 
ATOM   6347 O  OD1   . ASN A 1 787 ? -10.152 -1.859  -19.806 1.00 61.86  ? 787  ASN A OD1   1 
ATOM   6348 N  ND2   . ASN A 1 787 ? -11.017 -2.319  -21.829 1.00 55.48  ? 787  ASN A ND2   1 
ATOM   6349 N  N     . ILE A 1 788 ? -12.700 -5.725  -17.281 1.00 39.92  ? 788  ILE A N     1 
ATOM   6350 C  CA    . ILE A 1 788 ? -13.749 -6.258  -16.418 1.00 41.22  ? 788  ILE A CA    1 
ATOM   6351 C  C     . ILE A 1 788 ? -14.230 -5.197  -15.424 1.00 44.42  ? 788  ILE A C     1 
ATOM   6352 O  O     . ILE A 1 788 ? -15.435 -5.028  -15.215 1.00 44.25  ? 788  ILE A O     1 
ATOM   6353 C  CB    . ILE A 1 788 ? -13.269 -7.509  -15.659 1.00 41.32  ? 788  ILE A CB    1 
ATOM   6354 C  CG1   . ILE A 1 788 ? -12.786 -8.580  -16.642 1.00 39.26  ? 788  ILE A CG1   1 
ATOM   6355 C  CG2   . ILE A 1 788 ? -14.377 -8.060  -14.776 1.00 39.22  ? 788  ILE A CG2   1 
ATOM   6356 C  CD1   . ILE A 1 788 ? -11.990 -9.689  -15.986 1.00 38.40  ? 788  ILE A CD1   1 
ATOM   6357 N  N     . ALA A 1 789 ? -13.280 -4.475  -14.831 1.00 43.35  ? 789  ALA A N     1 
ATOM   6358 C  CA    . ALA A 1 789 ? -13.588 -3.461  -13.826 1.00 45.77  ? 789  ALA A CA    1 
ATOM   6359 C  C     . ALA A 1 789 ? -14.380 -2.299  -14.412 1.00 48.12  ? 789  ALA A C     1 
ATOM   6360 O  O     . ALA A 1 789 ? -15.203 -1.689  -13.727 1.00 50.72  ? 789  ALA A O     1 
ATOM   6361 C  CB    . ALA A 1 789 ? -12.308 -2.951  -13.172 1.00 45.64  ? 789  ALA A CB    1 
ATOM   6362 N  N     . LYS A 1 790 ? -14.124 -2.000  -15.681 1.00 47.86  ? 790  LYS A N     1 
ATOM   6363 C  CA    . LYS A 1 790 ? -14.795 -0.905  -16.371 1.00 50.65  ? 790  LYS A CA    1 
ATOM   6364 C  C     . LYS A 1 790 ? -16.310 -1.083  -16.375 1.00 51.32  ? 790  LYS A C     1 
ATOM   6365 O  O     . LYS A 1 790 ? -17.061 -0.107  -16.336 1.00 53.69  ? 790  LYS A O     1 
ATOM   6366 C  CB    . LYS A 1 790 ? -14.281 -0.797  -17.810 1.00 53.36  ? 790  LYS A CB    1 
ATOM   6367 C  CG    . LYS A 1 790 ? -14.911 0.323   -18.629 1.00 56.57  ? 790  LYS A CG    1 
ATOM   6368 C  CD    . LYS A 1 790 ? -14.420 0.295   -20.070 1.00 57.35  ? 790  LYS A CD    1 
ATOM   6369 C  CE    . LYS A 1 790 ? -15.042 1.412   -20.898 1.00 58.33  ? 790  LYS A CE    1 
ATOM   6370 N  NZ    . LYS A 1 790 ? -14.576 1.381   -22.315 1.00 58.58  ? 790  LYS A NZ    1 
ATOM   6371 N  N     . TYR A 1 791 ? -16.755 -2.334  -16.408 1.00 46.26  ? 791  TYR A N     1 
ATOM   6372 C  CA    . TYR A 1 791 ? -18.178 -2.629  -16.518 1.00 44.61  ? 791  TYR A CA    1 
ATOM   6373 C  C     . TYR A 1 791 ? -18.763 -3.244  -15.243 1.00 46.95  ? 791  TYR A C     1 
ATOM   6374 O  O     . TYR A 1 791 ? -19.891 -3.743  -15.242 1.00 46.62  ? 791  TYR A O     1 
ATOM   6375 C  CB    . TYR A 1 791 ? -18.436 -3.534  -17.726 1.00 42.21  ? 791  TYR A CB    1 
ATOM   6376 C  CG    . TYR A 1 791 ? -18.093 -2.890  -19.057 1.00 39.34  ? 791  TYR A CG    1 
ATOM   6377 C  CD1   . TYR A 1 791 ? -18.946 -1.959  -19.637 1.00 42.31  ? 791  TYR A CD1   1 
ATOM   6378 C  CD2   . TYR A 1 791 ? -16.922 -3.212  -19.729 1.00 34.18  ? 791  TYR A CD2   1 
ATOM   6379 C  CE1   . TYR A 1 791 ? -18.642 -1.366  -20.851 1.00 40.82  ? 791  TYR A CE1   1 
ATOM   6380 C  CE2   . TYR A 1 791 ? -16.609 -2.624  -20.946 1.00 33.27  ? 791  TYR A CE2   1 
ATOM   6381 C  CZ    . TYR A 1 791 ? -17.476 -1.702  -21.501 1.00 37.87  ? 791  TYR A CZ    1 
ATOM   6382 O  OH    . TYR A 1 791 ? -17.183 -1.111  -22.710 1.00 35.65  ? 791  TYR A OH    1 
ATOM   6383 N  N     . ASP A 1 792 ? -17.997 -3.186  -14.158 1.00 47.23  ? 792  ASP A N     1 
ATOM   6384 C  CA    . ASP A 1 792 ? -18.412 -3.763  -12.884 1.00 48.61  ? 792  ASP A CA    1 
ATOM   6385 C  C     . ASP A 1 792 ? -19.066 -2.711  -11.981 1.00 50.73  ? 792  ASP A C     1 
ATOM   6386 O  O     . ASP A 1 792 ? -18.400 -1.810  -11.475 1.00 51.36  ? 792  ASP A O     1 
ATOM   6387 C  CB    . ASP A 1 792 ? -17.203 -4.395  -12.182 1.00 52.03  ? 792  ASP A CB    1 
ATOM   6388 C  CG    . ASP A 1 792 ? -17.591 -5.270  -10.997 1.00 55.24  ? 792  ASP A CG    1 
ATOM   6389 O  OD1   . ASP A 1 792 ? -18.689 -5.083  -10.430 1.00 60.09  ? 792  ASP A OD1   1 
ATOM   6390 O  OD2   . ASP A 1 792 ? -16.783 -6.147  -10.625 1.00 53.89  ? 792  ASP A OD2   1 
ATOM   6391 N  N     . VAL A 1 793 ? -20.374 -2.838  -11.776 1.00 50.47  ? 793  VAL A N     1 
ATOM   6392 C  CA    . VAL A 1 793 ? -21.098 -1.929  -10.894 1.00 54.05  ? 793  VAL A CA    1 
ATOM   6393 C  C     . VAL A 1 793 ? -21.731 -2.697  -9.738  1.00 56.41  ? 793  VAL A C     1 
ATOM   6394 O  O     . VAL A 1 793 ? -22.847 -3.205  -9.855  1.00 57.34  ? 793  VAL A O     1 
ATOM   6395 C  CB    . VAL A 1 793 ? -22.190 -1.152  -11.651 1.00 54.40  ? 793  VAL A CB    1 
ATOM   6396 C  CG1   . VAL A 1 793 ? -22.891 -0.173  -10.717 1.00 57.85  ? 793  VAL A CG1   1 
ATOM   6397 C  CG2   . VAL A 1 793 ? -21.586 -0.417  -12.834 1.00 53.67  ? 793  VAL A CG2   1 
ATOM   6398 N  N     . GLY A 1 794 ? -21.005 -2.785  -8.627  1.00 57.74  ? 794  GLY A N     1 
ATOM   6399 C  CA    . GLY A 1 794 ? -21.472 -3.514  -7.461  1.00 58.58  ? 794  GLY A CA    1 
ATOM   6400 C  C     . GLY A 1 794 ? -21.656 -4.994  -7.739  1.00 57.14  ? 794  GLY A C     1 
ATOM   6401 O  O     . GLY A 1 794 ? -22.578 -5.622  -7.219  1.00 57.01  ? 794  GLY A O     1 
ATOM   6402 N  N     . GLY A 1 795 ? -20.781 -5.552  -8.569  1.00 53.69  ? 795  GLY A N     1 
ATOM   6403 C  CA    . GLY A 1 795 ? -20.863 -6.957  -8.931  1.00 51.33  ? 795  GLY A CA    1 
ATOM   6404 C  C     . GLY A 1 795 ? -21.853 -7.217  -10.052 1.00 48.99  ? 795  GLY A C     1 
ATOM   6405 O  O     . GLY A 1 795 ? -22.084 -8.364  -10.435 1.00 48.97  ? 795  GLY A O     1 
ATOM   6406 N  N     . PHE A 1 796 ? -22.431 -6.146  -10.586 1.00 49.41  ? 796  PHE A N     1 
ATOM   6407 C  CA    . PHE A 1 796 ? -23.437 -6.253  -11.638 1.00 49.15  ? 796  PHE A CA    1 
ATOM   6408 C  C     . PHE A 1 796 ? -23.022 -5.482  -12.894 1.00 48.32  ? 796  PHE A C     1 
ATOM   6409 O  O     . PHE A 1 796 ? -22.243 -4.535  -12.811 1.00 49.71  ? 796  PHE A O     1 
ATOM   6410 C  CB    . PHE A 1 796 ? -24.792 -5.768  -11.117 1.00 52.92  ? 796  PHE A CB    1 
ATOM   6411 C  CG    . PHE A 1 796 ? -25.390 -6.661  -10.068 1.00 53.02  ? 796  PHE A CG    1 
ATOM   6412 C  CD1   . PHE A 1 796 ? -26.150 -7.763  -10.428 1.00 51.92  ? 796  PHE A CD1   1 
ATOM   6413 C  CD2   . PHE A 1 796 ? -25.189 -6.403  -8.722  1.00 53.64  ? 796  PHE A CD2   1 
ATOM   6414 C  CE1   . PHE A 1 796 ? -26.701 -8.589  -9.466  1.00 52.71  ? 796  PHE A CE1   1 
ATOM   6415 C  CE2   . PHE A 1 796 ? -25.739 -7.223  -7.755  1.00 55.45  ? 796  PHE A CE2   1 
ATOM   6416 C  CZ    . PHE A 1 796 ? -26.497 -8.318  -8.128  1.00 55.14  ? 796  PHE A CZ    1 
ATOM   6417 N  N     . PRO A 1 797 ? -23.529 -5.902  -14.067 1.00 48.29  ? 797  PRO A N     1 
ATOM   6418 C  CA    . PRO A 1 797 ? -23.154 -5.275  -15.342 1.00 48.66  ? 797  PRO A CA    1 
ATOM   6419 C  C     . PRO A 1 797 ? -23.538 -3.802  -15.451 1.00 51.86  ? 797  PRO A C     1 
ATOM   6420 O  O     . PRO A 1 797 ? -24.696 -3.441  -15.243 1.00 52.09  ? 797  PRO A O     1 
ATOM   6421 C  CB    . PRO A 1 797 ? -23.928 -6.098  -16.381 1.00 45.25  ? 797  PRO A CB    1 
ATOM   6422 C  CG    . PRO A 1 797 ? -25.001 -6.793  -15.614 1.00 47.84  ? 797  PRO A CG    1 
ATOM   6423 C  CD    . PRO A 1 797 ? -24.408 -7.065  -14.274 1.00 47.93  ? 797  PRO A CD    1 
ATOM   6424 N  N     . GLY A 1 798 ? -22.562 -2.964  -15.783 1.00 53.41  ? 798  GLY A N     1 
ATOM   6425 C  CA    . GLY A 1 798 ? -22.813 -1.555  -16.025 1.00 53.31  ? 798  GLY A CA    1 
ATOM   6426 C  C     . GLY A 1 798 ? -23.281 -1.312  -17.447 1.00 52.57  ? 798  GLY A C     1 
ATOM   6427 O  O     . GLY A 1 798 ? -23.519 -2.263  -18.193 1.00 51.69  ? 798  GLY A O     1 
ATOM   6428 N  N     . PRO A 1 799 ? -23.424 -0.032  -17.830 1.00 52.54  ? 799  PRO A N     1 
ATOM   6429 C  CA    . PRO A 1 799 ? -23.874 0.349   -19.174 1.00 49.65  ? 799  PRO A CA    1 
ATOM   6430 C  C     . PRO A 1 799 ? -22.992 -0.236  -20.276 1.00 46.15  ? 799  PRO A C     1 
ATOM   6431 O  O     . PRO A 1 799 ? -21.767 -0.205  -20.164 1.00 45.76  ? 799  PRO A O     1 
ATOM   6432 C  CB    . PRO A 1 799 ? -23.758 1.877   -19.159 1.00 51.43  ? 799  PRO A CB    1 
ATOM   6433 C  CG    . PRO A 1 799 ? -23.886 2.250   -17.725 1.00 53.57  ? 799  PRO A CG    1 
ATOM   6434 C  CD    . PRO A 1 799 ? -23.220 1.141   -16.963 1.00 53.05  ? 799  PRO A CD    1 
ATOM   6435 N  N     . LYS A 1 800 ? -23.627 -0.768  -21.317 1.00 46.12  ? 800  LYS A N     1 
ATOM   6436 C  CA    . LYS A 1 800 ? -22.937 -1.353  -22.469 1.00 43.45  ? 800  LYS A CA    1 
ATOM   6437 C  C     . LYS A 1 800 ? -22.008 -2.505  -22.096 1.00 42.76  ? 800  LYS A C     1 
ATOM   6438 O  O     . LYS A 1 800 ? -21.008 -2.743  -22.775 1.00 43.27  ? 800  LYS A O     1 
ATOM   6439 C  CB    . LYS A 1 800 ? -22.159 -0.286  -23.248 1.00 42.95  ? 800  LYS A CB    1 
ATOM   6440 C  CG    . LYS A 1 800 ? -22.993 0.910   -23.669 1.00 47.33  ? 800  LYS A CG    1 
ATOM   6441 N  N     . CYS A 1 801 ? -22.337 -3.217  -21.024 1.00 41.78  ? 801  CYS A N     1 
ATOM   6442 C  CA    . CYS A 1 801 ? -21.532 -4.357  -20.609 1.00 36.53  ? 801  CYS A CA    1 
ATOM   6443 C  C     . CYS A 1 801 ? -21.598 -5.454  -21.663 1.00 33.95  ? 801  CYS A C     1 
ATOM   6444 O  O     . CYS A 1 801 ? -22.680 -5.934  -21.996 1.00 32.61  ? 801  CYS A O     1 
ATOM   6445 C  CB    . CYS A 1 801 ? -21.995 -4.900  -19.256 1.00 38.49  ? 801  CYS A CB    1 
ATOM   6446 S  SG    . CYS A 1 801 ? -20.981 -6.283  -18.629 1.00 37.10  ? 801  CYS A SG    1 
ATOM   6447 N  N     . PRO A 1 802 ? -20.434 -5.838  -22.205 1.00 32.00  ? 802  PRO A N     1 
ATOM   6448 C  CA    . PRO A 1 802 ? -20.348 -6.915  -23.195 1.00 34.37  ? 802  PRO A CA    1 
ATOM   6449 C  C     . PRO A 1 802 ? -20.868 -8.229  -22.631 1.00 34.41  ? 802  PRO A C     1 
ATOM   6450 O  O     . PRO A 1 802 ? -20.776 -8.457  -21.424 1.00 35.27  ? 802  PRO A O     1 
ATOM   6451 C  CB    . PRO A 1 802 ? -18.845 -7.020  -23.467 1.00 32.51  ? 802  PRO A CB    1 
ATOM   6452 C  CG    . PRO A 1 802 ? -18.308 -5.665  -23.131 1.00 32.11  ? 802  PRO A CG    1 
ATOM   6453 C  CD    . PRO A 1 802 ? -19.125 -5.208  -21.959 1.00 30.89  ? 802  PRO A CD    1 
ATOM   6454 N  N     . PHE A 1 803 ? -21.408 -9.069  -23.507 1.00 32.87  ? 803  PHE A N     1 
ATOM   6455 C  CA    . PHE A 1 803 ? -21.974 -10.362 -23.131 1.00 33.82  ? 803  PHE A CA    1 
ATOM   6456 C  C     . PHE A 1 803 ? -21.010 -11.198 -22.288 1.00 31.50  ? 803  PHE A C     1 
ATOM   6457 O  O     . PHE A 1 803 ? -21.378 -11.682 -21.216 1.00 33.96  ? 803  PHE A O     1 
ATOM   6458 C  CB    . PHE A 1 803 ? -22.375 -11.130 -24.394 1.00 34.80  ? 803  PHE A CB    1 
ATOM   6459 C  CG    . PHE A 1 803 ? -23.208 -12.357 -24.132 1.00 35.76  ? 803  PHE A CG    1 
ATOM   6460 C  CD1   . PHE A 1 803 ? -24.583 -12.258 -23.977 1.00 35.54  ? 803  PHE A CD1   1 
ATOM   6461 C  CD2   . PHE A 1 803 ? -22.621 -13.611 -24.075 1.00 30.90  ? 803  PHE A CD2   1 
ATOM   6462 C  CE1   . PHE A 1 803 ? -25.356 -13.384 -23.751 1.00 34.91  ? 803  PHE A CE1   1 
ATOM   6463 C  CE2   . PHE A 1 803 ? -23.388 -14.743 -23.849 1.00 31.40  ? 803  PHE A CE2   1 
ATOM   6464 C  CZ    . PHE A 1 803 ? -24.760 -14.628 -23.686 1.00 33.14  ? 803  PHE A CZ    1 
ATOM   6465 N  N     . HIS A 1 804 ? -19.778 -11.361 -22.765 1.00 28.34  ? 804  HIS A N     1 
ATOM   6466 C  CA    . HIS A 1 804 ? -18.807 -12.202 -22.061 1.00 28.13  ? 804  HIS A CA    1 
ATOM   6467 C  C     . HIS A 1 804 ? -18.378 -11.623 -20.711 1.00 28.46  ? 804  HIS A C     1 
ATOM   6468 O  O     . HIS A 1 804 ? -18.076 -12.368 -19.776 1.00 28.00  ? 804  HIS A O     1 
ATOM   6469 C  CB    . HIS A 1 804 ? -17.585 -12.511 -22.935 1.00 24.50  ? 804  HIS A CB    1 
ATOM   6470 C  CG    . HIS A 1 804 ? -16.809 -11.302 -23.354 1.00 25.46  ? 804  HIS A CG    1 
ATOM   6471 N  ND1   . HIS A 1 804 ? -17.308 -10.359 -24.231 1.00 26.99  ? 804  HIS A ND1   1 
ATOM   6472 C  CD2   . HIS A 1 804 ? -15.562 -10.888 -23.034 1.00 24.70  ? 804  HIS A CD2   1 
ATOM   6473 C  CE1   . HIS A 1 804 ? -16.406 -9.416  -24.422 1.00 27.71  ? 804  HIS A CE1   1 
ATOM   6474 N  NE2   . HIS A 1 804 ? -15.333 -9.715  -23.708 1.00 29.29  ? 804  HIS A NE2   1 
ATOM   6475 N  N     . ILE A 1 805 ? -18.355 -10.299 -20.614 1.00 26.39  ? 805  ILE A N     1 
ATOM   6476 C  CA    . ILE A 1 805 ? -18.034 -9.629  -19.356 1.00 29.05  ? 805  ILE A CA    1 
ATOM   6477 C  C     . ILE A 1 805 ? -19.173 -9.834  -18.353 1.00 30.89  ? 805  ILE A C     1 
ATOM   6478 O  O     . ILE A 1 805 ? -18.939 -9.998  -17.154 1.00 34.23  ? 805  ILE A O     1 
ATOM   6479 C  CB    . ILE A 1 805 ? -17.773 -8.117  -19.571 1.00 29.35  ? 805  ILE A CB    1 
ATOM   6480 C  CG1   . ILE A 1 805 ? -16.640 -7.911  -20.584 1.00 28.26  ? 805  ILE A CG1   1 
ATOM   6481 C  CG2   . ILE A 1 805 ? -17.446 -7.423  -18.257 1.00 33.15  ? 805  ILE A CG2   1 
ATOM   6482 C  CD1   . ILE A 1 805 ? -15.337 -8.633  -20.223 1.00 25.53  ? 805  ILE A CD1   1 
ATOM   6483 N  N     . ARG A 1 806 ? -20.405 -9.835  -18.855 1.00 30.15  ? 806  ARG A N     1 
ATOM   6484 C  CA    . ARG A 1 806 ? -21.574 -10.129 -18.027 1.00 32.59  ? 806  ARG A CA    1 
ATOM   6485 C  C     . ARG A 1 806 ? -21.459 -11.527 -17.427 1.00 32.78  ? 806  ARG A C     1 
ATOM   6486 O  O     . ARG A 1 806 ? -21.811 -11.753 -16.269 1.00 32.86  ? 806  ARG A O     1 
ATOM   6487 C  CB    . ARG A 1 806 ? -22.860 -10.016 -18.850 1.00 29.18  ? 806  ARG A CB    1 
ATOM   6488 C  CG    . ARG A 1 806 ? -24.113 -10.500 -18.128 1.00 30.11  ? 806  ARG A CG    1 
ATOM   6489 C  CD    . ARG A 1 806 ? -25.341 -10.354 -19.013 1.00 33.24  ? 806  ARG A CD    1 
ATOM   6490 N  NE    . ARG A 1 806 ? -25.566 -8.958  -19.378 1.00 35.09  ? 806  ARG A NE    1 
ATOM   6491 C  CZ    . ARG A 1 806 ? -26.355 -8.130  -18.700 1.00 37.83  ? 806  ARG A CZ    1 
ATOM   6492 N  NH1   . ARG A 1 806 ? -27.007 -8.563  -17.625 1.00 36.46  ? 806  ARG A NH1   1 
ATOM   6493 N  NH2   . ARG A 1 806 ? -26.498 -6.872  -19.096 1.00 37.47  ? 806  ARG A NH2   1 
ATOM   6494 N  N     . GLY A 1 807 ? -20.947 -12.460 -18.223 1.00 29.75  ? 807  GLY A N     1 
ATOM   6495 C  CA    . GLY A 1 807 ? -20.746 -13.823 -17.767 1.00 30.74  ? 807  GLY A CA    1 
ATOM   6496 C  C     . GLY A 1 807 ? -19.735 -13.912 -16.641 1.00 30.65  ? 807  GLY A C     1 
ATOM   6497 O  O     . GLY A 1 807 ? -19.896 -14.700 -15.707 1.00 31.78  ? 807  GLY A O     1 
ATOM   6498 N  N     . ILE A 1 808 ? -18.689 -13.098 -16.729 1.00 28.08  ? 808  ILE A N     1 
ATOM   6499 C  CA    . ILE A 1 808 ? -17.650 -13.067 -15.704 1.00 29.34  ? 808  ILE A CA    1 
ATOM   6500 C  C     . ILE A 1 808 ? -18.183 -12.525 -14.377 1.00 32.05  ? 808  ILE A C     1 
ATOM   6501 O  O     . ILE A 1 808 ? -17.878 -13.056 -13.308 1.00 35.78  ? 808  ILE A O     1 
ATOM   6502 C  CB    . ILE A 1 808 ? -16.454 -12.224 -16.163 1.00 33.49  ? 808  ILE A CB    1 
ATOM   6503 C  CG1   . ILE A 1 808 ? -15.788 -12.879 -17.372 1.00 31.64  ? 808  ILE A CG1   1 
ATOM   6504 C  CG2   . ILE A 1 808 ? -15.449 -12.044 -15.030 1.00 32.57  ? 808  ILE A CG2   1 
ATOM   6505 C  CD1   . ILE A 1 808 ? -14.711 -12.027 -17.994 1.00 32.06  ? 808  ILE A CD1   1 
ATOM   6506 N  N     . LEU A 1 809 ? -18.988 -11.471 -14.453 1.00 31.67  ? 809  LEU A N     1 
ATOM   6507 C  CA    . LEU A 1 809 ? -19.612 -10.897 -13.266 1.00 31.51  ? 809  LEU A CA    1 
ATOM   6508 C  C     . LEU A 1 809 ? -20.536 -11.912 -12.600 1.00 32.31  ? 809  LEU A C     1 
ATOM   6509 O  O     . LEU A 1 809 ? -20.592 -12.003 -11.376 1.00 35.61  ? 809  LEU A O     1 
ATOM   6510 C  CB    . LEU A 1 809 ? -20.379 -9.626  -13.631 1.00 30.82  ? 809  LEU A CB    1 
ATOM   6511 C  CG    . LEU A 1 809 ? -19.489 -8.521  -14.209 1.00 35.14  ? 809  LEU A CG    1 
ATOM   6512 C  CD1   . LEU A 1 809 ? -20.306 -7.295  -14.567 1.00 36.49  ? 809  LEU A CD1   1 
ATOM   6513 C  CD2   . LEU A 1 809 ? -18.371 -8.160  -13.237 1.00 33.86  ? 809  LEU A CD2   1 
ATOM   6514 N  N     . THR A 1 810 ? -21.249 -12.683 -13.414 1.00 32.62  ? 810  THR A N     1 
ATOM   6515 C  CA    . THR A 1 810 ? -22.114 -13.740 -12.905 1.00 35.68  ? 810  THR A CA    1 
ATOM   6516 C  C     . THR A 1 810 ? -21.287 -14.785 -12.164 1.00 36.32  ? 810  THR A C     1 
ATOM   6517 O  O     . THR A 1 810 ? -21.679 -15.267 -11.100 1.00 37.09  ? 810  THR A O     1 
ATOM   6518 C  CB    . THR A 1 810 ? -22.881 -14.427 -14.045 1.00 33.10  ? 810  THR A CB    1 
ATOM   6519 O  OG1   . THR A 1 810 ? -23.560 -13.438 -14.831 1.00 32.52  ? 810  THR A OG1   1 
ATOM   6520 C  CG2   . THR A 1 810 ? -23.891 -15.417 -13.486 1.00 32.30  ? 810  THR A CG2   1 
ATOM   6521 N  N     . TYR A 1 811 ? -20.134 -15.123 -12.735 1.00 35.61  ? 811  TYR A N     1 
ATOM   6522 C  CA    . TYR A 1 811 ? -19.201 -16.057 -12.112 1.00 33.15  ? 811  TYR A CA    1 
ATOM   6523 C  C     . TYR A 1 811 ? -18.699 -15.534 -10.775 1.00 33.12  ? 811  TYR A C     1 
ATOM   6524 O  O     . TYR A 1 811 ? -18.701 -16.256 -9.776  1.00 37.78  ? 811  TYR A O     1 
ATOM   6525 C  CB    . TYR A 1 811 ? -18.013 -16.296 -13.040 1.00 31.37  ? 811  TYR A CB    1 
ATOM   6526 C  CG    . TYR A 1 811 ? -16.944 -17.227 -12.498 1.00 33.10  ? 811  TYR A CG    1 
ATOM   6527 C  CD1   . TYR A 1 811 ? -17.157 -18.598 -12.423 1.00 34.53  ? 811  TYR A CD1   1 
ATOM   6528 C  CD2   . TYR A 1 811 ? -15.708 -16.734 -12.093 1.00 34.49  ? 811  TYR A CD2   1 
ATOM   6529 C  CE1   . TYR A 1 811 ? -16.174 -19.453 -11.943 1.00 34.70  ? 811  TYR A CE1   1 
ATOM   6530 C  CE2   . TYR A 1 811 ? -14.719 -17.579 -11.613 1.00 34.85  ? 811  TYR A CE2   1 
ATOM   6531 C  CZ    . TYR A 1 811 ? -14.957 -18.935 -11.538 1.00 36.28  ? 811  TYR A CZ    1 
ATOM   6532 O  OH    . TYR A 1 811 ? -13.977 -19.777 -11.058 1.00 35.33  ? 811  TYR A OH    1 
ATOM   6533 N  N     . ASN A 1 812 ? -18.266 -14.277 -10.765 1.00 32.76  ? 812  ASN A N     1 
ATOM   6534 C  CA    . ASN A 1 812 ? -17.736 -13.660 -9.552  1.00 34.37  ? 812  ASN A CA    1 
ATOM   6535 C  C     . ASN A 1 812 ? -18.739 -13.667 -8.398  1.00 39.30  ? 812  ASN A C     1 
ATOM   6536 O  O     . ASN A 1 812 ? -18.368 -13.932 -7.256  1.00 46.35  ? 812  ASN A O     1 
ATOM   6537 C  CB    . ASN A 1 812 ? -17.237 -12.235 -9.828  1.00 31.79  ? 812  ASN A CB    1 
ATOM   6538 C  CG    . ASN A 1 812 ? -16.009 -12.207 -10.733 1.00 34.48  ? 812  ASN A CG    1 
ATOM   6539 O  OD1   . ASN A 1 812 ? -15.376 -13.235 -10.977 1.00 32.61  ? 812  ASN A OD1   1 
ATOM   6540 N  ND2   . ASN A 1 812 ? -15.666 -11.023 -11.228 1.00 35.56  ? 812  ASN A ND2   1 
ATOM   6541 N  N     . ARG A 1 813 ? -20.006 -13.387 -8.698  1.00 35.91  ? 813  ARG A N     1 
ATOM   6542 C  CA    . ARG A 1 813 ? -21.055 -13.435 -7.682  1.00 40.75  ? 813  ARG A CA    1 
ATOM   6543 C  C     . ARG A 1 813 ? -21.279 -14.860 -7.181  1.00 42.52  ? 813  ARG A C     1 
ATOM   6544 O  O     . ARG A 1 813 ? -21.606 -15.073 -6.013  1.00 45.29  ? 813  ARG A O     1 
ATOM   6545 C  CB    . ARG A 1 813 ? -22.373 -12.866 -8.217  1.00 41.53  ? 813  ARG A CB    1 
ATOM   6546 C  CG    . ARG A 1 813 ? -22.308 -11.406 -8.641  1.00 43.23  ? 813  ARG A CG    1 
ATOM   6547 C  CD    . ARG A 1 813 ? -23.706 -10.819 -8.810  1.00 44.16  ? 813  ARG A CD    1 
ATOM   6548 N  NE    . ARG A 1 813 ? -24.529 -11.623 -9.708  1.00 40.20  ? 813  ARG A NE    1 
ATOM   6549 C  CZ    . ARG A 1 813 ? -24.586 -11.451 -11.025 1.00 40.36  ? 813  ARG A CZ    1 
ATOM   6550 N  NH1   . ARG A 1 813 ? -23.864 -10.499 -11.605 1.00 38.47  ? 813  ARG A NH1   1 
ATOM   6551 N  NH2   . ARG A 1 813 ? -25.362 -12.235 -11.763 1.00 40.24  ? 813  ARG A NH2   1 
ATOM   6552 N  N     . ALA A 1 814 ? -21.097 -15.830 -8.070  1.00 40.13  ? 814  ALA A N     1 
ATOM   6553 C  CA    . ALA A 1 814 ? -21.344 -17.228 -7.738  1.00 39.87  ? 814  ALA A CA    1 
ATOM   6554 C  C     . ALA A 1 814 ? -20.270 -17.815 -6.822  1.00 40.75  ? 814  ALA A C     1 
ATOM   6555 O  O     . ALA A 1 814 ? -20.560 -18.684 -6.000  1.00 43.50  ? 814  ALA A O     1 
ATOM   6556 C  CB    . ALA A 1 814 ? -21.472 -18.058 -9.012  1.00 39.16  ? 814  ALA A CB    1 
ATOM   6557 N  N     . ILE A 1 815 ? -19.035 -17.341 -6.966  1.00 41.41  ? 815  ILE A N     1 
ATOM   6558 C  CA    . ILE A 1 815 ? -17.915 -17.864 -6.184  1.00 43.35  ? 815  ILE A CA    1 
ATOM   6559 C  C     . ILE A 1 815 ? -17.524 -16.921 -5.051  1.00 47.90  ? 815  ILE A C     1 
ATOM   6560 O  O     . ILE A 1 815 ? -16.507 -17.123 -4.386  1.00 50.01  ? 815  ILE A O     1 
ATOM   6561 C  CB    . ILE A 1 815 ? -16.671 -18.105 -7.058  1.00 40.09  ? 815  ILE A CB    1 
ATOM   6562 C  CG1   . ILE A 1 815 ? -16.176 -16.784 -7.654  1.00 41.15  ? 815  ILE A CG1   1 
ATOM   6563 C  CG2   . ILE A 1 815 ? -16.970 -19.121 -8.151  1.00 37.88  ? 815  ILE A CG2   1 
ATOM   6564 C  CD1   . ILE A 1 815 ? -14.754 -16.841 -8.171  1.00 40.78  ? 815  ILE A CD1   1 
ATOM   6565 N  N     . LYS A 1 816 ? -18.334 -15.888 -4.850  1.00 49.13  ? 816  LYS A N     1 
ATOM   6566 C  CA    . LYS A 1 816 ? -18.104 -14.899 -3.806  1.00 55.66  ? 816  LYS A CA    1 
ATOM   6567 C  C     . LYS A 1 816 ? -17.972 -15.573 -2.443  1.00 61.96  ? 816  LYS A C     1 
ATOM   6568 O  O     . LYS A 1 816 ? -18.867 -16.299 -2.012  1.00 63.44  ? 816  LYS A O     1 
ATOM   6569 C  CB    . LYS A 1 816 ? -19.263 -13.899 -3.782  1.00 58.17  ? 816  LYS A CB    1 
ATOM   6570 C  CG    . LYS A 1 816 ? -19.027 -12.663 -2.931  1.00 62.33  ? 816  LYS A CG    1 
ATOM   6571 C  CD    . LYS A 1 816 ? -18.650 -11.465 -3.789  1.00 63.39  ? 816  LYS A CD    1 
ATOM   6572 C  CE    . LYS A 1 816 ? -18.722 -10.172 -2.993  1.00 67.28  ? 816  LYS A CE    1 
ATOM   6573 N  NZ    . LYS A 1 816 ? -20.086 -9.939  -2.437  1.00 68.86  ? 816  LYS A NZ    1 
ATOM   6574 N  N     . GLY A 1 817 ? -16.847 -15.343 -1.773  1.00 65.13  ? 817  GLY A N     1 
ATOM   6575 C  CA    . GLY A 1 817 ? -16.639 -15.884 -0.443  1.00 70.39  ? 817  GLY A CA    1 
ATOM   6576 C  C     . GLY A 1 817 ? -15.911 -17.215 -0.424  1.00 72.95  ? 817  GLY A C     1 
ATOM   6577 O  O     . GLY A 1 817 ? -15.768 -17.838 0.629   1.00 75.21  ? 817  GLY A O     1 
ATOM   6578 N  N     . ASN A 1 818 ? -15.459 -17.658 -1.593  1.00 71.16  ? 818  ASN A N     1 
ATOM   6579 C  CA    . ASN A 1 818 ? -14.651 -18.868 -1.693  1.00 70.17  ? 818  ASN A CA    1 
ATOM   6580 C  C     . ASN A 1 818 ? -13.233 -18.528 -2.134  1.00 70.85  ? 818  ASN A C     1 
ATOM   6581 O  O     . ASN A 1 818 ? -12.969 -18.350 -3.324  1.00 67.71  ? 818  ASN A O     1 
ATOM   6582 C  CB    . ASN A 1 818 ? -15.285 -19.867 -2.661  1.00 69.25  ? 818  ASN A CB    1 
ATOM   6583 C  CG    . ASN A 1 818 ? -16.674 -20.296 -2.231  1.00 71.18  ? 818  ASN A CG    1 
ATOM   6584 N  N     . ILE A 1 819 ? -12.325 -18.438 -1.167  1.00 74.40  ? 819  ILE A N     1 
ATOM   6585 C  CA    . ILE A 1 819 ? -10.953 -18.009 -1.430  1.00 74.49  ? 819  ILE A CA    1 
ATOM   6586 C  C     . ILE A 1 819 ? -10.182 -18.986 -2.316  1.00 73.81  ? 819  ILE A C     1 
ATOM   6587 O  O     . ILE A 1 819 ? -9.156  -18.630 -2.896  1.00 73.94  ? 819  ILE A O     1 
ATOM   6588 C  CB    . ILE A 1 819 ? -10.170 -17.792 -0.119  1.00 76.80  ? 819  ILE A CB    1 
ATOM   6589 N  N     . ASP A 1 820 ? -10.681 -20.214 -2.423  1.00 72.68  ? 820  ASP A N     1 
ATOM   6590 C  CA    . ASP A 1 820 ? -9.997  -21.253 -3.186  1.00 70.43  ? 820  ASP A CA    1 
ATOM   6591 C  C     . ASP A 1 820 ? -10.389 -21.257 -4.662  1.00 66.03  ? 820  ASP A C     1 
ATOM   6592 O  O     . ASP A 1 820 ? -9.632  -21.738 -5.507  1.00 66.63  ? 820  ASP A O     1 
ATOM   6593 C  CB    . ASP A 1 820 ? -10.264 -22.629 -2.568  1.00 72.56  ? 820  ASP A CB    1 
ATOM   6594 N  N     . ALA A 1 821 ? -11.567 -20.718 -4.967  1.00 60.99  ? 821  ALA A N     1 
ATOM   6595 C  CA    . ALA A 1 821 ? -12.103 -20.732 -6.329  1.00 53.39  ? 821  ALA A CA    1 
ATOM   6596 C  C     . ALA A 1 821 ? -11.219 -19.972 -7.316  1.00 48.81  ? 821  ALA A C     1 
ATOM   6597 O  O     . ALA A 1 821 ? -10.677 -18.921 -6.983  1.00 47.75  ? 821  ALA A O     1 
ATOM   6598 C  CB    . ALA A 1 821 ? -13.514 -20.166 -6.344  1.00 53.22  ? 821  ALA A CB    1 
ATOM   6599 N  N     . PRO A 1 822 ? -11.080 -20.506 -8.543  1.00 46.44  ? 822  PRO A N     1 
ATOM   6600 C  CA    . PRO A 1 822 ? -10.261 -19.878 -9.587  1.00 45.19  ? 822  PRO A CA    1 
ATOM   6601 C  C     . PRO A 1 822 ? -10.801 -18.512 -9.992  1.00 45.47  ? 822  PRO A C     1 
ATOM   6602 O  O     . PRO A 1 822 ? -11.986 -18.378 -10.292 1.00 47.33  ? 822  PRO A O     1 
ATOM   6603 C  CB    . PRO A 1 822 ? -10.382 -20.853 -10.764 1.00 41.03  ? 822  PRO A CB    1 
ATOM   6604 C  CG    . PRO A 1 822 ? -10.791 -22.147 -10.156 1.00 43.53  ? 822  PRO A CG    1 
ATOM   6605 C  CD    . PRO A 1 822 ? -11.664 -21.778 -8.996  1.00 44.34  ? 822  PRO A CD    1 
ATOM   6606 N  N     . GLN A 1 823 ? -9.933  -17.509 -10.000 1.00 44.53  ? 823  GLN A N     1 
ATOM   6607 C  CA    . GLN A 1 823 ? -10.334 -16.166 -10.390 1.00 42.48  ? 823  GLN A CA    1 
ATOM   6608 C  C     . GLN A 1 823 ? -10.098 -15.949 -11.880 1.00 42.86  ? 823  GLN A C     1 
ATOM   6609 O  O     . GLN A 1 823 ? -9.141  -16.474 -12.450 1.00 38.29  ? 823  GLN A O     1 
ATOM   6610 C  CB    . GLN A 1 823 ? -9.555  -15.124 -9.587  1.00 43.94  ? 823  GLN A CB    1 
ATOM   6611 C  CG    . GLN A 1 823 ? -9.749  -15.226 -8.082  1.00 48.65  ? 823  GLN A CG    1 
ATOM   6612 C  CD    . GLN A 1 823 ? -11.141 -14.813 -7.639  1.00 52.12  ? 823  GLN A CD    1 
ATOM   6613 O  OE1   . GLN A 1 823 ? -11.703 -15.390 -6.708  1.00 58.39  ? 823  GLN A OE1   1 
ATOM   6614 N  NE2   . GLN A 1 823 ? -11.699 -13.803 -8.298  1.00 48.97  ? 823  GLN A NE2   1 
ATOM   6615 N  N     . VAL A 1 824 ? -10.983 -15.183 -12.509 1.00 44.15  ? 824  VAL A N     1 
ATOM   6616 C  CA    . VAL A 1 824 ? -10.787 -14.787 -13.893 1.00 41.13  ? 824  VAL A CA    1 
ATOM   6617 C  C     . VAL A 1 824 ? -9.712  -13.711 -13.936 1.00 40.05  ? 824  VAL A C     1 
ATOM   6618 O  O     . VAL A 1 824 ? -9.788  -12.722 -13.207 1.00 44.86  ? 824  VAL A O     1 
ATOM   6619 C  CB    . VAL A 1 824 ? -12.081 -14.234 -14.519 1.00 36.48  ? 824  VAL A CB    1 
ATOM   6620 C  CG1   . VAL A 1 824 ? -11.808 -13.712 -15.918 1.00 29.27  ? 824  VAL A CG1   1 
ATOM   6621 C  CG2   . VAL A 1 824 ? -13.161 -15.303 -14.543 1.00 33.98  ? 824  VAL A CG2   1 
ATOM   6622 N  N     . VAL A 1 825 ? -8.709  -13.907 -14.781 1.00 38.51  ? 825  VAL A N     1 
ATOM   6623 C  CA    . VAL A 1 825 ? -7.616  -12.947 -14.887 1.00 41.81  ? 825  VAL A CA    1 
ATOM   6624 C  C     . VAL A 1 825 ? -7.882  -11.926 -15.985 1.00 40.07  ? 825  VAL A C     1 
ATOM   6625 O  O     . VAL A 1 825 ? -8.152  -12.285 -17.133 1.00 35.96  ? 825  VAL A O     1 
ATOM   6626 C  CB    . VAL A 1 825 ? -6.263  -13.645 -15.149 1.00 42.04  ? 825  VAL A CB    1 
ATOM   6627 C  CG1   . VAL A 1 825 ? -5.170  -12.614 -15.412 1.00 41.64  ? 825  VAL A CG1   1 
ATOM   6628 C  CG2   . VAL A 1 825 ? -5.890  -14.543 -13.971 1.00 41.88  ? 825  VAL A CG2   1 
ATOM   6629 N  N     . GLU A 1 826 ? -7.816  -10.652 -15.612 1.00 41.59  ? 826  GLU A N     1 
ATOM   6630 C  CA    . GLU A 1 826 ? -7.950  -9.548  -16.553 1.00 40.29  ? 826  GLU A CA    1 
ATOM   6631 C  C     . GLU A 1 826 ? -7.019  -9.721  -17.749 1.00 35.13  ? 826  GLU A C     1 
ATOM   6632 O  O     . GLU A 1 826 ? -5.810  -9.886  -17.590 1.00 37.53  ? 826  GLU A O     1 
ATOM   6633 C  CB    . GLU A 1 826 ? -7.654  -8.220  -15.848 1.00 40.09  ? 826  GLU A CB    1 
ATOM   6634 C  CG    . GLU A 1 826 ? -7.362  -7.063  -16.789 1.00 43.27  ? 826  GLU A CG    1 
ATOM   6635 C  CD    . GLU A 1 826 ? -8.602  -6.551  -17.497 1.00 47.15  ? 826  GLU A CD    1 
ATOM   6636 O  OE1   . GLU A 1 826 ? -9.709  -6.683  -16.929 1.00 47.58  ? 826  GLU A OE1   1 
ATOM   6637 O  OE2   . GLU A 1 826 ? -8.468  -6.015  -18.621 1.00 45.97  ? 826  GLU A OE2   1 
ATOM   6638 N  N     . GLY A 1 827 ? -7.594  -9.697  -18.945 1.00 32.96  ? 827  GLY A N     1 
ATOM   6639 C  CA    . GLY A 1 827 ? -6.817  -9.808  -20.164 1.00 35.23  ? 827  GLY A CA    1 
ATOM   6640 C  C     . GLY A 1 827 ? -6.753  -11.209 -20.739 1.00 38.90  ? 827  GLY A C     1 
ATOM   6641 O  O     . GLY A 1 827 ? -6.488  -11.376 -21.929 1.00 41.34  ? 827  GLY A O     1 
ATOM   6642 N  N     . GLU A 1 828 ? -6.988  -12.221 -19.906 1.00 32.83  ? 828  GLU A N     1 
ATOM   6643 C  CA    . GLU A 1 828 ? -6.923  -13.603 -20.380 1.00 35.27  ? 828  GLU A CA    1 
ATOM   6644 C  C     . GLU A 1 828 ? -8.257  -14.064 -20.966 1.00 32.57  ? 828  GLU A C     1 
ATOM   6645 O  O     . GLU A 1 828 ? -9.200  -13.280 -21.067 1.00 37.90  ? 828  GLU A O     1 
ATOM   6646 C  CB    . GLU A 1 828 ? -6.415  -14.543 -19.277 1.00 41.70  ? 828  GLU A CB    1 
ATOM   6647 C  CG    . GLU A 1 828 ? -4.985  -14.211 -18.838 1.00 51.54  ? 828  GLU A CG    1 
ATOM   6648 C  CD    . GLU A 1 828 ? -4.302  -15.330 -18.062 1.00 59.31  ? 828  GLU A CD    1 
ATOM   6649 O  OE1   . GLU A 1 828 ? -3.068  -15.252 -17.879 1.00 63.43  ? 828  GLU A OE1   1 
ATOM   6650 O  OE2   . GLU A 1 828 ? -4.987  -16.282 -17.632 1.00 60.60  ? 828  GLU A OE2   1 
ATOM   6651 N  N     . LYS A 1 829 ? -8.341  -15.325 -21.368 1.00 28.49  ? 829  LYS A N     1 
ATOM   6652 C  CA    . LYS A 1 829 ? -9.540  -15.785 -22.063 1.00 30.34  ? 829  LYS A CA    1 
ATOM   6653 C  C     . LYS A 1 829 ? -10.517 -16.562 -21.185 1.00 27.73  ? 829  LYS A C     1 
ATOM   6654 O  O     . LYS A 1 829 ? -10.132 -17.185 -20.196 1.00 24.54  ? 829  LYS A O     1 
ATOM   6655 C  CB    . LYS A 1 829 ? -9.172  -16.576 -23.318 1.00 31.62  ? 829  LYS A CB    1 
ATOM   6656 C  CG    . LYS A 1 829 ? -8.471  -15.717 -24.373 1.00 35.50  ? 829  LYS A CG    1 
ATOM   6657 C  CD    . LYS A 1 829 ? -8.445  -16.391 -25.733 1.00 36.09  ? 829  LYS A CD    1 
ATOM   6658 C  CE    . LYS A 1 829 ? -7.654  -15.565 -26.738 1.00 32.87  ? 829  LYS A CE    1 
ATOM   6659 N  NZ    . LYS A 1 829 ? -7.613  -16.216 -28.077 1.00 30.02  ? 829  LYS A NZ    1 
ATOM   6660 N  N     . VAL A 1 830 ? -11.789 -16.515 -21.557 1.00 27.73  ? 830  VAL A N     1 
ATOM   6661 C  CA    . VAL A 1 830 ? -12.821 -17.190 -20.789 1.00 22.79  ? 830  VAL A CA    1 
ATOM   6662 C  C     . VAL A 1 830 ? -13.686 -18.057 -21.689 1.00 24.30  ? 830  VAL A C     1 
ATOM   6663 O  O     . VAL A 1 830 ? -13.904 -17.733 -22.858 1.00 24.43  ? 830  VAL A O     1 
ATOM   6664 C  CB    . VAL A 1 830 ? -13.725 -16.181 -20.042 1.00 26.78  ? 830  VAL A CB    1 
ATOM   6665 C  CG1   . VAL A 1 830 ? -12.924 -15.429 -18.988 1.00 31.68  ? 830  VAL A CG1   1 
ATOM   6666 C  CG2   . VAL A 1 830 ? -14.368 -15.199 -21.022 1.00 25.15  ? 830  VAL A CG2   1 
ATOM   6667 N  N     . TYR A 1 831 ? -14.147 -19.175 -21.135 1.00 24.48  ? 831  TYR A N     1 
ATOM   6668 C  CA    . TYR A 1 831 ? -15.218 -19.957 -21.726 1.00 23.17  ? 831  TYR A CA    1 
ATOM   6669 C  C     . TYR A 1 831 ? -16.508 -19.247 -21.347 1.00 26.98  ? 831  TYR A C     1 
ATOM   6670 O  O     . TYR A 1 831 ? -16.606 -18.709 -20.250 1.00 26.11  ? 831  TYR A O     1 
ATOM   6671 C  CB    . TYR A 1 831 ? -15.222 -21.376 -21.141 1.00 21.44  ? 831  TYR A CB    1 
ATOM   6672 C  CG    . TYR A 1 831 ? -14.169 -22.304 -21.715 1.00 24.37  ? 831  TYR A CG    1 
ATOM   6673 C  CD1   . TYR A 1 831 ? -13.935 -22.360 -23.081 1.00 25.23  ? 831  TYR A CD1   1 
ATOM   6674 C  CD2   . TYR A 1 831 ? -13.422 -23.136 -20.889 1.00 29.18  ? 831  TYR A CD2   1 
ATOM   6675 C  CE1   . TYR A 1 831 ? -12.980 -23.214 -23.611 1.00 27.39  ? 831  TYR A CE1   1 
ATOM   6676 C  CE2   . TYR A 1 831 ? -12.467 -23.997 -21.409 1.00 30.46  ? 831  TYR A CE2   1 
ATOM   6677 C  CZ    . TYR A 1 831 ? -12.247 -24.030 -22.771 1.00 30.49  ? 831  TYR A CZ    1 
ATOM   6678 O  OH    . TYR A 1 831 ? -11.294 -24.879 -23.299 1.00 31.33  ? 831  TYR A OH    1 
ATOM   6679 N  N     . VAL A 1 832 ? -17.488 -19.237 -22.247 1.00 26.87  ? 832  VAL A N     1 
ATOM   6680 C  CA    . VAL A 1 832 ? -18.765 -18.565 -21.993 1.00 24.85  ? 832  VAL A CA    1 
ATOM   6681 C  C     . VAL A 1 832 ? -19.940 -19.469 -22.359 1.00 26.06  ? 832  VAL A C     1 
ATOM   6682 O  O     . VAL A 1 832 ? -19.967 -20.049 -23.444 1.00 26.42  ? 832  VAL A O     1 
ATOM   6683 C  CB    . VAL A 1 832 ? -18.897 -17.261 -22.806 1.00 26.22  ? 832  VAL A CB    1 
ATOM   6684 C  CG1   . VAL A 1 832 ? -20.175 -16.520 -22.425 1.00 26.76  ? 832  VAL A CG1   1 
ATOM   6685 C  CG2   . VAL A 1 832 ? -17.676 -16.361 -22.596 1.00 25.19  ? 832  VAL A CG2   1 
ATOM   6686 N  N     . LEU A 1 833 ? -20.907 -19.588 -21.451 1.00 25.08  ? 833  LEU A N     1 
ATOM   6687 C  CA    . LEU A 1 833 ? -22.111 -20.377 -21.702 1.00 26.83  ? 833  LEU A CA    1 
ATOM   6688 C  C     . LEU A 1 833 ? -23.356 -19.578 -21.349 1.00 29.72  ? 833  LEU A C     1 
ATOM   6689 O  O     . LEU A 1 833 ? -23.371 -18.874 -20.343 1.00 27.24  ? 833  LEU A O     1 
ATOM   6690 C  CB    . LEU A 1 833 ? -22.098 -21.670 -20.883 1.00 26.74  ? 833  LEU A CB    1 
ATOM   6691 C  CG    . LEU A 1 833 ? -21.252 -22.849 -21.369 1.00 26.92  ? 833  LEU A CG    1 
ATOM   6692 C  CD1   . LEU A 1 833 ? -21.215 -23.954 -20.313 1.00 26.23  ? 833  LEU A CD1   1 
ATOM   6693 C  CD2   . LEU A 1 833 ? -21.775 -23.395 -22.695 1.00 19.52  ? 833  LEU A CD2   1 
ATOM   6694 N  N     . PRO A 1 834 ? -24.407 -19.691 -22.178 1.00 33.27  ? 834  PRO A N     1 
ATOM   6695 C  CA    . PRO A 1 834 ? -25.712 -19.082 -21.899 1.00 33.56  ? 834  PRO A CA    1 
ATOM   6696 C  C     . PRO A 1 834 ? -26.496 -19.908 -20.881 1.00 33.52  ? 834  PRO A C     1 
ATOM   6697 O  O     . PRO A 1 834 ? -26.322 -21.125 -20.823 1.00 30.53  ? 834  PRO A O     1 
ATOM   6698 C  CB    . PRO A 1 834 ? -26.411 -19.132 -23.258 1.00 34.56  ? 834  PRO A CB    1 
ATOM   6699 C  CG    . PRO A 1 834 ? -25.826 -20.338 -23.920 1.00 33.83  ? 834  PRO A CG    1 
ATOM   6700 C  CD    . PRO A 1 834 ? -24.388 -20.389 -23.476 1.00 32.40  ? 834  PRO A CD    1 
ATOM   6701 N  N     . LEU A 1 835 ? -27.356 -19.256 -20.103 1.00 35.95  ? 835  LEU A N     1 
ATOM   6702 C  CA    . LEU A 1 835 ? -28.122 -19.936 -19.060 1.00 35.96  ? 835  LEU A CA    1 
ATOM   6703 C  C     . LEU A 1 835 ? -29.623 -19.793 -19.284 1.00 36.16  ? 835  LEU A C     1 
ATOM   6704 O  O     . LEU A 1 835 ? -30.095 -18.732 -19.692 1.00 39.24  ? 835  LEU A O     1 
ATOM   6705 C  CB    . LEU A 1 835 ? -27.744 -19.385 -17.683 1.00 34.75  ? 835  LEU A CB    1 
ATOM   6706 C  CG    . LEU A 1 835 ? -26.277 -19.561 -17.287 1.00 34.39  ? 835  LEU A CG    1 
ATOM   6707 C  CD1   . LEU A 1 835 ? -25.942 -18.714 -16.068 1.00 34.85  ? 835  LEU A CD1   1 
ATOM   6708 C  CD2   . LEU A 1 835 ? -25.971 -21.029 -17.026 1.00 34.29  ? 835  LEU A CD2   1 
ATOM   6709 N  N     . ARG A 1 836 ? -30.367 -20.864 -19.017 1.00 35.46  ? 836  ARG A N     1 
ATOM   6710 C  CA    . ARG A 1 836 ? -31.820 -20.854 -19.186 1.00 39.21  ? 836  ARG A CA    1 
ATOM   6711 C  C     . ARG A 1 836 ? -32.496 -19.887 -18.220 1.00 42.04  ? 836  ARG A C     1 
ATOM   6712 O  O     . ARG A 1 836 ? -31.962 -19.592 -17.146 1.00 41.20  ? 836  ARG A O     1 
ATOM   6713 C  CB    . ARG A 1 836 ? -32.408 -22.259 -19.012 1.00 43.46  ? 836  ARG A CB    1 
ATOM   6714 C  CG    . ARG A 1 836 ? -32.152 -23.189 -20.185 1.00 45.44  ? 836  ARG A CG    1 
ATOM   6715 C  CD    . ARG A 1 836 ? -32.943 -24.487 -20.063 1.00 48.31  ? 836  ARG A CD    1 
ATOM   6716 N  NE    . ARG A 1 836 ? -32.437 -25.360 -19.006 1.00 51.06  ? 836  ARG A NE    1 
ATOM   6717 C  CZ    . ARG A 1 836 ? -33.000 -25.492 -17.808 1.00 53.76  ? 836  ARG A CZ    1 
ATOM   6718 N  NH1   . ARG A 1 836 ? -34.094 -24.804 -17.509 1.00 55.81  ? 836  ARG A NH1   1 
ATOM   6719 N  NH2   . ARG A 1 836 ? -32.471 -26.313 -16.910 1.00 53.30  ? 836  ARG A NH2   1 
ATOM   6720 N  N     . GLU A 1 837 ? -33.671 -19.399 -18.615 1.00 43.02  ? 837  GLU A N     1 
ATOM   6721 C  CA    . GLU A 1 837 ? -34.447 -18.468 -17.802 1.00 44.11  ? 837  GLU A CA    1 
ATOM   6722 C  C     . GLU A 1 837 ? -34.772 -19.082 -16.446 1.00 46.32  ? 837  GLU A C     1 
ATOM   6723 O  O     . GLU A 1 837 ? -35.153 -20.248 -16.357 1.00 48.91  ? 837  GLU A O     1 
ATOM   6724 C  CB    . GLU A 1 837 ? -35.751 -18.094 -18.515 1.00 46.99  ? 837  GLU A CB    1 
ATOM   6725 C  CG    . GLU A 1 837 ? -36.582 -17.047 -17.782 1.00 51.11  ? 837  GLU A CG    1 
ATOM   6726 C  CD    . GLU A 1 837 ? -37.965 -16.849 -18.389 1.00 56.83  ? 837  GLU A CD    1 
ATOM   6727 O  OE1   . GLU A 1 837 ? -38.367 -17.663 -19.250 1.00 55.40  ? 837  GLU A OE1   1 
ATOM   6728 O  OE2   . GLU A 1 837 ? -38.650 -15.877 -17.998 1.00 59.03  ? 837  GLU A OE2   1 
ATOM   6729 N  N     . GLY A 1 838 ? -34.609 -18.295 -15.388 1.00 46.05  ? 838  GLY A N     1 
ATOM   6730 C  CA    . GLY A 1 838 ? -34.936 -18.745 -14.047 1.00 44.26  ? 838  GLY A CA    1 
ATOM   6731 C  C     . GLY A 1 838 ? -33.813 -19.496 -13.356 1.00 43.93  ? 838  GLY A C     1 
ATOM   6732 O  O     . GLY A 1 838 ? -34.034 -20.150 -12.337 1.00 46.61  ? 838  GLY A O     1 
ATOM   6733 N  N     . ASN A 1 839 ? -32.606 -19.406 -13.909 1.00 42.13  ? 839  ASN A N     1 
ATOM   6734 C  CA    . ASN A 1 839 ? -31.436 -20.035 -13.302 1.00 41.81  ? 839  ASN A CA    1 
ATOM   6735 C  C     . ASN A 1 839 ? -31.057 -19.361 -11.981 1.00 43.28  ? 839  ASN A C     1 
ATOM   6736 O  O     . ASN A 1 839 ? -31.321 -18.175 -11.794 1.00 46.28  ? 839  ASN A O     1 
ATOM   6737 C  CB    . ASN A 1 839 ? -30.252 -19.997 -14.272 1.00 41.63  ? 839  ASN A CB    1 
ATOM   6738 C  CG    . ASN A 1 839 ? -29.755 -18.589 -14.525 1.00 42.78  ? 839  ASN A CG    1 
ATOM   6739 O  OD1   . ASN A 1 839 ? -29.010 -18.029 -13.719 1.00 41.38  ? 839  ASN A OD1   1 
ATOM   6740 N  ND2   . ASN A 1 839 ? -30.164 -18.007 -15.648 1.00 42.90  ? 839  ASN A ND2   1 
ATOM   6741 N  N     . PRO A 1 840 ? -30.429 -20.112 -11.062 1.00 45.28  ? 840  PRO A N     1 
ATOM   6742 C  CA    . PRO A 1 840 ? -30.070 -19.560 -9.747  1.00 48.06  ? 840  PRO A CA    1 
ATOM   6743 C  C     . PRO A 1 840 ? -28.899 -18.571 -9.778  1.00 47.03  ? 840  PRO A C     1 
ATOM   6744 O  O     . PRO A 1 840 ? -28.598 -17.958 -8.752  1.00 47.80  ? 840  PRO A O     1 
ATOM   6745 C  CB    . PRO A 1 840 ? -29.687 -20.806 -8.940  1.00 48.93  ? 840  PRO A CB    1 
ATOM   6746 C  CG    . PRO A 1 840 ? -29.232 -21.789 -9.970  1.00 49.05  ? 840  PRO A CG    1 
ATOM   6747 C  CD    . PRO A 1 840 ? -30.118 -21.549 -11.159 1.00 46.45  ? 840  PRO A CD    1 
ATOM   6748 N  N     . PHE A 1 841 ? -28.255 -18.417 -10.930 1.00 42.59  ? 841  PHE A N     1 
ATOM   6749 C  CA    . PHE A 1 841 ? -27.123 -17.504 -11.051 1.00 41.58  ? 841  PHE A CA    1 
ATOM   6750 C  C     . PHE A 1 841 ? -27.555 -16.055 -11.255 1.00 44.42  ? 841  PHE A C     1 
ATOM   6751 O  O     . PHE A 1 841 ? -26.748 -15.135 -11.112 1.00 46.68  ? 841  PHE A O     1 
ATOM   6752 C  CB    . PHE A 1 841 ? -26.202 -17.933 -12.195 1.00 40.61  ? 841  PHE A CB    1 
ATOM   6753 C  CG    . PHE A 1 841 ? -25.603 -19.292 -12.009 1.00 41.84  ? 841  PHE A CG    1 
ATOM   6754 C  CD1   . PHE A 1 841 ? -24.536 -19.481 -11.146 1.00 43.38  ? 841  PHE A CD1   1 
ATOM   6755 C  CD2   . PHE A 1 841 ? -26.102 -20.381 -12.703 1.00 43.92  ? 841  PHE A CD2   1 
ATOM   6756 C  CE1   . PHE A 1 841 ? -23.982 -20.734 -10.973 1.00 45.98  ? 841  PHE A CE1   1 
ATOM   6757 C  CE2   . PHE A 1 841 ? -25.553 -21.637 -12.535 1.00 45.26  ? 841  PHE A CE2   1 
ATOM   6758 C  CZ    . PHE A 1 841 ? -24.493 -21.814 -11.668 1.00 47.17  ? 841  PHE A CZ    1 
ATOM   6759 N  N     . GLY A 1 842 ? -28.820 -15.856 -11.610 1.00 46.37  ? 842  GLY A N     1 
ATOM   6760 C  CA    . GLY A 1 842 ? -29.378 -14.521 -11.735 1.00 47.06  ? 842  GLY A CA    1 
ATOM   6761 C  C     . GLY A 1 842 ? -29.003 -13.761 -12.996 1.00 48.09  ? 842  GLY A C     1 
ATOM   6762 O  O     . GLY A 1 842 ? -29.128 -12.537 -13.040 1.00 50.50  ? 842  GLY A O     1 
ATOM   6763 N  N     . ASP A 1 843 ? -28.546 -14.471 -14.023 1.00 43.99  ? 843  ASP A N     1 
ATOM   6764 C  CA    . ASP A 1 843 ? -28.228 -13.826 -15.296 1.00 42.74  ? 843  ASP A CA    1 
ATOM   6765 C  C     . ASP A 1 843 ? -28.269 -14.800 -16.472 1.00 41.38  ? 843  ASP A C     1 
ATOM   6766 O  O     . ASP A 1 843 ? -28.390 -16.010 -16.284 1.00 43.61  ? 843  ASP A O     1 
ATOM   6767 C  CB    . ASP A 1 843 ? -26.873 -13.117 -15.231 1.00 45.57  ? 843  ASP A CB    1 
ATOM   6768 C  CG    . ASP A 1 843 ? -26.913 -11.723 -15.846 1.00 48.42  ? 843  ASP A CG    1 
ATOM   6769 O  OD1   . ASP A 1 843 ? -27.671 -11.517 -16.819 1.00 48.75  ? 843  ASP A OD1   1 
ATOM   6770 O  OD2   . ASP A 1 843 ? -26.190 -10.832 -15.353 1.00 48.97  ? 843  ASP A OD2   1 
ATOM   6771 N  N     . LYS A 1 844 ? -28.164 -14.262 -17.684 1.00 37.57  ? 844  LYS A N     1 
ATOM   6772 C  CA    . LYS A 1 844 ? -28.374 -15.043 -18.900 1.00 37.72  ? 844  LYS A CA    1 
ATOM   6773 C  C     . LYS A 1 844 ? -27.122 -15.768 -19.402 1.00 35.55  ? 844  LYS A C     1 
ATOM   6774 O  O     . LYS A 1 844 ? -27.179 -16.510 -20.384 1.00 34.59  ? 844  LYS A O     1 
ATOM   6775 C  CB    . LYS A 1 844 ? -28.952 -14.156 -20.006 1.00 40.45  ? 844  LYS A CB    1 
ATOM   6776 C  CG    . LYS A 1 844 ? -28.104 -12.933 -20.320 1.00 41.61  ? 844  LYS A CG    1 
ATOM   6777 C  CD    . LYS A 1 844 ? -28.687 -12.136 -21.478 1.00 40.64  ? 844  LYS A CD    1 
ATOM   6778 C  CE    . LYS A 1 844 ? -27.758 -10.998 -21.886 1.00 39.53  ? 844  LYS A CE    1 
ATOM   6779 N  NZ    . LYS A 1 844 ? -28.311 -10.222 -23.027 1.00 38.63  ? 844  LYS A NZ    1 
ATOM   6780 N  N     . CYS A 1 845 ? -25.996 -15.560 -18.728 1.00 31.56  ? 845  CYS A N     1 
ATOM   6781 C  CA    . CYS A 1 845 ? -24.769 -16.263 -19.086 1.00 32.36  ? 845  CYS A CA    1 
ATOM   6782 C  C     . CYS A 1 845 ? -23.787 -16.297 -17.928 1.00 32.35  ? 845  CYS A C     1 
ATOM   6783 O  O     . CYS A 1 845 ? -23.948 -15.582 -16.935 1.00 34.30  ? 845  CYS A O     1 
ATOM   6784 C  CB    . CYS A 1 845 ? -24.104 -15.616 -20.303 1.00 34.83  ? 845  CYS A CB    1 
ATOM   6785 S  SG    . CYS A 1 845 ? -23.550 -13.917 -20.027 1.00 35.36  ? 845  CYS A SG    1 
ATOM   6786 N  N     . ILE A 1 846 ? -22.769 -17.138 -18.069 1.00 26.95  ? 846  ILE A N     1 
ATOM   6787 C  CA    . ILE A 1 846 ? -21.709 -17.248 -17.084 1.00 29.13  ? 846  ILE A CA    1 
ATOM   6788 C  C     . ILE A 1 846 ? -20.401 -17.566 -17.814 1.00 30.78  ? 846  ILE A C     1 
ATOM   6789 O  O     . ILE A 1 846 ? -20.409 -18.186 -18.879 1.00 30.04  ? 846  ILE A O     1 
ATOM   6790 C  CB    . ILE A 1 846 ? -22.032 -18.320 -16.012 1.00 31.76  ? 846  ILE A CB    1 
ATOM   6791 C  CG1   . ILE A 1 846 ? -21.088 -18.189 -14.813 1.00 31.75  ? 846  ILE A CG1   1 
ATOM   6792 C  CG2   . ILE A 1 846 ? -21.987 -19.730 -16.611 1.00 29.61  ? 846  ILE A CG2   1 
ATOM   6793 C  CD1   . ILE A 1 846 ? -21.425 -19.123 -13.663 1.00 29.66  ? 846  ILE A CD1   1 
ATOM   6794 N  N     . ALA A 1 847 ? -19.286 -17.101 -17.262 1.00 27.45  ? 847  ALA A N     1 
ATOM   6795 C  CA    . ALA A 1 847 ? -17.979 -17.341 -17.857 1.00 31.09  ? 847  ALA A CA    1 
ATOM   6796 C  C     . ALA A 1 847 ? -16.993 -17.793 -16.794 1.00 34.27  ? 847  ALA A C     1 
ATOM   6797 O  O     . ALA A 1 847 ? -17.157 -17.483 -15.621 1.00 38.42  ? 847  ALA A O     1 
ATOM   6798 C  CB    . ALA A 1 847 ? -17.465 -16.090 -18.559 1.00 25.51  ? 847  ALA A CB    1 
ATOM   6799 N  N     . TRP A 1 848 ? -15.974 -18.533 -17.206 1.00 29.22  ? 848  TRP A N     1 
ATOM   6800 C  CA    . TRP A 1 848 ? -14.947 -18.985 -16.281 1.00 27.83  ? 848  TRP A CA    1 
ATOM   6801 C  C     . TRP A 1 848 ? -13.632 -19.096 -17.053 1.00 26.23  ? 848  TRP A C     1 
ATOM   6802 O  O     . TRP A 1 848 ? -13.654 -19.117 -18.280 1.00 23.54  ? 848  TRP A O     1 
ATOM   6803 C  CB    . TRP A 1 848 ? -15.366 -20.304 -15.610 1.00 26.60  ? 848  TRP A CB    1 
ATOM   6804 C  CG    . TRP A 1 848 ? -15.369 -21.501 -16.501 1.00 28.90  ? 848  TRP A CG    1 
ATOM   6805 C  CD1   . TRP A 1 848 ? -14.416 -22.477 -16.559 1.00 28.70  ? 848  TRP A CD1   1 
ATOM   6806 C  CD2   . TRP A 1 848 ? -16.374 -21.862 -17.457 1.00 24.96  ? 848  TRP A CD2   1 
ATOM   6807 N  NE1   . TRP A 1 848 ? -14.763 -23.423 -17.493 1.00 27.82  ? 848  TRP A NE1   1 
ATOM   6808 C  CE2   . TRP A 1 848 ? -15.959 -23.069 -18.059 1.00 28.02  ? 848  TRP A CE2   1 
ATOM   6809 C  CE3   . TRP A 1 848 ? -17.580 -21.284 -17.865 1.00 27.61  ? 848  TRP A CE3   1 
ATOM   6810 C  CZ2   . TRP A 1 848 ? -16.711 -23.707 -19.046 1.00 25.91  ? 848  TRP A CZ2   1 
ATOM   6811 C  CZ3   . TRP A 1 848 ? -18.327 -21.922 -18.846 1.00 25.03  ? 848  TRP A CZ3   1 
ATOM   6812 C  CH2   . TRP A 1 848 ? -17.888 -23.117 -19.425 1.00 25.94  ? 848  TRP A CH2   1 
ATOM   6813 N  N     . PRO A 1 849 ? -12.484 -19.117 -16.346 1.00 29.21  ? 849  PRO A N     1 
ATOM   6814 C  CA    . PRO A 1 849 ? -11.184 -19.137 -17.030 1.00 30.53  ? 849  PRO A CA    1 
ATOM   6815 C  C     . PRO A 1 849 ? -11.058 -20.282 -18.030 1.00 30.91  ? 849  PRO A C     1 
ATOM   6816 O  O     . PRO A 1 849 ? -11.281 -21.441 -17.682 1.00 33.60  ? 849  PRO A O     1 
ATOM   6817 C  CB    . PRO A 1 849 ? -10.187 -19.324 -15.883 1.00 31.20  ? 849  PRO A CB    1 
ATOM   6818 C  CG    . PRO A 1 849 ? -10.866 -18.710 -14.706 1.00 32.52  ? 849  PRO A CG    1 
ATOM   6819 C  CD    . PRO A 1 849 ? -12.332 -19.005 -14.883 1.00 30.74  ? 849  PRO A CD    1 
ATOM   6820 N  N     . SER A 1 850 ? -10.707 -19.944 -19.266 1.00 26.70  ? 850  SER A N     1 
ATOM   6821 C  CA    . SER A 1 850 ? -10.584 -20.931 -20.333 1.00 31.66  ? 850  SER A CA    1 
ATOM   6822 C  C     . SER A 1 850 ? -9.469  -21.932 -20.052 1.00 34.70  ? 850  SER A C     1 
ATOM   6823 O  O     . SER A 1 850 ? -8.566  -21.673 -19.250 1.00 30.11  ? 850  SER A O     1 
ATOM   6824 C  CB    . SER A 1 850 ? -10.318 -20.240 -21.669 1.00 34.06  ? 850  SER A CB    1 
ATOM   6825 O  OG    . SER A 1 850 ? -8.977  -19.786 -21.730 1.00 35.17  ? 850  SER A OG    1 
ATOM   6826 N  N     . GLY A 1 851 ? -9.541  -23.074 -20.727 1.00 37.54  ? 851  GLY A N     1 
ATOM   6827 C  CA    . GLY A 1 851 ? -8.571  -24.138 -20.557 1.00 38.53  ? 851  GLY A CA    1 
ATOM   6828 C  C     . GLY A 1 851 ? -8.735  -24.867 -19.239 1.00 42.22  ? 851  GLY A C     1 
ATOM   6829 O  O     . GLY A 1 851 ? -7.877  -25.660 -18.853 1.00 41.39  ? 851  GLY A O     1 
ATOM   6830 N  N     . THR A 1 852 ? -9.833  -24.596 -18.539 1.00 43.51  ? 852  THR A N     1 
ATOM   6831 C  CA    . THR A 1 852 ? -10.079 -25.230 -17.247 1.00 42.26  ? 852  THR A CA    1 
ATOM   6832 C  C     . THR A 1 852 ? -11.502 -25.761 -17.124 1.00 40.81  ? 852  THR A C     1 
ATOM   6833 O  O     . THR A 1 852 ? -12.429 -25.255 -17.763 1.00 33.63  ? 852  THR A O     1 
ATOM   6834 C  CB    . THR A 1 852 ? -9.860  -24.253 -16.070 1.00 38.71  ? 852  THR A CB    1 
ATOM   6835 O  OG1   . THR A 1 852 ? -10.939 -23.308 -16.028 1.00 34.54  ? 852  THR A OG1   1 
ATOM   6836 C  CG2   . THR A 1 852 ? -8.524  -23.517 -16.195 1.00 37.47  ? 852  THR A CG2   1 
ATOM   6837 N  N     . GLU A 1 853 ? -11.664 -26.784 -16.290 1.00 41.96  ? 853  GLU A N     1 
ATOM   6838 C  CA    . GLU A 1 853 ? -12.985 -27.190 -15.841 1.00 41.23  ? 853  GLU A CA    1 
ATOM   6839 C  C     . GLU A 1 853 ? -13.499 -26.067 -14.957 1.00 39.28  ? 853  GLU A C     1 
ATOM   6840 O  O     . GLU A 1 853 ? -12.726 -25.449 -14.223 1.00 38.28  ? 853  GLU A O     1 
ATOM   6841 C  CB    . GLU A 1 853 ? -12.902 -28.482 -15.023 1.00 47.64  ? 853  GLU A CB    1 
ATOM   6842 C  CG    . GLU A 1 853 ? -12.558 -29.727 -15.831 1.00 53.15  ? 853  GLU A CG    1 
ATOM   6843 C  CD    . GLU A 1 853 ? -13.743 -30.258 -16.620 1.00 56.14  ? 853  GLU A CD    1 
ATOM   6844 O  OE1   . GLU A 1 853 ? -14.896 -29.944 -16.253 1.00 55.17  ? 853  GLU A OE1   1 
ATOM   6845 O  OE2   . GLU A 1 853 ? -13.522 -30.991 -17.606 1.00 57.96  ? 853  GLU A OE2   1 
ATOM   6846 N  N     . ILE A 1 854 ? -14.793 -25.781 -15.034 1.00 37.99  ? 854  ILE A N     1 
ATOM   6847 C  CA    . ILE A 1 854 ? -15.377 -24.823 -14.113 1.00 40.95  ? 854  ILE A CA    1 
ATOM   6848 C  C     . ILE A 1 854 ? -15.366 -25.454 -12.719 1.00 44.12  ? 854  ILE A C     1 
ATOM   6849 O  O     . ILE A 1 854 ? -15.509 -26.671 -12.584 1.00 46.82  ? 854  ILE A O     1 
ATOM   6850 C  CB    . ILE A 1 854 ? -16.794 -24.385 -14.559 1.00 43.81  ? 854  ILE A CB    1 
ATOM   6851 C  CG1   . ILE A 1 854 ? -17.212 -23.103 -13.839 1.00 44.69  ? 854  ILE A CG1   1 
ATOM   6852 C  CG2   . ILE A 1 854 ? -17.813 -25.502 -14.359 1.00 46.45  ? 854  ILE A CG2   1 
ATOM   6853 C  CD1   . ILE A 1 854 ? -18.490 -22.497 -14.379 1.00 46.81  ? 854  ILE A CD1   1 
ATOM   6854 N  N     . THR A 1 855 ? -15.158 -24.633 -11.692 1.00 42.04  ? 855  THR A N     1 
ATOM   6855 C  CA    . THR A 1 855 ? -15.001 -25.129 -10.324 1.00 41.93  ? 855  THR A CA    1 
ATOM   6856 C  C     . THR A 1 855 ? -16.181 -25.979 -9.842  1.00 42.69  ? 855  THR A C     1 
ATOM   6857 O  O     . THR A 1 855 ? -17.335 -25.693 -10.171 1.00 39.29  ? 855  THR A O     1 
ATOM   6858 C  CB    . THR A 1 855 ? -14.766 -23.975 -9.331  1.00 41.09  ? 855  THR A CB    1 
ATOM   6859 O  OG1   . THR A 1 855 ? -14.891 -24.468 -7.994  1.00 47.05  ? 855  THR A OG1   1 
ATOM   6860 C  CG2   . THR A 1 855 ? -15.781 -22.861 -9.551  1.00 39.62  ? 855  THR A CG2   1 
ATOM   6861 N  N     . ASP A 1 856 ? -15.877 -27.018 -9.061  1.00 43.21  ? 856  ASP A N     1 
ATOM   6862 C  CA    . ASP A 1 856 ? -16.887 -27.948 -8.544  1.00 47.54  ? 856  ASP A CA    1 
ATOM   6863 C  C     . ASP A 1 856 ? -17.939 -27.259 -7.680  1.00 49.65  ? 856  ASP A C     1 
ATOM   6864 O  O     . ASP A 1 856 ? -19.029 -27.796 -7.470  1.00 50.71  ? 856  ASP A O     1 
ATOM   6865 C  CB    . ASP A 1 856 ? -16.235 -29.083 -7.738  1.00 50.91  ? 856  ASP A CB    1 
ATOM   6866 C  CG    . ASP A 1 856 ? -15.618 -30.156 -8.622  1.00 56.34  ? 856  ASP A CG    1 
ATOM   6867 O  OD1   . ASP A 1 856 ? -15.915 -30.181 -9.836  1.00 54.95  ? 856  ASP A OD1   1 
ATOM   6868 O  OD2   . ASP A 1 856 ? -14.844 -30.984 -8.096  1.00 60.33  ? 856  ASP A OD2   1 
ATOM   6869 N  N     . LEU A 1 857 ? -17.595 -26.081 -7.167  1.00 47.97  ? 857  LEU A N     1 
ATOM   6870 C  CA    . LEU A 1 857 ? -18.515 -25.279 -6.374  1.00 49.70  ? 857  LEU A CA    1 
ATOM   6871 C  C     . LEU A 1 857 ? -19.834 -25.063 -7.105  1.00 47.33  ? 857  LEU A C     1 
ATOM   6872 O  O     . LEU A 1 857 ? -20.903 -25.115 -6.501  1.00 48.10  ? 857  LEU A O     1 
ATOM   6873 C  CB    . LEU A 1 857 ? -17.891 -23.918 -6.058  1.00 54.18  ? 857  LEU A CB    1 
ATOM   6874 C  CG    . LEU A 1 857 ? -16.558 -23.901 -5.309  1.00 58.54  ? 857  LEU A CG    1 
ATOM   6875 C  CD1   . LEU A 1 857 ? -16.098 -22.468 -5.083  1.00 58.15  ? 857  LEU A CD1   1 
ATOM   6876 C  CD2   . LEU A 1 857 ? -16.674 -24.650 -3.990  1.00 60.54  ? 857  LEU A CD2   1 
ATOM   6877 N  N     . ILE A 1 858 ? -19.753 -24.824 -8.411  1.00 44.11  ? 858  ILE A N     1 
ATOM   6878 C  CA    . ILE A 1 858 ? -20.930 -24.468 -9.194  1.00 44.87  ? 858  ILE A CA    1 
ATOM   6879 C  C     . ILE A 1 858 ? -21.088 -25.279 -10.482 1.00 44.02  ? 858  ILE A C     1 
ATOM   6880 O  O     . ILE A 1 858 ? -21.977 -24.991 -11.285 1.00 45.79  ? 858  ILE A O     1 
ATOM   6881 C  CB    . ILE A 1 858 ? -20.898 -22.978 -9.580  1.00 42.07  ? 858  ILE A CB    1 
ATOM   6882 C  CG1   . ILE A 1 858 ? -19.681 -22.689 -10.462 1.00 37.16  ? 858  ILE A CG1   1 
ATOM   6883 C  CG2   . ILE A 1 858 ? -20.885 -22.101 -8.335  1.00 44.53  ? 858  ILE A CG2   1 
ATOM   6884 C  CD1   . ILE A 1 858 ? -19.574 -21.245 -10.909 1.00 38.54  ? 858  ILE A CD1   1 
ATOM   6885 N  N     . LYS A 1 859 ? -20.238 -26.283 -10.684 1.00 38.98  ? 859  LYS A N     1 
ATOM   6886 C  CA    . LYS A 1 859 ? -20.237 -27.020 -11.950 1.00 38.96  ? 859  LYS A CA    1 
ATOM   6887 C  C     . LYS A 1 859 ? -21.564 -27.714 -12.257 1.00 39.34  ? 859  LYS A C     1 
ATOM   6888 O  O     . LYS A 1 859 ? -22.111 -27.556 -13.350 1.00 37.26  ? 859  LYS A O     1 
ATOM   6889 C  CB    . LYS A 1 859 ? -19.089 -28.034 -12.013 1.00 40.66  ? 859  LYS A CB    1 
ATOM   6890 C  CG    . LYS A 1 859 ? -19.045 -28.800 -13.331 1.00 39.51  ? 859  LYS A CG    1 
ATOM   6891 C  CD    . LYS A 1 859 ? -17.847 -29.732 -13.421 1.00 43.03  ? 859  LYS A CD    1 
ATOM   6892 C  CE    . LYS A 1 859 ? -17.923 -30.586 -14.683 1.00 47.53  ? 859  LYS A CE    1 
ATOM   6893 N  NZ    . LYS A 1 859 ? -16.754 -31.502 -14.839 1.00 49.41  ? 859  LYS A NZ    1 
ATOM   6894 N  N     . ASP A 1 860 ? -22.076 -28.477 -11.293 1.00 39.50  ? 860  ASP A N     1 
ATOM   6895 C  CA    . ASP A 1 860 ? -23.305 -29.241 -11.494 1.00 44.53  ? 860  ASP A CA    1 
ATOM   6896 C  C     . ASP A 1 860 ? -24.512 -28.348 -11.786 1.00 46.96  ? 860  ASP A C     1 
ATOM   6897 O  O     . ASP A 1 860 ? -25.400 -28.727 -12.550 1.00 48.70  ? 860  ASP A O     1 
ATOM   6898 C  CB    . ASP A 1 860 ? -23.588 -30.152 -10.294 1.00 46.54  ? 860  ASP A CB    1 
ATOM   6899 C  CG    . ASP A 1 860 ? -22.577 -31.283 -10.166 1.00 49.84  ? 860  ASP A CG    1 
ATOM   6900 O  OD1   . ASP A 1 860 ? -21.868 -31.573 -11.156 1.00 49.92  ? 860  ASP A OD1   1 
ATOM   6901 O  OD2   . ASP A 1 860 ? -22.494 -31.887 -9.075  1.00 53.00  ? 860  ASP A OD2   1 
ATOM   6902 N  N     . ASP A 1 861 ? -24.538 -27.162 -11.186 1.00 43.22  ? 861  ASP A N     1 
ATOM   6903 C  CA    . ASP A 1 861 ? -25.628 -26.221 -11.417 1.00 44.10  ? 861  ASP A CA    1 
ATOM   6904 C  C     . ASP A 1 861 ? -25.516 -25.533 -12.777 1.00 43.57  ? 861  ASP A C     1 
ATOM   6905 O  O     . ASP A 1 861 ? -26.530 -25.206 -13.393 1.00 45.70  ? 861  ASP A O     1 
ATOM   6906 C  CB    . ASP A 1 861 ? -25.706 -25.188 -10.291 1.00 46.46  ? 861  ASP A CB    1 
ATOM   6907 C  CG    . ASP A 1 861 ? -26.322 -25.755 -9.023  1.00 54.29  ? 861  ASP A CG    1 
ATOM   6908 O  OD1   . ASP A 1 861 ? -27.278 -26.555 -9.126  1.00 56.44  ? 861  ASP A OD1   1 
ATOM   6909 O  OD2   . ASP A 1 861 ? -25.848 -25.408 -7.921  1.00 58.70  ? 861  ASP A OD2   1 
ATOM   6910 N  N     . VAL A 1 862 ? -24.286 -25.312 -13.239 1.00 39.08  ? 862  VAL A N     1 
ATOM   6911 C  CA    . VAL A 1 862 ? -24.062 -24.750 -14.566 1.00 36.12  ? 862  VAL A CA    1 
ATOM   6912 C  C     . VAL A 1 862 ? -24.517 -25.741 -15.631 1.00 36.57  ? 862  VAL A C     1 
ATOM   6913 O  O     . VAL A 1 862 ? -25.215 -25.370 -16.574 1.00 34.62  ? 862  VAL A O     1 
ATOM   6914 C  CB    . VAL A 1 862 ? -22.572 -24.385 -14.809 1.00 41.25  ? 862  VAL A CB    1 
ATOM   6915 C  CG1   . VAL A 1 862 ? -22.324 -24.095 -16.281 1.00 35.80  ? 862  VAL A CG1   1 
ATOM   6916 C  CG2   . VAL A 1 862 ? -22.163 -23.190 -13.960 1.00 43.11  ? 862  VAL A CG2   1 
ATOM   6917 N  N     . LEU A 1 863 ? -24.121 -27.001 -15.464 1.00 34.93  ? 863  LEU A N     1 
ATOM   6918 C  CA    . LEU A 1 863 ? -24.514 -28.073 -16.375 1.00 36.61  ? 863  LEU A CA    1 
ATOM   6919 C  C     . LEU A 1 863 ? -26.028 -28.210 -16.465 1.00 39.56  ? 863  LEU A C     1 
ATOM   6920 O  O     . LEU A 1 863 ? -26.575 -28.490 -17.530 1.00 38.47  ? 863  LEU A O     1 
ATOM   6921 C  CB    . LEU A 1 863 ? -23.924 -29.407 -15.917 1.00 36.52  ? 863  LEU A CB    1 
ATOM   6922 C  CG    . LEU A 1 863 ? -22.407 -29.557 -16.006 1.00 39.29  ? 863  LEU A CG    1 
ATOM   6923 C  CD1   . LEU A 1 863 ? -21.970 -30.924 -15.495 1.00 40.33  ? 863  LEU A CD1   1 
ATOM   6924 C  CD2   . LEU A 1 863 ? -21.958 -29.347 -17.429 1.00 36.00  ? 863  LEU A CD2   1 
ATOM   6925 N  N     . HIS A 1 864 ? -26.699 -28.021 -15.335 1.00 41.00  ? 864  HIS A N     1 
ATOM   6926 C  CA    . HIS A 1 864 ? -28.142 -28.178 -15.271 1.00 43.86  ? 864  HIS A CA    1 
ATOM   6927 C  C     . HIS A 1 864 ? -28.863 -27.033 -15.979 1.00 43.51  ? 864  HIS A C     1 
ATOM   6928 O  O     . HIS A 1 864 ? -29.940 -27.221 -16.539 1.00 46.38  ? 864  HIS A O     1 
ATOM   6929 C  CB    . HIS A 1 864 ? -28.598 -28.272 -13.811 1.00 47.94  ? 864  HIS A CB    1 
ATOM   6930 C  CG    . HIS A 1 864 ? -30.056 -28.561 -13.647 1.00 52.01  ? 864  HIS A CG    1 
ATOM   6931 N  ND1   . HIS A 1 864 ? -31.007 -27.565 -13.544 1.00 54.23  ? 864  HIS A ND1   1 
ATOM   6932 C  CD2   . HIS A 1 864 ? -30.731 -29.731 -13.558 1.00 56.57  ? 864  HIS A CD2   1 
ATOM   6933 C  CE1   . HIS A 1 864 ? -32.200 -28.110 -13.403 1.00 56.60  ? 864  HIS A CE1   1 
ATOM   6934 N  NE2   . HIS A 1 864 ? -32.062 -29.426 -13.408 1.00 58.23  ? 864  HIS A NE2   1 
ATOM   6935 N  N     . TRP A 1 865 ? -28.257 -25.850 -15.966 1.00 41.35  ? 865  TRP A N     1 
ATOM   6936 C  CA    . TRP A 1 865 ? -28.940 -24.653 -16.446 1.00 39.77  ? 865  TRP A CA    1 
ATOM   6937 C  C     . TRP A 1 865 ? -28.421 -24.097 -17.770 1.00 40.03  ? 865  TRP A C     1 
ATOM   6938 O  O     . TRP A 1 865 ? -28.878 -23.041 -18.215 1.00 39.07  ? 865  TRP A O     1 
ATOM   6939 C  CB    . TRP A 1 865 ? -28.926 -23.572 -15.367 1.00 36.58  ? 865  TRP A CB    1 
ATOM   6940 C  CG    . TRP A 1 865 ? -29.851 -23.884 -14.242 1.00 40.85  ? 865  TRP A CG    1 
ATOM   6941 C  CD1   . TRP A 1 865 ? -29.534 -24.489 -13.059 1.00 41.51  ? 865  TRP A CD1   1 
ATOM   6942 C  CD2   . TRP A 1 865 ? -31.256 -23.624 -14.196 1.00 44.58  ? 865  TRP A CD2   1 
ATOM   6943 N  NE1   . TRP A 1 865 ? -30.656 -24.616 -12.278 1.00 45.50  ? 865  TRP A NE1   1 
ATOM   6944 C  CE2   . TRP A 1 865 ? -31.727 -24.091 -12.953 1.00 47.36  ? 865  TRP A CE2   1 
ATOM   6945 C  CE3   . TRP A 1 865 ? -32.162 -23.037 -15.084 1.00 45.98  ? 865  TRP A CE3   1 
ATOM   6946 C  CZ2   . TRP A 1 865 ? -33.064 -23.987 -12.574 1.00 49.99  ? 865  TRP A CZ2   1 
ATOM   6947 C  CZ3   . TRP A 1 865 ? -33.488 -22.936 -14.708 1.00 48.93  ? 865  TRP A CZ3   1 
ATOM   6948 C  CH2   . TRP A 1 865 ? -33.927 -23.409 -13.465 1.00 51.31  ? 865  TRP A CH2   1 
ATOM   6949 N  N     . MET A 1 866 ? -27.474 -24.801 -18.390 1.00 41.66  ? 866  MET A N     1 
ATOM   6950 C  CA    . MET A 1 866 ? -26.981 -24.431 -19.716 1.00 41.71  ? 866  MET A CA    1 
ATOM   6951 C  C     . MET A 1 866 ? -28.150 -24.287 -20.668 1.00 39.45  ? 866  MET A C     1 
ATOM   6952 O  O     . MET A 1 866 ? -29.083 -25.090 -20.632 1.00 42.13  ? 866  MET A O     1 
ATOM   6953 C  CB    . MET A 1 866 ? -26.071 -25.516 -20.279 1.00 45.34  ? 866  MET A CB    1 
ATOM   6954 C  CG    . MET A 1 866 ? -24.756 -25.685 -19.585 1.00 47.89  ? 866  MET A CG    1 
ATOM   6955 S  SD    . MET A 1 866 ? -23.963 -27.170 -20.214 1.00 44.14  ? 866  MET A SD    1 
ATOM   6956 C  CE    . MET A 1 866 ? -23.982 -26.813 -21.968 1.00 41.12  ? 866  MET A CE    1 
ATOM   6957 N  N     . ASP A 1 867 ? -28.102 -23.274 -21.525 1.00 35.81  ? 867  ASP A N     1 
ATOM   6958 C  CA    . ASP A 1 867 ? -29.162 -23.090 -22.504 1.00 37.98  ? 867  ASP A CA    1 
ATOM   6959 C  C     . ASP A 1 867 ? -28.739 -23.684 -23.841 1.00 36.23  ? 867  ASP A C     1 
ATOM   6960 O  O     . ASP A 1 867 ? -28.101 -23.012 -24.652 1.00 33.32  ? 867  ASP A O     1 
ATOM   6961 C  CB    . ASP A 1 867 ? -29.516 -21.609 -22.654 1.00 36.33  ? 867  ASP A CB    1 
ATOM   6962 C  CG    . ASP A 1 867 ? -30.873 -21.398 -23.305 1.00 38.48  ? 867  ASP A CG    1 
ATOM   6963 O  OD1   . ASP A 1 867 ? -31.300 -22.259 -24.099 1.00 35.66  ? 867  ASP A OD1   1 
ATOM   6964 O  OD2   . ASP A 1 867 ? -31.518 -20.370 -23.018 1.00 45.78  ? 867  ASP A OD2   1 
ATOM   6965 N  N     . TYR A 1 868 ? -29.099 -24.947 -24.063 1.00 35.35  ? 868  TYR A N     1 
ATOM   6966 C  CA    . TYR A 1 868 ? -28.728 -25.656 -25.285 1.00 37.08  ? 868  TYR A CA    1 
ATOM   6967 C  C     . TYR A 1 868 ? -29.431 -25.073 -26.504 1.00 36.77  ? 868  TYR A C     1 
ATOM   6968 O  O     . TYR A 1 868 ? -28.884 -25.078 -27.606 1.00 37.92  ? 868  TYR A O     1 
ATOM   6969 C  CB    . TYR A 1 868 ? -29.064 -27.146 -25.181 1.00 38.98  ? 868  TYR A CB    1 
ATOM   6970 C  CG    . TYR A 1 868 ? -28.214 -27.926 -24.204 1.00 40.36  ? 868  TYR A CG    1 
ATOM   6971 C  CD1   . TYR A 1 868 ? -26.971 -28.422 -24.577 1.00 40.07  ? 868  TYR A CD1   1 
ATOM   6972 C  CD2   . TYR A 1 868 ? -28.666 -28.188 -22.917 1.00 43.54  ? 868  TYR A CD2   1 
ATOM   6973 C  CE1   . TYR A 1 868 ? -26.194 -29.145 -23.689 1.00 42.38  ? 868  TYR A CE1   1 
ATOM   6974 C  CE2   . TYR A 1 868 ? -27.899 -28.908 -22.023 1.00 46.37  ? 868  TYR A CE2   1 
ATOM   6975 C  CZ    . TYR A 1 868 ? -26.663 -29.384 -22.413 1.00 47.51  ? 868  TYR A CZ    1 
ATOM   6976 O  OH    . TYR A 1 868 ? -25.900 -30.104 -21.523 1.00 50.93  ? 868  TYR A OH    1 
ATOM   6977 N  N     . THR A 1 869 ? -30.649 -24.584 -26.304 1.00 36.82  ? 869  THR A N     1 
ATOM   6978 C  CA    . THR A 1 869 ? -31.424 -24.015 -27.400 1.00 35.92  ? 869  THR A CA    1 
ATOM   6979 C  C     . THR A 1 869 ? -30.746 -22.752 -27.927 1.00 36.88  ? 869  THR A C     1 
ATOM   6980 O  O     . THR A 1 869 ? -30.565 -22.592 -29.135 1.00 35.94  ? 869  THR A O     1 
ATOM   6981 C  CB    . THR A 1 869 ? -32.868 -23.698 -26.968 1.00 41.56  ? 869  THR A CB    1 
ATOM   6982 O  OG1   . THR A 1 869 ? -33.468 -24.874 -26.406 1.00 45.60  ? 869  THR A OG1   1 
ATOM   6983 C  CG2   . THR A 1 869 ? -33.694 -23.231 -28.165 1.00 41.65  ? 869  THR A CG2   1 
ATOM   6984 N  N     . VAL A 1 870 ? -30.362 -21.866 -27.014 1.00 35.87  ? 870  VAL A N     1 
ATOM   6985 C  CA    . VAL A 1 870 ? -29.653 -20.649 -27.387 1.00 34.62  ? 870  VAL A CA    1 
ATOM   6986 C  C     . VAL A 1 870 ? -28.301 -21.003 -27.996 1.00 39.42  ? 870  VAL A C     1 
ATOM   6987 O  O     . VAL A 1 870 ? -27.903 -20.446 -29.017 1.00 37.58  ? 870  VAL A O     1 
ATOM   6988 C  CB    . VAL A 1 870 ? -29.463 -19.710 -26.179 1.00 33.99  ? 870  VAL A CB    1 
ATOM   6989 C  CG1   . VAL A 1 870 ? -28.331 -18.715 -26.435 1.00 35.07  ? 870  VAL A CG1   1 
ATOM   6990 C  CG2   . VAL A 1 870 ? -30.764 -18.984 -25.867 1.00 37.26  ? 870  VAL A CG2   1 
ATOM   6991 N  N     . LEU A 1 871 ? -27.608 -21.945 -27.365 1.00 43.40  ? 871  LEU A N     1 
ATOM   6992 C  CA    . LEU A 1 871 ? -26.304 -22.396 -27.829 1.00 42.19  ? 871  LEU A CA    1 
ATOM   6993 C  C     . LEU A 1 871 ? -26.365 -22.854 -29.284 1.00 38.65  ? 871  LEU A C     1 
ATOM   6994 O  O     . LEU A 1 871 ? -25.544 -22.454 -30.102 1.00 40.92  ? 871  LEU A O     1 
ATOM   6995 C  CB    . LEU A 1 871 ? -25.810 -23.537 -26.936 1.00 48.89  ? 871  LEU A CB    1 
ATOM   6996 C  CG    . LEU A 1 871 ? -24.308 -23.676 -26.694 1.00 54.54  ? 871  LEU A CG    1 
ATOM   6997 C  CD1   . LEU A 1 871 ? -24.070 -24.596 -25.504 1.00 55.16  ? 871  LEU A CD1   1 
ATOM   6998 C  CD2   . LEU A 1 871 ? -23.591 -24.196 -27.937 1.00 55.78  ? 871  LEU A CD2   1 
ATOM   6999 N  N     . LEU A 1 872 ? -27.346 -23.691 -29.600 1.00 43.04  ? 872  LEU A N     1 
ATOM   7000 C  CA    . LEU A 1 872 ? -27.509 -24.211 -30.953 1.00 45.61  ? 872  LEU A CA    1 
ATOM   7001 C  C     . LEU A 1 872 ? -27.805 -23.113 -31.972 1.00 46.30  ? 872  LEU A C     1 
ATOM   7002 O  O     . LEU A 1 872 ? -27.062 -22.924 -32.932 1.00 47.40  ? 872  LEU A O     1 
ATOM   7003 C  CB    . LEU A 1 872 ? -28.634 -25.242 -30.992 1.00 45.74  ? 872  LEU A CB    1 
ATOM   7004 C  CG    . LEU A 1 872 ? -28.830 -25.907 -32.354 1.00 49.72  ? 872  LEU A CG    1 
ATOM   7005 C  CD1   . LEU A 1 872 ? -27.609 -26.748 -32.703 1.00 51.44  ? 872  LEU A CD1   1 
ATOM   7006 C  CD2   . LEU A 1 872 ? -30.089 -26.746 -32.374 1.00 49.58  ? 872  LEU A CD2   1 
ATOM   7007 N  N     . GLU A 1 873 ? -28.900 -22.394 -31.758 1.00 42.84  ? 873  GLU A N     1 
ATOM   7008 C  CA    . GLU A 1 873 ? -29.363 -21.411 -32.729 1.00 47.36  ? 873  GLU A CA    1 
ATOM   7009 C  C     . GLU A 1 873 ? -28.431 -20.210 -32.900 1.00 42.78  ? 873  GLU A C     1 
ATOM   7010 O  O     . GLU A 1 873 ? -28.421 -19.582 -33.960 1.00 45.62  ? 873  GLU A O     1 
ATOM   7011 C  CB    . GLU A 1 873 ? -30.796 -20.966 -32.405 1.00 55.37  ? 873  GLU A CB    1 
ATOM   7012 C  CG    . GLU A 1 873 ? -31.857 -21.829 -33.075 1.00 63.21  ? 873  GLU A CG    1 
ATOM   7013 C  CD    . GLU A 1 873 ? -33.139 -21.933 -32.277 1.00 67.95  ? 873  GLU A CD    1 
ATOM   7014 O  OE1   . GLU A 1 873 ? -33.195 -21.358 -31.170 1.00 69.78  ? 873  GLU A OE1   1 
ATOM   7015 O  OE2   . GLU A 1 873 ? -34.087 -22.596 -32.758 1.00 69.82  ? 873  GLU A OE2   1 
ATOM   7016 N  N     . LYS A 1 874 ? -27.637 -19.907 -31.877 1.00 42.28  ? 874  LYS A N     1 
ATOM   7017 C  CA    . LYS A 1 874 ? -26.779 -18.729 -31.926 1.00 44.42  ? 874  LYS A CA    1 
ATOM   7018 C  C     . LYS A 1 874 ? -25.371 -19.018 -32.453 1.00 45.52  ? 874  LYS A C     1 
ATOM   7019 O  O     . LYS A 1 874 ? -24.831 -18.242 -33.242 1.00 45.59  ? 874  LYS A O     1 
ATOM   7020 C  CB    . LYS A 1 874 ? -26.707 -18.067 -30.552 1.00 50.42  ? 874  LYS A CB    1 
ATOM   7021 C  CG    . LYS A 1 874 ? -26.510 -16.566 -30.596 1.00 55.70  ? 874  LYS A CG    1 
ATOM   7022 C  CD    . LYS A 1 874 ? -26.634 -15.956 -29.214 1.00 57.38  ? 874  LYS A CD    1 
ATOM   7023 C  CE    . LYS A 1 874 ? -25.601 -16.529 -28.259 1.00 55.16  ? 874  LYS A CE    1 
ATOM   7024 N  NZ    . LYS A 1 874 ? -25.512 -15.735 -26.998 1.00 54.40  ? 874  LYS A NZ    1 
ATOM   7025 N  N     . THR A 1 875 ? -24.776 -20.128 -32.026 1.00 40.61  ? 875  THR A N     1 
ATOM   7026 C  CA    . THR A 1 875 ? -23.417 -20.449 -32.454 1.00 39.57  ? 875  THR A CA    1 
ATOM   7027 C  C     . THR A 1 875 ? -23.375 -21.354 -33.684 1.00 37.85  ? 875  THR A C     1 
ATOM   7028 O  O     . THR A 1 875 ? -22.395 -21.347 -34.424 1.00 40.32  ? 875  THR A O     1 
ATOM   7029 C  CB    . THR A 1 875 ? -22.589 -21.110 -31.326 1.00 41.16  ? 875  THR A CB    1 
ATOM   7030 O  OG1   . THR A 1 875 ? -23.061 -22.448 -31.100 1.00 44.06  ? 875  THR A OG1   1 
ATOM   7031 C  CG2   . THR A 1 875 ? -22.694 -20.304 -30.044 1.00 38.40  ? 875  THR A CG2   1 
ATOM   7032 N  N     . PHE A 1 876 ? -24.431 -22.132 -33.904 1.00 31.54  ? 876  PHE A N     1 
ATOM   7033 C  CA    . PHE A 1 876 ? -24.416 -23.114 -34.988 1.00 28.10  ? 876  PHE A CA    1 
ATOM   7034 C  C     . PHE A 1 876 ? -25.331 -22.752 -36.155 1.00 30.28  ? 876  PHE A C     1 
ATOM   7035 O  O     . PHE A 1 876 ? -24.874 -22.615 -37.290 1.00 29.41  ? 876  PHE A O     1 
ATOM   7036 C  CB    . PHE A 1 876 ? -24.762 -24.514 -34.458 1.00 26.32  ? 876  PHE A CB    1 
ATOM   7037 C  CG    . PHE A 1 876 ? -24.693 -25.593 -35.503 1.00 29.01  ? 876  PHE A CG    1 
ATOM   7038 C  CD1   . PHE A 1 876 ? -23.481 -25.945 -36.078 1.00 32.51  ? 876  PHE A CD1   1 
ATOM   7039 C  CD2   . PHE A 1 876 ? -25.835 -26.262 -35.905 1.00 33.50  ? 876  PHE A CD2   1 
ATOM   7040 C  CE1   . PHE A 1 876 ? -23.413 -26.943 -37.041 1.00 35.12  ? 876  PHE A CE1   1 
ATOM   7041 C  CE2   . PHE A 1 876 ? -25.774 -27.260 -36.867 1.00 36.67  ? 876  PHE A CE2   1 
ATOM   7042 C  CZ    . PHE A 1 876 ? -24.561 -27.601 -37.434 1.00 33.18  ? 876  PHE A CZ    1 
ATOM   7043 N  N     . ILE A 1 877 ? -26.619 -22.590 -35.869 1.00 32.55  ? 877  ILE A N     1 
ATOM   7044 C  CA    . ILE A 1 877 ? -27.621 -22.373 -36.913 1.00 35.28  ? 877  ILE A CA    1 
ATOM   7045 C  C     . ILE A 1 877 ? -27.472 -21.046 -37.661 1.00 34.25  ? 877  ILE A C     1 
ATOM   7046 O  O     . ILE A 1 877 ? -27.556 -21.008 -38.890 1.00 33.22  ? 877  ILE A O     1 
ATOM   7047 C  CB    . ILE A 1 877 ? -29.055 -22.537 -36.354 1.00 35.24  ? 877  ILE A CB    1 
ATOM   7048 C  CG1   . ILE A 1 877 ? -29.298 -24.004 -35.987 1.00 34.41  ? 877  ILE A CG1   1 
ATOM   7049 C  CG2   . ILE A 1 877 ? -30.095 -22.052 -37.357 1.00 35.01  ? 877  ILE A CG2   1 
ATOM   7050 C  CD1   . ILE A 1 877 ? -30.681 -24.296 -35.452 1.00 36.59  ? 877  ILE A CD1   1 
ATOM   7051 N  N     . LYS A 1 878 ? -27.250 -19.962 -36.928 1.00 33.87  ? 878  LYS A N     1 
ATOM   7052 C  CA    . LYS A 1 878 ? -27.058 -18.657 -37.557 1.00 40.46  ? 878  LYS A CA    1 
ATOM   7053 C  C     . LYS A 1 878 ? -25.873 -18.622 -38.544 1.00 39.73  ? 878  LYS A C     1 
ATOM   7054 O  O     . LYS A 1 878 ? -26.031 -18.149 -39.666 1.00 42.64  ? 878  LYS A O     1 
ATOM   7055 C  CB    . LYS A 1 878 ? -26.950 -17.545 -36.506 1.00 45.75  ? 878  LYS A CB    1 
ATOM   7056 C  CG    . LYS A 1 878 ? -27.727 -16.288 -36.850 1.00 49.65  ? 878  LYS A CG    1 
ATOM   7057 C  CD    . LYS A 1 878 ? -27.640 -15.263 -35.730 1.00 53.19  ? 878  LYS A CD    1 
ATOM   7058 N  N     . PRO A 1 879 ? -24.686 -19.126 -38.140 1.00 36.79  ? 879  PRO A N     1 
ATOM   7059 C  CA    . PRO A 1 879 ? -23.612 -19.175 -39.143 1.00 36.49  ? 879  PRO A CA    1 
ATOM   7060 C  C     . PRO A 1 879 ? -23.924 -20.126 -40.298 1.00 35.85  ? 879  PRO A C     1 
ATOM   7061 O  O     . PRO A 1 879 ? -23.572 -19.834 -41.440 1.00 29.45  ? 879  PRO A O     1 
ATOM   7062 C  CB    . PRO A 1 879 ? -22.409 -19.693 -38.347 1.00 36.82  ? 879  PRO A CB    1 
ATOM   7063 C  CG    . PRO A 1 879 ? -22.710 -19.351 -36.936 1.00 35.79  ? 879  PRO A CG    1 
ATOM   7064 C  CD    . PRO A 1 879 ? -24.194 -19.502 -36.801 1.00 33.73  ? 879  PRO A CD    1 
ATOM   7065 N  N     . LEU A 1 880 ? -24.578 -21.248 -40.008 1.00 34.75  ? 880  LEU A N     1 
ATOM   7066 C  CA    . LEU A 1 880 ? -24.926 -22.206 -41.053 1.00 34.73  ? 880  LEU A CA    1 
ATOM   7067 C  C     . LEU A 1 880 ? -25.906 -21.596 -42.059 1.00 36.17  ? 880  LEU A C     1 
ATOM   7068 O  O     . LEU A 1 880 ? -25.786 -21.810 -43.267 1.00 36.66  ? 880  LEU A O     1 
ATOM   7069 C  CB    . LEU A 1 880 ? -25.505 -23.493 -40.456 1.00 32.88  ? 880  LEU A CB    1 
ATOM   7070 C  CG    . LEU A 1 880 ? -25.856 -24.550 -41.507 1.00 34.75  ? 880  LEU A CG    1 
ATOM   7071 C  CD1   . LEU A 1 880 ? -24.617 -24.936 -42.306 1.00 32.42  ? 880  LEU A CD1   1 
ATOM   7072 C  CD2   . LEU A 1 880 ? -26.498 -25.771 -40.873 1.00 30.67  ? 880  LEU A CD2   1 
ATOM   7073 N  N     . GLU A 1 881 ? -26.871 -20.835 -41.552 1.00 37.51  ? 881  GLU A N     1 
ATOM   7074 C  CA    . GLU A 1 881 ? -27.803 -20.109 -42.408 1.00 43.92  ? 881  GLU A CA    1 
ATOM   7075 C  C     . GLU A 1 881 ? -27.047 -19.154 -43.334 1.00 40.61  ? 881  GLU A C     1 
ATOM   7076 O  O     . GLU A 1 881 ? -27.417 -18.970 -44.495 1.00 39.31  ? 881  GLU A O     1 
ATOM   7077 C  CB    . GLU A 1 881 ? -28.814 -19.335 -41.559 1.00 49.41  ? 881  GLU A CB    1 
ATOM   7078 C  CG    . GLU A 1 881 ? -29.692 -18.371 -42.353 1.00 57.92  ? 881  GLU A CG    1 
ATOM   7079 C  CD    . GLU A 1 881 ? -30.608 -19.078 -43.336 1.00 63.69  ? 881  GLU A CD    1 
ATOM   7080 O  OE1   . GLU A 1 881 ? -31.116 -20.170 -43.002 1.00 65.13  ? 881  GLU A OE1   1 
ATOM   7081 O  OE2   . GLU A 1 881 ? -30.818 -18.541 -44.446 1.00 66.11  ? 881  GLU A OE2   1 
ATOM   7082 N  N     . GLY A 1 882 ? -25.976 -18.564 -42.814 1.00 36.00  ? 882  GLY A N     1 
ATOM   7083 C  CA    . GLY A 1 882 ? -25.152 -17.660 -43.595 1.00 37.02  ? 882  GLY A CA    1 
ATOM   7084 C  C     . GLY A 1 882 ? -24.411 -18.361 -44.719 1.00 38.81  ? 882  GLY A C     1 
ATOM   7085 O  O     . GLY A 1 882 ? -24.372 -17.862 -45.844 1.00 40.76  ? 882  GLY A O     1 
ATOM   7086 N  N     . PHE A 1 883 ? -23.821 -19.515 -44.414 1.00 31.99  ? 883  PHE A N     1 
ATOM   7087 C  CA    . PHE A 1 883 ? -23.096 -20.295 -45.413 1.00 38.04  ? 883  PHE A CA    1 
ATOM   7088 C  C     . PHE A 1 883 ? -24.031 -20.726 -46.535 1.00 40.20  ? 883  PHE A C     1 
ATOM   7089 O  O     . PHE A 1 883 ? -23.727 -20.560 -47.715 1.00 41.47  ? 883  PHE A O     1 
ATOM   7090 C  CB    . PHE A 1 883 ? -22.490 -21.569 -44.805 1.00 33.06  ? 883  PHE A CB    1 
ATOM   7091 C  CG    . PHE A 1 883 ? -21.556 -21.331 -43.653 1.00 33.98  ? 883  PHE A CG    1 
ATOM   7092 C  CD1   . PHE A 1 883 ? -20.990 -20.086 -43.428 1.00 35.29  ? 883  PHE A CD1   1 
ATOM   7093 C  CD2   . PHE A 1 883 ? -21.232 -22.372 -42.799 1.00 34.22  ? 883  PHE A CD2   1 
ATOM   7094 C  CE1   . PHE A 1 883 ? -20.131 -19.884 -42.363 1.00 31.90  ? 883  PHE A CE1   1 
ATOM   7095 C  CE2   . PHE A 1 883 ? -20.370 -22.177 -41.736 1.00 35.18  ? 883  PHE A CE2   1 
ATOM   7096 C  CZ    . PHE A 1 883 ? -19.822 -20.931 -41.516 1.00 30.14  ? 883  PHE A CZ    1 
ATOM   7097 N  N     . THR A 1 884 ? -25.171 -21.289 -46.149 1.00 38.33  ? 884  THR A N     1 
ATOM   7098 C  CA    . THR A 1 884 ? -26.054 -21.965 -47.095 1.00 38.75  ? 884  THR A CA    1 
ATOM   7099 C  C     . THR A 1 884 ? -26.849 -21.013 -47.985 1.00 40.21  ? 884  THR A C     1 
ATOM   7100 O  O     . THR A 1 884 ? -27.020 -21.277 -49.174 1.00 42.16  ? 884  THR A O     1 
ATOM   7101 C  CB    . THR A 1 884 ? -27.014 -22.937 -46.378 1.00 35.06  ? 884  THR A CB    1 
ATOM   7102 O  OG1   . THR A 1 884 ? -27.820 -22.215 -45.443 1.00 34.47  ? 884  THR A OG1   1 
ATOM   7103 C  CG2   . THR A 1 884 ? -26.228 -24.014 -45.637 1.00 34.16  ? 884  THR A CG2   1 
ATOM   7104 N  N     . SER A 1 885 ? -27.335 -19.912 -47.420 1.00 38.11  ? 885  SER A N     1 
ATOM   7105 C  CA    . SER A 1 885 ? -28.054 -18.928 -48.226 1.00 40.89  ? 885  SER A CA    1 
ATOM   7106 C  C     . SER A 1 885 ? -27.108 -18.312 -49.251 1.00 42.25  ? 885  SER A C     1 
ATOM   7107 O  O     . SER A 1 885 ? -27.505 -18.008 -50.376 1.00 41.64  ? 885  SER A O     1 
ATOM   7108 C  CB    . SER A 1 885 ? -28.677 -17.839 -47.350 1.00 42.95  ? 885  SER A CB    1 
ATOM   7109 O  OG    . SER A 1 885 ? -27.678 -17.072 -46.699 1.00 46.26  ? 885  SER A OG    1 
ATOM   7110 N  N     . ALA A 1 886 ? -25.850 -18.139 -48.854 1.00 40.22  ? 886  ALA A N     1 
ATOM   7111 C  CA    . ALA A 1 886 ? -24.818 -17.661 -49.765 1.00 41.64  ? 886  ALA A CA    1 
ATOM   7112 C  C     . ALA A 1 886 ? -24.599 -18.659 -50.898 1.00 40.39  ? 886  ALA A C     1 
ATOM   7113 O  O     . ALA A 1 886 ? -24.517 -18.279 -52.062 1.00 40.64  ? 886  ALA A O     1 
ATOM   7114 C  CB    . ALA A 1 886 ? -23.514 -17.419 -49.010 1.00 41.98  ? 886  ALA A CB    1 
ATOM   7115 N  N     . ALA A 1 887 ? -24.520 -19.939 -50.552 1.00 42.21  ? 887  ALA A N     1 
ATOM   7116 C  CA    . ALA A 1 887 ? -24.276 -20.989 -51.538 1.00 42.27  ? 887  ALA A CA    1 
ATOM   7117 C  C     . ALA A 1 887 ? -25.540 -21.385 -52.301 1.00 44.56  ? 887  ALA A C     1 
ATOM   7118 O  O     . ALA A 1 887 ? -25.495 -22.261 -53.166 1.00 44.76  ? 887  ALA A O     1 
ATOM   7119 C  CB    . ALA A 1 887 ? -23.658 -22.207 -50.871 1.00 38.82  ? 887  ALA A CB    1 
ATOM   7120 N  N     . LYS A 1 888 ? -26.656 -20.736 -51.971 1.00 45.12  ? 888  LYS A N     1 
ATOM   7121 C  CA    . LYS A 1 888 ? -27.951 -20.978 -52.617 1.00 49.48  ? 888  LYS A CA    1 
ATOM   7122 C  C     . LYS A 1 888 ? -28.461 -22.399 -52.393 1.00 47.77  ? 888  LYS A C     1 
ATOM   7123 O  O     . LYS A 1 888 ? -28.819 -23.095 -53.342 1.00 43.97  ? 888  LYS A O     1 
ATOM   7124 C  CB    . LYS A 1 888 ? -27.893 -20.682 -54.122 1.00 52.49  ? 888  LYS A CB    1 
ATOM   7125 C  CG    . LYS A 1 888 ? -27.256 -19.354 -54.496 1.00 58.49  ? 888  LYS A CG    1 
ATOM   7126 C  CD    . LYS A 1 888 ? -28.225 -18.193 -54.368 1.00 61.85  ? 888  LYS A CD    1 
ATOM   7127 C  CE    . LYS A 1 888 ? -27.625 -16.926 -54.965 1.00 62.13  ? 888  LYS A CE    1 
ATOM   7128 N  NZ    . LYS A 1 888 ? -28.495 -15.739 -54.760 1.00 63.04  ? 888  LYS A NZ    1 
ATOM   7129 N  N     . LEU A 1 889 ? -28.486 -22.830 -51.139 1.00 49.11  ? 889  LEU A N     1 
ATOM   7130 C  CA    . LEU A 1 889 ? -29.064 -24.127 -50.805 1.00 48.13  ? 889  LEU A CA    1 
ATOM   7131 C  C     . LEU A 1 889 ? -29.629 -24.127 -49.391 1.00 46.89  ? 889  LEU A C     1 
ATOM   7132 O  O     . LEU A 1 889 ? -29.446 -23.167 -48.640 1.00 45.03  ? 889  LEU A O     1 
ATOM   7133 C  CB    . LEU A 1 889 ? -28.049 -25.259 -51.011 1.00 46.46  ? 889  LEU A CB    1 
ATOM   7134 C  CG    . LEU A 1 889 ? -26.621 -25.114 -50.479 1.00 44.86  ? 889  LEU A CG    1 
ATOM   7135 C  CD1   . LEU A 1 889 ? -26.545 -25.441 -48.999 1.00 46.40  ? 889  LEU A CD1   1 
ATOM   7136 C  CD2   . LEU A 1 889 ? -25.666 -25.998 -51.269 1.00 44.33  ? 889  LEU A CD2   1 
ATOM   7137 N  N     . ASP A 1 890 ? -30.325 -25.203 -49.040 1.00 46.53  ? 890  ASP A N     1 
ATOM   7138 C  CA    . ASP A 1 890 ? -30.973 -25.304 -47.740 1.00 46.32  ? 890  ASP A CA    1 
ATOM   7139 C  C     . ASP A 1 890 ? -30.345 -26.398 -46.886 1.00 45.77  ? 890  ASP A C     1 
ATOM   7140 O  O     . ASP A 1 890 ? -29.978 -27.462 -47.388 1.00 44.90  ? 890  ASP A O     1 
ATOM   7141 C  CB    . ASP A 1 890 ? -32.472 -25.565 -47.912 1.00 48.70  ? 890  ASP A CB    1 
ATOM   7142 C  CG    . ASP A 1 890 ? -33.196 -24.404 -48.572 1.00 52.46  ? 890  ASP A CG    1 
ATOM   7143 O  OD1   . ASP A 1 890 ? -32.910 -23.243 -48.214 1.00 51.37  ? 890  ASP A OD1   1 
ATOM   7144 O  OD2   . ASP A 1 890 ? -34.051 -24.653 -49.451 1.00 56.52  ? 890  ASP A OD2   1 
ATOM   7145 N  N     . TYR A 1 891 ? -30.217 -26.128 -45.592 1.00 45.34  ? 891  TYR A N     1 
ATOM   7146 C  CA    . TYR A 1 891 ? -29.703 -27.119 -44.658 1.00 44.62  ? 891  TYR A CA    1 
ATOM   7147 C  C     . TYR A 1 891 ? -30.857 -27.956 -44.126 1.00 42.94  ? 891  TYR A C     1 
ATOM   7148 O  O     . TYR A 1 891 ? -30.656 -28.907 -43.372 1.00 39.97  ? 891  TYR A O     1 
ATOM   7149 C  CB    . TYR A 1 891 ? -28.956 -26.445 -43.503 1.00 40.85  ? 891  TYR A CB    1 
ATOM   7150 C  CG    . TYR A 1 891 ? -29.805 -25.517 -42.657 1.00 41.35  ? 891  TYR A CG    1 
ATOM   7151 C  CD1   . TYR A 1 891 ? -30.565 -26.004 -41.599 1.00 41.18  ? 891  TYR A CD1   1 
ATOM   7152 C  CD2   . TYR A 1 891 ? -29.827 -24.149 -42.901 1.00 44.42  ? 891  TYR A CD2   1 
ATOM   7153 C  CE1   . TYR A 1 891 ? -31.336 -25.159 -40.822 1.00 43.43  ? 891  TYR A CE1   1 
ATOM   7154 C  CE2   . TYR A 1 891 ? -30.595 -23.293 -42.125 1.00 44.28  ? 891  TYR A CE2   1 
ATOM   7155 C  CZ    . TYR A 1 891 ? -31.346 -23.806 -41.088 1.00 44.79  ? 891  TYR A CZ    1 
ATOM   7156 O  OH    . TYR A 1 891 ? -32.111 -22.966 -40.310 1.00 45.68  ? 891  TYR A OH    1 
ATOM   7157 N  N     . GLU A 1 892 ? -32.067 -27.585 -44.530 1.00 47.41  ? 892  GLU A N     1 
ATOM   7158 C  CA    . GLU A 1 892 ? -33.285 -28.230 -44.058 1.00 51.36  ? 892  GLU A CA    1 
ATOM   7159 C  C     . GLU A 1 892 ? -34.282 -28.320 -45.209 1.00 54.30  ? 892  GLU A C     1 
ATOM   7160 O  O     . GLU A 1 892 ? -34.522 -27.330 -45.906 1.00 52.37  ? 892  GLU A O     1 
ATOM   7161 C  CB    . GLU A 1 892 ? -33.882 -27.410 -42.915 1.00 54.94  ? 892  GLU A CB    1 
ATOM   7162 C  CG    . GLU A 1 892 ? -34.606 -28.214 -41.856 1.00 59.62  ? 892  GLU A CG    1 
ATOM   7163 C  CD    . GLU A 1 892 ? -34.922 -27.381 -40.627 1.00 61.02  ? 892  GLU A CD    1 
ATOM   7164 O  OE1   . GLU A 1 892 ? -34.919 -26.135 -40.738 1.00 60.89  ? 892  GLU A OE1   1 
ATOM   7165 O  OE2   . GLU A 1 892 ? -35.163 -27.968 -39.551 1.00 62.73  ? 892  GLU A OE2   1 
ATOM   7166 N  N     . LYS A 1 893 ? -34.857 -29.504 -45.411 1.00 56.01  ? 893  LYS A N     1 
ATOM   7167 C  CA    . LYS A 1 893 ? -35.815 -29.720 -46.495 1.00 58.77  ? 893  LYS A CA    1 
ATOM   7168 C  C     . LYS A 1 893 ? -37.034 -28.815 -46.346 1.00 60.13  ? 893  LYS A C     1 
ATOM   7169 O  O     . LYS A 1 893 ? -37.677 -28.793 -45.296 1.00 61.17  ? 893  LYS A O     1 
ATOM   7170 C  CB    . LYS A 1 893 ? -36.251 -31.187 -46.549 1.00 61.78  ? 893  LYS A CB    1 
ATOM   7171 N  N     . LYS A 1 894 ? -37.339 -28.065 -47.401 1.00 60.87  ? 894  LYS A N     1 
ATOM   7172 C  CA    . LYS A 1 894 ? -38.434 -27.101 -47.373 1.00 62.51  ? 894  LYS A CA    1 
ATOM   7173 C  C     . LYS A 1 894 ? -39.783 -27.759 -47.640 1.00 64.62  ? 894  LYS A C     1 
ATOM   7174 O  O     . LYS A 1 894 ? -39.852 -28.892 -48.118 1.00 65.44  ? 894  LYS A O     1 
ATOM   7175 C  CB    . LYS A 1 894 ? -38.188 -25.984 -48.390 1.00 64.39  ? 894  LYS A CB    1 
ATOM   7176 N  N     . ALA A 1 895 ? -40.854 -27.036 -47.329 1.00 65.15  ? 895  ALA A N     1 
ATOM   7177 C  CA    . ALA A 1 895 ? -42.207 -27.536 -47.538 1.00 65.79  ? 895  ALA A CA    1 
ATOM   7178 C  C     . ALA A 1 895 ? -42.656 -27.329 -48.984 1.00 67.39  ? 895  ALA A C     1 
ATOM   7179 O  O     . ALA A 1 895 ? -42.386 -26.288 -49.585 1.00 66.54  ? 895  ALA A O     1 
ATOM   7180 C  CB    . ALA A 1 895 ? -43.172 -26.861 -46.578 1.00 64.98  ? 895  ALA A CB    1 
ATOM   7181 N  N     . SER A 1 896 ? -43.343 -28.326 -49.533 1.00 68.15  ? 896  SER A N     1 
ATOM   7182 C  CA    . SER A 1 896 ? -43.820 -28.269 -50.910 1.00 67.69  ? 896  SER A CA    1 
ATOM   7183 C  C     . SER A 1 896 ? -45.211 -28.876 -51.029 1.00 65.98  ? 896  SER A C     1 
ATOM   7184 O  O     . SER A 1 896 ? -45.745 -29.425 -50.064 1.00 65.21  ? 896  SER A O     1 
ATOM   7185 C  CB    . SER A 1 896 ? -42.862 -29.020 -51.838 1.00 69.72  ? 896  SER A CB    1 
ATOM   7186 O  OG    . SER A 1 896 ? -42.962 -30.422 -51.645 1.00 69.89  ? 896  SER A OG    1 
ATOM   7187 N  N     . LEU A 1 897 ? -45.788 -28.791 -52.224 1.00 64.37  ? 897  LEU A N     1 
ATOM   7188 C  CA    . LEU A 1 897 ? -47.093 -29.384 -52.489 1.00 65.96  ? 897  LEU A CA    1 
ATOM   7189 C  C     . LEU A 1 897 ? -47.019 -30.908 -52.436 1.00 64.93  ? 897  LEU A C     1 
ATOM   7190 O  O     . LEU A 1 897 ? -48.040 -31.586 -52.337 1.00 63.59  ? 897  LEU A O     1 
ATOM   7191 C  CB    . LEU A 1 897 ? -47.632 -28.924 -53.847 1.00 67.99  ? 897  LEU A CB    1 
ATOM   7192 N  N     . PHE A 1 898 ? -45.802 -31.439 -52.489 1.00 66.03  ? 898  PHE A N     1 
ATOM   7193 C  CA    . PHE A 1 898 ? -45.583 -32.881 -52.446 1.00 70.55  ? 898  PHE A CA    1 
ATOM   7194 C  C     . PHE A 1 898 ? -45.848 -33.477 -51.066 1.00 68.83  ? 898  PHE A C     1 
ATOM   7195 O  O     . PHE A 1 898 ? -45.925 -34.697 -50.915 1.00 67.17  ? 898  PHE A O     1 
ATOM   7196 C  CB    . PHE A 1 898 ? -44.160 -33.212 -52.898 1.00 73.96  ? 898  PHE A CB    1 
ATOM   7197 C  CG    . PHE A 1 898 ? -43.964 -33.118 -54.380 1.00 80.16  ? 898  PHE A CG    1 
ATOM   7198 C  CD1   . PHE A 1 898 ? -43.885 -34.263 -55.151 1.00 82.81  ? 898  PHE A CD1   1 
ATOM   7199 C  CD2   . PHE A 1 898 ? -43.874 -31.885 -55.007 1.00 83.39  ? 898  PHE A CD2   1 
ATOM   7200 C  CE1   . PHE A 1 898 ? -43.711 -34.184 -56.515 1.00 86.19  ? 898  PHE A CE1   1 
ATOM   7201 C  CE2   . PHE A 1 898 ? -43.701 -31.800 -56.375 1.00 87.12  ? 898  PHE A CE2   1 
ATOM   7202 C  CZ    . PHE A 1 898 ? -43.620 -32.952 -57.130 1.00 87.82  ? 898  PHE A CZ    1 
ATOM   7203 N  N     . ASP A 1 899 ? -45.990 -32.613 -50.065 1.00 67.61  ? 899  ASP A N     1 
ATOM   7204 C  CA    . ASP A 1 899 ? -46.238 -33.054 -48.697 1.00 67.49  ? 899  ASP A CA    1 
ATOM   7205 C  C     . ASP A 1 899 ? -47.634 -33.649 -48.520 1.00 69.46  ? 899  ASP A C     1 
ATOM   7206 O  O     . ASP A 1 899 ? -47.922 -34.279 -47.504 1.00 72.10  ? 899  ASP A O     1 
ATOM   7207 C  CB    . ASP A 1 899 ? -46.037 -31.896 -47.717 1.00 67.22  ? 899  ASP A CB    1 
ATOM   7208 C  CG    . ASP A 1 899 ? -44.612 -31.376 -47.714 1.00 70.31  ? 899  ASP A CG    1 
ATOM   7209 O  OD1   . ASP A 1 899 ? -44.425 -30.151 -47.552 1.00 71.39  ? 899  ASP A OD1   1 
ATOM   7210 O  OD2   . ASP A 1 899 ? -43.678 -32.191 -47.873 1.00 70.10  ? 899  ASP A OD2   1 
ATOM   7211 N  N     . MET A 1 900 ? -48.498 -33.450 -49.510 1.00 67.95  ? 900  MET A N     1 
ATOM   7212 C  CA    . MET A 1 900 ? -49.866 -33.950 -49.434 1.00 69.75  ? 900  MET A CA    1 
ATOM   7213 C  C     . MET A 1 900 ? -49.972 -35.399 -49.903 1.00 73.83  ? 900  MET A C     1 
ATOM   7214 O  O     . MET A 1 900 ? -51.072 -35.928 -50.070 1.00 75.13  ? 900  MET A O     1 
ATOM   7215 C  CB    . MET A 1 900 ? -50.813 -33.054 -50.237 1.00 70.01  ? 900  MET A CB    1 
ATOM   7216 C  CG    . MET A 1 900 ? -50.884 -31.623 -49.726 1.00 68.59  ? 900  MET A CG    1 
ATOM   7217 S  SD    . MET A 1 900 ? -51.956 -30.558 -50.711 1.00 100.95 ? 900  MET A SD    1 
ATOM   7218 C  CE    . MET A 1 900 ? -53.568 -31.255 -50.347 1.00 75.74  ? 900  MET A CE    1 
ATOM   7219 N  N     . PHE A 1 901 ? -48.823 -36.035 -50.114 1.00 77.24  ? 901  PHE A N     1 
ATOM   7220 C  CA    . PHE A 1 901 ? -48.781 -37.438 -50.512 1.00 83.20  ? 901  PHE A CA    1 
ATOM   7221 C  C     . PHE A 1 901 ? -48.138 -38.292 -49.422 1.00 84.45  ? 901  PHE A C     1 
ATOM   7222 O  O     . PHE A 1 901 ? -47.429 -37.778 -48.557 1.00 81.78  ? 901  PHE A O     1 
ATOM   7223 C  CB    . PHE A 1 901 ? -48.020 -37.610 -51.831 1.00 84.93  ? 901  PHE A CB    1 
ATOM   7224 C  CG    . PHE A 1 901 ? -48.648 -36.892 -52.992 1.00 85.98  ? 901  PHE A CG    1 
ATOM   7225 C  CD1   . PHE A 1 901 ? -49.792 -37.389 -53.595 1.00 87.00  ? 901  PHE A CD1   1 
ATOM   7226 C  CD2   . PHE A 1 901 ? -48.091 -35.724 -53.485 1.00 85.14  ? 901  PHE A CD2   1 
ATOM   7227 C  CE1   . PHE A 1 901 ? -50.372 -36.732 -54.662 1.00 88.24  ? 901  PHE A CE1   1 
ATOM   7228 C  CE2   . PHE A 1 901 ? -48.665 -35.062 -54.553 1.00 86.05  ? 901  PHE A CE2   1 
ATOM   7229 C  CZ    . PHE A 1 901 ? -49.807 -35.567 -55.142 1.00 87.81  ? 901  PHE A CZ    1 
ATOM   7230 N  N     . ASP A 1 902 ? -48.392 -39.598 -49.472 1.00 87.56  ? 902  ASP A N     1 
ATOM   7231 C  CA    . ASP A 1 902 ? -47.829 -40.529 -48.499 1.00 85.73  ? 902  ASP A CA    1 
ATOM   7232 C  C     . ASP A 1 902 ? -46.548 -41.174 -49.021 1.00 84.81  ? 902  ASP A C     1 
ATOM   7233 O  O     . ASP A 1 902 ? -45.549 -40.493 -49.256 1.00 83.84  ? 902  ASP A O     1 
ATOM   7234 C  CB    . ASP A 1 902 ? -48.851 -41.608 -48.135 1.00 85.66  ? 902  ASP A CB    1 
ATOM   7235 C  "C4'" . DG  B 2 1   ? -43.720 -5.429  -27.344 1.00 77.32  ? 102  DG  P "C4'" 1 
ATOM   7236 O  "O4'" . DG  B 2 1   ? -43.593 -4.198  -28.100 1.00 76.73  ? 102  DG  P "O4'" 1 
ATOM   7237 C  "C3'" . DG  B 2 1   ? -42.332 -6.056  -27.387 1.00 77.67  ? 102  DG  P "C3'" 1 
ATOM   7238 O  "O3'" . DG  B 2 1   ? -42.192 -6.843  -28.568 1.00 77.53  ? 102  DG  P "O3'" 1 
ATOM   7239 C  "C2'" . DG  B 2 1   ? -41.429 -4.825  -27.391 1.00 76.42  ? 102  DG  P "C2'" 1 
ATOM   7240 C  "C1'" . DG  B 2 1   ? -42.234 -3.835  -28.223 1.00 75.84  ? 102  DG  P "C1'" 1 
ATOM   7241 N  N9    . DG  B 2 1   ? -42.112 -2.443  -27.801 1.00 74.21  ? 102  DG  P N9    1 
ATOM   7242 C  C8    . DG  B 2 1   ? -42.070 -1.966  -26.514 1.00 73.70  ? 102  DG  P C8    1 
ATOM   7243 N  N7    . DG  B 2 1   ? -41.965 -0.666  -26.447 1.00 71.28  ? 102  DG  P N7    1 
ATOM   7244 C  C5    . DG  B 2 1   ? -41.940 -0.256  -27.775 1.00 71.28  ? 102  DG  P C5    1 
ATOM   7245 C  C6    . DG  B 2 1   ? -41.839 1.042   -28.332 1.00 72.44  ? 102  DG  P C6    1 
ATOM   7246 O  O6    . DG  B 2 1   ? -41.747 2.124   -27.737 1.00 72.67  ? 102  DG  P O6    1 
ATOM   7247 N  N1    . DG  B 2 1   ? -41.847 1.013   -29.726 1.00 71.81  ? 102  DG  P N1    1 
ATOM   7248 C  C2    . DG  B 2 1   ? -41.943 -0.130  -30.487 1.00 72.08  ? 102  DG  P C2    1 
ATOM   7249 N  N2    . DG  B 2 1   ? -41.938 0.025   -31.819 1.00 63.98  ? 102  DG  P N2    1 
ATOM   7250 N  N3    . DG  B 2 1   ? -42.037 -1.350  -29.978 1.00 71.99  ? 102  DG  P N3    1 
ATOM   7251 C  C4    . DG  B 2 1   ? -42.031 -1.338  -28.621 1.00 71.86  ? 102  DG  P C4    1 
ATOM   7252 P  P     . DC  B 2 2   ? -40.829 -7.647  -28.855 1.00 83.17  ? 103  DC  P P     1 
ATOM   7253 O  OP1   . DC  B 2 2   ? -41.186 -8.938  -29.486 1.00 85.36  ? 103  DC  P OP1   1 
ATOM   7254 O  OP2   . DC  B 2 2   ? -40.014 -7.638  -27.618 1.00 81.09  ? 103  DC  P OP2   1 
ATOM   7255 O  "O5'" . DC  B 2 2   ? -40.090 -6.752  -29.956 1.00 82.46  ? 103  DC  P "O5'" 1 
ATOM   7256 C  "C5'" . DC  B 2 2   ? -40.684 -6.579  -31.244 1.00 82.55  ? 103  DC  P "C5'" 1 
ATOM   7257 C  "C4'" . DC  B 2 2   ? -39.845 -5.689  -32.147 1.00 81.49  ? 103  DC  P "C4'" 1 
ATOM   7258 O  "O4'" . DC  B 2 2   ? -39.934 -4.311  -31.698 1.00 78.86  ? 103  DC  P "O4'" 1 
ATOM   7259 C  "C3'" . DC  B 2 2   ? -38.351 -6.000  -32.192 1.00 81.92  ? 103  DC  P "C3'" 1 
ATOM   7260 O  "O3'" . DC  B 2 2   ? -37.846 -5.690  -33.482 1.00 85.38  ? 103  DC  P "O3'" 1 
ATOM   7261 C  "C2'" . DC  B 2 2   ? -37.795 -5.012  -31.175 1.00 78.21  ? 103  DC  P "C2'" 1 
ATOM   7262 C  "C1'" . DC  B 2 2   ? -38.620 -3.804  -31.592 1.00 75.45  ? 103  DC  P "C1'" 1 
ATOM   7263 N  N1    . DC  B 2 2   ? -38.596 -2.667  -30.632 1.00 70.83  ? 103  DC  P N1    1 
ATOM   7264 C  C2    . DC  B 2 2   ? -38.690 -1.360  -31.124 1.00 68.09  ? 103  DC  P C2    1 
ATOM   7265 O  O2    . DC  B 2 2   ? -38.793 -1.181  -32.343 1.00 67.06  ? 103  DC  P O2    1 
ATOM   7266 N  N3    . DC  B 2 2   ? -38.668 -0.325  -30.251 1.00 62.58  ? 103  DC  P N3    1 
ATOM   7267 C  C4    . DC  B 2 2   ? -38.559 -0.563  -28.944 1.00 66.43  ? 103  DC  P C4    1 
ATOM   7268 N  N4    . DC  B 2 2   ? -38.542 0.490   -28.123 1.00 64.95  ? 103  DC  P N4    1 
ATOM   7269 C  C5    . DC  B 2 2   ? -38.462 -1.888  -28.422 1.00 68.97  ? 103  DC  P C5    1 
ATOM   7270 C  C6    . DC  B 2 2   ? -38.482 -2.903  -29.294 1.00 69.63  ? 103  DC  P C6    1 
ATOM   7271 P  P     . DG  B 2 3   ? -37.669 -6.841  -34.590 1.00 77.32  ? 104  DG  P P     1 
ATOM   7272 O  OP1   . DG  B 2 3   ? -38.965 -7.551  -34.704 1.00 81.64  ? 104  DG  P OP1   1 
ATOM   7273 O  OP2   . DG  B 2 3   ? -36.429 -7.583  -34.274 1.00 73.78  ? 104  DG  P OP2   1 
ATOM   7274 O  "O5'" . DG  B 2 3   ? -37.424 -6.027  -35.946 1.00 79.55  ? 104  DG  P "O5'" 1 
ATOM   7275 C  "C5'" . DG  B 2 3   ? -38.304 -4.957  -36.281 1.00 77.97  ? 104  DG  P "C5'" 1 
ATOM   7276 C  "C4'" . DG  B 2 3   ? -37.664 -3.929  -37.203 1.00 75.21  ? 104  DG  P "C4'" 1 
ATOM   7277 O  "O4'" . DG  B 2 3   ? -37.368 -2.718  -36.466 1.00 71.75  ? 104  DG  P "O4'" 1 
ATOM   7278 C  "C3'" . DG  B 2 3   ? -36.345 -4.310  -37.859 1.00 74.95  ? 104  DG  P "C3'" 1 
ATOM   7279 O  "O3'" . DG  B 2 3   ? -36.251 -3.582  -39.078 1.00 73.95  ? 104  DG  P "O3'" 1 
ATOM   7280 C  "C2'" . DG  B 2 3   ? -35.317 -3.854  -36.824 1.00 72.52  ? 104  DG  P "C2'" 1 
ATOM   7281 C  "C1'" . DG  B 2 3   ? -35.974 -2.611  -36.235 1.00 71.41  ? 104  DG  P "C1'" 1 
ATOM   7282 N  N9    . DG  B 2 3   ? -35.795 -2.452  -34.796 1.00 69.63  ? 104  DG  P N9    1 
ATOM   7283 C  C8    . DG  B 2 3   ? -35.713 -3.438  -33.844 1.00 68.77  ? 104  DG  P C8    1 
ATOM   7284 N  N7    . DG  B 2 3   ? -35.563 -2.975  -32.634 1.00 68.39  ? 104  DG  P N7    1 
ATOM   7285 C  C5    . DG  B 2 3   ? -35.550 -1.594  -32.791 1.00 67.40  ? 104  DG  P C5    1 
ATOM   7286 C  C6    . DG  B 2 3   ? -35.419 -0.557  -31.833 1.00 61.43  ? 104  DG  P C6    1 
ATOM   7287 O  O6    . DG  B 2 3   ? -35.283 -0.650  -30.605 1.00 61.54  ? 104  DG  P O6    1 
ATOM   7288 N  N1    . DG  B 2 3   ? -35.457 0.702   -32.428 1.00 60.13  ? 104  DG  P N1    1 
ATOM   7289 C  C2    . DG  B 2 3   ? -35.602 0.932   -33.775 1.00 62.64  ? 104  DG  P C2    1 
ATOM   7290 N  N2    . DG  B 2 3   ? -35.616 2.216   -34.162 1.00 63.02  ? 104  DG  P N2    1 
ATOM   7291 N  N3    . DG  B 2 3   ? -35.728 -0.027  -34.682 1.00 62.92  ? 104  DG  P N3    1 
ATOM   7292 C  C4    . DG  B 2 3   ? -35.694 -1.258  -34.118 1.00 66.55  ? 104  DG  P C4    1 
ATOM   7293 P  P     . DG  B 2 4   ? -35.008 -3.800  -40.073 1.00 94.59  ? 105  DG  P P     1 
ATOM   7294 O  OP1   . DG  B 2 4   ? -35.563 -3.897  -41.441 1.00 96.87  ? 105  DG  P OP1   1 
ATOM   7295 O  OP2   . DG  B 2 4   ? -34.159 -4.891  -39.545 1.00 94.59  ? 105  DG  P OP2   1 
ATOM   7296 O  "O5'" . DG  B 2 4   ? -34.191 -2.431  -39.959 1.00 82.28  ? 105  DG  P "O5'" 1 
ATOM   7297 C  "C5'" . DG  B 2 4   ? -34.876 -1.261  -39.534 1.00 79.93  ? 105  DG  P "C5'" 1 
ATOM   7298 C  "C4'" . DG  B 2 4   ? -33.951 -0.061  -39.451 1.00 78.28  ? 105  DG  P "C4'" 1 
ATOM   7299 O  "O4'" . DG  B 2 4   ? -33.727 0.279   -38.059 1.00 75.78  ? 105  DG  P "O4'" 1 
ATOM   7300 C  "C3'" . DG  B 2 4   ? -32.566 -0.235  -40.060 1.00 78.93  ? 105  DG  P "C3'" 1 
ATOM   7301 O  "O3'" . DG  B 2 4   ? -32.138 1.032   -40.544 1.00 80.25  ? 105  DG  P "O3'" 1 
ATOM   7302 C  "C2'" . DG  B 2 4   ? -31.740 -0.705  -38.866 1.00 76.62  ? 105  DG  P "C2'" 1 
ATOM   7303 C  "C1'" . DG  B 2 4   ? -32.364 0.093   -37.727 1.00 73.57  ? 105  DG  P "C1'" 1 
ATOM   7304 N  N9    . DG  B 2 4   ? -32.302 -0.580  -36.433 1.00 68.75  ? 105  DG  P N9    1 
ATOM   7305 C  C8    . DG  B 2 4   ? -32.291 -1.934  -36.195 1.00 68.19  ? 105  DG  P C8    1 
ATOM   7306 N  N7    . DG  B 2 4   ? -32.230 -2.236  -34.927 1.00 65.66  ? 105  DG  P N7    1 
ATOM   7307 C  C5    . DG  B 2 4   ? -32.199 -1.003  -34.284 1.00 63.16  ? 105  DG  P C5    1 
ATOM   7308 C  C6    . DG  B 2 4   ? -32.134 -0.691  -32.905 1.00 61.60  ? 105  DG  P C6    1 
ATOM   7309 O  O6    . DG  B 2 4   ? -32.087 -1.471  -31.941 1.00 61.51  ? 105  DG  P O6    1 
ATOM   7310 N  N1    . DG  B 2 4   ? -32.122 0.686   -32.690 1.00 59.05  ? 105  DG  P N1    1 
ATOM   7311 C  C2    . DG  B 2 4   ? -32.168 1.641   -33.679 1.00 66.39  ? 105  DG  P C2    1 
ATOM   7312 N  N2    . DG  B 2 4   ? -32.150 2.923   -33.279 1.00 65.72  ? 105  DG  P N2    1 
ATOM   7313 N  N3    . DG  B 2 4   ? -32.229 1.361   -34.974 1.00 64.73  ? 105  DG  P N3    1 
ATOM   7314 C  C4    . DG  B 2 4   ? -32.242 0.024   -35.199 1.00 64.66  ? 105  DG  P C4    1 
ATOM   7315 P  P     . DA  B 2 5   ? -30.784 1.174   -41.398 1.00 82.82  ? 106  DA  P P     1 
ATOM   7316 O  OP1   . DA  B 2 5   ? -31.149 1.842   -42.666 1.00 86.03  ? 106  DA  P OP1   1 
ATOM   7317 O  OP2   . DA  B 2 5   ? -30.091 -0.134  -41.432 1.00 82.51  ? 106  DA  P OP2   1 
ATOM   7318 O  "O5'" . DA  B 2 5   ? -29.895 2.182   -40.533 1.00 74.06  ? 106  DA  P "O5'" 1 
ATOM   7319 C  "C5'" . DA  B 2 5   ? -30.528 3.266   -39.863 1.00 71.89  ? 106  DA  P "C5'" 1 
ATOM   7320 C  "C4'" . DA  B 2 5   ? -29.632 3.864   -38.790 1.00 69.63  ? 106  DA  P "C4'" 1 
ATOM   7321 O  "O4'" . DA  B 2 5   ? -29.787 3.128   -37.549 1.00 68.10  ? 106  DA  P "O4'" 1 
ATOM   7322 C  "C3'" . DA  B 2 5   ? -28.138 3.857   -39.091 1.00 69.19  ? 106  DA  P "C3'" 1 
ATOM   7323 O  "O3'" . DA  B 2 5   ? -27.570 5.055   -38.593 1.00 70.53  ? 106  DA  P "O3'" 1 
ATOM   7324 C  "C2'" . DA  B 2 5   ? -27.631 2.653   -38.304 1.00 67.09  ? 106  DA  P "C2'" 1 
ATOM   7325 C  "C1'" . DA  B 2 5   ? -28.514 2.751   -37.067 1.00 64.84  ? 106  DA  P "C1'" 1 
ATOM   7326 N  N9    . DA  B 2 5   ? -28.656 1.492   -36.345 1.00 63.39  ? 106  DA  P N9    1 
ATOM   7327 C  C8    . DA  B 2 5   ? -28.778 0.243   -36.883 1.00 63.51  ? 106  DA  P C8    1 
ATOM   7328 N  N7    . DA  B 2 5   ? -28.892 -0.710  -35.989 1.00 64.07  ? 106  DA  P N7    1 
ATOM   7329 C  C5    . DA  B 2 5   ? -28.841 -0.038  -34.780 1.00 62.50  ? 106  DA  P C5    1 
ATOM   7330 C  C6    . DA  B 2 5   ? -28.908 -0.481  -33.444 1.00 61.50  ? 106  DA  P C6    1 
ATOM   7331 N  N6    . DA  B 2 5   ? -29.048 -1.768  -33.103 1.00 61.32  ? 106  DA  P N6    1 
ATOM   7332 N  N1    . DA  B 2 5   ? -28.826 0.451   -32.473 1.00 59.41  ? 106  DA  P N1    1 
ATOM   7333 C  C2    . DA  B 2 5   ? -28.686 1.736   -32.818 1.00 58.79  ? 106  DA  P C2    1 
ATOM   7334 N  N3    . DA  B 2 5   ? -28.611 2.271   -34.036 1.00 60.78  ? 106  DA  P N3    1 
ATOM   7335 C  C4    . DA  B 2 5   ? -28.696 1.321   -34.981 1.00 62.18  ? 106  DA  P C4    1 
ATOM   7336 P  P     . DC  B 2 6   ? -26.119 5.531   -39.089 1.00 75.18  ? 107  DC  P P     1 
ATOM   7337 O  OP1   . DC  B 2 6   ? -26.209 6.979   -39.382 1.00 80.92  ? 107  DC  P OP1   1 
ATOM   7338 O  OP2   . DC  B 2 6   ? -25.666 4.588   -40.136 1.00 75.73  ? 107  DC  P OP2   1 
ATOM   7339 O  "O5'" . DC  B 2 6   ? -25.187 5.332   -37.804 1.00 73.26  ? 107  DC  P "O5'" 1 
ATOM   7340 C  "C5'" . DC  B 2 6   ? -25.442 6.113   -36.643 1.00 70.47  ? 107  DC  P "C5'" 1 
ATOM   7341 C  "C4'" . DC  B 2 6   ? -24.940 5.427   -35.385 1.00 63.38  ? 107  DC  P "C4'" 1 
ATOM   7342 O  "O4'" . DC  B 2 6   ? -25.544 4.117   -35.245 1.00 57.42  ? 107  DC  P "O4'" 1 
ATOM   7343 C  "C3'" . DC  B 2 6   ? -23.432 5.194   -35.330 1.00 61.57  ? 107  DC  P "C3'" 1 
ATOM   7344 O  "O3'" . DC  B 2 6   ? -22.872 5.956   -34.273 1.00 63.27  ? 107  DC  P "O3'" 1 
ATOM   7345 C  "C2'" . DC  B 2 6   ? -23.285 3.699   -35.052 1.00 56.33  ? 107  DC  P "C2'" 1 
ATOM   7346 C  "C1'" . DC  B 2 6   ? -24.648 3.354   -34.470 1.00 53.54  ? 107  DC  P "C1'" 1 
ATOM   7347 N  N1    . DC  B 2 6   ? -24.987 1.909   -34.567 1.00 49.01  ? 107  DC  P N1    1 
ATOM   7348 C  C2    . DC  B 2 6   ? -25.163 1.169   -33.393 1.00 47.71  ? 107  DC  P C2    1 
ATOM   7349 O  O2    . DC  B 2 6   ? -25.037 1.743   -32.304 1.00 47.70  ? 107  DC  P O2    1 
ATOM   7350 N  N3    . DC  B 2 6   ? -25.467 -0.151  -33.486 1.00 42.53  ? 107  DC  P N3    1 
ATOM   7351 C  C4    . DC  B 2 6   ? -25.591 -0.725  -34.685 1.00 43.54  ? 107  DC  P C4    1 
ATOM   7352 N  N4    . DC  B 2 6   ? -25.894 -2.028  -34.734 1.00 40.56  ? 107  DC  P N4    1 
ATOM   7353 C  C5    . DC  B 2 6   ? -25.413 0.016   -35.892 1.00 43.75  ? 107  DC  P C5    1 
ATOM   7354 C  C6    . DC  B 2 6   ? -25.113 1.315   -35.787 1.00 47.74  ? 107  DC  P C6    1 
ATOM   7355 P  P     . DT  B 2 7   ? -21.282 6.157   -34.175 1.00 79.50  ? 108  DT  P P     1 
ATOM   7356 O  OP1   . DT  B 2 7   ? -21.045 7.576   -33.826 1.00 81.13  ? 108  DT  P OP1   1 
ATOM   7357 O  OP2   . DT  B 2 7   ? -20.668 5.572   -35.389 1.00 79.27  ? 108  DT  P OP2   1 
ATOM   7358 O  "O5'" . DT  B 2 7   ? -20.852 5.234   -32.943 1.00 60.37  ? 108  DT  P "O5'" 1 
ATOM   7359 C  "C5'" . DT  B 2 7   ? -21.477 5.397   -31.676 1.00 60.58  ? 108  DT  P "C5'" 1 
ATOM   7360 C  "C4'" . DT  B 2 7   ? -21.121 4.224   -30.785 1.00 57.75  ? 108  DT  P "C4'" 1 
ATOM   7361 O  "O4'" . DT  B 2 7   ? -21.877 3.071   -31.223 1.00 56.22  ? 108  DT  P "O4'" 1 
ATOM   7362 C  "C3'" . DT  B 2 7   ? -19.650 3.826   -30.859 1.00 57.31  ? 108  DT  P "C3'" 1 
ATOM   7363 O  "O3'" . DT  B 2 7   ? -18.970 4.210   -29.665 1.00 59.75  ? 108  DT  P "O3'" 1 
ATOM   7364 C  "C2'" . DT  B 2 7   ? -19.653 2.309   -31.033 1.00 54.05  ? 108  DT  P "C2'" 1 
ATOM   7365 C  "C1'" . DT  B 2 7   ? -21.122 1.905   -30.978 1.00 53.65  ? 108  DT  P "C1'" 1 
ATOM   7366 N  N1    . DT  B 2 7   ? -21.479 0.881   -32.002 1.00 50.64  ? 108  DT  P N1    1 
ATOM   7367 C  C2    . DT  B 2 7   ? -21.941 -0.348  -31.583 1.00 47.36  ? 108  DT  P C2    1 
ATOM   7368 O  O2    . DT  B 2 7   ? -22.080 -0.641  -30.408 1.00 47.07  ? 108  DT  P O2    1 
ATOM   7369 N  N3    . DT  B 2 7   ? -22.239 -1.225  -32.596 1.00 44.61  ? 108  DT  P N3    1 
ATOM   7370 C  C4    . DT  B 2 7   ? -22.123 -0.998  -33.955 1.00 45.69  ? 108  DT  P C4    1 
ATOM   7371 O  O4    . DT  B 2 7   ? -22.420 -1.845  -34.793 1.00 45.01  ? 108  DT  P O4    1 
ATOM   7372 C  C5    . DT  B 2 7   ? -21.629 0.306   -34.323 1.00 49.19  ? 108  DT  P C5    1 
ATOM   7373 C  C7    . DT  B 2 7   ? -21.460 0.654   -35.773 1.00 49.16  ? 108  DT  P C7    1 
ATOM   7374 C  C6    . DT  B 2 7   ? -21.332 1.173   -33.344 1.00 50.92  ? 108  DT  P C6    1 
ATOM   7375 P  P     . DG  B 2 8   ? -17.396 3.919   -29.497 1.00 76.72  ? 109  DG  P P     1 
ATOM   7376 O  OP1   . DG  B 2 8   ? -16.868 4.946   -28.572 1.00 78.70  ? 109  DG  P OP1   1 
ATOM   7377 O  OP2   . DG  B 2 8   ? -16.796 3.762   -30.842 1.00 74.46  ? 109  DG  P OP2   1 
ATOM   7378 O  "O5'" . DG  B 2 8   ? -17.341 2.486   -28.780 1.00 56.70  ? 109  DG  P "O5'" 1 
ATOM   7379 C  "C5'" . DG  B 2 8   ? -18.180 2.210   -27.660 1.00 51.91  ? 109  DG  P "C5'" 1 
ATOM   7380 C  "C4'" . DG  B 2 8   ? -17.963 0.800   -27.129 1.00 50.69  ? 109  DG  P "C4'" 1 
ATOM   7381 O  "O4'" . DG  B 2 8   ? -18.644 -0.164  -27.976 1.00 47.95  ? 109  DG  P "O4'" 1 
ATOM   7382 C  "C3'" . DG  B 2 8   ? -16.511 0.342   -27.046 1.00 48.31  ? 109  DG  P "C3'" 1 
ATOM   7383 O  "O3'" . DG  B 2 8   ? -16.346 -0.402  -25.842 1.00 46.71  ? 109  DG  P "O3'" 1 
ATOM   7384 C  "C2'" . DG  B 2 8   ? -16.333 -0.517  -28.296 1.00 44.48  ? 109  DG  P "C2'" 1 
ATOM   7385 C  "C1'" . DG  B 2 8   ? -17.724 -1.114  -28.481 1.00 45.10  ? 109  DG  P "C1'" 1 
ATOM   7386 N  N9    . DG  B 2 8   ? -18.091 -1.398  -29.870 1.00 45.14  ? 109  DG  P N9    1 
ATOM   7387 C  C8    . DG  B 2 8   ? -17.938 -0.573  -30.959 1.00 46.13  ? 109  DG  P C8    1 
ATOM   7388 N  N7    . DG  B 2 8   ? -18.370 -1.096  -32.074 1.00 46.22  ? 109  DG  P N7    1 
ATOM   7389 C  C5    . DG  B 2 8   ? -18.834 -2.354  -31.708 1.00 42.15  ? 109  DG  P C5    1 
ATOM   7390 C  C6    . DG  B 2 8   ? -19.410 -3.382  -32.494 1.00 41.54  ? 109  DG  P C6    1 
ATOM   7391 O  O6    . DG  B 2 8   ? -19.636 -3.385  -33.713 1.00 40.14  ? 109  DG  P O6    1 
ATOM   7392 N  N1    . DG  B 2 8   ? -19.744 -4.495  -31.725 1.00 39.16  ? 109  DG  P N1    1 
ATOM   7393 C  C2    . DG  B 2 8   ? -19.538 -4.600  -30.368 1.00 39.82  ? 109  DG  P C2    1 
ATOM   7394 N  N2    . DG  B 2 8   ? -19.918 -5.751  -29.792 1.00 36.62  ? 109  DG  P N2    1 
ATOM   7395 N  N3    . DG  B 2 8   ? -18.998 -3.645  -29.623 1.00 40.51  ? 109  DG  P N3    1 
ATOM   7396 C  C4    . DG  B 2 8   ? -18.671 -2.553  -30.355 1.00 42.23  ? 109  DG  P C4    1 
ATOM   7397 P  P     . DC  B 2 9   ? -14.916 -1.024  -25.454 1.00 48.43  ? 110  DC  P P     1 
ATOM   7398 O  OP1   . DC  B 2 9   ? -14.900 -1.203  -23.986 1.00 50.59  ? 110  DC  P OP1   1 
ATOM   7399 O  OP2   . DC  B 2 9   ? -13.856 -0.232  -26.119 1.00 50.86  ? 110  DC  P OP2   1 
ATOM   7400 O  "O5'" . DC  B 2 9   ? -14.943 -2.468  -26.128 1.00 46.08  ? 110  DC  P "O5'" 1 
ATOM   7401 C  "C5'" . DC  B 2 9   ? -15.984 -3.356  -25.771 1.00 40.03  ? 110  DC  P "C5'" 1 
ATOM   7402 C  "C4'" . DC  B 2 9   ? -15.803 -4.671  -26.502 1.00 42.77  ? 110  DC  P "C4'" 1 
ATOM   7403 O  "O4'" . DC  B 2 9   ? -16.226 -4.519  -27.874 1.00 45.49  ? 110  DC  P "O4'" 1 
ATOM   7404 C  "C3'" . DC  B 2 9   ? -14.368 -5.189  -26.555 1.00 42.90  ? 110  DC  P "C3'" 1 
ATOM   7405 O  "O3'" . DC  B 2 9   ? -14.355 -6.404  -25.816 1.00 42.13  ? 110  DC  P "O3'" 1 
ATOM   7406 C  "C2'" . DC  B 2 9   ? -14.076 -5.390  -28.046 1.00 42.88  ? 110  DC  P "C2'" 1 
ATOM   7407 C  "C1'" . DC  B 2 9   ? -15.467 -5.396  -28.671 1.00 42.93  ? 110  DC  P "C1'" 1 
ATOM   7408 N  N1    . DC  B 2 9   ? -15.589 -4.877  -30.070 1.00 43.92  ? 110  DC  P N1    1 
ATOM   7409 C  C2    . DC  B 2 9   ? -16.182 -5.680  -31.050 1.00 41.25  ? 110  DC  P C2    1 
ATOM   7410 O  O2    . DC  B 2 9   ? -16.572 -6.816  -30.742 1.00 41.45  ? 110  DC  P O2    1 
ATOM   7411 N  N3    . DC  B 2 9   ? -16.309 -5.195  -32.311 1.00 40.01  ? 110  DC  P N3    1 
ATOM   7412 C  C4    . DC  B 2 9   ? -15.875 -3.968  -32.602 1.00 42.39  ? 110  DC  P C4    1 
ATOM   7413 N  N4    . DC  B 2 9   ? -16.019 -3.543  -33.860 1.00 41.53  ? 110  DC  P N4    1 
ATOM   7414 C  C5    . DC  B 2 9   ? -15.274 -3.128  -31.616 1.00 41.96  ? 110  DC  P C5    1 
ATOM   7415 C  C6    . DC  B 2 9   ? -15.159 -3.617  -30.374 1.00 43.82  ? 110  DC  P C6    1 
ATOM   7416 P  P     . DT  B 2 10  ? -12.988 -7.210  -25.587 1.00 34.15  ? 111  DT  P P     1 
ATOM   7417 O  OP1   . DT  B 2 10  ? -13.135 -7.964  -24.319 1.00 33.49  ? 111  DT  P OP1   1 
ATOM   7418 O  OP2   . DT  B 2 10  ? -11.841 -6.289  -25.760 1.00 33.92  ? 111  DT  P OP2   1 
ATOM   7419 O  "O5'" . DT  B 2 10  ? -12.941 -8.228  -26.821 1.00 31.65  ? 111  DT  P "O5'" 1 
ATOM   7420 C  "C5'" . DT  B 2 10  ? -13.991 -9.163  -27.026 1.00 30.41  ? 111  DT  P "C5'" 1 
ATOM   7421 C  "C4'" . DT  B 2 10  ? -13.871 -9.800  -28.399 1.00 29.80  ? 111  DT  P "C4'" 1 
ATOM   7422 O  "O4'" . DT  B 2 10  ? -14.141 -8.819  -29.428 1.00 30.53  ? 111  DT  P "O4'" 1 
ATOM   7423 C  "C3'" . DT  B 2 10  ? -12.494 -10.370 -28.732 1.00 30.24  ? 111  DT  P "C3'" 1 
ATOM   7424 O  "O3'" . DT  B 2 10  ? -12.581 -11.784 -28.701 1.00 29.12  ? 111  DT  P "O3'" 1 
ATOM   7425 C  "C2'" . DT  B 2 10  ? -12.183 -9.868  -30.145 1.00 27.55  ? 111  DT  P "C2'" 1 
ATOM   7426 C  "C1'" . DT  B 2 10  ? -13.509 -9.269  -30.605 1.00 30.83  ? 111  DT  P "C1'" 1 
ATOM   7427 N  N1    . DT  B 2 10  ? -13.378 -8.115  -31.553 1.00 31.29  ? 111  DT  P N1    1 
ATOM   7428 C  C2    . DT  B 2 10  ? -13.884 -8.239  -32.828 1.00 32.08  ? 111  DT  P C2    1 
ATOM   7429 O  O2    . DT  B 2 10  ? -14.436 -9.245  -33.238 1.00 31.62  ? 111  DT  P O2    1 
ATOM   7430 N  N3    . DT  B 2 10  ? -13.723 -7.136  -33.624 1.00 33.83  ? 111  DT  P N3    1 
ATOM   7431 C  C4    . DT  B 2 10  ? -13.122 -5.943  -33.277 1.00 32.36  ? 111  DT  P C4    1 
ATOM   7432 O  O4    . DT  B 2 10  ? -13.029 -5.013  -34.069 1.00 32.74  ? 111  DT  P O4    1 
ATOM   7433 C  C5    . DT  B 2 10  ? -12.609 -5.876  -31.930 1.00 31.97  ? 111  DT  P C5    1 
ATOM   7434 C  C7    . DT  B 2 10  ? -11.924 -4.628  -31.445 1.00 27.61  ? 111  DT  P C7    1 
ATOM   7435 C  C6    . DT  B 2 10  ? -12.761 -6.951  -31.141 1.00 30.90  ? 111  DT  P C6    1 
ATOM   7436 P  P     . DT  B 2 11  ? -11.259 -12.686 -28.834 1.00 31.03  ? 112  DT  P P     1 
ATOM   7437 O  OP1   . DT  B 2 11  ? -11.560 -13.975 -28.177 1.00 34.54  ? 112  DT  P OP1   1 
ATOM   7438 O  OP2   . DT  B 2 11  ? -10.085 -11.892 -28.415 1.00 30.96  ? 112  DT  P OP2   1 
ATOM   7439 O  "O5'" . DT  B 2 11  ? -11.128 -12.934 -30.405 1.00 31.59  ? 112  DT  P "O5'" 1 
ATOM   7440 C  "C5'" . DT  B 2 11  ? -12.233 -13.446 -31.120 1.00 29.09  ? 112  DT  P "C5'" 1 
ATOM   7441 C  "C4'" . DT  B 2 11  ? -11.930 -13.420 -32.602 1.00 30.54  ? 112  DT  P "C4'" 1 
ATOM   7442 O  "O4'" . DT  B 2 11  ? -12.103 -12.069 -33.104 1.00 33.24  ? 112  DT  P "O4'" 1 
ATOM   7443 C  "C3'" . DT  B 2 11  ? -10.509 -13.847 -32.966 1.00 30.43  ? 112  DT  P "C3'" 1 
ATOM   7444 O  "O3'" . DT  B 2 11  ? -10.585 -14.815 -33.990 1.00 29.80  ? 112  DT  P "O3'" 1 
ATOM   7445 C  "C2'" . DT  B 2 11  ? -9.865  -12.562 -33.475 1.00 30.55  ? 112  DT  P "C2'" 1 
ATOM   7446 C  "C1'" . DT  B 2 11  ? -11.076 -11.829 -34.036 1.00 31.63  ? 112  DT  P "C1'" 1 
ATOM   7447 N  N1    . DT  B 2 11  ? -10.826 -10.373 -34.181 1.00 30.49  ? 112  DT  P N1    1 
ATOM   7448 C  C2    . DT  B 2 11  ? -11.278 -9.733  -35.315 1.00 28.64  ? 112  DT  P C2    1 
ATOM   7449 O  O2    . DT  B 2 11  ? -11.888 -10.302 -36.204 1.00 26.83  ? 112  DT  P O2    1 
ATOM   7450 N  N3    . DT  B 2 11  ? -10.987 -8.396  -35.369 1.00 25.07  ? 112  DT  P N3    1 
ATOM   7451 C  C4    . DT  B 2 11  ? -10.302 -7.658  -34.421 1.00 28.64  ? 112  DT  P C4    1 
ATOM   7452 O  O4    . DT  B 2 11  ? -10.085 -6.463  -34.558 1.00 30.39  ? 112  DT  P O4    1 
ATOM   7453 C  C5    . DT  B 2 11  ? -9.850  -8.386  -33.261 1.00 33.33  ? 112  DT  P C5    1 
ATOM   7454 C  C7    . DT  B 2 11  ? -9.091  -7.674  -32.176 1.00 30.09  ? 112  DT  P C7    1 
ATOM   7455 C  C6    . DT  B 2 11  ? -10.128 -9.698  -33.199 1.00 31.34  ? 112  DT  P C6    1 
ATOM   7456 P  P     . DA  B 2 12  ? -9.308  -15.711 -34.373 1.00 29.68  ? 113  DA  P P     1 
ATOM   7457 O  OP1   . DA  B 2 12  ? -9.335  -16.922 -33.532 1.00 29.26  ? 113  DA  P OP1   1 
ATOM   7458 O  OP2   . DA  B 2 12  ? -8.089  -14.879 -34.370 1.00 30.79  ? 113  DA  P OP2   1 
ATOM   7459 O  "O5'" . DA  B 2 12  ? -9.613  -16.156 -35.870 1.00 39.02  ? 113  DA  P "O5'" 1 
ATOM   7460 C  "C5'" . DA  B 2 12  ? -8.991  -15.469 -36.927 1.00 37.95  ? 113  DA  P "C5'" 1 
ATOM   7461 C  "C4'" . DA  B 2 12  ? -10.027 -14.903 -37.869 1.00 35.47  ? 113  DA  P "C4'" 1 
ATOM   7462 O  "O4'" . DA  B 2 12  ? -10.490 -13.632 -37.365 1.00 34.90  ? 113  DA  P "O4'" 1 
ATOM   7463 C  "C3'" . DA  B 2 12  ? -9.453  -14.626 -39.243 1.00 37.23  ? 113  DA  P "C3'" 1 
ATOM   7464 O  "O3'" . DA  B 2 12  ? -9.790  -15.694 -40.093 1.00 29.37  ? 113  DA  P "O3'" 1 
ATOM   7465 C  "C2'" . DA  B 2 12  ? -10.095 -13.325 -39.706 1.00 36.51  ? 113  DA  P "C2'" 1 
ATOM   7466 C  "C1'" . DA  B 2 12  ? -10.468 -12.658 -38.393 1.00 35.46  ? 113  DA  P "C1'" 1 
ATOM   7467 N  N9    . DA  B 2 12  ? -9.619  -11.545 -37.976 1.00 33.32  ? 113  DA  P N9    1 
ATOM   7468 C  C8    . DA  B 2 12  ? -8.941  -11.428 -36.795 1.00 30.98  ? 113  DA  P C8    1 
ATOM   7469 N  N7    . DA  B 2 12  ? -8.284  -10.300 -36.673 1.00 32.79  ? 113  DA  P N7    1 
ATOM   7470 C  C5    . DA  B 2 12  ? -8.555  -9.628  -37.856 1.00 31.39  ? 113  DA  P C5    1 
ATOM   7471 C  C6    . DA  B 2 12  ? -8.159  -8.373  -38.350 1.00 26.58  ? 113  DA  P C6    1 
ATOM   7472 N  N6    . DA  B 2 12  ? -7.365  -7.528  -37.688 1.00 27.12  ? 113  DA  P N6    1 
ATOM   7473 N  N1    . DA  B 2 12  ? -8.607  -8.014  -39.569 1.00 29.68  ? 113  DA  P N1    1 
ATOM   7474 C  C2    . DA  B 2 12  ? -9.397  -8.851  -40.247 1.00 25.83  ? 113  DA  P C2    1 
ATOM   7475 N  N3    . DA  B 2 12  ? -9.842  -10.048 -39.884 1.00 26.60  ? 113  DA  P N3    1 
ATOM   7476 C  C4    . DA  B 2 12  ? -9.380  -10.382 -38.669 1.00 29.68  ? 113  DA  P C4    1 
ATOM   7477 P  P     . DC  B 2 13  ? -8.696  -16.245 -41.117 1.00 31.66  ? 114  DC  P P     1 
ATOM   7478 O  OP1   . DC  B 2 13  ? -9.308  -17.367 -41.865 1.00 34.05  ? 114  DC  P OP1   1 
ATOM   7479 O  OP2   . DC  B 2 13  ? -7.449  -16.452 -40.354 1.00 37.20  ? 114  DC  P OP2   1 
ATOM   7480 O  "O5'" . DC  B 2 13  ? -8.458  -15.018 -42.110 1.00 31.18  ? 114  DC  P "O5'" 1 
ATOM   7481 C  "C5'" . DC  B 2 13  ? -9.536  -14.532 -42.896 1.00 31.56  ? 114  DC  P "C5'" 1 
ATOM   7482 C  "C4'" . DC  B 2 13  ? -9.019  -13.416 -43.782 1.00 32.80  ? 114  DC  P "C4'" 1 
ATOM   7483 O  "O4'" . DC  B 2 13  ? -8.721  -12.256 -42.958 1.00 31.86  ? 114  DC  P "O4'" 1 
ATOM   7484 C  "C3'" . DC  B 2 13  ? -7.730  -13.783 -44.510 1.00 35.48  ? 114  DC  P "C3'" 1 
ATOM   7485 O  "O3'" . DC  B 2 13  ? -7.938  -13.604 -45.901 1.00 40.81  ? 114  DC  P "O3'" 1 
ATOM   7486 C  "C2'" . DC  B 2 13  ? -6.690  -12.807 -43.965 1.00 33.31  ? 114  DC  P "C2'" 1 
ATOM   7487 C  "C1'" . DC  B 2 13  ? -7.527  -11.664 -43.414 1.00 28.90  ? 114  DC  P "C1'" 1 
ATOM   7488 N  N1    . DC  B 2 13  ? -6.867  -10.981 -42.264 1.00 26.10  ? 114  DC  P N1    1 
ATOM   7489 C  C2    . DC  B 2 13  ? -6.504  -9.636  -42.366 1.00 25.31  ? 114  DC  P C2    1 
ATOM   7490 O  O2    . DC  B 2 13  ? -6.739  -9.014  -43.415 1.00 28.13  ? 114  DC  P O2    1 
ATOM   7491 N  N3    . DC  B 2 13  ? -5.901  -9.043  -41.308 1.00 26.77  ? 114  DC  P N3    1 
ATOM   7492 C  C4    . DC  B 2 13  ? -5.664  -9.731  -40.194 1.00 27.80  ? 114  DC  P C4    1 
ATOM   7493 N  N4    . DC  B 2 13  ? -5.070  -9.078  -39.192 1.00 25.07  ? 114  DC  P N4    1 
ATOM   7494 C  C5    . DC  B 2 13  ? -6.025  -11.108 -40.067 1.00 28.69  ? 114  DC  P C5    1 
ATOM   7495 C  C6    . DC  B 2 13  ? -6.618  -11.685 -41.121 1.00 28.29  ? 114  DC  P C6    1 
ATOM   7496 P  P     . DC  B 2 14  ? -6.869  -14.155 -46.964 1.00 46.61  ? 115  DC  P P     1 
ATOM   7497 O  OP1   . DC  B 2 14  ? -7.557  -14.190 -48.275 1.00 41.07  ? 115  DC  P OP1   1 
ATOM   7498 O  OP2   . DC  B 2 14  ? -6.230  -15.369 -46.418 1.00 46.09  ? 115  DC  P OP2   1 
ATOM   7499 O  "O5'" . DC  B 2 14  ? -5.711  -13.044 -46.964 1.00 41.14  ? 115  DC  P "O5'" 1 
ATOM   7500 C  "C5'" . DC  B 2 14  ? -5.761  -11.986 -47.882 1.00 35.60  ? 115  DC  P "C5'" 1 
ATOM   7501 C  "C4'" . DC  B 2 14  ? -4.930  -10.791 -47.444 1.00 33.52  ? 115  DC  P "C4'" 1 
ATOM   7502 O  "O4'" . DC  B 2 14  ? -5.010  -10.545 -46.023 1.00 27.11  ? 115  DC  P "O4'" 1 
ATOM   7503 C  "C3'" . DC  B 2 14  ? -3.425  -10.869 -47.666 1.00 32.05  ? 115  DC  P "C3'" 1 
ATOM   7504 C  "C2'" . DC  B 2 14  ? -2.977  -9.643  -46.865 1.00 29.12  ? 115  DC  P "C2'" 1 
ATOM   7505 C  "C1'" . DC  B 2 14  ? -4.057  -9.525  -45.781 1.00 27.94  ? 115  DC  P "C1'" 1 
ATOM   7506 N  N1    . DC  B 2 14  ? -3.525  -9.654  -44.387 1.00 27.21  ? 115  DC  P N1    1 
ATOM   7507 C  C2    . DC  B 2 14  ? -2.955  -8.527  -43.785 1.00 26.31  ? 115  DC  P C2    1 
ATOM   7508 O  O2    . DC  B 2 14  ? -2.906  -7.470  -44.428 1.00 26.20  ? 115  DC  P O2    1 
ATOM   7509 N  N3    . DC  B 2 14  ? -2.469  -8.626  -42.521 1.00 25.68  ? 115  DC  P N3    1 
ATOM   7510 C  C4    . DC  B 2 14  ? -2.543  -9.792  -41.871 1.00 27.03  ? 115  DC  P C4    1 
ATOM   7511 N  N4    . DC  B 2 14  ? -2.049  -9.842  -40.628 1.00 24.37  ? 115  DC  P N4    1 
ATOM   7512 C  C5    . DC  B 2 14  ? -3.120  -10.958 -42.468 1.00 25.00  ? 115  DC  P C5    1 
ATOM   7513 C  C6    . DC  B 2 14  ? -3.595  -10.842 -43.717 1.00 25.59  ? 115  DC  P C6    1 
ATOM   7514 C  "C4'" . DA  C 3 1   ? 4.151   3.850   -26.831 0.50 77.87  ? 1    DA  T "C4'" 1 
ATOM   7515 O  "O4'" . DA  C 3 1   ? 5.478   4.414   -26.701 0.50 78.11  ? 1    DA  T "O4'" 1 
ATOM   7516 C  "C3'" . DA  C 3 1   ? 4.342   2.335   -26.891 1.00 78.12  ? 1    DA  T "C3'" 1 
ATOM   7517 O  "O3'" . DA  C 3 1   ? 3.713   1.794   -28.050 1.00 78.01  ? 1    DA  T "O3'" 1 
ATOM   7518 C  "C2'" . DA  C 3 1   ? 5.856   2.127   -26.940 1.00 77.04  ? 1    DA  T "C2'" 1 
ATOM   7519 C  "C1'" . DA  C 3 1   ? 6.382   3.512   -27.295 1.00 76.12  ? 1    DA  T "C1'" 1 
ATOM   7520 N  N9    . DA  C 3 1   ? 7.731   3.774   -26.800 1.00 73.58  ? 1    DA  T N9    1 
ATOM   7521 C  C8    . DA  C 3 1   ? 8.808   4.168   -27.543 1.00 71.45  ? 1    DA  T C8    1 
ATOM   7522 N  N7    . DA  C 3 1   ? 9.904   4.331   -26.844 0.50 72.31  ? 1    DA  T N7    1 
ATOM   7523 C  C5    . DA  C 3 1   ? 9.520   4.019   -25.551 0.50 73.50  ? 1    DA  T C5    1 
ATOM   7524 C  C6    . DA  C 3 1   ? 10.229  3.997   -24.335 0.50 75.26  ? 1    DA  T C6    1 
ATOM   7525 N  N6    . DA  C 3 1   ? 11.527  4.308   -24.239 1.00 77.58  ? 1    DA  T N6    1 
ATOM   7526 N  N1    . DA  C 3 1   ? 9.552   3.642   -23.223 1.00 75.02  ? 1    DA  T N1    1 
ATOM   7527 C  C2    . DA  C 3 1   ? 8.254   3.331   -23.329 1.00 74.00  ? 1    DA  T C2    1 
ATOM   7528 N  N3    . DA  C 3 1   ? 7.483   3.316   -24.414 0.50 72.52  ? 1    DA  T N3    1 
ATOM   7529 C  C4    . DA  C 3 1   ? 8.183   3.673   -25.503 0.50 73.09  ? 1    DA  T C4    1 
ATOM   7530 P  P     . DC  C 3 2   ? 3.702   0.204   -28.297 1.00 101.21 ? 2    DC  T P     1 
ATOM   7531 O  OP1   . DC  C 3 2   ? 2.519   -0.113  -29.127 0.50 98.99  ? 2    DC  T OP1   1 
ATOM   7532 O  OP2   . DC  C 3 2   ? 3.882   -0.463  -26.988 0.50 101.42 ? 2    DC  T OP2   1 
ATOM   7533 O  "O5'" . DC  C 3 2   ? 5.022   -0.059  -29.162 1.00 66.03  ? 2    DC  T "O5'" 1 
ATOM   7534 C  "C5'" . DC  C 3 2   ? 5.276   0.712   -30.331 1.00 61.38  ? 2    DC  T "C5'" 1 
ATOM   7535 C  "C4'" . DC  C 3 2   ? 6.733   0.591   -30.733 1.00 57.12  ? 2    DC  T "C4'" 1 
ATOM   7536 O  "O4'" . DC  C 3 2   ? 7.568   1.247   -29.751 1.00 57.66  ? 2    DC  T "O4'" 1 
ATOM   7537 C  "C3'" . DC  C 3 2   ? 7.266   -0.837  -30.773 1.00 50.79  ? 2    DC  T "C3'" 1 
ATOM   7538 O  "O3'" . DC  C 3 2   ? 7.197   -1.343  -32.090 1.00 40.80  ? 2    DC  T "O3'" 1 
ATOM   7539 C  "C2'" . DC  C 3 2   ? 8.724   -0.712  -30.331 1.00 53.14  ? 2    DC  T "C2'" 1 
ATOM   7540 C  "C1'" . DC  C 3 2   ? 8.875   0.759   -29.959 1.00 58.22  ? 2    DC  T "C1'" 1 
ATOM   7541 N  N1    . DC  C 3 2   ? 9.699   0.941   -28.733 1.00 64.74  ? 2    DC  T N1    1 
ATOM   7542 C  C2    . DC  C 3 2   ? 10.795  1.809   -28.769 1.00 68.52  ? 2    DC  T C2    1 
ATOM   7543 O  O2    . DC  C 3 2   ? 11.048  2.420   -29.816 0.50 67.56  ? 2    DC  T O2    1 
ATOM   7544 N  N3    . DC  C 3 2   ? 11.545  1.959   -27.648 1.00 72.26  ? 2    DC  T N3    1 
ATOM   7545 C  C4    . DC  C 3 2   ? 11.237  1.282   -26.541 1.00 71.16  ? 2    DC  T C4    1 
ATOM   7546 N  N4    . DC  C 3 2   ? 12.007  1.466   -25.464 0.50 73.52  ? 2    DC  T N4    1 
ATOM   7547 C  C5    . DC  C 3 2   ? 10.127  0.389   -26.488 0.50 67.26  ? 2    DC  T C5    1 
ATOM   7548 C  C6    . DC  C 3 2   ? 9.395   0.248   -27.597 0.50 65.08  ? 2    DC  T C6    1 
ATOM   7549 P  P     . A   C 3 3   ? 7.512   -2.890  -32.377 1.00 29.77  ? 3    A   T P     1 
ATOM   7550 O  OP1   . A   C 3 3   ? 6.709   -3.720  -31.440 1.00 32.13  ? 3    A   T OP1   1 
ATOM   7551 O  OP2   . A   C 3 3   ? 8.983   -3.075  -32.449 1.00 29.19  ? 3    A   T OP2   1 
ATOM   7552 O  "O5'" . A   C 3 3   ? 6.905   -3.136  -33.823 1.00 34.44  ? 3    A   T "O5'" 1 
ATOM   7553 C  "C5'" . A   C 3 3   ? 5.522   -2.936  -34.078 1.00 28.17  ? 3    A   T "C5'" 1 
ATOM   7554 C  "C4'" . A   C 3 3   ? 5.318   -2.452  -35.486 1.00 26.23  ? 3    A   T "C4'" 1 
ATOM   7555 O  "O4'" . A   C 3 3   ? 5.897   -3.400  -36.423 1.00 26.64  ? 3    A   T "O4'" 1 
ATOM   7556 C  "C3'" . A   C 3 3   ? 3.884   -2.296  -35.960 1.00 26.87  ? 3    A   T "C3'" 1 
ATOM   7557 O  "O3'" . A   C 3 3   ? 3.301   -1.088  -35.507 1.00 28.41  ? 3    A   T "O3'" 1 
ATOM   7558 C  "C2'" . A   C 3 3   ? 4.058   -2.351  -37.466 1.00 25.19  ? 3    A   T "C2'" 1 
ATOM   7559 O  "O2'" . A   C 3 3   ? 4.651   -1.146  -37.909 1.00 27.59  ? 3    A   T "O2'" 1 
ATOM   7560 C  "C1'" . A   C 3 3   ? 5.108   -3.452  -37.590 1.00 26.81  ? 3    A   T "C1'" 1 
ATOM   7561 N  N9    . A   C 3 3   ? 4.485   -4.784  -37.672 1.00 25.63  ? 3    A   T N9    1 
ATOM   7562 C  C8    . A   C 3 3   ? 4.414   -5.739  -36.689 1.00 25.01  ? 3    A   T C8    1 
ATOM   7563 N  N7    . A   C 3 3   ? 3.774   -6.819  -37.058 1.00 27.81  ? 3    A   T N7    1 
ATOM   7564 C  C5    . A   C 3 3   ? 3.397   -6.558  -38.368 1.00 27.45  ? 3    A   T C5    1 
ATOM   7565 C  C6    . A   C 3 3   ? 2.691   -7.317  -39.316 1.00 27.41  ? 3    A   T C6    1 
ATOM   7566 N  N6    . A   C 3 3   ? 2.220   -8.541  -39.071 1.00 23.06  ? 3    A   T N6    1 
ATOM   7567 N  N1    . A   C 3 3   ? 2.482   -6.767  -40.535 1.00 24.52  ? 3    A   T N1    1 
ATOM   7568 C  C2    . A   C 3 3   ? 2.957   -5.536  -40.772 1.00 26.05  ? 3    A   T C2    1 
ATOM   7569 N  N3    . A   C 3 3   ? 3.634   -4.727  -39.960 1.00 25.70  ? 3    A   T N3    1 
ATOM   7570 C  C4    . A   C 3 3   ? 3.824   -5.305  -38.760 1.00 26.45  ? 3    A   T C4    1 
ATOM   7571 P  P     . DG  C 3 4   ? 1.706   -0.902  -35.439 1.00 29.28  ? 4    DG  T P     1 
ATOM   7572 O  OP1   . DG  C 3 4   ? 1.479   0.405   -34.781 1.00 34.37  ? 4    DG  T OP1   1 
ATOM   7573 O  OP2   . DG  C 3 4   ? 1.096   -2.135  -34.900 1.00 35.78  ? 4    DG  T OP2   1 
ATOM   7574 O  "O5'" . DG  C 3 4   ? 1.252   -0.785  -36.966 1.00 27.60  ? 4    DG  T "O5'" 1 
ATOM   7575 C  "C5'" . DG  C 3 4   ? 1.633   0.344   -37.744 1.00 26.24  ? 4    DG  T "C5'" 1 
ATOM   7576 C  "C4'" . DG  C 3 4   ? 1.258   0.131   -39.201 1.00 28.51  ? 4    DG  T "C4'" 1 
ATOM   7577 O  "O4'" . DG  C 3 4   ? 1.805   -1.119  -39.691 1.00 28.37  ? 4    DG  T "O4'" 1 
ATOM   7578 C  "C3'" . DG  C 3 4   ? -0.238  0.025   -39.454 1.00 24.37  ? 4    DG  T "C3'" 1 
ATOM   7579 O  "O3'" . DG  C 3 4   ? -0.783  1.336   -39.594 1.00 25.19  ? 4    DG  T "O3'" 1 
ATOM   7580 C  "C2'" . DG  C 3 4   ? -0.276  -0.753  -40.761 1.00 23.47  ? 4    DG  T "C2'" 1 
ATOM   7581 C  "C1'" . DG  C 3 4   ? 0.888   -1.718  -40.590 1.00 26.97  ? 4    DG  T "C1'" 1 
ATOM   7582 N  N9    . DG  C 3 4   ? 0.491   -3.017  -40.055 1.00 27.71  ? 4    DG  T N9    1 
ATOM   7583 C  C8    . DG  C 3 4   ? 0.674   -3.475  -38.773 1.00 26.93  ? 4    DG  T C8    1 
ATOM   7584 N  N7    . DG  C 3 4   ? 0.216   -4.683  -38.587 1.00 27.88  ? 4    DG  T N7    1 
ATOM   7585 C  C5    . DG  C 3 4   ? -0.298  -5.051  -39.823 1.00 28.52  ? 4    DG  T C5    1 
ATOM   7586 C  C6    . DG  C 3 4   ? -0.924  -6.255  -40.232 1.00 27.04  ? 4    DG  T C6    1 
ATOM   7587 O  O6    . DG  C 3 4   ? -1.144  -7.266  -39.554 1.00 24.55  ? 4    DG  T O6    1 
ATOM   7588 N  N1    . DG  C 3 4   ? -1.304  -6.217  -41.572 1.00 23.76  ? 4    DG  T N1    1 
ATOM   7589 C  C2    . DG  C 3 4   ? -1.098  -5.142  -42.405 1.00 26.18  ? 4    DG  T C2    1 
ATOM   7590 N  N2    . DG  C 3 4   ? -1.529  -5.270  -43.667 1.00 25.69  ? 4    DG  T N2    1 
ATOM   7591 N  N3    . DG  C 3 4   ? -0.510  -4.012  -42.034 1.00 27.67  ? 4    DG  T N3    1 
ATOM   7592 C  C4    . DG  C 3 4   ? -0.138  -4.035  -40.735 1.00 27.09  ? 4    DG  T C4    1 
ATOM   7593 P  P     . DG  C 3 5   ? -2.372  1.551   -39.588 1.00 29.39  ? 5    DG  T P     1 
ATOM   7594 O  OP1   . DG  C 3 5   ? -2.620  3.013   -39.681 1.00 31.01  ? 5    DG  T OP1   1 
ATOM   7595 O  OP2   . DG  C 3 5   ? -2.918  0.757   -38.467 1.00 32.43  ? 5    DG  T OP2   1 
ATOM   7596 O  "O5'" . DG  C 3 5   ? -2.872  0.855   -40.936 1.00 27.76  ? 5    DG  T "O5'" 1 
ATOM   7597 C  "C5'" . DG  C 3 5   ? -2.705  1.471   -42.198 1.00 24.42  ? 5    DG  T "C5'" 1 
ATOM   7598 C  "C4'" . DG  C 3 5   ? -3.552  0.752   -43.232 1.00 24.07  ? 5    DG  T "C4'" 1 
ATOM   7599 O  "O4'" . DG  C 3 5   ? -3.333  -0.676  -43.117 1.00 27.76  ? 5    DG  T "O4'" 1 
ATOM   7600 C  "C3'" . DG  C 3 5   ? -5.061  0.947   -43.116 1.00 27.31  ? 5    DG  T "C3'" 1 
ATOM   7601 O  "O3'" . DG  C 3 5   ? -5.593  0.857   -44.423 1.00 25.27  ? 5    DG  T "O3'" 1 
ATOM   7602 C  "C2'" . DG  C 3 5   ? -5.484  -0.248  -42.272 1.00 26.41  ? 5    DG  T "C2'" 1 
ATOM   7603 C  "C1'" . DG  C 3 5   ? -4.545  -1.325  -42.800 1.00 25.62  ? 5    DG  T "C1'" 1 
ATOM   7604 N  N9    . DG  C 3 5   ? -4.313  -2.372  -41.812 1.00 27.46  ? 5    DG  T N9    1 
ATOM   7605 C  C8    . DG  C 3 5   ? -3.746  -2.230  -40.564 1.00 29.71  ? 5    DG  T C8    1 
ATOM   7606 N  N7    . DG  C 3 5   ? -3.687  -3.351  -39.894 1.00 25.55  ? 5    DG  T N7    1 
ATOM   7607 C  C5    . DG  C 3 5   ? -4.253  -4.293  -40.747 1.00 24.91  ? 5    DG  T C5    1 
ATOM   7608 C  C6    . DG  C 3 5   ? -4.470  -5.683  -40.566 1.00 26.87  ? 5    DG  T C6    1 
ATOM   7609 O  O6    . DG  C 3 5   ? -4.187  -6.379  -39.583 1.00 30.59  ? 5    DG  T O6    1 
ATOM   7610 N  N1    . DG  C 3 5   ? -5.071  -6.269  -41.676 1.00 26.83  ? 5    DG  T N1    1 
ATOM   7611 C  C2    . DG  C 3 5   ? -5.426  -5.588  -42.819 1.00 30.36  ? 5    DG  T C2    1 
ATOM   7612 N  N2    . DG  C 3 5   ? -6.001  -6.312  -43.791 1.00 29.85  ? 5    DG  T N2    1 
ATOM   7613 N  N3    . DG  C 3 5   ? -5.234  -4.287  -42.998 1.00 26.83  ? 5    DG  T N3    1 
ATOM   7614 C  C4    . DG  C 3 5   ? -4.646  -3.704  -41.928 1.00 24.56  ? 5    DG  T C4    1 
ATOM   7615 P  P     . DT  C 3 6   ? -7.166  1.028   -44.696 1.00 28.53  ? 6    DT  T P     1 
ATOM   7616 O  OP1   . DT  C 3 6   ? -7.257  1.579   -46.067 1.00 30.15  ? 6    DT  T OP1   1 
ATOM   7617 O  OP2   . DT  C 3 6   ? -7.805  1.705   -43.555 1.00 27.28  ? 6    DT  T OP2   1 
ATOM   7618 O  "O5'" . DT  C 3 6   ? -7.724  -0.472  -44.718 1.00 30.59  ? 6    DT  T "O5'" 1 
ATOM   7619 C  "C5'" . DT  C 3 6   ? -7.368  -1.337  -45.784 1.00 26.40  ? 6    DT  T "C5'" 1 
ATOM   7620 C  "C4'" . DT  C 3 6   ? -8.271  -2.560  -45.815 1.00 25.56  ? 6    DT  T "C4'" 1 
ATOM   7621 O  "O4'" . DT  C 3 6   ? -7.936  -3.482  -44.739 1.00 26.95  ? 6    DT  T "O4'" 1 
ATOM   7622 C  "C3'" . DT  C 3 6   ? -9.757  -2.252  -45.676 1.00 27.56  ? 6    DT  T "C3'" 1 
ATOM   7623 O  "O3'" . DT  C 3 6   ? -10.448 -3.015  -46.663 1.00 30.68  ? 6    DT  T "O3'" 1 
ATOM   7624 C  "C2'" . DT  C 3 6   ? -10.080 -2.670  -44.240 1.00 26.11  ? 6    DT  T "C2'" 1 
ATOM   7625 C  "C1'" . DT  C 3 6   ? -9.101  -3.817  -44.011 1.00 27.70  ? 6    DT  T "C1'" 1 
ATOM   7626 N  N1    . DT  C 3 6   ? -8.696  -4.061  -42.581 1.00 27.33  ? 6    DT  T N1    1 
ATOM   7627 C  C2    . DT  C 3 6   ? -8.744  -5.345  -42.089 1.00 27.89  ? 6    DT  T C2    1 
ATOM   7628 O  O2    . DT  C 3 6   ? -9.106  -6.295  -42.749 1.00 26.12  ? 6    DT  T O2    1 
ATOM   7629 N  N3    . DT  C 3 6   ? -8.350  -5.484  -40.785 1.00 29.39  ? 6    DT  T N3    1 
ATOM   7630 C  C4    . DT  C 3 6   ? -7.919  -4.483  -39.940 1.00 26.44  ? 6    DT  T C4    1 
ATOM   7631 O  O4    . DT  C 3 6   ? -7.583  -4.704  -38.784 1.00 29.34  ? 6    DT  T O4    1 
ATOM   7632 C  C5    . DT  C 3 6   ? -7.890  -3.160  -40.509 1.00 27.84  ? 6    DT  T C5    1 
ATOM   7633 C  C7    . DT  C 3 6   ? -7.439  -1.997  -39.667 1.00 23.15  ? 6    DT  T C7    1 
ATOM   7634 C  C6    . DT  C 3 6   ? -8.273  -3.016  -41.786 1.00 26.21  ? 6    DT  T C6    1 
ATOM   7635 P  P     . DA  C 3 7   ? -12.037 -2.870  -46.850 1.00 30.55  ? 7    DA  T P     1 
ATOM   7636 O  OP1   . DA  C 3 7   ? -12.350 -3.394  -48.201 1.00 30.90  ? 7    DA  T OP1   1 
ATOM   7637 O  OP2   . DA  C 3 7   ? -12.460 -1.506  -46.475 1.00 29.53  ? 7    DA  T OP2   1 
ATOM   7638 O  "O5'" . DA  C 3 7   ? -12.637 -3.867  -45.761 1.00 30.21  ? 7    DA  T "O5'" 1 
ATOM   7639 C  "C5'" . DA  C 3 7   ? -12.434 -5.256  -45.945 1.00 30.47  ? 7    DA  T "C5'" 1 
ATOM   7640 C  "C4'" . DA  C 3 7   ? -13.105 -6.015  -44.825 1.00 32.13  ? 7    DA  T "C4'" 1 
ATOM   7641 O  "O4'" . DA  C 3 7   ? -12.264 -5.955  -43.644 1.00 31.41  ? 7    DA  T "O4'" 1 
ATOM   7642 C  "C3'" . DA  C 3 7   ? -14.480 -5.485  -44.420 1.00 35.60  ? 7    DA  T "C3'" 1 
ATOM   7643 O  "O3'" . DA  C 3 7   ? -15.383 -6.577  -44.481 1.00 36.43  ? 7    DA  T "O3'" 1 
ATOM   7644 C  "C2'" . DA  C 3 7   ? -14.273 -5.030  -42.978 1.00 34.48  ? 7    DA  T "C2'" 1 
ATOM   7645 C  "C1'" . DA  C 3 7   ? -13.132 -5.945  -42.539 1.00 31.08  ? 7    DA  T "C1'" 1 
ATOM   7646 N  N9    . DA  C 3 7   ? -12.454 -5.486  -41.329 1.00 29.10  ? 7    DA  T N9    1 
ATOM   7647 C  C8    . DA  C 3 7   ? -11.962 -4.234  -41.073 1.00 26.45  ? 7    DA  T C8    1 
ATOM   7648 N  N7    . DA  C 3 7   ? -11.425 -4.116  -39.880 1.00 27.80  ? 7    DA  T N7    1 
ATOM   7649 C  C5    . DA  C 3 7   ? -11.581 -5.379  -39.314 1.00 28.23  ? 7    DA  T C5    1 
ATOM   7650 C  C6    . DA  C 3 7   ? -11.226 -5.920  -38.059 1.00 29.70  ? 7    DA  T C6    1 
ATOM   7651 N  N6    . DA  C 3 7   ? -10.607 -5.219  -37.104 1.00 32.50  ? 7    DA  T N6    1 
ATOM   7652 N  N1    . DA  C 3 7   ? -11.528 -7.212  -37.814 1.00 28.51  ? 7    DA  T N1    1 
ATOM   7653 C  C2    . DA  C 3 7   ? -12.151 -7.916  -38.768 1.00 28.82  ? 7    DA  T C2    1 
ATOM   7654 N  N3    . DA  C 3 7   ? -12.528 -7.520  -39.983 1.00 27.40  ? 7    DA  T N3    1 
ATOM   7655 C  C4    . DA  C 3 7   ? -12.215 -6.231  -40.194 1.00 27.02  ? 7    DA  T C4    1 
ATOM   7656 P  P     . DA  C 3 8   ? -16.969 -6.352  -44.599 1.00 32.32  ? 8    DA  T P     1 
ATOM   7657 O  OP1   . DA  C 3 8   ? -17.304 -6.462  -46.037 1.00 34.37  ? 8    DA  T OP1   1 
ATOM   7658 O  OP2   . DA  C 3 8   ? -17.385 -5.154  -43.844 1.00 32.28  ? 8    DA  T OP2   1 
ATOM   7659 O  "O5'" . DA  C 3 8   ? -17.566 -7.631  -43.846 1.00 32.17  ? 8    DA  T "O5'" 1 
ATOM   7660 C  "C5'" . DA  C 3 8   ? -16.983 -8.906  -44.111 1.00 31.52  ? 8    DA  T "C5'" 1 
ATOM   7661 C  "C4'" . DA  C 3 8   ? -16.943 -9.737  -42.845 1.00 36.59  ? 8    DA  T "C4'" 1 
ATOM   7662 O  "O4'" . DA  C 3 8   ? -15.879 -9.252  -41.999 1.00 36.49  ? 8    DA  T "O4'" 1 
ATOM   7663 C  "C3'" . DA  C 3 8   ? -18.208 -9.635  -42.007 1.00 41.00  ? 8    DA  T "C3'" 1 
ATOM   7664 O  "O3'" . DA  C 3 8   ? -19.052 -10.721 -42.316 1.00 40.23  ? 8    DA  T "O3'" 1 
ATOM   7665 C  "C2'" . DA  C 3 8   ? -17.716 -9.752  -40.572 1.00 43.03  ? 8    DA  T "C2'" 1 
ATOM   7666 C  "C1'" . DA  C 3 8   ? -16.243 -9.392  -40.641 1.00 40.94  ? 8    DA  T "C1'" 1 
ATOM   7667 N  N9    . DA  C 3 8   ? -15.936 -8.155  -39.933 1.00 40.38  ? 8    DA  T N9    1 
ATOM   7668 C  C8    . DA  C 3 8   ? -16.023 -6.872  -40.402 1.00 35.43  ? 8    DA  T C8    1 
ATOM   7669 N  N7    . DA  C 3 8   ? -15.669 -5.973  -39.515 1.00 35.51  ? 8    DA  T N7    1 
ATOM   7670 C  C5    . DA  C 3 8   ? -15.331 -6.714  -38.391 1.00 36.07  ? 8    DA  T C5    1 
ATOM   7671 C  C6    . DA  C 3 8   ? -14.874 -6.360  -37.105 1.00 33.93  ? 8    DA  T C6    1 
ATOM   7672 N  N6    . DA  C 3 8   ? -14.664 -5.099  -36.710 1.00 31.19  ? 8    DA  T N6    1 
ATOM   7673 N  N1    . DA  C 3 8   ? -14.638 -7.361  -36.228 1.00 37.04  ? 8    DA  T N1    1 
ATOM   7674 C  C2    . DA  C 3 8   ? -14.846 -8.626  -36.612 1.00 36.71  ? 8    DA  T C2    1 
ATOM   7675 N  N3    . DA  C 3 8   ? -15.272 -9.080  -37.790 1.00 35.64  ? 8    DA  T N3    1 
ATOM   7676 C  C4    . DA  C 3 8   ? -15.496 -8.064  -38.637 1.00 36.27  ? 8    DA  T C4    1 
ATOM   7677 P  P     . DG  C 3 9   ? -20.566 -10.749 -41.789 1.00 46.74  ? 9    DG  T P     1 
ATOM   7678 O  OP1   . DG  C 3 9   ? -21.235 -11.846 -42.520 1.00 46.62  ? 9    DG  T OP1   1 
ATOM   7679 O  OP2   . DG  C 3 9   ? -21.110 -9.373  -41.854 1.00 52.10  ? 9    DG  T OP2   1 
ATOM   7680 O  "O5'" . DG  C 3 9   ? -20.436 -11.137 -40.245 1.00 40.11  ? 9    DG  T "O5'" 1 
ATOM   7681 C  "C5'" . DG  C 3 9   ? -19.908 -12.401 -39.852 1.00 38.48  ? 9    DG  T "C5'" 1 
ATOM   7682 C  "C4'" . DG  C 3 9   ? -20.090 -12.574 -38.356 1.00 38.03  ? 9    DG  T "C4'" 1 
ATOM   7683 O  "O4'" . DG  C 3 9   ? -19.205 -11.653 -37.669 1.00 38.41  ? 9    DG  T "O4'" 1 
ATOM   7684 C  "C3'" . DG  C 3 9   ? -21.503 -12.288 -37.852 1.00 37.46  ? 9    DG  T "C3'" 1 
ATOM   7685 O  "O3'" . DG  C 3 9   ? -21.865 -13.262 -36.886 1.00 40.99  ? 9    DG  T "O3'" 1 
ATOM   7686 C  "C2'" . DG  C 3 9   ? -21.403 -10.902 -37.229 1.00 36.40  ? 9    DG  T "C2'" 1 
ATOM   7687 C  "C1'" . DG  C 3 9   ? -19.945 -10.828 -36.791 1.00 36.61  ? 9    DG  T "C1'" 1 
ATOM   7688 N  N9    . DG  C 3 9   ? -19.438 -9.458  -36.842 1.00 37.74  ? 9    DG  T N9    1 
ATOM   7689 C  C8    . DG  C 3 9   ? -19.517 -8.586  -37.900 1.00 37.26  ? 9    DG  T C8    1 
ATOM   7690 N  N7    . DG  C 3 9   ? -18.989 -7.420  -37.650 1.00 36.77  ? 9    DG  T N7    1 
ATOM   7691 C  C5    . DG  C 3 9   ? -18.533 -7.520  -36.341 1.00 32.76  ? 9    DG  T C5    1 
ATOM   7692 C  C6    . DG  C 3 9   ? -17.872 -6.567  -35.525 1.00 34.29  ? 9    DG  T C6    1 
ATOM   7693 O  O6    . DG  C 3 9   ? -17.544 -5.404  -35.804 1.00 36.32  ? 9    DG  T O6    1 
ATOM   7694 N  N1    . DG  C 3 9   ? -17.591 -7.079  -34.262 1.00 32.22  ? 9    DG  T N1    1 
ATOM   7695 C  C2    . DG  C 3 9   ? -17.904 -8.352  -33.843 1.00 36.80  ? 9    DG  T C2    1 
ATOM   7696 N  N2    . DG  C 3 9   ? -17.553 -8.675  -32.588 1.00 36.15  ? 9    DG  T N2    1 
ATOM   7697 N  N3    . DG  C 3 9   ? -18.522 -9.252  -34.598 1.00 37.69  ? 9    DG  T N3    1 
ATOM   7698 C  C4    . DG  C 3 9   ? -18.806 -8.768  -35.831 1.00 36.26  ? 9    DG  T C4    1 
ATOM   7699 P  P     . DC  C 3 10  ? -23.297 -13.199 -36.156 1.00 49.43  ? 10   DC  T P     1 
ATOM   7700 O  OP1   . DC  C 3 10  ? -23.722 -14.598 -35.931 1.00 52.95  ? 10   DC  T OP1   1 
ATOM   7701 O  OP2   . DC  C 3 10  ? -24.176 -12.273 -36.906 1.00 52.12  ? 10   DC  T OP2   1 
ATOM   7702 O  "O5'" . DC  C 3 10  ? -22.978 -12.536 -34.736 1.00 39.58  ? 10   DC  T "O5'" 1 
ATOM   7703 C  "C5'" . DC  C 3 10  ? -21.876 -13.015 -33.970 1.00 38.78  ? 10   DC  T "C5'" 1 
ATOM   7704 C  "C4'" . DC  C 3 10  ? -21.919 -12.508 -32.537 1.00 39.54  ? 10   DC  T "C4'" 1 
ATOM   7705 O  "O4'" . DC  C 3 10  ? -21.220 -11.240 -32.452 1.00 35.96  ? 10   DC  T "O4'" 1 
ATOM   7706 C  "C3'" . DC  C 3 10  ? -23.305 -12.269 -31.946 1.00 42.27  ? 10   DC  T "C3'" 1 
ATOM   7707 O  "O3'" . DC  C 3 10  ? -23.283 -12.655 -30.576 1.00 44.60  ? 10   DC  T "O3'" 1 
ATOM   7708 C  "C2'" . DC  C 3 10  ? -23.513 -10.767 -32.109 1.00 37.35  ? 10   DC  T "C2'" 1 
ATOM   7709 C  "C1'" . DC  C 3 10  ? -22.091 -10.220 -32.011 1.00 36.20  ? 10   DC  T "C1'" 1 
ATOM   7710 N  N1    . DC  C 3 10  ? -21.833 -9.024  -32.870 1.00 36.42  ? 10   DC  T N1    1 
ATOM   7711 C  C2    . DC  C 3 10  ? -21.171 -7.917  -32.326 1.00 36.35  ? 10   DC  T C2    1 
ATOM   7712 O  O2    . DC  C 3 10  ? -20.814 -7.947  -31.144 1.00 39.00  ? 10   DC  T O2    1 
ATOM   7713 N  N3    . DC  C 3 10  ? -20.939 -6.837  -33.109 1.00 33.75  ? 10   DC  T N3    1 
ATOM   7714 C  C4    . DC  C 3 10  ? -21.337 -6.836  -34.381 1.00 35.20  ? 10   DC  T C4    1 
ATOM   7715 N  N4    . DC  C 3 10  ? -21.081 -5.741  -35.106 1.00 37.07  ? 10   DC  T N4    1 
ATOM   7716 C  C5    . DC  C 3 10  ? -22.017 -7.952  -34.955 1.00 35.27  ? 10   DC  T C5    1 
ATOM   7717 C  C6    . DC  C 3 10  ? -22.240 -9.015  -34.172 1.00 34.94  ? 10   DC  T C6    1 
ATOM   7718 P  P     . DA  C 3 11  ? -24.633 -12.660 -29.704 1.00 52.17  ? 11   DA  T P     1 
ATOM   7719 O  OP1   . DA  C 3 11  ? -24.434 -13.637 -28.614 1.00 56.53  ? 11   DA  T OP1   1 
ATOM   7720 O  OP2   . DA  C 3 11  ? -25.789 -12.768 -30.623 1.00 53.42  ? 11   DA  T OP2   1 
ATOM   7721 O  "O5'" . DA  C 3 11  ? -24.665 -11.218 -29.034 1.00 41.21  ? 11   DA  T "O5'" 1 
ATOM   7722 C  "C5'" . DA  C 3 11  ? -23.663 -10.925 -28.084 1.00 40.14  ? 11   DA  T "C5'" 1 
ATOM   7723 C  "C4'" . DA  C 3 11  ? -23.821 -9.504  -27.590 1.00 36.83  ? 11   DA  T "C4'" 1 
ATOM   7724 O  "O4'" . DA  C 3 11  ? -23.460 -8.590  -28.648 1.00 36.06  ? 11   DA  T "O4'" 1 
ATOM   7725 C  "C3'" . DA  C 3 11  ? -25.231 -9.135  -27.149 1.00 41.39  ? 11   DA  T "C3'" 1 
ATOM   7726 O  "O3'" . DA  C 3 11  ? -25.100 -8.665  -25.815 1.00 40.20  ? 11   DA  T "O3'" 1 
ATOM   7727 C  "C2'" . DA  C 3 11  ? -25.676 -8.063  -28.151 1.00 39.98  ? 11   DA  T "C2'" 1 
ATOM   7728 C  "C1'" . DA  C 3 11  ? -24.351 -7.499  -28.640 1.00 37.38  ? 11   DA  T "C1'" 1 
ATOM   7729 N  N9    . DA  C 3 11  ? -24.359 -6.962  -29.999 1.00 39.31  ? 11   DA  T N9    1 
ATOM   7730 C  C8    . DA  C 3 11  ? -24.877 -7.544  -31.124 1.00 41.68  ? 11   DA  T C8    1 
ATOM   7731 N  N7    . DA  C 3 11  ? -24.722 -6.824  -32.211 1.00 42.71  ? 11   DA  T N7    1 
ATOM   7732 C  C5    . DA  C 3 11  ? -24.051 -5.695  -31.770 1.00 39.23  ? 11   DA  T C5    1 
ATOM   7733 C  C6    . DA  C 3 11  ? -23.589 -4.543  -32.435 1.00 36.05  ? 11   DA  T C6    1 
ATOM   7734 N  N6    . DA  C 3 11  ? -23.741 -4.335  -33.748 1.00 39.88  ? 11   DA  T N6    1 
ATOM   7735 N  N1    . DA  C 3 11  ? -22.965 -3.607  -31.694 1.00 32.89  ? 11   DA  T N1    1 
ATOM   7736 C  C2    . DA  C 3 11  ? -22.810 -3.811  -30.380 1.00 34.40  ? 11   DA  T C2    1 
ATOM   7737 N  N3    . DA  C 3 11  ? -23.193 -4.854  -29.645 1.00 37.08  ? 11   DA  T N3    1 
ATOM   7738 C  C4    . DA  C 3 11  ? -23.815 -5.767  -30.409 1.00 38.25  ? 11   DA  T C4    1 
ATOM   7739 P  P     . DG  C 3 12  ? -26.360 -8.088  -25.011 1.00 42.87  ? 12   DG  T P     1 
ATOM   7740 O  OP1   . DG  C 3 12  ? -26.189 -8.542  -23.613 1.00 43.63  ? 12   DG  T OP1   1 
ATOM   7741 O  OP2   . DG  C 3 12  ? -27.610 -8.393  -25.742 1.00 46.00  ? 12   DG  T OP2   1 
ATOM   7742 O  "O5'" . DG  C 3 12  ? -26.128 -6.511  -25.046 1.00 42.12  ? 12   DG  T "O5'" 1 
ATOM   7743 C  "C5'" . DG  C 3 12  ? -24.943 -5.972  -24.474 1.00 37.71  ? 12   DG  T "C5'" 1 
ATOM   7744 C  "C4'" . DG  C 3 12  ? -25.022 -4.457  -24.408 1.00 40.94  ? 12   DG  T "C4'" 1 
ATOM   7745 O  "O4'" . DG  C 3 12  ? -24.833 -3.899  -25.732 1.00 40.75  ? 12   DG  T "O4'" 1 
ATOM   7746 C  "C3'" . DG  C 3 12  ? -26.345 -3.887  -23.904 1.00 42.23  ? 12   DG  T "C3'" 1 
ATOM   7747 O  "O3'" . DG  C 3 12  ? -26.043 -2.716  -23.168 1.00 44.84  ? 12   DG  T "O3'" 1 
ATOM   7748 C  "C2'" . DG  C 3 12  ? -27.109 -3.577  -25.190 1.00 38.18  ? 12   DG  T "C2'" 1 
ATOM   7749 C  "C1'" . DG  C 3 12  ? -25.977 -3.161  -26.125 1.00 41.98  ? 12   DG  T "C1'" 1 
ATOM   7750 N  N9    . DG  C 3 12  ? -26.193 -3.454  -27.539 1.00 41.16  ? 12   DG  T N9    1 
ATOM   7751 C  C8    . DG  C 3 12  ? -26.633 -4.634  -28.086 1.00 42.45  ? 12   DG  T C8    1 
ATOM   7752 N  N7    . DG  C 3 12  ? -26.715 -4.607  -29.388 1.00 38.40  ? 12   DG  T N7    1 
ATOM   7753 C  C5    . DG  C 3 12  ? -26.300 -3.325  -29.727 1.00 38.18  ? 12   DG  T C5    1 
ATOM   7754 C  C6    . DG  C 3 12  ? -26.181 -2.709  -30.996 1.00 37.32  ? 12   DG  T C6    1 
ATOM   7755 O  O6    . DG  C 3 12  ? -26.425 -3.190  -32.111 1.00 39.30  ? 12   DG  T O6    1 
ATOM   7756 N  N1    . DG  C 3 12  ? -25.723 -1.401  -30.895 1.00 38.57  ? 12   DG  T N1    1 
ATOM   7757 C  C2    . DG  C 3 12  ? -25.421 -0.763  -29.716 1.00 42.24  ? 12   DG  T C2    1 
ATOM   7758 N  N2    . DG  C 3 12  ? -24.993 0.504   -29.817 1.00 40.69  ? 12   DG  T N2    1 
ATOM   7759 N  N3    . DG  C 3 12  ? -25.530 -1.327  -28.519 1.00 43.60  ? 12   DG  T N3    1 
ATOM   7760 C  C4    . DG  C 3 12  ? -25.973 -2.605  -28.601 1.00 40.37  ? 12   DG  T C4    1 
ATOM   7761 P  P     . DT  C 3 13  ? -27.179 -1.965  -22.318 1.00 57.18  ? 13   DT  T P     1 
ATOM   7762 O  OP1   . DT  C 3 13  ? -26.526 -1.492  -21.078 1.00 59.93  ? 13   DT  T OP1   1 
ATOM   7763 O  OP2   . DT  C 3 13  ? -28.371 -2.837  -22.247 1.00 60.91  ? 13   DT  T OP2   1 
ATOM   7764 O  "O5'" . DT  C 3 13  ? -27.548 -0.693  -23.213 1.00 54.56  ? 13   DT  T "O5'" 1 
ATOM   7765 C  "C5'" . DT  C 3 13  ? -26.507 0.193   -23.593 1.00 57.45  ? 13   DT  T "C5'" 1 
ATOM   7766 C  "C4'" . DT  C 3 13  ? -27.005 1.318   -24.487 1.00 59.46  ? 13   DT  T "C4'" 1 
ATOM   7767 O  "O4'" . DT  C 3 13  ? -27.107 0.859   -25.859 1.00 53.82  ? 13   DT  T "O4'" 1 
ATOM   7768 C  "C3'" . DT  C 3 13  ? -28.364 1.913   -24.138 1.00 60.31  ? 13   DT  T "C3'" 1 
ATOM   7769 O  "O3'" . DT  C 3 13  ? -28.231 3.321   -24.257 1.00 64.46  ? 13   DT  T "O3'" 1 
ATOM   7770 C  "C2'" . DT  C 3 13  ? -29.292 1.338   -25.208 1.00 58.13  ? 13   DT  T "C2'" 1 
ATOM   7771 C  "C1'" . DT  C 3 13  ? -28.348 1.258   -26.401 1.00 58.76  ? 13   DT  T "C1'" 1 
ATOM   7772 N  N1    . DT  C 3 13  ? -28.700 0.253   -27.449 1.00 57.80  ? 13   DT  T N1    1 
ATOM   7773 C  C2    . DT  C 3 13  ? -28.574 0.606   -28.776 1.00 55.38  ? 13   DT  T C2    1 
ATOM   7774 O  O2    . DT  C 3 13  ? -28.205 1.709   -29.135 1.00 53.71  ? 13   DT  T O2    1 
ATOM   7775 N  N3    . DT  C 3 13  ? -28.904 -0.381  -29.672 1.00 51.05  ? 13   DT  T N3    1 
ATOM   7776 C  C4    . DT  C 3 13  ? -29.330 -1.663  -29.372 1.00 55.76  ? 13   DT  T C4    1 
ATOM   7777 O  O4    . DT  C 3 13  ? -29.604 -2.490  -30.237 1.00 52.82  ? 13   DT  T O4    1 
ATOM   7778 C  C5    . DT  C 3 13  ? -29.434 -1.967  -27.966 1.00 54.91  ? 13   DT  T C5    1 
ATOM   7779 C  C7    . DT  C 3 13  ? -29.892 -3.328  -27.532 1.00 53.19  ? 13   DT  T C7    1 
ATOM   7780 C  C6    . DT  C 3 13  ? -29.116 -1.010  -27.082 1.00 56.44  ? 13   DT  T C6    1 
ATOM   7781 P  P     . DC  C 3 14  ? -29.279 4.312   -23.548 1.00 68.47  ? 14   DC  T P     1 
ATOM   7782 O  OP1   . DC  C 3 14  ? -28.537 5.043   -22.497 1.00 68.11  ? 14   DC  T OP1   1 
ATOM   7783 O  OP2   . DC  C 3 14  ? -30.505 3.557   -23.207 1.00 69.09  ? 14   DC  T OP2   1 
ATOM   7784 O  "O5'" . DC  C 3 14  ? -29.662 5.337   -24.711 1.00 66.61  ? 14   DC  T "O5'" 1 
ATOM   7785 C  "C5'" . DC  C 3 14  ? -28.711 5.570   -25.739 1.00 65.65  ? 14   DC  T "C5'" 1 
ATOM   7786 C  "C4'" . DC  C 3 14  ? -29.407 5.898   -27.045 1.00 64.54  ? 14   DC  T "C4'" 1 
ATOM   7787 O  "O4'" . DC  C 3 14  ? -29.653 4.680   -27.790 1.00 60.30  ? 14   DC  T "O4'" 1 
ATOM   7788 C  "C3'" . DC  C 3 14  ? -30.756 6.592   -26.896 1.00 67.15  ? 14   DC  T "C3'" 1 
ATOM   7789 O  "O3'" . DC  C 3 14  ? -30.768 7.707   -27.776 1.00 70.22  ? 14   DC  T "O3'" 1 
ATOM   7790 C  "C2'" . DC  C 3 14  ? -31.767 5.521   -27.311 1.00 64.69  ? 14   DC  T "C2'" 1 
ATOM   7791 C  "C1'" . DC  C 3 14  ? -30.956 4.728   -28.328 1.00 60.72  ? 14   DC  T "C1'" 1 
ATOM   7792 N  N1    . DC  C 3 14  ? -31.392 3.320   -28.548 1.00 56.28  ? 14   DC  T N1    1 
ATOM   7793 C  C2    . DC  C 3 14  ? -31.478 2.828   -29.856 1.00 55.31  ? 14   DC  T C2    1 
ATOM   7794 O  O2    . DC  C 3 14  ? -31.204 3.579   -30.801 1.00 56.17  ? 14   DC  T O2    1 
ATOM   7795 N  N3    . DC  C 3 14  ? -31.863 1.542   -30.052 1.00 52.97  ? 14   DC  T N3    1 
ATOM   7796 C  C4    . DC  C 3 14  ? -32.151 0.765   -29.009 1.00 54.43  ? 14   DC  T C4    1 
ATOM   7797 N  N4    . DC  C 3 14  ? -32.525 -0.494  -29.258 1.00 54.25  ? 14   DC  T N4    1 
ATOM   7798 C  C5    . DC  C 3 14  ? -32.068 1.249   -27.668 1.00 56.36  ? 14   DC  T C5    1 
ATOM   7799 C  C6    . DC  C 3 14  ? -31.685 2.519   -27.485 1.00 55.08  ? 14   DC  T C6    1 
ATOM   7800 P  P     . DC  C 3 15  ? -31.833 8.895   -27.578 1.00 84.53  ? 15   DC  T P     1 
ATOM   7801 O  OP1   . DC  C 3 15  ? -31.062 10.158  -27.539 1.00 87.79  ? 15   DC  T OP1   1 
ATOM   7802 O  OP2   . DC  C 3 15  ? -32.743 8.552   -26.462 1.00 81.52  ? 15   DC  T OP2   1 
ATOM   7803 O  "O5'" . DC  C 3 15  ? -32.686 8.860   -28.928 1.00 61.19  ? 15   DC  T "O5'" 1 
ATOM   7804 C  "C5'" . DC  C 3 15  ? -32.081 8.386   -30.122 1.00 62.18  ? 15   DC  T "C5'" 1 
ATOM   7805 C  "C4'" . DC  C 3 15  ? -33.119 8.207   -31.213 1.00 65.09  ? 15   DC  T "C4'" 1 
ATOM   7806 O  "O4'" . DC  C 3 15  ? -33.412 6.796   -31.396 1.00 66.75  ? 15   DC  T "O4'" 1 
ATOM   7807 C  "C3'" . DC  C 3 15  ? -34.459 8.874   -30.942 1.00 67.65  ? 15   DC  T "C3'" 1 
ATOM   7808 O  "O3'" . DC  C 3 15  ? -34.973 9.310   -32.183 1.00 69.67  ? 15   DC  T "O3'" 1 
ATOM   7809 C  "C2'" . DC  C 3 15  ? -35.287 7.734   -30.359 1.00 65.77  ? 15   DC  T "C2'" 1 
ATOM   7810 C  "C1'" . DC  C 3 15  ? -34.791 6.559   -31.187 1.00 65.06  ? 15   DC  T "C1'" 1 
ATOM   7811 N  N1    . DC  C 3 15  ? -34.956 5.252   -30.490 1.00 61.80  ? 15   DC  T N1    1 
ATOM   7812 C  C2    . DC  C 3 15  ? -35.011 4.074   -31.240 1.00 58.77  ? 15   DC  T C2    1 
ATOM   7813 O  O2    . DC  C 3 15  ? -34.920 4.144   -32.473 1.00 55.82  ? 15   DC  T O2    1 
ATOM   7814 N  N3    . DC  C 3 15  ? -35.162 2.892   -30.589 1.00 58.67  ? 15   DC  T N3    1 
ATOM   7815 C  C4    . DC  C 3 15  ? -35.257 2.868   -29.257 1.00 57.77  ? 15   DC  T C4    1 
ATOM   7816 N  N4    . DC  C 3 15  ? -35.404 1.683   -28.657 1.00 55.51  ? 15   DC  T N4    1 
ATOM   7817 C  C5    . DC  C 3 15  ? -35.204 4.062   -28.477 1.00 60.11  ? 15   DC  T C5    1 
ATOM   7818 C  C6    . DC  C 3 15  ? -35.056 5.219   -29.129 1.00 60.35  ? 15   DC  T C6    1 
ATOM   7819 P  P     . DG  C 3 16  ? -36.246 10.285  -32.249 1.00 68.45  ? 16   DG  T P     1 
ATOM   7820 O  OP1   . DG  C 3 16  ? -35.736 11.627  -32.603 1.00 71.95  ? 16   DG  T OP1   1 
ATOM   7821 O  OP2   . DG  C 3 16  ? -37.062 10.114  -31.027 1.00 67.56  ? 16   DG  T OP2   1 
ATOM   7822 O  "O5'" . DG  C 3 16  ? -37.081 9.704   -33.480 1.00 58.35  ? 16   DG  T "O5'" 1 
ATOM   7823 C  "C5'" . DG  C 3 16  ? -36.368 9.053   -34.524 1.00 56.92  ? 16   DG  T "C5'" 1 
ATOM   7824 C  "C4'" . DG  C 3 16  ? -37.261 8.137   -35.340 1.00 57.33  ? 16   DG  T "C4'" 1 
ATOM   7825 O  "O4'" . DG  C 3 16  ? -37.297 6.826   -34.719 1.00 57.84  ? 16   DG  T "O4'" 1 
ATOM   7826 C  "C3'" . DG  C 3 16  ? -38.710 8.591   -35.490 1.00 58.71  ? 16   DG  T "C3'" 1 
ATOM   7827 O  "O3'" . DG  C 3 16  ? -39.139 8.319   -36.823 1.00 59.73  ? 16   DG  T "O3'" 1 
ATOM   7828 C  "C2'" . DG  C 3 16  ? -39.457 7.756   -34.449 1.00 56.55  ? 16   DG  T "C2'" 1 
ATOM   7829 C  "C1'" . DG  C 3 16  ? -38.616 6.485   -34.344 1.00 55.23  ? 16   DG  T "C1'" 1 
ATOM   7830 N  N9    . DG  C 3 16  ? -38.573 5.920   -32.995 1.00 53.72  ? 16   DG  T N9    1 
ATOM   7831 C  C8    . DG  C 3 16  ? -38.499 6.609   -31.806 1.00 53.89  ? 16   DG  T C8    1 
ATOM   7832 N  N7    . DG  C 3 16  ? -38.480 5.836   -30.753 1.00 52.87  ? 16   DG  T N7    1 
ATOM   7833 C  C5    . DG  C 3 16  ? -38.545 4.548   -31.275 1.00 51.39  ? 16   DG  T C5    1 
ATOM   7834 C  C6    . DG  C 3 16  ? -38.556 3.295   -30.614 1.00 51.79  ? 16   DG  T C6    1 
ATOM   7835 O  O6    . DG  C 3 16  ? -38.511 3.060   -29.396 1.00 52.33  ? 16   DG  T O6    1 
ATOM   7836 N  N1    . DG  C 3 16  ? -38.628 2.240   -31.522 1.00 49.94  ? 16   DG  T N1    1 
ATOM   7837 C  C2    . DG  C 3 16  ? -38.685 2.381   -32.889 1.00 48.11  ? 16   DG  T C2    1 
ATOM   7838 N  N2    . DG  C 3 16  ? -38.750 1.244   -33.596 1.00 43.46  ? 16   DG  T N2    1 
ATOM   7839 N  N3    . DG  C 3 16  ? -38.678 3.549   -33.520 1.00 47.51  ? 16   DG  T N3    1 
ATOM   7840 C  C4    . DG  C 3 16  ? -38.604 4.585   -32.653 1.00 49.95  ? 16   DG  T C4    1 
ATOM   7841 P  P     . DC  C 3 17  ? -40.631 8.682   -37.292 1.00 65.57  ? 17   DC  T P     1 
ATOM   7842 O  OP1   . DC  C 3 17  ? -40.624 8.762   -38.769 1.00 67.79  ? 17   DC  T OP1   1 
ATOM   7843 O  OP2   . DC  C 3 17  ? -41.091 9.840   -36.494 1.00 64.65  ? 17   DC  T OP2   1 
ATOM   7844 O  "O5'" . DC  C 3 17  ? -41.489 7.402   -36.867 1.00 55.67  ? 17   DC  T "O5'" 1 
ATOM   7845 C  "C5'" . DC  C 3 17  ? -41.290 6.169   -37.543 1.00 51.84  ? 17   DC  T "C5'" 1 
ATOM   7846 C  "C4'" . DC  C 3 17  ? -42.091 5.064   -36.880 1.00 51.22  ? 17   DC  T "C4'" 1 
ATOM   7847 O  "O4'" . DC  C 3 17  ? -41.583 4.839   -35.540 1.00 51.45  ? 17   DC  T "O4'" 1 
ATOM   7848 C  "C3'" . DC  C 3 17  ? -43.584 5.348   -36.715 1.00 53.57  ? 17   DC  T "C3'" 1 
ATOM   7849 O  "O3'" . DC  C 3 17  ? -44.314 4.190   -37.083 1.00 53.88  ? 17   DC  T "O3'" 1 
ATOM   7850 C  "C2'" . DC  C 3 17  ? -43.715 5.606   -35.218 1.00 53.50  ? 17   DC  T "C2'" 1 
ATOM   7851 C  "C1'" . DC  C 3 17  ? -42.700 4.589   -34.720 1.00 52.59  ? 17   DC  T "C1'" 1 
ATOM   7852 N  N1    . DC  C 3 17  ? -42.349 4.732   -33.281 1.00 51.42  ? 17   DC  T N1    1 
ATOM   7853 C  C2    . DC  C 3 17  ? -42.095 3.587   -32.521 1.00 49.53  ? 17   DC  T C2    1 
ATOM   7854 O  O2    . DC  C 3 17  ? -42.153 2.476   -33.063 1.00 50.02  ? 17   DC  T O2    1 
ATOM   7855 N  N3    . DC  C 3 17  ? -41.784 3.726   -31.208 1.00 50.86  ? 17   DC  T N3    1 
ATOM   7856 C  C4    . DC  C 3 17  ? -41.727 4.940   -30.660 1.00 55.44  ? 17   DC  T C4    1 
ATOM   7857 N  N4    . DC  C 3 17  ? -41.416 5.028   -29.363 1.00 57.22  ? 17   DC  T N4    1 
ATOM   7858 C  C5    . DC  C 3 17  ? -41.988 6.119   -31.420 1.00 57.83  ? 17   DC  T C5    1 
ATOM   7859 C  C6    . DC  C 3 17  ? -42.294 5.969   -32.714 1.00 56.02  ? 17   DC  T C6    1 
ATOM   7860 P  P     . DG  C 3 18  ? -45.837 4.311   -37.569 1.00 51.84  ? 18   DG  T P     1 
ATOM   7861 O  OP1   . DG  C 3 18  ? -46.425 2.956   -37.548 1.00 59.42  ? 18   DG  T OP1   1 
ATOM   7862 O  OP2   . DG  C 3 18  ? -45.838 5.099   -38.821 1.00 56.39  ? 18   DG  T OP2   1 
ATOM   7863 O  "O5'" . DG  C 3 18  ? -46.544 5.191   -36.434 1.00 53.56  ? 18   DG  T "O5'" 1 
ATOM   7864 C  "C5'" . DG  C 3 18  ? -47.957 5.343   -36.400 1.00 50.21  ? 18   DG  T "C5'" 1 
ATOM   7865 C  "C4'" . DG  C 3 18  ? -48.440 5.204   -34.970 1.00 39.57  ? 18   DG  T "C4'" 1 
ATOM   7866 O  "O4'" . DG  C 3 18  ? -49.734 5.834   -34.808 1.00 39.46  ? 18   DG  T "O4'" 1 
ATOM   7867 C  "C3'" . DG  C 3 18  ? -48.637 3.768   -34.505 1.00 41.59  ? 18   DG  T "C3'" 1 
ATOM   7868 O  "O3'" . DG  C 3 18  ? -48.299 3.708   -33.130 1.00 40.58  ? 18   DG  T "O3'" 1 
ATOM   7869 C  "C2'" . DG  C 3 18  ? -50.131 3.535   -34.745 1.00 37.73  ? 18   DG  T "C2'" 1 
ATOM   7870 C  "C1'" . DG  C 3 18  ? -50.684 4.894   -34.336 1.00 38.55  ? 18   DG  T "C1'" 1 
ATOM   7871 N  N9    . DG  C 3 18  ? -51.981 5.255   -34.908 1.00 37.98  ? 18   DG  T N9    1 
ATOM   7872 C  C8    . DG  C 3 18  ? -53.128 5.585   -34.222 1.00 38.05  ? 18   DG  T C8    1 
ATOM   7873 N  N7    . DG  C 3 18  ? -54.135 5.882   -34.996 1.00 37.51  ? 18   DG  T N7    1 
ATOM   7874 C  C5    . DG  C 3 18  ? -53.624 5.744   -36.280 1.00 41.52  ? 18   DG  T C5    1 
ATOM   7875 C  C6    . DG  C 3 18  ? -54.248 5.936   -37.535 1.00 38.62  ? 18   DG  T C6    1 
ATOM   7876 O  O6    . DG  C 3 18  ? -55.413 6.270   -37.782 1.00 37.86  ? 18   DG  T O6    1 
ATOM   7877 N  N1    . DG  C 3 18  ? -53.372 5.692   -38.584 1.00 38.58  ? 18   DG  T N1    1 
ATOM   7878 C  C2    . DG  C 3 18  ? -52.059 5.316   -38.445 1.00 40.58  ? 18   DG  T C2    1 
ATOM   7879 N  N2    . DG  C 3 18  ? -51.376 5.132   -39.584 1.00 38.32  ? 18   DG  T N2    1 
ATOM   7880 N  N3    . DG  C 3 18  ? -51.458 5.132   -37.277 1.00 41.66  ? 18   DG  T N3    1 
ATOM   7881 C  C4    . DG  C 3 18  ? -52.300 5.361   -36.242 1.00 37.37  ? 18   DG  T C4    1 
HETATM 7882 CA CA    . CA  D 4 .   ? 1.313   -12.983 -51.484 1.00 31.79  ? 1001 CA  A CA    1 
HETATM 7883 P  PA    . TTP E 5 .   ? 0.442   -12.205 -48.159 1.00 30.30  ? 1002 TTP A PA    1 
HETATM 7884 O  O1A   . TTP E 5 .   ? -0.269  -13.084 -47.210 1.00 31.61  ? 1002 TTP A O1A   1 
HETATM 7885 O  O2A   . TTP E 5 .   ? 0.066   -12.657 -49.656 1.00 27.64  ? 1002 TTP A O2A   1 
HETATM 7886 O  O3A   . TTP E 5 .   ? 2.001   -12.334 -47.761 1.00 37.74  ? 1002 TTP A O3A   1 
HETATM 7887 P  PB    . TTP E 5 .   ? 3.166   -12.130 -48.864 1.00 28.83  ? 1002 TTP A PB    1 
HETATM 7888 O  O1B   . TTP E 5 .   ? 4.007   -11.003 -48.404 1.00 29.58  ? 1002 TTP A O1B   1 
HETATM 7889 O  O2B   . TTP E 5 .   ? 2.646   -11.844 -50.356 1.00 30.06  ? 1002 TTP A O2B   1 
HETATM 7890 O  O3B   . TTP E 5 .   ? 4.159   -13.401 -48.803 1.00 31.88  ? 1002 TTP A O3B   1 
HETATM 7891 P  PG    . TTP E 5 .   ? 3.711   -14.678 -49.685 1.00 28.85  ? 1002 TTP A PG    1 
HETATM 7892 O  O1G   . TTP E 5 .   ? 2.394   -14.484 -50.322 1.00 26.72  ? 1002 TTP A O1G   1 
HETATM 7893 O  O2G   . TTP E 5 .   ? 4.850   -14.903 -50.793 1.00 31.96  ? 1002 TTP A O2G   1 
HETATM 7894 O  O3G   . TTP E 5 .   ? 3.660   -15.974 -48.734 1.00 36.27  ? 1002 TTP A O3G   1 
HETATM 7895 O  "O5'" . TTP E 5 .   ? -0.090  -10.704 -47.876 1.00 30.45  ? 1002 TTP A "O5'" 1 
HETATM 7896 C  "C5'" . TTP E 5 .   ? 0.271   -9.825  -48.941 1.00 23.15  ? 1002 TTP A "C5'" 1 
HETATM 7897 C  "C4'" . TTP E 5 .   ? 0.715   -8.473  -48.359 1.00 27.14  ? 1002 TTP A "C4'" 1 
HETATM 7898 O  "O4'" . TTP E 5 .   ? -0.102  -8.059  -47.229 1.00 29.33  ? 1002 TTP A "O4'" 1 
HETATM 7899 C  "C3'" . TTP E 5 .   ? 2.132   -8.586  -47.743 1.00 24.46  ? 1002 TTP A "C3'" 1 
HETATM 7900 O  "O3'" . TTP E 5 .   ? 3.171   -8.608  -48.732 1.00 25.87  ? 1002 TTP A "O3'" 1 
HETATM 7901 C  "C2'" . TTP E 5 .   ? 2.134   -7.296  -46.892 1.00 25.73  ? 1002 TTP A "C2'" 1 
HETATM 7902 C  "C1'" . TTP E 5 .   ? 0.720   -7.344  -46.280 1.00 24.48  ? 1002 TTP A "C1'" 1 
HETATM 7903 N  N1    . TTP E 5 .   ? 0.806   -8.052  -44.992 1.00 23.67  ? 1002 TTP A N1    1 
HETATM 7904 C  C2    . TTP E 5 .   ? 1.223   -7.394  -43.891 1.00 27.62  ? 1002 TTP A C2    1 
HETATM 7905 O  O2    . TTP E 5 .   ? 1.509   -6.208  -43.957 1.00 27.52  ? 1002 TTP A O2    1 
HETATM 7906 N  N3    . TTP E 5 .   ? 1.325   -8.025  -42.707 1.00 26.19  ? 1002 TTP A N3    1 
HETATM 7907 C  C4    . TTP E 5 .   ? 1.016   -9.335  -42.601 1.00 24.47  ? 1002 TTP A C4    1 
HETATM 7908 O  O4    . TTP E 5 .   ? 1.111   -9.906  -41.533 1.00 23.38  ? 1002 TTP A O4    1 
HETATM 7909 C  C5    . TTP E 5 .   ? 0.585   -10.045 -43.743 1.00 26.17  ? 1002 TTP A C5    1 
HETATM 7910 C  C5M   . TTP E 5 .   ? 0.237   -11.512 -43.644 1.00 21.50  ? 1002 TTP A C5M   1 
HETATM 7911 C  C6    . TTP E 5 .   ? 0.486   -9.385  -44.918 1.00 25.14  ? 1002 TTP A C6    1 
HETATM 7912 NA NA    . NA  F 6 .   ? 4.451   -24.638 -12.255 1.00 49.83  ? 1003 NA  A NA    1 
HETATM 7913 NA NA    . NA  G 6 .   ? -0.635  -44.719 -19.788 1.00 57.21  ? 1004 NA  A NA    1 
HETATM 7914 CA CA    . CA  H 4 .   ? 19.175  -28.486 6.976   1.00 49.42  ? 1005 CA  A CA    1 
HETATM 7915 NA NA    . NA  I 6 .   ? 8.936   -7.318  -0.415  1.00 57.22  ? 1006 NA  A NA    1 
HETATM 7916 CA CA    . CA  J 4 .   ? 3.801   -50.674 -50.655 1.00 73.87  ? 1007 CA  A CA    1 
HETATM 7917 CL CL    . CL  K 7 .   ? 9.232   -17.127 -51.600 1.00 53.27  ? 1008 CL  A CL    1 
HETATM 7918 NA NA    . NA  L 6 .   ? 2.575   -18.735 -53.989 1.00 57.80  ? 1009 NA  A NA    1 
HETATM 7919 O  O     . HOH M 8 .   ? -4.082  -3.950  -52.642 1.00 22.66  ? 1101 HOH A O     1 
HETATM 7920 O  O     . HOH M 8 .   ? 29.490  4.792   -30.944 1.00 29.47  ? 1102 HOH A O     1 
HETATM 7921 O  O     . HOH M 8 .   ? -15.343 -24.750 -26.855 1.00 20.00  ? 1103 HOH A O     1 
HETATM 7922 O  O     . HOH M 8 .   ? 15.007  -23.952 -31.239 1.00 23.81  ? 1104 HOH A O     1 
HETATM 7923 O  O     . HOH M 8 .   ? 31.566  5.022   -21.502 1.00 40.05  ? 1105 HOH A O     1 
HETATM 7924 O  O     . HOH M 8 .   ? -1.015  -2.162  -43.967 1.00 24.33  ? 1106 HOH A O     1 
HETATM 7925 O  O     . HOH M 8 .   ? -0.852  -17.762 -30.227 1.00 27.01  ? 1107 HOH A O     1 
HETATM 7926 O  O     . HOH M 8 .   ? 6.629   -10.899 -47.517 1.00 27.68  ? 1108 HOH A O     1 
HETATM 7927 O  O     . HOH M 8 .   ? 21.591  -22.880 -16.365 1.00 25.35  ? 1109 HOH A O     1 
HETATM 7928 O  O     . HOH M 8 .   ? 24.258  -3.379  -33.679 1.00 28.21  ? 1110 HOH A O     1 
HETATM 7929 O  O     . HOH M 8 .   ? 20.464  -8.980  -21.963 1.00 28.81  ? 1111 HOH A O     1 
HETATM 7930 O  O     . HOH M 8 .   ? 21.843  -8.875  -24.114 1.00 26.02  ? 1112 HOH A O     1 
HETATM 7931 O  O     . HOH M 8 .   ? 13.877  -21.590 -36.551 1.00 27.18  ? 1113 HOH A O     1 
HETATM 7932 O  O     . HOH M 8 .   ? 1.227   7.346   -38.531 1.00 31.16  ? 1114 HOH A O     1 
HETATM 7933 O  O     . HOH M 8 .   ? -12.668 -22.469 -29.615 1.00 22.31  ? 1115 HOH A O     1 
HETATM 7934 O  O     . HOH M 8 .   ? 21.180  10.174  -42.263 1.00 36.86  ? 1116 HOH A O     1 
HETATM 7935 O  O     . HOH M 8 .   ? -15.630 -13.138 -40.630 1.00 41.10  ? 1117 HOH A O     1 
HETATM 7936 O  O     . HOH M 8 .   ? 10.584  -24.778 4.807   1.00 37.91  ? 1118 HOH A O     1 
HETATM 7937 O  O     . HOH M 8 .   ? -6.987  -6.666  -46.794 1.00 26.79  ? 1119 HOH A O     1 
HETATM 7938 O  O     . HOH M 8 .   ? 5.741   -23.211 -37.220 1.00 24.38  ? 1120 HOH A O     1 
HETATM 7939 O  O     . HOH M 8 .   ? -11.413 -22.570 -13.747 1.00 35.24  ? 1121 HOH A O     1 
HETATM 7940 O  O     . HOH M 8 .   ? -17.043 -17.307 -33.016 1.00 30.03  ? 1122 HOH A O     1 
HETATM 7941 O  O     . HOH M 8 .   ? -9.600  -21.270 -34.081 1.00 37.17  ? 1123 HOH A O     1 
HETATM 7942 O  O     . HOH M 8 .   ? 6.920   -21.739 -13.267 1.00 30.42  ? 1124 HOH A O     1 
HETATM 7943 O  O     . HOH M 8 .   ? 0.062   -28.124 -3.503  1.00 36.26  ? 1125 HOH A O     1 
HETATM 7944 O  O     . HOH M 8 .   ? 7.623   -30.131 -2.726  1.00 31.24  ? 1126 HOH A O     1 
HETATM 7945 O  O     . HOH M 8 .   ? 26.918  -19.661 -22.509 1.00 30.94  ? 1127 HOH A O     1 
HETATM 7946 O  O     . HOH M 8 .   ? 19.132  2.574   -38.086 1.00 29.44  ? 1128 HOH A O     1 
HETATM 7947 O  O     . HOH M 8 .   ? 11.793  9.434   -36.788 1.00 47.58  ? 1129 HOH A O     1 
HETATM 7948 O  O     . HOH M 8 .   ? 4.230   -13.886 -41.831 1.00 29.19  ? 1130 HOH A O     1 
HETATM 7949 O  O     . HOH M 8 .   ? 14.185  -40.564 -6.518  1.00 37.88  ? 1131 HOH A O     1 
HETATM 7950 O  O     . HOH M 8 .   ? 13.375  -23.774 -37.957 1.00 24.47  ? 1132 HOH A O     1 
HETATM 7951 O  O     . HOH M 8 .   ? 35.260  13.687  -38.404 1.00 36.87  ? 1133 HOH A O     1 
HETATM 7952 O  O     . HOH M 8 .   ? 23.258  -6.404  -38.699 1.00 32.41  ? 1134 HOH A O     1 
HETATM 7953 O  O     . HOH M 8 .   ? -25.205 -5.331  -20.836 1.00 36.22  ? 1135 HOH A O     1 
HETATM 7954 O  O     . HOH M 8 .   ? 3.350   -29.816 -10.212 1.00 35.44  ? 1136 HOH A O     1 
HETATM 7955 O  O     . HOH M 8 .   ? 3.667   -11.155 -42.503 1.00 26.15  ? 1137 HOH A O     1 
HETATM 7956 O  O     . HOH M 8 .   ? 18.995  -4.944  -28.625 1.00 24.81  ? 1138 HOH A O     1 
HETATM 7957 O  O     . HOH M 8 .   ? 21.570  -11.284 -25.706 1.00 27.68  ? 1139 HOH A O     1 
HETATM 7958 O  O     . HOH M 8 .   ? -2.165  -2.553  -51.467 1.00 25.39  ? 1140 HOH A O     1 
HETATM 7959 O  O     . HOH M 8 .   ? -3.423  2.606   -50.541 1.00 31.71  ? 1141 HOH A O     1 
HETATM 7960 O  O     . HOH M 8 .   ? 6.592   6.669   -64.746 1.00 36.74  ? 1142 HOH A O     1 
HETATM 7961 O  O     . HOH M 8 .   ? 23.199  -5.208  -41.332 1.00 37.34  ? 1143 HOH A O     1 
HETATM 7962 O  O     . HOH M 8 .   ? -20.496 -9.449  -50.702 1.00 38.63  ? 1144 HOH A O     1 
HETATM 7963 O  O     . HOH M 8 .   ? 11.564  -8.867  -35.015 1.00 32.84  ? 1145 HOH A O     1 
HETATM 7964 O  O     . HOH M 8 .   ? 33.180  5.498   -31.016 1.00 34.95  ? 1146 HOH A O     1 
HETATM 7965 O  O     . HOH M 8 .   ? -24.186 -15.983 -9.989  1.00 36.24  ? 1147 HOH A O     1 
HETATM 7966 O  O     . HOH M 8 .   ? -0.073  -24.100 -61.958 1.00 43.57  ? 1148 HOH A O     1 
HETATM 7967 O  O     . HOH M 8 .   ? 8.990   -43.808 -18.093 1.00 45.34  ? 1149 HOH A O     1 
HETATM 7968 O  O     . HOH M 8 .   ? -16.093 -13.208 -6.436  1.00 45.57  ? 1150 HOH A O     1 
HETATM 7969 O  O     . HOH M 8 .   ? -17.807 -12.138 -57.457 1.00 40.42  ? 1151 HOH A O     1 
HETATM 7970 O  O     . HOH M 8 .   ? 11.873  8.918   -45.428 1.00 30.00  ? 1152 HOH A O     1 
HETATM 7971 O  O     . HOH M 8 .   ? -9.346  -0.281  -49.324 1.00 51.19  ? 1153 HOH A O     1 
HETATM 7972 O  O     . HOH M 8 .   ? -12.727 -23.861 -27.303 1.00 27.34  ? 1154 HOH A O     1 
HETATM 7973 O  O     . HOH M 8 .   ? 38.889  9.557   -32.492 1.00 48.60  ? 1155 HOH A O     1 
HETATM 7974 O  O     . HOH M 8 .   ? 35.675  -13.697 -17.607 1.00 38.88  ? 1156 HOH A O     1 
HETATM 7975 O  O     . HOH M 8 .   ? -15.285 -32.391 -41.591 1.00 36.42  ? 1157 HOH A O     1 
HETATM 7976 O  O     . HOH M 8 .   ? -31.559 -16.433 -18.768 1.00 44.52  ? 1158 HOH A O     1 
HETATM 7977 O  O     . HOH M 8 .   ? -14.653 -5.596  -22.866 1.00 32.84  ? 1159 HOH A O     1 
HETATM 7978 O  O     . HOH M 8 .   ? 25.931  -8.610  -20.199 1.00 31.70  ? 1160 HOH A O     1 
HETATM 7979 O  O     . HOH M 8 .   ? 23.836  18.757  -36.815 1.00 38.79  ? 1161 HOH A O     1 
HETATM 7980 O  O     . HOH M 8 .   ? 17.106  -25.945 -42.900 1.00 35.25  ? 1162 HOH A O     1 
HETATM 7981 O  O     . HOH M 8 .   ? 19.103  15.978  -29.519 1.00 48.73  ? 1163 HOH A O     1 
HETATM 7982 O  O     . HOH M 8 .   ? -3.879  -35.543 -48.058 1.00 47.00  ? 1164 HOH A O     1 
HETATM 7983 O  O     . HOH M 8 .   ? 19.045  -7.578  -44.285 1.00 33.89  ? 1165 HOH A O     1 
HETATM 7984 O  O     . HOH M 8 .   ? 10.723  -9.462  -52.212 1.00 34.40  ? 1166 HOH A O     1 
HETATM 7985 O  O     . HOH M 8 .   ? 4.537   -27.497 -53.296 1.00 34.46  ? 1167 HOH A O     1 
HETATM 7986 O  O     . HOH M 8 .   ? -12.261 -25.928 -37.947 1.00 37.13  ? 1168 HOH A O     1 
HETATM 7987 O  O     . HOH M 8 .   ? 20.733  -6.824  -51.092 1.00 42.50  ? 1169 HOH A O     1 
HETATM 7988 O  O     . HOH M 8 .   ? 22.950  -15.390 -26.795 1.00 29.65  ? 1170 HOH A O     1 
HETATM 7989 O  O     . HOH M 8 .   ? 2.412   -41.840 -8.777  1.00 40.42  ? 1171 HOH A O     1 
HETATM 7990 O  O     . HOH M 8 .   ? -19.722 -9.799  -10.024 1.00 43.93  ? 1172 HOH A O     1 
HETATM 7991 O  O     . HOH M 8 .   ? 9.805   -12.328 -37.189 1.00 28.05  ? 1173 HOH A O     1 
HETATM 7992 O  O     . HOH M 8 .   ? 10.189  -12.946 -22.800 1.00 38.47  ? 1174 HOH A O     1 
HETATM 7993 O  O     . HOH M 8 .   ? 2.736   11.573  -38.573 1.00 40.59  ? 1175 HOH A O     1 
HETATM 7994 O  O     . HOH M 8 .   ? 23.962  -14.682 -0.512  1.00 45.36  ? 1176 HOH A O     1 
HETATM 7995 O  O     . HOH M 8 .   ? 13.963  2.965   -35.230 1.00 40.03  ? 1177 HOH A O     1 
HETATM 7996 O  O     . HOH M 8 .   ? 25.633  20.556  -36.518 1.00 48.41  ? 1178 HOH A O     1 
HETATM 7997 O  O     . HOH M 8 .   ? -20.916 -31.812 -20.185 1.00 29.51  ? 1179 HOH A O     1 
HETATM 7998 O  O     . HOH M 8 .   ? -6.265  -29.917 -29.829 1.00 43.43  ? 1180 HOH A O     1 
HETATM 7999 O  O     . HOH M 8 .   ? 14.186  -43.846 -23.795 1.00 59.33  ? 1181 HOH A O     1 
HETATM 8000 O  O     . HOH M 8 .   ? 22.360  -15.258 -37.837 1.00 30.29  ? 1182 HOH A O     1 
HETATM 8001 O  O     . HOH M 8 .   ? 33.496  13.425  -23.464 1.00 45.07  ? 1183 HOH A O     1 
HETATM 8002 O  O     . HOH M 8 .   ? 4.880   -25.215 0.284   1.00 33.72  ? 1184 HOH A O     1 
HETATM 8003 O  O     . HOH M 8 .   ? 29.225  -21.628 -20.057 1.00 39.08  ? 1185 HOH A O     1 
HETATM 8004 O  O     . HOH M 8 .   ? -31.406 -14.863 -16.385 1.00 43.63  ? 1186 HOH A O     1 
HETATM 8005 O  O     . HOH M 8 .   ? 24.623  -13.970 -38.165 1.00 34.18  ? 1187 HOH A O     1 
HETATM 8006 O  O     . HOH M 8 .   ? 18.586  -29.170 3.119   1.00 45.27  ? 1188 HOH A O     1 
HETATM 8007 O  O     . HOH M 8 .   ? -9.579  -4.132  -62.260 1.00 41.87  ? 1189 HOH A O     1 
HETATM 8008 O  O     . HOH M 8 .   ? 19.808  20.220  -37.694 1.00 35.47  ? 1190 HOH A O     1 
HETATM 8009 O  O     . HOH M 8 .   ? 15.503  -2.349  -55.784 1.00 46.05  ? 1191 HOH A O     1 
HETATM 8010 O  O     . HOH M 8 .   ? 13.041  13.160  -47.308 1.00 42.70  ? 1192 HOH A O     1 
HETATM 8011 O  O     . HOH M 8 .   ? 0.528   -12.316 -40.297 1.00 31.47  ? 1193 HOH A O     1 
HETATM 8012 O  O     . HOH M 8 .   ? -0.449  -29.167 -0.928  1.00 35.23  ? 1194 HOH A O     1 
HETATM 8013 O  O     . HOH M 8 .   ? -3.502  6.561   -51.561 1.00 41.90  ? 1195 HOH A O     1 
HETATM 8014 O  O     . HOH M 8 .   ? 19.310  -2.609  -27.490 1.00 44.68  ? 1196 HOH A O     1 
HETATM 8015 O  O     . HOH M 8 .   ? 4.481   -12.153 -28.117 1.00 35.31  ? 1197 HOH A O     1 
HETATM 8016 O  O     . HOH M 8 .   ? -21.568 -21.204 -26.414 1.00 27.15  ? 1198 HOH A O     1 
HETATM 8017 O  O     . HOH M 8 .   ? 26.498  18.949  -43.530 1.00 41.89  ? 1199 HOH A O     1 
HETATM 8018 O  O     . HOH M 8 .   ? 0.962   -25.890 -50.278 1.00 36.72  ? 1200 HOH A O     1 
HETATM 8019 O  O     . HOH M 8 .   ? -8.299  -21.650 -31.936 1.00 43.09  ? 1201 HOH A O     1 
HETATM 8020 O  O     . HOH M 8 .   ? -12.494 -27.888 -34.015 1.00 36.97  ? 1202 HOH A O     1 
HETATM 8021 O  O     . HOH M 8 .   ? 14.601  10.256  -38.048 1.00 43.56  ? 1203 HOH A O     1 
HETATM 8022 O  O     . HOH M 8 .   ? -14.361 -2.711  -52.364 1.00 39.61  ? 1204 HOH A O     1 
HETATM 8023 O  O     . HOH M 8 .   ? 13.731  -44.810 -12.352 1.00 41.56  ? 1205 HOH A O     1 
HETATM 8024 O  O     . HOH M 8 .   ? 18.789  -18.479 -43.098 1.00 48.73  ? 1206 HOH A O     1 
HETATM 8025 O  O     . HOH M 8 .   ? -10.986 -25.261 -25.893 1.00 26.77  ? 1207 HOH A O     1 
HETATM 8026 O  O     . HOH M 8 .   ? 22.100  19.868  -38.489 1.00 36.49  ? 1208 HOH A O     1 
HETATM 8027 O  O     . HOH M 8 .   ? 13.842  -40.563 -41.905 1.00 41.33  ? 1209 HOH A O     1 
HETATM 8028 O  O     . HOH M 8 .   ? 27.099  5.914   -30.688 1.00 37.65  ? 1210 HOH A O     1 
HETATM 8029 O  O     . HOH M 8 .   ? -12.838 -28.195 -36.418 1.00 31.66  ? 1211 HOH A O     1 
HETATM 8030 O  O     . HOH M 8 .   ? 14.126  -4.283  -27.794 1.00 36.53  ? 1212 HOH A O     1 
HETATM 8031 O  O     . HOH M 8 .   ? 14.265  -28.438 -27.293 1.00 30.30  ? 1213 HOH A O     1 
HETATM 8032 O  O     . HOH M 8 .   ? 28.063  -26.594 -17.660 1.00 45.15  ? 1214 HOH A O     1 
HETATM 8033 O  O     . HOH M 8 .   ? -9.568  -12.205 -47.992 1.00 36.96  ? 1215 HOH A O     1 
HETATM 8034 O  O     . HOH M 8 .   ? 21.401  -16.112 -40.127 1.00 46.72  ? 1216 HOH A O     1 
HETATM 8035 O  O     . HOH M 8 .   ? 31.182  -15.272 -34.906 1.00 45.05  ? 1217 HOH A O     1 
HETATM 8036 O  O     . HOH M 8 .   ? -30.063 -26.923 -19.204 1.00 49.24  ? 1218 HOH A O     1 
HETATM 8037 O  O     . HOH M 8 .   ? -12.901 -13.864 -10.900 1.00 45.15  ? 1219 HOH A O     1 
HETATM 8038 O  O     . HOH M 8 .   ? 22.239  3.950   -25.267 1.00 44.06  ? 1220 HOH A O     1 
HETATM 8039 O  O     . HOH M 8 .   ? -2.121  -15.728 -21.998 1.00 40.87  ? 1221 HOH A O     1 
HETATM 8040 O  O     . HOH M 8 .   ? -6.882  -6.370  -20.535 1.00 49.70  ? 1222 HOH A O     1 
HETATM 8041 O  O     . HOH M 8 .   ? 17.014  -25.219 -22.452 1.00 29.42  ? 1223 HOH A O     1 
HETATM 8042 O  O     . HOH M 8 .   ? 9.361   -9.972  -36.434 1.00 31.02  ? 1224 HOH A O     1 
HETATM 8043 O  O     . HOH M 8 .   ? -5.243  -19.100 -20.916 1.00 44.91  ? 1225 HOH A O     1 
HETATM 8044 O  O     . HOH M 8 .   ? -24.536 -15.235 -45.792 1.00 42.96  ? 1226 HOH A O     1 
HETATM 8045 O  O     . HOH M 8 .   ? 24.823  -8.684  -5.094  1.00 43.59  ? 1227 HOH A O     1 
HETATM 8046 O  O     . HOH M 8 .   ? 13.881  -30.222 -53.425 1.00 49.34  ? 1228 HOH A O     1 
HETATM 8047 O  O     . HOH M 8 .   ? 12.183  -9.705  -19.725 1.00 46.21  ? 1229 HOH A O     1 
HETATM 8048 O  O     . HOH M 8 .   ? 22.011  -13.255 2.726   1.00 38.33  ? 1230 HOH A O     1 
HETATM 8049 O  O     . HOH M 8 .   ? 36.496  -6.700  -17.516 1.00 41.30  ? 1231 HOH A O     1 
HETATM 8050 O  O     . HOH M 8 .   ? 40.148  -19.095 -24.027 1.00 50.16  ? 1232 HOH A O     1 
HETATM 8051 O  O     . HOH M 8 .   ? 5.694   -5.085  -62.596 1.00 41.39  ? 1233 HOH A O     1 
HETATM 8052 O  O     . HOH M 8 .   ? 4.961   -20.574 -37.309 1.00 29.02  ? 1234 HOH A O     1 
HETATM 8053 O  O     . HOH M 8 .   ? -19.041 -11.617 -26.118 1.00 49.82  ? 1235 HOH A O     1 
HETATM 8054 O  O     . HOH M 8 .   ? 3.951   -24.834 -38.465 1.00 27.80  ? 1236 HOH A O     1 
HETATM 8055 O  O     . HOH M 8 .   ? 2.084   -13.466 -22.686 1.00 40.87  ? 1237 HOH A O     1 
HETATM 8056 O  O     . HOH M 8 .   ? 20.438  -13.322 -47.913 1.00 40.61  ? 1238 HOH A O     1 
HETATM 8057 O  O     . HOH M 8 .   ? 20.947  -12.285 -50.490 1.00 40.61  ? 1239 HOH A O     1 
HETATM 8058 O  O     . HOH M 8 .   ? 8.156   -22.528 -16.729 1.00 48.15  ? 1240 HOH A O     1 
HETATM 8059 O  O     . HOH M 8 .   ? -21.033 -8.084  -26.221 1.00 42.41  ? 1241 HOH A O     1 
HETATM 8060 O  O     . HOH M 8 .   ? 16.228  25.515  -25.849 1.00 38.83  ? 1242 HOH A O     1 
HETATM 8061 O  O     . HOH M 8 .   ? -4.916  -32.583 -4.839  1.00 48.75  ? 1243 HOH A O     1 
HETATM 8062 O  O     . HOH M 8 .   ? -24.738 -15.733 -33.659 1.00 31.33  ? 1244 HOH A O     1 
HETATM 8063 O  O     . HOH M 8 .   ? -8.598  -38.539 -59.486 1.00 45.94  ? 1245 HOH A O     1 
HETATM 8064 O  O     . HOH M 8 .   ? -10.096 -23.041 -35.814 1.00 33.77  ? 1246 HOH A O     1 
HETATM 8065 O  O     . HOH M 8 .   ? -5.619  -20.179 -34.817 1.00 51.44  ? 1247 HOH A O     1 
HETATM 8066 O  O     . HOH M 8 .   ? 25.096  -22.790 -33.851 1.00 36.27  ? 1248 HOH A O     1 
HETATM 8067 O  O     . HOH M 8 .   ? -12.243 -39.102 -59.739 1.00 48.94  ? 1249 HOH A O     1 
HETATM 8068 O  O     . HOH M 8 .   ? 6.196   -19.651 -14.770 1.00 34.08  ? 1250 HOH A O     1 
HETATM 8069 O  O     . HOH M 8 .   ? 3.631   -12.182 -62.526 1.00 38.05  ? 1251 HOH A O     1 
HETATM 8070 O  O     . HOH M 8 .   ? 11.386  6.185   -45.135 1.00 27.57  ? 1252 HOH A O     1 
HETATM 8071 O  O     . HOH M 8 .   ? 2.198   -9.740  -8.313  1.00 40.94  ? 1253 HOH A O     1 
HETATM 8072 O  O     . HOH M 8 .   ? -17.249 -15.575 -27.786 1.00 34.77  ? 1254 HOH A O     1 
HETATM 8073 O  O     . HOH M 8 .   ? -28.257 -16.271 -22.964 1.00 37.49  ? 1255 HOH A O     1 
HETATM 8074 O  O     . HOH M 8 .   ? 2.529   -11.394 -30.093 1.00 42.26  ? 1256 HOH A O     1 
HETATM 8075 O  O     . HOH M 8 .   ? -31.596 -31.295 -42.587 1.00 36.46  ? 1257 HOH A O     1 
HETATM 8076 O  O     . HOH M 8 .   ? -15.544 -13.465 -31.597 1.00 40.89  ? 1258 HOH A O     1 
HETATM 8077 O  O     . HOH M 8 .   ? 15.009  -25.985 -26.410 1.00 32.35  ? 1259 HOH A O     1 
HETATM 8078 O  O     . HOH M 8 .   ? 7.462   13.685  -63.644 1.00 41.69  ? 1260 HOH A O     1 
HETATM 8079 O  O     . HOH M 8 .   ? -13.853 -21.989 -12.570 1.00 28.68  ? 1261 HOH A O     1 
HETATM 8080 O  O     . HOH M 8 .   ? -27.890 -15.459 -8.033  1.00 49.95  ? 1262 HOH A O     1 
HETATM 8081 O  O     . HOH M 8 .   ? 29.165  -4.496  -37.796 1.00 49.45  ? 1263 HOH A O     1 
HETATM 8082 O  O     . HOH M 8 .   ? 6.285   10.589  -68.839 1.00 53.34  ? 1264 HOH A O     1 
HETATM 8083 O  O     . HOH M 8 .   ? -5.262  -33.690 -55.094 1.00 47.66  ? 1265 HOH A O     1 
HETATM 8084 O  O     . HOH M 8 .   ? 14.456  -24.812 -42.573 1.00 38.10  ? 1266 HOH A O     1 
HETATM 8085 O  O     . HOH M 8 .   ? 9.302   -22.540 3.920   1.00 37.09  ? 1267 HOH A O     1 
HETATM 8086 O  O     . HOH M 8 .   ? 34.577  -10.219 -29.068 1.00 43.93  ? 1268 HOH A O     1 
HETATM 8087 O  O     . HOH M 8 .   ? 10.089  -29.629 -36.287 1.00 35.94  ? 1269 HOH A O     1 
HETATM 8088 O  O     . HOH M 8 .   ? 12.265  -7.520  -25.938 1.00 43.84  ? 1270 HOH A O     1 
HETATM 8089 O  O     . HOH M 8 .   ? -21.987 -15.862 -39.370 1.00 33.39  ? 1271 HOH A O     1 
HETATM 8090 O  O     . HOH M 8 .   ? 20.426  -21.816 -33.338 1.00 50.10  ? 1272 HOH A O     1 
HETATM 8091 O  O     . HOH M 8 .   ? 8.930   -32.537 -30.094 1.00 32.85  ? 1273 HOH A O     1 
HETATM 8092 O  O     . HOH M 8 .   ? 29.293  16.029  -23.327 1.00 46.43  ? 1274 HOH A O     1 
HETATM 8093 O  O     . HOH M 8 .   ? -12.141 -37.587 -56.920 1.00 41.30  ? 1275 HOH A O     1 
HETATM 8094 O  O     . HOH M 8 .   ? -18.691 -34.427 -26.068 1.00 46.21  ? 1276 HOH A O     1 
HETATM 8095 O  O     . HOH M 8 .   ? 2.613   4.668   -35.325 1.00 34.84  ? 1277 HOH A O     1 
HETATM 8096 O  O     . HOH M 8 .   ? 19.948  -32.103 -1.528  1.00 44.47  ? 1278 HOH A O     1 
HETATM 8097 O  O     . HOH M 8 .   ? -4.591  -4.249  -71.829 1.00 44.36  ? 1279 HOH A O     1 
HETATM 8098 O  O     . HOH M 8 .   ? 3.666   13.570  -64.569 1.00 41.13  ? 1280 HOH A O     1 
HETATM 8099 O  O     . HOH M 8 .   ? 1.146   13.227  -63.860 1.00 36.43  ? 1281 HOH A O     1 
HETATM 8100 O  O     . HOH M 8 .   ? 13.820  10.697  -46.290 1.00 26.91  ? 1282 HOH A O     1 
HETATM 8101 O  O     . HOH M 8 .   ? 6.986   -8.434  -36.435 1.00 27.60  ? 1283 HOH A O     1 
HETATM 8102 O  O     . HOH M 8 .   ? -16.505 -20.446 -60.511 1.00 52.05  ? 1284 HOH A O     1 
HETATM 8103 O  O     . HOH M 8 .   ? 22.426  0.239   -50.024 1.00 48.81  ? 1285 HOH A O     1 
HETATM 8104 O  O     . HOH M 8 .   ? 14.732  -28.798 -41.103 1.00 41.13  ? 1286 HOH A O     1 
HETATM 8105 O  O     . HOH M 8 .   ? 3.706   -26.207 -40.637 1.00 45.74  ? 1287 HOH A O     1 
HETATM 8106 O  O     . HOH M 8 .   ? -15.325 -31.676 -38.996 1.00 27.72  ? 1288 HOH A O     1 
HETATM 8107 O  O     . HOH M 8 .   ? -6.858  -28.011 -28.659 1.00 46.66  ? 1289 HOH A O     1 
HETATM 8108 O  O     . HOH M 8 .   ? -13.500 -9.199  -62.236 1.00 39.50  ? 1290 HOH A O     1 
HETATM 8109 O  O     . HOH M 8 .   ? 13.363  -27.330 -42.781 1.00 32.51  ? 1291 HOH A O     1 
HETATM 8110 O  O     . HOH M 8 .   ? -12.902 -0.796  -51.362 1.00 45.98  ? 1292 HOH A O     1 
HETATM 8111 O  O     . HOH M 8 .   ? -3.882  -14.924 -28.369 1.00 42.23  ? 1293 HOH A O     1 
HETATM 8112 O  O     . HOH M 8 .   ? 10.204  13.103  -64.300 1.00 50.28  ? 1294 HOH A O     1 
HETATM 8113 O  O     . HOH M 8 .   ? -19.346 -10.042 -7.169  1.00 46.33  ? 1295 HOH A O     1 
HETATM 8114 O  O     . HOH M 8 .   ? -13.616 -12.547 -41.928 1.00 34.19  ? 1296 HOH A O     1 
HETATM 8115 O  O     . HOH M 8 .   ? 28.788  -26.041 -14.601 1.00 47.12  ? 1297 HOH A O     1 
HETATM 8116 O  O     . HOH M 8 .   ? -3.746  7.605   -57.910 1.00 35.83  ? 1298 HOH A O     1 
HETATM 8117 O  O     . HOH M 8 .   ? 9.376   -10.894 -56.155 1.00 39.26  ? 1299 HOH A O     1 
HETATM 8118 O  O     . HOH M 8 .   ? -25.576 -3.041  -19.272 1.00 38.56  ? 1300 HOH A O     1 
HETATM 8119 O  O     . HOH M 8 .   ? 5.206   10.860  -42.644 1.00 31.59  ? 1301 HOH A O     1 
HETATM 8120 O  O     . HOH M 8 .   ? 25.998  -19.241 -37.253 1.00 44.40  ? 1302 HOH A O     1 
HETATM 8121 O  O     . HOH M 8 .   ? -30.091 -17.956 -50.894 1.00 53.12  ? 1303 HOH A O     1 
HETATM 8122 O  O     . HOH M 8 .   ? 11.424  -39.621 2.224   1.00 52.09  ? 1304 HOH A O     1 
HETATM 8123 O  O     . HOH M 8 .   ? 18.549  17.719  -31.418 1.00 37.40  ? 1305 HOH A O     1 
HETATM 8124 O  O     . HOH M 8 .   ? -30.215 -18.170 -22.310 1.00 41.66  ? 1306 HOH A O     1 
HETATM 8125 O  O     . HOH M 8 .   ? 23.129  -36.048 -22.002 1.00 44.94  ? 1307 HOH A O     1 
HETATM 8126 O  O     . HOH M 8 .   ? 11.928  -11.599 -56.094 1.00 59.83  ? 1308 HOH A O     1 
HETATM 8127 O  O     . HOH M 8 .   ? 18.332  9.066   -32.266 1.00 39.34  ? 1309 HOH A O     1 
HETATM 8128 O  O     . HOH M 8 .   ? 7.970   -28.333 8.550   1.00 46.38  ? 1310 HOH A O     1 
HETATM 8129 O  O     . HOH M 8 .   ? 15.572  -10.056 -17.579 1.00 36.77  ? 1311 HOH A O     1 
HETATM 8130 O  O     . HOH M 8 .   ? 3.200   -11.768 -34.795 1.00 37.22  ? 1312 HOH A O     1 
HETATM 8131 O  O     . HOH M 8 .   ? 20.895  10.006  -33.342 1.00 31.50  ? 1313 HOH A O     1 
HETATM 8132 O  O     . HOH M 8 .   ? 5.612   -10.183 -56.328 1.00 36.77  ? 1314 HOH A O     1 
HETATM 8133 O  O     . HOH M 8 .   ? 9.324   -49.004 -7.043  1.00 49.81  ? 1315 HOH A O     1 
HETATM 8134 O  O     . HOH M 8 .   ? -22.631 -35.191 -21.929 1.00 45.65  ? 1316 HOH A O     1 
HETATM 8135 O  O     . HOH M 8 .   ? 25.705  -11.159 -37.911 1.00 40.08  ? 1317 HOH A O     1 
HETATM 8136 O  O     . HOH M 8 .   ? -13.051 -27.495 -8.379  1.00 43.51  ? 1318 HOH A O     1 
HETATM 8137 O  O     . HOH M 8 .   ? 2.858   -21.110 -38.973 1.00 43.94  ? 1319 HOH A O     1 
HETATM 8138 O  O     . HOH M 8 .   ? -20.686 -9.399  -46.110 1.00 43.64  ? 1320 HOH A O     1 
HETATM 8139 O  O     . HOH M 8 .   ? 29.681  -22.405 -23.050 1.00 36.98  ? 1321 HOH A O     1 
HETATM 8140 O  O     . HOH M 8 .   ? -25.878 -31.369 -13.326 1.00 50.86  ? 1322 HOH A O     1 
HETATM 8141 O  O     . HOH M 8 .   ? 21.285  -2.167  -20.740 1.00 38.33  ? 1323 HOH A O     1 
HETATM 8142 O  O     . HOH M 8 .   ? 28.978  -26.552 -24.811 1.00 43.80  ? 1324 HOH A O     1 
HETATM 8143 O  O     . HOH M 8 .   ? 30.140  -25.009 -23.278 1.00 44.67  ? 1325 HOH A O     1 
HETATM 8144 O  O     . HOH M 8 .   ? 15.074  -19.821 -38.249 1.00 30.16  ? 1326 HOH A O     1 
HETATM 8145 O  O     . HOH M 8 .   ? 5.361   -13.868 -19.795 1.00 45.03  ? 1327 HOH A O     1 
HETATM 8146 O  O     . HOH M 8 .   ? 6.943   -8.110  -1.534  1.00 47.92  ? 1328 HOH A O     1 
HETATM 8147 O  O     . HOH M 8 .   ? 23.113  -24.959 -25.564 1.00 34.81  ? 1329 HOH A O     1 
HETATM 8148 O  O     . HOH M 8 .   ? -18.958 -14.718 -25.741 1.00 40.70  ? 1330 HOH A O     1 
HETATM 8149 O  O     . HOH M 8 .   ? 15.000  -24.171 -39.955 1.00 42.20  ? 1331 HOH A O     1 
HETATM 8150 O  O     . HOH M 8 .   ? 2.642   -24.043 -8.276  1.00 45.95  ? 1332 HOH A O     1 
HETATM 8151 O  O     . HOH M 8 .   ? -0.579  -19.419 -19.503 1.00 36.48  ? 1333 HOH A O     1 
HETATM 8152 O  O     . HOH M 8 .   ? -31.925 -19.950 -40.435 1.00 50.62  ? 1334 HOH A O     1 
HETATM 8153 O  O     . HOH M 8 .   ? 1.506   -25.583 -6.560  1.00 52.55  ? 1335 HOH A O     1 
HETATM 8154 O  O     . HOH M 8 .   ? 17.330  1.683   -31.603 1.00 37.11  ? 1336 HOH A O     1 
HETATM 8155 O  O     . HOH M 8 .   ? -5.369  -19.282 -52.641 1.00 35.94  ? 1337 HOH A O     1 
HETATM 8156 O  O     . HOH M 8 .   ? -3.103  -11.367 -18.639 1.00 52.95  ? 1338 HOH A O     1 
HETATM 8157 O  O     . HOH M 8 .   ? 1.039   4.683   -37.191 1.00 39.51  ? 1339 HOH A O     1 
HETATM 8158 O  O     . HOH M 8 .   ? -22.854 -26.834 -58.311 1.00 51.43  ? 1340 HOH A O     1 
HETATM 8159 O  O     . HOH M 8 .   ? -20.914 -25.141 -57.819 1.00 42.26  ? 1341 HOH A O     1 
HETATM 8160 O  O     . HOH M 8 .   ? -4.938  4.541   -51.674 1.00 35.34  ? 1342 HOH A O     1 
HETATM 8161 O  O     . HOH M 8 .   ? -22.021 -10.244 -48.464 1.00 44.90  ? 1343 HOH A O     1 
HETATM 8162 O  O     . HOH M 8 .   ? 11.935  -1.331  -29.776 1.00 44.79  ? 1344 HOH A O     1 
HETATM 8163 O  O     . HOH M 8 .   ? -28.058 -12.074 -25.312 1.00 54.46  ? 1345 HOH A O     1 
HETATM 8164 O  O     . HOH M 8 .   ? 28.424  -30.173 -19.023 1.00 49.17  ? 1346 HOH A O     1 
HETATM 8165 O  O     . HOH M 8 .   ? -0.063  10.710  -64.434 1.00 59.33  ? 1347 HOH A O     1 
HETATM 8166 O  O     . HOH M 8 .   ? -24.210 -17.774 -25.684 1.00 41.70  ? 1348 HOH A O     1 
HETATM 8167 O  O     . HOH M 8 .   ? 35.792  2.268   -26.370 1.00 52.68  ? 1349 HOH A O     1 
HETATM 8168 O  O     . HOH M 8 .   ? 10.381  -6.365  -5.956  1.00 43.21  ? 1350 HOH A O     1 
HETATM 8169 O  O     . HOH M 8 .   ? 12.790  -5.309  -64.914 1.00 48.22  ? 1351 HOH A O     1 
HETATM 8170 O  O     . HOH M 8 .   ? 8.328   -38.703 -24.749 1.00 45.12  ? 1352 HOH A O     1 
HETATM 8171 O  O     . HOH M 8 .   ? -8.600  -23.431 -43.893 1.00 44.61  ? 1353 HOH A O     1 
HETATM 8172 O  O     . HOH M 8 .   ? -34.345 -19.777 -21.364 1.00 53.79  ? 1354 HOH A O     1 
HETATM 8173 O  O     . HOH M 8 .   ? -12.248 -6.352  -65.887 1.00 52.29  ? 1355 HOH A O     1 
HETATM 8174 O  O     . HOH M 8 .   ? -10.803 -25.612 -40.437 1.00 57.57  ? 1356 HOH A O     1 
HETATM 8175 O  O     . HOH M 8 .   ? 5.877   -37.124 -24.103 1.00 54.92  ? 1357 HOH A O     1 
HETATM 8176 O  O     . HOH M 8 .   ? -15.489 -32.272 -18.682 1.00 43.21  ? 1358 HOH A O     1 
HETATM 8177 O  O     . HOH M 8 .   ? 15.752  -10.026 -20.866 1.00 37.95  ? 1359 HOH A O     1 
HETATM 8178 O  O     . HOH M 8 .   ? 5.132   -33.096 -44.425 1.00 36.50  ? 1360 HOH A O     1 
HETATM 8179 O  O     . HOH M 8 .   ? 30.242  7.796   -46.736 1.00 46.06  ? 1361 HOH A O     1 
HETATM 8180 O  O     . HOH M 8 .   ? 7.423   14.966  -50.770 1.00 39.47  ? 1362 HOH A O     1 
HETATM 8181 O  O     . HOH M 8 .   ? -2.203  -13.321 -50.496 1.00 38.64  ? 1363 HOH A O     1 
HETATM 8182 O  O     . HOH M 8 .   ? -15.162 -19.373 -65.901 1.00 47.30  ? 1364 HOH A O     1 
HETATM 8183 O  O     . HOH M 8 .   ? -0.648  -15.362 -31.424 1.00 53.28  ? 1365 HOH A O     1 
HETATM 8184 O  O     . HOH M 8 .   ? 2.228   -14.339 -2.872  1.00 39.72  ? 1366 HOH A O     1 
HETATM 8185 O  O     . HOH M 8 .   ? -20.549 -19.283 -34.082 1.00 49.49  ? 1367 HOH A O     1 
HETATM 8186 O  O     . HOH M 8 .   ? -3.430  11.087  -41.724 1.00 47.62  ? 1368 HOH A O     1 
HETATM 8187 O  O     . HOH M 8 .   ? 3.458   15.930  -62.529 1.00 46.34  ? 1369 HOH A O     1 
HETATM 8188 O  O     . HOH M 8 .   ? 2.528   12.333  -53.539 1.00 47.22  ? 1370 HOH A O     1 
HETATM 8189 O  O     . HOH M 8 .   ? 17.102  -41.170 -19.721 1.00 55.06  ? 1371 HOH A O     1 
HETATM 8190 O  O     . HOH M 8 .   ? 4.470   -37.721 0.687   1.00 33.02  ? 1372 HOH A O     1 
HETATM 8191 O  O     . HOH M 8 .   ? -5.145  -16.194 -22.063 1.00 31.97  ? 1373 HOH A O     1 
HETATM 8192 O  O     . HOH M 8 .   ? -10.511 -23.167 -31.267 1.00 40.44  ? 1374 HOH A O     1 
HETATM 8193 O  O     . HOH M 8 .   ? 2.486   -26.469 -36.363 1.00 38.61  ? 1375 HOH A O     1 
HETATM 8194 O  O     . HOH M 8 .   ? -13.404 -29.200 -26.154 1.00 35.56  ? 1376 HOH A O     1 
HETATM 8195 O  O     . HOH M 8 .   ? -5.482  -28.659 -26.674 1.00 39.33  ? 1377 HOH A O     1 
HETATM 8196 O  O     . HOH M 8 .   ? 19.094  -37.643 -8.963  1.00 41.22  ? 1378 HOH A O     1 
HETATM 8197 O  O     . HOH M 8 .   ? 3.625   -38.918 -2.397  1.00 41.40  ? 1379 HOH A O     1 
HETATM 8198 O  O     . HOH M 8 .   ? 10.848  -25.420 -19.937 1.00 40.96  ? 1380 HOH A O     1 
HETATM 8199 O  O     . HOH M 8 .   ? 22.702  1.510   -24.306 1.00 53.17  ? 1381 HOH A O     1 
HETATM 8200 O  O     . HOH M 8 .   ? 10.540  8.123   -35.190 1.00 50.41  ? 1382 HOH A O     1 
HETATM 8201 O  O     . HOH M 8 .   ? -11.194 -27.892 -25.913 1.00 29.05  ? 1383 HOH A O     1 
HETATM 8202 O  O     . HOH M 8 .   ? 20.672  16.067  -44.352 1.00 44.82  ? 1384 HOH A O     1 
HETATM 8203 O  O     . HOH M 8 .   ? 21.593  -25.419 -27.643 1.00 46.12  ? 1385 HOH A O     1 
HETATM 8204 O  O     . HOH M 8 .   ? 16.207  7.906   -61.618 1.00 44.45  ? 1386 HOH A O     1 
HETATM 8205 O  O     . HOH M 8 .   ? -9.705  -28.806 -27.758 1.00 45.98  ? 1387 HOH A O     1 
HETATM 8206 O  O     . HOH M 8 .   ? 6.718   -38.166 -2.229  1.00 50.53  ? 1388 HOH A O     1 
HETATM 8207 O  O     . HOH M 8 .   ? -7.067  -17.883 -8.969  1.00 45.18  ? 1389 HOH A O     1 
HETATM 8208 O  O     . HOH M 8 .   ? -9.636  -27.688 -14.977 1.00 47.64  ? 1390 HOH A O     1 
HETATM 8209 O  O     . HOH M 8 .   ? -14.168 -30.894 -24.223 1.00 37.12  ? 1391 HOH A O     1 
HETATM 8210 O  O     . HOH M 8 .   ? -21.439 -15.186 -58.825 1.00 48.49  ? 1392 HOH A O     1 
HETATM 8211 O  O     . HOH M 8 .   ? -14.495 -29.301 -11.948 1.00 47.65  ? 1393 HOH A O     1 
HETATM 8212 O  O     . HOH M 8 .   ? 16.527  -39.678 -7.530  1.00 50.33  ? 1394 HOH A O     1 
HETATM 8213 O  O     . HOH M 8 .   ? -24.848 -39.102 -43.952 1.00 54.27  ? 1395 HOH A O     1 
HETATM 8214 O  O     . HOH M 8 .   ? 10.601  -26.620 -53.019 1.00 45.48  ? 1396 HOH A O     1 
HETATM 8215 O  O     . HOH M 8 .   ? 14.616  13.597  -49.755 1.00 43.15  ? 1397 HOH A O     1 
HETATM 8216 O  O     . HOH M 8 .   ? -22.572 -8.218  -52.443 1.00 48.44  ? 1398 HOH A O     1 
HETATM 8217 O  O     . HOH M 8 .   ? 31.261  16.261  -24.648 1.00 52.05  ? 1399 HOH A O     1 
HETATM 8218 O  O     . HOH M 8 .   ? 21.358  -9.405  -51.536 1.00 53.70  ? 1400 HOH A O     1 
HETATM 8219 O  O     . HOH M 8 .   ? -7.053  -9.703  -12.794 1.00 51.11  ? 1401 HOH A O     1 
HETATM 8220 O  O     . HOH M 8 .   ? -7.275  -2.330  -20.426 1.00 55.05  ? 1402 HOH A O     1 
HETATM 8221 O  O     . HOH M 8 .   ? 1.463   -29.827 -58.509 1.00 45.73  ? 1403 HOH A O     1 
HETATM 8222 O  O     . HOH M 8 .   ? -23.282 -37.799 -23.136 1.00 49.69  ? 1404 HOH A O     1 
HETATM 8223 O  O     . HOH M 8 .   ? 10.832  -48.053 -12.270 1.00 44.89  ? 1405 HOH A O     1 
HETATM 8224 O  O     . HOH M 8 .   ? 20.071  -3.035  -8.946  1.00 43.67  ? 1406 HOH A O     1 
HETATM 8225 O  O     . HOH M 8 .   ? 7.110   15.555  -61.693 1.00 44.31  ? 1407 HOH A O     1 
HETATM 8226 O  O     . HOH M 8 .   ? -13.691 -31.016 -28.267 1.00 40.74  ? 1408 HOH A O     1 
HETATM 8227 O  O     . HOH M 8 .   ? -9.971  -26.832 -21.980 1.00 45.80  ? 1409 HOH A O     1 
HETATM 8228 O  O     . HOH M 8 .   ? -17.147 -8.970  -9.833  1.00 45.22  ? 1410 HOH A O     1 
HETATM 8229 O  O     . HOH M 8 .   ? -29.809 -35.597 -26.089 1.00 42.76  ? 1411 HOH A O     1 
HETATM 8230 O  O     . HOH M 8 .   ? 17.417  4.152   -30.283 1.00 41.39  ? 1412 HOH A O     1 
HETATM 8231 O  O     . HOH M 8 .   ? 2.344   -36.655 -0.522  1.00 42.43  ? 1413 HOH A O     1 
HETATM 8232 O  O     . HOH M 8 .   ? -12.146 -8.562  -69.869 1.00 50.07  ? 1414 HOH A O     1 
HETATM 8233 O  O     . HOH M 8 .   ? -15.360 -3.995  -55.322 1.00 36.95  ? 1415 HOH A O     1 
HETATM 8234 O  O     . HOH M 8 .   ? 17.257  -26.005 -24.949 1.00 36.67  ? 1416 HOH A O     1 
HETATM 8235 O  O     . HOH M 8 .   ? 28.591  14.690  -18.010 1.00 67.45  ? 1417 HOH A O     1 
HETATM 8236 O  O     . HOH M 8 .   ? 1.775   -13.820 -12.317 1.00 45.87  ? 1418 HOH A O     1 
HETATM 8237 O  O     . HOH M 8 .   ? -32.422 -24.173 -44.885 1.00 53.51  ? 1419 HOH A O     1 
HETATM 8238 O  O     . HOH M 8 .   ? 20.110  12.944  -41.332 1.00 41.38  ? 1420 HOH A O     1 
HETATM 8239 O  O     . HOH M 8 .   ? -19.546 -33.097 -17.928 1.00 45.33  ? 1421 HOH A O     1 
HETATM 8240 O  O     . HOH M 8 .   ? 4.103   -34.956 -53.389 1.00 47.99  ? 1422 HOH A O     1 
HETATM 8241 O  O     . HOH M 8 .   ? -30.573 -18.507 -38.608 1.00 48.20  ? 1423 HOH A O     1 
HETATM 8242 O  O     . HOH M 8 .   ? 1.632   -29.039 0.776   1.00 45.45  ? 1424 HOH A O     1 
HETATM 8243 O  O     . HOH M 8 .   ? -4.012  -6.863  -20.802 1.00 53.61  ? 1425 HOH A O     1 
HETATM 8244 O  O     . HOH M 8 .   ? -14.225 -37.505 -36.080 1.00 51.04  ? 1426 HOH A O     1 
HETATM 8245 O  O     . HOH M 8 .   ? 32.345  -22.341 -23.259 1.00 43.27  ? 1427 HOH A O     1 
HETATM 8246 O  O     . HOH M 8 .   ? 3.378   -33.114 -32.901 1.00 44.47  ? 1428 HOH A O     1 
HETATM 8247 O  O     . HOH M 8 .   ? 21.995  4.354   -48.874 1.00 52.23  ? 1429 HOH A O     1 
HETATM 8248 O  O     . HOH M 8 .   ? -0.514  -14.059 -2.865  1.00 40.19  ? 1430 HOH A O     1 
HETATM 8249 O  O     . HOH M 8 .   ? -7.617  -8.776  -26.085 1.00 41.21  ? 1431 HOH A O     1 
HETATM 8250 O  O     . HOH M 8 .   ? 15.561  -11.018 -59.470 1.00 55.07  ? 1432 HOH A O     1 
HETATM 8251 O  O     . HOH M 8 .   ? 26.516  -2.294  -46.584 1.00 48.47  ? 1433 HOH A O     1 
HETATM 8252 O  O     . HOH M 8 .   ? -23.794 -13.328 -47.822 1.00 54.46  ? 1434 HOH A O     1 
HETATM 8253 O  O     . HOH M 8 .   ? 33.163  -21.789 -21.144 1.00 47.67  ? 1435 HOH A O     1 
HETATM 8254 O  O     . HOH M 8 .   ? 33.925  -6.092  -14.262 1.00 56.63  ? 1436 HOH A O     1 
HETATM 8255 O  O     . HOH M 8 .   ? -11.054 -1.966  -16.328 1.00 50.77  ? 1437 HOH A O     1 
HETATM 8256 O  O     . HOH M 8 .   ? 8.280   -20.456 5.475   1.00 51.13  ? 1438 HOH A O     1 
HETATM 8257 O  O     . HOH M 8 .   ? 14.848  6.190   -33.664 1.00 41.29  ? 1439 HOH A O     1 
HETATM 8258 O  O     . HOH M 8 .   ? 12.708  7.624   -33.416 1.00 46.60  ? 1440 HOH A O     1 
HETATM 8259 O  O     . HOH M 8 .   ? -7.537  -18.293 -19.937 1.00 39.67  ? 1441 HOH A O     1 
HETATM 8260 O  O     . HOH M 8 .   ? -7.292  -17.588 -17.602 1.00 40.81  ? 1442 HOH A O     1 
HETATM 8261 O  O     . HOH M 8 .   ? -8.859  -16.191 -16.530 1.00 48.50  ? 1443 HOH A O     1 
HETATM 8262 O  O     . HOH M 8 .   ? 31.688  -11.467 -42.619 1.00 50.50  ? 1444 HOH A O     1 
HETATM 8263 O  O     . HOH M 8 .   ? -1.889  -2.661  -46.334 1.00 29.03  ? 1445 HOH A O     1 
HETATM 8264 O  O     . HOH M 8 .   ? 26.763  -19.604 -18.250 1.00 38.02  ? 1446 HOH A O     1 
HETATM 8265 O  O     . HOH M 8 .   ? 23.279  -29.214 -25.405 1.00 42.25  ? 1447 HOH A O     1 
HETATM 8266 O  O     . HOH M 8 .   ? -16.638 -11.543 -27.274 1.00 43.08  ? 1448 HOH A O     1 
HETATM 8267 O  O     . HOH M 8 .   ? -12.453 -10.851 -12.267 1.00 44.27  ? 1449 HOH A O     1 
HETATM 8268 O  O     . HOH M 8 .   ? 23.714  19.952  -43.257 1.00 52.38  ? 1450 HOH A O     1 
HETATM 8269 O  O     . HOH M 8 .   ? -12.008 0.663   -63.594 1.00 58.74  ? 1451 HOH A O     1 
HETATM 8270 O  O     . HOH M 8 .   ? -21.103 -16.606 -35.217 1.00 49.73  ? 1452 HOH A O     1 
HETATM 8271 O  O     . HOH M 8 .   ? -5.443  -25.797 -49.014 1.00 43.43  ? 1453 HOH A O     1 
HETATM 8272 O  O     . HOH M 8 .   ? 2.020   -41.784 -6.434  1.00 44.09  ? 1454 HOH A O     1 
HETATM 8273 O  O     . HOH M 8 .   ? -6.109  -25.138 -46.282 1.00 56.03  ? 1455 HOH A O     1 
HETATM 8274 O  O     . HOH M 8 .   ? 7.055   -25.575 -17.715 1.00 46.93  ? 1456 HOH A O     1 
HETATM 8275 O  O     . HOH M 8 .   ? 29.891  -14.762 -18.576 1.00 48.11  ? 1457 HOH A O     1 
HETATM 8276 O  O     . HOH M 8 .   ? 4.236   17.069  -58.023 1.00 54.37  ? 1458 HOH A O     1 
HETATM 8277 O  O     . HOH M 8 .   ? 16.320  -6.573  -55.797 1.00 46.20  ? 1459 HOH A O     1 
HETATM 8278 O  O     . HOH M 8 .   ? 24.246  7.362   -21.288 1.00 45.19  ? 1460 HOH A O     1 
HETATM 8279 O  O     . HOH M 8 .   ? 2.051   -15.419 -34.347 1.00 37.95  ? 1461 HOH A O     1 
HETATM 8280 O  O     . HOH M 8 .   ? 16.251  13.269  -37.963 1.00 40.10  ? 1462 HOH A O     1 
HETATM 8281 O  O     . HOH M 8 .   ? 3.582   -19.092 -46.394 1.00 34.44  ? 1463 HOH A O     1 
HETATM 8282 O  O     . HOH M 8 .   ? 10.340  -10.700 -15.031 1.00 37.95  ? 1464 HOH A O     1 
HETATM 8283 O  O     . HOH M 8 .   ? -1.457  -13.572 -29.659 1.00 55.43  ? 1465 HOH A O     1 
HETATM 8284 O  O     . HOH M 8 .   ? 3.184   -11.840 -25.613 1.00 44.03  ? 1466 HOH A O     1 
HETATM 8285 O  O     . HOH M 8 .   ? -2.170  -15.470 -2.339  1.00 49.73  ? 1467 HOH A O     1 
HETATM 8286 O  O     . HOH M 8 .   ? 1.896   -17.407 -52.094 1.00 60.64  ? 1468 HOH A O     1 
HETATM 8287 O  O     . HOH M 8 .   ? -0.810  -26.046 -17.412 1.00 37.36  ? 1469 HOH A O     1 
HETATM 8288 O  O     . HOH M 8 .   ? 0.135   -23.132 -17.402 1.00 26.06  ? 1470 HOH A O     1 
HETATM 8289 O  O     . HOH M 8 .   ? 1.601   -29.806 -18.737 1.00 51.07  ? 1471 HOH A O     1 
HETATM 8290 O  O     . HOH M 8 .   ? -27.485 -33.305 -53.145 1.00 50.27  ? 1472 HOH A O     1 
HETATM 8291 O  O     . HOH M 8 .   ? 5.726   -17.200 -51.848 1.00 48.45  ? 1473 HOH A O     1 
HETATM 8292 O  O     . HOH M 8 .   ? 36.434  -3.217  -33.080 1.00 38.79  ? 1474 HOH A O     1 
HETATM 8293 O  O     . HOH M 8 .   ? -31.978 -26.072 -23.043 1.00 37.19  ? 1475 HOH A O     1 
HETATM 8294 O  O     . HOH M 8 .   ? -9.757  -30.571 -44.746 1.00 29.95  ? 1476 HOH A O     1 
HETATM 8295 O  O     . HOH M 8 .   ? -3.790  -30.996 -32.042 1.00 57.06  ? 1477 HOH A O     1 
HETATM 8296 O  O     . HOH M 8 .   ? 13.391  -21.857 5.675   1.00 39.02  ? 1478 HOH A O     1 
HETATM 8297 O  O     . HOH M 8 .   ? 4.259   -22.975 -0.661  1.00 32.07  ? 1479 HOH A O     1 
HETATM 8298 O  O     . HOH M 8 .   ? 12.230  -10.479 -22.450 1.00 48.74  ? 1480 HOH A O     1 
HETATM 8299 O  O     . HOH M 8 .   ? -23.029 -26.926 -8.513  1.00 38.92  ? 1481 HOH A O     1 
HETATM 8300 O  O     . HOH M 8 .   ? -21.626 -17.331 -2.708  1.00 78.72  ? 1482 HOH A O     1 
HETATM 8301 O  O     . HOH M 8 .   ? 7.427   9.223   -32.132 1.00 53.47  ? 1483 HOH A O     1 
HETATM 8302 O  O     . HOH M 8 .   ? -20.892 -19.601 -59.508 1.00 48.79  ? 1484 HOH A O     1 
HETATM 8303 O  O     . HOH M 8 .   ? -19.873 0.339   -16.401 1.00 54.10  ? 1485 HOH A O     1 
HETATM 8304 O  O     . HOH M 8 .   ? -20.168 -29.774 -9.167  1.00 40.58  ? 1486 HOH A O     1 
HETATM 8305 O  O     . HOH M 8 .   ? 26.471  7.322   -17.601 1.00 53.36  ? 1487 HOH A O     1 
HETATM 8306 O  O     . HOH M 8 .   ? 11.830  -31.241 -35.403 1.00 45.79  ? 1488 HOH A O     1 
HETATM 8307 O  O     . HOH M 8 .   ? 1.039   -11.989 -32.926 1.00 57.11  ? 1489 HOH A O     1 
HETATM 8308 O  O     . HOH M 8 .   ? 26.181  -15.136 -12.075 1.00 48.79  ? 1490 HOH A O     1 
HETATM 8309 O  O     . HOH M 8 .   ? 8.908   -24.588 -18.419 1.00 42.83  ? 1491 HOH A O     1 
HETATM 8310 O  O     . HOH M 8 .   ? 14.494  -35.690 -25.163 1.00 54.49  ? 1492 HOH A O     1 
HETATM 8311 O  O     . HOH M 8 .   ? -3.345  -37.341 -7.733  1.00 46.02  ? 1493 HOH A O     1 
HETATM 8312 O  O     . HOH M 8 .   ? 5.462   -11.211 -20.261 1.00 55.45  ? 1494 HOH A O     1 
HETATM 8313 O  O     . HOH M 8 .   ? 18.202  -7.463  -19.503 1.00 55.93  ? 1495 HOH A O     1 
HETATM 8314 O  O     . HOH M 8 .   ? -5.715  -21.286 -3.353  1.00 61.15  ? 1496 HOH A O     1 
HETATM 8315 O  O     . HOH M 8 .   ? 3.768   -26.585 -13.510 1.00 55.40  ? 1497 HOH A O     1 
HETATM 8316 O  O     . HOH M 8 .   ? 0.425   -23.952 -11.202 1.00 63.98  ? 1498 HOH A O     1 
HETATM 8317 O  O     . HOH M 8 .   ? 21.393  -27.735 7.430   1.00 42.45  ? 1499 HOH A O     1 
HETATM 8318 O  O     . HOH M 8 .   ? 20.439  -29.966 5.564   1.00 46.72  ? 1500 HOH A O     1 
HETATM 8319 O  O     . HOH M 8 .   ? 16.164  -35.079 -23.443 1.00 46.05  ? 1501 HOH A O     1 
HETATM 8320 O  O     . HOH M 8 .   ? 16.193  -32.941 -23.446 1.00 53.28  ? 1502 HOH A O     1 
HETATM 8321 O  O     . HOH M 8 .   ? 13.731  -32.887 -27.056 1.00 43.37  ? 1503 HOH A O     1 
HETATM 8322 O  O     . HOH M 8 .   ? 3.136   -50.230 -52.894 1.00 55.19  ? 1504 HOH A O     1 
HETATM 8323 O  O     . HOH M 8 .   ? 2.125   -52.338 -50.165 1.00 74.56  ? 1505 HOH A O     1 
HETATM 8324 O  O     . HOH M 8 .   ? 4.303   -49.425 -48.638 1.00 49.07  ? 1506 HOH A O     1 
HETATM 8325 O  O     . HOH M 8 .   ? -4.183  -12.442 -50.541 1.00 47.82  ? 1507 HOH A O     1 
HETATM 8326 O  O     . HOH M 8 .   ? 13.378  13.967  -43.238 1.00 51.81  ? 1508 HOH A O     1 
HETATM 8327 O  O     . HOH M 8 .   ? 11.589  12.683  -43.684 1.00 49.93  ? 1509 HOH A O     1 
HETATM 8328 O  O     . HOH M 8 .   ? 7.856   13.063  -41.609 1.00 55.81  ? 1510 HOH A O     1 
HETATM 8329 O  O     . HOH M 8 .   ? 23.186  -18.740 -0.828  1.00 42.34  ? 1511 HOH A O     1 
HETATM 8330 O  O     . HOH M 8 .   ? 3.355   -26.079 -43.776 1.00 37.88  ? 1512 HOH A O     1 
HETATM 8331 O  O     . HOH M 8 .   ? -23.824 -10.427 -14.473 1.00 45.95  ? 1513 HOH A O     1 
HETATM 8332 O  O     . HOH M 8 .   ? 19.251  -25.760 -33.223 1.00 54.13  ? 1514 HOH A O     1 
HETATM 8333 O  O     . HOH M 8 .   ? 19.170  -24.346 -31.563 1.00 50.65  ? 1515 HOH A O     1 
HETATM 8334 O  O     . HOH M 8 .   ? 18.457  -24.578 -29.468 1.00 46.92  ? 1516 HOH A O     1 
HETATM 8335 O  O     . HOH M 8 .   ? -29.630 -33.968 -28.097 1.00 53.43  ? 1517 HOH A O     1 
HETATM 8336 O  O     . HOH M 8 .   ? 12.409  -25.459 9.606   1.00 41.02  ? 1518 HOH A O     1 
HETATM 8337 O  O     . HOH M 8 .   ? 8.915   -34.598 -53.395 1.00 48.42  ? 1519 HOH A O     1 
HETATM 8338 O  O     . HOH M 8 .   ? 24.705  -27.490 -25.520 1.00 51.76  ? 1520 HOH A O     1 
HETATM 8339 O  O     . HOH M 8 .   ? 16.489  -13.875 -39.524 1.00 57.13  ? 1521 HOH A O     1 
HETATM 8340 O  O     . HOH M 8 .   ? 18.712  -15.192 -40.230 1.00 52.83  ? 1522 HOH A O     1 
HETATM 8341 O  O     . HOH M 8 .   ? 0.979   -46.492 -20.236 1.00 58.37  ? 1523 HOH A O     1 
HETATM 8342 O  O     . HOH M 8 .   ? 7.048   -6.370  -5.063  1.00 64.34  ? 1524 HOH A O     1 
HETATM 8343 O  O     . HOH M 8 .   ? -14.831 -31.037 -30.511 1.00 39.44  ? 1525 HOH A O     1 
HETATM 8344 O  O     . HOH M 8 .   ? 36.527  -1.233  -34.409 1.00 55.85  ? 1526 HOH A O     1 
HETATM 8345 O  O     . HOH M 8 .   ? -15.118 -32.098 -60.882 1.00 51.57  ? 1527 HOH A O     1 
HETATM 8346 O  O     . HOH M 8 .   ? -22.730 -23.112 -5.172  1.00 59.18  ? 1528 HOH A O     1 
HETATM 8347 O  O     . HOH M 8 .   ? -25.808 -22.932 -3.898  1.00 58.64  ? 1529 HOH A O     1 
HETATM 8348 O  O     . HOH M 8 .   ? -16.181 -2.762  -47.398 1.00 53.90  ? 1530 HOH A O     1 
HETATM 8349 O  O     . HOH M 8 .   ? -32.897 -32.949 -35.915 1.00 47.96  ? 1531 HOH A O     1 
HETATM 8350 O  O     . HOH M 8 .   ? 12.465  9.240   -42.415 1.00 46.88  ? 1532 HOH A O     1 
HETATM 8351 O  O     . HOH M 8 .   ? 11.382  9.421   -40.132 1.00 40.75  ? 1533 HOH A O     1 
HETATM 8352 O  O     . HOH M 8 .   ? 21.469  -28.418 -27.209 1.00 62.18  ? 1534 HOH A O     1 
HETATM 8353 O  O     . HOH M 8 .   ? -0.893  -14.139 -41.477 1.00 49.35  ? 1535 HOH A O     1 
HETATM 8354 O  O     . HOH M 8 .   ? -17.441 -32.641 -30.783 1.00 44.34  ? 1536 HOH A O     1 
HETATM 8355 O  O     . HOH M 8 .   ? -19.038 -31.867 -33.203 1.00 45.99  ? 1537 HOH A O     1 
HETATM 8356 O  O     . HOH M 8 .   ? 14.123  -11.648 -56.845 1.00 44.12  ? 1538 HOH A O     1 
HETATM 8357 O  O     . HOH M 8 .   ? 14.289  -28.345 -51.574 1.00 43.38  ? 1539 HOH A O     1 
HETATM 8358 O  O     . HOH M 8 .   ? -1.374  -31.702 -22.009 1.00 57.34  ? 1540 HOH A O     1 
HETATM 8359 O  O     . HOH M 8 .   ? -11.073 -6.563  -68.473 1.00 68.43  ? 1541 HOH A O     1 
HETATM 8360 O  O     . HOH M 8 .   ? 6.102   -18.049 -62.427 1.00 62.46  ? 1542 HOH A O     1 
HETATM 8361 O  O     . HOH M 8 .   ? 4.478   -16.263 -63.376 1.00 73.16  ? 1543 HOH A O     1 
HETATM 8362 O  O     . HOH M 8 .   ? -3.503  -19.119 -18.735 1.00 52.57  ? 1544 HOH A O     1 
HETATM 8363 O  O     . HOH M 8 .   ? 20.501  -29.907 -24.934 1.00 55.71  ? 1545 HOH A O     1 
HETATM 8364 O  O     . HOH M 8 .   ? 18.598  -28.813 -25.626 1.00 60.42  ? 1546 HOH A O     1 
HETATM 8365 O  O     . HOH M 8 .   ? 9.292   -52.196 -39.168 1.00 48.23  ? 1547 HOH A O     1 
HETATM 8366 O  O     . HOH M 8 .   ? 11.209  -51.189 -37.207 1.00 67.32  ? 1548 HOH A O     1 
HETATM 8367 O  O     . HOH M 8 .   ? -0.307  -7.280  -71.196 1.00 53.76  ? 1549 HOH A O     1 
HETATM 8368 O  O     . HOH M 8 .   ? -8.304  -21.797 -13.377 1.00 59.48  ? 1550 HOH A O     1 
HETATM 8369 O  O     . HOH M 8 .   ? -6.167  -34.970 -57.386 1.00 59.64  ? 1551 HOH A O     1 
HETATM 8370 O  O     . HOH M 8 .   ? 6.758   -41.296 -3.617  1.00 52.46  ? 1552 HOH A O     1 
HETATM 8371 O  O     . HOH M 8 .   ? -41.943 -30.600 -48.993 1.00 50.91  ? 1553 HOH A O     1 
HETATM 8372 O  O     . HOH M 8 .   ? 1.541   -14.842 -42.345 1.00 43.81  ? 1554 HOH A O     1 
HETATM 8373 O  O     . HOH M 8 .   ? -15.526 -1.381  -10.749 1.00 56.04  ? 1555 HOH A O     1 
HETATM 8374 O  O     . HOH M 8 .   ? 28.938  -7.741  -40.985 1.00 45.13  ? 1556 HOH A O     1 
HETATM 8375 O  O     . HOH M 8 .   ? 2.180   14.433  -55.773 1.00 48.62  ? 1557 HOH A O     1 
HETATM 8376 O  O     . HOH M 8 .   ? 3.798   0.496   -70.314 1.00 57.49  ? 1558 HOH A O     1 
HETATM 8377 O  O     . HOH M 8 .   ? 4.817   -1.426  -72.302 1.00 55.04  ? 1559 HOH A O     1 
HETATM 8378 O  O     . HOH M 8 .   ? 4.717   3.193   -70.370 1.00 47.67  ? 1560 HOH A O     1 
HETATM 8379 O  O     . HOH M 8 .   ? -6.500  -23.984 -31.539 1.00 54.32  ? 1561 HOH A O     1 
HETATM 8380 O  O     . HOH M 8 .   ? -10.061 -25.870 -35.022 1.00 64.54  ? 1562 HOH A O     1 
HETATM 8381 O  O     . HOH M 8 .   ? -7.284  -22.034 -37.642 1.00 51.04  ? 1563 HOH A O     1 
HETATM 8382 O  O     . HOH M 8 .   ? -7.879  -19.480 -38.174 1.00 50.76  ? 1564 HOH A O     1 
HETATM 8383 O  O     . HOH M 8 .   ? -30.640 -15.960 -44.298 1.00 60.44  ? 1565 HOH A O     1 
HETATM 8384 O  O     . HOH M 8 .   ? 1.375   -47.177 -52.878 1.00 52.53  ? 1566 HOH A O     1 
HETATM 8385 O  O     . HOH M 8 .   ? 25.386  -9.132  -40.266 1.00 58.76  ? 1567 HOH A O     1 
HETATM 8386 O  O     . HOH M 8 .   ? 20.813  -30.159 1.184   1.00 56.25  ? 1568 HOH A O     1 
HETATM 8387 O  O     . HOH M 8 .   ? 22.207  -30.439 -2.620  1.00 50.65  ? 1569 HOH A O     1 
HETATM 8388 O  O     . HOH M 8 .   ? -5.865  -39.354 -55.463 1.00 68.90  ? 1570 HOH A O     1 
HETATM 8389 O  O     . HOH M 8 .   ? -5.077  -40.558 -53.113 1.00 65.30  ? 1571 HOH A O     1 
HETATM 8390 O  O     . HOH M 8 .   ? 16.376  19.212  -34.265 1.00 70.14  ? 1572 HOH A O     1 
HETATM 8391 O  O     . HOH M 8 .   ? 15.913  15.823  -35.327 1.00 52.60  ? 1573 HOH A O     1 
HETATM 8392 O  O     . HOH M 8 .   ? 16.906  14.843  -27.924 1.00 47.01  ? 1574 HOH A O     1 
HETATM 8393 O  O     . HOH M 8 .   ? 19.072  -40.937 -21.498 1.00 55.04  ? 1575 HOH A O     1 
HETATM 8394 O  O     . HOH M 8 .   ? -31.019 -30.408 -17.347 1.00 60.25  ? 1576 HOH A O     1 
HETATM 8395 O  O     . HOH M 8 .   ? -28.269 -32.613 -21.734 1.00 55.32  ? 1577 HOH A O     1 
HETATM 8396 O  O     . HOH M 8 .   ? 18.081  22.586  -37.271 1.00 50.02  ? 1578 HOH A O     1 
HETATM 8397 O  O     . HOH M 8 .   ? 0.950   17.217  -57.353 1.00 58.68  ? 1579 HOH A O     1 
HETATM 8398 O  O     . HOH M 8 .   ? 2.601   16.709  -54.422 1.00 47.34  ? 1580 HOH A O     1 
HETATM 8399 O  O     . HOH M 8 .   ? 4.738   14.740  -50.459 1.00 42.94  ? 1581 HOH A O     1 
HETATM 8400 O  O     . HOH M 8 .   ? 20.948  8.255   -52.512 1.00 65.33  ? 1582 HOH A O     1 
HETATM 8401 O  O     . HOH M 8 .   ? -19.285 -2.763  -50.887 1.00 57.90  ? 1583 HOH A O     1 
HETATM 8402 O  O     . HOH M 8 .   ? 16.252  -25.939 -32.903 1.00 52.43  ? 1584 HOH A O     1 
HETATM 8403 O  O     . HOH M 8 .   ? 9.296   -4.215  -67.727 1.00 52.50  ? 1585 HOH A O     1 
HETATM 8404 O  O     . HOH M 8 .   ? 11.205  15.535  -62.959 1.00 45.58  ? 1586 HOH A O     1 
HETATM 8405 O  O     . HOH M 8 .   ? 9.060   -6.081  -2.482  1.00 63.28  ? 1587 HOH A O     1 
HETATM 8406 O  O     . HOH M 8 .   ? 9.980   -36.275 -55.253 1.00 50.00  ? 1588 HOH A O     1 
HETATM 8407 O  O     . HOH M 8 .   ? -9.822  -28.770 -23.703 1.00 46.26  ? 1589 HOH A O     1 
HETATM 8408 O  O     . HOH M 8 .   ? 15.031  -32.256 -25.215 1.00 39.20  ? 1590 HOH A O     1 
HETATM 8409 O  O     . HOH M 8 .   ? 9.367   12.842  -67.183 1.00 50.90  ? 1591 HOH A O     1 
HETATM 8410 O  O     . HOH M 8 .   ? 11.210  -6.800  0.062   1.00 53.62  ? 1592 HOH A O     1 
HETATM 8411 O  O     . HOH M 8 .   ? -3.597  -35.353 -44.400 1.00 64.59  ? 1593 HOH A O     1 
HETATM 8412 O  O     . HOH M 8 .   ? -25.590 -34.526 -51.567 1.00 44.25  ? 1594 HOH A O     1 
HETATM 8413 O  O     . HOH M 8 .   ? 36.194  -5.511  -33.829 1.00 54.67  ? 1595 HOH A O     1 
HETATM 8414 O  O     . HOH M 8 .   ? 4.625   -32.101 -36.870 1.00 52.77  ? 1596 HOH A O     1 
HETATM 8415 O  O     . HOH M 8 .   ? -28.051 -15.078 -25.224 1.00 53.11  ? 1597 HOH A O     1 
HETATM 8416 O  O     . HOH M 8 .   ? 3.992   -37.937 -19.822 1.00 53.16  ? 1598 HOH A O     1 
HETATM 8417 O  O     . HOH M 8 .   ? -0.456  -33.524 3.478   1.00 76.55  ? 1599 HOH A O     1 
HETATM 8418 O  O     . HOH M 8 .   ? 2.690   -14.177 -19.717 1.00 58.04  ? 1600 HOH A O     1 
HETATM 8419 O  O     . HOH M 8 .   ? -18.547 -31.420 -10.207 1.00 57.87  ? 1601 HOH A O     1 
HETATM 8420 O  O     . HOH M 8 .   ? 18.375  14.777  -41.208 1.00 60.84  ? 1602 HOH A O     1 
HETATM 8421 O  O     . HOH M 8 .   ? 22.893  -6.882  -43.359 1.00 53.14  ? 1603 HOH A O     1 
HETATM 8422 O  O     . HOH M 8 .   ? -29.590 -39.744 -33.508 1.00 56.68  ? 1604 HOH A O     1 
HETATM 8423 O  O     . HOH M 8 .   ? 28.682  -17.578 -14.019 1.00 54.07  ? 1605 HOH A O     1 
HETATM 8424 O  O     . HOH M 8 .   ? 4.138   -22.244 -11.985 1.00 55.52  ? 1606 HOH A O     1 
HETATM 8425 O  O     . HOH M 8 .   ? -2.273  -44.388 -21.524 1.00 61.25  ? 1607 HOH A O     1 
HETATM 8426 O  O     . HOH M 8 .   ? 0.718   -44.298 -21.744 1.00 60.62  ? 1608 HOH A O     1 
HETATM 8427 O  O     . HOH M 8 .   ? 6.658   -28.617 10.976  1.00 57.25  ? 1609 HOH A O     1 
HETATM 8428 O  O     . HOH M 8 .   ? 8.682   15.307  -40.521 1.00 69.71  ? 1610 HOH A O     1 
HETATM 8429 O  O     . HOH M 8 .   ? 14.070  16.046  -59.236 1.00 64.90  ? 1611 HOH A O     1 
HETATM 8430 O  O     . HOH M 8 .   ? -24.655 -16.826 -7.360  1.00 53.95  ? 1612 HOH A O     1 
HETATM 8431 O  O     . HOH M 8 .   ? 2.202   -24.110 -13.054 1.00 57.65  ? 1613 HOH A O     1 
HETATM 8432 O  O     . HOH M 8 .   ? 3.158   -19.653 -14.409 1.00 48.84  ? 1614 HOH A O     1 
HETATM 8433 O  O     . HOH M 8 .   ? 8.662   -25.239 -54.423 1.00 55.43  ? 1615 HOH A O     1 
HETATM 8434 O  O     . HOH M 8 .   ? 2.464   -20.178 -55.898 1.00 63.87  ? 1616 HOH A O     1 
HETATM 8435 O  O     . HOH M 8 .   ? 3.593   -24.628 -15.584 1.00 68.76  ? 1617 HOH A O     1 
HETATM 8436 O  O     . HOH M 8 .   ? -10.328 -5.242  -14.905 1.00 56.70  ? 1618 HOH A O     1 
HETATM 8437 O  O     . HOH M 8 .   ? -10.291 -7.018  -12.724 1.00 48.08  ? 1619 HOH A O     1 
HETATM 8438 O  O     . HOH M 8 .   ? 16.587  -4.845  -54.426 1.00 55.68  ? 1620 HOH A O     1 
HETATM 8439 O  O     . HOH M 8 .   ? 18.424  -39.453 -13.088 1.00 42.46  ? 1621 HOH A O     1 
HETATM 8440 O  O     . HOH M 8 .   ? -23.356 -21.209 -59.751 1.00 66.01  ? 1622 HOH A O     1 
HETATM 8441 O  O     . HOH M 8 .   ? -25.479 -20.262 -58.085 1.00 45.71  ? 1623 HOH A O     1 
HETATM 8442 O  O     . HOH M 8 .   ? 28.096  -19.274 -15.983 1.00 55.86  ? 1624 HOH A O     1 
HETATM 8443 O  O     . HOH M 8 .   ? 25.054  -24.642 -0.747  1.00 61.88  ? 1625 HOH A O     1 
HETATM 8444 O  O     . HOH M 8 .   ? 24.000  -28.165 -7.823  1.00 58.07  ? 1626 HOH A O     1 
HETATM 8445 O  O     . HOH M 8 .   ? 26.561  -29.031 -10.751 1.00 62.83  ? 1627 HOH A O     1 
HETATM 8446 O  O     . HOH M 8 .   ? 3.350   -51.265 -9.503  1.00 51.38  ? 1628 HOH A O     1 
HETATM 8447 O  O     . HOH M 8 .   ? 0.536   -22.954 -36.591 1.00 49.66  ? 1629 HOH A O     1 
HETATM 8448 O  O     . HOH M 8 .   ? -0.967  -24.541 -35.836 1.00 62.18  ? 1630 HOH A O     1 
HETATM 8449 O  O     . HOH M 8 .   ? 15.508  11.680  -41.606 1.00 52.47  ? 1631 HOH A O     1 
HETATM 8450 O  O     . HOH M 8 .   ? 9.644   12.212  -42.680 1.00 63.68  ? 1632 HOH A O     1 
HETATM 8451 O  O     . HOH M 8 .   ? 6.484   -34.651 -54.986 1.00 46.01  ? 1633 HOH A O     1 
HETATM 8452 O  O     . HOH M 8 .   ? 11.379  -19.329 4.219   1.00 64.38  ? 1634 HOH A O     1 
HETATM 8453 O  O     . HOH M 8 .   ? 12.008  -34.176 -28.041 1.00 50.60  ? 1635 HOH A O     1 
HETATM 8454 O  O     . HOH M 8 .   ? 12.382  -34.640 -38.437 1.00 57.00  ? 1636 HOH A O     1 
HETATM 8455 O  O     . HOH M 8 .   ? 11.883  -35.616 -35.937 1.00 54.79  ? 1637 HOH A O     1 
HETATM 8456 O  O     . HOH M 8 .   ? 35.609  3.840   -29.469 1.00 56.98  ? 1638 HOH A O     1 
HETATM 8457 O  O     . HOH M 8 .   ? 34.696  1.443   -30.847 1.00 46.42  ? 1639 HOH A O     1 
HETATM 8458 O  O     . HOH M 8 .   ? 33.056  8.493   -47.059 1.00 56.52  ? 1640 HOH A O     1 
HETATM 8459 O  O     . HOH M 8 .   ? 0.493   -19.732 -40.383 1.00 55.92  ? 1641 HOH A O     1 
HETATM 8460 O  O     . HOH M 8 .   ? 5.835   -49.105 -7.201  1.00 52.02  ? 1642 HOH A O     1 
HETATM 8461 O  O     . HOH M 8 .   ? 26.468  -32.333 -23.056 1.00 68.01  ? 1643 HOH A O     1 
HETATM 8462 O  O     . HOH M 8 .   ? -27.826 -4.424  -17.448 1.00 47.92  ? 1644 HOH A O     1 
HETATM 8463 O  O     . HOH M 8 .   ? -6.450  -25.224 -5.841  1.00 64.34  ? 1645 HOH A O     1 
HETATM 8464 O  O     . HOH M 8 .   ? 3.018   -48.382 -50.617 1.00 45.16  ? 1646 HOH A O     1 
HETATM 8465 O  O     . HOH M 8 .   ? 12.332  -11.016 -17.071 1.00 51.12  ? 1647 HOH A O     1 
HETATM 8466 O  O     . HOH M 8 .   ? -8.865  -28.142 -43.793 1.00 54.83  ? 1648 HOH A O     1 
HETATM 8467 O  O     . HOH M 8 .   ? 24.890  -2.647  -48.580 1.00 63.63  ? 1649 HOH A O     1 
HETATM 8468 O  O     . HOH M 8 .   ? 25.755  -5.502  -42.105 1.00 61.17  ? 1650 HOH A O     1 
HETATM 8469 O  O     . HOH M 8 .   ? -17.590 -32.826 -27.779 1.00 50.14  ? 1651 HOH A O     1 
HETATM 8470 O  O     . HOH M 8 .   ? 11.390  15.574  -31.880 1.00 53.17  ? 1652 HOH A O     1 
HETATM 8471 O  O     . HOH M 8 .   ? 14.662  15.416  -31.163 1.00 59.96  ? 1653 HOH A O     1 
HETATM 8472 O  O     . HOH M 8 .   ? 0.203   -16.150 -49.709 1.00 57.47  ? 1654 HOH A O     1 
HETATM 8473 O  O     . HOH M 8 .   ? -12.783 -30.915 -37.773 1.00 63.24  ? 1655 HOH A O     1 
HETATM 8474 O  O     . HOH M 8 .   ? 38.992  -12.977 -26.685 1.00 53.40  ? 1656 HOH A O     1 
HETATM 8475 O  O     . HOH M 8 .   ? -21.859 -15.754 -43.464 1.00 52.01  ? 1657 HOH A O     1 
HETATM 8476 O  O     . HOH M 8 .   ? 15.844  -29.550 -37.337 1.00 63.62  ? 1658 HOH A O     1 
HETATM 8477 O  O     . HOH M 8 .   ? 10.258  -41.813 -1.193  1.00 54.86  ? 1659 HOH A O     1 
HETATM 8478 O  O     . HOH M 8 .   ? 3.382   -42.891 -5.058  1.00 43.94  ? 1660 HOH A O     1 
HETATM 8479 O  O     . HOH M 8 .   ? 3.453   -41.877 -2.801  1.00 51.00  ? 1661 HOH A O     1 
HETATM 8480 O  O     . HOH M 8 .   ? 11.379  -21.170 -52.532 1.00 66.26  ? 1662 HOH A O     1 
HETATM 8481 O  O     . HOH M 8 .   ? -20.096 -7.286  -56.213 1.00 65.28  ? 1663 HOH A O     1 
HETATM 8482 O  O     . HOH M 8 .   ? -0.183  -13.923 -35.572 1.00 49.72  ? 1664 HOH A O     1 
HETATM 8483 O  O     . HOH M 8 .   ? 7.120   -14.491 -62.604 1.00 75.18  ? 1665 HOH A O     1 
HETATM 8484 O  O     . HOH M 8 .   ? 15.000  23.387  -34.603 1.00 63.68  ? 1666 HOH A O     1 
HETATM 8485 O  O     . HOH M 8 .   ? 15.393  -36.262 -50.494 1.00 43.82  ? 1667 HOH A O     1 
HETATM 8486 O  O     . HOH M 8 .   ? 24.173  4.415   -54.979 1.00 46.10  ? 1668 HOH A O     1 
HETATM 8487 O  O     . HOH M 8 .   ? 5.951   -23.953 -55.323 1.00 58.89  ? 1669 HOH A O     1 
HETATM 8488 O  O     . HOH M 8 .   ? 4.334   -10.238 -12.942 1.00 62.01  ? 1670 HOH A O     1 
HETATM 8489 O  O     . HOH M 8 .   ? -5.105  -18.223 -36.605 1.00 68.43  ? 1671 HOH A O     1 
HETATM 8490 O  O     . HOH M 8 .   ? 2.660   -26.188 -11.878 1.00 47.12  ? 1672 HOH A O     1 
HETATM 8491 O  O     . HOH N 8 .   ? -10.452 -16.227 -28.592 1.00 32.08  ? 201  HOH P O     1 
HETATM 8492 O  O     . HOH N 8 .   ? -10.789 -6.816  -28.354 1.00 34.56  ? 202  HOH P O     1 
HETATM 8493 O  O     . HOH N 8 .   ? -17.429 -8.686  -28.762 1.00 34.30  ? 203  HOH P O     1 
HETATM 8494 O  O     . HOH N 8 .   ? -8.269  -19.793 -41.702 1.00 30.84  ? 204  HOH P O     1 
HETATM 8495 O  O     . HOH N 8 .   ? -13.325 -3.165  -23.306 1.00 40.22  ? 205  HOH P O     1 
HETATM 8496 O  O     . HOH N 8 .   ? -6.406  -9.949  -34.658 1.00 44.19  ? 206  HOH P O     1 
HETATM 8497 O  O     . HOH N 8 .   ? -9.025  -9.447  -28.423 1.00 39.59  ? 207  HOH P O     1 
HETATM 8498 O  O     . HOH N 8 .   ? -7.751  -12.878 -29.551 1.00 38.02  ? 208  HOH P O     1 
HETATM 8499 O  O     . HOH N 8 .   ? -11.060 -4.032  -25.213 1.00 33.60  ? 209  HOH P O     1 
HETATM 8500 O  O     . HOH N 8 .   ? -18.946 -2.105  -35.803 1.00 46.27  ? 210  HOH P O     1 
HETATM 8501 O  O     . HOH N 8 .   ? -8.191  -19.046 -34.560 1.00 33.58  ? 211  HOH P O     1 
HETATM 8502 O  O     . HOH N 8 .   ? -15.294 -11.630 -33.568 1.00 33.61  ? 212  HOH P O     1 
HETATM 8503 O  O     . HOH N 8 .   ? -4.260  -10.160 -36.736 1.00 44.72  ? 213  HOH P O     1 
HETATM 8504 O  O     . HOH N 8 .   ? -4.123  -6.108  -46.438 1.00 31.56  ? 214  HOH P O     1 
HETATM 8505 O  O     . HOH N 8 .   ? -6.205  -14.212 -38.826 1.00 51.09  ? 215  HOH P O     1 
HETATM 8506 O  O     . HOH N 8 .   ? -3.638  -14.212 -39.577 1.00 47.65  ? 216  HOH P O     1 
HETATM 8507 O  O     . HOH N 8 .   ? -43.093 -10.177 -27.955 1.00 49.73  ? 217  HOH P O     1 
HETATM 8508 O  O     . HOH N 8 .   ? -12.052 -2.570  -34.256 1.00 35.48  ? 218  HOH P O     1 
HETATM 8509 O  O     . HOH N 8 .   ? -6.637  -14.034 -50.684 1.00 44.10  ? 219  HOH P O     1 
HETATM 8510 O  O     . HOH N 8 .   ? -17.974 0.071   -34.437 1.00 44.00  ? 220  HOH P O     1 
HETATM 8511 O  O     . HOH N 8 .   ? -2.549  -11.899 -38.898 1.00 49.30  ? 221  HOH P O     1 
HETATM 8512 O  O     . HOH N 8 .   ? -32.711 6.438   -36.089 1.00 42.01  ? 222  HOH P O     1 
HETATM 8513 O  O     . HOH N 8 .   ? -6.032  -14.606 -35.713 1.00 60.46  ? 223  HOH P O     1 
HETATM 8514 O  O     . HOH N 8 .   ? -41.752 -2.885  -31.953 1.00 58.61  ? 224  HOH P O     1 
HETATM 8515 O  O     . HOH N 8 .   ? -42.423 -4.180  -34.741 1.00 67.42  ? 225  HOH P O     1 
HETATM 8516 O  O     . HOH N 8 .   ? -18.582 -7.055  -26.914 1.00 54.79  ? 226  HOH P O     1 
HETATM 8517 O  O     . HOH N 8 .   ? -12.987 -1.759  -28.402 1.00 50.07  ? 227  HOH P O     1 
HETATM 8518 O  O     . HOH N 8 .   ? -7.157  -10.480 -31.570 1.00 57.77  ? 228  HOH P O     1 
HETATM 8519 O  O     . HOH N 8 .   ? -19.357 -4.459  -26.691 1.00 46.55  ? 229  HOH P O     1 
HETATM 8520 O  O     . HOH N 8 .   ? -33.356 -4.147  -31.127 1.00 69.52  ? 230  HOH P O     1 
HETATM 8521 O  O     . HOH N 8 .   ? -32.818 4.254   -36.561 1.00 55.83  ? 231  HOH P O     1 
HETATM 8522 O  O     . HOH N 8 .   ? -35.550 3.172   -38.147 1.00 68.67  ? 232  HOH P O     1 
HETATM 8523 O  O     . HOH N 8 .   ? -8.236  -4.758  -33.931 1.00 44.66  ? 233  HOH P O     1 
HETATM 8524 O  O     . HOH N 8 .   ? -10.820 -2.943  -27.820 1.00 55.97  ? 234  HOH P O     1 
HETATM 8525 O  O     . HOH N 8 .   ? -9.274  -4.804  -28.902 1.00 47.79  ? 235  HOH P O     1 
HETATM 8526 O  O     . HOH N 8 .   ? -17.069 -0.393  -36.678 1.00 56.07  ? 236  HOH P O     1 
HETATM 8527 O  O     . HOH N 8 .   ? -5.164  -16.800 -48.452 1.00 48.17  ? 237  HOH P O     1 
HETATM 8528 O  O     . HOH N 8 .   ? -2.414  -16.113 -37.944 1.00 58.94  ? 238  HOH P O     1 
HETATM 8529 O  O     . HOH O 8 .   ? -4.574  -3.556  -45.683 1.00 26.15  ? 101  HOH T O     1 
HETATM 8530 O  O     . HOH O 8 .   ? -5.685  0.760   -38.117 1.00 39.24  ? 102  HOH T O     1 
HETATM 8531 O  O     . HOH O 8 .   ? -12.353 -10.049 -41.662 1.00 45.36  ? 103  HOH T O     1 
HETATM 8532 O  O     . HOH O 8 .   ? -24.283 -8.380  -21.742 1.00 34.37  ? 104  HOH T O     1 
HETATM 8533 O  O     . HOH O 8 .   ? -4.970  3.924   -40.532 1.00 27.85  ? 105  HOH T O     1 
HETATM 8534 O  O     . HOH O 8 .   ? -18.272 -8.235  -47.549 1.00 30.00  ? 106  HOH T O     1 
HETATM 8535 O  O     . HOH O 8 .   ? -26.590 -13.882 -32.516 1.00 44.80  ? 107  HOH T O     1 
HETATM 8536 O  O     . HOH O 8 .   ? -1.610  4.975   -38.272 1.00 29.07  ? 108  HOH T O     1 
HETATM 8537 O  O     . HOH O 8 .   ? -6.980  3.885   -42.372 1.00 37.18  ? 109  HOH T O     1 
HETATM 8538 O  O     . HOH O 8 .   ? -20.630 -12.279 -44.981 1.00 37.66  ? 110  HOH T O     1 
HETATM 8539 O  O     . HOH O 8 .   ? -22.123 -5.699  -26.859 1.00 43.87  ? 111  HOH T O     1 
HETATM 8540 O  O     . HOH O 8 .   ? -13.967 -0.355  -48.542 1.00 48.60  ? 112  HOH T O     1 
HETATM 8541 O  O     . HOH O 8 .   ? -1.702  -2.024  -35.134 1.00 48.77  ? 113  HOH T O     1 
HETATM 8542 O  O     . HOH O 8 .   ? -28.074 -6.417  -30.735 1.00 43.74  ? 114  HOH T O     1 
HETATM 8543 O  O     . HOH O 8 .   ? -20.053 -9.525  -29.170 1.00 32.84  ? 115  HOH T O     1 
HETATM 8544 O  O     . HOH O 8 .   ? -38.430 3.305   -36.217 1.00 60.21  ? 116  HOH T O     1 
HETATM 8545 O  O     . HOH O 8 .   ? 12.911  0.850   -30.826 1.00 52.14  ? 117  HOH T O     1 
HETATM 8546 O  O     . HOH O 8 .   ? 5.666   -6.226  -32.756 1.00 48.21  ? 118  HOH T O     1 
HETATM 8547 O  O     . HOH O 8 .   ? -48.643 4.401   -40.086 1.00 36.85  ? 119  HOH T O     1 
HETATM 8548 O  O     . HOH O 8 .   ? -6.077  4.259   -38.345 1.00 48.56  ? 120  HOH T O     1 
HETATM 8549 O  O     . HOH O 8 .   ? -8.932  0.577   -41.480 1.00 47.74  ? 121  HOH T O     1 
HETATM 8550 O  O     . HOH O 8 .   ? -8.652  5.324   -40.734 1.00 49.85  ? 122  HOH T O     1 
HETATM 8551 O  O     . HOH O 8 .   ? -18.026 -4.546  -47.298 1.00 42.14  ? 123  HOH T O     1 
HETATM 8552 O  O     . HOH O 8 .   ? -11.025 -1.899  -38.408 1.00 41.34  ? 124  HOH T O     1 
HETATM 8553 O  O     . HOH O 8 .   ? -24.007 -15.860 -37.955 1.00 40.05  ? 125  HOH T O     1 
HETATM 8554 O  O     . HOH O 8 .   ? -3.151  -3.429  -37.007 1.00 50.16  ? 126  HOH T O     1 
HETATM 8555 O  O     . HOH O 8 .   ? 4.262   -3.904  -30.761 1.00 57.88  ? 127  HOH T O     1 
HETATM 8556 O  O     . HOH O 8 .   ? 2.739   -5.920  -33.341 1.00 56.25  ? 128  HOH T O     1 
HETATM 8557 O  O     . HOH O 8 .   ? -10.954 -2.177  -50.306 1.00 27.06  ? 129  HOH T O     1 
HETATM 8558 O  O     . HOH O 8 .   ? -15.736 -3.361  -39.420 1.00 49.50  ? 130  HOH T O     1 
HETATM 8559 O  O     . HOH O 8 .   ? -2.610  0.379   -35.943 1.00 52.14  ? 131  HOH T O     1 
HETATM 8560 O  O     . HOH O 8 .   ? -19.028 -2.437  -39.897 1.00 68.72  ? 132  HOH T O     1 
HETATM 8561 O  O     . HOH O 8 .   ? -14.054 -11.481 -38.323 0.50 37.40  ? 133  HOH T O     1 
HETATM 8562 O  O     . HOH O 8 .   ? -38.149 4.016   -26.645 1.00 50.76  ? 134  HOH T O     1 
HETATM 8563 O  O     . HOH O 8 .   ? -27.516 -5.182  -33.206 1.00 45.99  ? 135  HOH T O     1 
HETATM 8564 O  O     . HOH O 8 .   ? 7.535   -5.196  -29.236 1.00 55.51  ? 136  HOH T O     1 
HETATM 8565 O  O     . HOH O 8 .   ? -2.904  -6.281  -36.613 1.00 62.96  ? 137  HOH T O     1 
HETATM 8566 O  O     . HOH O 8 .   ? 0.487   -5.476  -36.022 1.00 50.57  ? 138  HOH T O     1 
HETATM 8567 O  O     . HOH O 8 .   ? -35.591 0.968   -25.968 1.00 59.70  ? 139  HOH T O     1 
HETATM 8568 O  O     . HOH O 8 .   ? -32.517 5.756   -33.715 1.00 58.86  ? 140  HOH T O     1 
HETATM 8569 O  O     . HOH O 8 .   ? -32.109 -5.798  -32.553 1.00 51.09  ? 141  HOH T O     1 
HETATM 8570 O  O     . HOH O 8 .   ? -40.375 7.494   -28.293 1.00 45.56  ? 142  HOH T O     1 
HETATM 8571 O  O     . HOH O 8 .   ? -30.526 -4.901  -31.166 1.00 59.05  ? 143  HOH T O     1 
HETATM 8572 O  O     . HOH O 8 .   ? -4.491  -1.259  -33.981 1.00 53.91  ? 144  HOH T O     1 
HETATM 8573 O  O     . HOH O 8 .   ? -7.845  1.753   -38.930 1.00 56.55  ? 145  HOH T O     1 
HETATM 8574 O  O     . HOH O 8 .   ? -37.053 5.178   -37.737 1.00 69.49  ? 146  HOH T O     1 
HETATM 8575 O  O     . HOH O 8 .   ? -17.748 -3.263  -37.447 1.00 65.40  ? 147  HOH T O     1 
HETATM 8576 O  O     . HOH O 8 .   ? -41.670 1.266   -35.798 1.00 67.94  ? 148  HOH T O     1 
HETATM 8577 O  O     . HOH O 8 .   ? -9.690  1.186   -47.497 1.00 57.91  ? 149  HOH T O     1 
HETATM 8578 O  O     . HOH O 8 .   ? -18.614 -0.752  -38.408 1.00 69.35  ? 150  HOH T O     1 
HETATM 8579 O  O     . HOH O 8 .   ? -18.984 -4.866  -38.854 1.00 68.50  ? 151  HOH T O     1 
HETATM 8580 O  O     . HOH O 8 .   ? -16.190 -11.879 -37.852 0.50 28.48  ? 152  HOH T O     1 
HETATM 8581 O  O     . HOH O 8 .   ? -27.998 -7.197  -22.018 1.00 58.85  ? 153  HOH T O     1 
HETATM 8582 O  O     . HOH O 8 .   ? -1.213  0.337   -32.722 1.00 52.63  ? 154  HOH T O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 1   ? 0.6903 0.7229 1.3028 0.1194  0.1633  0.1512  1   MET A N     
2    C CA    . MET A 1   ? 0.6906 0.7129 1.2627 0.1152  0.1732  0.1400  1   MET A CA    
3    C C     . MET A 1   ? 0.6413 0.6880 1.2205 0.1057  0.1569  0.1393  1   MET A C     
4    O O     . MET A 1   ? 0.6110 0.6795 1.2213 0.1022  0.1340  0.1467  1   MET A O     
5    C CB    . MET A 1   ? 0.7551 0.7589 1.2696 0.1079  0.1588  0.1316  1   MET A CB    
6    C CG    . MET A 1   ? 0.7763 0.7957 1.3001 0.1049  0.1225  0.1366  1   MET A CG    
7    S SD    . MET A 1   ? 1.1280 1.1294 1.5809 0.0930  0.1056  0.1253  1   MET A SD    
8    C CE    . MET A 1   ? 0.6223 0.5888 1.0509 0.1003  0.1280  0.1233  1   MET A CE    
9    N N     . LYS A 2   ? 0.6250 0.6629 1.1602 0.0962  0.1660  0.1289  2   LYS A N     
10   C CA    . LYS A 2   ? 0.5803 0.6370 1.1141 0.0869  0.1511  0.1270  2   LYS A CA    
11   C C     . LYS A 2   ? 0.4784 0.5428 0.9923 0.0797  0.1184  0.1249  2   LYS A C     
12   O O     . LYS A 2   ? 0.4826 0.5319 0.9565 0.0768  0.1126  0.1191  2   LYS A O     
13   C CB    . LYS A 2   ? 0.6426 0.6860 1.1338 0.0789  0.1692  0.1178  2   LYS A CB    
14   C CG    . LYS A 2   ? 0.6907 0.7385 1.2107 0.0813  0.1924  0.1210  2   LYS A CG    
15   C CD    . LYS A 2   ? 0.7081 0.7852 1.2722 0.0799  0.1754  0.1280  2   LYS A CD    
16   C CE    . LYS A 2   ? 0.7517 0.8264 1.3300 0.0779  0.1936  0.1302  2   LYS A CE    
17   N NZ    . LYS A 2   ? 0.7794 0.8422 1.3230 0.0720  0.2134  0.1229  2   LYS A NZ    
18   N N     . GLU A 3   ? 0.4118 0.4979 0.9523 0.0760  0.0981  0.1296  3   GLU A N     
19   C CA    . GLU A 3   ? 0.3976 0.4887 0.9202 0.0687  0.0684  0.1278  3   GLU A CA    
20   C C     . GLU A 3   ? 0.3349 0.4179 0.8039 0.0595  0.0666  0.1165  3   GLU A C     
21   O O     . GLU A 3   ? 0.3239 0.4046 0.7788 0.0570  0.0825  0.1122  3   GLU A O     
22   C CB    . GLU A 3   ? 0.4117 0.5244 0.9750 0.0658  0.0487  0.1360  3   GLU A CB    
23   C CG    . GLU A 3   ? 0.5261 0.6489 1.1420 0.0721  0.0508  0.1480  3   GLU A CG    
24   C CD    . GLU A 3   ? 0.6131 0.7501 1.2516 0.0633  0.0277  0.1546  3   GLU A CD    
25   O OE1   . GLU A 3   ? 0.7073 0.8507 1.3782 0.0636  0.0322  0.1623  3   GLU A OE1   
26   O OE2   . GLU A 3   ? 0.6114 0.7518 1.2350 0.0559  0.0056  0.1523  3   GLU A OE2   
27   N N     . PHE A 4   ? 0.3301 0.4086 0.7700 0.0542  0.0476  0.1125  4   PHE A N     
28   C CA    . PHE A 4   ? 0.2732 0.3476 0.6687 0.0459  0.0441  0.1033  4   PHE A CA    
29   C C     . PHE A 4   ? 0.2942 0.3712 0.6767 0.0398  0.0191  0.1017  4   PHE A C     
30   O O     . PHE A 4   ? 0.2910 0.3651 0.6810 0.0406  0.0049  0.1056  4   PHE A O     
31   C CB    . PHE A 4   ? 0.2734 0.3306 0.6272 0.0446  0.0593  0.0966  4   PHE A CB    
32   C CG    . PHE A 4   ? 0.3231 0.3670 0.6618 0.0461  0.0541  0.0962  4   PHE A CG    
33   C CD1   . PHE A 4   ? 0.2974 0.3362 0.6003 0.0393  0.0403  0.0908  4   PHE A CD1   
34   C CD2   . PHE A 4   ? 0.3362 0.3716 0.6963 0.0546  0.0644  0.1015  4   PHE A CD2   
35   C CE1   . PHE A 4   ? 0.2987 0.3236 0.5853 0.0398  0.0357  0.0904  4   PHE A CE1   
36   C CE2   . PHE A 4   ? 0.3436 0.3645 0.6884 0.0562  0.0596  0.1015  4   PHE A CE2   
37   C CZ    . PHE A 4   ? 0.3123 0.3276 0.6189 0.0481  0.0447  0.0958  4   PHE A CZ    
38   N N     . TYR A 5   ? 0.2850 0.3657 0.6475 0.0336  0.0142  0.0965  5   TYR A N     
39   C CA    . TYR A 5   ? 0.2851 0.3650 0.6320 0.0273  -0.0061 0.0939  5   TYR A CA    
40   C C     . TYR A 5   ? 0.3098 0.3778 0.6176 0.0242  -0.0090 0.0880  5   TYR A C     
41   O O     . TYR A 5   ? 0.2583 0.3199 0.5461 0.0253  0.0047  0.0848  5   TYR A O     
42   C CB    . TYR A 5   ? 0.3115 0.3975 0.6515 0.0229  -0.0077 0.0904  5   TYR A CB    
43   C CG    . TYR A 5   ? 0.3045 0.3890 0.6146 0.0217  0.0054  0.0844  5   TYR A CG    
44   C CD1   . TYR A 5   ? 0.2366 0.3167 0.5134 0.0174  0.0003  0.0785  5   TYR A CD1   
45   C CD2   . TYR A 5   ? 0.2869 0.3743 0.6028 0.0242  0.0227  0.0856  5   TYR A CD2   
46   C CE1   . TYR A 5   ? 0.2341 0.3157 0.4880 0.0158  0.0104  0.0752  5   TYR A CE1   
47   C CE2   . TYR A 5   ? 0.2682 0.3541 0.5566 0.0216  0.0319  0.0819  5   TYR A CE2   
48   C CZ    . TYR A 5   ? 0.2823 0.3668 0.5419 0.0176  0.0250  0.0773  5   TYR A CZ    
49   O OH    . TYR A 5   ? 0.2453 0.3311 0.4820 0.0146  0.0326  0.0757  5   TYR A OH    
50   N N     . LEU A 6   ? 0.3152 0.3784 0.6102 0.0189  -0.0270 0.0866  6   LEU A N     
51   C CA    . LEU A 6   ? 0.2671 0.3193 0.5239 0.0144  -0.0306 0.0807  6   LEU A CA    
52   C C     . LEU A 6   ? 0.3065 0.3597 0.5401 0.0083  -0.0346 0.0744  6   LEU A C     
53   O O     . LEU A 6   ? 0.2615 0.3152 0.4706 0.0066  -0.0257 0.0692  6   LEU A O     
54   C CB    . LEU A 6   ? 0.2805 0.3226 0.5374 0.0126  -0.0468 0.0843  6   LEU A CB    
55   C CG    . LEU A 6   ? 0.3177 0.3568 0.5970 0.0199  -0.0425 0.0913  6   LEU A CG    
56   C CD1   . LEU A 6   ? 0.3628 0.3939 0.6486 0.0180  -0.0627 0.0975  6   LEU A CD1   
57   C CD2   . LEU A 6   ? 0.3223 0.3520 0.5758 0.0219  -0.0260 0.0866  6   LEU A CD2   
58   N N     . THR A 7   ? 0.3075 0.3601 0.5496 0.0047  -0.0479 0.0755  7   THR A N     
59   C CA    . THR A 7   ? 0.3131 0.3636 0.5357 -0.0002 -0.0502 0.0697  7   THR A CA    
60   C C     . THR A 7   ? 0.3301 0.3846 0.5757 -0.0011 -0.0556 0.0728  7   THR A C     
61   O O     . THR A 7   ? 0.3252 0.3826 0.5987 -0.0008 -0.0637 0.0796  7   THR A O     
62   C CB    . THR A 7   ? 0.3091 0.3442 0.5023 -0.0078 -0.0627 0.0656  7   THR A CB    
63   O OG1   . THR A 7   ? 0.3425 0.3699 0.5482 -0.0117 -0.0803 0.0710  7   THR A OG1   
64   C CG2   . THR A 7   ? 0.2952 0.3249 0.4642 -0.0083 -0.0584 0.0628  7   THR A CG2   
65   N N     . VAL A 8   ? 0.3094 0.3642 0.5445 -0.0024 -0.0509 0.0684  8   VAL A N     
66   C CA    . VAL A 8   ? 0.3094 0.3636 0.5596 -0.0049 -0.0563 0.0703  8   VAL A CA    
67   C C     . VAL A 8   ? 0.3686 0.4102 0.5910 -0.0096 -0.0576 0.0634  8   VAL A C     
68   O O     . VAL A 8   ? 0.3392 0.3812 0.5410 -0.0075 -0.0479 0.0584  8   VAL A O     
69   C CB    . VAL A 8   ? 0.3281 0.3962 0.6033 0.0010  -0.0438 0.0738  8   VAL A CB    
70   C CG1   . VAL A 8   ? 0.3004 0.3726 0.5591 0.0044  -0.0297 0.0696  8   VAL A CG1   
71   C CG2   . VAL A 8   ? 0.3677 0.4350 0.6630 -0.0026 -0.0512 0.0772  8   VAL A CG2   
72   N N     . GLU A 9   ? 0.3657 0.3952 0.5875 -0.0165 -0.0692 0.0637  9   GLU A N     
73   C CA    . GLU A 9   ? 0.3788 0.3914 0.5734 -0.0212 -0.0684 0.0569  9   GLU A CA    
74   C C     . GLU A 9   ? 0.4269 0.4323 0.6325 -0.0258 -0.0742 0.0589  9   GLU A C     
75   O O     . GLU A 9   ? 0.4016 0.4129 0.6329 -0.0288 -0.0844 0.0659  9   GLU A O     
76   C CB    . GLU A 9   ? 0.4355 0.4275 0.5983 -0.0300 -0.0790 0.0526  9   GLU A CB    
77   C CG    . GLU A 9   ? 0.4857 0.4812 0.6346 -0.0279 -0.0761 0.0508  9   GLU A CG    
78   C CD    . GLU A 9   ? 0.5115 0.5109 0.6423 -0.0231 -0.0594 0.0446  9   GLU A CD    
79   O OE1   . GLU A 9   ? 0.4856 0.4865 0.6178 -0.0196 -0.0494 0.0424  9   GLU A OE1   
80   O OE2   . GLU A 9   ? 0.5058 0.5070 0.6223 -0.0230 -0.0567 0.0428  9   GLU A OE2   
81   N N     . GLN A 10  ? 0.4136 0.4060 0.6006 -0.0267 -0.0670 0.0533  10  GLN A N     
82   C CA    . GLN A 10  ? 0.4259 0.4036 0.6136 -0.0335 -0.0731 0.0537  10  GLN A CA    
83   C C     . GLN A 10  ? 0.4728 0.4194 0.6223 -0.0444 -0.0802 0.0470  10  GLN A C     
84   O O     . GLN A 10  ? 0.5244 0.4602 0.6473 -0.0420 -0.0691 0.0398  10  GLN A O     
85   C CB    . GLN A 10  ? 0.4114 0.3939 0.6072 -0.0261 -0.0580 0.0529  10  GLN A CB    
86   C CG    . GLN A 10  ? 0.4381 0.4015 0.6304 -0.0338 -0.0630 0.0525  10  GLN A CG    
87   C CD    . GLN A 10  ? 0.4913 0.4539 0.6854 -0.0261 -0.0473 0.0511  10  GLN A CD    
88   O OE1   . GLN A 10  ? 0.4806 0.4614 0.6854 -0.0150 -0.0344 0.0524  10  GLN A OE1   
89   N NE2   . GLN A 10  ? 0.5096 0.4490 0.6918 -0.0328 -0.0491 0.0489  10  GLN A NE2   
90   N N     . ILE A 11  ? 0.5087 0.4403 0.6552 -0.0573 -0.0986 0.0501  11  ILE A N     
91   C CA    . ILE A 11  ? 0.5690 0.4653 0.6744 -0.0708 -0.1067 0.0441  11  ILE A CA    
92   C C     . ILE A 11  ? 0.6127 0.4924 0.7187 -0.0821 -0.1171 0.0466  11  ILE A C     
93   O O     . ILE A 11  ? 0.6076 0.4916 0.7319 -0.0914 -0.1367 0.0550  11  ILE A O     
94   C CB    . ILE A 11  ? 0.5945 0.4824 0.6847 -0.0803 -0.1243 0.0461  11  ILE A CB    
95   C CG1   . ILE A 11  ? 0.5725 0.4765 0.6623 -0.0700 -0.1144 0.0441  11  ILE A CG1   
96   C CG2   . ILE A 11  ? 0.6367 0.4836 0.6780 -0.0962 -0.1318 0.0394  11  ILE A CG2   
97   C CD1   . ILE A 11  ? 0.6193 0.5161 0.6964 -0.0779 -0.1310 0.0470  11  ILE A CD1   
98   N N     . GLY A 12  ? 0.6757 0.5365 0.7633 -0.0814 -0.1040 0.0400  12  GLY A N     
99   C CA    . GLY A 12  ? 0.6608 0.5048 0.7480 -0.0916 -0.1111 0.0419  12  GLY A CA    
100  C C     . GLY A 12  ? 0.5897 0.4651 0.7255 -0.0853 -0.1124 0.0512  12  GLY A C     
101  O O     . GLY A 12  ? 0.5758 0.4748 0.7340 -0.0700 -0.0963 0.0519  12  GLY A O     
102  N N     . ASP A 13  ? 0.5596 0.4349 0.7114 -0.0981 -0.1318 0.0591  13  ASP A N     
103  C CA    . ASP A 13  ? 0.5531 0.4572 0.7525 -0.0940 -0.1330 0.0686  13  ASP A CA    
104  C C     . ASP A 13  ? 0.5153 0.4520 0.7526 -0.0883 -0.1404 0.0775  13  ASP A C     
105  O O     . ASP A 13  ? 0.4888 0.4492 0.7680 -0.0866 -0.1432 0.0867  13  ASP A O     
106  C CB    . ASP A 13  ? 0.6164 0.5055 0.8182 -0.1110 -0.1488 0.0736  13  ASP A CB    
107  C CG    . ASP A 13  ? 0.6931 0.5498 0.8617 -0.1150 -0.1381 0.0652  13  ASP A CG    
108  O OD1   . ASP A 13  ? 0.6837 0.5401 0.8438 -0.1005 -0.1161 0.0584  13  ASP A OD1   
109  O OD2   . ASP A 13  ? 0.7684 0.5993 0.9195 -0.1328 -0.1519 0.0662  13  ASP A OD2   
110  N N     . SER A 14  ? 0.5265 0.4632 0.7489 -0.0853 -0.1421 0.0750  14  SER A N     
111  C CA    . SER A 14  ? 0.5050 0.4679 0.7596 -0.0798 -0.1486 0.0832  14  SER A CA    
112  C C     . SER A 14  ? 0.4727 0.4536 0.7316 -0.0629 -0.1291 0.0793  14  SER A C     
113  O O     . SER A 14  ? 0.4482 0.4177 0.6756 -0.0586 -0.1174 0.0702  14  SER A O     
114  C CB    . SER A 14  ? 0.5269 0.4757 0.7644 -0.0920 -0.1708 0.0862  14  SER A CB    
115  O OG    . SER A 14  ? 0.5540 0.4992 0.8070 -0.1070 -0.1933 0.0958  14  SER A OG    
116  N N     . ILE A 15  ? 0.4243 0.4325 0.7228 -0.0542 -0.1252 0.0868  15  ILE A N     
117  C CA    . ILE A 15  ? 0.3742 0.3972 0.6754 -0.0412 -0.1106 0.0847  15  ILE A CA    
118  C C     . ILE A 15  ? 0.3733 0.3986 0.6789 -0.0429 -0.1236 0.0895  15  ILE A C     
119  O O     . ILE A 15  ? 0.4192 0.4552 0.7574 -0.0456 -0.1359 0.0996  15  ILE A O     
120  C CB    . ILE A 15  ? 0.3610 0.4078 0.6978 -0.0307 -0.0953 0.0893  15  ILE A CB    
121  C CG1   . ILE A 15  ? 0.3271 0.3710 0.6554 -0.0275 -0.0809 0.0846  15  ILE A CG1   
122  C CG2   . ILE A 15  ? 0.3634 0.4226 0.7028 -0.0203 -0.0838 0.0888  15  ILE A CG2   
123  C CD1   . ILE A 15  ? 0.3390 0.3733 0.6324 -0.0227 -0.0696 0.0755  15  ILE A CD1   
124  N N     . PHE A 16  ? 0.3468 0.3622 0.6208 -0.0414 -0.1210 0.0829  16  PHE A N     
125  C CA    . PHE A 16  ? 0.3533 0.3686 0.6271 -0.0422 -0.1317 0.0869  16  PHE A CA    
126  C C     . PHE A 16  ? 0.3610 0.3932 0.6471 -0.0292 -0.1154 0.0869  16  PHE A C     
127  O O     . PHE A 16  ? 0.3236 0.3550 0.5876 -0.0240 -0.1003 0.0792  16  PHE A O     
128  C CB    . PHE A 16  ? 0.4052 0.3950 0.6325 -0.0513 -0.1401 0.0798  16  PHE A CB    
129  C CG    . PHE A 16  ? 0.5094 0.4781 0.7227 -0.0672 -0.1618 0.0824  16  PHE A CG    
130  C CD1   . PHE A 16  ? 0.5528 0.5154 0.7684 -0.0756 -0.1839 0.0905  16  PHE A CD1   
131  C CD2   . PHE A 16  ? 0.5541 0.5070 0.7504 -0.0746 -0.1606 0.0775  16  PHE A CD2   
132  C CE1   . PHE A 16  ? 0.5987 0.5401 0.7981 -0.0928 -0.2060 0.0938  16  PHE A CE1   
133  C CE2   . PHE A 16  ? 0.6056 0.5352 0.7839 -0.0916 -0.1809 0.0797  16  PHE A CE2   
134  C CZ    . PHE A 16  ? 0.6244 0.5484 0.8035 -0.1015 -0.2044 0.0880  16  PHE A CZ    
135  N N     . GLU A 17  ? 0.3511 0.3976 0.6725 -0.0244 -0.1182 0.0961  17  GLU A N     
136  C CA    . GLU A 17  ? 0.3272 0.3855 0.6586 -0.0129 -0.1016 0.0962  17  GLU A CA    
137  C C     . GLU A 17  ? 0.3289 0.3854 0.6663 -0.0111 -0.1099 0.1018  17  GLU A C     
138  O O     . GLU A 17  ? 0.3399 0.3997 0.7045 -0.0137 -0.1255 0.1118  17  GLU A O     
139  C CB    . GLU A 17  ? 0.3319 0.4086 0.7018 -0.0054 -0.0878 0.1014  17  GLU A CB    
140  C CG    . GLU A 17  ? 0.3201 0.4040 0.6955 0.0049  -0.0693 0.1011  17  GLU A CG    
141  C CD    . GLU A 17  ? 0.3270 0.4260 0.7428 0.0117  -0.0562 0.1077  17  GLU A CD    
142  O OE1   . GLU A 17  ? 0.3007 0.4080 0.7483 0.0088  -0.0642 0.1148  17  GLU A OE1   
143  O OE2   . GLU A 17  ? 0.3611 0.4621 0.7752 0.0188  -0.0375 0.1060  17  GLU A OE2   
144  N N     . ARG A 18  ? 0.3055 0.3568 0.6181 -0.0069 -0.1000 0.0961  18  ARG A N     
145  C CA    . ARG A 18  ? 0.3026 0.3521 0.6221 -0.0024 -0.1020 0.1011  18  ARG A CA    
146  C C     . ARG A 18  ? 0.2820 0.3433 0.6230 0.0088  -0.0804 0.1025  18  ARG A C     
147  O O     . ARG A 18  ? 0.2787 0.3432 0.6061 0.0111  -0.0637 0.0958  18  ARG A O     
148  C CB    . ARG A 18  ? 0.3049 0.3380 0.5801 -0.0064 -0.1041 0.0938  18  ARG A CB    
149  C CG    . ARG A 18  ? 0.3831 0.3998 0.6301 -0.0186 -0.1228 0.0911  18  ARG A CG    
150  C CD    . ARG A 18  ? 0.3872 0.3885 0.5887 -0.0228 -0.1201 0.0824  18  ARG A CD    
151  N NE    . ARG A 18  ? 0.3678 0.3629 0.5656 -0.0203 -0.1234 0.0862  18  ARG A NE    
152  C CZ    . ARG A 18  ? 0.4343 0.4192 0.5980 -0.0220 -0.1173 0.0797  18  ARG A CZ    
153  N NH1   . ARG A 18  ? 0.3473 0.3298 0.4812 -0.0256 -0.1074 0.0699  18  ARG A NH1   
154  N NH2   . ARG A 18  ? 0.3582 0.3354 0.5189 -0.0199 -0.1206 0.0837  18  ARG A NH2   
155  N N     . TYR A 19  ? 0.2799 0.3466 0.6546 0.0153  -0.0802 0.1118  19  TYR A N     
156  C CA    . TYR A 19  ? 0.2712 0.3454 0.6662 0.0256  -0.0575 0.1132  19  TYR A CA    
157  C C     . TYR A 19  ? 0.3144 0.3859 0.7317 0.0335  -0.0556 0.1213  19  TYR A C     
158  O O     . TYR A 19  ? 0.3234 0.3918 0.7512 0.0317  -0.0747 0.1286  19  TYR A O     
159  C CB    . TYR A 19  ? 0.2738 0.3638 0.7046 0.0275  -0.0504 0.1174  19  TYR A CB    
160  C CG    . TYR A 19  ? 0.2817 0.3832 0.7602 0.0276  -0.0649 0.1301  19  TYR A CG    
161  C CD1   . TYR A 19  ? 0.3042 0.4167 0.8279 0.0371  -0.0534 0.1394  19  TYR A CD1   
162  C CD2   . TYR A 19  ? 0.2918 0.3926 0.7704 0.0174  -0.0898 0.1334  19  TYR A CD2   
163  C CE1   . TYR A 19  ? 0.3251 0.4517 0.8981 0.0371  -0.0673 0.1529  19  TYR A CE1   
164  C CE2   . TYR A 19  ? 0.3167 0.4293 0.8399 0.0155  -0.1056 0.1467  19  TYR A CE2   
165  C CZ    . TYR A 19  ? 0.3353 0.4629 0.9081 0.0257  -0.0948 0.1570  19  TYR A CZ    
166  O OH    . TYR A 19  ? 0.3932 0.5311 1.0052 0.0220  -0.1088 0.1696  19  TYR A OH    
167  N N     . ILE A 20  ? 0.2786 0.3490 0.7012 0.0420  -0.0321 0.1201  20  ILE A N     
168  C CA    . ILE A 20  ? 0.3163 0.3828 0.7640 0.0518  -0.0243 0.1278  20  ILE A CA    
169  C C     . ILE A 20  ? 0.3457 0.4282 0.8469 0.0595  -0.0126 0.1367  20  ILE A C     
170  O O     . ILE A 20  ? 0.3403 0.4272 0.8420 0.0604  0.0059  0.1323  20  ILE A O     
171  C CB    . ILE A 20  ? 0.3170 0.3663 0.7306 0.0553  -0.0029 0.1201  20  ILE A CB    
172  C CG1   . ILE A 20  ? 0.3041 0.3390 0.6665 0.0471  -0.0136 0.1119  20  ILE A CG1   
173  C CG2   . ILE A 20  ? 0.3117 0.3537 0.7520 0.0667  0.0093  0.1278  20  ILE A CG2   
174  C CD1   . ILE A 20  ? 0.3167 0.3436 0.6800 0.0460  -0.0346 0.1178  20  ILE A CD1   
175  N N     . ASP A 21  ? 0.3634 0.4550 0.9106 0.0645  -0.0236 0.1499  21  ASP A N     
176  C CA    . ASP A 21  ? 0.3416 0.4518 0.9462 0.0713  -0.0137 0.1600  21  ASP A CA    
177  C C     . ASP A 21  ? 0.3710 0.4737 0.9884 0.0828  0.0171  0.1606  21  ASP A C     
178  O O     . ASP A 21  ? 0.3729 0.4567 0.9605 0.0877  0.0311  0.1544  21  ASP A O     
179  C CB    . ASP A 21  ? 0.2955 0.4159 0.9295 0.0649  -0.0380 0.1713  21  ASP A CB    
180  C CG    . ASP A 21  ? 0.3087 0.4210 0.9506 0.0694  -0.0475 0.1792  21  ASP A CG    
181  O OD1   . ASP A 21  ? 0.3325 0.4324 0.9683 0.0799  -0.0292 0.1775  21  ASP A OD1   
182  O OD2   . ASP A 21  ? 0.3258 0.4424 0.9791 0.0616  -0.0736 0.1877  21  ASP A OD2   
183  N N     . SER A 22  ? 0.3673 0.4799 1.0183 0.0834  0.0279  0.1663  22  SER A N     
184  C CA    . SER A 22  ? 0.4151 0.5193 1.0780 0.0927  0.0593  0.1667  22  SER A CA    
185  C C     . SER A 22  ? 0.4264 0.5184 1.0959 0.1016  0.0626  0.1720  22  SER A C     
186  O O     . SER A 22  ? 0.4531 0.5313 1.1228 0.1101  0.0904  0.1706  22  SER A O     
187  C CB    . SER A 22  ? 0.4679 0.5856 1.1675 0.0906  0.0675  0.1733  22  SER A CB    
188  O OG    . SER A 22  ? 0.5280 0.6597 1.2596 0.0862  0.0432  0.1848  22  SER A OG    
189  N N     . ASN A 23  ? 0.4089 0.5035 1.0814 0.0990  0.0347  0.1780  23  ASN A N     
190  C CA    . ASN A 23  ? 0.4498 0.5317 1.1257 0.1070  0.0346  0.1834  23  ASN A CA    
191  C C     . ASN A 23  ? 0.4490 0.5108 1.0820 0.1080  0.0258  0.1771  23  ASN A C     
192  O O     . ASN A 23  ? 0.4473 0.4962 1.0765 0.1127  0.0193  0.1816  23  ASN A O     
193  C CB    . ASN A 23  ? 0.4569 0.5533 1.1695 0.1038  0.0107  0.1971  23  ASN A CB    
194  C CG    . ASN A 23  ? 0.4590 0.5727 1.2168 0.1037  0.0210  0.2053  23  ASN A CG    
195  O OD1   . ASN A 23  ? 0.4129 0.5434 1.1905 0.0942  0.0019  0.2114  23  ASN A OD1   
196  N ND2   . ASN A 23  ? 0.5009 0.6079 1.2735 0.1137  0.0520  0.2059  23  ASN A ND2   
197  N N     . GLY A 24  ? 0.4143 0.4727 1.0154 0.1034  0.0255  0.1676  24  GLY A N     
198  C CA    . GLY A 24  ? 0.4051 0.4409 0.9434 0.0964  0.0213  0.1561  24  GLY A CA    
199  C C     . GLY A 24  ? 0.4040 0.4399 0.9244 0.0867  -0.0125 0.1579  24  GLY A C     
200  O O     . GLY A 24  ? 0.4356 0.4522 0.9098 0.0818  -0.0174 0.1510  24  GLY A O     
201  N N     . ARG A 25  ? 0.3938 0.4494 0.9480 0.0826  -0.0355 0.1671  25  ARG A N     
202  C CA    . ARG A 25  ? 0.4288 0.4816 0.9652 0.0717  -0.0681 0.1697  25  ARG A CA    
203  C C     . ARG A 25  ? 0.3778 0.4342 0.8802 0.0576  -0.0787 0.1593  25  ARG A C     
204  O O     . ARG A 25  ? 0.3430 0.4147 0.8631 0.0562  -0.0727 0.1580  25  ARG A O     
205  C CB    . ARG A 25  ? 0.5193 0.5869 1.1074 0.0727  -0.0894 0.1870  25  ARG A CB    
206  C CG    . ARG A 25  ? 0.6175 0.6816 1.1890 0.0591  -0.1254 0.1913  25  ARG A CG    
207  C CD    . ARG A 25  ? 0.7324 0.8036 1.3364 0.0560  -0.1418 0.2048  25  ARG A CD    
208  N NE    . ARG A 25  ? 0.8092 0.8788 1.4000 0.0395  -0.1754 0.2090  25  ARG A NE    
209  C CZ    . ARG A 25  ? 0.8697 0.9420 1.4806 0.0326  -0.1963 0.2214  25  ARG A CZ    
210  N NH1   . ARG A 25  ? 0.8876 0.9672 1.5367 0.0421  -0.1873 0.2312  25  ARG A NH1   
211  N NH2   . ARG A 25  ? 0.8974 0.9635 1.4893 0.0156  -0.2260 0.2243  25  ARG A NH2   
212  N N     . GLU A 26  ? 0.3639 0.4045 0.8174 0.0476  -0.0931 0.1519  26  GLU A N     
213  C CA    . GLU A 26  ? 0.3727 0.4139 0.7934 0.0349  -0.1023 0.1423  26  GLU A CA    
214  C C     . GLU A 26  ? 0.3561 0.4075 0.8011 0.0267  -0.1277 0.1511  26  GLU A C     
215  O O     . GLU A 26  ? 0.3454 0.3930 0.8023 0.0235  -0.1501 0.1618  26  GLU A O     
216  C CB    . GLU A 26  ? 0.3871 0.4078 0.7492 0.0264  -0.1081 0.1320  26  GLU A CB    
217  C CG    . GLU A 26  ? 0.3977 0.4172 0.7282 0.0139  -0.1174 0.1230  26  GLU A CG    
218  C CD    . GLU A 26  ? 0.4420 0.4431 0.7167 0.0060  -0.1186 0.1124  26  GLU A CD    
219  O OE1   . GLU A 26  ? 0.3928 0.3848 0.6486 0.0101  -0.1061 0.1087  26  GLU A OE1   
220  O OE2   . GLU A 26  ? 0.4641 0.4586 0.7132 -0.0049 -0.1312 0.1077  26  GLU A OE2   
221  N N     . ARG A 27  ? 0.3172 0.3800 0.7678 0.0222  -0.1250 0.1473  27  ARG A N     
222  C CA    . ARG A 27  ? 0.3763 0.4460 0.8437 0.0119  -0.1484 0.1543  27  ARG A CA    
223  C C     . ARG A 27  ? 0.3503 0.4140 0.7807 0.0014  -0.1488 0.1422  27  ARG A C     
224  O O     . ARG A 27  ? 0.3481 0.4086 0.7507 0.0042  -0.1294 0.1303  27  ARG A O     
225  C CB    . ARG A 27  ? 0.3961 0.4892 0.9267 0.0180  -0.1459 0.1670  27  ARG A CB    
226  C CG    . ARG A 27  ? 0.4636 0.5634 1.0376 0.0285  -0.1472 0.1814  27  ARG A CG    
227  C CD    . ARG A 27  ? 0.5238 0.6403 1.1423 0.0282  -0.1412 0.1896  27  ARG A CD    
228  N NE    . ARG A 27  ? 0.5638 0.6825 1.2122 0.0369  -0.1340 0.1990  27  ARG A NE    
229  C CZ    . ARG A 27  ? 0.5717 0.6898 1.2360 0.0316  -0.1549 0.2109  27  ARG A CZ    
230  N NH1   . ARG A 27  ? 0.5735 0.6864 1.2228 0.0164  -0.1849 0.2145  27  ARG A NH1   
231  N NH2   . ARG A 27  ? 0.5715 0.6927 1.2655 0.0412  -0.1456 0.2194  27  ARG A NH2   
232  N N     . THR A 28  ? 0.3555 0.4164 0.7850 -0.0110 -0.1713 0.1461  28  THR A N     
233  C CA    . THR A 28  ? 0.3698 0.4221 0.7662 -0.0210 -0.1719 0.1357  28  THR A CA    
234  C C     . THR A 28  ? 0.3935 0.4567 0.8223 -0.0279 -0.1841 0.1438  28  THR A C     
235  O O     . THR A 28  ? 0.4143 0.4829 0.8729 -0.0329 -0.2050 0.1573  28  THR A O     
236  C CB    . THR A 28  ? 0.4324 0.4590 0.7761 -0.0335 -0.1875 0.1291  28  THR A CB    
237  O OG1   . THR A 28  ? 0.5373 0.5546 0.8513 -0.0279 -0.1757 0.1218  28  THR A OG1   
238  C CG2   . THR A 28  ? 0.4133 0.4288 0.7242 -0.0428 -0.1854 0.1184  28  THR A CG2   
239  N N     . ARG A 29  ? 0.3800 0.4470 0.8043 -0.0286 -0.1714 0.1365  29  ARG A N     
240  C CA    . ARG A 29  ? 0.4181 0.4927 0.8675 -0.0368 -0.1818 0.1427  29  ARG A CA    
241  C C     . ARG A 29  ? 0.4470 0.5065 0.8583 -0.0451 -0.1783 0.1311  29  ARG A C     
242  O O     . ARG A 29  ? 0.4264 0.4809 0.8100 -0.0391 -0.1592 0.1194  29  ARG A O     
243  C CB    . ARG A 29  ? 0.4133 0.5139 0.9167 -0.0263 -0.1666 0.1503  29  ARG A CB    
244  C CG    . ARG A 29  ? 0.3999 0.5053 0.8950 -0.0151 -0.1366 0.1402  29  ARG A CG    
245  C CD    . ARG A 29  ? 0.3926 0.5203 0.9396 -0.0051 -0.1208 0.1484  29  ARG A CD    
246  N NE    . ARG A 29  ? 0.3899 0.5187 0.9254 0.0054  -0.0925 0.1400  29  ARG A NE    
247  C CZ    . ARG A 29  ? 0.3465 0.4879 0.9150 0.0157  -0.0729 0.1445  29  ARG A CZ    
248  N NH1   . ARG A 29  ? 0.3465 0.5000 0.9602 0.0179  -0.0762 0.1565  29  ARG A NH1   
249  N NH2   . ARG A 29  ? 0.3130 0.4509 0.8627 0.0224  -0.0488 0.1363  29  ARG A NH2   
250  N N     . GLU A 30  ? 0.4620 0.5132 0.8720 -0.0596 -0.1976 0.1352  30  GLU A N     
251  C CA    . GLU A 30  ? 0.4969 0.5320 0.8755 -0.0677 -0.1941 0.1256  30  GLU A CA    
252  C C     . GLU A 30  ? 0.4667 0.5193 0.8842 -0.0669 -0.1886 0.1311  30  GLU A C     
253  O O     . GLU A 30  ? 0.4599 0.5254 0.9161 -0.0728 -0.2039 0.1441  30  GLU A O     
254  C CB    . GLU A 30  ? 0.5881 0.5953 0.9305 -0.0866 -0.2183 0.1251  30  GLU A CB    
255  C CG    . GLU A 30  ? 0.6489 0.6348 0.9577 -0.0958 -0.2142 0.1155  30  GLU A CG    
256  C CD    . GLU A 30  ? 0.7347 0.6889 1.0057 -0.1168 -0.2380 0.1155  30  GLU A CD    
257  O OE1   . GLU A 30  ? 0.7337 0.6839 1.0053 -0.1250 -0.2598 0.1241  30  GLU A OE1   
258  O OE2   . GLU A 30  ? 0.7784 0.7094 1.0172 -0.1257 -0.2348 0.1074  30  GLU A OE2   
259  N N     . VAL A 31  ? 0.4573 0.5112 0.8659 -0.0599 -0.1669 0.1223  31  VAL A N     
260  C CA    . VAL A 31  ? 0.4363 0.5056 0.8790 -0.0584 -0.1585 0.1268  31  VAL A CA    
261  C C     . VAL A 31  ? 0.4443 0.4952 0.8585 -0.0664 -0.1561 0.1190  31  VAL A C     
262  O O     . VAL A 31  ? 0.4368 0.4746 0.8159 -0.0616 -0.1420 0.1077  31  VAL A O     
263  C CB    . VAL A 31  ? 0.4141 0.5036 0.8799 -0.0419 -0.1328 0.1259  31  VAL A CB    
264  C CG1   . VAL A 31  ? 0.4235 0.5251 0.9180 -0.0416 -0.1228 0.1293  31  VAL A CG1   
265  C CG2   . VAL A 31  ? 0.3628 0.4691 0.8617 -0.0336 -0.1330 0.1345  31  VAL A CG2   
266  N N     . GLU A 32  ? 0.4445 0.4942 0.8751 -0.0787 -0.1698 0.1258  32  GLU A N     
267  C CA    . GLU A 32  ? 0.4696 0.5001 0.8756 -0.0866 -0.1668 0.1193  32  GLU A CA    
268  C C     . GLU A 32  ? 0.4002 0.4464 0.8272 -0.0751 -0.1435 0.1180  32  GLU A C     
269  O O     . GLU A 32  ? 0.4250 0.4826 0.8836 -0.0792 -0.1442 0.1252  32  GLU A O     
270  C CB    . GLU A 32  ? 0.5158 0.5377 0.9300 -0.1060 -0.1907 0.1277  32  GLU A CB    
271  C CG    . GLU A 32  ? 0.6102 0.5966 0.9769 -0.1191 -0.1941 0.1188  32  GLU A CG    
272  N N     . TYR A 33  ? 0.3502 0.3965 0.7587 -0.0618 -0.1236 0.1094  33  TYR A N     
273  C CA    . TYR A 33  ? 0.3216 0.3825 0.7466 -0.0503 -0.1016 0.1088  33  TYR A CA    
274  C C     . TYR A 33  ? 0.3638 0.4135 0.7817 -0.0550 -0.0964 0.1066  33  TYR A C     
275  O O     . TYR A 33  ? 0.3640 0.3888 0.7463 -0.0609 -0.0996 0.0997  33  TYR A O     
276  C CB    . TYR A 33  ? 0.3013 0.3620 0.7023 -0.0378 -0.0853 0.1007  33  TYR A CB    
277  C CG    . TYR A 33  ? 0.2977 0.3714 0.7101 -0.0270 -0.0638 0.1005  33  TYR A CG    
278  C CD1   . TYR A 33  ? 0.2959 0.3899 0.7456 -0.0224 -0.0557 0.1078  33  TYR A CD1   
279  C CD2   . TYR A 33  ? 0.2734 0.3380 0.6587 -0.0217 -0.0512 0.0935  33  TYR A CD2   
280  C CE1   . TYR A 33  ? 0.2678 0.3696 0.7218 -0.0144 -0.0357 0.1073  33  TYR A CE1   
281  C CE2   . TYR A 33  ? 0.2978 0.3725 0.6901 -0.0136 -0.0338 0.0944  33  TYR A CE2   
282  C CZ    . TYR A 33  ? 0.2796 0.3713 0.7034 -0.0107 -0.0262 0.1008  33  TYR A CZ    
283  O OH    . TYR A 33  ? 0.2383 0.3357 0.6628 -0.0045 -0.0088 0.1013  33  TYR A OH    
284  N N     . LYS A 34  ? 0.3465 0.4127 0.7975 -0.0525 -0.0869 0.1126  34  LYS A N     
285  C CA    . LYS A 34  ? 0.3701 0.4268 0.8171 -0.0562 -0.0803 0.1116  34  LYS A CA    
286  C C     . LYS A 34  ? 0.3228 0.3852 0.7653 -0.0433 -0.0576 0.1082  34  LYS A C     
287  O O     . LYS A 34  ? 0.3063 0.3875 0.7770 -0.0377 -0.0460 0.1133  34  LYS A O     
288  C CB    . LYS A 34  ? 0.3958 0.4652 0.8827 -0.0658 -0.0879 0.1220  34  LYS A CB    
289  C CG    . LYS A 34  ? 0.4860 0.5478 0.9758 -0.0820 -0.1136 0.1271  34  LYS A CG    
290  C CD    . LYS A 34  ? 0.5703 0.6531 1.1101 -0.0904 -0.1216 0.1401  34  LYS A CD    
291  C CE    . LYS A 34  ? 0.6065 0.7199 1.1907 -0.0809 -0.1179 0.1486  34  LYS A CE    
292  N N     . PRO A 35  ? 0.3370 0.3819 0.7434 -0.0389 -0.0507 0.1001  35  PRO A N     
293  C CA    . PRO A 35  ? 0.3341 0.3842 0.7336 -0.0273 -0.0319 0.0980  35  PRO A CA    
294  C C     . PRO A 35  ? 0.3439 0.3904 0.7510 -0.0287 -0.0233 0.1009  35  PRO A C     
295  O O     . PRO A 35  ? 0.3845 0.4189 0.7933 -0.0385 -0.0314 0.1022  35  PRO A O     
296  C CB    . PRO A 35  ? 0.3093 0.3425 0.6712 -0.0232 -0.0305 0.0898  35  PRO A CB    
297  C CG    . PRO A 35  ? 0.3569 0.3670 0.7020 -0.0344 -0.0440 0.0868  35  PRO A CG    
298  C CD    . PRO A 35  ? 0.3743 0.3932 0.7444 -0.0448 -0.0599 0.0930  35  PRO A CD    
299  N N     . SER A 36  ? 0.3321 0.3873 0.7416 -0.0202 -0.0077 0.1024  36  SER A N     
300  C CA    . SER A 36  ? 0.3311 0.3806 0.7428 -0.0208 0.0014  0.1052  36  SER A CA    
301  C C     . SER A 36  ? 0.3491 0.3896 0.7345 -0.0119 0.0111  0.1022  36  SER A C     
302  O O     . SER A 36  ? 0.3327 0.3813 0.7086 -0.0044 0.0159  0.1006  36  SER A O     
303  C CB    . SER A 36  ? 0.3464 0.4132 0.7868 -0.0206 0.0119  0.1118  36  SER A CB    
304  O OG    . SER A 36  ? 0.3658 0.4416 0.8371 -0.0292 0.0039  0.1167  36  SER A OG    
305  N N     . LEU A 37  ? 0.3703 0.3936 0.7446 -0.0131 0.0133  0.1022  37  LEU A N     
306  C CA    . LEU A 37  ? 0.3696 0.3867 0.7263 -0.0041 0.0230  0.1025  37  LEU A CA    
307  C C     . LEU A 37  ? 0.3559 0.3673 0.7197 -0.0065 0.0300  0.1081  37  LEU A C     
308  O O     . LEU A 37  ? 0.3520 0.3642 0.7332 -0.0153 0.0276  0.1107  37  LEU A O     
309  C CB    . LEU A 37  ? 0.3239 0.3213 0.6562 -0.0009 0.0203  0.0967  37  LEU A CB    
310  C CG    . LEU A 37  ? 0.3184 0.3191 0.6396 0.0011  0.0148  0.0909  37  LEU A CG    
311  C CD1   . LEU A 37  ? 0.4020 0.3780 0.6988 0.0014  0.0132  0.0846  37  LEU A CD1   
312  C CD2   . LEU A 37  ? 0.3138 0.3330 0.6337 0.0104  0.0216  0.0924  37  LEU A CD2   
313  N N     . PHE A 38  ? 0.3658 0.3722 0.7174 0.0008  0.0382  0.1109  38  PHE A N     
314  C CA    . PHE A 38  ? 0.3279 0.3298 0.6843 -0.0012 0.0456  0.1174  38  PHE A CA    
315  C C     . PHE A 38  ? 0.3560 0.3376 0.6960 0.0038  0.0484  0.1191  38  PHE A C     
316  O O     . PHE A 38  ? 0.3621 0.3390 0.6885 0.0124  0.0484  0.1170  38  PHE A O     
317  C CB    . PHE A 38  ? 0.3148 0.3329 0.6751 0.0014  0.0542  0.1224  38  PHE A CB    
318  C CG    . PHE A 38  ? 0.2991 0.3350 0.6760 -0.0022 0.0548  0.1211  38  PHE A CG    
319  C CD1   . PHE A 38  ? 0.3055 0.3468 0.7024 -0.0092 0.0605  0.1247  38  PHE A CD1   
320  C CD2   . PHE A 38  ? 0.2886 0.3350 0.6621 0.0018  0.0508  0.1169  38  PHE A CD2   
321  C CE1   . PHE A 38  ? 0.2960 0.3531 0.7114 -0.0110 0.0630  0.1243  38  PHE A CE1   
322  C CE2   . PHE A 38  ? 0.3071 0.3676 0.6962 -0.0005 0.0519  0.1163  38  PHE A CE2   
323  C CZ    . PHE A 38  ? 0.2929 0.3590 0.7041 -0.0062 0.0585  0.1202  38  PHE A CZ    
324  N N     . ALA A 39  ? 0.4067 0.3759 0.7494 -0.0013 0.0516  0.1233  39  ALA A N     
325  C CA    . ALA A 39  ? 0.3817 0.3304 0.7103 0.0039  0.0556  0.1267  39  ALA A CA    
326  C C     . ALA A 39  ? 0.4149 0.3640 0.7472 0.0014  0.0626  0.1352  39  ALA A C     
327  O O     . ALA A 39  ? 0.3819 0.3388 0.7277 -0.0077 0.0646  0.1367  39  ALA A O     
328  C CB    . ALA A 39  ? 0.4056 0.3284 0.7265 -0.0017 0.0515  0.1222  39  ALA A CB    
329  N N     . HIS A 40  ? 0.3964 0.3369 0.7172 0.0094  0.0665  0.1415  40  HIS A N     
330  C CA    . HIS A 40  ? 0.4501 0.3856 0.7692 0.0062  0.0723  0.1503  40  HIS A CA    
331  C C     . HIS A 40  ? 0.4701 0.3875 0.7927 -0.0040 0.0734  0.1500  40  HIS A C     
332  O O     . HIS A 40  ? 0.4742 0.3737 0.7924 -0.0051 0.0697  0.1453  40  HIS A O     
333  C CB    . HIS A 40  ? 0.4777 0.4045 0.7844 0.0167  0.0737  0.1584  40  HIS A CB    
334  C CG    . HIS A 40  ? 0.5064 0.4532 0.8108 0.0239  0.0723  0.1618  40  HIS A CG    
335  N ND1   . HIS A 40  ? 0.5235 0.4720 0.8248 0.0359  0.0699  0.1636  40  HIS A ND1   
336  C CD2   . HIS A 40  ? 0.5097 0.4747 0.8140 0.0198  0.0735  0.1641  40  HIS A CD2   
337  C CE1   . HIS A 40  ? 0.5249 0.4937 0.8253 0.0381  0.0680  0.1674  40  HIS A CE1   
338  N NE2   . HIS A 40  ? 0.5057 0.4829 0.8055 0.0282  0.0700  0.1674  40  HIS A NE2   
339  N N     . CYS A 41  ? 0.4279 0.3482 0.7565 -0.0126 0.0791  0.1549  41  CYS A N     
340  C CA    . CYS A 41  ? 0.4481 0.3542 0.7825 -0.0241 0.0808  0.1557  41  CYS A CA    
341  C C     . CYS A 41  ? 0.4710 0.3662 0.7967 -0.0271 0.0887  0.1649  41  CYS A C     
342  O O     . CYS A 41  ? 0.4804 0.3829 0.7978 -0.0226 0.0924  0.1703  41  CYS A O     
343  C CB    . CYS A 41  ? 0.4542 0.3782 0.8118 -0.0346 0.0805  0.1520  41  CYS A CB    
344  S SG    . CYS A 41  ? 0.4666 0.4134 0.8355 -0.0373 0.0917  0.1560  41  CYS A SG    
345  N N     . PRO A 42  ? 0.4991 0.3751 0.8242 -0.0361 0.0908  0.1670  42  PRO A N     
346  C CA    . PRO A 42  ? 0.5475 0.4104 0.8616 -0.0399 0.0983  0.1761  42  PRO A CA    
347  C C     . PRO A 42  ? 0.5476 0.4279 0.8680 -0.0463 0.1073  0.1791  42  PRO A C     
348  O O     . PRO A 42  ? 0.4819 0.3823 0.8218 -0.0508 0.1094  0.1741  42  PRO A O     
349  C CB    . PRO A 42  ? 0.5724 0.4149 0.8889 -0.0513 0.0989  0.1759  42  PRO A CB    
350  C CG    . PRO A 42  ? 0.5884 0.4238 0.9066 -0.0497 0.0899  0.1680  42  PRO A CG    
351  C CD    . PRO A 42  ? 0.5261 0.3885 0.8566 -0.0443 0.0856  0.1619  42  PRO A CD    
352  N N     . GLU A 43  ? 0.6101 0.4806 0.9130 -0.0469 0.1130  0.1876  43  GLU A N     
353  C CA    . GLU A 43  ? 0.6630 0.5432 0.9639 -0.0539 0.1236  0.1906  43  GLU A CA    
354  C C     . GLU A 43  ? 0.6997 0.5817 1.0184 -0.0677 0.1343  0.1890  43  GLU A C     
355  O O     . GLU A 43  ? 0.7092 0.6035 1.0350 -0.0732 0.1454  0.1885  43  GLU A O     
356  C CB    . GLU A 43  ? 0.7056 0.5694 0.9788 -0.0538 0.1257  0.2011  43  GLU A CB    
357  N N     . SER A 44  ? 0.7038 0.5730 1.0301 -0.0735 0.1315  0.1886  44  SER A N     
358  C CA    . SER A 44  ? 0.7577 0.6294 1.1041 -0.0876 0.1404  0.1886  44  SER A CA    
359  C C     . SER A 44  ? 0.7793 0.6755 1.1592 -0.0897 0.1368  0.1818  44  SER A C     
360  O O     . SER A 44  ? 0.8051 0.7065 1.2085 -0.1012 0.1402  0.1822  44  SER A O     
361  C CB    . SER A 44  ? 0.7466 0.5925 1.0851 -0.0950 0.1381  0.1920  44  SER A CB    
362  N N     . GLN A 45  ? 0.7795 0.6909 1.1623 -0.0793 0.1290  0.1767  45  GLN A N     
363  C CA    . GLN A 45  ? 0.8105 0.7439 1.2228 -0.0806 0.1232  0.1711  45  GLN A CA    
364  C C     . GLN A 45  ? 0.7850 0.7420 1.2119 -0.0777 0.1325  0.1699  45  GLN A C     
365  O O     . GLN A 45  ? 0.7778 0.7384 1.1884 -0.0682 0.1323  0.1682  45  GLN A O     
366  C CB    . GLN A 45  ? 0.8494 0.7795 1.2541 -0.0724 0.1071  0.1654  45  GLN A CB    
367  C CG    . GLN A 45  ? 0.8795 0.8289 1.3109 -0.0752 0.0981  0.1605  45  GLN A CG    
368  C CD    . GLN A 45  ? 0.9431 0.8779 1.3647 -0.0752 0.0829  0.1558  45  GLN A CD    
369  O OE1   . GLN A 45  ? 0.9485 0.8944 1.3851 -0.0781 0.0726  0.1519  45  GLN A OE1   
370  N NE2   . GLN A 45  ? 0.9830 0.8906 1.3779 -0.0723 0.0818  0.1564  45  GLN A NE2   
371  N N     . ALA A 46  ? 0.7602 0.7326 1.2187 -0.0862 0.1411  0.1711  46  ALA A N     
372  C CA    . ALA A 46  ? 0.7166 0.7095 1.1926 -0.0835 0.1527  0.1702  46  ALA A CA    
373  C C     . ALA A 46  ? 0.6893 0.6979 1.1714 -0.0737 0.1409  0.1646  46  ALA A C     
374  O O     . ALA A 46  ? 0.6946 0.7111 1.1945 -0.0747 0.1265  0.1624  46  ALA A O     
375  C CB    . ALA A 46  ? 0.6891 0.6969 1.2008 -0.0921 0.1622  0.1720  46  ALA A CB    
376  N N     . THR A 47  ? 0.6363 0.6473 1.1008 -0.0657 0.1466  0.1626  47  THR A N     
377  C CA    . THR A 47  ? 0.5743 0.5990 1.0418 -0.0567 0.1371  0.1575  47  THR A CA    
378  C C     . THR A 47  ? 0.5253 0.5548 0.9824 -0.0522 0.1506  0.1566  47  THR A C     
379  O O     . THR A 47  ? 0.5431 0.5603 0.9796 -0.0554 0.1642  0.1596  47  THR A O     
380  C CB    . THR A 47  ? 0.6310 0.6452 1.0726 -0.0495 0.1207  0.1544  47  THR A CB    
381  O OG1   . THR A 47  ? 0.6206 0.6470 1.0607 -0.0412 0.1140  0.1496  47  THR A OG1   
382  C CG2   . THR A 47  ? 0.6641 0.6598 1.0715 -0.0473 0.1247  0.1581  47  THR A CG2   
383  N N     . LYS A 48  ? 0.4878 0.5326 0.9566 -0.0460 0.1466  0.1526  48  LYS A N     
384  C CA    . LYS A 48  ? 0.5089 0.5555 0.9641 -0.0418 0.1581  0.1509  48  LYS A CA    
385  C C     . LYS A 48  ? 0.4875 0.5311 0.9130 -0.0342 0.1457  0.1475  48  LYS A C     
386  O O     . LYS A 48  ? 0.4653 0.5084 0.8733 -0.0315 0.1521  0.1460  48  LYS A O     
387  C CB    . LYS A 48  ? 0.5180 0.5829 1.0074 -0.0398 0.1648  0.1495  48  LYS A CB    
388  C CG    . LYS A 48  ? 0.5155 0.5947 1.0211 -0.0342 0.1459  0.1461  48  LYS A CG    
389  C CD    . LYS A 48  ? 0.5228 0.6200 1.0656 -0.0320 0.1523  0.1468  48  LYS A CD    
390  N N     . TYR A 49  ? 0.4632 0.5034 0.8826 -0.0315 0.1291  0.1466  49  TYR A N     
391  C CA    . TYR A 49  ? 0.4007 0.4398 0.7969 -0.0239 0.1178  0.1439  49  TYR A CA    
392  C C     . TYR A 49  ? 0.4000 0.4239 0.7675 -0.0229 0.1159  0.1485  49  TYR A C     
393  O O     . TYR A 49  ? 0.3746 0.3870 0.7416 -0.0255 0.1136  0.1516  49  TYR A O     
394  C CB    . TYR A 49  ? 0.3836 0.4284 0.7916 -0.0202 0.1016  0.1394  49  TYR A CB    
395  C CG    . TYR A 49  ? 0.3462 0.4060 0.7840 -0.0217 0.0996  0.1367  49  TYR A CG    
396  C CD1   . TYR A 49  ? 0.3622 0.4333 0.8021 -0.0172 0.1013  0.1338  49  TYR A CD1   
397  C CD2   . TYR A 49  ? 0.3199 0.3826 0.7842 -0.0281 0.0948  0.1381  49  TYR A CD2   
398  C CE1   . TYR A 49  ? 0.3496 0.4344 0.8188 -0.0177 0.0985  0.1329  49  TYR A CE1   
399  C CE2   . TYR A 49  ? 0.3698 0.4480 0.8647 -0.0298 0.0908  0.1379  49  TYR A CE2   
400  C CZ    . TYR A 49  ? 0.3608 0.4502 0.8588 -0.0239 0.0928  0.1355  49  TYR A CZ    
401  O OH    . TYR A 49  ? 0.3889 0.4936 0.9192 -0.0247 0.0880  0.1367  49  TYR A OH    
402  N N     . PHE A 50  ? 0.3934 0.4170 0.7374 -0.0196 0.1159  0.1497  50  PHE A N     
403  C CA    . PHE A 50  ? 0.3936 0.4060 0.7127 -0.0181 0.1119  0.1559  50  PHE A CA    
404  C C     . PHE A 50  ? 0.4002 0.4209 0.7075 -0.0103 0.1018  0.1547  50  PHE A C     
405  O O     . PHE A 50  ? 0.3821 0.4138 0.6907 -0.0090 0.1023  0.1500  50  PHE A O     
406  C CB    . PHE A 50  ? 0.4093 0.4109 0.7082 -0.0260 0.1239  0.1619  50  PHE A CB    
407  C CG    . PHE A 50  ? 0.4753 0.4680 0.7847 -0.0344 0.1364  0.1635  50  PHE A CG    
408  C CD1   . PHE A 50  ? 0.5137 0.4911 0.8160 -0.0379 0.1357  0.1696  50  PHE A CD1   
409  C CD2   . PHE A 50  ? 0.4819 0.4814 0.8099 -0.0385 0.1495  0.1595  50  PHE A CD2   
410  C CE1   . PHE A 50  ? 0.5196 0.4888 0.8313 -0.0466 0.1477  0.1712  50  PHE A CE1   
411  C CE2   . PHE A 50  ? 0.4691 0.4623 0.8103 -0.0464 0.1622  0.1616  50  PHE A CE2   
412  C CZ    . PHE A 50  ? 0.5061 0.4841 0.8381 -0.0510 0.1612  0.1672  50  PHE A CZ    
413  N N     . ASP A 51  ? 0.3867 0.4022 0.6840 -0.0049 0.0933  0.1595  51  ASP A N     
414  C CA    . ASP A 51  ? 0.3851 0.4101 0.6725 0.0019  0.0851  0.1603  51  ASP A CA    
415  C C     . ASP A 51  ? 0.3922 0.4172 0.6573 -0.0037 0.0881  0.1668  51  ASP A C     
416  O O     . ASP A 51  ? 0.4309 0.4457 0.6862 -0.0124 0.0972  0.1700  51  ASP A O     
417  C CB    . ASP A 51  ? 0.3574 0.3783 0.6458 0.0109  0.0765  0.1638  51  ASP A CB    
418  C CG    . ASP A 51  ? 0.4145 0.4228 0.6916 0.0102  0.0762  0.1753  51  ASP A CG    
419  O OD1   . ASP A 51  ? 0.4177 0.4208 0.6807 0.0020  0.0807  0.1815  51  ASP A OD1   
420  O OD2   . ASP A 51  ? 0.4756 0.4770 0.7566 0.0181  0.0717  0.1786  51  ASP A OD2   
421  N N     . ILE A 52  ? 0.3653 0.4002 0.6207 -0.0001 0.0806  0.1691  52  ILE A N     
422  C CA    . ILE A 52  ? 0.3973 0.4317 0.6288 -0.0077 0.0815  0.1751  52  ILE A CA    
423  C C     . ILE A 52  ? 0.4690 0.4903 0.6834 -0.0131 0.0800  0.1877  52  ILE A C     
424  O O     . ILE A 52  ? 0.5354 0.5492 0.7251 -0.0234 0.0825  0.1931  52  ILE A O     
425  C CB    . ILE A 52  ? 0.4134 0.4630 0.6398 -0.0039 0.0723  0.1757  52  ILE A CB    
426  C CG1   . ILE A 52  ? 0.3438 0.3997 0.5787 0.0056  0.0615  0.1831  52  ILE A CG1   
427  C CG2   . ILE A 52  ? 0.3741 0.4340 0.6130 0.0000  0.0739  0.1637  52  ILE A CG2   
428  C CD1   . ILE A 52  ? 0.3984 0.4714 0.6310 0.0088  0.0530  0.1855  52  ILE A CD1   
429  N N     . TYR A 53  ? 0.4152 0.4308 0.6403 -0.0069 0.0758  0.1924  53  TYR A N     
430  C CA    . TYR A 53  ? 0.4671 0.4690 0.6778 -0.0112 0.0732  0.2053  53  TYR A CA    
431  C C     . TYR A 53  ? 0.4747 0.4582 0.6824 -0.0190 0.0844  0.2041  53  TYR A C     
432  O O     . TYR A 53  ? 0.4782 0.4466 0.6717 -0.0241 0.0838  0.2141  53  TYR A O     
433  C CB    . TYR A 53  ? 0.4642 0.4685 0.6874 0.0007  0.0630  0.2130  53  TYR A CB    
434  C CG    . TYR A 53  ? 0.4483 0.4725 0.6801 0.0095  0.0540  0.2135  53  TYR A CG    
435  C CD1   . TYR A 53  ? 0.4369 0.4706 0.6554 0.0055  0.0454  0.2241  53  TYR A CD1   
436  C CD2   . TYR A 53  ? 0.4166 0.4493 0.6685 0.0203  0.0542  0.2039  53  TYR A CD2   
437  C CE1   . TYR A 53  ? 0.4265 0.4801 0.6551 0.0127  0.0378  0.2252  53  TYR A CE1   
438  C CE2   . TYR A 53  ? 0.4255 0.4756 0.6848 0.0278  0.0479  0.2042  53  TYR A CE2   
439  C CZ    . TYR A 53  ? 0.4278 0.4897 0.6773 0.0244  0.0400  0.2150  53  TYR A CZ    
440  O OH    . TYR A 53  ? 0.4173 0.4984 0.6765 0.0311  0.0343  0.2159  53  TYR A OH    
441  N N     . GLY A 54  ? 0.4762 0.4616 0.6986 -0.0202 0.0942  0.1927  54  GLY A N     
442  C CA    . GLY A 54  ? 0.4838 0.4551 0.7069 -0.0287 0.1068  0.1914  54  GLY A CA    
443  C C     . GLY A 54  ? 0.4687 0.4333 0.7110 -0.0250 0.1063  0.1901  54  GLY A C     
444  O O     . GLY A 54  ? 0.4975 0.4503 0.7414 -0.0327 0.1159  0.1905  54  GLY A O     
445  N N     . LYS A 55  ? 0.4840 0.4543 0.7393 -0.0141 0.0961  0.1886  55  LYS A N     
446  C CA    . LYS A 55  ? 0.4913 0.4520 0.7614 -0.0114 0.0953  0.1863  55  LYS A CA    
447  C C     . LYS A 55  ? 0.4033 0.3726 0.6950 -0.0135 0.0990  0.1752  55  LYS A C     
448  O O     . LYS A 55  ? 0.3835 0.3682 0.6828 -0.0097 0.0962  0.1685  55  LYS A O     
449  C CB    . LYS A 55  ? 0.4957 0.4548 0.7683 0.0008  0.0851  0.1887  55  LYS A CB    
450  C CG    . LYS A 55  ? 0.5233 0.4777 0.7807 0.0044  0.0794  0.2019  55  LYS A CG    
451  N N     . PRO A 56  ? 0.4124 0.3722 0.7148 -0.0203 0.1045  0.1740  56  PRO A N     
452  C CA    . PRO A 56  ? 0.3987 0.3682 0.7252 -0.0239 0.1065  0.1659  56  PRO A CA    
453  C C     . PRO A 56  ? 0.4271 0.3996 0.7635 -0.0173 0.0953  0.1594  56  PRO A C     
454  O O     . PRO A 56  ? 0.4447 0.4045 0.7721 -0.0115 0.0892  0.1609  56  PRO A O     
455  C CB    . PRO A 56  ? 0.4162 0.3729 0.7497 -0.0337 0.1137  0.1688  56  PRO A CB    
456  C CG    . PRO A 56  ? 0.4380 0.3744 0.7515 -0.0318 0.1109  0.1763  56  PRO A CG    
457  C CD    . PRO A 56  ? 0.4375 0.3771 0.7307 -0.0256 0.1081  0.1814  56  PRO A CD    
458  N N     . CYS A 57  ? 0.3698 0.3571 0.7235 -0.0184 0.0934  0.1525  57  CYS A N     
459  C CA    . CYS A 57  ? 0.4538 0.4422 0.8146 -0.0150 0.0827  0.1459  57  CYS A CA    
460  C C     . CYS A 57  ? 0.4321 0.4266 0.8174 -0.0238 0.0813  0.1428  57  CYS A C     
461  O O     . CYS A 57  ? 0.3582 0.3636 0.7593 -0.0294 0.0895  0.1447  57  CYS A O     
462  C CB    . CYS A 57  ? 0.4385 0.4411 0.7952 -0.0074 0.0781  0.1416  57  CYS A CB    
463  S SG    . CYS A 57  ? 0.5003 0.5024 0.8337 0.0024  0.0775  0.1463  57  CYS A SG    
464  N N     A THR A 58  ? 0.4479 0.4345 0.8362 -0.0256 0.0711  0.1386  58  THR A N     
465  N N     B THR A 58  ? 0.4478 0.4345 0.8359 -0.0255 0.0711  0.1386  58  THR A N     
466  C CA    A THR A 58  ? 0.4436 0.4386 0.8558 -0.0346 0.0654  0.1365  58  THR A CA    
467  C CA    B THR A 58  ? 0.4467 0.4413 0.8586 -0.0346 0.0653  0.1365  58  THR A CA    
468  C C     A THR A 58  ? 0.4211 0.4257 0.8348 -0.0309 0.0552  0.1305  58  THR A C     
469  C C     B THR A 58  ? 0.4213 0.4256 0.8350 -0.0310 0.0550  0.1305  58  THR A C     
470  O O     A THR A 58  ? 0.4201 0.4158 0.8135 -0.0238 0.0504  0.1264  58  THR A O     
471  O O     B THR A 58  ? 0.4206 0.4160 0.8141 -0.0240 0.0502  0.1263  58  THR A O     
472  C CB    A THR A 58  ? 0.4795 0.4562 0.8929 -0.0442 0.0594  0.1369  58  THR A CB    
473  C CB    B THR A 58  ? 0.4872 0.4626 0.8991 -0.0440 0.0596  0.1370  58  THR A CB    
474  O OG1   A THR A 58  ? 0.5218 0.4763 0.9093 -0.0389 0.0540  0.1333  58  THR A OG1   
475  O OG1   B THR A 58  ? 0.4796 0.4644 0.9149 -0.0540 0.0505  0.1360  58  THR A OG1   
476  C CG2   A THR A 58  ? 0.4782 0.4480 0.8957 -0.0507 0.0696  0.1433  58  THR A CG2   
477  C CG2   B THR A 58  ? 0.5289 0.4811 0.9139 -0.0384 0.0536  0.1330  58  THR A CG2   
478  N N     . ARG A 59  ? 0.3869 0.4094 0.8258 -0.0354 0.0526  0.1306  59  ARG A N     
479  C CA    . ARG A 59  ? 0.3789 0.4102 0.8202 -0.0331 0.0421  0.1259  59  ARG A CA    
480  C C     . ARG A 59  ? 0.4156 0.4353 0.8573 -0.0420 0.0270  0.1236  59  ARG A C     
481  O O     . ARG A 59  ? 0.4729 0.4919 0.9328 -0.0529 0.0234  0.1274  59  ARG A O     
482  C CB    . ARG A 59  ? 0.3663 0.4210 0.8352 -0.0333 0.0459  0.1283  59  ARG A CB    
483  C CG    . ARG A 59  ? 0.3040 0.3673 0.7743 -0.0304 0.0350  0.1243  59  ARG A CG    
484  C CD    . ARG A 59  ? 0.3003 0.3850 0.7982 -0.0287 0.0407  0.1273  59  ARG A CD    
485  N NE    . ARG A 59  ? 0.3394 0.4351 0.8746 -0.0372 0.0398  0.1337  59  ARG A NE    
486  C CZ    . ARG A 59  ? 0.3952 0.4974 0.9514 -0.0441 0.0239  0.1360  59  ARG A CZ    
487  N NH1   . ARG A 59  ? 0.4234 0.5190 0.9623 -0.0439 0.0084  0.1314  59  ARG A NH1   
488  N NH2   . ARG A 59  ? 0.3990 0.5142 0.9933 -0.0521 0.0233  0.1436  59  ARG A NH2   
489  N N     . LYS A 60  ? 0.4108 0.4199 0.8308 -0.0386 0.0184  0.1174  60  LYS A N     
490  C CA    . LYS A 60  ? 0.4510 0.4460 0.8654 -0.0485 0.0034  0.1144  60  LYS A CA    
491  C C     . LYS A 60  ? 0.4306 0.4390 0.8531 -0.0493 -0.0076 0.1125  60  LYS A C     
492  O O     . LYS A 60  ? 0.3850 0.3960 0.7926 -0.0402 -0.0060 0.1081  60  LYS A O     
493  C CB    . LYS A 60  ? 0.5340 0.4996 0.9128 -0.0456 0.0031  0.1085  60  LYS A CB    
494  C CG    . LYS A 60  ? 0.6106 0.5581 0.9806 -0.0460 0.0116  0.1110  60  LYS A CG    
495  C CD    . LYS A 60  ? 0.6419 0.5584 0.9786 -0.0420 0.0126  0.1053  60  LYS A CD    
496  C CE    . LYS A 60  ? 0.6824 0.5775 1.0044 -0.0545 -0.0005 0.0999  60  LYS A CE    
497  N NZ    . LYS A 60  ? 0.7411 0.6230 1.0692 -0.0702 -0.0064 0.1034  60  LYS A NZ    
498  N N     . LEU A 61  ? 0.4318 0.4494 0.8793 -0.0606 -0.0192 0.1170  61  LEU A N     
499  C CA    . LEU A 61  ? 0.4782 0.5062 0.9338 -0.0629 -0.0324 0.1167  61  LEU A CA    
500  C C     . LEU A 61  ? 0.5086 0.5105 0.9345 -0.0721 -0.0479 0.1113  61  LEU A C     
501  O O     . LEU A 61  ? 0.5268 0.5088 0.9431 -0.0833 -0.0536 0.1115  61  LEU A O     
502  C CB    . LEU A 61  ? 0.5013 0.5530 1.0017 -0.0705 -0.0387 0.1260  61  LEU A CB    
503  C CG    . LEU A 61  ? 0.5167 0.5840 1.0337 -0.0707 -0.0512 0.1284  61  LEU A CG    
504  C CD1   . LEU A 61  ? 0.4993 0.5814 1.0177 -0.0556 -0.0378 0.1262  61  LEU A CD1   
505  C CD2   . LEU A 61  ? 0.5076 0.5952 1.0711 -0.0809 -0.0612 0.1396  61  LEU A CD2   
506  N N     . PHE A 62  ? 0.5132 0.5123 0.9214 -0.0683 -0.0538 0.1063  62  PHE A N     
507  C CA    . PHE A 62  ? 0.5156 0.4867 0.8907 -0.0777 -0.0670 0.1004  62  PHE A CA    
508  C C     . PHE A 62  ? 0.5241 0.5027 0.9109 -0.0883 -0.0873 0.1043  62  PHE A C     
509  O O     . PHE A 62  ? 0.5085 0.5123 0.9195 -0.0820 -0.0880 0.1082  62  PHE A O     
510  C CB    . PHE A 62  ? 0.4667 0.4225 0.8058 -0.0664 -0.0572 0.0911  62  PHE A CB    
511  C CG    . PHE A 62  ? 0.4666 0.4132 0.7943 -0.0565 -0.0396 0.0889  62  PHE A CG    
512  C CD1   . PHE A 62  ? 0.5168 0.4320 0.8200 -0.0617 -0.0379 0.0854  62  PHE A CD1   
513  C CD2   . PHE A 62  ? 0.4200 0.3875 0.7605 -0.0426 -0.0254 0.0911  62  PHE A CD2   
514  C CE1   . PHE A 62  ? 0.5136 0.4202 0.8086 -0.0518 -0.0225 0.0849  62  PHE A CE1   
515  C CE2   . PHE A 62  ? 0.4361 0.3955 0.7671 -0.0342 -0.0116 0.0910  62  PHE A CE2   
516  C CZ    . PHE A 62  ? 0.4634 0.3933 0.7735 -0.0380 -0.0102 0.0883  62  PHE A CZ    
517  N N     . ALA A 63  ? 0.5037 0.4584 0.8719 -0.1050 -0.1040 0.1037  63  ALA A N     
518  C CA    . ALA A 63  ? 0.5308 0.4895 0.9075 -0.1179 -0.1268 0.1090  63  ALA A CA    
519  C C     . ALA A 63  ? 0.5693 0.5272 0.9267 -0.1106 -0.1288 0.1037  63  ALA A C     
520  O O     . ALA A 63  ? 0.5975 0.5711 0.9739 -0.1139 -0.1428 0.1099  63  ALA A O     
521  C CB    . ALA A 63  ? 0.6019 0.5285 0.9525 -0.1394 -0.1444 0.1087  63  ALA A CB    
522  N N     . ASN A 64  ? 0.5768 0.5169 0.8981 -0.1006 -0.1143 0.0931  64  ASN A N     
523  C CA    . ASN A 64  ? 0.5253 0.4635 0.8256 -0.0936 -0.1135 0.0873  64  ASN A CA    
524  C C     . ASN A 64  ? 0.5083 0.4416 0.7877 -0.0775 -0.0913 0.0788  64  ASN A C     
525  O O     . ASN A 64  ? 0.5187 0.4444 0.7945 -0.0730 -0.0785 0.0771  64  ASN A O     
526  C CB    . ASN A 64  ? 0.5486 0.4554 0.8114 -0.1096 -0.1310 0.0834  64  ASN A CB    
527  C CG    . ASN A 64  ? 0.5953 0.4633 0.8216 -0.1203 -0.1296 0.0771  64  ASN A CG    
528  O OD1   . ASN A 64  ? 0.5918 0.4403 0.7891 -0.1117 -0.1123 0.0680  64  ASN A OD1   
529  N ND2   . ASN A 64  ? 0.5883 0.4443 0.8166 -0.1395 -0.1476 0.0828  64  ASN A ND2   
530  N N     . MET A 65  ? 0.4878 0.4261 0.7549 -0.0694 -0.0876 0.0745  65  MET A N     
531  C CA    . MET A 65  ? 0.4665 0.4059 0.7194 -0.0543 -0.0681 0.0685  65  MET A CA    
532  C C     . MET A 65  ? 0.4990 0.4049 0.7148 -0.0553 -0.0599 0.0603  65  MET A C     
533  O O     . MET A 65  ? 0.4683 0.3745 0.6807 -0.0434 -0.0432 0.0581  65  MET A O     
534  C CB    . MET A 65  ? 0.4288 0.3818 0.6779 -0.0473 -0.0673 0.0665  65  MET A CB    
535  C CG    . MET A 65  ? 0.3949 0.3807 0.6808 -0.0415 -0.0678 0.0740  65  MET A CG    
536  S SD    . MET A 65  ? 0.4198 0.4186 0.6994 -0.0343 -0.0669 0.0719  65  MET A SD    
537  C CE    . MET A 65  ? 0.4865 0.4681 0.7513 -0.0491 -0.0901 0.0721  65  MET A CE    
538  N N     . ARG A 66  ? 0.5825 0.4579 0.7700 -0.0699 -0.0716 0.0564  66  ARG A N     
539  C CA    . ARG A 66  ? 0.6176 0.4551 0.7670 -0.0724 -0.0625 0.0482  66  ARG A CA    
540  C C     . ARG A 66  ? 0.5895 0.4193 0.7472 -0.0709 -0.0542 0.0503  66  ARG A C     
541  O O     . ARG A 66  ? 0.5669 0.3827 0.7107 -0.0609 -0.0369 0.0460  66  ARG A O     
542  C CB    . ARG A 66  ? 0.6943 0.4965 0.8077 -0.0918 -0.0780 0.0439  66  ARG A CB    
543  C CG    . ARG A 66  ? 0.7359 0.4920 0.8054 -0.0963 -0.0672 0.0347  66  ARG A CG    
544  N N     . ASP A 67  ? 0.5756 0.4151 0.7576 -0.0807 -0.0662 0.0578  67  ASP A N     
545  C CA    . ASP A 67  ? 0.6088 0.4414 0.7995 -0.0811 -0.0595 0.0606  67  ASP A CA    
546  C C     . ASP A 67  ? 0.5886 0.4445 0.8007 -0.0620 -0.0411 0.0633  67  ASP A C     
547  O O     . ASP A 67  ? 0.6485 0.4901 0.8543 -0.0571 -0.0293 0.0627  67  ASP A O     
548  C CB    . ASP A 67  ? 0.6128 0.4571 0.8312 -0.0956 -0.0760 0.0694  67  ASP A CB    
549  C CG    . ASP A 67  ? 0.6971 0.5109 0.8901 -0.1179 -0.0952 0.0682  67  ASP A CG    
550  O OD1   . ASP A 67  ? 0.7717 0.5474 0.9197 -0.1225 -0.0923 0.0592  67  ASP A OD1   
551  O OD2   . ASP A 67  ? 0.6746 0.5018 0.8925 -0.1314 -0.1130 0.0768  67  ASP A OD2   
552  N N     . ALA A 68  ? 0.4978 0.3872 0.7330 -0.0523 -0.0393 0.0666  68  ALA A N     
553  C CA    . ALA A 68  ? 0.4832 0.3942 0.7351 -0.0363 -0.0238 0.0697  68  ALA A CA    
554  C C     . ALA A 68  ? 0.5320 0.4293 0.7602 -0.0244 -0.0094 0.0641  68  ALA A C     
555  O O     . ALA A 68  ? 0.5666 0.4623 0.7977 -0.0152 0.0028  0.0664  68  ALA A O     
556  C CB    . ALA A 68  ? 0.3791 0.3245 0.6561 -0.0309 -0.0255 0.0739  68  ALA A CB    
557  N N     A SER A 69  ? 0.5197 0.4070 0.7256 -0.0247 -0.0108 0.0575  69  SER A N     
558  N N     B SER A 69  ? 0.5195 0.4070 0.7256 -0.0248 -0.0109 0.0575  69  SER A N     
559  C CA    A SER A 69  ? 0.5209 0.3970 0.7074 -0.0134 0.0040  0.0525  69  SER A CA    
560  C CA    B SER A 69  ? 0.5204 0.3961 0.7064 -0.0137 0.0037  0.0524  69  SER A CA    
561  C C     A SER A 69  ? 0.5628 0.4015 0.7261 -0.0146 0.0124  0.0484  69  SER A C     
562  C C     B SER A 69  ? 0.5620 0.4015 0.7265 -0.0146 0.0123  0.0487  69  SER A C     
563  O O     A SER A 69  ? 0.5712 0.4046 0.7312 -0.0018 0.0280  0.0482  69  SER A O     
564  O O     B SER A 69  ? 0.5678 0.4035 0.7311 -0.0017 0.0276  0.0493  69  SER A O     
565  C CB    A SER A 69  ? 0.5149 0.3888 0.6828 -0.0147 0.0014  0.0464  69  SER A CB    
566  C CB    B SER A 69  ? 0.5193 0.3887 0.6839 -0.0165 0.0004  0.0457  69  SER A CB    
567  O OG    A SER A 69  ? 0.5458 0.3973 0.6940 -0.0310 -0.0130 0.0423  69  SER A OG    
568  O OG    B SER A 69  ? 0.4733 0.3736 0.6559 -0.0149 -0.0065 0.0490  69  SER A OG    
569  N N     . GLN A 70  ? 0.5872 0.3993 0.7348 -0.0304 0.0020  0.0458  70  GLN A N     
570  C CA    . GLN A 70  ? 0.6113 0.3830 0.7334 -0.0339 0.0097  0.0416  70  GLN A CA    
571  C C     . GLN A 70  ? 0.5915 0.3694 0.7341 -0.0267 0.0173  0.0484  70  GLN A C     
572  O O     . GLN A 70  ? 0.6123 0.3654 0.7412 -0.0198 0.0310  0.0467  70  GLN A O     
573  C CB    . GLN A 70  ? 0.6731 0.4141 0.7712 -0.0558 -0.0059 0.0380  70  GLN A CB    
574  C CG    . GLN A 70  ? 0.7091 0.4299 0.7744 -0.0648 -0.0117 0.0301  70  GLN A CG    
575  N N     . TRP A 71  ? 0.5456 0.3552 0.7204 -0.0282 0.0092  0.0564  71  TRP A N     
576  C CA    . TRP A 71  ? 0.5335 0.3508 0.7277 -0.0225 0.0159  0.0636  71  TRP A CA    
577  C C     . TRP A 71  ? 0.4836 0.3151 0.6858 -0.0032 0.0312  0.0668  71  TRP A C     
578  O O     . TRP A 71  ? 0.4947 0.3147 0.6971 0.0040  0.0411  0.0703  71  TRP A O     
579  C CB    . TRP A 71  ? 0.4728 0.3204 0.6989 -0.0292 0.0056  0.0711  71  TRP A CB    
580  C CG    . TRP A 71  ? 0.5363 0.3906 0.7799 -0.0251 0.0128  0.0785  71  TRP A CG    
581  C CD1   . TRP A 71  ? 0.4909 0.3222 0.7292 -0.0328 0.0133  0.0801  71  TRP A CD1   
582  C CD2   . TRP A 71  ? 0.4358 0.3191 0.7015 -0.0138 0.0204  0.0854  71  TRP A CD2   
583  N NE1   . TRP A 71  ? 0.4771 0.3220 0.7338 -0.0264 0.0210  0.0877  71  TRP A NE1   
584  C CE2   . TRP A 71  ? 0.4443 0.3204 0.7170 -0.0152 0.0252  0.0910  71  TRP A CE2   
585  C CE3   . TRP A 71  ? 0.4331 0.3453 0.7105 -0.0042 0.0233  0.0873  71  TRP A CE3   
586  C CZ2   . TRP A 71  ? 0.4499 0.3460 0.7393 -0.0075 0.0326  0.0987  71  TRP A CZ2   
587  C CZ3   . TRP A 71  ? 0.3963 0.3277 0.6895 0.0028  0.0304  0.0948  71  TRP A CZ3   
588  C CH2   . TRP A 71  ? 0.3973 0.3203 0.6958 0.0010  0.0349  0.1004  71  TRP A CH2   
589  N N     . ILE A 72  ? 0.5024 0.3588 0.7117 0.0044  0.0320  0.0665  72  ILE A N     
590  C CA    . ILE A 72  ? 0.4783 0.3507 0.6957 0.0211  0.0442  0.0706  72  ILE A CA    
591  C C     . ILE A 72  ? 0.5258 0.3692 0.7245 0.0299  0.0578  0.0672  72  ILE A C     
592  O O     . ILE A 72  ? 0.5311 0.3757 0.7388 0.0417  0.0678  0.0736  72  ILE A O     
593  C CB    . ILE A 72  ? 0.4754 0.3746 0.6980 0.0250  0.0419  0.0695  72  ILE A CB    
594  C CG1   . ILE A 72  ? 0.4489 0.3767 0.6924 0.0192  0.0318  0.0739  72  ILE A CG1   
595  C CG2   . ILE A 72  ? 0.4499 0.3638 0.6793 0.0406  0.0535  0.0740  72  ILE A CG2   
596  C CD1   . ILE A 72  ? 0.4552 0.4051 0.7008 0.0209  0.0285  0.0722  72  ILE A CD1   
597  N N     . LYS A 73  ? 0.5645 0.3799 0.7364 0.0239  0.0587  0.0577  73  LYS A N     
598  C CA    . LYS A 73  ? 0.6163 0.3983 0.7669 0.0315  0.0744  0.0531  73  LYS A CA    
599  C C     . LYS A 73  ? 0.6178 0.3714 0.7630 0.0310  0.0797  0.0553  73  LYS A C     
600  O O     . LYS A 73  ? 0.5786 0.3201 0.7246 0.0447  0.0949  0.0582  73  LYS A O     
601  C CB    . LYS A 73  ? 0.6707 0.4227 0.7875 0.0216  0.0740  0.0415  73  LYS A CB    
602  N N     . ARG A 74  ? 0.6071 0.3502 0.7482 0.0151  0.0673  0.0549  74  ARG A N     
603  C CA    . ARG A 74  ? 0.6631 0.3779 0.7972 0.0122  0.0712  0.0571  74  ARG A CA    
604  C C     . ARG A 74  ? 0.6385 0.3753 0.8001 0.0253  0.0770  0.0683  74  ARG A C     
605  O O     . ARG A 74  ? 0.6536 0.3672 0.8099 0.0331  0.0882  0.0711  74  ARG A O     
606  C CB    . ARG A 74  ? 0.7191 0.4216 0.8458 -0.0095 0.0552  0.0554  74  ARG A CB    
607  C CG    . ARG A 74  ? 0.7872 0.4504 0.8760 -0.0250 0.0505  0.0449  74  ARG A CG    
608  C CD    . ARG A 74  ? 0.8023 0.4451 0.8814 -0.0466 0.0363  0.0452  74  ARG A CD    
609  N NE    . ARG A 74  ? 0.7902 0.4724 0.9025 -0.0551 0.0193  0.0525  74  ARG A NE    
610  C CZ    . ARG A 74  ? 0.7990 0.4997 0.9172 -0.0650 0.0039  0.0518  74  ARG A CZ    
611  N NH1   . ARG A 74  ? 0.8415 0.5241 0.9317 -0.0690 0.0020  0.0438  74  ARG A NH1   
612  N NH2   . ARG A 74  ? 0.7409 0.4770 0.8931 -0.0707 -0.0088 0.0594  74  ARG A NH2   
613  N N     . MET A 75  ? 0.5367 0.3156 0.7256 0.0273  0.0695  0.0751  75  MET A N     
614  C CA    . MET A 75  ? 0.5738 0.3738 0.7855 0.0376  0.0735  0.0863  75  MET A CA    
615  C C     . MET A 75  ? 0.5201 0.3215 0.7353 0.0566  0.0870  0.0905  75  MET A C     
616  O O     . MET A 75  ? 0.5252 0.3245 0.7496 0.0658  0.0932  0.0994  75  MET A O     
617  C CB    . MET A 75  ? 0.5394 0.3804 0.7742 0.0345  0.0641  0.0914  75  MET A CB    
618  C CG    . MET A 75  ? 0.5213 0.3654 0.7627 0.0181  0.0529  0.0911  75  MET A CG    
619  S SD    . MET A 75  ? 0.5503 0.3811 0.7976 0.0139  0.0555  0.0989  75  MET A SD    
620  C CE    . MET A 75  ? 0.4555 0.3216 0.7251 0.0240  0.0592  0.1100  75  MET A CE    
621  N N     . GLU A 76  ? 0.5625 0.3681 0.7716 0.0620  0.0912  0.0850  76  GLU A N     
622  C CA    . GLU A 76  ? 0.6037 0.4111 0.8185 0.0798  0.1050  0.0888  76  GLU A CA    
623  C C     . GLU A 76  ? 0.6252 0.3901 0.8242 0.0862  0.1193  0.0868  76  GLU A C     
624  O O     . GLU A 76  ? 0.6498 0.4149 0.8622 0.1017  0.1297  0.0957  76  GLU A O     
625  C CB    . GLU A 76  ? 0.6587 0.4767 0.8679 0.0815  0.1071  0.0818  76  GLU A CB    
626  C CG    . GLU A 76  ? 0.7297 0.5549 0.9496 0.0995  0.1219  0.0863  76  GLU A CG    
627  C CD    . GLU A 76  ? 0.7831 0.6204 0.9974 0.0994  0.1239  0.0795  76  GLU A CD    
628  O OE1   . GLU A 76  ? 0.7752 0.6192 0.9792 0.0861  0.1120  0.0726  76  GLU A OE1   
629  O OE2   . GLU A 76  ? 0.8317 0.6722 1.0535 0.1128  0.1376  0.0817  76  GLU A OE2   
630  N N     . ASP A 77  ? 0.6739 0.4010 0.8440 0.0736  0.1191  0.0760  77  ASP A N     
631  C CA    . ASP A 77  ? 0.7537 0.4330 0.9019 0.0771  0.1334  0.0723  77  ASP A CA    
632  C C     . ASP A 77  ? 0.7275 0.3966 0.8834 0.0783  0.1330  0.0810  77  ASP A C     
633  O O     . ASP A 77  ? 0.7672 0.4045 0.9151 0.0880  0.1473  0.0828  77  ASP A O     
634  C CB    . ASP A 77  ? 0.8318 0.4709 0.9418 0.0594  0.1310  0.0584  77  ASP A CB    
635  C CG    . ASP A 77  ? 0.8609 0.5021 0.9571 0.0577  0.1331  0.0493  77  ASP A CG    
636  O OD1   . ASP A 77  ? 0.8298 0.4930 0.9426 0.0736  0.1433  0.0525  77  ASP A OD1   
637  O OD2   . ASP A 77  ? 0.9025 0.5232 0.9712 0.0397  0.1239  0.0397  77  ASP A OD2   
638  N N     . ILE A 78  ? 0.6613 0.3556 0.8322 0.0683  0.1179  0.0865  78  ILE A N     
639  C CA    . ILE A 78  ? 0.6634 0.3511 0.8419 0.0677  0.1166  0.0954  78  ILE A CA    
640  C C     . ILE A 78  ? 0.6601 0.3761 0.8661 0.0851  0.1206  0.1095  78  ILE A C     
641  O O     . ILE A 78  ? 0.7046 0.4053 0.9138 0.0926  0.1266  0.1178  78  ILE A O     
642  C CB    . ILE A 78  ? 0.6395 0.3410 0.8228 0.0488  0.1004  0.0956  78  ILE A CB    
643  C CG1   . ILE A 78  ? 0.6937 0.3673 0.8515 0.0299  0.0937  0.0840  78  ILE A CG1   
644  C CG2   . ILE A 78  ? 0.6246 0.3198 0.8154 0.0478  0.1005  0.1051  78  ILE A CG2   
645  C CD1   . ILE A 78  ? 0.6259 0.3154 0.7936 0.0112  0.0777  0.0853  78  ILE A CD1   
646  N N     . GLY A 79  ? 0.6629 0.4187 0.8873 0.0905  0.1163  0.1128  79  GLY A N     
647  C CA    . GLY A 79  ? 0.5559 0.3409 0.8052 0.1041  0.1170  0.1271  79  GLY A CA    
648  C C     . GLY A 79  ? 0.5573 0.3718 0.8196 0.0952  0.1043  0.1344  79  GLY A C     
649  O O     . GLY A 79  ? 0.5689 0.3944 0.8441 0.1015  0.1035  0.1474  79  GLY A O     
650  N N     . LEU A 80  ? 0.5236 0.3494 0.7820 0.0804  0.0949  0.1267  80  LEU A N     
651  C CA    . LEU A 80  ? 0.5077 0.3594 0.7777 0.0715  0.0856  0.1322  80  LEU A CA    
652  C C     . LEU A 80  ? 0.4879 0.3717 0.7650 0.0683  0.0792  0.1287  80  LEU A C     
653  O O     . LEU A 80  ? 0.5060 0.3876 0.7756 0.0661  0.0784  0.1189  80  LEU A O     
654  C CB    . LEU A 80  ? 0.4935 0.3287 0.7567 0.0558  0.0810  0.1283  80  LEU A CB    
655  C CG    . LEU A 80  ? 0.5240 0.3292 0.7801 0.0554  0.0857  0.1332  80  LEU A CG    
656  C CD1   . LEU A 80  ? 0.5346 0.3252 0.7842 0.0374  0.0802  0.1276  80  LEU A CD1   
657  C CD2   . LEU A 80  ? 0.5174 0.3357 0.7848 0.0614  0.0865  0.1472  80  LEU A CD2   
658  N N     . GLU A 81  ? 0.4815 0.3919 0.7700 0.0670  0.0749  0.1368  81  GLU A N     
659  C CA    . GLU A 81  ? 0.4642 0.4035 0.7582 0.0640  0.0698  0.1344  81  GLU A CA    
660  C C     . GLU A 81  ? 0.4507 0.3909 0.7430 0.0509  0.0640  0.1249  81  GLU A C     
661  O O     . GLU A 81  ? 0.3962 0.3289 0.6907 0.0413  0.0622  0.1250  81  GLU A O     
662  C CB    . GLU A 81  ? 0.4851 0.4468 0.7869 0.0640  0.0675  0.1455  81  GLU A CB    
663  C CG    . GLU A 81  ? 0.4761 0.4651 0.7806 0.0623  0.0636  0.1441  81  GLU A CG    
664  C CD    . GLU A 81  ? 0.4741 0.4802 0.7804 0.0603  0.0616  0.1551  81  GLU A CD    
665  O OE1   . GLU A 81  ? 0.4603 0.4577 0.7659 0.0604  0.0626  0.1643  81  GLU A OE1   
666  O OE2   . GLU A 81  ? 0.4504 0.4761 0.7558 0.0574  0.0588  0.1544  81  GLU A OE2   
667  N N     . ALA A 82  ? 0.4466 0.3966 0.7365 0.0503  0.0610  0.1174  82  ALA A N     
668  C CA    . ALA A 82  ? 0.3862 0.3418 0.6778 0.0389  0.0539  0.1104  82  ALA A CA    
669  C C     . ALA A 82  ? 0.3571 0.3417 0.6575 0.0385  0.0517  0.1130  82  ALA A C     
670  O O     . ALA A 82  ? 0.3361 0.3328 0.6333 0.0437  0.0515  0.1113  82  ALA A O     
671  C CB    . ALA A 82  ? 0.3793 0.3209 0.6581 0.0370  0.0513  0.1003  82  ALA A CB    
672  N N     . LEU A 83  ? 0.3333 0.3272 0.6435 0.0318  0.0512  0.1170  83  LEU A N     
673  C CA    . LEU A 83  ? 0.3454 0.3617 0.6603 0.0310  0.0518  0.1201  83  LEU A CA    
674  C C     . LEU A 83  ? 0.3353 0.3623 0.6566 0.0249  0.0473  0.1139  83  LEU A C     
675  O O     . LEU A 83  ? 0.3195 0.3388 0.6464 0.0187  0.0425  0.1093  83  LEU A O     
676  C CB    . LEU A 83  ? 0.3162 0.3343 0.6353 0.0273  0.0566  0.1282  83  LEU A CB    
677  C CG    . LEU A 83  ? 0.3433 0.3540 0.6560 0.0330  0.0599  0.1373  83  LEU A CG    
678  C CD1   . LEU A 83  ? 0.3585 0.3464 0.6711 0.0324  0.0613  0.1379  83  LEU A CD1   
679  C CD2   . LEU A 83  ? 0.3526 0.3715 0.6627 0.0287  0.0635  0.1453  83  LEU A CD2   
680  N N     . GLY A 84  ? 0.3118 0.3557 0.6319 0.0263  0.0481  0.1145  84  GLY A N     
681  C CA    . GLY A 84  ? 0.2725 0.3264 0.5992 0.0218  0.0449  0.1099  84  GLY A CA    
682  C C     . GLY A 84  ? 0.3443 0.4043 0.6612 0.0254  0.0407  0.1049  84  GLY A C     
683  O O     . GLY A 84  ? 0.2695 0.3261 0.5760 0.0313  0.0409  0.1043  84  GLY A O     
684  N N     . MET A 85  ? 0.3023 0.3710 0.6237 0.0221  0.0379  0.1016  85  MET A N     
685  C CA    . MET A 85  ? 0.2981 0.3717 0.6093 0.0241  0.0337  0.0967  85  MET A CA    
686  C C     . MET A 85  ? 0.3147 0.3750 0.6198 0.0229  0.0264  0.0904  85  MET A C     
687  O O     . MET A 85  ? 0.2636 0.3175 0.5764 0.0168  0.0198  0.0882  85  MET A O     
688  C CB    . MET A 85  ? 0.2838 0.3678 0.6011 0.0209  0.0332  0.0958  85  MET A CB    
689  C CG    . MET A 85  ? 0.2684 0.3556 0.5744 0.0217  0.0281  0.0907  85  MET A CG    
690  S SD    . MET A 85  ? 0.3088 0.4007 0.5953 0.0272  0.0310  0.0910  85  MET A SD    
691  C CE    . MET A 85  ? 0.2269 0.3301 0.5110 0.0263  0.0386  0.0980  85  MET A CE    
692  N N     . ASP A 86  ? 0.2943 0.3498 0.5851 0.0281  0.0280  0.0881  86  ASP A N     
693  C CA    . ASP A 86  ? 0.3600 0.3976 0.6389 0.0266  0.0241  0.0815  86  ASP A CA    
694  C C     . ASP A 86  ? 0.3481 0.3874 0.6166 0.0238  0.0183  0.0757  86  ASP A C     
695  O O     . ASP A 86  ? 0.3533 0.3758 0.6093 0.0195  0.0131  0.0698  86  ASP A O     
696  C CB    . ASP A 86  ? 0.4588 0.4869 0.7287 0.0343  0.0318  0.0821  86  ASP A CB    
697  C CG    . ASP A 86  ? 0.5546 0.6004 0.8239 0.0418  0.0373  0.0861  86  ASP A CG    
698  O OD1   . ASP A 86  ? 0.6470 0.6889 0.9075 0.0469  0.0415  0.0836  86  ASP A OD1   
699  O OD2   . ASP A 86  ? 0.5212 0.5838 0.7983 0.0416  0.0377  0.0920  86  ASP A OD2   
700  N N     . ASP A 87  ? 0.3383 0.3952 0.6089 0.0252  0.0190  0.0774  87  ASP A N     
701  C CA    . ASP A 87  ? 0.3142 0.3727 0.5764 0.0217  0.0128  0.0727  87  ASP A CA    
702  C C     . ASP A 87  ? 0.3024 0.3629 0.5794 0.0157  0.0052  0.0740  87  ASP A C     
703  O O     . ASP A 87  ? 0.2696 0.3434 0.5591 0.0165  0.0084  0.0781  87  ASP A O     
704  C CB    . ASP A 87  ? 0.3576 0.4320 0.6142 0.0251  0.0172  0.0742  87  ASP A CB    
705  C CG    . ASP A 87  ? 0.4005 0.4738 0.6443 0.0218  0.0117  0.0690  87  ASP A CG    
706  O OD1   . ASP A 87  ? 0.3903 0.4535 0.6333 0.0163  0.0029  0.0658  87  ASP A OD1   
707  O OD2   . ASP A 87  ? 0.3944 0.4768 0.6286 0.0237  0.0152  0.0689  87  ASP A OD2   
708  N N     . PHE A 88  ? 0.3136 0.3602 0.5893 0.0091  -0.0044 0.0712  88  PHE A N     
709  C CA    . PHE A 88  ? 0.3230 0.3728 0.6191 0.0031  -0.0129 0.0746  88  PHE A CA    
710  C C     . PHE A 88  ? 0.3031 0.3650 0.6073 0.0029  -0.0166 0.0760  88  PHE A C     
711  O O     . PHE A 88  ? 0.3421 0.4139 0.6705 0.0019  -0.0174 0.0811  88  PHE A O     
712  C CB    . PHE A 88  ? 0.3357 0.3667 0.6263 -0.0060 -0.0249 0.0724  88  PHE A CB    
713  C CG    . PHE A 88  ? 0.3563 0.3716 0.6390 -0.0066 -0.0205 0.0712  88  PHE A CG    
714  C CD1   . PHE A 88  ? 0.3397 0.3621 0.6379 -0.0027 -0.0117 0.0760  88  PHE A CD1   
715  C CD2   . PHE A 88  ? 0.3796 0.3701 0.6367 -0.0112 -0.0238 0.0651  88  PHE A CD2   
716  C CE1   . PHE A 88  ? 0.3210 0.3270 0.6113 -0.0028 -0.0074 0.0753  88  PHE A CE1   
717  C CE2   . PHE A 88  ? 0.4031 0.3758 0.6514 -0.0111 -0.0180 0.0638  88  PHE A CE2   
718  C CZ    . PHE A 88  ? 0.3739 0.3550 0.6398 -0.0065 -0.0103 0.0692  88  PHE A CZ    
719  N N     . LYS A 89  ? 0.3088 0.3694 0.5938 0.0042  -0.0176 0.0718  89  LYS A N     
720  C CA    . LYS A 89  ? 0.3455 0.4150 0.6362 0.0044  -0.0204 0.0733  89  LYS A CA    
721  C C     . LYS A 89  ? 0.2904 0.3743 0.5905 0.0101  -0.0079 0.0768  89  LYS A C     
722  O O     . LYS A 89  ? 0.2699 0.3604 0.5848 0.0106  -0.0072 0.0799  89  LYS A O     
723  C CB    . LYS A 89  ? 0.3473 0.4089 0.6133 0.0024  -0.0261 0.0680  89  LYS A CB    
724  C CG    . LYS A 89  ? 0.4063 0.4676 0.6499 0.0062  -0.0172 0.0637  89  LYS A CG    
725  C CD    . LYS A 89  ? 0.4435 0.4934 0.6625 0.0021  -0.0233 0.0581  89  LYS A CD    
726  C CE    . LYS A 89  ? 0.4380 0.4866 0.6378 0.0054  -0.0138 0.0541  89  LYS A CE    
727  N NZ    . LYS A 89  ? 0.4064 0.4489 0.6087 0.0082  -0.0079 0.0539  89  LYS A NZ    
728  N N     . LEU A 90  ? 0.2396 0.3269 0.5312 0.0138  0.0022  0.0769  90  LEU A N     
729  C CA    . LEU A 90  ? 0.2355 0.3327 0.5326 0.0166  0.0135  0.0810  90  LEU A CA    
730  C C     . LEU A 90  ? 0.3028 0.4024 0.6249 0.0158  0.0172  0.0857  90  LEU A C     
731  O O     . LEU A 90  ? 0.2884 0.3931 0.6202 0.0166  0.0252  0.0886  90  LEU A O     
732  C CB    . LEU A 90  ? 0.2188 0.3189 0.5020 0.0194  0.0207  0.0820  90  LEU A CB    
733  C CG    . LEU A 90  ? 0.2478 0.3500 0.5098 0.0204  0.0200  0.0791  90  LEU A CG    
734  C CD1   . LEU A 90  ? 0.2488 0.3585 0.5044 0.0228  0.0270  0.0836  90  LEU A CD1   
735  C CD2   . LEU A 90  ? 0.2668 0.3711 0.5208 0.0182  0.0188  0.0772  90  LEU A CD2   
736  N N     . ALA A 91  ? 0.2240 0.3183 0.5554 0.0138  0.0127  0.0865  91  ALA A N     
737  C CA    . ALA A 91  ? 0.2652 0.3623 0.6222 0.0117  0.0153  0.0913  91  ALA A CA    
738  C C     . ALA A 91  ? 0.2386 0.3409 0.6183 0.0096  0.0094  0.0937  91  ALA A C     
739  O O     . ALA A 91  ? 0.2520 0.3619 0.6539 0.0105  0.0177  0.0982  91  ALA A O     
740  C CB    . ALA A 91  ? 0.2334 0.3214 0.5924 0.0084  0.0102  0.0913  91  ALA A CB    
741  N N     . TYR A 92  ? 0.2456 0.3431 0.6200 0.0067  -0.0044 0.0912  92  TYR A N     
742  C CA    . TYR A 92  ? 0.2621 0.3647 0.6581 0.0049  -0.0128 0.0949  92  TYR A CA    
743  C C     . TYR A 92  ? 0.2780 0.3881 0.6792 0.0106  -0.0021 0.0963  92  TYR A C     
744  O O     . TYR A 92  ? 0.2378 0.3560 0.6686 0.0123  0.0023  0.1020  92  TYR A O     
745  C CB    . TYR A 92  ? 0.3120 0.4047 0.6926 -0.0002 -0.0301 0.0918  92  TYR A CB    
746  C CG    . TYR A 92  ? 0.3165 0.4144 0.7175 -0.0015 -0.0404 0.0969  92  TYR A CG    
747  C CD1   . TYR A 92  ? 0.3183 0.4216 0.7511 -0.0068 -0.0512 0.1044  92  TYR A CD1   
748  C CD2   . TYR A 92  ? 0.2751 0.3729 0.6653 0.0023  -0.0396 0.0953  92  TYR A CD2   
749  C CE1   . TYR A 92  ? 0.3239 0.4338 0.7799 -0.0073 -0.0617 0.1112  92  TYR A CE1   
750  C CE2   . TYR A 92  ? 0.2759 0.3775 0.6863 0.0021  -0.0491 0.1011  92  TYR A CE2   
751  C CZ    . TYR A 92  ? 0.2895 0.3979 0.7343 -0.0023 -0.0604 0.1095  92  TYR A CZ    
752  O OH    . TYR A 92  ? 0.3299 0.4440 0.7994 -0.0019 -0.0710 0.1174  92  TYR A OH    
753  N N     . LEU A 93  ? 0.2791 0.3856 0.6520 0.0134  0.0029  0.0914  93  LEU A N     
754  C CA    . LEU A 93  ? 0.2858 0.3947 0.6567 0.0175  0.0137  0.0920  93  LEU A CA    
755  C C     . LEU A 93  ? 0.2971 0.4101 0.6820 0.0197  0.0310  0.0956  93  LEU A C     
756  O O     . LEU A 93  ? 0.2576 0.3724 0.6587 0.0227  0.0402  0.0986  93  LEU A O     
757  C CB    . LEU A 93  ? 0.2361 0.3404 0.5719 0.0179  0.0161  0.0865  93  LEU A CB    
758  C CG    . LEU A 93  ? 0.2196 0.3180 0.5376 0.0158  0.0033  0.0825  93  LEU A CG    
759  C CD1   . LEU A 93  ? 0.2196 0.3162 0.5062 0.0158  0.0085  0.0782  93  LEU A CD1   
760  C CD2   . LEU A 93  ? 0.2246 0.3222 0.5583 0.0166  -0.0028 0.0855  93  LEU A CD2   
761  N N     . SER A 94  ? 0.2891 0.4016 0.6669 0.0184  0.0363  0.0955  94  SER A N     
762  C CA    . SER A 94  ? 0.3095 0.4228 0.6948 0.0188  0.0528  0.0987  94  SER A CA    
763  C C     . SER A 94  ? 0.3063 0.4257 0.7301 0.0190  0.0565  0.1042  94  SER A C     
764  O O     . SER A 94  ? 0.3230 0.4423 0.7576 0.0205  0.0728  0.1068  94  SER A O     
765  C CB    . SER A 94  ? 0.3243 0.4349 0.6943 0.0169  0.0549  0.0987  94  SER A CB    
766  O OG    . SER A 94  ? 0.3371 0.4459 0.7102 0.0159  0.0704  0.1021  94  SER A OG    
767  N N     . ASP A 95  ? 0.2896 0.4133 0.7334 0.0164  0.0420  0.1062  95  ASP A N     
768  C CA    . ASP A 95  ? 0.3233 0.4560 0.8081 0.0152  0.0423  0.1129  95  ASP A CA    
769  C C     . ASP A 95  ? 0.3507 0.4896 0.8591 0.0192  0.0421  0.1166  95  ASP A C     
770  O O     . ASP A 95  ? 0.3615 0.5079 0.9022 0.0218  0.0539  0.1224  95  ASP A O     
771  C CB    . ASP A 95  ? 0.3223 0.4560 0.8180 0.0088  0.0241  0.1146  95  ASP A CB    
772  C CG    . ASP A 95  ? 0.3562 0.4838 0.8404 0.0052  0.0272  0.1133  95  ASP A CG    
773  O OD1   . ASP A 95  ? 0.3573 0.4835 0.8350 0.0073  0.0436  0.1135  95  ASP A OD1   
774  O OD2   . ASP A 95  ? 0.3501 0.4721 0.8299 -0.0002 0.0133  0.1124  95  ASP A OD2   
775  N N     . THR A 96  ? 0.3095 0.4446 0.8021 0.0199  0.0293  0.1137  96  THR A N     
776  C CA    . THR A 96  ? 0.2915 0.4310 0.8056 0.0237  0.0253  0.1181  96  THR A CA    
777  C C     . THR A 96  ? 0.2938 0.4286 0.8015 0.0306  0.0458  0.1168  96  THR A C     
778  O O     . THR A 96  ? 0.2952 0.4348 0.8332 0.0358  0.0529  0.1226  96  THR A O     
779  C CB    . THR A 96  ? 0.2705 0.4041 0.7651 0.0209  0.0043  0.1153  96  THR A CB    
780  O OG1   . THR A 96  ? 0.2295 0.3610 0.7188 0.0131  -0.0123 0.1145  96  THR A OG1   
781  C CG2   . THR A 96  ? 0.2426 0.3815 0.7655 0.0237  -0.0043 0.1224  96  THR A CG2   
782  N N     . TYR A 97  ? 0.3174 0.4420 0.7859 0.0301  0.0556  0.1099  97  TYR A N     
783  C CA    . TYR A 97  ? 0.3145 0.4297 0.7675 0.0340  0.0746  0.1079  97  TYR A CA    
784  C C     . TYR A 97  ? 0.3467 0.4561 0.7863 0.0320  0.0942  0.1066  97  TYR A C     
785  O O     . TYR A 97  ? 0.3206 0.4206 0.7221 0.0289  0.0987  0.1019  97  TYR A O     
786  C CB    . TYR A 97  ? 0.2462 0.3520 0.6614 0.0332  0.0676  0.1019  97  TYR A CB    
787  C CG    . TYR A 97  ? 0.2747 0.3833 0.7019 0.0344  0.0492  0.1038  97  TYR A CG    
788  C CD1   . TYR A 97  ? 0.2521 0.3604 0.7033 0.0402  0.0525  0.1086  97  TYR A CD1   
789  C CD2   . TYR A 97  ? 0.2241 0.3342 0.6397 0.0296  0.0289  0.1014  97  TYR A CD2   
790  C CE1   . TYR A 97  ? 0.2641 0.3742 0.7264 0.0406  0.0339  0.1119  97  TYR A CE1   
791  C CE2   . TYR A 97  ? 0.2264 0.3363 0.6496 0.0289  0.0112  0.1036  97  TYR A CE2   
792  C CZ    . TYR A 97  ? 0.2773 0.3878 0.7241 0.0342  0.0127  0.1094  97  TYR A CZ    
793  O OH    . TYR A 97  ? 0.2915 0.4009 0.7454 0.0328  -0.0065 0.1130  97  TYR A OH    
794  N N     . ASN A 98  ? 0.3628 0.4779 0.8344 0.0330  0.1053  0.1117  98  ASN A N     
795  C CA    . ASN A 98  ? 0.3848 0.4932 0.8454 0.0299  0.1238  0.1114  98  ASN A CA    
796  C C     . ASN A 98  ? 0.3781 0.4713 0.8247 0.0317  0.1485  0.1101  98  ASN A C     
797  O O     . ASN A 98  ? 0.4392 0.5288 0.9005 0.0318  0.1684  0.1128  98  ASN A O     
798  C CB    . ASN A 98  ? 0.4383 0.5580 0.9375 0.0287  0.1259  0.1173  98  ASN A CB    
799  C CG    . ASN A 98  ? 0.5235 0.6530 1.0702 0.0341  0.1313  0.1239  98  ASN A CG    
800  O OD1   . ASN A 98  ? 0.5733 0.7051 1.1300 0.0387  0.1228  0.1251  98  ASN A OD1   
801  N ND2   . ASN A 98  ? 0.5461 0.6736 1.1093 0.0328  0.1419  0.1271  98  ASN A ND2   
802  N N     . TYR A 99  ? 0.4655 0.4926 0.8261 0.0654  0.1722  0.2419  99  TYR A N     
803  C CA    . TYR A 99  ? 0.4789 0.4961 0.8100 0.0737  0.1940  0.2397  99  TYR A CA    
804  C C     . TYR A 99  ? 0.4731 0.4844 0.7591 0.0775  0.1786  0.2245  99  TYR A C     
805  O O     . TYR A 99  ? 0.4835 0.5020 0.7692 0.0743  0.1531  0.2166  99  TYR A O     
806  C CB    . TYR A 99  ? 0.4636 0.4956 0.8378 0.0760  0.2102  0.2443  99  TYR A CB    
807  C CG    . TYR A 99  ? 0.4065 0.4614 0.8213 0.0724  0.1884  0.2398  99  TYR A CG    
808  C CD1   . TYR A 99  ? 0.4128 0.4691 0.8084 0.0760  0.1761  0.2269  99  TYR A CD1   
809  C CD2   . TYR A 99  ? 0.3985 0.4726 0.8698 0.0644  0.1798  0.2491  99  TYR A CD2   
810  C CE1   . TYR A 99  ? 0.4046 0.4799 0.8342 0.0727  0.1564  0.2237  99  TYR A CE1   
811  C CE2   . TYR A 99  ? 0.3588 0.4525 0.8640 0.0604  0.1584  0.2458  99  TYR A CE2   
812  C CZ    . TYR A 99  ? 0.3845 0.4782 0.8678 0.0651  0.1472  0.2333  99  TYR A CZ    
813  O OH    . TYR A 99  ? 0.3654 0.4766 0.8794 0.0612  0.1261  0.2308  99  TYR A OH    
814  N N     . GLU A 100 ? 0.5163 0.5135 0.7635 0.0834  0.1947  0.2201  100 GLU A N     
815  C CA    . GLU A 100 ? 0.5645 0.5571 0.7714 0.0854  0.1809  0.2057  100 GLU A CA    
816  C C     . GLU A 100 ? 0.5254 0.5344 0.7616 0.0851  0.1708  0.1981  100 GLU A C     
817  O O     . GLU A 100 ? 0.5173 0.5291 0.7748 0.0884  0.1878  0.2005  100 GLU A O     
818  C CB    . GLU A 100 ? 0.6844 0.6546 0.8398 0.0900  0.2006  0.2027  100 GLU A CB    
819  C CG    . GLU A 100 ? 0.7758 0.7408 0.8877 0.0899  0.1852  0.1880  100 GLU A CG    
820  C CD    . GLU A 100 ? 0.9062 0.8469 0.9654 0.0924  0.2040  0.1840  100 GLU A CD    
821  O OE1   . GLU A 100 ? 0.9751 0.9002 1.0246 0.0949  0.2292  0.1930  100 GLU A OE1   
822  O OE2   . GLU A 100 ? 0.9266 0.8623 0.9527 0.0910  0.1941  0.1717  100 GLU A OE2   
823  N N     . ILE A 101 ? 0.4622 0.4812 0.6996 0.0816  0.1439  0.1897  101 ILE A N     
824  C CA    . ILE A 101 ? 0.4317 0.4652 0.6949 0.0805  0.1318  0.1832  101 ILE A CA    
825  C C     . ILE A 101 ? 0.4460 0.4715 0.6816 0.0846  0.1394  0.1734  101 ILE A C     
826  O O     . ILE A 101 ? 0.4725 0.4877 0.6634 0.0845  0.1331  0.1639  101 ILE A O     
827  C CB    . ILE A 101 ? 0.4122 0.4553 0.6788 0.0754  0.1026  0.1763  101 ILE A CB    
828  C CG1   . ILE A 101 ? 0.4096 0.4596 0.7105 0.0699  0.0951  0.1855  101 ILE A CG1   
829  C CG2   . ILE A 101 ? 0.4054 0.4595 0.6870 0.0745  0.0904  0.1684  101 ILE A CG2   
830  C CD1   . ILE A 101 ? 0.4006 0.4546 0.6999 0.0652  0.0692  0.1786  101 ILE A CD1   
831  N N     . LYS A 102 ? 0.4352 0.4653 0.6991 0.0881  0.1531  0.1765  102 LYS A N     
832  C CA    . LYS A 102 ? 0.4966 0.5187 0.7410 0.0917  0.1588  0.1671  102 LYS A CA    
833  C C     . LYS A 102 ? 0.4715 0.5108 0.7477 0.0896  0.1391  0.1638  102 LYS A C     
834  O O     . LYS A 102 ? 0.4862 0.5416 0.8119 0.0897  0.1379  0.1731  102 LYS A O     
835  C CB    . LYS A 102 ? 0.5525 0.5640 0.8037 0.0988  0.1907  0.1733  102 LYS A CB    
836  C CG    . LYS A 102 ? 0.5889 0.5789 0.8016 0.1007  0.2125  0.1762  102 LYS A CG    
837  N N     . TYR A 103 ? 0.4728 0.5093 0.7209 0.0871  0.1227  0.1512  103 TYR A N     
838  C CA    . TYR A 103 ? 0.4412 0.4915 0.7131 0.0843  0.1027  0.1478  103 TYR A CA    
839  C C     . TYR A 103 ? 0.4279 0.4704 0.6876 0.0875  0.1079  0.1402  103 TYR A C     
840  O O     . TYR A 103 ? 0.4255 0.4500 0.6470 0.0895  0.1214  0.1334  103 TYR A O     
841  C CB    . TYR A 103 ? 0.3928 0.4482 0.6487 0.0780  0.0774  0.1405  103 TYR A CB    
842  C CG    . TYR A 103 ? 0.4133 0.4573 0.6193 0.0768  0.0736  0.1285  103 TYR A CG    
843  C CD1   . TYR A 103 ? 0.3855 0.4292 0.5770 0.0746  0.0631  0.1179  103 TYR A CD1   
844  C CD2   . TYR A 103 ? 0.4045 0.4386 0.5784 0.0772  0.0798  0.1287  103 TYR A CD2   
845  C CE1   . TYR A 103 ? 0.3814 0.4172 0.5309 0.0721  0.0587  0.1076  103 TYR A CE1   
846  C CE2   . TYR A 103 ? 0.3918 0.4183 0.5226 0.0751  0.0740  0.1189  103 TYR A CE2   
847  C CZ    . TYR A 103 ? 0.4042 0.4325 0.5245 0.0721  0.0634  0.1082  103 TYR A CZ    
848  O OH    . TYR A 103 ? 0.4362 0.4593 0.5171 0.0686  0.0568  0.0989  103 TYR A OH    
849  N N     . ASP A 104 ? 0.4153 0.4697 0.7061 0.0874  0.0966  0.1418  104 ASP A N     
850  C CA    . ASP A 104 ? 0.4037 0.4504 0.6862 0.0903  0.0994  0.1356  104 ASP A CA    
851  C C     . ASP A 104 ? 0.3723 0.4236 0.6417 0.0838  0.0741  0.1260  104 ASP A C     
852  O O     . ASP A 104 ? 0.3894 0.4551 0.6877 0.0809  0.0568  0.1300  104 ASP A O     
853  C CB    . ASP A 104 ? 0.4138 0.4700 0.7445 0.0968  0.1082  0.1472  104 ASP A CB    
854  C CG    . ASP A 104 ? 0.4823 0.5260 0.8039 0.1022  0.1168  0.1425  104 ASP A CG    
855  O OD1   . ASP A 104 ? 0.4694 0.4996 0.7504 0.0985  0.1106  0.1295  104 ASP A OD1   
856  O OD2   . ASP A 104 ? 0.5500 0.5976 0.9071 0.1103  0.1300  0.1526  104 ASP A OD2   
857  N N     . HIS A 105 ? 0.3806 0.4193 0.6060 0.0808  0.0722  0.1136  105 HIS A N     
858  C CA    . HIS A 105 ? 0.4051 0.4482 0.6160 0.0743  0.0505  0.1043  105 HIS A CA    
859  C C     . HIS A 105 ? 0.3536 0.3994 0.5829 0.0747  0.0428  0.1045  105 HIS A C     
860  O O     . HIS A 105 ? 0.3464 0.4000 0.5785 0.0696  0.0234  0.1014  105 HIS A O     
861  C CB    . HIS A 105 ? 0.4446 0.4756 0.6077 0.0703  0.0509  0.0920  105 HIS A CB    
862  C CG    . HIS A 105 ? 0.5305 0.5437 0.6722 0.0716  0.0646  0.0856  105 HIS A CG    
863  N ND1   . HIS A 105 ? 0.5745 0.5844 0.7117 0.0689  0.0572  0.0792  105 HIS A ND1   
864  C CD2   . HIS A 105 ? 0.6024 0.5969 0.7231 0.0749  0.0862  0.0845  105 HIS A CD2   
865  C CE1   . HIS A 105 ? 0.5957 0.5855 0.7114 0.0704  0.0734  0.0743  105 HIS A CE1   
866  N NE2   . HIS A 105 ? 0.6421 0.6215 0.7464 0.0740  0.0913  0.0769  105 HIS A NE2   
867  N N     . THR A 106 ? 0.3499 0.3879 0.5913 0.0812  0.0588  0.1088  106 THR A N     
868  C CA    . THR A 106 ? 0.3543 0.3936 0.6137 0.0830  0.0523  0.1109  106 THR A CA    
869  C C     . THR A 106 ? 0.3352 0.3945 0.6377 0.0820  0.0355  0.1218  106 THR A C     
870  O O     . THR A 106 ? 0.2917 0.3542 0.6053 0.0809  0.0224  0.1232  106 THR A O     
871  C CB    . THR A 106 ? 0.3855 0.4110 0.6516 0.0922  0.0751  0.1148  106 THR A CB    
872  O OG1   . THR A 106 ? 0.3873 0.4221 0.6921 0.0996  0.0886  0.1285  106 THR A OG1   
873  C CG2   . THR A 106 ? 0.3941 0.3957 0.6132 0.0916  0.0922  0.1033  106 THR A CG2   
874  N N     . LYS A 107 ? 0.3030 0.3741 0.6273 0.0813  0.0353  0.1294  107 LYS A N     
875  C CA    . LYS A 107 ? 0.2974 0.3861 0.6600 0.0775  0.0187  0.1391  107 LYS A CA    
876  C C     . LYS A 107 ? 0.2982 0.3902 0.6452 0.0683  -0.0037 0.1322  107 LYS A C     
877  O O     . LYS A 107 ? 0.3155 0.4133 0.6727 0.0591  -0.0197 0.1333  107 LYS A O     
878  C CB    . LYS A 107 ? 0.3199 0.4163 0.7089 0.0775  0.0306  0.1491  107 LYS A CB    
879  C CG    . LYS A 107 ? 0.4066 0.5003 0.8143 0.0860  0.0543  0.1570  107 LYS A CG    
880  C CD    . LYS A 107 ? 0.4507 0.5490 0.8777 0.0840  0.0469  0.1613  107 LYS A CD    
881  C CE    . LYS A 107 ? 0.5097 0.6077 0.9613 0.0915  0.0701  0.1714  107 LYS A CE    
882  N NZ    . LYS A 107 ? 0.5222 0.6264 0.9956 0.0903  0.0620  0.1775  107 LYS A NZ    
883  N N     . ILE A 108 ? 0.2850 0.3677 0.5931 0.0662  -0.0031 0.1208  108 ILE A N     
884  C CA    . ILE A 108 ? 0.2770 0.3615 0.5690 0.0591  -0.0206 0.1141  108 ILE A CA    
885  C C     . ILE A 108 ? 0.2837 0.3639 0.5561 0.0553  -0.0337 0.1051  108 ILE A C     
886  O O     . ILE A 108 ? 0.2695 0.3410 0.5173 0.0566  -0.0267 0.0976  108 ILE A O     
887  C CB    . ILE A 108 ? 0.2821 0.3612 0.5447 0.0592  -0.0136 0.1078  108 ILE A CB    
888  C CG1   . ILE A 108 ? 0.2780 0.3582 0.5550 0.0631  0.0017  0.1169  108 ILE A CG1   
889  C CG2   . ILE A 108 ? 0.2978 0.3789 0.5474 0.0537  -0.0301 0.1020  108 ILE A CG2   
890  C CD1   . ILE A 108 ? 0.2481 0.3223 0.4957 0.0635  0.0076  0.1130  108 ILE A CD1   
891  N N     . ARG A 109 ? 0.2375 0.3218 0.5187 0.0496  -0.0522 0.1058  109 ARG A N     
892  C CA    . ARG A 109 ? 0.2486 0.3274 0.5110 0.0458  -0.0637 0.0984  109 ARG A CA    
893  C C     . ARG A 109 ? 0.2710 0.3454 0.4999 0.0425  -0.0665 0.0864  109 ARG A C     
894  O O     . ARG A 109 ? 0.2451 0.3208 0.4707 0.0390  -0.0758 0.0844  109 ARG A O     
895  C CB    . ARG A 109 ? 0.2439 0.3231 0.5164 0.0386  -0.0799 0.1010  109 ARG A CB    
896  C CG    . ARG A 109 ? 0.2738 0.3461 0.5305 0.0360  -0.0899 0.0966  109 ARG A CG    
897  C CD    . ARG A 109 ? 0.2713 0.3411 0.5332 0.0282  -0.1037 0.0993  109 ARG A CD    
898  N NE    . ARG A 109 ? 0.2762 0.3526 0.5672 0.0292  -0.0998 0.1098  109 ARG A NE    
899  C CZ    . ARG A 109 ? 0.2817 0.3583 0.5835 0.0329  -0.0974 0.1156  109 ARG A CZ    
900  N NH1   . ARG A 109 ? 0.2646 0.3332 0.5494 0.0358  -0.0987 0.1122  109 ARG A NH1   
901  N NH2   . ARG A 109 ? 0.2558 0.3404 0.5867 0.0340  -0.0935 0.1257  109 ARG A NH2   
902  N N     . VAL A 110 ? 0.2855 0.3545 0.4905 0.0437  -0.0579 0.0788  110 VAL A N     
903  C CA    . VAL A 110 ? 0.2467 0.3148 0.4236 0.0404  -0.0607 0.0684  110 VAL A CA    
904  C C     . VAL A 110 ? 0.2960 0.3593 0.4593 0.0358  -0.0690 0.0622  110 VAL A C     
905  O O     . VAL A 110 ? 0.2933 0.3500 0.4521 0.0359  -0.0645 0.0615  110 VAL A O     
906  C CB    . VAL A 110 ? 0.2492 0.3151 0.4065 0.0423  -0.0476 0.0637  110 VAL A CB    
907  C CG1   . VAL A 110 ? 0.2236 0.2934 0.3577 0.0387  -0.0524 0.0548  110 VAL A CG1   
908  C CG2   . VAL A 110 ? 0.2354 0.3029 0.4030 0.0471  -0.0372 0.0707  110 VAL A CG2   
909  N N     . ALA A 111 ? 0.2683 0.3325 0.4238 0.0319  -0.0798 0.0581  111 ALA A N     
910  C CA    . ALA A 111 ? 0.2367 0.2950 0.3778 0.0271  -0.0870 0.0526  111 ALA A CA    
911  C C     . ALA A 111 ? 0.2480 0.3089 0.3668 0.0247  -0.0847 0.0429  111 ALA A C     
912  O O     . ALA A 111 ? 0.2837 0.3506 0.4006 0.0260  -0.0854 0.0409  111 ALA A O     
913  C CB    . ALA A 111 ? 0.2082 0.2624 0.3557 0.0237  -0.1008 0.0555  111 ALA A CB    
914  N N     . ASN A 112 ? 0.3031 0.3597 0.4072 0.0213  -0.0817 0.0377  112 ASN A N     
915  C CA    . ASN A 112 ? 0.3380 0.3989 0.4240 0.0175  -0.0798 0.0291  112 ASN A CA    
916  C C     . ASN A 112 ? 0.3326 0.3857 0.4079 0.0126  -0.0854 0.0258  112 ASN A C     
917  O O     . ASN A 112 ? 0.3150 0.3578 0.3867 0.0104  -0.0857 0.0273  112 ASN A O     
918  C CB    . ASN A 112 ? 0.3877 0.4481 0.4630 0.0152  -0.0708 0.0253  112 ASN A CB    
919  C CG    . ASN A 112 ? 0.4579 0.5264 0.5333 0.0180  -0.0651 0.0256  112 ASN A CG    
920  O OD1   . ASN A 112 ? 0.5180 0.5847 0.6041 0.0231  -0.0614 0.0316  112 ASN A OD1   
921  N ND2   . ASN A 112 ? 0.4003 0.4781 0.4638 0.0144  -0.0644 0.0197  112 ASN A ND2   
922  N N     . PHE A 113 ? 0.3101 0.3661 0.3791 0.0115  -0.0888 0.0217  113 PHE A N     
923  C CA    . PHE A 113 ? 0.2837 0.3295 0.3384 0.0066  -0.0922 0.0184  113 PHE A CA    
924  C C     . PHE A 113 ? 0.2954 0.3478 0.3390 0.0044  -0.0879 0.0110  113 PHE A C     
925  O O     . PHE A 113 ? 0.2654 0.3317 0.3148 0.0077  -0.0846 0.0094  113 PHE A O     
926  C CB    . PHE A 113 ? 0.3641 0.3979 0.4207 0.0064  -0.1025 0.0227  113 PHE A CB    
927  C CG    . PHE A 113 ? 0.3663 0.3997 0.4211 0.0079  -0.1054 0.0203  113 PHE A CG    
928  C CD1   . PHE A 113 ? 0.4128 0.4323 0.4504 0.0041  -0.1095 0.0167  113 PHE A CD1   
929  C CD2   . PHE A 113 ? 0.3391 0.3829 0.4070 0.0131  -0.1030 0.0218  113 PHE A CD2   
930  C CE1   . PHE A 113 ? 0.4065 0.4213 0.4400 0.0058  -0.1104 0.0138  113 PHE A CE1   
931  C CE2   . PHE A 113 ? 0.3681 0.4084 0.4339 0.0152  -0.1045 0.0198  113 PHE A CE2   
932  C CZ    . PHE A 113 ? 0.3781 0.4033 0.4268 0.0116  -0.1078 0.0155  113 PHE A CZ    
933  N N     . ASP A 114 ? 0.2762 0.3189 0.3045 -0.0008 -0.0874 0.0077  114 ASP A N     
934  C CA    . ASP A 114 ? 0.2730 0.3212 0.2919 -0.0033 -0.0814 0.0013  114 ASP A CA    
935  C C     . ASP A 114 ? 0.3174 0.3466 0.3172 -0.0078 -0.0830 -0.0002 114 ASP A C     
936  O O     . ASP A 114 ? 0.2877 0.3030 0.2797 -0.0112 -0.0872 0.0029  114 ASP A O     
937  C CB    . ASP A 114 ? 0.3234 0.3834 0.3419 -0.0079 -0.0742 -0.0020 114 ASP A CB    
938  C CG    . ASP A 114 ? 0.4458 0.5178 0.4619 -0.0103 -0.0675 -0.0073 114 ASP A CG    
939  O OD1   . ASP A 114 ? 0.4710 0.5601 0.4992 -0.0054 -0.0662 -0.0075 114 ASP A OD1   
940  O OD2   . ASP A 114 ? 0.5130 0.5778 0.5166 -0.0166 -0.0629 -0.0103 114 ASP A OD2   
941  N N     . ILE A 115 ? 0.2907 0.3180 0.2820 -0.0072 -0.0792 -0.0045 115 ILE A N     
942  C CA    . ILE A 115 ? 0.3214 0.3276 0.2893 -0.0118 -0.0796 -0.0065 115 ILE A CA    
943  C C     . ILE A 115 ? 0.3607 0.3717 0.3195 -0.0154 -0.0673 -0.0120 115 ILE A C     
944  O O     . ILE A 115 ? 0.3491 0.3817 0.3228 -0.0133 -0.0599 -0.0142 115 ILE A O     
945  C CB    . ILE A 115 ? 0.3526 0.3442 0.3119 -0.0091 -0.0846 -0.0072 115 ILE A CB    
946  C CG1   . ILE A 115 ? 0.3289 0.3300 0.2926 -0.0036 -0.0746 -0.0120 115 ILE A CG1   
947  C CG2   . ILE A 115 ? 0.3534 0.3442 0.3271 -0.0063 -0.0965 -0.0012 115 ILE A CG2   
948  C CD1   . ILE A 115 ? 0.3548 0.3352 0.3039 -0.0017 -0.0766 -0.0144 115 ILE A CD1   
949  N N     . GLU A 116 ? 0.3488 0.3401 0.2838 -0.0212 -0.0654 -0.0133 116 GLU A N     
950  C CA    . GLU A 116 ? 0.4044 0.3975 0.3294 -0.0250 -0.0519 -0.0182 116 GLU A CA    
951  C C     . GLU A 116 ? 0.4222 0.3926 0.3223 -0.0248 -0.0488 -0.0213 116 GLU A C     
952  O O     . GLU A 116 ? 0.4413 0.3877 0.3218 -0.0269 -0.0590 -0.0191 116 GLU A O     
953  C CB    . GLU A 116 ? 0.4395 0.4270 0.3545 -0.0335 -0.0487 -0.0173 116 GLU A CB    
954  C CG    . GLU A 116 ? 0.4826 0.4872 0.4169 -0.0350 -0.0502 -0.0155 116 GLU A CG    
955  C CD    . GLU A 116 ? 0.5252 0.5595 0.4819 -0.0336 -0.0435 -0.0187 116 GLU A CD    
956  O OE1   . GLU A 116 ? 0.5305 0.5740 0.4884 -0.0345 -0.0334 -0.0221 116 GLU A OE1   
957  O OE2   . GLU A 116 ? 0.5526 0.6011 0.5258 -0.0314 -0.0481 -0.0171 116 GLU A OE2   
958  N N     . VAL A 117 ? 0.4081 0.3860 0.3095 -0.0221 -0.0348 -0.0260 117 VAL A N     
959  C CA    . VAL A 117 ? 0.4335 0.3875 0.3083 -0.0216 -0.0274 -0.0302 117 VAL A CA    
960  C C     . VAL A 117 ? 0.4701 0.4300 0.3409 -0.0240 -0.0081 -0.0338 117 VAL A C     
961  O O     . VAL A 117 ? 0.4208 0.4069 0.3169 -0.0190 0.0025  -0.0350 117 VAL A O     
962  C CB    . VAL A 117 ? 0.4291 0.3829 0.3114 -0.0123 -0.0270 -0.0323 117 VAL A CB    
963  C CG1   . VAL A 117 ? 0.4215 0.3464 0.2723 -0.0120 -0.0168 -0.0379 117 VAL A CG1   
964  C CG2   . VAL A 117 ? 0.4055 0.3540 0.2936 -0.0109 -0.0451 -0.0283 117 VAL A CG2   
965  N N     . THR A 118 ? 0.5260 0.4621 0.3659 -0.0318 -0.0036 -0.0347 118 THR A N     
966  C CA    . THR A 118 ? 0.5134 0.4515 0.3469 -0.0347 0.0168  -0.0379 118 THR A CA    
967  C C     . THR A 118 ? 0.5540 0.4805 0.3765 -0.0276 0.0305  -0.0429 118 THR A C     
968  O O     . THR A 118 ? 0.5698 0.4640 0.3608 -0.0271 0.0258  -0.0452 118 THR A O     
969  C CB    . THR A 118 ? 0.5335 0.4457 0.3333 -0.0452 0.0188  -0.0367 118 THR A CB    
970  O OG1   . THR A 118 ? 0.5016 0.4260 0.3150 -0.0512 0.0106  -0.0323 118 THR A OG1   
971  C CG2   . THR A 118 ? 0.5766 0.4868 0.3664 -0.0482 0.0423  -0.0401 118 THR A CG2   
972  N N     . SER A 119 ? 0.6052 0.5580 0.4542 -0.0221 0.0471  -0.0442 119 SER A N     
973  C CA    . SER A 119 ? 0.7057 0.6492 0.5483 -0.0135 0.0643  -0.0485 119 SER A CA    
974  C C     . SER A 119 ? 0.7827 0.7410 0.6353 -0.0144 0.0885  -0.0494 119 SER A C     
975  O O     . SER A 119 ? 0.7727 0.7704 0.6652 -0.0137 0.0924  -0.0462 119 SER A O     
976  C CB    . SER A 119 ? 0.7228 0.6866 0.5965 -0.0011 0.0605  -0.0476 119 SER A CB    
977  O OG    . SER A 119 ? 0.7802 0.7375 0.6526 0.0087  0.0802  -0.0511 119 SER A OG    
978  N N     . PRO A 120 ? 0.8594 0.7858 0.6752 -0.0166 0.1050  -0.0535 120 PRO A N     
979  C CA    . PRO A 120 ? 0.9151 0.8526 0.7386 -0.0176 0.1312  -0.0541 120 PRO A CA    
980  C C     . PRO A 120 ? 0.9437 0.8999 0.7956 -0.0034 0.1503  -0.0551 120 PRO A C     
981  O O     . PRO A 120 ? 0.9525 0.9297 0.8256 -0.0024 0.1719  -0.0537 120 PRO A O     
982  C CB    . PRO A 120 ? 0.9555 0.8446 0.7215 -0.0247 0.1407  -0.0580 120 PRO A CB    
983  C CG    . PRO A 120 ? 0.9765 0.8302 0.7092 -0.0216 0.1253  -0.0615 120 PRO A CG    
984  C CD    . PRO A 120 ? 0.9150 0.7918 0.6774 -0.0202 0.0990  -0.0573 120 PRO A CD    
985  N N     . ASP A 121 ? 0.9727 0.9218 0.8268 0.0075  0.1431  -0.0566 121 ASP A N     
986  C CA    . ASP A 121 ? 1.0297 0.9905 0.9073 0.0229  0.1617  -0.0571 121 ASP A CA    
987  C C     . ASP A 121 ? 0.9701 0.9658 0.8928 0.0333  0.1482  -0.0521 121 ASP A C     
988  O O     . ASP A 121 ? 0.9917 0.9740 0.9123 0.0447  0.1485  -0.0537 121 ASP A O     
989  C CB    . ASP A 121 ? 1.1564 1.0664 0.9874 0.0283  0.1733  -0.0646 121 ASP A CB    
990  C CG    . ASP A 121 ? 1.2372 1.1153 1.0369 0.0249  0.1486  -0.0674 121 ASP A CG    
991  O OD1   . ASP A 121 ? 1.2499 1.1351 1.0505 0.0152  0.1251  -0.0641 121 ASP A OD1   
992  O OD2   . ASP A 121 ? 1.2885 1.1339 1.0636 0.0317  0.1533  -0.0727 121 ASP A OD2   
993  N N     . GLY A 122 ? 0.9020 0.9400 0.8628 0.0286  0.1366  -0.0461 122 GLY A N     
994  C CA    . GLY A 122 ? 0.8548 0.9277 0.8574 0.0375  0.1241  -0.0404 122 GLY A CA    
995  C C     . GLY A 122 ? 0.8026 0.8654 0.7950 0.0345  0.0977  -0.0399 122 GLY A C     
996  O O     . GLY A 122 ? 0.7841 0.8175 0.7417 0.0246  0.0871  -0.0431 122 GLY A O     
997  N N     . PHE A 123 ? 0.7699 0.8579 0.7939 0.0434  0.0875  -0.0348 123 PHE A N     
998  C CA    . PHE A 123 ? 0.7377 0.8201 0.7575 0.0417  0.0646  -0.0332 123 PHE A CA    
999  C C     . PHE A 123 ? 0.7001 0.7370 0.6821 0.0430  0.0604  -0.0382 123 PHE A C     
1000 O O     . PHE A 123 ? 0.7469 0.7657 0.7210 0.0530  0.0723  -0.0408 123 PHE A O     
1001 C CB    . PHE A 123 ? 0.7253 0.8414 0.7842 0.0522  0.0576  -0.0263 123 PHE A CB    
1002 C CG    . PHE A 123 ? 0.7392 0.8488 0.7945 0.0517  0.0370  -0.0241 123 PHE A CG    
1003 C CD1   . PHE A 123 ? 0.7442 0.8668 0.8033 0.0415  0.0216  -0.0221 123 PHE A CD1   
1004 C CD2   . PHE A 123 ? 0.7517 0.8409 0.7999 0.0614  0.0348  -0.0241 123 PHE A CD2   
1005 C CE1   . PHE A 123 ? 0.7323 0.8491 0.7895 0.0417  0.0052  -0.0196 123 PHE A CE1   
1006 C CE2   . PHE A 123 ? 0.7448 0.8291 0.7919 0.0605  0.0173  -0.0214 123 PHE A CE2   
1007 C CZ    . PHE A 123 ? 0.7328 0.8318 0.7852 0.0510  0.0030  -0.0189 123 PHE A CZ    
1008 N N     . PRO A 124 ? 0.6124 0.6303 0.5714 0.0326  0.0435  -0.0393 124 PRO A N     
1009 C CA    . PRO A 124 ? 0.6139 0.5902 0.5375 0.0309  0.0360  -0.0433 124 PRO A CA    
1010 C C     . PRO A 124 ? 0.5662 0.5419 0.5027 0.0395  0.0264  -0.0408 124 PRO A C     
1011 O O     . PRO A 124 ? 0.5817 0.5706 0.5326 0.0373  0.0098  -0.0362 124 PRO A O     
1012 C CB    . PRO A 124 ? 0.5862 0.5533 0.4928 0.0177  0.0195  -0.0423 124 PRO A CB    
1013 C CG    . PRO A 124 ? 0.5343 0.5398 0.4741 0.0157  0.0139  -0.0370 124 PRO A CG    
1014 C CD    . PRO A 124 ? 0.5547 0.5889 0.5205 0.0217  0.0309  -0.0364 124 PRO A CD    
1015 N N     . GLU A 125 ? 0.5187 0.4772 0.4488 0.0494  0.0383  -0.0438 125 GLU A N     
1016 C CA    . GLU A 125 ? 0.5391 0.4935 0.4801 0.0580  0.0315  -0.0413 125 GLU A CA    
1017 C C     . GLU A 125 ? 0.5528 0.4816 0.4727 0.0491  0.0118  -0.0420 125 GLU A C     
1018 O O     . GLU A 125 ? 0.5744 0.4672 0.4572 0.0411  0.0097  -0.0478 125 GLU A O     
1019 C CB    . GLU A 125 ? 0.6401 0.5737 0.5731 0.0700  0.0504  -0.0452 125 GLU A CB    
1020 C CG    . GLU A 125 ? 0.7432 0.7099 0.7108 0.0830  0.0685  -0.0411 125 GLU A CG    
1021 C CD    . GLU A 125 ? 0.8031 0.8118 0.8143 0.0898  0.0582  -0.0313 125 GLU A CD    
1022 O OE1   . GLU A 125 ? 0.8240 0.8272 0.8371 0.0906  0.0436  -0.0284 125 GLU A OE1   
1023 O OE2   . GLU A 125 ? 0.7948 0.8420 0.8376 0.0936  0.0643  -0.0263 125 GLU A OE2   
1024 N N     . PRO A 126 ? 0.5232 0.4711 0.4670 0.0502  -0.0029 -0.0356 126 PRO A N     
1025 C CA    . PRO A 126 ? 0.5376 0.4680 0.4705 0.0422  -0.0216 -0.0343 126 PRO A CA    
1026 C C     . PRO A 126 ? 0.5976 0.4881 0.5042 0.0419  -0.0219 -0.0392 126 PRO A C     
1027 O O     . PRO A 126 ? 0.6092 0.4758 0.4938 0.0312  -0.0356 -0.0408 126 PRO A O     
1028 C CB    . PRO A 126 ? 0.5114 0.4715 0.4788 0.0476  -0.0300 -0.0262 126 PRO A CB    
1029 C CG    . PRO A 126 ? 0.5041 0.5002 0.4962 0.0529  -0.0212 -0.0233 126 PRO A CG    
1030 C CD    . PRO A 126 ? 0.4966 0.4855 0.4798 0.0582  -0.0026 -0.0284 126 PRO A CD    
1031 N N     . SER A 127 ? 0.6189 0.5015 0.5280 0.0533  -0.0072 -0.0413 127 SER A N     
1032 C CA    . SER A 127 ? 0.6388 0.4799 0.5211 0.0531  -0.0058 -0.0468 127 SER A CA    
1033 C C     . SER A 127 ? 0.7164 0.5190 0.5528 0.0438  -0.0011 -0.0562 127 SER A C     
1034 O O     . SER A 127 ? 0.8002 0.5642 0.6054 0.0362  -0.0080 -0.0613 127 SER A O     
1035 C CB    . SER A 127 ? 0.6610 0.5014 0.5574 0.0693  0.0111  -0.0462 127 SER A CB    
1036 O OG    . SER A 127 ? 0.6827 0.5282 0.5785 0.0776  0.0325  -0.0494 127 SER A OG    
1037 N N     . GLN A 128 ? 0.7094 0.5213 0.5399 0.0434  0.0105  -0.0583 128 GLN A N     
1038 C CA    . GLN A 128 ? 0.7832 0.5584 0.5672 0.0344  0.0162  -0.0665 128 GLN A CA    
1039 C C     . GLN A 128 ? 0.7515 0.5256 0.5207 0.0192  -0.0033 -0.0645 128 GLN A C     
1040 O O     . GLN A 128 ? 0.7875 0.5252 0.5171 0.0079  -0.0132 -0.0689 128 GLN A O     
1041 C CB    . GLN A 128 ? 0.8392 0.6209 0.6222 0.0422  0.0421  -0.0697 128 GLN A CB    
1042 C CG    . GLN A 128 ? 0.9153 0.6958 0.7125 0.0588  0.0635  -0.0711 128 GLN A CG    
1043 C CD    . GLN A 128 ? 1.0324 0.7675 0.8003 0.0593  0.0628  -0.0772 128 GLN A CD    
1044 O OE1   . GLN A 128 ? 1.0520 0.7927 0.8420 0.0668  0.0583  -0.0733 128 GLN A OE1   
1045 N NE2   . GLN A 128 ? 1.1079 0.7952 0.8233 0.0503  0.0672  -0.0867 128 GLN A NE2   
1046 N N     . ALA A 129 ? 0.6537 0.4668 0.4541 0.0190  -0.0090 -0.0575 129 ALA A N     
1047 C CA    . ALA A 129 ? 0.6007 0.4167 0.3931 0.0069  -0.0255 -0.0540 129 ALA A CA    
1048 C C     . ALA A 129 ? 0.6241 0.4060 0.3694 -0.0026 -0.0218 -0.0596 129 ALA A C     
1049 O O     . ALA A 129 ? 0.6911 0.4503 0.4103 -0.0138 -0.0393 -0.0590 129 ALA A O     
1050 C CB    . ALA A 129 ? 0.5543 0.3672 0.3536 0.0008  -0.0492 -0.0492 129 ALA A CB    
1051 N N     . LYS A 130 ? 0.6212 0.3999 0.3559 0.0019  0.0010  -0.0643 130 LYS A N     
1052 C CA    . LYS A 130 ? 0.6933 0.4347 0.3782 -0.0061 0.0085  -0.0704 130 LYS A CA    
1053 C C     . LYS A 130 ? 0.6751 0.4260 0.3539 -0.0145 0.0053  -0.0664 130 LYS A C     
1054 O O     . LYS A 130 ? 0.7221 0.4418 0.3574 -0.0226 0.0089  -0.0697 130 LYS A O     
1055 C CB    . LYS A 130 ? 0.7721 0.4988 0.4437 0.0030  0.0376  -0.0777 130 LYS A CB    
1056 C CG    . LYS A 130 ? 0.7641 0.5317 0.4758 0.0130  0.0575  -0.0746 130 LYS A CG    
1057 C CD    . LYS A 130 ? 0.8102 0.5624 0.5111 0.0232  0.0873  -0.0808 130 LYS A CD    
1058 N N     . HIS A 131 ? 0.5863 0.3774 0.3059 -0.0130 -0.0009 -0.0593 131 HIS A N     
1059 C CA    . HIS A 131 ? 0.6032 0.4032 0.3198 -0.0207 -0.0036 -0.0551 131 HIS A CA    
1060 C C     . HIS A 131 ? 0.5729 0.3776 0.2967 -0.0274 -0.0294 -0.0479 131 HIS A C     
1061 O O     . HIS A 131 ? 0.5630 0.3834 0.3143 -0.0237 -0.0419 -0.0445 131 HIS A O     
1062 C CB    . HIS A 131 ? 0.5651 0.4049 0.3196 -0.0154 0.0115  -0.0530 131 HIS A CB    
1063 C CG    . HIS A 131 ? 0.6085 0.4514 0.3663 -0.0073 0.0374  -0.0580 131 HIS A CG    
1064 N ND1   . HIS A 131 ? 0.6084 0.4726 0.3986 0.0048  0.0450  -0.0581 131 HIS A ND1   
1065 C CD2   . HIS A 131 ? 0.6994 0.5269 0.4333 -0.0090 0.0584  -0.0621 131 HIS A CD2   
1066 C CE1   . HIS A 131 ? 0.6789 0.5423 0.4679 0.0111  0.0696  -0.0618 131 HIS A CE1   
1067 N NE2   . HIS A 131 ? 0.7360 0.5772 0.4910 0.0027  0.0789  -0.0645 131 HIS A NE2   
1068 N N     . PRO A 132 ? 0.5944 0.3849 0.2942 -0.0367 -0.0362 -0.0448 132 PRO A N     
1069 C CA    . PRO A 132 ? 0.6118 0.4061 0.3193 -0.0420 -0.0595 -0.0366 132 PRO A CA    
1070 C C     . PRO A 132 ? 0.5930 0.4268 0.3483 -0.0369 -0.0621 -0.0312 132 PRO A C     
1071 O O     . PRO A 132 ? 0.5801 0.4367 0.3544 -0.0339 -0.0473 -0.0323 132 PRO A O     
1072 C CB    . PRO A 132 ? 0.6359 0.4097 0.3098 -0.0508 -0.0596 -0.0341 132 PRO A CB    
1073 C CG    . PRO A 132 ? 0.6854 0.4307 0.3196 -0.0524 -0.0418 -0.0421 132 PRO A CG    
1074 C CD    . PRO A 132 ? 0.6493 0.4161 0.3108 -0.0423 -0.0221 -0.0480 132 PRO A CD    
1075 N N     . ILE A 133 ? 0.5218 0.3632 0.2958 -0.0367 -0.0807 -0.0252 133 ILE A N     
1076 C CA    . ILE A 133 ? 0.4841 0.3561 0.2957 -0.0334 -0.0843 -0.0194 133 ILE A CA    
1077 C C     . ILE A 133 ? 0.5182 0.3841 0.3196 -0.0395 -0.0894 -0.0138 133 ILE A C     
1078 O O     . ILE A 133 ? 0.5420 0.3887 0.3264 -0.0444 -0.1048 -0.0085 133 ILE A O     
1079 C CB    . ILE A 133 ? 0.4596 0.3400 0.2947 -0.0304 -0.1001 -0.0145 133 ILE A CB    
1080 C CG1   . ILE A 133 ? 0.4460 0.3290 0.2894 -0.0243 -0.0948 -0.0195 133 ILE A CG1   
1081 C CG2   . ILE A 133 ? 0.4190 0.3269 0.2885 -0.0271 -0.1023 -0.0085 133 ILE A CG2   
1082 C CD1   . ILE A 133 ? 0.4228 0.3094 0.2854 -0.0229 -0.1096 -0.0148 133 ILE A CD1   
1083 N N     . ASP A 134 ? 0.4763 0.3578 0.2879 -0.0398 -0.0770 -0.0144 134 ASP A N     
1084 C CA    . ASP A 134 ? 0.4956 0.3671 0.2939 -0.0458 -0.0788 -0.0095 134 ASP A CA    
1085 C C     . ASP A 134 ? 0.4728 0.3631 0.2997 -0.0440 -0.0835 -0.0037 134 ASP A C     
1086 O O     . ASP A 134 ? 0.5249 0.4064 0.3435 -0.0480 -0.0845 0.0009  134 ASP A O     
1087 C CB    . ASP A 134 ? 0.5315 0.3961 0.3096 -0.0505 -0.0607 -0.0142 134 ASP A CB    
1088 C CG    . ASP A 134 ? 0.5204 0.4130 0.3236 -0.0471 -0.0439 -0.0199 134 ASP A CG    
1089 O OD1   . ASP A 134 ? 0.4874 0.4061 0.3231 -0.0432 -0.0463 -0.0187 134 ASP A OD1   
1090 O OD2   . ASP A 134 ? 0.5858 0.4741 0.3758 -0.0482 -0.0282 -0.0252 134 ASP A OD2   
1091 N N     . ALA A 135 ? 0.4240 0.3373 0.2822 -0.0379 -0.0853 -0.0038 135 ALA A N     
1092 C CA    . ALA A 135 ? 0.4072 0.3344 0.2898 -0.0356 -0.0896 0.0015  135 ALA A CA    
1093 C C     . ALA A 135 ? 0.4228 0.3675 0.3331 -0.0287 -0.0953 0.0030  135 ALA A C     
1094 O O     . ALA A 135 ? 0.4223 0.3786 0.3408 -0.0251 -0.0903 -0.0019 135 ALA A O     
1095 C CB    . ALA A 135 ? 0.3605 0.3008 0.2499 -0.0384 -0.0761 -0.0017 135 ALA A CB    
1096 N N     . ILE A 136 ? 0.3960 0.3420 0.3214 -0.0263 -0.1052 0.0105  136 ILE A N     
1097 C CA    . ILE A 136 ? 0.3924 0.3559 0.3458 -0.0200 -0.1078 0.0127  136 ILE A CA    
1098 C C     . ILE A 136 ? 0.3820 0.3514 0.3516 -0.0179 -0.1069 0.0183  136 ILE A C     
1099 O O     . ILE A 136 ? 0.3861 0.3435 0.3531 -0.0186 -0.1135 0.0253  136 ILE A O     
1100 C CB    . ILE A 136 ? 0.3794 0.3369 0.3383 -0.0185 -0.1216 0.0174  136 ILE A CB    
1101 C CG1   . ILE A 136 ? 0.3855 0.3304 0.3233 -0.0211 -0.1224 0.0114  136 ILE A CG1   
1102 C CG2   . ILE A 136 ? 0.3064 0.2819 0.2947 -0.0123 -0.1220 0.0203  136 ILE A CG2   
1103 C CD1   . ILE A 136 ? 0.3924 0.3256 0.3292 -0.0228 -0.1379 0.0154  136 ILE A CD1   
1104 N N     . THR A 137 ? 0.3313 0.3177 0.3161 -0.0150 -0.0983 0.0154  137 THR A N     
1105 C CA    . THR A 137 ? 0.3125 0.3025 0.3124 -0.0119 -0.0961 0.0201  137 THR A CA    
1106 C C     . THR A 137 ? 0.2824 0.2858 0.3048 -0.0055 -0.0983 0.0231  137 THR A C     
1107 O O     . THR A 137 ? 0.3137 0.3297 0.3403 -0.0040 -0.0951 0.0187  137 THR A O     
1108 C CB    . THR A 137 ? 0.3488 0.3430 0.3435 -0.0155 -0.0842 0.0146  137 THR A CB    
1109 O OG1   . THR A 137 ? 0.3893 0.3690 0.3640 -0.0219 -0.0815 0.0130  137 THR A OG1   
1110 C CG2   . THR A 137 ? 0.3235 0.3175 0.3305 -0.0117 -0.0801 0.0185  137 THR A CG2   
1111 N N     . HIS A 138 ? 0.2880 0.2888 0.3261 -0.0014 -0.1033 0.0317  138 HIS A N     
1112 C CA    . HIS A 138 ? 0.3007 0.3123 0.3611 0.0041  -0.1055 0.0362  138 HIS A CA    
1113 C C     . HIS A 138 ? 0.2804 0.2934 0.3567 0.0090  -0.0989 0.0421  138 HIS A C     
1114 O O     . HIS A 138 ? 0.2988 0.3039 0.3825 0.0108  -0.1025 0.0498  138 HIS A O     
1115 C CB    . HIS A 138 ? 0.2984 0.3051 0.3648 0.0033  -0.1196 0.0420  138 HIS A CB    
1116 C CG    . HIS A 138 ? 0.3349 0.3516 0.4263 0.0075  -0.1228 0.0480  138 HIS A CG    
1117 N ND1   . HIS A 138 ? 0.2912 0.3087 0.3839 0.0060  -0.1296 0.0468  138 HIS A ND1   
1118 C CD2   . HIS A 138 ? 0.3537 0.3780 0.4695 0.0128  -0.1191 0.0556  138 HIS A CD2   
1119 C CE1   . HIS A 138 ? 0.2718 0.2981 0.3896 0.0094  -0.1306 0.0536  138 HIS A CE1   
1120 N NE2   . HIS A 138 ? 0.2931 0.3244 0.4256 0.0138  -0.1239 0.0592  138 HIS A NE2   
1121 N N     . TYR A 139 ? 0.2574 0.2793 0.3376 0.0116  -0.0887 0.0387  139 TYR A N     
1122 C CA    . TYR A 139 ? 0.2846 0.3050 0.3761 0.0166  -0.0794 0.0431  139 TYR A CA    
1123 C C     . TYR A 139 ? 0.3072 0.3363 0.4241 0.0227  -0.0805 0.0511  139 TYR A C     
1124 O O     . TYR A 139 ? 0.2915 0.3302 0.4119 0.0231  -0.0821 0.0495  139 TYR A O     
1125 C CB    . TYR A 139 ? 0.2662 0.2881 0.3435 0.0146  -0.0674 0.0350  139 TYR A CB    
1126 C CG    . TYR A 139 ? 0.2741 0.2911 0.3586 0.0198  -0.0557 0.0383  139 TYR A CG    
1127 C CD1   . TYR A 139 ? 0.2664 0.2679 0.3472 0.0210  -0.0484 0.0401  139 TYR A CD1   
1128 C CD2   . TYR A 139 ? 0.2761 0.3016 0.3695 0.0241  -0.0507 0.0400  139 TYR A CD2   
1129 C CE1   . TYR A 139 ? 0.3171 0.3110 0.4030 0.0266  -0.0352 0.0429  139 TYR A CE1   
1130 C CE2   . TYR A 139 ? 0.3013 0.3198 0.3986 0.0290  -0.0378 0.0429  139 TYR A CE2   
1131 C CZ    . TYR A 139 ? 0.3463 0.3488 0.4399 0.0305  -0.0295 0.0440  139 TYR A CZ    
1132 O OH    . TYR A 139 ? 0.3459 0.3384 0.4418 0.0363  -0.0141 0.0465  139 TYR A OH    
1133 N N     . ASP A 140 ? 0.3054 0.3312 0.4413 0.0278  -0.0789 0.0606  140 ASP A N     
1134 C CA    . ASP A 140 ? 0.3156 0.3505 0.4800 0.0335  -0.0781 0.0698  140 ASP A CA    
1135 C C     . ASP A 140 ? 0.3366 0.3691 0.5066 0.0398  -0.0604 0.0713  140 ASP A C     
1136 O O     . ASP A 140 ? 0.3397 0.3616 0.5089 0.0430  -0.0525 0.0734  140 ASP A O     
1137 C CB    . ASP A 140 ? 0.3140 0.3494 0.5013 0.0348  -0.0900 0.0813  140 ASP A CB    
1138 C CG    . ASP A 140 ? 0.3527 0.4005 0.5735 0.0387  -0.0914 0.0915  140 ASP A CG    
1139 O OD1   . ASP A 140 ? 0.3438 0.3975 0.5718 0.0341  -0.1049 0.0934  140 ASP A OD1   
1140 O OD2   . ASP A 140 ? 0.3383 0.3886 0.5776 0.0459  -0.0781 0.0976  140 ASP A OD2   
1141 N N     . SER A 141 ? 0.2834 0.3231 0.4571 0.0419  -0.0533 0.0707  141 SER A N     
1142 C CA    . SER A 141 ? 0.2677 0.3022 0.4393 0.0470  -0.0351 0.0707  141 SER A CA    
1143 C C     . SER A 141 ? 0.2858 0.3187 0.4864 0.0552  -0.0266 0.0824  141 SER A C     
1144 O O     . SER A 141 ? 0.3298 0.3515 0.5254 0.0601  -0.0098 0.0822  141 SER A O     
1145 C CB    . SER A 141 ? 0.2834 0.3254 0.4511 0.0472  -0.0307 0.0688  141 SER A CB    
1146 O OG    . SER A 141 ? 0.3190 0.3718 0.5151 0.0499  -0.0356 0.0782  141 SER A OG    
1147 N N     . ILE A 142 ? 0.2858 0.3297 0.5169 0.0566  -0.0379 0.0928  142 ILE A N     
1148 C CA    . ILE A 142 ? 0.3270 0.3745 0.5932 0.0646  -0.0315 0.1062  142 ILE A CA    
1149 C C     . ILE A 142 ? 0.3720 0.4088 0.6389 0.0678  -0.0319 0.1094  142 ILE A C     
1150 O O     . ILE A 142 ? 0.3619 0.3910 0.6392 0.0763  -0.0157 0.1145  142 ILE A O     
1151 C CB    . ILE A 142 ? 0.2756 0.3405 0.5769 0.0633  -0.0454 0.1171  142 ILE A CB    
1152 C CG1   . ILE A 142 ? 0.2523 0.3246 0.5561 0.0622  -0.0398 0.1160  142 ILE A CG1   
1153 C CG2   . ILE A 142 ? 0.2815 0.3505 0.6105 0.0666  -0.0399 0.1274  142 ILE A CG2   
1154 C CD1   . ILE A 142 ? 0.2690 0.3520 0.5921 0.0551  -0.0490 0.1210  142 ILE A CD1   
1155 N N     . ASP A 143 ? 0.3641 0.3982 0.6178 0.0615  -0.0488 0.1066  143 ASP A N     
1156 C CA    . ASP A 143 ? 0.3594 0.3809 0.6087 0.0638  -0.0500 0.1097  143 ASP A CA    
1157 C C     . ASP A 143 ? 0.3440 0.3459 0.5587 0.0628  -0.0350 0.0981  143 ASP A C     
1158 O O     . ASP A 143 ? 0.3835 0.3707 0.5958 0.0672  -0.0280 0.1010  143 ASP A O     
1159 C CB    . ASP A 143 ? 0.3941 0.4162 0.6356 0.0564  -0.0725 0.1104  143 ASP A CB    
1160 C CG    . ASP A 143 ? 0.4774 0.5149 0.7471 0.0543  -0.0881 0.1205  143 ASP A CG    
1161 O OD1   . ASP A 143 ? 0.4406 0.4883 0.7358 0.0578  -0.0793 0.1266  143 ASP A OD1   
1162 O OD2   . ASP A 143 ? 0.5183 0.5549 0.7740 0.0455  -0.1053 0.1179  143 ASP A OD2   
1163 N N     . ASP A 144 ? 0.3337 0.3352 0.5223 0.0565  -0.0309 0.0855  144 ASP A N     
1164 C CA    . ASP A 144 ? 0.3230 0.3080 0.4763 0.0518  -0.0210 0.0733  144 ASP A CA    
1165 C C     . ASP A 144 ? 0.3423 0.3167 0.4803 0.0467  -0.0301 0.0713  144 ASP A C     
1166 O O     . ASP A 144 ? 0.3859 0.3416 0.5096 0.0471  -0.0204 0.0691  144 ASP A O     
1167 C CB    . ASP A 144 ? 0.3553 0.3245 0.5061 0.0587  0.0010  0.0735  144 ASP A CB    
1168 C CG    . ASP A 144 ? 0.3984 0.3502 0.5102 0.0514  0.0107  0.0595  144 ASP A CG    
1169 O OD1   . ASP A 144 ? 0.3908 0.3500 0.4827 0.0418  0.0023  0.0501  144 ASP A OD1   
1170 O OD2   . ASP A 144 ? 0.4327 0.3632 0.5346 0.0549  0.0269  0.0583  144 ASP A OD2   
1171 N N     . ARG A 145 ? 0.3097 0.2939 0.4491 0.0416  -0.0479 0.0724  145 ARG A N     
1172 C CA    . ARG A 145 ? 0.3330 0.3069 0.4563 0.0363  -0.0573 0.0714  145 ARG A CA    
1173 C C     . ARG A 145 ? 0.3466 0.3268 0.4497 0.0266  -0.0672 0.0620  145 ARG A C     
1174 O O     . ARG A 145 ? 0.3223 0.3167 0.4332 0.0257  -0.0737 0.0611  145 ARG A O     
1175 C CB    . ARG A 145 ? 0.2836 0.2590 0.4300 0.0410  -0.0702 0.0856  145 ARG A CB    
1176 C CG    . ARG A 145 ? 0.3259 0.2950 0.4956 0.0520  -0.0603 0.0971  145 ARG A CG    
1177 C CD    . ARG A 145 ? 0.3438 0.2891 0.4918 0.0526  -0.0487 0.0938  145 ARG A CD    
1178 N NE    . ARG A 145 ? 0.4279 0.3653 0.5995 0.0649  -0.0388 0.1061  145 ARG A NE    
1179 C CZ    . ARG A 145 ? 0.4445 0.3748 0.6222 0.0723  -0.0181 0.1051  145 ARG A CZ    
1180 N NH1   . ARG A 145 ? 0.4223 0.3522 0.5813 0.0675  -0.0070 0.0923  145 ARG A NH1   
1181 N NH2   . ARG A 145 ? 0.4597 0.3825 0.6612 0.0848  -0.0082 0.1172  145 ARG A NH2   
1182 N N     . PHE A 146 ? 0.3508 0.3194 0.4286 0.0197  -0.0670 0.0555  146 PHE A N     
1183 C CA    . PHE A 146 ? 0.3588 0.3322 0.4189 0.0114  -0.0750 0.0478  146 PHE A CA    
1184 C C     . PHE A 146 ? 0.4006 0.3672 0.4581 0.0098  -0.0892 0.0544  146 PHE A C     
1185 O O     . PHE A 146 ? 0.4285 0.3795 0.4754 0.0087  -0.0892 0.0577  146 PHE A O     
1186 C CB    . PHE A 146 ? 0.3243 0.2902 0.3588 0.0035  -0.0659 0.0371  146 PHE A CB    
1187 C CG    . PHE A 146 ? 0.3043 0.2761 0.3359 0.0025  -0.0546 0.0297  146 PHE A CG    
1188 C CD1   . PHE A 146 ? 0.2909 0.2780 0.3168 -0.0022 -0.0556 0.0219  146 PHE A CD1   
1189 C CD2   . PHE A 146 ? 0.3162 0.2767 0.3492 0.0064  -0.0428 0.0310  146 PHE A CD2   
1190 C CE1   . PHE A 146 ? 0.2905 0.2830 0.3114 -0.0040 -0.0475 0.0160  146 PHE A CE1   
1191 C CE2   . PHE A 146 ? 0.3400 0.3026 0.3647 0.0043  -0.0331 0.0238  146 PHE A CE2   
1192 C CZ    . PHE A 146 ? 0.2759 0.2552 0.2942 -0.0015 -0.0367 0.0165  146 PHE A CZ    
1193 N N     . TYR A 147 ? 0.3585 0.3344 0.4233 0.0091  -0.1014 0.0564  147 TYR A N     
1194 C CA    . TYR A 147 ? 0.3396 0.3072 0.3969 0.0058  -0.1164 0.0617  147 TYR A CA    
1195 C C     . TYR A 147 ? 0.3708 0.3319 0.3982 -0.0025 -0.1170 0.0519  147 TYR A C     
1196 O O     . TYR A 147 ? 0.3263 0.2966 0.3504 -0.0045 -0.1159 0.0445  147 TYR A O     
1197 C CB    . TYR A 147 ? 0.3157 0.2933 0.3949 0.0078  -0.1299 0.0692  147 TYR A CB    
1198 C CG    . TYR A 147 ? 0.3342 0.3193 0.4469 0.0161  -0.1293 0.0812  147 TYR A CG    
1199 C CD1   . TYR A 147 ? 0.3619 0.3415 0.4864 0.0188  -0.1394 0.0939  147 TYR A CD1   
1200 C CD2   . TYR A 147 ? 0.3262 0.3238 0.4590 0.0216  -0.1179 0.0806  147 TYR A CD2   
1201 C CE1   . TYR A 147 ? 0.3700 0.3585 0.5296 0.0275  -0.1373 0.1060  147 TYR A CE1   
1202 C CE2   . TYR A 147 ? 0.3164 0.3204 0.4807 0.0297  -0.1145 0.0918  147 TYR A CE2   
1203 C CZ    . TYR A 147 ? 0.3305 0.3310 0.5101 0.0330  -0.1237 0.1045  147 TYR A CZ    
1204 O OH    . TYR A 147 ? 0.3379 0.3469 0.5533 0.0422  -0.1191 0.1169  147 TYR A OH    
1205 N N     . VAL A 148 ? 0.3767 0.3212 0.3829 -0.0066 -0.1174 0.0526  148 VAL A N     
1206 C CA    . VAL A 148 ? 0.3813 0.3185 0.3589 -0.0144 -0.1139 0.0435  148 VAL A CA    
1207 C C     . VAL A 148 ? 0.4137 0.3364 0.3718 -0.0187 -0.1272 0.0470  148 VAL A C     
1208 O O     . VAL A 148 ? 0.4271 0.3357 0.3792 -0.0187 -0.1354 0.0561  148 VAL A O     
1209 C CB    . VAL A 148 ? 0.3932 0.3205 0.3560 -0.0181 -0.1011 0.0397  148 VAL A CB    
1210 C CG1   . VAL A 148 ? 0.3898 0.3122 0.3268 -0.0265 -0.0958 0.0310  148 VAL A CG1   
1211 C CG2   . VAL A 148 ? 0.3546 0.2931 0.3317 -0.0155 -0.0890 0.0353  148 VAL A CG2   
1212 N N     . PHE A 149 ? 0.3768 0.3015 0.3235 -0.0222 -0.1291 0.0400  149 PHE A N     
1213 C CA    . PHE A 149 ? 0.4664 0.3743 0.3888 -0.0275 -0.1407 0.0412  149 PHE A CA    
1214 C C     . PHE A 149 ? 0.4694 0.3654 0.3602 -0.0337 -0.1298 0.0325  149 PHE A C     
1215 O O     . PHE A 149 ? 0.4594 0.3650 0.3492 -0.0342 -0.1191 0.0232  149 PHE A O     
1216 C CB    . PHE A 149 ? 0.4702 0.3839 0.4001 -0.0271 -0.1499 0.0396  149 PHE A CB    
1217 C CG    . PHE A 149 ? 0.4347 0.3606 0.3972 -0.0222 -0.1607 0.0489  149 PHE A CG    
1218 C CD1   . PHE A 149 ? 0.4531 0.3709 0.4167 -0.0249 -0.1798 0.0583  149 PHE A CD1   
1219 C CD2   . PHE A 149 ? 0.3810 0.3266 0.3729 -0.0157 -0.1518 0.0489  149 PHE A CD2   
1220 C CE1   . PHE A 149 ? 0.4293 0.3611 0.4276 -0.0208 -0.1891 0.0679  149 PHE A CE1   
1221 C CE2   . PHE A 149 ? 0.3380 0.2947 0.3608 -0.0111 -0.1593 0.0580  149 PHE A CE2   
1222 C CZ    . PHE A 149 ? 0.3812 0.3324 0.4097 -0.0136 -0.1776 0.0677  149 PHE A CZ    
1223 N N     . ASP A 150 ? 0.4913 0.3667 0.3576 -0.0381 -0.1322 0.0368  150 ASP A N     
1224 C CA    . ASP A 150 ? 0.5432 0.4068 0.3812 -0.0443 -0.1190 0.0300  150 ASP A CA    
1225 C C     . ASP A 150 ? 0.5740 0.4124 0.3746 -0.0503 -0.1261 0.0305  150 ASP A C     
1226 O O     . ASP A 150 ? 0.5578 0.3785 0.3441 -0.0520 -0.1396 0.0399  150 ASP A O     
1227 C CB    . ASP A 150 ? 0.5431 0.4008 0.3804 -0.0453 -0.1112 0.0339  150 ASP A CB    
1228 C CG    . ASP A 150 ? 0.5497 0.3978 0.3624 -0.0528 -0.0957 0.0273  150 ASP A CG    
1229 O OD1   . ASP A 150 ? 0.5213 0.3724 0.3228 -0.0559 -0.0882 0.0190  150 ASP A OD1   
1230 O OD2   . ASP A 150 ? 0.5165 0.3536 0.3223 -0.0554 -0.0898 0.0308  150 ASP A OD2   
1231 N N     . LEU A 151 ? 0.5422 0.3783 0.3262 -0.0532 -0.1169 0.0208  151 LEU A N     
1232 C CA    . LEU A 151 ? 0.5781 0.3865 0.3207 -0.0593 -0.1199 0.0193  151 LEU A CA    
1233 C C     . LEU A 151 ? 0.6079 0.3993 0.3221 -0.0652 -0.1072 0.0190  151 LEU A C     
1234 O O     . LEU A 151 ? 0.5838 0.3844 0.3003 -0.0665 -0.0879 0.0116  151 LEU A O     
1235 C CB    . LEU A 151 ? 0.5968 0.4061 0.3321 -0.0590 -0.1129 0.0090  151 LEU A CB    
1236 C CG    . LEU A 151 ? 0.6742 0.4511 0.3621 -0.0654 -0.1133 0.0055  151 LEU A CG    
1237 C CD1   . LEU A 151 ? 0.6802 0.4352 0.3481 -0.0699 -0.1378 0.0143  151 LEU A CD1   
1238 C CD2   . LEU A 151 ? 0.6611 0.4385 0.3451 -0.0632 -0.1035 -0.0050 151 LEU A CD2   
1239 N N     . LEU A 152 ? 0.6257 0.3926 0.3140 -0.0690 -0.1183 0.0280  152 LEU A N     
1240 C CA    . LEU A 152 ? 0.6622 0.4090 0.3205 -0.0750 -0.1069 0.0293  152 LEU A CA    
1241 C C     . LEU A 152 ? 0.7318 0.4552 0.3469 -0.0814 -0.0976 0.0225  152 LEU A C     
1242 O O     . LEU A 152 ? 0.7789 0.4942 0.3765 -0.0860 -0.0790 0.0189  152 LEU A O     
1243 C CB    . LEU A 152 ? 0.6920 0.4201 0.3387 -0.0756 -0.1221 0.0432  152 LEU A CB    
1244 C CG    . LEU A 152 ? 0.6731 0.4181 0.3580 -0.0689 -0.1265 0.0512  152 LEU A CG    
1245 C CD1   . LEU A 152 ? 0.6431 0.3650 0.3107 -0.0695 -0.1360 0.0650  152 LEU A CD1   
1246 C CD2   . LEU A 152 ? 0.6365 0.4014 0.3449 -0.0681 -0.1058 0.0431  152 LEU A CD2   
1247 N N     . ASN A 153 ? 0.7146 0.4254 0.3116 -0.0822 -0.1098 0.0206  153 ASN A N     
1248 C CA    . ASN A 153 ? 0.8014 0.4831 0.3506 -0.0883 -0.1018 0.0142  153 ASN A CA    
1249 C C     . ASN A 153 ? 0.8085 0.4971 0.3621 -0.0855 -0.0931 0.0025  153 ASN A C     
1250 O O     . ASN A 153 ? 0.8052 0.4974 0.3692 -0.0833 -0.1084 0.0020  153 ASN A O     
1251 C CB    . ASN A 153 ? 0.8649 0.5128 0.3721 -0.0945 -0.1237 0.0225  153 ASN A CB    
1252 C CG    . ASN A 153 ? 0.9421 0.5778 0.4385 -0.0968 -0.1302 0.0351  153 ASN A CG    
1253 O OD1   . ASN A 153 ? 0.9638 0.5967 0.4539 -0.0985 -0.1116 0.0346  153 ASN A OD1   
1254 N ND2   . ASN A 153 ? 0.9847 0.6138 0.4808 -0.0969 -0.1568 0.0473  153 ASN A ND2   
1255 N N     . SER A 154 ? 0.8139 0.5038 0.3603 -0.0855 -0.0678 -0.0063 154 SER A N     
1256 C CA    . SER A 154 ? 0.7598 0.4576 0.3138 -0.0809 -0.0553 -0.0169 154 SER A CA    
1257 C C     . SER A 154 ? 0.8197 0.4913 0.3319 -0.0847 -0.0333 -0.0240 154 SER A C     
1258 O O     . SER A 154 ? 0.8495 0.5080 0.3394 -0.0902 -0.0228 -0.0213 154 SER A O     
1259 C CB    . SER A 154 ? 0.7378 0.4781 0.3453 -0.0736 -0.0437 -0.0197 154 SER A CB    
1260 O OG    . SER A 154 ? 0.7439 0.4930 0.3597 -0.0681 -0.0276 -0.0288 154 SER A OG    
1261 N N     . PRO A 155 ? 0.8724 0.5339 0.3725 -0.0816 -0.0248 -0.0330 155 PRO A N     
1262 C CA    . PRO A 155 ? 0.9094 0.5488 0.3750 -0.0831 0.0014  -0.0405 155 PRO A CA    
1263 C C     . PRO A 155 ? 0.8750 0.5450 0.3735 -0.0796 0.0273  -0.0421 155 PRO A C     
1264 O O     . PRO A 155 ? 0.9561 0.6118 0.4310 -0.0817 0.0512  -0.0460 155 PRO A O     
1265 C CB    . PRO A 155 ? 0.9479 0.5771 0.4072 -0.0776 0.0049  -0.0496 155 PRO A CB    
1266 C CG    . PRO A 155 ? 0.9179 0.5779 0.4245 -0.0716 -0.0139 -0.0469 155 PRO A CG    
1267 C CD    . PRO A 155 ? 0.8689 0.5337 0.3820 -0.0770 -0.0383 -0.0363 155 PRO A CD    
1268 N N     . TYR A 156 ? 0.7939 0.5051 0.3458 -0.0752 0.0224  -0.0388 156 TYR A N     
1269 C CA    . TYR A 156 ? 0.8214 0.5650 0.4082 -0.0738 0.0430  -0.0396 156 TYR A CA    
1270 C C     . TYR A 156 ? 0.8410 0.5889 0.4307 -0.0816 0.0404  -0.0326 156 TYR A C     
1271 O O     . TYR A 156 ? 0.8601 0.6366 0.4818 -0.0827 0.0527  -0.0324 156 TYR A O     
1272 C CB    . TYR A 156 ? 0.7924 0.5780 0.4338 -0.0646 0.0412  -0.0413 156 TYR A CB    
1273 C CG    . TYR A 156 ? 0.8301 0.6117 0.4713 -0.0559 0.0466  -0.0479 156 TYR A CG    
1274 C CD1   . TYR A 156 ? 0.9311 0.6840 0.5364 -0.0554 0.0653  -0.0539 156 TYR A CD1   
1275 C CD2   . TYR A 156 ? 0.8145 0.6175 0.4889 -0.0480 0.0341  -0.0479 156 TYR A CD2   
1276 C CE1   . TYR A 156 ? 0.9698 0.7148 0.5729 -0.0470 0.0718  -0.0602 156 TYR A CE1   
1277 C CE2   . TYR A 156 ? 0.8691 0.6654 0.5423 -0.0399 0.0396  -0.0534 156 TYR A CE2   
1278 C CZ    . TYR A 156 ? 0.9296 0.6964 0.5672 -0.0392 0.0585  -0.0598 156 TYR A CZ    
1279 O OH    . TYR A 156 ? 0.9418 0.6980 0.5763 -0.0307 0.0656  -0.0657 156 TYR A OH    
1280 N N     . GLY A 157 ? 0.8694 0.5879 0.4253 -0.0874 0.0239  -0.0263 157 GLY A N     
1281 C CA    . GLY A 157 ? 0.8710 0.5853 0.4223 -0.0945 0.0227  -0.0190 157 GLY A CA    
1282 C C     . GLY A 157 ? 0.8376 0.5438 0.3878 -0.0950 -0.0041 -0.0098 157 GLY A C     
1283 O O     . GLY A 157 ? 0.8090 0.5337 0.3887 -0.0890 -0.0205 -0.0087 157 GLY A O     
1284 N N     . ASN A 158 ? 0.7893 0.4677 0.3061 -0.1017 -0.0079 -0.0023 158 ASN A N     
1285 C CA    . ASN A 158 ? 0.7785 0.4502 0.2974 -0.1015 -0.0310 0.0086  158 ASN A CA    
1286 C C     . ASN A 158 ? 0.7969 0.4859 0.3445 -0.1027 -0.0246 0.0126  158 ASN A C     
1287 O O     . ASN A 158 ? 0.8408 0.5242 0.3780 -0.1091 -0.0057 0.0117  158 ASN A O     
1288 C CB    . ASN A 158 ? 0.8197 0.4488 0.2842 -0.1074 -0.0416 0.0163  158 ASN A CB    
1289 C CG    . ASN A 158 ? 0.8772 0.4845 0.3081 -0.1081 -0.0514 0.0123  158 ASN A CG    
1290 O OD1   . ASN A 158 ? 0.8648 0.4889 0.3179 -0.1029 -0.0561 0.0059  158 ASN A OD1   
1291 N ND2   . ASN A 158 ? 0.9725 0.5394 0.3469 -0.1151 -0.0545 0.0160  158 ASN A ND2   
1292 N N     . VAL A 159 ? 0.7345 0.4427 0.3170 -0.0971 -0.0393 0.0170  159 VAL A N     
1293 C CA    . VAL A 159 ? 0.7353 0.4591 0.3456 -0.0980 -0.0329 0.0192  159 VAL A CA    
1294 C C     . VAL A 159 ? 0.7530 0.4653 0.3657 -0.0948 -0.0505 0.0311  159 VAL A C     
1295 O O     . VAL A 159 ? 0.7620 0.4638 0.3661 -0.0908 -0.0703 0.0379  159 VAL A O     
1296 C CB    . VAL A 159 ? 0.7204 0.4832 0.3771 -0.0933 -0.0281 0.0115  159 VAL A CB    
1297 C CG1   . VAL A 159 ? 0.7111 0.4885 0.3711 -0.0954 -0.0094 0.0014  159 VAL A CG1   
1298 C CG2   . VAL A 159 ? 0.7182 0.4931 0.3956 -0.0844 -0.0473 0.0132  159 VAL A CG2   
1299 N N     . GLU A 160 ? 0.7323 0.4466 0.3579 -0.0969 -0.0429 0.0339  160 GLU A N     
1300 C CA    . GLU A 160 ? 0.7829 0.4879 0.4165 -0.0922 -0.0559 0.0452  160 GLU A CA    
1301 C C     . GLU A 160 ? 0.6969 0.4298 0.3736 -0.0834 -0.0644 0.0441  160 GLU A C     
1302 O O     . GLU A 160 ? 0.6790 0.4384 0.3790 -0.0825 -0.0578 0.0342  160 GLU A O     
1303 C CB    . GLU A 160 ? 0.8553 0.5469 0.4830 -0.0982 -0.0419 0.0478  160 GLU A CB    
1304 C CG    . GLU A 160 ? 0.9986 0.6584 0.5824 -0.1068 -0.0332 0.0517  160 GLU A CG    
1305 C CD    . GLU A 160 ? 1.1037 0.7495 0.6835 -0.1134 -0.0191 0.0544  160 GLU A CD    
1306 O OE1   . GLU A 160 ? 1.1144 0.7790 0.7249 -0.1140 -0.0115 0.0490  160 GLU A OE1   
1307 O OE2   . GLU A 160 ? 1.1924 0.8063 0.7364 -0.1185 -0.0156 0.0622  160 GLU A OE2   
1308 N N     . GLU A 161 ? 0.6783 0.4050 0.3658 -0.0764 -0.0783 0.0551  161 GLU A N     
1309 C CA    . GLU A 161 ? 0.6618 0.4120 0.3891 -0.0676 -0.0846 0.0555  161 GLU A CA    
1310 C C     . GLU A 161 ? 0.6269 0.3928 0.3757 -0.0695 -0.0680 0.0471  161 GLU A C     
1311 O O     . GLU A 161 ? 0.6437 0.3974 0.3799 -0.0767 -0.0545 0.0453  161 GLU A O     
1312 C CB    . GLU A 161 ? 0.7276 0.4667 0.4637 -0.0593 -0.0996 0.0705  161 GLU A CB    
1313 C CG    . GLU A 161 ? 0.8201 0.5505 0.5438 -0.0570 -0.1214 0.0800  161 GLU A CG    
1314 C CD    . GLU A 161 ? 0.8717 0.5993 0.6151 -0.0476 -0.1371 0.0959  161 GLU A CD    
1315 O OE1   . GLU A 161 ? 0.8987 0.6128 0.6265 -0.0473 -0.1559 0.1072  161 GLU A OE1   
1316 O OE2   . GLU A 161 ? 0.8710 0.6098 0.6454 -0.0404 -0.1305 0.0975  161 GLU A OE2   
1317 N N     . TRP A 162 ? 0.5724 0.3644 0.3522 -0.0640 -0.0697 0.0421  162 TRP A N     
1318 C CA    . TRP A 162 ? 0.5538 0.3609 0.3543 -0.0653 -0.0576 0.0350  162 TRP A CA    
1319 C C     . TRP A 162 ? 0.5495 0.3411 0.3560 -0.0608 -0.0568 0.0428  162 TRP A C     
1320 O O     . TRP A 162 ? 0.5822 0.3678 0.3972 -0.0516 -0.0688 0.0536  162 TRP A O     
1321 C CB    . TRP A 162 ? 0.5167 0.3527 0.3452 -0.0594 -0.0618 0.0296  162 TRP A CB    
1322 C CG    . TRP A 162 ? 0.4800 0.3308 0.3298 -0.0589 -0.0534 0.0241  162 TRP A CG    
1323 C CD1   . TRP A 162 ? 0.4328 0.2976 0.2857 -0.0667 -0.0419 0.0138  162 TRP A CD1   
1324 C CD2   . TRP A 162 ? 0.4596 0.3126 0.3298 -0.0503 -0.0561 0.0286  162 TRP A CD2   
1325 N NE1   . TRP A 162 ? 0.4333 0.3066 0.3029 -0.0645 -0.0385 0.0112  162 TRP A NE1   
1326 C CE2   . TRP A 162 ? 0.4330 0.2980 0.3126 -0.0540 -0.0456 0.0198  162 TRP A CE2   
1327 C CE3   . TRP A 162 ? 0.4681 0.3143 0.3501 -0.0400 -0.0661 0.0398  162 TRP A CE3   
1328 C CZ2   . TRP A 162 ? 0.4359 0.3027 0.3316 -0.0477 -0.0433 0.0209  162 TRP A CZ2   
1329 C CZ3   . TRP A 162 ? 0.4531 0.3040 0.3562 -0.0327 -0.0626 0.0416  162 TRP A CZ3   
1330 C CH2   . TRP A 162 ? 0.4392 0.2985 0.3468 -0.0365 -0.0504 0.0317  162 TRP A CH2   
1331 N N     . SER A 163 ? 0.5621 0.3467 0.3648 -0.0676 -0.0425 0.0378  163 SER A N     
1332 C CA    . SER A 163 ? 0.5902 0.3556 0.3957 -0.0636 -0.0383 0.0440  163 SER A CA    
1333 C C     . SER A 163 ? 0.5686 0.3483 0.3970 -0.0607 -0.0319 0.0375  163 SER A C     
1334 O O     . SER A 163 ? 0.5685 0.3606 0.3981 -0.0697 -0.0227 0.0260  163 SER A O     
1335 C CB    . SER A 163 ? 0.5955 0.3347 0.3754 -0.0742 -0.0260 0.0436  163 SER A CB    
1336 O OG    . SER A 163 ? 0.6161 0.3384 0.3997 -0.0725 -0.0173 0.0450  163 SER A OG    
1337 N N     . ILE A 164 ? 0.5685 0.3463 0.4149 -0.0483 -0.0369 0.0454  164 ILE A N     
1338 C CA    . ILE A 164 ? 0.5290 0.3163 0.3940 -0.0445 -0.0297 0.0401  164 ILE A CA    
1339 C C     . ILE A 164 ? 0.5936 0.3580 0.4449 -0.0513 -0.0141 0.0352  164 ILE A C     
1340 O O     . ILE A 164 ? 0.6257 0.3960 0.4814 -0.0549 -0.0056 0.0258  164 ILE A O     
1341 C CB    . ILE A 164 ? 0.5794 0.3707 0.4693 -0.0287 -0.0371 0.0508  164 ILE A CB    
1342 C CG1   . ILE A 164 ? 0.5408 0.3470 0.4489 -0.0251 -0.0298 0.0439  164 ILE A CG1   
1343 C CG2   . ILE A 164 ? 0.6042 0.3677 0.4917 -0.0209 -0.0352 0.0636  164 ILE A CG2   
1344 C CD1   . ILE A 164 ? 0.5036 0.3215 0.4404 -0.0106 -0.0368 0.0537  164 ILE A CD1   
1345 N N     . GLU A 165 ? 0.6053 0.3415 0.4375 -0.0540 -0.0106 0.0414  165 GLU A N     
1346 C CA    . GLU A 165 ? 0.6947 0.4040 0.5109 -0.0617 0.0047  0.0370  165 GLU A CA    
1347 C C     . GLU A 165 ? 0.6472 0.3666 0.4519 -0.0798 0.0122  0.0226  165 GLU A C     
1348 O O     . GLU A 165 ? 0.6498 0.3644 0.4516 -0.0874 0.0223  0.0133  165 GLU A O     
1349 C CB    . GLU A 165 ? 0.8090 0.4846 0.6063 -0.0604 0.0063  0.0484  165 GLU A CB    
1350 C CG    . GLU A 165 ? 0.8896 0.5527 0.7005 -0.0423 0.0000  0.0645  165 GLU A CG    
1351 C CD    . GLU A 165 ? 0.9612 0.6434 0.7840 -0.0339 -0.0194 0.0746  165 GLU A CD    
1352 O OE1   . GLU A 165 ? 0.9554 0.6523 0.7682 -0.0423 -0.0264 0.0698  165 GLU A OE1   
1353 O OE2   . GLU A 165 ? 1.0286 0.7108 0.8711 -0.0191 -0.0272 0.0876  165 GLU A OE2   
1354 N N     . ILE A 166 ? 0.5908 0.3240 0.3890 -0.0871 0.0074  0.0211  166 ILE A N     
1355 C CA    . ILE A 166 ? 0.6049 0.3530 0.3980 -0.1035 0.0141  0.0092  166 ILE A CA    
1356 C C     . ILE A 166 ? 0.5621 0.3438 0.3755 -0.1037 0.0110  -0.0001 166 ILE A C     
1357 O O     . ILE A 166 ? 0.5451 0.3356 0.3583 -0.1161 0.0173  -0.0101 166 ILE A O     
1358 C CB    . ILE A 166 ? 0.6459 0.3987 0.4273 -0.1095 0.0123  0.0110  166 ILE A CB    
1359 C CG1   . ILE A 166 ? 0.7353 0.4517 0.4918 -0.1113 0.0165  0.0203  166 ILE A CG1   
1360 C CG2   . ILE A 166 ? 0.6273 0.4013 0.4107 -0.1252 0.0198  -0.0003 166 ILE A CG2   
1361 C CD1   . ILE A 166 ? 0.7696 0.4845 0.5085 -0.1176 0.0168  0.0225  166 ILE A CD1   
1362 N N     . ALA A 167 ? 0.5305 0.3304 0.3610 -0.0905 0.0004  0.0039  167 ALA A N     
1363 C CA    . ALA A 167 ? 0.5382 0.3684 0.3871 -0.0891 -0.0030 -0.0032 167 ALA A CA    
1364 C C     . ALA A 167 ? 0.5434 0.3675 0.3932 -0.0918 0.0041  -0.0094 167 ALA A C     
1365 O O     . ALA A 167 ? 0.5019 0.3461 0.3571 -0.0990 0.0046  -0.0182 167 ALA A O     
1366 C CB    . ALA A 167 ? 0.4574 0.3020 0.3233 -0.0743 -0.0146 0.0035  167 ALA A CB    
1367 N N     . ALA A 168 ? 0.5437 0.3386 0.3867 -0.0859 0.0098  -0.0044 168 ALA A N     
1368 C CA    . ALA A 168 ? 0.5552 0.3372 0.3947 -0.0869 0.0186  -0.0100 168 ALA A CA    
1369 C C     . ALA A 168 ? 0.6342 0.4011 0.4535 -0.1056 0.0285  -0.0202 168 ALA A C     
1370 O O     . ALA A 168 ? 0.6595 0.4230 0.4728 -0.1118 0.0337  -0.0288 168 ALA A O     
1371 C CB    . ALA A 168 ? 0.5614 0.3162 0.4027 -0.0722 0.0232  -0.0003 168 ALA A CB    
1372 N N     . LYS A 169 ? 0.6511 0.4077 0.4581 -0.1156 0.0310  -0.0192 169 LYS A N     
1373 C CA    . LYS A 169 ? 0.6641 0.4057 0.4531 -0.1352 0.0403  -0.0280 169 LYS A CA    
1374 C C     . LYS A 169 ? 0.6196 0.3931 0.4156 -0.1497 0.0369  -0.0391 169 LYS A C     
1375 O O     . LYS A 169 ? 0.6303 0.4387 0.4444 -0.1453 0.0277  -0.0388 169 LYS A O     
1376 C CB    . LYS A 169 ? 0.6528 0.3792 0.4292 -0.1426 0.0441  -0.0231 169 LYS A CB    
1377 C CG    . LYS A 169 ? 0.7529 0.4394 0.5157 -0.1332 0.0496  -0.0128 169 LYS A CG    
1378 C CD    . LYS A 169 ? 0.8526 0.5234 0.5994 -0.1417 0.0533  -0.0078 169 LYS A CD    
1379 C CE    . LYS A 169 ? 0.9770 0.6025 0.7061 -0.1360 0.0610  0.0014  169 LYS A CE    
1380 N NZ    . LYS A 169 ? 1.0206 0.6407 0.7615 -0.1133 0.0541  0.0132  169 LYS A NZ    
1381 N N     . LEU A 170 ? 0.6226 0.3829 0.4041 -0.1672 0.0437  -0.0484 170 LEU A N     
1382 C CA    . LEU A 170 ? 0.6434 0.4335 0.4314 -0.1835 0.0391  -0.0581 170 LEU A CA    
1383 C C     . LEU A 170 ? 0.6202 0.4375 0.4205 -0.1923 0.0366  -0.0567 170 LEU A C     
1384 O O     . LEU A 170 ? 0.6151 0.4169 0.4084 -0.1925 0.0421  -0.0511 170 LEU A O     
1385 C CB    . LEU A 170 ? 0.7134 0.4785 0.4798 -0.2030 0.0465  -0.0680 170 LEU A CB    
1386 C CG    . LEU A 170 ? 0.7931 0.5163 0.5386 -0.1968 0.0554  -0.0699 170 LEU A CG    
1387 C CD1   . LEU A 170 ? 0.8352 0.5333 0.5561 -0.2196 0.0622  -0.0815 170 LEU A CD1   
1388 C CD2   . LEU A 170 ? 0.8218 0.5576 0.5764 -0.1805 0.0503  -0.0692 170 LEU A CD2   
1389 N N     . GLN A 171 ? 0.5418 0.3987 0.3600 -0.1991 0.0291  -0.0613 171 GLN A N     
1390 C CA    . GLN A 171 ? 0.5502 0.4355 0.3833 -0.2080 0.0289  -0.0605 171 GLN A CA    
1391 C C     . GLN A 171 ? 0.5833 0.4488 0.4027 -0.2281 0.0391  -0.0632 171 GLN A C     
1392 O O     . GLN A 171 ? 0.5567 0.4253 0.3787 -0.2313 0.0448  -0.0590 171 GLN A O     
1393 C CB    . GLN A 171 ? 0.5976 0.5274 0.4533 -0.2136 0.0196  -0.0650 171 GLN A CB    
1394 C CG    . GLN A 171 ? 0.7304 0.6842 0.6027 -0.1940 0.0102  -0.0611 171 GLN A CG    
1395 C CD    . GLN A 171 ? 0.8164 0.7876 0.7032 -0.1830 0.0104  -0.0546 171 GLN A CD    
1396 O OE1   . GLN A 171 ? 0.9188 0.8863 0.8033 -0.1900 0.0181  -0.0529 171 GLN A OE1   
1397 N NE2   . GLN A 171 ? 0.8231 0.8114 0.7228 -0.1663 0.0029  -0.0511 171 GLN A NE2   
1398 N N     . GLU A 172 ? 0.5827 0.4249 0.3852 -0.2419 0.0423  -0.0702 172 GLU A N     
1399 C CA    . GLU A 172 ? 0.6214 0.4411 0.4092 -0.2633 0.0521  -0.0737 172 GLU A CA    
1400 C C     . GLU A 172 ? 0.6754 0.4530 0.4431 -0.2564 0.0630  -0.0664 172 GLU A C     
1401 O O     . GLU A 172 ? 0.7418 0.5006 0.4981 -0.2718 0.0726  -0.0665 172 GLU A O     
1402 C CB    . GLU A 172 ? 0.7008 0.5021 0.4719 -0.2801 0.0520  -0.0841 172 GLU A CB    
1403 C CG    . GLU A 172 ? 0.7328 0.5743 0.5203 -0.2898 0.0393  -0.0908 172 GLU A CG    
1404 C CD    . GLU A 172 ? 0.8012 0.6559 0.5944 -0.2701 0.0301  -0.0898 172 GLU A CD    
1405 O OE1   . GLU A 172 ? 0.8545 0.6909 0.6430 -0.2487 0.0333  -0.0837 172 GLU A OE1   
1406 O OE2   . GLU A 172 ? 0.7966 0.6808 0.5999 -0.2764 0.0191  -0.0943 172 GLU A OE2   
1407 N N     . GLN A 173 ? 0.6650 0.4281 0.4290 -0.2337 0.0611  -0.0592 173 GLN A N     
1408 C CA    . GLN A 173 ? 0.6987 0.4269 0.4468 -0.2242 0.0682  -0.0496 173 GLN A CA    
1409 C C     . GLN A 173 ? 0.6742 0.4230 0.4331 -0.2137 0.0644  -0.0412 173 GLN A C     
1410 O O     . GLN A 173 ? 0.7090 0.4332 0.4547 -0.2046 0.0672  -0.0319 173 GLN A O     
1411 C CB    . GLN A 173 ? 0.7661 0.4653 0.5051 -0.2055 0.0680  -0.0451 173 GLN A CB    
1412 C CG    . GLN A 173 ? 0.8113 0.4825 0.5346 -0.2131 0.0744  -0.0533 173 GLN A CG    
1413 C CD    . GLN A 173 ? 0.8188 0.4630 0.5369 -0.1922 0.0767  -0.0475 173 GLN A CD    
1414 O OE1   . GLN A 173 ? 0.7963 0.4587 0.5277 -0.1795 0.0701  -0.0479 173 GLN A OE1   
1415 N NE2   . GLN A 173 ? 0.8340 0.4351 0.5346 -0.1882 0.0867  -0.0411 173 GLN A NE2   
1416 N N     . GLY A 174 ? 0.6252 0.4174 0.4064 -0.2146 0.0578  -0.0442 174 GLY A N     
1417 C CA    . GLY A 174 ? 0.5877 0.3982 0.3774 -0.2046 0.0552  -0.0378 174 GLY A CA    
1418 C C     . GLY A 174 ? 0.5726 0.3882 0.3691 -0.1822 0.0445  -0.0324 174 GLY A C     
1419 O O     . GLY A 174 ? 0.5749 0.3949 0.3716 -0.1718 0.0413  -0.0261 174 GLY A O     
1420 N N     . GLY A 175 ? 0.5552 0.3686 0.3557 -0.1757 0.0395  -0.0350 175 GLY A N     
1421 C CA    . GLY A 175 ? 0.5306 0.3505 0.3409 -0.1557 0.0300  -0.0299 175 GLY A CA    
1422 C C     . GLY A 175 ? 0.5077 0.3686 0.3407 -0.1526 0.0217  -0.0343 175 GLY A C     
1423 O O     . GLY A 175 ? 0.5194 0.4054 0.3621 -0.1646 0.0229  -0.0400 175 GLY A O     
1424 N N     . ASP A 176 ? 0.4913 0.3594 0.3345 -0.1364 0.0136  -0.0307 176 ASP A N     
1425 C CA    . ASP A 176 ? 0.4791 0.3832 0.3430 -0.1309 0.0055  -0.0330 176 ASP A CA    
1426 C C     . ASP A 176 ? 0.5164 0.4285 0.3866 -0.1296 0.0024  -0.0377 176 ASP A C     
1427 O O     . ASP A 176 ? 0.5668 0.5081 0.4529 -0.1262 -0.0042 -0.0396 176 ASP A O     
1428 C CB    . ASP A 176 ? 0.4456 0.3539 0.3163 -0.1146 -0.0019 -0.0254 176 ASP A CB    
1429 C CG    . ASP A 176 ? 0.5191 0.4173 0.3785 -0.1160 0.0007  -0.0210 176 ASP A CG    
1430 O OD1   . ASP A 176 ? 0.5105 0.4158 0.3669 -0.1283 0.0078  -0.0248 176 ASP A OD1   
1431 O OD2   . ASP A 176 ? 0.5279 0.4112 0.3812 -0.1054 -0.0046 -0.0133 176 ASP A OD2   
1432 N N     . GLU A 177 ? 0.5332 0.4170 0.3888 -0.1318 0.0080  -0.0392 177 GLU A N     
1433 C CA    . GLU A 177 ? 0.5836 0.4674 0.4384 -0.1310 0.0075  -0.0441 177 GLU A CA    
1434 C C     . GLU A 177 ? 0.5502 0.4492 0.4206 -0.1139 0.0004  -0.0394 177 GLU A C     
1435 O O     . GLU A 177 ? 0.5815 0.4968 0.4567 -0.1143 -0.0031 -0.0435 177 GLU A O     
1436 C CB    . GLU A 177 ? 0.6292 0.5328 0.4837 -0.1483 0.0056  -0.0535 177 GLU A CB    
1437 C CG    . GLU A 177 ? 0.7490 0.6251 0.5813 -0.1655 0.0138  -0.0607 177 GLU A CG    
1438 C CD    . GLU A 177 ? 0.8051 0.7041 0.6396 -0.1856 0.0096  -0.0689 177 GLU A CD    
1439 O OE1   . GLU A 177 ? 0.8642 0.7920 0.7104 -0.1846 0.0005  -0.0708 177 GLU A OE1   
1440 O OE2   . GLU A 177 ? 0.8047 0.6935 0.6302 -0.2029 0.0149  -0.0727 177 GLU A OE2   
1441 N N     . VAL A 178 ? 0.5094 0.4029 0.3869 -0.0997 -0.0022 -0.0305 178 VAL A N     
1442 C CA    . VAL A 178 ? 0.5006 0.4027 0.3929 -0.0839 -0.0075 -0.0250 178 VAL A CA    
1443 C C     . VAL A 178 ? 0.5681 0.4496 0.4526 -0.0809 0.0001  -0.0266 178 VAL A C     
1444 O O     . VAL A 178 ? 0.5336 0.3849 0.4056 -0.0811 0.0085  -0.0250 178 VAL A O     
1445 C CB    . VAL A 178 ? 0.4896 0.3842 0.3889 -0.0716 -0.0122 -0.0145 178 VAL A CB    
1446 C CG1   . VAL A 178 ? 0.4852 0.3863 0.4016 -0.0566 -0.0167 -0.0082 178 VAL A CG1   
1447 C CG2   . VAL A 178 ? 0.4361 0.3473 0.3384 -0.0744 -0.0184 -0.0138 178 VAL A CG2   
1448 N N     . PRO A 179 ? 0.5162 0.4121 0.4062 -0.0782 -0.0016 -0.0296 179 PRO A N     
1449 C CA    . PRO A 179 ? 0.5359 0.4118 0.4140 -0.0769 0.0075  -0.0329 179 PRO A CA    
1450 C C     . PRO A 179 ? 0.5097 0.3579 0.3895 -0.0638 0.0159  -0.0250 179 PRO A C     
1451 O O     . PRO A 179 ? 0.4575 0.3132 0.3568 -0.0506 0.0109  -0.0150 179 PRO A O     
1452 C CB    . PRO A 179 ? 0.5686 0.4687 0.4582 -0.0707 0.0018  -0.0327 179 PRO A CB    
1453 C CG    . PRO A 179 ? 0.5392 0.4715 0.4393 -0.0767 -0.0093 -0.0344 179 PRO A CG    
1454 C CD    . PRO A 179 ? 0.4777 0.4078 0.3832 -0.0762 -0.0114 -0.0300 179 PRO A CD    
1455 N N     . SER A 180 ? 0.5443 0.3602 0.4041 -0.0679 0.0286  -0.0291 180 SER A N     
1456 C CA    . SER A 180 ? 0.5571 0.3441 0.4188 -0.0554 0.0387  -0.0211 180 SER A CA    
1457 C C     . SER A 180 ? 0.5519 0.3461 0.4350 -0.0374 0.0404  -0.0127 180 SER A C     
1458 O O     . SER A 180 ? 0.5757 0.3608 0.4746 -0.0238 0.0427  -0.0014 180 SER A O     
1459 C CB    . SER A 180 ? 0.6414 0.3898 0.4751 -0.0633 0.0543  -0.0287 180 SER A CB    
1460 O OG    . SER A 180 ? 0.7048 0.4489 0.5252 -0.0663 0.0609  -0.0370 180 SER A OG    
1461 N N     . GLU A 181 ? 0.5216 0.3332 0.4066 -0.0375 0.0389  -0.0170 181 GLU A N     
1462 C CA    . GLU A 181 ? 0.5315 0.3488 0.4357 -0.0218 0.0429  -0.0095 181 GLU A CA    
1463 C C     . GLU A 181 ? 0.5035 0.3482 0.4399 -0.0112 0.0296  0.0019  181 GLU A C     
1464 O O     . GLU A 181 ? 0.5664 0.4167 0.5237 0.0018  0.0323  0.0102  181 GLU A O     
1465 C CB    . GLU A 181 ? 0.5771 0.3998 0.4688 -0.0256 0.0470  -0.0172 181 GLU A CB    
1466 C CG    . GLU A 181 ? 0.5905 0.4466 0.4850 -0.0338 0.0319  -0.0214 181 GLU A CG    
1467 C CD    . GLU A 181 ? 0.6688 0.5251 0.5398 -0.0529 0.0275  -0.0329 181 GLU A CD    
1468 O OE1   . GLU A 181 ? 0.6683 0.5004 0.5228 -0.0609 0.0340  -0.0371 181 GLU A OE1   
1469 O OE2   . GLU A 181 ? 0.6852 0.5665 0.5561 -0.0599 0.0175  -0.0369 181 GLU A OE2   
1470 N N     . ILE A 182 ? 0.4249 0.2852 0.3646 -0.0172 0.0162  0.0023  182 ILE A N     
1471 C CA    . ILE A 182 ? 0.3983 0.2792 0.3634 -0.0087 0.0032  0.0123  182 ILE A CA    
1472 C C     . ILE A 182 ? 0.4145 0.2853 0.3822 -0.0070 -0.0026 0.0200  182 ILE A C     
1473 O O     . ILE A 182 ? 0.4031 0.2865 0.3889 -0.0006 -0.0141 0.0289  182 ILE A O     
1474 C CB    . ILE A 182 ? 0.3985 0.3088 0.3675 -0.0142 -0.0090 0.0080  182 ILE A CB    
1475 C CG1   . ILE A 182 ? 0.3485 0.2613 0.3022 -0.0270 -0.0139 0.0015  182 ILE A CG1   
1476 C CG2   . ILE A 182 ? 0.3819 0.3028 0.3473 -0.0158 -0.0051 0.0019  182 ILE A CG2   
1477 C CD1   . ILE A 182 ? 0.3252 0.2662 0.2852 -0.0306 -0.0243 -0.0016 182 ILE A CD1   
1478 N N     . ILE A 183 ? 0.4491 0.2955 0.3966 -0.0135 0.0049  0.0168  183 ILE A N     
1479 C CA    . ILE A 183 ? 0.4736 0.3066 0.4189 -0.0125 0.0003  0.0246  183 ILE A CA    
1480 C C     . ILE A 183 ? 0.4687 0.3000 0.4386 0.0032  -0.0039 0.0399  183 ILE A C     
1481 O O     . ILE A 183 ? 0.5167 0.3554 0.4947 0.0055  -0.0175 0.0482  183 ILE A O     
1482 C CB    . ILE A 183 ? 0.5475 0.3491 0.4678 -0.0205 0.0122  0.0200  183 ILE A CB    
1483 C CG1   . ILE A 183 ? 0.5455 0.3528 0.4451 -0.0383 0.0111  0.0078  183 ILE A CG1   
1484 C CG2   . ILE A 183 ? 0.5944 0.3766 0.5151 -0.0145 0.0097  0.0318  183 ILE A CG2   
1485 C CD1   . ILE A 183 ? 0.5456 0.3713 0.4480 -0.0422 -0.0019 0.0101  183 ILE A CD1   
1486 N N     . ASP A 184 ? 0.4215 0.2434 0.4032 0.0136  0.0076  0.0439  184 ASP A N     
1487 C CA    . ASP A 184 ? 0.4769 0.2998 0.4877 0.0291  0.0050  0.0598  184 ASP A CA    
1488 C C     . ASP A 184 ? 0.4614 0.3149 0.5006 0.0348  -0.0072 0.0657  184 ASP A C     
1489 O O     . ASP A 184 ? 0.4597 0.3196 0.5280 0.0465  -0.0112 0.0794  184 ASP A O     
1490 C CB    . ASP A 184 ? 0.5674 0.3682 0.5826 0.0394  0.0249  0.0624  184 ASP A CB    
1491 C CG    . ASP A 184 ? 0.6910 0.4565 0.6798 0.0353  0.0370  0.0589  184 ASP A CG    
1492 O OD1   . ASP A 184 ? 0.7463 0.5046 0.7224 0.0288  0.0282  0.0607  184 ASP A OD1   
1493 O OD2   . ASP A 184 ? 0.7199 0.4622 0.6985 0.0381  0.0562  0.0541  184 ASP A OD2   
1494 N N     . LYS A 185 ? 0.4076 0.2803 0.4399 0.0263  -0.0131 0.0560  185 LYS A N     
1495 C CA    . LYS A 185 ? 0.4349 0.3340 0.4911 0.0304  -0.0236 0.0603  185 LYS A CA    
1496 C C     . LYS A 185 ? 0.4159 0.3279 0.4689 0.0239  -0.0421 0.0607  185 LYS A C     
1497 O O     . LYS A 185 ? 0.3841 0.3157 0.4521 0.0249  -0.0521 0.0626  185 LYS A O     
1498 C CB    . LYS A 185 ? 0.3962 0.3062 0.4480 0.0276  -0.0158 0.0506  185 LYS A CB    
1499 C CG    . LYS A 185 ? 0.4626 0.3576 0.5132 0.0336  0.0035  0.0493  185 LYS A CG    
1500 C CD    . LYS A 185 ? 0.4926 0.3986 0.5365 0.0305  0.0088  0.0409  185 LYS A CD    
1501 C CE    . LYS A 185 ? 0.5422 0.4297 0.5802 0.0362  0.0293  0.0394  185 LYS A CE    
1502 N NZ    . LYS A 185 ? 0.5284 0.4264 0.5607 0.0345  0.0335  0.0338  185 LYS A NZ    
1503 N N     . ILE A 186 ? 0.3978 0.2962 0.4292 0.0169  -0.0453 0.0585  186 ILE A N     
1504 C CA    . ILE A 186 ? 0.3990 0.3049 0.4209 0.0100  -0.0599 0.0574  186 ILE A CA    
1505 C C     . ILE A 186 ? 0.4020 0.3038 0.4346 0.0151  -0.0741 0.0713  186 ILE A C     
1506 O O     . ILE A 186 ? 0.4071 0.2917 0.4392 0.0195  -0.0721 0.0797  186 ILE A O     
1507 C CB    . ILE A 186 ? 0.4223 0.3168 0.4136 -0.0017 -0.0553 0.0475  186 ILE A CB    
1508 C CG1   . ILE A 186 ? 0.4199 0.3237 0.4029 -0.0084 -0.0453 0.0343  186 ILE A CG1   
1509 C CG2   . ILE A 186 ? 0.4217 0.3196 0.4012 -0.0075 -0.0680 0.0476  186 ILE A CG2   
1510 C CD1   . ILE A 186 ? 0.4144 0.3074 0.3719 -0.0206 -0.0382 0.0251  186 ILE A CD1   
1511 N N     . ILE A 187 ? 0.3618 0.2786 0.4036 0.0143  -0.0890 0.0741  187 ILE A N     
1512 C CA    . ILE A 187 ? 0.4434 0.3572 0.4916 0.0163  -0.1062 0.0865  187 ILE A CA    
1513 C C     . ILE A 187 ? 0.4599 0.3692 0.4801 0.0061  -0.1163 0.0806  187 ILE A C     
1514 O O     . ILE A 187 ? 0.4276 0.3493 0.4466 0.0022  -0.1212 0.0742  187 ILE A O     
1515 C CB    . ILE A 187 ? 0.4348 0.3673 0.5183 0.0231  -0.1160 0.0962  187 ILE A CB    
1516 C CG1   . ILE A 187 ? 0.4645 0.3995 0.5756 0.0342  -0.1026 0.1028  187 ILE A CG1   
1517 C CG2   . ILE A 187 ? 0.4245 0.3552 0.5130 0.0225  -0.1374 0.1088  187 ILE A CG2   
1518 C CD1   . ILE A 187 ? 0.4839 0.4379 0.6347 0.0415  -0.1100 0.1144  187 ILE A CD1   
1519 N N     . TYR A 188 ? 0.4907 0.3801 0.4869 0.0023  -0.1177 0.0830  188 TYR A N     
1520 C CA    . TYR A 188 ? 0.4944 0.3747 0.4581 -0.0078 -0.1215 0.0760  188 TYR A CA    
1521 C C     . TYR A 188 ? 0.5003 0.3731 0.4549 -0.0097 -0.1417 0.0852  188 TYR A C     
1522 O O     . TYR A 188 ? 0.4812 0.3448 0.4416 -0.0053 -0.1512 0.0987  188 TYR A O     
1523 C CB    . TYR A 188 ? 0.4995 0.3602 0.4379 -0.0129 -0.1086 0.0720  188 TYR A CB    
1524 C CG    . TYR A 188 ? 0.4952 0.3440 0.3997 -0.0229 -0.1101 0.0665  188 TYR A CG    
1525 C CD1   . TYR A 188 ? 0.4885 0.3486 0.3840 -0.0293 -0.1043 0.0539  188 TYR A CD1   
1526 C CD2   . TYR A 188 ? 0.5125 0.3380 0.3938 -0.0253 -0.1162 0.0748  188 TYR A CD2   
1527 C CE1   . TYR A 188 ? 0.5161 0.3650 0.3818 -0.0377 -0.1027 0.0491  188 TYR A CE1   
1528 C CE2   . TYR A 188 ? 0.5454 0.3578 0.3929 -0.0346 -0.1153 0.0699  188 TYR A CE2   
1529 C CZ    . TYR A 188 ? 0.5611 0.3855 0.4016 -0.0407 -0.1076 0.0567  188 TYR A CZ    
1530 O OH    . TYR A 188 ? 0.5560 0.3673 0.3643 -0.0491 -0.1039 0.0518  188 TYR A OH    
1531 N N     . MET A 189 ? 0.5300 0.4057 0.4693 -0.0163 -0.1482 0.0781  189 MET A N     
1532 C CA    . MET A 189 ? 0.5382 0.4043 0.4632 -0.0203 -0.1679 0.0848  189 MET A CA    
1533 C C     . MET A 189 ? 0.5134 0.3640 0.3976 -0.0299 -0.1657 0.0751  189 MET A C     
1534 O O     . MET A 189 ? 0.4749 0.3335 0.3549 -0.0329 -0.1606 0.0642  189 MET A O     
1535 C CB    . MET A 189 ? 0.5252 0.4089 0.4763 -0.0183 -0.1809 0.0876  189 MET A CB    
1536 C CG    . MET A 189 ? 0.5479 0.4470 0.5414 -0.0087 -0.1844 0.0997  189 MET A CG    
1537 S SD    . MET A 189 ? 0.5976 0.5213 0.6258 -0.0068 -0.1911 0.0995  189 MET A SD    
1538 C CE    . MET A 189 ? 0.4913 0.4258 0.5201 -0.0049 -0.1671 0.0838  189 MET A CE    
1539 N N     . PRO A 190 ? 0.5483 0.3754 0.4019 -0.0342 -0.1683 0.0798  190 PRO A N     
1540 C CA    . PRO A 190 ? 0.5914 0.4004 0.4032 -0.0434 -0.1650 0.0719  190 PRO A CA    
1541 C C     . PRO A 190 ? 0.6129 0.4111 0.4058 -0.0482 -0.1849 0.0749  190 PRO A C     
1542 O O     . PRO A 190 ? 0.6508 0.4498 0.4568 -0.0460 -0.2045 0.0872  190 PRO A O     
1543 C CB    . PRO A 190 ? 0.6165 0.4029 0.4044 -0.0456 -0.1600 0.0780  190 PRO A CB    
1544 C CG    . PRO A 190 ? 0.6267 0.4135 0.4375 -0.0380 -0.1728 0.0938  190 PRO A CG    
1545 C CD    . PRO A 190 ? 0.5814 0.3963 0.4376 -0.0300 -0.1719 0.0931  190 PRO A CD    
1546 N N     . PHE A 191 ? 0.6341 0.4221 0.3972 -0.0548 -0.1798 0.0640  191 PHE A N     
1547 C CA    . PHE A 191 ? 0.6453 0.4181 0.3837 -0.0610 -0.1971 0.0644  191 PHE A CA    
1548 C C     . PHE A 191 ? 0.7107 0.4542 0.3963 -0.0693 -0.1895 0.0578  191 PHE A C     
1549 O O     . PHE A 191 ? 0.7067 0.4503 0.3831 -0.0700 -0.1675 0.0485  191 PHE A O     
1550 C CB    . PHE A 191 ? 0.6433 0.4327 0.4018 -0.0597 -0.1984 0.0565  191 PHE A CB    
1551 C CG    . PHE A 191 ? 0.6035 0.4192 0.4109 -0.0526 -0.2070 0.0639  191 PHE A CG    
1552 C CD1   . PHE A 191 ? 0.6037 0.4204 0.4234 -0.0542 -0.2302 0.0745  191 PHE A CD1   
1553 C CD2   . PHE A 191 ? 0.5447 0.3842 0.3859 -0.0450 -0.1912 0.0603  191 PHE A CD2   
1554 C CE1   . PHE A 191 ? 0.5824 0.4251 0.4515 -0.0474 -0.2326 0.0807  191 PHE A CE1   
1555 C CE2   . PHE A 191 ? 0.5165 0.3779 0.4002 -0.0384 -0.1967 0.0671  191 PHE A CE2   
1556 C CZ    . PHE A 191 ? 0.5461 0.4090 0.4439 -0.0392 -0.2184 0.0782  191 PHE A CZ    
1557 N N     . ASP A 192 ? 0.7580 0.4766 0.4089 -0.0763 -0.2077 0.0630  192 ASP A N     
1558 C CA    . ASP A 192 ? 0.8301 0.5158 0.4249 -0.0846 -0.2010 0.0578  192 ASP A CA    
1559 C C     . ASP A 192 ? 0.8212 0.4961 0.3922 -0.0894 -0.1966 0.0445  192 ASP A C     
1560 O O     . ASP A 192 ? 0.8964 0.5455 0.4240 -0.0951 -0.1847 0.0375  192 ASP A O     
1561 C CB    . ASP A 192 ? 0.8669 0.5321 0.4420 -0.0887 -0.2154 0.0690  192 ASP A CB    
1562 C CG    . ASP A 192 ? 0.9150 0.5883 0.5128 -0.0898 -0.2366 0.0743  192 ASP A CG    
1563 O OD1   . ASP A 192 ? 0.9035 0.5830 0.5093 -0.0915 -0.2391 0.0666  192 ASP A OD1   
1564 O OD2   . ASP A 192 ? 0.9425 0.6158 0.5504 -0.0892 -0.2505 0.0866  192 ASP A OD2   
1565 N N     . ASN A 193 ? 0.7496 0.4437 0.3517 -0.0864 -0.2035 0.0412  193 ASN A N     
1566 C CA    . ASN A 193 ? 0.7746 0.4587 0.3597 -0.0895 -0.1981 0.0288  193 ASN A CA    
1567 C C     . ASN A 193 ? 0.7031 0.4175 0.3331 -0.0822 -0.1937 0.0238  193 ASN A C     
1568 O O     . ASN A 193 ? 0.6776 0.4172 0.3504 -0.0772 -0.2037 0.0320  193 ASN A O     
1569 C CB    . ASN A 193 ? 0.8829 0.5490 0.4545 -0.0962 -0.2142 0.0319  193 ASN A CB    
1570 C CG    . ASN A 193 ? 1.0622 0.6940 0.5836 -0.1037 -0.2119 0.0323  193 ASN A CG    
1571 O OD1   . ASN A 193 ? 1.1590 0.7717 0.6442 -0.1055 -0.1929 0.0232  193 ASN A OD1   
1572 N ND2   . ASN A 193 ? 1.0765 0.7011 0.5970 -0.1080 -0.2304 0.0432  193 ASN A ND2   
1573 N N     . GLU A 194 ? 0.7038 0.4164 0.3266 -0.0807 -0.1766 0.0110  194 GLU A N     
1574 C CA    . GLU A 194 ? 0.6775 0.4177 0.3421 -0.0731 -0.1704 0.0064  194 GLU A CA    
1575 C C     . GLU A 194 ? 0.6596 0.4028 0.3410 -0.0754 -0.1928 0.0109  194 GLU A C     
1576 O O     . GLU A 194 ? 0.6278 0.3992 0.3540 -0.0691 -0.1950 0.0145  194 GLU A O     
1577 C CB    . GLU A 194 ? 0.6927 0.4276 0.3443 -0.0703 -0.1480 -0.0070 194 GLU A CB    
1578 C CG    . GLU A 194 ? 0.6391 0.4029 0.3334 -0.0615 -0.1406 -0.0106 194 GLU A CG    
1579 C CD    . GLU A 194 ? 0.7037 0.4601 0.3858 -0.0578 -0.1208 -0.0222 194 GLU A CD    
1580 O OE1   . GLU A 194 ? 0.7450 0.4702 0.3830 -0.0626 -0.1136 -0.0284 194 GLU A OE1   
1581 O OE2   . GLU A 194 ? 0.6666 0.4476 0.3828 -0.0494 -0.1121 -0.0246 194 GLU A OE2   
1582 N N     . LYS A 195 ? 0.7118 0.4259 0.3580 -0.0849 -0.2080 0.0108  195 LYS A N     
1583 C CA    . LYS A 195 ? 0.7513 0.4709 0.4208 -0.0876 -0.2241 0.0156  195 LYS A CA    
1584 C C     . LYS A 195 ? 0.7333 0.4802 0.4490 -0.0843 -0.2373 0.0301  195 LYS A C     
1585 O O     . LYS A 195 ? 0.7143 0.4819 0.4689 -0.0817 -0.2435 0.0339  195 LYS A O     
1586 C CB    . LYS A 195 ? 0.7775 0.4641 0.4079 -0.0979 -0.2321 0.0142  195 LYS A CB    
1587 C CG    . LYS A 195 ? 0.8577 0.5161 0.4475 -0.1005 -0.2184 -0.0005 195 LYS A CG    
1588 N N     . GLU A 196 ? 0.7138 0.4595 0.4247 -0.0840 -0.2395 0.0383  196 GLU A N     
1589 C CA    . GLU A 196 ? 0.6857 0.4543 0.4379 -0.0798 -0.2494 0.0520  196 GLU A CA    
1590 C C     . GLU A 196 ? 0.6061 0.4049 0.3989 -0.0695 -0.2402 0.0530  196 GLU A C     
1591 O O     . GLU A 196 ? 0.5910 0.4128 0.4275 -0.0650 -0.2452 0.0611  196 GLU A O     
1592 C CB    . GLU A 196 ? 0.6723 0.4278 0.4049 -0.0817 -0.2536 0.0602  196 GLU A CB    
1593 C CG    . GLU A 196 ? 0.7657 0.4920 0.4598 -0.0921 -0.2646 0.0607  196 GLU A CG    
1594 C CD    . GLU A 196 ? 0.7815 0.4924 0.4521 -0.0940 -0.2680 0.0686  196 GLU A CD    
1595 O OE1   . GLU A 196 ? 0.7715 0.4986 0.4681 -0.0873 -0.2685 0.0781  196 GLU A OE1   
1596 O OE2   . GLU A 196 ? 0.8036 0.4844 0.4283 -0.1020 -0.2694 0.0653  196 GLU A OE2   
1597 N N     . LEU A 197 ? 0.5525 0.3505 0.3301 -0.0664 -0.2259 0.0447  197 LEU A N     
1598 C CA    . LEU A 197 ? 0.5129 0.3398 0.3302 -0.0567 -0.2105 0.0432  197 LEU A CA    
1599 C C     . LEU A 197 ? 0.5417 0.3848 0.3882 -0.0542 -0.2133 0.0409  197 LEU A C     
1600 O O     . LEU A 197 ? 0.5037 0.3697 0.3906 -0.0485 -0.2159 0.0480  197 LEU A O     
1601 C CB    . LEU A 197 ? 0.5115 0.3380 0.3142 -0.0541 -0.1857 0.0321  197 LEU A CB    
1602 C CG    . LEU A 197 ? 0.5042 0.3588 0.3418 -0.0457 -0.1687 0.0293  197 LEU A CG    
1603 C CD1   . LEU A 197 ? 0.5151 0.3674 0.3372 -0.0461 -0.1499 0.0237  197 LEU A CD1   
1604 C CD2   . LEU A 197 ? 0.4765 0.3456 0.3319 -0.0417 -0.1621 0.0219  197 LEU A CD2   
1605 N N     . LEU A 198 ? 0.5687 0.4517 0.3757 -0.0463 -0.2098 0.0511  198 LEU A N     
1606 C CA    . LEU A 198 ? 0.5483 0.4401 0.3740 -0.0469 -0.2096 0.0452  198 LEU A CA    
1607 C C     . LEU A 198 ? 0.5283 0.4350 0.3823 -0.0481 -0.2231 0.0487  198 LEU A C     
1608 O O     . LEU A 198 ? 0.4794 0.4004 0.3645 -0.0439 -0.2227 0.0491  198 LEU A O     
1609 C CB    . LEU A 198 ? 0.5690 0.4457 0.3649 -0.0561 -0.2040 0.0335  198 LEU A CB    
1610 C CG    . LEU A 198 ? 0.5733 0.4407 0.3481 -0.0538 -0.1882 0.0285  198 LEU A CG    
1611 C CD1   . LEU A 198 ? 0.6117 0.4635 0.3573 -0.0620 -0.1804 0.0159  198 LEU A CD1   
1612 C CD2   . LEU A 198 ? 0.5415 0.4240 0.3479 -0.0427 -0.1758 0.0295  198 LEU A CD2   
1613 N N     . MET A 199 ? 0.5800 0.4845 0.4235 -0.0541 -0.2347 0.0514  199 MET A N     
1614 C CA    . MET A 199 ? 0.6356 0.5570 0.5059 -0.0556 -0.2483 0.0555  199 MET A CA    
1615 C C     . MET A 199 ? 0.5803 0.5208 0.4894 -0.0428 -0.2484 0.0646  199 MET A C     
1616 O O     . MET A 199 ? 0.5480 0.5066 0.4907 -0.0409 -0.2510 0.0652  199 MET A O     
1617 C CB    . MET A 199 ? 0.7403 0.6569 0.5904 -0.0630 -0.2611 0.0584  199 MET A CB    
1618 C CG    . MET A 199 ? 0.8355 0.7384 0.6555 -0.0778 -0.2638 0.0484  199 MET A CG    
1619 S SD    . MET A 199 ? 1.6718 1.5753 1.4755 -0.0875 -0.2818 0.0523  199 MET A SD    
1620 C CE    . MET A 199 ? 0.6558 0.5411 0.4255 -0.0842 -0.2782 0.0585  199 MET A CE    
1621 N N     . GLU A 200 ? 0.5382 0.4735 0.4416 -0.0345 -0.2447 0.0713  200 GLU A N     
1622 C CA    . GLU A 200 ? 0.5416 0.4912 0.4781 -0.0218 -0.2428 0.0791  200 GLU A CA    
1623 C C     . GLU A 200 ? 0.4744 0.4323 0.4337 -0.0162 -0.2303 0.0757  200 GLU A C     
1624 O O     . GLU A 200 ? 0.4432 0.4192 0.4384 -0.0093 -0.2297 0.0789  200 GLU A O     
1625 C CB    . GLU A 200 ? 0.6319 0.5689 0.5525 -0.0152 -0.2404 0.0861  200 GLU A CB    
1626 C CG    . GLU A 200 ? 0.7466 0.6948 0.6985 -0.0016 -0.2376 0.0936  200 GLU A CG    
1627 C CD    . GLU A 200 ? 0.8402 0.8111 0.8272 0.0024  -0.2483 0.0982  200 GLU A CD    
1628 O OE1   . GLU A 200 ? 0.8712 0.8447 0.8511 -0.0028 -0.2622 0.1010  200 GLU A OE1   
1629 O OE2   . GLU A 200 ? 0.8598 0.8468 0.8813 0.0103  -0.2424 0.0988  200 GLU A OE2   
1630 N N     . TYR A 201 ? 0.4164 0.3619 0.3547 -0.0190 -0.2200 0.0693  201 TYR A N     
1631 C CA    . TYR A 201 ? 0.4374 0.3903 0.3943 -0.0138 -0.2088 0.0666  201 TYR A CA    
1632 C C     . TYR A 201 ? 0.4404 0.4079 0.4238 -0.0173 -0.2128 0.0637  201 TYR A C     
1633 O O     . TYR A 201 ? 0.4379 0.4200 0.4527 -0.0109 -0.2072 0.0656  201 TYR A O     
1634 C CB    . TYR A 201 ? 0.4306 0.3689 0.3585 -0.0165 -0.1984 0.0603  201 TYR A CB    
1635 C CG    . TYR A 201 ? 0.4171 0.3642 0.3639 -0.0101 -0.1835 0.0577  201 TYR A CG    
1636 C CD1   . TYR A 201 ? 0.3891 0.3426 0.3516 -0.0010 -0.1755 0.0624  201 TYR A CD1   
1637 C CD2   . TYR A 201 ? 0.4263 0.3746 0.3751 -0.0131 -0.1742 0.0497  201 TYR A CD2   
1638 C CE1   . TYR A 201 ? 0.3730 0.3353 0.3511 0.0037  -0.1596 0.0593  201 TYR A CE1   
1639 C CE2   . TYR A 201 ? 0.3913 0.3483 0.3569 -0.0070 -0.1586 0.0478  201 TYR A CE2   
1640 C CZ    . TYR A 201 ? 0.4030 0.3680 0.3827 0.0009  -0.1518 0.0526  201 TYR A CZ    
1641 O OH    . TYR A 201 ? 0.3810 0.3549 0.3746 0.0059  -0.1372 0.0509  201 TYR A OH    
1642 N N     . LEU A 202 ? 0.4274 0.3898 0.3973 -0.0283 -0.2220 0.0588  202 LEU A N     
1643 C CA    . LEU A 202 ? 0.4398 0.4141 0.4328 -0.0345 -0.2275 0.0558  202 LEU A CA    
1644 C C     . LEU A 202 ? 0.4131 0.4103 0.4438 -0.0306 -0.2338 0.0624  202 LEU A C     
1645 O O     . LEU A 202 ? 0.4113 0.4242 0.4740 -0.0298 -0.2313 0.0624  202 LEU A O     
1646 C CB    . LEU A 202 ? 0.4769 0.4381 0.4435 -0.0488 -0.2360 0.0482  202 LEU A CB    
1647 C CG    . LEU A 202 ? 0.5368 0.4774 0.4741 -0.0533 -0.2254 0.0383  202 LEU A CG    
1648 C CD1   . LEU A 202 ? 0.5501 0.4753 0.4590 -0.0682 -0.2343 0.0301  202 LEU A CD1   
1649 C CD2   . LEU A 202 ? 0.5132 0.4597 0.4744 -0.0484 -0.2084 0.0348  202 LEU A CD2   
1650 N N     . ASN A 203 ? 0.4001 0.3995 0.4274 -0.0281 -0.2419 0.0682  203 ASN A N     
1651 C CA    . ASN A 203 ? 0.4486 0.4706 0.5113 -0.0224 -0.2479 0.0749  203 ASN A CA    
1652 C C     . ASN A 203 ? 0.4215 0.4541 0.5128 -0.0092 -0.2355 0.0788  203 ASN A C     
1653 O O     . ASN A 203 ? 0.3751 0.4285 0.5028 -0.0061 -0.2343 0.0805  203 ASN A O     
1654 C CB    . ASN A 203 ? 0.5054 0.5258 0.5559 -0.0210 -0.2595 0.0812  203 ASN A CB    
1655 C CG    . ASN A 203 ? 0.6489 0.6637 0.6765 -0.0348 -0.2729 0.0777  203 ASN A CG    
1656 O OD1   . ASN A 203 ? 0.6157 0.6319 0.6438 -0.0458 -0.2748 0.0706  203 ASN A OD1   
1657 N ND2   . ASN A 203 ? 0.7277 0.7352 0.7340 -0.0350 -0.2822 0.0826  203 ASN A ND2   
1658 N N     . PHE A 204 ? 0.4184 0.4362 0.4917 -0.0024 -0.2257 0.0796  204 PHE A N     
1659 C CA    . PHE A 204 ? 0.3996 0.4230 0.4929 0.0087  -0.2123 0.0818  204 PHE A CA    
1660 C C     . PHE A 204 ? 0.3987 0.4320 0.5123 0.0069  -0.2035 0.0773  204 PHE A C     
1661 O O     . PHE A 204 ? 0.3853 0.4348 0.5315 0.0130  -0.1967 0.0792  204 PHE A O     
1662 C CB    . PHE A 204 ? 0.3818 0.3850 0.4454 0.0125  -0.2042 0.0819  204 PHE A CB    
1663 C CG    . PHE A 204 ? 0.3686 0.3739 0.4456 0.0211  -0.1896 0.0821  204 PHE A CG    
1664 C CD1   . PHE A 204 ? 0.3970 0.4074 0.4933 0.0317  -0.1855 0.0875  204 PHE A CD1   
1665 C CD2   . PHE A 204 ? 0.4012 0.4025 0.4697 0.0189  -0.1799 0.0771  204 PHE A CD2   
1666 C CE1   . PHE A 204 ? 0.3880 0.3985 0.4943 0.0386  -0.1719 0.0871  204 PHE A CE1   
1667 C CE2   . PHE A 204 ? 0.4172 0.4208 0.4961 0.0258  -0.1665 0.0773  204 PHE A CE2   
1668 C CZ    . PHE A 204 ? 0.4054 0.4131 0.5029 0.0352  -0.1628 0.0822  204 PHE A CZ    
1669 N N     . TRP A 205 ? 0.3546 0.3772 0.4479 -0.0015 -0.2033 0.0714  205 TRP A N     
1670 C CA    . TRP A 205 ? 0.3649 0.3929 0.4721 -0.0040 -0.1948 0.0673  205 TRP A CA    
1671 C C     . TRP A 205 ? 0.3633 0.4118 0.5064 -0.0085 -0.2004 0.0681  205 TRP A C     
1672 O O     . TRP A 205 ? 0.3421 0.4020 0.5100 -0.0055 -0.1879 0.0678  205 TRP A O     
1673 C CB    . TRP A 205 ? 0.3461 0.3550 0.4200 -0.0124 -0.1905 0.0590  205 TRP A CB    
1674 C CG    . TRP A 205 ? 0.3433 0.3509 0.4222 -0.0134 -0.1746 0.0536  205 TRP A CG    
1675 C CD1   . TRP A 205 ? 0.3556 0.3687 0.4514 -0.0204 -0.1743 0.0509  205 TRP A CD1   
1676 C CD2   . TRP A 205 ? 0.3474 0.3469 0.4128 -0.0079 -0.1576 0.0507  205 TRP A CD2   
1677 N NE1   . TRP A 205 ? 0.2995 0.3061 0.3920 -0.0185 -0.1578 0.0474  205 TRP A NE1   
1678 C CE2   . TRP A 205 ? 0.3488 0.3486 0.4237 -0.0104 -0.1480 0.0475  205 TRP A CE2   
1679 C CE3   . TRP A 205 ? 0.3364 0.3291 0.3831 -0.0018 -0.1497 0.0509  205 TRP A CE3   
1680 C CZ2   . TRP A 205 ? 0.3419 0.3363 0.4083 -0.0055 -0.1323 0.0454  205 TRP A CZ2   
1681 C CZ3   . TRP A 205 ? 0.3840 0.3742 0.4240 0.0019  -0.1340 0.0478  205 TRP A CZ3   
1682 C CH2   . TRP A 205 ? 0.3695 0.3610 0.4196 0.0008  -0.1261 0.0456  205 TRP A CH2   
1683 N N     A GLN A 206 ? 0.3709 0.4229 0.5127 -0.0168 -0.2149 0.0679  206 GLN A N     
1684 N N     B GLN A 206 ? 0.3707 0.4230 0.5131 -0.0168 -0.2148 0.0679  206 GLN A N     
1685 C CA    A GLN A 206 ? 0.4052 0.4778 0.5793 -0.0233 -0.2206 0.0680  206 GLN A CA    
1686 C CA    B GLN A 206 ? 0.4022 0.4751 0.5775 -0.0232 -0.2198 0.0679  206 GLN A CA    
1687 C C     A GLN A 206 ? 0.4041 0.4987 0.6155 -0.0126 -0.2139 0.0735  206 GLN A C     
1688 C C     B GLN A 206 ? 0.4040 0.4992 0.6162 -0.0127 -0.2143 0.0736  206 GLN A C     
1689 O O     A GLN A 206 ? 0.4036 0.5157 0.6471 -0.0146 -0.2086 0.0732  206 GLN A O     
1690 O O     B GLN A 206 ? 0.4067 0.5205 0.6517 -0.0151 -0.2101 0.0734  206 GLN A O     
1691 C CB    A GLN A 206 ? 0.4394 0.5119 0.6014 -0.0333 -0.2371 0.0670  206 GLN A CB    
1692 C CB    B GLN A 206 ? 0.4469 0.5190 0.6101 -0.0351 -0.2361 0.0658  206 GLN A CB    
1693 C CG    A GLN A 206 ? 0.4480 0.5432 0.6418 -0.0420 -0.2439 0.0665  206 GLN A CG    
1694 C CG    B GLN A 206 ? 0.4951 0.5467 0.6275 -0.0487 -0.2402 0.0577  206 GLN A CG    
1695 C CD    A GLN A 206 ? 0.4885 0.5853 0.6691 -0.0517 -0.2607 0.0657  206 GLN A CD    
1696 C CD    B GLN A 206 ? 0.5338 0.5855 0.6556 -0.0624 -0.2548 0.0544  206 GLN A CD    
1697 O OE1   A GLN A 206 ? 0.5225 0.6131 0.6839 -0.0469 -0.2676 0.0696  206 GLN A OE1   
1698 O OE1   B GLN A 206 ? 0.5346 0.5710 0.6360 -0.0758 -0.2578 0.0463  206 GLN A OE1   
1699 N NE2   A GLN A 206 ? 0.4300 0.5347 0.6200 -0.0665 -0.2670 0.0607  206 GLN A NE2   
1700 N NE2   B GLN A 206 ? 0.5509 0.6191 0.6856 -0.0592 -0.2638 0.0602  206 GLN A NE2   
1701 N N     . GLN A 207 ? 0.3845 0.4767 0.5905 -0.0017 -0.2135 0.0783  207 GLN A N     
1702 C CA    . GLN A 207 ? 0.4398 0.5494 0.6775 0.0098  -0.2075 0.0832  207 GLN A CA    
1703 C C     . GLN A 207 ? 0.3977 0.5076 0.6476 0.0174  -0.1892 0.0824  207 GLN A C     
1704 O O     . GLN A 207 ? 0.4188 0.5465 0.7015 0.0228  -0.1809 0.0837  207 GLN A O     
1705 C CB    . GLN A 207 ? 0.5305 0.6331 0.7551 0.0186  -0.2138 0.0887  207 GLN A CB    
1706 C CG    . GLN A 207 ? 0.6168 0.7333 0.8705 0.0322  -0.2080 0.0938  207 GLN A CG    
1707 C CD    . GLN A 207 ? 0.7471 0.8555 0.9874 0.0402  -0.2168 0.1003  207 GLN A CD    
1708 O OE1   . GLN A 207 ? 0.8081 0.9043 1.0200 0.0341  -0.2288 0.1013  207 GLN A OE1   
1709 N NE2   . GLN A 207 ? 0.7720 0.8857 1.0318 0.0539  -0.2104 0.1047  207 GLN A NE2   
1710 N N     . LYS A 208 ? 0.3680 0.4588 0.5907 0.0177  -0.1825 0.0799  208 LYS A N     
1711 C CA    . LYS A 208 ? 0.3296 0.4197 0.5591 0.0243  -0.1657 0.0793  208 LYS A CA    
1712 C C     . LYS A 208 ? 0.3360 0.4160 0.5479 0.0171  -0.1577 0.0739  208 LYS A C     
1713 O O     . LYS A 208 ? 0.3196 0.3836 0.5040 0.0192  -0.1485 0.0713  208 LYS A O     
1714 C CB    . LYS A 208 ? 0.2939 0.3693 0.5043 0.0338  -0.1604 0.0814  208 LYS A CB    
1715 C CG    . LYS A 208 ? 0.3311 0.4113 0.5540 0.0424  -0.1644 0.0862  208 LYS A CG    
1716 C CD    . LYS A 208 ? 0.3504 0.4112 0.5501 0.0498  -0.1609 0.0886  208 LYS A CD    
1717 C CE    . LYS A 208 ? 0.3976 0.4587 0.6035 0.0577  -0.1688 0.0945  208 LYS A CE    
1718 N NZ    . LYS A 208 ? 0.3290 0.4095 0.5742 0.0666  -0.1626 0.0964  208 LYS A NZ    
1719 N N     . THR A 209 ? 0.3102 0.3982 0.5351 0.0080  -0.1585 0.0712  209 THR A N     
1720 C CA    . THR A 209 ? 0.2894 0.3635 0.4936 0.0010  -0.1494 0.0655  209 THR A CA    
1721 C C     . THR A 209 ? 0.2926 0.3662 0.4984 0.0063  -0.1294 0.0648  209 THR A C     
1722 O O     . THR A 209 ? 0.2761 0.3645 0.5093 0.0075  -0.1212 0.0664  209 THR A O     
1723 C CB    . THR A 209 ? 0.2744 0.3541 0.4916 -0.0110 -0.1549 0.0630  209 THR A CB    
1724 O OG1   . THR A 209 ? 0.3451 0.4303 0.5651 -0.0168 -0.1750 0.0641  209 THR A OG1   
1725 C CG2   . THR A 209 ? 0.2729 0.3318 0.4628 -0.0173 -0.1474 0.0572  209 THR A CG2   
1726 N N     . PRO A 210 ? 0.3238 0.3815 0.5000 0.0088  -0.1216 0.0623  210 PRO A N     
1727 C CA    . PRO A 210 ? 0.3211 0.3780 0.4937 0.0132  -0.1043 0.0618  210 PRO A CA    
1728 C C     . PRO A 210 ? 0.3062 0.3670 0.4917 0.0082  -0.0956 0.0616  210 PRO A C     
1729 O O     . PRO A 210 ? 0.3291 0.3843 0.5129 0.0006  -0.1010 0.0598  210 PRO A O     
1730 C CB    . PRO A 210 ? 0.2735 0.3140 0.4119 0.0140  -0.1021 0.0587  210 PRO A CB    
1731 C CG    . PRO A 210 ? 0.2782 0.3116 0.4029 0.0129  -0.1160 0.0583  210 PRO A CG    
1732 C CD    . PRO A 210 ? 0.3358 0.3768 0.4798 0.0072  -0.1292 0.0597  210 PRO A CD    
1733 N N     . VAL A 211 ? 0.2667 0.3354 0.4631 0.0117  -0.0819 0.0633  211 VAL A N     
1734 C CA    . VAL A 211 ? 0.2445 0.3131 0.4460 0.0073  -0.0713 0.0640  211 VAL A CA    
1735 C C     . VAL A 211 ? 0.2738 0.3305 0.4483 0.0108  -0.0623 0.0638  211 VAL A C     
1736 O O     . VAL A 211 ? 0.2837 0.3287 0.4452 0.0080  -0.0609 0.0635  211 VAL A O     
1737 C CB    . VAL A 211 ? 0.2284 0.3135 0.4572 0.0079  -0.0608 0.0663  211 VAL A CB    
1738 C CG1   . VAL A 211 ? 0.1994 0.2809 0.4253 0.0037  -0.0474 0.0679  211 VAL A CG1   
1739 C CG2   . VAL A 211 ? 0.1983 0.2992 0.4590 0.0040  -0.0697 0.0669  211 VAL A CG2   
1740 N N     . ILE A 212 ? 0.2241 0.2838 0.3905 0.0170  -0.0562 0.0639  212 ILE A N     
1741 C CA    . ILE A 212 ? 0.2483 0.3006 0.3894 0.0204  -0.0505 0.0635  212 ILE A CA    
1742 C C     . ILE A 212 ? 0.2970 0.3427 0.4204 0.0227  -0.0590 0.0606  212 ILE A C     
1743 O O     . ILE A 212 ? 0.2977 0.3462 0.4245 0.0247  -0.0630 0.0600  212 ILE A O     
1744 C CB    . ILE A 212 ? 0.2521 0.3118 0.3920 0.0235  -0.0382 0.0647  212 ILE A CB    
1745 C CG1   . ILE A 212 ? 0.2905 0.3575 0.4486 0.0203  -0.0288 0.0674  212 ILE A CG1   
1746 C CG2   . ILE A 212 ? 0.2421 0.2978 0.3574 0.0259  -0.0338 0.0649  212 ILE A CG2   
1747 C CD1   . ILE A 212 ? 0.2663 0.3259 0.4188 0.0169  -0.0257 0.0706  212 ILE A CD1   
1748 N N     . LEU A 213 ? 0.3104 0.3462 0.4146 0.0227  -0.0610 0.0590  213 LEU A N     
1749 C CA    . LEU A 213 ? 0.2920 0.3213 0.3774 0.0237  -0.0673 0.0558  213 LEU A CA    
1750 C C     . LEU A 213 ? 0.3088 0.3392 0.3764 0.0275  -0.0596 0.0551  213 LEU A C     
1751 O O     . LEU A 213 ? 0.2842 0.3129 0.3466 0.0294  -0.0547 0.0562  213 LEU A O     
1752 C CB    . LEU A 213 ? 0.2980 0.3154 0.3756 0.0199  -0.0760 0.0530  213 LEU A CB    
1753 C CG    . LEU A 213 ? 0.3284 0.3376 0.3851 0.0194  -0.0825 0.0492  213 LEU A CG    
1754 C CD1   . LEU A 213 ? 0.3150 0.3279 0.3749 0.0194  -0.0888 0.0506  213 LEU A CD1   
1755 C CD2   . LEU A 213 ? 0.3448 0.3410 0.3930 0.0141  -0.0903 0.0456  213 LEU A CD2   
1756 N N     . THR A 214 ? 0.2902 0.3239 0.3491 0.0285  -0.0586 0.0537  214 THR A N     
1757 C CA    . THR A 214 ? 0.3040 0.3428 0.3479 0.0305  -0.0518 0.0527  214 THR A CA    
1758 C C     . THR A 214 ? 0.2835 0.3192 0.3110 0.0290  -0.0546 0.0491  214 THR A C     
1759 O O     . THR A 214 ? 0.2885 0.3154 0.3130 0.0269  -0.0624 0.0479  214 THR A O     
1760 C CB    . THR A 214 ? 0.3517 0.4011 0.4010 0.0311  -0.0427 0.0548  214 THR A CB    
1761 O OG1   . THR A 214 ? 0.3189 0.3759 0.3542 0.0322  -0.0376 0.0544  214 THR A OG1   
1762 C CG2   . THR A 214 ? 0.2760 0.3254 0.3301 0.0297  -0.0419 0.0535  214 THR A CG2   
1763 N N     . GLY A 215 ? 0.3018 0.3454 0.3181 0.0292  -0.0485 0.0478  215 GLY A N     
1764 C CA    . GLY A 215 ? 0.2915 0.3336 0.2912 0.0264  -0.0491 0.0441  215 GLY A CA    
1765 C C     . GLY A 215 ? 0.3143 0.3677 0.3061 0.0283  -0.0439 0.0429  215 GLY A C     
1766 O O     . GLY A 215 ? 0.3320 0.3934 0.3308 0.0323  -0.0405 0.0460  215 GLY A O     
1767 N N     . TRP A 216 ? 0.3412 0.3959 0.3190 0.0256  -0.0433 0.0391  216 TRP A N     
1768 C CA    . TRP A 216 ? 0.3364 0.4063 0.3099 0.0277  -0.0382 0.0378  216 TRP A CA    
1769 C C     . TRP A 216 ? 0.3039 0.3686 0.2731 0.0315  -0.0391 0.0354  216 TRP A C     
1770 O O     . TRP A 216 ? 0.3468 0.4014 0.3043 0.0275  -0.0412 0.0314  216 TRP A O     
1771 C CB    . TRP A 216 ? 0.3450 0.4244 0.3077 0.0209  -0.0344 0.0344  216 TRP A CB    
1772 C CG    . TRP A 216 ? 0.3519 0.4543 0.3155 0.0224  -0.0295 0.0343  216 TRP A CG    
1773 C CD1   . TRP A 216 ? 0.3246 0.4384 0.2839 0.0230  -0.0269 0.0311  216 TRP A CD1   
1774 C CD2   . TRP A 216 ? 0.3062 0.4248 0.2762 0.0236  -0.0271 0.0378  216 TRP A CD2   
1775 N NE1   . TRP A 216 ? 0.3294 0.4678 0.2946 0.0252  -0.0240 0.0330  216 TRP A NE1   
1776 C CE2   . TRP A 216 ? 0.3473 0.4883 0.3173 0.0252  -0.0247 0.0373  216 TRP A CE2   
1777 C CE3   . TRP A 216 ? 0.3256 0.4427 0.3009 0.0231  -0.0264 0.0412  216 TRP A CE3   
1778 C CZ2   . TRP A 216 ? 0.3786 0.5407 0.3528 0.0262  -0.0235 0.0410  216 TRP A CZ2   
1779 C CZ3   . TRP A 216 ? 0.3782 0.5137 0.3547 0.0233  -0.0239 0.0441  216 TRP A CZ3   
1780 C CH2   . TRP A 216 ? 0.3746 0.5324 0.3501 0.0248  -0.0234 0.0444  216 TRP A CH2   
1781 N N     . ASN A 217 ? 0.2952 0.3648 0.2721 0.0391  -0.0369 0.0380  217 ASN A N     
1782 C CA    . ASN A 217 ? 0.3395 0.4003 0.3134 0.0441  -0.0363 0.0354  217 ASN A CA    
1783 C C     . ASN A 217 ? 0.3472 0.3852 0.3178 0.0411  -0.0421 0.0333  217 ASN A C     
1784 O O     . ASN A 217 ? 0.3726 0.3995 0.3339 0.0415  -0.0418 0.0286  217 ASN A O     
1785 C CB    . ASN A 217 ? 0.3965 0.4660 0.3603 0.0433  -0.0318 0.0298  217 ASN A CB    
1786 C CG    . ASN A 217 ? 0.4942 0.5878 0.4655 0.0498  -0.0262 0.0319  217 ASN A CG    
1787 O OD1   . ASN A 217 ? 0.6004 0.7122 0.5692 0.0454  -0.0236 0.0301  217 ASN A OD1   
1788 N ND2   . ASN A 217 ? 0.4868 0.5807 0.4674 0.0602  -0.0248 0.0360  217 ASN A ND2   
1789 N N     . VAL A 218 ? 0.3405 0.3722 0.3187 0.0378  -0.0472 0.0365  218 VAL A N     
1790 C CA    . VAL A 218 ? 0.3856 0.3996 0.3629 0.0338  -0.0545 0.0350  218 VAL A CA    
1791 C C     . VAL A 218 ? 0.4191 0.4207 0.3977 0.0371  -0.0539 0.0339  218 VAL A C     
1792 O O     . VAL A 218 ? 0.4286 0.4148 0.3986 0.0329  -0.0586 0.0296  218 VAL A O     
1793 C CB    . VAL A 218 ? 0.3583 0.3720 0.3484 0.0305  -0.0598 0.0390  218 VAL A CB    
1794 C CG1   . VAL A 218 ? 0.3333 0.3508 0.3182 0.0268  -0.0614 0.0389  218 VAL A CG1   
1795 C CG2   . VAL A 218 ? 0.3437 0.3664 0.3492 0.0344  -0.0548 0.0442  218 VAL A CG2   
1796 N N     . GLU A 219 ? 0.4062 0.4128 0.3935 0.0440  -0.0481 0.0378  219 GLU A N     
1797 C CA    . GLU A 219 ? 0.4647 0.4558 0.4529 0.0473  -0.0463 0.0373  219 GLU A CA    
1798 C C     . GLU A 219 ? 0.4498 0.4332 0.4252 0.0516  -0.0416 0.0312  219 GLU A C     
1799 O O     . GLU A 219 ? 0.4323 0.3957 0.4013 0.0504  -0.0418 0.0269  219 GLU A O     
1800 C CB    . GLU A 219 ? 0.4985 0.4944 0.4985 0.0538  -0.0415 0.0449  219 GLU A CB    
1801 C CG    . GLU A 219 ? 0.6063 0.5824 0.6062 0.0574  -0.0386 0.0453  219 GLU A CG    
1802 C CD    . GLU A 219 ? 0.7029 0.6807 0.7124 0.0627  -0.0343 0.0543  219 GLU A CD    
1803 O OE1   . GLU A 219 ? 0.7630 0.7356 0.7809 0.0565  -0.0362 0.0575  219 GLU A OE1   
1804 O OE2   . GLU A 219 ? 0.7011 0.6862 0.7100 0.0729  -0.0292 0.0587  219 GLU A OE2   
1805 N N     . SER A 220 ? 0.3755 0.3749 0.3472 0.0559  -0.0368 0.0302  220 SER A N     
1806 C CA    . SER A 220 ? 0.4397 0.4357 0.4021 0.0611  -0.0303 0.0242  220 SER A CA    
1807 C C     . SER A 220 ? 0.4589 0.4494 0.4042 0.0528  -0.0318 0.0161  220 SER A C     
1808 O O     . SER A 220 ? 0.4930 0.4743 0.4273 0.0547  -0.0263 0.0092  220 SER A O     
1809 C CB    . SER A 220 ? 0.4830 0.5024 0.4534 0.0711  -0.0234 0.0277  220 SER A CB    
1810 O OG    . SER A 220 ? 0.5578 0.5981 0.5275 0.0657  -0.0246 0.0279  220 SER A OG    
1811 N N     . PHE A 221 ? 0.4135 0.4082 0.3553 0.0440  -0.0385 0.0171  221 PHE A N     
1812 C CA    . PHE A 221 ? 0.4250 0.4122 0.3478 0.0357  -0.0406 0.0110  221 PHE A CA    
1813 C C     . PHE A 221 ? 0.4240 0.3966 0.3402 0.0262  -0.0521 0.0116  221 PHE A C     
1814 O O     . PHE A 221 ? 0.4608 0.4153 0.3639 0.0213  -0.0559 0.0068  221 PHE A O     
1815 C CB    . PHE A 221 ? 0.4127 0.4184 0.3315 0.0337  -0.0363 0.0107  221 PHE A CB    
1816 C CG    . PHE A 221 ? 0.4349 0.4309 0.3317 0.0244  -0.0375 0.0053  221 PHE A CG    
1817 C CD1   . PHE A 221 ? 0.4324 0.4204 0.3144 0.0241  -0.0309 -0.0024 221 PHE A CD1   
1818 C CD2   . PHE A 221 ? 0.4207 0.4132 0.3103 0.0162  -0.0447 0.0081  221 PHE A CD2   
1819 C CE1   . PHE A 221 ? 0.4629 0.4405 0.3214 0.0145  -0.0315 -0.0070 221 PHE A CE1   
1820 C CE2   . PHE A 221 ? 0.4473 0.4284 0.3140 0.0075  -0.0463 0.0045  221 PHE A CE2   
1821 C CZ    . PHE A 221 ? 0.4476 0.4214 0.2977 0.0059  -0.0398 -0.0030 221 PHE A CZ    
1822 N N     . ALA A 222 ? 0.3908 0.3719 0.3160 0.0237  -0.0576 0.0174  222 ALA A N     
1823 C CA    . ALA A 222 ? 0.3933 0.3644 0.3145 0.0162  -0.0689 0.0191  222 ALA A CA    
1824 C C     . ALA A 222 ? 0.3782 0.3356 0.3035 0.0135  -0.0767 0.0185  222 ALA A C     
1825 O O     . ALA A 222 ? 0.3971 0.3412 0.3079 0.0064  -0.0847 0.0156  222 ALA A O     
1826 C CB    . ALA A 222 ? 0.3681 0.3506 0.3028 0.0165  -0.0713 0.0254  222 ALA A CB    
1827 N N     . ILE A 223 ? 0.3247 0.2853 0.2682 0.0179  -0.0745 0.0214  223 ILE A N     
1828 C CA    . ILE A 223 ? 0.3477 0.2961 0.2967 0.0136  -0.0811 0.0208  223 ILE A CA    
1829 C C     . ILE A 223 ? 0.3843 0.3135 0.3142 0.0101  -0.0801 0.0127  223 ILE A C     
1830 O O     . ILE A 223 ? 0.4129 0.3303 0.3327 0.0013  -0.0898 0.0096  223 ILE A O     
1831 C CB    . ILE A 223 ? 0.3482 0.3024 0.3195 0.0178  -0.0774 0.0258  223 ILE A CB    
1832 C CG1   . ILE A 223 ? 0.3674 0.3383 0.3560 0.0190  -0.0790 0.0325  223 ILE A CG1   
1833 C CG2   . ILE A 223 ? 0.3441 0.2843 0.3195 0.0114  -0.0830 0.0239  223 ILE A CG2   
1834 C CD1   . ILE A 223 ? 0.3959 0.3744 0.4024 0.0235  -0.0724 0.0377  223 ILE A CD1   
1835 N N     . PRO A 224 ? 0.3973 0.3233 0.3219 0.0172  -0.0684 0.0091  224 PRO A N     
1836 C CA    . PRO A 224 ? 0.4450 0.3500 0.3500 0.0139  -0.0659 0.0001  224 PRO A CA    
1837 C C     . PRO A 224 ? 0.4341 0.3328 0.3142 0.0062  -0.0696 -0.0057 224 PRO A C     
1838 O O     . PRO A 224 ? 0.4636 0.3431 0.3256 -0.0017 -0.0732 -0.0126 224 PRO A O     
1839 C CB    . PRO A 224 ? 0.4380 0.3442 0.3454 0.0257  -0.0516 -0.0015 224 PRO A CB    
1840 C CG    . PRO A 224 ? 0.4655 0.3969 0.3876 0.0331  -0.0482 0.0058  224 PRO A CG    
1841 C CD    . PRO A 224 ? 0.3940 0.3337 0.3299 0.0283  -0.0577 0.0128  224 PRO A CD    
1842 N N     . TYR A 225 ? 0.3815 0.2942 0.2583 0.0073  -0.0685 -0.0031 225 TYR A N     
1843 C CA    . TYR A 225 ? 0.4443 0.3491 0.2952 -0.0010 -0.0717 -0.0075 225 TYR A CA    
1844 C C     . TYR A 225 ? 0.4618 0.3572 0.3061 -0.0113 -0.0882 -0.0052 225 TYR A C     
1845 O O     . TYR A 225 ? 0.4557 0.3342 0.2765 -0.0200 -0.0930 -0.0111 225 TYR A O     
1846 C CB    . TYR A 225 ? 0.4478 0.3677 0.2954 0.0006  -0.0668 -0.0049 225 TYR A CB    
1847 C CG    . TYR A 225 ? 0.4936 0.4029 0.3112 -0.0069 -0.0641 -0.0114 225 TYR A CG    
1848 C CD1   . TYR A 225 ? 0.4751 0.3876 0.2843 -0.0034 -0.0494 -0.0183 225 TYR A CD1   
1849 C CD2   . TYR A 225 ? 0.5170 0.4134 0.3145 -0.0173 -0.0761 -0.0103 225 TYR A CD2   
1850 C CE1   . TYR A 225 ? 0.5224 0.4250 0.3031 -0.0111 -0.0452 -0.0248 225 TYR A CE1   
1851 C CE2   . TYR A 225 ? 0.5485 0.4333 0.3150 -0.0252 -0.0733 -0.0158 225 TYR A CE2   
1852 C CZ    . TYR A 225 ? 0.5715 0.4589 0.3291 -0.0226 -0.0571 -0.0235 225 TYR A CZ    
1853 O OH    . TYR A 225 ? 0.6463 0.5222 0.3722 -0.0315 -0.0526 -0.0294 225 TYR A OH    
1854 N N     . VAL A 226 ? 0.4333 0.3404 0.2984 -0.0101 -0.0967 0.0033  226 VAL A N     
1855 C CA    . VAL A 226 ? 0.4374 0.3406 0.3027 -0.0179 -0.1132 0.0070  226 VAL A CA    
1856 C C     . VAL A 226 ? 0.4580 0.3478 0.3205 -0.0250 -0.1195 0.0020  226 VAL A C     
1857 O O     . VAL A 226 ? 0.4630 0.3417 0.3071 -0.0349 -0.1310 -0.0005 226 VAL A O     
1858 C CB    . VAL A 226 ? 0.4230 0.3429 0.3170 -0.0134 -0.1186 0.0165  226 VAL A CB    
1859 C CG1   . VAL A 226 ? 0.3878 0.3068 0.2881 -0.0201 -0.1359 0.0204  226 VAL A CG1   
1860 C CG2   . VAL A 226 ? 0.4558 0.3848 0.3480 -0.0092 -0.1143 0.0208  226 VAL A CG2   
1861 N N     . TYR A 227 ? 0.4656 0.3553 0.3444 -0.0207 -0.1119 0.0004  227 TYR A N     
1862 C CA    . TYR A 227 ? 0.4435 0.3184 0.3203 -0.0283 -0.1160 -0.0049 227 TYR A CA    
1863 C C     . TYR A 227 ? 0.4943 0.3467 0.3377 -0.0355 -0.1137 -0.0157 227 TYR A C     
1864 O O     . TYR A 227 ? 0.5055 0.3458 0.3355 -0.0476 -0.1247 -0.0200 227 TYR A O     
1865 C CB    . TYR A 227 ? 0.4064 0.2809 0.3026 -0.0215 -0.1053 -0.0043 227 TYR A CB    
1866 C CG    . TYR A 227 ? 0.5054 0.3624 0.4000 -0.0305 -0.1083 -0.0099 227 TYR A CG    
1867 C CD1   . TYR A 227 ? 0.5187 0.3819 0.4297 -0.0396 -0.1211 -0.0065 227 TYR A CD1   
1868 C CD2   . TYR A 227 ? 0.5584 0.3924 0.4358 -0.0303 -0.0977 -0.0189 227 TYR A CD2   
1869 C CE1   . TYR A 227 ? 0.5850 0.4325 0.4943 -0.0501 -0.1238 -0.0120 227 TYR A CE1   
1870 C CE2   . TYR A 227 ? 0.5921 0.4065 0.4658 -0.0400 -0.0996 -0.0247 227 TYR A CE2   
1871 C CZ    . TYR A 227 ? 0.6321 0.4537 0.5214 -0.