data_4KHW
# 
_entry.id   4KHW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4KHW         
NDB   NA2393       
RCSB  RCSB079359   
WWPDB D_1000079359 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4KHQ . unspecified 
PDB 4KHS . unspecified 
PDB 4KHU . unspecified 
PDB 4KHY . unspecified 
PDB 4KI4 . unspecified 
PDB 4KI6 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4KHW 
_pdbx_database_status.recvd_initial_deposition_date   2013-05-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Clausen, A.R.'  1 
'Pedersen, L.C.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structure-function analysis of ribonucleotide bypass by B family DNA replicases.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            110 
_citation.page_first                16802 
_citation.page_last                 16807 
_citation.year                      2013 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24082122 
_citation.pdbx_database_id_DOI      10.1073/pnas.1309119110 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Clausen, A.R.'  1 
primary 'Murray, M.S.'   2 
primary 'Passer, A.R.'   3 
primary 'Pedersen, L.C.' 4 
primary 'Kunkel, T.A.'   5 
# 
_cell.entry_id           4KHW 
_cell.length_a           80.355 
_cell.length_b           118.630 
_cell.length_c           126.310 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4KHW 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase'                                                                   104689.156 1   2.7.7.7 
'D327A, D222A, L415F' ? ? 
2 polymer     syn 
;DNA/RNA (5'-D(*AP*CP*AP*G)-R(P*G)-D(P*TP*AP*AP*GP*CP*AP*GP*TP*CP*CP*GP*CP*G)-3')
;
5566.605   1   ?       ?                     ? ? 
3 polymer     syn 
;DNA (5'-D(*GP*CP*GP*GP*AP*CP*TP*GP*CP*TP*TP*AP*CP*C)-3')
;
4256.766   1   ?       ?                     ? ? 
4 non-polymer syn "THYMIDINE-5'-TRIPHOSPHATE"                                                        482.168    1   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                                                      40.078     8   ?       ? ? ? 
6 non-polymer syn 'SODIUM ION'                                                                       22.990     2   ?       ? ? ? 
7 water       nat water                                                                              18.015     534 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Gp43 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'                                    no no 
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSFYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSFYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
A ? 
2 'polydeoxyribonucleotide/polyribonucleotide hybrid' no no 
'(DA)(DC)(DA)(DG)G(DT)(DA)(DA)(DG)(DC)(DA)(DG)(DT)(DC)(DC)(DG)(DC)(DG)' ACAGGTAAGCAGTCCGCG T ? 
3 polydeoxyribonucleotide                             no no '(DG)(DC)(DG)(DG)(DA)(DC)(DT)(DG)(DC)(DT)(DT)(DA)(DC)(DC)' 
GCGGACTGCTTACC P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   GLU n 
1 4   PHE n 
1 5   TYR n 
1 6   LEU n 
1 7   THR n 
1 8   VAL n 
1 9   GLU n 
1 10  GLN n 
1 11  ILE n 
1 12  GLY n 
1 13  ASP n 
1 14  SER n 
1 15  ILE n 
1 16  PHE n 
1 17  GLU n 
1 18  ARG n 
1 19  TYR n 
1 20  ILE n 
1 21  ASP n 
1 22  SER n 
1 23  ASN n 
1 24  GLY n 
1 25  ARG n 
1 26  GLU n 
1 27  ARG n 
1 28  THR n 
1 29  ARG n 
1 30  GLU n 
1 31  VAL n 
1 32  GLU n 
1 33  TYR n 
1 34  LYS n 
1 35  PRO n 
1 36  SER n 
1 37  LEU n 
1 38  PHE n 
1 39  ALA n 
1 40  HIS n 
1 41  CYS n 
1 42  PRO n 
1 43  GLU n 
1 44  SER n 
1 45  GLN n 
1 46  ALA n 
1 47  THR n 
1 48  LYS n 
1 49  TYR n 
1 50  PHE n 
1 51  ASP n 
1 52  ILE n 
1 53  TYR n 
1 54  GLY n 
1 55  LYS n 
1 56  PRO n 
1 57  CYS n 
1 58  THR n 
1 59  ARG n 
1 60  LYS n 
1 61  LEU n 
1 62  PHE n 
1 63  ALA n 
1 64  ASN n 
1 65  MET n 
1 66  ARG n 
1 67  ASP n 
1 68  ALA n 
1 69  SER n 
1 70  GLN n 
1 71  TRP n 
1 72  ILE n 
1 73  LYS n 
1 74  ARG n 
1 75  MET n 
1 76  GLU n 
1 77  ASP n 
1 78  ILE n 
1 79  GLY n 
1 80  LEU n 
1 81  GLU n 
1 82  ALA n 
1 83  LEU n 
1 84  GLY n 
1 85  MET n 
1 86  ASP n 
1 87  ASP n 
1 88  PHE n 
1 89  LYS n 
1 90  LEU n 
1 91  ALA n 
1 92  TYR n 
1 93  LEU n 
1 94  SER n 
1 95  ASP n 
1 96  THR n 
1 97  TYR n 
1 98  ASN n 
1 99  TYR n 
1 100 GLU n 
1 101 ILE n 
1 102 LYS n 
1 103 TYR n 
1 104 ASP n 
1 105 HIS n 
1 106 THR n 
1 107 LYS n 
1 108 ILE n 
1 109 ARG n 
1 110 VAL n 
1 111 ALA n 
1 112 ASN n 
1 113 PHE n 
1 114 ASP n 
1 115 ILE n 
1 116 GLU n 
1 117 VAL n 
1 118 THR n 
1 119 SER n 
1 120 PRO n 
1 121 ASP n 
1 122 GLY n 
1 123 PHE n 
1 124 PRO n 
1 125 GLU n 
1 126 PRO n 
1 127 SER n 
1 128 GLN n 
1 129 ALA n 
1 130 LYS n 
1 131 HIS n 
1 132 PRO n 
1 133 ILE n 
1 134 ASP n 
1 135 ALA n 
1 136 ILE n 
1 137 THR n 
1 138 HIS n 
1 139 TYR n 
1 140 ASP n 
1 141 SER n 
1 142 ILE n 
1 143 ASP n 
1 144 ASP n 
1 145 ARG n 
1 146 PHE n 
1 147 TYR n 
1 148 VAL n 
1 149 PHE n 
1 150 ASP n 
1 151 LEU n 
1 152 LEU n 
1 153 ASN n 
1 154 SER n 
1 155 PRO n 
1 156 TYR n 
1 157 GLY n 
1 158 ASN n 
1 159 VAL n 
1 160 GLU n 
1 161 GLU n 
1 162 TRP n 
1 163 SER n 
1 164 ILE n 
1 165 GLU n 
1 166 ILE n 
1 167 ALA n 
1 168 ALA n 
1 169 LYS n 
1 170 LEU n 
1 171 GLN n 
1 172 GLU n 
1 173 GLN n 
1 174 GLY n 
1 175 GLY n 
1 176 ASP n 
1 177 GLU n 
1 178 VAL n 
1 179 PRO n 
1 180 SER n 
1 181 GLU n 
1 182 ILE n 
1 183 ILE n 
1 184 ASP n 
1 185 LYS n 
1 186 ILE n 
1 187 ILE n 
1 188 TYR n 
1 189 MET n 
1 190 PRO n 
1 191 PHE n 
1 192 ASP n 
1 193 ASN n 
1 194 GLU n 
1 195 LYS n 
1 196 GLU n 
1 197 LEU n 
1 198 LEU n 
1 199 MET n 
1 200 GLU n 
1 201 TYR n 
1 202 LEU n 
1 203 ASN n 
1 204 PHE n 
1 205 TRP n 
1 206 GLN n 
1 207 GLN n 
1 208 LYS n 
1 209 THR n 
1 210 PRO n 
1 211 VAL n 
1 212 ILE n 
1 213 LEU n 
1 214 THR n 
1 215 GLY n 
1 216 TRP n 
1 217 ASN n 
1 218 VAL n 
1 219 GLU n 
1 220 SER n 
1 221 PHE n 
1 222 ALA n 
1 223 ILE n 
1 224 PRO n 
1 225 TYR n 
1 226 VAL n 
1 227 TYR n 
1 228 ASN n 
1 229 ARG n 
1 230 ILE n 
1 231 LYS n 
1 232 ASN n 
1 233 ILE n 
1 234 PHE n 
1 235 GLY n 
1 236 GLU n 
1 237 SER n 
1 238 THR n 
1 239 ALA n 
1 240 LYS n 
1 241 ARG n 
1 242 LEU n 
1 243 SER n 
1 244 PRO n 
1 245 HIS n 
1 246 ARG n 
1 247 LYS n 
1 248 THR n 
1 249 ARG n 
1 250 VAL n 
1 251 LYS n 
1 252 VAL n 
1 253 ILE n 
1 254 GLU n 
1 255 ASN n 
1 256 MET n 
1 257 TYR n 
1 258 GLY n 
1 259 SER n 
1 260 ARG n 
1 261 GLU n 
1 262 ILE n 
1 263 ILE n 
1 264 THR n 
1 265 LEU n 
1 266 PHE n 
1 267 GLY n 
1 268 ILE n 
1 269 SER n 
1 270 VAL n 
1 271 LEU n 
1 272 ASP n 
1 273 TYR n 
1 274 ILE n 
1 275 ASP n 
1 276 LEU n 
1 277 TYR n 
1 278 LYS n 
1 279 LYS n 
1 280 PHE n 
1 281 SER n 
1 282 PHE n 
1 283 THR n 
1 284 ASN n 
1 285 GLN n 
1 286 PRO n 
1 287 SER n 
1 288 TYR n 
1 289 SER n 
1 290 LEU n 
1 291 ASP n 
1 292 TYR n 
1 293 ILE n 
1 294 SER n 
1 295 GLU n 
1 296 PHE n 
1 297 GLU n 
1 298 LEU n 
1 299 ASN n 
1 300 VAL n 
1 301 GLY n 
1 302 LYS n 
1 303 LEU n 
1 304 LYS n 
1 305 TYR n 
1 306 ASP n 
1 307 GLY n 
1 308 PRO n 
1 309 ILE n 
1 310 SER n 
1 311 LYS n 
1 312 LEU n 
1 313 ARG n 
1 314 GLU n 
1 315 SER n 
1 316 ASN n 
1 317 HIS n 
1 318 GLN n 
1 319 ARG n 
1 320 TYR n 
1 321 ILE n 
1 322 SER n 
1 323 TYR n 
1 324 ASN n 
1 325 ILE n 
1 326 ILE n 
1 327 ALA n 
1 328 VAL n 
1 329 TYR n 
1 330 ARG n 
1 331 VAL n 
1 332 LEU n 
1 333 GLN n 
1 334 ILE n 
1 335 ASP n 
1 336 ALA n 
1 337 LYS n 
1 338 ARG n 
1 339 GLN n 
1 340 PHE n 
1 341 ILE n 
1 342 ASN n 
1 343 LEU n 
1 344 SER n 
1 345 LEU n 
1 346 ASP n 
1 347 MET n 
1 348 GLY n 
1 349 TYR n 
1 350 TYR n 
1 351 ALA n 
1 352 LYS n 
1 353 ILE n 
1 354 GLN n 
1 355 ILE n 
1 356 GLN n 
1 357 SER n 
1 358 VAL n 
1 359 PHE n 
1 360 SER n 
1 361 PRO n 
1 362 ILE n 
1 363 LYS n 
1 364 THR n 
1 365 TRP n 
1 366 ASP n 
1 367 ALA n 
1 368 ILE n 
1 369 ILE n 
1 370 PHE n 
1 371 ASN n 
1 372 SER n 
1 373 LEU n 
1 374 LYS n 
1 375 GLU n 
1 376 GLN n 
1 377 ASN n 
1 378 LYS n 
1 379 VAL n 
1 380 ILE n 
1 381 PRO n 
1 382 GLN n 
1 383 GLY n 
1 384 ARG n 
1 385 SER n 
1 386 HIS n 
1 387 PRO n 
1 388 VAL n 
1 389 GLN n 
1 390 PRO n 
1 391 TYR n 
1 392 PRO n 
1 393 GLY n 
1 394 ALA n 
1 395 PHE n 
1 396 VAL n 
1 397 LYS n 
1 398 GLU n 
1 399 PRO n 
1 400 ILE n 
1 401 PRO n 
1 402 ASN n 
1 403 ARG n 
1 404 TYR n 
1 405 LYS n 
1 406 TYR n 
1 407 VAL n 
1 408 MET n 
1 409 SER n 
1 410 PHE n 
1 411 ASP n 
1 412 LEU n 
1 413 THR n 
1 414 SER n 
1 415 PHE n 
1 416 TYR n 
1 417 PRO n 
1 418 SER n 
1 419 ILE n 
1 420 ILE n 
1 421 ARG n 
1 422 GLN n 
1 423 VAL n 
1 424 ASN n 
1 425 ILE n 
1 426 SER n 
1 427 PRO n 
1 428 GLU n 
1 429 THR n 
1 430 ILE n 
1 431 ALA n 
1 432 GLY n 
1 433 THR n 
1 434 PHE n 
1 435 LYS n 
1 436 VAL n 
1 437 ALA n 
1 438 PRO n 
1 439 LEU n 
1 440 HIS n 
1 441 ASP n 
1 442 TYR n 
1 443 ILE n 
1 444 ASN n 
1 445 ALA n 
1 446 VAL n 
1 447 ALA n 
1 448 GLU n 
1 449 ARG n 
1 450 PRO n 
1 451 SER n 
1 452 ASP n 
1 453 VAL n 
1 454 TYR n 
1 455 SER n 
1 456 CYS n 
1 457 SER n 
1 458 PRO n 
1 459 ASN n 
1 460 GLY n 
1 461 MET n 
1 462 MET n 
1 463 TYR n 
1 464 TYR n 
1 465 LYS n 
1 466 ASP n 
1 467 ARG n 
1 468 ASP n 
1 469 GLY n 
1 470 VAL n 
1 471 VAL n 
1 472 PRO n 
1 473 THR n 
1 474 GLU n 
1 475 ILE n 
1 476 THR n 
1 477 LYS n 
1 478 VAL n 
1 479 PHE n 
1 480 ASN n 
1 481 GLN n 
1 482 ARG n 
1 483 LYS n 
1 484 GLU n 
1 485 HIS n 
1 486 LYS n 
1 487 GLY n 
1 488 TYR n 
1 489 MET n 
1 490 LEU n 
1 491 ALA n 
1 492 ALA n 
1 493 GLN n 
1 494 ARG n 
1 495 ASN n 
1 496 GLY n 
1 497 GLU n 
1 498 ILE n 
1 499 ILE n 
1 500 LYS n 
1 501 GLU n 
1 502 ALA n 
1 503 LEU n 
1 504 HIS n 
1 505 ASN n 
1 506 PRO n 
1 507 ASN n 
1 508 LEU n 
1 509 SER n 
1 510 VAL n 
1 511 ASP n 
1 512 GLU n 
1 513 PRO n 
1 514 LEU n 
1 515 ASP n 
1 516 VAL n 
1 517 ASP n 
1 518 TYR n 
1 519 ARG n 
1 520 PHE n 
1 521 ASP n 
1 522 PHE n 
1 523 SER n 
1 524 ASP n 
1 525 GLU n 
1 526 ILE n 
1 527 LYS n 
1 528 GLU n 
1 529 LYS n 
1 530 ILE n 
1 531 LYS n 
1 532 LYS n 
1 533 LEU n 
1 534 SER n 
1 535 ALA n 
1 536 LYS n 
1 537 SER n 
1 538 LEU n 
1 539 ASN n 
1 540 GLU n 
1 541 MET n 
1 542 LEU n 
1 543 PHE n 
1 544 ARG n 
1 545 ALA n 
1 546 GLN n 
1 547 ARG n 
1 548 THR n 
1 549 GLU n 
1 550 VAL n 
1 551 ALA n 
1 552 GLY n 
1 553 MET n 
1 554 THR n 
1 555 ALA n 
1 556 GLN n 
1 557 ILE n 
1 558 ASN n 
1 559 ARG n 
1 560 LYS n 
1 561 LEU n 
1 562 LEU n 
1 563 ILE n 
1 564 ASN n 
1 565 SER n 
1 566 LEU n 
1 567 TYR n 
1 568 GLY n 
1 569 ALA n 
1 570 LEU n 
1 571 GLY n 
1 572 ASN n 
1 573 VAL n 
1 574 TRP n 
1 575 PHE n 
1 576 ARG n 
1 577 TYR n 
1 578 TYR n 
1 579 ASP n 
1 580 LEU n 
1 581 ARG n 
1 582 ASN n 
1 583 ALA n 
1 584 THR n 
1 585 ALA n 
1 586 ILE n 
1 587 THR n 
1 588 THR n 
1 589 PHE n 
1 590 GLY n 
1 591 GLN n 
1 592 MET n 
1 593 ALA n 
1 594 LEU n 
1 595 GLN n 
1 596 TRP n 
1 597 ILE n 
1 598 GLU n 
1 599 ARG n 
1 600 LYS n 
1 601 VAL n 
1 602 ASN n 
1 603 GLU n 
1 604 TYR n 
1 605 LEU n 
1 606 ASN n 
1 607 GLU n 
1 608 VAL n 
1 609 CYS n 
1 610 GLY n 
1 611 THR n 
1 612 GLU n 
1 613 GLY n 
1 614 GLU n 
1 615 ALA n 
1 616 PHE n 
1 617 VAL n 
1 618 LEU n 
1 619 TYR n 
1 620 GLY n 
1 621 ASP n 
1 622 THR n 
1 623 ASP n 
1 624 SER n 
1 625 ILE n 
1 626 TYR n 
1 627 VAL n 
1 628 SER n 
1 629 ALA n 
1 630 ASP n 
1 631 LYS n 
1 632 ILE n 
1 633 ILE n 
1 634 ASP n 
1 635 LYS n 
1 636 VAL n 
1 637 GLY n 
1 638 GLU n 
1 639 SER n 
1 640 LYS n 
1 641 PHE n 
1 642 ARG n 
1 643 ASP n 
1 644 THR n 
1 645 ASN n 
1 646 HIS n 
1 647 TRP n 
1 648 VAL n 
1 649 ASP n 
1 650 PHE n 
1 651 LEU n 
1 652 ASP n 
1 653 LYS n 
1 654 PHE n 
1 655 ALA n 
1 656 ARG n 
1 657 GLU n 
1 658 ARG n 
1 659 MET n 
1 660 GLU n 
1 661 PRO n 
1 662 ALA n 
1 663 ILE n 
1 664 ASP n 
1 665 ARG n 
1 666 GLY n 
1 667 PHE n 
1 668 ARG n 
1 669 GLU n 
1 670 MET n 
1 671 CYS n 
1 672 GLU n 
1 673 TYR n 
1 674 MET n 
1 675 ASN n 
1 676 ASN n 
1 677 LYS n 
1 678 GLN n 
1 679 HIS n 
1 680 LEU n 
1 681 MET n 
1 682 PHE n 
1 683 MET n 
1 684 ASP n 
1 685 ARG n 
1 686 GLU n 
1 687 ALA n 
1 688 ILE n 
1 689 ALA n 
1 690 GLY n 
1 691 PRO n 
1 692 PRO n 
1 693 LEU n 
1 694 GLY n 
1 695 SER n 
1 696 LYS n 
1 697 GLY n 
1 698 ILE n 
1 699 GLY n 
1 700 GLY n 
1 701 PHE n 
1 702 TRP n 
1 703 THR n 
1 704 GLY n 
1 705 LYS n 
1 706 LYS n 
1 707 ARG n 
1 708 TYR n 
1 709 ALA n 
1 710 LEU n 
1 711 ASN n 
1 712 VAL n 
1 713 TRP n 
1 714 ASP n 
1 715 MET n 
1 716 GLU n 
1 717 GLY n 
1 718 THR n 
1 719 ARG n 
1 720 TYR n 
1 721 ALA n 
1 722 GLU n 
1 723 PRO n 
1 724 LYS n 
1 725 LEU n 
1 726 LYS n 
1 727 ILE n 
1 728 MET n 
1 729 GLY n 
1 730 LEU n 
1 731 GLU n 
1 732 THR n 
1 733 GLN n 
1 734 LYS n 
1 735 SER n 
1 736 SER n 
1 737 THR n 
1 738 PRO n 
1 739 LYS n 
1 740 ALA n 
1 741 VAL n 
1 742 GLN n 
1 743 LYS n 
1 744 ALA n 
1 745 LEU n 
1 746 LYS n 
1 747 GLU n 
1 748 CYS n 
1 749 ILE n 
1 750 ARG n 
1 751 ARG n 
1 752 MET n 
1 753 LEU n 
1 754 GLN n 
1 755 GLU n 
1 756 GLY n 
1 757 GLU n 
1 758 GLU n 
1 759 SER n 
1 760 LEU n 
1 761 GLN n 
1 762 GLU n 
1 763 TYR n 
1 764 PHE n 
1 765 LYS n 
1 766 GLU n 
1 767 PHE n 
1 768 GLU n 
1 769 LYS n 
1 770 GLU n 
1 771 PHE n 
1 772 ARG n 
1 773 GLN n 
1 774 LEU n 
1 775 ASN n 
1 776 TYR n 
1 777 ILE n 
1 778 SER n 
1 779 ILE n 
1 780 ALA n 
1 781 SER n 
1 782 VAL n 
1 783 SER n 
1 784 SER n 
1 785 ALA n 
1 786 ASN n 
1 787 ASN n 
1 788 ILE n 
1 789 ALA n 
1 790 LYS n 
1 791 TYR n 
1 792 ASP n 
1 793 VAL n 
1 794 GLY n 
1 795 GLY n 
1 796 PHE n 
1 797 PRO n 
1 798 GLY n 
1 799 PRO n 
1 800 LYS n 
1 801 CYS n 
1 802 PRO n 
1 803 PHE n 
1 804 HIS n 
1 805 ILE n 
1 806 ARG n 
1 807 GLY n 
1 808 ILE n 
1 809 LEU n 
1 810 THR n 
1 811 TYR n 
1 812 ASN n 
1 813 ARG n 
1 814 ALA n 
1 815 ILE n 
1 816 LYS n 
1 817 GLY n 
1 818 ASN n 
1 819 ILE n 
1 820 ASP n 
1 821 ALA n 
1 822 PRO n 
1 823 GLN n 
1 824 VAL n 
1 825 VAL n 
1 826 GLU n 
1 827 GLY n 
1 828 GLU n 
1 829 LYS n 
1 830 VAL n 
1 831 TYR n 
1 832 VAL n 
1 833 LEU n 
1 834 PRO n 
1 835 LEU n 
1 836 ARG n 
1 837 GLU n 
1 838 GLY n 
1 839 ASN n 
1 840 PRO n 
1 841 PHE n 
1 842 GLY n 
1 843 ASP n 
1 844 LYS n 
1 845 CYS n 
1 846 ILE n 
1 847 ALA n 
1 848 TRP n 
1 849 PRO n 
1 850 SER n 
1 851 GLY n 
1 852 THR n 
1 853 GLU n 
1 854 ILE n 
1 855 THR n 
1 856 ASP n 
1 857 LEU n 
1 858 ILE n 
1 859 LYS n 
1 860 ASP n 
1 861 ASP n 
1 862 VAL n 
1 863 LEU n 
1 864 HIS n 
1 865 TRP n 
1 866 MET n 
1 867 ASP n 
1 868 TYR n 
1 869 THR n 
1 870 VAL n 
1 871 LEU n 
1 872 LEU n 
1 873 GLU n 
1 874 LYS n 
1 875 THR n 
1 876 PHE n 
1 877 ILE n 
1 878 LYS n 
1 879 PRO n 
1 880 LEU n 
1 881 GLU n 
1 882 GLY n 
1 883 PHE n 
1 884 THR n 
1 885 SER n 
1 886 ALA n 
1 887 ALA n 
1 888 LYS n 
1 889 LEU n 
1 890 ASP n 
1 891 TYR n 
1 892 GLU n 
1 893 LYS n 
1 894 LYS n 
1 895 ALA n 
1 896 SER n 
1 897 LEU n 
1 898 PHE n 
1 899 ASP n 
1 900 MET n 
1 901 PHE n 
1 902 ASP n 
1 903 PHE n 
2 1   DA  n 
2 2   DC  n 
2 3   DA  n 
2 4   DG  n 
2 5   G   n 
2 6   DT  n 
2 7   DA  n 
2 8   DA  n 
2 9   DG  n 
2 10  DC  n 
2 11  DA  n 
2 12  DG  n 
2 13  DT  n 
2 14  DC  n 
2 15  DC  n 
2 16  DG  n 
2 17  DC  n 
2 18  DG  n 
3 1   DG  n 
3 2   DC  n 
3 3   DG  n 
3 4   DG  n 
3 5   DA  n 
3 6   DC  n 
3 7   DT  n 
3 8   DG  n 
3 9   DC  n 
3 10  DT  n 
3 11  DT  n 
3 12  DA  n 
3 13  DC  n 
3 14  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 43 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage RB69' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     12353 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPR69 Q38087 1 
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFDIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIDVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
1 ? 
2 PDB 4KHW       4KHW   2 ? ? ? 
3 PDB 4KHW       4KHW   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4KHW A 1 ? 903 ? Q38087 1   ? 903 ? 1   903 
2 2 4KHW T 1 ? 18  ? 4KHW   1   ? 18  ? 1   18  
3 3 4KHW P 1 ? 14  ? 4KHW   102 ? 115 ? 102 115 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4KHW ALA A 222 ? UNP Q38087 ASP 222 'ENGINEERED MUTATION' 222 1 
1 4KHW ALA A 327 ? UNP Q38087 ASP 327 'ENGINEERED MUTATION' 327 2 
1 4KHW PHE A 415 ? UNP Q38087 LEU 415 'ENGINEERED MUTATION' 415 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
NA  non-polymer         . 'SODIUM ION'                         ? 'Na 1'              22.990  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TTP non-polymer         . "THYMIDINE-5'-TRIPHOSPHATE"          ? 'C10 H17 N2 O14 P3' 482.168 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4KHW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.63 
_exptl_crystal.density_percent_sol   53.21 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'50 MM TRIS-HCL, 19% PEG350, 180 MM CALCIUM CHLORIDE,, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2010-06-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             1.00 
_diffrn_source.pdbx_wavelength_list        1.00 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4KHW 
_reflns.observed_criterion_sigma_I   3.000 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.371 
_reflns.number_obs                   44309 
_reflns.number_all                   46949 
_reflns.percent_possible_obs         98.7 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.37 
_reflns_shell.d_res_low              2.44 
_reflns_shell.percent_possible_all   98.7 
_reflns_shell.Rmerge_I_obs           0.453 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4KHW 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     44309 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             44.642 
_refine.ls_d_res_high                            2.371 
_refine.ls_percent_reflns_obs                    97.55 
_refine.ls_R_factor_obs                          0.1743 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1717 
_refine.ls_R_factor_R_free                       0.2241 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.98 
_refine.ls_number_reflns_R_free                  2413 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            0.81060 
_refine.aniso_B[2][2]                            -4.81290 
_refine.aniso_B[3][3]                            4.00230 
_refine.aniso_B[1][2]                            -0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             1.00 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       LS_WUNIT_K1 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.28 
_refine.pdbx_overall_phase_error                 23.42 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7210 
_refine_hist.pdbx_number_atoms_nucleic_acid   651 
_refine_hist.pdbx_number_atoms_ligand         39 
_refine_hist.number_atoms_solvent             534 
_refine_hist.number_atoms_total               8434 
_refine_hist.d_res_high                       2.371 
_refine_hist.d_res_low                        44.642 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 8266  'X-RAY DIFFRACTION' ? 
f_angle_d          0.764  ? ? 11381 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 11.451 ? ? 2763  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.052  ? ? 1206  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 1353  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.3713 2.4197  2108 0.2827 76.00  0.3483 . . 107 . . . . 
'X-RAY DIFFRACTION' . 2.4197 2.4723  2665 0.2651 98.00  0.2770 . . 139 . . . . 
'X-RAY DIFFRACTION' . 2.4723 2.5298  2680 0.2588 98.00  0.3306 . . 124 . . . . 
'X-RAY DIFFRACTION' . 2.5298 2.5930  2669 0.2464 98.00  0.2826 . . 158 . . . . 
'X-RAY DIFFRACTION' . 2.5930 2.6631  2691 0.2371 99.00  0.2730 . . 159 . . . . 
'X-RAY DIFFRACTION' . 2.6631 2.7415  2692 0.2400 99.00  0.3098 . . 149 . . . . 
'X-RAY DIFFRACTION' . 2.7415 2.8300  2713 0.2248 99.00  0.2634 . . 146 . . . . 
'X-RAY DIFFRACTION' . 2.8300 2.9311  2740 0.2165 99.00  0.2478 . . 135 . . . . 
'X-RAY DIFFRACTION' . 2.9311 3.0484  2713 0.2099 99.00  0.2949 . . 143 . . . . 
'X-RAY DIFFRACTION' . 3.0484 3.1871  2767 0.1950 99.00  0.2732 . . 117 . . . . 
'X-RAY DIFFRACTION' . 3.1871 3.3551  2710 0.1779 99.00  0.2107 . . 152 . . . . 
'X-RAY DIFFRACTION' . 3.3551 3.5652  2736 0.1576 99.00  0.2417 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.5652 3.8404  2783 0.1505 99.00  0.2132 . . 158 . . . . 
'X-RAY DIFFRACTION' . 3.8404 4.2266  2765 0.1290 100.00 0.1709 . . 147 . . . . 
'X-RAY DIFFRACTION' . 4.2266 4.8375  2801 0.1157 100.00 0.1689 . . 140 . . . . 
'X-RAY DIFFRACTION' . 4.8375 6.0923  2813 0.1327 100.00 0.1877 . . 166 . . . . 
'X-RAY DIFFRACTION' . 6.0923 44.6497 2988 0.1539 99.00  0.1939 . . 131 . . . . 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    4KHW 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  4KHW 
_struct.title                     'Ternary complex of RB69 mutant L415F with ribonucleotide at -2 position' 
_struct.pdbx_descriptor           'DNA polymerase (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4KHW 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'RIBONUCLEOTIDE, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 6 ? 
M N N 5 ? 
N N N 6 ? 
O N N 7 ? 
P N N 7 ? 
Q N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 64  ? GLY A 79  ? ASN A 64  GLY A 79  1 ? 16 
HELX_P HELX_P2  2  ASP A 87  ? TYR A 97  ? ASP A 87  TYR A 97  1 ? 11 
HELX_P HELX_P3  3  ASP A 104 ? ILE A 108 ? ASP A 104 ILE A 108 5 ? 5  
HELX_P HELX_P4  4  SER A 163 ? LYS A 169 ? SER A 163 LYS A 169 1 ? 7  
HELX_P HELX_P5  5  LEU A 170 ? GLY A 174 ? LEU A 170 GLY A 174 5 ? 5  
HELX_P HELX_P6  6  PRO A 179 ? ASP A 184 ? PRO A 179 ASP A 184 1 ? 6  
HELX_P HELX_P7  7  ASN A 193 ? LYS A 208 ? ASN A 193 LYS A 208 1 ? 16 
HELX_P HELX_P8  8  PHE A 221 ? GLY A 235 ? PHE A 221 GLY A 235 1 ? 15 
HELX_P HELX_P9  9  GLY A 235 ? LYS A 240 ? GLY A 235 LYS A 240 1 ? 6  
HELX_P HELX_P10 10 ARG A 241 ? SER A 243 ? ARG A 241 SER A 243 5 ? 3  
HELX_P HELX_P11 11 ASP A 272 ? SER A 281 ? ASP A 272 SER A 281 1 ? 10 
HELX_P HELX_P12 12 SER A 289 ? ASN A 299 ? SER A 289 ASN A 299 1 ? 11 
HELX_P HELX_P13 13 PRO A 308 ? ASN A 316 ? PRO A 308 ASN A 316 1 ? 9  
HELX_P HELX_P14 14 ASN A 316 ? GLN A 339 ? ASN A 316 GLN A 339 1 ? 24 
HELX_P HELX_P15 15 GLN A 339 ? LYS A 352 ? GLN A 339 LYS A 352 1 ? 14 
HELX_P HELX_P16 16 GLN A 354 ? PHE A 359 ? GLN A 354 PHE A 359 5 ? 6  
HELX_P HELX_P17 17 SER A 360 ? GLN A 376 ? SER A 360 GLN A 376 1 ? 17 
HELX_P HELX_P18 18 SER A 414 ? ASN A 424 ? SER A 414 ASN A 424 1 ? 11 
HELX_P HELX_P19 19 PRO A 438 ? ASN A 444 ? PRO A 438 ASN A 444 1 ? 7  
HELX_P HELX_P20 20 GLY A 469 ? LEU A 503 ? GLY A 469 LEU A 503 1 ? 35 
HELX_P HELX_P21 21 SER A 523 ? LYS A 531 ? SER A 523 LYS A 531 1 ? 9  
HELX_P HELX_P22 22 SER A 534 ? GLY A 571 ? SER A 534 GLY A 571 1 ? 38 
HELX_P HELX_P23 23 ASP A 579 ? GLY A 610 ? ASP A 579 GLY A 610 1 ? 32 
HELX_P HELX_P24 24 ALA A 629 ? LYS A 635 ? ALA A 629 LYS A 635 1 ? 7  
HELX_P HELX_P25 25 GLY A 637 ? PHE A 641 ? GLY A 637 PHE A 641 5 ? 5  
HELX_P HELX_P26 26 ASP A 643 ? ARG A 658 ? ASP A 643 ARG A 658 1 ? 16 
HELX_P HELX_P27 27 ARG A 658 ? MET A 674 ? ARG A 658 MET A 674 1 ? 17 
HELX_P HELX_P28 28 LEU A 730 ? LYS A 734 ? LEU A 730 LYS A 734 5 ? 5  
HELX_P HELX_P29 29 PRO A 738 ? GLU A 755 ? PRO A 738 GLU A 755 1 ? 18 
HELX_P HELX_P30 30 GLY A 756 ? PHE A 771 ? GLY A 756 PHE A 771 1 ? 16 
HELX_P HELX_P31 31 ARG A 772 ? LEU A 774 ? ARG A 772 LEU A 774 5 ? 3  
HELX_P HELX_P32 32 ILE A 788 ? LYS A 790 ? ILE A 788 LYS A 790 5 ? 3  
HELX_P HELX_P33 33 PRO A 802 ? ILE A 815 ? PRO A 802 ILE A 815 1 ? 14 
HELX_P HELX_P34 34 ILE A 858 ? MET A 866 ? ILE A 858 MET A 866 1 ? 9  
HELX_P HELX_P35 35 ASP A 867 ? PHE A 876 ? ASP A 867 PHE A 876 1 ? 10 
HELX_P HELX_P36 36 PHE A 876 ? LYS A 888 ? PHE A 876 LYS A 888 1 ? 13 
HELX_P HELX_P37 37 SER A 896 ? PHE A 901 ? SER A 896 PHE A 901 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D TTP .   O2B ? ? ? 1_555 E CA  .  CA ? ? A TTP 1001 A CA  1002 1_555 ? ? ? ? ? ? ?            2.073 ? 
metalc2  metalc ? ? D TTP .   O2A ? ? ? 1_555 E CA  .  CA ? ? A TTP 1001 A CA  1002 1_555 ? ? ? ? ? ? ?            2.123 ? 
metalc3  metalc ? ? D TTP .   O1G ? ? ? 1_555 E CA  .  CA ? ? A TTP 1001 A CA  1002 1_555 ? ? ? ? ? ? ?            2.237 ? 
metalc4  metalc ? ? A ASN 505 O   ? ? ? 1_555 I CA  .  CA ? ? A ASN 505  A CA  1006 1_555 ? ? ? ? ? ? ?            2.279 ? 
metalc5  metalc ? ? N NA  .   NA  ? ? ? 1_555 O HOH .  O  ? ? A NA  1011 A HOH 1538 1_555 ? ? ? ? ? ? ?            2.339 ? 
metalc6  metalc ? ? A GLU 177 OE2 ? ? ? 1_555 K CA  .  CA ? ? A GLU 177  A CA  1008 1_555 ? ? ? ? ? ? ?            2.352 ? 
metalc7  metalc ? ? A GLU 686 OE1 ? ? ? 1_555 M CA  .  CA ? ? A GLU 686  A CA  1010 1_555 ? ? ? ? ? ? ?            2.358 ? 
metalc8  metalc ? ? N NA  .   NA  ? ? ? 1_555 O HOH .  O  ? ? A NA  1011 A HOH 1541 1_555 ? ? ? ? ? ? ?            2.359 ? 
metalc9  metalc ? ? A LEU 412 O   ? ? ? 1_555 E CA  .  CA ? ? A LEU 412  A CA  1002 1_555 ? ? ? ? ? ? ?            2.362 ? 
metalc10 metalc ? ? A ASN 232 OD1 ? ? ? 1_555 N NA  .  NA ? ? A ASN 232  A NA  1011 1_555 ? ? ? ? ? ? ?            2.366 ? 
metalc11 metalc ? ? G CA  .   CA  ? ? ? 1_555 O HOH .  O  ? ? A CA  1004 A HOH 1391 1_555 ? ? ? ? ? ? ?            2.366 ? 
metalc12 metalc ? ? A ASP 623 OD1 ? ? ? 1_555 E CA  .  CA ? ? A ASP 623  A CA  1002 1_555 ? ? ? ? ? ? ?            2.368 ? 
metalc13 metalc ? ? A GLU 116 OE2 ? ? ? 1_555 G CA  .  CA ? ? A GLU 116  A CA  1004 1_555 ? ? ? ? ? ? ?            2.374 ? 
metalc14 metalc ? ? N NA  .   NA  ? ? ? 1_555 O HOH .  O  ? ? A NA  1011 A HOH 1540 1_555 ? ? ? ? ? ? ?            2.375 ? 
metalc15 metalc ? ? I CA  .   CA  ? ? ? 1_555 O HOH .  O  ? ? A CA  1006 A HOH 1387 1_555 ? ? ? ? ? ? ?            2.376 ? 
metalc16 metalc ? ? A LYS 531 O   ? ? ? 1_555 I CA  .  CA ? ? A LYS 531  A CA  1006 1_555 ? ? ? ? ? ? ?            2.377 ? 
metalc17 metalc ? ? L NA  .   NA  ? ? ? 1_555 O HOH .  O  ? ? A NA  1009 A HOH 1543 1_555 ? ? ? ? ? ? ?            2.381 ? 
metalc18 metalc ? ? A ASP 411 OD2 ? ? ? 1_555 F CA  .  CA ? ? A ASP 411  A CA  1003 1_555 ? ? ? ? ? ? ?            2.390 ? 
metalc19 metalc ? ? H CA  .   CA  ? ? ? 1_555 O HOH .  O  ? ? A CA  1005 A HOH 1339 1_555 ? ? ? ? ? ? ?            2.392 ? 
metalc20 metalc ? ? L NA  .   NA  ? ? ? 1_555 O HOH .  O  ? ? A NA  1009 A HOH 1544 1_555 ? ? ? ? ? ? ?            2.395 ? 
metalc21 metalc ? ? G CA  .   CA  ? ? ? 1_555 O HOH .  O  ? ? A CA  1004 A HOH 1163 1_555 ? ? ? ? ? ? ?            2.399 ? 
metalc22 metalc ? ? A GLU 196 OE2 ? ? ? 1_555 J CA  .  CA ? ? A GLU 196  A CA  1007 1_555 ? ? ? ? ? ? ?            2.400 ? 
metalc23 metalc ? ? I CA  .   CA  ? ? ? 1_555 O HOH .  O  ? ? A CA  1006 A HOH 1455 1_555 ? ? ? ? ? ? ?            2.400 ? 
metalc24 metalc ? ? N NA  .   NA  ? ? ? 1_555 O HOH .  O  ? ? A NA  1011 A HOH 1539 1_555 ? ? ? ? ? ? ?            2.401 ? 
metalc25 metalc ? ? K CA  .   CA  ? ? ? 1_555 O HOH .  O  ? ? A CA  1008 A HOH 1405 1_555 ? ? ? ? ? ? ?            2.402 ? 
metalc26 metalc ? ? L NA  .   NA  ? ? ? 1_555 O HOH .  O  ? ? A NA  1009 A HOH 1542 1_555 ? ? ? ? ? ? ?            2.406 ? 
metalc27 metalc ? ? F CA  .   CA  ? ? ? 1_555 Q HOH .  O  ? ? A CA  1003 P HOH 208  1_555 ? ? ? ? ? ? ?            2.407 ? 
metalc28 metalc ? ? I CA  .   CA  ? ? ? 1_555 O HOH .  O  ? ? A CA  1006 A HOH 1388 1_555 ? ? ? ? ? ? ?            2.408 ? 
metalc29 metalc ? ? A ASN 507 OD1 ? ? ? 1_555 I CA  .  CA ? ? A ASN 507  A CA  1006 1_555 ? ? ? ? ? ? ?            2.409 ? 
metalc30 metalc ? ? H CA  .   CA  ? ? ? 1_555 O HOH .  O  ? ? A CA  1005 A HOH 1454 1_555 ? ? ? ? ? ? ?            2.413 ? 
metalc31 metalc ? ? A GLU 196 OE1 ? ? ? 1_555 J CA  .  CA ? ? A GLU 196  A CA  1007 1_555 ? ? ? ? ? ? ?            2.418 ? 
metalc32 metalc ? ? D TTP .   O2A ? ? ? 1_555 F CA  .  CA ? ? A TTP 1001 A CA  1003 1_555 ? ? ? ? ? ? ?            2.418 ? 
metalc33 metalc ? ? A ASP 411 OD2 ? ? ? 1_555 E CA  .  CA ? ? A ASP 411  A CA  1002 1_555 ? ? ? ? ? ? ?            2.420 ? 
metalc34 metalc ? ? I CA  .   CA  ? ? ? 1_555 O HOH .  O  ? ? A CA  1006 A HOH 1389 1_555 ? ? ? ? ? ? ?            2.422 ? 
metalc35 metalc ? ? A ASP 684 OD2 ? ? ? 1_555 H CA  .  CA ? ? A ASP 684  A CA  1005 1_555 ? ? ? ? ? ? ?            2.428 ? 
metalc36 metalc ? ? M CA  .   CA  ? ? ? 1_555 O HOH .  O  ? ? A CA  1010 A HOH 1546 1_555 ? ? ? ? ? ? ?            2.441 ? 
metalc37 metalc ? ? A ASP 411 OD1 ? ? ? 1_555 E CA  .  CA ? ? A ASP 411  A CA  1002 1_555 ? ? ? ? ? ? ?            2.441 ? 
metalc38 metalc ? ? F CA  .   CA  ? ? ? 1_555 O HOH .  O  ? ? A CA  1003 A HOH 1435 1_555 ? ? ? ? ? ? ?            2.444 ? 
metalc39 metalc ? ? A ASP 623 OD2 ? ? ? 1_555 F CA  .  CA ? ? A ASP 623  A CA  1003 1_555 ? ? ? ? ? ? ?            2.446 ? 
metalc40 metalc ? ? A GLU 660 OE1 ? ? ? 1_555 H CA  .  CA ? ? A GLU 660  A CA  1005 1_555 ? ? ? ? ? ? ?            2.447 ? 
metalc41 metalc ? ? A ASP 192 OD2 ? ? ? 1_555 J CA  .  CA ? ? A ASP 192  A CA  1007 1_555 ? ? ? ? ? ? ?            2.448 ? 
metalc42 metalc ? ? G CA  .   CA  ? ? ? 1_555 O HOH .  O  ? ? A CA  1004 A HOH 1390 1_555 ? ? ? ? ? ? ?            2.449 ? 
metalc43 metalc ? ? A GLU 172 OE1 ? ? ? 1_555 K CA  .  CA ? ? A GLU 172  A CA  1008 1_555 ? ? ? ? ? ? ?            2.455 ? 
metalc44 metalc ? ? A ASP 411 OD1 ? ? ? 1_555 M CA  .  CA ? ? A ASP 411  A CA  1010 1_555 ? ? ? ? ? ? ?            2.463 ? 
metalc45 metalc ? ? A GLU 116 OE1 ? ? ? 1_555 G CA  .  CA ? ? A GLU 116  A CA  1004 1_555 ? ? ? ? ? ? ?            2.506 ? 
metalc46 metalc ? ? A ALA 721 O   ? ? ? 1_555 L NA  .  NA ? ? A ALA 721  A NA  1009 1_555 ? ? ? ? ? ? ?            2.836 ? 
metalc47 metalc ? ? L NA  .   NA  ? ? ? 1_555 O HOH .  O  ? ? A NA  1009 A HOH 1462 1_555 ? ? ? ? ? ? ?            2.894 ? 
metalc48 metalc ? ? A ASP 192 OD1 ? ? ? 1_555 J CA  .  CA ? ? A ASP 192  A CA  1007 1_555 ? ? ? ? ? ? ?            2.934 ? 
hydrog1  hydrog ? ? B DG  4   N1  ? ? ? 1_555 C DC  14 N3 ? ? T DG  4    P DC  115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  4   N2  ? ? ? 1_555 C DC  14 O2 ? ? T DG  4    P DC  115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  4   O6  ? ? ? 1_555 C DC  14 N4 ? ? T DG  4    P DC  115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B G   5   N1  ? ? ? 1_555 C DC  13 N3 ? ? T G   5    P DC  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B G   5   N2  ? ? ? 1_555 C DC  13 O2 ? ? T G   5    P DC  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B G   5   O6  ? ? ? 1_555 C DC  13 N4 ? ? T G   5    P DC  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DT  6   N3  ? ? ? 1_555 C DA  12 N1 ? ? T DT  6    P DA  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DT  6   O4  ? ? ? 1_555 C DA  12 N6 ? ? T DT  6    P DA  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  7   N1  ? ? ? 1_555 C DT  11 N3 ? ? T DA  7    P DT  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DA  7   N6  ? ? ? 1_555 C DT  11 O4 ? ? T DA  7    P DT  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DA  8   N1  ? ? ? 1_555 C DT  10 N3 ? ? T DA  8    P DT  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DA  8   N6  ? ? ? 1_555 C DT  10 O4 ? ? T DA  8    P DT  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  9   N1  ? ? ? 1_555 C DC  9  N3 ? ? T DG  9    P DC  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  9   N2  ? ? ? 1_555 C DC  9  O2 ? ? T DG  9    P DC  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  9   O6  ? ? ? 1_555 C DC  9  N4 ? ? T DG  9    P DC  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  10  N3  ? ? ? 1_555 C DG  8  N1 ? ? T DC  10   P DG  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  10  N4  ? ? ? 1_555 C DG  8  O6 ? ? T DC  10   P DG  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  10  O2  ? ? ? 1_555 C DG  8  N2 ? ? T DC  10   P DG  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DA  11  N1  ? ? ? 1_555 C DT  7  N3 ? ? T DA  11   P DT  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DA  11  N6  ? ? ? 1_555 C DT  7  O4 ? ? T DA  11   P DT  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DG  12  N1  ? ? ? 1_555 C DC  6  N3 ? ? T DG  12   P DC  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DG  12  N2  ? ? ? 1_555 C DC  6  O2 ? ? T DG  12   P DC  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DG  12  O6  ? ? ? 1_555 C DC  6  N4 ? ? T DG  12   P DC  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DT  13  N3  ? ? ? 1_555 C DA  5  N1 ? ? T DT  13   P DA  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DT  13  O4  ? ? ? 1_555 C DA  5  N6 ? ? T DT  13   P DA  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DC  14  N3  ? ? ? 1_555 C DG  4  N1 ? ? T DC  14   P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DC  14  N4  ? ? ? 1_555 C DG  4  O6 ? ? T DC  14   P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DC  14  O2  ? ? ? 1_555 C DG  4  N2 ? ? T DC  14   P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DC  15  N3  ? ? ? 1_555 C DG  3  N1 ? ? T DC  15   P DG  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DC  15  N4  ? ? ? 1_555 C DG  3  O6 ? ? T DC  15   P DG  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DC  15  O2  ? ? ? 1_555 C DG  3  N2 ? ? T DC  15   P DG  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DG  16  N1  ? ? ? 1_555 C DC  2  N3 ? ? T DG  16   P DC  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DG  16  N2  ? ? ? 1_555 C DC  2  O2 ? ? T DG  16   P DC  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DG  16  O6  ? ? ? 1_555 C DC  2  N4 ? ? T DG  16   P DC  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? B DC  17  N3  ? ? ? 1_555 C DG  1  N1 ? ? T DC  17   P DG  102  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? B DC  17  N4  ? ? ? 1_555 C DG  1  O6 ? ? T DC  17   P DG  102  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? B DC  17  O2  ? ? ? 1_555 C DG  1  N2 ? ? T DC  17   P DG  102  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 2 ? 
D ? 6 ? 
E ? 2 ? 
F ? 2 ? 
G ? 7 ? 
H ? 4 ? 
I ? 3 ? 
J ? 3 ? 
K ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
G 6 7 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 4   ? ILE A 11  ? PHE A 4   ILE A 11  
A 2 SER A 14  ? ILE A 20  ? SER A 14  ILE A 20  
A 3 GLU A 26  ? VAL A 31  ? GLU A 26  VAL A 31  
B 1 SER A 36  ? HIS A 40  ? SER A 36  HIS A 40  
B 2 CYS A 57  ? LEU A 61  ? CYS A 57  LEU A 61  
C 1 PHE A 50  ? ASP A 51  ? PHE A 50  ASP A 51  
C 2 LYS A 378 ? VAL A 379 ? LYS A 378 VAL A 379 
D 1 ILE A 186 ? PHE A 191 ? ILE A 186 PHE A 191 
D 2 ARG A 145 ? LEU A 151 ? ARG A 145 LEU A 151 
D 3 ILE A 133 ? ASP A 140 ? ILE A 133 ASP A 140 
D 4 VAL A 110 ? VAL A 117 ? VAL A 110 VAL A 117 
D 5 ILE A 212 ? THR A 214 ? ILE A 212 THR A 214 
D 6 SER A 269 ? VAL A 270 ? SER A 269 VAL A 270 
E 1 ASN A 153 ? SER A 154 ? ASN A 153 SER A 154 
E 2 GLY A 157 ? ASN A 158 ? GLY A 157 ASN A 158 
F 1 THR A 248 ? VAL A 252 ? THR A 248 VAL A 252 
F 2 GLU A 261 ? LEU A 265 ? GLU A 261 LEU A 265 
G 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
G 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
G 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
G 4 MET A 683 ? ALA A 689 ? MET A 683 ALA A 689 
G 5 VAL A 407 ? LEU A 412 ? VAL A 407 LEU A 412 
G 6 SER A 624 ? SER A 628 ? SER A 624 SER A 628 
G 7 VAL A 617 ? TYR A 619 ? VAL A 617 TYR A 619 
H 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
H 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
H 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
H 4 THR A 718 ? MET A 728 ? THR A 718 MET A 728 
I 1 ILE A 430 ? THR A 433 ? ILE A 430 THR A 433 
I 2 MET A 461 ? TYR A 463 ? MET A 461 TYR A 463 
I 3 SER A 455 ? CYS A 456 ? SER A 455 CYS A 456 
J 1 SER A 781 ? SER A 784 ? SER A 781 SER A 784 
J 2 LYS A 829 ? PRO A 834 ? LYS A 829 PRO A 834 
J 3 CYS A 845 ? PRO A 849 ? CYS A 845 PRO A 849 
K 1 ASP A 792 ? VAL A 793 ? ASP A 792 VAL A 793 
K 2 PHE A 796 ? PRO A 797 ? PHE A 796 PRO A 797 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 6   ? N LEU A 6   O ARG A 18  ? O ARG A 18  
A 2 3 N TYR A 19  ? N TYR A 19  O ARG A 27  ? O ARG A 27  
B 1 2 N LEU A 37  ? N LEU A 37  O LYS A 60  ? O LYS A 60  
C 1 2 N PHE A 50  ? N PHE A 50  O VAL A 379 ? O VAL A 379 
D 1 2 O ILE A 187 ? O ILE A 187 N PHE A 146 ? N PHE A 146 
D 2 3 O PHE A 149 ? O PHE A 149 N ILE A 136 ? N ILE A 136 
D 3 4 O TYR A 139 ? O TYR A 139 N ASN A 112 ? N ASN A 112 
D 4 5 N ALA A 111 ? N ALA A 111 O ILE A 212 ? O ILE A 212 
D 5 6 N LEU A 213 ? N LEU A 213 O SER A 269 ? O SER A 269 
E 1 2 N SER A 154 ? N SER A 154 O GLY A 157 ? O GLY A 157 
F 1 2 N ARG A 249 ? N ARG A 249 O THR A 264 ? O THR A 264 
G 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
G 2 3 N THR A 703 ? N THR A 703 O ARG A 707 ? O ARG A 707 
G 3 4 O TRP A 713 ? O TRP A 713 N ILE A 688 ? N ILE A 688 
G 4 5 O ALA A 689 ? O ALA A 689 N VAL A 407 ? N VAL A 407 
G 5 6 N MET A 408 ? N MET A 408 O VAL A 627 ? O VAL A 627 
G 6 7 O TYR A 626 ? O TYR A 626 N LEU A 618 ? N LEU A 618 
H 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
H 2 3 N THR A 703 ? N THR A 703 O ARG A 707 ? O ARG A 707 
H 3 4 N LEU A 710 ? N LEU A 710 O LYS A 726 ? O LYS A 726 
I 1 2 N ALA A 431 ? N ALA A 431 O MET A 462 ? O MET A 462 
I 2 3 O TYR A 463 ? O TYR A 463 N SER A 455 ? N SER A 455 
J 1 2 N SER A 781 ? N SER A 781 O VAL A 832 ? O VAL A 832 
J 2 3 N TYR A 831 ? N TYR A 831 O TRP A 848 ? O TRP A 848 
K 1 2 N VAL A 793 ? N VAL A 793 O PHE A 796 ? O PHE A 796 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE TTP A 1001' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 1002'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 1003'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 1004'  
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 1005'  
AC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 1006'  
AC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA A 1007'  
AC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA A 1008'  
AC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 1009'  
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 1010'  
BC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 1011'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 20 ASP A 411 ? ASP A 411  . ? 1_555 ? 
2  AC1 20 LEU A 412 ? LEU A 412  . ? 1_555 ? 
3  AC1 20 THR A 413 ? THR A 413  . ? 1_555 ? 
4  AC1 20 SER A 414 ? SER A 414  . ? 1_555 ? 
5  AC1 20 PHE A 415 ? PHE A 415  . ? 1_555 ? 
6  AC1 20 TYR A 416 ? TYR A 416  . ? 1_555 ? 
7  AC1 20 ARG A 482 ? ARG A 482  . ? 1_555 ? 
8  AC1 20 LYS A 486 ? LYS A 486  . ? 1_555 ? 
9  AC1 20 LYS A 560 ? LYS A 560  . ? 1_555 ? 
10 AC1 20 ASN A 564 ? ASN A 564  . ? 1_555 ? 
11 AC1 20 ASP A 623 ? ASP A 623  . ? 1_555 ? 
12 AC1 20 CA  E .   ? CA  A 1002 . ? 1_555 ? 
13 AC1 20 CA  F .   ? CA  A 1003 . ? 1_555 ? 
14 AC1 20 CA  M .   ? CA  A 1010 . ? 1_555 ? 
15 AC1 20 HOH O .   ? HOH A 1106 . ? 1_555 ? 
16 AC1 20 HOH O .   ? HOH A 1183 . ? 1_555 ? 
17 AC1 20 HOH O .   ? HOH A 1315 . ? 1_555 ? 
18 AC1 20 DC  C 14  ? DC  P 115  . ? 1_555 ? 
19 AC1 20 DA  B 3   ? DA  T 3    . ? 1_555 ? 
20 AC1 20 DG  B 4   ? DG  T 4    . ? 1_555 ? 
21 AC2 5  ASP A 411 ? ASP A 411  . ? 1_555 ? 
22 AC2 5  LEU A 412 ? LEU A 412  . ? 1_555 ? 
23 AC2 5  ASP A 623 ? ASP A 623  . ? 1_555 ? 
24 AC2 5  TTP D .   ? TTP A 1001 . ? 1_555 ? 
25 AC2 5  CA  F .   ? CA  A 1003 . ? 1_555 ? 
26 AC3 6  ASP A 411 ? ASP A 411  . ? 1_555 ? 
27 AC3 6  ASP A 623 ? ASP A 623  . ? 1_555 ? 
28 AC3 6  TTP D .   ? TTP A 1001 . ? 1_555 ? 
29 AC3 6  CA  E .   ? CA  A 1002 . ? 1_555 ? 
30 AC3 6  HOH O .   ? HOH A 1435 . ? 1_555 ? 
31 AC3 6  HOH Q .   ? HOH P 208  . ? 1_555 ? 
32 AC4 4  GLU A 116 ? GLU A 116  . ? 1_555 ? 
33 AC4 4  HOH O .   ? HOH A 1163 . ? 1_555 ? 
34 AC4 4  HOH O .   ? HOH A 1390 . ? 1_555 ? 
35 AC4 4  HOH O .   ? HOH A 1391 . ? 1_555 ? 
36 AC5 4  GLU A 660 ? GLU A 660  . ? 1_555 ? 
37 AC5 4  ASP A 684 ? ASP A 684  . ? 1_555 ? 
38 AC5 4  HOH O .   ? HOH A 1339 . ? 1_555 ? 
39 AC5 4  HOH O .   ? HOH A 1454 . ? 1_555 ? 
40 AC6 7  ASN A 505 ? ASN A 505  . ? 1_555 ? 
41 AC6 7  ASN A 507 ? ASN A 507  . ? 1_555 ? 
42 AC6 7  LYS A 531 ? LYS A 531  . ? 1_555 ? 
43 AC6 7  HOH O .   ? HOH A 1387 . ? 1_555 ? 
44 AC6 7  HOH O .   ? HOH A 1388 . ? 1_555 ? 
45 AC6 7  HOH O .   ? HOH A 1389 . ? 1_555 ? 
46 AC6 7  HOH O .   ? HOH A 1455 . ? 1_555 ? 
47 AC7 3  ASP A 192 ? ASP A 192  . ? 1_555 ? 
48 AC7 3  GLU A 196 ? GLU A 196  . ? 1_555 ? 
49 AC7 3  ASP A 860 ? ASP A 860  . ? 4_556 ? 
50 AC8 3  GLU A 172 ? GLU A 172  . ? 1_555 ? 
51 AC8 3  GLU A 177 ? GLU A 177  . ? 1_555 ? 
52 AC8 3  HOH O .   ? HOH A 1405 . ? 1_555 ? 
53 AC9 5  ALA A 721 ? ALA A 721  . ? 1_555 ? 
54 AC9 5  HOH O .   ? HOH A 1462 . ? 1_555 ? 
55 AC9 5  HOH O .   ? HOH A 1542 . ? 1_555 ? 
56 AC9 5  HOH O .   ? HOH A 1543 . ? 1_555 ? 
57 AC9 5  HOH O .   ? HOH A 1544 . ? 1_555 ? 
58 BC1 5  ASP A 411 ? ASP A 411  . ? 1_555 ? 
59 BC1 5  GLU A 686 ? GLU A 686  . ? 1_555 ? 
60 BC1 5  GLU A 716 ? GLU A 716  . ? 1_555 ? 
61 BC1 5  TTP D .   ? TTP A 1001 . ? 1_555 ? 
62 BC1 5  HOH O .   ? HOH A 1546 . ? 1_555 ? 
63 BC2 5  ASN A 232 ? ASN A 232  . ? 1_555 ? 
64 BC2 5  HOH O .   ? HOH A 1538 . ? 1_555 ? 
65 BC2 5  HOH O .   ? HOH A 1539 . ? 1_555 ? 
66 BC2 5  HOH O .   ? HOH A 1540 . ? 1_555 ? 
67 BC2 5  HOH O .   ? HOH A 1541 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4KHW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4KHW 
_atom_sites.fract_transf_matrix[1][1]   0.012445 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008430 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007917 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? 37.371  38.542 30.126  1.00 66.51  ? 1    MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? 36.136  39.084 29.573  1.00 62.14  ? 1    MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? 36.077  40.603 29.705  1.00 58.31  ? 1    MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? 36.874  41.208 30.425  1.00 55.32  ? 1    MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? 34.915  38.451 30.249  1.00 62.53  ? 1    MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? 34.920  38.539 31.773  1.00 63.38  ? 1    MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? 33.317  38.164 32.524  1.00 78.69  ? 1    MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? 33.006  36.511 31.906  1.00 45.49  ? 1    MET A CE    1 
ATOM   9    N  N     . LYS A 1 2   ? 35.126  41.208 29.000  1.00 58.12  ? 2    LYS A N     1 
ATOM   10   C  CA    . LYS A 1 2   ? 34.895  42.645 29.084  1.00 57.60  ? 2    LYS A CA    1 
ATOM   11   C  C     . LYS A 1 2   ? 34.177  42.991 30.380  1.00 55.52  ? 2    LYS A C     1 
ATOM   12   O  O     . LYS A 1 2   ? 33.270  42.273 30.804  1.00 55.58  ? 2    LYS A O     1 
ATOM   13   C  CB    . LYS A 1 2   ? 34.061  43.124 27.894  1.00 59.24  ? 2    LYS A CB    1 
ATOM   14   C  CG    . LYS A 1 2   ? 34.776  43.037 26.561  1.00 62.90  ? 2    LYS A CG    1 
ATOM   15   C  CD    . LYS A 1 2   ? 35.973  43.975 26.521  1.00 65.36  ? 2    LYS A CD    1 
ATOM   16   C  CE    . LYS A 1 2   ? 35.548  45.425 26.705  1.00 63.82  ? 2    LYS A CE    1 
ATOM   17   N  NZ    . LYS A 1 2   ? 36.705  46.362 26.623  1.00 65.29  ? 2    LYS A NZ    1 
ATOM   18   N  N     . GLU A 1 3   ? 34.584  44.091 31.006  1.00 53.03  ? 3    GLU A N     1 
ATOM   19   C  CA    . GLU A 1 3   ? 33.954  44.542 32.242  1.00 50.74  ? 3    GLU A CA    1 
ATOM   20   C  C     . GLU A 1 3   ? 32.542  45.055 31.992  1.00 46.31  ? 3    GLU A C     1 
ATOM   21   O  O     . GLU A 1 3   ? 32.266  45.661 30.957  1.00 47.10  ? 3    GLU A O     1 
ATOM   22   C  CB    . GLU A 1 3   ? 34.783  45.643 32.904  1.00 53.74  ? 3    GLU A CB    1 
ATOM   23   C  CG    . GLU A 1 3   ? 36.181  45.219 33.296  1.00 60.06  ? 3    GLU A CG    1 
ATOM   24   C  CD    . GLU A 1 3   ? 36.797  46.149 34.314  1.00 65.01  ? 3    GLU A CD    1 
ATOM   25   O  OE1   . GLU A 1 3   ? 37.892  45.832 34.828  1.00 70.45  ? 3    GLU A OE1   1 
ATOM   26   O  OE2   . GLU A 1 3   ? 36.182  47.195 34.605  1.00 63.86  ? 3    GLU A OE2   1 
ATOM   27   N  N     . PHE A 1 4   ? 31.649  44.809 32.944  1.00 41.44  ? 4    PHE A N     1 
ATOM   28   C  CA    . PHE A 1 4   ? 30.291  45.338 32.865  1.00 38.83  ? 4    PHE A CA    1 
ATOM   29   C  C     . PHE A 1 4   ? 29.736  45.649 34.250  1.00 36.83  ? 4    PHE A C     1 
ATOM   30   O  O     . PHE A 1 4   ? 29.970  44.903 35.200  1.00 37.67  ? 4    PHE A O     1 
ATOM   31   C  CB    . PHE A 1 4   ? 29.369  44.379 32.109  1.00 38.23  ? 4    PHE A CB    1 
ATOM   32   C  CG    . PHE A 1 4   ? 29.105  43.088 32.826  1.00 39.73  ? 4    PHE A CG    1 
ATOM   33   C  CD1   . PHE A 1 4   ? 30.009  42.041 32.753  1.00 43.95  ? 4    PHE A CD1   1 
ATOM   34   C  CD2   . PHE A 1 4   ? 27.941  42.912 33.555  1.00 37.77  ? 4    PHE A CD2   1 
ATOM   35   C  CE1   . PHE A 1 4   ? 29.762  40.846 33.405  1.00 44.29  ? 4    PHE A CE1   1 
ATOM   36   C  CE2   . PHE A 1 4   ? 27.688  41.722 34.208  1.00 37.68  ? 4    PHE A CE2   1 
ATOM   37   C  CZ    . PHE A 1 4   ? 28.599  40.687 34.132  1.00 41.53  ? 4    PHE A CZ    1 
ATOM   38   N  N     . TYR A 1 5   ? 29.006  46.755 34.358  1.00 33.82  ? 5    TYR A N     1 
ATOM   39   C  CA    . TYR A 1 5   ? 28.477  47.199 35.641  1.00 30.19  ? 5    TYR A CA    1 
ATOM   40   C  C     . TYR A 1 5   ? 27.336  46.306 36.110  1.00 34.30  ? 5    TYR A C     1 
ATOM   41   O  O     . TYR A 1 5   ? 26.722  45.596 35.315  1.00 29.20  ? 5    TYR A O     1 
ATOM   42   C  CB    . TYR A 1 5   ? 27.989  48.648 35.544  1.00 29.56  ? 5    TYR A CB    1 
ATOM   43   C  CG    . TYR A 1 5   ? 26.766  48.820 34.669  1.00 32.18  ? 5    TYR A CG    1 
ATOM   44   C  CD1   . TYR A 1 5   ? 26.885  48.982 33.297  1.00 28.62  ? 5    TYR A CD1   1 
ATOM   45   C  CD2   . TYR A 1 5   ? 25.490  48.818 35.219  1.00 31.55  ? 5    TYR A CD2   1 
ATOM   46   C  CE1   . TYR A 1 5   ? 25.771  49.136 32.498  1.00 27.92  ? 5    TYR A CE1   1 
ATOM   47   C  CE2   . TYR A 1 5   ? 24.370  48.967 34.427  1.00 27.17  ? 5    TYR A CE2   1 
ATOM   48   C  CZ    . TYR A 1 5   ? 24.518  49.127 33.066  1.00 30.23  ? 5    TYR A CZ    1 
ATOM   49   O  OH    . TYR A 1 5   ? 23.406  49.282 32.272  1.00 29.81  ? 5    TYR A OH    1 
ATOM   50   N  N     . LEU A 1 6   ? 27.054  46.354 37.407  1.00 34.04  ? 6    LEU A N     1 
ATOM   51   C  CA    . LEU A 1 6   ? 25.913  45.651 37.973  1.00 32.57  ? 6    LEU A CA    1 
ATOM   52   C  C     . LEU A 1 6   ? 24.855  46.666 38.385  1.00 32.30  ? 6    LEU A C     1 
ATOM   53   O  O     . LEU A 1 6   ? 23.706  46.601 37.948  1.00 30.85  ? 6    LEU A O     1 
ATOM   54   C  CB    . LEU A 1 6   ? 26.345  44.826 39.184  1.00 32.64  ? 6    LEU A CB    1 
ATOM   55   C  CG    . LEU A 1 6   ? 27.306  43.674 38.896  1.00 34.84  ? 6    LEU A CG    1 
ATOM   56   C  CD1   . LEU A 1 6   ? 27.983  43.207 40.171  1.00 35.07  ? 6    LEU A CD1   1 
ATOM   57   C  CD2   . LEU A 1 6   ? 26.563  42.524 38.235  1.00 35.87  ? 6    LEU A CD2   1 
ATOM   58   N  N     . THR A 1 7   ? 25.257  47.603 39.238  1.00 32.61  ? 7    THR A N     1 
ATOM   59   C  CA    . THR A 1 7   ? 24.372  48.655 39.720  1.00 31.37  ? 7    THR A CA    1 
ATOM   60   C  C     . THR A 1 7   ? 25.142  49.968 39.801  1.00 31.72  ? 7    THR A C     1 
ATOM   61   O  O     . THR A 1 7   ? 26.362  49.974 39.943  1.00 34.87  ? 7    THR A O     1 
ATOM   62   C  CB    . THR A 1 7   ? 23.824  48.335 41.126  1.00 32.00  ? 7    THR A CB    1 
ATOM   63   O  OG1   . THR A 1 7   ? 24.914  48.240 42.051  1.00 33.65  ? 7    THR A OG1   1 
ATOM   64   C  CG2   . THR A 1 7   ? 23.055  47.021 41.133  1.00 29.83  ? 7    THR A CG2   1 
ATOM   65   N  N     . VAL A 1 8   ? 24.430  51.084 39.716  1.00 28.22  ? 8    VAL A N     1 
ATOM   66   C  CA    . VAL A 1 8   ? 25.064  52.386 39.855  1.00 29.36  ? 8    VAL A CA    1 
ATOM   67   C  C     . VAL A 1 8   ? 24.144  53.323 40.626  1.00 30.03  ? 8    VAL A C     1 
ATOM   68   O  O     . VAL A 1 8   ? 22.926  53.301 40.445  1.00 31.09  ? 8    VAL A O     1 
ATOM   69   C  CB    . VAL A 1 8   ? 25.446  52.989 38.480  1.00 31.06  ? 8    VAL A CB    1 
ATOM   70   C  CG1   . VAL A 1 8   ? 24.204  53.324 37.664  1.00 27.35  ? 8    VAL A CG1   1 
ATOM   71   C  CG2   . VAL A 1 8   ? 26.318  54.215 38.657  1.00 30.68  ? 8    VAL A CG2   1 
ATOM   72   N  N     . GLU A 1 9   ? 24.721  54.116 41.519  1.00 30.00  ? 9    GLU A N     1 
ATOM   73   C  CA    . GLU A 1 9   ? 23.944  55.086 42.277  1.00 33.64  ? 9    GLU A CA    1 
ATOM   74   C  C     . GLU A 1 9   ? 24.693  56.405 42.364  1.00 37.72  ? 9    GLU A C     1 
ATOM   75   O  O     . GLU A 1 9   ? 25.914  56.446 42.201  1.00 41.10  ? 9    GLU A O     1 
ATOM   76   C  CB    . GLU A 1 9   ? 23.658  54.570 43.689  1.00 34.05  ? 9    GLU A CB    1 
ATOM   77   C  CG    . GLU A 1 9   ? 22.917  53.239 43.756  1.00 36.18  ? 9    GLU A CG    1 
ATOM   78   C  CD    . GLU A 1 9   ? 21.430  53.355 43.445  1.00 37.01  ? 9    GLU A CD    1 
ATOM   79   O  OE1   . GLU A 1 9   ? 20.958  54.470 43.133  1.00 34.29  ? 9    GLU A OE1   1 
ATOM   80   O  OE2   . GLU A 1 9   ? 20.728  52.322 43.516  1.00 39.31  ? 9    GLU A OE2   1 
ATOM   81   N  N     . GLN A 1 10  ? 23.960  57.483 42.617  1.00 36.04  ? 10   GLN A N     1 
ATOM   82   C  CA    . GLN A 1 10  ? 24.584  58.764 42.902  1.00 35.79  ? 10   GLN A CA    1 
ATOM   83   C  C     . GLN A 1 10  ? 24.283  59.167 44.332  1.00 38.84  ? 10   GLN A C     1 
ATOM   84   O  O     . GLN A 1 10  ? 23.133  59.428 44.682  1.00 40.46  ? 10   GLN A O     1 
ATOM   85   C  CB    . GLN A 1 10  ? 24.087  59.847 41.951  1.00 36.62  ? 10   GLN A CB    1 
ATOM   86   C  CG    . GLN A 1 10  ? 24.680  61.211 42.261  1.00 40.17  ? 10   GLN A CG    1 
ATOM   87   C  CD    . GLN A 1 10  ? 24.063  62.332 41.449  1.00 40.79  ? 10   GLN A CD    1 
ATOM   88   O  OE1   . GLN A 1 10  ? 23.413  62.099 40.427  1.00 41.71  ? 10   GLN A OE1   1 
ATOM   89   N  NE2   . GLN A 1 10  ? 24.265  63.561 41.905  1.00 39.20  ? 10   GLN A NE2   1 
ATOM   90   N  N     . ILE A 1 11  ? 25.322  59.210 45.156  1.00 42.02  ? 11   ILE A N     1 
ATOM   91   C  CA    . ILE A 1 11  ? 25.186  59.653 46.534  1.00 44.54  ? 11   ILE A CA    1 
ATOM   92   C  C     . ILE A 1 11  ? 26.036  60.901 46.738  1.00 46.50  ? 11   ILE A C     1 
ATOM   93   O  O     . ILE A 1 11  ? 27.244  60.813 46.974  1.00 48.96  ? 11   ILE A O     1 
ATOM   94   C  CB    . ILE A 1 11  ? 25.634  58.571 47.529  1.00 47.30  ? 11   ILE A CB    1 
ATOM   95   C  CG1   . ILE A 1 11  ? 25.052  57.207 47.149  1.00 48.49  ? 11   ILE A CG1   1 
ATOM   96   C  CG2   . ILE A 1 11  ? 25.232  58.960 48.940  1.00 49.07  ? 11   ILE A CG2   1 
ATOM   97   C  CD1   . ILE A 1 11  ? 23.562  57.159 47.192  1.00 49.61  ? 11   ILE A CD1   1 
ATOM   98   N  N     . GLY A 1 12  ? 25.399  62.062 46.634  1.00 43.73  ? 12   GLY A N     1 
ATOM   99   C  CA    . GLY A 1 12  ? 26.107  63.321 46.743  1.00 44.13  ? 12   GLY A CA    1 
ATOM   100  C  C     . GLY A 1 12  ? 27.107  63.495 45.617  1.00 44.35  ? 12   GLY A C     1 
ATOM   101  O  O     . GLY A 1 12  ? 26.736  63.489 44.443  1.00 43.68  ? 12   GLY A O     1 
ATOM   102  N  N     . ASP A 1 13  ? 28.378  63.646 45.978  1.00 45.32  ? 13   ASP A N     1 
ATOM   103  C  CA    . ASP A 1 13  ? 29.438  63.831 44.995  1.00 45.05  ? 13   ASP A CA    1 
ATOM   104  C  C     . ASP A 1 13  ? 30.066  62.506 44.598  1.00 45.01  ? 13   ASP A C     1 
ATOM   105  O  O     . ASP A 1 13  ? 31.064  62.473 43.873  1.00 44.86  ? 13   ASP A O     1 
ATOM   106  C  CB    . ASP A 1 13  ? 30.518  64.770 45.532  1.00 46.98  ? 13   ASP A CB    1 
ATOM   107  C  CG    . ASP A 1 13  ? 30.015  66.183 45.714  1.00 50.29  ? 13   ASP A CG    1 
ATOM   108  O  OD1   . ASP A 1 13  ? 28.952  66.504 45.142  1.00 48.55  ? 13   ASP A OD1   1 
ATOM   109  O  OD2   . ASP A 1 13  ? 30.681  66.973 46.416  1.00 54.74  ? 13   ASP A OD2   1 
ATOM   110  N  N     . SER A 1 14  ? 29.479  61.411 45.070  1.00 44.51  ? 14   SER A N     1 
ATOM   111  C  CA    . SER A 1 14  ? 30.015  60.092 44.767  1.00 44.64  ? 14   SER A CA    1 
ATOM   112  C  C     . SER A 1 14  ? 29.102  59.274 43.865  1.00 43.56  ? 14   SER A C     1 
ATOM   113  O  O     . SER A 1 14  ? 27.874  59.321 43.982  1.00 41.27  ? 14   SER A O     1 
ATOM   114  C  CB    . SER A 1 14  ? 30.312  59.320 46.054  1.00 44.15  ? 14   SER A CB    1 
ATOM   115  O  OG    . SER A 1 14  ? 31.498  59.793 46.667  1.00 45.43  ? 14   SER A OG    1 
ATOM   116  N  N     . ILE A 1 15  ? 29.724  58.542 42.948  1.00 43.53  ? 15   ILE A N     1 
ATOM   117  C  CA    . ILE A 1 15  ? 29.038  57.520 42.180  1.00 42.07  ? 15   ILE A CA    1 
ATOM   118  C  C     . ILE A 1 15  ? 29.414  56.175 42.779  1.00 42.06  ? 15   ILE A C     1 
ATOM   119  O  O     . ILE A 1 15  ? 30.590  55.804 42.800  1.00 43.83  ? 15   ILE A O     1 
ATOM   120  C  CB    . ILE A 1 15  ? 29.445  57.547 40.697  1.00 39.61  ? 15   ILE A CB    1 
ATOM   121  C  CG1   . ILE A 1 15  ? 28.803  58.741 39.994  1.00 41.10  ? 15   ILE A CG1   1 
ATOM   122  C  CG2   . ILE A 1 15  ? 29.033  56.257 40.009  1.00 34.68  ? 15   ILE A CG2   1 
ATOM   123  C  CD1   . ILE A 1 15  ? 27.294  58.663 39.913  1.00 41.82  ? 15   ILE A CD1   1 
ATOM   124  N  N     . PHE A 1 16  ? 28.421  55.461 43.297  1.00 39.42  ? 16   PHE A N     1 
ATOM   125  C  CA    . PHE A 1 16  ? 28.660  54.132 43.840  1.00 39.76  ? 16   PHE A CA    1 
ATOM   126  C  C     . PHE A 1 16  ? 28.308  53.073 42.807  1.00 37.19  ? 16   PHE A C     1 
ATOM   127  O  O     . PHE A 1 16  ? 27.156  52.965 42.378  1.00 36.90  ? 16   PHE A O     1 
ATOM   128  C  CB    . PHE A 1 16  ? 27.886  53.923 45.141  1.00 40.94  ? 16   PHE A CB    1 
ATOM   129  C  CG    . PHE A 1 16  ? 28.521  54.585 46.328  1.00 45.12  ? 16   PHE A CG    1 
ATOM   130  C  CD1   . PHE A 1 16  ? 29.455  53.910 47.098  1.00 46.35  ? 16   PHE A CD1   1 
ATOM   131  C  CD2   . PHE A 1 16  ? 28.201  55.891 46.663  1.00 47.02  ? 16   PHE A CD2   1 
ATOM   132  C  CE1   . PHE A 1 16  ? 30.049  54.523 48.187  1.00 46.93  ? 16   PHE A CE1   1 
ATOM   133  C  CE2   . PHE A 1 16  ? 28.791  56.507 47.751  1.00 46.65  ? 16   PHE A CE2   1 
ATOM   134  C  CZ    . PHE A 1 16  ? 29.714  55.821 48.513  1.00 46.20  ? 16   PHE A CZ    1 
ATOM   135  N  N     . GLU A 1 17  ? 29.314  52.306 42.401  1.00 34.42  ? 17   GLU A N     1 
ATOM   136  C  CA    . GLU A 1 17  ? 29.135  51.319 41.351  1.00 31.88  ? 17   GLU A CA    1 
ATOM   137  C  C     . GLU A 1 17  ? 29.545  49.923 41.790  1.00 37.12  ? 17   GLU A C     1 
ATOM   138  O  O     . GLU A 1 17  ? 30.659  49.704 42.266  1.00 33.70  ? 17   GLU A O     1 
ATOM   139  C  CB    . GLU A 1 17  ? 29.928  51.704 40.107  1.00 32.01  ? 17   GLU A CB    1 
ATOM   140  C  CG    . GLU A 1 17  ? 29.819  50.687 38.984  1.00 42.12  ? 17   GLU A CG    1 
ATOM   141  C  CD    . GLU A 1 17  ? 30.823  50.926 37.877  1.00 43.14  ? 17   GLU A CD    1 
ATOM   142  O  OE1   . GLU A 1 17  ? 30.626  50.381 36.772  1.00 43.43  ? 17   GLU A OE1   1 
ATOM   143  O  OE2   . GLU A 1 17  ? 31.810  51.652 38.112  1.00 45.18  ? 17   GLU A OE2   1 
ATOM   144  N  N     . ARG A 1 18  ? 28.626  48.982 41.628  1.00 36.14  ? 18   ARG A N     1 
ATOM   145  C  CA    . ARG A 1 18  ? 28.966  47.579 41.722  1.00 33.12  ? 18   ARG A CA    1 
ATOM   146  C  C     . ARG A 1 18  ? 29.168  47.086 40.301  1.00 33.27  ? 18   ARG A C     1 
ATOM   147  O  O     . ARG A 1 18  ? 28.399  47.432 39.406  1.00 32.72  ? 18   ARG A O     1 
ATOM   148  C  CB    . ARG A 1 18  ? 27.852  46.807 42.417  1.00 32.69  ? 18   ARG A CB    1 
ATOM   149  C  CG    . ARG A 1 18  ? 27.642  47.234 43.860  1.00 35.61  ? 18   ARG A CG    1 
ATOM   150  C  CD    . ARG A 1 18  ? 26.375  46.631 44.437  1.00 35.31  ? 18   ARG A CD    1 
ATOM   151  N  NE    . ARG A 1 18  ? 26.431  45.176 44.482  1.00 32.71  ? 18   ARG A NE    1 
ATOM   152  C  CZ    . ARG A 1 18  ? 25.378  44.401 44.709  1.00 34.11  ? 18   ARG A CZ    1 
ATOM   153  N  NH1   . ARG A 1 18  ? 24.185  44.947 44.900  1.00 34.06  ? 18   ARG A NH1   1 
ATOM   154  N  NH2   . ARG A 1 18  ? 25.515  43.081 44.739  1.00 34.43  ? 18   ARG A NH2   1 
ATOM   155  N  N     . TYR A 1 19  ? 30.216  46.298 40.087  1.00 37.79  ? 19   TYR A N     1 
ATOM   156  C  CA    . TYR A 1 19  ? 30.535  45.823 38.747  1.00 39.35  ? 19   TYR A CA    1 
ATOM   157  C  C     . TYR A 1 19  ? 31.290  44.501 38.755  1.00 38.25  ? 19   TYR A C     1 
ATOM   158  O  O     . TYR A 1 19  ? 31.815  44.076 39.782  1.00 38.55  ? 19   TYR A O     1 
ATOM   159  C  CB    . TYR A 1 19  ? 31.340  46.879 37.981  1.00 41.97  ? 19   TYR A CB    1 
ATOM   160  C  CG    . TYR A 1 19  ? 32.745  47.105 38.504  1.00 45.89  ? 19   TYR A CG    1 
ATOM   161  C  CD1   . TYR A 1 19  ? 32.969  47.861 39.649  1.00 46.99  ? 19   TYR A CD1   1 
ATOM   162  C  CD2   . TYR A 1 19  ? 33.849  46.580 37.839  1.00 47.28  ? 19   TYR A CD2   1 
ATOM   163  C  CE1   . TYR A 1 19  ? 34.250  48.077 40.125  1.00 48.25  ? 19   TYR A CE1   1 
ATOM   164  C  CE2   . TYR A 1 19  ? 35.136  46.793 38.308  1.00 50.02  ? 19   TYR A CE2   1 
ATOM   165  C  CZ    . TYR A 1 19  ? 35.329  47.544 39.451  1.00 50.55  ? 19   TYR A CZ    1 
ATOM   166  O  OH    . TYR A 1 19  ? 36.603  47.761 39.926  1.00 51.90  ? 19   TYR A OH    1 
ATOM   167  N  N     . ILE A 1 20  ? 31.322  43.856 37.595  1.00 37.15  ? 20   ILE A N     1 
ATOM   168  C  CA    . ILE A 1 20  ? 32.102  42.648 37.389  1.00 38.22  ? 20   ILE A CA    1 
ATOM   169  C  C     . ILE A 1 20  ? 33.363  43.033 36.632  1.00 43.89  ? 20   ILE A C     1 
ATOM   170  O  O     . ILE A 1 20  ? 33.285  43.650 35.568  1.00 46.43  ? 20   ILE A O     1 
ATOM   171  C  CB    . ILE A 1 20  ? 31.313  41.623 36.557  1.00 37.26  ? 20   ILE A CB    1 
ATOM   172  C  CG1   . ILE A 1 20  ? 30.026  41.221 37.285  1.00 33.23  ? 20   ILE A CG1   1 
ATOM   173  C  CG2   . ILE A 1 20  ? 32.171  40.409 36.256  1.00 35.61  ? 20   ILE A CG2   1 
ATOM   174  C  CD1   . ILE A 1 20  ? 30.261  40.495 38.591  1.00 33.86  ? 20   ILE A CD1   1 
ATOM   175  N  N     . ASP A 1 21  ? 34.526  42.690 37.176  1.00 47.08  ? 21   ASP A N     1 
ATOM   176  C  CA    . ASP A 1 21  ? 35.779  43.091 36.540  1.00 49.78  ? 21   ASP A CA    1 
ATOM   177  C  C     . ASP A 1 21  ? 36.220  42.160 35.406  1.00 53.26  ? 21   ASP A C     1 
ATOM   178  O  O     . ASP A 1 21  ? 35.522  41.205 35.055  1.00 52.03  ? 21   ASP A O     1 
ATOM   179  C  CB    . ASP A 1 21  ? 36.903  43.292 37.571  1.00 49.30  ? 21   ASP A CB    1 
ATOM   180  C  CG    . ASP A 1 21  ? 37.250  42.022 38.338  1.00 47.10  ? 21   ASP A CG    1 
ATOM   181  O  OD1   . ASP A 1 21  ? 37.037  40.909 37.817  1.00 47.80  ? 21   ASP A OD1   1 
ATOM   182  O  OD2   . ASP A 1 21  ? 37.756  42.144 39.474  1.00 46.30  ? 21   ASP A OD2   1 
ATOM   183  N  N     . SER A 1 22  ? 37.393  42.451 34.850  1.00 55.89  ? 22   SER A N     1 
ATOM   184  C  CA    . SER A 1 22  ? 37.932  41.708 33.720  1.00 58.05  ? 22   SER A CA    1 
ATOM   185  C  C     . SER A 1 22  ? 38.170  40.234 34.045  1.00 59.30  ? 22   SER A C     1 
ATOM   186  O  O     . SER A 1 22  ? 38.225  39.396 33.146  1.00 60.73  ? 22   SER A O     1 
ATOM   187  C  CB    . SER A 1 22  ? 39.234  42.354 33.252  1.00 60.64  ? 22   SER A CB    1 
ATOM   188  O  OG    . SER A 1 22  ? 40.148  42.466 34.329  1.00 63.61  ? 22   SER A OG    1 
ATOM   189  N  N     . ASN A 1 23  ? 38.312  39.921 35.330  1.00 59.23  ? 23   ASN A N     1 
ATOM   190  C  CA    . ASN A 1 23  ? 38.527  38.542 35.756  1.00 60.11  ? 23   ASN A CA    1 
ATOM   191  C  C     . ASN A 1 23  ? 37.228  37.851 36.148  1.00 58.22  ? 23   ASN A C     1 
ATOM   192  O  O     . ASN A 1 23  ? 37.235  36.699 36.575  1.00 59.37  ? 23   ASN A O     1 
ATOM   193  C  CB    . ASN A 1 23  ? 39.533  38.475 36.908  1.00 61.56  ? 23   ASN A CB    1 
ATOM   194  C  CG    . ASN A 1 23  ? 40.883  39.053 36.537  1.00 62.80  ? 23   ASN A CG    1 
ATOM   195  O  OD1   . ASN A 1 23  ? 41.380  39.972 37.191  1.00 61.08  ? 23   ASN A OD1   1 
ATOM   196  N  ND2   . ASN A 1 23  ? 41.483  38.523 35.477  1.00 64.90  ? 23   ASN A ND2   1 
ATOM   197  N  N     . GLY A 1 24  ? 36.115  38.564 36.004  1.00 55.69  ? 24   GLY A N     1 
ATOM   198  C  CA    . GLY A 1 24  ? 34.804  38.001 36.272  1.00 51.03  ? 24   GLY A CA    1 
ATOM   199  C  C     . GLY A 1 24  ? 34.364  38.127 37.719  1.00 50.55  ? 24   GLY A C     1 
ATOM   200  O  O     . GLY A 1 24  ? 33.365  37.533 38.124  1.00 53.76  ? 24   GLY A O     1 
ATOM   201  N  N     . ARG A 1 25  ? 35.104  38.908 38.499  1.00 48.97  ? 25   ARG A N     1 
ATOM   202  C  CA    . ARG A 1 25  ? 34.829  39.050 39.926  1.00 49.28  ? 25   ARG A CA    1 
ATOM   203  C  C     . ARG A 1 25  ? 34.064  40.338 40.252  1.00 45.68  ? 25   ARG A C     1 
ATOM   204  O  O     . ARG A 1 25  ? 34.347  41.393 39.686  1.00 45.06  ? 25   ARG A O     1 
ATOM   205  C  CB    . ARG A 1 25  ? 36.140  38.986 40.716  1.00 56.53  ? 25   ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 25  ? 36.009  39.342 42.183  1.00 62.39  ? 25   ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 25  ? 37.295  39.066 42.938  1.00 69.44  ? 25   ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 25  ? 37.414  39.931 44.107  1.00 74.92  ? 25   ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 25  ? 38.372  39.832 45.022  1.00 81.49  ? 25   ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 25  ? 39.302  38.891 44.918  1.00 84.58  ? 25   ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 25  ? 38.394  40.673 46.047  1.00 82.68  ? 25   ARG A NH2   1 
ATOM   212  N  N     . GLU A 1 26  ? 33.094  40.245 41.161  1.00 44.14  ? 26   GLU A N     1 
ATOM   213  C  CA    . GLU A 1 26  ? 32.302  41.410 41.563  1.00 42.14  ? 26   GLU A CA    1 
ATOM   214  C  C     . GLU A 1 26  ? 33.064  42.343 42.497  1.00 44.20  ? 26   GLU A C     1 
ATOM   215  O  O     . GLU A 1 26  ? 33.574  41.920 43.534  1.00 43.62  ? 26   GLU A O     1 
ATOM   216  C  CB    . GLU A 1 26  ? 30.982  40.995 42.223  1.00 41.03  ? 26   GLU A CB    1 
ATOM   217  C  CG    . GLU A 1 26  ? 30.243  42.164 42.881  1.00 44.10  ? 26   GLU A CG    1 
ATOM   218  C  CD    . GLU A 1 26  ? 28.918  41.771 43.516  1.00 44.90  ? 26   GLU A CD    1 
ATOM   219  O  OE1   . GLU A 1 26  ? 28.306  40.773 43.076  1.00 43.76  ? 26   GLU A OE1   1 
ATOM   220  O  OE2   . GLU A 1 26  ? 28.488  42.468 44.460  1.00 46.16  ? 26   GLU A OE2   1 
ATOM   221  N  N     . ARG A 1 27  ? 33.127  43.618 42.123  1.00 46.82  ? 27   ARG A N     1 
ATOM   222  C  CA    . ARG A 1 27  ? 33.793  44.632 42.932  1.00 47.03  ? 27   ARG A CA    1 
ATOM   223  C  C     . ARG A 1 27  ? 32.836  45.785 43.221  1.00 44.80  ? 27   ARG A C     1 
ATOM   224  O  O     . ARG A 1 27  ? 31.721  45.820 42.704  1.00 44.02  ? 27   ARG A O     1 
ATOM   225  C  CB    . ARG A 1 27  ? 35.035  45.164 42.211  1.00 49.49  ? 27   ARG A CB    1 
ATOM   226  C  CG    . ARG A 1 27  ? 35.848  44.100 41.481  1.00 53.62  ? 27   ARG A CG    1 
ATOM   227  C  CD    . ARG A 1 27  ? 36.433  43.082 42.443  1.00 57.75  ? 27   ARG A CD    1 
ATOM   228  N  NE    . ARG A 1 27  ? 37.593  43.603 43.157  1.00 63.83  ? 27   ARG A NE    1 
ATOM   229  C  CZ    . ARG A 1 27  ? 38.849  43.269 42.882  1.00 68.09  ? 27   ARG A CZ    1 
ATOM   230  N  NH1   . ARG A 1 27  ? 39.112  42.403 41.910  1.00 67.50  ? 27   ARG A NH1   1 
ATOM   231  N  NH2   . ARG A 1 27  ? 39.844  43.795 43.583  1.00 71.73  ? 27   ARG A NH2   1 
ATOM   232  N  N     . THR A 1 28  ? 33.277  46.722 44.053  1.00 45.22  ? 28   THR A N     1 
ATOM   233  C  CA    . THR A 1 28  ? 32.509  47.930 44.336  1.00 44.01  ? 28   THR A CA    1 
ATOM   234  C  C     . THR A 1 28  ? 33.460  49.109 44.479  1.00 45.48  ? 28   THR A C     1 
ATOM   235  O  O     . THR A 1 28  ? 34.423  49.047 45.242  1.00 47.71  ? 28   THR A O     1 
ATOM   236  C  CB    . THR A 1 28  ? 31.656  47.791 45.617  1.00 43.87  ? 28   THR A CB    1 
ATOM   237  O  OG1   . THR A 1 28  ? 30.584  46.872 45.379  1.00 47.89  ? 28   THR A OG1   1 
ATOM   238  C  CG2   . THR A 1 28  ? 31.061  49.129 46.018  1.00 41.73  ? 28   THR A CG2   1 
ATOM   239  N  N     . ARG A 1 29  ? 33.196  50.177 43.734  1.00 44.93  ? 29   ARG A N     1 
ATOM   240  C  CA    . ARG A 1 29  ? 34.040  51.365 43.792  1.00 46.28  ? 29   ARG A CA    1 
ATOM   241  C  C     . ARG A 1 29  ? 33.237  52.639 44.022  1.00 47.85  ? 29   ARG A C     1 
ATOM   242  O  O     . ARG A 1 29  ? 32.142  52.799 43.488  1.00 46.47  ? 29   ARG A O     1 
ATOM   243  C  CB    . ARG A 1 29  ? 34.886  51.495 42.521  1.00 44.90  ? 29   ARG A CB    1 
ATOM   244  C  CG    . ARG A 1 29  ? 34.095  51.482 41.220  1.00 40.66  ? 29   ARG A CG    1 
ATOM   245  C  CD    . ARG A 1 29  ? 35.026  51.476 40.016  1.00 39.72  ? 29   ARG A CD    1 
ATOM   246  N  NE    . ARG A 1 29  ? 34.339  51.053 38.801  1.00 40.35  ? 29   ARG A NE    1 
ATOM   247  C  CZ    . ARG A 1 29  ? 34.956  50.641 37.699  1.00 45.52  ? 29   ARG A CZ    1 
ATOM   248  N  NH1   . ARG A 1 29  ? 36.280  50.593 37.658  1.00 48.60  ? 29   ARG A NH1   1 
ATOM   249  N  NH2   . ARG A 1 29  ? 34.250  50.269 36.638  1.00 45.53  ? 29   ARG A NH2   1 
ATOM   250  N  N     . GLU A 1 30  ? 33.790  53.534 44.834  1.00 51.58  ? 30   GLU A N     1 
ATOM   251  C  CA    . GLU A 1 30  ? 33.213  54.854 45.040  1.00 50.36  ? 30   GLU A CA    1 
ATOM   252  C  C     . GLU A 1 30  ? 34.014  55.853 44.223  1.00 49.33  ? 30   GLU A C     1 
ATOM   253  O  O     . GLU A 1 30  ? 35.159  56.162 44.550  1.00 53.78  ? 30   GLU A O     1 
ATOM   254  C  CB    . GLU A 1 30  ? 33.238  55.239 46.520  1.00 52.70  ? 30   GLU A CB    1 
ATOM   255  C  CG    . GLU A 1 30  ? 32.700  56.634 46.804  1.00 57.56  ? 30   GLU A CG    1 
ATOM   256  C  CD    . GLU A 1 30  ? 32.794  57.012 48.269  1.00 64.06  ? 30   GLU A CD    1 
ATOM   257  O  OE1   . GLU A 1 30  ? 33.292  56.190 49.066  1.00 66.67  ? 30   GLU A OE1   1 
ATOM   258  O  OE2   . GLU A 1 30  ? 32.366  58.131 48.624  1.00 66.09  ? 30   GLU A OE2   1 
ATOM   259  N  N     . VAL A 1 31  ? 33.417  56.345 43.146  1.00 44.62  ? 31   VAL A N     1 
ATOM   260  C  CA    . VAL A 1 31  ? 34.117  57.260 42.261  1.00 43.80  ? 31   VAL A CA    1 
ATOM   261  C  C     . VAL A 1 31  ? 33.655  58.694 42.466  1.00 43.44  ? 31   VAL A C     1 
ATOM   262  O  O     . VAL A 1 31  ? 32.463  58.986 42.385  1.00 40.40  ? 31   VAL A O     1 
ATOM   263  C  CB    . VAL A 1 31  ? 33.926  56.868 40.785  1.00 43.53  ? 31   VAL A CB    1 
ATOM   264  C  CG1   . VAL A 1 31  ? 34.607  57.876 39.875  1.00 46.25  ? 31   VAL A CG1   1 
ATOM   265  C  CG2   . VAL A 1 31  ? 34.472  55.476 40.538  1.00 42.76  ? 31   VAL A CG2   1 
ATOM   266  N  N     . GLU A 1 32  ? 34.604  59.582 42.747  1.00 47.32  ? 32   GLU A N     1 
ATOM   267  C  CA    . GLU A 1 32  ? 34.314  61.007 42.813  1.00 46.80  ? 32   GLU A CA    1 
ATOM   268  C  C     . GLU A 1 32  ? 34.213  61.528 41.385  1.00 44.94  ? 32   GLU A C     1 
ATOM   269  O  O     . GLU A 1 32  ? 35.128  62.176 40.875  1.00 45.68  ? 32   GLU A O     1 
ATOM   270  C  CB    . GLU A 1 32  ? 35.398  61.746 43.593  1.00 50.10  ? 32   GLU A CB    1 
ATOM   271  C  CG    . GLU A 1 32  ? 34.860  62.633 44.705  1.00 51.67  ? 32   GLU A CG    1 
ATOM   272  N  N     . TYR A 1 33  ? 33.087  61.220 40.748  1.00 42.96  ? 33   TYR A N     1 
ATOM   273  C  CA    . TYR A 1 33  ? 32.867  61.488 39.331  1.00 42.03  ? 33   TYR A CA    1 
ATOM   274  C  C     . TYR A 1 33  ? 32.874  62.974 38.995  1.00 45.59  ? 33   TYR A C     1 
ATOM   275  O  O     . TYR A 1 33  ? 32.182  63.769 39.633  1.00 45.63  ? 33   TYR A O     1 
ATOM   276  C  CB    . TYR A 1 33  ? 31.540  60.863 38.888  1.00 38.74  ? 33   TYR A CB    1 
ATOM   277  C  CG    . TYR A 1 33  ? 31.237  61.013 37.415  1.00 38.48  ? 33   TYR A CG    1 
ATOM   278  C  CD1   . TYR A 1 33  ? 32.106  60.513 36.452  1.00 36.97  ? 33   TYR A CD1   1 
ATOM   279  C  CD2   . TYR A 1 33  ? 30.071  61.637 36.984  1.00 36.67  ? 33   TYR A CD2   1 
ATOM   280  C  CE1   . TYR A 1 33  ? 31.831  60.643 35.104  1.00 35.44  ? 33   TYR A CE1   1 
ATOM   281  C  CE2   . TYR A 1 33  ? 29.787  61.769 35.634  1.00 34.38  ? 33   TYR A CE2   1 
ATOM   282  C  CZ    . TYR A 1 33  ? 30.672  61.270 34.700  1.00 35.17  ? 33   TYR A CZ    1 
ATOM   283  O  OH    . TYR A 1 33  ? 30.398  61.399 33.358  1.00 36.48  ? 33   TYR A OH    1 
ATOM   284  N  N     . LYS A 1 34  ? 33.661  63.339 37.987  1.00 47.14  ? 34   LYS A N     1 
ATOM   285  C  CA    . LYS A 1 34  ? 33.710  64.715 37.510  1.00 48.90  ? 34   LYS A CA    1 
ATOM   286  C  C     . LYS A 1 34  ? 32.905  64.832 36.221  1.00 42.79  ? 34   LYS A C     1 
ATOM   287  O  O     . LYS A 1 34  ? 33.402  64.507 35.142  1.00 40.86  ? 34   LYS A O     1 
ATOM   288  C  CB    . LYS A 1 34  ? 35.159  65.147 37.282  1.00 54.40  ? 34   LYS A CB    1 
ATOM   289  C  CG    . LYS A 1 34  ? 36.029  65.053 38.527  1.00 60.55  ? 34   LYS A CG    1 
ATOM   290  C  CD    . LYS A 1 34  ? 37.503  65.188 38.184  1.00 66.18  ? 34   LYS A CD    1 
ATOM   291  C  CE    . LYS A 1 34  ? 37.784  66.498 37.464  1.00 69.64  ? 34   LYS A CE    1 
ATOM   292  N  NZ    . LYS A 1 34  ? 39.211  66.617 37.043  1.00 73.01  ? 34   LYS A NZ    1 
ATOM   293  N  N     . PRO A 1 35  ? 31.651  65.296 36.334  1.00 39.71  ? 35   PRO A N     1 
ATOM   294  C  CA    . PRO A 1 35  ? 30.749  65.332 35.181  1.00 39.23  ? 35   PRO A CA    1 
ATOM   295  C  C     . PRO A 1 35  ? 30.990  66.560 34.321  1.00 41.75  ? 35   PRO A C     1 
ATOM   296  O  O     . PRO A 1 35  ? 31.528  67.561 34.798  1.00 44.36  ? 35   PRO A O     1 
ATOM   297  C  CB    . PRO A 1 35  ? 29.374  65.431 35.834  1.00 36.68  ? 35   PRO A CB    1 
ATOM   298  C  CG    . PRO A 1 35  ? 29.628  66.239 37.071  1.00 38.24  ? 35   PRO A CG    1 
ATOM   299  C  CD    . PRO A 1 35  ? 31.018  65.856 37.543  1.00 38.62  ? 35   PRO A CD    1 
ATOM   300  N  N     . SER A 1 36  ? 30.590  66.482 33.059  1.00 39.69  ? 36   SER A N     1 
ATOM   301  C  CA    . SER A 1 36  ? 30.670  67.635 32.180  1.00 41.05  ? 36   SER A CA    1 
ATOM   302  C  C     . SER A 1 36  ? 29.285  68.042 31.694  1.00 40.76  ? 36   SER A C     1 
ATOM   303  O  O     . SER A 1 36  ? 28.449  67.196 31.367  1.00 40.79  ? 36   SER A O     1 
ATOM   304  C  CB    . SER A 1 36  ? 31.589  67.352 30.990  1.00 42.60  ? 36   SER A CB    1 
ATOM   305  O  OG    . SER A 1 36  ? 32.934  67.196 31.408  1.00 46.21  ? 36   SER A OG    1 
ATOM   306  N  N     . LEU A 1 37  ? 29.043  69.346 31.669  1.00 35.93  ? 37   LEU A N     1 
ATOM   307  C  CA    . LEU A 1 37  ? 27.849  69.884 31.045  1.00 34.05  ? 37   LEU A CA    1 
ATOM   308  C  C     . LEU A 1 37  ? 28.294  70.913 30.021  1.00 37.66  ? 37   LEU A C     1 
ATOM   309  O  O     . LEU A 1 37  ? 29.468  71.278 29.978  1.00 40.48  ? 37   LEU A O     1 
ATOM   310  C  CB    . LEU A 1 37  ? 26.921  70.501 32.089  1.00 33.12  ? 37   LEU A CB    1 
ATOM   311  C  CG    . LEU A 1 37  ? 26.313  69.480 33.055  1.00 32.59  ? 37   LEU A CG    1 
ATOM   312  C  CD1   . LEU A 1 37  ? 25.595  70.164 34.209  1.00 33.33  ? 37   LEU A CD1   1 
ATOM   313  C  CD2   . LEU A 1 37  ? 25.374  68.535 32.315  1.00 29.16  ? 37   LEU A CD2   1 
ATOM   314  N  N     . PHE A 1 38  ? 27.367  71.375 29.190  1.00 36.78  ? 38   PHE A N     1 
ATOM   315  C  CA    . PHE A 1 38  ? 27.739  72.228 28.070  1.00 35.50  ? 38   PHE A CA    1 
ATOM   316  C  C     . PHE A 1 38  ? 26.896  73.491 27.993  1.00 38.59  ? 38   PHE A C     1 
ATOM   317  O  O     . PHE A 1 38  ? 25.745  73.517 28.427  1.00 37.85  ? 38   PHE A O     1 
ATOM   318  C  CB    . PHE A 1 38  ? 27.637  71.453 26.756  1.00 34.50  ? 38   PHE A CB    1 
ATOM   319  C  CG    . PHE A 1 38  ? 28.471  70.201 26.722  1.00 36.79  ? 38   PHE A CG    1 
ATOM   320  C  CD1   . PHE A 1 38  ? 28.027  69.031 27.323  1.00 35.45  ? 38   PHE A CD1   1 
ATOM   321  C  CD2   . PHE A 1 38  ? 29.699  70.190 26.083  1.00 38.30  ? 38   PHE A CD2   1 
ATOM   322  C  CE1   . PHE A 1 38  ? 28.796  67.882 27.296  1.00 36.57  ? 38   PHE A CE1   1 
ATOM   323  C  CE2   . PHE A 1 38  ? 30.473  69.039 26.047  1.00 37.89  ? 38   PHE A CE2   1 
ATOM   324  C  CZ    . PHE A 1 38  ? 30.020  67.884 26.656  1.00 37.36  ? 38   PHE A CZ    1 
ATOM   325  N  N     . ALA A 1 39  ? 27.488  74.539 27.433  1.00 38.76  ? 39   ALA A N     1 
ATOM   326  C  CA    . ALA A 1 39  ? 26.784  75.787 27.201  1.00 36.02  ? 39   ALA A CA    1 
ATOM   327  C  C     . ALA A 1 39  ? 27.113  76.264 25.799  1.00 34.80  ? 39   ALA A C     1 
ATOM   328  O  O     . ALA A 1 39  ? 28.211  76.025 25.303  1.00 34.44  ? 39   ALA A O     1 
ATOM   329  C  CB    . ALA A 1 39  ? 27.197  76.826 28.225  1.00 37.05  ? 39   ALA A CB    1 
ATOM   330  N  N     . HIS A 1 40  ? 26.158  76.926 25.157  1.00 34.80  ? 40   HIS A N     1 
ATOM   331  C  CA    . HIS A 1 40  ? 26.398  77.493 23.842  1.00 36.36  ? 40   HIS A CA    1 
ATOM   332  C  C     . HIS A 1 40  ? 27.543  78.494 23.922  1.00 38.80  ? 40   HIS A C     1 
ATOM   333  O  O     . HIS A 1 40  ? 27.763  79.125 24.956  1.00 43.51  ? 40   HIS A O     1 
ATOM   334  C  CB    . HIS A 1 40  ? 25.130  78.150 23.294  1.00 38.91  ? 40   HIS A CB    1 
ATOM   335  C  CG    . HIS A 1 40  ? 24.081  77.170 22.866  1.00 41.98  ? 40   HIS A CG    1 
ATOM   336  N  ND1   . HIS A 1 40  ? 22.768  77.256 23.276  1.00 43.20  ? 40   HIS A ND1   1 
ATOM   337  C  CD2   . HIS A 1 40  ? 24.154  76.080 22.064  1.00 42.19  ? 40   HIS A CD2   1 
ATOM   338  C  CE1   . HIS A 1 40  ? 22.077  76.261 22.748  1.00 42.64  ? 40   HIS A CE1   1 
ATOM   339  N  NE2   . HIS A 1 40  ? 22.894  75.534 22.007  1.00 41.33  ? 40   HIS A NE2   1 
ATOM   340  N  N     . CYS A 1 41  ? 28.286  78.616 22.833  1.00 37.49  ? 41   CYS A N     1 
ATOM   341  C  CA    . CYS A 1 41  ? 29.431  79.508 22.795  1.00 41.45  ? 41   CYS A CA    1 
ATOM   342  C  C     . CYS A 1 41  ? 29.473  80.164 21.422  1.00 43.99  ? 41   CYS A C     1 
ATOM   343  O  O     . CYS A 1 41  ? 28.801  79.699 20.501  1.00 43.01  ? 41   CYS A O     1 
ATOM   344  C  CB    . CYS A 1 41  ? 30.715  78.719 23.063  1.00 42.77  ? 41   CYS A CB    1 
ATOM   345  S  SG    . CYS A 1 41  ? 31.211  77.612 21.728  1.00 48.82  ? 41   CYS A SG    1 
ATOM   346  N  N     . PRO A 1 42  ? 30.246  81.254 21.278  1.00 49.09  ? 42   PRO A N     1 
ATOM   347  C  CA    . PRO A 1 42  ? 30.331  81.908 19.967  1.00 52.11  ? 42   PRO A CA    1 
ATOM   348  C  C     . PRO A 1 42  ? 30.888  80.979 18.894  1.00 56.66  ? 42   PRO A C     1 
ATOM   349  O  O     . PRO A 1 42  ? 31.568  79.997 19.213  1.00 58.47  ? 42   PRO A O     1 
ATOM   350  C  CB    . PRO A 1 42  ? 31.303  83.064 20.217  1.00 51.82  ? 42   PRO A CB    1 
ATOM   351  C  CG    . PRO A 1 42  ? 31.203  83.338 21.671  1.00 51.32  ? 42   PRO A CG    1 
ATOM   352  C  CD    . PRO A 1 42  ? 30.986  82.000 22.311  1.00 49.85  ? 42   PRO A CD    1 
ATOM   353  N  N     . GLU A 1 43  ? 30.590  81.289 17.635  1.00 58.58  ? 43   GLU A N     1 
ATOM   354  C  CA    . GLU A 1 43  ? 31.085  80.511 16.503  1.00 62.15  ? 43   GLU A CA    1 
ATOM   355  C  C     . GLU A 1 43  ? 32.607  80.521 16.459  1.00 62.55  ? 43   GLU A C     1 
ATOM   356  O  O     . GLU A 1 43  ? 33.233  79.552 16.027  1.00 62.65  ? 43   GLU A O     1 
ATOM   357  C  CB    . GLU A 1 43  ? 30.534  81.071 15.188  1.00 67.66  ? 43   GLU A CB    1 
ATOM   358  C  CG    . GLU A 1 43  ? 29.020  81.028 15.062  1.00 73.36  ? 43   GLU A CG    1 
ATOM   359  C  CD    . GLU A 1 43  ? 28.507  79.668 14.636  1.00 80.04  ? 43   GLU A CD    1 
ATOM   360  O  OE1   . GLU A 1 43  ? 27.272  79.484 14.609  1.00 82.11  ? 43   GLU A OE1   1 
ATOM   361  O  OE2   . GLU A 1 43  ? 29.338  78.788 14.323  1.00 83.00  ? 43   GLU A OE2   1 
ATOM   362  N  N     . SER A 1 44  ? 33.193  81.623 16.916  1.00 64.15  ? 44   SER A N     1 
ATOM   363  C  CA    . SER A 1 44  ? 34.638  81.817 16.862  1.00 66.26  ? 44   SER A CA    1 
ATOM   364  C  C     . SER A 1 44  ? 35.380  80.907 17.832  1.00 67.62  ? 44   SER A C     1 
ATOM   365  O  O     . SER A 1 44  ? 36.516  80.515 17.571  1.00 70.49  ? 44   SER A O     1 
ATOM   366  C  CB    . SER A 1 44  ? 34.996  83.282 17.135  1.00 66.63  ? 44   SER A CB    1 
ATOM   367  O  OG    . SER A 1 44  ? 34.579  83.680 18.431  1.00 65.39  ? 44   SER A OG    1 
ATOM   368  N  N     . GLN A 1 45  ? 34.742  80.576 18.951  1.00 67.43  ? 45   GLN A N     1 
ATOM   369  C  CA    . GLN A 1 45  ? 35.366  79.701 19.935  1.00 68.50  ? 45   GLN A CA    1 
ATOM   370  C  C     . GLN A 1 45  ? 35.469  78.283 19.387  1.00 68.96  ? 45   GLN A C     1 
ATOM   371  O  O     . GLN A 1 45  ? 34.468  77.571 19.276  1.00 66.24  ? 45   GLN A O     1 
ATOM   372  C  CB    . GLN A 1 45  ? 34.606  79.725 21.264  1.00 67.99  ? 45   GLN A CB    1 
ATOM   373  C  CG    . GLN A 1 45  ? 35.329  79.001 22.392  1.00 68.39  ? 45   GLN A CG    1 
ATOM   374  C  CD    . GLN A 1 45  ? 34.988  79.559 23.757  1.00 67.99  ? 45   GLN A CD    1 
ATOM   375  N  N     . ALA A 1 46  ? 36.690  77.892 19.027  1.00 70.73  ? 46   ALA A N     1 
ATOM   376  C  CA    . ALA A 1 46  ? 36.953  76.577 18.456  1.00 69.37  ? 46   ALA A CA    1 
ATOM   377  C  C     . ALA A 1 46  ? 36.568  75.476 19.433  1.00 68.91  ? 46   ALA A C     1 
ATOM   378  O  O     . ALA A 1 46  ? 36.904  75.537 20.616  1.00 71.39  ? 46   ALA A O     1 
ATOM   379  C  CB    . ALA A 1 46  ? 38.418  76.452 18.064  1.00 68.90  ? 46   ALA A CB    1 
ATOM   380  N  N     . THR A 1 47  ? 35.858  74.469 18.935  1.00 65.43  ? 47   THR A N     1 
ATOM   381  C  CA    . THR A 1 47  ? 35.412  73.375 19.784  1.00 62.91  ? 47   THR A CA    1 
ATOM   382  C  C     . THR A 1 47  ? 35.150  72.110 18.977  1.00 56.66  ? 47   THR A C     1 
ATOM   383  O  O     . THR A 1 47  ? 35.105  72.141 17.747  1.00 55.44  ? 47   THR A O     1 
ATOM   384  C  CB    . THR A 1 47  ? 34.142  73.763 20.570  1.00 66.28  ? 47   THR A CB    1 
ATOM   385  O  OG1   . THR A 1 47  ? 33.771  72.692 21.447  1.00 68.84  ? 47   THR A OG1   1 
ATOM   386  C  CG2   . THR A 1 47  ? 32.992  74.063 19.619  1.00 65.98  ? 47   THR A CG2   1 
ATOM   387  N  N     . LYS A 1 48  ? 34.987  70.994 19.679  1.00 53.56  ? 48   LYS A N     1 
ATOM   388  C  CA    . LYS A 1 48  ? 34.663  69.728 19.039  1.00 52.98  ? 48   LYS A CA    1 
ATOM   389  C  C     . LYS A 1 48  ? 33.218  69.359 19.350  1.00 53.90  ? 48   LYS A C     1 
ATOM   390  O  O     . LYS A 1 48  ? 32.661  68.424 18.769  1.00 55.09  ? 48   LYS A O     1 
ATOM   391  C  CB    . LYS A 1 48  ? 35.608  68.623 19.523  1.00 53.58  ? 48   LYS A CB    1 
ATOM   392  C  CG    . LYS A 1 48  ? 35.167  67.930 20.808  1.00 53.88  ? 48   LYS A CG    1 
ATOM   393  C  CD    . LYS A 1 48  ? 36.252  67.010 21.357  1.00 54.50  ? 48   LYS A CD    1 
ATOM   394  C  CE    . LYS A 1 48  ? 37.368  67.807 22.016  1.00 54.86  ? 48   LYS A CE    1 
ATOM   395  N  N     . TYR A 1 49  ? 32.614  70.110 20.267  1.00 52.10  ? 49   TYR A N     1 
ATOM   396  C  CA    . TYR A 1 49  ? 31.260  69.827 20.732  1.00 46.90  ? 49   TYR A CA    1 
ATOM   397  C  C     . TYR A 1 49  ? 30.214  70.740 20.103  1.00 45.29  ? 49   TYR A C     1 
ATOM   398  O  O     . TYR A 1 49  ? 30.375  71.962 20.060  1.00 41.62  ? 49   TYR A O     1 
ATOM   399  C  CB    . TYR A 1 49  ? 31.187  69.941 22.254  1.00 44.35  ? 49   TYR A CB    1 
ATOM   400  C  CG    . TYR A 1 49  ? 32.182  69.074 22.987  1.00 44.53  ? 49   TYR A CG    1 
ATOM   401  C  CD1   . TYR A 1 49  ? 33.297  69.632 23.597  1.00 44.79  ? 49   TYR A CD1   1 
ATOM   402  C  CD2   . TYR A 1 49  ? 32.008  67.698 23.071  1.00 44.50  ? 49   TYR A CD2   1 
ATOM   403  C  CE1   . TYR A 1 49  ? 34.211  68.844 24.273  1.00 47.70  ? 49   TYR A CE1   1 
ATOM   404  C  CE2   . TYR A 1 49  ? 32.917  66.902 23.744  1.00 45.98  ? 49   TYR A CE2   1 
ATOM   405  C  CZ    . TYR A 1 49  ? 34.016  67.481 24.343  1.00 49.11  ? 49   TYR A CZ    1 
ATOM   406  O  OH    . TYR A 1 49  ? 34.923  66.690 25.013  1.00 53.56  ? 49   TYR A OH    1 
ATOM   407  N  N     . PHE A 1 50  ? 29.136  70.133 19.622  1.00 46.68  ? 50   PHE A N     1 
ATOM   408  C  CA    . PHE A 1 50  ? 28.022  70.872 19.042  1.00 45.25  ? 50   PHE A CA    1 
ATOM   409  C  C     . PHE A 1 50  ? 26.715  70.259 19.530  1.00 44.31  ? 50   PHE A C     1 
ATOM   410  O  O     . PHE A 1 50  ? 26.664  69.064 19.828  1.00 45.78  ? 50   PHE A O     1 
ATOM   411  C  CB    . PHE A 1 50  ? 28.088  70.818 17.515  1.00 45.25  ? 50   PHE A CB    1 
ATOM   412  C  CG    . PHE A 1 50  ? 29.392  71.306 16.947  1.00 48.69  ? 50   PHE A CG    1 
ATOM   413  C  CD1   . PHE A 1 50  ? 30.465  70.442 16.786  1.00 48.62  ? 50   PHE A CD1   1 
ATOM   414  C  CD2   . PHE A 1 50  ? 29.543  72.630 16.571  1.00 49.00  ? 50   PHE A CD2   1 
ATOM   415  C  CE1   . PHE A 1 50  ? 31.664  70.894 16.268  1.00 48.41  ? 50   PHE A CE1   1 
ATOM   416  C  CE2   . PHE A 1 50  ? 30.739  73.086 16.052  1.00 48.34  ? 50   PHE A CE2   1 
ATOM   417  C  CZ    . PHE A 1 50  ? 31.800  72.218 15.899  1.00 48.53  ? 50   PHE A CZ    1 
ATOM   418  N  N     . ASP A 1 51  ? 25.658  71.062 19.628  1.00 40.34  ? 51   ASP A N     1 
ATOM   419  C  CA    . ASP A 1 51  ? 24.354  70.488 19.938  1.00 35.73  ? 51   ASP A CA    1 
ATOM   420  C  C     . ASP A 1 51  ? 23.816  69.768 18.702  1.00 34.23  ? 51   ASP A C     1 
ATOM   421  O  O     . ASP A 1 51  ? 24.443  69.792 17.642  1.00 35.68  ? 51   ASP A O     1 
ATOM   422  C  CB    . ASP A 1 51  ? 23.362  71.524 20.504  1.00 34.98  ? 51   ASP A CB    1 
ATOM   423  C  CG    . ASP A 1 51  ? 22.937  72.596 19.486  1.00 37.80  ? 51   ASP A CG    1 
ATOM   424  O  OD1   . ASP A 1 51  ? 23.116  72.413 18.267  1.00 41.24  ? 51   ASP A OD1   1 
ATOM   425  O  OD2   . ASP A 1 51  ? 22.391  73.639 19.914  1.00 36.17  ? 51   ASP A OD2   1 
ATOM   426  N  N     . ILE A 1 52  ? 22.651  69.146 18.827  1.00 34.53  ? 52   ILE A N     1 
ATOM   427  C  CA    . ILE A 1 52  ? 22.099  68.362 17.730  1.00 35.84  ? 52   ILE A CA    1 
ATOM   428  C  C     . ILE A 1 52  ? 21.738  69.238 16.525  1.00 37.45  ? 52   ILE A C     1 
ATOM   429  O  O     . ILE A 1 52  ? 21.558  68.740 15.413  1.00 40.07  ? 52   ILE A O     1 
ATOM   430  C  CB    . ILE A 1 52  ? 20.871  67.553 18.185  1.00 35.26  ? 52   ILE A CB    1 
ATOM   431  C  CG1   . ILE A 1 52  ? 19.723  68.493 18.543  1.00 30.21  ? 52   ILE A CG1   1 
ATOM   432  C  CG2   . ILE A 1 52  ? 21.225  66.673 19.377  1.00 29.59  ? 52   ILE A CG2   1 
ATOM   433  C  CD1   . ILE A 1 52  ? 18.491  67.782 19.043  1.00 37.31  ? 52   ILE A CD1   1 
ATOM   434  N  N     . TYR A 1 53  ? 21.653  70.545 16.752  1.00 35.11  ? 53   TYR A N     1 
ATOM   435  C  CA    . TYR A 1 53  ? 21.281  71.484 15.703  1.00 33.55  ? 53   TYR A CA    1 
ATOM   436  C  C     . TYR A 1 53  ? 22.499  72.153 15.077  1.00 37.61  ? 53   TYR A C     1 
ATOM   437  O  O     . TYR A 1 53  ? 22.357  73.015 14.210  1.00 39.06  ? 53   TYR A O     1 
ATOM   438  C  CB    . TYR A 1 53  ? 20.331  72.546 16.249  1.00 32.24  ? 53   TYR A CB    1 
ATOM   439  C  CG    . TYR A 1 53  ? 19.137  71.985 16.988  1.00 35.65  ? 53   TYR A CG    1 
ATOM   440  C  CD1   . TYR A 1 53  ? 19.066  72.042 18.373  1.00 34.59  ? 53   TYR A CD1   1 
ATOM   441  C  CD2   . TYR A 1 53  ? 18.084  71.391 16.302  1.00 37.10  ? 53   TYR A CD2   1 
ATOM   442  C  CE1   . TYR A 1 53  ? 17.976  71.529 19.057  1.00 35.76  ? 53   TYR A CE1   1 
ATOM   443  C  CE2   . TYR A 1 53  ? 16.990  70.873 16.976  1.00 37.51  ? 53   TYR A CE2   1 
ATOM   444  C  CZ    . TYR A 1 53  ? 16.941  70.945 18.354  1.00 36.21  ? 53   TYR A CZ    1 
ATOM   445  O  OH    . TYR A 1 53  ? 15.856  70.430 19.032  1.00 34.45  ? 53   TYR A OH    1 
ATOM   446  N  N     . GLY A 1 54  ? 23.691  71.766 15.527  1.00 40.52  ? 54   GLY A N     1 
ATOM   447  C  CA    . GLY A 1 54  ? 24.931  72.253 14.942  1.00 39.40  ? 54   GLY A CA    1 
ATOM   448  C  C     . GLY A 1 54  ? 25.561  73.456 15.624  1.00 39.75  ? 54   GLY A C     1 
ATOM   449  O  O     . GLY A 1 54  ? 26.621  73.923 15.212  1.00 42.61  ? 54   GLY A O     1 
ATOM   450  N  N     . LYS A 1 55  ? 24.915  73.968 16.665  1.00 40.26  ? 55   LYS A N     1 
ATOM   451  C  CA    . LYS A 1 55  ? 25.447  75.120 17.387  1.00 43.46  ? 55   LYS A CA    1 
ATOM   452  C  C     . LYS A 1 55  ? 26.614  74.700 18.274  1.00 42.77  ? 55   LYS A C     1 
ATOM   453  O  O     . LYS A 1 55  ? 26.513  73.718 19.008  1.00 45.18  ? 55   LYS A O     1 
ATOM   454  C  CB    . LYS A 1 55  ? 24.351  75.784 18.223  1.00 45.16  ? 55   LYS A CB    1 
ATOM   455  C  CG    . LYS A 1 55  ? 23.140  76.201 17.410  1.00 50.71  ? 55   LYS A CG    1 
ATOM   456  C  CD    . LYS A 1 55  ? 23.554  77.100 16.256  1.00 57.80  ? 55   LYS A CD    1 
ATOM   457  C  CE    . LYS A 1 55  ? 22.402  77.348 15.296  1.00 62.01  ? 55   LYS A CE    1 
ATOM   458  N  NZ    . LYS A 1 55  ? 22.820  78.206 14.151  1.00 63.84  ? 55   LYS A NZ    1 
ATOM   459  N  N     . PRO A 1 56  ? 27.730  75.444 18.208  1.00 39.02  ? 56   PRO A N     1 
ATOM   460  C  CA    . PRO A 1 56  ? 28.906  75.081 19.004  1.00 38.48  ? 56   PRO A CA    1 
ATOM   461  C  C     . PRO A 1 56  ? 28.646  75.248 20.497  1.00 36.50  ? 56   PRO A C     1 
ATOM   462  O  O     . PRO A 1 56  ? 27.851  76.097 20.903  1.00 32.85  ? 56   PRO A O     1 
ATOM   463  C  CB    . PRO A 1 56  ? 29.973  76.074 18.529  1.00 34.70  ? 56   PRO A CB    1 
ATOM   464  C  CG    . PRO A 1 56  ? 29.201  77.248 18.049  1.00 39.37  ? 56   PRO A CG    1 
ATOM   465  C  CD    . PRO A 1 56  ? 27.942  76.685 17.444  1.00 40.83  ? 56   PRO A CD    1 
ATOM   466  N  N     . CYS A 1 57  ? 29.306  74.423 21.299  1.00 34.98  ? 57   CYS A N     1 
ATOM   467  C  CA    . CYS A 1 57  ? 29.167  74.486 22.742  1.00 36.03  ? 57   CYS A CA    1 
ATOM   468  C  C     . CYS A 1 57  ? 30.529  74.336 23.386  1.00 39.29  ? 57   CYS A C     1 
ATOM   469  O  O     . CYS A 1 57  ? 31.404  73.665 22.848  1.00 41.19  ? 57   CYS A O     1 
ATOM   470  C  CB    . CYS A 1 57  ? 28.271  73.352 23.248  1.00 35.95  ? 57   CYS A CB    1 
ATOM   471  S  SG    . CYS A 1 57  ? 26.602  73.306 22.565  1.00 54.29  ? 57   CYS A SG    1 
ATOM   472  N  N     A THR A 1 58  ? 30.717  74.964 24.542  0.52 40.76  ? 58   THR A N     1 
ATOM   473  N  N     B THR A 1 58  ? 30.705  74.975 24.535  0.48 40.74  ? 58   THR A N     1 
ATOM   474  C  CA    A THR A 1 58  ? 31.931  74.752 25.321  0.52 41.23  ? 58   THR A CA    1 
ATOM   475  C  CA    B THR A 1 58  ? 31.899  74.772 25.338  0.48 41.13  ? 58   THR A CA    1 
ATOM   476  C  C     A THR A 1 58  ? 31.654  73.803 26.475  0.52 40.96  ? 58   THR A C     1 
ATOM   477  C  C     B THR A 1 58  ? 31.592  73.715 26.392  0.48 40.83  ? 58   THR A C     1 
ATOM   478  O  O     A THR A 1 58  ? 30.637  73.919 27.161  0.52 40.37  ? 58   THR A O     1 
ATOM   479  O  O     B THR A 1 58  ? 30.479  73.655 26.915  0.48 40.08  ? 58   THR A O     1 
ATOM   480  C  CB    A THR A 1 58  ? 32.526  76.067 25.866  0.52 41.00  ? 58   THR A CB    1 
ATOM   481  C  CB    B THR A 1 58  ? 32.375  76.085 26.006  0.48 41.58  ? 58   THR A CB    1 
ATOM   482  O  OG1   A THR A 1 58  ? 31.485  76.875 26.429  0.52 42.05  ? 58   THR A OG1   1 
ATOM   483  O  OG1   B THR A 1 58  ? 33.536  75.829 26.804  0.48 41.45  ? 58   THR A OG1   1 
ATOM   484  C  CG2   A THR A 1 58  ? 33.222  76.834 24.757  0.52 38.53  ? 58   THR A CG2   1 
ATOM   485  C  CG2   B THR A 1 58  ? 31.282  76.680 26.884  0.48 41.77  ? 58   THR A CG2   1 
ATOM   486  N  N     . ARG A 1 59  ? 32.567  72.861 26.679  1.00 40.94  ? 59   ARG A N     1 
ATOM   487  C  CA    . ARG A 1 59  ? 32.410  71.859 27.720  1.00 39.71  ? 59   ARG A CA    1 
ATOM   488  C  C     . ARG A 1 59  ? 32.826  72.453 29.056  1.00 42.48  ? 59   ARG A C     1 
ATOM   489  O  O     . ARG A 1 59  ? 33.892  73.055 29.167  1.00 46.08  ? 59   ARG A O     1 
ATOM   490  C  CB    . ARG A 1 59  ? 33.251  70.622 27.407  1.00 38.54  ? 59   ARG A CB    1 
ATOM   491  C  CG    . ARG A 1 59  ? 33.089  69.494 28.410  1.00 38.31  ? 59   ARG A CG    1 
ATOM   492  C  CD    . ARG A 1 59  ? 33.845  68.247 27.978  1.00 39.80  ? 59   ARG A CD    1 
ATOM   493  N  NE    . ARG A 1 59  ? 35.286  68.463 27.939  1.00 42.63  ? 59   ARG A NE    1 
ATOM   494  C  CZ    . ARG A 1 59  ? 36.091  68.308 28.986  1.00 46.51  ? 59   ARG A CZ    1 
ATOM   495  N  NH1   . ARG A 1 59  ? 35.590  67.940 30.157  1.00 49.02  ? 59   ARG A NH1   1 
ATOM   496  N  NH2   . ARG A 1 59  ? 37.395  68.523 28.864  1.00 46.09  ? 59   ARG A NH2   1 
ATOM   497  N  N     . LYS A 1 60  ? 31.976  72.303 30.063  1.00 42.78  ? 60   LYS A N     1 
ATOM   498  C  CA    . LYS A 1 60  ? 32.316  72.746 31.406  1.00 46.28  ? 60   LYS A CA    1 
ATOM   499  C  C     . LYS A 1 60  ? 32.551  71.541 32.308  1.00 48.30  ? 60   LYS A C     1 
ATOM   500  O  O     . LYS A 1 60  ? 31.612  70.832 32.667  1.00 49.70  ? 60   LYS A O     1 
ATOM   501  C  CB    . LYS A 1 60  ? 31.219  73.646 31.985  1.00 48.72  ? 60   LYS A CB    1 
ATOM   502  C  CG    . LYS A 1 60  ? 31.079  74.995 31.284  1.00 53.04  ? 60   LYS A CG    1 
ATOM   503  C  CD    . LYS A 1 60  ? 30.136  75.928 32.038  1.00 55.51  ? 60   LYS A CD    1 
ATOM   504  C  CE    . LYS A 1 60  ? 30.783  76.529 33.283  1.00 58.44  ? 60   LYS A CE    1 
ATOM   505  N  NZ    . LYS A 1 60  ? 31.700  77.662 32.955  1.00 61.71  ? 60   LYS A NZ    1 
ATOM   506  N  N     . LEU A 1 61  ? 33.809  71.295 32.653  1.00 47.97  ? 61   LEU A N     1 
ATOM   507  C  CA    . LEU A 1 61  ? 34.125  70.233 33.594  1.00 47.33  ? 61   LEU A CA    1 
ATOM   508  C  C     . LEU A 1 61  ? 33.883  70.762 34.998  1.00 47.25  ? 61   LEU A C     1 
ATOM   509  O  O     . LEU A 1 61  ? 34.223  71.906 35.310  1.00 47.73  ? 61   LEU A O     1 
ATOM   510  C  CB    . LEU A 1 61  ? 35.574  69.767 33.439  1.00 49.13  ? 61   LEU A CB    1 
ATOM   511  C  CG    . LEU A 1 61  ? 35.987  68.517 34.225  1.00 49.46  ? 61   LEU A CG    1 
ATOM   512  C  CD1   . LEU A 1 61  ? 35.344  67.264 33.641  1.00 48.70  ? 61   LEU A CD1   1 
ATOM   513  C  CD2   . LEU A 1 61  ? 37.502  68.375 34.273  1.00 49.95  ? 61   LEU A CD2   1 
ATOM   514  N  N     . PHE A 1 62  ? 33.279  69.933 35.838  1.00 45.59  ? 62   PHE A N     1 
ATOM   515  C  CA    . PHE A 1 62  ? 32.973  70.330 37.201  1.00 46.53  ? 62   PHE A CA    1 
ATOM   516  C  C     . PHE A 1 62  ? 33.777  69.510 38.197  1.00 51.71  ? 62   PHE A C     1 
ATOM   517  O  O     . PHE A 1 62  ? 34.088  68.344 37.950  1.00 55.15  ? 62   PHE A O     1 
ATOM   518  C  CB    . PHE A 1 62  ? 31.475  70.192 37.472  1.00 43.67  ? 62   PHE A CB    1 
ATOM   519  C  CG    . PHE A 1 62  ? 30.630  71.150 36.683  1.00 40.91  ? 62   PHE A CG    1 
ATOM   520  C  CD1   . PHE A 1 62  ? 30.127  70.794 35.442  1.00 38.36  ? 62   PHE A CD1   1 
ATOM   521  C  CD2   . PHE A 1 62  ? 30.349  72.414 37.177  1.00 36.96  ? 62   PHE A CD2   1 
ATOM   522  C  CE1   . PHE A 1 62  ? 29.355  71.679 34.710  1.00 35.62  ? 62   PHE A CE1   1 
ATOM   523  C  CE2   . PHE A 1 62  ? 29.580  73.298 36.451  1.00 34.99  ? 62   PHE A CE2   1 
ATOM   524  C  CZ    . PHE A 1 62  ? 29.081  72.931 35.217  1.00 34.91  ? 62   PHE A CZ    1 
ATOM   525  N  N     . ALA A 1 63  ? 34.119  70.132 39.320  1.00 52.69  ? 63   ALA A N     1 
ATOM   526  C  CA    . ALA A 1 63  ? 34.886  69.465 40.362  1.00 54.45  ? 63   ALA A CA    1 
ATOM   527  C  C     . ALA A 1 63  ? 34.077  68.326 40.970  1.00 53.72  ? 63   ALA A C     1 
ATOM   528  O  O     . ALA A 1 63  ? 34.626  67.290 41.351  1.00 54.90  ? 63   ALA A O     1 
ATOM   529  C  CB    . ALA A 1 63  ? 35.296  70.461 41.433  1.00 57.84  ? 63   ALA A CB    1 
ATOM   530  N  N     . ASN A 1 64  ? 32.768  68.526 41.055  1.00 52.50  ? 64   ASN A N     1 
ATOM   531  C  CA    . ASN A 1 64  ? 31.870  67.499 41.564  1.00 53.84  ? 64   ASN A CA    1 
ATOM   532  C  C     . ASN A 1 64  ? 30.469  67.634 40.979  1.00 52.86  ? 64   ASN A C     1 
ATOM   533  O  O     . ASN A 1 64  ? 30.160  68.621 40.307  1.00 51.75  ? 64   ASN A O     1 
ATOM   534  C  CB    . ASN A 1 64  ? 31.827  67.517 43.093  1.00 55.95  ? 64   ASN A CB    1 
ATOM   535  C  CG    . ASN A 1 64  ? 31.655  68.913 43.657  1.00 59.65  ? 64   ASN A CG    1 
ATOM   536  O  OD1   . ASN A 1 64  ? 30.552  69.460 43.669  1.00 60.82  ? 64   ASN A OD1   1 
ATOM   537  N  ND2   . ASN A 1 64  ? 32.749  69.495 44.136  1.00 61.53  ? 64   ASN A ND2   1 
ATOM   538  N  N     . MET A 1 65  ? 29.628  66.637 41.235  1.00 50.32  ? 65   MET A N     1 
ATOM   539  C  CA    . MET A 1 65  ? 28.294  66.601 40.646  1.00 47.49  ? 65   MET A CA    1 
ATOM   540  C  C     . MET A 1 65  ? 27.368  67.670 41.214  1.00 51.55  ? 65   MET A C     1 
ATOM   541  O  O     . MET A 1 65  ? 26.544  68.232 40.492  1.00 52.81  ? 65   MET A O     1 
ATOM   542  C  CB    . MET A 1 65  ? 27.677  65.211 40.792  1.00 41.78  ? 65   MET A CB    1 
ATOM   543  C  CG    . MET A 1 65  ? 28.311  64.181 39.871  1.00 40.99  ? 65   MET A CG    1 
ATOM   544  S  SD    . MET A 1 65  ? 27.655  62.515 40.076  1.00 44.18  ? 65   MET A SD    1 
ATOM   545  C  CE    . MET A 1 65  ? 28.175  62.146 41.748  1.00 41.97  ? 65   MET A CE    1 
ATOM   546  N  N     . ARG A 1 66  ? 27.509  67.956 42.503  1.00 53.30  ? 66   ARG A N     1 
ATOM   547  C  CA    . ARG A 1 66  ? 26.675  68.970 43.136  1.00 55.23  ? 66   ARG A CA    1 
ATOM   548  C  C     . ARG A 1 66  ? 26.990  70.365 42.601  1.00 53.25  ? 66   ARG A C     1 
ATOM   549  O  O     . ARG A 1 66  ? 26.115  71.224 42.552  1.00 52.07  ? 66   ARG A O     1 
ATOM   550  C  CB    . ARG A 1 66  ? 26.787  68.904 44.664  1.00 61.60  ? 66   ARG A CB    1 
ATOM   551  C  CG    . ARG A 1 66  ? 26.061  67.696 45.270  1.00 63.68  ? 66   ARG A CG    1 
ATOM   552  C  CD    . ARG A 1 66  ? 26.310  67.567 46.766  1.00 65.39  ? 66   ARG A CD    1 
ATOM   553  N  N     . ASP A 1 67  ? 28.234  70.580 42.180  1.00 53.44  ? 67   ASP A N     1 
ATOM   554  C  CA    . ASP A 1 67  ? 28.609  71.829 41.521  1.00 52.78  ? 67   ASP A CA    1 
ATOM   555  C  C     . ASP A 1 67  ? 27.975  71.923 40.136  1.00 51.49  ? 67   ASP A C     1 
ATOM   556  O  O     . ASP A 1 67  ? 27.624  73.009 39.674  1.00 53.40  ? 67   ASP A O     1 
ATOM   557  C  CB    . ASP A 1 67  ? 30.131  71.959 41.407  1.00 53.00  ? 67   ASP A CB    1 
ATOM   558  C  CG    . ASP A 1 67  ? 30.770  72.498 42.673  1.00 56.49  ? 67   ASP A CG    1 
ATOM   559  O  OD1   . ASP A 1 67  ? 30.064  73.149 43.473  1.00 58.25  ? 67   ASP A OD1   1 
ATOM   560  O  OD2   . ASP A 1 67  ? 31.984  72.279 42.862  1.00 57.69  ? 67   ASP A OD2   1 
ATOM   561  N  N     . ALA A 1 68  ? 27.833  70.778 39.479  1.00 47.17  ? 68   ALA A N     1 
ATOM   562  C  CA    . ALA A 1 68  ? 27.263  70.733 38.140  1.00 43.74  ? 68   ALA A CA    1 
ATOM   563  C  C     . ALA A 1 68  ? 25.768  71.023 38.168  1.00 46.85  ? 68   ALA A C     1 
ATOM   564  O  O     . ALA A 1 68  ? 25.227  71.615 37.235  1.00 49.37  ? 68   ALA A O     1 
ATOM   565  C  CB    . ALA A 1 68  ? 27.532  69.387 37.496  1.00 41.10  ? 68   ALA A CB    1 
ATOM   566  N  N     A SER A 1 69  ? 25.109  70.601 39.243  0.50 46.69  ? 69   SER A N     1 
ATOM   567  N  N     B SER A 1 69  ? 25.104  70.603 39.241  0.50 46.69  ? 69   SER A N     1 
ATOM   568  C  CA    A SER A 1 69  ? 23.674  70.809 39.405  0.50 45.87  ? 69   SER A CA    1 
ATOM   569  C  CA    B SER A 1 69  ? 23.667  70.815 39.383  0.50 45.85  ? 69   SER A CA    1 
ATOM   570  C  C     A SER A 1 69  ? 23.373  72.259 39.762  0.50 47.36  ? 69   SER A C     1 
ATOM   571  C  C     B SER A 1 69  ? 23.354  72.255 39.782  0.50 47.37  ? 69   SER A C     1 
ATOM   572  O  O     A SER A 1 69  ? 22.416  72.848 39.259  0.50 47.03  ? 69   SER A O     1 
ATOM   573  O  O     B SER A 1 69  ? 22.370  72.835 39.323  0.50 47.07  ? 69   SER A O     1 
ATOM   574  C  CB    A SER A 1 69  ? 23.122  69.885 40.490  0.50 45.02  ? 69   SER A CB    1 
ATOM   575  C  CB    B SER A 1 69  ? 23.077  69.844 40.408  0.50 44.91  ? 69   SER A CB    1 
ATOM   576  O  OG    A SER A 1 69  ? 23.485  68.539 40.245  0.50 43.88  ? 69   SER A OG    1 
ATOM   577  O  OG    B SER A 1 69  ? 23.583  70.101 41.707  0.50 45.89  ? 69   SER A OG    1 
ATOM   578  N  N     . GLN A 1 70  ? 24.196  72.826 40.639  1.00 49.63  ? 70   GLN A N     1 
ATOM   579  C  CA    . GLN A 1 70  ? 24.036  74.213 41.062  1.00 53.06  ? 70   GLN A CA    1 
ATOM   580  C  C     . GLN A 1 70  ? 24.251  75.147 39.880  1.00 48.81  ? 70   GLN A C     1 
ATOM   581  O  O     . GLN A 1 70  ? 23.691  76.241 39.829  1.00 50.62  ? 70   GLN A O     1 
ATOM   582  C  CB    . GLN A 1 70  ? 25.014  74.554 42.190  1.00 61.94  ? 70   GLN A CB    1 
ATOM   583  C  CG    . GLN A 1 70  ? 24.665  73.928 43.535  1.00 69.71  ? 70   GLN A CG    1 
ATOM   584  C  CD    . GLN A 1 70  ? 25.809  74.002 44.533  1.00 78.57  ? 70   GLN A CD    1 
ATOM   585  O  OE1   . GLN A 1 70  ? 26.857  74.589 44.254  1.00 81.86  ? 70   GLN A OE1   1 
ATOM   586  N  NE2   . GLN A 1 70  ? 25.615  73.399 45.704  1.00 81.26  ? 70   GLN A NE2   1 
ATOM   587  N  N     . TRP A 1 71  ? 25.065  74.703 38.928  1.00 44.71  ? 71   TRP A N     1 
ATOM   588  C  CA    . TRP A 1 71  ? 25.294  75.455 37.706  1.00 41.35  ? 71   TRP A CA    1 
ATOM   589  C  C     . TRP A 1 71  ? 24.066  75.414 36.803  1.00 40.61  ? 71   TRP A C     1 
ATOM   590  O  O     . TRP A 1 71  ? 23.746  76.401 36.143  1.00 44.78  ? 71   TRP A O     1 
ATOM   591  C  CB    . TRP A 1 71  ? 26.519  74.922 36.963  1.00 38.21  ? 71   TRP A CB    1 
ATOM   592  C  CG    . TRP A 1 71  ? 26.790  75.632 35.676  1.00 37.43  ? 71   TRP A CG    1 
ATOM   593  C  CD1   . TRP A 1 71  ? 27.414  76.837 35.518  1.00 36.57  ? 71   TRP A CD1   1 
ATOM   594  C  CD2   . TRP A 1 71  ? 26.449  75.181 34.361  1.00 36.64  ? 71   TRP A CD2   1 
ATOM   595  N  NE1   . TRP A 1 71  ? 27.480  77.164 34.185  1.00 35.78  ? 71   TRP A NE1   1 
ATOM   596  C  CE2   . TRP A 1 71  ? 26.895  76.163 33.453  1.00 36.55  ? 71   TRP A CE2   1 
ATOM   597  C  CE3   . TRP A 1 71  ? 25.809  74.042 33.862  1.00 35.90  ? 71   TRP A CE3   1 
ATOM   598  C  CZ2   . TRP A 1 71  ? 26.719  76.042 32.075  1.00 35.58  ? 71   TRP A CZ2   1 
ATOM   599  C  CZ3   . TRP A 1 71  ? 25.638  73.923 32.494  1.00 35.01  ? 71   TRP A CZ3   1 
ATOM   600  C  CH2   . TRP A 1 71  ? 26.091  74.917 31.617  1.00 31.74  ? 71   TRP A CH2   1 
ATOM   601  N  N     . ILE A 1 72  ? 23.382  74.275 36.774  1.00 38.44  ? 72   ILE A N     1 
ATOM   602  C  CA    . ILE A 1 72  ? 22.148  74.158 36.004  1.00 37.38  ? 72   ILE A CA    1 
ATOM   603  C  C     . ILE A 1 72  ? 21.106  75.119 36.555  1.00 38.75  ? 72   ILE A C     1 
ATOM   604  O  O     . ILE A 1 72  ? 20.421  75.807 35.796  1.00 40.53  ? 72   ILE A O     1 
ATOM   605  C  CB    . ILE A 1 72  ? 21.578  72.725 36.035  1.00 36.87  ? 72   ILE A CB    1 
ATOM   606  C  CG1   . ILE A 1 72  ? 22.559  71.744 35.396  1.00 36.50  ? 72   ILE A CG1   1 
ATOM   607  C  CG2   . ILE A 1 72  ? 20.237  72.661 35.317  1.00 35.90  ? 72   ILE A CG2   1 
ATOM   608  C  CD1   . ILE A 1 72  ? 22.054  70.314 35.352  1.00 34.68  ? 72   ILE A CD1   1 
ATOM   609  N  N     . LYS A 1 73  ? 21.002  75.168 37.882  1.00 40.75  ? 73   LYS A N     1 
ATOM   610  C  CA    . LYS A 1 73  ? 20.062  76.063 38.556  1.00 41.30  ? 73   LYS A CA    1 
ATOM   611  C  C     . LYS A 1 73  ? 20.365  77.522 38.233  1.00 43.44  ? 73   LYS A C     1 
ATOM   612  O  O     . LYS A 1 73  ? 19.455  78.316 38.002  1.00 43.28  ? 73   LYS A O     1 
ATOM   613  C  CB    . LYS A 1 73  ? 20.085  75.838 40.070  1.00 39.17  ? 73   LYS A CB    1 
ATOM   614  N  N     . ARG A 1 74  ? 21.648  77.868 38.211  1.00 45.80  ? 74   ARG A N     1 
ATOM   615  C  CA    . ARG A 1 74  ? 22.054  79.230 37.884  1.00 49.43  ? 74   ARG A CA    1 
ATOM   616  C  C     . ARG A 1 74  ? 21.746  79.586 36.434  1.00 48.22  ? 74   ARG A C     1 
ATOM   617  O  O     . ARG A 1 74  ? 21.300  80.698 36.148  1.00 47.69  ? 74   ARG A O     1 
ATOM   618  C  CB    . ARG A 1 74  ? 23.536  79.460 38.196  1.00 51.74  ? 74   ARG A CB    1 
ATOM   619  C  CG    . ARG A 1 74  ? 23.817  79.720 39.668  1.00 55.82  ? 74   ARG A CG    1 
ATOM   620  C  CD    . ARG A 1 74  ? 25.150  80.421 39.867  1.00 58.98  ? 74   ARG A CD    1 
ATOM   621  N  NE    . ARG A 1 74  ? 26.255  79.658 39.297  1.00 61.24  ? 74   ARG A NE    1 
ATOM   622  C  CZ    . ARG A 1 74  ? 26.889  78.677 39.932  1.00 63.42  ? 74   ARG A CZ    1 
ATOM   623  N  NH1   . ARG A 1 74  ? 26.526  78.336 41.161  1.00 64.11  ? 74   ARG A NH1   1 
ATOM   624  N  NH2   . ARG A 1 74  ? 27.883  78.034 39.336  1.00 64.50  ? 74   ARG A NH2   1 
ATOM   625  N  N     . MET A 1 75  ? 21.975  78.642 35.524  1.00 45.75  ? 75   MET A N     1 
ATOM   626  C  CA    . MET A 1 75  ? 21.714  78.876 34.104  1.00 44.64  ? 75   MET A CA    1 
ATOM   627  C  C     . MET A 1 75  ? 20.227  79.071 33.850  1.00 46.54  ? 75   MET A C     1 
ATOM   628  O  O     . MET A 1 75  ? 19.833  79.763 32.912  1.00 46.83  ? 75   MET A O     1 
ATOM   629  C  CB    . MET A 1 75  ? 22.265  77.737 33.249  1.00 41.94  ? 75   MET A CB    1 
ATOM   630  C  CG    . MET A 1 75  ? 23.783  77.684 33.213  1.00 41.34  ? 75   MET A CG    1 
ATOM   631  S  SD    . MET A 1 75  ? 24.522  79.019 32.253  1.00 40.91  ? 75   MET A SD    1 
ATOM   632  C  CE    . MET A 1 75  ? 24.234  78.446 30.581  1.00 32.63  ? 75   MET A CE    1 
ATOM   633  N  N     . GLU A 1 76  ? 19.407  78.460 34.697  1.00 49.98  ? 76   GLU A N     1 
ATOM   634  C  CA    . GLU A 1 76  ? 17.971  78.696 34.669  1.00 53.26  ? 76   GLU A CA    1 
ATOM   635  C  C     . GLU A 1 76  ? 17.673  80.128 35.115  1.00 51.50  ? 76   GLU A C     1 
ATOM   636  O  O     . GLU A 1 76  ? 16.902  80.834 34.470  1.00 50.50  ? 76   GLU A O     1 
ATOM   637  C  CB    . GLU A 1 76  ? 17.257  77.695 35.577  1.00 56.89  ? 76   GLU A CB    1 
ATOM   638  C  CG    . GLU A 1 76  ? 15.749  77.845 35.621  1.00 61.79  ? 76   GLU A CG    1 
ATOM   639  C  CD    . GLU A 1 76  ? 15.110  76.907 36.627  1.00 66.32  ? 76   GLU A CD    1 
ATOM   640  O  OE1   . GLU A 1 76  ? 15.804  76.491 37.581  1.00 66.23  ? 76   GLU A OE1   1 
ATOM   641  O  OE2   . GLU A 1 76  ? 13.915  76.579 36.461  1.00 68.59  ? 76   GLU A OE2   1 
ATOM   642  N  N     . ASP A 1 77  ? 18.302  80.549 36.211  1.00 52.12  ? 77   ASP A N     1 
ATOM   643  C  CA    . ASP A 1 77  ? 18.103  81.888 36.762  1.00 55.26  ? 77   ASP A CA    1 
ATOM   644  C  C     . ASP A 1 77  ? 18.628  82.986 35.840  1.00 55.56  ? 77   ASP A C     1 
ATOM   645  O  O     . ASP A 1 77  ? 18.197  84.136 35.927  1.00 57.37  ? 77   ASP A O     1 
ATOM   646  C  CB    . ASP A 1 77  ? 18.764  82.017 38.138  1.00 59.70  ? 77   ASP A CB    1 
ATOM   647  C  CG    . ASP A 1 77  ? 18.184  81.060 39.164  1.00 62.74  ? 77   ASP A CG    1 
ATOM   648  O  OD1   . ASP A 1 77  ? 17.007  80.664 39.022  1.00 62.64  ? 77   ASP A OD1   1 
ATOM   649  O  OD2   . ASP A 1 77  ? 18.910  80.711 40.118  1.00 63.90  ? 77   ASP A OD2   1 
ATOM   650  N  N     . ILE A 1 78  ? 19.572  82.634 34.973  1.00 53.15  ? 78   ILE A N     1 
ATOM   651  C  CA    . ILE A 1 78  ? 20.106  83.577 33.993  1.00 48.62  ? 78   ILE A CA    1 
ATOM   652  C  C     . ILE A 1 78  ? 19.197  83.613 32.771  1.00 48.68  ? 78   ILE A C     1 
ATOM   653  O  O     . ILE A 1 78  ? 18.967  84.671 32.182  1.00 52.36  ? 78   ILE A O     1 
ATOM   654  C  CB    . ILE A 1 78  ? 21.534  83.195 33.555  1.00 44.83  ? 78   ILE A CB    1 
ATOM   655  C  CG1   . ILE A 1 78  ? 22.504  83.313 34.731  1.00 46.29  ? 78   ILE A CG1   1 
ATOM   656  C  CG2   . ILE A 1 78  ? 22.004  84.079 32.409  1.00 43.51  ? 78   ILE A CG2   1 
ATOM   657  C  CD1   . ILE A 1 78  ? 23.920  82.881 34.403  1.00 45.71  ? 78   ILE A CD1   1 
ATOM   658  N  N     . GLY A 1 79  ? 18.673  82.448 32.406  1.00 46.86  ? 79   GLY A N     1 
ATOM   659  C  CA    . GLY A 1 79  ? 17.786  82.332 31.265  1.00 46.66  ? 79   GLY A CA    1 
ATOM   660  C  C     . GLY A 1 79  ? 18.466  81.696 30.069  1.00 47.45  ? 79   GLY A C     1 
ATOM   661  O  O     . GLY A 1 79  ? 18.074  81.930 28.926  1.00 50.16  ? 79   GLY A O     1 
ATOM   662  N  N     . LEU A 1 80  ? 19.489  80.889 30.330  1.00 44.66  ? 80   LEU A N     1 
ATOM   663  C  CA    . LEU A 1 80  ? 20.236  80.234 29.260  1.00 39.92  ? 80   LEU A CA    1 
ATOM   664  C  C     . LEU A 1 80  ? 20.167  78.716 29.359  1.00 40.05  ? 80   LEU A C     1 
ATOM   665  O  O     . LEU A 1 80  ? 20.069  78.154 30.451  1.00 41.05  ? 80   LEU A O     1 
ATOM   666  C  CB    . LEU A 1 80  ? 21.693  80.689 29.262  1.00 36.46  ? 80   LEU A CB    1 
ATOM   667  C  CG    . LEU A 1 80  ? 21.965  82.131 28.839  1.00 37.55  ? 80   LEU A CG    1 
ATOM   668  C  CD1   . LEU A 1 80  ? 23.425  82.473 29.072  1.00 37.55  ? 80   LEU A CD1   1 
ATOM   669  C  CD2   . LEU A 1 80  ? 21.586  82.346 27.380  1.00 36.91  ? 80   LEU A CD2   1 
ATOM   670  N  N     . GLU A 1 81  ? 20.226  78.058 28.207  1.00 39.68  ? 81   GLU A N     1 
ATOM   671  C  CA    . GLU A 1 81  ? 20.148  76.606 28.147  1.00 38.34  ? 81   GLU A CA    1 
ATOM   672  C  C     . GLU A 1 81  ? 21.387  75.936 28.745  1.00 37.07  ? 81   GLU A C     1 
ATOM   673  O  O     . GLU A 1 81  ? 22.520  76.300 28.434  1.00 37.99  ? 81   GLU A O     1 
ATOM   674  C  CB    . GLU A 1 81  ? 19.946  76.148 26.701  1.00 39.76  ? 81   GLU A CB    1 
ATOM   675  C  CG    . GLU A 1 81  ? 19.713  74.657 26.551  1.00 43.56  ? 81   GLU A CG    1 
ATOM   676  C  CD    . GLU A 1 81  ? 19.541  74.237 25.105  1.00 46.84  ? 81   GLU A CD    1 
ATOM   677  O  OE1   . GLU A 1 81  ? 19.599  75.114 24.217  1.00 48.88  ? 81   GLU A OE1   1 
ATOM   678  O  OE2   . GLU A 1 81  ? 19.348  73.028 24.856  1.00 47.58  ? 81   GLU A OE2   1 
ATOM   679  N  N     . ALA A 1 82  ? 21.159  74.959 29.614  1.00 34.44  ? 82   ALA A N     1 
ATOM   680  C  CA    . ALA A 1 82  ? 22.242  74.161 30.167  1.00 34.73  ? 82   ALA A CA    1 
ATOM   681  C  C     . ALA A 1 82  ? 22.198  72.766 29.554  1.00 32.04  ? 82   ALA A C     1 
ATOM   682  O  O     . ALA A 1 82  ? 21.414  71.918 29.977  1.00 33.52  ? 82   ALA A O     1 
ATOM   683  C  CB    . ALA A 1 82  ? 22.124  74.086 31.679  1.00 37.55  ? 82   ALA A CB    1 
ATOM   684  N  N     . LEU A 1 83  ? 23.045  72.537 28.556  1.00 31.67  ? 83   LEU A N     1 
ATOM   685  C  CA    . LEU A 1 83  ? 22.992  71.314 27.755  1.00 34.64  ? 83   LEU A CA    1 
ATOM   686  C  C     . LEU A 1 83  ? 23.803  70.158 28.347  1.00 35.55  ? 83   LEU A C     1 
ATOM   687  O  O     . LEU A 1 83  ? 24.706  70.364 29.159  1.00 36.23  ? 83   LEU A O     1 
ATOM   688  C  CB    . LEU A 1 83  ? 23.455  71.596 26.322  1.00 29.05  ? 83   LEU A CB    1 
ATOM   689  C  CG    . LEU A 1 83  ? 22.693  72.635 25.495  1.00 34.61  ? 83   LEU A CG    1 
ATOM   690  C  CD1   . LEU A 1 83  ? 23.183  74.056 25.767  1.00 29.87  ? 83   LEU A CD1   1 
ATOM   691  C  CD2   . LEU A 1 83  ? 22.800  72.305 24.014  1.00 34.57  ? 83   LEU A CD2   1 
ATOM   692  N  N     . GLY A 1 84  ? 23.474  68.938 27.933  1.00 34.62  ? 84   GLY A N     1 
ATOM   693  C  CA    . GLY A 1 84  ? 24.200  67.762 28.379  1.00 35.22  ? 84   GLY A CA    1 
ATOM   694  C  C     . GLY A 1 84  ? 23.381  66.843 29.268  1.00 36.61  ? 84   GLY A C     1 
ATOM   695  O  O     . GLY A 1 84  ? 22.260  67.176 29.657  1.00 38.18  ? 84   GLY A O     1 
ATOM   696  N  N     . MET A 1 85  ? 23.944  65.682 29.590  1.00 33.84  ? 85   MET A N     1 
ATOM   697  C  CA    . MET A 1 85  ? 23.256  64.698 30.418  1.00 31.59  ? 85   MET A CA    1 
ATOM   698  C  C     . MET A 1 85  ? 23.214  65.116 31.889  1.00 33.31  ? 85   MET A C     1 
ATOM   699  O  O     . MET A 1 85  ? 24.232  65.101 32.580  1.00 32.58  ? 85   MET A O     1 
ATOM   700  C  CB    . MET A 1 85  ? 23.908  63.322 30.270  1.00 32.09  ? 85   MET A CB    1 
ATOM   701  C  CG    . MET A 1 85  ? 23.307  62.248 31.165  1.00 31.27  ? 85   MET A CG    1 
ATOM   702  S  SD    . MET A 1 85  ? 21.511  62.140 31.049  1.00 39.00  ? 85   MET A SD    1 
ATOM   703  C  CE    . MET A 1 85  ? 21.304  61.531 29.379  1.00 27.25  ? 85   MET A CE    1 
ATOM   704  N  N     . ASP A 1 86  ? 22.027  65.480 32.361  1.00 36.81  ? 86   ASP A N     1 
ATOM   705  C  CA    . ASP A 1 86  ? 21.850  65.955 33.729  1.00 39.53  ? 86   ASP A CA    1 
ATOM   706  C  C     . ASP A 1 86  ? 21.757  64.808 34.736  1.00 39.41  ? 86   ASP A C     1 
ATOM   707  O  O     . ASP A 1 86  ? 22.051  64.990 35.916  1.00 43.21  ? 86   ASP A O     1 
ATOM   708  C  CB    . ASP A 1 86  ? 20.612  66.846 33.824  1.00 42.51  ? 86   ASP A CB    1 
ATOM   709  C  CG    . ASP A 1 86  ? 19.375  66.183 33.248  1.00 49.16  ? 86   ASP A CG    1 
ATOM   710  O  OD1   . ASP A 1 86  ? 18.578  65.619 34.029  1.00 52.85  ? 86   ASP A OD1   1 
ATOM   711  O  OD2   . ASP A 1 86  ? 19.207  66.216 32.011  1.00 52.42  ? 86   ASP A OD2   1 
ATOM   712  N  N     . ASP A 1 87  ? 21.335  63.636 34.273  1.00 36.30  ? 87   ASP A N     1 
ATOM   713  C  CA    . ASP A 1 87  ? 21.353  62.435 35.101  1.00 37.10  ? 87   ASP A CA    1 
ATOM   714  C  C     . ASP A 1 87  ? 22.772  61.880 35.082  1.00 38.49  ? 87   ASP A C     1 
ATOM   715  O  O     . ASP A 1 87  ? 23.137  61.126 34.179  1.00 40.97  ? 87   ASP A O     1 
ATOM   716  C  CB    . ASP A 1 87  ? 20.371  61.393 34.553  1.00 37.49  ? 87   ASP A CB    1 
ATOM   717  C  CG    . ASP A 1 87  ? 20.157  60.217 35.503  1.00 36.07  ? 87   ASP A CG    1 
ATOM   718  O  OD1   . ASP A 1 87  ? 21.035  59.943 36.348  1.00 33.37  ? 87   ASP A OD1   1 
ATOM   719  O  OD2   . ASP A 1 87  ? 19.102  59.557 35.394  1.00 37.38  ? 87   ASP A OD2   1 
ATOM   720  N  N     . PHE A 1 88  ? 23.566  62.244 36.083  1.00 34.79  ? 88   PHE A N     1 
ATOM   721  C  CA    . PHE A 1 88  ? 24.994  61.940 36.079  1.00 34.73  ? 88   PHE A CA    1 
ATOM   722  C  C     . PHE A 1 88  ? 25.331  60.452 36.143  1.00 36.56  ? 88   PHE A C     1 
ATOM   723  O  O     . PHE A 1 88  ? 26.406  60.048 35.699  1.00 38.91  ? 88   PHE A O     1 
ATOM   724  C  CB    . PHE A 1 88  ? 25.694  62.691 37.207  1.00 35.42  ? 88   PHE A CB    1 
ATOM   725  C  CG    . PHE A 1 88  ? 25.458  64.169 37.174  1.00 35.77  ? 88   PHE A CG    1 
ATOM   726  C  CD1   . PHE A 1 88  ? 25.552  64.869 35.983  1.00 33.88  ? 88   PHE A CD1   1 
ATOM   727  C  CD2   . PHE A 1 88  ? 25.114  64.856 38.327  1.00 37.19  ? 88   PHE A CD2   1 
ATOM   728  C  CE1   . PHE A 1 88  ? 25.324  66.231 35.943  1.00 34.03  ? 88   PHE A CE1   1 
ATOM   729  C  CE2   . PHE A 1 88  ? 24.884  66.220 38.295  1.00 37.67  ? 88   PHE A CE2   1 
ATOM   730  C  CZ    . PHE A 1 88  ? 24.989  66.908 37.100  1.00 36.11  ? 88   PHE A CZ    1 
ATOM   731  N  N     . LYS A 1 89  ? 24.427  59.645 36.696  1.00 34.73  ? 89   LYS A N     1 
ATOM   732  C  CA    . LYS A 1 89  ? 24.621  58.197 36.719  1.00 32.72  ? 89   LYS A CA    1 
ATOM   733  C  C     . LYS A 1 89  ? 24.757  57.680 35.295  1.00 32.49  ? 89   LYS A C     1 
ATOM   734  O  O     . LYS A 1 89  ? 25.613  56.843 35.009  1.00 34.14  ? 89   LYS A O     1 
ATOM   735  C  CB    . LYS A 1 89  ? 23.454  57.491 37.411  1.00 33.93  ? 89   LYS A CB    1 
ATOM   736  C  CG    . LYS A 1 89  ? 23.311  57.811 38.890  1.00 37.55  ? 89   LYS A CG    1 
ATOM   737  C  CD    . LYS A 1 89  ? 22.201  56.988 39.523  1.00 35.98  ? 89   LYS A CD    1 
ATOM   738  C  CE    . LYS A 1 89  ? 20.891  57.171 38.780  1.00 35.37  ? 89   LYS A CE    1 
ATOM   739  N  NZ    . LYS A 1 89  ? 20.452  58.594 38.765  1.00 37.47  ? 89   LYS A NZ    1 
ATOM   740  N  N     . LEU A 1 90  ? 23.913  58.196 34.405  1.00 31.93  ? 90   LEU A N     1 
ATOM   741  C  CA    . LEU A 1 90  ? 23.952  57.821 32.993  1.00 33.41  ? 90   LEU A CA    1 
ATOM   742  C  C     . LEU A 1 90  ? 25.243  58.279 32.315  1.00 36.82  ? 90   LEU A C     1 
ATOM   743  O  O     . LEU A 1 90  ? 25.802  57.566 31.478  1.00 38.25  ? 90   LEU A O     1 
ATOM   744  C  CB    . LEU A 1 90  ? 22.736  58.379 32.247  1.00 32.36  ? 90   LEU A CB    1 
ATOM   745  C  CG    . LEU A 1 90  ? 21.366  57.812 32.627  1.00 33.46  ? 90   LEU A CG    1 
ATOM   746  C  CD1   . LEU A 1 90  ? 20.281  58.385 31.726  1.00 33.85  ? 90   LEU A CD1   1 
ATOM   747  C  CD2   . LEU A 1 90  ? 21.379  56.293 32.561  1.00 32.13  ? 90   LEU A CD2   1 
ATOM   748  N  N     . ALA A 1 91  ? 25.711  59.470 32.679  1.00 36.54  ? 91   ALA A N     1 
ATOM   749  C  CA    . ALA A 1 91  ? 26.949  60.005 32.124  1.00 37.17  ? 91   ALA A CA    1 
ATOM   750  C  C     . ALA A 1 91  ? 28.129  59.152 32.565  1.00 38.05  ? 91   ALA A C     1 
ATOM   751  O  O     . ALA A 1 91  ? 29.037  58.883 31.780  1.00 39.63  ? 91   ALA A O     1 
ATOM   752  C  CB    . ALA A 1 91  ? 27.148  61.448 32.553  1.00 35.80  ? 91   ALA A CB    1 
ATOM   753  N  N     . TYR A 1 92  ? 28.103  58.729 33.826  1.00 37.56  ? 92   TYR A N     1 
ATOM   754  C  CA    . TYR A 1 92  ? 29.139  57.865 34.367  1.00 39.73  ? 92   TYR A CA    1 
ATOM   755  C  C     . TYR A 1 92  ? 29.188  56.540 33.617  1.00 39.71  ? 92   TYR A C     1 
ATOM   756  O  O     . TYR A 1 92  ? 30.260  56.085 33.213  1.00 38.73  ? 92   TYR A O     1 
ATOM   757  C  CB    . TYR A 1 92  ? 28.898  57.596 35.853  1.00 41.48  ? 92   TYR A CB    1 
ATOM   758  C  CG    . TYR A 1 92  ? 29.884  56.613 36.432  1.00 43.87  ? 92   TYR A CG    1 
ATOM   759  C  CD1   . TYR A 1 92  ? 29.570  55.262 36.545  1.00 43.59  ? 92   TYR A CD1   1 
ATOM   760  C  CD2   . TYR A 1 92  ? 31.140  57.032 36.844  1.00 46.06  ? 92   TYR A CD2   1 
ATOM   761  C  CE1   . TYR A 1 92  ? 30.479  54.360 37.063  1.00 44.75  ? 92   TYR A CE1   1 
ATOM   762  C  CE2   . TYR A 1 92  ? 32.053  56.140 37.363  1.00 48.96  ? 92   TYR A CE2   1 
ATOM   763  C  CZ    . TYR A 1 92  ? 31.719  54.805 37.471  1.00 47.67  ? 92   TYR A CZ    1 
ATOM   764  O  OH    . TYR A 1 92  ? 32.632  53.918 37.989  1.00 49.64  ? 92   TYR A OH    1 
ATOM   765  N  N     . LEU A 1 93  ? 28.021  55.921 33.449  1.00 39.43  ? 93   LEU A N     1 
ATOM   766  C  CA    . LEU A 1 93  ? 27.927  54.645 32.745  1.00 38.89  ? 93   LEU A CA    1 
ATOM   767  C  C     . LEU A 1 93  ? 28.416  54.782 31.308  1.00 39.66  ? 93   LEU A C     1 
ATOM   768  O  O     . LEU A 1 93  ? 29.089  53.892 30.783  1.00 41.67  ? 93   LEU A O     1 
ATOM   769  C  CB    . LEU A 1 93  ? 26.495  54.103 32.774  1.00 35.85  ? 93   LEU A CB    1 
ATOM   770  C  CG    . LEU A 1 93  ? 25.981  53.595 34.124  1.00 34.69  ? 93   LEU A CG    1 
ATOM   771  C  CD1   . LEU A 1 93  ? 24.629  52.921 33.968  1.00 30.17  ? 93   LEU A CD1   1 
ATOM   772  C  CD2   . LEU A 1 93  ? 26.984  52.642 34.750  1.00 36.70  ? 93   LEU A CD2   1 
ATOM   773  N  N     . SER A 1 94  ? 28.086  55.910 30.687  1.00 37.23  ? 94   SER A N     1 
ATOM   774  C  CA    . SER A 1 94  ? 28.506  56.190 29.323  1.00 36.39  ? 94   SER A CA    1 
ATOM   775  C  C     . SER A 1 94  ? 30.024  56.306 29.221  1.00 37.57  ? 94   SER A C     1 
ATOM   776  O  O     . SER A 1 94  ? 30.636  55.762 28.302  1.00 38.54  ? 94   SER A O     1 
ATOM   777  C  CB    . SER A 1 94  ? 27.850  57.472 28.817  1.00 33.87  ? 94   SER A CB    1 
ATOM   778  O  OG    . SER A 1 94  ? 27.998  57.581 27.415  1.00 33.02  ? 94   SER A OG    1 
ATOM   779  N  N     . ASP A 1 95  ? 30.626  57.016 30.168  1.00 37.80  ? 95   ASP A N     1 
ATOM   780  C  CA    . ASP A 1 95  ? 32.073  57.197 30.180  1.00 40.27  ? 95   ASP A CA    1 
ATOM   781  C  C     . ASP A 1 95  ? 32.782  55.880 30.458  1.00 46.71  ? 95   ASP A C     1 
ATOM   782  O  O     . ASP A 1 95  ? 33.666  55.462 29.706  1.00 52.53  ? 95   ASP A O     1 
ATOM   783  C  CB    . ASP A 1 95  ? 32.486  58.219 31.240  1.00 39.12  ? 95   ASP A CB    1 
ATOM   784  C  CG    . ASP A 1 95  ? 32.187  59.645 30.827  1.00 39.94  ? 95   ASP A CG    1 
ATOM   785  O  OD1   . ASP A 1 95  ? 32.272  60.547 31.687  1.00 38.22  ? 95   ASP A OD1   1 
ATOM   786  O  OD2   . ASP A 1 95  ? 31.865  59.864 29.641  1.00 40.63  ? 95   ASP A OD2   1 
ATOM   787  N  N     . THR A 1 96  ? 32.382  55.235 31.549  1.00 44.33  ? 96   THR A N     1 
ATOM   788  C  CA    . THR A 1 96  ? 33.051  54.041 32.041  1.00 44.34  ? 96   THR A CA    1 
ATOM   789  C  C     . THR A 1 96  ? 32.905  52.864 31.079  1.00 48.03  ? 96   THR A C     1 
ATOM   790  O  O     . THR A 1 96  ? 33.781  52.001 31.003  1.00 51.41  ? 96   THR A O     1 
ATOM   791  C  CB    . THR A 1 96  ? 32.507  53.650 33.431  1.00 41.87  ? 96   THR A CB    1 
ATOM   792  O  OG1   . THR A 1 96  ? 32.410  54.820 34.251  1.00 40.12  ? 96   THR A OG1   1 
ATOM   793  C  CG2   . THR A 1 96  ? 33.421  52.643 34.109  1.00 42.05  ? 96   THR A CG2   1 
ATOM   794  N  N     . TYR A 1 97  ? 31.803  52.835 30.334  1.00 46.37  ? 97   TYR A N     1 
ATOM   795  C  CA    . TYR A 1 97  ? 31.540  51.721 29.425  1.00 43.30  ? 97   TYR A CA    1 
ATOM   796  C  C     . TYR A 1 97  ? 31.350  52.176 27.986  1.00 43.47  ? 97   TYR A C     1 
ATOM   797  O  O     . TYR A 1 97  ? 30.256  52.077 27.430  1.00 41.50  ? 97   TYR A O     1 
ATOM   798  C  CB    . TYR A 1 97  ? 30.345  50.902 29.918  1.00 38.72  ? 97   TYR A CB    1 
ATOM   799  C  CG    . TYR A 1 97  ? 30.603  50.321 31.285  1.00 36.93  ? 97   TYR A CG    1 
ATOM   800  C  CD1   . TYR A 1 97  ? 30.182  50.979 32.432  1.00 36.20  ? 97   TYR A CD1   1 
ATOM   801  C  CD2   . TYR A 1 97  ? 31.311  49.139 31.431  1.00 37.76  ? 97   TYR A CD2   1 
ATOM   802  C  CE1   . TYR A 1 97  ? 30.439  50.463 33.685  1.00 37.06  ? 97   TYR A CE1   1 
ATOM   803  C  CE2   . TYR A 1 97  ? 31.573  48.614 32.677  1.00 38.36  ? 97   TYR A CE2   1 
ATOM   804  C  CZ    . TYR A 1 97  ? 31.136  49.277 33.801  1.00 38.79  ? 97   TYR A CZ    1 
ATOM   805  O  OH    . TYR A 1 97  ? 31.400  48.748 35.042  1.00 41.26  ? 97   TYR A OH    1 
ATOM   806  N  N     . ASN A 1 98  ? 32.436  52.658 27.388  1.00 46.04  ? 98   ASN A N     1 
ATOM   807  C  CA    . ASN A 1 98  ? 32.410  53.208 26.036  1.00 46.43  ? 98   ASN A CA    1 
ATOM   808  C  C     . ASN A 1 98  ? 32.421  52.130 24.956  1.00 47.54  ? 98   ASN A C     1 
ATOM   809  O  O     . ASN A 1 98  ? 33.238  52.174 24.038  1.00 51.88  ? 98   ASN A O     1 
ATOM   810  C  CB    . ASN A 1 98  ? 33.588  54.168 25.833  1.00 46.89  ? 98   ASN A CB    1 
ATOM   811  N  N     . TYR A 1 99  ? 31.509  51.169 25.072  1.00 54.40  ? 99   TYR A N     1 
ATOM   812  C  CA    . TYR A 1 99  ? 31.421  50.053 24.131  1.00 54.75  ? 99   TYR A CA    1 
ATOM   813  C  C     . TYR A 1 99  ? 30.118  49.278 24.316  1.00 50.78  ? 99   TYR A C     1 
ATOM   814  O  O     . TYR A 1 99  ? 29.435  49.442 25.325  1.00 49.39  ? 99   TYR A O     1 
ATOM   815  C  CB    . TYR A 1 99  ? 32.618  49.109 24.297  1.00 54.15  ? 99   TYR A CB    1 
ATOM   816  C  CG    . TYR A 1 99  ? 32.895  48.693 25.730  1.00 54.32  ? 99   TYR A CG    1 
ATOM   817  C  CD1   . TYR A 1 99  ? 33.805  49.393 26.514  1.00 53.03  ? 99   TYR A CD1   1 
ATOM   818  C  CD2   . TYR A 1 99  ? 32.252  47.596 26.295  1.00 53.86  ? 99   TYR A CD2   1 
ATOM   819  C  CE1   . TYR A 1 99  ? 34.065  49.015 27.820  1.00 51.61  ? 99   TYR A CE1   1 
ATOM   820  C  CE2   . TYR A 1 99  ? 32.506  47.212 27.603  1.00 51.04  ? 99   TYR A CE2   1 
ATOM   821  C  CZ    . TYR A 1 99  ? 33.414  47.926 28.360  1.00 50.02  ? 99   TYR A CZ    1 
ATOM   822  O  OH    . TYR A 1 99  ? 33.673  47.552 29.658  1.00 47.80  ? 99   TYR A OH    1 
ATOM   823  N  N     . GLU A 1 100 ? 29.777  48.440 23.341  1.00 49.19  ? 100  GLU A N     1 
ATOM   824  C  CA    . GLU A 1 100 ? 28.598  47.591 23.454  1.00 47.64  ? 100  GLU A CA    1 
ATOM   825  C  C     . GLU A 1 100 ? 28.817  46.562 24.554  1.00 44.88  ? 100  GLU A C     1 
ATOM   826  O  O     . GLU A 1 100 ? 29.660  45.675 24.433  1.00 45.03  ? 100  GLU A O     1 
ATOM   827  C  CB    . GLU A 1 100 ? 28.286  46.891 22.130  1.00 53.75  ? 100  GLU A CB    1 
ATOM   828  C  CG    . GLU A 1 100 ? 27.092  45.945 22.207  1.00 60.24  ? 100  GLU A CG    1 
ATOM   829  C  CD    . GLU A 1 100 ? 26.831  45.209 20.903  1.00 68.33  ? 100  GLU A CD    1 
ATOM   830  O  OE1   . GLU A 1 100 ? 27.532  45.486 19.906  1.00 71.50  ? 100  GLU A OE1   1 
ATOM   831  O  OE2   . GLU A 1 100 ? 25.922  44.351 20.878  1.00 71.18  ? 100  GLU A OE2   1 
ATOM   832  N  N     . ILE A 1 101 ? 28.053  46.691 25.630  1.00 43.05  ? 101  ILE A N     1 
ATOM   833  C  CA    . ILE A 1 101 ? 28.230  45.844 26.799  1.00 42.47  ? 101  ILE A CA    1 
ATOM   834  C  C     . ILE A 1 101 ? 27.817  44.396 26.563  1.00 44.64  ? 101  ILE A C     1 
ATOM   835  O  O     . ILE A 1 101 ? 26.648  44.100 26.318  1.00 45.39  ? 101  ILE A O     1 
ATOM   836  C  CB    . ILE A 1 101 ? 27.465  46.401 28.008  1.00 41.26  ? 101  ILE A CB    1 
ATOM   837  C  CG1   . ILE A 1 101 ? 28.053  47.751 28.418  1.00 41.68  ? 101  ILE A CG1   1 
ATOM   838  C  CG2   . ILE A 1 101 ? 27.520  45.423 29.167  1.00 39.79  ? 101  ILE A CG2   1 
ATOM   839  C  CD1   . ILE A 1 101 ? 27.379  48.372 29.609  1.00 40.46  ? 101  ILE A CD1   1 
ATOM   840  N  N     . LYS A 1 102 ? 28.798  43.501 26.631  1.00 46.37  ? 102  LYS A N     1 
ATOM   841  C  CA    . LYS A 1 102 ? 28.547  42.068 26.607  1.00 43.47  ? 102  LYS A CA    1 
ATOM   842  C  C     . LYS A 1 102 ? 28.608  41.570 28.045  1.00 42.67  ? 102  LYS A C     1 
ATOM   843  O  O     . LYS A 1 102 ? 29.662  41.616 28.680  1.00 45.08  ? 102  LYS A O     1 
ATOM   844  C  CB    . LYS A 1 102 ? 29.591  41.351 25.747  1.00 41.63  ? 102  LYS A CB    1 
ATOM   845  N  N     . TYR A 1 103 ? 27.473  41.113 28.564  1.00 37.38  ? 103  TYR A N     1 
ATOM   846  C  CA    . TYR A 1 103 ? 27.391  40.740 29.971  1.00 35.41  ? 103  TYR A CA    1 
ATOM   847  C  C     . TYR A 1 103 ? 27.238  39.240 30.170  1.00 38.59  ? 103  TYR A C     1 
ATOM   848  O  O     . TYR A 1 103 ? 26.633  38.549 29.350  1.00 40.44  ? 103  TYR A O     1 
ATOM   849  C  CB    . TYR A 1 103 ? 26.246  41.485 30.664  1.00 34.02  ? 103  TYR A CB    1 
ATOM   850  C  CG    . TYR A 1 103 ? 24.858  41.089 30.199  1.00 35.10  ? 103  TYR A CG    1 
ATOM   851  C  CD1   . TYR A 1 103 ? 24.293  41.653 29.060  1.00 35.88  ? 103  TYR A CD1   1 
ATOM   852  C  CD2   . TYR A 1 103 ? 24.105  40.161 30.910  1.00 32.32  ? 103  TYR A CD2   1 
ATOM   853  C  CE1   . TYR A 1 103 ? 23.022  41.298 28.638  1.00 34.30  ? 103  TYR A CE1   1 
ATOM   854  C  CE2   . TYR A 1 103 ? 22.835  39.801 30.497  1.00 32.03  ? 103  TYR A CE2   1 
ATOM   855  C  CZ    . TYR A 1 103 ? 22.299  40.371 29.361  1.00 33.31  ? 103  TYR A CZ    1 
ATOM   856  O  OH    . TYR A 1 103 ? 21.036  40.015 28.946  1.00 32.60  ? 103  TYR A OH    1 
ATOM   857  N  N     . ASP A 1 104 ? 27.799  38.747 31.269  1.00 40.40  ? 104  ASP A N     1 
ATOM   858  C  CA    . ASP A 1 104 ? 27.667  37.350 31.648  1.00 39.72  ? 104  ASP A CA    1 
ATOM   859  C  C     . ASP A 1 104 ? 26.664  37.259 32.789  1.00 37.57  ? 104  ASP A C     1 
ATOM   860  O  O     . ASP A 1 104 ? 26.987  37.573 33.936  1.00 37.88  ? 104  ASP A O     1 
ATOM   861  C  CB    . ASP A 1 104 ? 29.021  36.792 32.087  1.00 40.44  ? 104  ASP A CB    1 
ATOM   862  C  CG    . ASP A 1 104 ? 29.004  35.288 32.269  1.00 43.64  ? 104  ASP A CG    1 
ATOM   863  O  OD1   . ASP A 1 104 ? 27.904  34.699 32.327  1.00 42.97  ? 104  ASP A OD1   1 
ATOM   864  O  OD2   . ASP A 1 104 ? 30.098  34.691 32.357  1.00 48.15  ? 104  ASP A OD2   1 
ATOM   865  N  N     . HIS A 1 105 ? 25.450  36.824 32.471  1.00 35.71  ? 105  HIS A N     1 
ATOM   866  C  CA    . HIS A 1 105 ? 24.369  36.796 33.452  1.00 36.09  ? 105  HIS A CA    1 
ATOM   867  C  C     . HIS A 1 105 ? 24.653  35.851 34.620  1.00 35.79  ? 105  HIS A C     1 
ATOM   868  O  O     . HIS A 1 105 ? 24.107  36.027 35.708  1.00 39.06  ? 105  HIS A O     1 
ATOM   869  C  CB    . HIS A 1 105 ? 23.038  36.437 32.784  1.00 40.12  ? 105  HIS A CB    1 
ATOM   870  C  CG    . HIS A 1 105 ? 22.914  34.992 32.418  1.00 48.56  ? 105  HIS A CG    1 
ATOM   871  N  ND1   . HIS A 1 105 ? 22.405  34.046 33.282  1.00 50.87  ? 105  HIS A ND1   1 
ATOM   872  C  CD2   . HIS A 1 105 ? 23.239  34.328 31.283  1.00 52.53  ? 105  HIS A CD2   1 
ATOM   873  C  CE1   . HIS A 1 105 ? 22.420  32.863 32.695  1.00 52.77  ? 105  HIS A CE1   1 
ATOM   874  N  NE2   . HIS A 1 105 ? 22.921  33.006 31.481  1.00 54.12  ? 105  HIS A NE2   1 
ATOM   875  N  N     . THR A 1 106 ? 25.511  34.859 34.399  1.00 31.23  ? 106  THR A N     1 
ATOM   876  C  CA    . THR A 1 106 ? 25.861  33.913 35.454  1.00 32.87  ? 106  THR A CA    1 
ATOM   877  C  C     . THR A 1 106 ? 26.622  34.606 36.575  1.00 36.85  ? 106  THR A C     1 
ATOM   878  O  O     . THR A 1 106 ? 26.671  34.110 37.703  1.00 37.36  ? 106  THR A O     1 
ATOM   879  C  CB    . THR A 1 106 ? 26.716  32.751 34.921  1.00 34.08  ? 106  THR A CB    1 
ATOM   880  O  OG1   . THR A 1 106 ? 28.011  33.238 34.540  1.00 35.40  ? 106  THR A OG1   1 
ATOM   881  C  CG2   . THR A 1 106 ? 26.031  32.092 33.729  1.00 33.83  ? 106  THR A CG2   1 
ATOM   882  N  N     . LYS A 1 107 ? 27.213  35.754 36.253  1.00 38.83  ? 107  LYS A N     1 
ATOM   883  C  CA    . LYS A 1 107 ? 27.973  36.535 37.223  1.00 39.03  ? 107  LYS A CA    1 
ATOM   884  C  C     . LYS A 1 107 ? 27.058  37.495 37.980  1.00 36.33  ? 107  LYS A C     1 
ATOM   885  O  O     . LYS A 1 107 ? 27.409  37.987 39.050  1.00 38.48  ? 107  LYS A O     1 
ATOM   886  C  CB    . LYS A 1 107 ? 29.080  37.326 36.524  1.00 41.59  ? 107  LYS A CB    1 
ATOM   887  C  CG    . LYS A 1 107 ? 29.976  36.500 35.611  1.00 46.29  ? 107  LYS A CG    1 
ATOM   888  C  CD    . LYS A 1 107 ? 30.998  35.700 36.399  1.00 49.92  ? 107  LYS A CD    1 
ATOM   889  C  CE    . LYS A 1 107 ? 31.979  34.996 35.474  1.00 52.11  ? 107  LYS A CE    1 
ATOM   890  N  NZ    . LYS A 1 107 ? 33.019  34.238 36.227  1.00 52.35  ? 107  LYS A NZ    1 
ATOM   891  N  N     . ILE A 1 108 ? 25.886  37.762 37.415  1.00 32.15  ? 108  ILE A N     1 
ATOM   892  C  CA    . ILE A 1 108 ? 24.940  38.680 38.029  1.00 31.93  ? 108  ILE A CA    1 
ATOM   893  C  C     . ILE A 1 108 ? 24.105  37.963 39.073  1.00 32.53  ? 108  ILE A C     1 
ATOM   894  O  O     . ILE A 1 108 ? 23.425  36.984 38.768  1.00 36.35  ? 108  ILE A O     1 
ATOM   895  C  CB    . ILE A 1 108 ? 24.006  39.305 36.982  1.00 36.14  ? 108  ILE A CB    1 
ATOM   896  C  CG1   . ILE A 1 108 ? 24.826  39.950 35.863  1.00 36.65  ? 108  ILE A CG1   1 
ATOM   897  C  CG2   . ILE A 1 108 ? 23.076  40.318 37.638  1.00 38.13  ? 108  ILE A CG2   1 
ATOM   898  C  CD1   . ILE A 1 108 ? 23.991  40.638 34.812  1.00 36.51  ? 108  ILE A CD1   1 
ATOM   899  N  N     . ARG A 1 109 ? 24.158  38.442 40.310  1.00 30.43  ? 109  ARG A N     1 
ATOM   900  C  CA    . ARG A 1 109 ? 23.430  37.782 41.386  1.00 28.73  ? 109  ARG A CA    1 
ATOM   901  C  C     . ARG A 1 109 ? 21.955  38.154 41.358  1.00 27.83  ? 109  ARG A C     1 
ATOM   902  O  O     . ARG A 1 109 ? 21.579  39.272 41.713  1.00 27.91  ? 109  ARG A O     1 
ATOM   903  C  CB    . ARG A 1 109 ? 24.040  38.107 42.752  1.00 27.60  ? 109  ARG A CB    1 
ATOM   904  C  CG    . ARG A 1 109 ? 23.504  37.225 43.864  1.00 28.45  ? 109  ARG A CG    1 
ATOM   905  C  CD    . ARG A 1 109 ? 24.216  37.491 45.173  1.00 32.85  ? 109  ARG A CD    1 
ATOM   906  N  NE    . ARG A 1 109 ? 25.653  37.263 45.069  1.00 35.93  ? 109  ARG A NE    1 
ATOM   907  C  CZ    . ARG A 1 109 ? 26.254  36.104 45.325  1.00 36.21  ? 109  ARG A CZ    1 
ATOM   908  N  NH1   . ARG A 1 109 ? 25.547  35.048 45.706  1.00 33.61  ? 109  ARG A NH1   1 
ATOM   909  N  NH2   . ARG A 1 109 ? 27.569  36.003 45.202  1.00 37.41  ? 109  ARG A NH2   1 
ATOM   910  N  N     . VAL A 1 110 ? 21.122  37.214 40.921  1.00 27.15  ? 110  VAL A N     1 
ATOM   911  C  CA    . VAL A 1 110 ? 19.680  37.431 40.903  1.00 25.08  ? 110  VAL A CA    1 
ATOM   912  C  C     . VAL A 1 110 ? 19.027  36.712 42.067  1.00 23.67  ? 110  VAL A C     1 
ATOM   913  O  O     . VAL A 1 110 ? 19.124  35.491 42.194  1.00 25.42  ? 110  VAL A O     1 
ATOM   914  C  CB    . VAL A 1 110 ? 19.036  36.944 39.604  1.00 25.62  ? 110  VAL A CB    1 
ATOM   915  C  CG1   . VAL A 1 110 ? 17.556  37.308 39.592  1.00 21.70  ? 110  VAL A CG1   1 
ATOM   916  C  CG2   . VAL A 1 110 ? 19.746  37.550 38.410  1.00 28.24  ? 110  VAL A CG2   1 
ATOM   917  N  N     . ALA A 1 111 ? 18.358  37.479 42.916  1.00 21.81  ? 111  ALA A N     1 
ATOM   918  C  CA    . ALA A 1 111 ? 17.745  36.923 44.106  1.00 23.12  ? 111  ALA A CA    1 
ATOM   919  C  C     . ALA A 1 111 ? 16.227  36.944 44.021  1.00 27.33  ? 111  ALA A C     1 
ATOM   920  O  O     . ALA A 1 111 ? 15.615  37.998 43.838  1.00 27.60  ? 111  ALA A O     1 
ATOM   921  C  CB    . ALA A 1 111 ? 18.219  37.668 45.347  1.00 21.51  ? 111  ALA A CB    1 
ATOM   922  N  N     A ASN A 1 112 ? 15.637  35.759 44.132  0.67 28.30  ? 112  ASN A N     1 
ATOM   923  N  N     B ASN A 1 112 ? 15.622  35.768 44.150  0.33 28.08  ? 112  ASN A N     1 
ATOM   924  C  CA    A ASN A 1 112 ? 14.195  35.600 44.233  0.67 27.56  ? 112  ASN A CA    1 
ATOM   925  C  CA    B ASN A 1 112 ? 14.171  35.647 44.210  0.33 27.54  ? 112  ASN A CA    1 
ATOM   926  C  C     A ASN A 1 112 ? 13.851  35.268 45.671  0.67 28.22  ? 112  ASN A C     1 
ATOM   927  C  C     B ASN A 1 112 ? 13.753  35.227 45.611  0.33 28.22  ? 112  ASN A C     1 
ATOM   928  O  O     A ASN A 1 112 ? 14.313  34.259 46.204  0.67 30.16  ? 112  ASN A O     1 
ATOM   929  O  O     B ASN A 1 112 ? 14.067  34.123 46.054  0.33 29.66  ? 112  ASN A O     1 
ATOM   930  C  CB    A ASN A 1 112 ? 13.719  34.461 43.330  0.67 26.17  ? 112  ASN A CB    1 
ATOM   931  C  CB    B ASN A 1 112 ? 13.672  34.629 43.180  0.33 27.07  ? 112  ASN A CB    1 
ATOM   932  C  CG    A ASN A 1 112 ? 13.516  34.895 41.894  0.67 25.88  ? 112  ASN A CG    1 
ATOM   933  C  CG    B ASN A 1 112 ? 12.164  34.443 43.220  0.33 29.62  ? 112  ASN A CG    1 
ATOM   934  O  OD1   A ASN A 1 112 ? 14.476  35.080 41.145  0.67 28.11  ? 112  ASN A OD1   1 
ATOM   935  O  OD1   B ASN A 1 112 ? 11.431  35.305 43.701  0.33 31.41  ? 112  ASN A OD1   1 
ATOM   936  N  ND2   A ASN A 1 112 ? 12.259  35.045 41.495  0.67 23.93  ? 112  ASN A ND2   1 
ATOM   937  N  ND2   B ASN A 1 112 ? 11.694  33.311 42.710  0.33 31.22  ? 112  ASN A ND2   1 
ATOM   938  N  N     . PHE A 1 113 ? 13.053  36.111 46.311  1.00 26.93  ? 113  PHE A N     1 
ATOM   939  C  CA    . PHE A 1 113 ? 12.663  35.834 47.683  1.00 26.63  ? 113  PHE A CA    1 
ATOM   940  C  C     . PHE A 1 113 ? 11.203  36.139 47.971  1.00 25.40  ? 113  PHE A C     1 
ATOM   941  O  O     . PHE A 1 113 ? 10.536  36.855 47.224  1.00 23.00  ? 113  PHE A O     1 
ATOM   942  C  CB    . PHE A 1 113 ? 13.590  36.544 48.679  1.00 29.99  ? 113  PHE A CB    1 
ATOM   943  C  CG    . PHE A 1 113 ? 13.199  37.962 48.980  1.00 31.78  ? 113  PHE A CG    1 
ATOM   944  C  CD1   . PHE A 1 113 ? 12.854  38.337 50.268  1.00 32.40  ? 113  PHE A CD1   1 
ATOM   945  C  CD2   . PHE A 1 113 ? 13.180  38.920 47.982  1.00 31.41  ? 113  PHE A CD2   1 
ATOM   946  C  CE1   . PHE A 1 113 ? 12.496  39.643 50.556  1.00 31.12  ? 113  PHE A CE1   1 
ATOM   947  C  CE2   . PHE A 1 113 ? 12.822  40.227 48.263  1.00 31.87  ? 113  PHE A CE2   1 
ATOM   948  C  CZ    . PHE A 1 113 ? 12.479  40.588 49.553  1.00 30.92  ? 113  PHE A CZ    1 
ATOM   949  N  N     . ASP A 1 114 ? 10.719  35.564 49.062  1.00 24.73  ? 114  ASP A N     1 
ATOM   950  C  CA    . ASP A 1 114 ? 9.343   35.718 49.483  1.00 27.36  ? 114  ASP A CA    1 
ATOM   951  C  C     . ASP A 1 114 ? 9.332   35.493 50.983  1.00 27.62  ? 114  ASP A C     1 
ATOM   952  O  O     . ASP A 1 114 ? 9.997   34.586 51.480  1.00 28.76  ? 114  ASP A O     1 
ATOM   953  C  CB    . ASP A 1 114 ? 8.462   34.683 48.777  1.00 32.67  ? 114  ASP A CB    1 
ATOM   954  C  CG    . ASP A 1 114 ? 6.976   34.908 49.016  1.00 39.25  ? 114  ASP A CG    1 
ATOM   955  O  OD1   . ASP A 1 114 ? 6.387   35.783 48.342  1.00 42.13  ? 114  ASP A OD1   1 
ATOM   956  O  OD2   . ASP A 1 114 ? 6.392   34.197 49.863  1.00 40.20  ? 114  ASP A OD2   1 
ATOM   957  N  N     . ILE A 1 115 ? 8.606   36.330 51.712  1.00 26.93  ? 115  ILE A N     1 
ATOM   958  C  CA    . ILE A 1 115 ? 8.507   36.152 53.151  1.00 27.82  ? 115  ILE A CA    1 
ATOM   959  C  C     . ILE A 1 115 ? 7.090   35.780 53.551  1.00 30.28  ? 115  ILE A C     1 
ATOM   960  O  O     . ILE A 1 115 ? 6.139   36.001 52.802  1.00 32.69  ? 115  ILE A O     1 
ATOM   961  C  CB    . ILE A 1 115 ? 8.942   37.413 53.931  1.00 26.41  ? 115  ILE A CB    1 
ATOM   962  C  CG1   . ILE A 1 115 ? 7.835   38.472 53.915  1.00 23.91  ? 115  ILE A CG1   1 
ATOM   963  C  CG2   . ILE A 1 115 ? 10.251  37.961 53.376  1.00 25.70  ? 115  ILE A CG2   1 
ATOM   964  C  CD1   . ILE A 1 115 ? 8.107   39.651 54.831  1.00 22.16  ? 115  ILE A CD1   1 
ATOM   965  N  N     . GLU A 1 116 ? 6.955   35.197 54.734  1.00 29.50  ? 116  GLU A N     1 
ATOM   966  C  CA    . GLU A 1 116 ? 5.643   34.929 55.287  1.00 30.54  ? 116  GLU A CA    1 
ATOM   967  C  C     . GLU A 1 116 ? 5.509   35.672 56.604  1.00 33.15  ? 116  GLU A C     1 
ATOM   968  O  O     . GLU A 1 116 ? 6.455   35.743 57.393  1.00 36.71  ? 116  GLU A O     1 
ATOM   969  C  CB    . GLU A 1 116 ? 5.433   33.430 55.489  1.00 29.88  ? 116  GLU A CB    1 
ATOM   970  C  CG    . GLU A 1 116 ? 5.605   32.593 54.234  1.00 31.10  ? 116  GLU A CG    1 
ATOM   971  C  CD    . GLU A 1 116 ? 4.509   32.810 53.200  1.00 35.51  ? 116  GLU A CD    1 
ATOM   972  O  OE1   . GLU A 1 116 ? 3.475   33.439 53.514  1.00 34.43  ? 116  GLU A OE1   1 
ATOM   973  O  OE2   . GLU A 1 116 ? 4.683   32.341 52.057  1.00 42.51  ? 116  GLU A OE2   1 
ATOM   974  N  N     . VAL A 1 117 ? 4.338   36.255 56.824  1.00 30.60  ? 117  VAL A N     1 
ATOM   975  C  CA    . VAL A 1 117 ? 4.065   36.977 58.055  1.00 29.65  ? 117  VAL A CA    1 
ATOM   976  C  C     . VAL A 1 117 ? 2.677   36.608 58.555  1.00 30.33  ? 117  VAL A C     1 
ATOM   977  O  O     . VAL A 1 117 ? 1.673   36.958 57.936  1.00 31.12  ? 117  VAL A O     1 
ATOM   978  C  CB    . VAL A 1 117 ? 4.150   38.507 57.855  1.00 24.75  ? 117  VAL A CB    1 
ATOM   979  C  CG1   . VAL A 1 117 ? 3.725   39.228 59.111  1.00 26.05  ? 117  VAL A CG1   1 
ATOM   980  C  CG2   . VAL A 1 117 ? 5.557   38.922 57.468  1.00 27.40  ? 117  VAL A CG2   1 
ATOM   981  N  N     . THR A 1 118 ? 2.627   35.881 59.666  1.00 30.91  ? 118  THR A N     1 
ATOM   982  C  CA    . THR A 1 118 ? 1.361   35.534 60.288  1.00 31.94  ? 118  THR A CA    1 
ATOM   983  C  C     . THR A 1 118 ? 0.777   36.768 60.953  1.00 36.72  ? 118  THR A C     1 
ATOM   984  O  O     . THR A 1 118 ? 1.446   37.432 61.741  1.00 35.34  ? 118  THR A O     1 
ATOM   985  C  CB    . THR A 1 118 ? 1.531   34.435 61.348  1.00 33.52  ? 118  THR A CB    1 
ATOM   986  O  OG1   . THR A 1 118 ? 1.986   33.231 60.720  1.00 36.12  ? 118  THR A OG1   1 
ATOM   987  C  CG2   . THR A 1 118 ? 0.211   34.163 62.049  1.00 32.02  ? 118  THR A CG2   1 
ATOM   988  N  N     . SER A 1 119 ? -0.469  37.080 60.618  1.00 43.64  ? 119  SER A N     1 
ATOM   989  C  CA    . SER A 1 119 ? -1.153  38.215 61.215  1.00 50.43  ? 119  SER A CA    1 
ATOM   990  C  C     . SER A 1 119 ? -2.599  37.863 61.525  1.00 59.82  ? 119  SER A C     1 
ATOM   991  O  O     . SER A 1 119 ? -3.384  37.580 60.619  1.00 60.25  ? 119  SER A O     1 
ATOM   992  C  CB    . SER A 1 119 ? -1.093  39.431 60.291  1.00 48.81  ? 119  SER A CB    1 
ATOM   993  O  OG    . SER A 1 119 ? -1.871  40.494 60.814  1.00 49.86  ? 119  SER A OG    1 
ATOM   994  N  N     . PRO A 1 120 ? -2.953  37.874 62.816  1.00 68.46  ? 120  PRO A N     1 
ATOM   995  C  CA    . PRO A 1 120 ? -4.316  37.563 63.259  1.00 74.87  ? 120  PRO A CA    1 
ATOM   996  C  C     . PRO A 1 120 ? -5.301  38.690 62.951  1.00 79.86  ? 120  PRO A C     1 
ATOM   997  O  O     . PRO A 1 120 ? -6.482  38.420 62.727  1.00 81.69  ? 120  PRO A O     1 
ATOM   998  C  CB    . PRO A 1 120 ? -4.156  37.393 64.772  1.00 75.21  ? 120  PRO A CB    1 
ATOM   999  C  CG    . PRO A 1 120 ? -2.975  38.230 65.118  1.00 74.12  ? 120  PRO A CG    1 
ATOM   1000 C  CD    . PRO A 1 120 ? -2.045  38.132 63.946  1.00 70.19  ? 120  PRO A CD    1 
ATOM   1001 N  N     . ASP A 1 121 ? -4.821  39.930 62.933  1.00 81.99  ? 121  ASP A N     1 
ATOM   1002 C  CA    . ASP A 1 121 ? -5.697  41.083 62.726  1.00 85.90  ? 121  ASP A CA    1 
ATOM   1003 C  C     . ASP A 1 121 ? -5.632  41.634 61.301  1.00 83.12  ? 121  ASP A C     1 
ATOM   1004 O  O     . ASP A 1 121 ? -5.411  42.828 61.096  1.00 84.29  ? 121  ASP A O     1 
ATOM   1005 C  CB    . ASP A 1 121 ? -5.390  42.187 63.745  1.00 91.20  ? 121  ASP A CB    1 
ATOM   1006 C  CG    . ASP A 1 121 ? -3.961  42.685 63.653  1.00 94.75  ? 121  ASP A CG    1 
ATOM   1007 O  OD1   . ASP A 1 121 ? -3.125  41.976 63.055  1.00 95.55  ? 121  ASP A OD1   1 
ATOM   1008 O  OD2   . ASP A 1 121 ? -3.676  43.784 64.176  1.00 96.79  ? 121  ASP A OD2   1 
ATOM   1009 N  N     . GLY A 1 122 ? -5.830  40.760 60.320  1.00 79.85  ? 122  GLY A N     1 
ATOM   1010 C  CA    . GLY A 1 122 ? -5.891  41.183 58.932  1.00 77.39  ? 122  GLY A CA    1 
ATOM   1011 C  C     . GLY A 1 122 ? -4.538  41.283 58.258  1.00 73.00  ? 122  GLY A C     1 
ATOM   1012 O  O     . GLY A 1 122 ? -3.565  40.673 58.701  1.00 73.03  ? 122  GLY A O     1 
ATOM   1013 N  N     . PHE A 1 123 ? -4.480  42.059 57.179  1.00 68.37  ? 123  PHE A N     1 
ATOM   1014 C  CA    . PHE A 1 123 ? -3.256  42.200 56.398  1.00 62.18  ? 123  PHE A CA    1 
ATOM   1015 C  C     . PHE A 1 123 ? -2.175  42.977 57.145  1.00 58.70  ? 123  PHE A C     1 
ATOM   1016 O  O     . PHE A 1 123 ? -2.408  44.097 57.600  1.00 61.09  ? 123  PHE A O     1 
ATOM   1017 C  CB    . PHE A 1 123 ? -3.549  42.877 55.060  1.00 60.58  ? 123  PHE A CB    1 
ATOM   1018 C  CG    . PHE A 1 123 ? -2.328  43.110 54.222  1.00 59.86  ? 123  PHE A CG    1 
ATOM   1019 C  CD1   . PHE A 1 123 ? -1.820  42.099 53.422  1.00 59.05  ? 123  PHE A CD1   1 
ATOM   1020 C  CD2   . PHE A 1 123 ? -1.687  44.340 54.231  1.00 60.51  ? 123  PHE A CD2   1 
ATOM   1021 C  CE1   . PHE A 1 123 ? -0.695  42.310 52.647  1.00 59.21  ? 123  PHE A CE1   1 
ATOM   1022 C  CE2   . PHE A 1 123 ? -0.561  44.556 53.459  1.00 59.88  ? 123  PHE A CE2   1 
ATOM   1023 C  CZ    . PHE A 1 123 ? -0.065  43.540 52.666  1.00 59.10  ? 123  PHE A CZ    1 
ATOM   1024 N  N     . PRO A 1 124 ? -0.979  42.383 57.261  1.00 51.87  ? 124  PRO A N     1 
ATOM   1025 C  CA    . PRO A 1 124 ? 0.141   43.011 57.968  1.00 49.05  ? 124  PRO A CA    1 
ATOM   1026 C  C     . PRO A 1 124 ? 0.756   44.156 57.166  1.00 46.02  ? 124  PRO A C     1 
ATOM   1027 O  O     . PRO A 1 124 ? 1.528   43.915 56.238  1.00 43.73  ? 124  PRO A O     1 
ATOM   1028 C  CB    . PRO A 1 124 ? 1.142   41.861 58.122  1.00 47.41  ? 124  PRO A CB    1 
ATOM   1029 C  CG    . PRO A 1 124 ? 0.846   40.947 56.984  1.00 45.86  ? 124  PRO A CG    1 
ATOM   1030 C  CD    . PRO A 1 124 ? -0.631  41.054 56.725  1.00 48.54  ? 124  PRO A CD    1 
ATOM   1031 N  N     . GLU A 1 125 ? 0.413   45.390 57.524  1.00 47.14  ? 125  GLU A N     1 
ATOM   1032 C  CA    . GLU A 1 125 ? 0.917   46.559 56.810  1.00 48.50  ? 125  GLU A CA    1 
ATOM   1033 C  C     . GLU A 1 125 ? 2.428   46.692 56.939  1.00 47.22  ? 125  GLU A C     1 
ATOM   1034 O  O     . GLU A 1 125 ? 2.954   46.777 58.048  1.00 51.65  ? 125  GLU A O     1 
ATOM   1035 C  CB    . GLU A 1 125 ? 0.228   47.837 57.296  1.00 52.82  ? 125  GLU A CB    1 
ATOM   1036 C  CG    . GLU A 1 125 ? -1.187  48.016 56.765  1.00 58.19  ? 125  GLU A CG    1 
ATOM   1037 C  CD    . GLU A 1 125 ? -1.239  48.118 55.247  1.00 61.78  ? 125  GLU A CD    1 
ATOM   1038 O  OE1   . GLU A 1 125 ? -0.247  48.577 54.641  1.00 63.54  ? 125  GLU A OE1   1 
ATOM   1039 O  OE2   . GLU A 1 125 ? -2.273  47.738 54.658  1.00 62.75  ? 125  GLU A OE2   1 
ATOM   1040 N  N     . PRO A 1 126 ? 3.132   46.707 55.797  1.00 40.55  ? 126  PRO A N     1 
ATOM   1041 C  CA    . PRO A 1 126 ? 4.597   46.789 55.783  1.00 39.26  ? 126  PRO A CA    1 
ATOM   1042 C  C     . PRO A 1 126 ? 5.141   48.045 56.467  1.00 43.24  ? 126  PRO A C     1 
ATOM   1043 O  O     . PRO A 1 126 ? 6.221   47.994 57.055  1.00 44.71  ? 126  PRO A O     1 
ATOM   1044 C  CB    . PRO A 1 126 ? 4.943   46.783 54.286  1.00 35.90  ? 126  PRO A CB    1 
ATOM   1045 C  CG    . PRO A 1 126 ? 3.670   47.127 53.581  1.00 36.15  ? 126  PRO A CG    1 
ATOM   1046 C  CD    . PRO A 1 126 ? 2.570   46.598 54.441  1.00 36.38  ? 126  PRO A CD    1 
ATOM   1047 N  N     . SER A 1 127 ? 4.402   49.148 56.403  1.00 44.52  ? 127  SER A N     1 
ATOM   1048 C  CA    . SER A 1 127 ? 4.845   50.391 57.028  1.00 45.34  ? 127  SER A CA    1 
ATOM   1049 C  C     . SER A 1 127 ? 4.888   50.248 58.545  1.00 47.60  ? 127  SER A C     1 
ATOM   1050 O  O     . SER A 1 127 ? 5.679   50.912 59.218  1.00 51.01  ? 127  SER A O     1 
ATOM   1051 C  CB    . SER A 1 127 ? 3.933   51.554 56.633  1.00 46.91  ? 127  SER A CB    1 
ATOM   1052 O  OG    . SER A 1 127 ? 2.608   51.344 57.091  1.00 50.94  ? 127  SER A OG    1 
ATOM   1053 N  N     . GLN A 1 128 ? 4.035   49.375 59.076  1.00 45.73  ? 128  GLN A N     1 
ATOM   1054 C  CA    . GLN A 1 128 ? 3.967   49.149 60.516  1.00 47.56  ? 128  GLN A CA    1 
ATOM   1055 C  C     . GLN A 1 128 ? 4.855   47.980 60.943  1.00 46.60  ? 128  GLN A C     1 
ATOM   1056 O  O     . GLN A 1 128 ? 5.591   48.080 61.929  1.00 49.43  ? 128  GLN A O     1 
ATOM   1057 C  CB    . GLN A 1 128 ? 2.519   48.908 60.961  1.00 48.75  ? 128  GLN A CB    1 
ATOM   1058 C  CG    . GLN A 1 128 ? 1.528   49.954 60.470  1.00 52.80  ? 128  GLN A CG    1 
ATOM   1059 C  CD    . GLN A 1 128 ? 1.921   51.362 60.867  1.00 61.85  ? 128  GLN A CD    1 
ATOM   1060 O  OE1   . GLN A 1 128 ? 1.993   52.259 60.025  1.00 64.80  ? 128  GLN A OE1   1 
ATOM   1061 N  NE2   . GLN A 1 128 ? 2.176   51.566 62.155  1.00 65.73  ? 128  GLN A NE2   1 
ATOM   1062 N  N     . ALA A 1 129 ? 4.781   46.884 60.189  1.00 40.57  ? 129  ALA A N     1 
ATOM   1063 C  CA    . ALA A 1 129 ? 5.526   45.664 60.489  1.00 35.39  ? 129  ALA A CA    1 
ATOM   1064 C  C     . ALA A 1 129 ? 5.360   45.240 61.950  1.00 37.61  ? 129  ALA A C     1 
ATOM   1065 O  O     . ALA A 1 129 ? 6.339   45.006 62.658  1.00 39.27  ? 129  ALA A O     1 
ATOM   1066 C  CB    . ALA A 1 129 ? 6.993   45.839 60.136  1.00 31.94  ? 129  ALA A CB    1 
ATOM   1067 N  N     . LYS A 1 130 ? 4.109   45.154 62.391  1.00 38.26  ? 130  LYS A N     1 
ATOM   1068 C  CA    . LYS A 1 130 ? 3.793   44.811 63.773  1.00 39.10  ? 130  LYS A CA    1 
ATOM   1069 C  C     . LYS A 1 130 ? 4.088   43.348 64.068  1.00 40.90  ? 130  LYS A C     1 
ATOM   1070 O  O     . LYS A 1 130 ? 4.362   42.977 65.211  1.00 45.36  ? 130  LYS A O     1 
ATOM   1071 C  CB    . LYS A 1 130 ? 2.313   45.071 64.065  1.00 38.38  ? 130  LYS A CB    1 
ATOM   1072 C  CG    . LYS A 1 130 ? 1.841   46.480 63.793  1.00 39.30  ? 130  LYS A CG    1 
ATOM   1073 C  CD    . LYS A 1 130 ? 0.361   46.608 64.110  1.00 43.16  ? 130  LYS A CD    1 
ATOM   1074 N  N     . HIS A 1 131 ? 4.022   42.519 63.032  1.00 37.64  ? 131  HIS A N     1 
ATOM   1075 C  CA    . HIS A 1 131 ? 4.053   41.073 63.210  1.00 37.91  ? 131  HIS A CA    1 
ATOM   1076 C  C     . HIS A 1 131 ? 5.380   40.460 62.790  1.00 36.42  ? 131  HIS A C     1 
ATOM   1077 O  O     . HIS A 1 131 ? 6.033   40.949 61.868  1.00 36.20  ? 131  HIS A O     1 
ATOM   1078 C  CB    . HIS A 1 131 ? 2.904   40.428 62.437  1.00 38.97  ? 131  HIS A CB    1 
ATOM   1079 C  CG    . HIS A 1 131 ? 1.583   41.089 62.669  1.00 41.94  ? 131  HIS A CG    1 
ATOM   1080 N  ND1   . HIS A 1 131 ? 0.825   40.857 63.795  1.00 45.09  ? 131  HIS A ND1   1 
ATOM   1081 C  CD2   . HIS A 1 131 ? 0.891   41.984 61.925  1.00 42.88  ? 131  HIS A CD2   1 
ATOM   1082 C  CE1   . HIS A 1 131 ? -0.280  41.577 63.733  1.00 48.05  ? 131  HIS A CE1   1 
ATOM   1083 N  NE2   . HIS A 1 131 ? -0.265  42.269 62.608  1.00 46.82  ? 131  HIS A NE2   1 
ATOM   1084 N  N     . PRO A 1 132 ? 5.784   39.379 63.474  1.00 36.08  ? 132  PRO A N     1 
ATOM   1085 C  CA    . PRO A 1 132 ? 7.053   38.709 63.183  1.00 35.16  ? 132  PRO A CA    1 
ATOM   1086 C  C     . PRO A 1 132 ? 7.102   38.116 61.783  1.00 32.84  ? 132  PRO A C     1 
ATOM   1087 O  O     . PRO A 1 132 ? 6.108   37.575 61.293  1.00 32.41  ? 132  PRO A O     1 
ATOM   1088 C  CB    . PRO A 1 132 ? 7.102   37.584 64.222  1.00 34.65  ? 132  PRO A CB    1 
ATOM   1089 C  CG    . PRO A 1 132 ? 6.217   38.040 65.323  1.00 35.97  ? 132  PRO A CG    1 
ATOM   1090 C  CD    . PRO A 1 132 ? 5.113   38.794 64.647  1.00 35.79  ? 132  PRO A CD    1 
ATOM   1091 N  N     . ILE A 1 133 ? 8.260   38.230 61.145  1.00 30.12  ? 133  ILE A N     1 
ATOM   1092 C  CA    . ILE A 1 133 ? 8.519   37.506 59.914  1.00 30.83  ? 133  ILE A CA    1 
ATOM   1093 C  C     . ILE A 1 133 ? 8.871   36.074 60.307  1.00 33.50  ? 133  ILE A C     1 
ATOM   1094 O  O     . ILE A 1 133 ? 9.910   35.836 60.924  1.00 34.46  ? 133  ILE A O     1 
ATOM   1095 C  CB    . ILE A 1 133 ? 9.676   38.147 59.130  1.00 28.10  ? 133  ILE A CB    1 
ATOM   1096 C  CG1   . ILE A 1 133 ? 9.365   39.619 58.854  1.00 24.97  ? 133  ILE A CG1   1 
ATOM   1097 C  CG2   . ILE A 1 133 ? 9.930   37.392 57.834  1.00 26.02  ? 133  ILE A CG2   1 
ATOM   1098 C  CD1   . ILE A 1 133 ? 10.466  40.345 58.133  1.00 43.00  ? 133  ILE A CD1   1 
ATOM   1099 N  N     . ASP A 1 134 ? 7.998   35.126 59.977  1.00 31.65  ? 134  ASP A N     1 
ATOM   1100 C  CA    . ASP A 1 134 ? 8.181   33.748 60.429  1.00 31.77  ? 134  ASP A CA    1 
ATOM   1101 C  C     . ASP A 1 134 ? 8.695   32.791 59.352  1.00 33.18  ? 134  ASP A C     1 
ATOM   1102 O  O     . ASP A 1 134 ? 8.876   31.596 59.601  1.00 35.50  ? 134  ASP A O     1 
ATOM   1103 C  CB    . ASP A 1 134 ? 6.902   33.205 61.076  1.00 32.99  ? 134  ASP A CB    1 
ATOM   1104 C  CG    . ASP A 1 134 ? 5.684   33.368 60.195  1.00 31.52  ? 134  ASP A CG    1 
ATOM   1105 O  OD1   . ASP A 1 134 ? 5.800   33.188 58.964  1.00 31.19  ? 134  ASP A OD1   1 
ATOM   1106 O  OD2   . ASP A 1 134 ? 4.605   33.677 60.741  1.00 31.80  ? 134  ASP A OD2   1 
ATOM   1107 N  N     . ALA A 1 135 ? 8.934   33.323 58.159  1.00 31.71  ? 135  ALA A N     1 
ATOM   1108 C  CA    . ALA A 1 135 ? 9.522   32.538 57.084  1.00 29.20  ? 135  ALA A CA    1 
ATOM   1109 C  C     . ALA A 1 135 ? 10.097  33.435 55.997  1.00 31.69  ? 135  ALA A C     1 
ATOM   1110 O  O     . ALA A 1 135 ? 9.467   34.408 55.584  1.00 31.05  ? 135  ALA A O     1 
ATOM   1111 C  CB    . ALA A 1 135 ? 8.494   31.578 56.490  1.00 25.58  ? 135  ALA A CB    1 
ATOM   1112 N  N     . ILE A 1 136 ? 11.306  33.111 55.554  1.00 31.03  ? 136  ILE A N     1 
ATOM   1113 C  CA    . ILE A 1 136 ? 11.872  33.717 54.360  1.00 28.23  ? 136  ILE A CA    1 
ATOM   1114 C  C     . ILE A 1 136 ? 12.514  32.624 53.522  1.00 28.07  ? 136  ILE A C     1 
ATOM   1115 O  O     . ILE A 1 136 ? 13.366  31.883 54.014  1.00 30.88  ? 136  ILE A O     1 
ATOM   1116 C  CB    . ILE A 1 136 ? 12.963  34.756 54.689  1.00 28.12  ? 136  ILE A CB    1 
ATOM   1117 C  CG1   . ILE A 1 136 ? 12.444  35.822 55.656  1.00 30.25  ? 136  ILE A CG1   1 
ATOM   1118 C  CG2   . ILE A 1 136 ? 13.489  35.402 53.409  1.00 24.55  ? 136  ILE A CG2   1 
ATOM   1119 C  CD1   . ILE A 1 136 ? 13.520  36.781 56.138  1.00 29.12  ? 136  ILE A CD1   1 
ATOM   1120 N  N     . THR A 1 137 ? 12.098  32.510 52.265  1.00 26.02  ? 137  THR A N     1 
ATOM   1121 C  CA    . THR A 1 137 ? 12.823  31.678 51.313  1.00 24.67  ? 137  THR A CA    1 
ATOM   1122 C  C     . THR A 1 137 ? 13.513  32.577 50.305  1.00 24.42  ? 137  THR A C     1 
ATOM   1123 O  O     . THR A 1 137 ? 12.876  33.404 49.653  1.00 25.53  ? 137  THR A O     1 
ATOM   1124 C  CB    . THR A 1 137 ? 11.920  30.679 50.583  1.00 25.09  ? 137  THR A CB    1 
ATOM   1125 O  OG1   . THR A 1 137 ? 11.359  29.765 51.530  1.00 24.85  ? 137  THR A OG1   1 
ATOM   1126 C  CG2   . THR A 1 137 ? 12.730  29.889 49.564  1.00 26.10  ? 137  THR A CG2   1 
ATOM   1127 N  N     . HIS A 1 138 ? 14.824  32.411 50.192  1.00 22.76  ? 138  HIS A N     1 
ATOM   1128 C  CA    . HIS A 1 138 ? 15.644  33.279 49.367  1.00 21.71  ? 138  HIS A CA    1 
ATOM   1129 C  C     . HIS A 1 138 ? 16.424  32.418 48.390  1.00 23.77  ? 138  HIS A C     1 
ATOM   1130 O  O     . HIS A 1 138 ? 17.315  31.671 48.792  1.00 26.97  ? 138  HIS A O     1 
ATOM   1131 C  CB    . HIS A 1 138 ? 16.601  34.062 50.266  1.00 25.31  ? 138  HIS A CB    1 
ATOM   1132 C  CG    . HIS A 1 138 ? 17.436  35.076 49.547  1.00 28.58  ? 138  HIS A CG    1 
ATOM   1133 N  ND1   . HIS A 1 138 ? 17.332  36.430 49.789  1.00 28.05  ? 138  HIS A ND1   1 
ATOM   1134 C  CD2   . HIS A 1 138 ? 18.412  34.935 48.616  1.00 30.19  ? 138  HIS A CD2   1 
ATOM   1135 C  CE1   . HIS A 1 138 ? 18.196  37.078 49.028  1.00 29.82  ? 138  HIS A CE1   1 
ATOM   1136 N  NE2   . HIS A 1 138 ? 18.864  36.195 48.308  1.00 30.23  ? 138  HIS A NE2   1 
ATOM   1137 N  N     . TYR A 1 139 ? 16.078  32.504 47.110  1.00 21.76  ? 139  TYR A N     1 
ATOM   1138 C  CA    . TYR A 1 139 ? 16.822  31.783 46.086  1.00 22.86  ? 139  TYR A CA    1 
ATOM   1139 C  C     . TYR A 1 139 ? 17.930  32.661 45.516  1.00 26.89  ? 139  TYR A C     1 
ATOM   1140 O  O     . TYR A 1 139 ? 17.687  33.800 45.118  1.00 28.79  ? 139  TYR A O     1 
ATOM   1141 C  CB    . TYR A 1 139 ? 15.898  31.301 44.965  1.00 23.04  ? 139  TYR A CB    1 
ATOM   1142 C  CG    . TYR A 1 139 ? 16.641  30.721 43.781  1.00 25.59  ? 139  TYR A CG    1 
ATOM   1143 C  CD1   . TYR A 1 139 ? 16.945  31.506 42.673  1.00 28.23  ? 139  TYR A CD1   1 
ATOM   1144 C  CD2   . TYR A 1 139 ? 17.052  29.394 43.776  1.00 25.91  ? 139  TYR A CD2   1 
ATOM   1145 C  CE1   . TYR A 1 139 ? 17.633  30.984 41.592  1.00 30.32  ? 139  TYR A CE1   1 
ATOM   1146 C  CE2   . TYR A 1 139 ? 17.739  28.863 42.698  1.00 29.66  ? 139  TYR A CE2   1 
ATOM   1147 C  CZ    . TYR A 1 139 ? 18.027  29.664 41.608  1.00 32.40  ? 139  TYR A CZ    1 
ATOM   1148 O  OH    . TYR A 1 139 ? 18.712  29.151 40.530  1.00 34.69  ? 139  TYR A OH    1 
ATOM   1149 N  N     . ASP A 1 140 ? 19.145  32.121 45.482  1.00 26.98  ? 140  ASP A N     1 
ATOM   1150 C  CA    . ASP A 1 140 ? 20.287  32.817 44.905  1.00 26.34  ? 140  ASP A CA    1 
ATOM   1151 C  C     . ASP A 1 140 ? 20.634  32.168 43.570  1.00 29.10  ? 140  ASP A C     1 
ATOM   1152 O  O     . ASP A 1 140 ? 20.903  30.968 43.517  1.00 32.04  ? 140  ASP A O     1 
ATOM   1153 C  CB    . ASP A 1 140 ? 21.481  32.742 45.856  1.00 29.17  ? 140  ASP A CB    1 
ATOM   1154 C  CG    . ASP A 1 140 ? 22.677  33.529 45.356  1.00 32.64  ? 140  ASP A CG    1 
ATOM   1155 O  OD1   . ASP A 1 140 ? 23.424  33.005 44.503  1.00 29.18  ? 140  ASP A OD1   1 
ATOM   1156 O  OD2   . ASP A 1 140 ? 22.874  34.671 45.822  1.00 37.02  ? 140  ASP A OD2   1 
ATOM   1157 N  N     . SER A 1 141 ? 20.626  32.957 42.497  1.00 28.51  ? 141  SER A N     1 
ATOM   1158 C  CA    . SER A 1 141 ? 20.820  32.422 41.149  1.00 26.96  ? 141  SER A CA    1 
ATOM   1159 C  C     . SER A 1 141 ? 22.233  31.908 40.924  1.00 30.52  ? 141  SER A C     1 
ATOM   1160 O  O     . SER A 1 141 ? 22.458  31.029 40.088  1.00 33.66  ? 141  SER A O     1 
ATOM   1161 C  CB    . SER A 1 141 ? 20.473  33.471 40.089  1.00 26.67  ? 141  SER A CB    1 
ATOM   1162 O  OG    . SER A 1 141 ? 21.372  34.563 40.137  1.00 28.93  ? 141  SER A OG    1 
ATOM   1163 N  N     . ILE A 1 142 ? 23.187  32.459 41.667  1.00 31.50  ? 142  ILE A N     1 
ATOM   1164 C  CA    . ILE A 1 142 ? 24.578  32.031 41.549  1.00 34.48  ? 142  ILE A CA    1 
ATOM   1165 C  C     . ILE A 1 142 ? 24.818  30.700 42.261  1.00 36.12  ? 142  ILE A C     1 
ATOM   1166 O  O     . ILE A 1 142 ? 25.407  29.777 41.691  1.00 38.22  ? 142  ILE A O     1 
ATOM   1167 C  CB    . ILE A 1 142 ? 25.547  33.104 42.079  1.00 32.94  ? 142  ILE A CB    1 
ATOM   1168 C  CG1   . ILE A 1 142 ? 25.496  34.345 41.184  1.00 28.59  ? 142  ILE A CG1   1 
ATOM   1169 C  CG2   . ILE A 1 142 ? 26.959  32.554 42.148  1.00 27.47  ? 142  ILE A CG2   1 
ATOM   1170 C  CD1   . ILE A 1 142 ? 26.326  35.492 41.695  1.00 26.35  ? 142  ILE A CD1   1 
ATOM   1171 N  N     . ASP A 1 143 ? 24.349  30.600 43.501  1.00 32.85  ? 143  ASP A N     1 
ATOM   1172 C  CA    . ASP A 1 143 ? 24.458  29.355 44.248  1.00 32.05  ? 143  ASP A CA    1 
ATOM   1173 C  C     . ASP A 1 143 ? 23.502  28.308 43.701  1.00 33.55  ? 143  ASP A C     1 
ATOM   1174 O  O     . ASP A 1 143 ? 23.726  27.112 43.882  1.00 34.00  ? 143  ASP A O     1 
ATOM   1175 C  CB    . ASP A 1 143 ? 24.168  29.576 45.733  1.00 31.63  ? 143  ASP A CB    1 
ATOM   1176 C  CG    . ASP A 1 143 ? 25.198  30.454 46.402  1.00 36.52  ? 143  ASP A CG    1 
ATOM   1177 O  OD1   . ASP A 1 143 ? 26.316  30.591 45.860  1.00 37.42  ? 143  ASP A OD1   1 
ATOM   1178 O  OD2   . ASP A 1 143 ? 24.891  31.005 47.477  1.00 38.91  ? 143  ASP A OD2   1 
ATOM   1179 N  N     . ASP A 1 144 ? 22.445  28.770 43.029  1.00 34.18  ? 144  ASP A N     1 
ATOM   1180 C  CA    . ASP A 1 144 ? 21.362  27.904 42.567  1.00 33.08  ? 144  ASP A CA    1 
ATOM   1181 C  C     . ASP A 1 144 ? 20.796  27.143 43.763  1.00 33.15  ? 144  ASP A C     1 
ATOM   1182 O  O     . ASP A 1 144 ? 20.594  25.930 43.714  1.00 36.96  ? 144  ASP A O     1 
ATOM   1183 C  CB    . ASP A 1 144 ? 21.851  26.950 41.470  1.00 34.38  ? 144  ASP A CB    1 
ATOM   1184 C  CG    . ASP A 1 144 ? 20.723  26.174 40.825  1.00 36.14  ? 144  ASP A CG    1 
ATOM   1185 O  OD1   . ASP A 1 144 ? 20.980  25.050 40.346  1.00 40.70  ? 144  ASP A OD1   1 
ATOM   1186 O  OD2   . ASP A 1 144 ? 19.581  26.683 40.803  1.00 32.76  ? 144  ASP A OD2   1 
ATOM   1187 N  N     . ARG A 1 145 ? 20.562  27.870 44.849  1.00 30.38  ? 145  ARG A N     1 
ATOM   1188 C  CA    . ARG A 1 145 ? 20.097  27.266 46.090  1.00 30.37  ? 145  ARG A CA    1 
ATOM   1189 C  C     . ARG A 1 145 ? 18.951  28.063 46.700  1.00 29.66  ? 145  ARG A C     1 
ATOM   1190 O  O     . ARG A 1 145 ? 18.944  29.293 46.658  1.00 29.58  ? 145  ARG A O     1 
ATOM   1191 C  CB    . ARG A 1 145 ? 21.241  27.164 47.103  1.00 30.04  ? 145  ARG A CB    1 
ATOM   1192 C  CG    . ARG A 1 145 ? 22.358  26.211 46.711  1.00 32.95  ? 145  ARG A CG    1 
ATOM   1193 C  CD    . ARG A 1 145 ? 21.882  24.770 46.712  1.00 34.63  ? 145  ARG A CD    1 
ATOM   1194 N  NE    . ARG A 1 145 ? 22.986  23.833 46.524  1.00 38.13  ? 145  ARG A NE    1 
ATOM   1195 C  CZ    . ARG A 1 145 ? 23.401  23.395 45.340  1.00 39.60  ? 145  ARG A CZ    1 
ATOM   1196 N  NH1   . ARG A 1 145 ? 22.804  23.808 44.230  1.00 40.26  ? 145  ARG A NH1   1 
ATOM   1197 N  NH2   . ARG A 1 145 ? 24.413  22.543 45.266  1.00 39.47  ? 145  ARG A NH2   1 
ATOM   1198 N  N     . PHE A 1 146 ? 17.985  27.351 47.268  1.00 27.93  ? 146  PHE A N     1 
ATOM   1199 C  CA    . PHE A 1 146 ? 16.897  27.982 47.994  1.00 25.54  ? 146  PHE A CA    1 
ATOM   1200 C  C     . PHE A 1 146 ? 17.257  28.031 49.469  1.00 27.57  ? 146  PHE A C     1 
ATOM   1201 O  O     . PHE A 1 146 ? 17.228  27.011 50.160  1.00 30.33  ? 146  PHE A O     1 
ATOM   1202 C  CB    . PHE A 1 146 ? 15.598  27.201 47.804  1.00 24.70  ? 146  PHE A CB    1 
ATOM   1203 C  CG    . PHE A 1 146 ? 15.091  27.199 46.391  1.00 26.23  ? 146  PHE A CG    1 
ATOM   1204 C  CD1   . PHE A 1 146 ? 15.643  26.357 45.442  1.00 26.34  ? 146  PHE A CD1   1 
ATOM   1205 C  CD2   . PHE A 1 146 ? 14.050  28.032 46.015  1.00 26.88  ? 146  PHE A CD2   1 
ATOM   1206 C  CE1   . PHE A 1 146 ? 15.175  26.352 44.143  1.00 27.41  ? 146  PHE A CE1   1 
ATOM   1207 C  CE2   . PHE A 1 146 ? 13.577  28.030 44.720  1.00 26.52  ? 146  PHE A CE2   1 
ATOM   1208 C  CZ    . PHE A 1 146 ? 14.140  27.189 43.782  1.00 27.16  ? 146  PHE A CZ    1 
ATOM   1209 N  N     . TYR A 1 147 ? 17.620  29.213 49.949  1.00 25.10  ? 147  TYR A N     1 
ATOM   1210 C  CA    . TYR A 1 147 ? 17.950  29.378 51.355  1.00 26.19  ? 147  TYR A CA    1 
ATOM   1211 C  C     . TYR A 1 147 ? 16.681  29.632 52.155  1.00 27.80  ? 147  TYR A C     1 
ATOM   1212 O  O     . TYR A 1 147 ? 16.018  30.656 51.983  1.00 27.62  ? 147  TYR A O     1 
ATOM   1213 C  CB    . TYR A 1 147 ? 18.963  30.508 51.545  1.00 25.23  ? 147  TYR A CB    1 
ATOM   1214 C  CG    . TYR A 1 147 ? 20.309  30.213 50.922  1.00 26.77  ? 147  TYR A CG    1 
ATOM   1215 C  CD1   . TYR A 1 147 ? 20.589  30.585 49.613  1.00 28.36  ? 147  TYR A CD1   1 
ATOM   1216 C  CD2   . TYR A 1 147 ? 21.298  29.551 51.639  1.00 28.21  ? 147  TYR A CD2   1 
ATOM   1217 C  CE1   . TYR A 1 147 ? 21.819  30.314 49.038  1.00 31.68  ? 147  TYR A CE1   1 
ATOM   1218 C  CE2   . TYR A 1 147 ? 22.530  29.275 51.073  1.00 31.03  ? 147  TYR A CE2   1 
ATOM   1219 C  CZ    . TYR A 1 147 ? 22.786  29.659 49.772  1.00 34.15  ? 147  TYR A CZ    1 
ATOM   1220 O  OH    . TYR A 1 147 ? 24.012  29.384 49.207  1.00 34.35  ? 147  TYR A OH    1 
ATOM   1221 N  N     . VAL A 1 148 ? 16.343  28.684 53.022  1.00 29.37  ? 148  VAL A N     1 
ATOM   1222 C  CA    . VAL A 1 148 ? 15.100  28.754 53.778  1.00 30.50  ? 148  VAL A CA    1 
ATOM   1223 C  C     . VAL A 1 148 ? 15.330  29.180 55.224  1.00 31.95  ? 148  VAL A C     1 
ATOM   1224 O  O     . VAL A 1 148 ? 16.052  28.517 55.972  1.00 32.58  ? 148  VAL A O     1 
ATOM   1225 C  CB    . VAL A 1 148 ? 14.347  27.413 53.748  1.00 30.00  ? 148  VAL A CB    1 
ATOM   1226 C  CG1   . VAL A 1 148 ? 13.065  27.503 54.563  1.00 22.74  ? 148  VAL A CG1   1 
ATOM   1227 C  CG2   . VAL A 1 148 ? 14.048  27.021 52.315  1.00 27.57  ? 148  VAL A CG2   1 
ATOM   1228 N  N     . PHE A 1 149 ? 14.706  30.293 55.601  1.00 29.76  ? 149  PHE A N     1 
ATOM   1229 C  CA    . PHE A 1 149 ? 14.792  30.818 56.958  1.00 29.95  ? 149  PHE A CA    1 
ATOM   1230 C  C     . PHE A 1 149 ? 13.464  30.597 57.669  1.00 29.44  ? 149  PHE A C     1 
ATOM   1231 O  O     . PHE A 1 149 ? 12.473  31.266 57.374  1.00 30.56  ? 149  PHE A O     1 
ATOM   1232 C  CB    . PHE A 1 149 ? 15.146  32.306 56.932  1.00 28.66  ? 149  PHE A CB    1 
ATOM   1233 C  CG    . PHE A 1 149 ? 16.468  32.600 56.285  1.00 25.45  ? 149  PHE A CG    1 
ATOM   1234 C  CD1   . PHE A 1 149 ? 16.580  32.668 54.906  1.00 23.51  ? 149  PHE A CD1   1 
ATOM   1235 C  CD2   . PHE A 1 149 ? 17.597  32.809 57.056  1.00 27.61  ? 149  PHE A CD2   1 
ATOM   1236 C  CE1   . PHE A 1 149 ? 17.794  32.935 54.307  1.00 26.02  ? 149  PHE A CE1   1 
ATOM   1237 C  CE2   . PHE A 1 149 ? 18.815  33.079 56.463  1.00 30.39  ? 149  PHE A CE2   1 
ATOM   1238 C  CZ    . PHE A 1 149 ? 18.913  33.143 55.085  1.00 29.05  ? 149  PHE A CZ    1 
ATOM   1239 N  N     . ASP A 1 150 ? 13.455  29.654 58.605  1.00 28.13  ? 150  ASP A N     1 
ATOM   1240 C  CA    . ASP A 1 150 ? 12.221  29.197 59.232  1.00 32.05  ? 150  ASP A CA    1 
ATOM   1241 C  C     . ASP A 1 150 ? 12.192  29.561 60.713  1.00 36.08  ? 150  ASP A C     1 
ATOM   1242 O  O     . ASP A 1 150 ? 13.110  29.227 61.464  1.00 42.18  ? 150  ASP A O     1 
ATOM   1243 C  CB    . ASP A 1 150 ? 12.084  27.683 59.039  1.00 32.71  ? 150  ASP A CB    1 
ATOM   1244 C  CG    . ASP A 1 150 ? 10.815  27.118 59.650  1.00 33.94  ? 150  ASP A CG    1 
ATOM   1245 O  OD1   . ASP A 1 150 ? 9.891   27.897 59.970  1.00 34.57  ? 150  ASP A OD1   1 
ATOM   1246 O  OD2   . ASP A 1 150 ? 10.743  25.880 59.798  1.00 34.45  ? 150  ASP A OD2   1 
ATOM   1247 N  N     . LEU A 1 151 ? 11.132  30.250 61.124  1.00 31.54  ? 151  LEU A N     1 
ATOM   1248 C  CA    . LEU A 1 151 ? 10.974  30.647 62.517  1.00 32.25  ? 151  LEU A CA    1 
ATOM   1249 C  C     . LEU A 1 151 ? 10.151  29.630 63.294  1.00 35.33  ? 151  LEU A C     1 
ATOM   1250 O  O     . LEU A 1 151 ? 8.931   29.566 63.142  1.00 36.01  ? 151  LEU A O     1 
ATOM   1251 C  CB    . LEU A 1 151 ? 10.310  32.015 62.614  1.00 33.27  ? 151  LEU A CB    1 
ATOM   1252 C  CG    . LEU A 1 151 ? 10.075  32.503 64.043  1.00 36.39  ? 151  LEU A CG    1 
ATOM   1253 C  CD1   . LEU A 1 151 ? 11.387  32.487 64.798  1.00 36.47  ? 151  LEU A CD1   1 
ATOM   1254 C  CD2   . LEU A 1 151 ? 9.457   33.891 64.060  1.00 35.36  ? 151  LEU A CD2   1 
ATOM   1255 N  N     . LEU A 1 152 ? 10.817  28.847 64.138  1.00 36.33  ? 152  LEU A N     1 
ATOM   1256 C  CA    . LEU A 1 152 ? 10.140  27.804 64.898  1.00 37.46  ? 152  LEU A CA    1 
ATOM   1257 C  C     . LEU A 1 152 ? 9.338   28.375 66.059  1.00 42.25  ? 152  LEU A C     1 
ATOM   1258 O  O     . LEU A 1 152 ? 8.312   27.815 66.446  1.00 43.58  ? 152  LEU A O     1 
ATOM   1259 C  CB    . LEU A 1 152 ? 11.140  26.771 65.416  1.00 34.50  ? 152  LEU A CB    1 
ATOM   1260 C  CG    . LEU A 1 152 ? 11.908  26.002 64.347  1.00 35.13  ? 152  LEU A CG    1 
ATOM   1261 C  CD1   . LEU A 1 152 ? 12.759  24.920 64.989  1.00 36.80  ? 152  LEU A CD1   1 
ATOM   1262 C  CD2   . LEU A 1 152 ? 10.950  25.415 63.319  1.00 33.25  ? 152  LEU A CD2   1 
ATOM   1263 N  N     . ASN A 1 153 ? 9.808   29.490 66.612  1.00 42.03  ? 153  ASN A N     1 
ATOM   1264 C  CA    . ASN A 1 153 ? 9.173   30.075 67.787  1.00 40.60  ? 153  ASN A CA    1 
ATOM   1265 C  C     . ASN A 1 153 ? 8.699   31.500 67.560  1.00 40.58  ? 153  ASN A C     1 
ATOM   1266 O  O     . ASN A 1 153 ? 9.484   32.398 67.263  1.00 39.26  ? 153  ASN A O     1 
ATOM   1267 C  CB    . ASN A 1 153 ? 10.106  30.006 68.992  1.00 41.65  ? 153  ASN A CB    1 
ATOM   1268 C  CG    . ASN A 1 153 ? 10.540  28.592 69.302  1.00 45.86  ? 153  ASN A CG    1 
ATOM   1269 O  OD1   . ASN A 1 153 ? 9.751   27.652 69.192  1.00 49.95  ? 153  ASN A OD1   1 
ATOM   1270 N  ND2   . ASN A 1 153 ? 11.802  28.428 69.677  1.00 47.62  ? 153  ASN A ND2   1 
ATOM   1271 N  N     . SER A 1 154 ? 7.398   31.692 67.717  1.00 42.33  ? 154  SER A N     1 
ATOM   1272 C  CA    . SER A 1 154 ? 6.766   32.974 67.477  1.00 42.98  ? 154  SER A CA    1 
ATOM   1273 C  C     . SER A 1 154 ? 5.723   33.198 68.562  1.00 46.31  ? 154  SER A C     1 
ATOM   1274 O  O     . SER A 1 154 ? 5.241   32.241 69.164  1.00 48.04  ? 154  SER A O     1 
ATOM   1275 C  CB    . SER A 1 154 ? 6.112   32.964 66.092  1.00 40.07  ? 154  SER A CB    1 
ATOM   1276 O  OG    . SER A 1 154 ? 5.161   34.002 65.947  1.00 39.95  ? 154  SER A OG    1 
ATOM   1277 N  N     . PRO A 1 155 ? 5.378   34.465 68.831  1.00 48.20  ? 155  PRO A N     1 
ATOM   1278 C  CA    . PRO A 1 155 ? 4.288   34.729 69.777  1.00 48.43  ? 155  PRO A CA    1 
ATOM   1279 C  C     . PRO A 1 155 ? 2.943   34.217 69.263  1.00 48.48  ? 155  PRO A C     1 
ATOM   1280 O  O     . PRO A 1 155 ? 1.960   34.244 70.002  1.00 52.62  ? 155  PRO A O     1 
ATOM   1281 C  CB    . PRO A 1 155 ? 4.273   36.260 69.880  1.00 49.07  ? 155  PRO A CB    1 
ATOM   1282 C  CG    . PRO A 1 155 ? 5.037   36.751 68.682  1.00 46.97  ? 155  PRO A CG    1 
ATOM   1283 C  CD    . PRO A 1 155 ? 6.064   35.702 68.418  1.00 47.70  ? 155  PRO A CD    1 
ATOM   1284 N  N     . TYR A 1 156 ? 2.907   33.757 68.016  1.00 46.42  ? 156  TYR A N     1 
ATOM   1285 C  CA    . TYR A 1 156 ? 1.677   33.242 67.424  1.00 49.41  ? 156  TYR A CA    1 
ATOM   1286 C  C     . TYR A 1 156 ? 1.681   31.715 67.331  1.00 50.32  ? 156  TYR A C     1 
ATOM   1287 O  O     . TYR A 1 156 ? 0.747   31.116 66.797  1.00 50.92  ? 156  TYR A O     1 
ATOM   1288 C  CB    . TYR A 1 156 ? 1.440   33.864 66.043  1.00 50.57  ? 156  TYR A CB    1 
ATOM   1289 C  CG    . TYR A 1 156 ? 1.264   35.369 66.069  1.00 53.44  ? 156  TYR A CG    1 
ATOM   1290 C  CD1   . TYR A 1 156 ? 0.707   36.005 67.171  1.00 56.82  ? 156  TYR A CD1   1 
ATOM   1291 C  CD2   . TYR A 1 156 ? 1.662   36.154 64.993  1.00 52.23  ? 156  TYR A CD2   1 
ATOM   1292 C  CE1   . TYR A 1 156 ? 0.546   37.380 67.201  1.00 58.83  ? 156  TYR A CE1   1 
ATOM   1293 C  CE2   . TYR A 1 156 ? 1.507   37.530 65.014  1.00 53.46  ? 156  TYR A CE2   1 
ATOM   1294 C  CZ    . TYR A 1 156 ? 0.948   38.138 66.119  1.00 56.79  ? 156  TYR A CZ    1 
ATOM   1295 O  OH    . TYR A 1 156 ? 0.790   39.506 66.148  1.00 56.72  ? 156  TYR A OH    1 
ATOM   1296 N  N     . GLY A 1 157 ? 2.733   31.090 67.854  1.00 50.61  ? 157  GLY A N     1 
ATOM   1297 C  CA    . GLY A 1 157 ? 2.806   29.638 67.903  1.00 48.51  ? 157  GLY A CA    1 
ATOM   1298 C  C     . GLY A 1 157 ? 4.206   29.058 67.796  1.00 46.24  ? 157  GLY A C     1 
ATOM   1299 O  O     . GLY A 1 157 ? 5.036   29.550 67.034  1.00 46.40  ? 157  GLY A O     1 
ATOM   1300 N  N     . ASN A 1 158 ? 4.464   28.007 68.569  1.00 47.36  ? 158  ASN A N     1 
ATOM   1301 C  CA    . ASN A 1 158 ? 5.725   27.276 68.493  1.00 47.11  ? 158  ASN A CA    1 
ATOM   1302 C  C     . ASN A 1 158 ? 5.550   25.992 67.693  1.00 44.93  ? 158  ASN A C     1 
ATOM   1303 O  O     . ASN A 1 158 ? 4.654   25.194 67.972  1.00 45.30  ? 158  ASN A O     1 
ATOM   1304 C  CB    . ASN A 1 158 ? 6.257   26.958 69.891  1.00 52.18  ? 158  ASN A CB    1 
ATOM   1305 C  CG    . ASN A 1 158 ? 6.358   28.190 70.770  1.00 56.63  ? 158  ASN A CG    1 
ATOM   1306 O  OD1   . ASN A 1 158 ? 5.513   28.418 71.637  1.00 58.89  ? 158  ASN A OD1   1 
ATOM   1307 N  ND2   . ASN A 1 158 ? 7.389   28.994 70.546  1.00 57.30  ? 158  ASN A ND2   1 
ATOM   1308 N  N     . VAL A 1 159 ? 6.410   25.797 66.699  1.00 42.73  ? 159  VAL A N     1 
ATOM   1309 C  CA    . VAL A 1 159 ? 6.257   24.701 65.750  1.00 39.49  ? 159  VAL A CA    1 
ATOM   1310 C  C     . VAL A 1 159 ? 7.526   23.872 65.644  1.00 39.99  ? 159  VAL A C     1 
ATOM   1311 O  O     . VAL A 1 159 ? 8.600   24.309 66.055  1.00 41.87  ? 159  VAL A O     1 
ATOM   1312 C  CB    . VAL A 1 159 ? 5.919   25.235 64.351  1.00 38.58  ? 159  VAL A CB    1 
ATOM   1313 C  CG1   . VAL A 1 159 ? 4.573   25.937 64.362  1.00 38.32  ? 159  VAL A CG1   1 
ATOM   1314 C  CG2   . VAL A 1 159 ? 7.011   26.182 63.872  1.00 37.21  ? 159  VAL A CG2   1 
ATOM   1315 N  N     . GLU A 1 160 ? 7.399   22.674 65.085  1.00 41.36  ? 160  GLU A N     1 
ATOM   1316 C  CA    . GLU A 1 160 ? 8.557   21.820 64.865  1.00 45.48  ? 160  GLU A CA    1 
ATOM   1317 C  C     . GLU A 1 160 ? 9.200   22.144 63.529  1.00 41.16  ? 160  GLU A C     1 
ATOM   1318 O  O     . GLU A 1 160 ? 8.598   22.808 62.683  1.00 39.53  ? 160  GLU A O     1 
ATOM   1319 C  CB    . GLU A 1 160 ? 8.159   20.349 64.913  1.00 52.02  ? 160  GLU A CB    1 
ATOM   1320 C  CG    . GLU A 1 160 ? 7.701   19.889 66.277  1.00 61.28  ? 160  GLU A CG    1 
ATOM   1321 C  CD    . GLU A 1 160 ? 6.631   18.829 66.184  1.00 71.97  ? 160  GLU A CD    1 
ATOM   1322 O  OE1   . GLU A 1 160 ? 5.828   18.887 65.227  1.00 73.18  ? 160  GLU A OE1   1 
ATOM   1323 O  OE2   . GLU A 1 160 ? 6.598   17.936 67.058  1.00 78.35  ? 160  GLU A OE2   1 
ATOM   1324 N  N     . GLU A 1 161 ? 10.429  21.675 63.348  1.00 40.56  ? 161  GLU A N     1 
ATOM   1325 C  CA    . GLU A 1 161 ? 11.146  21.906 62.105  1.00 39.97  ? 161  GLU A CA    1 
ATOM   1326 C  C     . GLU A 1 161 ? 10.375  21.358 60.914  1.00 40.31  ? 161  GLU A C     1 
ATOM   1327 O  O     . GLU A 1 161 ? 9.641   20.372 61.016  1.00 39.46  ? 161  GLU A O     1 
ATOM   1328 C  CB    . GLU A 1 161 ? 12.544  21.286 62.149  1.00 41.49  ? 161  GLU A CB    1 
ATOM   1329 C  CG    . GLU A 1 161 ? 13.460  21.890 63.193  1.00 45.79  ? 161  GLU A CG    1 
ATOM   1330 C  CD    . GLU A 1 161 ? 14.863  21.321 63.133  1.00 50.90  ? 161  GLU A CD    1 
ATOM   1331 O  OE1   . GLU A 1 161 ? 15.215  20.702 62.105  1.00 49.54  ? 161  GLU A OE1   1 
ATOM   1332 O  OE2   . GLU A 1 161 ? 15.612  21.493 64.119  1.00 55.34  ? 161  GLU A OE2   1 
ATOM   1333 N  N     . TRP A 1 162 ? 10.539  22.032 59.787  1.00 39.84  ? 162  TRP A N     1 
ATOM   1334 C  CA    . TRP A 1 162 ? 9.992   21.585 58.523  1.00 36.22  ? 162  TRP A CA    1 
ATOM   1335 C  C     . TRP A 1 162 ? 10.770  20.362 58.062  1.00 33.77  ? 162  TRP A C     1 
ATOM   1336 O  O     . TRP A 1 162 ? 11.997  20.339 58.136  1.00 35.54  ? 162  TRP A O     1 
ATOM   1337 C  CB    . TRP A 1 162 ? 10.115  22.724 57.514  1.00 35.77  ? 162  TRP A CB    1 
ATOM   1338 C  CG    . TRP A 1 162 ? 9.973   22.341 56.083  1.00 35.02  ? 162  TRP A CG    1 
ATOM   1339 C  CD1   . TRP A 1 162 ? 8.811   22.198 55.383  1.00 35.49  ? 162  TRP A CD1   1 
ATOM   1340 C  CD2   . TRP A 1 162 ? 11.034  22.091 55.157  1.00 31.60  ? 162  TRP A CD2   1 
ATOM   1341 N  NE1   . TRP A 1 162 ? 9.084   21.860 54.080  1.00 34.37  ? 162  TRP A NE1   1 
ATOM   1342 C  CE2   . TRP A 1 162 ? 10.444  21.789 53.915  1.00 30.29  ? 162  TRP A CE2   1 
ATOM   1343 C  CE3   . TRP A 1 162 ? 12.428  22.086 55.258  1.00 29.77  ? 162  TRP A CE3   1 
ATOM   1344 C  CZ2   . TRP A 1 162 ? 11.198  21.487 52.785  1.00 25.18  ? 162  TRP A CZ2   1 
ATOM   1345 C  CZ3   . TRP A 1 162 ? 13.172  21.787 54.136  1.00 27.63  ? 162  TRP A CZ3   1 
ATOM   1346 C  CH2   . TRP A 1 162 ? 12.556  21.492 52.916  1.00 26.54  ? 162  TRP A CH2   1 
ATOM   1347 N  N     . SER A 1 163 ? 10.055  19.341 57.605  1.00 32.35  ? 163  SER A N     1 
ATOM   1348 C  CA    . SER A 1 163 ? 10.686  18.107 57.152  1.00 32.57  ? 163  SER A CA    1 
ATOM   1349 C  C     . SER A 1 163 ? 10.837  18.069 55.633  1.00 34.01  ? 163  SER A C     1 
ATOM   1350 O  O     . SER A 1 163 ? 9.842   18.066 54.902  1.00 34.48  ? 163  SER A O     1 
ATOM   1351 C  CB    . SER A 1 163 ? 9.873   16.900 57.615  1.00 33.22  ? 163  SER A CB    1 
ATOM   1352 O  OG    . SER A 1 163 ? 10.257  15.734 56.909  1.00 35.92  ? 163  SER A OG    1 
ATOM   1353 N  N     . ILE A 1 164 ? 12.079  18.034 55.160  1.00 32.98  ? 164  ILE A N     1 
ATOM   1354 C  CA    . ILE A 1 164 ? 12.338  17.993 53.724  1.00 34.27  ? 164  ILE A CA    1 
ATOM   1355 C  C     . ILE A 1 164 ? 11.878  16.658 53.136  1.00 40.37  ? 164  ILE A C     1 
ATOM   1356 O  O     . ILE A 1 164 ? 11.566  16.564 51.950  1.00 42.21  ? 164  ILE A O     1 
ATOM   1357 C  CB    . ILE A 1 164 ? 13.828  18.268 53.394  1.00 29.81  ? 164  ILE A CB    1 
ATOM   1358 C  CG1   . ILE A 1 164 ? 14.019  18.490 51.889  1.00 28.87  ? 164  ILE A CG1   1 
ATOM   1359 C  CG2   . ILE A 1 164 ? 14.722  17.151 53.915  1.00 28.42  ? 164  ILE A CG2   1 
ATOM   1360 C  CD1   . ILE A 1 164 ? 15.369  19.052 51.521  1.00 26.54  ? 164  ILE A CD1   1 
ATOM   1361 N  N     . GLU A 1 165 ? 11.815  15.636 53.986  1.00 45.17  ? 165  GLU A N     1 
ATOM   1362 C  CA    . GLU A 1 165 ? 11.329  14.318 53.587  1.00 46.83  ? 165  GLU A CA    1 
ATOM   1363 C  C     . GLU A 1 165 ? 9.829   14.350 53.312  1.00 43.18  ? 165  GLU A C     1 
ATOM   1364 O  O     . GLU A 1 165 ? 9.360   13.825 52.302  1.00 42.10  ? 165  GLU A O     1 
ATOM   1365 C  CB    . GLU A 1 165 ? 11.636  13.278 54.672  1.00 54.06  ? 165  GLU A CB    1 
ATOM   1366 C  CG    . GLU A 1 165 ? 13.114  12.933 54.834  1.00 60.38  ? 165  GLU A CG    1 
ATOM   1367 C  CD    . GLU A 1 165 ? 13.899  13.983 55.610  1.00 65.48  ? 165  GLU A CD    1 
ATOM   1368 O  OE1   . GLU A 1 165 ? 13.293  14.707 56.432  1.00 64.24  ? 165  GLU A OE1   1 
ATOM   1369 O  OE2   . GLU A 1 165 ? 15.127  14.083 55.397  1.00 69.38  ? 165  GLU A OE2   1 
ATOM   1370 N  N     . ILE A 1 166 ? 9.082   14.962 54.225  1.00 42.93  ? 166  ILE A N     1 
ATOM   1371 C  CA    . ILE A 1 166 ? 7.636   15.091 54.082  1.00 40.81  ? 166  ILE A CA    1 
ATOM   1372 C  C     . ILE A 1 166 ? 7.289   16.034 52.930  1.00 37.16  ? 166  ILE A C     1 
ATOM   1373 O  O     . ILE A 1 166 ? 6.370   15.774 52.154  1.00 36.06  ? 166  ILE A O     1 
ATOM   1374 C  CB    . ILE A 1 166 ? 6.989   15.585 55.395  1.00 40.41  ? 166  ILE A CB    1 
ATOM   1375 C  CG1   . ILE A 1 166 ? 7.080   14.498 56.472  1.00 42.36  ? 166  ILE A CG1   1 
ATOM   1376 C  CG2   . ILE A 1 166 ? 5.543   15.998 55.167  1.00 37.68  ? 166  ILE A CG2   1 
ATOM   1377 C  CD1   . ILE A 1 166 ? 6.525   14.919 57.816  1.00 43.78  ? 166  ILE A CD1   1 
ATOM   1378 N  N     . ALA A 1 167 ? 8.044   17.119 52.814  1.00 35.19  ? 167  ALA A N     1 
ATOM   1379 C  CA    . ALA A 1 167 ? 7.838   18.086 51.743  1.00 35.26  ? 167  ALA A CA    1 
ATOM   1380 C  C     . ALA A 1 167 ? 7.945   17.446 50.359  1.00 36.81  ? 167  ALA A C     1 
ATOM   1381 O  O     . ALA A 1 167 ? 7.189   17.786 49.449  1.00 38.20  ? 167  ALA A O     1 
ATOM   1382 C  CB    . ALA A 1 167 ? 8.828   19.221 51.870  1.00 32.91  ? 167  ALA A CB    1 
ATOM   1383 N  N     . ALA A 1 168 ? 8.884   16.517 50.209  1.00 34.65  ? 168  ALA A N     1 
ATOM   1384 C  CA    . ALA A 1 168 ? 9.124   15.868 48.924  1.00 33.07  ? 168  ALA A CA    1 
ATOM   1385 C  C     . ALA A 1 168 ? 8.006   14.901 48.553  1.00 37.20  ? 168  ALA A C     1 
ATOM   1386 O  O     . ALA A 1 168 ? 7.707   14.719 47.373  1.00 38.61  ? 168  ALA A O     1 
ATOM   1387 C  CB    . ALA A 1 168 ? 10.463  15.150 48.932  1.00 32.10  ? 168  ALA A CB    1 
ATOM   1388 N  N     . LYS A 1 169 ? 7.396   14.287 49.564  1.00 40.71  ? 169  LYS A N     1 
ATOM   1389 C  CA    . LYS A 1 169 ? 6.322   13.314 49.356  1.00 42.02  ? 169  LYS A CA    1 
ATOM   1390 C  C     . LYS A 1 169 ? 5.142   13.887 48.571  1.00 42.00  ? 169  LYS A C     1 
ATOM   1391 O  O     . LYS A 1 169 ? 4.919   15.099 48.554  1.00 41.39  ? 169  LYS A O     1 
ATOM   1392 C  CB    . LYS A 1 169 ? 5.830   12.751 50.694  1.00 43.36  ? 169  LYS A CB    1 
ATOM   1393 C  CG    . LYS A 1 169 ? 6.768   11.744 51.341  1.00 48.24  ? 169  LYS A CG    1 
ATOM   1394 C  CD    . LYS A 1 169 ? 6.128   11.116 52.573  1.00 55.14  ? 169  LYS A CD    1 
ATOM   1395 C  CE    . LYS A 1 169 ? 6.919   9.915  53.078  1.00 60.24  ? 169  LYS A CE    1 
ATOM   1396 N  NZ    . LYS A 1 169 ? 8.299   10.277 53.507  1.00 62.41  ? 169  LYS A NZ    1 
ATOM   1397 N  N     . LEU A 1 170 ? 4.398   12.998 47.919  1.00 41.14  ? 170  LEU A N     1 
ATOM   1398 C  CA    . LEU A 1 170 ? 3.194   13.365 47.184  1.00 40.03  ? 170  LEU A CA    1 
ATOM   1399 C  C     . LEU A 1 170 ? 2.143   13.868 48.159  1.00 40.61  ? 170  LEU A C     1 
ATOM   1400 O  O     . LEU A 1 170 ? 2.147   13.476 49.327  1.00 40.95  ? 170  LEU A O     1 
ATOM   1401 C  CB    . LEU A 1 170 ? 2.640   12.152 46.432  1.00 42.74  ? 170  LEU A CB    1 
ATOM   1402 C  CG    . LEU A 1 170 ? 3.241   11.705 45.094  1.00 45.96  ? 170  LEU A CG    1 
ATOM   1403 C  CD1   . LEU A 1 170 ? 4.739   11.431 45.178  1.00 48.52  ? 170  LEU A CD1   1 
ATOM   1404 C  CD2   . LEU A 1 170 ? 2.510   10.467 44.601  1.00 46.49  ? 170  LEU A CD2   1 
ATOM   1405 N  N     . GLN A 1 171 ? 1.238   14.724 47.690  1.00 40.49  ? 171  GLN A N     1 
ATOM   1406 C  CA    . GLN A 1 171 ? 0.155   15.200 48.548  1.00 42.79  ? 171  GLN A CA    1 
ATOM   1407 C  C     . GLN A 1 171 ? -0.744  14.044 48.951  1.00 42.09  ? 171  GLN A C     1 
ATOM   1408 O  O     . GLN A 1 171 ? -1.353  14.060 50.017  1.00 42.45  ? 171  GLN A O     1 
ATOM   1409 C  CB    . GLN A 1 171 ? -0.645  16.329 47.893  1.00 48.89  ? 171  GLN A CB    1 
ATOM   1410 C  CG    . GLN A 1 171 ? -0.010  17.698 48.112  1.00 55.79  ? 171  GLN A CG    1 
ATOM   1411 C  CD    . GLN A 1 171 ? -0.959  18.847 47.843  1.00 62.73  ? 171  GLN A CD    1 
ATOM   1412 O  OE1   . GLN A 1 171 ? -2.083  18.647 47.379  1.00 67.39  ? 171  GLN A OE1   1 
ATOM   1413 N  NE2   . GLN A 1 171 ? -0.509  20.065 48.136  1.00 62.10  ? 171  GLN A NE2   1 
ATOM   1414 N  N     . GLU A 1 172 ? -0.791  13.026 48.099  1.00 42.91  ? 172  GLU A N     1 
ATOM   1415 C  CA    . GLU A 1 172 ? -1.539  11.813 48.388  1.00 45.56  ? 172  GLU A CA    1 
ATOM   1416 C  C     . GLU A 1 172 ? -0.823  10.964 49.446  1.00 45.04  ? 172  GLU A C     1 
ATOM   1417 O  O     . GLU A 1 172 ? -1.406  10.038 50.009  1.00 48.07  ? 172  GLU A O     1 
ATOM   1418 C  CB    . GLU A 1 172 ? -1.781  11.017 47.099  1.00 48.30  ? 172  GLU A CB    1 
ATOM   1419 C  CG    . GLU A 1 172 ? -2.547  11.788 46.008  1.00 51.80  ? 172  GLU A CG    1 
ATOM   1420 C  CD    . GLU A 1 172 ? -1.655  12.697 45.163  1.00 55.47  ? 172  GLU A CD    1 
ATOM   1421 O  OE1   . GLU A 1 172 ? -2.188  13.454 44.318  1.00 57.39  ? 172  GLU A OE1   1 
ATOM   1422 O  OE2   . GLU A 1 172 ? -0.419  12.652 45.339  1.00 55.45  ? 172  GLU A OE2   1 
ATOM   1423 N  N     . GLN A 1 173 ? 0.440   11.292 49.714  1.00 42.15  ? 173  GLN A N     1 
ATOM   1424 C  CA    . GLN A 1 173 ? 1.206   10.641 50.776  1.00 42.36  ? 173  GLN A CA    1 
ATOM   1425 C  C     . GLN A 1 173 ? 1.184   11.467 52.055  1.00 41.32  ? 173  GLN A C     1 
ATOM   1426 O  O     . GLN A 1 173 ? 1.841   11.120 53.039  1.00 42.45  ? 173  GLN A O     1 
ATOM   1427 C  CB    . GLN A 1 173 ? 2.663   10.449 50.357  1.00 44.00  ? 173  GLN A CB    1 
ATOM   1428 C  CG    . GLN A 1 173 ? 2.896   9.434  49.260  1.00 47.32  ? 173  GLN A CG    1 
ATOM   1429 C  CD    . GLN A 1 173 ? 4.373   9.245  48.969  1.00 48.82  ? 173  GLN A CD    1 
ATOM   1430 O  OE1   . GLN A 1 173 ? 4.926   9.875  48.067  1.00 48.01  ? 173  GLN A OE1   1 
ATOM   1431 N  NE2   . GLN A 1 173 ? 5.023   8.381  49.742  1.00 50.77  ? 173  GLN A NE2   1 
ATOM   1432 N  N     . GLY A 1 174 ? 0.434   12.563 52.036  1.00 40.01  ? 174  GLY A N     1 
ATOM   1433 C  CA    . GLY A 1 174 ? 0.414   13.489 53.153  1.00 38.39  ? 174  GLY A CA    1 
ATOM   1434 C  C     . GLY A 1 174 ? 1.551   14.487 53.038  1.00 37.82  ? 174  GLY A C     1 
ATOM   1435 O  O     . GLY A 1 174 ? 1.831   15.241 53.969  1.00 39.43  ? 174  GLY A O     1 
ATOM   1436 N  N     . GLY A 1 175 ? 2.207   14.485 51.882  1.00 35.21  ? 175  GLY A N     1 
ATOM   1437 C  CA    . GLY A 1 175 ? 3.330   15.365 51.627  1.00 31.02  ? 175  GLY A CA    1 
ATOM   1438 C  C     . GLY A 1 175 ? 2.910   16.687 51.018  1.00 31.80  ? 175  GLY A C     1 
ATOM   1439 O  O     . GLY A 1 175 ? 1.722   17.002 50.962  1.00 32.83  ? 175  GLY A O     1 
ATOM   1440 N  N     . ASP A 1 176 ? 3.886   17.457 50.548  1.00 32.11  ? 176  ASP A N     1 
ATOM   1441 C  CA    . ASP A 1 176 ? 3.625   18.804 50.052  1.00 33.02  ? 176  ASP A CA    1 
ATOM   1442 C  C     . ASP A 1 176 ? 3.936   18.978 48.563  1.00 35.60  ? 176  ASP A C     1 
ATOM   1443 O  O     . ASP A 1 176 ? 3.732   20.056 48.004  1.00 38.09  ? 176  ASP A O     1 
ATOM   1444 C  CB    . ASP A 1 176 ? 4.413   19.821 50.875  1.00 31.54  ? 176  ASP A CB    1 
ATOM   1445 C  CG    . ASP A 1 176 ? 4.047   19.788 52.345  1.00 35.32  ? 176  ASP A CG    1 
ATOM   1446 O  OD1   . ASP A 1 176 ? 2.842   19.670 52.659  1.00 36.58  ? 176  ASP A OD1   1 
ATOM   1447 O  OD2   . ASP A 1 176 ? 4.966   19.876 53.190  1.00 34.92  ? 176  ASP A OD2   1 
ATOM   1448 N  N     . GLU A 1 177 ? 4.428   17.915 47.933  1.00 35.66  ? 177  GLU A N     1 
ATOM   1449 C  CA    . GLU A 1 177 ? 4.746   17.922 46.504  1.00 37.93  ? 177  GLU A CA    1 
ATOM   1450 C  C     . GLU A 1 177 ? 5.673   19.056 46.072  1.00 33.85  ? 177  GLU A C     1 
ATOM   1451 O  O     . GLU A 1 177 ? 5.527   19.605 44.981  1.00 36.41  ? 177  GLU A O     1 
ATOM   1452 C  CB    . GLU A 1 177 ? 3.474   17.918 45.649  1.00 41.87  ? 177  GLU A CB    1 
ATOM   1453 C  CG    . GLU A 1 177 ? 2.853   16.542 45.484  1.00 48.83  ? 177  GLU A CG    1 
ATOM   1454 C  CD    . GLU A 1 177 ? 1.589   16.567 44.649  1.00 57.06  ? 177  GLU A CD    1 
ATOM   1455 O  OE1   . GLU A 1 177 ? 1.455   17.470 43.796  1.00 60.89  ? 177  GLU A OE1   1 
ATOM   1456 O  OE2   . GLU A 1 177 ? 0.726   15.687 44.851  1.00 59.51  ? 177  GLU A OE2   1 
ATOM   1457 N  N     . VAL A 1 178 ? 6.617   19.409 46.937  1.00 30.17  ? 178  VAL A N     1 
ATOM   1458 C  CA    . VAL A 1 178 ? 7.704   20.293 46.547  1.00 31.10  ? 178  VAL A CA    1 
ATOM   1459 C  C     . VAL A 1 178 ? 8.491   19.602 45.440  1.00 36.08  ? 178  VAL A C     1 
ATOM   1460 O  O     . VAL A 1 178 ? 9.006   18.504 45.643  1.00 38.05  ? 178  VAL A O     1 
ATOM   1461 C  CB    . VAL A 1 178 ? 8.647   20.588 47.728  1.00 28.76  ? 178  VAL A CB    1 
ATOM   1462 C  CG1   . VAL A 1 178 ? 9.873   21.362 47.256  1.00 27.43  ? 178  VAL A CG1   1 
ATOM   1463 C  CG2   . VAL A 1 178 ? 7.912   21.351 48.818  1.00 26.28  ? 178  VAL A CG2   1 
ATOM   1464 N  N     . PRO A 1 179 ? 8.576   20.242 44.261  1.00 36.15  ? 179  PRO A N     1 
ATOM   1465 C  CA    . PRO A 1 179 ? 9.194   19.684 43.051  1.00 33.76  ? 179  PRO A CA    1 
ATOM   1466 C  C     . PRO A 1 179 ? 10.542  19.015 43.310  1.00 32.42  ? 179  PRO A C     1 
ATOM   1467 O  O     . PRO A 1 179 ? 11.424  19.607 43.930  1.00 32.21  ? 179  PRO A O     1 
ATOM   1468 C  CB    . PRO A 1 179 ? 9.370   20.913 42.161  1.00 34.19  ? 179  PRO A CB    1 
ATOM   1469 C  CG    . PRO A 1 179 ? 8.244   21.800 42.555  1.00 33.25  ? 179  PRO A CG    1 
ATOM   1470 C  CD    . PRO A 1 179 ? 8.077   21.612 44.038  1.00 32.86  ? 179  PRO A CD    1 
ATOM   1471 N  N     . SER A 1 180 ? 10.684  17.782 42.836  1.00 34.76  ? 180  SER A N     1 
ATOM   1472 C  CA    . SER A 1 180 ? 11.882  16.987 43.085  1.00 35.71  ? 180  SER A CA    1 
ATOM   1473 C  C     . SER A 1 180 ? 13.159  17.658 42.582  1.00 36.10  ? 180  SER A C     1 
ATOM   1474 O  O     . SER A 1 180 ? 14.235  17.464 43.148  1.00 40.50  ? 180  SER A O     1 
ATOM   1475 C  CB    . SER A 1 180 ? 11.735  15.595 42.461  1.00 36.64  ? 180  SER A CB    1 
ATOM   1476 O  OG    . SER A 1 180 ? 11.534  15.677 41.060  1.00 37.44  ? 180  SER A OG    1 
ATOM   1477 N  N     . GLU A 1 181 ? 13.035  18.457 41.528  1.00 31.90  ? 181  GLU A N     1 
ATOM   1478 C  CA    . GLU A 1 181 ? 14.200  19.097 40.929  1.00 32.78  ? 181  GLU A CA    1 
ATOM   1479 C  C     . GLU A 1 181 ? 14.812  20.186 41.812  1.00 33.72  ? 181  GLU A C     1 
ATOM   1480 O  O     . GLU A 1 181 ? 15.901  20.675 41.522  1.00 37.65  ? 181  GLU A O     1 
ATOM   1481 C  CB    . GLU A 1 181 ? 13.869  19.661 39.542  1.00 34.87  ? 181  GLU A CB    1 
ATOM   1482 C  CG    . GLU A 1 181 ? 12.884  20.825 39.536  1.00 37.79  ? 181  GLU A CG    1 
ATOM   1483 C  CD    . GLU A 1 181 ? 11.437  20.380 39.381  1.00 39.19  ? 181  GLU A CD    1 
ATOM   1484 O  OE1   . GLU A 1 181 ? 11.148  19.185 39.610  1.00 40.02  ? 181  GLU A OE1   1 
ATOM   1485 O  OE2   . GLU A 1 181 ? 10.589  21.227 39.023  1.00 37.13  ? 181  GLU A OE2   1 
ATOM   1486 N  N     . ILE A 1 182 ? 14.122  20.565 42.885  1.00 33.42  ? 182  ILE A N     1 
ATOM   1487 C  CA    . ILE A 1 182 ? 14.636  21.603 43.782  1.00 33.83  ? 182  ILE A CA    1 
ATOM   1488 C  C     . ILE A 1 182 ? 14.880  21.112 45.212  1.00 31.29  ? 182  ILE A C     1 
ATOM   1489 O  O     . ILE A 1 182 ? 15.404  21.853 46.045  1.00 31.14  ? 182  ILE A O     1 
ATOM   1490 C  CB    . ILE A 1 182 ? 13.714  22.852 43.825  1.00 40.33  ? 182  ILE A CB    1 
ATOM   1491 C  CG1   . ILE A 1 182 ? 12.512  22.611 44.742  1.00 38.54  ? 182  ILE A CG1   1 
ATOM   1492 C  CG2   . ILE A 1 182 ? 13.271  23.251 42.421  1.00 40.31  ? 182  ILE A CG2   1 
ATOM   1493 C  CD1   . ILE A 1 182 ? 11.599  23.813 44.878  1.00 35.69  ? 182  ILE A CD1   1 
ATOM   1494 N  N     . ILE A 1 183 ? 14.502  19.869 45.491  1.00 29.74  ? 183  ILE A N     1 
ATOM   1495 C  CA    . ILE A 1 183 ? 14.680  19.293 46.822  1.00 31.91  ? 183  ILE A CA    1 
ATOM   1496 C  C     . ILE A 1 183 ? 16.132  19.368 47.283  1.00 34.91  ? 183  ILE A C     1 
ATOM   1497 O  O     . ILE A 1 183 ? 16.415  19.743 48.422  1.00 35.88  ? 183  ILE A O     1 
ATOM   1498 C  CB    . ILE A 1 183 ? 14.197  17.826 46.873  1.00 32.45  ? 183  ILE A CB    1 
ATOM   1499 C  CG1   . ILE A 1 183 ? 12.671  17.774 46.877  1.00 32.04  ? 183  ILE A CG1   1 
ATOM   1500 C  CG2   . ILE A 1 183 ? 14.725  17.122 48.113  1.00 30.54  ? 183  ILE A CG2   1 
ATOM   1501 C  CD1   . ILE A 1 183 ? 12.048  18.466 48.070  1.00 30.84  ? 183  ILE A CD1   1 
ATOM   1502 N  N     . ASP A 1 184 ? 17.051  19.031 46.384  1.00 35.18  ? 184  ASP A N     1 
ATOM   1503 C  CA    . ASP A 1 184 ? 18.470  19.007 46.717  1.00 35.02  ? 184  ASP A CA    1 
ATOM   1504 C  C     . ASP A 1 184 ? 19.088  20.401 46.721  1.00 36.04  ? 184  ASP A C     1 
ATOM   1505 O  O     . ASP A 1 184 ? 20.240  20.576 47.113  1.00 38.88  ? 184  ASP A O     1 
ATOM   1506 C  CB    . ASP A 1 184 ? 19.225  18.099 45.748  1.00 39.31  ? 184  ASP A CB    1 
ATOM   1507 C  CG    . ASP A 1 184 ? 18.724  16.666 45.784  1.00 46.76  ? 184  ASP A CG    1 
ATOM   1508 O  OD1   . ASP A 1 184 ? 18.124  16.269 46.806  1.00 47.33  ? 184  ASP A OD1   1 
ATOM   1509 O  OD2   . ASP A 1 184 ? 18.931  15.936 44.792  1.00 51.48  ? 184  ASP A OD2   1 
ATOM   1510 N  N     . LYS A 1 185 ? 18.318  21.393 46.291  1.00 36.49  ? 185  LYS A N     1 
ATOM   1511 C  CA    . LYS A 1 185 ? 18.815  22.762 46.206  1.00 35.77  ? 185  LYS A CA    1 
ATOM   1512 C  C     . LYS A 1 185 ? 18.360  23.600 47.395  1.00 34.85  ? 185  LYS A C     1 
ATOM   1513 O  O     . LYS A 1 185 ? 18.692  24.780 47.501  1.00 34.01  ? 185  LYS A O     1 
ATOM   1514 C  CB    . LYS A 1 185 ? 18.350  23.412 44.904  1.00 33.37  ? 185  LYS A CB    1 
ATOM   1515 C  CG    . LYS A 1 185 ? 18.757  22.654 43.654  1.00 33.90  ? 185  LYS A CG    1 
ATOM   1516 C  CD    . LYS A 1 185 ? 18.381  23.432 42.409  1.00 34.37  ? 185  LYS A CD    1 
ATOM   1517 C  CE    . LYS A 1 185 ? 18.838  22.716 41.155  1.00 37.54  ? 185  LYS A CE    1 
ATOM   1518 N  NZ    . LYS A 1 185 ? 18.474  23.492 39.941  1.00 40.21  ? 185  LYS A NZ    1 
ATOM   1519 N  N     . ILE A 1 186 ? 17.592  22.984 48.284  1.00 33.33  ? 186  ILE A N     1 
ATOM   1520 C  CA    . ILE A 1 186 ? 17.089  23.669 49.465  1.00 30.58  ? 186  ILE A CA    1 
ATOM   1521 C  C     . ILE A 1 186 ? 18.110  23.641 50.597  1.00 31.12  ? 186  ILE A C     1 
ATOM   1522 O  O     . ILE A 1 186 ? 18.665  22.591 50.924  1.00 32.52  ? 186  ILE A O     1 
ATOM   1523 C  CB    . ILE A 1 186 ? 15.776  23.033 49.961  1.00 29.74  ? 186  ILE A CB    1 
ATOM   1524 C  CG1   . ILE A 1 186 ? 14.697  23.125 48.881  1.00 30.02  ? 186  ILE A CG1   1 
ATOM   1525 C  CG2   . ILE A 1 186 ? 15.307  23.696 51.245  1.00 28.12  ? 186  ILE A CG2   1 
ATOM   1526 C  CD1   . ILE A 1 186 ? 13.411  22.423 49.249  1.00 31.67  ? 186  ILE A CD1   1 
ATOM   1527 N  N     . ILE A 1 187 ? 18.360  24.803 51.188  1.00 30.58  ? 187  ILE A N     1 
ATOM   1528 C  CA    . ILE A 1 187 ? 19.209  24.886 52.367  1.00 32.75  ? 187  ILE A CA    1 
ATOM   1529 C  C     . ILE A 1 187 ? 18.387  25.410 53.543  1.00 36.64  ? 187  ILE A C     1 
ATOM   1530 O  O     . ILE A 1 187 ? 18.065  26.596 53.622  1.00 37.21  ? 187  ILE A O     1 
ATOM   1531 C  CB    . ILE A 1 187 ? 20.456  25.749 52.106  1.00 31.08  ? 187  ILE A CB    1 
ATOM   1532 C  CG1   . ILE A 1 187 ? 21.348  25.058 51.067  1.00 31.61  ? 187  ILE A CG1   1 
ATOM   1533 C  CG2   . ILE A 1 187 ? 21.221  25.991 53.396  1.00 27.69  ? 187  ILE A CG2   1 
ATOM   1534 C  CD1   . ILE A 1 187 ? 22.619  25.807 50.732  1.00 31.83  ? 187  ILE A CD1   1 
ATOM   1535 N  N     . TYR A 1 188 ? 18.045  24.499 54.449  1.00 40.56  ? 188  TYR A N     1 
ATOM   1536 C  CA    . TYR A 1 188 ? 17.090  24.768 55.519  1.00 39.15  ? 188  TYR A CA    1 
ATOM   1537 C  C     . TYR A 1 188 ? 17.754  25.301 56.784  1.00 38.87  ? 188  TYR A C     1 
ATOM   1538 O  O     . TYR A 1 188 ? 18.695  24.705 57.305  1.00 39.15  ? 188  TYR A O     1 
ATOM   1539 C  CB    . TYR A 1 188 ? 16.292  23.498 55.831  1.00 37.02  ? 188  TYR A CB    1 
ATOM   1540 C  CG    . TYR A 1 188 ? 15.246  23.667 56.908  1.00 37.74  ? 188  TYR A CG    1 
ATOM   1541 C  CD1   . TYR A 1 188 ? 14.157  24.506 56.717  1.00 35.38  ? 188  TYR A CD1   1 
ATOM   1542 C  CD2   . TYR A 1 188 ? 15.341  22.979 58.111  1.00 39.04  ? 188  TYR A CD2   1 
ATOM   1543 C  CE1   . TYR A 1 188 ? 13.193  24.659 57.696  1.00 35.88  ? 188  TYR A CE1   1 
ATOM   1544 C  CE2   . TYR A 1 188 ? 14.384  23.127 59.098  1.00 38.19  ? 188  TYR A CE2   1 
ATOM   1545 C  CZ    . TYR A 1 188 ? 13.311  23.969 58.885  1.00 37.80  ? 188  TYR A CZ    1 
ATOM   1546 O  OH    . TYR A 1 188 ? 12.355  24.118 59.864  1.00 38.22  ? 188  TYR A OH    1 
ATOM   1547 N  N     . MET A 1 189 ? 17.249  26.427 57.277  1.00 38.50  ? 189  MET A N     1 
ATOM   1548 C  CA    . MET A 1 189 ? 17.774  27.039 58.492  1.00 37.07  ? 189  MET A CA    1 
ATOM   1549 C  C     . MET A 1 189 ? 16.660  27.405 59.465  1.00 34.95  ? 189  MET A C     1 
ATOM   1550 O  O     . MET A 1 189 ? 16.008  28.435 59.310  1.00 33.41  ? 189  MET A O     1 
ATOM   1551 C  CB    . MET A 1 189 ? 18.592  28.283 58.148  1.00 36.28  ? 189  MET A CB    1 
ATOM   1552 C  CG    . MET A 1 189 ? 19.923  27.982 57.485  1.00 37.66  ? 189  MET A CG    1 
ATOM   1553 S  SD    . MET A 1 189 ? 20.589  29.417 56.632  1.00 48.79  ? 189  MET A SD    1 
ATOM   1554 C  CE    . MET A 1 189 ? 19.370  29.611 55.336  1.00 31.54  ? 189  MET A CE    1 
ATOM   1555 N  N     . PRO A 1 190 ? 16.431  26.552 60.471  1.00 35.64  ? 190  PRO A N     1 
ATOM   1556 C  CA    . PRO A 1 190 ? 15.441  26.861 61.505  1.00 37.48  ? 190  PRO A CA    1 
ATOM   1557 C  C     . PRO A 1 190 ? 16.027  27.807 62.548  1.00 40.94  ? 190  PRO A C     1 
ATOM   1558 O  O     . PRO A 1 190 ? 17.237  27.796 62.778  1.00 42.46  ? 190  PRO A O     1 
ATOM   1559 C  CB    . PRO A 1 190 ? 15.163  25.494 62.127  1.00 35.45  ? 190  PRO A CB    1 
ATOM   1560 C  CG    . PRO A 1 190 ? 16.448  24.758 61.967  1.00 34.46  ? 190  PRO A CG    1 
ATOM   1561 C  CD    . PRO A 1 190 ? 17.044  25.227 60.668  1.00 34.05  ? 190  PRO A CD    1 
ATOM   1562 N  N     . PHE A 1 191 ? 15.177  28.621 63.164  1.00 41.50  ? 191  PHE A N     1 
ATOM   1563 C  CA    . PHE A 1 191 ? 15.626  29.552 64.192  1.00 44.63  ? 191  PHE A CA    1 
ATOM   1564 C  C     . PHE A 1 191 ? 14.710  29.513 65.406  1.00 49.54  ? 191  PHE A C     1 
ATOM   1565 O  O     . PHE A 1 191 ? 13.499  29.331 65.272  1.00 50.29  ? 191  PHE A O     1 
ATOM   1566 C  CB    . PHE A 1 191 ? 15.706  30.971 63.631  1.00 42.30  ? 191  PHE A CB    1 
ATOM   1567 C  CG    . PHE A 1 191 ? 16.726  31.129 62.545  1.00 39.99  ? 191  PHE A CG    1 
ATOM   1568 C  CD1   . PHE A 1 191 ? 16.381  30.924 61.219  1.00 38.69  ? 191  PHE A CD1   1 
ATOM   1569 C  CD2   . PHE A 1 191 ? 18.034  31.469 62.850  1.00 38.55  ? 191  PHE A CD2   1 
ATOM   1570 C  CE1   . PHE A 1 191 ? 17.321  31.064 60.215  1.00 39.24  ? 191  PHE A CE1   1 
ATOM   1571 C  CE2   . PHE A 1 191 ? 18.979  31.610 61.851  1.00 39.75  ? 191  PHE A CE2   1 
ATOM   1572 C  CZ    . PHE A 1 191 ? 18.621  31.406 60.531  1.00 41.35  ? 191  PHE A CZ    1 
ATOM   1573 N  N     . ASP A 1 192 ? 15.291  29.682 66.591  1.00 51.34  ? 192  ASP A N     1 
ATOM   1574 C  CA    . ASP A 1 192 ? 14.514  29.620 67.821  1.00 55.54  ? 192  ASP A CA    1 
ATOM   1575 C  C     . ASP A 1 192 ? 13.846  30.953 68.172  1.00 54.06  ? 192  ASP A C     1 
ATOM   1576 O  O     . ASP A 1 192 ? 13.041  31.014 69.099  1.00 58.81  ? 192  ASP A O     1 
ATOM   1577 C  CB    . ASP A 1 192 ? 15.349  29.073 68.994  1.00 63.29  ? 192  ASP A CB    1 
ATOM   1578 C  CG    . ASP A 1 192 ? 16.638  29.850 69.223  1.00 70.62  ? 192  ASP A CG    1 
ATOM   1579 O  OD1   . ASP A 1 192 ? 16.639  31.082 69.027  1.00 74.61  ? 192  ASP A OD1   1 
ATOM   1580 O  OD2   . ASP A 1 192 ? 17.654  29.226 69.605  1.00 72.92  ? 192  ASP A OD2   1 
ATOM   1581 N  N     . ASN A 1 193 ? 14.187  32.012 67.440  1.00 48.16  ? 193  ASN A N     1 
ATOM   1582 C  CA    . ASN A 1 193 ? 13.478  33.293 67.553  1.00 47.68  ? 193  ASN A CA    1 
ATOM   1583 C  C     . ASN A 1 193 ? 13.770  34.273 66.413  1.00 46.40  ? 193  ASN A C     1 
ATOM   1584 O  O     . ASN A 1 193 ? 14.776  34.153 65.710  1.00 46.95  ? 193  ASN A O     1 
ATOM   1585 C  CB    . ASN A 1 193 ? 13.687  33.958 68.919  1.00 49.07  ? 193  ASN A CB    1 
ATOM   1586 C  CG    . ASN A 1 193 ? 15.133  34.242 69.215  1.00 51.08  ? 193  ASN A CG    1 
ATOM   1587 O  OD1   . ASN A 1 193 ? 15.838  34.852 68.411  1.00 53.14  ? 193  ASN A OD1   1 
ATOM   1588 N  ND2   . ASN A 1 193 ? 15.592  33.793 70.374  1.00 52.57  ? 193  ASN A ND2   1 
ATOM   1589 N  N     . GLU A 1 194 ? 12.872  35.238 66.246  1.00 43.83  ? 194  GLU A N     1 
ATOM   1590 C  CA    . GLU A 1 194 ? 12.896  36.158 65.113  1.00 42.58  ? 194  GLU A CA    1 
ATOM   1591 C  C     . GLU A 1 194 ? 14.172  36.996 64.987  1.00 44.35  ? 194  GLU A C     1 
ATOM   1592 O  O     . GLU A 1 194 ? 14.657  37.226 63.878  1.00 45.63  ? 194  GLU A O     1 
ATOM   1593 C  CB    . GLU A 1 194 ? 11.675  37.080 65.163  1.00 40.58  ? 194  GLU A CB    1 
ATOM   1594 C  CG    . GLU A 1 194 ? 11.523  37.972 63.952  1.00 38.79  ? 194  GLU A CG    1 
ATOM   1595 C  CD    . GLU A 1 194 ? 10.406  38.975 64.114  1.00 42.26  ? 194  GLU A CD    1 
ATOM   1596 O  OE1   . GLU A 1 194 ? 10.066  39.649 63.119  1.00 43.99  ? 194  GLU A OE1   1 
ATOM   1597 O  OE2   . GLU A 1 194 ? 9.871   39.091 65.237  1.00 42.62  ? 194  GLU A OE2   1 
ATOM   1598 N  N     . LYS A 1 195 ? 14.707  37.458 66.115  1.00 43.55  ? 195  LYS A N     1 
ATOM   1599 C  CA    . LYS A 1 195 ? 15.902  38.295 66.095  1.00 40.31  ? 195  LYS A CA    1 
ATOM   1600 C  C     . LYS A 1 195 ? 17.087  37.562 65.477  1.00 42.75  ? 195  LYS A C     1 
ATOM   1601 O  O     . LYS A 1 195 ? 17.817  38.126 64.665  1.00 42.93  ? 195  LYS A O     1 
ATOM   1602 C  CB    . LYS A 1 195 ? 16.254  38.781 67.501  1.00 38.98  ? 195  LYS A CB    1 
ATOM   1603 C  CG    . LYS A 1 195 ? 15.248  39.755 68.088  1.00 40.79  ? 195  LYS A CG    1 
ATOM   1604 N  N     . GLU A 1 196 ? 17.263  36.298 65.853  1.00 44.27  ? 196  GLU A N     1 
ATOM   1605 C  CA    . GLU A 1 196 ? 18.363  35.493 65.331  1.00 45.81  ? 196  GLU A CA    1 
ATOM   1606 C  C     . GLU A 1 196 ? 18.200  35.202 63.839  1.00 43.93  ? 196  GLU A C     1 
ATOM   1607 O  O     . GLU A 1 196 ? 19.184  35.154 63.100  1.00 44.37  ? 196  GLU A O     1 
ATOM   1608 C  CB    . GLU A 1 196 ? 18.505  34.194 66.128  1.00 48.22  ? 196  GLU A CB    1 
ATOM   1609 C  CG    . GLU A 1 196 ? 18.891  34.409 67.588  1.00 54.71  ? 196  GLU A CG    1 
ATOM   1610 C  CD    . GLU A 1 196 ? 18.957  33.115 68.381  1.00 60.90  ? 196  GLU A CD    1 
ATOM   1611 O  OE1   . GLU A 1 196 ? 19.251  32.061 67.779  1.00 62.43  ? 196  GLU A OE1   1 
ATOM   1612 O  OE2   . GLU A 1 196 ? 18.713  33.150 69.608  1.00 64.04  ? 196  GLU A OE2   1 
ATOM   1613 N  N     . LEU A 1 197 ? 16.955  35.016 63.406  1.00 40.79  ? 197  LEU A N     1 
ATOM   1614 C  CA    . LEU A 1 197 ? 16.641  34.797 61.994  1.00 37.56  ? 197  LEU A CA    1 
ATOM   1615 C  C     . LEU A 1 197 ? 17.021  36.010 61.152  1.00 38.64  ? 197  LEU A C     1 
ATOM   1616 O  O     . LEU A 1 197 ? 17.678  35.886 60.117  1.00 39.48  ? 197  LEU A O     1 
ATOM   1617 C  CB    . LEU A 1 197 ? 15.147  34.494 61.824  1.00 35.56  ? 197  LEU A CB    1 
ATOM   1618 C  CG    . LEU A 1 197 ? 14.570  34.131 60.447  1.00 33.90  ? 197  LEU A CG    1 
ATOM   1619 C  CD1   . LEU A 1 197 ? 13.317  33.289 60.627  1.00 33.48  ? 197  LEU A CD1   1 
ATOM   1620 C  CD2   . LEU A 1 197 ? 14.244  35.356 59.599  1.00 32.30  ? 197  LEU A CD2   1 
ATOM   1621 N  N     . LEU A 1 198 ? 16.581  37.182 61.594  1.00 37.49  ? 198  LEU A N     1 
ATOM   1622 C  CA    . LEU A 1 198 ? 16.799  38.405 60.841  1.00 36.09  ? 198  LEU A CA    1 
ATOM   1623 C  C     . LEU A 1 198 ? 18.279  38.779 60.774  1.00 39.65  ? 198  LEU A C     1 
ATOM   1624 O  O     . LEU A 1 198 ? 18.766  39.191 59.723  1.00 40.20  ? 198  LEU A O     1 
ATOM   1625 C  CB    . LEU A 1 198 ? 15.962  39.548 61.417  1.00 35.13  ? 198  LEU A CB    1 
ATOM   1626 C  CG    . LEU A 1 198 ? 14.446  39.328 61.331  1.00 33.85  ? 198  LEU A CG    1 
ATOM   1627 C  CD1   . LEU A 1 198 ? 13.675  40.497 61.928  1.00 33.92  ? 198  LEU A CD1   1 
ATOM   1628 C  CD2   . LEU A 1 198 ? 14.016  39.085 59.893  1.00 31.34  ? 198  LEU A CD2   1 
ATOM   1629 N  N     A MET A 1 199 ? 18.992  38.626 61.883  0.53 42.42  ? 199  MET A N     1 
ATOM   1630 N  N     B MET A 1 199 ? 18.978  38.641 61.902  0.47 42.39  ? 199  MET A N     1 
ATOM   1631 C  CA    A MET A 1 199 ? 20.417  38.939 61.898  0.53 43.01  ? 199  MET A CA    1 
ATOM   1632 C  CA    B MET A 1 199 ? 20.419  38.892 61.964  0.47 43.08  ? 199  MET A CA    1 
ATOM   1633 C  C     A MET A 1 199 ? 21.195  37.969 61.011  0.53 41.98  ? 199  MET A C     1 
ATOM   1634 C  C     B MET A 1 199 ? 21.150  37.982 60.989  0.47 41.93  ? 199  MET A C     1 
ATOM   1635 O  O     A MET A 1 199 ? 22.150  38.359 60.335  0.53 41.12  ? 199  MET A O     1 
ATOM   1636 O  O     B MET A 1 199 ? 22.023  38.422 60.239  0.47 40.89  ? 199  MET A O     1 
ATOM   1637 C  CB    A MET A 1 199 ? 20.967  38.929 63.326  0.53 45.02  ? 199  MET A CB    1 
ATOM   1638 C  CB    B MET A 1 199 ? 20.962  38.657 63.381  0.47 44.88  ? 199  MET A CB    1 
ATOM   1639 C  CG    A MET A 1 199 ? 22.415  39.377 63.419  0.53 47.08  ? 199  MET A CG    1 
ATOM   1640 C  CG    B MET A 1 199 ? 20.563  39.707 64.410  0.47 45.51  ? 199  MET A CG    1 
ATOM   1641 S  SD    A MET A 1 199 ? 22.723  40.911 62.516  0.53 42.19  ? 199  MET A SD    1 
ATOM   1642 S  SD    B MET A 1 199 ? 21.434  39.547 65.990  0.47 48.27  ? 199  MET A SD    1 
ATOM   1643 C  CE    A MET A 1 199 ? 21.724  42.070 63.448  0.53 32.42  ? 199  MET A CE    1 
ATOM   1644 C  CE    B MET A 1 199 ? 21.058  37.855 66.438  0.47 35.59  ? 199  MET A CE    1 
ATOM   1645 N  N     . GLU A 1 200 ? 20.778  36.707 61.010  1.00 42.74  ? 200  GLU A N     1 
ATOM   1646 C  CA    . GLU A 1 200 ? 21.388  35.710 60.145  1.00 44.38  ? 200  GLU A CA    1 
ATOM   1647 C  C     . GLU A 1 200 ? 21.072  36.010 58.683  1.00 40.50  ? 200  GLU A C     1 
ATOM   1648 O  O     . GLU A 1 200 ? 21.935  35.881 57.816  1.00 40.84  ? 200  GLU A O     1 
ATOM   1649 C  CB    . GLU A 1 200 ? 20.918  34.305 60.525  1.00 48.82  ? 200  GLU A CB    1 
ATOM   1650 C  CG    . GLU A 1 200 ? 21.463  33.201 59.635  1.00 56.13  ? 200  GLU A CG    1 
ATOM   1651 C  CD    . GLU A 1 200 ? 22.976  33.210 59.551  1.00 64.98  ? 200  GLU A CD    1 
ATOM   1652 O  OE1   . GLU A 1 200 ? 23.506  32.936 58.452  1.00 66.68  ? 200  GLU A OE1   1 
ATOM   1653 O  OE2   . GLU A 1 200 ? 23.632  33.486 60.581  1.00 68.56  ? 200  GLU A OE2   1 
ATOM   1654 N  N     . TYR A 1 201 ? 19.838  36.424 58.419  1.00 35.35  ? 201  TYR A N     1 
ATOM   1655 C  CA    . TYR A 1 201 ? 19.442  36.802 57.070  1.00 33.94  ? 201  TYR A CA    1 
ATOM   1656 C  C     . TYR A 1 201 ? 20.229  38.019 56.585  1.00 36.15  ? 201  TYR A C     1 
ATOM   1657 O  O     . TYR A 1 201 ? 20.620  38.082 55.422  1.00 36.88  ? 201  TYR A O     1 
ATOM   1658 C  CB    . TYR A 1 201 ? 17.942  37.078 56.996  1.00 33.26  ? 201  TYR A CB    1 
ATOM   1659 C  CG    . TYR A 1 201 ? 17.454  37.335 55.588  1.00 34.43  ? 201  TYR A CG    1 
ATOM   1660 C  CD1   . TYR A 1 201 ? 17.395  36.306 54.660  1.00 34.72  ? 201  TYR A CD1   1 
ATOM   1661 C  CD2   . TYR A 1 201 ? 17.056  38.606 55.185  1.00 32.19  ? 201  TYR A CD2   1 
ATOM   1662 C  CE1   . TYR A 1 201 ? 16.953  36.528 53.368  1.00 33.40  ? 201  TYR A CE1   1 
ATOM   1663 C  CE2   . TYR A 1 201 ? 16.611  38.840 53.893  1.00 32.42  ? 201  TYR A CE2   1 
ATOM   1664 C  CZ    . TYR A 1 201 ? 16.562  37.795 52.988  1.00 35.14  ? 201  TYR A CZ    1 
ATOM   1665 O  OH    . TYR A 1 201 ? 16.121  38.012 51.698  1.00 36.55  ? 201  TYR A OH    1 
ATOM   1666 N  N     . LEU A 1 202 ? 20.462  38.977 57.479  1.00 37.29  ? 202  LEU A N     1 
ATOM   1667 C  CA    . LEU A 1 202 ? 21.245  40.168 57.150  1.00 36.86  ? 202  LEU A CA    1 
ATOM   1668 C  C     . LEU A 1 202 ? 22.682  39.803 56.815  1.00 36.89  ? 202  LEU A C     1 
ATOM   1669 O  O     . LEU A 1 202 ? 23.274  40.347 55.882  1.00 35.01  ? 202  LEU A O     1 
ATOM   1670 C  CB    . LEU A 1 202 ? 21.240  41.157 58.314  1.00 37.31  ? 202  LEU A CB    1 
ATOM   1671 C  CG    . LEU A 1 202 ? 20.056  42.111 58.405  1.00 38.83  ? 202  LEU A CG    1 
ATOM   1672 C  CD1   . LEU A 1 202 ? 20.234  43.040 59.596  1.00 41.65  ? 202  LEU A CD1   1 
ATOM   1673 C  CD2   . LEU A 1 202 ? 19.925  42.901 57.114  1.00 37.20  ? 202  LEU A CD2   1 
ATOM   1674 N  N     . ASN A 1 203 ? 23.242  38.887 57.595  1.00 36.88  ? 203  ASN A N     1 
ATOM   1675 C  CA    . ASN A 1 203 ? 24.599  38.430 57.356  1.00 39.62  ? 203  ASN A CA    1 
ATOM   1676 C  C     . ASN A 1 203 ? 24.669  37.621 56.069  1.00 40.13  ? 203  ASN A C     1 
ATOM   1677 O  O     . ASN A 1 203 ? 25.611  37.752 55.287  1.00 42.34  ? 203  ASN A O     1 
ATOM   1678 C  CB    . ASN A 1 203 ? 25.117  37.641 58.557  1.00 44.49  ? 203  ASN A CB    1 
ATOM   1679 C  CG    . ASN A 1 203 ? 25.463  38.540 59.729  1.00 53.20  ? 203  ASN A CG    1 
ATOM   1680 O  OD1   . ASN A 1 203 ? 26.624  38.895 59.928  1.00 60.03  ? 203  ASN A OD1   1 
ATOM   1681 N  ND2   . ASN A 1 203 ? 24.453  38.931 60.498  1.00 54.29  ? 203  ASN A ND2   1 
ATOM   1682 N  N     . PHE A 1 204 ? 23.649  36.796 55.856  1.00 37.87  ? 204  PHE A N     1 
ATOM   1683 C  CA    . PHE A 1 204 ? 23.466  36.077 54.602  1.00 36.07  ? 204  PHE A CA    1 
ATOM   1684 C  C     . PHE A 1 204 ? 23.376  37.066 53.439  1.00 38.75  ? 204  PHE A C     1 
ATOM   1685 O  O     . PHE A 1 204 ? 23.974  36.862 52.379  1.00 39.22  ? 204  PHE A O     1 
ATOM   1686 C  CB    . PHE A 1 204 ? 22.191  35.237 54.689  1.00 34.66  ? 204  PHE A CB    1 
ATOM   1687 C  CG    . PHE A 1 204 ? 21.694  34.734 53.366  1.00 36.73  ? 204  PHE A CG    1 
ATOM   1688 C  CD1   . PHE A 1 204 ? 22.211  33.574 52.812  1.00 39.75  ? 204  PHE A CD1   1 
ATOM   1689 C  CD2   . PHE A 1 204 ? 20.691  35.406 52.686  1.00 33.07  ? 204  PHE A CD2   1 
ATOM   1690 C  CE1   . PHE A 1 204 ? 21.748  33.104 51.598  1.00 38.60  ? 204  PHE A CE1   1 
ATOM   1691 C  CE2   . PHE A 1 204 ? 20.225  34.942 51.472  1.00 32.36  ? 204  PHE A CE2   1 
ATOM   1692 C  CZ    . PHE A 1 204 ? 20.752  33.789 50.927  1.00 35.85  ? 204  PHE A CZ    1 
ATOM   1693 N  N     . TRP A 1 205 ? 22.626  38.142 53.659  1.00 36.65  ? 205  TRP A N     1 
ATOM   1694 C  CA    . TRP A 1 205 ? 22.417  39.182 52.660  1.00 31.56  ? 205  TRP A CA    1 
ATOM   1695 C  C     . TRP A 1 205 ? 23.734  39.845 52.275  1.00 34.77  ? 205  TRP A C     1 
ATOM   1696 O  O     . TRP A 1 205 ? 23.968  40.132 51.105  1.00 35.45  ? 205  TRP A O     1 
ATOM   1697 C  CB    . TRP A 1 205 ? 21.439  40.222 53.208  1.00 30.67  ? 205  TRP A CB    1 
ATOM   1698 C  CG    . TRP A 1 205 ? 20.981  41.268 52.230  1.00 32.02  ? 205  TRP A CG    1 
ATOM   1699 C  CD1   . TRP A 1 205 ? 21.629  42.423 51.899  1.00 33.42  ? 205  TRP A CD1   1 
ATOM   1700 C  CD2   . TRP A 1 205 ? 19.752  41.273 51.488  1.00 29.37  ? 205  TRP A CD2   1 
ATOM   1701 N  NE1   . TRP A 1 205 ? 20.890  43.136 50.988  1.00 33.18  ? 205  TRP A NE1   1 
ATOM   1702 C  CE2   . TRP A 1 205 ? 19.733  42.453 50.720  1.00 30.59  ? 205  TRP A CE2   1 
ATOM   1703 C  CE3   . TRP A 1 205 ? 18.672  40.390 51.394  1.00 26.59  ? 205  TRP A CE3   1 
ATOM   1704 C  CZ2   . TRP A 1 205 ? 18.677  42.773 49.868  1.00 28.05  ? 205  TRP A CZ2   1 
ATOM   1705 C  CZ3   . TRP A 1 205 ? 17.624  40.709 50.547  1.00 25.41  ? 205  TRP A CZ3   1 
ATOM   1706 C  CH2   . TRP A 1 205 ? 17.635  41.889 49.796  1.00 25.60  ? 205  TRP A CH2   1 
ATOM   1707 N  N     . GLN A 1 206 ? 24.596  40.081 53.260  1.00 36.52  ? 206  GLN A N     1 
ATOM   1708 C  CA    . GLN A 1 206 ? 25.880  40.728 53.007  1.00 40.87  ? 206  GLN A CA    1 
ATOM   1709 C  C     . GLN A 1 206 ? 26.822  39.839 52.206  1.00 39.66  ? 206  GLN A C     1 
ATOM   1710 O  O     . GLN A 1 206 ? 27.546  40.320 51.336  1.00 37.62  ? 206  GLN A O     1 
ATOM   1711 C  CB    . GLN A 1 206 ? 26.542  41.154 54.317  1.00 48.71  ? 206  GLN A CB    1 
ATOM   1712 C  CG    . GLN A 1 206 ? 25.860  42.331 54.988  1.00 56.89  ? 206  GLN A CG    1 
ATOM   1713 C  CD    . GLN A 1 206 ? 26.657  42.873 56.155  1.00 65.96  ? 206  GLN A CD    1 
ATOM   1714 O  OE1   . GLN A 1 206 ? 26.292  43.886 56.753  1.00 68.59  ? 206  GLN A OE1   1 
ATOM   1715 N  NE2   . GLN A 1 206 ? 27.755  42.199 56.487  1.00 68.33  ? 206  GLN A NE2   1 
ATOM   1716 N  N     . GLN A 1 207 ? 26.808  38.544 52.506  1.00 43.46  ? 207  GLN A N     1 
ATOM   1717 C  CA    . GLN A 1 207 ? 27.635  37.576 51.789  1.00 47.71  ? 207  GLN A CA    1 
ATOM   1718 C  C     . GLN A 1 207 ? 27.183  37.423 50.347  1.00 44.35  ? 207  GLN A C     1 
ATOM   1719 O  O     . GLN A 1 207 ? 28.002  37.300 49.436  1.00 45.19  ? 207  GLN A O     1 
ATOM   1720 C  CB    . GLN A 1 207 ? 27.596  36.210 52.480  1.00 53.96  ? 207  GLN A CB    1 
ATOM   1721 C  CG    . GLN A 1 207 ? 28.337  36.168 53.799  1.00 63.65  ? 207  GLN A CG    1 
ATOM   1722 C  CD    . GLN A 1 207 ? 29.793  36.570 53.653  1.00 72.80  ? 207  GLN A CD    1 
ATOM   1723 O  OE1   . GLN A 1 207 ? 30.269  37.483 54.331  1.00 75.10  ? 207  GLN A OE1   1 
ATOM   1724 N  NE2   . GLN A 1 207 ? 30.509  35.888 52.764  1.00 75.36  ? 207  GLN A NE2   1 
ATOM   1725 N  N     . LYS A 1 208 ? 25.870  37.427 50.151  1.00 40.86  ? 208  LYS A N     1 
ATOM   1726 C  CA    . LYS A 1 208 ? 25.286  37.225 48.835  1.00 37.83  ? 208  LYS A CA    1 
ATOM   1727 C  C     . LYS A 1 208 ? 24.354  38.377 48.505  1.00 35.59  ? 208  LYS A C     1 
ATOM   1728 O  O     . LYS A 1 208 ? 23.141  38.200 48.402  1.00 36.09  ? 208  LYS A O     1 
ATOM   1729 C  CB    . LYS A 1 208 ? 24.525  35.903 48.807  1.00 36.49  ? 208  LYS A CB    1 
ATOM   1730 C  CG    . LYS A 1 208 ? 25.371  34.728 49.252  1.00 35.38  ? 208  LYS A CG    1 
ATOM   1731 C  CD    . LYS A 1 208 ? 24.535  33.499 49.527  1.00 34.07  ? 208  LYS A CD    1 
ATOM   1732 C  CE    . LYS A 1 208 ? 25.375  32.431 50.207  1.00 34.40  ? 208  LYS A CE    1 
ATOM   1733 N  NZ    . LYS A 1 208 ? 26.577  32.083 49.399  1.00 33.09  ? 208  LYS A NZ    1 
ATOM   1734 N  N     . THR A 1 209 ? 24.930  39.562 48.343  1.00 33.95  ? 209  THR A N     1 
ATOM   1735 C  CA    . THR A 1 209 ? 24.141  40.761 48.116  1.00 33.78  ? 209  THR A CA    1 
ATOM   1736 C  C     . THR A 1 209 ? 23.515  40.755 46.735  1.00 35.48  ? 209  THR A C     1 
ATOM   1737 O  O     . THR A 1 209 ? 24.221  40.695 45.729  1.00 39.08  ? 209  THR A O     1 
ATOM   1738 C  CB    . THR A 1 209 ? 24.972  42.034 48.317  1.00 37.05  ? 209  THR A CB    1 
ATOM   1739 O  OG1   . THR A 1 209 ? 25.460  42.072 49.666  1.00 41.13  ? 209  THR A OG1   1 
ATOM   1740 C  CG2   . THR A 1 209 ? 24.119  43.265 48.054  1.00 33.06  ? 209  THR A CG2   1 
ATOM   1741 N  N     . PRO A 1 210 ? 22.176  40.800 46.692  1.00 32.82  ? 210  PRO A N     1 
ATOM   1742 C  CA    . PRO A 1 210 ? 21.423  40.784 45.437  1.00 30.17  ? 210  PRO A CA    1 
ATOM   1743 C  C     . PRO A 1 210 ? 21.817  41.944 44.537  1.00 28.76  ? 210  PRO A C     1 
ATOM   1744 O  O     . PRO A 1 210 ? 21.974  43.069 45.011  1.00 30.56  ? 210  PRO A O     1 
ATOM   1745 C  CB    . PRO A 1 210 ? 19.974  40.955 45.901  1.00 26.48  ? 210  PRO A CB    1 
ATOM   1746 C  CG    . PRO A 1 210 ? 19.963  40.433 47.299  1.00 26.90  ? 210  PRO A CG    1 
ATOM   1747 C  CD    . PRO A 1 210 ? 21.289  40.837 47.867  1.00 29.33  ? 210  PRO A CD    1 
ATOM   1748 N  N     . VAL A 1 211 ? 22.002  41.660 43.255  1.00 25.69  ? 211  VAL A N     1 
ATOM   1749 C  CA    . VAL A 1 211 ? 22.160  42.706 42.262  1.00 27.62  ? 211  VAL A CA    1 
ATOM   1750 C  C     . VAL A 1 211 ? 20.777  42.966 41.689  1.00 31.23  ? 211  VAL A C     1 
ATOM   1751 O  O     . VAL A 1 211 ? 20.257  44.081 41.752  1.00 30.31  ? 211  VAL A O     1 
ATOM   1752 C  CB    . VAL A 1 211 ? 23.132  42.288 41.150  1.00 26.38  ? 211  VAL A CB    1 
ATOM   1753 C  CG1   . VAL A 1 211 ? 23.056  43.258 39.984  1.00 25.08  ? 211  VAL A CG1   1 
ATOM   1754 C  CG2   . VAL A 1 211 ? 24.550  42.210 41.698  1.00 22.34  ? 211  VAL A CG2   1 
ATOM   1755 N  N     . ILE A 1 212 ? 20.179  41.913 41.144  1.00 33.33  ? 212  ILE A N     1 
ATOM   1756 C  CA    . ILE A 1 212 ? 18.776  41.937 40.766  1.00 30.70  ? 212  ILE A CA    1 
ATOM   1757 C  C     . ILE A 1 212 ? 17.969  41.298 41.885  1.00 30.80  ? 212  ILE A C     1 
ATOM   1758 O  O     . ILE A 1 212 ? 18.230  40.160 42.274  1.00 30.20  ? 212  ILE A O     1 
ATOM   1759 C  CB    . ILE A 1 212 ? 18.522  41.158 39.469  1.00 26.99  ? 212  ILE A CB    1 
ATOM   1760 C  CG1   . ILE A 1 212 ? 19.378  41.727 38.334  1.00 23.05  ? 212  ILE A CG1   1 
ATOM   1761 C  CG2   . ILE A 1 212 ? 17.041  41.192 39.114  1.00 25.23  ? 212  ILE A CG2   1 
ATOM   1762 C  CD1   . ILE A 1 212 ? 19.159  43.207 38.085  1.00 19.22  ? 212  ILE A CD1   1 
ATOM   1763 N  N     . LEU A 1 213 ? 17.002  42.039 42.414  1.00 29.21  ? 213  LEU A N     1 
ATOM   1764 C  CA    . LEU A 1 213 ? 16.149  41.524 43.477  1.00 26.26  ? 213  LEU A CA    1 
ATOM   1765 C  C     . LEU A 1 213 ? 14.714  41.429 42.983  1.00 26.18  ? 213  LEU A C     1 
ATOM   1766 O  O     . LEU A 1 213 ? 14.148  42.415 42.513  1.00 25.75  ? 213  LEU A O     1 
ATOM   1767 C  CB    . LEU A 1 213 ? 16.224  42.423 44.709  1.00 26.15  ? 213  LEU A CB    1 
ATOM   1768 C  CG    . LEU A 1 213 ? 15.427  41.931 45.917  1.00 25.99  ? 213  LEU A CG    1 
ATOM   1769 C  CD1   . LEU A 1 213 ? 15.857  40.523 46.288  1.00 27.57  ? 213  LEU A CD1   1 
ATOM   1770 C  CD2   . LEU A 1 213 ? 15.606  42.875 47.089  1.00 26.03  ? 213  LEU A CD2   1 
ATOM   1771 N  N     . THR A 1 214 ? 14.126  40.243 43.087  1.00 26.53  ? 214  THR A N     1 
ATOM   1772 C  CA    . THR A 1 214 ? 12.783  40.032 42.557  1.00 27.25  ? 214  THR A CA    1 
ATOM   1773 C  C     . THR A 1 214 ? 11.948  39.079 43.405  1.00 28.00  ? 214  THR A C     1 
ATOM   1774 O  O     . THR A 1 214 ? 12.375  38.624 44.468  1.00 27.97  ? 214  THR A O     1 
ATOM   1775 C  CB    . THR A 1 214 ? 12.822  39.522 41.095  1.00 27.31  ? 214  THR A CB    1 
ATOM   1776 O  OG1   . THR A 1 214 ? 11.489  39.434 40.576  1.00 27.27  ? 214  THR A OG1   1 
ATOM   1777 C  CG2   . THR A 1 214 ? 13.491  38.159 41.014  1.00 21.69  ? 214  THR A CG2   1 
ATOM   1778 N  N     . GLY A 1 215 ? 10.755  38.779 42.907  1.00 26.77  ? 215  GLY A N     1 
ATOM   1779 C  CA    . GLY A 1 215 ? 9.782   37.986 43.627  1.00 23.65  ? 215  GLY A CA    1 
ATOM   1780 C  C     . GLY A 1 215 ? 8.408   38.525 43.301  1.00 25.88  ? 215  GLY A C     1 
ATOM   1781 O  O     . GLY A 1 215 ? 8.257   39.323 42.377  1.00 30.19  ? 215  GLY A O     1 
ATOM   1782 N  N     . TRP A 1 216 ? 7.403   38.100 44.056  1.00 26.49  ? 216  TRP A N     1 
ATOM   1783 C  CA    . TRP A 1 216 ? 6.043   38.550 43.808  1.00 23.94  ? 216  TRP A CA    1 
ATOM   1784 C  C     . TRP A 1 216 ? 5.616   39.573 44.852  1.00 25.15  ? 216  TRP A C     1 
ATOM   1785 O  O     . TRP A 1 216 ? 5.585   39.272 46.044  1.00 28.11  ? 216  TRP A O     1 
ATOM   1786 C  CB    . TRP A 1 216 ? 5.085   37.363 43.795  1.00 23.95  ? 216  TRP A CB    1 
ATOM   1787 C  CG    . TRP A 1 216 ? 3.816   37.662 43.080  1.00 23.80  ? 216  TRP A CG    1 
ATOM   1788 C  CD1   . TRP A 1 216 ? 2.603   37.922 43.638  1.00 24.89  ? 216  TRP A CD1   1 
ATOM   1789 C  CD2   . TRP A 1 216 ? 3.636   37.754 41.664  1.00 20.54  ? 216  TRP A CD2   1 
ATOM   1790 N  NE1   . TRP A 1 216 ? 1.673   38.163 42.658  1.00 25.88  ? 216  TRP A NE1   1 
ATOM   1791 C  CE2   . TRP A 1 216 ? 2.283   38.066 41.436  1.00 23.17  ? 216  TRP A CE2   1 
ATOM   1792 C  CE3   . TRP A 1 216 ? 4.489   37.600 40.567  1.00 20.41  ? 216  TRP A CE3   1 
ATOM   1793 C  CZ2   . TRP A 1 216 ? 1.760   38.228 40.155  1.00 24.94  ? 216  TRP A CZ2   1 
ATOM   1794 C  CZ3   . TRP A 1 216 ? 3.968   37.758 39.296  1.00 22.25  ? 216  TRP A CZ3   1 
ATOM   1795 C  CH2   . TRP A 1 216 ? 2.617   38.070 39.101  1.00 24.55  ? 216  TRP A CH2   1 
ATOM   1796 N  N     . ASN A 1 217 ? 5.293   40.779 44.393  1.00 24.92  ? 217  ASN A N     1 
ATOM   1797 C  CA    . ASN A 1 217 ? 4.961   41.899 45.274  1.00 26.47  ? 217  ASN A CA    1 
ATOM   1798 C  C     . ASN A 1 217 ? 6.078   42.278 46.236  1.00 23.52  ? 217  ASN A C     1 
ATOM   1799 O  O     . ASN A 1 217 ? 5.816   42.850 47.291  1.00 27.31  ? 217  ASN A O     1 
ATOM   1800 C  CB    . ASN A 1 217 ? 3.670   41.636 46.061  1.00 31.78  ? 217  ASN A CB    1 
ATOM   1801 C  CG    . ASN A 1 217 ? 2.428   41.953 45.264  1.00 43.90  ? 217  ASN A CG    1 
ATOM   1802 O  OD1   . ASN A 1 217 ? 2.065   43.117 45.097  1.00 50.14  ? 217  ASN A OD1   1 
ATOM   1803 N  ND2   . ASN A 1 217 ? 1.765   40.916 44.764  1.00 50.10  ? 217  ASN A ND2   1 
ATOM   1804 N  N     . VAL A 1 218 ? 7.319   41.966 45.874  1.00 22.29  ? 218  VAL A N     1 
ATOM   1805 C  CA    . VAL A 1 218 ? 8.442   42.227 46.767  1.00 27.96  ? 218  VAL A CA    1 
ATOM   1806 C  C     . VAL A 1 218 ? 8.637   43.713 47.043  1.00 32.98  ? 218  VAL A C     1 
ATOM   1807 O  O     . VAL A 1 218 ? 9.065   44.086 48.134  1.00 34.01  ? 218  VAL A O     1 
ATOM   1808 C  CB    . VAL A 1 218 ? 9.760   41.617 46.252  1.00 25.18  ? 218  VAL A CB    1 
ATOM   1809 C  CG1   . VAL A 1 218 ? 9.751   40.112 46.446  1.00 23.94  ? 218  VAL A CG1   1 
ATOM   1810 C  CG2   . VAL A 1 218 ? 9.990   41.985 44.795  1.00 23.04  ? 218  VAL A CG2   1 
ATOM   1811 N  N     . GLU A 1 219 ? 8.311   44.556 46.067  1.00 33.40  ? 219  GLU A N     1 
ATOM   1812 C  CA    . GLU A 1 219 ? 8.485   45.995 46.238  1.00 36.23  ? 219  GLU A CA    1 
ATOM   1813 C  C     . GLU A 1 219 ? 7.386   46.613 47.100  1.00 34.98  ? 219  GLU A C     1 
ATOM   1814 O  O     . GLU A 1 219 ? 7.640   47.536 47.876  1.00 34.30  ? 219  GLU A O     1 
ATOM   1815 C  CB    . GLU A 1 219 ? 8.567   46.709 44.890  1.00 40.73  ? 219  GLU A CB    1 
ATOM   1816 C  CG    . GLU A 1 219 ? 8.609   48.225 45.012  1.00 49.01  ? 219  GLU A CG    1 
ATOM   1817 C  CD    . GLU A 1 219 ? 8.825   48.914 43.687  1.00 55.86  ? 219  GLU A CD    1 
ATOM   1818 O  OE1   . GLU A 1 219 ? 7.837   49.422 43.114  1.00 58.01  ? 219  GLU A OE1   1 
ATOM   1819 O  OE2   . GLU A 1 219 ? 9.985   48.946 43.221  1.00 57.90  ? 219  GLU A OE2   1 
ATOM   1820 N  N     . SER A 1 220 ? 6.168   46.100 46.976  1.00 33.56  ? 220  SER A N     1 
ATOM   1821 C  CA    . SER A 1 220 ? 5.059   46.643 47.750  1.00 35.65  ? 220  SER A CA    1 
ATOM   1822 C  C     . SER A 1 220 ? 4.862   45.942 49.094  1.00 32.41  ? 220  SER A C     1 
ATOM   1823 O  O     . SER A 1 220 ? 4.218   46.488 49.992  1.00 32.71  ? 220  SER A O     1 
ATOM   1824 C  CB    . SER A 1 220 ? 3.764   46.635 46.931  1.00 40.16  ? 220  SER A CB    1 
ATOM   1825 O  OG    . SER A 1 220 ? 3.508   45.351 46.390  1.00 48.05  ? 220  SER A OG    1 
ATOM   1826 N  N     . PHE A 1 221 ? 5.417   44.742 49.242  1.00 29.73  ? 221  PHE A N     1 
ATOM   1827 C  CA    . PHE A 1 221 ? 5.285   44.028 50.510  1.00 30.41  ? 221  PHE A CA    1 
ATOM   1828 C  C     . PHE A 1 221 ? 6.595   43.569 51.147  1.00 31.33  ? 221  PHE A C     1 
ATOM   1829 O  O     . PHE A 1 221 ? 6.999   44.095 52.181  1.00 31.83  ? 221  PHE A O     1 
ATOM   1830 C  CB    . PHE A 1 221 ? 4.340   42.833 50.392  1.00 27.87  ? 221  PHE A CB    1 
ATOM   1831 C  CG    . PHE A 1 221 ? 4.188   42.079 51.678  1.00 29.56  ? 221  PHE A CG    1 
ATOM   1832 C  CD1   . PHE A 1 221 ? 4.865   40.888 51.885  1.00 28.33  ? 221  PHE A CD1   1 
ATOM   1833 C  CD2   . PHE A 1 221 ? 3.401   42.586 52.700  1.00 30.85  ? 221  PHE A CD2   1 
ATOM   1834 C  CE1   . PHE A 1 221 ? 4.742   40.204 53.078  1.00 29.63  ? 221  PHE A CE1   1 
ATOM   1835 C  CE2   . PHE A 1 221 ? 3.272   41.905 53.896  1.00 32.06  ? 221  PHE A CE2   1 
ATOM   1836 C  CZ    . PHE A 1 221 ? 3.944   40.711 54.086  1.00 31.40  ? 221  PHE A CZ    1 
ATOM   1837 N  N     . ALA A 1 222 ? 7.234   42.573 50.539  1.00 30.55  ? 222  ALA A N     1 
ATOM   1838 C  CA    . ALA A 1 222 ? 8.386   41.902 51.142  1.00 30.35  ? 222  ALA A CA    1 
ATOM   1839 C  C     . ALA A 1 222 ? 9.507   42.857 51.554  1.00 30.70  ? 222  ALA A C     1 
ATOM   1840 O  O     . ALA A 1 222 ? 9.890   42.910 52.726  1.00 30.25  ? 222  ALA A O     1 
ATOM   1841 C  CB    . ALA A 1 222 ? 8.924   40.819 50.207  1.00 28.36  ? 222  ALA A CB    1 
ATOM   1842 N  N     . ILE A 1 223 ? 10.029  43.608 50.591  1.00 29.33  ? 223  ILE A N     1 
ATOM   1843 C  CA    . ILE A 1 223 ? 11.119  44.533 50.875  1.00 29.05  ? 223  ILE A CA    1 
ATOM   1844 C  C     . ILE A 1 223 ? 10.766  45.564 51.959  1.00 31.00  ? 223  ILE A C     1 
ATOM   1845 O  O     . ILE A 1 223 ? 11.474  45.650 52.962  1.00 31.19  ? 223  ILE A O     1 
ATOM   1846 C  CB    . ILE A 1 223 ? 11.664  45.206 49.595  1.00 28.28  ? 223  ILE A CB    1 
ATOM   1847 C  CG1   . ILE A 1 223 ? 12.196  44.145 48.631  1.00 27.95  ? 223  ILE A CG1   1 
ATOM   1848 C  CG2   . ILE A 1 223 ? 12.746  46.211 49.944  1.00 29.47  ? 223  ILE A CG2   1 
ATOM   1849 C  CD1   . ILE A 1 223 ? 12.365  44.636 47.214  1.00 28.32  ? 223  ILE A CD1   1 
ATOM   1850 N  N     . PRO A 1 224 ? 9.665   46.326 51.787  1.00 30.27  ? 224  PRO A N     1 
ATOM   1851 C  CA    . PRO A 1 224 ? 9.373   47.285 52.858  1.00 31.16  ? 224  PRO A CA    1 
ATOM   1852 C  C     . PRO A 1 224 ? 9.048   46.619 54.198  1.00 34.96  ? 224  PRO A C     1 
ATOM   1853 O  O     . PRO A 1 224 ? 9.390   47.182 55.240  1.00 36.68  ? 224  PRO A O     1 
ATOM   1854 C  CB    . PRO A 1 224 ? 8.156   48.051 52.326  1.00 28.25  ? 224  PRO A CB    1 
ATOM   1855 C  CG    . PRO A 1 224 ? 7.529   47.139 51.347  1.00 26.85  ? 224  PRO A CG    1 
ATOM   1856 C  CD    . PRO A 1 224 ? 8.671   46.413 50.702  1.00 26.74  ? 224  PRO A CD    1 
ATOM   1857 N  N     . TYR A 1 225 ? 8.415   45.448 54.182  1.00 33.52  ? 225  TYR A N     1 
ATOM   1858 C  CA    . TYR A 1 225 ? 8.119   44.773 55.440  1.00 31.61  ? 225  TYR A CA    1 
ATOM   1859 C  C     . TYR A 1 225 ? 9.410   44.370 56.141  1.00 34.42  ? 225  TYR A C     1 
ATOM   1860 O  O     . TYR A 1 225 ? 9.587   44.639 57.331  1.00 37.17  ? 225  TYR A O     1 
ATOM   1861 C  CB    . TYR A 1 225 ? 7.215   43.552 55.261  1.00 26.69  ? 225  TYR A CB    1 
ATOM   1862 C  CG    . TYR A 1 225 ? 6.547   43.156 56.557  1.00 29.22  ? 225  TYR A CG    1 
ATOM   1863 C  CD1   . TYR A 1 225 ? 7.255   42.496 57.557  1.00 32.08  ? 225  TYR A CD1   1 
ATOM   1864 C  CD2   . TYR A 1 225 ? 5.219   43.473 56.797  1.00 32.87  ? 225  TYR A CD2   1 
ATOM   1865 C  CE1   . TYR A 1 225 ? 6.655   42.155 58.752  1.00 35.19  ? 225  TYR A CE1   1 
ATOM   1866 C  CE2   . TYR A 1 225 ? 4.609   43.134 57.989  1.00 36.70  ? 225  TYR A CE2   1 
ATOM   1867 C  CZ    . TYR A 1 225 ? 5.331   42.476 58.962  1.00 38.66  ? 225  TYR A CZ    1 
ATOM   1868 O  OH    . TYR A 1 225 ? 4.724   42.136 60.148  1.00 42.85  ? 225  TYR A OH    1 
ATOM   1869 N  N     . VAL A 1 226 ? 10.304  43.720 55.402  1.00 30.48  ? 226  VAL A N     1 
ATOM   1870 C  CA    . VAL A 1 226 ? 11.584  43.304 55.961  1.00 31.95  ? 226  VAL A CA    1 
ATOM   1871 C  C     . VAL A 1 226 ? 12.375  44.507 56.467  1.00 34.40  ? 226  VAL A C     1 
ATOM   1872 O  O     . VAL A 1 226 ? 12.887  44.492 57.587  1.00 35.64  ? 226  VAL A O     1 
ATOM   1873 C  CB    . VAL A 1 226 ? 12.422  42.504 54.942  1.00 32.34  ? 226  VAL A CB    1 
ATOM   1874 C  CG1   . VAL A 1 226 ? 13.861  42.377 55.413  1.00 31.87  ? 226  VAL A CG1   1 
ATOM   1875 C  CG2   . VAL A 1 226 ? 11.810  41.127 54.716  1.00 32.62  ? 226  VAL A CG2   1 
ATOM   1876 N  N     . TYR A 1 227 ? 12.451  45.555 55.651  1.00 34.86  ? 227  TYR A N     1 
ATOM   1877 C  CA    . TYR A 1 227 ? 13.179  46.762 56.029  1.00 34.80  ? 227  TYR A CA    1 
ATOM   1878 C  C     . TYR A 1 227 ? 12.620  47.391 57.302  1.00 38.36  ? 227  TYR A C     1 
ATOM   1879 O  O     . TYR A 1 227 ? 13.376  47.774 58.191  1.00 41.15  ? 227  TYR A O     1 
ATOM   1880 C  CB    . TYR A 1 227 ? 13.181  47.789 54.892  1.00 32.40  ? 227  TYR A CB    1 
ATOM   1881 C  CG    . TYR A 1 227 ? 13.910  49.074 55.239  1.00 33.96  ? 227  TYR A CG    1 
ATOM   1882 C  CD1   . TYR A 1 227 ? 15.290  49.167 55.116  1.00 35.21  ? 227  TYR A CD1   1 
ATOM   1883 C  CD2   . TYR A 1 227 ? 13.217  50.191 55.693  1.00 37.22  ? 227  TYR A CD2   1 
ATOM   1884 C  CE1   . TYR A 1 227 ? 15.962  50.337 55.434  1.00 40.54  ? 227  TYR A CE1   1 
ATOM   1885 C  CE2   . TYR A 1 227 ? 13.880  51.367 56.013  1.00 41.69  ? 227  TYR A CE2   1 
ATOM   1886 C  CZ    . TYR A 1 227 ? 15.252  51.435 55.881  1.00 43.46  ? 227  TYR A CZ    1 
ATOM   1887 O  OH    . TYR A 1 227 ? 15.918  52.600 56.198  1.00 46.33  ? 227  TYR A OH    1 
ATOM   1888 N  N     . ASN A 1 228 ? 11.298  47.494 57.386  1.00 38.17  ? 228  ASN A N     1 
ATOM   1889 C  CA    . ASN A 1 228 ? 10.656  48.112 58.540  1.00 37.44  ? 228  ASN A CA    1 
ATOM   1890 C  C     . ASN A 1 228 ? 10.687  47.242 59.789  1.00 38.19  ? 228  ASN A C     1 
ATOM   1891 O  O     . ASN A 1 228 ? 10.793  47.756 60.903  1.00 38.98  ? 228  ASN A O     1 
ATOM   1892 C  CB    . ASN A 1 228 ? 9.221   48.517 58.210  1.00 35.74  ? 228  ASN A CB    1 
ATOM   1893 C  CG    . ASN A 1 228 ? 9.143   49.867 57.533  1.00 35.22  ? 228  ASN A CG    1 
ATOM   1894 O  OD1   . ASN A 1 228 ? 9.753   50.837 57.985  1.00 39.62  ? 228  ASN A OD1   1 
ATOM   1895 N  ND2   . ASN A 1 228 ? 8.397   49.937 56.437  1.00 32.85  ? 228  ASN A ND2   1 
ATOM   1896 N  N     . ARG A 1 229 ? 10.587  45.929 59.603  1.00 34.78  ? 229  ARG A N     1 
ATOM   1897 C  CA    . ARG A 1 229 ? 10.668  44.998 60.721  1.00 31.70  ? 229  ARG A CA    1 
ATOM   1898 C  C     . ARG A 1 229 ? 12.059  45.080 61.344  1.00 32.04  ? 229  ARG A C     1 
ATOM   1899 O  O     . ARG A 1 229 ? 12.200  45.239 62.557  1.00 34.56  ? 229  ARG A O     1 
ATOM   1900 C  CB    . ARG A 1 229 ? 10.372  43.573 60.255  1.00 30.14  ? 229  ARG A CB    1 
ATOM   1901 C  CG    . ARG A 1 229 ? 10.264  42.564 61.381  1.00 30.67  ? 229  ARG A CG    1 
ATOM   1902 C  CD    . ARG A 1 229 ? 9.094   42.877 62.301  1.00 32.21  ? 229  ARG A CD    1 
ATOM   1903 N  NE    . ARG A 1 229 ? 9.017   41.927 63.409  1.00 34.99  ? 229  ARG A NE    1 
ATOM   1904 C  CZ    . ARG A 1 229 ? 8.126   41.993 64.392  1.00 38.06  ? 229  ARG A CZ    1 
ATOM   1905 N  NH1   . ARG A 1 229 ? 7.228   42.968 64.410  1.00 40.12  ? 229  ARG A NH1   1 
ATOM   1906 N  NH2   . ARG A 1 229 ? 8.132   41.084 65.360  1.00 38.92  ? 229  ARG A NH2   1 
ATOM   1907 N  N     . ILE A 1 230 ? 13.083  44.993 60.500  1.00 31.04  ? 230  ILE A N     1 
ATOM   1908 C  CA    . ILE A 1 230 ? 14.465  45.102 60.954  1.00 33.58  ? 230  ILE A CA    1 
ATOM   1909 C  C     . ILE A 1 230 ? 14.739  46.487 61.539  1.00 38.54  ? 230  ILE A C     1 
ATOM   1910 O  O     . ILE A 1 230 ? 15.482  46.623 62.510  1.00 43.94  ? 230  ILE A O     1 
ATOM   1911 C  CB    . ILE A 1 230 ? 15.463  44.784 59.816  1.00 25.83  ? 230  ILE A CB    1 
ATOM   1912 C  CG1   . ILE A 1 230 ? 15.334  43.318 59.398  1.00 28.56  ? 230  ILE A CG1   1 
ATOM   1913 C  CG2   . ILE A 1 230 ? 16.894  45.073 60.245  1.00 26.80  ? 230  ILE A CG2   1 
ATOM   1914 C  CD1   . ILE A 1 230 ? 16.355  42.869 58.368  1.00 24.66  ? 230  ILE A CD1   1 
ATOM   1915 N  N     . LYS A 1 231 ? 14.122  47.508 60.952  1.00 38.47  ? 231  LYS A N     1 
ATOM   1916 C  CA    . LYS A 1 231 ? 14.241  48.877 61.447  1.00 40.64  ? 231  LYS A CA    1 
ATOM   1917 C  C     . LYS A 1 231 ? 13.614  49.021 62.836  1.00 42.83  ? 231  LYS A C     1 
ATOM   1918 O  O     . LYS A 1 231 ? 14.202  49.625 63.734  1.00 43.91  ? 231  LYS A O     1 
ATOM   1919 C  CB    . LYS A 1 231 ? 13.573  49.846 60.472  1.00 42.61  ? 231  LYS A CB    1 
ATOM   1920 C  CG    . LYS A 1 231 ? 13.692  51.318 60.826  1.00 46.61  ? 231  LYS A CG    1 
ATOM   1921 C  CD    . LYS A 1 231 ? 12.856  52.152 59.867  1.00 49.88  ? 231  LYS A CD    1 
ATOM   1922 C  CE    . LYS A 1 231 ? 12.998  53.638 60.137  1.00 56.81  ? 231  LYS A CE    1 
ATOM   1923 N  NZ    . LYS A 1 231 ? 12.132  54.436 59.221  1.00 59.94  ? 231  LYS A NZ    1 
ATOM   1924 N  N     . ASN A 1 232 ? 12.418  48.467 63.006  1.00 41.54  ? 232  ASN A N     1 
ATOM   1925 C  CA    . ASN A 1 232 ? 11.724  48.533 64.284  1.00 42.58  ? 232  ASN A CA    1 
ATOM   1926 C  C     . ASN A 1 232 ? 12.466  47.777 65.381  1.00 46.30  ? 232  ASN A C     1 
ATOM   1927 O  O     . ASN A 1 232 ? 12.558  48.244 66.517  1.00 48.92  ? 232  ASN A O     1 
ATOM   1928 C  CB    . ASN A 1 232 ? 10.299  47.991 64.148  1.00 44.26  ? 232  ASN A CB    1 
ATOM   1929 C  CG    . ASN A 1 232 ? 9.407   48.896 63.325  1.00 48.49  ? 232  ASN A CG    1 
ATOM   1930 O  OD1   . ASN A 1 232 ? 9.841   49.939 62.843  1.00 50.77  ? 232  ASN A OD1   1 
ATOM   1931 N  ND2   . ASN A 1 232 ? 8.154   48.490 63.147  1.00 50.02  ? 232  ASN A ND2   1 
ATOM   1932 N  N     . ILE A 1 233 ? 13.002  46.614 65.029  1.00 43.81  ? 233  ILE A N     1 
ATOM   1933 C  CA    . ILE A 1 233 ? 13.633  45.739 66.007  1.00 43.24  ? 233  ILE A CA    1 
ATOM   1934 C  C     . ILE A 1 233 ? 15.081  46.113 66.326  1.00 45.25  ? 233  ILE A C     1 
ATOM   1935 O  O     . ILE A 1 233 ? 15.446  46.230 67.493  1.00 52.11  ? 233  ILE A O     1 
ATOM   1936 C  CB    . ILE A 1 233 ? 13.561  44.260 65.569  1.00 41.28  ? 233  ILE A CB    1 
ATOM   1937 C  CG1   . ILE A 1 233 ? 12.105  43.798 65.507  1.00 39.98  ? 233  ILE A CG1   1 
ATOM   1938 C  CG2   . ILE A 1 233 ? 14.366  43.382 66.516  1.00 41.44  ? 233  ILE A CG2   1 
ATOM   1939 C  CD1   . ILE A 1 233 ? 11.935  42.353 65.098  1.00 40.64  ? 233  ILE A CD1   1 
ATOM   1940 N  N     . PHE A 1 234 ? 15.900  46.306 65.296  1.00 43.21  ? 234  PHE A N     1 
ATOM   1941 C  CA    . PHE A 1 234 ? 17.324  46.565 65.502  1.00 44.51  ? 234  PHE A CA    1 
ATOM   1942 C  C     . PHE A 1 234 ? 17.722  48.037 65.332  1.00 47.57  ? 234  PHE A C     1 
ATOM   1943 O  O     . PHE A 1 234 ? 18.838  48.428 65.682  1.00 50.78  ? 234  PHE A O     1 
ATOM   1944 C  CB    . PHE A 1 234 ? 18.175  45.709 64.562  1.00 41.62  ? 234  PHE A CB    1 
ATOM   1945 C  CG    . PHE A 1 234 ? 17.946  44.238 64.692  1.00 42.37  ? 234  PHE A CG    1 
ATOM   1946 C  CD1   . PHE A 1 234 ? 17.042  43.593 63.867  1.00 41.58  ? 234  PHE A CD1   1 
ATOM   1947 C  CD2   . PHE A 1 234 ? 18.653  43.494 65.620  1.00 42.27  ? 234  PHE A CD2   1 
ATOM   1948 C  CE1   . PHE A 1 234 ? 16.837  42.239 63.975  1.00 41.38  ? 234  PHE A CE1   1 
ATOM   1949 C  CE2   . PHE A 1 234 ? 18.450  42.140 65.732  1.00 43.57  ? 234  PHE A CE2   1 
ATOM   1950 C  CZ    . PHE A 1 234 ? 17.542  41.511 64.909  1.00 42.32  ? 234  PHE A CZ    1 
ATOM   1951 N  N     . GLY A 1 235 ? 16.822  48.851 64.793  1.00 45.87  ? 235  GLY A N     1 
ATOM   1952 C  CA    . GLY A 1 235 ? 17.147  50.242 64.540  1.00 50.69  ? 235  GLY A CA    1 
ATOM   1953 C  C     . GLY A 1 235 ? 17.481  50.489 63.082  1.00 53.71  ? 235  GLY A C     1 
ATOM   1954 O  O     . GLY A 1 235 ? 17.809  49.559 62.344  1.00 53.38  ? 235  GLY A O     1 
ATOM   1955 N  N     . GLU A 1 236 ? 17.410  51.750 62.669  1.00 56.79  ? 236  GLU A N     1 
ATOM   1956 C  CA    . GLU A 1 236 ? 17.562  52.109 61.263  1.00 58.71  ? 236  GLU A CA    1 
ATOM   1957 C  C     . GLU A 1 236 ? 18.944  51.779 60.700  1.00 55.06  ? 236  GLU A C     1 
ATOM   1958 O  O     . GLU A 1 236 ? 19.080  51.465 59.518  1.00 54.57  ? 236  GLU A O     1 
ATOM   1959 C  CB    . GLU A 1 236 ? 17.245  53.593 61.057  1.00 65.54  ? 236  GLU A CB    1 
ATOM   1960 C  CG    . GLU A 1 236 ? 17.192  54.020 59.601  1.00 72.11  ? 236  GLU A CG    1 
ATOM   1961 C  CD    . GLU A 1 236 ? 16.807  55.475 59.440  1.00 79.31  ? 236  GLU A CD    1 
ATOM   1962 O  OE1   . GLU A 1 236 ? 16.270  56.055 60.408  1.00 80.72  ? 236  GLU A OE1   1 
ATOM   1963 O  OE2   . GLU A 1 236 ? 17.044  56.039 58.349  1.00 82.51  ? 236  GLU A OE2   1 
ATOM   1964 N  N     . SER A 1 237 ? 19.965  51.836 61.548  1.00 53.46  ? 237  SER A N     1 
ATOM   1965 C  CA    . SER A 1 237 ? 21.343  51.663 61.091  1.00 52.13  ? 237  SER A CA    1 
ATOM   1966 C  C     . SER A 1 237 ? 21.641  50.251 60.575  1.00 48.03  ? 237  SER A C     1 
ATOM   1967 O  O     . SER A 1 237 ? 22.398  50.083 59.618  1.00 45.65  ? 237  SER A O     1 
ATOM   1968 C  CB    . SER A 1 237 ? 22.329  52.055 62.194  1.00 55.44  ? 237  SER A CB    1 
ATOM   1969 O  OG    . SER A 1 237 ? 23.610  52.341 61.658  1.00 58.22  ? 237  SER A OG    1 
ATOM   1970 N  N     . THR A 1 238 ? 21.047  49.242 61.209  1.00 46.58  ? 238  THR A N     1 
ATOM   1971 C  CA    . THR A 1 238 ? 21.218  47.857 60.774  1.00 47.05  ? 238  THR A CA    1 
ATOM   1972 C  C     . THR A 1 238 ? 20.280  47.540 59.622  1.00 46.53  ? 238  THR A C     1 
ATOM   1973 O  O     . THR A 1 238 ? 20.563  46.669 58.803  1.00 46.41  ? 238  THR A O     1 
ATOM   1974 C  CB    . THR A 1 238 ? 20.884  46.859 61.886  1.00 49.69  ? 238  THR A CB    1 
ATOM   1975 O  OG1   . THR A 1 238 ? 19.497  46.976 62.212  1.00 53.88  ? 238  THR A OG1   1 
ATOM   1976 C  CG2   . THR A 1 238 ? 21.712  47.123 63.124  1.00 50.35  ? 238  THR A CG2   1 
ATOM   1977 N  N     . ALA A 1 239 ? 19.146  48.233 59.583  1.00 46.04  ? 239  ALA A N     1 
ATOM   1978 C  CA    . ALA A 1 239 ? 18.178  48.060 58.510  1.00 41.68  ? 239  ALA A CA    1 
ATOM   1979 C  C     . ALA A 1 239 ? 18.812  48.496 57.199  1.00 41.18  ? 239  ALA A C     1 
ATOM   1980 O  O     . ALA A 1 239 ? 18.503  47.961 56.134  1.00 38.91  ? 239  ALA A O     1 
ATOM   1981 C  CB    . ALA A 1 239 ? 16.924  48.869 58.793  1.00 40.78  ? 239  ALA A CB    1 
ATOM   1982 N  N     . LYS A 1 240 ? 19.720  49.463 57.295  1.00 43.30  ? 240  LYS A N     1 
ATOM   1983 C  CA    . LYS A 1 240 ? 20.428  49.980 56.130  1.00 44.95  ? 240  LYS A CA    1 
ATOM   1984 C  C     . LYS A 1 240 ? 21.455  48.993 55.571  1.00 44.37  ? 240  LYS A C     1 
ATOM   1985 O  O     . LYS A 1 240 ? 22.001  49.211 54.488  1.00 43.21  ? 240  LYS A O     1 
ATOM   1986 C  CB    . LYS A 1 240 ? 21.096  51.317 56.455  1.00 49.26  ? 240  LYS A CB    1 
ATOM   1987 C  CG    . LYS A 1 240 ? 20.113  52.458 56.668  1.00 53.54  ? 240  LYS A CG    1 
ATOM   1988 C  CD    . LYS A 1 240 ? 20.836  53.769 56.924  1.00 56.17  ? 240  LYS A CD    1 
ATOM   1989 C  CE    . LYS A 1 240 ? 19.859  54.916 57.103  1.00 55.56  ? 240  LYS A CE    1 
ATOM   1990 N  NZ    . LYS A 1 240 ? 20.574  56.215 57.242  1.00 56.79  ? 240  LYS A NZ    1 
ATOM   1991 N  N     . ARG A 1 241 ? 21.709  47.908 56.303  1.00 43.41  ? 241  ARG A N     1 
ATOM   1992 C  CA    . ARG A 1 241 ? 22.603  46.856 55.822  1.00 41.24  ? 241  ARG A CA    1 
ATOM   1993 C  C     . ARG A 1 241 ? 21.995  46.150 54.615  1.00 38.14  ? 241  ARG A C     1 
ATOM   1994 O  O     . ARG A 1 241 ? 22.685  45.421 53.901  1.00 41.01  ? 241  ARG A O     1 
ATOM   1995 C  CB    . ARG A 1 241 ? 22.911  45.837 56.923  1.00 40.65  ? 241  ARG A CB    1 
ATOM   1996 C  CG    . ARG A 1 241 ? 23.733  46.384 58.078  1.00 42.51  ? 241  ARG A CG    1 
ATOM   1997 C  CD    . ARG A 1 241 ? 23.867  45.350 59.185  1.00 43.31  ? 241  ARG A CD    1 
ATOM   1998 N  NE    . ARG A 1 241 ? 24.507  44.127 58.711  1.00 44.67  ? 241  ARG A NE    1 
ATOM   1999 C  CZ    . ARG A 1 241 ? 24.544  42.989 59.396  1.00 46.12  ? 241  ARG A CZ    1 
ATOM   2000 N  NH1   . ARG A 1 241 ? 23.973  42.914 60.591  1.00 46.02  ? 241  ARG A NH1   1 
ATOM   2001 N  NH2   . ARG A 1 241 ? 25.147  41.924 58.886  1.00 48.65  ? 241  ARG A NH2   1 
ATOM   2002 N  N     . LEU A 1 242 ? 20.702  46.371 54.395  1.00 32.54  ? 242  LEU A N     1 
ATOM   2003 C  CA    . LEU A 1 242 ? 20.017  45.845 53.221  1.00 33.77  ? 242  LEU A CA    1 
ATOM   2004 C  C     . LEU A 1 242 ? 20.523  46.516 51.952  1.00 32.97  ? 242  LEU A C     1 
ATOM   2005 O  O     . LEU A 1 242 ? 20.323  46.011 50.853  1.00 33.94  ? 242  LEU A O     1 
ATOM   2006 C  CB    . LEU A 1 242 ? 18.502  46.025 53.351  1.00 34.39  ? 242  LEU A CB    1 
ATOM   2007 C  CG    . LEU A 1 242 ? 17.821  45.109 54.369  1.00 33.60  ? 242  LEU A CG    1 
ATOM   2008 C  CD1   . LEU A 1 242 ? 16.330  45.394 54.438  1.00 34.56  ? 242  LEU A CD1   1 
ATOM   2009 C  CD2   . LEU A 1 242 ? 18.080  43.650 54.020  1.00 29.11  ? 242  LEU A CD2   1 
ATOM   2010 N  N     . SER A 1 243 ? 21.173  47.662 52.117  1.00 34.24  ? 243  SER A N     1 
ATOM   2011 C  CA    . SER A 1 243 ? 21.812  48.363 51.010  1.00 35.62  ? 243  SER A CA    1 
ATOM   2012 C  C     . SER A 1 243 ? 23.326  48.188 51.093  1.00 39.46  ? 243  SER A C     1 
ATOM   2013 O  O     . SER A 1 243 ? 23.924  48.460 52.135  1.00 45.23  ? 243  SER A O     1 
ATOM   2014 C  CB    . SER A 1 243 ? 21.456  49.851 51.048  1.00 35.75  ? 243  SER A CB    1 
ATOM   2015 O  OG    . SER A 1 243 ? 22.274  50.607 50.168  1.00 35.96  ? 243  SER A OG    1 
ATOM   2016 N  N     . PRO A 1 244 ? 23.952  47.737 49.994  1.00 35.05  ? 244  PRO A N     1 
ATOM   2017 C  CA    . PRO A 1 244 ? 25.407  47.544 49.951  1.00 33.92  ? 244  PRO A CA    1 
ATOM   2018 C  C     . PRO A 1 244 ? 26.165  48.852 50.169  1.00 36.07  ? 244  PRO A C     1 
ATOM   2019 O  O     . PRO A 1 244 ? 27.355  48.827 50.482  1.00 39.03  ? 244  PRO A O     1 
ATOM   2020 C  CB    . PRO A 1 244 ? 25.647  47.016 48.532  1.00 33.35  ? 244  PRO A CB    1 
ATOM   2021 C  CG    . PRO A 1 244 ? 24.465  47.465 47.747  1.00 31.89  ? 244  PRO A CG    1 
ATOM   2022 C  CD    . PRO A 1 244 ? 23.317  47.410 48.706  1.00 31.98  ? 244  PRO A CD    1 
ATOM   2023 N  N     . HIS A 1 245 ? 25.473  49.976 50.005  1.00 36.12  ? 245  HIS A N     1 
ATOM   2024 C  CA    . HIS A 1 245 ? 26.063  51.286 50.233  1.00 39.48  ? 245  HIS A CA    1 
ATOM   2025 C  C     . HIS A 1 245 ? 25.477  51.921 51.487  1.00 42.66  ? 245  HIS A C     1 
ATOM   2026 O  O     . HIS A 1 245 ? 25.646  53.118 51.724  1.00 46.83  ? 245  HIS A O     1 
ATOM   2027 C  CB    . HIS A 1 245 ? 25.825  52.193 49.027  1.00 38.32  ? 245  HIS A CB    1 
ATOM   2028 C  CG    . HIS A 1 245 ? 26.194  51.568 47.720  1.00 35.88  ? 245  HIS A CG    1 
ATOM   2029 N  ND1   . HIS A 1 245 ? 27.434  51.015 47.483  1.00 37.52  ? 245  HIS A ND1   1 
ATOM   2030 C  CD2   . HIS A 1 245 ? 25.488  51.410 46.577  1.00 33.60  ? 245  HIS A CD2   1 
ATOM   2031 C  CE1   . HIS A 1 245 ? 27.474  50.542 46.251  1.00 36.20  ? 245  HIS A CE1   1 
ATOM   2032 N  NE2   . HIS A 1 245 ? 26.305  50.768 45.679  1.00 34.32  ? 245  HIS A NE2   1 
ATOM   2033 N  N     . ARG A 1 246 ? 24.778  51.110 52.277  1.00 42.19  ? 246  ARG A N     1 
ATOM   2034 C  CA    . ARG A 1 246 ? 24.199  51.546 53.547  1.00 45.79  ? 246  ARG A CA    1 
ATOM   2035 C  C     . ARG A 1 246 ? 23.330  52.801 53.426  1.00 46.42  ? 246  ARG A C     1 
ATOM   2036 O  O     . ARG A 1 246 ? 23.213  53.578 54.375  1.00 48.41  ? 246  ARG A O     1 
ATOM   2037 C  CB    . ARG A 1 246 ? 25.297  51.754 54.600  1.00 50.14  ? 246  ARG A CB    1 
ATOM   2038 C  CG    . ARG A 1 246 ? 26.194  50.538 54.830  1.00 54.86  ? 246  ARG A CG    1 
ATOM   2039 C  CD    . ARG A 1 246 ? 25.417  49.358 55.402  1.00 60.14  ? 246  ARG A CD    1 
ATOM   2040 N  NE    . ARG A 1 246 ? 26.266  48.195 55.653  1.00 64.88  ? 246  ARG A NE    1 
ATOM   2041 C  CZ    . ARG A 1 246 ? 26.473  47.212 54.780  1.00 65.97  ? 246  ARG A CZ    1 
ATOM   2042 N  NH1   . ARG A 1 246 ? 25.894  47.245 53.588  1.00 61.29  ? 246  ARG A NH1   1 
ATOM   2043 N  NH2   . ARG A 1 246 ? 27.262  46.194 55.100  1.00 70.23  ? 246  ARG A NH2   1 
ATOM   2044 N  N     . LYS A 1 247 ? 22.730  53.001 52.256  1.00 44.76  ? 247  LYS A N     1 
ATOM   2045 C  CA    . LYS A 1 247 ? 21.792  54.100 52.072  1.00 47.14  ? 247  LYS A CA    1 
ATOM   2046 C  C     . LYS A 1 247 ? 20.449  53.610 51.550  1.00 48.06  ? 247  LYS A C     1 
ATOM   2047 O  O     . LYS A 1 247 ? 20.376  52.882 50.562  1.00 47.14  ? 247  LYS A O     1 
ATOM   2048 C  CB    . LYS A 1 247 ? 22.352  55.176 51.141  1.00 49.44  ? 247  LYS A CB    1 
ATOM   2049 C  CG    . LYS A 1 247 ? 21.439  56.395 51.029  1.00 54.60  ? 247  LYS A CG    1 
ATOM   2050 C  CD    . LYS A 1 247 ? 22.138  57.577 50.377  1.00 58.61  ? 247  LYS A CD    1 
ATOM   2051 C  CE    . LYS A 1 247 ? 21.371  58.880 50.589  1.00 59.33  ? 247  LYS A CE    1 
ATOM   2052 N  NZ    . LYS A 1 247 ? 19.990  58.835 50.031  1.00 58.38  ? 247  LYS A NZ    1 
ATOM   2053 N  N     . THR A 1 248 ? 19.385  54.013 52.230  1.00 49.94  ? 248  THR A N     1 
ATOM   2054 C  CA    . THR A 1 248 ? 18.041  53.689 51.791  1.00 50.36  ? 248  THR A CA    1 
ATOM   2055 C  C     . THR A 1 248 ? 17.229  54.969 51.709  1.00 56.62  ? 248  THR A C     1 
ATOM   2056 O  O     . THR A 1 248 ? 17.622  55.997 52.259  1.00 61.52  ? 248  THR A O     1 
ATOM   2057 C  CB    . THR A 1 248 ? 17.352  52.708 52.752  1.00 48.42  ? 248  THR A CB    1 
ATOM   2058 O  OG1   . THR A 1 248 ? 17.122  53.348 54.013  1.00 51.67  ? 248  THR A OG1   1 
ATOM   2059 C  CG2   . THR A 1 248 ? 18.220  51.479 52.965  1.00 46.03  ? 248  THR A CG2   1 
ATOM   2060 N  N     . ARG A 1 249 ? 16.102  54.910 51.011  1.00 57.74  ? 249  ARG A N     1 
ATOM   2061 C  CA    . ARG A 1 249 ? 15.219  56.062 50.913  1.00 60.73  ? 249  ARG A CA    1 
ATOM   2062 C  C     . ARG A 1 249 ? 13.774  55.632 51.093  1.00 60.67  ? 249  ARG A C     1 
ATOM   2063 O  O     . ARG A 1 249 ? 13.261  54.818 50.327  1.00 60.24  ? 249  ARG A O     1 
ATOM   2064 C  CB    . ARG A 1 249 ? 15.389  56.768 49.569  1.00 62.68  ? 249  ARG A CB    1 
ATOM   2065 C  CG    . ARG A 1 249 ? 14.597  58.061 49.460  1.00 66.89  ? 249  ARG A CG    1 
ATOM   2066 C  CD    . ARG A 1 249 ? 14.669  58.636 48.060  1.00 72.21  ? 249  ARG A CD    1 
ATOM   2067 N  NE    . ARG A 1 249 ? 14.108  57.720 47.070  1.00 75.75  ? 249  ARG A NE    1 
ATOM   2068 C  CZ    . ARG A 1 249 ? 14.678  57.442 45.901  1.00 77.04  ? 249  ARG A CZ    1 
ATOM   2069 N  NH1   . ARG A 1 249 ? 15.831  58.011 45.572  1.00 79.32  ? 249  ARG A NH1   1 
ATOM   2070 N  NH2   . ARG A 1 249 ? 14.097  56.596 45.062  1.00 74.49  ? 249  ARG A NH2   1 
ATOM   2071 N  N     . VAL A 1 250 ? 13.121  56.178 52.110  1.00 61.68  ? 250  VAL A N     1 
ATOM   2072 C  CA    . VAL A 1 250 ? 11.725  55.859 52.358  1.00 62.81  ? 250  VAL A CA    1 
ATOM   2073 C  C     . VAL A 1 250 ? 10.815  56.858 51.655  1.00 69.34  ? 250  VAL A C     1 
ATOM   2074 O  O     . VAL A 1 250 ? 10.641  57.985 52.117  1.00 69.84  ? 250  VAL A O     1 
ATOM   2075 C  CB    . VAL A 1 250 ? 11.403  55.846 53.859  1.00 60.05  ? 250  VAL A CB    1 
ATOM   2076 C  CG1   . VAL A 1 250 ? 9.966   55.405 54.082  1.00 57.74  ? 250  VAL A CG1   1 
ATOM   2077 C  CG2   . VAL A 1 250 ? 12.368  54.933 54.602  1.00 58.02  ? 250  VAL A CG2   1 
ATOM   2078 N  N     . LYS A 1 251 ? 10.249  56.441 50.528  1.00 76.18  ? 251  LYS A N     1 
ATOM   2079 C  CA    . LYS A 1 251 ? 9.277   57.258 49.811  1.00 85.29  ? 251  LYS A CA    1 
ATOM   2080 C  C     . LYS A 1 251 ? 7.871   56.964 50.337  1.00 91.91  ? 251  LYS A C     1 
ATOM   2081 O  O     . LYS A 1 251 ? 7.390   55.832 50.236  1.00 92.81  ? 251  LYS A O     1 
ATOM   2082 C  CB    . LYS A 1 251 ? 9.355   56.984 48.308  1.00 83.65  ? 251  LYS A CB    1 
ATOM   2083 N  N     . VAL A 1 252 ? 7.216   57.981 50.894  1.00 93.57  ? 252  VAL A N     1 
ATOM   2084 C  CA    . VAL A 1 252 ? 5.916   57.796 51.543  1.00 90.62  ? 252  VAL A CA    1 
ATOM   2085 C  C     . VAL A 1 252 ? 4.736   58.355 50.744  1.00 90.84  ? 252  VAL A C     1 
ATOM   2086 O  O     . VAL A 1 252 ? 4.814   59.445 50.176  1.00 89.47  ? 252  VAL A O     1 
ATOM   2087 C  CB    . VAL A 1 252 ? 5.897   58.416 52.957  1.00 88.36  ? 252  VAL A CB    1 
ATOM   2088 N  N     . ILE A 1 253 ? 3.641   57.598 50.719  1.00 91.86  ? 253  ILE A N     1 
ATOM   2089 C  CA    . ILE A 1 253 ? 2.412   58.022 50.051  1.00 92.01  ? 253  ILE A CA    1 
ATOM   2090 C  C     . ILE A 1 253 ? 1.178   57.591 50.848  1.00 91.49  ? 253  ILE A C     1 
ATOM   2091 O  O     . ILE A 1 253 ? 0.497   56.633 50.483  1.00 91.74  ? 253  ILE A O     1 
ATOM   2092 C  CB    . ILE A 1 253 ? 2.317   57.453 48.620  1.00 89.33  ? 253  ILE A CB    1 
ATOM   2093 N  N     . GLU A 1 254 ? 0.896   58.312 51.931  1.00 89.52  ? 254  GLU A N     1 
ATOM   2094 C  CA    . GLU A 1 254 ? -0.200  57.977 52.840  1.00 86.12  ? 254  GLU A CA    1 
ATOM   2095 C  C     . GLU A 1 254 ? -1.572  58.051 52.172  1.00 84.53  ? 254  GLU A C     1 
ATOM   2096 O  O     . GLU A 1 254 ? -2.598  57.786 52.803  1.00 81.88  ? 254  GLU A O     1 
ATOM   2097 C  CB    . GLU A 1 254 ? -0.168  58.897 54.062  1.00 85.47  ? 254  GLU A CB    1 
ATOM   2098 C  CG    . GLU A 1 254 ? 1.179   58.947 54.761  1.00 82.91  ? 254  GLU A CG    1 
ATOM   2099 C  CD    . GLU A 1 254 ? 1.172   59.858 55.971  1.00 83.19  ? 254  GLU A CD    1 
ATOM   2100 N  N     . SER A 1 259 ? -0.733  54.872 55.841  1.00 97.07  ? 259  SER A N     1 
ATOM   2101 C  CA    . SER A 1 259 ? 0.519   55.292 55.222  1.00 97.17  ? 259  SER A CA    1 
ATOM   2102 C  C     . SER A 1 259 ? 1.099   54.189 54.344  1.00 98.22  ? 259  SER A C     1 
ATOM   2103 O  O     . SER A 1 259 ? 1.096   53.016 54.719  1.00 97.83  ? 259  SER A O     1 
ATOM   2104 C  CB    . SER A 1 259 ? 1.541   55.703 56.287  1.00 95.20  ? 259  SER A CB    1 
ATOM   2105 O  OG    . SER A 1 259 ? 2.008   54.578 57.014  1.00 92.11  ? 259  SER A OG    1 
ATOM   2106 N  N     . ARG A 1 260 ? 1.594   54.575 53.173  1.00 99.41  ? 260  ARG A N     1 
ATOM   2107 C  CA    . ARG A 1 260 ? 2.213   53.631 52.250  1.00 97.65  ? 260  ARG A CA    1 
ATOM   2108 C  C     . ARG A 1 260 ? 3.679   53.994 52.039  1.00 90.70  ? 260  ARG A C     1 
ATOM   2109 O  O     . ARG A 1 260 ? 4.031   55.172 51.976  1.00 90.36  ? 260  ARG A O     1 
ATOM   2110 C  CB    . ARG A 1 260 ? 1.469   53.624 50.913  1.00 102.31 ? 260  ARG A CB    1 
ATOM   2111 C  CG    . ARG A 1 260 ? -0.046  53.539 51.053  1.00 107.63 ? 260  ARG A CG    1 
ATOM   2112 C  CD    . ARG A 1 260 ? -0.471  52.267 51.770  1.00 109.99 ? 260  ARG A CD    1 
ATOM   2113 N  NE    . ARG A 1 260 ? -0.220  51.080 50.959  1.00 110.25 ? 260  ARG A NE    1 
ATOM   2114 C  CZ    . ARG A 1 260 ? -1.090  50.574 50.092  1.00 112.00 ? 260  ARG A CZ    1 
ATOM   2115 N  NH1   . ARG A 1 260 ? -2.273  51.151 49.927  1.00 114.59 ? 260  ARG A NH1   1 
ATOM   2116 N  NH2   . ARG A 1 260 ? -0.781  49.491 49.391  1.00 110.92 ? 260  ARG A NH2   1 
ATOM   2117 N  N     . GLU A 1 261 ? 4.532   52.980 51.935  1.00 84.65  ? 261  GLU A N     1 
ATOM   2118 C  CA    . GLU A 1 261 ? 5.969   53.201 51.813  1.00 79.31  ? 261  GLU A CA    1 
ATOM   2119 C  C     . GLU A 1 261 ? 6.611   52.308 50.758  1.00 75.85  ? 261  GLU A C     1 
ATOM   2120 O  O     . GLU A 1 261 ? 6.411   51.092 50.752  1.00 74.91  ? 261  GLU A O     1 
ATOM   2121 C  CB    . GLU A 1 261 ? 6.662   52.967 53.160  1.00 77.29  ? 261  GLU A CB    1 
ATOM   2122 C  CG    . GLU A 1 261 ? 6.392   54.034 54.213  1.00 77.24  ? 261  GLU A CG    1 
ATOM   2123 C  CD    . GLU A 1 261 ? 7.014   53.696 55.556  1.00 75.34  ? 261  GLU A CD    1 
ATOM   2124 O  OE1   . GLU A 1 261 ? 7.243   54.621 56.365  1.00 73.49  ? 261  GLU A OE1   1 
ATOM   2125 O  OE2   . GLU A 1 261 ? 7.271   52.500 55.803  1.00 75.42  ? 261  GLU A OE2   1 
ATOM   2126 N  N     . ILE A 1 262 ? 7.383   52.918 49.865  1.00 72.82  ? 262  ILE A N     1 
ATOM   2127 C  CA    . ILE A 1 262 ? 8.250   52.160 48.970  1.00 68.33  ? 262  ILE A CA    1 
ATOM   2128 C  C     . ILE A 1 262 ? 9.700   52.487 49.291  1.00 61.15  ? 262  ILE A C     1 
ATOM   2129 O  O     . ILE A 1 262 ? 10.174  53.595 49.043  1.00 62.64  ? 262  ILE A O     1 
ATOM   2130 C  CB    . ILE A 1 262 ? 7.974   52.449 47.483  1.00 69.68  ? 262  ILE A CB    1 
ATOM   2131 C  CG1   . ILE A 1 262 ? 6.566   51.987 47.104  1.00 71.30  ? 262  ILE A CG1   1 
ATOM   2132 C  CG2   . ILE A 1 262 ? 9.007   51.750 46.606  1.00 67.33  ? 262  ILE A CG2   1 
ATOM   2133 C  CD1   . ILE A 1 262 ? 6.343   50.498 47.266  1.00 71.07  ? 262  ILE A CD1   1 
ATOM   2134 N  N     . ILE A 1 263 ? 10.396  51.514 49.859  1.00 53.05  ? 263  ILE A N     1 
ATOM   2135 C  CA    . ILE A 1 263 ? 11.778  51.709 50.258  1.00 47.44  ? 263  ILE A CA    1 
ATOM   2136 C  C     . ILE A 1 263 ? 12.704  51.535 49.061  1.00 46.47  ? 263  ILE A C     1 
ATOM   2137 O  O     . ILE A 1 263 ? 12.588  50.571 48.306  1.00 48.90  ? 263  ILE A O     1 
ATOM   2138 C  CB    . ILE A 1 263 ? 12.178  50.754 51.405  1.00 42.59  ? 263  ILE A CB    1 
ATOM   2139 C  CG1   . ILE A 1 263 ? 11.676  51.291 52.748  1.00 43.75  ? 263  ILE A CG1   1 
ATOM   2140 C  CG2   . ILE A 1 263 ? 13.682  50.589 51.472  1.00 41.20  ? 263  ILE A CG2   1 
ATOM   2141 C  CD1   . ILE A 1 263 ? 10.196  51.100 52.990  1.00 43.80  ? 263  ILE A CD1   1 
ATOM   2142 N  N     . THR A 1 264 ? 13.606  52.491 48.879  1.00 43.22  ? 264  THR A N     1 
ATOM   2143 C  CA    . THR A 1 264 ? 14.604  52.399 47.829  1.00 38.40  ? 264  THR A CA    1 
ATOM   2144 C  C     . THR A 1 264 ? 15.938  51.959 48.421  1.00 36.15  ? 264  THR A C     1 
ATOM   2145 O  O     . THR A 1 264 ? 16.541  52.672 49.221  1.00 35.67  ? 264  THR A O     1 
ATOM   2146 C  CB    . THR A 1 264 ? 14.784  53.744 47.106  1.00 37.66  ? 264  THR A CB    1 
ATOM   2147 O  OG1   . THR A 1 264 ? 13.548  54.128 46.490  1.00 38.92  ? 264  THR A OG1   1 
ATOM   2148 C  CG2   . THR A 1 264 ? 15.869  53.636 46.046  1.00 36.91  ? 264  THR A CG2   1 
ATOM   2149 N  N     . LEU A 1 265 ? 16.387  50.773 48.032  1.00 33.09  ? 265  LEU A N     1 
ATOM   2150 C  CA    . LEU A 1 265 ? 17.669  50.256 48.480  1.00 31.99  ? 265  LEU A CA    1 
ATOM   2151 C  C     . LEU A 1 265 ? 18.738  50.615 47.466  1.00 36.53  ? 265  LEU A C     1 
ATOM   2152 O  O     . LEU A 1 265 ? 18.834  49.984 46.413  1.00 42.21  ? 265  LEU A O     1 
ATOM   2153 C  CB    . LEU A 1 265 ? 17.597  48.740 48.624  1.00 30.09  ? 265  LEU A CB    1 
ATOM   2154 C  CG    . LEU A 1 265 ? 16.502  48.207 49.544  1.00 28.97  ? 265  LEU A CG    1 
ATOM   2155 C  CD1   . LEU A 1 265 ? 16.425  46.696 49.439  1.00 27.49  ? 265  LEU A CD1   1 
ATOM   2156 C  CD2   . LEU A 1 265 ? 16.762  48.639 50.979  1.00 28.67  ? 265  LEU A CD2   1 
ATOM   2157 N  N     . PHE A 1 266 ? 19.535  51.632 47.774  1.00 34.59  ? 266  PHE A N     1 
ATOM   2158 C  CA    . PHE A 1 266 ? 20.607  52.043 46.879  1.00 33.99  ? 266  PHE A CA    1 
ATOM   2159 C  C     . PHE A 1 266 ? 21.607  50.909 46.699  1.00 33.50  ? 266  PHE A C     1 
ATOM   2160 O  O     . PHE A 1 266 ? 21.988  50.246 47.663  1.00 33.92  ? 266  PHE A O     1 
ATOM   2161 C  CB    . PHE A 1 266 ? 21.304  53.297 47.408  1.00 37.67  ? 266  PHE A CB    1 
ATOM   2162 C  CG    . PHE A 1 266 ? 20.499  54.555 47.241  1.00 41.24  ? 266  PHE A CG    1 
ATOM   2163 C  CD1   . PHE A 1 266 ? 19.472  54.861 48.119  1.00 43.17  ? 266  PHE A CD1   1 
ATOM   2164 C  CD2   . PHE A 1 266 ? 20.769  55.429 46.204  1.00 42.46  ? 266  PHE A CD2   1 
ATOM   2165 C  CE1   . PHE A 1 266 ? 18.732  56.015 47.965  1.00 44.65  ? 266  PHE A CE1   1 
ATOM   2166 C  CE2   . PHE A 1 266 ? 20.036  56.586 46.045  1.00 44.51  ? 266  PHE A CE2   1 
ATOM   2167 C  CZ    . PHE A 1 266 ? 19.015  56.879 46.926  1.00 46.41  ? 266  PHE A CZ    1 
ATOM   2168 N  N     . GLY A 1 267 ? 22.012  50.677 45.454  1.00 32.32  ? 267  GLY A N     1 
ATOM   2169 C  CA    . GLY A 1 267 ? 22.971  49.634 45.147  1.00 33.26  ? 267  GLY A CA    1 
ATOM   2170 C  C     . GLY A 1 267 ? 22.303  48.329 44.768  1.00 35.49  ? 267  GLY A C     1 
ATOM   2171 O  O     . GLY A 1 267 ? 22.972  47.342 44.458  1.00 37.00  ? 267  GLY A O     1 
ATOM   2172 N  N     . ILE A 1 268 ? 20.975  48.323 44.800  1.00 36.73  ? 268  ILE A N     1 
ATOM   2173 C  CA    . ILE A 1 268 ? 20.203  47.157 44.390  1.00 34.54  ? 268  ILE A CA    1 
ATOM   2174 C  C     . ILE A 1 268 ? 19.165  47.552 43.348  1.00 33.12  ? 268  ILE A C     1 
ATOM   2175 O  O     . ILE A 1 268 ? 18.500  48.579 43.481  1.00 34.73  ? 268  ILE A O     1 
ATOM   2176 C  CB    . ILE A 1 268 ? 19.501  46.496 45.592  1.00 33.72  ? 268  ILE A CB    1 
ATOM   2177 C  CG1   . ILE A 1 268 ? 20.537  46.015 46.608  1.00 36.01  ? 268  ILE A CG1   1 
ATOM   2178 C  CG2   . ILE A 1 268 ? 18.622  45.332 45.140  1.00 30.42  ? 268  ILE A CG2   1 
ATOM   2179 C  CD1   . ILE A 1 268 ? 19.942  45.261 47.770  1.00 38.31  ? 268  ILE A CD1   1 
ATOM   2180 N  N     . SER A 1 269 ? 19.044  46.740 42.303  1.00 31.32  ? 269  SER A N     1 
ATOM   2181 C  CA    . SER A 1 269 ? 18.043  46.957 41.271  1.00 30.56  ? 269  SER A CA    1 
ATOM   2182 C  C     . SER A 1 269 ? 16.855  46.032 41.488  1.00 28.98  ? 269  SER A C     1 
ATOM   2183 O  O     . SER A 1 269 ? 16.909  44.846 41.162  1.00 29.62  ? 269  SER A O     1 
ATOM   2184 C  CB    . SER A 1 269 ? 18.644  46.728 39.885  1.00 30.96  ? 269  SER A CB    1 
ATOM   2185 O  OG    . SER A 1 269 ? 19.628  47.705 39.599  1.00 31.63  ? 269  SER A OG    1 
ATOM   2186 N  N     . VAL A 1 270 ? 15.783  46.580 42.046  1.00 28.21  ? 270  VAL A N     1 
ATOM   2187 C  CA    . VAL A 1 270 ? 14.588  45.797 42.325  1.00 25.55  ? 270  VAL A CA    1 
ATOM   2188 C  C     . VAL A 1 270 ? 13.674  45.706 41.109  1.00 27.28  ? 270  VAL A C     1 
ATOM   2189 O  O     . VAL A 1 270 ? 13.175  46.715 40.615  1.00 30.79  ? 270  VAL A O     1 
ATOM   2190 C  CB    . VAL A 1 270 ? 13.791  46.378 43.508  1.00 22.49  ? 270  VAL A CB    1 
ATOM   2191 C  CG1   . VAL A 1 270 ? 12.493  45.609 43.704  1.00 21.50  ? 270  VAL A CG1   1 
ATOM   2192 C  CG2   . VAL A 1 270 ? 14.624  46.347 44.774  1.00 21.13  ? 270  VAL A CG2   1 
ATOM   2193 N  N     . LEU A 1 271 ? 13.462  44.484 40.635  1.00 29.26  ? 271  LEU A N     1 
ATOM   2194 C  CA    . LEU A 1 271 ? 12.529  44.222 39.548  1.00 27.67  ? 271  LEU A CA    1 
ATOM   2195 C  C     . LEU A 1 271 ? 11.423  43.312 40.048  1.00 26.37  ? 271  LEU A C     1 
ATOM   2196 O  O     . LEU A 1 271 ? 11.450  42.108 39.787  1.00 25.94  ? 271  LEU A O     1 
ATOM   2197 C  CB    . LEU A 1 271 ? 13.242  43.546 38.379  1.00 27.90  ? 271  LEU A CB    1 
ATOM   2198 C  CG    . LEU A 1 271 ? 14.405  44.314 37.752  1.00 30.67  ? 271  LEU A CG    1 
ATOM   2199 C  CD1   . LEU A 1 271 ? 15.153  43.431 36.770  1.00 31.73  ? 271  LEU A CD1   1 
ATOM   2200 C  CD2   . LEU A 1 271 ? 13.894  45.561 37.064  1.00 32.74  ? 271  LEU A CD2   1 
ATOM   2201 N  N     . ASP A 1 272 ? 10.473  43.886 40.784  1.00 25.10  ? 272  ASP A N     1 
ATOM   2202 C  CA    . ASP A 1 272 ? 9.312   43.151 41.269  1.00 25.12  ? 272  ASP A CA    1 
ATOM   2203 C  C     . ASP A 1 272 ? 8.671   42.435 40.085  1.00 23.57  ? 272  ASP A C     1 
ATOM   2204 O  O     . ASP A 1 272 ? 8.367   43.061 39.069  1.00 25.00  ? 272  ASP A O     1 
ATOM   2205 C  CB    . ASP A 1 272 ? 8.318   44.122 41.903  1.00 26.77  ? 272  ASP A CB    1 
ATOM   2206 C  CG    . ASP A 1 272 ? 7.250   43.423 42.719  1.00 30.44  ? 272  ASP A CG    1 
ATOM   2207 O  OD1   . ASP A 1 272 ? 6.985   42.225 42.473  1.00 30.00  ? 272  ASP A OD1   1 
ATOM   2208 O  OD2   . ASP A 1 272 ? 6.671   44.085 43.606  1.00 33.50  ? 272  ASP A OD2   1 
ATOM   2209 N  N     . TYR A 1 273 ? 8.491   41.124 40.193  1.00 19.83  ? 273  TYR A N     1 
ATOM   2210 C  CA    . TYR A 1 273 ? 8.031   40.372 39.031  1.00 21.22  ? 273  TYR A CA    1 
ATOM   2211 C  C     . TYR A 1 273 ? 6.589   40.692 38.642  1.00 23.69  ? 273  TYR A C     1 
ATOM   2212 O  O     . TYR A 1 273 ? 6.213   40.548 37.478  1.00 26.23  ? 273  TYR A O     1 
ATOM   2213 C  CB    . TYR A 1 273 ? 8.246   38.859 39.177  1.00 19.07  ? 273  TYR A CB    1 
ATOM   2214 C  CG    . TYR A 1 273 ? 8.593   38.222 37.849  1.00 21.86  ? 273  TYR A CG    1 
ATOM   2215 C  CD1   . TYR A 1 273 ? 7.599   37.814 36.967  1.00 19.71  ? 273  TYR A CD1   1 
ATOM   2216 C  CD2   . TYR A 1 273 ? 9.917   38.068 37.457  1.00 25.49  ? 273  TYR A CD2   1 
ATOM   2217 C  CE1   . TYR A 1 273 ? 7.915   37.252 35.742  1.00 20.35  ? 273  TYR A CE1   1 
ATOM   2218 C  CE2   . TYR A 1 273 ? 10.243  37.506 36.235  1.00 25.24  ? 273  TYR A CE2   1 
ATOM   2219 C  CZ    . TYR A 1 273 ? 9.237   37.101 35.383  1.00 24.46  ? 273  TYR A CZ    1 
ATOM   2220 O  OH    . TYR A 1 273 ? 9.560   36.546 34.168  1.00 27.28  ? 273  TYR A OH    1 
ATOM   2221 N  N     . ILE A 1 274 ? 5.788   41.140 39.603  1.00 22.96  ? 274  ILE A N     1 
ATOM   2222 C  CA    . ILE A 1 274 ? 4.419   41.532 39.292  1.00 20.69  ? 274  ILE A CA    1 
ATOM   2223 C  C     . ILE A 1 274 ? 4.419   42.742 38.357  1.00 21.58  ? 274  ILE A C     1 
ATOM   2224 O  O     . ILE A 1 274 ? 3.570   42.852 37.477  1.00 24.32  ? 274  ILE A O     1 
ATOM   2225 C  CB    . ILE A 1 274 ? 3.570   41.787 40.567  1.00 27.67  ? 274  ILE A CB    1 
ATOM   2226 C  CG1   . ILE A 1 274 ? 2.095   41.995 40.204  1.00 30.17  ? 274  ILE A CG1   1 
ATOM   2227 C  CG2   . ILE A 1 274 ? 4.108   42.965 41.364  1.00 26.94  ? 274  ILE A CG2   1 
ATOM   2228 C  CD1   . ILE A 1 274 ? 1.164   41.989 41.407  1.00 33.79  ? 274  ILE A CD1   1 
ATOM   2229 N  N     . ASP A 1 275 ? 5.399   43.628 38.528  1.00 22.32  ? 275  ASP A N     1 
ATOM   2230 C  CA    . ASP A 1 275 ? 5.548   44.800 37.669  1.00 23.20  ? 275  ASP A CA    1 
ATOM   2231 C  C     . ASP A 1 275 ? 6.095   44.412 36.297  1.00 23.86  ? 275  ASP A C     1 
ATOM   2232 O  O     . ASP A 1 275 ? 5.665   44.952 35.276  1.00 23.85  ? 275  ASP A O     1 
ATOM   2233 C  CB    . ASP A 1 275 ? 6.470   45.831 38.320  1.00 25.84  ? 275  ASP A CB    1 
ATOM   2234 C  CG    . ASP A 1 275 ? 5.896   46.398 39.598  1.00 32.94  ? 275  ASP A CG    1 
ATOM   2235 O  OD1   . ASP A 1 275 ? 4.654   46.420 39.725  1.00 32.50  ? 275  ASP A OD1   1 
ATOM   2236 O  OD2   . ASP A 1 275 ? 6.683   46.825 40.475  1.00 39.18  ? 275  ASP A OD2   1 
ATOM   2237 N  N     . LEU A 1 276 ? 7.057   43.492 36.282  1.00 23.05  ? 276  LEU A N     1 
ATOM   2238 C  CA    . LEU A 1 276 ? 7.583   42.964 35.028  1.00 23.08  ? 276  LEU A CA    1 
ATOM   2239 C  C     . LEU A 1 276 ? 6.464   42.295 34.252  1.00 23.62  ? 276  LEU A C     1 
ATOM   2240 O  O     . LEU A 1 276 ? 6.337   42.466 33.039  1.00 28.50  ? 276  LEU A O     1 
ATOM   2241 C  CB    . LEU A 1 276 ? 8.695   41.945 35.282  1.00 21.56  ? 276  LEU A CB    1 
ATOM   2242 C  CG    . LEU A 1 276 ? 10.051  42.453 35.759  1.00 20.51  ? 276  LEU A CG    1 
ATOM   2243 C  CD1   . LEU A 1 276 ? 10.986  41.274 35.937  1.00 19.64  ? 276  LEU A CD1   1 
ATOM   2244 C  CD2   . LEU A 1 276 ? 10.618  43.447 34.765  1.00 18.66  ? 276  LEU A CD2   1 
ATOM   2245 N  N     . TYR A 1 277 ? 5.645   41.534 34.967  1.00 21.25  ? 277  TYR A N     1 
ATOM   2246 C  CA    . TYR A 1 277 ? 4.556   40.802 34.344  1.00 22.63  ? 277  TYR A CA    1 
ATOM   2247 C  C     . TYR A 1 277 ? 3.522   41.761 33.763  1.00 23.64  ? 277  TYR A C     1 
ATOM   2248 O  O     . TYR A 1 277 ? 3.121   41.622 32.611  1.00 24.13  ? 277  TYR A O     1 
ATOM   2249 C  CB    . TYR A 1 277 ? 3.912   39.850 35.352  1.00 20.76  ? 277  TYR A CB    1 
ATOM   2250 C  CG    . TYR A 1 277 ? 2.880   38.913 34.764  1.00 21.83  ? 277  TYR A CG    1 
ATOM   2251 C  CD1   . TYR A 1 277 ? 3.230   37.635 34.350  1.00 19.17  ? 277  TYR A CD1   1 
ATOM   2252 C  CD2   . TYR A 1 277 ? 1.550   39.300 34.639  1.00 21.37  ? 277  TYR A CD2   1 
ATOM   2253 C  CE1   . TYR A 1 277 ? 2.287   36.772 33.822  1.00 30.21  ? 277  TYR A CE1   1 
ATOM   2254 C  CE2   . TYR A 1 277 ? 0.600   38.443 34.111  1.00 23.90  ? 277  TYR A CE2   1 
ATOM   2255 C  CZ    . TYR A 1 277 ? 0.974   37.181 33.706  1.00 20.23  ? 277  TYR A CZ    1 
ATOM   2256 O  OH    . TYR A 1 277 ? 0.033   36.329 33.181  1.00 24.87  ? 277  TYR A OH    1 
ATOM   2257 N  N     . LYS A 1 278 ? 3.101   42.743 34.554  1.00 24.92  ? 278  LYS A N     1 
ATOM   2258 C  CA    . LYS A 1 278 ? 2.075   43.682 34.105  1.00 25.35  ? 278  LYS A CA    1 
ATOM   2259 C  C     . LYS A 1 278 ? 2.511   44.509 32.894  1.00 27.13  ? 278  LYS A C     1 
ATOM   2260 O  O     . LYS A 1 278 ? 1.682   44.891 32.066  1.00 32.49  ? 278  LYS A O     1 
ATOM   2261 C  CB    . LYS A 1 278 ? 1.614   44.586 35.255  1.00 23.20  ? 278  LYS A CB    1 
ATOM   2262 C  CG    . LYS A 1 278 ? 0.752   43.862 36.283  1.00 22.86  ? 278  LYS A CG    1 
ATOM   2263 C  CD    . LYS A 1 278 ? 0.273   44.778 37.400  1.00 22.71  ? 278  LYS A CD    1 
ATOM   2264 C  CE    . LYS A 1 278 ? -0.677  44.038 38.328  1.00 23.61  ? 278  LYS A CE    1 
ATOM   2265 N  NZ    . LYS A 1 278 ? -1.211  44.908 39.409  1.00 27.70  ? 278  LYS A NZ    1 
ATOM   2266 N  N     . LYS A 1 279 ? 3.813   44.758 32.780  1.00 24.18  ? 279  LYS A N     1 
ATOM   2267 C  CA    . LYS A 1 279 ? 4.333   45.579 31.692  1.00 26.78  ? 279  LYS A CA    1 
ATOM   2268 C  C     . LYS A 1 279 ? 4.679   44.780 30.433  1.00 27.94  ? 279  LYS A C     1 
ATOM   2269 O  O     . LYS A 1 279 ? 4.503   45.274 29.318  1.00 31.65  ? 279  LYS A O     1 
ATOM   2270 C  CB    . LYS A 1 279 ? 5.555   46.382 32.153  1.00 28.21  ? 279  LYS A CB    1 
ATOM   2271 C  CG    . LYS A 1 279 ? 5.993   47.455 31.163  1.00 32.84  ? 279  LYS A CG    1 
ATOM   2272 C  CD    . LYS A 1 279 ? 7.289   48.123 31.595  1.00 38.71  ? 279  LYS A CD    1 
ATOM   2273 C  CE    . LYS A 1 279 ? 7.747   49.164 30.579  1.00 42.35  ? 279  LYS A CE    1 
ATOM   2274 N  NZ    . LYS A 1 279 ? 6.794   50.308 30.494  1.00 45.90  ? 279  LYS A NZ    1 
ATOM   2275 N  N     . PHE A 1 280 ? 5.152   43.548 30.608  1.00 23.76  ? 280  PHE A N     1 
ATOM   2276 C  CA    . PHE A 1 280 ? 5.727   42.791 29.496  1.00 20.50  ? 280  PHE A CA    1 
ATOM   2277 C  C     . PHE A 1 280 ? 4.939   41.553 29.054  1.00 25.97  ? 280  PHE A C     1 
ATOM   2278 O  O     . PHE A 1 280 ? 5.255   40.960 28.021  1.00 25.74  ? 280  PHE A O     1 
ATOM   2279 C  CB    . PHE A 1 280 ? 7.168   42.384 29.824  1.00 21.16  ? 280  PHE A CB    1 
ATOM   2280 C  CG    . PHE A 1 280 ? 8.087   43.545 30.094  1.00 25.12  ? 280  PHE A CG    1 
ATOM   2281 C  CD1   . PHE A 1 280 ? 9.059   43.459 31.076  1.00 28.89  ? 280  PHE A CD1   1 
ATOM   2282 C  CD2   . PHE A 1 280 ? 7.985   44.715 29.364  1.00 28.54  ? 280  PHE A CD2   1 
ATOM   2283 C  CE1   . PHE A 1 280 ? 9.906   44.519 31.330  1.00 31.51  ? 280  PHE A CE1   1 
ATOM   2284 C  CE2   . PHE A 1 280 ? 8.831   45.779 29.609  1.00 31.06  ? 280  PHE A CE2   1 
ATOM   2285 C  CZ    . PHE A 1 280 ? 9.792   45.682 30.596  1.00 32.50  ? 280  PHE A CZ    1 
ATOM   2286 N  N     . SER A 1 281 ? 3.927   41.156 29.822  1.00 25.12  ? 281  SER A N     1 
ATOM   2287 C  CA    . SER A 1 281 ? 3.189   39.926 29.512  1.00 24.69  ? 281  SER A CA    1 
ATOM   2288 C  C     . SER A 1 281 ? 2.063   40.147 28.510  1.00 28.63  ? 281  SER A C     1 
ATOM   2289 O  O     . SER A 1 281 ? 1.622   39.208 27.849  1.00 32.52  ? 281  SER A O     1 
ATOM   2290 C  CB    . SER A 1 281 ? 2.616   39.293 30.778  1.00 22.81  ? 281  SER A CB    1 
ATOM   2291 O  OG    . SER A 1 281 ? 1.511   40.040 31.252  1.00 23.42  ? 281  SER A OG    1 
ATOM   2292 N  N     . PHE A 1 282 ? 1.600   41.390 28.410  1.00 31.93  ? 282  PHE A N     1 
ATOM   2293 C  CA    . PHE A 1 282 ? 0.497   41.744 27.520  1.00 28.24  ? 282  PHE A CA    1 
ATOM   2294 C  C     . PHE A 1 282 ? -0.739  40.901 27.801  1.00 28.82  ? 282  PHE A C     1 
ATOM   2295 O  O     . PHE A 1 282 ? -1.371  40.356 26.896  1.00 31.70  ? 282  PHE A O     1 
ATOM   2296 C  CB    . PHE A 1 282 ? 0.926   41.654 26.060  1.00 24.90  ? 282  PHE A CB    1 
ATOM   2297 C  CG    . PHE A 1 282 ? 1.910   42.709 25.672  1.00 26.26  ? 282  PHE A CG    1 
ATOM   2298 C  CD1   . PHE A 1 282 ? 1.481   43.896 25.100  1.00 26.92  ? 282  PHE A CD1   1 
ATOM   2299 C  CD2   . PHE A 1 282 ? 3.264   42.533 25.910  1.00 25.51  ? 282  PHE A CD2   1 
ATOM   2300 C  CE1   . PHE A 1 282 ? 2.385   44.880 24.753  1.00 28.79  ? 282  PHE A CE1   1 
ATOM   2301 C  CE2   . PHE A 1 282 ? 4.174   43.514 25.565  1.00 27.87  ? 282  PHE A CE2   1 
ATOM   2302 C  CZ    . PHE A 1 282 ? 3.734   44.689 24.985  1.00 29.40  ? 282  PHE A CZ    1 
ATOM   2303 N  N     . THR A 1 283 ? -1.055  40.798 29.084  1.00 27.10  ? 283  THR A N     1 
ATOM   2304 C  CA    . THR A 1 283 ? -2.262  40.152 29.547  1.00 27.01  ? 283  THR A CA    1 
ATOM   2305 C  C     . THR A 1 283 ? -2.980  41.145 30.431  1.00 27.87  ? 283  THR A C     1 
ATOM   2306 O  O     . THR A 1 283 ? -2.385  42.116 30.894  1.00 30.69  ? 283  THR A O     1 
ATOM   2307 C  CB    . THR A 1 283 ? -1.939  38.940 30.420  1.00 28.60  ? 283  THR A CB    1 
ATOM   2308 O  OG1   . THR A 1 283 ? -1.251  39.380 31.600  1.00 29.78  ? 283  THR A OG1   1 
ATOM   2309 C  CG2   . THR A 1 283 ? -1.068  37.950 29.661  1.00 28.22  ? 283  THR A CG2   1 
ATOM   2310 N  N     . ASN A 1 284 ? -4.263  40.908 30.657  1.00 27.82  ? 284  ASN A N     1 
ATOM   2311 C  CA    . ASN A 1 284 ? -4.992  41.628 31.686  1.00 29.17  ? 284  ASN A CA    1 
ATOM   2312 C  C     . ASN A 1 284 ? -5.716  40.592 32.524  1.00 31.10  ? 284  ASN A C     1 
ATOM   2313 O  O     . ASN A 1 284 ? -6.679  39.975 32.068  1.00 33.80  ? 284  ASN A O     1 
ATOM   2314 C  CB    . ASN A 1 284 ? -5.978  42.623 31.081  1.00 31.34  ? 284  ASN A CB    1 
ATOM   2315 C  CG    . ASN A 1 284 ? -6.424  43.675 32.078  1.00 31.96  ? 284  ASN A CG    1 
ATOM   2316 O  OD1   . ASN A 1 284 ? -6.108  43.598 33.266  1.00 30.49  ? 284  ASN A OD1   1 
ATOM   2317 N  ND2   . ASN A 1 284 ? -7.169  44.664 31.598  1.00 32.39  ? 284  ASN A ND2   1 
ATOM   2318 N  N     . GLN A 1 285 ? -5.230  40.380 33.741  1.00 26.88  ? 285  GLN A N     1 
ATOM   2319 C  CA    . GLN A 1 285 ? -5.711  39.276 34.551  1.00 25.75  ? 285  GLN A CA    1 
ATOM   2320 C  C     . GLN A 1 285 ? -6.786  39.717 35.536  1.00 28.98  ? 285  GLN A C     1 
ATOM   2321 O  O     . GLN A 1 285 ? -6.733  40.825 36.064  1.00 31.79  ? 285  GLN A O     1 
ATOM   2322 C  CB    . GLN A 1 285 ? -4.543  38.613 35.284  1.00 25.72  ? 285  GLN A CB    1 
ATOM   2323 C  CG    . GLN A 1 285 ? -3.424  38.131 34.371  1.00 27.13  ? 285  GLN A CG    1 
ATOM   2324 C  CD    . GLN A 1 285 ? -3.794  36.891 33.576  1.00 28.99  ? 285  GLN A CD    1 
ATOM   2325 O  OE1   . GLN A 1 285 ? -4.928  36.415 33.630  1.00 32.80  ? 285  GLN A OE1   1 
ATOM   2326 N  NE2   . GLN A 1 285 ? -2.830  36.358 32.835  1.00 26.13  ? 285  GLN A NE2   1 
ATOM   2327 N  N     . PRO A 1 286 ? -7.777  38.845 35.778  1.00 29.94  ? 286  PRO A N     1 
ATOM   2328 C  CA    . PRO A 1 286 ? -8.830  39.127 36.758  1.00 29.34  ? 286  PRO A CA    1 
ATOM   2329 C  C     . PRO A 1 286 ? -8.248  39.193 38.170  1.00 28.32  ? 286  PRO A C     1 
ATOM   2330 O  O     . PRO A 1 286 ? -8.817  39.838 39.047  1.00 28.80  ? 286  PRO A O     1 
ATOM   2331 C  CB    . PRO A 1 286 ? -9.767  37.921 36.623  1.00 29.69  ? 286  PRO A CB    1 
ATOM   2332 C  CG    . PRO A 1 286 ? -9.441  37.315 35.302  1.00 27.92  ? 286  PRO A CG    1 
ATOM   2333 C  CD    . PRO A 1 286 ? -7.985  37.553 35.107  1.00 26.40  ? 286  PRO A CD    1 
ATOM   2334 N  N     . SER A 1 287 ? -7.113  38.530 38.375  1.00 26.00  ? 287  SER A N     1 
ATOM   2335 C  CA    . SER A 1 287 ? -6.423  38.551 39.659  1.00 25.63  ? 287  SER A CA    1 
ATOM   2336 C  C     . SER A 1 287 ? -4.918  38.493 39.462  1.00 27.96  ? 287  SER A C     1 
ATOM   2337 O  O     . SER A 1 287 ? -4.437  37.930 38.482  1.00 29.31  ? 287  SER A O     1 
ATOM   2338 C  CB    . SER A 1 287 ? -6.860  37.368 40.521  1.00 26.17  ? 287  SER A CB    1 
ATOM   2339 O  OG    . SER A 1 287 ? -6.048  37.261 41.677  1.00 29.06  ? 287  SER A OG    1 
ATOM   2340 N  N     . TYR A 1 288 ? -4.173  39.066 40.400  1.00 24.00  ? 288  TYR A N     1 
ATOM   2341 C  CA    . TYR A 1 288 ? -2.717  39.029 40.329  1.00 22.94  ? 288  TYR A CA    1 
ATOM   2342 C  C     . TYR A 1 288 ? -2.074  38.380 41.548  1.00 26.84  ? 288  TYR A C     1 
ATOM   2343 O  O     . TYR A 1 288 ? -0.939  38.691 41.903  1.00 28.04  ? 288  TYR A O     1 
ATOM   2344 C  CB    . TYR A 1 288 ? -2.139  40.420 40.072  1.00 22.66  ? 288  TYR A CB    1 
ATOM   2345 C  CG    . TYR A 1 288 ? -2.359  40.876 38.650  1.00 23.74  ? 288  TYR A CG    1 
ATOM   2346 C  CD1   . TYR A 1 288 ? -3.434  41.689 38.320  1.00 24.12  ? 288  TYR A CD1   1 
ATOM   2347 C  CD2   . TYR A 1 288 ? -1.506  40.467 37.631  1.00 22.51  ? 288  TYR A CD2   1 
ATOM   2348 C  CE1   . TYR A 1 288 ? -3.645  42.097 37.019  1.00 25.35  ? 288  TYR A CE1   1 
ATOM   2349 C  CE2   . TYR A 1 288 ? -1.710  40.871 36.328  1.00 23.50  ? 288  TYR A CE2   1 
ATOM   2350 C  CZ    . TYR A 1 288 ? -2.780  41.685 36.028  1.00 25.44  ? 288  TYR A CZ    1 
ATOM   2351 O  OH    . TYR A 1 288 ? -2.987  42.088 34.728  1.00 27.55  ? 288  TYR A OH    1 
ATOM   2352 N  N     . SER A 1 289 ? -2.806  37.474 42.185  1.00 25.72  ? 289  SER A N     1 
ATOM   2353 C  CA    . SER A 1 289 ? -2.208  36.633 43.205  1.00 28.04  ? 289  SER A CA    1 
ATOM   2354 C  C     . SER A 1 289 ? -1.266  35.680 42.491  1.00 31.58  ? 289  SER A C     1 
ATOM   2355 O  O     . SER A 1 289 ? -1.530  35.277 41.356  1.00 31.56  ? 289  SER A O     1 
ATOM   2356 C  CB    . SER A 1 289 ? -3.271  35.841 43.962  1.00 28.22  ? 289  SER A CB    1 
ATOM   2357 O  OG    . SER A 1 289 ? -3.768  34.767 43.179  1.00 30.48  ? 289  SER A OG    1 
ATOM   2358 N  N     . LEU A 1 290 ? -0.166  35.329 43.152  1.00 32.13  ? 290  LEU A N     1 
ATOM   2359 C  CA    . LEU A 1 290 ? 0.814   34.410 42.580  1.00 28.18  ? 290  LEU A CA    1 
ATOM   2360 C  C     . LEU A 1 290 ? 0.157   33.076 42.251  1.00 30.75  ? 290  LEU A C     1 
ATOM   2361 O  O     . LEU A 1 290 ? 0.512   32.420 41.274  1.00 30.85  ? 290  LEU A O     1 
ATOM   2362 C  CB    . LEU A 1 290 ? 1.976   34.206 43.550  1.00 22.63  ? 290  LEU A CB    1 
ATOM   2363 C  CG    . LEU A 1 290 ? 3.107   33.294 43.079  1.00 22.36  ? 290  LEU A CG    1 
ATOM   2364 C  CD1   . LEU A 1 290 ? 3.632   33.751 41.730  1.00 20.84  ? 290  LEU A CD1   1 
ATOM   2365 C  CD2   . LEU A 1 290 ? 4.218   33.283 44.110  1.00 21.68  ? 290  LEU A CD2   1 
ATOM   2366 N  N     . ASP A 1 291 ? -0.812  32.697 43.076  1.00 34.38  ? 291  ASP A N     1 
ATOM   2367 C  CA    . ASP A 1 291 ? -1.578  31.479 42.880  1.00 36.66  ? 291  ASP A CA    1 
ATOM   2368 C  C     . ASP A 1 291 ? -2.238  31.500 41.509  1.00 33.06  ? 291  ASP A C     1 
ATOM   2369 O  O     . ASP A 1 291 ? -2.044  30.595 40.695  1.00 32.65  ? 291  ASP A O     1 
ATOM   2370 C  CB    . ASP A 1 291 ? -2.652  31.377 43.960  1.00 43.89  ? 291  ASP A CB    1 
ATOM   2371 C  CG    . ASP A 1 291 ? -2.956  29.949 44.348  1.00 51.97  ? 291  ASP A CG    1 
ATOM   2372 O  OD1   . ASP A 1 291 ? -3.610  29.753 45.394  1.00 55.82  ? 291  ASP A OD1   1 
ATOM   2373 O  OD2   . ASP A 1 291 ? -2.534  29.026 43.619  1.00 56.06  ? 291  ASP A OD2   1 
ATOM   2374 N  N     . TYR A 1 292 ? -3.006  32.554 41.259  1.00 29.94  ? 292  TYR A N     1 
ATOM   2375 C  CA    . TYR A 1 292 ? -3.752  32.697 40.017  1.00 30.05  ? 292  TYR A CA    1 
ATOM   2376 C  C     . TYR A 1 292 ? -2.845  32.761 38.789  1.00 28.91  ? 292  TYR A C     1 
ATOM   2377 O  O     . TYR A 1 292 ? -3.124  32.127 37.773  1.00 28.79  ? 292  TYR A O     1 
ATOM   2378 C  CB    . TYR A 1 292 ? -4.634  33.947 40.074  1.00 29.85  ? 292  TYR A CB    1 
ATOM   2379 C  CG    . TYR A 1 292 ? -5.635  34.030 38.950  1.00 30.80  ? 292  TYR A CG    1 
ATOM   2380 C  CD1   . TYR A 1 292 ? -5.302  34.619 37.736  1.00 31.61  ? 292  TYR A CD1   1 
ATOM   2381 C  CD2   . TYR A 1 292 ? -6.915  33.517 39.100  1.00 32.29  ? 292  TYR A CD2   1 
ATOM   2382 C  CE1   . TYR A 1 292 ? -6.216  34.691 36.704  1.00 34.26  ? 292  TYR A CE1   1 
ATOM   2383 C  CE2   . TYR A 1 292 ? -7.837  33.587 38.075  1.00 33.88  ? 292  TYR A CE2   1 
ATOM   2384 C  CZ    . TYR A 1 292 ? -7.484  34.175 36.880  1.00 36.75  ? 292  TYR A CZ    1 
ATOM   2385 O  OH    . TYR A 1 292 ? -8.401  34.246 35.858  1.00 42.06  ? 292  TYR A OH    1 
ATOM   2386 N  N     . ILE A 1 293 ? -1.767  33.532 38.883  1.00 28.64  ? 293  ILE A N     1 
ATOM   2387 C  CA    . ILE A 1 293 ? -0.855  33.703 37.757  1.00 28.24  ? 293  ILE A CA    1 
ATOM   2388 C  C     . ILE A 1 293 ? -0.100  32.410 37.434  1.00 30.35  ? 293  ILE A C     1 
ATOM   2389 O  O     . ILE A 1 293 ? 0.074   32.059 36.264  1.00 30.85  ? 293  ILE A O     1 
ATOM   2390 C  CB    . ILE A 1 293 ? 0.137   34.855 38.004  1.00 25.91  ? 293  ILE A CB    1 
ATOM   2391 C  CG1   . ILE A 1 293 ? -0.623  36.154 38.275  1.00 27.97  ? 293  ILE A CG1   1 
ATOM   2392 C  CG2   . ILE A 1 293 ? 1.057   35.037 36.811  1.00 25.03  ? 293  ILE A CG2   1 
ATOM   2393 C  CD1   . ILE A 1 293 ? -1.513  36.589 37.128  1.00 21.68  ? 293  ILE A CD1   1 
ATOM   2394 N  N     . SER A 1 294 ? 0.334   31.702 38.474  1.00 27.51  ? 294  SER A N     1 
ATOM   2395 C  CA    . SER A 1 294 ? 1.010   30.419 38.303  1.00 25.72  ? 294  SER A CA    1 
ATOM   2396 C  C     . SER A 1 294 ? 0.117   29.418 37.589  1.00 28.06  ? 294  SER A C     1 
ATOM   2397 O  O     . SER A 1 294 ? 0.557   28.723 36.675  1.00 31.02  ? 294  SER A O     1 
ATOM   2398 C  CB    . SER A 1 294 ? 1.425   29.841 39.654  1.00 26.46  ? 294  SER A CB    1 
ATOM   2399 O  OG    . SER A 1 294 ? 2.397   30.651 40.282  1.00 29.39  ? 294  SER A OG    1 
ATOM   2400 N  N     . GLU A 1 295 ? -1.136  29.340 38.020  1.00 30.77  ? 295  GLU A N     1 
ATOM   2401 C  CA    . GLU A 1 295 ? -2.096  28.449 37.390  1.00 35.03  ? 295  GLU A CA    1 
ATOM   2402 C  C     . GLU A 1 295 ? -2.229  28.827 35.916  1.00 30.63  ? 295  GLU A C     1 
ATOM   2403 O  O     . GLU A 1 295 ? -2.298  27.963 35.047  1.00 31.63  ? 295  GLU A O     1 
ATOM   2404 C  CB    . GLU A 1 295 ? -3.450  28.543 38.098  1.00 43.42  ? 295  GLU A CB    1 
ATOM   2405 C  CG    . GLU A 1 295 ? -4.329  27.306 37.959  1.00 53.84  ? 295  GLU A CG    1 
ATOM   2406 C  CD    . GLU A 1 295 ? -4.891  27.124 36.559  1.00 63.64  ? 295  GLU A CD    1 
ATOM   2407 O  OE1   . GLU A 1 295 ? -5.453  28.099 36.016  1.00 66.35  ? 295  GLU A OE1   1 
ATOM   2408 O  OE2   . GLU A 1 295 ? -4.768  26.012 35.997  1.00 67.40  ? 295  GLU A OE2   1 
ATOM   2409 N  N     . PHE A 1 296 ? -2.242  30.126 35.642  1.00 25.98  ? 296  PHE A N     1 
ATOM   2410 C  CA    . PHE A 1 296 ? -2.387  30.617 34.279  1.00 26.91  ? 296  PHE A CA    1 
ATOM   2411 C  C     . PHE A 1 296 ? -1.138  30.374 33.426  1.00 27.68  ? 296  PHE A C     1 
ATOM   2412 O  O     . PHE A 1 296 ? -1.237  29.979 32.263  1.00 27.89  ? 296  PHE A O     1 
ATOM   2413 C  CB    . PHE A 1 296 ? -2.735  32.108 34.284  1.00 26.15  ? 296  PHE A CB    1 
ATOM   2414 C  CG    . PHE A 1 296 ? -2.952  32.683 32.910  1.00 28.48  ? 296  PHE A CG    1 
ATOM   2415 C  CD1   . PHE A 1 296 ? -4.193  32.598 32.297  1.00 28.04  ? 296  PHE A CD1   1 
ATOM   2416 C  CD2   . PHE A 1 296 ? -1.916  33.307 32.229  1.00 28.12  ? 296  PHE A CD2   1 
ATOM   2417 C  CE1   . PHE A 1 296 ? -4.399  33.125 31.027  1.00 24.67  ? 296  PHE A CE1   1 
ATOM   2418 C  CE2   . PHE A 1 296 ? -2.116  33.835 30.959  1.00 27.48  ? 296  PHE A CE2   1 
ATOM   2419 C  CZ    . PHE A 1 296 ? -3.360  33.743 30.359  1.00 23.86  ? 296  PHE A CZ    1 
ATOM   2420 N  N     . GLU A 1 297 ? 0.035   30.617 34.003  1.00 26.07  ? 297  GLU A N     1 
ATOM   2421 C  CA    . GLU A 1 297 ? 1.286   30.529 33.249  1.00 25.94  ? 297  GLU A CA    1 
ATOM   2422 C  C     . GLU A 1 297 ? 1.830   29.107 33.138  1.00 29.35  ? 297  GLU A C     1 
ATOM   2423 O  O     . GLU A 1 297 ? 2.415   28.734 32.118  1.00 31.66  ? 297  GLU A O     1 
ATOM   2424 C  CB    . GLU A 1 297 ? 2.353   31.440 33.869  1.00 25.94  ? 297  GLU A CB    1 
ATOM   2425 C  CG    . GLU A 1 297 ? 2.041   32.931 33.783  1.00 26.73  ? 297  GLU A CG    1 
ATOM   2426 C  CD    . GLU A 1 297 ? 2.060   33.454 32.358  1.00 30.83  ? 297  GLU A CD    1 
ATOM   2427 O  OE1   . GLU A 1 297 ? 2.856   32.938 31.542  1.00 30.86  ? 297  GLU A OE1   1 
ATOM   2428 O  OE2   . GLU A 1 297 ? 1.276   34.378 32.050  1.00 33.56  ? 297  GLU A OE2   1 
ATOM   2429 N  N     . LEU A 1 298 ? 1.627   28.318 34.187  1.00 29.75  ? 298  LEU A N     1 
ATOM   2430 C  CA    . LEU A 1 298 ? 2.297   27.030 34.319  1.00 30.64  ? 298  LEU A CA    1 
ATOM   2431 C  C     . LEU A 1 298 ? 1.339   25.852 34.348  1.00 35.19  ? 298  LEU A C     1 
ATOM   2432 O  O     . LEU A 1 298 ? 1.774   24.700 34.321  1.00 33.27  ? 298  LEU A O     1 
ATOM   2433 C  CB    . LEU A 1 298 ? 3.124   27.019 35.603  1.00 28.40  ? 298  LEU A CB    1 
ATOM   2434 C  CG    . LEU A 1 298 ? 4.055   28.216 35.759  1.00 24.12  ? 298  LEU A CG    1 
ATOM   2435 C  CD1   . LEU A 1 298 ? 4.716   28.197 37.128  1.00 21.72  ? 298  LEU A CD1   1 
ATOM   2436 C  CD2   . LEU A 1 298 ? 5.087   28.213 34.644  1.00 22.04  ? 298  LEU A CD2   1 
ATOM   2437 N  N     A ASN A 1 299 ? 0.047   26.156 34.423  0.61 39.41  ? 299  ASN A N     1 
ATOM   2438 N  N     B ASN A 1 299 ? 0.041   26.138 34.392  0.39 39.47  ? 299  ASN A N     1 
ATOM   2439 C  CA    A ASN A 1 299 ? -0.998  25.142 34.497  0.61 42.63  ? 299  ASN A CA    1 
ATOM   2440 C  CA    B ASN A 1 299 ? -0.987  25.101 34.483  0.39 42.72  ? 299  ASN A CA    1 
ATOM   2441 C  C     A ASN A 1 299 ? -0.805  24.201 35.680  0.61 44.46  ? 299  ASN A C     1 
ATOM   2442 C  C     B ASN A 1 299 ? -0.769  24.179 35.681  0.39 44.50  ? 299  ASN A C     1 
ATOM   2443 O  O     A ASN A 1 299 ? -1.084  23.006 35.593  0.61 46.65  ? 299  ASN A O     1 
ATOM   2444 O  O     B ASN A 1 299 ? -0.986  22.970 35.606  0.39 46.32  ? 299  ASN A O     1 
ATOM   2445 C  CB    A ASN A 1 299 ? -1.105  24.371 33.178  0.61 44.29  ? 299  ASN A CB    1 
ATOM   2446 C  CB    B ASN A 1 299 ? -1.083  24.295 33.181  0.39 43.77  ? 299  ASN A CB    1 
ATOM   2447 C  CG    A ASN A 1 299 ? -1.178  25.292 31.976  0.61 46.70  ? 299  ASN A CG    1 
ATOM   2448 C  CG    B ASN A 1 299 ? -2.340  23.444 33.111  0.39 44.61  ? 299  ASN A CG    1 
ATOM   2449 O  OD1   A ASN A 1 299 ? -2.231  25.857 31.673  0.61 47.47  ? 299  ASN A OD1   1 
ATOM   2450 O  OD1   B ASN A 1 299 ? -3.339  23.738 33.768  0.39 44.44  ? 299  ASN A OD1   1 
ATOM   2451 N  ND2   A ASN A 1 299 ? -0.053  25.458 31.290  0.61 46.51  ? 299  ASN A ND2   1 
ATOM   2452 N  ND2   B ASN A 1 299 ? -2.290  22.377 32.322  0.39 44.58  ? 299  ASN A ND2   1 
ATOM   2453 N  N     . VAL A 1 300 ? -0.320  24.758 36.786  1.00 45.07  ? 300  VAL A N     1 
ATOM   2454 C  CA    . VAL A 1 300 ? -0.161  24.009 38.022  1.00 47.86  ? 300  VAL A CA    1 
ATOM   2455 C  C     . VAL A 1 300 ? -1.410  24.215 38.868  1.00 54.97  ? 300  VAL A C     1 
ATOM   2456 O  O     . VAL A 1 300 ? -2.112  25.210 38.708  1.00 56.84  ? 300  VAL A O     1 
ATOM   2457 C  CB    . VAL A 1 300 ? 1.074   24.474 38.809  1.00 44.20  ? 300  VAL A CB    1 
ATOM   2458 C  CG1   . VAL A 1 300 ? 2.337   24.163 38.033  1.00 41.52  ? 300  VAL A CG1   1 
ATOM   2459 C  CG2   . VAL A 1 300 ? 0.984   25.963 39.110  1.00 43.15  ? 300  VAL A CG2   1 
ATOM   2460 N  N     . GLY A 1 301 ? -1.690  23.273 39.762  1.00 58.83  ? 301  GLY A N     1 
ATOM   2461 C  CA    . GLY A 1 301 ? -2.870  23.362 40.602  1.00 61.17  ? 301  GLY A CA    1 
ATOM   2462 C  C     . GLY A 1 301 ? -2.755  24.463 41.635  1.00 63.10  ? 301  GLY A C     1 
ATOM   2463 O  O     . GLY A 1 301 ? -1.655  24.921 41.951  1.00 61.59  ? 301  GLY A O     1 
ATOM   2464 N  N     . LYS A 1 302 ? -3.897  24.899 42.154  1.00 66.63  ? 302  LYS A N     1 
ATOM   2465 C  CA    . LYS A 1 302 ? -3.920  25.860 43.245  1.00 68.84  ? 302  LYS A CA    1 
ATOM   2466 C  C     . LYS A 1 302 ? -3.374  25.204 44.508  1.00 70.58  ? 302  LYS A C     1 
ATOM   2467 O  O     . LYS A 1 302 ? -3.672  24.042 44.791  1.00 71.79  ? 302  LYS A O     1 
ATOM   2468 C  CB    . LYS A 1 302 ? -5.345  26.360 43.485  1.00 69.70  ? 302  LYS A CB    1 
ATOM   2469 N  N     . LEU A 1 303 ? -2.567  25.947 45.257  1.00 69.10  ? 303  LEU A N     1 
ATOM   2470 C  CA    . LEU A 1 303 ? -1.990  25.438 46.496  1.00 69.59  ? 303  LEU A CA    1 
ATOM   2471 C  C     . LEU A 1 303 ? -3.071  25.210 47.550  1.00 74.77  ? 303  LEU A C     1 
ATOM   2472 O  O     . LEU A 1 303 ? -3.480  26.141 48.244  1.00 79.22  ? 303  LEU A O     1 
ATOM   2473 C  CB    . LEU A 1 303 ? -0.925  26.402 47.021  1.00 64.39  ? 303  LEU A CB    1 
ATOM   2474 C  CG    . LEU A 1 303 ? 0.290   26.597 46.112  1.00 59.66  ? 303  LEU A CG    1 
ATOM   2475 C  CD1   . LEU A 1 303 ? 1.211   27.677 46.656  1.00 58.98  ? 303  LEU A CD1   1 
ATOM   2476 C  CD2   . LEU A 1 303 ? 1.043   25.287 45.935  1.00 56.41  ? 303  LEU A CD2   1 
ATOM   2477 N  N     . LYS A 1 304 ? -3.524  23.966 47.667  1.00 73.42  ? 304  LYS A N     1 
ATOM   2478 C  CA    . LYS A 1 304 ? -4.626  23.625 48.560  1.00 73.31  ? 304  LYS A CA    1 
ATOM   2479 C  C     . LYS A 1 304 ? -4.210  23.544 50.029  1.00 76.66  ? 304  LYS A C     1 
ATOM   2480 O  O     . LYS A 1 304 ? -3.306  22.789 50.386  1.00 78.37  ? 304  LYS A O     1 
ATOM   2481 C  CB    . LYS A 1 304 ? -5.260  22.299 48.129  1.00 71.36  ? 304  LYS A CB    1 
ATOM   2482 N  N     . TYR A 1 305 ? -4.873  24.328 50.875  1.00 77.60  ? 305  TYR A N     1 
ATOM   2483 C  CA    . TYR A 1 305 ? -4.740  24.180 52.325  1.00 79.36  ? 305  TYR A CA    1 
ATOM   2484 C  C     . TYR A 1 305 ? -6.075  24.433 53.027  1.00 80.42  ? 305  TYR A C     1 
ATOM   2485 O  O     . TYR A 1 305 ? -6.885  25.238 52.570  1.00 81.32  ? 305  TYR A O     1 
ATOM   2486 C  CB    . TYR A 1 305 ? -3.624  25.065 52.892  1.00 80.50  ? 305  TYR A CB    1 
ATOM   2487 C  CG    . TYR A 1 305 ? -3.838  26.557 52.752  1.00 82.05  ? 305  TYR A CG    1 
ATOM   2488 C  CD1   . TYR A 1 305 ? -4.411  27.296 53.781  1.00 83.72  ? 305  TYR A CD1   1 
ATOM   2489 C  CD2   . TYR A 1 305 ? -3.442  27.231 51.604  1.00 81.39  ? 305  TYR A CD2   1 
ATOM   2490 C  CE1   . TYR A 1 305 ? -4.598  28.663 53.663  1.00 84.43  ? 305  TYR A CE1   1 
ATOM   2491 C  CE2   . TYR A 1 305 ? -3.624  28.597 51.476  1.00 81.93  ? 305  TYR A CE2   1 
ATOM   2492 C  CZ    . TYR A 1 305 ? -4.203  29.309 52.508  1.00 83.45  ? 305  TYR A CZ    1 
ATOM   2493 O  OH    . TYR A 1 305 ? -4.385  30.670 52.384  1.00 82.01  ? 305  TYR A OH    1 
ATOM   2494 N  N     . ASP A 1 306 ? -6.294  23.739 54.138  1.00 81.71  ? 306  ASP A N     1 
ATOM   2495 C  CA    . ASP A 1 306 ? -7.614  23.681 54.765  1.00 84.66  ? 306  ASP A CA    1 
ATOM   2496 C  C     . ASP A 1 306 ? -8.106  24.999 55.366  1.00 83.58  ? 306  ASP A C     1 
ATOM   2497 O  O     . ASP A 1 306 ? -9.034  25.617 54.842  1.00 86.85  ? 306  ASP A O     1 
ATOM   2498 C  CB    . ASP A 1 306 ? -7.660  22.561 55.808  1.00 87.98  ? 306  ASP A CB    1 
ATOM   2499 C  CG    . ASP A 1 306 ? -7.471  21.187 55.191  1.00 89.84  ? 306  ASP A CG    1 
ATOM   2500 O  OD1   . ASP A 1 306 ? -6.851  20.315 55.838  1.00 91.57  ? 306  ASP A OD1   1 
ATOM   2501 O  OD2   . ASP A 1 306 ? -7.943  20.983 54.052  1.00 89.32  ? 306  ASP A OD2   1 
ATOM   2502 N  N     . GLY A 1 307 ? -7.494  25.422 56.467  1.00 77.98  ? 307  GLY A N     1 
ATOM   2503 C  CA    . GLY A 1 307 ? -7.941  26.615 57.163  1.00 74.57  ? 307  GLY A CA    1 
ATOM   2504 C  C     . GLY A 1 307 ? -7.589  27.913 56.461  1.00 70.59  ? 307  GLY A C     1 
ATOM   2505 O  O     . GLY A 1 307 ? -7.242  27.914 55.279  1.00 68.27  ? 307  GLY A O     1 
ATOM   2506 N  N     . PRO A 1 308 ? -7.691  29.036 57.190  1.00 68.66  ? 308  PRO A N     1 
ATOM   2507 C  CA    . PRO A 1 308 ? -7.291  30.363 56.708  1.00 64.74  ? 308  PRO A CA    1 
ATOM   2508 C  C     . PRO A 1 308 ? -5.781  30.553 56.802  1.00 61.49  ? 308  PRO A C     1 
ATOM   2509 O  O     . PRO A 1 308 ? -5.143  29.915 57.642  1.00 60.49  ? 308  PRO A O     1 
ATOM   2510 C  CB    . PRO A 1 308 ? -7.994  31.305 57.685  1.00 66.17  ? 308  PRO A CB    1 
ATOM   2511 C  CG    . PRO A 1 308 ? -8.072  30.521 58.954  1.00 67.58  ? 308  PRO A CG    1 
ATOM   2512 C  CD    . PRO A 1 308 ? -8.292  29.093 58.535  1.00 68.44  ? 308  PRO A CD    1 
ATOM   2513 N  N     . ILE A 1 309 ? -5.225  31.422 55.959  1.00 60.66  ? 309  ILE A N     1 
ATOM   2514 C  CA    . ILE A 1 309 ? -3.782  31.668 55.942  1.00 60.62  ? 309  ILE A CA    1 
ATOM   2515 C  C     . ILE A 1 309 ? -3.268  32.169 57.295  1.00 61.92  ? 309  ILE A C     1 
ATOM   2516 O  O     . ILE A 1 309 ? -2.134  31.884 57.684  1.00 60.61  ? 309  ILE A O     1 
ATOM   2517 C  CB    . ILE A 1 309 ? -3.386  32.658 54.821  1.00 59.80  ? 309  ILE A CB    1 
ATOM   2518 C  CG1   . ILE A 1 309 ? -1.871  32.887 54.800  1.00 57.21  ? 309  ILE A CG1   1 
ATOM   2519 C  CG2   . ILE A 1 309 ? -4.122  33.980 54.982  1.00 63.05  ? 309  ILE A CG2   1 
ATOM   2520 C  CD1   . ILE A 1 309 ? -1.058  31.626 54.576  1.00 56.41  ? 309  ILE A CD1   1 
ATOM   2521 N  N     . SER A 1 310 ? -4.119  32.888 58.021  1.00 63.43  ? 310  SER A N     1 
ATOM   2522 C  CA    . SER A 1 310 ? -3.749  33.435 59.322  1.00 66.40  ? 310  SER A CA    1 
ATOM   2523 C  C     . SER A 1 310 ? -3.571  32.353 60.388  1.00 69.01  ? 310  SER A C     1 
ATOM   2524 O  O     . SER A 1 310 ? -3.129  32.635 61.502  1.00 69.01  ? 310  SER A O     1 
ATOM   2525 C  CB    . SER A 1 310 ? -4.786  34.464 59.782  1.00 69.32  ? 310  SER A CB    1 
ATOM   2526 O  OG    . SER A 1 310 ? -6.083  33.894 59.838  1.00 71.29  ? 310  SER A OG    1 
ATOM   2527 N  N     . LYS A 1 311 ? -3.916  31.116 60.045  1.00 57.35  ? 311  LYS A N     1 
ATOM   2528 C  CA    . LYS A 1 311 ? -3.765  29.999 60.969  1.00 55.62  ? 311  LYS A CA    1 
ATOM   2529 C  C     . LYS A 1 311 ? -2.932  28.869 60.365  1.00 50.13  ? 311  LYS A C     1 
ATOM   2530 O  O     . LYS A 1 311 ? -2.624  27.887 61.045  1.00 49.70  ? 311  LYS A O     1 
ATOM   2531 C  CB    . LYS A 1 311 ? -5.137  29.469 61.400  1.00 56.76  ? 311  LYS A CB    1 
ATOM   2532 C  CG    . LYS A 1 311 ? -5.999  30.484 62.138  1.00 56.27  ? 311  LYS A CG    1 
ATOM   2533 N  N     . LEU A 1 312 ? -2.566  29.017 59.093  1.00 45.08  ? 312  LEU A N     1 
ATOM   2534 C  CA    . LEU A 1 312 ? -1.842  27.976 58.366  1.00 42.16  ? 312  LEU A CA    1 
ATOM   2535 C  C     . LEU A 1 312 ? -0.557  27.543 59.067  1.00 40.55  ? 312  LEU A C     1 
ATOM   2536 O  O     . LEU A 1 312 ? -0.237  26.356 59.109  1.00 39.87  ? 312  LEU A O     1 
ATOM   2537 C  CB    . LEU A 1 312 ? -1.535  28.421 56.934  1.00 39.89  ? 312  LEU A CB    1 
ATOM   2538 C  CG    . LEU A 1 312 ? -0.795  27.395 56.070  1.00 38.92  ? 312  LEU A CG    1 
ATOM   2539 C  CD1   . LEU A 1 312 ? -1.554  26.077 56.034  1.00 38.23  ? 312  LEU A CD1   1 
ATOM   2540 C  CD2   . LEU A 1 312 ? -0.576  27.924 54.663  1.00 38.00  ? 312  LEU A CD2   1 
ATOM   2541 N  N     . ARG A 1 313 ? 0.173   28.504 59.621  1.00 40.77  ? 313  ARG A N     1 
ATOM   2542 C  CA    . ARG A 1 313 ? 1.418   28.190 60.310  1.00 40.43  ? 313  ARG A CA    1 
ATOM   2543 C  C     . ARG A 1 313 ? 1.159   27.388 61.581  1.00 42.73  ? 313  ARG A C     1 
ATOM   2544 O  O     . ARG A 1 313 ? 1.862   26.417 61.868  1.00 43.55  ? 313  ARG A O     1 
ATOM   2545 C  CB    . ARG A 1 313 ? 2.200   29.460 60.640  1.00 35.46  ? 313  ARG A CB    1 
ATOM   2546 C  CG    . ARG A 1 313 ? 3.517   29.188 61.342  1.00 34.49  ? 313  ARG A CG    1 
ATOM   2547 C  CD    . ARG A 1 313 ? 4.302   30.464 61.574  1.00 34.58  ? 313  ARG A CD    1 
ATOM   2548 N  NE    . ARG A 1 313 ? 5.531   30.210 62.316  1.00 33.71  ? 313  ARG A NE    1 
ATOM   2549 C  CZ    . ARG A 1 313 ? 5.590   30.125 63.639  1.00 35.45  ? 313  ARG A CZ    1 
ATOM   2550 N  NH1   . ARG A 1 313 ? 4.486   30.273 64.358  1.00 34.97  ? 313  ARG A NH1   1 
ATOM   2551 N  NH2   . ARG A 1 313 ? 6.748   29.891 64.244  1.00 37.00  ? 313  ARG A NH2   1 
ATOM   2552 N  N     . GLU A 1 314 ? 0.146   27.798 62.337  1.00 43.33  ? 314  GLU A N     1 
ATOM   2553 C  CA    . GLU A 1 314 ? -0.192  27.128 63.588  1.00 44.77  ? 314  GLU A CA    1 
ATOM   2554 C  C     . GLU A 1 314 ? -0.639  25.693 63.340  1.00 45.85  ? 314  GLU A C     1 
ATOM   2555 O  O     . GLU A 1 314 ? -0.176  24.765 64.002  1.00 49.57  ? 314  GLU A O     1 
ATOM   2556 C  CB    . GLU A 1 314 ? -1.287  27.898 64.335  1.00 43.09  ? 314  GLU A CB    1 
ATOM   2557 N  N     . SER A 1 315 ? -1.533  25.520 62.372  1.00 42.28  ? 315  SER A N     1 
ATOM   2558 C  CA    . SER A 1 315 ? -2.124  24.218 62.088  1.00 43.19  ? 315  SER A CA    1 
ATOM   2559 C  C     . SER A 1 315 ? -1.198  23.303 61.289  1.00 45.16  ? 315  SER A C     1 
ATOM   2560 O  O     . SER A 1 315 ? -0.964  22.155 61.672  1.00 46.96  ? 315  SER A O     1 
ATOM   2561 C  CB    . SER A 1 315 ? -3.448  24.395 61.347  1.00 41.10  ? 315  SER A CB    1 
ATOM   2562 O  OG    . SER A 1 315 ? -3.299  25.291 60.259  1.00 39.60  ? 315  SER A OG    1 
ATOM   2563 N  N     . ASN A 1 316 ? -0.677  23.814 60.179  1.00 44.58  ? 316  ASN A N     1 
ATOM   2564 C  CA    . ASN A 1 316 ? 0.180   23.022 59.306  1.00 41.28  ? 316  ASN A CA    1 
ATOM   2565 C  C     . ASN A 1 316 ? 1.448   23.773 58.918  1.00 41.45  ? 316  ASN A C     1 
ATOM   2566 O  O     . ASN A 1 316 ? 1.596   24.213 57.779  1.00 42.43  ? 316  ASN A O     1 
ATOM   2567 C  CB    . ASN A 1 316 ? -0.585  22.599 58.051  1.00 37.06  ? 316  ASN A CB    1 
ATOM   2568 C  CG    . ASN A 1 316 ? 0.008   21.371 57.396  1.00 37.96  ? 316  ASN A CG    1 
ATOM   2569 O  OD1   . ASN A 1 316 ? 1.175   21.043 57.610  1.00 39.52  ? 316  ASN A OD1   1 
ATOM   2570 N  ND2   . ASN A 1 316 ? -0.795  20.681 56.594  1.00 39.31  ? 316  ASN A ND2   1 
ATOM   2571 N  N     . HIS A 1 317 ? 2.356   23.918 59.876  1.00 40.15  ? 317  HIS A N     1 
ATOM   2572 C  CA    . HIS A 1 317 ? 3.613   24.612 59.645  1.00 36.96  ? 317  HIS A CA    1 
ATOM   2573 C  C     . HIS A 1 317 ? 4.433   23.938 58.552  1.00 36.95  ? 317  HIS A C     1 
ATOM   2574 O  O     . HIS A 1 317 ? 5.161   24.602 57.810  1.00 40.49  ? 317  HIS A O     1 
ATOM   2575 C  CB    . HIS A 1 317 ? 4.431   24.675 60.932  1.00 35.65  ? 317  HIS A CB    1 
ATOM   2576 C  CG    . HIS A 1 317 ? 5.827   25.168 60.729  1.00 35.72  ? 317  HIS A CG    1 
ATOM   2577 N  ND1   . HIS A 1 317 ? 6.920   24.329 60.734  1.00 38.97  ? 317  HIS A ND1   1 
ATOM   2578 C  CD2   . HIS A 1 317 ? 6.307   26.413 60.498  1.00 34.54  ? 317  HIS A CD2   1 
ATOM   2579 C  CE1   . HIS A 1 317 ? 8.015   25.037 60.526  1.00 37.39  ? 317  HIS A CE1   1 
ATOM   2580 N  NE2   . HIS A 1 317 ? 7.672   26.304 60.381  1.00 35.75  ? 317  HIS A NE2   1 
ATOM   2581 N  N     . GLN A 1 318 ? 4.314   22.617 58.465  1.00 32.71  ? 318  GLN A N     1 
ATOM   2582 C  CA    . GLN A 1 318 ? 4.998   21.842 57.437  1.00 31.73  ? 318  GLN A CA    1 
ATOM   2583 C  C     . GLN A 1 318 ? 4.645   22.370 56.044  1.00 32.91  ? 318  GLN A C     1 
ATOM   2584 O  O     . GLN A 1 318 ? 5.525   22.654 55.226  1.00 31.56  ? 318  GLN A O     1 
ATOM   2585 C  CB    . GLN A 1 318 ? 4.631   20.360 57.567  1.00 30.67  ? 318  GLN A CB    1 
ATOM   2586 C  CG    . GLN A 1 318 ? 5.169   19.476 56.452  1.00 32.52  ? 318  GLN A CG    1 
ATOM   2587 C  CD    . GLN A 1 318 ? 6.684   19.368 56.461  1.00 34.33  ? 318  GLN A CD    1 
ATOM   2588 O  OE1   . GLN A 1 318 ? 7.312   19.374 57.521  1.00 36.82  ? 318  GLN A OE1   1 
ATOM   2589 N  NE2   . GLN A 1 318 ? 7.278   19.270 55.275  1.00 32.13  ? 318  GLN A NE2   1 
ATOM   2590 N  N     . ARG A 1 319 ? 3.350   22.529 55.797  1.00 33.50  ? 319  ARG A N     1 
ATOM   2591 C  CA    . ARG A 1 319 ? 2.857   23.004 54.511  1.00 34.70  ? 319  ARG A CA    1 
ATOM   2592 C  C     . ARG A 1 319 ? 3.110   24.500 54.324  1.00 30.76  ? 319  ARG A C     1 
ATOM   2593 O  O     . ARG A 1 319 ? 3.348   24.966 53.209  1.00 31.36  ? 319  ARG A O     1 
ATOM   2594 C  CB    . ARG A 1 319 ? 1.366   22.691 54.384  1.00 40.16  ? 319  ARG A CB    1 
ATOM   2595 C  CG    . ARG A 1 319 ? 0.740   23.126 53.078  1.00 45.88  ? 319  ARG A CG    1 
ATOM   2596 C  CD    . ARG A 1 319 ? -0.402  22.204 52.709  1.00 54.27  ? 319  ARG A CD    1 
ATOM   2597 N  NE    . ARG A 1 319 ? 0.087   20.893 52.293  1.00 60.60  ? 319  ARG A NE    1 
ATOM   2598 C  CZ    . ARG A 1 319 ? -0.697  19.849 52.049  1.00 66.04  ? 319  ARG A CZ    1 
ATOM   2599 N  NH1   . ARG A 1 319 ? -2.012  19.962 52.184  1.00 68.22  ? 319  ARG A NH1   1 
ATOM   2600 N  NH2   . ARG A 1 319 ? -0.168  18.693 51.674  1.00 68.12  ? 319  ARG A NH2   1 
ATOM   2601 N  N     . TYR A 1 320 ? 3.052   25.236 55.427  1.00 26.31  ? 320  TYR A N     1 
ATOM   2602 C  CA    . TYR A 1 320 ? 3.303   26.670 55.445  1.00 26.98  ? 320  TYR A CA    1 
ATOM   2603 C  C     . TYR A 1 320 ? 4.670   26.973 54.849  1.00 28.55  ? 320  TYR A C     1 
ATOM   2604 O  O     . TYR A 1 320 ? 4.796   27.789 53.934  1.00 26.92  ? 320  TYR A O     1 
ATOM   2605 C  CB    . TYR A 1 320 ? 3.245   27.149 56.894  1.00 29.36  ? 320  TYR A CB    1 
ATOM   2606 C  CG    . TYR A 1 320 ? 3.348   28.642 57.113  1.00 28.42  ? 320  TYR A CG    1 
ATOM   2607 C  CD1   . TYR A 1 320 ? 2.294   29.487 56.795  1.00 26.96  ? 320  TYR A CD1   1 
ATOM   2608 C  CD2   . TYR A 1 320 ? 4.481   29.198 57.693  1.00 27.71  ? 320  TYR A CD2   1 
ATOM   2609 C  CE1   . TYR A 1 320 ? 2.378   30.849 57.020  1.00 28.37  ? 320  TYR A CE1   1 
ATOM   2610 C  CE2   . TYR A 1 320 ? 4.575   30.555 57.922  1.00 28.98  ? 320  TYR A CE2   1 
ATOM   2611 C  CZ    . TYR A 1 320 ? 3.520   31.378 57.585  1.00 30.49  ? 320  TYR A CZ    1 
ATOM   2612 O  OH    . TYR A 1 320 ? 3.608   32.734 57.814  1.00 29.43  ? 320  TYR A OH    1 
ATOM   2613 N  N     . ILE A 1 321 ? 5.690   26.295 55.367  1.00 29.77  ? 321  ILE A N     1 
ATOM   2614 C  CA    . ILE A 1 321 ? 7.055   26.464 54.887  1.00 29.74  ? 321  ILE A CA    1 
ATOM   2615 C  C     . ILE A 1 321 ? 7.209   25.948 53.462  1.00 29.72  ? 321  ILE A C     1 
ATOM   2616 O  O     . ILE A 1 321 ? 7.835   26.598 52.622  1.00 26.39  ? 321  ILE A O     1 
ATOM   2617 C  CB    . ILE A 1 321 ? 8.057   25.745 55.805  1.00 29.27  ? 321  ILE A CB    1 
ATOM   2618 C  CG1   . ILE A 1 321 ? 8.112   26.450 57.157  1.00 28.71  ? 321  ILE A CG1   1 
ATOM   2619 C  CG2   . ILE A 1 321 ? 9.445   25.717 55.178  1.00 28.79  ? 321  ILE A CG2   1 
ATOM   2620 C  CD1   . ILE A 1 321 ? 8.447   27.924 57.054  1.00 27.72  ? 321  ILE A CD1   1 
ATOM   2621 N  N     . SER A 1 322 ? 6.632   24.781 53.194  1.00 30.70  ? 322  SER A N     1 
ATOM   2622 C  CA    . SER A 1 322 ? 6.672   24.205 51.856  1.00 32.21  ? 322  SER A CA    1 
ATOM   2623 C  C     . SER A 1 322 ? 6.062   25.139 50.816  1.00 33.72  ? 322  SER A C     1 
ATOM   2624 O  O     . SER A 1 322 ? 6.646   25.353 49.753  1.00 33.81  ? 322  SER A O     1 
ATOM   2625 C  CB    . SER A 1 322 ? 5.974   22.845 51.821  1.00 31.06  ? 322  SER A CB    1 
ATOM   2626 O  OG    . SER A 1 322 ? 6.820   21.821 52.318  1.00 31.33  ? 322  SER A OG    1 
ATOM   2627 N  N     . TYR A 1 323 ? 4.896   25.701 51.125  1.00 32.71  ? 323  TYR A N     1 
ATOM   2628 C  CA    . TYR A 1 323 ? 4.241   26.612 50.192  1.00 31.88  ? 323  TYR A CA    1 
ATOM   2629 C  C     . TYR A 1 323 ? 5.063   27.873 49.973  1.00 27.33  ? 323  TYR A C     1 
ATOM   2630 O  O     . TYR A 1 323 ? 5.072   28.427 48.877  1.00 26.81  ? 323  TYR A O     1 
ATOM   2631 C  CB    . TYR A 1 323 ? 2.821   26.954 50.643  1.00 36.38  ? 323  TYR A CB    1 
ATOM   2632 C  CG    . TYR A 1 323 ? 1.830   25.856 50.339  1.00 42.65  ? 323  TYR A CG    1 
ATOM   2633 C  CD1   . TYR A 1 323 ? 0.486   25.991 50.662  1.00 44.82  ? 323  TYR A CD1   1 
ATOM   2634 C  CD2   . TYR A 1 323 ? 2.243   24.680 49.728  1.00 45.32  ? 323  TYR A CD2   1 
ATOM   2635 C  CE1   . TYR A 1 323 ? -0.419  24.984 50.379  1.00 45.18  ? 323  TYR A CE1   1 
ATOM   2636 C  CE2   . TYR A 1 323 ? 1.348   23.668 49.446  1.00 48.47  ? 323  TYR A CE2   1 
ATOM   2637 C  CZ    . TYR A 1 323 ? 0.018   23.824 49.772  1.00 49.25  ? 323  TYR A CZ    1 
ATOM   2638 O  OH    . TYR A 1 323 ? -0.876  22.814 49.493  1.00 54.02  ? 323  TYR A OH    1 
ATOM   2639 N  N     . ASN A 1 324 ? 5.764   28.314 51.013  1.00 26.14  ? 324  ASN A N     1 
ATOM   2640 C  CA    . ASN A 1 324 ? 6.655   29.464 50.893  1.00 24.36  ? 324  ASN A CA    1 
ATOM   2641 C  C     . ASN A 1 324 ? 7.802   29.189 49.919  1.00 21.34  ? 324  ASN A C     1 
ATOM   2642 O  O     . ASN A 1 324 ? 8.154   30.036 49.099  1.00 19.60  ? 324  ASN A O     1 
ATOM   2643 C  CB    . ASN A 1 324 ? 7.188   29.878 52.267  1.00 25.28  ? 324  ASN A CB    1 
ATOM   2644 C  CG    . ASN A 1 324 ? 8.161   31.042 52.192  1.00 27.70  ? 324  ASN A CG    1 
ATOM   2645 O  OD1   . ASN A 1 324 ? 9.322   30.923 52.583  1.00 25.14  ? 324  ASN A OD1   1 
ATOM   2646 N  ND2   . ASN A 1 324 ? 7.692   32.175 51.678  1.00 29.79  ? 324  ASN A ND2   1 
ATOM   2647 N  N     . ILE A 1 325 ? 8.371   27.993 50.007  1.00 23.16  ? 325  ILE A N     1 
ATOM   2648 C  CA    . ILE A 1 325 ? 9.428   27.591 49.088  1.00 27.46  ? 325  ILE A CA    1 
ATOM   2649 C  C     . ILE A 1 325 ? 8.896   27.523 47.658  1.00 29.81  ? 325  ILE A C     1 
ATOM   2650 O  O     . ILE A 1 325 ? 9.514   28.047 46.733  1.00 31.05  ? 325  ILE A O     1 
ATOM   2651 C  CB    . ILE A 1 325 ? 10.055  26.239 49.495  1.00 25.94  ? 325  ILE A CB    1 
ATOM   2652 C  CG1   . ILE A 1 325 ? 10.685  26.348 50.888  1.00 23.85  ? 325  ILE A CG1   1 
ATOM   2653 C  CG2   . ILE A 1 325 ? 11.087  25.799 48.465  1.00 20.81  ? 325  ILE A CG2   1 
ATOM   2654 C  CD1   . ILE A 1 325 ? 11.114  25.020 51.475  1.00 24.92  ? 325  ILE A CD1   1 
ATOM   2655 N  N     . ILE A 1 326 ? 7.736   26.894 47.490  1.00 31.79  ? 326  ILE A N     1 
ATOM   2656 C  CA    . ILE A 1 326 ? 7.106   26.763 46.178  1.00 30.41  ? 326  ILE A CA    1 
ATOM   2657 C  C     . ILE A 1 326 ? 6.798   28.122 45.541  1.00 26.67  ? 326  ILE A C     1 
ATOM   2658 O  O     . ILE A 1 326 ? 7.008   28.310 44.346  1.00 28.81  ? 326  ILE A O     1 
ATOM   2659 C  CB    . ILE A 1 326 ? 5.827   25.900 46.259  1.00 30.91  ? 326  ILE A CB    1 
ATOM   2660 C  CG1   . ILE A 1 326 ? 6.182   24.479 46.697  1.00 32.75  ? 326  ILE A CG1   1 
ATOM   2661 C  CG2   . ILE A 1 326 ? 5.096   25.874 44.925  1.00 31.25  ? 326  ILE A CG2   1 
ATOM   2662 C  CD1   . ILE A 1 326 ? 4.982   23.595 46.985  1.00 33.91  ? 326  ILE A CD1   1 
ATOM   2663 N  N     . ALA A 1 327 ? 6.323   29.067 46.347  1.00 24.73  ? 327  ALA A N     1 
ATOM   2664 C  CA    . ALA A 1 327 ? 6.003   30.411 45.862  1.00 24.36  ? 327  ALA A CA    1 
ATOM   2665 C  C     . ALA A 1 327 ? 7.214   31.108 45.240  1.00 25.74  ? 327  ALA A C     1 
ATOM   2666 O  O     . ALA A 1 327 ? 7.086   31.838 44.258  1.00 27.93  ? 327  ALA A O     1 
ATOM   2667 C  CB    . ALA A 1 327 ? 5.421   31.261 46.985  1.00 21.81  ? 327  ALA A CB    1 
ATOM   2668 N  N     . VAL A 1 328 ? 8.387   30.881 45.819  1.00 25.40  ? 328  VAL A N     1 
ATOM   2669 C  CA    . VAL A 1 328 ? 9.622   31.405 45.256  1.00 23.32  ? 328  VAL A CA    1 
ATOM   2670 C  C     . VAL A 1 328 ? 9.922   30.684 43.949  1.00 22.84  ? 328  VAL A C     1 
ATOM   2671 O  O     . VAL A 1 328 ? 10.254  31.313 42.943  1.00 24.70  ? 328  VAL A O     1 
ATOM   2672 C  CB    . VAL A 1 328 ? 10.810  31.230 46.227  1.00 22.98  ? 328  VAL A CB    1 
ATOM   2673 C  CG1   . VAL A 1 328 ? 12.120  31.562 45.540  1.00 18.96  ? 328  VAL A CG1   1 
ATOM   2674 C  CG2   . VAL A 1 328 ? 10.624  32.097 47.455  1.00 22.83  ? 328  VAL A CG2   1 
ATOM   2675 N  N     . TYR A 1 329 ? 9.788   29.361 43.971  1.00 20.36  ? 329  TYR A N     1 
ATOM   2676 C  CA    . TYR A 1 329 ? 10.059  28.543 42.795  1.00 21.50  ? 329  TYR A CA    1 
ATOM   2677 C  C     . TYR A 1 329 ? 9.102   28.830 41.644  1.00 22.53  ? 329  TYR A C     1 
ATOM   2678 O  O     . TYR A 1 329 ? 9.498   28.793 40.480  1.00 26.47  ? 329  TYR A O     1 
ATOM   2679 C  CB    . TYR A 1 329 ? 10.028  27.051 43.140  1.00 22.91  ? 329  TYR A CB    1 
ATOM   2680 C  CG    . TYR A 1 329 ? 10.428  26.160 41.983  1.00 25.23  ? 329  TYR A CG    1 
ATOM   2681 C  CD1   . TYR A 1 329 ? 11.524  26.477 41.186  1.00 25.72  ? 329  TYR A CD1   1 
ATOM   2682 C  CD2   . TYR A 1 329 ? 9.721   25.000 41.693  1.00 24.66  ? 329  TYR A CD2   1 
ATOM   2683 C  CE1   . TYR A 1 329 ? 11.897  25.670 40.130  1.00 27.84  ? 329  TYR A CE1   1 
ATOM   2684 C  CE2   . TYR A 1 329 ? 10.090  24.185 40.638  1.00 26.32  ? 329  TYR A CE2   1 
ATOM   2685 C  CZ    . TYR A 1 329 ? 11.180  24.526 39.860  1.00 28.52  ? 329  TYR A CZ    1 
ATOM   2686 O  OH    . TYR A 1 329 ? 11.560  23.726 38.806  1.00 30.19  ? 329  TYR A OH    1 
ATOM   2687 N  N     A ARG A 1 330 ? 7.848   29.121 41.967  0.50 23.93  ? 330  ARG A N     1 
ATOM   2688 N  N     B ARG A 1 330 ? 7.844   29.110 41.973  0.50 23.93  ? 330  ARG A N     1 
ATOM   2689 C  CA    A ARG A 1 330 ? 6.858   29.401 40.931  0.50 25.45  ? 330  ARG A CA    1 
ATOM   2690 C  CA    B ARG A 1 330 ? 6.837   29.417 40.958  0.50 25.23  ? 330  ARG A CA    1 
ATOM   2691 C  C     A ARG A 1 330 ? 7.209   30.646 40.115  0.50 26.29  ? 330  ARG A C     1 
ATOM   2692 C  C     B ARG A 1 330 ? 7.248   30.624 40.115  0.50 26.30  ? 330  ARG A C     1 
ATOM   2693 O  O     A ARG A 1 330 ? 6.986   30.681 38.907  0.50 28.08  ? 330  ARG A O     1 
ATOM   2694 O  O     B ARG A 1 330 ? 7.102   30.611 38.892  0.50 28.08  ? 330  ARG A O     1 
ATOM   2695 C  CB    A ARG A 1 330 ? 5.446   29.495 41.519  0.50 23.66  ? 330  ARG A CB    1 
ATOM   2696 C  CB    B ARG A 1 330 ? 5.461   29.654 41.595  0.50 23.50  ? 330  ARG A CB    1 
ATOM   2697 C  CG    A ARG A 1 330 ? 4.846   28.137 41.864  0.50 22.58  ? 330  ARG A CG    1 
ATOM   2698 C  CG    B ARG A 1 330 ? 4.799   28.404 42.180  0.50 22.87  ? 330  ARG A CG    1 
ATOM   2699 C  CD    A ARG A 1 330 ? 3.393   28.253 42.290  0.50 22.48  ? 330  ARG A CD    1 
ATOM   2700 C  CD    B ARG A 1 330 ? 4.469   27.374 41.109  0.50 23.20  ? 330  ARG A CD    1 
ATOM   2701 N  NE    A ARG A 1 330 ? 2.729   26.954 42.311  0.50 22.75  ? 330  ARG A NE    1 
ATOM   2702 N  NE    B ARG A 1 330 ? 3.750   26.219 41.648  0.50 24.46  ? 330  ARG A NE    1 
ATOM   2703 C  CZ    A ARG A 1 330 ? 1.433   26.780 42.544  0.50 18.58  ? 330  ARG A CZ    1 
ATOM   2704 C  CZ    B ARG A 1 330 ? 4.233   24.980 41.686  0.50 19.12  ? 330  ARG A CZ    1 
ATOM   2705 N  NH1   A ARG A 1 330 ? 0.652   27.824 42.781  0.50 18.32  ? 330  ARG A NH1   1 
ATOM   2706 N  NH1   B ARG A 1 330 ? 5.445   24.719 41.214  0.50 19.26  ? 330  ARG A NH1   1 
ATOM   2707 N  NH2   A ARG A 1 330 ? 0.918   25.558 42.539  0.50 32.65  ? 330  ARG A NH2   1 
ATOM   2708 N  NH2   B ARG A 1 330 ? 3.502   23.999 42.195  0.50 19.45  ? 330  ARG A NH2   1 
ATOM   2709 N  N     . VAL A 1 331 ? 7.774   31.655 40.770  1.00 24.37  ? 331  VAL A N     1 
ATOM   2710 C  CA    . VAL A 1 331 ? 8.207   32.860 40.068  1.00 22.90  ? 331  VAL A CA    1 
ATOM   2711 C  C     . VAL A 1 331 ? 9.373   32.541 39.137  1.00 21.58  ? 331  VAL A C     1 
ATOM   2712 O  O     . VAL A 1 331 ? 9.416   33.004 37.998  1.00 24.46  ? 331  VAL A O     1 
ATOM   2713 C  CB    . VAL A 1 331 ? 8.601   33.994 41.037  1.00 23.91  ? 331  VAL A CB    1 
ATOM   2714 C  CG1   . VAL A 1 331 ? 9.144   35.184 40.264  1.00 20.92  ? 331  VAL A CG1   1 
ATOM   2715 C  CG2   . VAL A 1 331 ? 7.404   34.412 41.879  1.00 25.61  ? 331  VAL A CG2   1 
ATOM   2716 N  N     . LEU A 1 332 ? 10.310  31.735 39.625  1.00 19.26  ? 332  LEU A N     1 
ATOM   2717 C  CA    . LEU A 1 332 ? 11.425  31.275 38.808  1.00 20.52  ? 332  LEU A CA    1 
ATOM   2718 C  C     . LEU A 1 332 ? 10.928  30.511 37.586  1.00 24.88  ? 332  LEU A C     1 
ATOM   2719 O  O     . LEU A 1 332 ? 11.458  30.669 36.485  1.00 25.22  ? 332  LEU A O     1 
ATOM   2720 C  CB    . LEU A 1 332 ? 12.346  30.378 39.631  1.00 22.02  ? 332  LEU A CB    1 
ATOM   2721 C  CG    . LEU A 1 332 ? 13.166  31.078 40.708  1.00 25.26  ? 332  LEU A CG    1 
ATOM   2722 C  CD1   . LEU A 1 332 ? 13.810  30.058 41.628  1.00 26.69  ? 332  LEU A CD1   1 
ATOM   2723 C  CD2   . LEU A 1 332 ? 14.223  31.971 40.070  1.00 28.68  ? 332  LEU A CD2   1 
ATOM   2724 N  N     . GLN A 1 333 ? 9.909   29.681 37.792  1.00 26.60  ? 333  GLN A N     1 
ATOM   2725 C  CA    . GLN A 1 333 ? 9.327   28.896 36.710  1.00 26.20  ? 333  GLN A CA    1 
ATOM   2726 C  C     . GLN A 1 333 ? 8.654   29.807 35.698  1.00 24.84  ? 333  GLN A C     1 
ATOM   2727 O  O     . GLN A 1 333 ? 8.810   29.628 34.489  1.00 26.78  ? 333  GLN A O     1 
ATOM   2728 C  CB    . GLN A 1 333 ? 8.311   27.896 37.253  1.00 26.68  ? 333  GLN A CB    1 
ATOM   2729 C  CG    . GLN A 1 333 ? 8.911   26.759 38.050  1.00 29.81  ? 333  GLN A CG    1 
ATOM   2730 C  CD    . GLN A 1 333 ? 7.847   25.830 38.598  1.00 33.23  ? 333  GLN A CD    1 
ATOM   2731 O  OE1   . GLN A 1 333 ? 7.013   26.234 39.409  1.00 35.19  ? 333  GLN A OE1   1 
ATOM   2732 N  NE2   . GLN A 1 333 ? 7.864   24.581 38.149  1.00 33.09  ? 333  GLN A NE2   1 
ATOM   2733 N  N     . ILE A 1 334 ? 7.893   30.774 36.199  1.00 23.02  ? 334  ILE A N     1 
ATOM   2734 C  CA    . ILE A 1 334 ? 7.264   31.764 35.340  1.00 24.66  ? 334  ILE A CA    1 
ATOM   2735 C  C     . ILE A 1 334 ? 8.334   32.503 34.546  1.00 29.26  ? 334  ILE A C     1 
ATOM   2736 O  O     . ILE A 1 334 ? 8.194   32.698 33.337  1.00 32.26  ? 334  ILE A O     1 
ATOM   2737 C  CB    . ILE A 1 334 ? 6.424   32.771 36.148  1.00 21.86  ? 334  ILE A CB    1 
ATOM   2738 C  CG1   . ILE A 1 334 ? 5.188   32.087 36.731  1.00 22.88  ? 334  ILE A CG1   1 
ATOM   2739 C  CG2   . ILE A 1 334 ? 6.010   33.945 35.274  1.00 18.60  ? 334  ILE A CG2   1 
ATOM   2740 C  CD1   . ILE A 1 334 ? 4.384   32.971 37.660  1.00 23.36  ? 334  ILE A CD1   1 
ATOM   2741 N  N     . ASP A 1 335 ? 9.415   32.892 35.220  1.00 26.59  ? 335  ASP A N     1 
ATOM   2742 C  CA    . ASP A 1 335 ? 10.487  33.608 34.541  1.00 24.38  ? 335  ASP A CA    1 
ATOM   2743 C  C     . ASP A 1 335 ? 11.205  32.728 33.533  1.00 25.84  ? 335  ASP A C     1 
ATOM   2744 O  O     . ASP A 1 335 ? 11.646  33.210 32.499  1.00 27.87  ? 335  ASP A O     1 
ATOM   2745 C  CB    . ASP A 1 335 ? 11.497  34.201 35.518  1.00 22.47  ? 335  ASP A CB    1 
ATOM   2746 C  CG    . ASP A 1 335 ? 12.517  35.085 34.823  1.00 25.69  ? 335  ASP A CG    1 
ATOM   2747 O  OD1   . ASP A 1 335 ? 12.106  35.992 34.064  1.00 27.86  ? 335  ASP A OD1   1 
ATOM   2748 O  OD2   . ASP A 1 335 ? 13.729  34.860 35.015  1.00 25.64  ? 335  ASP A OD2   1 
ATOM   2749 N  N     . ALA A 1 336 ? 11.328  31.440 33.834  1.00 23.59  ? 336  ALA A N     1 
ATOM   2750 C  CA    . ALA A 1 336 ? 11.952  30.519 32.893  1.00 23.39  ? 336  ALA A CA    1 
ATOM   2751 C  C     . ALA A 1 336 ? 11.130  30.454 31.605  1.00 24.39  ? 336  ALA A C     1 
ATOM   2752 O  O     . ALA A 1 336 ? 11.680  30.296 30.513  1.00 27.51  ? 336  ALA A O     1 
ATOM   2753 C  CB    . ALA A 1 336 ? 12.110  29.141 33.515  1.00 19.33  ? 336  ALA A CB    1 
ATOM   2754 N  N     . LYS A 1 337 ? 9.814   30.597 31.739  1.00 22.68  ? 337  LYS A N     1 
ATOM   2755 C  CA    . LYS A 1 337 ? 8.927   30.620 30.580  1.00 23.83  ? 337  LYS A CA    1 
ATOM   2756 C  C     . LYS A 1 337 ? 8.909   31.987 29.899  1.00 25.26  ? 337  LYS A C     1 
ATOM   2757 O  O     . LYS A 1 337 ? 9.164   32.089 28.701  1.00 27.11  ? 337  LYS A O     1 
ATOM   2758 C  CB    . LYS A 1 337 ? 7.506   30.208 30.976  1.00 23.04  ? 337  LYS A CB    1 
ATOM   2759 C  CG    . LYS A 1 337 ? 6.465   30.379 29.871  1.00 22.81  ? 337  LYS A CG    1 
ATOM   2760 C  CD    . LYS A 1 337 ? 5.058   30.235 30.435  1.00 25.91  ? 337  LYS A CD    1 
ATOM   2761 C  CE    . LYS A 1 337 ? 3.987   30.384 29.369  1.00 28.83  ? 337  LYS A CE    1 
ATOM   2762 N  NZ    . LYS A 1 337 ? 2.627   30.432 29.982  1.00 30.61  ? 337  LYS A NZ    1 
ATOM   2763 N  N     . ARG A 1 338 ? 8.611   33.033 30.669  1.00 25.80  ? 338  ARG A N     1 
ATOM   2764 C  CA    . ARG A 1 338 ? 8.444   34.385 30.125  1.00 26.27  ? 338  ARG A CA    1 
ATOM   2765 C  C     . ARG A 1 338 ? 9.761   35.100 29.837  1.00 25.99  ? 338  ARG A C     1 
ATOM   2766 O  O     . ARG A 1 338 ? 9.846   35.876 28.889  1.00 27.84  ? 338  ARG A O     1 
ATOM   2767 C  CB    . ARG A 1 338 ? 7.589   35.245 31.061  1.00 26.73  ? 338  ARG A CB    1 
ATOM   2768 C  CG    . ARG A 1 338 ? 6.130   34.826 31.144  1.00 27.54  ? 338  ARG A CG    1 
ATOM   2769 C  CD    . ARG A 1 338 ? 5.402   35.014 29.819  1.00 26.06  ? 338  ARG A CD    1 
ATOM   2770 N  NE    . ARG A 1 338 ? 3.951   34.999 30.004  1.00 27.43  ? 338  ARG A NE    1 
ATOM   2771 C  CZ    . ARG A 1 338 ? 3.096   35.731 29.295  1.00 25.63  ? 338  ARG A CZ    1 
ATOM   2772 N  NH1   . ARG A 1 338 ? 3.541   36.540 28.341  1.00 24.82  ? 338  ARG A NH1   1 
ATOM   2773 N  NH2   . ARG A 1 338 ? 1.795   35.657 29.542  1.00 21.83  ? 338  ARG A NH2   1 
ATOM   2774 N  N     . GLN A 1 339 ? 10.770  34.852 30.668  1.00 24.17  ? 339  GLN A N     1 
ATOM   2775 C  CA    . GLN A 1 339 ? 12.104  35.433 30.489  1.00 25.73  ? 339  GLN A CA    1 
ATOM   2776 C  C     . GLN A 1 339 ? 12.129  36.962 30.516  1.00 26.55  ? 339  GLN A C     1 
ATOM   2777 O  O     . GLN A 1 339 ? 12.740  37.601 29.659  1.00 28.34  ? 339  GLN A O     1 
ATOM   2778 C  CB    . GLN A 1 339 ? 12.764  34.884 29.221  1.00 27.54  ? 339  GLN A CB    1 
ATOM   2779 C  CG    . GLN A 1 339 ? 12.813  33.371 29.208  1.00 33.73  ? 339  GLN A CG    1 
ATOM   2780 C  CD    . GLN A 1 339 ? 13.454  32.807 27.961  1.00 42.39  ? 339  GLN A CD    1 
ATOM   2781 O  OE1   . GLN A 1 339 ? 14.141  33.516 27.225  1.00 48.46  ? 339  GLN A OE1   1 
ATOM   2782 N  NE2   . GLN A 1 339 ? 13.231  31.521 27.714  1.00 41.42  ? 339  GLN A NE2   1 
ATOM   2783 N  N     . PHE A 1 340 ? 11.477  37.539 31.520  1.00 23.82  ? 340  PHE A N     1 
ATOM   2784 C  CA    . PHE A 1 340 ? 11.430  38.986 31.673  1.00 23.63  ? 340  PHE A CA    1 
ATOM   2785 C  C     . PHE A 1 340 ? 12.704  39.527 32.308  1.00 26.82  ? 340  PHE A C     1 
ATOM   2786 O  O     . PHE A 1 340 ? 13.099  40.667 32.045  1.00 27.43  ? 340  PHE A O     1 
ATOM   2787 C  CB    . PHE A 1 340 ? 10.220  39.397 32.509  1.00 25.04  ? 340  PHE A CB    1 
ATOM   2788 C  CG    . PHE A 1 340 ? 8.906   39.114 31.850  1.00 26.26  ? 340  PHE A CG    1 
ATOM   2789 C  CD1   . PHE A 1 340 ? 8.805   39.083 30.470  1.00 26.53  ? 340  PHE A CD1   1 
ATOM   2790 C  CD2   . PHE A 1 340 ? 7.771   38.876 32.609  1.00 26.59  ? 340  PHE A CD2   1 
ATOM   2791 C  CE1   . PHE A 1 340 ? 7.598   38.823 29.857  1.00 28.12  ? 340  PHE A CE1   1 
ATOM   2792 C  CE2   . PHE A 1 340 ? 6.558   38.613 32.003  1.00 27.19  ? 340  PHE A CE2   1 
ATOM   2793 C  CZ    . PHE A 1 340 ? 6.471   38.588 30.625  1.00 28.45  ? 340  PHE A CZ    1 
ATOM   2794 N  N     . ILE A 1 341 ? 13.340  38.721 33.155  1.00 26.70  ? 341  ILE A N     1 
ATOM   2795 C  CA    . ILE A 1 341 ? 14.613  39.116 33.750  1.00 27.35  ? 341  ILE A CA    1 
ATOM   2796 C  C     . ILE A 1 341 ? 15.654  39.281 32.647  1.00 27.85  ? 341  ILE A C     1 
ATOM   2797 O  O     . ILE A 1 341 ? 16.315  40.318 32.550  1.00 27.56  ? 341  ILE A O     1 
ATOM   2798 C  CB    . ILE A 1 341 ? 15.122  38.087 34.776  1.00 26.57  ? 341  ILE A CB    1 
ATOM   2799 C  CG1   . ILE A 1 341 ? 14.143  37.960 35.945  1.00 27.63  ? 341  ILE A CG1   1 
ATOM   2800 C  CG2   . ILE A 1 341 ? 16.498  38.482 35.286  1.00 19.94  ? 341  ILE A CG2   1 
ATOM   2801 C  CD1   . ILE A 1 341 ? 13.971  39.232 36.719  1.00 28.75  ? 341  ILE A CD1   1 
ATOM   2802 N  N     . ASN A 1 342 ? 15.785  38.253 31.815  1.00 26.96  ? 342  ASN A N     1 
ATOM   2803 C  CA    . ASN A 1 342 ? 16.652  38.311 30.649  1.00 27.09  ? 342  ASN A CA    1 
ATOM   2804 C  C     . ASN A 1 342 ? 16.347  39.525 29.777  1.00 26.34  ? 342  ASN A C     1 
ATOM   2805 O  O     . ASN A 1 342 ? 17.260  40.207 29.313  1.00 28.02  ? 342  ASN A O     1 
ATOM   2806 C  CB    . ASN A 1 342 ? 16.524  37.023 29.832  1.00 30.29  ? 342  ASN A CB    1 
ATOM   2807 C  CG    . ASN A 1 342 ? 17.251  37.099 28.505  1.00 34.77  ? 342  ASN A CG    1 
ATOM   2808 O  OD1   . ASN A 1 342 ? 18.474  36.957 28.443  1.00 39.03  ? 342  ASN A OD1   1 
ATOM   2809 N  ND2   . ASN A 1 342 ? 16.499  37.317 27.432  1.00 34.17  ? 342  ASN A ND2   1 
ATOM   2810 N  N     . LEU A 1 343 ? 15.062  39.798 29.568  1.00 26.82  ? 343  LEU A N     1 
ATOM   2811 C  CA    . LEU A 1 343 ? 14.645  40.966 28.798  1.00 27.59  ? 343  LEU A CA    1 
ATOM   2812 C  C     . LEU A 1 343 ? 15.139  42.261 29.436  1.00 28.58  ? 343  LEU A C     1 
ATOM   2813 O  O     . LEU A 1 343 ? 15.660  43.140 28.751  1.00 32.48  ? 343  LEU A O     1 
ATOM   2814 C  CB    . LEU A 1 343 ? 13.123  41.008 28.658  1.00 26.97  ? 343  LEU A CB    1 
ATOM   2815 C  CG    . LEU A 1 343 ? 12.552  42.269 27.999  1.00 25.15  ? 343  LEU A CG    1 
ATOM   2816 C  CD1   . LEU A 1 343 ? 12.836  42.280 26.503  1.00 24.58  ? 343  LEU A CD1   1 
ATOM   2817 C  CD2   . LEU A 1 343 ? 11.062  42.406 28.275  1.00 23.02  ? 343  LEU A CD2   1 
ATOM   2818 N  N     . SER A 1 344 ? 14.974  42.371 30.750  1.00 25.90  ? 344  SER A N     1 
ATOM   2819 C  CA    . SER A 1 344 ? 15.404  43.561 31.481  1.00 26.34  ? 344  SER A CA    1 
ATOM   2820 C  C     . SER A 1 344 ? 16.916  43.762 31.422  1.00 28.72  ? 344  SER A C     1 
ATOM   2821 O  O     . SER A 1 344 ? 17.398  44.894 31.367  1.00 29.83  ? 344  SER A O     1 
ATOM   2822 C  CB    . SER A 1 344 ? 14.949  43.488 32.938  1.00 25.31  ? 344  SER A CB    1 
ATOM   2823 O  OG    . SER A 1 344 ? 13.541  43.368 33.025  1.00 25.85  ? 344  SER A OG    1 
ATOM   2824 N  N     . LEU A 1 345 ? 17.661  42.663 31.442  1.00 28.75  ? 345  LEU A N     1 
ATOM   2825 C  CA    . LEU A 1 345 ? 19.114  42.732 31.358  1.00 27.51  ? 345  LEU A CA    1 
ATOM   2826 C  C     . LEU A 1 345 ? 19.556  43.156 29.966  1.00 28.65  ? 345  LEU A C     1 
ATOM   2827 O  O     . LEU A 1 345 ? 20.440  44.003 29.820  1.00 28.14  ? 345  LEU A O     1 
ATOM   2828 C  CB    . LEU A 1 345 ? 19.744  41.393 31.737  1.00 29.50  ? 345  LEU A CB    1 
ATOM   2829 C  CG    . LEU A 1 345 ? 19.521  40.961 33.190  1.00 30.32  ? 345  LEU A CG    1 
ATOM   2830 C  CD1   . LEU A 1 345 ? 20.210  39.636 33.477  1.00 27.34  ? 345  LEU A CD1   1 
ATOM   2831 C  CD2   . LEU A 1 345 ? 19.995  42.042 34.156  1.00 30.53  ? 345  LEU A CD2   1 
ATOM   2832 N  N     . ASP A 1 346 ? 18.940  42.563 28.947  1.00 32.60  ? 346  ASP A N     1 
ATOM   2833 C  CA    . ASP A 1 346 ? 19.223  42.937 27.563  1.00 36.04  ? 346  ASP A CA    1 
ATOM   2834 C  C     . ASP A 1 346 ? 18.986  44.421 27.348  1.00 33.18  ? 346  ASP A C     1 
ATOM   2835 O  O     . ASP A 1 346 ? 19.907  45.160 27.009  1.00 36.03  ? 346  ASP A O     1 
ATOM   2836 C  CB    . ASP A 1 346 ? 18.359  42.134 26.591  1.00 39.56  ? 346  ASP A CB    1 
ATOM   2837 C  CG    . ASP A 1 346 ? 18.991  40.816 26.207  1.00 45.02  ? 346  ASP A CG    1 
ATOM   2838 O  OD1   . ASP A 1 346 ? 20.193  40.624 26.494  1.00 47.86  ? 346  ASP A OD1   1 
ATOM   2839 O  OD2   . ASP A 1 346 ? 18.287  39.976 25.607  1.00 47.45  ? 346  ASP A OD2   1 
ATOM   2840 N  N     . MET A 1 347 ? 17.745  44.846 27.558  1.00 28.73  ? 347  MET A N     1 
ATOM   2841 C  CA    . MET A 1 347 ? 17.365  46.240 27.400  1.00 28.18  ? 347  MET A CA    1 
ATOM   2842 C  C     . MET A 1 347 ? 18.233  47.165 28.241  1.00 27.97  ? 347  MET A C     1 
ATOM   2843 O  O     . MET A 1 347 ? 18.707  48.192 27.755  1.00 27.00  ? 347  MET A O     1 
ATOM   2844 C  CB    . MET A 1 347 ? 15.901  46.435 27.781  1.00 32.68  ? 347  MET A CB    1 
ATOM   2845 C  CG    . MET A 1 347 ? 14.909  46.067 26.692  1.00 36.65  ? 347  MET A CG    1 
ATOM   2846 S  SD    . MET A 1 347 ? 13.228  46.503 27.174  1.00 92.79  ? 347  MET A SD    1 
ATOM   2847 C  CE    . MET A 1 347 ? 13.494  48.137 27.857  1.00 31.71  ? 347  MET A CE    1 
ATOM   2848 N  N     . GLY A 1 348 ? 18.439  46.793 29.501  1.00 27.62  ? 348  GLY A N     1 
ATOM   2849 C  CA    . GLY A 1 348 ? 19.191  47.614 30.432  1.00 26.56  ? 348  GLY A CA    1 
ATOM   2850 C  C     . GLY A 1 348 ? 20.624  47.862 30.003  1.00 27.70  ? 348  GLY A C     1 
ATOM   2851 O  O     . GLY A 1 348 ? 21.091  49.004 29.982  1.00 25.60  ? 348  GLY A O     1 
ATOM   2852 N  N     . TYR A 1 349 ? 21.324  46.787 29.658  1.00 28.04  ? 349  TYR A N     1 
ATOM   2853 C  CA    . TYR A 1 349 ? 22.715  46.892 29.236  1.00 30.50  ? 349  TYR A CA    1 
ATOM   2854 C  C     . TYR A 1 349 ? 22.848  47.503 27.846  1.00 33.89  ? 349  TYR A C     1 
ATOM   2855 O  O     . TYR A 1 349 ? 23.876  48.098 27.517  1.00 36.68  ? 349  TYR A O     1 
ATOM   2856 C  CB    . TYR A 1 349 ? 23.401  45.526 29.310  1.00 27.51  ? 349  TYR A CB    1 
ATOM   2857 C  CG    . TYR A 1 349 ? 23.763  45.149 30.724  1.00 26.24  ? 349  TYR A CG    1 
ATOM   2858 C  CD1   . TYR A 1 349 ? 24.547  45.991 31.501  1.00 28.88  ? 349  TYR A CD1   1 
ATOM   2859 C  CD2   . TYR A 1 349 ? 23.303  43.970 31.294  1.00 24.78  ? 349  TYR A CD2   1 
ATOM   2860 C  CE1   . TYR A 1 349 ? 24.879  45.662 32.801  1.00 28.60  ? 349  TYR A CE1   1 
ATOM   2861 C  CE2   . TYR A 1 349 ? 23.631  43.630 32.595  1.00 25.19  ? 349  TYR A CE2   1 
ATOM   2862 C  CZ    . TYR A 1 349 ? 24.420  44.482 33.344  1.00 26.44  ? 349  TYR A CZ    1 
ATOM   2863 O  OH    . TYR A 1 349 ? 24.750  44.155 34.639  1.00 26.64  ? 349  TYR A OH    1 
ATOM   2864 N  N     . TYR A 1 350 ? 21.801  47.364 27.040  1.00 34.13  ? 350  TYR A N     1 
ATOM   2865 C  CA    . TYR A 1 350 ? 21.772  47.984 25.723  1.00 33.67  ? 350  TYR A CA    1 
ATOM   2866 C  C     . TYR A 1 350 ? 21.680  49.502 25.849  1.00 32.25  ? 350  TYR A C     1 
ATOM   2867 O  O     . TYR A 1 350 ? 22.373  50.235 25.145  1.00 35.54  ? 350  TYR A O     1 
ATOM   2868 C  CB    . TYR A 1 350 ? 20.596  47.455 24.897  1.00 33.50  ? 350  TYR A CB    1 
ATOM   2869 C  CG    . TYR A 1 350 ? 20.523  48.041 23.503  1.00 33.19  ? 350  TYR A CG    1 
ATOM   2870 C  CD1   . TYR A 1 350 ? 21.267  47.500 22.464  1.00 33.17  ? 350  TYR A CD1   1 
ATOM   2871 C  CD2   . TYR A 1 350 ? 19.713  49.136 23.226  1.00 31.64  ? 350  TYR A CD2   1 
ATOM   2872 C  CE1   . TYR A 1 350 ? 21.210  48.031 21.193  1.00 33.81  ? 350  TYR A CE1   1 
ATOM   2873 C  CE2   . TYR A 1 350 ? 19.646  49.674 21.954  1.00 32.03  ? 350  TYR A CE2   1 
ATOM   2874 C  CZ    . TYR A 1 350 ? 20.397  49.114 20.941  1.00 33.37  ? 350  TYR A CZ    1 
ATOM   2875 O  OH    . TYR A 1 350 ? 20.338  49.642 19.674  1.00 33.93  ? 350  TYR A OH    1 
ATOM   2876 N  N     . ALA A 1 351 ? 20.825  49.966 26.754  1.00 27.08  ? 351  ALA A N     1 
ATOM   2877 C  CA    . ALA A 1 351 ? 20.592  51.395 26.925  1.00 27.88  ? 351  ALA A CA    1 
ATOM   2878 C  C     . ALA A 1 351 ? 21.665  52.050 27.781  1.00 29.52  ? 351  ALA A C     1 
ATOM   2879 O  O     . ALA A 1 351 ? 21.837  53.270 27.736  1.00 27.93  ? 351  ALA A O     1 
ATOM   2880 C  CB    . ALA A 1 351 ? 19.212  51.643 27.534  1.00 24.84  ? 351  ALA A CB    1 
ATOM   2881 N  N     . LYS A 1 352 ? 22.382  51.231 28.549  1.00 29.93  ? 352  LYS A N     1 
ATOM   2882 C  CA    . LYS A 1 352 ? 23.311  51.712 29.573  1.00 29.10  ? 352  LYS A CA    1 
ATOM   2883 C  C     . LYS A 1 352 ? 22.574  52.542 30.627  1.00 32.58  ? 352  LYS A C     1 
ATOM   2884 O  O     . LYS A 1 352 ? 22.830  53.737 30.797  1.00 30.58  ? 352  LYS A O     1 
ATOM   2885 C  CB    . LYS A 1 352 ? 24.489  52.471 28.957  1.00 26.59  ? 352  LYS A CB    1 
ATOM   2886 C  CG    . LYS A 1 352 ? 25.365  51.586 28.083  1.00 28.21  ? 352  LYS A CG    1 
ATOM   2887 C  CD    . LYS A 1 352 ? 26.378  52.385 27.285  1.00 29.74  ? 352  LYS A CD    1 
ATOM   2888 C  CE    . LYS A 1 352 ? 27.188  51.463 26.387  1.00 33.63  ? 352  LYS A CE    1 
ATOM   2889 N  NZ    . LYS A 1 352 ? 28.028  52.212 25.409  1.00 38.40  ? 352  LYS A NZ    1 
ATOM   2890 N  N     . ILE A 1 353 ? 21.644  51.878 31.315  1.00 33.01  ? 353  ILE A N     1 
ATOM   2891 C  CA    . ILE A 1 353 ? 20.858  52.468 32.392  1.00 29.89  ? 353  ILE A CA    1 
ATOM   2892 C  C     . ILE A 1 353 ? 20.878  51.541 33.596  1.00 28.41  ? 353  ILE A C     1 
ATOM   2893 O  O     . ILE A 1 353 ? 21.356  50.407 33.509  1.00 25.26  ? 353  ILE A O     1 
ATOM   2894 C  CB    . ILE A 1 353 ? 19.378  52.634 31.990  1.00 28.66  ? 353  ILE A CB    1 
ATOM   2895 C  CG1   . ILE A 1 353 ? 18.795  51.289 31.545  1.00 29.47  ? 353  ILE A CG1   1 
ATOM   2896 C  CG2   . ILE A 1 353 ? 19.227  53.658 30.896  1.00 27.28  ? 353  ILE A CG2   1 
ATOM   2897 C  CD1   . ILE A 1 353 ? 17.373  51.370 31.043  1.00 31.78  ? 353  ILE A CD1   1 
ATOM   2898 N  N     . GLN A 1 354 ? 20.355  52.029 34.719  1.00 31.88  ? 354  GLN A N     1 
ATOM   2899 C  CA    . GLN A 1 354 ? 20.041  51.166 35.850  1.00 31.10  ? 354  GLN A CA    1 
ATOM   2900 C  C     . GLN A 1 354 ? 19.037  50.144 35.344  1.00 29.91  ? 354  GLN A C     1 
ATOM   2901 O  O     . GLN A 1 354 ? 18.101  50.502 34.624  1.00 27.44  ? 354  GLN A O     1 
ATOM   2902 C  CB    . GLN A 1 354 ? 19.412  51.966 36.992  1.00 28.55  ? 354  GLN A CB    1 
ATOM   2903 C  CG    . GLN A 1 354 ? 20.311  53.009 37.624  1.00 30.25  ? 354  GLN A CG    1 
ATOM   2904 C  CD    . GLN A 1 354 ? 19.608  53.774 38.730  1.00 36.12  ? 354  GLN A CD    1 
ATOM   2905 O  OE1   . GLN A 1 354 ? 18.527  54.329 38.526  1.00 37.90  ? 354  GLN A OE1   1 
ATOM   2906 N  NE2   . GLN A 1 354 ? 20.211  53.795 39.913  1.00 37.29  ? 354  GLN A NE2   1 
ATOM   2907 N  N     . ILE A 1 355 ? 19.226  48.880 35.709  1.00 27.92  ? 355  ILE A N     1 
ATOM   2908 C  CA    . ILE A 1 355 ? 18.366  47.820 35.195  1.00 26.14  ? 355  ILE A CA    1 
ATOM   2909 C  C     . ILE A 1 355 ? 16.891  48.096 35.480  1.00 25.38  ? 355  ILE A C     1 
ATOM   2910 O  O     . ILE A 1 355 ? 16.036  47.850 34.633  1.00 28.96  ? 355  ILE A O     1 
ATOM   2911 C  CB    . ILE A 1 355 ? 18.769  46.428 35.731  1.00 27.93  ? 355  ILE A CB    1 
ATOM   2912 C  CG1   . ILE A 1 355 ? 20.255  46.169 35.472  1.00 27.20  ? 355  ILE A CG1   1 
ATOM   2913 C  CG2   . ILE A 1 355 ? 17.921  45.335 35.080  1.00 26.67  ? 355  ILE A CG2   1 
ATOM   2914 C  CD1   . ILE A 1 355 ? 20.655  46.330 34.024  1.00 19.74  ? 355  ILE A CD1   1 
ATOM   2915 N  N     . GLN A 1 356 ? 16.599  48.648 36.653  1.00 23.08  ? 356  GLN A N     1 
ATOM   2916 C  CA    . GLN A 1 356 ? 15.215  48.937 37.020  1.00 24.27  ? 356  GLN A CA    1 
ATOM   2917 C  C     . GLN A 1 356 ? 14.564  50.004 36.135  1.00 25.50  ? 356  GLN A C     1 
ATOM   2918 O  O     . GLN A 1 356 ? 13.344  50.160 36.146  1.00 26.34  ? 356  GLN A O     1 
ATOM   2919 C  CB    . GLN A 1 356 ? 15.103  49.324 38.501  1.00 25.68  ? 356  GLN A CB    1 
ATOM   2920 C  CG    . GLN A 1 356 ? 15.774  50.640 38.886  1.00 23.71  ? 356  GLN A CG    1 
ATOM   2921 C  CD    . GLN A 1 356 ? 17.178  50.444 39.424  1.00 25.59  ? 356  GLN A CD    1 
ATOM   2922 O  OE1   . GLN A 1 356 ? 17.910  49.568 38.967  1.00 26.21  ? 356  GLN A OE1   1 
ATOM   2923 N  NE2   . GLN A 1 356 ? 17.559  51.257 40.405  1.00 23.23  ? 356  GLN A NE2   1 
ATOM   2924 N  N     . SER A 1 357 ? 15.373  50.730 35.365  1.00 26.94  ? 357  SER A N     1 
ATOM   2925 C  CA    . SER A 1 357 ? 14.847  51.778 34.491  1.00 27.72  ? 357  SER A CA    1 
ATOM   2926 C  C     . SER A 1 357 ? 14.196  51.228 33.229  1.00 27.28  ? 357  SER A C     1 
ATOM   2927 O  O     . SER A 1 357 ? 13.698  51.992 32.403  1.00 28.80  ? 357  SER A O     1 
ATOM   2928 C  CB    . SER A 1 357 ? 15.933  52.793 34.122  1.00 29.56  ? 357  SER A CB    1 
ATOM   2929 O  OG    . SER A 1 357 ? 16.287  53.582 35.243  1.00 33.00  ? 357  SER A OG    1 
ATOM   2930 N  N     . VAL A 1 358 ? 14.187  49.908 33.079  1.00 24.64  ? 358  VAL A N     1 
ATOM   2931 C  CA    . VAL A 1 358 ? 13.501  49.300 31.945  1.00 28.08  ? 358  VAL A CA    1 
ATOM   2932 C  C     . VAL A 1 358 ? 11.987  49.521 32.026  1.00 26.91  ? 358  VAL A C     1 
ATOM   2933 O  O     . VAL A 1 358 ? 11.273  49.354 31.038  1.00 27.32  ? 358  VAL A O     1 
ATOM   2934 C  CB    . VAL A 1 358 ? 13.825  47.794 31.793  1.00 30.54  ? 358  VAL A CB    1 
ATOM   2935 C  CG1   . VAL A 1 358 ? 15.319  47.592 31.533  1.00 31.90  ? 358  VAL A CG1   1 
ATOM   2936 C  CG2   . VAL A 1 358 ? 13.367  47.015 33.016  1.00 16.90  ? 358  VAL A CG2   1 
ATOM   2937 N  N     . PHE A 1 359 ? 11.504  49.905 33.204  1.00 24.44  ? 359  PHE A N     1 
ATOM   2938 C  CA    . PHE A 1 359 ? 10.100  50.264 33.363  1.00 26.57  ? 359  PHE A CA    1 
ATOM   2939 C  C     . PHE A 1 359 ? 9.812   51.638 32.784  1.00 28.83  ? 359  PHE A C     1 
ATOM   2940 O  O     . PHE A 1 359 ? 8.653   52.024 32.645  1.00 31.96  ? 359  PHE A O     1 
ATOM   2941 C  CB    . PHE A 1 359 ? 9.687   50.241 34.836  1.00 25.04  ? 359  PHE A CB    1 
ATOM   2942 C  CG    . PHE A 1 359 ? 9.678   48.869 35.441  1.00 23.43  ? 359  PHE A CG    1 
ATOM   2943 C  CD1   . PHE A 1 359 ? 8.802   47.898 34.975  1.00 23.68  ? 359  PHE A CD1   1 
ATOM   2944 C  CD2   . PHE A 1 359 ? 10.539  48.549 36.478  1.00 21.23  ? 359  PHE A CD2   1 
ATOM   2945 C  CE1   . PHE A 1 359 ? 8.788   46.629 35.529  1.00 25.35  ? 359  PHE A CE1   1 
ATOM   2946 C  CE2   . PHE A 1 359 ? 10.530  47.282 37.037  1.00 25.10  ? 359  PHE A CE2   1 
ATOM   2947 C  CZ    . PHE A 1 359 ? 9.652   46.321 36.563  1.00 25.22  ? 359  PHE A CZ    1 
ATOM   2948 N  N     . SER A 1 360 ? 10.865  52.383 32.462  1.00 27.13  ? 360  SER A N     1 
ATOM   2949 C  CA    . SER A 1 360 ? 10.699  53.708 31.873  1.00 22.76  ? 360  SER A CA    1 
ATOM   2950 C  C     . SER A 1 360 ? 11.312  53.783 30.484  1.00 23.42  ? 360  SER A C     1 
ATOM   2951 O  O     . SER A 1 360 ? 12.524  53.939 30.344  1.00 25.60  ? 360  SER A O     1 
ATOM   2952 C  CB    . SER A 1 360 ? 11.311  54.784 32.767  1.00 20.64  ? 360  SER A CB    1 
ATOM   2953 O  OG    . SER A 1 360 ? 11.298  56.040 32.114  1.00 22.04  ? 360  SER A OG    1 
ATOM   2954 N  N     . PRO A 1 361 ? 10.473  53.671 29.446  1.00 24.79  ? 361  PRO A N     1 
ATOM   2955 C  CA    . PRO A 1 361 ? 10.938  53.796 28.062  1.00 26.16  ? 361  PRO A CA    1 
ATOM   2956 C  C     . PRO A 1 361 ? 11.547  55.168 27.796  1.00 25.44  ? 361  PRO A C     1 
ATOM   2957 O  O     . PRO A 1 361 ? 12.478  55.280 27.000  1.00 25.59  ? 361  PRO A O     1 
ATOM   2958 C  CB    . PRO A 1 361 ? 9.657   53.618 27.243  1.00 23.39  ? 361  PRO A CB    1 
ATOM   2959 C  CG    . PRO A 1 361 ? 8.547   53.911 28.193  1.00 23.11  ? 361  PRO A CG    1 
ATOM   2960 C  CD    . PRO A 1 361 ? 9.026   53.419 29.517  1.00 22.76  ? 361  PRO A CD    1 
ATOM   2961 N  N     . ILE A 1 362 ? 11.031  56.196 28.460  1.00 23.63  ? 362  ILE A N     1 
ATOM   2962 C  CA    . ILE A 1 362 ? 11.588  57.533 28.304  1.00 25.64  ? 362  ILE A CA    1 
ATOM   2963 C  C     . ILE A 1 362 ? 13.021  57.585 28.820  1.00 27.02  ? 362  ILE A C     1 
ATOM   2964 O  O     . ILE A 1 362 ? 13.921  58.063 28.126  1.00 26.62  ? 362  ILE A O     1 
ATOM   2965 C  CB    . ILE A 1 362 ? 10.725  58.603 28.995  1.00 22.61  ? 362  ILE A CB    1 
ATOM   2966 C  CG1   . ILE A 1 362 ? 9.485   58.895 28.149  1.00 20.05  ? 362  ILE A CG1   1 
ATOM   2967 C  CG2   . ILE A 1 362 ? 11.523  59.884 29.212  1.00 18.49  ? 362  ILE A CG2   1 
ATOM   2968 C  CD1   . ILE A 1 362 ? 8.572   59.953 28.731  1.00 20.69  ? 362  ILE A CD1   1 
ATOM   2969 N  N     . LYS A 1 363 ? 13.230  57.080 30.032  1.00 26.37  ? 363  LYS A N     1 
ATOM   2970 C  CA    . LYS A 1 363 ? 14.571  56.994 30.599  1.00 26.50  ? 363  LYS A CA    1 
ATOM   2971 C  C     . LYS A 1 363 ? 15.446  56.103 29.729  1.00 23.70  ? 363  LYS A C     1 
ATOM   2972 O  O     . LYS A 1 363 ? 16.600  56.429 29.453  1.00 25.95  ? 363  LYS A O     1 
ATOM   2973 C  CB    . LYS A 1 363 ? 14.522  56.443 32.023  1.00 28.97  ? 363  LYS A CB    1 
ATOM   2974 C  CG    . LYS A 1 363 ? 15.891  56.227 32.642  1.00 31.37  ? 363  LYS A CG    1 
ATOM   2975 C  CD    . LYS A 1 363 ? 16.672  57.530 32.730  1.00 32.20  ? 363  LYS A CD    1 
ATOM   2976 C  CE    . LYS A 1 363 ? 16.020  58.499 33.703  1.00 34.67  ? 363  LYS A CE    1 
ATOM   2977 N  NZ    . LYS A 1 363 ? 16.885  59.683 33.977  1.00 35.59  ? 363  LYS A NZ    1 
ATOM   2978 N  N     . THR A 1 364 ? 14.879  54.980 29.301  1.00 20.72  ? 364  THR A N     1 
ATOM   2979 C  CA    . THR A 1 364 ? 15.573  54.040 28.435  1.00 22.52  ? 364  THR A CA    1 
ATOM   2980 C  C     . THR A 1 364 ? 16.034  54.719 27.153  1.00 26.72  ? 364  THR A C     1 
ATOM   2981 O  O     . THR A 1 364 ? 17.193  54.593 26.758  1.00 29.32  ? 364  THR A O     1 
ATOM   2982 C  CB    . THR A 1 364 ? 14.670  52.848 28.071  1.00 20.90  ? 364  THR A CB    1 
ATOM   2983 O  OG1   . THR A 1 364 ? 14.308  52.144 29.263  1.00 20.95  ? 364  THR A OG1   1 
ATOM   2984 C  CG2   . THR A 1 364 ? 15.390  51.898 27.128  1.00 20.30  ? 364  THR A CG2   1 
ATOM   2985 N  N     . TRP A 1 365 ? 15.128  55.452 26.511  1.00 26.90  ? 365  TRP A N     1 
ATOM   2986 C  CA    . TRP A 1 365 ? 15.449  56.108 25.246  1.00 26.80  ? 365  TRP A CA    1 
ATOM   2987 C  C     . TRP A 1 365 ? 16.352  57.329 25.408  1.00 27.34  ? 365  TRP A C     1 
ATOM   2988 O  O     . TRP A 1 365 ? 17.209  57.591 24.559  1.00 26.04  ? 365  TRP A O     1 
ATOM   2989 C  CB    . TRP A 1 365 ? 14.178  56.481 24.483  1.00 24.66  ? 365  TRP A CB    1 
ATOM   2990 C  CG    . TRP A 1 365 ? 13.587  55.327 23.738  1.00 23.33  ? 365  TRP A CG    1 
ATOM   2991 C  CD1   . TRP A 1 365 ? 12.376  54.741 23.959  1.00 23.42  ? 365  TRP A CD1   1 
ATOM   2992 C  CD2   . TRP A 1 365 ? 14.187  54.612 22.650  1.00 23.58  ? 365  TRP A CD2   1 
ATOM   2993 N  NE1   . TRP A 1 365 ? 12.181  53.709 23.073  1.00 24.02  ? 365  TRP A NE1   1 
ATOM   2994 C  CE2   . TRP A 1 365 ? 13.278  53.610 22.260  1.00 24.05  ? 365  TRP A CE2   1 
ATOM   2995 C  CE3   . TRP A 1 365 ? 15.402  54.726 21.967  1.00 24.13  ? 365  TRP A CE3   1 
ATOM   2996 C  CZ2   . TRP A 1 365 ? 13.545  52.726 21.218  1.00 24.56  ? 365  TRP A CZ2   1 
ATOM   2997 C  CZ3   . TRP A 1 365 ? 15.666  53.849 20.935  1.00 24.24  ? 365  TRP A CZ3   1 
ATOM   2998 C  CH2   . TRP A 1 365 ? 14.741  52.860 20.570  1.00 26.27  ? 365  TRP A CH2   1 
ATOM   2999 N  N     . ASP A 1 366 ? 16.159  58.071 26.494  1.00 27.46  ? 366  ASP A N     1 
ATOM   3000 C  CA    . ASP A 1 366 ? 17.005  59.220 26.780  1.00 25.96  ? 366  ASP A CA    1 
ATOM   3001 C  C     . ASP A 1 366 ? 18.465  58.786 26.827  1.00 29.88  ? 366  ASP A C     1 
ATOM   3002 O  O     . ASP A 1 366 ? 19.342  59.477 26.316  1.00 33.34  ? 366  ASP A O     1 
ATOM   3003 C  CB    . ASP A 1 366 ? 16.603  59.888 28.098  1.00 23.60  ? 366  ASP A CB    1 
ATOM   3004 C  CG    . ASP A 1 366 ? 17.262  61.241 28.290  1.00 28.55  ? 366  ASP A CG    1 
ATOM   3005 O  OD1   . ASP A 1 366 ? 17.324  62.020 27.316  1.00 33.25  ? 366  ASP A OD1   1 
ATOM   3006 O  OD2   . ASP A 1 366 ? 17.731  61.526 29.413  1.00 29.37  ? 366  ASP A OD2   1 
ATOM   3007 N  N     . ALA A 1 367 ? 18.715  57.621 27.415  1.00 28.80  ? 367  ALA A N     1 
ATOM   3008 C  CA    . ALA A 1 367 ? 20.077  57.111 27.535  1.00 29.75  ? 367  ALA A CA    1 
ATOM   3009 C  C     . ALA A 1 367 ? 20.616  56.553 26.222  1.00 28.67  ? 367  ALA A C     1 
ATOM   3010 O  O     . ALA A 1 367 ? 21.792  56.728 25.911  1.00 27.54  ? 367  ALA A O     1 
ATOM   3011 C  CB    . ALA A 1 367 ? 20.155  56.067 28.623  1.00 27.00  ? 367  ALA A CB    1 
ATOM   3012 N  N     . ILE A 1 368 ? 19.760  55.874 25.462  1.00 28.82  ? 368  ILE A N     1 
ATOM   3013 C  CA    . ILE A 1 368 ? 20.154  55.323 24.167  1.00 26.93  ? 368  ILE A CA    1 
ATOM   3014 C  C     . ILE A 1 368 ? 20.538  56.445 23.219  1.00 28.30  ? 368  ILE A C     1 
ATOM   3015 O  O     . ILE A 1 368 ? 21.596  56.410 22.593  1.00 30.95  ? 368  ILE A O     1 
ATOM   3016 C  CB    . ILE A 1 368 ? 19.014  54.519 23.527  1.00 25.08  ? 368  ILE A CB    1 
ATOM   3017 C  CG1   . ILE A 1 368 ? 18.788  53.214 24.291  1.00 25.10  ? 368  ILE A CG1   1 
ATOM   3018 C  CG2   . ILE A 1 368 ? 19.323  54.233 22.065  1.00 24.00  ? 368  ILE A CG2   1 
ATOM   3019 C  CD1   . ILE A 1 368 ? 17.568  52.443 23.837  1.00 23.55  ? 368  ILE A CD1   1 
ATOM   3020 N  N     . ILE A 1 369 ? 19.666  57.441 23.126  1.00 27.84  ? 369  ILE A N     1 
ATOM   3021 C  CA    . ILE A 1 369 ? 19.903  58.593 22.271  1.00 27.60  ? 369  ILE A CA    1 
ATOM   3022 C  C     . ILE A 1 369 ? 21.115  59.385 22.753  1.00 28.03  ? 369  ILE A C     1 
ATOM   3023 O  O     . ILE A 1 369 ? 21.944  59.815 21.948  1.00 28.35  ? 369  ILE A O     1 
ATOM   3024 C  CB    . ILE A 1 369 ? 18.663  59.497 22.214  1.00 26.80  ? 369  ILE A CB    1 
ATOM   3025 C  CG1   . ILE A 1 369 ? 17.520  58.763 21.510  1.00 24.45  ? 369  ILE A CG1   1 
ATOM   3026 C  CG2   . ILE A 1 369 ? 18.978  60.796 21.500  1.00 27.56  ? 369  ILE A CG2   1 
ATOM   3027 C  CD1   . ILE A 1 369 ? 16.214  59.503 21.546  1.00 24.57  ? 369  ILE A CD1   1 
ATOM   3028 N  N     . PHE A 1 370 ? 21.225  59.560 24.067  1.00 27.84  ? 370  PHE A N     1 
ATOM   3029 C  CA    . PHE A 1 370 ? 22.370  60.261 24.637  1.00 28.99  ? 370  PHE A CA    1 
ATOM   3030 C  C     . PHE A 1 370 ? 23.682  59.572 24.291  1.00 29.10  ? 370  PHE A C     1 
ATOM   3031 O  O     . PHE A 1 370 ? 24.618  60.217 23.832  1.00 33.37  ? 370  PHE A O     1 
ATOM   3032 C  CB    . PHE A 1 370 ? 22.240  60.414 26.153  1.00 30.91  ? 370  PHE A CB    1 
ATOM   3033 C  CG    . PHE A 1 370 ? 23.557  60.567 26.860  1.00 33.55  ? 370  PHE A CG    1 
ATOM   3034 C  CD1   . PHE A 1 370 ? 24.009  59.583 27.721  1.00 34.15  ? 370  PHE A CD1   1 
ATOM   3035 C  CD2   . PHE A 1 370 ? 24.353  61.684 26.649  1.00 36.77  ? 370  PHE A CD2   1 
ATOM   3036 C  CE1   . PHE A 1 370 ? 25.225  59.713 28.369  1.00 35.64  ? 370  PHE A CE1   1 
ATOM   3037 C  CE2   . PHE A 1 370 ? 25.574  61.818 27.292  1.00 38.00  ? 370  PHE A CE2   1 
ATOM   3038 C  CZ    . PHE A 1 370 ? 26.010  60.831 28.154  1.00 36.72  ? 370  PHE A CZ    1 
ATOM   3039 N  N     . ASN A 1 371 ? 23.751  58.265 24.515  1.00 28.49  ? 371  ASN A N     1 
ATOM   3040 C  CA    . ASN A 1 371 ? 24.961  57.516 24.186  1.00 31.42  ? 371  ASN A CA    1 
ATOM   3041 C  C     . ASN A 1 371 ? 25.284  57.579 22.696  1.00 37.11  ? 371  ASN A C     1 
ATOM   3042 O  O     . ASN A 1 371 ? 26.448  57.675 22.307  1.00 39.55  ? 371  ASN A O     1 
ATOM   3043 C  CB    . ASN A 1 371 ? 24.856  56.063 24.652  1.00 28.79  ? 371  ASN A CB    1 
ATOM   3044 C  CG    . ASN A 1 371 ? 25.134  55.905 26.136  1.00 31.40  ? 371  ASN A CG    1 
ATOM   3045 O  OD1   . ASN A 1 371 ? 26.287  55.927 26.566  1.00 31.47  ? 371  ASN A OD1   1 
ATOM   3046 N  ND2   . ASN A 1 371 ? 24.079  55.739 26.925  1.00 31.31  ? 371  ASN A ND2   1 
ATOM   3047 N  N     . SER A 1 372 ? 24.244  57.541 21.868  1.00 35.97  ? 372  SER A N     1 
ATOM   3048 C  CA    . SER A 1 372 ? 24.410  57.594 20.423  1.00 33.16  ? 372  SER A CA    1 
ATOM   3049 C  C     . SER A 1 372 ? 24.966  58.945 19.985  1.00 36.21  ? 372  SER A C     1 
ATOM   3050 O  O     . SER A 1 372 ? 25.777  59.021 19.064  1.00 38.07  ? 372  SER A O     1 
ATOM   3051 C  CB    . SER A 1 372 ? 23.076  57.327 19.732  1.00 33.23  ? 372  SER A CB    1 
ATOM   3052 O  OG    . SER A 1 372 ? 23.226  57.262 18.324  1.00 36.46  ? 372  SER A OG    1 
ATOM   3053 N  N     . LEU A 1 373 ? 24.523  60.008 20.648  1.00 37.16  ? 373  LEU A N     1 
ATOM   3054 C  CA    . LEU A 1 373 ? 24.971  61.358 20.326  1.00 37.44  ? 373  LEU A CA    1 
ATOM   3055 C  C     . LEU A 1 373 ? 26.361  61.643 20.889  1.00 39.40  ? 373  LEU A C     1 
ATOM   3056 O  O     . LEU A 1 373 ? 27.165  62.343 20.267  1.00 39.40  ? 373  LEU A O     1 
ATOM   3057 C  CB    . LEU A 1 373 ? 23.970  62.385 20.848  1.00 35.74  ? 373  LEU A CB    1 
ATOM   3058 C  CG    . LEU A 1 373 ? 22.622  62.376 20.127  1.00 36.59  ? 373  LEU A CG    1 
ATOM   3059 C  CD1   . LEU A 1 373 ? 21.634  63.315 20.799  1.00 35.05  ? 373  LEU A CD1   1 
ATOM   3060 C  CD2   . LEU A 1 373 ? 22.813  62.747 18.667  1.00 37.07  ? 373  LEU A CD2   1 
ATOM   3061 N  N     . LYS A 1 374 ? 26.637  61.101 22.070  1.00 40.33  ? 374  LYS A N     1 
ATOM   3062 C  CA    . LYS A 1 374 ? 27.949  61.244 22.690  1.00 44.35  ? 374  LYS A CA    1 
ATOM   3063 C  C     . LYS A 1 374 ? 29.028  60.624 21.806  1.00 50.19  ? 374  LYS A C     1 
ATOM   3064 O  O     . LYS A 1 374 ? 30.174  61.074 21.799  1.00 54.09  ? 374  LYS A O     1 
ATOM   3065 C  CB    . LYS A 1 374 ? 27.957  60.616 24.090  1.00 42.32  ? 374  LYS A CB    1 
ATOM   3066 C  CG    . LYS A 1 374 ? 29.339  60.470 24.707  1.00 44.08  ? 374  LYS A CG    1 
ATOM   3067 C  CD    . LYS A 1 374 ? 29.254  60.213 26.197  1.00 45.28  ? 374  LYS A CD    1 
ATOM   3068 C  CE    . LYS A 1 374 ? 30.553  59.639 26.732  1.00 47.89  ? 374  LYS A CE    1 
ATOM   3069 N  NZ    . LYS A 1 374 ? 30.794  58.258 26.222  1.00 50.23  ? 374  LYS A NZ    1 
ATOM   3070 N  N     . GLU A 1 375 ? 28.642  59.599 21.050  1.00 53.77  ? 375  GLU A N     1 
ATOM   3071 C  CA    . GLU A 1 375 ? 29.537  58.940 20.103  1.00 59.57  ? 375  GLU A CA    1 
ATOM   3072 C  C     . GLU A 1 375 ? 30.098  59.910 19.069  1.00 58.86  ? 375  GLU A C     1 
ATOM   3073 O  O     . GLU A 1 375 ? 31.261  59.808 18.679  1.00 60.44  ? 375  GLU A O     1 
ATOM   3074 C  CB    . GLU A 1 375 ? 28.807  57.801 19.386  1.00 65.01  ? 375  GLU A CB    1 
ATOM   3075 C  CG    . GLU A 1 375 ? 29.031  56.433 20.000  1.00 73.11  ? 375  GLU A CG    1 
ATOM   3076 C  CD    . GLU A 1 375 ? 30.456  55.945 19.818  1.00 83.40  ? 375  GLU A CD    1 
ATOM   3077 O  OE1   . GLU A 1 375 ? 31.045  55.438 20.798  1.00 87.24  ? 375  GLU A OE1   1 
ATOM   3078 O  OE2   . GLU A 1 375 ? 30.986  56.069 18.691  1.00 86.66  ? 375  GLU A OE2   1 
ATOM   3079 N  N     . GLN A 1 376 ? 29.264  60.847 18.629  1.00 55.48  ? 376  GLN A N     1 
ATOM   3080 C  CA    . GLN A 1 376 ? 29.651  61.794 17.590  1.00 54.71  ? 376  GLN A CA    1 
ATOM   3081 C  C     . GLN A 1 376 ? 30.065  63.139 18.181  1.00 54.20  ? 376  GLN A C     1 
ATOM   3082 O  O     . GLN A 1 376 ? 30.023  64.161 17.496  1.00 56.21  ? 376  GLN A O     1 
ATOM   3083 C  CB    . GLN A 1 376 ? 28.497  61.996 16.608  1.00 56.03  ? 376  GLN A CB    1 
ATOM   3084 C  CG    . GLN A 1 376 ? 27.837  60.706 16.145  1.00 58.57  ? 376  GLN A CG    1 
ATOM   3085 C  CD    . GLN A 1 376 ? 26.538  60.951 15.399  1.00 62.46  ? 376  GLN A CD    1 
ATOM   3086 O  OE1   . GLN A 1 376 ? 25.489  60.420 15.766  1.00 63.58  ? 376  GLN A OE1   1 
ATOM   3087 N  NE2   . GLN A 1 376 ? 26.601  61.758 14.345  1.00 64.31  ? 376  GLN A NE2   1 
ATOM   3088 N  N     . ASN A 1 377 ? 30.462  63.127 19.452  1.00 53.07  ? 377  ASN A N     1 
ATOM   3089 C  CA    . ASN A 1 377 ? 30.819  64.345 20.178  1.00 54.32  ? 377  ASN A CA    1 
ATOM   3090 C  C     . ASN A 1 377 ? 29.714  65.401 20.141  1.00 52.00  ? 377  ASN A C     1 
ATOM   3091 O  O     . ASN A 1 377 ? 29.985  66.604 20.148  1.00 52.79  ? 377  ASN A O     1 
ATOM   3092 C  CB    . ASN A 1 377 ? 32.139  64.922 19.663  1.00 58.80  ? 377  ASN A CB    1 
ATOM   3093 C  CG    . ASN A 1 377 ? 33.311  63.995 19.912  1.00 66.52  ? 377  ASN A CG    1 
ATOM   3094 O  OD1   . ASN A 1 377 ? 33.354  63.288 20.919  1.00 68.29  ? 377  ASN A OD1   1 
ATOM   3095 N  ND2   . ASN A 1 377 ? 34.269  63.990 18.990  1.00 70.91  ? 377  ASN A ND2   1 
ATOM   3096 N  N     . LYS A 1 378 ? 28.469  64.937 20.102  1.00 46.36  ? 378  LYS A N     1 
ATOM   3097 C  CA    . LYS A 1 378 ? 27.321  65.827 20.048  1.00 40.50  ? 378  LYS A CA    1 
ATOM   3098 C  C     . LYS A 1 378 ? 26.713  66.009 21.429  1.00 38.30  ? 378  LYS A C     1 
ATOM   3099 O  O     . LYS A 1 378 ? 26.845  65.146 22.296  1.00 39.64  ? 378  LYS A O     1 
ATOM   3100 C  CB    . LYS A 1 378 ? 26.279  65.302 19.065  1.00 37.34  ? 378  LYS A CB    1 
ATOM   3101 C  CG    . LYS A 1 378 ? 26.772  65.274 17.634  1.00 39.66  ? 378  LYS A CG    1 
ATOM   3102 C  CD    . LYS A 1 378 ? 25.686  64.807 16.684  1.00 44.40  ? 378  LYS A CD    1 
ATOM   3103 C  CE    . LYS A 1 378 ? 26.122  64.955 15.236  1.00 48.36  ? 378  LYS A CE    1 
ATOM   3104 N  NZ    . LYS A 1 378 ? 25.114  64.394 14.295  1.00 50.75  ? 378  LYS A NZ    1 
ATOM   3105 N  N     . VAL A 1 379 ? 26.049  67.141 21.626  1.00 36.05  ? 379  VAL A N     1 
ATOM   3106 C  CA    . VAL A 1 379 ? 25.550  67.520 22.939  1.00 35.56  ? 379  VAL A CA    1 
ATOM   3107 C  C     . VAL A 1 379 ? 24.024  67.530 22.971  1.00 35.61  ? 379  VAL A C     1 
ATOM   3108 O  O     . VAL A 1 379 ? 23.386  68.182 22.145  1.00 38.24  ? 379  VAL A O     1 
ATOM   3109 C  CB    . VAL A 1 379 ? 26.080  68.912 23.339  1.00 36.08  ? 379  VAL A CB    1 
ATOM   3110 C  CG1   . VAL A 1 379 ? 25.623  69.269 24.736  1.00 38.05  ? 379  VAL A CG1   1 
ATOM   3111 C  CG2   . VAL A 1 379 ? 27.600  68.947 23.246  1.00 31.45  ? 379  VAL A CG2   1 
ATOM   3112 N  N     . ILE A 1 380 ? 23.443  66.806 23.923  1.00 32.59  ? 380  ILE A N     1 
ATOM   3113 C  CA    . ILE A 1 380 ? 21.989  66.699 24.017  1.00 30.78  ? 380  ILE A CA    1 
ATOM   3114 C  C     . ILE A 1 380 ? 21.373  67.993 24.550  1.00 31.54  ? 380  ILE A C     1 
ATOM   3115 O  O     . ILE A 1 380 ? 22.003  68.707 25.330  1.00 32.01  ? 380  ILE A O     1 
ATOM   3116 C  CB    . ILE A 1 380 ? 21.554  65.494 24.894  1.00 32.70  ? 380  ILE A CB    1 
ATOM   3117 C  CG1   . ILE A 1 380 ? 21.938  65.712 26.358  1.00 30.26  ? 380  ILE A CG1   1 
ATOM   3118 C  CG2   . ILE A 1 380 ? 22.161  64.199 24.369  1.00 31.03  ? 380  ILE A CG2   1 
ATOM   3119 C  CD1   . ILE A 1 380 ? 21.536  64.569 27.255  1.00 28.77  ? 380  ILE A CD1   1 
ATOM   3120 N  N     . PRO A 1 381 ? 20.142  68.310 24.114  1.00 31.67  ? 381  PRO A N     1 
ATOM   3121 C  CA    . PRO A 1 381 ? 19.468  69.533 24.563  1.00 30.64  ? 381  PRO A CA    1 
ATOM   3122 C  C     . PRO A 1 381 ? 18.991  69.415 26.004  1.00 30.66  ? 381  PRO A C     1 
ATOM   3123 O  O     . PRO A 1 381 ? 18.807  68.305 26.499  1.00 29.81  ? 381  PRO A O     1 
ATOM   3124 C  CB    . PRO A 1 381 ? 18.266  69.624 23.623  1.00 23.22  ? 381  PRO A CB    1 
ATOM   3125 C  CG    . PRO A 1 381 ? 17.975  68.230 23.269  1.00 22.81  ? 381  PRO A CG    1 
ATOM   3126 C  CD    . PRO A 1 381 ? 19.311  67.551 23.166  1.00 30.95  ? 381  PRO A CD    1 
ATOM   3127 N  N     . GLN A 1 382 ? 18.795  70.549 26.670  1.00 32.83  ? 382  GLN A N     1 
ATOM   3128 C  CA    . GLN A 1 382 ? 18.259  70.539 28.024  1.00 34.09  ? 382  GLN A CA    1 
ATOM   3129 C  C     . GLN A 1 382 ? 16.785  70.160 27.989  1.00 32.59  ? 382  GLN A C     1 
ATOM   3130 O  O     . GLN A 1 382 ? 16.062  70.542 27.069  1.00 34.33  ? 382  GLN A O     1 
ATOM   3131 C  CB    . GLN A 1 382 ? 18.428  71.909 28.694  1.00 36.64  ? 382  GLN A CB    1 
ATOM   3132 C  CG    . GLN A 1 382 ? 18.116  71.904 30.189  1.00 37.24  ? 382  GLN A CG    1 
ATOM   3133 C  CD    . GLN A 1 382 ? 18.345  73.251 30.857  1.00 40.22  ? 382  GLN A CD    1 
ATOM   3134 O  OE1   . GLN A 1 382 ? 18.239  74.303 30.224  1.00 40.73  ? 382  GLN A OE1   1 
ATOM   3135 N  NE2   . GLN A 1 382 ? 18.660  73.221 32.147  1.00 42.30  ? 382  GLN A NE2   1 
ATOM   3136 N  N     . GLY A 1 383 ? 16.347  69.393 28.981  1.00 31.78  ? 383  GLY A N     1 
ATOM   3137 C  CA    . GLY A 1 383 ? 14.941  69.073 29.112  1.00 33.15  ? 383  GLY A CA    1 
ATOM   3138 C  C     . GLY A 1 383 ? 14.185  70.347 29.404  1.00 39.68  ? 383  GLY A C     1 
ATOM   3139 O  O     . GLY A 1 383 ? 14.651  71.187 30.172  1.00 42.52  ? 383  GLY A O     1 
ATOM   3140 N  N     . ARG A 1 384 ? 13.027  70.510 28.777  1.00 43.42  ? 384  ARG A N     1 
ATOM   3141 C  CA    . ARG A 1 384 ? 12.228  71.711 28.985  1.00 44.33  ? 384  ARG A CA    1 
ATOM   3142 C  C     . ARG A 1 384 ? 10.847  71.386 29.530  1.00 42.27  ? 384  ARG A C     1 
ATOM   3143 O  O     . ARG A 1 384 ? 10.395  70.243 29.481  1.00 40.68  ? 384  ARG A O     1 
ATOM   3144 C  CB    . ARG A 1 384 ? 12.113  72.516 27.691  1.00 47.30  ? 384  ARG A CB    1 
ATOM   3145 C  CG    . ARG A 1 384 ? 13.400  73.204 27.276  1.00 54.62  ? 384  ARG A CG    1 
ATOM   3146 C  CD    . ARG A 1 384 ? 13.292  73.721 25.857  1.00 63.89  ? 384  ARG A CD    1 
ATOM   3147 N  NE    . ARG A 1 384 ? 12.980  72.640 24.925  1.00 72.61  ? 384  ARG A NE    1 
ATOM   3148 C  CZ    . ARG A 1 384 ? 12.568  72.823 23.674  1.00 77.80  ? 384  ARG A CZ    1 
ATOM   3149 N  NH1   . ARG A 1 384 ? 12.410  74.051 23.198  1.00 78.52  ? 384  ARG A NH1   1 
ATOM   3150 N  NH2   . ARG A 1 384 ? 12.309  71.776 22.901  1.00 79.25  ? 384  ARG A NH2   1 
ATOM   3151 N  N     . SER A 1 385 ? 10.188  72.405 30.063  1.00 43.42  ? 385  SER A N     1 
ATOM   3152 C  CA    . SER A 1 385 ? 8.836   72.261 30.568  1.00 43.29  ? 385  SER A CA    1 
ATOM   3153 C  C     . SER A 1 385 ? 7.861   72.533 29.436  1.00 40.60  ? 385  SER A C     1 
ATOM   3154 O  O     . SER A 1 385 ? 8.034   73.483 28.675  1.00 43.63  ? 385  SER A O     1 
ATOM   3155 C  CB    . SER A 1 385 ? 8.595   73.238 31.720  1.00 46.65  ? 385  SER A CB    1 
ATOM   3156 O  OG    . SER A 1 385 ? 7.289   73.097 32.251  1.00 48.65  ? 385  SER A OG    1 
ATOM   3157 N  N     . HIS A 1 386 ? 6.846   71.688 29.314  1.00 38.87  ? 386  HIS A N     1 
ATOM   3158 C  CA    . HIS A 1 386 ? 5.820   71.874 28.296  1.00 38.64  ? 386  HIS A CA    1 
ATOM   3159 C  C     . HIS A 1 386 ? 4.444   71.572 28.868  1.00 36.92  ? 386  HIS A C     1 
ATOM   3160 O  O     . HIS A 1 386 ? 4.290   70.656 29.676  1.00 36.91  ? 386  HIS A O     1 
ATOM   3161 C  CB    . HIS A 1 386 ? 6.070   70.966 27.089  1.00 39.52  ? 386  HIS A CB    1 
ATOM   3162 C  CG    . HIS A 1 386 ? 7.387   71.190 26.417  1.00 40.45  ? 386  HIS A CG    1 
ATOM   3163 N  ND1   . HIS A 1 386 ? 8.466   70.352 26.599  1.00 40.64  ? 386  HIS A ND1   1 
ATOM   3164 C  CD2   . HIS A 1 386 ? 7.796   72.150 25.555  1.00 44.02  ? 386  HIS A CD2   1 
ATOM   3165 C  CE1   . HIS A 1 386 ? 9.485   70.788 25.880  1.00 44.13  ? 386  HIS A CE1   1 
ATOM   3166 N  NE2   . HIS A 1 386 ? 9.105   71.877 25.237  1.00 47.36  ? 386  HIS A NE2   1 
ATOM   3167 N  N     . PRO A 1 387 ? 3.433   72.341 28.446  1.00 35.53  ? 387  PRO A N     1 
ATOM   3168 C  CA    . PRO A 1 387 ? 2.054   72.044 28.835  1.00 35.36  ? 387  PRO A CA    1 
ATOM   3169 C  C     . PRO A 1 387 ? 1.550   70.821 28.076  1.00 38.03  ? 387  PRO A C     1 
ATOM   3170 O  O     . PRO A 1 387 ? 1.902   70.645 26.909  1.00 39.05  ? 387  PRO A O     1 
ATOM   3171 C  CB    . PRO A 1 387 ? 1.296   73.291 28.384  1.00 33.62  ? 387  PRO A CB    1 
ATOM   3172 C  CG    . PRO A 1 387 ? 2.088   73.811 27.241  1.00 34.44  ? 387  PRO A CG    1 
ATOM   3173 C  CD    . PRO A 1 387 ? 3.522   73.523 27.572  1.00 34.74  ? 387  PRO A CD    1 
ATOM   3174 N  N     . VAL A 1 388 ? 0.753   69.983 28.731  1.00 37.72  ? 388  VAL A N     1 
ATOM   3175 C  CA    . VAL A 1 388 ? 0.184   68.813 28.070  1.00 34.94  ? 388  VAL A CA    1 
ATOM   3176 C  C     . VAL A 1 388 ? -0.904  69.233 27.089  1.00 36.75  ? 388  VAL A C     1 
ATOM   3177 O  O     . VAL A 1 388 ? -1.788  70.017 27.429  1.00 38.98  ? 388  VAL A O     1 
ATOM   3178 C  CB    . VAL A 1 388 ? -0.401  67.809 29.079  1.00 29.23  ? 388  VAL A CB    1 
ATOM   3179 C  CG1   . VAL A 1 388 ? -1.032  66.629 28.352  1.00 24.57  ? 388  VAL A CG1   1 
ATOM   3180 C  CG2   . VAL A 1 388 ? 0.679   67.332 30.032  1.00 29.21  ? 388  VAL A CG2   1 
ATOM   3181 N  N     . GLN A 1 389 ? -0.824  68.719 25.867  1.00 36.27  ? 389  GLN A N     1 
ATOM   3182 C  CA    . GLN A 1 389 ? -1.829  68.999 24.853  1.00 37.70  ? 389  GLN A CA    1 
ATOM   3183 C  C     . GLN A 1 389 ? -2.295  67.711 24.196  1.00 33.27  ? 389  GLN A C     1 
ATOM   3184 O  O     . GLN A 1 389 ? -1.493  66.819 23.934  1.00 31.23  ? 389  GLN A O     1 
ATOM   3185 C  CB    . GLN A 1 389 ? -1.269  69.927 23.776  1.00 46.06  ? 389  GLN A CB    1 
ATOM   3186 C  CG    . GLN A 1 389 ? -0.784  71.272 24.273  1.00 55.13  ? 389  GLN A CG    1 
ATOM   3187 C  CD    . GLN A 1 389 ? -0.360  72.178 23.132  1.00 63.76  ? 389  GLN A CD    1 
ATOM   3188 O  OE1   . GLN A 1 389 ? 0.552   72.994 23.276  1.00 66.62  ? 389  GLN A OE1   1 
ATOM   3189 N  NE2   . GLN A 1 389 ? -1.024  72.039 21.988  1.00 66.39  ? 389  GLN A NE2   1 
ATOM   3190 N  N     . PRO A 1 390 ? -3.602  67.613 23.921  1.00 34.25  ? 390  PRO A N     1 
ATOM   3191 C  CA    . PRO A 1 390 ? -4.121  66.502 23.120  1.00 31.56  ? 390  PRO A CA    1 
ATOM   3192 C  C     . PRO A 1 390 ? -3.584  66.624 21.706  1.00 29.16  ? 390  PRO A C     1 
ATOM   3193 O  O     . PRO A 1 390 ? -3.198  67.717 21.293  1.00 32.71  ? 390  PRO A O     1 
ATOM   3194 C  CB    . PRO A 1 390 ? -5.635  66.749 23.112  1.00 32.98  ? 390  PRO A CB    1 
ATOM   3195 C  CG    . PRO A 1 390 ? -5.892  67.693 24.253  1.00 34.20  ? 390  PRO A CG    1 
ATOM   3196 C  CD    . PRO A 1 390 ? -4.665  68.536 24.352  1.00 33.64  ? 390  PRO A CD    1 
ATOM   3197 N  N     . TYR A 1 391 ? -3.554  65.518 20.978  1.00 24.11  ? 391  TYR A N     1 
ATOM   3198 C  CA    . TYR A 1 391 ? -3.142  65.540 19.584  1.00 23.11  ? 391  TYR A CA    1 
ATOM   3199 C  C     . TYR A 1 391 ? -3.704  64.303 18.895  1.00 26.18  ? 391  TYR A C     1 
ATOM   3200 O  O     . TYR A 1 391 ? -3.941  63.290 19.550  1.00 26.88  ? 391  TYR A O     1 
ATOM   3201 C  CB    . TYR A 1 391 ? -1.611  65.646 19.459  1.00 23.70  ? 391  TYR A CB    1 
ATOM   3202 C  CG    . TYR A 1 391 ? -0.823  64.409 19.841  1.00 25.45  ? 391  TYR A CG    1 
ATOM   3203 C  CD1   . TYR A 1 391 ? -0.400  64.200 21.149  1.00 24.78  ? 391  TYR A CD1   1 
ATOM   3204 C  CD2   . TYR A 1 391 ? -0.476  63.464 18.884  1.00 26.88  ? 391  TYR A CD2   1 
ATOM   3205 C  CE1   . TYR A 1 391 ? 0.331   63.074 21.492  1.00 25.32  ? 391  TYR A CE1   1 
ATOM   3206 C  CE2   . TYR A 1 391 ? 0.250   62.340 19.216  1.00 27.45  ? 391  TYR A CE2   1 
ATOM   3207 C  CZ    . TYR A 1 391 ? 0.652   62.148 20.519  1.00 29.50  ? 391  TYR A CZ    1 
ATOM   3208 O  OH    . TYR A 1 391 ? 1.378   61.022 20.839  1.00 32.87  ? 391  TYR A OH    1 
ATOM   3209 N  N     . PRO A 1 392 ? -3.947  64.384 17.577  1.00 25.47  ? 392  PRO A N     1 
ATOM   3210 C  CA    . PRO A 1 392 ? -4.645  63.288 16.896  1.00 24.34  ? 392  PRO A CA    1 
ATOM   3211 C  C     . PRO A 1 392 ? -3.823  62.009 16.802  1.00 24.95  ? 392  PRO A C     1 
ATOM   3212 O  O     . PRO A 1 392 ? -2.593  62.055 16.745  1.00 24.08  ? 392  PRO A O     1 
ATOM   3213 C  CB    . PRO A 1 392 ? -4.899  63.856 15.500  1.00 23.48  ? 392  PRO A CB    1 
ATOM   3214 C  CG    . PRO A 1 392 ? -3.827  64.855 15.306  1.00 23.06  ? 392  PRO A CG    1 
ATOM   3215 C  CD    . PRO A 1 392 ? -3.601  65.473 16.650  1.00 23.11  ? 392  PRO A CD    1 
ATOM   3216 N  N     . GLY A 1 393 ? -4.513  60.873 16.785  1.00 26.26  ? 393  GLY A N     1 
ATOM   3217 C  CA    . GLY A 1 393 ? -3.862  59.584 16.656  1.00 24.64  ? 393  GLY A CA    1 
ATOM   3218 C  C     . GLY A 1 393 ? -4.217  58.875 15.364  1.00 28.12  ? 393  GLY A C     1 
ATOM   3219 O  O     . GLY A 1 393 ? -4.181  59.465 14.282  1.00 28.70  ? 393  GLY A O     1 
ATOM   3220 N  N     . ALA A 1 394 ? -4.570  57.601 15.480  1.00 27.49  ? 394  ALA A N     1 
ATOM   3221 C  CA    . ALA A 1 394 ? -4.809  56.762 14.314  1.00 27.52  ? 394  ALA A CA    1 
ATOM   3222 C  C     . ALA A 1 394 ? -6.215  56.923 13.753  1.00 30.42  ? 394  ALA A C     1 
ATOM   3223 O  O     . ALA A 1 394 ? -7.090  57.520 14.381  1.00 31.91  ? 394  ALA A O     1 
ATOM   3224 C  CB    . ALA A 1 394 ? -4.548  55.311 14.660  1.00 24.39  ? 394  ALA A CB    1 
ATOM   3225 N  N     . PHE A 1 395 ? -6.423  56.383 12.558  1.00 30.38  ? 395  PHE A N     1 
ATOM   3226 C  CA    . PHE A 1 395 ? -7.754  56.321 11.977  1.00 26.95  ? 395  PHE A CA    1 
ATOM   3227 C  C     . PHE A 1 395 ? -8.323  54.921 12.127  1.00 26.18  ? 395  PHE A C     1 
ATOM   3228 O  O     . PHE A 1 395 ? -7.630  53.928 11.898  1.00 25.92  ? 395  PHE A O     1 
ATOM   3229 C  CB    . PHE A 1 395 ? -7.731  56.711 10.499  1.00 25.63  ? 395  PHE A CB    1 
ATOM   3230 C  CG    . PHE A 1 395 ? -9.048  56.517 9.806   1.00 28.76  ? 395  PHE A CG    1 
ATOM   3231 C  CD1   . PHE A 1 395 ? -10.047 57.473 9.908   1.00 32.87  ? 395  PHE A CD1   1 
ATOM   3232 C  CD2   . PHE A 1 395 ? -9.291  55.377 9.056   1.00 29.64  ? 395  PHE A CD2   1 
ATOM   3233 C  CE1   . PHE A 1 395 ? -11.263 57.296 9.272   1.00 34.77  ? 395  PHE A CE1   1 
ATOM   3234 C  CE2   . PHE A 1 395 ? -10.505 55.192 8.420   1.00 30.64  ? 395  PHE A CE2   1 
ATOM   3235 C  CZ    . PHE A 1 395 ? -11.492 56.153 8.526   1.00 34.15  ? 395  PHE A CZ    1 
ATOM   3236 N  N     . VAL A 1 396 ? -9.590  54.850 12.514  1.00 24.87  ? 396  VAL A N     1 
ATOM   3237 C  CA    . VAL A 1 396 ? -10.292 53.581 12.591  1.00 25.50  ? 396  VAL A CA    1 
ATOM   3238 C  C     . VAL A 1 396 ? -11.546 53.671 11.743  1.00 31.14  ? 396  VAL A C     1 
ATOM   3239 O  O     . VAL A 1 396 ? -12.372 54.561 11.939  1.00 34.42  ? 396  VAL A O     1 
ATOM   3240 C  CB    . VAL A 1 396 ? -10.689 53.237 14.032  1.00 26.37  ? 396  VAL A CB    1 
ATOM   3241 C  CG1   . VAL A 1 396 ? -11.385 51.886 14.073  1.00 27.79  ? 396  VAL A CG1   1 
ATOM   3242 C  CG2   . VAL A 1 396 ? -9.468  53.238 14.934  1.00 26.22  ? 396  VAL A CG2   1 
ATOM   3243 N  N     . LYS A 1 397 ? -11.684 52.756 10.792  1.00 33.83  ? 397  LYS A N     1 
ATOM   3244 C  CA    . LYS A 1 397 ? -12.843 52.761 9.913   1.00 35.20  ? 397  LYS A CA    1 
ATOM   3245 C  C     . LYS A 1 397 ? -14.083 52.308 10.674  1.00 36.28  ? 397  LYS A C     1 
ATOM   3246 O  O     . LYS A 1 397 ? -13.994 51.491 11.589  1.00 37.46  ? 397  LYS A O     1 
ATOM   3247 C  CB    . LYS A 1 397 ? -12.603 51.860 8.701   1.00 35.49  ? 397  LYS A CB    1 
ATOM   3248 C  CG    . LYS A 1 397 ? -13.683 51.956 7.641   1.00 38.67  ? 397  LYS A CG    1 
ATOM   3249 C  CD    . LYS A 1 397 ? -13.367 51.075 6.447   1.00 43.69  ? 397  LYS A CD    1 
ATOM   3250 C  CE    . LYS A 1 397 ? -14.500 51.098 5.433   1.00 47.09  ? 397  LYS A CE    1 
ATOM   3251 N  NZ    . LYS A 1 397 ? -14.795 52.481 4.961   1.00 48.93  ? 397  LYS A NZ    1 
ATOM   3252 N  N     . GLU A 1 398 ? -15.235 52.857 10.305  1.00 36.20  ? 398  GLU A N     1 
ATOM   3253 C  CA    . GLU A 1 398 ? -16.502 52.419 10.870  1.00 35.27  ? 398  GLU A CA    1 
ATOM   3254 C  C     . GLU A 1 398 ? -17.046 51.282 10.021  1.00 34.38  ? 398  GLU A C     1 
ATOM   3255 O  O     . GLU A 1 398 ? -17.523 51.502 8.911   1.00 37.40  ? 398  GLU A O     1 
ATOM   3256 C  CB    . GLU A 1 398 ? -17.504 53.571 10.903  1.00 36.16  ? 398  GLU A CB    1 
ATOM   3257 C  CG    . GLU A 1 398 ? -18.808 53.233 11.601  1.00 37.57  ? 398  GLU A CG    1 
ATOM   3258 C  CD    . GLU A 1 398 ? -18.659 53.174 13.104  1.00 39.65  ? 398  GLU A CD    1 
ATOM   3259 O  OE1   . GLU A 1 398 ? -18.410 54.232 13.718  1.00 38.97  ? 398  GLU A OE1   1 
ATOM   3260 O  OE2   . GLU A 1 398 ? -18.785 52.068 13.670  1.00 42.08  ? 398  GLU A OE2   1 
ATOM   3261 N  N     . PRO A 1 399 ? -16.970 50.052 10.537  1.00 34.86  ? 399  PRO A N     1 
ATOM   3262 C  CA    . PRO A 1 399 ? -17.388 48.907 9.730   1.00 34.71  ? 399  PRO A CA    1 
ATOM   3263 C  C     . PRO A 1 399 ? -18.900 48.783 9.700   1.00 32.26  ? 399  PRO A C     1 
ATOM   3264 O  O     . PRO A 1 399 ? -19.568 49.150 10.665  1.00 31.93  ? 399  PRO A O     1 
ATOM   3265 C  CB    . PRO A 1 399 ? -16.788 47.725 10.487  1.00 37.71  ? 399  PRO A CB    1 
ATOM   3266 C  CG    . PRO A 1 399 ? -16.810 48.169 11.908  1.00 38.20  ? 399  PRO A CG    1 
ATOM   3267 C  CD    . PRO A 1 399 ? -16.565 49.654 11.897  1.00 35.78  ? 399  PRO A CD    1 
ATOM   3268 N  N     . ILE A 1 400 ? -19.428 48.281 8.592   1.00 30.94  ? 400  ILE A N     1 
ATOM   3269 C  CA    . ILE A 1 400 ? -20.839 47.949 8.511   1.00 36.80  ? 400  ILE A CA    1 
ATOM   3270 C  C     . ILE A 1 400 ? -21.085 46.680 9.313   1.00 39.72  ? 400  ILE A C     1 
ATOM   3271 O  O     . ILE A 1 400 ? -20.576 45.614 8.961   1.00 37.99  ? 400  ILE A O     1 
ATOM   3272 C  CB    . ILE A 1 400 ? -21.269 47.703 7.063   1.00 37.55  ? 400  ILE A CB    1 
ATOM   3273 C  CG1   . ILE A 1 400 ? -21.047 48.963 6.223   1.00 33.49  ? 400  ILE A CG1   1 
ATOM   3274 C  CG2   . ILE A 1 400 ? -22.722 47.261 7.010   1.00 34.18  ? 400  ILE A CG2   1 
ATOM   3275 C  CD1   . ILE A 1 400 ? -21.269 48.756 4.744   1.00 34.64  ? 400  ILE A CD1   1 
ATOM   3276 N  N     . PRO A 1 401 ? -21.856 46.793 10.405  1.00 41.69  ? 401  PRO A N     1 
ATOM   3277 C  CA    . PRO A 1 401 ? -22.153 45.642 11.265  1.00 41.38  ? 401  PRO A CA    1 
ATOM   3278 C  C     . PRO A 1 401 ? -22.803 44.522 10.462  1.00 43.52  ? 401  PRO A C     1 
ATOM   3279 O  O     . PRO A 1 401 ? -23.921 44.688 9.968   1.00 46.52  ? 401  PRO A O     1 
ATOM   3280 C  CB    . PRO A 1 401 ? -23.141 46.213 12.285  1.00 38.67  ? 401  PRO A CB    1 
ATOM   3281 C  CG    . PRO A 1 401 ? -22.871 47.687 12.294  1.00 37.58  ? 401  PRO A CG    1 
ATOM   3282 C  CD    . PRO A 1 401 ? -22.503 48.027 10.885  1.00 39.15  ? 401  PRO A CD    1 
ATOM   3283 N  N     . ASN A 1 402 ? -22.100 43.402 10.330  1.00 40.21  ? 402  ASN A N     1 
ATOM   3284 C  CA    . ASN A 1 402 ? -22.571 42.309 9.494   1.00 40.32  ? 402  ASN A CA    1 
ATOM   3285 C  C     . ASN A 1 402 ? -21.707 41.069 9.659   1.00 41.12  ? 402  ASN A C     1 
ATOM   3286 O  O     . ASN A 1 402 ? -20.666 41.109 10.315  1.00 39.71  ? 402  ASN A O     1 
ATOM   3287 C  CB    . ASN A 1 402 ? -22.572 42.745 8.029   1.00 40.24  ? 402  ASN A CB    1 
ATOM   3288 C  CG    . ASN A 1 402 ? -23.479 41.902 7.170   1.00 40.97  ? 402  ASN A CG    1 
ATOM   3289 O  OD1   . ASN A 1 402 ? -24.327 41.169 7.677   1.00 43.85  ? 402  ASN A OD1   1 
ATOM   3290 N  ND2   . ASN A 1 402 ? -23.307 42.000 5.859   1.00 40.28  ? 402  ASN A ND2   1 
ATOM   3291 N  N     . ARG A 1 403 ? -22.151 39.964 9.071   1.00 41.89  ? 403  ARG A N     1 
ATOM   3292 C  CA    . ARG A 1 403 ? -21.311 38.783 8.955   1.00 40.57  ? 403  ARG A CA    1 
ATOM   3293 C  C     . ARG A 1 403 ? -20.388 38.963 7.756   1.00 40.46  ? 403  ARG A C     1 
ATOM   3294 O  O     . ARG A 1 403 ? -20.683 39.743 6.847   1.00 38.95  ? 403  ARG A O     1 
ATOM   3295 C  CB    . ARG A 1 403 ? -22.158 37.519 8.793   1.00 41.63  ? 403  ARG A CB    1 
ATOM   3296 C  CG    . ARG A 1 403 ? -22.952 37.448 7.496   1.00 45.85  ? 403  ARG A CG    1 
ATOM   3297 C  CD    . ARG A 1 403 ? -23.700 36.124 7.370   1.00 47.09  ? 403  ARG A CD    1 
ATOM   3298 N  NE    . ARG A 1 403 ? -24.865 36.059 8.247   1.00 47.30  ? 403  ARG A NE    1 
ATOM   3299 C  CZ    . ARG A 1 403 ? -25.667 35.002 8.344   1.00 48.23  ? 403  ARG A CZ    1 
ATOM   3300 N  NH1   . ARG A 1 403 ? -25.426 33.919 7.619   1.00 48.72  ? 403  ARG A NH1   1 
ATOM   3301 N  NH2   . ARG A 1 403 ? -26.709 35.028 9.165   1.00 47.48  ? 403  ARG A NH2   1 
ATOM   3302 N  N     . TYR A 1 404 ? -19.262 38.258 7.766   1.00 42.07  ? 404  TYR A N     1 
ATOM   3303 C  CA    . TYR A 1 404 ? -18.311 38.323 6.663   1.00 43.51  ? 404  TYR A CA    1 
ATOM   3304 C  C     . TYR A 1 404 ? -17.684 36.958 6.418   1.00 45.04  ? 404  TYR A C     1 
ATOM   3305 O  O     . TYR A 1 404 ? -16.789 36.536 7.154   1.00 46.31  ? 404  TYR A O     1 
ATOM   3306 C  CB    . TYR A 1 404 ? -17.239 39.381 6.933   1.00 43.45  ? 404  TYR A CB    1 
ATOM   3307 C  CG    . TYR A 1 404 ? -17.795 40.786 6.940   1.00 43.90  ? 404  TYR A CG    1 
ATOM   3308 C  CD1   . TYR A 1 404 ? -17.924 41.509 5.759   1.00 43.57  ? 404  TYR A CD1   1 
ATOM   3309 C  CD2   . TYR A 1 404 ? -18.211 41.383 8.123   1.00 41.75  ? 404  TYR A CD2   1 
ATOM   3310 C  CE1   . TYR A 1 404 ? -18.442 42.792 5.759   1.00 40.65  ? 404  TYR A CE1   1 
ATOM   3311 C  CE2   . TYR A 1 404 ? -18.732 42.661 8.132   1.00 41.07  ? 404  TYR A CE2   1 
ATOM   3312 C  CZ    . TYR A 1 404 ? -18.845 43.362 6.949   1.00 40.93  ? 404  TYR A CZ    1 
ATOM   3313 O  OH    . TYR A 1 404 ? -19.362 44.637 6.958   1.00 40.92  ? 404  TYR A OH    1 
ATOM   3314 N  N     . LYS A 1 405 ? -18.166 36.279 5.379   1.00 43.86  ? 405  LYS A N     1 
ATOM   3315 C  CA    . LYS A 1 405 ? -17.779 34.900 5.096   1.00 42.92  ? 405  LYS A CA    1 
ATOM   3316 C  C     . LYS A 1 405 ? -16.279 34.739 4.866   1.00 43.07  ? 405  LYS A C     1 
ATOM   3317 O  O     . LYS A 1 405 ? -15.600 34.056 5.631   1.00 43.61  ? 405  LYS A O     1 
ATOM   3318 C  CB    . LYS A 1 405 ? -18.563 34.357 3.902   1.00 44.83  ? 405  LYS A CB    1 
ATOM   3319 C  CG    . LYS A 1 405 ? -18.341 32.879 3.635   1.00 45.09  ? 405  LYS A CG    1 
ATOM   3320 C  CD    . LYS A 1 405 ? -19.186 32.394 2.471   1.00 47.07  ? 405  LYS A CD    1 
ATOM   3321 N  N     . TYR A 1 406 ? -15.762 35.367 3.818   1.00 44.10  ? 406  TYR A N     1 
ATOM   3322 C  CA    . TYR A 1 406 ? -14.336 35.276 3.522   1.00 46.54  ? 406  TYR A CA    1 
ATOM   3323 C  C     . TYR A 1 406 ? -13.619 36.596 3.796   1.00 44.56  ? 406  TYR A C     1 
ATOM   3324 O  O     . TYR A 1 406 ? -14.034 37.653 3.316   1.00 48.22  ? 406  TYR A O     1 
ATOM   3325 C  CB    . TYR A 1 406 ? -14.109 34.815 2.078   1.00 50.65  ? 406  TYR A CB    1 
ATOM   3326 C  CG    . TYR A 1 406 ? -14.517 33.376 1.826   1.00 53.22  ? 406  TYR A CG    1 
ATOM   3327 C  CD1   . TYR A 1 406 ? -13.697 32.322 2.214   1.00 55.14  ? 406  TYR A CD1   1 
ATOM   3328 C  CD2   . TYR A 1 406 ? -15.718 33.071 1.199   1.00 54.15  ? 406  TYR A CD2   1 
ATOM   3329 C  CE1   . TYR A 1 406 ? -14.063 31.004 1.987   1.00 56.26  ? 406  TYR A CE1   1 
ATOM   3330 C  CE2   . TYR A 1 406 ? -16.093 31.755 0.966   1.00 56.61  ? 406  TYR A CE2   1 
ATOM   3331 C  CZ    . TYR A 1 406 ? -15.262 30.725 1.362   1.00 56.64  ? 406  TYR A CZ    1 
ATOM   3332 O  OH    . TYR A 1 406 ? -15.628 29.416 1.136   1.00 54.99  ? 406  TYR A OH    1 
ATOM   3333 N  N     . VAL A 1 407 ? -12.546 36.529 4.582   1.00 39.12  ? 407  VAL A N     1 
ATOM   3334 C  CA    . VAL A 1 407 ? -11.802 37.726 4.967   1.00 38.15  ? 407  VAL A CA    1 
ATOM   3335 C  C     . VAL A 1 407 ? -10.284 37.519 4.939   1.00 38.55  ? 407  VAL A C     1 
ATOM   3336 O  O     . VAL A 1 407 ? -9.766  36.557 5.505   1.00 36.85  ? 407  VAL A O     1 
ATOM   3337 C  CB    . VAL A 1 407 ? -12.223 38.221 6.376   1.00 38.95  ? 407  VAL A CB    1 
ATOM   3338 C  CG1   . VAL A 1 407 ? -11.249 39.271 6.898   1.00 37.96  ? 407  VAL A CG1   1 
ATOM   3339 C  CG2   . VAL A 1 407 ? -13.645 38.769 6.357   1.00 38.25  ? 407  VAL A CG2   1 
ATOM   3340 N  N     . MET A 1 408 ? -9.579  38.426 4.268   1.00 41.70  ? 408  MET A N     1 
ATOM   3341 C  CA    . MET A 1 408 ? -8.125  38.469 4.336   1.00 43.91  ? 408  MET A CA    1 
ATOM   3342 C  C     . MET A 1 408 ? -7.706  39.776 4.983   1.00 40.79  ? 408  MET A C     1 
ATOM   3343 O  O     . MET A 1 408 ? -8.236  40.834 4.647   1.00 41.14  ? 408  MET A O     1 
ATOM   3344 C  CB    . MET A 1 408 ? -7.499  38.409 2.946   1.00 48.77  ? 408  MET A CB    1 
ATOM   3345 C  CG    . MET A 1 408 ? -8.076  37.379 2.006   1.00 54.44  ? 408  MET A CG    1 
ATOM   3346 S  SD    . MET A 1 408 ? -6.932  37.122 0.638   1.00 79.62  ? 408  MET A SD    1 
ATOM   3347 C  CE    . MET A 1 408 ? -5.555  36.414 1.537   1.00 39.38  ? 408  MET A CE    1 
ATOM   3348 N  N     . SER A 1 409 ? -6.744  39.712 5.894   1.00 38.28  ? 409  SER A N     1 
ATOM   3349 C  CA    . SER A 1 409 ? -6.250  40.917 6.543   1.00 37.37  ? 409  SER A CA    1 
ATOM   3350 C  C     . SER A 1 409 ? -4.828  41.245 6.105   1.00 41.76  ? 409  SER A C     1 
ATOM   3351 O  O     . SER A 1 409 ? -4.056  40.359 5.727   1.00 45.18  ? 409  SER A O     1 
ATOM   3352 C  CB    . SER A 1 409 ? -6.321  40.782 8.064   1.00 32.62  ? 409  SER A CB    1 
ATOM   3353 O  OG    . SER A 1 409 ? -5.441  39.771 8.523   1.00 33.53  ? 409  SER A OG    1 
ATOM   3354 N  N     . PHE A 1 410 ? -4.499  42.530 6.147   1.00 40.16  ? 410  PHE A N     1 
ATOM   3355 C  CA    . PHE A 1 410 ? -3.161  43.001 5.827   1.00 39.00  ? 410  PHE A CA    1 
ATOM   3356 C  C     . PHE A 1 410 ? -2.734  44.029 6.859   1.00 38.31  ? 410  PHE A C     1 
ATOM   3357 O  O     . PHE A 1 410 ? -3.498  44.927 7.214   1.00 38.00  ? 410  PHE A O     1 
ATOM   3358 C  CB    . PHE A 1 410 ? -3.125  43.611 4.429   1.00 37.32  ? 410  PHE A CB    1 
ATOM   3359 C  CG    . PHE A 1 410 ? -3.354  42.617 3.334   1.00 39.22  ? 410  PHE A CG    1 
ATOM   3360 C  CD1   . PHE A 1 410 ? -4.639  42.268 2.954   1.00 40.25  ? 410  PHE A CD1   1 
ATOM   3361 C  CD2   . PHE A 1 410 ? -2.283  42.029 2.683   1.00 42.93  ? 410  PHE A CD2   1 
ATOM   3362 C  CE1   . PHE A 1 410 ? -4.851  41.347 1.947   1.00 43.88  ? 410  PHE A CE1   1 
ATOM   3363 C  CE2   . PHE A 1 410 ? -2.487  41.106 1.672   1.00 43.79  ? 410  PHE A CE2   1 
ATOM   3364 C  CZ    . PHE A 1 410 ? -3.773  40.766 1.304   1.00 44.80  ? 410  PHE A CZ    1 
ATOM   3365 N  N     . ASP A 1 411 ? -1.508  43.894 7.339   1.00 37.54  ? 411  ASP A N     1 
ATOM   3366 C  CA    . ASP A 1 411 ? -1.024  44.740 8.413   1.00 37.23  ? 411  ASP A CA    1 
ATOM   3367 C  C     . ASP A 1 411 ? 0.381   45.231 8.102   1.00 36.43  ? 411  ASP A C     1 
ATOM   3368 O  O     . ASP A 1 411 ? 1.208   44.491 7.567   1.00 38.00  ? 411  ASP A O     1 
ATOM   3369 C  CB    . ASP A 1 411 ? -1.060  43.973 9.738   1.00 38.46  ? 411  ASP A CB    1 
ATOM   3370 C  CG    . ASP A 1 411 ? -0.298  44.674 10.842  1.00 43.53  ? 411  ASP A CG    1 
ATOM   3371 O  OD1   . ASP A 1 411 ? 0.890   44.344 11.051  1.00 48.82  ? 411  ASP A OD1   1 
ATOM   3372 O  OD2   . ASP A 1 411 ? -0.886  45.550 11.510  1.00 45.72  ? 411  ASP A OD2   1 
ATOM   3373 N  N     . LEU A 1 412 ? 0.638   46.491 8.430   1.00 33.95  ? 412  LEU A N     1 
ATOM   3374 C  CA    . LEU A 1 412 ? 1.935   47.097 8.171   1.00 33.49  ? 412  LEU A CA    1 
ATOM   3375 C  C     . LEU A 1 412 ? 2.960   46.716 9.234   1.00 33.76  ? 412  LEU A C     1 
ATOM   3376 O  O     . LEU A 1 412 ? 2.677   46.743 10.429  1.00 34.81  ? 412  LEU A O     1 
ATOM   3377 C  CB    . LEU A 1 412 ? 1.798   48.616 8.074   1.00 32.04  ? 412  LEU A CB    1 
ATOM   3378 C  CG    . LEU A 1 412 ? 1.192   49.110 6.759   1.00 31.60  ? 412  LEU A CG    1 
ATOM   3379 C  CD1   . LEU A 1 412 ? 0.214   50.241 7.001   1.00 32.02  ? 412  LEU A CD1   1 
ATOM   3380 C  CD2   . LEU A 1 412 ? 2.288   49.552 5.804   1.00 29.71  ? 412  LEU A CD2   1 
ATOM   3381 N  N     . THR A 1 413 ? 4.155   46.359 8.784   1.00 35.31  ? 413  THR A N     1 
ATOM   3382 C  CA    . THR A 1 413 ? 5.235   45.986 9.682   1.00 37.07  ? 413  THR A CA    1 
ATOM   3383 C  C     . THR A 1 413 ? 5.724   47.183 10.498  1.00 37.60  ? 413  THR A C     1 
ATOM   3384 O  O     . THR A 1 413 ? 6.179   48.178 9.930   1.00 36.23  ? 413  THR A O     1 
ATOM   3385 C  CB    . THR A 1 413 ? 6.421   45.400 8.897   1.00 38.41  ? 413  THR A CB    1 
ATOM   3386 O  OG1   . THR A 1 413 ? 6.031   44.160 8.292   1.00 46.19  ? 413  THR A OG1   1 
ATOM   3387 C  CG2   . THR A 1 413 ? 7.595   45.154 9.820   1.00 37.03  ? 413  THR A CG2   1 
ATOM   3388 N  N     . SER A 1 414 ? 5.618   47.069 11.824  1.00 35.97  ? 414  SER A N     1 
ATOM   3389 C  CA    . SER A 1 414 ? 6.122   48.070 12.769  1.00 36.29  ? 414  SER A CA    1 
ATOM   3390 C  C     . SER A 1 414 ? 5.809   49.506 12.335  1.00 33.96  ? 414  SER A C     1 
ATOM   3391 O  O     . SER A 1 414 ? 6.713   50.317 12.116  1.00 30.93  ? 414  SER A O     1 
ATOM   3392 C  CB    . SER A 1 414 ? 7.624   47.878 12.982  1.00 41.15  ? 414  SER A CB    1 
ATOM   3393 O  OG    . SER A 1 414 ? 8.099   48.695 14.036  1.00 46.06  ? 414  SER A OG    1 
ATOM   3394 N  N     . PHE A 1 415 ? 4.514   49.792 12.231  1.00 32.22  ? 415  PHE A N     1 
ATOM   3395 C  CA    . PHE A 1 415 ? 3.983   50.968 11.543  1.00 29.66  ? 415  PHE A CA    1 
ATOM   3396 C  C     . PHE A 1 415 ? 4.623   52.312 11.885  1.00 29.93  ? 415  PHE A C     1 
ATOM   3397 O  O     . PHE A 1 415 ? 5.259   52.936 11.033  1.00 31.05  ? 415  PHE A O     1 
ATOM   3398 C  CB    . PHE A 1 415 ? 2.474   51.046 11.766  1.00 28.50  ? 415  PHE A CB    1 
ATOM   3399 C  CG    . PHE A 1 415 ? 1.782   52.021 10.869  1.00 29.85  ? 415  PHE A CG    1 
ATOM   3400 C  CD1   . PHE A 1 415 ? 2.130   52.112 9.532   1.00 28.95  ? 415  PHE A CD1   1 
ATOM   3401 C  CD2   . PHE A 1 415 ? 0.770   52.834 11.352  1.00 31.02  ? 415  PHE A CD2   1 
ATOM   3402 C  CE1   . PHE A 1 415 ? 1.494   53.005 8.697   1.00 28.25  ? 415  PHE A CE1   1 
ATOM   3403 C  CE2   . PHE A 1 415 ? 0.127   53.724 10.518  1.00 31.15  ? 415  PHE A CE2   1 
ATOM   3404 C  CZ    . PHE A 1 415 ? 0.491   53.806 9.187   1.00 29.51  ? 415  PHE A CZ    1 
ATOM   3405 N  N     . TYR A 1 416 ? 4.431   52.767 13.120  1.00 26.05  ? 416  TYR A N     1 
ATOM   3406 C  CA    . TYR A 1 416 ? 4.942   54.071 13.533  1.00 24.92  ? 416  TYR A CA    1 
ATOM   3407 C  C     . TYR A 1 416 ? 6.471   54.171 13.492  1.00 26.69  ? 416  TYR A C     1 
ATOM   3408 O  O     . TYR A 1 416 ? 7.005   55.183 13.049  1.00 29.10  ? 416  TYR A O     1 
ATOM   3409 C  CB    . TYR A 1 416 ? 4.390   54.489 14.903  1.00 22.85  ? 416  TYR A CB    1 
ATOM   3410 C  CG    . TYR A 1 416 ? 2.939   54.935 14.889  1.00 21.74  ? 416  TYR A CG    1 
ATOM   3411 C  CD1   . TYR A 1 416 ? 2.159   54.818 13.745  1.00 21.17  ? 416  TYR A CD1   1 
ATOM   3412 C  CD2   . TYR A 1 416 ? 2.358   55.487 16.020  1.00 21.81  ? 416  TYR A CD2   1 
ATOM   3413 C  CE1   . TYR A 1 416 ? 0.841   55.227 13.733  1.00 22.89  ? 416  TYR A CE1   1 
ATOM   3414 C  CE2   . TYR A 1 416 ? 1.040   55.899 16.019  1.00 24.73  ? 416  TYR A CE2   1 
ATOM   3415 C  CZ    . TYR A 1 416 ? 0.285   55.767 14.872  1.00 25.94  ? 416  TYR A CZ    1 
ATOM   3416 O  OH    . TYR A 1 416 ? -1.027  56.179 14.864  1.00 28.67  ? 416  TYR A OH    1 
ATOM   3417 N  N     . PRO A 1 417 ? 7.184   53.132 13.957  1.00 28.11  ? 417  PRO A N     1 
ATOM   3418 C  CA    . PRO A 1 417 ? 8.635   53.204 13.762  1.00 29.14  ? 417  PRO A CA    1 
ATOM   3419 C  C     . PRO A 1 417 ? 9.023   53.267 12.286  1.00 29.91  ? 417  PRO A C     1 
ATOM   3420 O  O     . PRO A 1 417 ? 9.962   53.980 11.933  1.00 31.01  ? 417  PRO A O     1 
ATOM   3421 C  CB    . PRO A 1 417 ? 9.128   51.895 14.377  1.00 30.10  ? 417  PRO A CB    1 
ATOM   3422 C  CG    . PRO A 1 417 ? 8.123   51.586 15.425  1.00 29.75  ? 417  PRO A CG    1 
ATOM   3423 C  CD    . PRO A 1 417 ? 6.810   52.022 14.853  1.00 30.00  ? 417  PRO A CD    1 
ATOM   3424 N  N     . SER A 1 418 ? 8.305   52.541 11.436  1.00 27.37  ? 418  SER A N     1 
ATOM   3425 C  CA    . SER A 1 418 ? 8.597   52.548 10.008  1.00 25.78  ? 418  SER A CA    1 
ATOM   3426 C  C     . SER A 1 418 ? 8.330   53.923 9.413   1.00 24.07  ? 418  SER A C     1 
ATOM   3427 O  O     . SER A 1 418 ? 9.077   54.394 8.556   1.00 25.09  ? 418  SER A O     1 
ATOM   3428 C  CB    . SER A 1 418 ? 7.778   51.479 9.288   1.00 28.26  ? 418  SER A CB    1 
ATOM   3429 O  OG    . SER A 1 418 ? 8.088   50.187 9.783   1.00 29.90  ? 418  SER A OG    1 
ATOM   3430 N  N     . ILE A 1 419 ? 7.262   54.562 9.877   1.00 24.52  ? 419  ILE A N     1 
ATOM   3431 C  CA    . ILE A 1 419 ? 6.949   55.927 9.474   1.00 27.28  ? 419  ILE A CA    1 
ATOM   3432 C  C     . ILE A 1 419 ? 8.086   56.862 9.868   1.00 28.69  ? 419  ILE A C     1 
ATOM   3433 O  O     . ILE A 1 419 ? 8.491   57.721 9.089   1.00 33.41  ? 419  ILE A O     1 
ATOM   3434 C  CB    . ILE A 1 419 ? 5.631   56.416 10.112  1.00 24.89  ? 419  ILE A CB    1 
ATOM   3435 C  CG1   . ILE A 1 419 ? 4.448   55.620 9.556   1.00 23.96  ? 419  ILE A CG1   1 
ATOM   3436 C  CG2   . ILE A 1 419 ? 5.433   57.904 9.866   1.00 21.71  ? 419  ILE A CG2   1 
ATOM   3437 C  CD1   . ILE A 1 419 ? 3.140   55.915 10.242  1.00 23.34  ? 419  ILE A CD1   1 
ATOM   3438 N  N     . ILE A 1 420 ? 8.609   56.676 11.076  1.00 27.04  ? 420  ILE A N     1 
ATOM   3439 C  CA    . ILE A 1 420 ? 9.726   57.476 11.567  1.00 28.20  ? 420  ILE A CA    1 
ATOM   3440 C  C     . ILE A 1 420 ? 10.955  57.343 10.677  1.00 30.49  ? 420  ILE A C     1 
ATOM   3441 O  O     . ILE A 1 420 ? 11.541  58.341 10.257  1.00 31.32  ? 420  ILE A O     1 
ATOM   3442 C  CB    . ILE A 1 420 ? 10.107  57.090 13.006  1.00 27.39  ? 420  ILE A CB    1 
ATOM   3443 C  CG1   . ILE A 1 420 ? 9.002   57.511 13.973  1.00 28.10  ? 420  ILE A CG1   1 
ATOM   3444 C  CG2   . ILE A 1 420 ? 11.426  57.732 13.403  1.00 25.73  ? 420  ILE A CG2   1 
ATOM   3445 C  CD1   . ILE A 1 420 ? 9.303   57.209 15.422  1.00 29.65  ? 420  ILE A CD1   1 
ATOM   3446 N  N     . ARG A 1 421 ? 11.338  56.105 10.386  1.00 29.82  ? 421  ARG A N     1 
ATOM   3447 C  CA    . ARG A 1 421 ? 12.501  55.849 9.549   1.00 29.50  ? 421  ARG A CA    1 
ATOM   3448 C  C     . ARG A 1 421 ? 12.274  56.330 8.117   1.00 32.09  ? 421  ARG A C     1 
ATOM   3449 O  O     . ARG A 1 421 ? 13.176  56.888 7.493   1.00 35.10  ? 421  ARG A O     1 
ATOM   3450 C  CB    . ARG A 1 421 ? 12.841  54.362 9.556   1.00 27.26  ? 421  ARG A CB    1 
ATOM   3451 C  CG    . ARG A 1 421 ? 13.056  53.770 10.939  1.00 28.34  ? 421  ARG A CG    1 
ATOM   3452 C  CD    . ARG A 1 421 ? 13.028  52.252 10.879  1.00 28.99  ? 421  ARG A CD    1 
ATOM   3453 N  NE    . ARG A 1 421 ? 13.945  51.741 9.864   1.00 34.08  ? 421  ARG A NE    1 
ATOM   3454 C  CZ    . ARG A 1 421 ? 13.778  50.592 9.218   1.00 36.98  ? 421  ARG A CZ    1 
ATOM   3455 N  NH1   . ARG A 1 421 ? 12.726  49.829 9.479   1.00 36.88  ? 421  ARG A NH1   1 
ATOM   3456 N  NH2   . ARG A 1 421 ? 14.660  50.206 8.308   1.00 35.90  ? 421  ARG A NH2   1 
ATOM   3457 N  N     . GLN A 1 422 ? 11.067  56.115 7.602   1.00 30.19  ? 422  GLN A N     1 
ATOM   3458 C  CA    . GLN A 1 422 ? 10.746  56.493 6.228   1.00 31.00  ? 422  GLN A CA    1 
ATOM   3459 C  C     . GLN A 1 422 ? 10.801  58.002 6.004   1.00 33.01  ? 422  GLN A C     1 
ATOM   3460 O  O     . GLN A 1 422 ? 11.487  58.480 5.100   1.00 34.56  ? 422  GLN A O     1 
ATOM   3461 C  CB    . GLN A 1 422 ? 9.375   55.943 5.821   1.00 30.43  ? 422  GLN A CB    1 
ATOM   3462 C  CG    . GLN A 1 422 ? 8.764   56.637 4.613   1.00 32.37  ? 422  GLN A CG    1 
ATOM   3463 C  CD    . GLN A 1 422 ? 7.759   55.773 3.871   1.00 33.93  ? 422  GLN A CD    1 
ATOM   3464 O  OE1   . GLN A 1 422 ? 7.733   54.553 4.031   1.00 34.75  ? 422  GLN A OE1   1 
ATOM   3465 N  NE2   . GLN A 1 422 ? 6.929   56.406 3.049   1.00 34.20  ? 422  GLN A NE2   1 
ATOM   3466 N  N     . VAL A 1 423 ? 10.076  58.747 6.832   1.00 32.43  ? 423  VAL A N     1 
ATOM   3467 C  CA    . VAL A 1 423 ? 10.019  60.200 6.711   1.00 30.64  ? 423  VAL A CA    1 
ATOM   3468 C  C     . VAL A 1 423 ? 11.297  60.845 7.259   1.00 34.82  ? 423  VAL A C     1 
ATOM   3469 O  O     . VAL A 1 423 ? 11.598  62.000 6.955   1.00 36.79  ? 423  VAL A O     1 
ATOM   3470 C  CB    . VAL A 1 423 ? 8.778   60.758 7.442   1.00 27.10  ? 423  VAL A CB    1 
ATOM   3471 C  CG1   . VAL A 1 423 ? 8.590   62.236 7.159   1.00 24.80  ? 423  VAL A CG1   1 
ATOM   3472 C  CG2   . VAL A 1 423 ? 7.534   59.986 7.024   1.00 24.07  ? 423  VAL A CG2   1 
ATOM   3473 N  N     . ASN A 1 424 ? 12.050  60.072 8.044   1.00 35.78  ? 424  ASN A N     1 
ATOM   3474 C  CA    . ASN A 1 424 ? 13.256  60.542 8.736   1.00 34.65  ? 424  ASN A CA    1 
ATOM   3475 C  C     . ASN A 1 424 ? 12.908  61.580 9.798   1.00 33.46  ? 424  ASN A C     1 
ATOM   3476 O  O     . ASN A 1 424 ? 13.462  62.679 9.828   1.00 34.41  ? 424  ASN A O     1 
ATOM   3477 C  CB    . ASN A 1 424 ? 14.317  61.074 7.762   1.00 35.62  ? 424  ASN A CB    1 
ATOM   3478 C  CG    . ASN A 1 424 ? 15.714  61.090 8.369   1.00 42.05  ? 424  ASN A CG    1 
ATOM   3479 O  OD1   . ASN A 1 424 ? 16.088  60.191 9.128   1.00 43.71  ? 424  ASN A OD1   1 
ATOM   3480 N  ND2   . ASN A 1 424 ? 16.491  62.115 8.039   1.00 44.53  ? 424  ASN A ND2   1 
ATOM   3481 N  N     . ILE A 1 425 ? 11.978  61.212 10.670  1.00 30.81  ? 425  ILE A N     1 
ATOM   3482 C  CA    . ILE A 1 425 ? 11.500  62.101 11.717  1.00 27.83  ? 425  ILE A CA    1 
ATOM   3483 C  C     . ILE A 1 425 ? 12.423  62.066 12.933  1.00 29.15  ? 425  ILE A C     1 
ATOM   3484 O  O     . ILE A 1 425 ? 12.696  61.007 13.493  1.00 29.56  ? 425  ILE A O     1 
ATOM   3485 C  CB    . ILE A 1 425 ? 10.058  61.740 12.121  1.00 25.25  ? 425  ILE A CB    1 
ATOM   3486 C  CG1   . ILE A 1 425 ? 9.129   61.873 10.911  1.00 26.66  ? 425  ILE A CG1   1 
ATOM   3487 C  CG2   . ILE A 1 425 ? 9.577   62.626 13.250  1.00 22.92  ? 425  ILE A CG2   1 
ATOM   3488 C  CD1   . ILE A 1 425 ? 7.704   61.426 11.170  1.00 25.72  ? 425  ILE A CD1   1 
ATOM   3489 N  N     . SER A 1 426 ? 12.898  63.239 13.334  1.00 30.58  ? 426  SER A N     1 
ATOM   3490 C  CA    . SER A 1 426 ? 13.884  63.356 14.396  1.00 30.45  ? 426  SER A CA    1 
ATOM   3491 C  C     . SER A 1 426 ? 13.915  64.814 14.825  1.00 33.42  ? 426  SER A C     1 
ATOM   3492 O  O     . SER A 1 426 ? 13.565  65.692 14.038  1.00 37.43  ? 426  SER A O     1 
ATOM   3493 C  CB    . SER A 1 426 ? 15.258  62.935 13.870  1.00 31.61  ? 426  SER A CB    1 
ATOM   3494 O  OG    . SER A 1 426 ? 16.127  62.546 14.918  1.00 32.74  ? 426  SER A OG    1 
ATOM   3495 N  N     . PRO A 1 427 ? 14.317  65.085 16.077  1.00 30.09  ? 427  PRO A N     1 
ATOM   3496 C  CA    . PRO A 1 427 ? 14.393  66.476 16.531  1.00 30.15  ? 427  PRO A CA    1 
ATOM   3497 C  C     . PRO A 1 427 ? 15.302  67.343 15.663  1.00 31.90  ? 427  PRO A C     1 
ATOM   3498 O  O     . PRO A 1 427 ? 14.997  68.518 15.452  1.00 33.35  ? 427  PRO A O     1 
ATOM   3499 C  CB    . PRO A 1 427 ? 14.965  66.353 17.949  1.00 27.05  ? 427  PRO A CB    1 
ATOM   3500 C  CG    . PRO A 1 427 ? 15.539  64.986 18.027  1.00 26.35  ? 427  PRO A CG    1 
ATOM   3501 C  CD    . PRO A 1 427 ? 14.675  64.149 17.151  1.00 27.02  ? 427  PRO A CD    1 
ATOM   3502 N  N     . GLU A 1 428 ? 16.384  66.768 15.147  1.00 31.79  ? 428  GLU A N     1 
ATOM   3503 C  CA    . GLU A 1 428 ? 17.390  67.553 14.437  1.00 33.49  ? 428  GLU A CA    1 
ATOM   3504 C  C     . GLU A 1 428 ? 17.294  67.446 12.916  1.00 32.77  ? 428  GLU A C     1 
ATOM   3505 O  O     . GLU A 1 428 ? 18.125  68.001 12.202  1.00 34.69  ? 428  GLU A O     1 
ATOM   3506 C  CB    . GLU A 1 428 ? 18.796  67.156 14.903  1.00 35.29  ? 428  GLU A CB    1 
ATOM   3507 C  CG    . GLU A 1 428 ? 19.354  65.884 14.273  1.00 37.74  ? 428  GLU A CG    1 
ATOM   3508 C  CD    . GLU A 1 428 ? 18.763  64.609 14.848  1.00 41.12  ? 428  GLU A CD    1 
ATOM   3509 O  OE1   . GLU A 1 428 ? 17.606  64.629 15.321  1.00 40.06  ? 428  GLU A OE1   1 
ATOM   3510 O  OE2   . GLU A 1 428 ? 19.466  63.575 14.827  1.00 44.49  ? 428  GLU A OE2   1 
ATOM   3511 N  N     . THR A 1 429 ? 16.283  66.742 12.419  1.00 33.59  ? 429  THR A N     1 
ATOM   3512 C  CA    . THR A 1 429 ? 16.119  66.589 10.975  1.00 33.79  ? 429  THR A CA    1 
ATOM   3513 C  C     . THR A 1 429 ? 14.946  67.405 10.442  1.00 35.05  ? 429  THR A C     1 
ATOM   3514 O  O     . THR A 1 429 ? 14.584  67.293 9.273   1.00 36.09  ? 429  THR A O     1 
ATOM   3515 C  CB    . THR A 1 429 ? 15.937  65.116 10.569  1.00 32.72  ? 429  THR A CB    1 
ATOM   3516 O  OG1   . THR A 1 429 ? 14.778  64.580 11.219  1.00 30.87  ? 429  THR A OG1   1 
ATOM   3517 C  CG2   . THR A 1 429 ? 17.154  64.305 10.966  1.00 32.51  ? 429  THR A CG2   1 
ATOM   3518 N  N     . ILE A 1 430 ? 14.354  68.220 11.309  1.00 34.63  ? 430  ILE A N     1 
ATOM   3519 C  CA    . ILE A 1 430 ? 13.295  69.131 10.900  1.00 38.47  ? 430  ILE A CA    1 
ATOM   3520 C  C     . ILE A 1 430 ? 13.822  70.151 9.893   1.00 41.94  ? 430  ILE A C     1 
ATOM   3521 O  O     . ILE A 1 430 ? 14.704  70.949 10.210  1.00 43.80  ? 430  ILE A O     1 
ATOM   3522 C  CB    . ILE A 1 430 ? 12.710  69.870 12.110  1.00 39.07  ? 430  ILE A CB    1 
ATOM   3523 C  CG1   . ILE A 1 430 ? 12.053  68.870 13.062  1.00 42.13  ? 430  ILE A CG1   1 
ATOM   3524 C  CG2   . ILE A 1 430 ? 11.719  70.932 11.658  1.00 36.48  ? 430  ILE A CG2   1 
ATOM   3525 C  CD1   . ILE A 1 430 ? 11.365  69.506 14.243  1.00 44.22  ? 430  ILE A CD1   1 
ATOM   3526 N  N     . ALA A 1 431 ? 13.282  70.119 8.680   1.00 39.93  ? 431  ALA A N     1 
ATOM   3527 C  CA    . ALA A 1 431 ? 13.761  70.986 7.612   1.00 40.60  ? 431  ALA A CA    1 
ATOM   3528 C  C     . ALA A 1 431 ? 12.944  72.269 7.521   1.00 44.45  ? 431  ALA A C     1 
ATOM   3529 O  O     . ALA A 1 431 ? 13.469  73.337 7.200   1.00 49.88  ? 431  ALA A O     1 
ATOM   3530 C  CB    . ALA A 1 431 ? 13.732  70.248 6.288   1.00 39.92  ? 431  ALA A CB    1 
ATOM   3531 N  N     . GLY A 1 432 ? 11.654  72.158 7.807   1.00 40.26  ? 432  GLY A N     1 
ATOM   3532 C  CA    . GLY A 1 432 ? 10.767  73.299 7.728   1.00 39.46  ? 432  GLY A CA    1 
ATOM   3533 C  C     . GLY A 1 432 ? 9.323   72.862 7.638   1.00 38.93  ? 432  GLY A C     1 
ATOM   3534 O  O     . GLY A 1 432 ? 8.956   71.792 8.125   1.00 40.58  ? 432  GLY A O     1 
ATOM   3535 N  N     . THR A 1 433 ? 8.502   73.685 7.000   1.00 37.11  ? 433  THR A N     1 
ATOM   3536 C  CA    . THR A 1 433 ? 7.075   73.426 6.959   1.00 37.87  ? 433  THR A CA    1 
ATOM   3537 C  C     . THR A 1 433 ? 6.468   73.766 5.602   1.00 38.83  ? 433  THR A C     1 
ATOM   3538 O  O     . THR A 1 433 ? 7.043   74.537 4.831   1.00 41.36  ? 433  THR A O     1 
ATOM   3539 C  CB    . THR A 1 433 ? 6.349   74.215 8.065   1.00 39.14  ? 433  THR A CB    1 
ATOM   3540 O  OG1   . THR A 1 433 ? 4.959   73.872 8.071   1.00 46.79  ? 433  THR A OG1   1 
ATOM   3541 C  CG2   . THR A 1 433 ? 6.502   75.712 7.844   1.00 37.06  ? 433  THR A CG2   1 
ATOM   3542 N  N     . PHE A 1 434 ? 5.313   73.174 5.312   1.00 35.97  ? 434  PHE A N     1 
ATOM   3543 C  CA    . PHE A 1 434 ? 4.571   73.499 4.099   1.00 38.47  ? 434  PHE A CA    1 
ATOM   3544 C  C     . PHE A 1 434 ? 3.095   73.730 4.411   1.00 41.08  ? 434  PHE A C     1 
ATOM   3545 O  O     . PHE A 1 434 ? 2.601   73.316 5.461   1.00 40.37  ? 434  PHE A O     1 
ATOM   3546 C  CB    . PHE A 1 434 ? 4.740   72.402 3.040   1.00 37.98  ? 434  PHE A CB    1 
ATOM   3547 C  CG    . PHE A 1 434 ? 4.113   71.080 3.412   1.00 37.17  ? 434  PHE A CG    1 
ATOM   3548 C  CD1   . PHE A 1 434 ? 4.805   70.158 4.186   1.00 34.75  ? 434  PHE A CD1   1 
ATOM   3549 C  CD2   . PHE A 1 434 ? 2.839   70.751 2.968   1.00 35.75  ? 434  PHE A CD2   1 
ATOM   3550 C  CE1   . PHE A 1 434 ? 4.235   68.935 4.517   1.00 29.63  ? 434  PHE A CE1   1 
ATOM   3551 C  CE2   . PHE A 1 434 ? 2.262   69.534 3.302   1.00 32.31  ? 434  PHE A CE2   1 
ATOM   3552 C  CZ    . PHE A 1 434 ? 2.961   68.628 4.078   1.00 29.00  ? 434  PHE A CZ    1 
ATOM   3553 N  N     . LYS A 1 435 ? 2.394   74.397 3.500   1.00 44.44  ? 435  LYS A N     1 
ATOM   3554 C  CA    . LYS A 1 435 ? 0.971   74.652 3.680   1.00 48.93  ? 435  LYS A CA    1 
ATOM   3555 C  C     . LYS A 1 435 ? 0.159   73.382 3.425   1.00 48.72  ? 435  LYS A C     1 
ATOM   3556 O  O     . LYS A 1 435 ? 0.204   72.820 2.330   1.00 49.88  ? 435  LYS A O     1 
ATOM   3557 C  CB    . LYS A 1 435 ? 0.506   75.763 2.739   1.00 56.51  ? 435  LYS A CB    1 
ATOM   3558 C  CG    . LYS A 1 435 ? -0.875  76.305 3.072   1.00 63.93  ? 435  LYS A CG    1 
ATOM   3559 C  CD    . LYS A 1 435 ? -1.585  76.865 1.847   1.00 68.69  ? 435  LYS A CD    1 
ATOM   3560 C  CE    . LYS A 1 435 ? -2.952  77.426 2.220   1.00 71.04  ? 435  LYS A CE    1 
ATOM   3561 N  NZ    . LYS A 1 435 ? -3.752  76.490 3.066   1.00 70.41  ? 435  LYS A NZ    1 
ATOM   3562 N  N     . VAL A 1 436 ? -0.588  72.935 4.432   1.00 48.13  ? 436  VAL A N     1 
ATOM   3563 C  CA    . VAL A 1 436 ? -1.344  71.689 4.320   1.00 47.49  ? 436  VAL A CA    1 
ATOM   3564 C  C     . VAL A 1 436 ? -2.681  71.845 3.607   1.00 49.17  ? 436  VAL A C     1 
ATOM   3565 O  O     . VAL A 1 436 ? -3.351  72.873 3.711   1.00 52.72  ? 436  VAL A O     1 
ATOM   3566 C  CB    . VAL A 1 436 ? -1.616  71.026 5.697   1.00 42.56  ? 436  VAL A CB    1 
ATOM   3567 C  CG1   . VAL A 1 436 ? -0.336  70.845 6.459   1.00 40.62  ? 436  VAL A CG1   1 
ATOM   3568 C  CG2   . VAL A 1 436 ? -2.611  71.841 6.515   1.00 45.46  ? 436  VAL A CG2   1 
ATOM   3569 N  N     . ALA A 1 437 ? -3.054  70.803 2.875   1.00 49.19  ? 437  ALA A N     1 
ATOM   3570 C  CA    . ALA A 1 437 ? -4.392  70.679 2.325   1.00 51.09  ? 437  ALA A CA    1 
ATOM   3571 C  C     . ALA A 1 437 ? -5.156  69.763 3.273   1.00 51.14  ? 437  ALA A C     1 
ATOM   3572 O  O     . ALA A 1 437 ? -4.542  69.116 4.124   1.00 48.18  ? 437  ALA A O     1 
ATOM   3573 C  CB    . ALA A 1 437 ? -4.326  70.076 0.930   1.00 51.26  ? 437  ALA A CB    1 
ATOM   3574 N  N     . PRO A 1 438 ? -6.495  69.720 3.155   1.00 49.49  ? 438  PRO A N     1 
ATOM   3575 C  CA    . PRO A 1 438 ? -7.255  68.728 3.920   1.00 45.00  ? 438  PRO A CA    1 
ATOM   3576 C  C     . PRO A 1 438 ? -6.665  67.336 3.725   1.00 43.38  ? 438  PRO A C     1 
ATOM   3577 O  O     . PRO A 1 438 ? -6.175  67.033 2.637   1.00 44.15  ? 438  PRO A O     1 
ATOM   3578 C  CB    . PRO A 1 438 ? -8.644  68.808 3.292   1.00 45.71  ? 438  PRO A CB    1 
ATOM   3579 C  CG    . PRO A 1 438 ? -8.763  70.225 2.864   1.00 46.61  ? 438  PRO A CG    1 
ATOM   3580 C  CD    . PRO A 1 438 ? -7.381  70.660 2.442   1.00 48.01  ? 438  PRO A CD    1 
ATOM   3581 N  N     . LEU A 1 439 ? -6.698  66.516 4.769   1.00 42.09  ? 439  LEU A N     1 
ATOM   3582 C  CA    . LEU A 1 439 ? -6.040  65.214 4.751   1.00 43.40  ? 439  LEU A CA    1 
ATOM   3583 C  C     . LEU A 1 439 ? -6.497  64.329 3.596   1.00 43.51  ? 439  LEU A C     1 
ATOM   3584 O  O     . LEU A 1 439 ? -5.704  63.577 3.031   1.00 42.64  ? 439  LEU A O     1 
ATOM   3585 C  CB    . LEU A 1 439 ? -6.247  64.488 6.082   1.00 46.46  ? 439  LEU A CB    1 
ATOM   3586 C  CG    . LEU A 1 439 ? -5.471  63.180 6.253   1.00 47.88  ? 439  LEU A CG    1 
ATOM   3587 C  CD1   . LEU A 1 439 ? -3.971  63.439 6.305   1.00 45.11  ? 439  LEU A CD1   1 
ATOM   3588 C  CD2   . LEU A 1 439 ? -5.937  62.435 7.493   1.00 50.31  ? 439  LEU A CD2   1 
ATOM   3589 N  N     . HIS A 1 440 ? -7.771  64.426 3.239   1.00 47.03  ? 440  HIS A N     1 
ATOM   3590 C  CA    . HIS A 1 440 ? -8.314  63.580 2.183   1.00 53.04  ? 440  HIS A CA    1 
ATOM   3591 C  C     . HIS A 1 440 ? -7.796  63.948 0.798   1.00 51.12  ? 440  HIS A C     1 
ATOM   3592 O  O     . HIS A 1 440 ? -7.841  63.132 -0.122  1.00 53.12  ? 440  HIS A O     1 
ATOM   3593 C  CB    . HIS A 1 440 ? -9.842  63.568 2.228   1.00 62.31  ? 440  HIS A CB    1 
ATOM   3594 C  CG    . HIS A 1 440 ? -10.397 62.610 3.234   1.00 71.52  ? 440  HIS A CG    1 
ATOM   3595 N  ND1   . HIS A 1 440 ? -11.013 61.430 2.878   1.00 76.00  ? 440  HIS A ND1   1 
ATOM   3596 C  CD2   . HIS A 1 440 ? -10.400 62.642 4.588   1.00 73.87  ? 440  HIS A CD2   1 
ATOM   3597 C  CE1   . HIS A 1 440 ? -11.387 60.784 3.968   1.00 77.01  ? 440  HIS A CE1   1 
ATOM   3598 N  NE2   . HIS A 1 440 ? -11.026 61.498 5.019   1.00 76.21  ? 440  HIS A NE2   1 
ATOM   3599 N  N     . ASP A 1 441 ? -7.293  65.169 0.657   1.00 45.87  ? 441  ASP A N     1 
ATOM   3600 C  CA    . ASP A 1 441 ? -6.657  65.578 -0.587  1.00 44.85  ? 441  ASP A CA    1 
ATOM   3601 C  C     . ASP A 1 441 ? -5.371  64.788 -0.815  1.00 40.36  ? 441  ASP A C     1 
ATOM   3602 O  O     . ASP A 1 441 ? -5.074  64.390 -1.941  1.00 41.56  ? 441  ASP A O     1 
ATOM   3603 C  CB    . ASP A 1 441 ? -6.377  67.082 -0.586  1.00 48.60  ? 441  ASP A CB    1 
ATOM   3604 C  CG    . ASP A 1 441 ? -7.639  67.908 -0.723  1.00 52.49  ? 441  ASP A CG    1 
ATOM   3605 O  OD1   . ASP A 1 441 ? -8.649  67.371 -1.224  1.00 55.31  ? 441  ASP A OD1   1 
ATOM   3606 O  OD2   . ASP A 1 441 ? -7.619  69.095 -0.335  1.00 53.25  ? 441  ASP A OD2   1 
ATOM   3607 N  N     . TYR A 1 442 ? -4.614  64.554 0.252   1.00 36.48  ? 442  TYR A N     1 
ATOM   3608 C  CA    . TYR A 1 442 ? -3.415  63.724 0.152   1.00 38.28  ? 442  TYR A CA    1 
ATOM   3609 C  C     . TYR A 1 442 ? -3.786  62.254 -0.018  1.00 39.08  ? 442  TYR A C     1 
ATOM   3610 O  O     . TYR A 1 442 ? -3.135  61.527 -0.767  1.00 39.49  ? 442  TYR A O     1 
ATOM   3611 C  CB    . TYR A 1 442 ? -2.506  63.912 1.370   1.00 37.07  ? 442  TYR A CB    1 
ATOM   3612 C  CG    . TYR A 1 442 ? -2.004  65.325 1.519   1.00 38.51  ? 442  TYR A CG    1 
ATOM   3613 C  CD1   . TYR A 1 442 ? -1.044  65.834 0.654   1.00 37.80  ? 442  TYR A CD1   1 
ATOM   3614 C  CD2   . TYR A 1 442 ? -2.495  66.155 2.517   1.00 39.97  ? 442  TYR A CD2   1 
ATOM   3615 C  CE1   . TYR A 1 442 ? -0.586  67.131 0.779   1.00 38.14  ? 442  TYR A CE1   1 
ATOM   3616 C  CE2   . TYR A 1 442 ? -2.042  67.455 2.650   1.00 42.21  ? 442  TYR A CE2   1 
ATOM   3617 C  CZ    . TYR A 1 442 ? -1.089  67.937 1.777   1.00 40.30  ? 442  TYR A CZ    1 
ATOM   3618 O  OH    . TYR A 1 442 ? -0.638  69.230 1.907   1.00 39.77  ? 442  TYR A OH    1 
ATOM   3619 N  N     . ILE A 1 443 ? -4.835  61.827 0.679   1.00 40.04  ? 443  ILE A N     1 
ATOM   3620 C  CA    . ILE A 1 443 ? -5.328  60.458 0.568   1.00 43.00  ? 443  ILE A CA    1 
ATOM   3621 C  C     . ILE A 1 443 ? -5.727  60.135 -0.871  1.00 47.85  ? 443  ILE A C     1 
ATOM   3622 O  O     . ILE A 1 443 ? -5.460  59.041 -1.369  1.00 49.45  ? 443  ILE A O     1 
ATOM   3623 C  CB    . ILE A 1 443 ? -6.531  60.215 1.508   1.00 41.41  ? 443  ILE A CB    1 
ATOM   3624 C  CG1   . ILE A 1 443 ? -6.103  60.359 2.970   1.00 37.95  ? 443  ILE A CG1   1 
ATOM   3625 C  CG2   . ILE A 1 443 ? -7.133  58.838 1.269   1.00 39.29  ? 443  ILE A CG2   1 
ATOM   3626 C  CD1   . ILE A 1 443 ? -7.250  60.296 3.954   1.00 35.18  ? 443  ILE A CD1   1 
ATOM   3627 N  N     . ASN A 1 444 ? -6.350  61.103 -1.538  1.00 49.28  ? 444  ASN A N     1 
ATOM   3628 C  CA    . ASN A 1 444 ? -6.816  60.919 -2.908  1.00 50.25  ? 444  ASN A CA    1 
ATOM   3629 C  C     . ASN A 1 444 ? -5.848  61.444 -3.969  1.00 50.19  ? 444  ASN A C     1 
ATOM   3630 O  O     . ASN A 1 444 ? -6.238  61.647 -5.121  1.00 53.27  ? 444  ASN A O     1 
ATOM   3631 C  CB    . ASN A 1 444 ? -8.190  61.568 -3.091  1.00 51.18  ? 444  ASN A CB    1 
ATOM   3632 C  CG    . ASN A 1 444 ? -9.236  60.979 -2.169  1.00 51.38  ? 444  ASN A CG    1 
ATOM   3633 O  OD1   . ASN A 1 444 ? -9.895  61.698 -1.417  1.00 52.06  ? 444  ASN A OD1   1 
ATOM   3634 N  ND2   . ASN A 1 444 ? -9.392  59.662 -2.218  1.00 51.72  ? 444  ASN A ND2   1 
ATOM   3635 N  N     . ALA A 1 445 ? -4.594  61.661 -3.575  1.00 46.79  ? 445  ALA A N     1 
ATOM   3636 C  CA    . ALA A 1 445 ? -3.552  62.152 -4.480  1.00 47.88  ? 445  ALA A CA    1 
ATOM   3637 C  C     . ALA A 1 445 ? -3.963  63.418 -5.238  1.00 49.72  ? 445  ALA A C     1 
ATOM   3638 O  O     . ALA A 1 445 ? -3.511  63.661 -6.357  1.00 51.28  ? 445  ALA A O     1 
ATOM   3639 C  CB    . ALA A 1 445 ? -3.127  61.057 -5.453  1.00 48.53  ? 445  ALA A CB    1 
ATOM   3640 N  N     . VAL A 1 446 ? -4.816  64.220 -4.609  1.00 48.58  ? 446  VAL A N     1 
ATOM   3641 C  CA    . VAL A 1 446 ? -5.360  65.426 -5.218  1.00 48.29  ? 446  VAL A CA    1 
ATOM   3642 C  C     . VAL A 1 446 ? -4.523  66.653 -4.863  1.00 48.10  ? 446  VAL A C     1 
ATOM   3643 O  O     . VAL A 1 446 ? -4.282  67.524 -5.701  1.00 48.06  ? 446  VAL A O     1 
ATOM   3644 C  CB    . VAL A 1 446 ? -6.825  65.640 -4.772  1.00 48.55  ? 446  VAL A CB    1 
ATOM   3645 C  CG1   . VAL A 1 446 ? -7.248  67.091 -4.941  1.00 52.61  ? 446  VAL A CG1   1 
ATOM   3646 C  CG2   . VAL A 1 446 ? -7.757  64.699 -5.532  1.00 46.50  ? 446  VAL A CG2   1 
ATOM   3647 N  N     . ALA A 1 447 ? -4.071  66.704 -3.615  1.00 47.70  ? 447  ALA A N     1 
ATOM   3648 C  CA    . ALA A 1 447 ? -3.288  67.831 -3.125  1.00 48.90  ? 447  ALA A CA    1 
ATOM   3649 C  C     . ALA A 1 447 ? -1.959  67.990 -3.850  1.00 51.45  ? 447  ALA A C     1 
ATOM   3650 O  O     . ALA A 1 447 ? -1.389  67.026 -4.364  1.00 52.08  ? 447  ALA A O     1 
ATOM   3651 C  CB    . ALA A 1 447 ? -3.051  67.698 -1.635  1.00 47.58  ? 447  ALA A CB    1 
ATOM   3652 N  N     . GLU A 1 448 ? -1.478  69.226 -3.880  1.00 54.30  ? 448  GLU A N     1 
ATOM   3653 C  CA    . GLU A 1 448 ? -0.157  69.536 -4.402  1.00 57.52  ? 448  GLU A CA    1 
ATOM   3654 C  C     . GLU A 1 448 ? 0.909   68.768 -3.620  1.00 52.39  ? 448  GLU A C     1 
ATOM   3655 O  O     . GLU A 1 448 ? 0.824   68.648 -2.397  1.00 51.12  ? 448  GLU A O     1 
ATOM   3656 C  CB    . GLU A 1 448 ? 0.092   71.042 -4.297  1.00 64.17  ? 448  GLU A CB    1 
ATOM   3657 C  CG    . GLU A 1 448 ? 1.514   71.479 -4.595  1.00 73.60  ? 448  GLU A CG    1 
ATOM   3658 C  CD    . GLU A 1 448 ? 1.740   72.954 -4.310  1.00 81.70  ? 448  GLU A CD    1 
ATOM   3659 O  OE1   . GLU A 1 448 ? 2.909   73.353 -4.116  1.00 84.66  ? 448  GLU A OE1   1 
ATOM   3660 O  OE2   . GLU A 1 448 ? 0.748   73.714 -4.281  1.00 83.45  ? 448  GLU A OE2   1 
ATOM   3661 N  N     . ARG A 1 449 ? 1.896   68.235 -4.336  1.00 48.19  ? 449  ARG A N     1 
ATOM   3662 C  CA    . ARG A 1 449 ? 3.029   67.556 -3.717  1.00 43.67  ? 449  ARG A CA    1 
ATOM   3663 C  C     . ARG A 1 449 ? 3.733   68.503 -2.748  1.00 43.23  ? 449  ARG A C     1 
ATOM   3664 O  O     . ARG A 1 449 ? 4.235   69.549 -3.155  1.00 46.59  ? 449  ARG A O     1 
ATOM   3665 C  CB    . ARG A 1 449 ? 4.005   67.074 -4.793  1.00 42.25  ? 449  ARG A CB    1 
ATOM   3666 C  CG    . ARG A 1 449 ? 5.150   66.215 -4.283  1.00 42.15  ? 449  ARG A CG    1 
ATOM   3667 C  CD    . ARG A 1 449 ? 5.961   65.657 -5.444  1.00 43.98  ? 449  ARG A CD    1 
ATOM   3668 N  NE    . ARG A 1 449 ? 6.889   64.606 -5.034  1.00 43.82  ? 449  ARG A NE    1 
ATOM   3669 C  CZ    . ARG A 1 449 ? 8.197   64.626 -5.273  1.00 44.56  ? 449  ARG A CZ    1 
ATOM   3670 N  NH1   . ARG A 1 449 ? 8.742   65.648 -5.916  1.00 45.87  ? 449  ARG A NH1   1 
ATOM   3671 N  NH2   . ARG A 1 449 ? 8.961   63.620 -4.868  1.00 43.91  ? 449  ARG A NH2   1 
ATOM   3672 N  N     . PRO A 1 450 ? 3.760   68.139 -1.455  1.00 39.78  ? 450  PRO A N     1 
ATOM   3673 C  CA    . PRO A 1 450 ? 4.281   68.984 -0.373  1.00 39.54  ? 450  PRO A CA    1 
ATOM   3674 C  C     . PRO A 1 450 ? 5.666   69.561 -0.663  1.00 43.90  ? 450  PRO A C     1 
ATOM   3675 O  O     . PRO A 1 450 ? 5.837   70.781 -0.626  1.00 47.38  ? 450  PRO A O     1 
ATOM   3676 C  CB    . PRO A 1 450 ? 4.345   68.022 0.813   1.00 35.78  ? 450  PRO A CB    1 
ATOM   3677 C  CG    . PRO A 1 450 ? 3.262   67.047 0.546   1.00 35.16  ? 450  PRO A CG    1 
ATOM   3678 C  CD    . PRO A 1 450 ? 3.263   66.850 -0.945  1.00 37.08  ? 450  PRO A CD    1 
ATOM   3679 N  N     . SER A 1 451 ? 6.640   68.706 -0.953  1.00 45.38  ? 451  SER A N     1 
ATOM   3680 C  CA    . SER A 1 451 ? 7.989   69.192 -1.229  1.00 47.49  ? 451  SER A CA    1 
ATOM   3681 C  C     . SER A 1 451 ? 8.705   68.440 -2.337  1.00 51.02  ? 451  SER A C     1 
ATOM   3682 O  O     . SER A 1 451 ? 8.463   67.257 -2.579  1.00 48.15  ? 451  SER A O     1 
ATOM   3683 C  CB    . SER A 1 451 ? 8.857   69.184 0.031   1.00 44.88  ? 451  SER A CB    1 
ATOM   3684 O  OG    . SER A 1 451 ? 10.190  69.560 -0.272  1.00 44.53  ? 451  SER A OG    1 
ATOM   3685 N  N     . ASP A 1 452 ? 9.608   69.159 -2.991  1.00 55.82  ? 452  ASP A N     1 
ATOM   3686 C  CA    . ASP A 1 452 ? 10.386  68.638 -4.095  1.00 57.85  ? 452  ASP A CA    1 
ATOM   3687 C  C     . ASP A 1 452 ? 11.751  68.235 -3.560  1.00 51.63  ? 452  ASP A C     1 
ATOM   3688 O  O     . ASP A 1 452 ? 12.526  67.554 -4.229  1.00 52.08  ? 452  ASP A O     1 
ATOM   3689 C  CB    . ASP A 1 452 ? 10.549  69.743 -5.138  1.00 64.84  ? 452  ASP A CB    1 
ATOM   3690 C  CG    . ASP A 1 452 ? 10.717  69.205 -6.536  1.00 72.15  ? 452  ASP A CG    1 
ATOM   3691 O  OD1   . ASP A 1 452 ? 10.379  68.022 -6.760  1.00 75.51  ? 452  ASP A OD1   1 
ATOM   3692 O  OD2   . ASP A 1 452 ? 11.172  69.970 -7.414  1.00 73.20  ? 452  ASP A OD2   1 
ATOM   3693 N  N     . VAL A 1 453 ? 12.027  68.660 -2.332  1.00 44.50  ? 453  VAL A N     1 
ATOM   3694 C  CA    . VAL A 1 453 ? 13.367  68.596 -1.774  1.00 40.74  ? 453  VAL A CA    1 
ATOM   3695 C  C     . VAL A 1 453 ? 13.395  67.832 -0.457  1.00 39.91  ? 453  VAL A C     1 
ATOM   3696 O  O     . VAL A 1 453 ? 14.296  67.030 -0.213  1.00 40.58  ? 453  VAL A O     1 
ATOM   3697 C  CB    . VAL A 1 453 ? 13.916  70.021 -1.542  1.00 37.45  ? 453  VAL A CB    1 
ATOM   3698 C  CG1   . VAL A 1 453 ? 15.280  69.978 -0.882  1.00 37.69  ? 453  VAL A CG1   1 
ATOM   3699 C  CG2   . VAL A 1 453 ? 13.979  70.783 -2.855  1.00 39.21  ? 453  VAL A CG2   1 
ATOM   3700 N  N     . TYR A 1 454 ? 12.400  68.075 0.389   1.00 40.89  ? 454  TYR A N     1 
ATOM   3701 C  CA    . TYR A 1 454 ? 12.378  67.480 1.722   1.00 40.84  ? 454  TYR A CA    1 
ATOM   3702 C  C     . TYR A 1 454 ? 11.388  66.326 1.856   1.00 40.36  ? 454  TYR A C     1 
ATOM   3703 O  O     . TYR A 1 454 ? 10.470  66.177 1.051   1.00 41.64  ? 454  TYR A O     1 
ATOM   3704 C  CB    . TYR A 1 454 ? 12.078  68.550 2.772   1.00 40.79  ? 454  TYR A CB    1 
ATOM   3705 C  CG    . TYR A 1 454 ? 12.940  69.782 2.639   1.00 42.57  ? 454  TYR A CG    1 
ATOM   3706 C  CD1   . TYR A 1 454 ? 14.307  69.722 2.869   1.00 43.22  ? 454  TYR A CD1   1 
ATOM   3707 C  CD2   . TYR A 1 454 ? 12.388  71.005 2.282   1.00 45.33  ? 454  TYR A CD2   1 
ATOM   3708 C  CE1   . TYR A 1 454 ? 15.102  70.846 2.748   1.00 47.31  ? 454  TYR A CE1   1 
ATOM   3709 C  CE2   . TYR A 1 454 ? 13.175  72.137 2.159   1.00 47.62  ? 454  TYR A CE2   1 
ATOM   3710 C  CZ    . TYR A 1 454 ? 14.531  72.051 2.393   1.00 49.47  ? 454  TYR A CZ    1 
ATOM   3711 O  OH    . TYR A 1 454 ? 15.319  73.172 2.270   1.00 54.28  ? 454  TYR A OH    1 
ATOM   3712 N  N     . SER A 1 455 ? 11.593  65.510 2.886   1.00 38.47  ? 455  SER A N     1 
ATOM   3713 C  CA    . SER A 1 455 ? 10.696  64.403 3.194   1.00 35.62  ? 455  SER A CA    1 
ATOM   3714 C  C     . SER A 1 455 ? 9.549   64.903 4.061   1.00 35.40  ? 455  SER A C     1 
ATOM   3715 O  O     . SER A 1 455 ? 9.769   65.640 5.022   1.00 38.44  ? 455  SER A O     1 
ATOM   3716 C  CB    . SER A 1 455 ? 11.455  63.284 3.904   1.00 34.34  ? 455  SER A CB    1 
ATOM   3717 O  OG    . SER A 1 455 ? 10.568  62.270 4.328   1.00 36.24  ? 455  SER A OG    1 
ATOM   3718 N  N     . CYS A 1 456 ? 8.327   64.500 3.727   1.00 33.84  ? 456  CYS A N     1 
ATOM   3719 C  CA    . CYS A 1 456 ? 7.147   65.143 4.300   1.00 33.83  ? 456  CYS A CA    1 
ATOM   3720 C  C     . CYS A 1 456 ? 6.122   64.222 4.949   1.00 34.46  ? 456  CYS A C     1 
ATOM   3721 O  O     . CYS A 1 456 ? 5.971   63.058 4.578   1.00 36.39  ? 456  CYS A O     1 
ATOM   3722 C  CB    . CYS A 1 456 ? 6.441   65.994 3.240   1.00 33.78  ? 456  CYS A CB    1 
ATOM   3723 S  SG    . CYS A 1 456 ? 7.448   67.323 2.561   1.00 42.84  ? 456  CYS A SG    1 
ATOM   3724 N  N     . SER A 1 457 ? 5.421   64.784 5.926   1.00 33.15  ? 457  SER A N     1 
ATOM   3725 C  CA    . SER A 1 457 ? 4.221   64.189 6.488   1.00 31.22  ? 457  SER A CA    1 
ATOM   3726 C  C     . SER A 1 457 ? 3.073   65.144 6.192   1.00 33.51  ? 457  SER A C     1 
ATOM   3727 O  O     . SER A 1 457 ? 3.262   66.361 6.200   1.00 35.71  ? 457  SER A O     1 
ATOM   3728 C  CB    . SER A 1 457 ? 4.370   64.001 7.997   1.00 29.72  ? 457  SER A CB    1 
ATOM   3729 O  OG    . SER A 1 457 ? 3.115   63.746 8.599   1.00 30.48  ? 457  SER A OG    1 
ATOM   3730 N  N     . PRO A 1 458 ? 1.875   64.602 5.926   1.00 32.37  ? 458  PRO A N     1 
ATOM   3731 C  CA    . PRO A 1 458 ? 0.710   65.434 5.594   1.00 33.71  ? 458  PRO A CA    1 
ATOM   3732 C  C     . PRO A 1 458 ? 0.233   66.343 6.737   1.00 37.49  ? 458  PRO A C     1 
ATOM   3733 O  O     . PRO A 1 458 ? -0.809  66.984 6.605   1.00 40.50  ? 458  PRO A O     1 
ATOM   3734 C  CB    . PRO A 1 458 ? -0.367  64.405 5.243   1.00 33.15  ? 458  PRO A CB    1 
ATOM   3735 C  CG    . PRO A 1 458 ? 0.079   63.136 5.910   1.00 32.79  ? 458  PRO A CG    1 
ATOM   3736 C  CD    . PRO A 1 458 ? 1.572   63.164 5.847   1.00 30.47  ? 458  PRO A CD    1 
ATOM   3737 N  N     . ASN A 1 459 ? 0.980   66.401 7.837   1.00 36.19  ? 459  ASN A N     1 
ATOM   3738 C  CA    . ASN A 1 459 ? 0.668   67.331 8.917   1.00 33.67  ? 459  ASN A CA    1 
ATOM   3739 C  C     . ASN A 1 459 ? 1.314   68.701 8.702   1.00 33.24  ? 459  ASN A C     1 
ATOM   3740 O  O     . ASN A 1 459 ? 1.031   69.649 9.429   1.00 35.88  ? 459  ASN A O     1 
ATOM   3741 C  CB    . ASN A 1 459 ? 1.099   66.760 10.268  1.00 31.41  ? 459  ASN A CB    1 
ATOM   3742 C  CG    . ASN A 1 459 ? 2.593   66.900 10.514  1.00 30.75  ? 459  ASN A CG    1 
ATOM   3743 O  OD1   . ASN A 1 459 ? 3.405   66.703 9.611   1.00 33.04  ? 459  ASN A OD1   1 
ATOM   3744 N  ND2   . ASN A 1 459 ? 2.961   67.239 11.746  1.00 27.61  ? 459  ASN A ND2   1 
ATOM   3745 N  N     . GLY A 1 460 ? 2.193   68.796 7.709   1.00 29.81  ? 460  GLY A N     1 
ATOM   3746 C  CA    . GLY A 1 460 ? 2.839   70.056 7.393   1.00 29.55  ? 460  GLY A CA    1 
ATOM   3747 C  C     . GLY A 1 460 ? 4.335   70.082 7.626   1.00 30.97  ? 460  GLY A C     1 
ATOM   3748 O  O     . GLY A 1 460 ? 5.006   71.059 7.296   1.00 29.53  ? 460  GLY A O     1 
ATOM   3749 N  N     . MET A 1 461 ? 4.865   69.004 8.186   1.00 32.31  ? 461  MET A N     1 
ATOM   3750 C  CA    . MET A 1 461 ? 6.280   68.953 8.513   1.00 33.40  ? 461  MET A CA    1 
ATOM   3751 C  C     . MET A 1 461 ? 7.145   68.495 7.341   1.00 36.87  ? 461  MET A C     1 
ATOM   3752 O  O     . MET A 1 461 ? 6.735   67.657 6.534   1.00 36.61  ? 461  MET A O     1 
ATOM   3753 C  CB    . MET A 1 461 ? 6.510   68.060 9.731   1.00 31.26  ? 461  MET A CB    1 
ATOM   3754 C  CG    . MET A 1 461 ? 5.928   68.625 11.012  1.00 32.16  ? 461  MET A CG    1 
ATOM   3755 S  SD    . MET A 1 461 ? 6.679   70.205 11.447  1.00 38.46  ? 461  MET A SD    1 
ATOM   3756 C  CE    . MET A 1 461 ? 8.346   69.681 11.849  1.00 31.73  ? 461  MET A CE    1 
ATOM   3757 N  N     . MET A 1 462 ? 8.342   69.068 7.257   1.00 37.08  ? 462  MET A N     1 
ATOM   3758 C  CA    . MET A 1 462 ? 9.323   68.680 6.255   1.00 37.28  ? 462  MET A CA    1 
ATOM   3759 C  C     . MET A 1 462 ? 10.624  68.302 6.942   1.00 39.23  ? 462  MET A C     1 
ATOM   3760 O  O     . MET A 1 462 ? 11.033  68.939 7.913   1.00 41.03  ? 462  MET A O     1 
ATOM   3761 C  CB    . MET A 1 462 ? 9.575   69.824 5.276   1.00 37.88  ? 462  MET A CB    1 
ATOM   3762 C  CG    . MET A 1 462 ? 8.334   70.320 4.556   1.00 37.56  ? 462  MET A CG    1 
ATOM   3763 S  SD    . MET A 1 462 ? 8.760   71.411 3.186   1.00 42.73  ? 462  MET A SD    1 
ATOM   3764 C  CE    . MET A 1 462 ? 9.755   72.641 4.025   1.00 31.42  ? 462  MET A CE    1 
ATOM   3765 N  N     . TYR A 1 463 ? 11.276  67.266 6.433   1.00 39.74  ? 463  TYR A N     1 
ATOM   3766 C  CA    . TYR A 1 463 ? 12.505  66.778 7.039   1.00 39.30  ? 463  TYR A CA    1 
ATOM   3767 C  C     . TYR A 1 463 ? 13.600  66.602 6.000   1.00 43.31  ? 463  TYR A C     1 
ATOM   3768 O  O     . TYR A 1 463 ? 13.320  66.364 4.824   1.00 46.06  ? 463  TYR A O     1 
ATOM   3769 C  CB    . TYR A 1 463 ? 12.249  65.457 7.767   1.00 35.41  ? 463  TYR A CB    1 
ATOM   3770 C  CG    . TYR A 1 463 ? 11.164  65.548 8.817   1.00 35.31  ? 463  TYR A CG    1 
ATOM   3771 C  CD1   . TYR A 1 463 ? 9.831   65.341 8.486   1.00 35.53  ? 463  TYR A CD1   1 
ATOM   3772 C  CD2   . TYR A 1 463 ? 11.472  65.847 10.137  1.00 36.94  ? 463  TYR A CD2   1 
ATOM   3773 C  CE1   . TYR A 1 463 ? 8.835   65.426 9.442   1.00 35.65  ? 463  TYR A CE1   1 
ATOM   3774 C  CE2   . TYR A 1 463 ? 10.484  65.935 11.100  1.00 36.12  ? 463  TYR A CE2   1 
ATOM   3775 C  CZ    . TYR A 1 463 ? 9.167   65.724 10.747  1.00 35.43  ? 463  TYR A CZ    1 
ATOM   3776 O  OH    . TYR A 1 463 ? 8.182   65.810 11.704  1.00 34.10  ? 463  TYR A OH    1 
ATOM   3777 N  N     . TYR A 1 464 ? 14.849  66.729 6.435   1.00 43.42  ? 464  TYR A N     1 
ATOM   3778 C  CA    . TYR A 1 464 ? 15.981  66.512 5.543   1.00 44.78  ? 464  TYR A CA    1 
ATOM   3779 C  C     . TYR A 1 464 ? 16.061  65.042 5.152   1.00 42.79  ? 464  TYR A C     1 
ATOM   3780 O  O     . TYR A 1 464 ? 15.914  64.161 5.996   1.00 41.09  ? 464  TYR A O     1 
ATOM   3781 C  CB    . TYR A 1 464 ? 17.284  66.959 6.203   1.00 46.06  ? 464  TYR A CB    1 
ATOM   3782 C  CG    . TYR A 1 464 ? 17.336  68.440 6.494   1.00 49.38  ? 464  TYR A CG    1 
ATOM   3783 C  CD1   . TYR A 1 464 ? 17.159  68.922 7.783   1.00 49.82  ? 464  TYR A CD1   1 
ATOM   3784 C  CD2   . TYR A 1 464 ? 17.553  69.359 5.474   1.00 53.91  ? 464  TYR A CD2   1 
ATOM   3785 C  CE1   . TYR A 1 464 ? 17.204  70.278 8.051   1.00 52.50  ? 464  TYR A CE1   1 
ATOM   3786 C  CE2   . TYR A 1 464 ? 17.598  70.717 5.732   1.00 54.86  ? 464  TYR A CE2   1 
ATOM   3787 C  CZ    . TYR A 1 464 ? 17.422  71.170 7.022   1.00 54.89  ? 464  TYR A CZ    1 
ATOM   3788 O  OH    . TYR A 1 464 ? 17.467  72.521 7.285   1.00 56.11  ? 464  TYR A OH    1 
ATOM   3789 N  N     . LYS A 1 465 ? 16.284  64.783 3.869   1.00 42.59  ? 465  LYS A N     1 
ATOM   3790 C  CA    . LYS A 1 465 ? 16.350  63.416 3.370   1.00 43.84  ? 465  LYS A CA    1 
ATOM   3791 C  C     . LYS A 1 465 ? 17.765  62.860 3.430   1.00 49.11  ? 465  LYS A C     1 
ATOM   3792 O  O     . LYS A 1 465 ? 17.964  61.656 3.583   1.00 51.43  ? 465  LYS A O     1 
ATOM   3793 C  CB    . LYS A 1 465 ? 15.860  63.352 1.925   1.00 44.26  ? 465  LYS A CB    1 
ATOM   3794 C  CG    . LYS A 1 465 ? 14.410  63.734 1.737   1.00 45.03  ? 465  LYS A CG    1 
ATOM   3795 C  CD    . LYS A 1 465 ? 14.022  63.640 0.272   1.00 45.52  ? 465  LYS A CD    1 
ATOM   3796 C  CE    . LYS A 1 465 ? 14.175  62.222 -0.246  1.00 42.00  ? 465  LYS A CE    1 
ATOM   3797 N  NZ    . LYS A 1 465 ? 13.810  62.126 -1.685  1.00 43.53  ? 465  LYS A NZ    1 
ATOM   3798 N  N     A ASP A 1 466 ? 18.751  63.743 3.312   0.42 50.88  ? 466  ASP A N     1 
ATOM   3799 N  N     B ASP A 1 466 ? 18.742  63.751 3.302   0.58 50.90  ? 466  ASP A N     1 
ATOM   3800 C  CA    A ASP A 1 466 ? 20.145  63.320 3.244   0.42 52.42  ? 466  ASP A CA    1 
ATOM   3801 C  CA    B ASP A 1 466 ? 20.145  63.362 3.249   0.58 52.22  ? 466  ASP A CA    1 
ATOM   3802 C  C     A ASP A 1 466 ? 20.682  62.831 4.588   0.42 53.54  ? 466  ASP A C     1 
ATOM   3803 C  C     B ASP A 1 466 ? 20.649  62.835 4.588   0.58 53.48  ? 466  ASP A C     1 
ATOM   3804 O  O     A ASP A 1 466 ? 21.028  61.659 4.738   0.42 54.19  ? 466  ASP A O     1 
ATOM   3805 O  O     B ASP A 1 466 ? 20.939  61.647 4.734   0.58 54.24  ? 466  ASP A O     1 
ATOM   3806 C  CB    A ASP A 1 466 ? 21.017  64.454 2.700   0.42 52.84  ? 466  ASP A CB    1 
ATOM   3807 C  CB    B ASP A 1 466 ? 20.996  64.553 2.806   0.58 52.29  ? 466  ASP A CB    1 
ATOM   3808 C  CG    A ASP A 1 466 ? 20.566  64.929 1.330   0.42 52.34  ? 466  ASP A CG    1 
ATOM   3809 C  CG    B ASP A 1 466 ? 20.182  65.827 2.654   0.58 50.37  ? 466  ASP A CG    1 
ATOM   3810 O  OD1   A ASP A 1 466 ? 20.120  64.086 0.524   0.42 51.41  ? 466  ASP A OD1   1 
ATOM   3811 O  OD1   B ASP A 1 466 ? 19.943  66.247 1.503   0.58 52.15  ? 466  ASP A OD1   1 
ATOM   3812 O  OD2   A ASP A 1 466 ? 20.651  66.145 1.063   0.42 52.86  ? 466  ASP A OD2   1 
ATOM   3813 O  OD2   B ASP A 1 466 ? 19.774  66.404 3.685   0.58 45.84  ? 466  ASP A OD2   1 
ATOM   3814 N  N     . ARG A 1 467 ? 20.747  63.732 5.562   1.00 56.37  ? 467  ARG A N     1 
ATOM   3815 C  CA    . ARG A 1 467 ? 21.304  63.408 6.874   1.00 61.76  ? 467  ARG A CA    1 
ATOM   3816 C  C     . ARG A 1 467 ? 20.523  62.346 7.647   1.00 61.64  ? 467  ARG A C     1 
ATOM   3817 O  O     . ARG A 1 467 ? 19.305  62.229 7.515   1.00 59.87  ? 467  ARG A O     1 
ATOM   3818 C  CB    . ARG A 1 467 ? 21.421  64.685 7.711   1.00 65.30  ? 467  ARG A CB    1 
ATOM   3819 C  CG    . ARG A 1 467 ? 20.103  65.429 7.889   1.00 65.08  ? 467  ARG A CG    1 
ATOM   3820 C  CD    . ARG A 1 467 ? 20.320  66.871 8.329   1.00 66.32  ? 467  ARG A CD    1 
ATOM   3821 N  NE    . ARG A 1 467 ? 20.845  67.704 7.249   1.00 68.42  ? 467  ARG A NE    1 
ATOM   3822 C  CZ    . ARG A 1 467 ? 21.109  69.001 7.369   1.00 69.35  ? 467  ARG A CZ    1 
ATOM   3823 N  NH1   . ARG A 1 467 ? 20.898  69.616 8.524   1.00 68.07  ? 467  ARG A NH1   1 
ATOM   3824 N  NH2   . ARG A 1 467 ? 21.584  69.685 6.335   1.00 70.62  ? 467  ARG A NH2   1 
ATOM   3825 N  N     . ASP A 1 468 ? 21.241  61.578 8.460   1.00 64.01  ? 468  ASP A N     1 
ATOM   3826 C  CA    . ASP A 1 468 ? 20.625  60.556 9.296   1.00 63.83  ? 468  ASP A CA    1 
ATOM   3827 C  C     . ASP A 1 468 ? 20.127  61.178 10.594  1.00 59.62  ? 468  ASP A C     1 
ATOM   3828 O  O     . ASP A 1 468 ? 20.799  62.026 11.183  1.00 60.96  ? 468  ASP A O     1 
ATOM   3829 C  CB    . ASP A 1 468 ? 21.628  59.444 9.610   1.00 68.08  ? 468  ASP A CB    1 
ATOM   3830 C  CG    . ASP A 1 468 ? 22.398  58.987 8.383   1.00 72.93  ? 468  ASP A CG    1 
ATOM   3831 O  OD1   . ASP A 1 468 ? 21.824  58.247 7.557   1.00 74.81  ? 468  ASP A OD1   1 
ATOM   3832 O  OD2   . ASP A 1 468 ? 23.583  59.363 8.252   1.00 73.79  ? 468  ASP A OD2   1 
ATOM   3833 N  N     . GLY A 1 469 ? 18.948  60.759 11.038  1.00 54.00  ? 469  GLY A N     1 
ATOM   3834 C  CA    . GLY A 1 469 ? 18.397  61.244 12.289  1.00 46.44  ? 469  GLY A CA    1 
ATOM   3835 C  C     . GLY A 1 469 ? 18.695  60.288 13.425  1.00 40.77  ? 469  GLY A C     1 
ATOM   3836 O  O     . GLY A 1 469 ? 18.642  59.075 13.242  1.00 42.22  ? 469  GLY A O     1 
ATOM   3837 N  N     . VAL A 1 470 ? 19.005  60.827 14.599  1.00 34.93  ? 470  VAL A N     1 
ATOM   3838 C  CA    . VAL A 1 470 ? 19.341  59.990 15.742  1.00 32.11  ? 470  VAL A CA    1 
ATOM   3839 C  C     . VAL A 1 470 ? 18.140  59.145 16.182  1.00 29.26  ? 470  VAL A C     1 
ATOM   3840 O  O     . VAL A 1 470 ? 18.301  58.009 16.622  1.00 31.76  ? 470  VAL A O     1 
ATOM   3841 C  CB    . VAL A 1 470 ? 19.916  60.814 16.920  1.00 33.55  ? 470  VAL A CB    1 
ATOM   3842 C  CG1   . VAL A 1 470 ? 18.867  61.759 17.491  1.00 26.11  ? 470  VAL A CG1   1 
ATOM   3843 C  CG2   . VAL A 1 470 ? 20.472  59.891 17.999  1.00 26.87  ? 470  VAL A CG2   1 
ATOM   3844 N  N     . VAL A 1 471 ? 16.935  59.683 16.038  1.00 27.54  ? 471  VAL A N     1 
ATOM   3845 C  CA    . VAL A 1 471 ? 15.741  58.897 16.337  1.00 26.89  ? 471  VAL A CA    1 
ATOM   3846 C  C     . VAL A 1 471 ? 15.525  57.752 15.330  1.00 29.47  ? 471  VAL A C     1 
ATOM   3847 O  O     . VAL A 1 471 ? 15.360  56.605 15.741  1.00 28.11  ? 471  VAL A O     1 
ATOM   3848 C  CB    . VAL A 1 471 ? 14.467  59.770 16.521  1.00 22.89  ? 471  VAL A CB    1 
ATOM   3849 C  CG1   . VAL A 1 471 ? 13.209  58.916 16.439  1.00 22.04  ? 471  VAL A CG1   1 
ATOM   3850 C  CG2   . VAL A 1 471 ? 14.523  60.513 17.843  1.00 22.87  ? 471  VAL A CG2   1 
ATOM   3851 N  N     . PRO A 1 472 ? 15.534  58.047 14.013  1.00 32.98  ? 472  PRO A N     1 
ATOM   3852 C  CA    . PRO A 1 472 ? 15.444  56.919 13.077  1.00 32.72  ? 472  PRO A CA    1 
ATOM   3853 C  C     . PRO A 1 472 ? 16.604  55.938 13.228  1.00 34.11  ? 472  PRO A C     1 
ATOM   3854 O  O     . PRO A 1 472 ? 16.394  54.728 13.135  1.00 37.03  ? 472  PRO A O     1 
ATOM   3855 C  CB    . PRO A 1 472 ? 15.523  57.598 11.707  1.00 33.53  ? 472  PRO A CB    1 
ATOM   3856 C  CG    . PRO A 1 472 ? 14.997  58.964 11.937  1.00 33.37  ? 472  PRO A CG    1 
ATOM   3857 C  CD    . PRO A 1 472 ? 15.452  59.343 13.312  1.00 31.82  ? 472  PRO A CD    1 
ATOM   3858 N  N     . THR A 1 473 ? 17.805  56.457 13.462  1.00 33.14  ? 473  THR A N     1 
ATOM   3859 C  CA    . THR A 1 473 ? 18.993  55.615 13.591  1.00 33.82  ? 473  THR A CA    1 
ATOM   3860 C  C     . THR A 1 473 ? 18.868  54.597 14.722  1.00 33.78  ? 473  THR A C     1 
ATOM   3861 O  O     . THR A 1 473 ? 19.079  53.402 14.517  1.00 36.00  ? 473  THR A O     1 
ATOM   3862 C  CB    . THR A 1 473 ? 20.273  56.456 13.799  1.00 32.58  ? 473  THR A CB    1 
ATOM   3863 O  OG1   . THR A 1 473 ? 20.597  57.148 12.586  1.00 33.74  ? 473  THR A OG1   1 
ATOM   3864 C  CG2   . THR A 1 473 ? 21.440  55.566 14.190  1.00 28.41  ? 473  THR A CG2   1 
ATOM   3865 N  N     . GLU A 1 474 ? 18.513  55.069 15.912  1.00 32.42  ? 474  GLU A N     1 
ATOM   3866 C  CA    . GLU A 1 474 ? 18.449  54.195 17.077  1.00 33.51  ? 474  GLU A CA    1 
ATOM   3867 C  C     . GLU A 1 474 ? 17.184  53.342 17.115  1.00 33.58  ? 474  GLU A C     1 
ATOM   3868 O  O     . GLU A 1 474 ? 17.180  52.259 17.700  1.00 33.56  ? 474  GLU A O     1 
ATOM   3869 C  CB    . GLU A 1 474 ? 18.596  55.000 18.371  1.00 32.75  ? 474  GLU A CB    1 
ATOM   3870 C  CG    . GLU A 1 474 ? 19.955  55.653 18.529  1.00 36.73  ? 474  GLU A CG    1 
ATOM   3871 C  CD    . GLU A 1 474 ? 21.096  54.654 18.452  1.00 39.26  ? 474  GLU A CD    1 
ATOM   3872 O  OE1   . GLU A 1 474 ? 22.106  54.963 17.787  1.00 39.78  ? 474  GLU A OE1   1 
ATOM   3873 O  OE2   . GLU A 1 474 ? 20.987  53.566 19.058  1.00 41.40  ? 474  GLU A OE2   1 
ATOM   3874 N  N     . ILE A 1 475 ? 16.112  53.826 16.496  1.00 34.33  ? 475  ILE A N     1 
ATOM   3875 C  CA    . ILE A 1 475 ? 14.874  53.056 16.458  1.00 34.46  ? 475  ILE A CA    1 
ATOM   3876 C  C     . ILE A 1 475 ? 15.032  51.912 15.464  1.00 33.26  ? 475  ILE A C     1 
ATOM   3877 O  O     . ILE A 1 475 ? 14.391  50.871 15.593  1.00 34.67  ? 475  ILE A O     1 
ATOM   3878 C  CB    . ILE A 1 475 ? 13.640  53.931 16.112  1.00 26.45  ? 475  ILE A CB    1 
ATOM   3879 C  CG1   . ILE A 1 475 ? 12.367  53.330 16.717  1.00 25.91  ? 475  ILE A CG1   1 
ATOM   3880 C  CG2   . ILE A 1 475 ? 13.498  54.112 14.610  1.00 24.32  ? 475  ILE A CG2   1 
ATOM   3881 C  CD1   . ILE A 1 475 ? 11.130  54.180 16.522  1.00 24.76  ? 475  ILE A CD1   1 
ATOM   3882 N  N     . THR A 1 476 ? 15.915  52.104 14.490  1.00 31.13  ? 476  THR A N     1 
ATOM   3883 C  CA    . THR A 1 476 ? 16.182  51.083 13.491  1.00 31.34  ? 476  THR A CA    1 
ATOM   3884 C  C     . THR A 1 476 ? 16.991  49.935 14.095  1.00 35.50  ? 476  THR A C     1 
ATOM   3885 O  O     . THR A 1 476 ? 16.713  48.764 13.821  1.00 37.90  ? 476  THR A O     1 
ATOM   3886 C  CB    . THR A 1 476 ? 16.910  51.678 12.271  1.00 31.22  ? 476  THR A CB    1 
ATOM   3887 O  OG1   . THR A 1 476 ? 16.118  52.735 11.717  1.00 30.60  ? 476  THR A OG1   1 
ATOM   3888 C  CG2   . THR A 1 476 ? 17.139  50.625 11.203  1.00 29.24  ? 476  THR A CG2   1 
ATOM   3889 N  N     . LYS A 1 477 ? 17.980  50.271 14.925  1.00 33.32  ? 477  LYS A N     1 
ATOM   3890 C  CA    . LYS A 1 477 ? 18.794  49.262 15.609  1.00 29.74  ? 477  LYS A CA    1 
ATOM   3891 C  C     . LYS A 1 477 ? 17.933  48.314 16.437  1.00 30.34  ? 477  LYS A C     1 
ATOM   3892 O  O     . LYS A 1 477 ? 18.054  47.094 16.321  1.00 33.13  ? 477  LYS A O     1 
ATOM   3893 C  CB    . LYS A 1 477 ? 19.847  49.919 16.507  1.00 29.59  ? 477  LYS A CB    1 
ATOM   3894 C  CG    . LYS A 1 477 ? 20.931  50.678 15.760  1.00 33.59  ? 477  LYS A CG    1 
ATOM   3895 C  CD    . LYS A 1 477 ? 21.899  51.349 16.729  1.00 39.51  ? 477  LYS A CD    1 
ATOM   3896 C  CE    . LYS A 1 477 ? 22.879  52.262 15.996  1.00 46.91  ? 477  LYS A CE    1 
ATOM   3897 N  NZ    . LYS A 1 477 ? 23.902  52.886 16.892  1.00 50.46  ? 477  LYS A NZ    1 
ATOM   3898 N  N     . VAL A 1 478 ? 17.062  48.877 17.268  1.00 30.09  ? 478  VAL A N     1 
ATOM   3899 C  CA    . VAL A 1 478 ? 16.204  48.064 18.123  1.00 31.61  ? 478  VAL A CA    1 
ATOM   3900 C  C     . VAL A 1 478 ? 15.187  47.283 17.292  1.00 34.61  ? 478  VAL A C     1 
ATOM   3901 O  O     . VAL A 1 478 ? 14.887  46.126 17.594  1.00 37.77  ? 478  VAL A O     1 
ATOM   3902 C  CB    . VAL A 1 478 ? 15.483  48.912 19.194  1.00 28.31  ? 478  VAL A CB    1 
ATOM   3903 C  CG1   . VAL A 1 478 ? 14.604  48.029 20.067  1.00 23.87  ? 478  VAL A CG1   1 
ATOM   3904 C  CG2   . VAL A 1 478 ? 16.497  49.661 20.046  1.00 29.87  ? 478  VAL A CG2   1 
ATOM   3905 N  N     . PHE A 1 479 ? 14.671  47.908 16.237  1.00 32.68  ? 479  PHE A N     1 
ATOM   3906 C  CA    . PHE A 1 479 ? 13.716  47.238 15.360  1.00 33.39  ? 479  PHE A CA    1 
ATOM   3907 C  C     . PHE A 1 479 ? 14.295  45.975 14.724  1.00 36.54  ? 479  PHE A C     1 
ATOM   3908 O  O     . PHE A 1 479 ? 13.591  44.979 14.553  1.00 38.94  ? 479  PHE A O     1 
ATOM   3909 C  CB    . PHE A 1 479 ? 13.215  48.179 14.265  1.00 35.32  ? 479  PHE A CB    1 
ATOM   3910 C  CG    . PHE A 1 479 ? 12.582  47.463 13.107  1.00 37.96  ? 479  PHE A CG    1 
ATOM   3911 C  CD1   . PHE A 1 479 ? 11.311  46.919 13.223  1.00 38.39  ? 479  PHE A CD1   1 
ATOM   3912 C  CD2   . PHE A 1 479 ? 13.262  47.318 11.907  1.00 38.00  ? 479  PHE A CD2   1 
ATOM   3913 C  CE1   . PHE A 1 479 ? 10.728  46.249 12.161  1.00 39.40  ? 479  PHE A CE1   1 
ATOM   3914 C  CE2   . PHE A 1 479 ? 12.683  46.649 10.842  1.00 39.22  ? 479  PHE A CE2   1 
ATOM   3915 C  CZ    . PHE A 1 479 ? 11.415  46.115 10.968  1.00 39.21  ? 479  PHE A CZ    1 
ATOM   3916 N  N     . ASN A 1 480 ? 15.574  46.023 14.365  1.00 36.92  ? 480  ASN A N     1 
ATOM   3917 C  CA    . ASN A 1 480 ? 16.238  44.863 13.782  1.00 36.00  ? 480  ASN A CA    1 
ATOM   3918 C  C     . ASN A 1 480 ? 16.301  43.701 14.766  1.00 37.22  ? 480  ASN A C     1 
ATOM   3919 O  O     . ASN A 1 480 ? 16.113  42.543 14.385  1.00 35.95  ? 480  ASN A O     1 
ATOM   3920 C  CB    . ASN A 1 480 ? 17.635  45.232 13.286  1.00 34.76  ? 480  ASN A CB    1 
ATOM   3921 C  CG    . ASN A 1 480 ? 17.597  46.105 12.050  1.00 38.06  ? 480  ASN A CG    1 
ATOM   3922 O  OD1   . ASN A 1 480 ? 16.679  46.004 11.238  1.00 39.06  ? 480  ASN A OD1   1 
ATOM   3923 N  ND2   . ASN A 1 480 ? 18.595  46.969 11.901  1.00 39.50  ? 480  ASN A ND2   1 
ATOM   3924 N  N     . GLN A 1 481 ? 16.563  44.022 16.032  1.00 38.15  ? 481  GLN A N     1 
ATOM   3925 C  CA    . GLN A 1 481 ? 16.518  43.036 17.104  1.00 39.07  ? 481  GLN A CA    1 
ATOM   3926 C  C     . GLN A 1 481 ? 15.119  42.446 17.193  1.00 39.01  ? 481  GLN A C     1 
ATOM   3927 O  O     . GLN A 1 481 ? 14.955  41.245 17.402  1.00 40.76  ? 481  GLN A O     1 
ATOM   3928 C  CB    . GLN A 1 481 ? 16.869  43.677 18.445  1.00 39.85  ? 481  GLN A CB    1 
ATOM   3929 C  CG    . GLN A 1 481 ? 18.258  44.256 18.537  1.00 44.34  ? 481  GLN A CG    1 
ATOM   3930 C  CD    . GLN A 1 481 ? 18.486  44.965 19.858  1.00 51.19  ? 481  GLN A CD    1 
ATOM   3931 O  OE1   . GLN A 1 481 ? 17.701  44.824 20.802  1.00 48.61  ? 481  GLN A OE1   1 
ATOM   3932 N  NE2   . GLN A 1 481 ? 19.560  45.737 19.931  1.00 56.44  ? 481  GLN A NE2   1 
ATOM   3933 N  N     . ARG A 1 482 ? 14.114  43.302 17.034  1.00 36.60  ? 482  ARG A N     1 
ATOM   3934 C  CA    . ARG A 1 482 ? 12.724  42.872 17.094  1.00 33.77  ? 482  ARG A CA    1 
ATOM   3935 C  C     . ARG A 1 482 ? 12.398  41.919 15.954  1.00 35.47  ? 482  ARG A C     1 
ATOM   3936 O  O     . ARG A 1 482 ? 11.790  40.873 16.167  1.00 37.09  ? 482  ARG A O     1 
ATOM   3937 C  CB    . ARG A 1 482 ? 11.776  44.072 17.062  1.00 29.58  ? 482  ARG A CB    1 
ATOM   3938 C  CG    . ARG A 1 482 ? 10.325  43.721 17.356  1.00 29.15  ? 482  ARG A CG    1 
ATOM   3939 C  CD    . ARG A 1 482 ? 9.497   43.525 16.094  1.00 28.64  ? 482  ARG A CD    1 
ATOM   3940 N  NE    . ARG A 1 482 ? 8.164   43.018 16.411  1.00 29.91  ? 482  ARG A NE    1 
ATOM   3941 C  CZ    . ARG A 1 482 ? 7.090   43.202 15.651  1.00 32.60  ? 482  ARG A CZ    1 
ATOM   3942 N  NH1   . ARG A 1 482 ? 7.181   43.893 14.523  1.00 35.02  ? 482  ARG A NH1   1 
ATOM   3943 N  NH2   . ARG A 1 482 ? 5.921   42.699 16.023  1.00 31.98  ? 482  ARG A NH2   1 
ATOM   3944 N  N     . LYS A 1 483 ? 12.805  42.283 14.743  1.00 35.73  ? 483  LYS A N     1 
ATOM   3945 C  CA    . LYS A 1 483 ? 12.517  41.454 13.582  1.00 38.85  ? 483  LYS A CA    1 
ATOM   3946 C  C     . LYS A 1 483 ? 13.156  40.076 13.713  1.00 40.60  ? 483  LYS A C     1 
ATOM   3947 O  O     . LYS A 1 483 ? 12.547  39.066 13.363  1.00 40.58  ? 483  LYS A O     1 
ATOM   3948 C  CB    . LYS A 1 483 ? 12.986  42.123 12.293  1.00 39.81  ? 483  LYS A CB    1 
ATOM   3949 C  CG    . LYS A 1 483 ? 12.561  41.362 11.052  1.00 44.92  ? 483  LYS A CG    1 
ATOM   3950 C  CD    . LYS A 1 483 ? 13.082  42.002 9.785   1.00 50.61  ? 483  LYS A CD    1 
ATOM   3951 C  CE    . LYS A 1 483 ? 12.641  41.209 8.567   1.00 54.89  ? 483  LYS A CE    1 
ATOM   3952 N  NZ    . LYS A 1 483 ? 13.268  41.733 7.325   1.00 58.33  ? 483  LYS A NZ    1 
ATOM   3953 N  N     . GLU A 1 484 ? 14.385  40.044 14.218  1.00 42.29  ? 484  GLU A N     1 
ATOM   3954 C  CA    . GLU A 1 484 ? 15.098  38.789 14.413  1.00 45.30  ? 484  GLU A CA    1 
ATOM   3955 C  C     . GLU A 1 484 ? 14.337  37.853 15.350  1.00 45.68  ? 484  GLU A C     1 
ATOM   3956 O  O     . GLU A 1 484 ? 14.113  36.685 15.027  1.00 49.34  ? 484  GLU A O     1 
ATOM   3957 C  CB    . GLU A 1 484 ? 16.503  39.045 14.963  1.00 48.16  ? 484  GLU A CB    1 
ATOM   3958 C  CG    . GLU A 1 484 ? 17.232  37.778 15.373  1.00 54.48  ? 484  GLU A CG    1 
ATOM   3959 C  CD    . GLU A 1 484 ? 18.520  38.053 16.120  1.00 60.20  ? 484  GLU A CD    1 
ATOM   3960 O  OE1   . GLU A 1 484 ? 18.908  37.214 16.961  1.00 61.03  ? 484  GLU A OE1   1 
ATOM   3961 O  OE2   . GLU A 1 484 ? 19.146  39.104 15.865  1.00 63.68  ? 484  GLU A OE2   1 
ATOM   3962 N  N     . HIS A 1 485 ? 13.932  38.373 16.505  1.00 39.32  ? 485  HIS A N     1 
ATOM   3963 C  CA    . HIS A 1 485 ? 13.258  37.556 17.507  1.00 36.44  ? 485  HIS A CA    1 
ATOM   3964 C  C     . HIS A 1 485 ? 11.863  37.119 17.068  1.00 35.74  ? 485  HIS A C     1 
ATOM   3965 O  O     . HIS A 1 485 ? 11.419  36.022 17.413  1.00 34.75  ? 485  HIS A O     1 
ATOM   3966 C  CB    . HIS A 1 485 ? 13.199  38.277 18.853  1.00 35.74  ? 485  HIS A CB    1 
ATOM   3967 C  CG    . HIS A 1 485 ? 14.504  38.293 19.587  1.00 38.27  ? 485  HIS A CG    1 
ATOM   3968 N  ND1   . HIS A 1 485 ? 15.044  37.167 20.169  1.00 40.17  ? 485  HIS A ND1   1 
ATOM   3969 C  CD2   . HIS A 1 485 ? 15.372  39.301 19.842  1.00 37.69  ? 485  HIS A CD2   1 
ATOM   3970 C  CE1   . HIS A 1 485 ? 16.191  37.478 20.747  1.00 40.40  ? 485  HIS A CE1   1 
ATOM   3971 N  NE2   . HIS A 1 485 ? 16.413  38.768 20.563  1.00 38.19  ? 485  HIS A NE2   1 
ATOM   3972 N  N     . LYS A 1 486 ? 11.174  37.971 16.311  1.00 35.60  ? 486  LYS A N     1 
ATOM   3973 C  CA    . LYS A 1 486 ? 9.859   37.610 15.788  1.00 36.70  ? 486  LYS A CA    1 
ATOM   3974 C  C     . LYS A 1 486 ? 9.992   36.421 14.847  1.00 39.91  ? 486  LYS A C     1 
ATOM   3975 O  O     . LYS A 1 486 ? 9.147   35.521 14.836  1.00 44.37  ? 486  LYS A O     1 
ATOM   3976 C  CB    . LYS A 1 486 ? 9.192   38.786 15.073  1.00 35.50  ? 486  LYS A CB    1 
ATOM   3977 C  CG    . LYS A 1 486 ? 7.806   38.452 14.541  1.00 35.79  ? 486  LYS A CG    1 
ATOM   3978 C  CD    . LYS A 1 486 ? 7.071   39.683 14.047  1.00 37.56  ? 486  LYS A CD    1 
ATOM   3979 C  CE    . LYS A 1 486 ? 5.691   39.314 13.516  1.00 40.61  ? 486  LYS A CE    1 
ATOM   3980 N  NZ    . LYS A 1 486 ? 4.803   40.501 13.336  1.00 44.51  ? 486  LYS A NZ    1 
ATOM   3981 N  N     . GLY A 1 487 ? 11.071  36.422 14.070  1.00 36.70  ? 487  GLY A N     1 
ATOM   3982 C  CA    . GLY A 1 487 ? 11.376  35.315 13.187  1.00 36.48  ? 487  GLY A CA    1 
ATOM   3983 C  C     . GLY A 1 487 ? 11.470  34.010 13.950  1.00 35.54  ? 487  GLY A C     1 
ATOM   3984 O  O     . GLY A 1 487 ? 10.858  33.017 13.564  1.00 34.84  ? 487  GLY A O     1 
ATOM   3985 N  N     . TYR A 1 488 ? 12.233  34.016 15.040  1.00 35.96  ? 488  TYR A N     1 
ATOM   3986 C  CA    . TYR A 1 488 ? 12.357  32.839 15.888  1.00 38.27  ? 488  TYR A CA    1 
ATOM   3987 C  C     . TYR A 1 488 ? 10.988  32.426 16.418  1.00 39.32  ? 488  TYR A C     1 
ATOM   3988 O  O     . TYR A 1 488 ? 10.670  31.238 16.466  1.00 38.56  ? 488  TYR A O     1 
ATOM   3989 C  CB    . TYR A 1 488 ? 13.301  33.102 17.064  1.00 38.20  ? 488  TYR A CB    1 
ATOM   3990 C  CG    . TYR A 1 488 ? 14.705  33.514 16.681  1.00 38.63  ? 488  TYR A CG    1 
ATOM   3991 C  CD1   . TYR A 1 488 ? 15.253  33.153 15.458  1.00 39.29  ? 488  TYR A CD1   1 
ATOM   3992 C  CD2   . TYR A 1 488 ? 15.485  34.266 17.552  1.00 40.04  ? 488  TYR A CD2   1 
ATOM   3993 C  CE1   . TYR A 1 488 ? 16.539  33.533 15.113  1.00 42.79  ? 488  TYR A CE1   1 
ATOM   3994 C  CE2   . TYR A 1 488 ? 16.769  34.650 17.217  1.00 40.88  ? 488  TYR A CE2   1 
ATOM   3995 C  CZ    . TYR A 1 488 ? 17.291  34.282 15.999  1.00 43.87  ? 488  TYR A CZ    1 
ATOM   3996 O  OH    . TYR A 1 488 ? 18.569  34.669 15.671  1.00 46.67  ? 488  TYR A OH    1 
ATOM   3997 N  N     . MET A 1 489 ? 10.180  33.411 16.810  1.00 36.95  ? 489  MET A N     1 
ATOM   3998 C  CA    . MET A 1 489 ? 8.859   33.132 17.367  1.00 32.31  ? 489  MET A CA    1 
ATOM   3999 C  C     . MET A 1 489 ? 7.955   32.433 16.361  1.00 34.41  ? 489  MET A C     1 
ATOM   4000 O  O     . MET A 1 489 ? 7.401   31.367 16.642  1.00 35.56  ? 489  MET A O     1 
ATOM   4001 C  CB    . MET A 1 489 ? 8.178   34.409 17.849  1.00 27.80  ? 489  MET A CB    1 
ATOM   4002 C  CG    . MET A 1 489 ? 6.784   34.152 18.402  1.00 24.15  ? 489  MET A CG    1 
ATOM   4003 S  SD    . MET A 1 489 ? 5.767   35.625 18.559  1.00 55.16  ? 489  MET A SD    1 
ATOM   4004 C  CE    . MET A 1 489 ? 5.571   36.093 16.840  1.00 30.35  ? 489  MET A CE    1 
ATOM   4005 N  N     . LEU A 1 490 ? 7.806   33.045 15.190  1.00 34.48  ? 490  LEU A N     1 
ATOM   4006 C  CA    . LEU A 1 490 ? 6.934   32.508 14.150  1.00 36.15  ? 490  LEU A CA    1 
ATOM   4007 C  C     . LEU A 1 490 ? 7.382   31.130 13.680  1.00 39.60  ? 490  LEU A C     1 
ATOM   4008 O  O     . LEU A 1 490 ? 6.553   30.275 13.365  1.00 41.12  ? 490  LEU A O     1 
ATOM   4009 C  CB    . LEU A 1 490 ? 6.842   33.474 12.972  1.00 36.21  ? 490  LEU A CB    1 
ATOM   4010 C  CG    . LEU A 1 490 ? 5.987   34.711 13.246  1.00 36.28  ? 490  LEU A CG    1 
ATOM   4011 C  CD1   . LEU A 1 490 ? 6.039   35.677 12.074  1.00 36.81  ? 490  LEU A CD1   1 
ATOM   4012 C  CD2   . LEU A 1 490 ? 4.555   34.291 13.546  1.00 33.62  ? 490  LEU A CD2   1 
ATOM   4013 N  N     . ALA A 1 491 ? 8.694   30.919 13.635  1.00 41.21  ? 491  ALA A N     1 
ATOM   4014 C  CA    . ALA A 1 491 ? 9.240   29.619 13.268  1.00 42.88  ? 491  ALA A CA    1 
ATOM   4015 C  C     . ALA A 1 491 ? 8.872   28.580 14.322  1.00 43.09  ? 491  ALA A C     1 
ATOM   4016 O  O     . ALA A 1 491 ? 8.512   27.451 13.990  1.00 44.13  ? 491  ALA A O     1 
ATOM   4017 C  CB    . ALA A 1 491 ? 10.750  29.702 13.100  1.00 44.41  ? 491  ALA A CB    1 
ATOM   4018 N  N     . ALA A 1 492 ? 8.959   28.974 15.590  1.00 42.21  ? 492  ALA A N     1 
ATOM   4019 C  CA    . ALA A 1 492 ? 8.588   28.099 16.698  1.00 41.50  ? 492  ALA A CA    1 
ATOM   4020 C  C     . ALA A 1 492 ? 7.105   27.780 16.612  1.00 41.41  ? 492  ALA A C     1 
ATOM   4021 O  O     . ALA A 1 492 ? 6.679   26.649 16.852  1.00 39.52  ? 492  ALA A O     1 
ATOM   4022 C  CB    . ALA A 1 492 ? 8.910   28.762 18.025  1.00 37.42  ? 492  ALA A CB    1 
ATOM   4023 N  N     . GLN A 1 493 ? 6.329   28.800 16.262  1.00 40.93  ? 493  GLN A N     1 
ATOM   4024 C  CA    . GLN A 1 493 ? 4.891   28.672 16.071  1.00 41.28  ? 493  GLN A CA    1 
ATOM   4025 C  C     . GLN A 1 493 ? 4.566   27.726 14.912  1.00 41.29  ? 493  GLN A C     1 
ATOM   4026 O  O     . GLN A 1 493 ? 3.690   26.867 15.026  1.00 42.03  ? 493  GLN A O     1 
ATOM   4027 C  CB    . GLN A 1 493 ? 4.296   30.055 15.822  1.00 40.82  ? 493  GLN A CB    1 
ATOM   4028 C  CG    . GLN A 1 493 ? 2.800   30.095 15.618  1.00 45.81  ? 493  GLN A CG    1 
ATOM   4029 C  CD    . GLN A 1 493 ? 2.304   31.513 15.432  1.00 51.70  ? 493  GLN A CD    1 
ATOM   4030 O  OE1   . GLN A 1 493 ? 1.566   31.811 14.491  1.00 55.33  ? 493  GLN A OE1   1 
ATOM   4031 N  NE2   . GLN A 1 493 ? 2.717   32.403 16.327  1.00 50.60  ? 493  GLN A NE2   1 
ATOM   4032 N  N     . ARG A 1 494 ? 5.284   27.885 13.802  1.00 38.59  ? 494  ARG A N     1 
ATOM   4033 C  CA    . ARG A 1 494 ? 5.104   27.025 12.637  1.00 36.28  ? 494  ARG A CA    1 
ATOM   4034 C  C     . ARG A 1 494 ? 5.505   25.591 12.952  1.00 38.23  ? 494  ARG A C     1 
ATOM   4035 O  O     . ARG A 1 494 ? 4.826   24.644 12.553  1.00 39.23  ? 494  ARG A O     1 
ATOM   4036 C  CB    . ARG A 1 494 ? 5.917   27.536 11.447  1.00 33.46  ? 494  ARG A CB    1 
ATOM   4037 C  CG    . ARG A 1 494 ? 5.293   28.706 10.708  1.00 34.31  ? 494  ARG A CG    1 
ATOM   4038 C  CD    . ARG A 1 494 ? 6.066   29.009 9.431   1.00 31.57  ? 494  ARG A CD    1 
ATOM   4039 N  NE    . ARG A 1 494 ? 7.454   29.366 9.705   1.00 41.39  ? 494  ARG A NE    1 
ATOM   4040 C  CZ    . ARG A 1 494 ? 7.889   30.613 9.869   1.00 44.89  ? 494  ARG A CZ    1 
ATOM   4041 N  NH1   . ARG A 1 494 ? 7.043   31.633 9.782   1.00 45.24  ? 494  ARG A NH1   1 
ATOM   4042 N  NH2   . ARG A 1 494 ? 9.172   30.844 10.118  1.00 45.85  ? 494  ARG A NH2   1 
ATOM   4043 N  N     . ASN A 1 495 ? 6.620   25.442 13.661  1.00 37.82  ? 495  ASN A N     1 
ATOM   4044 C  CA    . ASN A 1 495 ? 7.076   24.136 14.102  1.00 40.67  ? 495  ASN A CA    1 
ATOM   4045 C  C     . ASN A 1 495 ? 6.059   23.504 15.040  1.00 40.89  ? 495  ASN A C     1 
ATOM   4046 O  O     . ASN A 1 495 ? 5.885   22.284 15.052  1.00 42.22  ? 495  ASN A O     1 
ATOM   4047 C  CB    . ASN A 1 495 ? 8.435   24.245 14.798  1.00 43.39  ? 495  ASN A CB    1 
ATOM   4048 C  CG    . ASN A 1 495 ? 9.571   24.512 13.827  1.00 46.03  ? 495  ASN A CG    1 
ATOM   4049 O  OD1   . ASN A 1 495 ? 9.455   24.263 12.626  1.00 48.38  ? 495  ASN A OD1   1 
ATOM   4050 N  ND2   . ASN A 1 495 ? 10.685  25.011 14.348  1.00 45.45  ? 495  ASN A ND2   1 
ATOM   4051 N  N     . GLY A 1 496 ? 5.387   24.346 15.820  1.00 39.49  ? 496  GLY A N     1 
ATOM   4052 C  CA    . GLY A 1 496 ? 4.367   23.892 16.746  1.00 40.44  ? 496  GLY A CA    1 
ATOM   4053 C  C     . GLY A 1 496 ? 3.240   23.168 16.039  1.00 44.55  ? 496  GLY A C     1 
ATOM   4054 O  O     . GLY A 1 496 ? 2.803   22.104 16.480  1.00 47.24  ? 496  GLY A O     1 
ATOM   4055 N  N     . GLU A 1 497 ? 2.780   23.740 14.929  1.00 44.28  ? 497  GLU A N     1 
ATOM   4056 C  CA    . GLU A 1 497 ? 1.685   23.156 14.162  1.00 44.40  ? 497  GLU A CA    1 
ATOM   4057 C  C     . GLU A 1 497 ? 2.079   21.830 13.516  1.00 47.25  ? 497  GLU A C     1 
ATOM   4058 O  O     . GLU A 1 497 ? 1.274   20.898 13.460  1.00 48.35  ? 497  GLU A O     1 
ATOM   4059 C  CB    . GLU A 1 497 ? 1.181   24.140 13.107  1.00 43.40  ? 497  GLU A CB    1 
ATOM   4060 C  CG    . GLU A 1 497 ? 0.619   25.426 13.694  1.00 42.77  ? 497  GLU A CG    1 
ATOM   4061 C  CD    . GLU A 1 497 ? -0.504  25.172 14.682  1.00 44.48  ? 497  GLU A CD    1 
ATOM   4062 O  OE1   . GLU A 1 497 ? -1.357  24.305 14.402  1.00 45.40  ? 497  GLU A OE1   1 
ATOM   4063 O  OE2   . GLU A 1 497 ? -0.533  25.834 15.742  1.00 46.02  ? 497  GLU A OE2   1 
ATOM   4064 N  N     . ILE A 1 498 ? 3.316   21.755 13.030  1.00 46.66  ? 498  ILE A N     1 
ATOM   4065 C  CA    . ILE A 1 498 ? 3.855   20.517 12.476  1.00 46.37  ? 498  ILE A CA    1 
ATOM   4066 C  C     . ILE A 1 498 ? 3.724   19.383 13.482  1.00 49.44  ? 498  ILE A C     1 
ATOM   4067 O  O     . ILE A 1 498 ? 3.271   18.289 13.149  1.00 53.13  ? 498  ILE A O     1 
ATOM   4068 C  CB    . ILE A 1 498 ? 5.342   20.664 12.111  1.00 43.87  ? 498  ILE A CB    1 
ATOM   4069 C  CG1   . ILE A 1 498 ? 5.517   21.603 10.920  1.00 41.27  ? 498  ILE A CG1   1 
ATOM   4070 C  CG2   . ILE A 1 498 ? 5.951   19.308 11.794  1.00 45.46  ? 498  ILE A CG2   1 
ATOM   4071 C  CD1   . ILE A 1 498 ? 6.966   21.809 10.526  1.00 39.55  ? 498  ILE A CD1   1 
ATOM   4072 N  N     . ILE A 1 499 ? 4.121   19.656 14.720  1.00 49.87  ? 499  ILE A N     1 
ATOM   4073 C  CA    . ILE A 1 499 ? 4.030   18.665 15.783  1.00 51.00  ? 499  ILE A CA    1 
ATOM   4074 C  C     . ILE A 1 499 ? 2.568   18.359 16.099  1.00 51.71  ? 499  ILE A C     1 
ATOM   4075 O  O     . ILE A 1 499 ? 2.208   17.207 16.336  1.00 54.08  ? 499  ILE A O     1 
ATOM   4076 C  CB    . ILE A 1 499 ? 4.765   19.134 17.054  1.00 48.54  ? 499  ILE A CB    1 
ATOM   4077 C  CG1   . ILE A 1 499 ? 6.215   19.497 16.722  1.00 49.99  ? 499  ILE A CG1   1 
ATOM   4078 C  CG2   . ILE A 1 499 ? 4.722   18.058 18.124  1.00 45.94  ? 499  ILE A CG2   1 
ATOM   4079 C  CD1   . ILE A 1 499 ? 6.993   20.065 17.890  1.00 50.62  ? 499  ILE A CD1   1 
ATOM   4080 N  N     . LYS A 1 500 ? 1.730   19.392 16.088  1.00 49.92  ? 500  LYS A N     1 
ATOM   4081 C  CA    . LYS A 1 500 ? 0.295   19.220 16.301  1.00 50.08  ? 500  LYS A CA    1 
ATOM   4082 C  C     . LYS A 1 500 ? -0.317  18.300 15.253  1.00 57.20  ? 500  LYS A C     1 
ATOM   4083 O  O     . LYS A 1 500 ? -1.226  17.525 15.552  1.00 58.79  ? 500  LYS A O     1 
ATOM   4084 C  CB    . LYS A 1 500 ? -0.424  20.567 16.268  1.00 45.65  ? 500  LYS A CB    1 
ATOM   4085 C  CG    . LYS A 1 500 ? -0.180  21.441 17.476  1.00 43.58  ? 500  LYS A CG    1 
ATOM   4086 C  CD    . LYS A 1 500 ? -1.034  22.690 17.398  1.00 44.16  ? 500  LYS A CD    1 
ATOM   4087 C  CE    . LYS A 1 500 ? -0.842  23.575 18.615  1.00 45.43  ? 500  LYS A CE    1 
ATOM   4088 N  NZ    . LYS A 1 500 ? -1.845  24.676 18.643  1.00 45.35  ? 500  LYS A NZ    1 
ATOM   4089 N  N     . GLU A 1 501 ? 0.179   18.399 14.023  1.00 61.90  ? 501  GLU A N     1 
ATOM   4090 C  CA    . GLU A 1 501 ? -0.280  17.535 12.941  1.00 68.58  ? 501  GLU A CA    1 
ATOM   4091 C  C     . GLU A 1 501 ? 0.173   16.095 13.156  1.00 70.40  ? 501  GLU A C     1 
ATOM   4092 O  O     . GLU A 1 501 ? -0.616  15.161 13.017  1.00 73.87  ? 501  GLU A O     1 
ATOM   4093 C  CB    . GLU A 1 501 ? 0.219   18.044 11.585  1.00 72.19  ? 501  GLU A CB    1 
ATOM   4094 C  CG    . GLU A 1 501 ? -0.385  19.373 11.143  1.00 74.32  ? 501  GLU A CG    1 
ATOM   4095 C  CD    . GLU A 1 501 ? -1.789  19.229 10.581  1.00 77.60  ? 501  GLU A CD    1 
ATOM   4096 O  OE1   . GLU A 1 501 ? -2.328  18.101 10.597  1.00 81.11  ? 501  GLU A OE1   1 
ATOM   4097 O  OE2   . GLU A 1 501 ? -2.352  20.243 10.114  1.00 76.19  ? 501  GLU A OE2   1 
ATOM   4098 N  N     . ALA A 1 502 ? 1.445   15.921 13.501  1.00 67.63  ? 502  ALA A N     1 
ATOM   4099 C  CA    . ALA A 1 502 ? 2.008   14.592 13.704  1.00 67.66  ? 502  ALA A CA    1 
ATOM   4100 C  C     . ALA A 1 502 ? 1.362   13.890 14.892  1.00 67.46  ? 502  ALA A C     1 
ATOM   4101 O  O     . ALA A 1 502 ? 1.374   12.664 14.983  1.00 68.83  ? 502  ALA A O     1 
ATOM   4102 C  CB    . ALA A 1 502 ? 3.507   14.677 13.892  1.00 67.49  ? 502  ALA A CB    1 
ATOM   4103 N  N     . LEU A 1 503 ? 0.791   14.678 15.797  1.00 65.40  ? 503  LEU A N     1 
ATOM   4104 C  CA    . LEU A 1 503 ? 0.112   14.139 16.969  1.00 64.55  ? 503  LEU A CA    1 
ATOM   4105 C  C     . LEU A 1 503 ? -1.247  13.532 16.632  1.00 67.94  ? 503  LEU A C     1 
ATOM   4106 O  O     . LEU A 1 503 ? -1.968  13.079 17.520  1.00 70.08  ? 503  LEU A O     1 
ATOM   4107 C  CB    . LEU A 1 503 ? -0.040  15.219 18.042  1.00 59.27  ? 503  LEU A CB    1 
ATOM   4108 C  CG    . LEU A 1 503 ? 1.132   15.331 19.018  1.00 57.63  ? 503  LEU A CG    1 
ATOM   4109 C  CD1   . LEU A 1 503 ? 1.084   16.647 19.777  1.00 56.44  ? 503  LEU A CD1   1 
ATOM   4110 C  CD2   . LEU A 1 503 ? 1.113   14.156 19.982  1.00 58.08  ? 503  LEU A CD2   1 
ATOM   4111 N  N     . HIS A 1 504 ? -1.599  13.525 15.352  1.00 69.53  ? 504  HIS A N     1 
ATOM   4112 C  CA    . HIS A 1 504 ? -2.830  12.880 14.922  1.00 75.03  ? 504  HIS A CA    1 
ATOM   4113 C  C     . HIS A 1 504 ? -2.598  11.394 14.682  1.00 78.67  ? 504  HIS A C     1 
ATOM   4114 O  O     . HIS A 1 504 ? -3.528  10.591 14.748  1.00 81.19  ? 504  HIS A O     1 
ATOM   4115 C  CB    . HIS A 1 504 ? -3.391  13.557 13.671  1.00 78.89  ? 504  HIS A CB    1 
ATOM   4116 C  CG    . HIS A 1 504 ? -3.991  14.901 13.938  1.00 83.20  ? 504  HIS A CG    1 
ATOM   4117 N  ND1   . HIS A 1 504 ? -3.797  15.985 13.109  1.00 85.53  ? 504  HIS A ND1   1 
ATOM   4118 C  CD2   . HIS A 1 504 ? -4.782  15.338 14.948  1.00 84.78  ? 504  HIS A CD2   1 
ATOM   4119 C  CE1   . HIS A 1 504 ? -4.440  17.031 13.596  1.00 85.36  ? 504  HIS A CE1   1 
ATOM   4120 N  NE2   . HIS A 1 504 ? -5.046  16.665 14.711  1.00 85.01  ? 504  HIS A NE2   1 
ATOM   4121 N  N     . ASN A 1 505 ? -1.347  11.032 14.416  1.00 78.67  ? 505  ASN A N     1 
ATOM   4122 C  CA    . ASN A 1 505 ? -0.985  9.635  14.205  1.00 77.49  ? 505  ASN A CA    1 
ATOM   4123 C  C     . ASN A 1 505 ? 0.282   9.235  14.953  1.00 72.12  ? 505  ASN A C     1 
ATOM   4124 O  O     . ASN A 1 505 ? 1.278   8.874  14.332  1.00 68.78  ? 505  ASN A O     1 
ATOM   4125 C  CB    . ASN A 1 505 ? -0.814  9.358  12.713  1.00 80.29  ? 505  ASN A CB    1 
ATOM   4126 C  CG    . ASN A 1 505 ? -2.069  9.653  11.922  1.00 82.70  ? 505  ASN A CG    1 
ATOM   4127 O  OD1   . ASN A 1 505 ? -3.167  9.251  12.308  1.00 83.60  ? 505  ASN A OD1   1 
ATOM   4128 N  ND2   . ASN A 1 505 ? -1.917  10.370 10.815  1.00 83.24  ? 505  ASN A ND2   1 
ATOM   4129 N  N     . PRO A 1 506 ? 0.243   9.284  16.294  1.00 70.55  ? 506  PRO A N     1 
ATOM   4130 C  CA    . PRO A 1 506 ? 1.442   8.989  17.084  1.00 70.43  ? 506  PRO A CA    1 
ATOM   4131 C  C     . PRO A 1 506 ? 1.830   7.516  17.000  1.00 71.85  ? 506  PRO A C     1 
ATOM   4132 O  O     . PRO A 1 506 ? 0.993   6.634  17.189  1.00 71.78  ? 506  PRO A O     1 
ATOM   4133 C  CB    . PRO A 1 506 ? 1.019   9.356  18.508  1.00 70.37  ? 506  PRO A CB    1 
ATOM   4134 C  CG    . PRO A 1 506 ? -0.455  9.155  18.519  1.00 70.99  ? 506  PRO A CG    1 
ATOM   4135 C  CD    . PRO A 1 506 ? -0.937  9.524  17.144  1.00 69.67  ? 506  PRO A CD    1 
ATOM   4136 N  N     . ASN A 1 507 ? 3.101   7.264  16.710  1.00 72.81  ? 507  ASN A N     1 
ATOM   4137 C  CA    . ASN A 1 507 ? 3.600   5.905  16.565  1.00 73.55  ? 507  ASN A CA    1 
ATOM   4138 C  C     . ASN A 1 507 ? 3.700   5.184  17.905  1.00 76.21  ? 507  ASN A C     1 
ATOM   4139 O  O     . ASN A 1 507 ? 4.181   5.744  18.888  1.00 75.20  ? 507  ASN A O     1 
ATOM   4140 C  CB    . ASN A 1 507 ? 4.960   5.915  15.864  1.00 71.47  ? 507  ASN A CB    1 
ATOM   4141 C  CG    . ASN A 1 507 ? 4.896   6.529  14.478  1.00 70.96  ? 507  ASN A CG    1 
ATOM   4142 O  OD1   . ASN A 1 507 ? 4.697   7.736  14.329  1.00 72.07  ? 507  ASN A OD1   1 
ATOM   4143 N  ND2   . ASN A 1 507 ? 5.070   5.700  13.455  1.00 69.90  ? 507  ASN A ND2   1 
ATOM   4144 N  N     . LEU A 1 508 ? 3.237   3.940  17.937  1.00 80.18  ? 508  LEU A N     1 
ATOM   4145 C  CA    . LEU A 1 508 ? 3.326   3.126  19.143  1.00 81.91  ? 508  LEU A CA    1 
ATOM   4146 C  C     . LEU A 1 508 ? 4.748   2.623  19.360  1.00 81.94  ? 508  LEU A C     1 
ATOM   4147 O  O     . LEU A 1 508 ? 5.110   1.540  18.895  1.00 85.75  ? 508  LEU A O     1 
ATOM   4148 C  CB    . LEU A 1 508 ? 2.352   1.947  19.071  1.00 83.41  ? 508  LEU A CB    1 
ATOM   4149 C  CG    . LEU A 1 508 ? 0.914   2.254  19.490  1.00 80.53  ? 508  LEU A CG    1 
ATOM   4150 C  CD1   . LEU A 1 508 ? 0.012   1.055  19.242  1.00 81.89  ? 508  LEU A CD1   1 
ATOM   4151 C  CD2   . LEU A 1 508 ? 0.874   2.665  20.954  1.00 76.39  ? 508  LEU A CD2   1 
ATOM   4152 N  N     . SER A 1 509 ? 5.550   3.415  20.066  1.00 76.40  ? 509  SER A N     1 
ATOM   4153 C  CA    . SER A 1 509 ? 6.932   3.048  20.350  1.00 75.31  ? 509  SER A CA    1 
ATOM   4154 C  C     . SER A 1 509 ? 7.492   3.848  21.521  1.00 73.67  ? 509  SER A C     1 
ATOM   4155 O  O     . SER A 1 509 ? 6.878   4.809  21.980  1.00 74.28  ? 509  SER A O     1 
ATOM   4156 C  CB    . SER A 1 509 ? 7.808   3.250  19.111  1.00 75.25  ? 509  SER A CB    1 
ATOM   4157 O  OG    . SER A 1 509 ? 7.794   4.604  18.693  1.00 73.46  ? 509  SER A OG    1 
ATOM   4158 N  N     . VAL A 1 510 ? 8.663   3.442  21.999  1.00 73.85  ? 510  VAL A N     1 
ATOM   4159 C  CA    . VAL A 1 510 ? 9.335   4.149  23.081  1.00 73.58  ? 510  VAL A CA    1 
ATOM   4160 C  C     . VAL A 1 510 ? 10.553  4.892  22.547  1.00 75.78  ? 510  VAL A C     1 
ATOM   4161 O  O     . VAL A 1 510 ? 11.512  4.277  22.077  1.00 77.91  ? 510  VAL A O     1 
ATOM   4162 C  CB    . VAL A 1 510 ? 9.772   3.189  24.202  1.00 73.37  ? 510  VAL A CB    1 
ATOM   4163 C  CG1   . VAL A 1 510 ? 10.512  3.949  25.293  1.00 70.72  ? 510  VAL A CG1   1 
ATOM   4164 C  CG2   . VAL A 1 510 ? 8.564   2.466  24.773  1.00 75.08  ? 510  VAL A CG2   1 
ATOM   4165 N  N     . ASP A 1 511 ? 10.506  6.218  22.611  1.00 73.28  ? 511  ASP A N     1 
ATOM   4166 C  CA    . ASP A 1 511 ? 11.591  7.040  22.096  1.00 73.00  ? 511  ASP A CA    1 
ATOM   4167 C  C     . ASP A 1 511 ? 11.753  8.319  22.901  1.00 74.83  ? 511  ASP A C     1 
ATOM   4168 O  O     . ASP A 1 511 ? 11.040  8.549  23.878  1.00 77.27  ? 511  ASP A O     1 
ATOM   4169 C  CB    . ASP A 1 511 ? 11.359  7.369  20.619  1.00 71.62  ? 511  ASP A CB    1 
ATOM   4170 C  CG    . ASP A 1 511 ? 9.923   7.780  20.328  1.00 70.84  ? 511  ASP A CG    1 
ATOM   4171 O  OD1   . ASP A 1 511 ? 9.269   8.356  21.222  1.00 69.76  ? 511  ASP A OD1   1 
ATOM   4172 O  OD2   . ASP A 1 511 ? 9.444   7.522  19.203  1.00 71.20  ? 511  ASP A OD2   1 
ATOM   4173 N  N     . GLU A 1 512 ? 12.698  9.151  22.481  1.00 74.11  ? 512  GLU A N     1 
ATOM   4174 C  CA    . GLU A 1 512 ? 12.936  10.424 23.139  1.00 72.80  ? 512  GLU A CA    1 
ATOM   4175 C  C     . GLU A 1 512 ? 12.747  11.560 22.143  1.00 68.27  ? 512  GLU A C     1 
ATOM   4176 O  O     . GLU A 1 512 ? 12.978  11.383 20.947  1.00 64.29  ? 512  GLU A O     1 
ATOM   4177 C  CB    . GLU A 1 512 ? 14.340  10.457 23.754  1.00 77.73  ? 512  GLU A CB    1 
ATOM   4178 C  CG    . GLU A 1 512 ? 14.549  9.440  24.875  1.00 83.10  ? 512  GLU A CG    1 
ATOM   4179 C  CD    . GLU A 1 512 ? 13.705  9.732  26.106  1.00 84.67  ? 512  GLU A CD    1 
ATOM   4180 O  OE1   . GLU A 1 512 ? 12.527  9.313  26.148  1.00 84.10  ? 512  GLU A OE1   1 
ATOM   4181 O  OE2   . GLU A 1 512 ? 14.226  10.380 27.037  1.00 85.60  ? 512  GLU A OE2   1 
ATOM   4182 N  N     . PRO A 1 513 ? 12.298  12.726 22.635  1.00 67.96  ? 513  PRO A N     1 
ATOM   4183 C  CA    . PRO A 1 513 ? 12.099  13.915 21.802  1.00 65.69  ? 513  PRO A CA    1 
ATOM   4184 C  C     . PRO A 1 513 ? 13.365  14.288 21.039  1.00 65.76  ? 513  PRO A C     1 
ATOM   4185 O  O     . PRO A 1 513 ? 14.460  14.209 21.593  1.00 67.80  ? 513  PRO A O     1 
ATOM   4186 C  CB    . PRO A 1 513 ? 11.749  15.005 22.824  1.00 64.00  ? 513  PRO A CB    1 
ATOM   4187 C  CG    . PRO A 1 513 ? 12.159  14.458 24.152  1.00 64.05  ? 513  PRO A CG    1 
ATOM   4188 C  CD    . PRO A 1 513 ? 11.953  12.987 24.041  1.00 66.52  ? 513  PRO A CD    1 
ATOM   4189 N  N     . LEU A 1 514 ? 13.208  14.676 19.777  1.00 65.16  ? 514  LEU A N     1 
ATOM   4190 C  CA    . LEU A 1 514 ? 14.344  15.023 18.932  1.00 66.64  ? 514  LEU A CA    1 
ATOM   4191 C  C     . LEU A 1 514 ? 15.051  16.271 19.438  1.00 68.78  ? 514  LEU A C     1 
ATOM   4192 O  O     . LEU A 1 514 ? 14.409  17.218 19.890  1.00 67.17  ? 514  LEU A O     1 
ATOM   4193 C  CB    . LEU A 1 514 ? 13.890  15.236 17.485  1.00 66.00  ? 514  LEU A CB    1 
ATOM   4194 C  CG    . LEU A 1 514 ? 13.384  14.012 16.718  1.00 67.40  ? 514  LEU A CG    1 
ATOM   4195 C  CD1   . LEU A 1 514 ? 12.628  14.443 15.473  1.00 67.06  ? 514  LEU A CD1   1 
ATOM   4196 C  CD2   . LEU A 1 514 ? 14.538  13.091 16.352  1.00 68.18  ? 514  LEU A CD2   1 
ATOM   4197 N  N     . ASP A 1 515 ? 16.377  16.265 19.366  1.00 73.99  ? 515  ASP A N     1 
ATOM   4198 C  CA    . ASP A 1 515 ? 17.160  17.448 19.701  1.00 77.37  ? 515  ASP A CA    1 
ATOM   4199 C  C     . ASP A 1 515 ? 17.147  18.413 18.519  1.00 75.86  ? 515  ASP A C     1 
ATOM   4200 O  O     . ASP A 1 515 ? 17.839  18.194 17.522  1.00 76.99  ? 515  ASP A O     1 
ATOM   4201 C  CB    . ASP A 1 515 ? 18.598  17.062 20.063  1.00 81.77  ? 515  ASP A CB    1 
ATOM   4202 C  CG    . ASP A 1 515 ? 19.465  18.269 20.384  1.00 84.36  ? 515  ASP A CG    1 
ATOM   4203 O  OD1   . ASP A 1 515 ? 20.088  18.822 19.452  1.00 86.15  ? 515  ASP A OD1   1 
ATOM   4204 O  OD2   . ASP A 1 515 ? 19.523  18.666 21.567  1.00 84.15  ? 515  ASP A OD2   1 
ATOM   4205 N  N     . VAL A 1 516 ? 16.343  19.469 18.626  1.00 70.90  ? 516  VAL A N     1 
ATOM   4206 C  CA    . VAL A 1 516 ? 16.225  20.457 17.557  1.00 67.82  ? 516  VAL A CA    1 
ATOM   4207 C  C     . VAL A 1 516 ? 16.205  21.881 18.106  1.00 65.55  ? 516  VAL A C     1 
ATOM   4208 O  O     . VAL A 1 516 ? 15.836  22.109 19.258  1.00 65.71  ? 516  VAL A O     1 
ATOM   4209 C  CB    . VAL A 1 516 ? 14.944  20.241 16.718  1.00 67.22  ? 516  VAL A CB    1 
ATOM   4210 C  CG1   . VAL A 1 516 ? 14.982  18.897 16.008  1.00 71.34  ? 516  VAL A CG1   1 
ATOM   4211 C  CG2   . VAL A 1 516 ? 13.709  20.346 17.597  1.00 64.27  ? 516  VAL A CG2   1 
ATOM   4212 N  N     . ASP A 1 517 ? 16.608  22.836 17.274  1.00 61.88  ? 517  ASP A N     1 
ATOM   4213 C  CA    . ASP A 1 517 ? 16.490  24.246 17.616  1.00 55.73  ? 517  ASP A CA    1 
ATOM   4214 C  C     . ASP A 1 517 ? 15.162  24.754 17.067  1.00 53.68  ? 517  ASP A C     1 
ATOM   4215 O  O     . ASP A 1 517 ? 15.031  24.995 15.867  1.00 55.15  ? 517  ASP A O     1 
ATOM   4216 C  CB    . ASP A 1 517 ? 17.652  25.045 17.022  1.00 54.85  ? 517  ASP A CB    1 
ATOM   4217 C  CG    . ASP A 1 517 ? 17.801  26.425 17.647  1.00 52.59  ? 517  ASP A CG    1 
ATOM   4218 O  OD1   . ASP A 1 517 ? 18.951  26.893 17.782  1.00 55.34  ? 517  ASP A OD1   1 
ATOM   4219 O  OD2   . ASP A 1 517 ? 16.777  27.044 18.001  1.00 49.26  ? 517  ASP A OD2   1 
ATOM   4220 N  N     . TYR A 1 518 ? 14.183  24.917 17.952  1.00 49.28  ? 518  TYR A N     1 
ATOM   4221 C  CA    . TYR A 1 518 ? 12.829  25.282 17.548  1.00 43.96  ? 518  TYR A CA    1 
ATOM   4222 C  C     . TYR A 1 518 ? 12.735  26.687 16.951  1.00 43.20  ? 518  TYR A C     1 
ATOM   4223 O  O     . TYR A 1 518 ? 11.747  27.017 16.296  1.00 39.05  ? 518  TYR A O     1 
ATOM   4224 C  CB    . TYR A 1 518 ? 11.859  25.131 18.723  1.00 42.09  ? 518  TYR A CB    1 
ATOM   4225 C  CG    . TYR A 1 518 ? 11.788  23.723 19.277  1.00 45.29  ? 518  TYR A CG    1 
ATOM   4226 C  CD1   . TYR A 1 518 ? 12.662  23.303 20.273  1.00 46.47  ? 518  TYR A CD1   1 
ATOM   4227 C  CD2   . TYR A 1 518 ? 10.851  22.813 18.802  1.00 44.78  ? 518  TYR A CD2   1 
ATOM   4228 C  CE1   . TYR A 1 518 ? 12.603  22.016 20.782  1.00 47.66  ? 518  TYR A CE1   1 
ATOM   4229 C  CE2   . TYR A 1 518 ? 10.784  21.525 19.305  1.00 45.71  ? 518  TYR A CE2   1 
ATOM   4230 C  CZ    . TYR A 1 518 ? 11.662  21.133 20.296  1.00 48.45  ? 518  TYR A CZ    1 
ATOM   4231 O  OH    . TYR A 1 518 ? 11.600  19.852 20.798  1.00 52.06  ? 518  TYR A OH    1 
ATOM   4232 N  N     . ARG A 1 519 ? 13.765  27.504 17.170  1.00 47.04  ? 519  ARG A N     1 
ATOM   4233 C  CA    . ARG A 1 519 ? 13.805  28.866 16.630  1.00 48.29  ? 519  ARG A CA    1 
ATOM   4234 C  C     . ARG A 1 519 ? 13.898  28.884 15.102  1.00 51.61  ? 519  ARG A C     1 
ATOM   4235 O  O     . ARG A 1 519 ? 13.739  29.934 14.476  1.00 53.09  ? 519  ARG A O     1 
ATOM   4236 C  CB    . ARG A 1 519 ? 14.984  29.650 17.211  1.00 47.10  ? 519  ARG A CB    1 
ATOM   4237 C  CG    . ARG A 1 519 ? 14.917  29.913 18.705  1.00 46.36  ? 519  ARG A CG    1 
ATOM   4238 C  CD    . ARG A 1 519 ? 16.167  30.650 19.167  1.00 47.35  ? 519  ARG A CD    1 
ATOM   4239 N  NE    . ARG A 1 519 ? 17.381  29.890 18.872  1.00 50.98  ? 519  ARG A NE    1 
ATOM   4240 C  CZ    . ARG A 1 519 ? 18.610  30.398 18.889  1.00 50.20  ? 519  ARG A CZ    1 
ATOM   4241 N  NH1   . ARG A 1 519 ? 18.798  31.679 19.180  1.00 49.67  ? 519  ARG A NH1   1 
ATOM   4242 N  NH2   . ARG A 1 519 ? 19.652  29.627 18.609  1.00 48.64  ? 519  ARG A NH2   1 
ATOM   4243 N  N     . PHE A 1 520 ? 14.164  27.724 14.507  1.00 50.92  ? 520  PHE A N     1 
ATOM   4244 C  CA    . PHE A 1 520 ? 14.295  27.619 13.059  1.00 50.38  ? 520  PHE A CA    1 
ATOM   4245 C  C     . PHE A 1 520 ? 13.374  26.541 12.511  1.00 50.28  ? 520  PHE A C     1 
ATOM   4246 O  O     . PHE A 1 520 ? 13.165  25.515 13.156  1.00 51.77  ? 520  PHE A O     1 
ATOM   4247 C  CB    . PHE A 1 520 ? 15.744  27.313 12.679  1.00 49.34  ? 520  PHE A CB    1 
ATOM   4248 C  CG    . PHE A 1 520 ? 16.734  28.259 13.285  1.00 50.03  ? 520  PHE A CG    1 
ATOM   4249 C  CD1   . PHE A 1 520 ? 17.017  29.469 12.676  1.00 50.51  ? 520  PHE A CD1   1 
ATOM   4250 C  CD2   . PHE A 1 520 ? 17.372  27.947 14.475  1.00 51.14  ? 520  PHE A CD2   1 
ATOM   4251 C  CE1   . PHE A 1 520 ? 17.925  30.347 13.240  1.00 51.68  ? 520  PHE A CE1   1 
ATOM   4252 C  CE2   . PHE A 1 520 ? 18.280  28.821 15.043  1.00 51.42  ? 520  PHE A CE2   1 
ATOM   4253 C  CZ    . PHE A 1 520 ? 18.557  30.022 14.424  1.00 51.17  ? 520  PHE A CZ    1 
ATOM   4254 N  N     . ASP A 1 521 ? 12.826  26.780 11.323  1.00 48.92  ? 521  ASP A N     1 
ATOM   4255 C  CA    . ASP A 1 521 ? 11.920  25.827 10.686  1.00 50.01  ? 521  ASP A CA    1 
ATOM   4256 C  C     . ASP A 1 521 ? 12.548  24.448 10.564  1.00 51.51  ? 521  ASP A C     1 
ATOM   4257 O  O     . ASP A 1 521 ? 13.682  24.310 10.102  1.00 53.43  ? 521  ASP A O     1 
ATOM   4258 C  CB    . ASP A 1 521 ? 11.493  26.323 9.304   1.00 52.40  ? 521  ASP A CB    1 
ATOM   4259 C  CG    . ASP A 1 521 ? 10.618  27.556 9.373   1.00 54.75  ? 521  ASP A CG    1 
ATOM   4260 O  OD1   . ASP A 1 521 ? 9.398   27.406 9.596   1.00 54.96  ? 521  ASP A OD1   1 
ATOM   4261 O  OD2   . ASP A 1 521 ? 11.147  28.675 9.198   1.00 55.87  ? 521  ASP A OD2   1 
ATOM   4262 N  N     . PHE A 1 522 ? 11.801  23.437 10.994  1.00 52.07  ? 522  PHE A N     1 
ATOM   4263 C  CA    . PHE A 1 522 ? 12.249  22.052 10.935  1.00 53.74  ? 522  PHE A CA    1 
ATOM   4264 C  C     . PHE A 1 522 ? 12.731  21.679 9.545   1.00 57.31  ? 522  PHE A C     1 
ATOM   4265 O  O     . PHE A 1 522 ? 12.098  22.022 8.546   1.00 56.99  ? 522  PHE A O     1 
ATOM   4266 C  CB    . PHE A 1 522 ? 11.112  21.115 11.345  1.00 53.56  ? 522  PHE A CB    1 
ATOM   4267 C  CG    . PHE A 1 522 ? 10.800  21.146 12.813  1.00 53.01  ? 522  PHE A CG    1 
ATOM   4268 C  CD1   . PHE A 1 522 ? 11.759  21.547 13.733  1.00 52.62  ? 522  PHE A CD1   1 
ATOM   4269 C  CD2   . PHE A 1 522 ? 9.551   20.771 13.274  1.00 51.67  ? 522  PHE A CD2   1 
ATOM   4270 C  CE1   . PHE A 1 522 ? 11.474  21.572 15.088  1.00 49.58  ? 522  PHE A CE1   1 
ATOM   4271 C  CE2   . PHE A 1 522 ? 9.262   20.795 14.627  1.00 50.82  ? 522  PHE A CE2   1 
ATOM   4272 C  CZ    . PHE A 1 522 ? 10.224  21.195 15.535  1.00 48.95  ? 522  PHE A CZ    1 
ATOM   4273 N  N     . SER A 1 523 ? 13.864  20.989 9.483   1.00 61.86  ? 523  SER A N     1 
ATOM   4274 C  CA    . SER A 1 523 ? 14.359  20.472 8.215   1.00 66.01  ? 523  SER A CA    1 
ATOM   4275 C  C     . SER A 1 523 ? 13.548  19.247 7.807   1.00 64.18  ? 523  SER A C     1 
ATOM   4276 O  O     . SER A 1 523 ? 12.863  18.641 8.633   1.00 61.05  ? 523  SER A O     1 
ATOM   4277 C  CB    . SER A 1 523 ? 15.845  20.118 8.310   1.00 69.11  ? 523  SER A CB    1 
ATOM   4278 O  OG    . SER A 1 523 ? 16.059  19.003 9.159   1.00 69.43  ? 523  SER A OG    1 
ATOM   4279 N  N     . ASP A 1 524 ? 13.629  18.888 6.531   1.00 66.02  ? 524  ASP A N     1 
ATOM   4280 C  CA    . ASP A 1 524 ? 12.865  17.764 6.001   1.00 69.71  ? 524  ASP A CA    1 
ATOM   4281 C  C     . ASP A 1 524 ? 13.240  16.443 6.672   1.00 68.72  ? 524  ASP A C     1 
ATOM   4282 O  O     . ASP A 1 524 ? 12.401  15.550 6.819   1.00 65.72  ? 524  ASP A O     1 
ATOM   4283 C  CB    . ASP A 1 524 ? 13.041  17.676 4.485   1.00 75.97  ? 524  ASP A CB    1 
ATOM   4284 C  CG    . ASP A 1 524 ? 12.463  18.881 3.766   1.00 78.98  ? 524  ASP A CG    1 
ATOM   4285 O  OD1   . ASP A 1 524 ? 11.375  19.348 4.166   1.00 78.99  ? 524  ASP A OD1   1 
ATOM   4286 O  OD2   . ASP A 1 524 ? 13.100  19.364 2.807   1.00 80.80  ? 524  ASP A OD2   1 
ATOM   4287 N  N     . GLU A 1 525 ? 14.499  16.327 7.083   1.00 70.85  ? 525  GLU A N     1 
ATOM   4288 C  CA    . GLU A 1 525 ? 14.939  15.178 7.863   1.00 74.40  ? 525  GLU A CA    1 
ATOM   4289 C  C     . GLU A 1 525 ? 14.206  15.148 9.199   1.00 72.76  ? 525  GLU A C     1 
ATOM   4290 O  O     . GLU A 1 525 ? 13.648  14.119 9.583   1.00 74.87  ? 525  GLU A O     1 
ATOM   4291 C  CB    . GLU A 1 525 ? 16.452  15.214 8.095   1.00 78.94  ? 525  GLU A CB    1 
ATOM   4292 C  CG    . GLU A 1 525 ? 17.295  14.836 6.880   1.00 83.66  ? 525  GLU A CG    1 
ATOM   4293 C  CD    . GLU A 1 525 ? 17.424  15.963 5.869   1.00 84.38  ? 525  GLU A CD    1 
ATOM   4294 O  OE1   . GLU A 1 525 ? 17.939  15.712 4.758   1.00 87.49  ? 525  GLU A OE1   1 
ATOM   4295 O  OE2   . GLU A 1 525 ? 17.018  17.101 6.187   1.00 81.55  ? 525  GLU A OE2   1 
ATOM   4296 N  N     . ILE A 1 526 ? 14.209  16.284 9.894   1.00 68.00  ? 526  ILE A N     1 
ATOM   4297 C  CA    . ILE A 1 526 ? 13.530  16.411 11.181  1.00 62.69  ? 526  ILE A CA    1 
ATOM   4298 C  C     . ILE A 1 526 ? 12.033  16.109 11.065  1.00 60.92  ? 526  ILE A C     1 
ATOM   4299 O  O     . ILE A 1 526 ? 11.486  15.349 11.865  1.00 60.52  ? 526  ILE A O     1 
ATOM   4300 C  CB    . ILE A 1 526 ? 13.738  17.813 11.794  1.00 58.21  ? 526  ILE A CB    1 
ATOM   4301 C  CG1   . ILE A 1 526 ? 15.218  18.045 12.106  1.00 58.51  ? 526  ILE A CG1   1 
ATOM   4302 C  CG2   . ILE A 1 526 ? 12.902  17.976 13.054  1.00 54.26  ? 526  ILE A CG2   1 
ATOM   4303 C  CD1   . ILE A 1 526 ? 15.547  19.469 12.511  1.00 56.96  ? 526  ILE A CD1   1 
ATOM   4304 N  N     . LYS A 1 527 ? 11.381  16.694 10.063  1.00 57.80  ? 527  LYS A N     1 
ATOM   4305 C  CA    . LYS A 1 527 ? 9.958   16.452 9.831   1.00 54.51  ? 527  LYS A CA    1 
ATOM   4306 C  C     . LYS A 1 527 ? 9.666   14.975 9.563   1.00 58.42  ? 527  LYS A C     1 
ATOM   4307 O  O     . LYS A 1 527 ? 8.647   14.448 10.011  1.00 58.94  ? 527  LYS A O     1 
ATOM   4308 C  CB    . LYS A 1 527 ? 9.433   17.322 8.685   1.00 51.49  ? 527  LYS A CB    1 
ATOM   4309 C  CG    . LYS A 1 527 ? 9.280   18.790 9.054   1.00 53.23  ? 527  LYS A CG    1 
ATOM   4310 C  CD    . LYS A 1 527 ? 8.500   19.574 8.004   1.00 54.58  ? 527  LYS A CD    1 
ATOM   4311 C  CE    . LYS A 1 527 ? 9.376   19.981 6.829   1.00 54.98  ? 527  LYS A CE    1 
ATOM   4312 N  NZ    . LYS A 1 527 ? 8.652   20.890 5.895   1.00 52.74  ? 527  LYS A NZ    1 
ATOM   4313 N  N     . GLU A 1 528 ? 10.563  14.315 8.835   1.00 59.97  ? 528  GLU A N     1 
ATOM   4314 C  CA    . GLU A 1 528 ? 10.421  12.889 8.561   1.00 62.69  ? 528  GLU A CA    1 
ATOM   4315 C  C     . GLU A 1 528 ? 10.500  12.075 9.850   1.00 62.12  ? 528  GLU A C     1 
ATOM   4316 O  O     . GLU A 1 528 ? 9.711   11.154 10.065  1.00 64.38  ? 528  GLU A O     1 
ATOM   4317 C  CB    . GLU A 1 528 ? 11.492  12.418 7.573   1.00 64.18  ? 528  GLU A CB    1 
ATOM   4318 N  N     . LYS A 1 529 ? 11.451  12.427 10.707  1.00 57.83  ? 529  LYS A N     1 
ATOM   4319 C  CA    . LYS A 1 529 ? 11.633  11.727 11.970  1.00 57.17  ? 529  LYS A CA    1 
ATOM   4320 C  C     . LYS A 1 529 ? 10.447  11.947 12.902  1.00 59.14  ? 529  LYS A C     1 
ATOM   4321 O  O     . LYS A 1 529 ? 10.054  11.043 13.639  1.00 58.43  ? 529  LYS A O     1 
ATOM   4322 C  CB    . LYS A 1 529 ? 12.930  12.174 12.652  1.00 55.59  ? 529  LYS A CB    1 
ATOM   4323 C  CG    . LYS A 1 529 ? 14.199  11.726 11.944  1.00 56.89  ? 529  LYS A CG    1 
ATOM   4324 C  CD    . LYS A 1 529 ? 15.444  12.130 12.722  1.00 54.86  ? 529  LYS A CD    1 
ATOM   4325 N  N     . ILE A 1 530 ? 9.881   13.150 12.861  1.00 62.62  ? 530  ILE A N     1 
ATOM   4326 C  CA    . ILE A 1 530 ? 8.771   13.525 13.737  1.00 64.12  ? 530  ILE A CA    1 
ATOM   4327 C  C     . ILE A 1 530 ? 7.544   12.636 13.534  1.00 65.28  ? 530  ILE A C     1 
ATOM   4328 O  O     . ILE A 1 530 ? 6.870   12.250 14.494  1.00 63.07  ? 530  ILE A O     1 
ATOM   4329 C  CB    . ILE A 1 530 ? 8.389   15.010 13.547  1.00 62.96  ? 530  ILE A CB    1 
ATOM   4330 C  CG1   . ILE A 1 530 ? 9.412   15.912 14.238  1.00 61.57  ? 530  ILE A CG1   1 
ATOM   4331 C  CG2   . ILE A 1 530 ? 7.007   15.293 14.098  1.00 61.62  ? 530  ILE A CG2   1 
ATOM   4332 C  CD1   . ILE A 1 530 ? 9.044   17.373 14.218  1.00 59.13  ? 530  ILE A CD1   1 
ATOM   4333 N  N     . LYS A 1 531 ? 7.275   12.290 12.280  1.00 68.34  ? 531  LYS A N     1 
ATOM   4334 C  CA    . LYS A 1 531 ? 6.143   11.429 11.951  1.00 69.06  ? 531  LYS A CA    1 
ATOM   4335 C  C     . LYS A 1 531 ? 6.314   10.003 12.492  1.00 68.29  ? 531  LYS A C     1 
ATOM   4336 O  O     . LYS A 1 531 ? 5.395   9.187  12.415  1.00 65.77  ? 531  LYS A O     1 
ATOM   4337 C  CB    . LYS A 1 531 ? 5.915   11.405 10.436  1.00 68.91  ? 531  LYS A CB    1 
ATOM   4338 C  CG    . LYS A 1 531 ? 5.543   12.754 9.840   1.00 64.02  ? 531  LYS A CG    1 
ATOM   4339 N  N     . LYS A 1 532 ? 7.488   9.715  13.046  1.00 70.13  ? 532  LYS A N     1 
ATOM   4340 C  CA    . LYS A 1 532 ? 7.779   8.390  13.585  1.00 73.42  ? 532  LYS A CA    1 
ATOM   4341 C  C     . LYS A 1 532 ? 7.853   8.363  15.112  1.00 74.11  ? 532  LYS A C     1 
ATOM   4342 O  O     . LYS A 1 532 ? 8.033   7.302  15.709  1.00 74.77  ? 532  LYS A O     1 
ATOM   4343 C  CB    . LYS A 1 532 ? 9.080   7.849  12.992  1.00 75.93  ? 532  LYS A CB    1 
ATOM   4344 C  CG    . LYS A 1 532 ? 9.032   7.657  11.490  1.00 78.01  ? 532  LYS A CG    1 
ATOM   4345 C  CD    . LYS A 1 532 ? 10.392  7.289  10.938  1.00 79.86  ? 532  LYS A CD    1 
ATOM   4346 C  CE    . LYS A 1 532 ? 10.359  7.226  9.424   1.00 82.12  ? 532  LYS A CE    1 
ATOM   4347 N  NZ    . LYS A 1 532 ? 11.713  7.012  8.853   1.00 84.91  ? 532  LYS A NZ    1 
ATOM   4348 N  N     . LEU A 1 533 ? 7.712   9.524  15.744  1.00 73.43  ? 533  LEU A N     1 
ATOM   4349 C  CA    . LEU A 1 533 ? 7.825   9.606  17.197  1.00 72.27  ? 533  LEU A CA    1 
ATOM   4350 C  C     . LEU A 1 533 ? 6.535   9.224  17.919  1.00 71.87  ? 533  LEU A C     1 
ATOM   4351 O  O     . LEU A 1 533 ? 5.447   9.264  17.341  1.00 70.14  ? 533  LEU A O     1 
ATOM   4352 C  CB    . LEU A 1 533 ? 8.284   11.000 17.632  1.00 68.76  ? 533  LEU A CB    1 
ATOM   4353 C  CG    . LEU A 1 533 ? 9.737   11.361 17.318  1.00 69.89  ? 533  LEU A CG    1 
ATOM   4354 C  CD1   . LEU A 1 533 ? 10.076  12.727 17.882  1.00 70.12  ? 533  LEU A CD1   1 
ATOM   4355 C  CD2   . LEU A 1 533 ? 10.687  10.309 17.865  1.00 71.24  ? 533  LEU A CD2   1 
ATOM   4356 N  N     . SER A 1 534 ? 6.673   8.850  19.188  1.00 72.20  ? 534  SER A N     1 
ATOM   4357 C  CA    . SER A 1 534 ? 5.534   8.500  20.025  1.00 70.47  ? 534  SER A CA    1 
ATOM   4358 C  C     . SER A 1 534 ? 4.768   9.749  20.434  1.00 70.17  ? 534  SER A C     1 
ATOM   4359 O  O     . SER A 1 534 ? 5.128   10.860 20.051  1.00 70.90  ? 534  SER A O     1 
ATOM   4360 C  CB    . SER A 1 534 ? 6.009   7.764  21.277  1.00 69.07  ? 534  SER A CB    1 
ATOM   4361 O  OG    . SER A 1 534 ? 6.801   8.611  22.093  1.00 65.68  ? 534  SER A OG    1 
ATOM   4362 N  N     . ALA A 1 535 ? 3.713   9.565  21.221  1.00 69.00  ? 535  ALA A N     1 
ATOM   4363 C  CA    . ALA A 1 535 ? 2.940   10.691 21.729  1.00 64.43  ? 535  ALA A CA    1 
ATOM   4364 C  C     . ALA A 1 535 ? 3.727   11.428 22.802  1.00 61.50  ? 535  ALA A C     1 
ATOM   4365 O  O     . ALA A 1 535 ? 3.727   12.657 22.846  1.00 59.10  ? 535  ALA A O     1 
ATOM   4366 C  CB    . ALA A 1 535 ? 1.611   10.217 22.282  1.00 64.79  ? 535  ALA A CB    1 
ATOM   4367 N  N     . LYS A 1 536 ? 4.397   10.665 23.661  1.00 63.39  ? 536  LYS A N     1 
ATOM   4368 C  CA    . LYS A 1 536 ? 5.189   11.231 24.750  1.00 62.93  ? 536  LYS A CA    1 
ATOM   4369 C  C     . LYS A 1 536 ? 6.283   12.149 24.218  1.00 62.41  ? 536  LYS A C     1 
ATOM   4370 O  O     . LYS A 1 536 ? 6.442   13.278 24.685  1.00 60.09  ? 536  LYS A O     1 
ATOM   4371 C  CB    . LYS A 1 536 ? 5.803   10.118 25.608  1.00 62.06  ? 536  LYS A CB    1 
ATOM   4372 N  N     . SER A 1 537 ? 7.029   11.659 23.234  1.00 64.76  ? 537  SER A N     1 
ATOM   4373 C  CA    . SER A 1 537 ? 8.087   12.449 22.619  1.00 67.31  ? 537  SER A CA    1 
ATOM   4374 C  C     . SER A 1 537 ? 7.516   13.660 21.883  1.00 67.67  ? 537  SER A C     1 
ATOM   4375 O  O     . SER A 1 537 ? 8.082   14.749 21.949  1.00 67.76  ? 537  SER A O     1 
ATOM   4376 C  CB    . SER A 1 537 ? 8.929   11.589 21.672  1.00 68.78  ? 537  SER A CB    1 
ATOM   4377 O  OG    . SER A 1 537 ? 9.698   10.641 22.392  1.00 70.59  ? 537  SER A OG    1 
ATOM   4378 N  N     . LEU A 1 538 ? 6.392   13.469 21.195  1.00 65.33  ? 538  LEU A N     1 
ATOM   4379 C  CA    . LEU A 1 538 ? 5.760   14.556 20.453  1.00 61.18  ? 538  LEU A CA    1 
ATOM   4380 C  C     . LEU A 1 538 ? 5.237   15.646 21.381  1.00 60.48  ? 538  LEU A C     1 
ATOM   4381 O  O     . LEU A 1 538 ? 5.531   16.827 21.188  1.00 59.40  ? 538  LEU A O     1 
ATOM   4382 C  CB    . LEU A 1 538 ? 4.627   14.034 19.570  1.00 60.79  ? 538  LEU A CB    1 
ATOM   4383 C  CG    . LEU A 1 538 ? 5.012   13.463 18.203  1.00 62.37  ? 538  LEU A CG    1 
ATOM   4384 C  CD1   . LEU A 1 538 ? 3.770   13.054 17.431  1.00 62.03  ? 538  LEU A CD1   1 
ATOM   4385 C  CD2   . LEU A 1 538 ? 5.835   14.467 17.413  1.00 61.13  ? 538  LEU A CD2   1 
ATOM   4386 N  N     . ASN A 1 539 ? 4.461   15.245 22.384  1.00 59.64  ? 539  ASN A N     1 
ATOM   4387 C  CA    . ASN A 1 539 ? 3.913   16.189 23.354  1.00 56.09  ? 539  ASN A CA    1 
ATOM   4388 C  C     . ASN A 1 539 ? 5.008   16.965 24.072  1.00 56.31  ? 539  ASN A C     1 
ATOM   4389 O  O     . ASN A 1 539 ? 4.831   18.136 24.411  1.00 58.54  ? 539  ASN A O     1 
ATOM   4390 C  CB    . ASN A 1 539 ? 3.016   15.472 24.363  1.00 54.85  ? 539  ASN A CB    1 
ATOM   4391 C  CG    . ASN A 1 539 ? 1.727   14.975 23.741  1.00 56.12  ? 539  ASN A CG    1 
ATOM   4392 O  OD1   . ASN A 1 539 ? 1.085   15.686 22.971  1.00 53.89  ? 539  ASN A OD1   1 
ATOM   4393 N  ND2   . ASN A 1 539 ? 1.349   13.744 24.064  1.00 60.24  ? 539  ASN A ND2   1 
ATOM   4394 N  N     . GLU A 1 540 ? 6.143   16.311 24.291  1.00 54.64  ? 540  GLU A N     1 
ATOM   4395 C  CA    . GLU A 1 540 ? 7.293   16.978 24.883  1.00 55.11  ? 540  GLU A CA    1 
ATOM   4396 C  C     . GLU A 1 540 ? 7.895   18.003 23.914  1.00 55.50  ? 540  GLU A C     1 
ATOM   4397 O  O     . GLU A 1 540 ? 8.288   19.097 24.323  1.00 55.98  ? 540  GLU A O     1 
ATOM   4398 C  CB    . GLU A 1 540 ? 8.341   15.958 25.335  1.00 57.97  ? 540  GLU A CB    1 
ATOM   4399 C  CG    . GLU A 1 540 ? 9.557   16.572 26.021  1.00 62.70  ? 540  GLU A CG    1 
ATOM   4400 C  CD    . GLU A 1 540 ? 9.196   17.398 27.250  1.00 66.99  ? 540  GLU A CD    1 
ATOM   4401 O  OE1   . GLU A 1 540 ? 9.921   18.374 27.545  1.00 66.56  ? 540  GLU A OE1   1 
ATOM   4402 O  OE2   . GLU A 1 540 ? 8.195   17.073 27.926  1.00 69.16  ? 540  GLU A OE2   1 
ATOM   4403 N  N     . MET A 1 541 ? 7.948   17.658 22.630  1.00 53.68  ? 541  MET A N     1 
ATOM   4404 C  CA    . MET A 1 541 ? 8.477   18.572 21.622  1.00 51.41  ? 541  MET A CA    1 
ATOM   4405 C  C     . MET A 1 541 ? 7.530   19.739 21.385  1.00 47.91  ? 541  MET A C     1 
ATOM   4406 O  O     . MET A 1 541 ? 7.968   20.867 21.165  1.00 47.70  ? 541  MET A O     1 
ATOM   4407 C  CB    . MET A 1 541 ? 8.741   17.847 20.302  1.00 55.09  ? 541  MET A CB    1 
ATOM   4408 C  CG    . MET A 1 541 ? 9.865   16.832 20.368  1.00 59.44  ? 541  MET A CG    1 
ATOM   4409 S  SD    . MET A 1 541 ? 10.339  16.190 18.751  1.00 63.47  ? 541  MET A SD    1 
ATOM   4410 C  CE    . MET A 1 541 ? 11.097  17.640 18.017  1.00 55.75  ? 541  MET A CE    1 
ATOM   4411 N  N     . LEU A 1 542 ? 6.231   19.458 21.420  1.00 45.63  ? 542  LEU A N     1 
ATOM   4412 C  CA    . LEU A 1 542 ? 5.219   20.496 21.287  1.00 41.93  ? 542  LEU A CA    1 
ATOM   4413 C  C     . LEU A 1 542 ? 5.346   21.479 22.443  1.00 43.03  ? 542  LEU A C     1 
ATOM   4414 O  O     . LEU A 1 542 ? 5.181   22.687 22.272  1.00 42.39  ? 542  LEU A O     1 
ATOM   4415 C  CB    . LEU A 1 542 ? 3.822   19.879 21.264  1.00 40.76  ? 542  LEU A CB    1 
ATOM   4416 C  CG    . LEU A 1 542 ? 2.658   20.868 21.197  1.00 42.27  ? 542  LEU A CG    1 
ATOM   4417 C  CD1   . LEU A 1 542 ? 2.814   21.789 19.999  1.00 45.45  ? 542  LEU A CD1   1 
ATOM   4418 C  CD2   . LEU A 1 542 ? 1.336   20.128 21.137  1.00 41.57  ? 542  LEU A CD2   1 
ATOM   4419 N  N     . PHE A 1 543 ? 5.658   20.949 23.620  1.00 43.95  ? 543  PHE A N     1 
ATOM   4420 C  CA    . PHE A 1 543 ? 5.858   21.775 24.801  1.00 41.66  ? 543  PHE A CA    1 
ATOM   4421 C  C     . PHE A 1 543 ? 7.076   22.678 24.634  1.00 38.21  ? 543  PHE A C     1 
ATOM   4422 O  O     . PHE A 1 543 ? 7.014   23.872 24.923  1.00 36.36  ? 543  PHE A O     1 
ATOM   4423 C  CB    . PHE A 1 543 ? 6.007   20.903 26.049  1.00 42.58  ? 543  PHE A CB    1 
ATOM   4424 C  CG    . PHE A 1 543 ? 6.298   21.682 27.299  1.00 43.18  ? 543  PHE A CG    1 
ATOM   4425 C  CD1   . PHE A 1 543 ? 5.282   22.347 27.967  1.00 40.68  ? 543  PHE A CD1   1 
ATOM   4426 C  CD2   . PHE A 1 543 ? 7.588   21.751 27.809  1.00 43.93  ? 543  PHE A CD2   1 
ATOM   4427 C  CE1   . PHE A 1 543 ? 5.546   23.070 29.117  1.00 40.92  ? 543  PHE A CE1   1 
ATOM   4428 C  CE2   . PHE A 1 543 ? 7.858   22.471 28.958  1.00 41.86  ? 543  PHE A CE2   1 
ATOM   4429 C  CZ    . PHE A 1 543 ? 6.835   23.132 29.613  1.00 41.39  ? 543  PHE A CZ    1 
ATOM   4430 N  N     . ARG A 1 544 ? 8.179   22.104 24.165  1.00 38.16  ? 544  ARG A N     1 
ATOM   4431 C  CA    . ARG A 1 544 ? 9.413   22.862 23.982  1.00 40.69  ? 544  ARG A CA    1 
ATOM   4432 C  C     . ARG A 1 544 ? 9.276   23.870 22.849  1.00 41.47  ? 544  ARG A C     1 
ATOM   4433 O  O     . ARG A 1 544 ? 9.886   24.940 22.880  1.00 40.22  ? 544  ARG A O     1 
ATOM   4434 C  CB    . ARG A 1 544 ? 10.590  21.920 23.724  1.00 43.05  ? 544  ARG A CB    1 
ATOM   4435 C  CG    . ARG A 1 544 ? 10.874  20.985 24.884  1.00 46.95  ? 544  ARG A CG    1 
ATOM   4436 C  CD    . ARG A 1 544 ? 11.999  20.012 24.572  1.00 52.38  ? 544  ARG A CD    1 
ATOM   4437 N  NE    . ARG A 1 544 ? 12.168  19.035 25.645  1.00 55.87  ? 544  ARG A NE    1 
ATOM   4438 C  CZ    . ARG A 1 544 ? 13.104  18.093 25.664  1.00 58.47  ? 544  ARG A CZ    1 
ATOM   4439 N  NH1   . ARG A 1 544 ? 13.969  17.991 24.665  1.00 58.90  ? 544  ARG A NH1   1 
ATOM   4440 N  NH2   . ARG A 1 544 ? 13.175  17.251 26.687  1.00 60.34  ? 544  ARG A NH2   1 
ATOM   4441 N  N     . ALA A 1 545 ? 8.470   23.519 21.851  1.00 41.71  ? 545  ALA A N     1 
ATOM   4442 C  CA    . ALA A 1 545 ? 8.185   24.417 20.741  1.00 40.02  ? 545  ALA A CA    1 
ATOM   4443 C  C     . ALA A 1 545 ? 7.445   25.635 21.264  1.00 39.70  ? 545  ALA A C     1 
ATOM   4444 O  O     . ALA A 1 545 ? 7.800   26.777 20.967  1.00 39.80  ? 545  ALA A O     1 
ATOM   4445 C  CB    . ALA A 1 545 ? 7.347   23.706 19.694  1.00 41.58  ? 545  ALA A CB    1 
ATOM   4446 N  N     . GLN A 1 546 ? 6.409   25.375 22.052  1.00 39.28  ? 546  GLN A N     1 
ATOM   4447 C  CA    . GLN A 1 546 ? 5.607   26.436 22.637  1.00 36.21  ? 546  GLN A CA    1 
ATOM   4448 C  C     . GLN A 1 546 ? 6.418   27.291 23.606  1.00 35.31  ? 546  GLN A C     1 
ATOM   4449 O  O     . GLN A 1 546 ? 6.237   28.506 23.669  1.00 35.17  ? 546  GLN A O     1 
ATOM   4450 C  CB    . GLN A 1 546 ? 4.372   25.846 23.317  1.00 37.10  ? 546  GLN A CB    1 
ATOM   4451 C  CG    . GLN A 1 546 ? 3.386   25.242 22.331  1.00 40.37  ? 546  GLN A CG    1 
ATOM   4452 C  CD    . GLN A 1 546 ? 2.204   24.579 23.004  1.00 45.06  ? 546  GLN A CD    1 
ATOM   4453 O  OE1   . GLN A 1 546 ? 1.206   24.264 22.355  1.00 45.73  ? 546  GLN A OE1   1 
ATOM   4454 N  NE2   . GLN A 1 546 ? 2.311   24.357 24.310  1.00 48.55  ? 546  GLN A NE2   1 
ATOM   4455 N  N     . ARG A 1 547 ? 7.321   26.659 24.350  1.00 36.00  ? 547  ARG A N     1 
ATOM   4456 C  CA    . ARG A 1 547 ? 8.203   27.401 25.247  1.00 36.39  ? 547  ARG A CA    1 
ATOM   4457 C  C     . ARG A 1 547 ? 9.148   28.303 24.464  1.00 37.61  ? 547  ARG A C     1 
ATOM   4458 O  O     . ARG A 1 547 ? 9.413   29.433 24.871  1.00 41.53  ? 547  ARG A O     1 
ATOM   4459 C  CB    . ARG A 1 547 ? 8.994   26.458 26.156  1.00 39.16  ? 547  ARG A CB    1 
ATOM   4460 C  CG    . ARG A 1 547 ? 8.225   26.015 27.387  1.00 39.55  ? 547  ARG A CG    1 
ATOM   4461 C  CD    . ARG A 1 547 ? 7.664   27.219 28.123  1.00 38.31  ? 547  ARG A CD    1 
ATOM   4462 N  NE    . ARG A 1 547 ? 6.820   26.835 29.250  1.00 39.79  ? 547  ARG A NE    1 
ATOM   4463 C  CZ    . ARG A 1 547 ? 7.279   26.590 30.472  1.00 40.15  ? 547  ARG A CZ    1 
ATOM   4464 N  NH1   . ARG A 1 547 ? 8.580   26.684 30.724  1.00 40.73  ? 547  ARG A NH1   1 
ATOM   4465 N  NH2   . ARG A 1 547 ? 6.440   26.250 31.442  1.00 36.34  ? 547  ARG A NH2   1 
ATOM   4466 N  N     . THR A 1 548 ? 9.646   27.800 23.339  1.00 36.33  ? 548  THR A N     1 
ATOM   4467 C  CA    . THR A 1 548 ? 10.519  28.579 22.469  1.00 34.64  ? 548  THR A CA    1 
ATOM   4468 C  C     . THR A 1 548 ? 9.749   29.747 21.856  1.00 34.63  ? 548  THR A C     1 
ATOM   4469 O  O     . THR A 1 548 ? 10.285  30.844 21.690  1.00 33.93  ? 548  THR A O     1 
ATOM   4470 C  CB    . THR A 1 548 ? 11.105  27.706 21.343  1.00 36.45  ? 548  THR A CB    1 
ATOM   4471 O  OG1   . THR A 1 548 ? 11.795  26.584 21.909  1.00 38.25  ? 548  THR A OG1   1 
ATOM   4472 C  CG2   . THR A 1 548 ? 12.068  28.508 20.485  1.00 35.68  ? 548  THR A CG2   1 
ATOM   4473 N  N     . GLU A 1 549 ? 8.484   29.506 21.526  1.00 34.73  ? 549  GLU A N     1 
ATOM   4474 C  CA    . GLU A 1 549 ? 7.639   30.544 20.947  1.00 31.90  ? 549  GLU A CA    1 
ATOM   4475 C  C     . GLU A 1 549 ? 7.382   31.659 21.948  1.00 29.45  ? 549  GLU A C     1 
ATOM   4476 O  O     . GLU A 1 549 ? 7.435   32.838 21.601  1.00 30.40  ? 549  GLU A O     1 
ATOM   4477 C  CB    . GLU A 1 549 ? 6.311   29.959 20.467  1.00 33.40  ? 549  GLU A CB    1 
ATOM   4478 C  CG    . GLU A 1 549 ? 5.386   30.984 19.838  1.00 32.94  ? 549  GLU A CG    1 
ATOM   4479 C  CD    . GLU A 1 549 ? 4.022   30.419 19.494  1.00 35.36  ? 549  GLU A CD    1 
ATOM   4480 O  OE1   . GLU A 1 549 ? 3.885   29.179 19.408  1.00 36.62  ? 549  GLU A OE1   1 
ATOM   4481 O  OE2   . GLU A 1 549 ? 3.084   31.222 19.312  1.00 34.91  ? 549  GLU A OE2   1 
ATOM   4482 N  N     . VAL A 1 550 ? 7.092   31.282 23.190  1.00 27.97  ? 550  VAL A N     1 
ATOM   4483 C  CA    . VAL A 1 550 ? 6.874   32.261 24.247  1.00 29.65  ? 550  VAL A CA    1 
ATOM   4484 C  C     . VAL A 1 550 ? 8.132   33.102 24.461  1.00 33.60  ? 550  VAL A C     1 
ATOM   4485 O  O     . VAL A 1 550 ? 8.056   34.327 24.576  1.00 34.99  ? 550  VAL A O     1 
ATOM   4486 C  CB    . VAL A 1 550 ? 6.453   31.583 25.568  1.00 28.24  ? 550  VAL A CB    1 
ATOM   4487 C  CG1   . VAL A 1 550 ? 6.512   32.566 26.725  1.00 24.71  ? 550  VAL A CG1   1 
ATOM   4488 C  CG2   . VAL A 1 550 ? 5.060   30.992 25.438  1.00 25.42  ? 550  VAL A CG2   1 
ATOM   4489 N  N     . ALA A 1 551 ? 9.285   32.438 24.498  1.00 33.34  ? 551  ALA A N     1 
ATOM   4490 C  CA    . ALA A 1 551 ? 10.568  33.120 24.649  1.00 30.04  ? 551  ALA A CA    1 
ATOM   4491 C  C     . ALA A 1 551 ? 10.792  34.126 23.524  1.00 29.70  ? 551  ALA A C     1 
ATOM   4492 O  O     . ALA A 1 551 ? 11.216  35.259 23.766  1.00 29.10  ? 551  ALA A O     1 
ATOM   4493 C  CB    . ALA A 1 551 ? 11.705  32.111 24.693  1.00 28.71  ? 551  ALA A CB    1 
ATOM   4494 N  N     . GLY A 1 552 ? 10.508  33.705 22.295  1.00 29.07  ? 552  GLY A N     1 
ATOM   4495 C  CA    . GLY A 1 552 ? 10.582  34.594 21.150  1.00 30.31  ? 552  GLY A CA    1 
ATOM   4496 C  C     . GLY A 1 552 ? 9.560   35.715 21.246  1.00 30.94  ? 552  GLY A C     1 
ATOM   4497 O  O     . GLY A 1 552 ? 9.851   36.864 20.897  1.00 31.33  ? 552  GLY A O     1 
ATOM   4498 N  N     . MET A 1 553 ? 8.363   35.381 21.725  1.00 29.52  ? 553  MET A N     1 
ATOM   4499 C  CA    . MET A 1 553 ? 7.292   36.361 21.873  1.00 26.58  ? 553  MET A CA    1 
ATOM   4500 C  C     . MET A 1 553 ? 7.695   37.492 22.811  1.00 27.12  ? 553  MET A C     1 
ATOM   4501 O  O     . MET A 1 553 ? 7.497   38.669 22.499  1.00 29.30  ? 553  MET A O     1 
ATOM   4502 C  CB    . MET A 1 553 ? 6.007   35.698 22.372  1.00 25.25  ? 553  MET A CB    1 
ATOM   4503 C  CG    . MET A 1 553 ? 4.908   36.687 22.739  1.00 23.52  ? 553  MET A CG    1 
ATOM   4504 S  SD    . MET A 1 553 ? 4.299   37.651 21.337  1.00 36.31  ? 553  MET A SD    1 
ATOM   4505 C  CE    . MET A 1 553 ? 3.107   36.520 20.632  1.00 48.95  ? 553  MET A CE    1 
ATOM   4506 N  N     . THR A 1 554 ? 8.266   37.129 23.956  1.00 24.51  ? 554  THR A N     1 
ATOM   4507 C  CA    . THR A 1 554 ? 8.708   38.113 24.936  1.00 25.16  ? 554  THR A CA    1 
ATOM   4508 C  C     . THR A 1 554 ? 9.729   39.061 24.326  1.00 29.85  ? 554  THR A C     1 
ATOM   4509 O  O     . THR A 1 554 ? 9.598   40.282 24.427  1.00 33.25  ? 554  THR A O     1 
ATOM   4510 C  CB    . THR A 1 554 ? 9.339   37.441 26.161  1.00 23.80  ? 554  THR A CB    1 
ATOM   4511 O  OG1   . THR A 1 554 ? 8.339   36.693 26.864  1.00 23.75  ? 554  THR A OG1   1 
ATOM   4512 C  CG2   . THR A 1 554 ? 9.928   38.488 27.091  1.00 22.80  ? 554  THR A CG2   1 
ATOM   4513 N  N     . ALA A 1 555 ? 10.739  38.487 23.683  1.00 30.82  ? 555  ALA A N     1 
ATOM   4514 C  CA    . ALA A 1 555 ? 11.817  39.266 23.093  1.00 32.51  ? 555  ALA A CA    1 
ATOM   4515 C  C     . ALA A 1 555 ? 11.324  40.200 21.994  1.00 31.35  ? 555  ALA A C     1 
ATOM   4516 O  O     . ALA A 1 555 ? 11.786  41.335 21.893  1.00 28.40  ? 555  ALA A O     1 
ATOM   4517 C  CB    . ALA A 1 555 ? 12.903  38.345 22.559  1.00 33.22  ? 555  ALA A CB    1 
ATOM   4518 N  N     . GLN A 1 556 ? 10.381  39.733 21.180  1.00 33.20  ? 556  GLN A N     1 
ATOM   4519 C  CA    . GLN A 1 556 ? 9.915   40.532 20.045  1.00 32.05  ? 556  GLN A CA    1 
ATOM   4520 C  C     . GLN A 1 556 ? 8.851   41.573 20.414  1.00 28.23  ? 556  GLN A C     1 
ATOM   4521 O  O     . GLN A 1 556 ? 8.935   42.721 19.985  1.00 30.51  ? 556  GLN A O     1 
ATOM   4522 C  CB    . GLN A 1 556 ? 9.445   39.641 18.879  1.00 32.10  ? 556  GLN A CB    1 
ATOM   4523 C  CG    . GLN A 1 556 ? 8.063   38.991 19.036  1.00 34.02  ? 556  GLN A CG    1 
ATOM   4524 C  CD    . GLN A 1 556 ? 6.913   39.903 18.606  1.00 33.63  ? 556  GLN A CD    1 
ATOM   4525 O  OE1   . GLN A 1 556 ? 7.123   40.922 17.943  1.00 30.29  ? 556  GLN A OE1   1 
ATOM   4526 N  NE2   . GLN A 1 556 ? 5.693   39.539 18.993  1.00 32.42  ? 556  GLN A NE2   1 
ATOM   4527 N  N     . ILE A 1 557 ? 7.860   41.177 21.207  1.00 23.40  ? 557  ILE A N     1 
ATOM   4528 C  CA    . ILE A 1 557 ? 6.732   42.055 21.487  1.00 25.96  ? 557  ILE A CA    1 
ATOM   4529 C  C     . ILE A 1 557 ? 7.142   43.199 22.410  1.00 29.00  ? 557  ILE A C     1 
ATOM   4530 O  O     . ILE A 1 557 ? 6.511   44.259 22.419  1.00 28.86  ? 557  ILE A O     1 
ATOM   4531 C  CB    . ILE A 1 557 ? 5.537   41.284 22.092  1.00 27.36  ? 557  ILE A CB    1 
ATOM   4532 C  CG1   . ILE A 1 557 ? 4.230   42.044 21.851  1.00 28.39  ? 557  ILE A CG1   1 
ATOM   4533 C  CG2   . ILE A 1 557 ? 5.754   41.016 23.577  1.00 23.59  ? 557  ILE A CG2   1 
ATOM   4534 C  CD1   . ILE A 1 557 ? 2.994   41.276 22.262  1.00 31.00  ? 557  ILE A CD1   1 
ATOM   4535 N  N     . ASN A 1 558 ? 8.211   42.985 23.170  1.00 28.99  ? 558  ASN A N     1 
ATOM   4536 C  CA    . ASN A 1 558 ? 8.698   43.997 24.099  1.00 28.59  ? 558  ASN A CA    1 
ATOM   4537 C  C     . ASN A 1 558 ? 9.714   44.938 23.469  1.00 29.95  ? 558  ASN A C     1 
ATOM   4538 O  O     . ASN A 1 558 ? 9.874   46.076 23.908  1.00 31.04  ? 558  ASN A O     1 
ATOM   4539 C  CB    . ASN A 1 558 ? 9.253   43.345 25.363  1.00 24.85  ? 558  ASN A CB    1 
ATOM   4540 C  CG    . ASN A 1 558 ? 8.157   42.806 26.254  1.00 27.14  ? 558  ASN A CG    1 
ATOM   4541 O  OD1   . ASN A 1 558 ? 7.198   43.512 26.562  1.00 27.32  ? 558  ASN A OD1   1 
ATOM   4542 N  ND2   . ASN A 1 558 ? 8.282   41.548 26.661  1.00 30.64  ? 558  ASN A ND2   1 
ATOM   4543 N  N     . ARG A 1 559 ? 10.397  44.466 22.434  1.00 28.95  ? 559  ARG A N     1 
ATOM   4544 C  CA    . ARG A 1 559 ? 11.225  45.357 21.640  1.00 29.05  ? 559  ARG A CA    1 
ATOM   4545 C  C     . ARG A 1 559 ? 10.306  46.207 20.770  1.00 30.22  ? 559  ARG A C     1 
ATOM   4546 O  O     . ARG A 1 559 ? 10.575  47.385 20.529  1.00 28.84  ? 559  ARG A O     1 
ATOM   4547 C  CB    . ARG A 1 559 ? 12.245  44.571 20.811  1.00 26.54  ? 559  ARG A CB    1 
ATOM   4548 C  CG    . ARG A 1 559 ? 13.461  44.160 21.625  1.00 27.61  ? 559  ARG A CG    1 
ATOM   4549 C  CD    . ARG A 1 559 ? 14.306  43.108 20.930  1.00 29.78  ? 559  ARG A CD    1 
ATOM   4550 N  NE    . ARG A 1 559 ? 15.510  42.804 21.700  1.00 29.72  ? 559  ARG A NE    1 
ATOM   4551 C  CZ    . ARG A 1 559 ? 15.529  42.037 22.786  1.00 31.22  ? 559  ARG A CZ    1 
ATOM   4552 N  NH1   . ARG A 1 559 ? 14.406  41.494 23.238  1.00 30.74  ? 559  ARG A NH1   1 
ATOM   4553 N  NH2   . ARG A 1 559 ? 16.670  41.814 23.423  1.00 32.87  ? 559  ARG A NH2   1 
ATOM   4554 N  N     . LYS A 1 560 ? 9.207   45.604 20.323  1.00 30.09  ? 560  LYS A N     1 
ATOM   4555 C  CA    . LYS A 1 560 ? 8.158   46.336 19.622  1.00 29.59  ? 560  LYS A CA    1 
ATOM   4556 C  C     . LYS A 1 560 ? 7.555   47.402 20.533  1.00 26.80  ? 560  LYS A C     1 
ATOM   4557 O  O     . LYS A 1 560 ? 7.314   48.536 20.117  1.00 26.28  ? 560  LYS A O     1 
ATOM   4558 C  CB    . LYS A 1 560 ? 7.063   45.383 19.148  1.00 28.80  ? 560  LYS A CB    1 
ATOM   4559 C  CG    . LYS A 1 560 ? 5.718   46.054 18.950  1.00 29.09  ? 560  LYS A CG    1 
ATOM   4560 C  CD    . LYS A 1 560 ? 4.688   45.077 18.430  1.00 32.52  ? 560  LYS A CD    1 
ATOM   4561 C  CE    . LYS A 1 560 ? 3.290   45.658 18.519  1.00 32.44  ? 560  LYS A CE    1 
ATOM   4562 N  NZ    . LYS A 1 560 ? 2.314   44.810 17.777  1.00 32.88  ? 560  LYS A NZ    1 
ATOM   4563 N  N     . LEU A 1 561 ? 7.317   47.026 21.783  1.00 23.99  ? 561  LEU A N     1 
ATOM   4564 C  CA    . LEU A 1 561 ? 6.784   47.955 22.766  1.00 23.21  ? 561  LEU A CA    1 
ATOM   4565 C  C     . LEU A 1 561 ? 7.743   49.121 22.981  1.00 24.30  ? 561  LEU A C     1 
ATOM   4566 O  O     . LEU A 1 561 ? 7.318   50.267 23.102  1.00 26.57  ? 561  LEU A O     1 
ATOM   4567 C  CB    . LEU A 1 561 ? 6.519   47.239 24.090  1.00 19.07  ? 561  LEU A CB    1 
ATOM   4568 C  CG    . LEU A 1 561 ? 6.155   48.128 25.278  1.00 20.53  ? 561  LEU A CG    1 
ATOM   4569 C  CD1   . LEU A 1 561 ? 4.886   48.913 24.987  1.00 18.34  ? 561  LEU A CD1   1 
ATOM   4570 C  CD2   . LEU A 1 561 ? 6.010   47.295 26.546  1.00 20.70  ? 561  LEU A CD2   1 
ATOM   4571 N  N     . LEU A 1 562 ? 9.039   48.826 23.018  1.00 23.77  ? 562  LEU A N     1 
ATOM   4572 C  CA    . LEU A 1 562 ? 10.043  49.860 23.254  1.00 22.98  ? 562  LEU A CA    1 
ATOM   4573 C  C     . LEU A 1 562 ? 10.114  50.878 22.112  1.00 26.07  ? 562  LEU A C     1 
ATOM   4574 O  O     . LEU A 1 562 ? 10.160  52.084 22.356  1.00 28.18  ? 562  LEU A O     1 
ATOM   4575 C  CB    . LEU A 1 562 ? 11.417  49.241 23.525  1.00 21.46  ? 562  LEU A CB    1 
ATOM   4576 C  CG    . LEU A 1 562 ? 12.543  50.198 23.932  1.00 24.00  ? 562  LEU A CG    1 
ATOM   4577 C  CD1   . LEU A 1 562 ? 12.179  50.979 25.194  1.00 20.42  ? 562  LEU A CD1   1 
ATOM   4578 C  CD2   . LEU A 1 562 ? 13.850  49.437 24.122  1.00 22.87  ? 562  LEU A CD2   1 
ATOM   4579 N  N     . ILE A 1 563 ? 10.115  50.402 20.870  1.00 25.22  ? 563  ILE A N     1 
ATOM   4580 C  CA    . ILE A 1 563 ? 10.192  51.312 19.731  1.00 24.55  ? 563  ILE A CA    1 
ATOM   4581 C  C     . ILE A 1 563 ? 8.902   52.103 19.535  1.00 23.22  ? 563  ILE A C     1 
ATOM   4582 O  O     . ILE A 1 563 ? 8.940   53.266 19.139  1.00 24.95  ? 563  ILE A O     1 
ATOM   4583 C  CB    . ILE A 1 563 ? 10.575  50.592 18.420  1.00 26.45  ? 563  ILE A CB    1 
ATOM   4584 C  CG1   . ILE A 1 563 ? 9.624   49.428 18.137  1.00 29.87  ? 563  ILE A CG1   1 
ATOM   4585 C  CG2   . ILE A 1 563 ? 12.019  50.115 18.474  1.00 24.03  ? 563  ILE A CG2   1 
ATOM   4586 C  CD1   . ILE A 1 563 ? 9.878   48.754 16.797  1.00 32.70  ? 563  ILE A CD1   1 
ATOM   4587 N  N     . ASN A 1 564 ? 7.763   51.476 19.813  1.00 22.29  ? 564  ASN A N     1 
ATOM   4588 C  CA    . ASN A 1 564 ? 6.492   52.185 19.758  1.00 22.58  ? 564  ASN A CA    1 
ATOM   4589 C  C     . ASN A 1 564 ? 6.402   53.216 20.879  1.00 24.44  ? 564  ASN A C     1 
ATOM   4590 O  O     . ASN A 1 564 ? 5.716   54.234 20.755  1.00 24.88  ? 564  ASN A O     1 
ATOM   4591 C  CB    . ASN A 1 564 ? 5.313   51.212 19.817  1.00 22.87  ? 564  ASN A CB    1 
ATOM   4592 C  CG    . ASN A 1 564 ? 5.188   50.372 18.557  1.00 24.49  ? 564  ASN A CG    1 
ATOM   4593 O  OD1   . ASN A 1 564 ? 5.818   50.661 17.541  1.00 25.33  ? 564  ASN A OD1   1 
ATOM   4594 N  ND2   . ASN A 1 564 ? 4.364   49.333 18.616  1.00 23.91  ? 564  ASN A ND2   1 
ATOM   4595 N  N     . SER A 1 565 ? 7.116   52.948 21.969  1.00 25.51  ? 565  SER A N     1 
ATOM   4596 C  CA    . SER A 1 565 ? 7.175   53.870 23.097  1.00 24.64  ? 565  SER A CA    1 
ATOM   4597 C  C     . SER A 1 565 ? 8.074   55.062 22.791  1.00 28.34  ? 565  SER A C     1 
ATOM   4598 O  O     . SER A 1 565 ? 7.923   56.128 23.386  1.00 30.14  ? 565  SER A O     1 
ATOM   4599 C  CB    . SER A 1 565 ? 7.662   53.156 24.355  1.00 21.03  ? 565  SER A CB    1 
ATOM   4600 O  OG    . SER A 1 565 ? 6.731   52.175 24.773  1.00 20.82  ? 565  SER A OG    1 
ATOM   4601 N  N     . LEU A 1 566 ? 9.015   54.879 21.869  1.00 28.78  ? 566  LEU A N     1 
ATOM   4602 C  CA    . LEU A 1 566 ? 9.815   56.000 21.395  1.00 28.45  ? 566  LEU A CA    1 
ATOM   4603 C  C     . LEU A 1 566 ? 8.908   56.978 20.654  1.00 30.28  ? 566  LEU A C     1 
ATOM   4604 O  O     . LEU A 1 566 ? 9.023   58.191 20.837  1.00 31.77  ? 566  LEU A O     1 
ATOM   4605 C  CB    . LEU A 1 566 ? 10.972  55.536 20.507  1.00 26.44  ? 566  LEU A CB    1 
ATOM   4606 C  CG    . LEU A 1 566 ? 11.861  56.629 19.901  1.00 24.71  ? 566  LEU A CG    1 
ATOM   4607 C  CD1   . LEU A 1 566 ? 12.287  57.653 20.947  1.00 20.89  ? 566  LEU A CD1   1 
ATOM   4608 C  CD2   . LEU A 1 566 ? 13.080  56.009 19.239  1.00 24.01  ? 566  LEU A CD2   1 
ATOM   4609 N  N     . TYR A 1 567 ? 8.002   56.453 19.828  1.00 28.66  ? 567  TYR A N     1 
ATOM   4610 C  CA    . TYR A 1 567 ? 6.990   57.306 19.215  1.00 26.61  ? 567  TYR A CA    1 
ATOM   4611 C  C     . TYR A 1 567 ? 6.208   58.016 20.312  1.00 25.98  ? 567  TYR A C     1 
ATOM   4612 O  O     . TYR A 1 567 ? 6.062   59.239 20.290  1.00 24.96  ? 567  TYR A O     1 
ATOM   4613 C  CB    . TYR A 1 567 ? 6.011   56.524 18.328  1.00 24.29  ? 567  TYR A CB    1 
ATOM   4614 C  CG    . TYR A 1 567 ? 4.618   57.119 18.391  1.00 25.39  ? 567  TYR A CG    1 
ATOM   4615 C  CD1   . TYR A 1 567 ? 4.325   58.326 17.761  1.00 27.84  ? 567  TYR A CD1   1 
ATOM   4616 C  CD2   . TYR A 1 567 ? 3.608   56.498 19.114  1.00 24.52  ? 567  TYR A CD2   1 
ATOM   4617 C  CE1   . TYR A 1 567 ? 3.064   58.887 17.842  1.00 27.71  ? 567  TYR A CE1   1 
ATOM   4618 C  CE2   . TYR A 1 567 ? 2.348   57.051 19.199  1.00 27.23  ? 567  TYR A CE2   1 
ATOM   4619 C  CZ    . TYR A 1 567 ? 2.081   58.244 18.561  1.00 29.86  ? 567  TYR A CZ    1 
ATOM   4620 O  OH    . TYR A 1 567 ? 0.828   58.796 18.644  1.00 33.80  ? 567  TYR A OH    1 
ATOM   4621 N  N     . GLY A 1 568 ? 5.708   57.236 21.267  1.00 24.07  ? 568  GLY A N     1 
ATOM   4622 C  CA    . GLY A 1 568 ? 4.884   57.767 22.333  1.00 23.14  ? 568  GLY A CA    1 
ATOM   4623 C  C     . GLY A 1 568 ? 5.611   58.817 23.147  1.00 24.30  ? 568  GLY A C     1 
ATOM   4624 O  O     . GLY A 1 568 ? 5.021   59.824 23.538  1.00 24.91  ? 568  GLY A O     1 
ATOM   4625 N  N     . ALA A 1 569 ? 6.895   58.576 23.395  1.00 23.59  ? 569  ALA A N     1 
ATOM   4626 C  CA    . ALA A 1 569 ? 7.739   59.521 24.117  1.00 21.89  ? 569  ALA A CA    1 
ATOM   4627 C  C     . ALA A 1 569 ? 7.697   60.906 23.478  1.00 23.68  ? 569  ALA A C     1 
ATOM   4628 O  O     . ALA A 1 569 ? 7.652   61.916 24.175  1.00 26.37  ? 569  ALA A O     1 
ATOM   4629 C  CB    . ALA A 1 569 ? 9.166   59.010 24.182  1.00 20.01  ? 569  ALA A CB    1 
ATOM   4630 N  N     . LEU A 1 570 ? 7.694   60.947 22.149  1.00 22.26  ? 570  LEU A N     1 
ATOM   4631 C  CA    . LEU A 1 570 ? 7.629   62.206 21.419  1.00 24.83  ? 570  LEU A CA    1 
ATOM   4632 C  C     . LEU A 1 570 ? 6.373   63.005 21.762  1.00 26.98  ? 570  LEU A C     1 
ATOM   4633 O  O     . LEU A 1 570 ? 6.337   64.225 21.589  1.00 28.28  ? 570  LEU A O     1 
ATOM   4634 C  CB    . LEU A 1 570 ? 7.680   61.953 19.912  1.00 27.86  ? 570  LEU A CB    1 
ATOM   4635 C  CG    . LEU A 1 570 ? 8.944   61.294 19.355  1.00 29.17  ? 570  LEU A CG    1 
ATOM   4636 C  CD1   . LEU A 1 570 ? 8.759   60.958 17.887  1.00 28.24  ? 570  LEU A CD1   1 
ATOM   4637 C  CD2   . LEU A 1 570 ? 10.159  62.191 19.551  1.00 27.17  ? 570  LEU A CD2   1 
ATOM   4638 N  N     . GLY A 1 571 ? 5.346   62.311 22.242  1.00 24.82  ? 571  GLY A N     1 
ATOM   4639 C  CA    . GLY A 1 571 ? 4.121   62.957 22.673  1.00 23.60  ? 571  GLY A CA    1 
ATOM   4640 C  C     . GLY A 1 571 ? 4.018   63.092 24.183  1.00 24.69  ? 571  GLY A C     1 
ATOM   4641 O  O     . GLY A 1 571 ? 2.940   63.365 24.715  1.00 24.33  ? 571  GLY A O     1 
ATOM   4642 N  N     . ASN A 1 572 ? 5.135   62.897 24.879  1.00 24.11  ? 572  ASN A N     1 
ATOM   4643 C  CA    . ASN A 1 572 ? 5.161   63.058 26.332  1.00 23.57  ? 572  ASN A CA    1 
ATOM   4644 C  C     . ASN A 1 572 ? 6.070   64.200 26.775  1.00 24.40  ? 572  ASN A C     1 
ATOM   4645 O  O     . ASN A 1 572 ? 7.252   64.233 26.430  1.00 22.35  ? 572  ASN A O     1 
ATOM   4646 C  CB    . ASN A 1 572 ? 5.576   61.761 27.024  1.00 24.52  ? 572  ASN A CB    1 
ATOM   4647 C  CG    . ASN A 1 572 ? 5.557   61.882 28.535  1.00 25.29  ? 572  ASN A CG    1 
ATOM   4648 O  OD1   . ASN A 1 572 ? 6.478   62.434 29.136  1.00 25.64  ? 572  ASN A OD1   1 
ATOM   4649 N  ND2   . ASN A 1 572 ? 4.501   61.372 29.156  1.00 23.99  ? 572  ASN A ND2   1 
ATOM   4650 N  N     . VAL A 1 573 ? 5.515   65.122 27.557  1.00 24.61  ? 573  VAL A N     1 
ATOM   4651 C  CA    . VAL A 1 573 ? 6.207   66.359 27.917  1.00 26.80  ? 573  VAL A CA    1 
ATOM   4652 C  C     . VAL A 1 573 ? 7.508   66.157 28.694  1.00 30.23  ? 573  VAL A C     1 
ATOM   4653 O  O     . VAL A 1 573 ? 8.331   67.068 28.780  1.00 31.77  ? 573  VAL A O     1 
ATOM   4654 C  CB    . VAL A 1 573 ? 5.294   67.307 28.726  1.00 27.36  ? 573  VAL A CB    1 
ATOM   4655 C  CG1   . VAL A 1 573 ? 4.069   67.710 27.906  1.00 23.87  ? 573  VAL A CG1   1 
ATOM   4656 C  CG2   . VAL A 1 573 ? 4.881   66.656 30.035  1.00 26.87  ? 573  VAL A CG2   1 
ATOM   4657 N  N     . TRP A 1 574 ? 7.696   64.968 29.255  1.00 31.47  ? 574  TRP A N     1 
ATOM   4658 C  CA    . TRP A 1 574 ? 8.880   64.698 30.065  1.00 30.06  ? 574  TRP A CA    1 
ATOM   4659 C  C     . TRP A 1 574 ? 10.037  64.147 29.245  1.00 27.31  ? 574  TRP A C     1 
ATOM   4660 O  O     . TRP A 1 574 ? 11.154  64.003 29.739  1.00 30.30  ? 574  TRP A O     1 
ATOM   4661 C  CB    . TRP A 1 574 ? 8.525   63.766 31.216  1.00 32.87  ? 574  TRP A CB    1 
ATOM   4662 C  CG    . TRP A 1 574 ? 7.528   64.394 32.110  1.00 39.34  ? 574  TRP A CG    1 
ATOM   4663 C  CD1   . TRP A 1 574 ? 6.189   64.145 32.152  1.00 41.13  ? 574  TRP A CD1   1 
ATOM   4664 C  CD2   . TRP A 1 574 ? 7.778   65.425 33.068  1.00 42.53  ? 574  TRP A CD2   1 
ATOM   4665 N  NE1   . TRP A 1 574 ? 5.591   64.939 33.100  1.00 44.44  ? 574  TRP A NE1   1 
ATOM   4666 C  CE2   . TRP A 1 574 ? 6.546   65.737 33.674  1.00 44.54  ? 574  TRP A CE2   1 
ATOM   4667 C  CE3   . TRP A 1 574 ? 8.925   66.108 33.480  1.00 43.53  ? 574  TRP A CE3   1 
ATOM   4668 C  CZ2   . TRP A 1 574 ? 6.428   66.700 34.668  1.00 44.03  ? 574  TRP A CZ2   1 
ATOM   4669 C  CZ3   . TRP A 1 574 ? 8.806   67.063 34.468  1.00 45.77  ? 574  TRP A CZ3   1 
ATOM   4670 C  CH2   . TRP A 1 574 ? 7.566   67.351 35.051  1.00 44.88  ? 574  TRP A CH2   1 
ATOM   4671 N  N     . PHE A 1 575 ? 9.761   63.854 27.982  1.00 24.44  ? 575  PHE A N     1 
ATOM   4672 C  CA    . PHE A 1 575 ? 10.784  63.394 27.063  1.00 23.94  ? 575  PHE A CA    1 
ATOM   4673 C  C     . PHE A 1 575 ? 11.654  64.576 26.664  1.00 28.29  ? 575  PHE A C     1 
ATOM   4674 O  O     . PHE A 1 575 ? 11.142  65.647 26.338  1.00 31.72  ? 575  PHE A O     1 
ATOM   4675 C  CB    . PHE A 1 575 ? 10.123  62.785 25.833  1.00 22.44  ? 575  PHE A CB    1 
ATOM   4676 C  CG    . PHE A 1 575 ? 11.048  61.962 24.983  1.00 25.30  ? 575  PHE A CG    1 
ATOM   4677 C  CD1   . PHE A 1 575 ? 11.977  61.118 25.566  1.00 25.82  ? 575  PHE A CD1   1 
ATOM   4678 C  CD2   . PHE A 1 575 ? 10.968  62.011 23.598  1.00 24.96  ? 575  PHE A CD2   1 
ATOM   4679 C  CE1   . PHE A 1 575 ? 12.822  60.353 24.790  1.00 24.89  ? 575  PHE A CE1   1 
ATOM   4680 C  CE2   . PHE A 1 575 ? 11.809  61.246 22.814  1.00 25.42  ? 575  PHE A CE2   1 
ATOM   4681 C  CZ    . PHE A 1 575 ? 12.738  60.414 23.411  1.00 26.54  ? 575  PHE A CZ    1 
ATOM   4682 N  N     . ARG A 1 576 ? 12.967  64.382 26.699  1.00 29.13  ? 576  ARG A N     1 
ATOM   4683 C  CA    . ARG A 1 576 ? 13.913  65.425 26.317  1.00 28.56  ? 576  ARG A CA    1 
ATOM   4684 C  C     . ARG A 1 576 ? 13.640  65.914 24.898  1.00 31.22  ? 576  ARG A C     1 
ATOM   4685 O  O     . ARG A 1 576 ? 13.833  67.090 24.587  1.00 32.22  ? 576  ARG A O     1 
ATOM   4686 C  CB    . ARG A 1 576 ? 15.346  64.897 26.418  1.00 25.64  ? 576  ARG A CB    1 
ATOM   4687 C  CG    . ARG A 1 576 ? 16.418  65.933 26.145  1.00 24.98  ? 576  ARG A CG    1 
ATOM   4688 C  CD    . ARG A 1 576 ? 17.795  65.304 26.211  1.00 26.57  ? 576  ARG A CD    1 
ATOM   4689 N  NE    . ARG A 1 576 ? 17.964  64.499 27.417  1.00 27.32  ? 576  ARG A NE    1 
ATOM   4690 C  CZ    . ARG A 1 576 ? 18.389  64.978 28.581  1.00 30.68  ? 576  ARG A CZ    1 
ATOM   4691 N  NH1   . ARG A 1 576 ? 18.695  66.263 28.701  1.00 30.98  ? 576  ARG A NH1   1 
ATOM   4692 N  NH2   . ARG A 1 576 ? 18.513  64.169 29.625  1.00 32.09  ? 576  ARG A NH2   1 
ATOM   4693 N  N     . TYR A 1 577 ? 13.170  65.004 24.048  1.00 31.56  ? 577  TYR A N     1 
ATOM   4694 C  CA    . TYR A 1 577 ? 12.934  65.310 22.640  1.00 31.27  ? 577  TYR A CA    1 
ATOM   4695 C  C     . TYR A 1 577 ? 11.448  65.329 22.308  1.00 33.90  ? 577  TYR A C     1 
ATOM   4696 O  O     . TYR A 1 577 ? 11.047  65.015 21.186  1.00 36.46  ? 577  TYR A O     1 
ATOM   4697 C  CB    . TYR A 1 577 ? 13.677  64.311 21.751  1.00 27.84  ? 577  TYR A CB    1 
ATOM   4698 C  CG    . TYR A 1 577 ? 15.120  64.159 22.154  1.00 26.92  ? 577  TYR A CG    1 
ATOM   4699 C  CD1   . TYR A 1 577 ? 15.509  63.160 23.034  1.00 27.02  ? 577  TYR A CD1   1 
ATOM   4700 C  CD2   . TYR A 1 577 ? 16.088  65.036 21.685  1.00 23.94  ? 577  TYR A CD2   1 
ATOM   4701 C  CE1   . TYR A 1 577 ? 16.825  63.028 23.422  1.00 30.14  ? 577  TYR A CE1   1 
ATOM   4702 C  CE2   . TYR A 1 577 ? 17.401  64.911 22.064  1.00 28.76  ? 577  TYR A CE2   1 
ATOM   4703 C  CZ    . TYR A 1 577 ? 17.766  63.906 22.935  1.00 31.57  ? 577  TYR A CZ    1 
ATOM   4704 O  OH    . TYR A 1 577 ? 19.079  63.775 23.318  1.00 36.00  ? 577  TYR A OH    1 
ATOM   4705 N  N     . TYR A 1 578 ? 10.641  65.695 23.298  1.00 32.20  ? 578  TYR A N     1 
ATOM   4706 C  CA    . TYR A 1 578 ? 9.213   65.902 23.104  1.00 30.63  ? 578  TYR A CA    1 
ATOM   4707 C  C     . TYR A 1 578 ? 8.979   66.939 22.018  1.00 32.32  ? 578  TYR A C     1 
ATOM   4708 O  O     . TYR A 1 578 ? 9.654   67.968 21.977  1.00 37.83  ? 578  TYR A O     1 
ATOM   4709 C  CB    . TYR A 1 578 ? 8.576   66.364 24.412  1.00 30.36  ? 578  TYR A CB    1 
ATOM   4710 C  CG    . TYR A 1 578 ? 7.173   66.916 24.282  1.00 29.60  ? 578  TYR A CG    1 
ATOM   4711 C  CD1   . TYR A 1 578 ? 6.943   68.287 24.288  1.00 29.18  ? 578  TYR A CD1   1 
ATOM   4712 C  CD2   . TYR A 1 578 ? 6.078   66.070 24.167  1.00 29.96  ? 578  TYR A CD2   1 
ATOM   4713 C  CE1   . TYR A 1 578 ? 5.662   68.798 24.180  1.00 31.00  ? 578  TYR A CE1   1 
ATOM   4714 C  CE2   . TYR A 1 578 ? 4.792   66.571 24.059  1.00 31.00  ? 578  TYR A CE2   1 
ATOM   4715 C  CZ    . TYR A 1 578 ? 4.588   67.935 24.065  1.00 32.09  ? 578  TYR A CZ    1 
ATOM   4716 O  OH    . TYR A 1 578 ? 3.309   68.435 23.959  1.00 32.06  ? 578  TYR A OH    1 
ATOM   4717 N  N     . ASP A 1 579 ? 8.023   66.659 21.140  1.00 30.46  ? 579  ASP A N     1 
ATOM   4718 C  CA    . ASP A 1 579 ? 7.699   67.560 20.045  1.00 31.36  ? 579  ASP A CA    1 
ATOM   4719 C  C     . ASP A 1 579 ? 6.436   67.077 19.349  1.00 31.97  ? 579  ASP A C     1 
ATOM   4720 O  O     . ASP A 1 579 ? 6.463   66.073 18.635  1.00 32.89  ? 579  ASP A O     1 
ATOM   4721 C  CB    . ASP A 1 579 ? 8.855   67.613 19.043  1.00 31.54  ? 579  ASP A CB    1 
ATOM   4722 C  CG    . ASP A 1 579 ? 8.828   68.861 18.186  1.00 32.20  ? 579  ASP A CG    1 
ATOM   4723 O  OD1   . ASP A 1 579 ? 9.916   69.362 17.832  1.00 32.66  ? 579  ASP A OD1   1 
ATOM   4724 O  OD2   . ASP A 1 579 ? 7.722   69.344 17.869  1.00 32.25  ? 579  ASP A OD2   1 
ATOM   4725 N  N     A LEU A 1 580 ? 5.333   67.791 19.556  0.50 32.06  ? 580  LEU A N     1 
ATOM   4726 N  N     B LEU A 1 580 ? 5.333   67.791 19.556  0.50 32.06  ? 580  LEU A N     1 
ATOM   4727 C  CA    A LEU A 1 580 ? 4.058   67.421 18.947  0.50 31.37  ? 580  LEU A CA    1 
ATOM   4728 C  CA    B LEU A 1 580 ? 4.059   67.421 18.946  0.50 31.37  ? 580  LEU A CA    1 
ATOM   4729 C  C     A LEU A 1 580 ? 4.096   67.508 17.427  0.50 31.27  ? 580  LEU A C     1 
ATOM   4730 C  C     B LEU A 1 580 ? 4.095   67.509 17.427  0.50 31.27  ? 580  LEU A C     1 
ATOM   4731 O  O     A LEU A 1 580 ? 3.300   66.862 16.750  0.50 31.94  ? 580  LEU A O     1 
ATOM   4732 O  O     B LEU A 1 580 ? 3.299   66.865 16.749  0.50 31.94  ? 580  LEU A O     1 
ATOM   4733 C  CB    A LEU A 1 580 ? 2.917   68.281 19.488  0.50 31.33  ? 580  LEU A CB    1 
ATOM   4734 C  CB    B LEU A 1 580 ? 2.917   68.280 19.488  0.50 31.33  ? 580  LEU A CB    1 
ATOM   4735 C  CG    A LEU A 1 580 ? 2.480   67.988 20.921  0.50 31.69  ? 580  LEU A CG    1 
ATOM   4736 C  CG    B LEU A 1 580 ? 2.491   67.994 20.926  0.50 31.69  ? 580  LEU A CG    1 
ATOM   4737 C  CD1   A LEU A 1 580 ? 1.199   68.737 21.248  0.50 32.66  ? 580  LEU A CD1   1 
ATOM   4738 C  CD1   B LEU A 1 580 ? 1.215   68.747 21.261  0.50 32.68  ? 580  LEU A CD1   1 
ATOM   4739 C  CD2   A LEU A 1 580 ? 2.306   66.494 21.132  0.50 30.59  ? 580  LEU A CD2   1 
ATOM   4740 C  CD2   B LEU A 1 580 ? 2.315   66.501 21.146  0.50 30.59  ? 580  LEU A CD2   1 
ATOM   4741 N  N     . ARG A 1 581 ? 5.016   68.311 16.899  1.00 30.01  ? 581  ARG A N     1 
ATOM   4742 C  CA    . ARG A 1 581 ? 5.180   68.432 15.453  1.00 31.01  ? 581  ARG A CA    1 
ATOM   4743 C  C     . ARG A 1 581 ? 5.573   67.082 14.875  1.00 30.95  ? 581  ARG A C     1 
ATOM   4744 O  O     . ARG A 1 581 ? 5.058   66.670 13.838  1.00 31.45  ? 581  ARG A O     1 
ATOM   4745 C  CB    . ARG A 1 581 ? 6.237   69.475 15.099  1.00 30.83  ? 581  ARG A CB    1 
ATOM   4746 C  CG    . ARG A 1 581 ? 5.860   70.896 15.464  1.00 33.24  ? 581  ARG A CG    1 
ATOM   4747 C  CD    . ARG A 1 581 ? 7.019   71.834 15.195  1.00 33.20  ? 581  ARG A CD    1 
ATOM   4748 N  NE    . ARG A 1 581 ? 8.201   71.472 15.971  1.00 34.49  ? 581  ARG A NE    1 
ATOM   4749 C  CZ    . ARG A 1 581 ? 9.406   72.004 15.790  1.00 35.59  ? 581  ARG A CZ    1 
ATOM   4750 N  NH1   . ARG A 1 581 ? 9.593   72.920 14.851  1.00 37.21  ? 581  ARG A NH1   1 
ATOM   4751 N  NH2   . ARG A 1 581 ? 10.428  71.618 16.544  1.00 34.07  ? 581  ARG A NH2   1 
ATOM   4752 N  N     . ASN A 1 582 ? 6.472   66.394 15.572  1.00 28.40  ? 582  ASN A N     1 
ATOM   4753 C  CA    . ASN A 1 582 ? 6.923   65.070 15.170  1.00 30.43  ? 582  ASN A CA    1 
ATOM   4754 C  C     . ASN A 1 582 ? 5.902   63.977 15.483  1.00 31.70  ? 582  ASN A C     1 
ATOM   4755 O  O     . ASN A 1 582 ? 5.701   63.054 14.688  1.00 30.29  ? 582  ASN A O     1 
ATOM   4756 C  CB    . ASN A 1 582 ? 8.254   64.740 15.846  1.00 30.36  ? 582  ASN A CB    1 
ATOM   4757 C  CG    . ASN A 1 582 ? 9.406   65.556 15.294  1.00 32.44  ? 582  ASN A CG    1 
ATOM   4758 O  OD1   . ASN A 1 582 ? 9.308   66.135 14.212  1.00 34.15  ? 582  ASN A OD1   1 
ATOM   4759 N  ND2   . ASN A 1 582 ? 10.510  65.597 16.031  1.00 32.50  ? 582  ASN A ND2   1 
ATOM   4760 N  N     . ALA A 1 583 ? 5.266   64.082 16.646  1.00 29.32  ? 583  ALA A N     1 
ATOM   4761 C  CA    . ALA A 1 583 ? 4.280   63.098 17.066  1.00 31.15  ? 583  ALA A CA    1 
ATOM   4762 C  C     . ALA A 1 583 ? 3.095   63.093 16.110  1.00 34.08  ? 583  ALA A C     1 
ATOM   4763 O  O     . ALA A 1 583 ? 2.646   62.035 15.661  1.00 36.86  ? 583  ALA A O     1 
ATOM   4764 C  CB    . ALA A 1 583 ? 3.819   63.381 18.487  1.00 30.37  ? 583  ALA A CB    1 
ATOM   4765 N  N     . THR A 1 584 ? 2.601   64.287 15.796  1.00 31.08  ? 584  THR A N     1 
ATOM   4766 C  CA    . THR A 1 584 ? 1.471   64.442 14.890  1.00 30.13  ? 584  THR A CA    1 
ATOM   4767 C  C     . THR A 1 584 ? 1.876   64.091 13.467  1.00 26.46  ? 584  THR A C     1 
ATOM   4768 O  O     . THR A 1 584 ? 1.076   63.553 12.701  1.00 25.41  ? 584  THR A O     1 
ATOM   4769 C  CB    . THR A 1 584 ? 0.905   65.870 14.955  1.00 35.55  ? 584  THR A CB    1 
ATOM   4770 O  OG1   . THR A 1 584 ? 0.385   66.108 16.269  1.00 37.55  ? 584  THR A OG1   1 
ATOM   4771 C  CG2   . THR A 1 584 ? -0.203  66.069 13.942  1.00 39.64  ? 584  THR A CG2   1 
ATOM   4772 N  N     . ALA A 1 585 ? 3.128   64.380 13.124  1.00 26.18  ? 585  ALA A N     1 
ATOM   4773 C  CA    . ALA A 1 585 ? 3.661   64.001 11.822  1.00 23.20  ? 585  ALA A CA    1 
ATOM   4774 C  C     . ALA A 1 585 ? 3.525   62.505 11.630  1.00 25.37  ? 585  ALA A C     1 
ATOM   4775 O  O     . ALA A 1 585 ? 3.126   62.046 10.565  1.00 25.51  ? 585  ALA A O     1 
ATOM   4776 C  CB    . ALA A 1 585 ? 5.109   64.416 11.690  1.00 23.56  ? 585  ALA A CB    1 
ATOM   4777 N  N     . ILE A 1 586 ? 3.851   61.754 12.677  1.00 22.27  ? 586  ILE A N     1 
ATOM   4778 C  CA    . ILE A 1 586 ? 3.749   60.302 12.646  1.00 25.06  ? 586  ILE A CA    1 
ATOM   4779 C  C     . ILE A 1 586 ? 2.306   59.826 12.499  1.00 25.52  ? 586  ILE A C     1 
ATOM   4780 O  O     . ILE A 1 586 ? 1.993   59.054 11.593  1.00 27.19  ? 586  ILE A O     1 
ATOM   4781 C  CB    . ILE A 1 586 ? 4.360   59.681 13.910  1.00 26.72  ? 586  ILE A CB    1 
ATOM   4782 C  CG1   . ILE A 1 586 ? 5.863   59.965 13.959  1.00 25.19  ? 586  ILE A CG1   1 
ATOM   4783 C  CG2   . ILE A 1 586 ? 4.086   58.186 13.957  1.00 21.16  ? 586  ILE A CG2   1 
ATOM   4784 C  CD1   . ILE A 1 586 ? 6.495   59.659 15.296  1.00 25.10  ? 586  ILE A CD1   1 
ATOM   4785 N  N     . THR A 1 587 ? 1.428   60.287 13.385  1.00 23.87  ? 587  THR A N     1 
ATOM   4786 C  CA    . THR A 1 587 ? 0.034   59.854 13.359  1.00 25.08  ? 587  THR A CA    1 
ATOM   4787 C  C     . THR A 1 587 ? -0.687  60.293 12.090  1.00 26.23  ? 587  THR A C     1 
ATOM   4788 O  O     . THR A 1 587 ? -1.422  59.508 11.493  1.00 26.97  ? 587  THR A O     1 
ATOM   4789 C  CB    . THR A 1 587 ? -0.757  60.363 14.574  1.00 27.73  ? 587  THR A CB    1 
ATOM   4790 O  OG1   . THR A 1 587 ? -0.747  61.797 14.590  1.00 27.03  ? 587  THR A OG1   1 
ATOM   4791 C  CG2   . THR A 1 587 ? -0.160  59.822 15.867  1.00 24.87  ? 587  THR A CG2   1 
ATOM   4792 N  N     . THR A 1 588 ? -0.481  61.543 11.681  1.00 22.71  ? 588  THR A N     1 
ATOM   4793 C  CA    . THR A 1 588 ? -1.148  62.055 10.489  1.00 27.48  ? 588  THR A CA    1 
ATOM   4794 C  C     . THR A 1 588 ? -0.704  61.281 9.256   1.00 28.32  ? 588  THR A C     1 
ATOM   4795 O  O     . THR A 1 588 ? -1.532  60.885 8.438   1.00 30.31  ? 588  THR A O     1 
ATOM   4796 C  CB    . THR A 1 588 ? -0.900  63.557 10.269  1.00 26.97  ? 588  THR A CB    1 
ATOM   4797 O  OG1   . THR A 1 588 ? -1.027  64.250 11.514  1.00 25.97  ? 588  THR A OG1   1 
ATOM   4798 C  CG2   . THR A 1 588 ? -1.909  64.120 9.279   1.00 26.23  ? 588  THR A CG2   1 
ATOM   4799 N  N     . PHE A 1 589 ? 0.603   61.065 9.134   1.00 28.37  ? 589  PHE A N     1 
ATOM   4800 C  CA    . PHE A 1 589 ? 1.147   60.223 8.077   1.00 32.52  ? 589  PHE A CA    1 
ATOM   4801 C  C     . PHE A 1 589 ? 0.493   58.848 8.146   1.00 33.55  ? 589  PHE A C     1 
ATOM   4802 O  O     . PHE A 1 589 ? 0.149   58.259 7.120   1.00 32.06  ? 589  PHE A O     1 
ATOM   4803 C  CB    . PHE A 1 589 ? 2.663   60.088 8.236   1.00 33.25  ? 589  PHE A CB    1 
ATOM   4804 C  CG    . PHE A 1 589 ? 3.344   59.406 7.080   1.00 34.60  ? 589  PHE A CG    1 
ATOM   4805 C  CD1   . PHE A 1 589 ? 3.413   58.022 7.011   1.00 34.28  ? 589  PHE A CD1   1 
ATOM   4806 C  CD2   . PHE A 1 589 ? 3.938   60.151 6.072   1.00 34.15  ? 589  PHE A CD2   1 
ATOM   4807 C  CE1   . PHE A 1 589 ? 4.049   57.396 5.949   1.00 34.37  ? 589  PHE A CE1   1 
ATOM   4808 C  CE2   . PHE A 1 589 ? 4.575   59.530 5.009   1.00 32.17  ? 589  PHE A CE2   1 
ATOM   4809 C  CZ    . PHE A 1 589 ? 4.630   58.153 4.948   1.00 32.41  ? 589  PHE A CZ    1 
ATOM   4810 N  N     . GLY A 1 590 ? 0.322   58.349 9.368   1.00 32.37  ? 590  GLY A N     1 
ATOM   4811 C  CA    . GLY A 1 590 ? -0.315  57.067 9.596   1.00 29.37  ? 590  GLY A CA    1 
ATOM   4812 C  C     . GLY A 1 590 ? -1.747  57.046 9.104   1.00 31.22  ? 590  GLY A C     1 
ATOM   4813 O  O     . GLY A 1 590 ? -2.165  56.104 8.430   1.00 31.71  ? 590  GLY A O     1 
ATOM   4814 N  N     . GLN A 1 591 ? -2.500  58.088 9.440   1.00 23.99  ? 591  GLN A N     1 
ATOM   4815 C  CA    . GLN A 1 591 ? -3.872  58.219 8.968   1.00 27.88  ? 591  GLN A CA    1 
ATOM   4816 C  C     . GLN A 1 591 ? -3.937  58.235 7.449   1.00 29.43  ? 591  GLN A C     1 
ATOM   4817 O  O     . GLN A 1 591 ? -4.792  57.588 6.843   1.00 29.47  ? 591  GLN A O     1 
ATOM   4818 C  CB    . GLN A 1 591 ? -4.513  59.489 9.516   1.00 30.24  ? 591  GLN A CB    1 
ATOM   4819 C  CG    . GLN A 1 591 ? -4.814  59.437 10.998  1.00 34.73  ? 591  GLN A CG    1 
ATOM   4820 C  CD    . GLN A 1 591 ? -6.068  60.206 11.352  1.00 37.99  ? 591  GLN A CD    1 
ATOM   4821 O  OE1   . GLN A 1 591 ? -6.849  60.580 10.474  1.00 38.56  ? 591  GLN A OE1   1 
ATOM   4822 N  NE2   . GLN A 1 591 ? -6.272  60.443 12.643  1.00 38.48  ? 591  GLN A NE2   1 
ATOM   4823 N  N     . MET A 1 592 ? -3.032  58.987 6.837   1.00 31.15  ? 592  MET A N     1 
ATOM   4824 C  CA    . MET A 1 592 ? -2.957  59.036 5.386   1.00 31.69  ? 592  MET A CA    1 
ATOM   4825 C  C     . MET A 1 592 ? -2.629  57.661 4.831   1.00 31.91  ? 592  MET A C     1 
ATOM   4826 O  O     . MET A 1 592 ? -3.354  57.141 3.989   1.00 34.69  ? 592  MET A O     1 
ATOM   4827 C  CB    . MET A 1 592 ? -1.896  60.032 4.927   1.00 27.84  ? 592  MET A CB    1 
ATOM   4828 C  CG    . MET A 1 592 ? -1.705  60.054 3.420   1.00 29.26  ? 592  MET A CG    1 
ATOM   4829 S  SD    . MET A 1 592 ? -0.291  61.040 2.903   1.00 37.31  ? 592  MET A SD    1 
ATOM   4830 C  CE    . MET A 1 592 ? 1.046   60.126 3.666   1.00 34.42  ? 592  MET A CE    1 
ATOM   4831 N  N     . ALA A 1 593 ? -1.532  57.087 5.317   1.00 29.70  ? 593  ALA A N     1 
ATOM   4832 C  CA    . ALA A 1 593 ? -1.049  55.789 4.856   1.00 31.17  ? 593  ALA A CA    1 
ATOM   4833 C  C     . ALA A 1 593 ? -2.151  54.733 4.816   1.00 35.12  ? 593  ALA A C     1 
ATOM   4834 O  O     . ALA A 1 593 ? -2.340  54.061 3.802   1.00 35.77  ? 593  ALA A O     1 
ATOM   4835 C  CB    . ALA A 1 593 ? 0.104   55.317 5.726   1.00 28.18  ? 593  ALA A CB    1 
ATOM   4836 N  N     . LEU A 1 594 ? -2.882  54.602 5.918   1.00 35.49  ? 594  LEU A N     1 
ATOM   4837 C  CA    . LEU A 1 594 ? -3.969  53.632 5.999   1.00 33.76  ? 594  LEU A CA    1 
ATOM   4838 C  C     . LEU A 1 594 ? -5.042  53.893 4.951   1.00 33.47  ? 594  LEU A C     1 
ATOM   4839 O  O     . LEU A 1 594 ? -5.386  53.007 4.172   1.00 35.20  ? 594  LEU A O     1 
ATOM   4840 C  CB    . LEU A 1 594 ? -4.594  53.627 7.397   1.00 32.66  ? 594  LEU A CB    1 
ATOM   4841 C  CG    . LEU A 1 594 ? -5.849  52.764 7.564   1.00 29.58  ? 594  LEU A CG    1 
ATOM   4842 C  CD1   . LEU A 1 594 ? -5.561  51.330 7.157   1.00 29.18  ? 594  LEU A CD1   1 
ATOM   4843 C  CD2   . LEU A 1 594 ? -6.371  52.827 8.995   1.00 27.92  ? 594  LEU A CD2   1 
ATOM   4844 N  N     . GLN A 1 595 ? -5.567  55.111 4.930   1.00 32.34  ? 595  GLN A N     1 
ATOM   4845 C  CA    . GLN A 1 595 ? -6.671  55.434 4.035   1.00 36.13  ? 595  GLN A CA    1 
ATOM   4846 C  C     . GLN A 1 595 ? -6.244  55.521 2.568   1.00 39.77  ? 595  GLN A C     1 
ATOM   4847 O  O     . GLN A 1 595 ? -7.057  55.312 1.666   1.00 42.07  ? 595  GLN A O     1 
ATOM   4848 C  CB    . GLN A 1 595 ? -7.378  56.707 4.505   1.00 36.40  ? 595  GLN A CB    1 
ATOM   4849 C  CG    . GLN A 1 595 ? -8.080  56.527 5.845   1.00 35.78  ? 595  GLN A CG    1 
ATOM   4850 C  CD    . GLN A 1 595 ? -8.506  57.835 6.477   1.00 39.53  ? 595  GLN A CD    1 
ATOM   4851 O  OE1   . GLN A 1 595 ? -9.655  58.259 6.339   1.00 42.19  ? 595  GLN A OE1   1 
ATOM   4852 N  NE2   . GLN A 1 595 ? -7.584  58.478 7.185   1.00 40.83  ? 595  GLN A NE2   1 
ATOM   4853 N  N     . TRP A 1 596 ? -4.967  55.818 2.337   1.00 39.82  ? 596  TRP A N     1 
ATOM   4854 C  CA    . TRP A 1 596 ? -4.394  55.771 0.993   1.00 40.63  ? 596  TRP A CA    1 
ATOM   4855 C  C     . TRP A 1 596 ? -4.456  54.340 0.476   1.00 38.61  ? 596  TRP A C     1 
ATOM   4856 O  O     . TRP A 1 596 ? -4.933  54.086 -0.627  1.00 37.52  ? 596  TRP A O     1 
ATOM   4857 C  CB    . TRP A 1 596 ? -2.940  56.266 1.015   1.00 40.72  ? 596  TRP A CB    1 
ATOM   4858 C  CG    . TRP A 1 596 ? -2.146  56.064 -0.262  1.00 42.22  ? 596  TRP A CG    1 
ATOM   4859 C  CD1   . TRP A 1 596 ? -1.582  54.899 -0.706  1.00 42.69  ? 596  TRP A CD1   1 
ATOM   4860 C  CD2   . TRP A 1 596 ? -1.792  57.070 -1.227  1.00 43.60  ? 596  TRP A CD2   1 
ATOM   4861 N  NE1   . TRP A 1 596 ? -0.921  55.114 -1.893  1.00 43.76  ? 596  TRP A NE1   1 
ATOM   4862 C  CE2   . TRP A 1 596 ? -1.032  56.435 -2.234  1.00 44.60  ? 596  TRP A CE2   1 
ATOM   4863 C  CE3   . TRP A 1 596 ? -2.053  58.439 -1.341  1.00 41.95  ? 596  TRP A CE3   1 
ATOM   4864 C  CZ2   . TRP A 1 596 ? -0.530  57.125 -3.339  1.00 46.11  ? 596  TRP A CZ2   1 
ATOM   4865 C  CZ3   . TRP A 1 596 ? -1.554  59.123 -2.440  1.00 43.00  ? 596  TRP A CZ3   1 
ATOM   4866 C  CH2   . TRP A 1 596 ? -0.801  58.464 -3.424  1.00 45.38  ? 596  TRP A CH2   1 
ATOM   4867 N  N     . ILE A 1 597 ? -3.985  53.403 1.289   1.00 38.81  ? 597  ILE A N     1 
ATOM   4868 C  CA    . ILE A 1 597 ? -3.930  52.011 0.873   1.00 41.88  ? 597  ILE A CA    1 
ATOM   4869 C  C     . ILE A 1 597 ? -5.314  51.358 0.836   1.00 45.52  ? 597  ILE A C     1 
ATOM   4870 O  O     . ILE A 1 597 ? -5.515  50.366 0.136   1.00 47.88  ? 597  ILE A O     1 
ATOM   4871 C  CB    . ILE A 1 597 ? -2.952  51.188 1.744   1.00 38.82  ? 597  ILE A CB    1 
ATOM   4872 C  CG1   . ILE A 1 597 ? -2.227  50.147 0.887   1.00 38.10  ? 597  ILE A CG1   1 
ATOM   4873 C  CG2   . ILE A 1 597 ? -3.662  50.553 2.936   1.00 37.05  ? 597  ILE A CG2   1 
ATOM   4874 C  CD1   . ILE A 1 597 ? -1.346  50.756 -0.183  1.00 33.45  ? 597  ILE A CD1   1 
ATOM   4875 N  N     . GLU A 1 598 ? -6.266  51.914 1.580   1.00 41.93  ? 598  GLU A N     1 
ATOM   4876 C  CA    . GLU A 1 598 ? -7.641  51.443 1.495   1.00 41.14  ? 598  GLU A CA    1 
ATOM   4877 C  C     . GLU A 1 598 ? -8.152  51.696 0.089   1.00 43.88  ? 598  GLU A C     1 
ATOM   4878 O  O     . GLU A 1 598 ? -8.753  50.822 -0.531  1.00 46.37  ? 598  GLU A O     1 
ATOM   4879 C  CB    . GLU A 1 598 ? -8.541  52.167 2.496   1.00 40.40  ? 598  GLU A CB    1 
ATOM   4880 C  CG    . GLU A 1 598 ? -10.011 51.773 2.393   1.00 40.59  ? 598  GLU A CG    1 
ATOM   4881 C  CD    . GLU A 1 598 ? -10.914 52.610 3.285   1.00 43.08  ? 598  GLU A CD    1 
ATOM   4882 O  OE1   . GLU A 1 598 ? -10.523 53.741 3.651   1.00 44.69  ? 598  GLU A OE1   1 
ATOM   4883 O  OE2   . GLU A 1 598 ? -12.019 52.133 3.621   1.00 42.36  ? 598  GLU A OE2   1 
ATOM   4884 N  N     . ARG A 1 599 ? -7.907  52.904 -0.407  1.00 44.10  ? 599  ARG A N     1 
ATOM   4885 C  CA    . ARG A 1 599 ? -8.306  53.270 -1.757  1.00 44.83  ? 599  ARG A CA    1 
ATOM   4886 C  C     . ARG A 1 599 ? -7.572  52.417 -2.787  1.00 45.71  ? 599  ARG A C     1 
ATOM   4887 O  O     . ARG A 1 599 ? -8.189  51.868 -3.700  1.00 47.36  ? 599  ARG A O     1 
ATOM   4888 C  CB    . ARG A 1 599 ? -8.042  54.754 -2.017  1.00 41.65  ? 599  ARG A CB    1 
ATOM   4889 C  CG    . ARG A 1 599 ? -8.369  55.181 -3.433  1.00 44.16  ? 599  ARG A CG    1 
ATOM   4890 C  CD    . ARG A 1 599 ? -8.153  56.668 -3.640  1.00 44.77  ? 599  ARG A CD    1 
ATOM   4891 N  NE    . ARG A 1 599 ? -6.786  57.076 -3.337  1.00 45.15  ? 599  ARG A NE    1 
ATOM   4892 C  CZ    . ARG A 1 599 ? -5.753  56.901 -4.155  1.00 47.63  ? 599  ARG A CZ    1 
ATOM   4893 N  NH1   . ARG A 1 599 ? -5.923  56.311 -5.331  1.00 50.81  ? 599  ARG A NH1   1 
ATOM   4894 N  NH2   . ARG A 1 599 ? -4.545  57.312 -3.794  1.00 46.63  ? 599  ARG A NH2   1 
ATOM   4895 N  N     . LYS A 1 600 ? -6.256  52.306 -2.629  1.00 43.23  ? 600  LYS A N     1 
ATOM   4896 C  CA    . LYS A 1 600 ? -5.436  51.526 -3.549  1.00 45.79  ? 600  LYS A CA    1 
ATOM   4897 C  C     . LYS A 1 600 ? -5.909  50.075 -3.642  1.00 50.14  ? 600  LYS A C     1 
ATOM   4898 O  O     . LYS A 1 600 ? -6.087  49.541 -4.738  1.00 53.76  ? 600  LYS A O     1 
ATOM   4899 C  CB    . LYS A 1 600 ? -3.962  51.576 -3.133  1.00 43.21  ? 600  LYS A CB    1 
ATOM   4900 C  CG    . LYS A 1 600 ? -3.254  52.885 -3.462  1.00 44.17  ? 600  LYS A CG    1 
ATOM   4901 C  CD    . LYS A 1 600 ? -3.106  53.070 -4.966  1.00 43.43  ? 600  LYS A CD    1 
ATOM   4902 C  CE    . LYS A 1 600 ? -2.333  54.336 -5.301  1.00 41.38  ? 600  LYS A CE    1 
ATOM   4903 N  NZ    . LYS A 1 600 ? -2.034  54.432 -6.758  1.00 42.44  ? 600  LYS A NZ    1 
ATOM   4904 N  N     . VAL A 1 601 ? -6.118  49.449 -2.488  1.00 49.21  ? 601  VAL A N     1 
ATOM   4905 C  CA    . VAL A 1 601 ? -6.578  48.065 -2.430  1.00 44.67  ? 601  VAL A CA    1 
ATOM   4906 C  C     . VAL A 1 601 ? -7.958  47.906 -3.066  1.00 47.71  ? 601  VAL A C     1 
ATOM   4907 O  O     . VAL A 1 601 ? -8.206  46.948 -3.799  1.00 51.00  ? 601  VAL A O     1 
ATOM   4908 C  CB    . VAL A 1 601 ? -6.584  47.536 -0.981  1.00 38.33  ? 601  VAL A CB    1 
ATOM   4909 C  CG1   . VAL A 1 601 ? -7.427  46.275 -0.862  1.00 38.71  ? 601  VAL A CG1   1 
ATOM   4910 C  CG2   . VAL A 1 601 ? -5.158  47.282 -0.514  1.00 35.57  ? 601  VAL A CG2   1 
ATOM   4911 N  N     . ASN A 1 602 ? -8.848  48.856 -2.795  1.00 46.60  ? 602  ASN A N     1 
ATOM   4912 C  CA    . ASN A 1 602 ? -10.171 48.852 -3.408  1.00 48.37  ? 602  ASN A CA    1 
ATOM   4913 C  C     . ASN A 1 602 ? -10.107 48.953 -4.930  1.00 53.41  ? 602  ASN A C     1 
ATOM   4914 O  O     . ASN A 1 602 ? -10.820 48.245 -5.642  1.00 56.37  ? 602  ASN A O     1 
ATOM   4915 C  CB    . ASN A 1 602 ? -11.037 49.979 -2.840  1.00 47.38  ? 602  ASN A CB    1 
ATOM   4916 C  CG    . ASN A 1 602 ? -11.731 49.587 -1.552  1.00 46.60  ? 602  ASN A CG    1 
ATOM   4917 O  OD1   . ASN A 1 602 ? -12.024 48.412 -1.323  1.00 44.54  ? 602  ASN A OD1   1 
ATOM   4918 N  ND2   . ASN A 1 602 ? -12.007 50.571 -0.704  1.00 47.30  ? 602  ASN A ND2   1 
ATOM   4919 N  N     . GLU A 1 603 ? -9.244  49.833 -5.423  1.00 54.54  ? 603  GLU A N     1 
ATOM   4920 C  CA    . GLU A 1 603 ? -9.074  50.010 -6.858  1.00 56.10  ? 603  GLU A CA    1 
ATOM   4921 C  C     . GLU A 1 603 ? -8.539  48.738 -7.520  1.00 57.41  ? 603  GLU A C     1 
ATOM   4922 O  O     . GLU A 1 603 ? -9.049  48.314 -8.557  1.00 61.26  ? 603  GLU A O     1 
ATOM   4923 C  CB    . GLU A 1 603 ? -8.146  51.195 -7.145  1.00 57.46  ? 603  GLU A CB    1 
ATOM   4924 C  CG    . GLU A 1 603 ? -8.712  52.550 -6.736  1.00 56.31  ? 603  GLU A CG    1 
ATOM   4925 C  CD    . GLU A 1 603 ? -7.667  53.651 -6.767  1.00 55.02  ? 603  GLU A CD    1 
ATOM   4926 O  OE1   . GLU A 1 603 ? -6.468  53.330 -6.908  1.00 54.21  ? 603  GLU A OE1   1 
ATOM   4927 O  OE2   . GLU A 1 603 ? -8.042  54.837 -6.651  1.00 55.30  ? 603  GLU A OE2   1 
ATOM   4928 N  N     . TYR A 1 604 ? -7.520  48.130 -6.916  1.00 56.77  ? 604  TYR A N     1 
ATOM   4929 C  CA    . TYR A 1 604 ? -6.912  46.920 -7.472  1.00 57.83  ? 604  TYR A CA    1 
ATOM   4930 C  C     . TYR A 1 604 ? -7.904  45.771 -7.544  1.00 59.69  ? 604  TYR A C     1 
ATOM   4931 O  O     . TYR A 1 604 ? -7.941  45.030 -8.525  1.00 60.54  ? 604  TYR A O     1 
ATOM   4932 C  CB    . TYR A 1 604 ? -5.688  46.483 -6.660  1.00 55.41  ? 604  TYR A CB    1 
ATOM   4933 C  CG    . TYR A 1 604 ? -5.027  45.210 -7.168  1.00 57.67  ? 604  TYR A CG    1 
ATOM   4934 C  CD1   . TYR A 1 604 ? -5.275  43.980 -6.565  1.00 58.94  ? 604  TYR A CD1   1 
ATOM   4935 C  CD2   . TYR A 1 604 ? -4.156  45.240 -8.252  1.00 59.18  ? 604  TYR A CD2   1 
ATOM   4936 C  CE1   . TYR A 1 604 ? -4.672  42.818 -7.029  1.00 62.44  ? 604  TYR A CE1   1 
ATOM   4937 C  CE2   . TYR A 1 604 ? -3.548  44.085 -8.719  1.00 61.58  ? 604  TYR A CE2   1 
ATOM   4938 C  CZ    . TYR A 1 604 ? -3.810  42.879 -8.106  1.00 63.58  ? 604  TYR A CZ    1 
ATOM   4939 O  OH    . TYR A 1 604 ? -3.206  41.734 -8.576  1.00 64.17  ? 604  TYR A OH    1 
ATOM   4940 N  N     . LEU A 1 605 ? -8.709  45.625 -6.499  1.00 60.12  ? 605  LEU A N     1 
ATOM   4941 C  CA    . LEU A 1 605 ? -9.618  44.491 -6.414  1.00 62.55  ? 605  LEU A CA    1 
ATOM   4942 C  C     . LEU A 1 605 ? -10.811 44.618 -7.352  1.00 63.25  ? 605  LEU A C     1 
ATOM   4943 O  O     . LEU A 1 605 ? -11.218 43.635 -7.961  1.00 67.65  ? 605  LEU A O     1 
ATOM   4944 C  CB    . LEU A 1 605 ? -10.050 44.236 -4.969  1.00 61.94  ? 605  LEU A CB    1 
ATOM   4945 C  CG    . LEU A 1 605 ? -8.939  43.594 -4.131  1.00 60.96  ? 605  LEU A CG    1 
ATOM   4946 C  CD1   . LEU A 1 605 ? -9.372  43.398 -2.692  1.00 59.39  ? 605  LEU A CD1   1 
ATOM   4947 C  CD2   . LEU A 1 605 ? -8.493  42.270 -4.746  1.00 60.51  ? 605  LEU A CD2   1 
ATOM   4948 N  N     . ASN A 1 606 ? -11.364 45.820 -7.482  1.00 60.25  ? 606  ASN A N     1 
ATOM   4949 C  CA    . ASN A 1 606 ? -12.390 46.054 -8.495  1.00 61.70  ? 606  ASN A CA    1 
ATOM   4950 C  C     . ASN A 1 606 ? -11.833 45.765 -9.888  1.00 63.73  ? 606  ASN A C     1 
ATOM   4951 O  O     . ASN A 1 606 ? -12.519 45.199 -10.741 1.00 67.61  ? 606  ASN A O     1 
ATOM   4952 C  CB    . ASN A 1 606 ? -12.934 47.484 -8.416  1.00 60.19  ? 606  ASN A CB    1 
ATOM   4953 C  CG    . ASN A 1 606 ? -13.850 47.695 -7.223  1.00 58.66  ? 606  ASN A CG    1 
ATOM   4954 O  OD1   . ASN A 1 606 ? -15.039 47.379 -7.276  1.00 60.10  ? 606  ASN A OD1   1 
ATOM   4955 N  ND2   . ASN A 1 606 ? -13.300 48.234 -6.142  1.00 56.13  ? 606  ASN A ND2   1 
ATOM   4956 N  N     . GLU A 1 607 ? -10.574 46.134 -10.098 1.00 61.34  ? 607  GLU A N     1 
ATOM   4957 C  CA    . GLU A 1 607 ? -9.897  45.893 -11.368 1.00 64.29  ? 607  GLU A CA    1 
ATOM   4958 C  C     . GLU A 1 607 ? -9.732  44.403 -11.678 1.00 70.00  ? 607  GLU A C     1 
ATOM   4959 O  O     . GLU A 1 607 ? -10.232 43.927 -12.694 1.00 73.79  ? 607  GLU A O     1 
ATOM   4960 C  CB    . GLU A 1 607 ? -8.538  46.598 -11.393 1.00 61.54  ? 607  GLU A CB    1 
ATOM   4961 C  CG    . GLU A 1 607 ? -7.751  46.404 -12.680 1.00 63.02  ? 607  GLU A CG    1 
ATOM   4962 C  CD    . GLU A 1 607 ? -6.397  47.087 -12.641 1.00 62.58  ? 607  GLU A CD    1 
ATOM   4963 N  N     . VAL A 1 608 ? -9.041  43.669 -10.805 1.00 71.48  ? 608  VAL A N     1 
ATOM   4964 C  CA    . VAL A 1 608 ? -8.740  42.256 -11.065 1.00 73.59  ? 608  VAL A CA    1 
ATOM   4965 C  C     . VAL A 1 608 ? -9.957  41.336 -10.978 1.00 74.03  ? 608  VAL A C     1 
ATOM   4966 O  O     . VAL A 1 608 ? -9.966  40.263 -11.582 1.00 76.59  ? 608  VAL A O     1 
ATOM   4967 C  CB    . VAL A 1 608 ? -7.622  41.701 -10.148 1.00 72.08  ? 608  VAL A CB    1 
ATOM   4968 C  CG1   . VAL A 1 608 ? -6.294  42.381 -10.448 1.00 71.77  ? 608  VAL A CG1   1 
ATOM   4969 C  CG2   . VAL A 1 608 ? -8.002  41.844 -8.681  1.00 69.20  ? 608  VAL A CG2   1 
ATOM   4970 N  N     . CYS A 1 609 ? -10.975 41.748 -10.226 1.00 72.27  ? 609  CYS A N     1 
ATOM   4971 C  CA    . CYS A 1 609 ? -12.207 40.970 -10.134 1.00 75.58  ? 609  CYS A CA    1 
ATOM   4972 C  C     . CYS A 1 609 ? -13.115 41.268 -11.315 1.00 79.04  ? 609  CYS A C     1 
ATOM   4973 O  O     . CYS A 1 609 ? -13.847 40.395 -11.787 1.00 81.63  ? 609  CYS A O     1 
ATOM   4974 C  CB    . CYS A 1 609 ? -12.953 41.257 -8.827  1.00 74.80  ? 609  CYS A CB    1 
ATOM   4975 S  SG    . CYS A 1 609 ? -12.176 40.575 -7.342  1.00 96.91  ? 609  CYS A SG    1 
ATOM   4976 N  N     . GLY A 1 610 ? -13.056 42.507 -11.790 1.00 79.41  ? 610  GLY A N     1 
ATOM   4977 C  CA    . GLY A 1 610 ? -13.901 42.950 -12.882 1.00 82.34  ? 610  GLY A CA    1 
ATOM   4978 C  C     . GLY A 1 610 ? -15.007 43.861 -12.390 1.00 82.69  ? 610  GLY A C     1 
ATOM   4979 O  O     . GLY A 1 610 ? -15.645 44.560 -13.179 1.00 85.61  ? 610  GLY A O     1 
ATOM   4980 N  N     . THR A 1 611 ? -15.231 43.857 -11.079 1.00 79.67  ? 611  THR A N     1 
ATOM   4981 C  CA    . THR A 1 611 ? -16.254 44.696 -10.464 1.00 77.25  ? 611  THR A CA    1 
ATOM   4982 C  C     . THR A 1 611 ? -15.907 46.177 -10.593 1.00 75.20  ? 611  THR A C     1 
ATOM   4983 O  O     . THR A 1 611 ? -14.883 46.538 -11.173 1.00 73.76  ? 611  THR A O     1 
ATOM   4984 C  CB    . THR A 1 611 ? -16.440 44.353 -8.972  1.00 73.33  ? 611  THR A CB    1 
ATOM   4985 N  N     . GLU A 1 612 ? -16.765 47.034 -10.051 1.00 73.37  ? 612  GLU A N     1 
ATOM   4986 C  CA    . GLU A 1 612 ? -16.509 48.470 -10.068 1.00 70.26  ? 612  GLU A CA    1 
ATOM   4987 C  C     . GLU A 1 612 ? -17.308 49.203 -8.998  1.00 67.70  ? 612  GLU A C     1 
ATOM   4988 O  O     . GLU A 1 612 ? -18.538 49.175 -8.997  1.00 67.45  ? 612  GLU A O     1 
ATOM   4989 C  CB    . GLU A 1 612 ? -16.817 49.059 -11.444 1.00 72.66  ? 612  GLU A CB    1 
ATOM   4990 C  CG    . GLU A 1 612 ? -16.481 50.534 -11.568 1.00 71.81  ? 612  GLU A CG    1 
ATOM   4991 N  N     . GLY A 1 613 ? -16.597 49.860 -8.088  1.00 66.24  ? 613  GLY A N     1 
ATOM   4992 C  CA    . GLY A 1 613 ? -17.230 50.662 -7.059  1.00 66.01  ? 613  GLY A CA    1 
ATOM   4993 C  C     . GLY A 1 613 ? -17.569 49.881 -5.808  1.00 66.66  ? 613  GLY A C     1 
ATOM   4994 O  O     . GLY A 1 613 ? -18.108 50.436 -4.850  1.00 65.86  ? 613  GLY A O     1 
ATOM   4995 N  N     . GLU A 1 614 ? -17.254 48.589 -5.811  1.00 68.19  ? 614  GLU A N     1 
ATOM   4996 C  CA    . GLU A 1 614 ? -17.529 47.744 -4.654  1.00 66.76  ? 614  GLU A CA    1 
ATOM   4997 C  C     . GLU A 1 614 ? -16.488 47.955 -3.563  1.00 59.43  ? 614  GLU A C     1 
ATOM   4998 O  O     . GLU A 1 614 ? -15.295 48.080 -3.841  1.00 55.60  ? 614  GLU A O     1 
ATOM   4999 C  CB    . GLU A 1 614 ? -17.597 46.268 -5.054  1.00 72.31  ? 614  GLU A CB    1 
ATOM   5000 C  CG    . GLU A 1 614 ? -18.712 45.952 -6.040  1.00 81.22  ? 614  GLU A CG    1 
ATOM   5001 C  CD    . GLU A 1 614 ? -20.092 46.306 -5.504  1.00 86.27  ? 614  GLU A CD    1 
ATOM   5002 O  OE1   . GLU A 1 614 ? -20.389 45.953 -4.341  1.00 85.22  ? 614  GLU A OE1   1 
ATOM   5003 O  OE2   . GLU A 1 614 ? -20.878 46.940 -6.244  1.00 89.51  ? 614  GLU A OE2   1 
ATOM   5004 N  N     . ALA A 1 615 ? -16.956 48.008 -2.321  1.00 57.13  ? 615  ALA A N     1 
ATOM   5005 C  CA    . ALA A 1 615 ? -16.075 48.167 -1.173  1.00 54.66  ? 615  ALA A CA    1 
ATOM   5006 C  C     . ALA A 1 615 ? -15.513 46.817 -0.754  1.00 55.72  ? 615  ALA A C     1 
ATOM   5007 O  O     . ALA A 1 615 ? -16.239 45.967 -0.242  1.00 56.65  ? 615  ALA A O     1 
ATOM   5008 C  CB    . ALA A 1 615 ? -16.818 48.815 -0.011  1.00 51.08  ? 615  ALA A CB    1 
ATOM   5009 N  N     . PHE A 1 616 ? -14.219 46.621 -0.977  1.00 54.40  ? 616  PHE A N     1 
ATOM   5010 C  CA    . PHE A 1 616 ? -13.576 45.367 -0.612  1.00 54.49  ? 616  PHE A CA    1 
ATOM   5011 C  C     . PHE A 1 616 ? -13.010 45.419 0.802   1.00 51.21  ? 616  PHE A C     1 
ATOM   5012 O  O     . PHE A 1 616 ? -13.069 44.437 1.543   1.00 53.28  ? 616  PHE A O     1 
ATOM   5013 C  CB    . PHE A 1 616 ? -12.491 44.997 -1.624  1.00 58.63  ? 616  PHE A CB    1 
ATOM   5014 C  CG    . PHE A 1 616 ? -13.031 44.415 -2.901  1.00 63.30  ? 616  PHE A CG    1 
ATOM   5015 C  CD1   . PHE A 1 616 ? -13.209 43.046 -3.035  1.00 63.79  ? 616  PHE A CD1   1 
ATOM   5016 C  CD2   . PHE A 1 616 ? -13.368 45.237 -3.965  1.00 64.95  ? 616  PHE A CD2   1 
ATOM   5017 C  CE1   . PHE A 1 616 ? -13.708 42.508 -4.208  1.00 65.55  ? 616  PHE A CE1   1 
ATOM   5018 C  CE2   . PHE A 1 616 ? -13.866 44.706 -5.138  1.00 66.73  ? 616  PHE A CE2   1 
ATOM   5019 C  CZ    . PHE A 1 616 ? -14.037 43.339 -5.260  1.00 67.41  ? 616  PHE A CZ    1 
ATOM   5020 N  N     . VAL A 1 617 ? -12.463 46.568 1.178   1.00 46.82  ? 617  VAL A N     1 
ATOM   5021 C  CA    . VAL A 1 617 ? -11.988 46.749 2.541   1.00 44.27  ? 617  VAL A CA    1 
ATOM   5022 C  C     . VAL A 1 617 ? -13.168 47.087 3.443   1.00 42.98  ? 617  VAL A C     1 
ATOM   5023 O  O     . VAL A 1 617 ? -13.819 48.117 3.273   1.00 46.62  ? 617  VAL A O     1 
ATOM   5024 C  CB    . VAL A 1 617 ? -10.914 47.847 2.635   1.00 40.58  ? 617  VAL A CB    1 
ATOM   5025 C  CG1   . VAL A 1 617 ? -10.460 48.018 4.077   1.00 37.60  ? 617  VAL A CG1   1 
ATOM   5026 C  CG2   . VAL A 1 617 ? -9.736  47.503 1.743   1.00 39.61  ? 617  VAL A CG2   1 
ATOM   5027 N  N     . LEU A 1 618 ? -13.446 46.207 4.397   1.00 38.23  ? 618  LEU A N     1 
ATOM   5028 C  CA    . LEU A 1 618 ? -14.620 46.355 5.244   1.00 39.17  ? 618  LEU A CA    1 
ATOM   5029 C  C     . LEU A 1 618 ? -14.294 47.029 6.576   1.00 43.02  ? 618  LEU A C     1 
ATOM   5030 O  O     . LEU A 1 618 ? -15.176 47.581 7.238   1.00 47.11  ? 618  LEU A O     1 
ATOM   5031 C  CB    . LEU A 1 618 ? -15.265 44.991 5.479   1.00 36.86  ? 618  LEU A CB    1 
ATOM   5032 C  CG    . LEU A 1 618 ? -14.393 43.947 6.178   1.00 36.36  ? 618  LEU A CG    1 
ATOM   5033 C  CD1   . LEU A 1 618 ? -14.770 43.842 7.645   1.00 34.89  ? 618  LEU A CD1   1 
ATOM   5034 C  CD2   . LEU A 1 618 ? -14.492 42.596 5.490   1.00 33.61  ? 618  LEU A CD2   1 
ATOM   5035 N  N     . TYR A 1 619 ? -13.024 46.984 6.962   1.00 38.28  ? 619  TYR A N     1 
ATOM   5036 C  CA    . TYR A 1 619 ? -12.603 47.542 8.238   1.00 34.01  ? 619  TYR A CA    1 
ATOM   5037 C  C     . TYR A 1 619 ? -11.111 47.845 8.241   1.00 35.83  ? 619  TYR A C     1 
ATOM   5038 O  O     . TYR A 1 619 ? -10.353 47.305 7.435   1.00 36.37  ? 619  TYR A O     1 
ATOM   5039 C  CB    . TYR A 1 619 ? -12.946 46.571 9.367   1.00 32.76  ? 619  TYR A CB    1 
ATOM   5040 C  CG    . TYR A 1 619 ? -12.565 47.048 10.751  1.00 31.48  ? 619  TYR A CG    1 
ATOM   5041 C  CD1   . TYR A 1 619 ? -11.571 46.405 11.479  1.00 29.24  ? 619  TYR A CD1   1 
ATOM   5042 C  CD2   . TYR A 1 619 ? -13.192 48.144 11.327  1.00 32.18  ? 619  TYR A CD2   1 
ATOM   5043 C  CE1   . TYR A 1 619 ? -11.219 46.835 12.745  1.00 28.98  ? 619  TYR A CE1   1 
ATOM   5044 C  CE2   . TYR A 1 619 ? -12.846 48.584 12.595  1.00 30.83  ? 619  TYR A CE2   1 
ATOM   5045 C  CZ    . TYR A 1 619 ? -11.859 47.927 13.299  1.00 28.92  ? 619  TYR A CZ    1 
ATOM   5046 O  OH    . TYR A 1 619 ? -11.514 48.363 14.563  1.00 26.28  ? 619  TYR A OH    1 
ATOM   5047 N  N     . GLY A 1 620 ? -10.701 48.722 9.152   1.00 35.75  ? 620  GLY A N     1 
ATOM   5048 C  CA    . GLY A 1 620 ? -9.304  49.062 9.317   1.00 32.41  ? 620  GLY A CA    1 
ATOM   5049 C  C     . GLY A 1 620 ? -9.063  49.816 10.607  1.00 33.72  ? 620  GLY A C     1 
ATOM   5050 O  O     . GLY A 1 620 ? -9.890  50.631 11.025  1.00 36.56  ? 620  GLY A O     1 
ATOM   5051 N  N     . ASP A 1 621 ? -7.927  49.538 11.239  1.00 31.40  ? 621  ASP A N     1 
ATOM   5052 C  CA    . ASP A 1 621 ? -7.543  50.200 12.479  1.00 28.99  ? 621  ASP A CA    1 
ATOM   5053 C  C     . ASP A 1 621 ? -6.058  50.540 12.414  1.00 29.35  ? 621  ASP A C     1 
ATOM   5054 O  O     . ASP A 1 621 ? -5.212  49.644 12.370  1.00 29.75  ? 621  ASP A O     1 
ATOM   5055 C  CB    . ASP A 1 621 ? -7.831  49.289 13.676  1.00 26.67  ? 621  ASP A CB    1 
ATOM   5056 C  CG    . ASP A 1 621 ? -7.693  50.001 15.013  1.00 28.64  ? 621  ASP A CG    1 
ATOM   5057 O  OD1   . ASP A 1 621 ? -6.977  51.024 15.092  1.00 30.48  ? 621  ASP A OD1   1 
ATOM   5058 O  OD2   . ASP A 1 621 ? -8.301  49.529 15.998  1.00 27.18  ? 621  ASP A OD2   1 
ATOM   5059 N  N     . THR A 1 622 ? -5.758  51.837 12.393  1.00 25.97  ? 622  THR A N     1 
ATOM   5060 C  CA    . THR A 1 622 ? -4.383  52.333 12.408  1.00 24.10  ? 622  THR A CA    1 
ATOM   5061 C  C     . THR A 1 622 ? -3.570  51.944 11.173  1.00 26.76  ? 622  THR A C     1 
ATOM   5062 O  O     . THR A 1 622 ? -3.242  52.796 10.353  1.00 28.77  ? 622  THR A O     1 
ATOM   5063 C  CB    . THR A 1 622 ? -3.634  51.888 13.678  1.00 23.12  ? 622  THR A CB    1 
ATOM   5064 O  OG1   . THR A 1 622 ? -4.451  52.147 14.828  1.00 25.75  ? 622  THR A OG1   1 
ATOM   5065 C  CG2   . THR A 1 622 ? -2.311  52.629 13.801  1.00 22.92  ? 622  THR A CG2   1 
ATOM   5066 N  N     . ASP A 1 623 ? -3.241  50.662 11.045  1.00 30.21  ? 623  ASP A N     1 
ATOM   5067 C  CA    . ASP A 1 623 ? -2.396  50.202 9.944   1.00 31.38  ? 623  ASP A CA    1 
ATOM   5068 C  C     . ASP A 1 623 ? -2.842  48.859 9.381   1.00 29.48  ? 623  ASP A C     1 
ATOM   5069 O  O     . ASP A 1 623 ? -2.064  48.158 8.736   1.00 32.15  ? 623  ASP A O     1 
ATOM   5070 C  CB    . ASP A 1 623 ? -0.942  50.099 10.398  1.00 30.87  ? 623  ASP A CB    1 
ATOM   5071 C  CG    . ASP A 1 623 ? -0.734  49.024 11.446  1.00 31.50  ? 623  ASP A CG    1 
ATOM   5072 O  OD1   . ASP A 1 623 ? 0.409   48.534 11.576  1.00 28.85  ? 623  ASP A OD1   1 
ATOM   5073 O  OD2   . ASP A 1 623 ? -1.713  48.663 12.135  1.00 34.03  ? 623  ASP A OD2   1 
ATOM   5074 N  N     . SER A 1 624 ? -4.090  48.497 9.628   1.00 26.91  ? 624  SER A N     1 
ATOM   5075 C  CA    . SER A 1 624 ? -4.582  47.216 9.156   1.00 32.74  ? 624  SER A CA    1 
ATOM   5076 C  C     . SER A 1 624 ? -5.770  47.405 8.242   1.00 36.95  ? 624  SER A C     1 
ATOM   5077 O  O     . SER A 1 624 ? -6.491  48.391 8.350   1.00 39.85  ? 624  SER A O     1 
ATOM   5078 C  CB    . SER A 1 624 ? -5.007  46.342 10.331  1.00 33.55  ? 624  SER A CB    1 
ATOM   5079 O  OG    . SER A 1 624 ? -6.253  46.775 10.848  1.00 33.21  ? 624  SER A OG    1 
ATOM   5080 N  N     . ILE A 1 625 ? -5.971  46.455 7.339   1.00 35.41  ? 625  ILE A N     1 
ATOM   5081 C  CA    . ILE A 1 625 ? -7.182  46.425 6.535   1.00 36.50  ? 625  ILE A CA    1 
ATOM   5082 C  C     . ILE A 1 625 ? -7.730  45.011 6.516   1.00 36.15  ? 625  ILE A C     1 
ATOM   5083 O  O     . ILE A 1 625 ? -6.977  44.043 6.423   1.00 35.19  ? 625  ILE A O     1 
ATOM   5084 C  CB    . ILE A 1 625 ? -6.951  46.917 5.085   1.00 36.57  ? 625  ILE A CB    1 
ATOM   5085 C  CG1   . ILE A 1 625 ? -5.897  46.064 4.383   1.00 34.52  ? 625  ILE A CG1   1 
ATOM   5086 C  CG2   . ILE A 1 625 ? -6.543  48.379 5.073   1.00 36.18  ? 625  ILE A CG2   1 
ATOM   5087 C  CD1   . ILE A 1 625 ? -5.780  46.341 2.915   1.00 36.76  ? 625  ILE A CD1   1 
ATOM   5088 N  N     . TYR A 1 626 ? -9.043  44.892 6.639   1.00 38.13  ? 626  TYR A N     1 
ATOM   5089 C  CA    . TYR A 1 626 ? -9.689  43.597 6.506   1.00 41.83  ? 626  TYR A CA    1 
ATOM   5090 C  C     . TYR A 1 626 ? -10.468 43.568 5.199   1.00 44.26  ? 626  TYR A C     1 
ATOM   5091 O  O     . TYR A 1 626 ? -11.423 44.323 5.013   1.00 46.47  ? 626  TYR A O     1 
ATOM   5092 C  CB    . TYR A 1 626 ? -10.575 43.294 7.720   1.00 41.33  ? 626  TYR A CB    1 
ATOM   5093 C  CG    . TYR A 1 626 ? -9.768  42.967 8.958   1.00 40.14  ? 626  TYR A CG    1 
ATOM   5094 C  CD1   . TYR A 1 626 ? -9.197  43.976 9.723   1.00 39.55  ? 626  TYR A CD1   1 
ATOM   5095 C  CD2   . TYR A 1 626 ? -9.559  41.651 9.349   1.00 41.61  ? 626  TYR A CD2   1 
ATOM   5096 C  CE1   . TYR A 1 626 ? -8.449  43.685 10.846  1.00 40.13  ? 626  TYR A CE1   1 
ATOM   5097 C  CE2   . TYR A 1 626 ? -8.812  41.349 10.474  1.00 41.72  ? 626  TYR A CE2   1 
ATOM   5098 C  CZ    . TYR A 1 626 ? -8.260  42.371 11.216  1.00 42.08  ? 626  TYR A CZ    1 
ATOM   5099 O  OH    . TYR A 1 626 ? -7.516  42.081 12.334  1.00 43.66  ? 626  TYR A OH    1 
ATOM   5100 N  N     . VAL A 1 627 ? -10.030 42.703 4.291   1.00 42.18  ? 627  VAL A N     1 
ATOM   5101 C  CA    . VAL A 1 627 ? -10.565 42.655 2.940   1.00 39.45  ? 627  VAL A CA    1 
ATOM   5102 C  C     . VAL A 1 627 ? -11.607 41.559 2.794   1.00 40.16  ? 627  VAL A C     1 
ATOM   5103 O  O     . VAL A 1 627 ? -11.338 40.395 3.093   1.00 41.37  ? 627  VAL A O     1 
ATOM   5104 C  CB    . VAL A 1 627 ? -9.445  42.397 1.923   1.00 38.28  ? 627  VAL A CB    1 
ATOM   5105 C  CG1   . VAL A 1 627 ? -10.030 42.143 0.551   1.00 37.00  ? 627  VAL A CG1   1 
ATOM   5106 C  CG2   . VAL A 1 627 ? -8.474  43.566 1.898   1.00 34.37  ? 627  VAL A CG2   1 
ATOM   5107 N  N     . SER A 1 628 ? -12.800 41.936 2.343   1.00 41.81  ? 628  SER A N     1 
ATOM   5108 C  CA    . SER A 1 628 ? -13.832 40.957 2.036   1.00 44.00  ? 628  SER A CA    1 
ATOM   5109 C  C     . SER A 1 628 ? -13.423 40.184 0.790   1.00 45.60  ? 628  SER A C     1 
ATOM   5110 O  O     . SER A 1 628 ? -13.331 40.748 -0.298  1.00 49.39  ? 628  SER A O     1 
ATOM   5111 C  CB    . SER A 1 628 ? -15.182 41.637 1.822   1.00 43.99  ? 628  SER A CB    1 
ATOM   5112 O  OG    . SER A 1 628 ? -16.194 40.671 1.597   1.00 46.23  ? 628  SER A OG    1 
ATOM   5113 N  N     . ALA A 1 629 ? -13.169 38.891 0.952   1.00 44.15  ? 629  ALA A N     1 
ATOM   5114 C  CA    . ALA A 1 629 ? -12.656 38.078 -0.143  1.00 44.36  ? 629  ALA A CA    1 
ATOM   5115 C  C     . ALA A 1 629 ? -13.726 37.178 -0.747  1.00 48.03  ? 629  ALA A C     1 
ATOM   5116 O  O     . ALA A 1 629 ? -13.410 36.210 -1.442  1.00 51.20  ? 629  ALA A O     1 
ATOM   5117 C  CB    . ALA A 1 629 ? -11.469 37.249 0.328   1.00 43.11  ? 629  ALA A CB    1 
ATOM   5118 N  N     . ASP A 1 630 ? -14.988 37.501 -0.482  1.00 48.80  ? 630  ASP A N     1 
ATOM   5119 C  CA    . ASP A 1 630 ? -16.104 36.719 -1.006  1.00 51.39  ? 630  ASP A CA    1 
ATOM   5120 C  C     . ASP A 1 630 ? -16.055 36.638 -2.526  1.00 52.31  ? 630  ASP A C     1 
ATOM   5121 O  O     . ASP A 1 630 ? -16.304 35.582 -3.104  1.00 55.27  ? 630  ASP A O     1 
ATOM   5122 C  CB    . ASP A 1 630 ? -17.442 37.310 -0.554  1.00 52.88  ? 630  ASP A CB    1 
ATOM   5123 C  CG    . ASP A 1 630 ? -17.704 37.103 0.925   1.00 54.50  ? 630  ASP A CG    1 
ATOM   5124 O  OD1   . ASP A 1 630 ? -16.734 36.888 1.684   1.00 54.83  ? 630  ASP A OD1   1 
ATOM   5125 O  OD2   . ASP A 1 630 ? -18.883 37.160 1.330   1.00 55.59  ? 630  ASP A OD2   1 
ATOM   5126 N  N     . LYS A 1 631 ? -15.709 37.752 -3.165  1.00 51.33  ? 631  LYS A N     1 
ATOM   5127 C  CA    . LYS A 1 631 ? -15.718 37.834 -4.623  1.00 55.06  ? 631  LYS A CA    1 
ATOM   5128 C  C     . LYS A 1 631 ? -14.453 37.271 -5.270  1.00 57.99  ? 631  LYS A C     1 
ATOM   5129 O  O     . LYS A 1 631 ? -14.480 36.853 -6.427  1.00 59.25  ? 631  LYS A O     1 
ATOM   5130 C  CB    . LYS A 1 631 ? -15.990 39.270 -5.076  1.00 53.31  ? 631  LYS A CB    1 
ATOM   5131 C  CG    . LYS A 1 631 ? -17.407 39.724 -4.761  1.00 54.70  ? 631  LYS A CG    1 
ATOM   5132 C  CD    . LYS A 1 631 ? -17.556 41.229 -4.832  1.00 58.28  ? 631  LYS A CD    1 
ATOM   5133 C  CE    . LYS A 1 631 ? -18.954 41.653 -4.409  1.00 62.67  ? 631  LYS A CE    1 
ATOM   5134 N  NZ    . LYS A 1 631 ? -19.081 43.132 -4.285  1.00 64.88  ? 631  LYS A NZ    1 
ATOM   5135 N  N     . ILE A 1 632 ? -13.352 37.253 -4.522  1.00 58.07  ? 632  ILE A N     1 
ATOM   5136 C  CA    . ILE A 1 632 ? -12.140 36.579 -4.979  1.00 57.61  ? 632  ILE A CA    1 
ATOM   5137 C  C     . ILE A 1 632 ? -12.391 35.073 -5.013  1.00 61.33  ? 632  ILE A C     1 
ATOM   5138 O  O     . ILE A 1 632 ? -11.978 34.379 -5.943  1.00 63.61  ? 632  ILE A O     1 
ATOM   5139 C  CB    . ILE A 1 632 ? -10.936 36.881 -4.065  1.00 52.29  ? 632  ILE A CB    1 
ATOM   5140 C  CG1   . ILE A 1 632 ? -10.643 38.383 -4.049  1.00 50.50  ? 632  ILE A CG1   1 
ATOM   5141 C  CG2   . ILE A 1 632 ? -9.704  36.113 -4.521  1.00 50.33  ? 632  ILE A CG2   1 
ATOM   5142 C  CD1   . ILE A 1 632 ? -9.455  38.766 -3.189  1.00 47.65  ? 632  ILE A CD1   1 
ATOM   5143 N  N     . ILE A 1 633 ? -13.082 34.577 -3.991  1.00 59.94  ? 633  ILE A N     1 
ATOM   5144 C  CA    . ILE A 1 633 ? -13.468 33.172 -3.930  1.00 60.12  ? 633  ILE A CA    1 
ATOM   5145 C  C     . ILE A 1 633 ? -14.485 32.827 -5.018  1.00 63.66  ? 633  ILE A C     1 
ATOM   5146 O  O     . ILE A 1 633 ? -14.371 31.794 -5.679  1.00 65.56  ? 633  ILE A O     1 
ATOM   5147 C  CB    . ILE A 1 633 ? -14.047 32.807 -2.544  1.00 58.04  ? 633  ILE A CB    1 
ATOM   5148 C  CG1   . ILE A 1 633 ? -12.950 32.839 -1.474  1.00 54.89  ? 633  ILE A CG1   1 
ATOM   5149 C  CG2   . ILE A 1 633 ? -14.708 31.435 -2.575  1.00 59.08  ? 633  ILE A CG2   1 
ATOM   5150 C  CD1   . ILE A 1 633 ? -11.899 31.752 -1.627  1.00 54.89  ? 633  ILE A CD1   1 
ATOM   5151 N  N     . ASP A 1 634 ? -15.469 33.702 -5.209  1.00 64.31  ? 634  ASP A N     1 
ATOM   5152 C  CA    . ASP A 1 634 ? -16.553 33.445 -6.157  1.00 67.73  ? 634  ASP A CA    1 
ATOM   5153 C  C     . ASP A 1 634 ? -16.120 33.496 -7.619  1.00 68.69  ? 634  ASP A C     1 
ATOM   5154 O  O     . ASP A 1 634 ? -16.733 32.854 -8.472  1.00 69.12  ? 634  ASP A O     1 
ATOM   5155 C  CB    . ASP A 1 634 ? -17.718 34.407 -5.922  1.00 70.34  ? 634  ASP A CB    1 
ATOM   5156 C  CG    . ASP A 1 634 ? -18.452 34.122 -4.629  1.00 72.89  ? 634  ASP A CG    1 
ATOM   5157 O  OD1   . ASP A 1 634 ? -18.327 32.992 -4.110  1.00 73.42  ? 634  ASP A OD1   1 
ATOM   5158 O  OD2   . ASP A 1 634 ? -19.155 35.029 -4.135  1.00 74.92  ? 634  ASP A OD2   1 
ATOM   5159 N  N     . LYS A 1 635 ? -15.065 34.255 -7.906  1.00 69.66  ? 635  LYS A N     1 
ATOM   5160 C  CA    . LYS A 1 635 ? -14.557 34.371 -9.269  1.00 72.80  ? 635  LYS A CA    1 
ATOM   5161 C  C     . LYS A 1 635 ? -13.934 33.047 -9.711  1.00 77.82  ? 635  LYS A C     1 
ATOM   5162 O  O     . LYS A 1 635 ? -13.718 32.814 -10.900 1.00 82.43  ? 635  LYS A O     1 
ATOM   5163 C  CB    . LYS A 1 635 ? -13.544 35.514 -9.374  1.00 69.47  ? 635  LYS A CB    1 
ATOM   5164 C  CG    . LYS A 1 635 ? -13.248 35.966 -10.798 1.00 69.24  ? 635  LYS A CG    1 
ATOM   5165 N  N     . VAL A 1 636 ? -13.650 32.185 -8.739  1.00 77.24  ? 636  VAL A N     1 
ATOM   5166 C  CA    . VAL A 1 636 ? -13.195 30.827 -9.011  1.00 78.29  ? 636  VAL A CA    1 
ATOM   5167 C  C     . VAL A 1 636 ? -14.334 29.851 -8.709  1.00 79.23  ? 636  VAL A C     1 
ATOM   5168 O  O     . VAL A 1 636 ? -14.418 28.770 -9.293  1.00 81.49  ? 636  VAL A O     1 
ATOM   5169 C  CB    . VAL A 1 636 ? -11.956 30.472 -8.157  1.00 76.74  ? 636  VAL A CB    1 
ATOM   5170 C  CG1   . VAL A 1 636 ? -11.467 29.062 -8.454  1.00 79.02  ? 636  VAL A CG1   1 
ATOM   5171 C  CG2   . VAL A 1 636 ? -10.846 31.474 -8.402  1.00 76.07  ? 636  VAL A CG2   1 
ATOM   5172 N  N     . GLY A 1 637 ? -15.218 30.252 -7.799  1.00 78.98  ? 637  GLY A N     1 
ATOM   5173 C  CA    . GLY A 1 637 ? -16.344 29.427 -7.402  1.00 82.13  ? 637  GLY A CA    1 
ATOM   5174 C  C     . GLY A 1 637 ? -15.936 28.399 -6.365  1.00 84.96  ? 637  GLY A C     1 
ATOM   5175 O  O     . GLY A 1 637 ? -14.861 27.805 -6.467  1.00 86.34  ? 637  GLY A O     1 
ATOM   5176 N  N     . GLU A 1 638 ? -16.792 28.185 -5.368  1.00 84.79  ? 638  GLU A N     1 
ATOM   5177 C  CA    . GLU A 1 638 ? -16.491 27.249 -4.288  1.00 83.98  ? 638  GLU A CA    1 
ATOM   5178 C  C     . GLU A 1 638 ? -16.308 25.824 -4.804  1.00 83.11  ? 638  GLU A C     1 
ATOM   5179 O  O     . GLU A 1 638 ? -15.629 25.011 -4.177  1.00 81.87  ? 638  GLU A O     1 
ATOM   5180 C  CB    . GLU A 1 638 ? -17.588 27.279 -3.216  1.00 88.32  ? 638  GLU A CB    1 
ATOM   5181 C  CG    . GLU A 1 638 ? -17.766 28.626 -2.520  1.00 92.68  ? 638  GLU A CG    1 
ATOM   5182 C  CD    . GLU A 1 638 ? -18.578 28.526 -1.233  1.00 96.21  ? 638  GLU A CD    1 
ATOM   5183 O  OE1   . GLU A 1 638 ? -18.131 27.831 -0.295  1.00 95.62  ? 638  GLU A OE1   1 
ATOM   5184 O  OE2   . GLU A 1 638 ? -19.664 29.140 -1.157  1.00 99.02  ? 638  GLU A OE2   1 
ATOM   5185 N  N     . SER A 1 639 ? -16.914 25.538 -5.954  1.00 84.01  ? 639  SER A N     1 
ATOM   5186 C  CA    . SER A 1 639 ? -16.906 24.201 -6.537  1.00 85.03  ? 639  SER A CA    1 
ATOM   5187 C  C     . SER A 1 639 ? -15.502 23.662 -6.803  1.00 84.79  ? 639  SER A C     1 
ATOM   5188 O  O     . SER A 1 639 ? -15.213 22.498 -6.520  1.00 86.47  ? 639  SER A O     1 
ATOM   5189 C  CB    . SER A 1 639 ? -17.712 24.191 -7.838  1.00 87.87  ? 639  SER A CB    1 
ATOM   5190 N  N     . LYS A 1 640 ? -14.632 24.515 -7.335  1.00 82.78  ? 640  LYS A N     1 
ATOM   5191 C  CA    . LYS A 1 640 ? -13.303 24.089 -7.773  1.00 82.47  ? 640  LYS A CA    1 
ATOM   5192 C  C     . LYS A 1 640 ? -12.328 23.767 -6.635  1.00 81.54  ? 640  LYS A C     1 
ATOM   5193 O  O     . LYS A 1 640 ? -11.152 23.506 -6.885  1.00 84.20  ? 640  LYS A O     1 
ATOM   5194 C  CB    . LYS A 1 640 ? -12.685 25.139 -8.704  1.00 80.44  ? 640  LYS A CB    1 
ATOM   5195 N  N     . PHE A 1 641 ? -12.807 23.779 -5.395  1.00 76.78  ? 641  PHE A N     1 
ATOM   5196 C  CA    . PHE A 1 641 ? -11.933 23.515 -4.254  1.00 72.03  ? 641  PHE A CA    1 
ATOM   5197 C  C     . PHE A 1 641 ? -12.142 22.132 -3.641  1.00 72.74  ? 641  PHE A C     1 
ATOM   5198 O  O     . PHE A 1 641 ? -13.273 21.709 -3.404  1.00 73.88  ? 641  PHE A O     1 
ATOM   5199 C  CB    . PHE A 1 641 ? -12.085 24.600 -3.186  1.00 67.16  ? 641  PHE A CB    1 
ATOM   5200 C  CG    . PHE A 1 641 ? -11.636 25.961 -3.639  1.00 63.83  ? 641  PHE A CG    1 
ATOM   5201 C  CD1   . PHE A 1 641 ? -12.555 26.975 -3.849  1.00 62.27  ? 641  PHE A CD1   1 
ATOM   5202 C  CD2   . PHE A 1 641 ? -10.294 26.222 -3.867  1.00 63.34  ? 641  PHE A CD2   1 
ATOM   5203 C  CE1   . PHE A 1 641 ? -12.145 28.227 -4.269  1.00 61.85  ? 641  PHE A CE1   1 
ATOM   5204 C  CE2   . PHE A 1 641 ? -9.876  27.474 -4.290  1.00 63.15  ? 641  PHE A CE2   1 
ATOM   5205 C  CZ    . PHE A 1 641 ? -10.804 28.477 -4.489  1.00 62.48  ? 641  PHE A CZ    1 
ATOM   5206 N  N     . ARG A 1 642 ? -11.038 21.437 -3.386  1.00 72.30  ? 642  ARG A N     1 
ATOM   5207 C  CA    . ARG A 1 642 ? -11.073 20.110 -2.780  1.00 73.70  ? 642  ARG A CA    1 
ATOM   5208 C  C     . ARG A 1 642 ? -11.573 20.176 -1.343  1.00 70.09  ? 642  ARG A C     1 
ATOM   5209 O  O     . ARG A 1 642 ? -12.634 19.644 -1.016  1.00 69.48  ? 642  ARG A O     1 
ATOM   5210 C  CB    . ARG A 1 642 ? -9.683  19.472 -2.813  1.00 75.65  ? 642  ARG A CB    1 
ATOM   5211 C  CG    . ARG A 1 642 ? -9.209  19.082 -4.202  1.00 78.88  ? 642  ARG A CG    1 
ATOM   5212 C  CD    . ARG A 1 642 ? -7.792  18.537 -4.167  1.00 79.39  ? 642  ARG A CD    1 
ATOM   5213 N  NE    . ARG A 1 642 ? -6.823  19.565 -3.799  1.00 77.83  ? 642  ARG A NE    1 
ATOM   5214 C  CZ    . ARG A 1 642 ? -6.257  20.399 -4.666  1.00 79.11  ? 642  ARG A CZ    1 
ATOM   5215 N  NH1   . ARG A 1 642 ? -6.567  20.330 -5.955  1.00 80.67  ? 642  ARG A NH1   1 
ATOM   5216 N  NH2   . ARG A 1 642 ? -5.384  21.304 -4.246  1.00 77.60  ? 642  ARG A NH2   1 
ATOM   5217 N  N     . ASP A 1 643 ? -10.795 20.831 -0.489  1.00 67.53  ? 643  ASP A N     1 
ATOM   5218 C  CA    . ASP A 1 643 ? -11.155 20.996 0.913   1.00 65.50  ? 643  ASP A CA    1 
ATOM   5219 C  C     . ASP A 1 643 ? -10.943 22.443 1.354   1.00 61.30  ? 643  ASP A C     1 
ATOM   5220 O  O     . ASP A 1 643 ? -10.610 23.303 0.540   1.00 61.56  ? 643  ASP A O     1 
ATOM   5221 C  CB    . ASP A 1 643 ? -10.350 20.034 1.791   1.00 65.90  ? 643  ASP A CB    1 
ATOM   5222 C  CG    . ASP A 1 643 ? -8.906  19.898 1.341   1.00 67.23  ? 643  ASP A CG    1 
ATOM   5223 O  OD1   . ASP A 1 643 ? -8.340  20.891 0.839   1.00 66.20  ? 643  ASP A OD1   1 
ATOM   5224 O  OD2   . ASP A 1 643 ? -8.340  18.794 1.487   1.00 69.72  ? 643  ASP A OD2   1 
ATOM   5225 N  N     . THR A 1 644 ? -11.150 22.708 2.640   1.00 58.03  ? 644  THR A N     1 
ATOM   5226 C  CA    . THR A 1 644 ? -10.961 24.048 3.184   1.00 56.72  ? 644  THR A CA    1 
ATOM   5227 C  C     . THR A 1 644 ? -9.532  24.523 2.952   1.00 56.72  ? 644  THR A C     1 
ATOM   5228 O  O     . THR A 1 644 ? -9.295  25.673 2.578   1.00 55.08  ? 644  THR A O     1 
ATOM   5229 C  CB    . THR A 1 644 ? -11.254 24.093 4.698   1.00 54.01  ? 644  THR A CB    1 
ATOM   5230 O  OG1   . THR A 1 644 ? -12.630 23.773 4.940   1.00 54.17  ? 644  THR A OG1   1 
ATOM   5231 C  CG2   . THR A 1 644 ? -10.957 25.475 5.256   1.00 50.08  ? 644  THR A CG2   1 
ATOM   5232 N  N     . ASN A 1 645 ? -8.584  23.617 3.162   1.00 58.26  ? 645  ASN A N     1 
ATOM   5233 C  CA    . ASN A 1 645 ? -7.167  23.925 3.022   1.00 57.94  ? 645  ASN A CA    1 
ATOM   5234 C  C     . ASN A 1 645 ? -6.806  24.358 1.604   1.00 57.17  ? 645  ASN A C     1 
ATOM   5235 O  O     . ASN A 1 645 ? -5.795  25.025 1.388   1.00 53.96  ? 645  ASN A O     1 
ATOM   5236 C  CB    . ASN A 1 645 ? -6.326  22.714 3.431   1.00 62.81  ? 645  ASN A CB    1 
ATOM   5237 C  CG    . ASN A 1 645 ? -4.868  23.062 3.637   1.00 66.73  ? 645  ASN A CG    1 
ATOM   5238 O  OD1   . ASN A 1 645 ? -4.526  24.212 3.906   1.00 67.77  ? 645  ASN A OD1   1 
ATOM   5239 N  ND2   . ASN A 1 645 ? -3.997  22.066 3.512   1.00 69.52  ? 645  ASN A ND2   1 
ATOM   5240 N  N     . HIS A 1 646 ? -7.643  23.978 0.642   1.00 60.32  ? 646  HIS A N     1 
ATOM   5241 C  CA    . HIS A 1 646 ? -7.399  24.306 -0.755  1.00 63.33  ? 646  HIS A CA    1 
ATOM   5242 C  C     . HIS A 1 646 ? -7.573  25.799 -1.018  1.00 63.62  ? 646  HIS A C     1 
ATOM   5243 O  O     . HIS A 1 646 ? -6.662  26.448 -1.528  1.00 65.66  ? 646  HIS A O     1 
ATOM   5244 C  CB    . HIS A 1 646 ? -8.307  23.483 -1.675  1.00 69.42  ? 646  HIS A CB    1 
ATOM   5245 C  CG    . HIS A 1 646 ? -7.965  23.602 -3.130  1.00 73.99  ? 646  HIS A CG    1 
ATOM   5246 N  ND1   . HIS A 1 646 ? -8.703  22.990 -4.120  1.00 75.07  ? 646  HIS A ND1   1 
ATOM   5247 C  CD2   . HIS A 1 646 ? -6.963  24.259 -3.762  1.00 74.27  ? 646  HIS A CD2   1 
ATOM   5248 C  CE1   . HIS A 1 646 ? -8.175  23.267 -5.298  1.00 76.72  ? 646  HIS A CE1   1 
ATOM   5249 N  NE2   . HIS A 1 646 ? -7.118  24.037 -5.109  1.00 75.78  ? 646  HIS A NE2   1 
ATOM   5250 N  N     . TRP A 1 647 ? -8.732  26.350 -0.669  1.00 61.58  ? 647  TRP A N     1 
ATOM   5251 C  CA    . TRP A 1 647 ? -8.967  27.771 -0.917  1.00 59.89  ? 647  TRP A CA    1 
ATOM   5252 C  C     . TRP A 1 647 ? -8.132  28.670 -0.009  1.00 56.93  ? 647  TRP A C     1 
ATOM   5253 O  O     . TRP A 1 647 ? -7.845  29.817 -0.357  1.00 56.46  ? 647  TRP A O     1 
ATOM   5254 C  CB    . TRP A 1 647 ? -10.457 28.131 -0.851  1.00 59.97  ? 647  TRP A CB    1 
ATOM   5255 C  CG    . TRP A 1 647 ? -11.130 27.844 0.453   1.00 57.92  ? 647  TRP A CG    1 
ATOM   5256 C  CD1   . TRP A 1 647 ? -11.914 26.767 0.751   1.00 59.33  ? 647  TRP A CD1   1 
ATOM   5257 C  CD2   . TRP A 1 647 ? -11.102 28.656 1.633   1.00 54.97  ? 647  TRP A CD2   1 
ATOM   5258 N  NE1   . TRP A 1 647 ? -12.369 26.856 2.044   1.00 57.50  ? 647  TRP A NE1   1 
ATOM   5259 C  CE2   . TRP A 1 647 ? -11.883 28.006 2.607   1.00 55.38  ? 647  TRP A CE2   1 
ATOM   5260 C  CE3   . TRP A 1 647 ? -10.487 29.869 1.960   1.00 54.88  ? 647  TRP A CE3   1 
ATOM   5261 C  CZ2   . TRP A 1 647 ? -12.066 28.526 3.887   1.00 56.39  ? 647  TRP A CZ2   1 
ATOM   5262 C  CZ3   . TRP A 1 647 ? -10.668 30.384 3.231   1.00 54.81  ? 647  TRP A CZ3   1 
ATOM   5263 C  CH2   . TRP A 1 647 ? -11.451 29.713 4.179   1.00 55.65  ? 647  TRP A CH2   1 
ATOM   5264 N  N     . VAL A 1 648 ? -7.738  28.148 1.149   1.00 54.70  ? 648  VAL A N     1 
ATOM   5265 C  CA    . VAL A 1 648 ? -6.816  28.868 2.020   1.00 53.52  ? 648  VAL A CA    1 
ATOM   5266 C  C     . VAL A 1 648 ? -5.472  29.029 1.316   1.00 57.10  ? 648  VAL A C     1 
ATOM   5267 O  O     . VAL A 1 648 ? -4.872  30.102 1.347   1.00 57.25  ? 648  VAL A O     1 
ATOM   5268 C  CB    . VAL A 1 648 ? -6.623  28.160 3.377   1.00 49.47  ? 648  VAL A CB    1 
ATOM   5269 C  CG1   . VAL A 1 648 ? -5.488  28.801 4.163   1.00 45.18  ? 648  VAL A CG1   1 
ATOM   5270 C  CG2   . VAL A 1 648 ? -7.912  28.197 4.180   1.00 49.19  ? 648  VAL A CG2   1 
ATOM   5271 N  N     . ASP A 1 649 ? -5.011  27.959 0.672   1.00 60.25  ? 649  ASP A N     1 
ATOM   5272 C  CA    . ASP A 1 649 ? -3.796  28.019 -0.136  1.00 62.12  ? 649  ASP A CA    1 
ATOM   5273 C  C     . ASP A 1 649 ? -3.977  28.990 -1.296  1.00 64.57  ? 649  ASP A C     1 
ATOM   5274 O  O     . ASP A 1 649 ? -3.040  29.693 -1.683  1.00 64.94  ? 649  ASP A O     1 
ATOM   5275 C  CB    . ASP A 1 649 ? -3.424  26.634 -0.670  1.00 62.51  ? 649  ASP A CB    1 
ATOM   5276 C  CG    . ASP A 1 649 ? -2.387  25.936 0.186   1.00 64.61  ? 649  ASP A CG    1 
ATOM   5277 O  OD1   . ASP A 1 649 ? -1.561  26.632 0.817   1.00 64.98  ? 649  ASP A OD1   1 
ATOM   5278 O  OD2   . ASP A 1 649 ? -2.396  24.688 0.222   1.00 65.63  ? 649  ASP A OD2   1 
ATOM   5279 N  N     . PHE A 1 650 ? -5.189  29.025 -1.842  1.00 65.03  ? 650  PHE A N     1 
ATOM   5280 C  CA    . PHE A 1 650 ? -5.501  29.900 -2.965  1.00 65.01  ? 650  PHE A CA    1 
ATOM   5281 C  C     . PHE A 1 650 ? -5.377  31.368 -2.584  1.00 64.32  ? 650  PHE A C     1 
ATOM   5282 O  O     . PHE A 1 650 ? -4.707  32.144 -3.269  1.00 65.69  ? 650  PHE A O     1 
ATOM   5283 C  CB    . PHE A 1 650 ? -6.903  29.620 -3.505  1.00 64.78  ? 650  PHE A CB    1 
ATOM   5284 C  CG    . PHE A 1 650 ? -7.342  30.596 -4.552  1.00 66.70  ? 650  PHE A CG    1 
ATOM   5285 C  CD1   . PHE A 1 650 ? -6.623  30.736 -5.731  1.00 69.37  ? 650  PHE A CD1   1 
ATOM   5286 C  CD2   . PHE A 1 650 ? -8.464  31.380 -4.359  1.00 66.20  ? 650  PHE A CD2   1 
ATOM   5287 C  CE1   . PHE A 1 650 ? -7.019  31.640 -6.699  1.00 70.43  ? 650  PHE A CE1   1 
ATOM   5288 C  CE2   . PHE A 1 650 ? -8.865  32.283 -5.322  1.00 67.70  ? 650  PHE A CE2   1 
ATOM   5289 C  CZ    . PHE A 1 650 ? -8.139  32.414 -6.492  1.00 69.81  ? 650  PHE A CZ    1 
ATOM   5290 N  N     . LEU A 1 651 ? -6.030  31.742 -1.489  1.00 61.44  ? 651  LEU A N     1 
ATOM   5291 C  CA    . LEU A 1 651 ? -5.973  33.112 -1.000  1.00 60.08  ? 651  LEU A CA    1 
ATOM   5292 C  C     . LEU A 1 651 ? -4.560  33.462 -0.553  1.00 59.49  ? 651  LEU A C     1 
ATOM   5293 O  O     . LEU A 1 651 ? -4.101  34.587 -0.748  1.00 58.62  ? 651  LEU A O     1 
ATOM   5294 C  CB    . LEU A 1 651 ? -6.965  33.311 0.146   1.00 56.73  ? 651  LEU A CB    1 
ATOM   5295 C  CG    . LEU A 1 651 ? -8.434  33.175 -0.250  1.00 55.65  ? 651  LEU A CG    1 
ATOM   5296 C  CD1   . LEU A 1 651 ? -9.340  33.510 0.920   1.00 52.68  ? 651  LEU A CD1   1 
ATOM   5297 C  CD2   . LEU A 1 651 ? -8.739  34.064 -1.446  1.00 56.61  ? 651  LEU A CD2   1 
ATOM   5298 N  N     . ASP A 1 652 ? -3.879  32.487 0.041   1.00 59.77  ? 652  ASP A N     1 
ATOM   5299 C  CA    . ASP A 1 652 ? -2.493  32.654 0.460   1.00 60.73  ? 652  ASP A CA    1 
ATOM   5300 C  C     . ASP A 1 652 ? -1.608  33.010 -0.731  1.00 64.23  ? 652  ASP A C     1 
ATOM   5301 O  O     . ASP A 1 652 ? -0.854  33.982 -0.684  1.00 64.00  ? 652  ASP A O     1 
ATOM   5302 C  CB    . ASP A 1 652 ? -1.985  31.380 1.137   1.00 61.25  ? 652  ASP A CB    1 
ATOM   5303 C  CG    . ASP A 1 652 ? -0.515  31.450 1.481   1.00 63.50  ? 652  ASP A CG    1 
ATOM   5304 O  OD1   . ASP A 1 652 ? -0.086  32.468 2.063   1.00 62.07  ? 652  ASP A OD1   1 
ATOM   5305 O  OD2   . ASP A 1 652 ? 0.213   30.486 1.156   1.00 66.98  ? 652  ASP A OD2   1 
ATOM   5306 N  N     . LYS A 1 653 ? -1.711  32.226 -1.800  1.00 66.61  ? 653  LYS A N     1 
ATOM   5307 C  CA    . LYS A 1 653 ? -0.961  32.506 -3.018  1.00 66.93  ? 653  LYS A CA    1 
ATOM   5308 C  C     . LYS A 1 653 ? -1.414  33.833 -3.626  1.00 65.23  ? 653  LYS A C     1 
ATOM   5309 O  O     . LYS A 1 653 ? -0.592  34.618 -4.097  1.00 66.60  ? 653  LYS A O     1 
ATOM   5310 C  CB    . LYS A 1 653 ? -1.120  31.366 -4.027  1.00 66.77  ? 653  LYS A CB    1 
ATOM   5311 N  N     . PHE A 1 654 ? -2.722  34.083 -3.592  1.00 60.41  ? 654  PHE A N     1 
ATOM   5312 C  CA    . PHE A 1 654 ? -3.297  35.294 -4.177  1.00 56.63  ? 654  PHE A CA    1 
ATOM   5313 C  C     . PHE A 1 654 ? -2.778  36.565 -3.514  1.00 54.86  ? 654  PHE A C     1 
ATOM   5314 O  O     . PHE A 1 654 ? -2.393  37.517 -4.194  1.00 55.36  ? 654  PHE A O     1 
ATOM   5315 C  CB    . PHE A 1 654 ? -4.826  35.259 -4.102  1.00 54.19  ? 654  PHE A CB    1 
ATOM   5316 C  CG    . PHE A 1 654 ? -5.499  36.371 -4.861  1.00 51.98  ? 654  PHE A CG    1 
ATOM   5317 C  CD1   . PHE A 1 654 ? -5.817  37.568 -4.238  1.00 51.41  ? 654  PHE A CD1   1 
ATOM   5318 C  CD2   . PHE A 1 654 ? -5.818  36.217 -6.197  1.00 51.37  ? 654  PHE A CD2   1 
ATOM   5319 C  CE1   . PHE A 1 654 ? -6.434  38.587 -4.938  1.00 50.41  ? 654  PHE A CE1   1 
ATOM   5320 C  CE2   . PHE A 1 654 ? -6.437  37.231 -6.897  1.00 51.47  ? 654  PHE A CE2   1 
ATOM   5321 C  CZ    . PHE A 1 654 ? -6.744  38.418 -6.267  1.00 50.40  ? 654  PHE A CZ    1 
ATOM   5322 N  N     . ALA A 1 655 ? -2.782  36.579 -2.185  1.00 51.67  ? 655  ALA A N     1 
ATOM   5323 C  CA    . ALA A 1 655 ? -2.314  37.737 -1.438  1.00 51.02  ? 655  ALA A CA    1 
ATOM   5324 C  C     . ALA A 1 655 ? -0.834  37.954 -1.693  1.00 54.65  ? 655  ALA A C     1 
ATOM   5325 O  O     . ALA A 1 655 ? -0.381  39.082 -1.874  1.00 54.10  ? 655  ALA A O     1 
ATOM   5326 C  CB    . ALA A 1 655 ? -2.566  37.551 0.046   1.00 46.42  ? 655  ALA A CB    1 
ATOM   5327 N  N     . ARG A 1 656 ? -0.092  36.853 -1.722  1.00 59.37  ? 656  ARG A N     1 
ATOM   5328 C  CA    . ARG A 1 656 ? 1.360   36.892 -1.825  1.00 64.03  ? 656  ARG A CA    1 
ATOM   5329 C  C     . ARG A 1 656 ? 1.845   37.251 -3.231  1.00 63.93  ? 656  ARG A C     1 
ATOM   5330 O  O     . ARG A 1 656 ? 2.817   37.989 -3.389  1.00 61.95  ? 656  ARG A O     1 
ATOM   5331 C  CB    . ARG A 1 656 ? 1.941   35.545 -1.387  1.00 69.44  ? 656  ARG A CB    1 
ATOM   5332 C  CG    . ARG A 1 656 ? 3.447   35.528 -1.202  1.00 73.32  ? 656  ARG A CG    1 
ATOM   5333 C  CD    . ARG A 1 656 ? 3.936   34.146 -0.785  1.00 76.59  ? 656  ARG A CD    1 
ATOM   5334 N  NE    . ARG A 1 656 ? 3.653   33.133 -1.800  1.00 81.40  ? 656  ARG A NE    1 
ATOM   5335 C  CZ    . ARG A 1 656 ? 2.671   32.239 -1.716  1.00 82.46  ? 656  ARG A CZ    1 
ATOM   5336 N  NH1   . ARG A 1 656 ? 1.874   32.226 -0.657  1.00 81.99  ? 656  ARG A NH1   1 
ATOM   5337 N  NH2   . ARG A 1 656 ? 2.489   31.357 -2.690  1.00 83.47  ? 656  ARG A NH2   1 
ATOM   5338 N  N     . GLU A 1 657 ? 1.161   36.737 -4.248  1.00 66.39  ? 657  GLU A N     1 
ATOM   5339 C  CA    . GLU A 1 657 ? 1.596   36.926 -5.630  1.00 68.55  ? 657  GLU A CA    1 
ATOM   5340 C  C     . GLU A 1 657 ? 0.940   38.115 -6.338  1.00 67.63  ? 657  GLU A C     1 
ATOM   5341 O  O     . GLU A 1 657 ? 1.531   38.702 -7.244  1.00 68.69  ? 657  GLU A O     1 
ATOM   5342 C  CB    . GLU A 1 657 ? 1.372   35.646 -6.440  1.00 72.14  ? 657  GLU A CB    1 
ATOM   5343 C  CG    . GLU A 1 657 ? 2.209   34.463 -5.973  1.00 76.43  ? 657  GLU A CG    1 
ATOM   5344 C  CD    . GLU A 1 657 ? 1.901   33.189 -6.739  1.00 82.80  ? 657  GLU A CD    1 
ATOM   5345 O  OE1   . GLU A 1 657 ? 2.800   32.329 -6.855  1.00 85.87  ? 657  GLU A OE1   1 
ATOM   5346 O  OE2   . GLU A 1 657 ? 0.758   33.046 -7.222  1.00 85.01  ? 657  GLU A OE2   1 
ATOM   5347 N  N     . ARG A 1 658 ? -0.272  38.473 -5.927  1.00 64.82  ? 658  ARG A N     1 
ATOM   5348 C  CA    . ARG A 1 658 ? -1.006  39.544 -6.595  1.00 64.50  ? 658  ARG A CA    1 
ATOM   5349 C  C     . ARG A 1 658 ? -1.197  40.804 -5.747  1.00 64.08  ? 658  ARG A C     1 
ATOM   5350 O  O     . ARG A 1 658 ? -0.817  41.902 -6.158  1.00 64.76  ? 658  ARG A O     1 
ATOM   5351 C  CB    . ARG A 1 658 ? -2.365  39.038 -7.084  1.00 66.24  ? 658  ARG A CB    1 
ATOM   5352 C  CG    . ARG A 1 658 ? -2.295  38.126 -8.298  1.00 71.45  ? 658  ARG A CG    1 
ATOM   5353 C  CD    . ARG A 1 658 ? -3.678  37.916 -8.897  1.00 72.96  ? 658  ARG A CD    1 
ATOM   5354 N  NE    . ARG A 1 658 ? -3.645  37.120 -10.122 1.00 71.67  ? 658  ARG A NE    1 
ATOM   5355 C  CZ    . ARG A 1 658 ? -3.562  37.634 -11.344 1.00 70.21  ? 658  ARG A CZ    1 
ATOM   5356 N  NH1   . ARG A 1 658 ? -3.502  38.948 -11.511 1.00 70.13  ? 658  ARG A NH1   1 
ATOM   5357 N  NH2   . ARG A 1 658 ? -3.540  36.834 -12.400 1.00 70.89  ? 658  ARG A NH2   1 
ATOM   5358 N  N     . MET A 1 659 ? -1.790  40.644 -4.569  1.00 62.24  ? 659  MET A N     1 
ATOM   5359 C  CA    . MET A 1 659 ? -2.171  41.787 -3.745  1.00 59.53  ? 659  MET A CA    1 
ATOM   5360 C  C     . MET A 1 659 ? -0.987  42.560 -3.160  1.00 58.20  ? 659  MET A C     1 
ATOM   5361 O  O     . MET A 1 659 ? -0.903  43.780 -3.313  1.00 58.12  ? 659  MET A O     1 
ATOM   5362 C  CB    . MET A 1 659 ? -3.121  41.350 -2.631  1.00 56.55  ? 659  MET A CB    1 
ATOM   5363 C  CG    . MET A 1 659 ? -4.413  40.741 -3.138  1.00 57.49  ? 659  MET A CG    1 
ATOM   5364 S  SD    . MET A 1 659 ? -5.665  40.612 -1.851  1.00 59.39  ? 659  MET A SD    1 
ATOM   5365 C  CE    . MET A 1 659 ? -5.867  42.343 -1.436  1.00 40.41  ? 659  MET A CE    1 
ATOM   5366 N  N     . GLU A 1 660 ? -0.085  41.855 -2.482  1.00 56.29  ? 660  GLU A N     1 
ATOM   5367 C  CA    . GLU A 1 660 ? 1.096   42.491 -1.892  1.00 56.40  ? 660  GLU A CA    1 
ATOM   5368 C  C     . GLU A 1 660 ? 1.936   43.332 -2.871  1.00 57.98  ? 660  GLU A C     1 
ATOM   5369 O  O     . GLU A 1 660 ? 2.321   44.452 -2.536  1.00 55.57  ? 660  GLU A O     1 
ATOM   5370 C  CB    . GLU A 1 660 ? 1.971   41.471 -1.146  1.00 57.44  ? 660  GLU A CB    1 
ATOM   5371 C  CG    . GLU A 1 660 ? 1.340   40.909 0.115   1.00 57.38  ? 660  GLU A CG    1 
ATOM   5372 C  CD    . GLU A 1 660 ? 2.295   40.035 0.900   1.00 58.13  ? 660  GLU A CD    1 
ATOM   5373 O  OE1   . GLU A 1 660 ? 3.525   40.219 0.757   1.00 60.14  ? 660  GLU A OE1   1 
ATOM   5374 O  OE2   . GLU A 1 660 ? 1.815   39.166 1.660   1.00 57.48  ? 660  GLU A OE2   1 
ATOM   5375 N  N     . PRO A 1 661 ? 2.223   42.806 -4.079  1.00 60.80  ? 661  PRO A N     1 
ATOM   5376 C  CA    . PRO A 1 661 ? 2.948   43.649 -5.039  1.00 61.79  ? 661  PRO A CA    1 
ATOM   5377 C  C     . PRO A 1 661 ? 2.180   44.920 -5.398  1.00 59.68  ? 661  PRO A C     1 
ATOM   5378 O  O     . PRO A 1 661 ? 2.790   45.978 -5.556  1.00 58.74  ? 661  PRO A O     1 
ATOM   5379 C  CB    . PRO A 1 661 ? 3.078   42.745 -6.267  1.00 63.90  ? 661  PRO A CB    1 
ATOM   5380 C  CG    . PRO A 1 661 ? 3.044   41.372 -5.718  1.00 63.56  ? 661  PRO A CG    1 
ATOM   5381 C  CD    . PRO A 1 661 ? 2.082   41.424 -4.575  1.00 61.08  ? 661  PRO A CD    1 
ATOM   5382 N  N     . ALA A 1 662 ? 0.860   44.812 -5.519  1.00 55.79  ? 662  ALA A N     1 
ATOM   5383 C  CA    . ALA A 1 662 ? 0.021   45.971 -5.793  1.00 51.93  ? 662  ALA A CA    1 
ATOM   5384 C  C     . ALA A 1 662 ? 0.118   46.967 -4.644  1.00 50.06  ? 662  ALA A C     1 
ATOM   5385 O  O     . ALA A 1 662 ? 0.230   48.174 -4.862  1.00 49.85  ? 662  ALA A O     1 
ATOM   5386 C  CB    . ALA A 1 662 ? -1.418  45.541 -6.009  1.00 49.27  ? 662  ALA A CB    1 
ATOM   5387 N  N     . ILE A 1 663 ? 0.082   46.446 -3.421  1.00 47.60  ? 663  ILE A N     1 
ATOM   5388 C  CA    . ILE A 1 663 ? 0.220   47.267 -2.225  1.00 45.55  ? 663  ILE A CA    1 
ATOM   5389 C  C     . ILE A 1 663 ? 1.599   47.918 -2.185  1.00 44.78  ? 663  ILE A C     1 
ATOM   5390 O  O     . ILE A 1 663 ? 1.729   49.097 -1.851  1.00 41.56  ? 663  ILE A O     1 
ATOM   5391 C  CB    . ILE A 1 663 ? -0.010  46.432 -0.948  1.00 45.61  ? 663  ILE A CB    1 
ATOM   5392 C  CG1   . ILE A 1 663 ? -1.447  45.908 -0.911  1.00 45.41  ? 663  ILE A CG1   1 
ATOM   5393 C  CG2   . ILE A 1 663 ? 0.295   47.249 0.301   1.00 42.59  ? 663  ILE A CG2   1 
ATOM   5394 C  CD1   . ILE A 1 663 ? -1.708  44.917 0.197   1.00 44.82  ? 663  ILE A CD1   1 
ATOM   5395 N  N     . ASP A 1 664 ? 2.621   47.145 -2.538  1.00 49.93  ? 664  ASP A N     1 
ATOM   5396 C  CA    . ASP A 1 664 ? 3.981   47.665 -2.630  1.00 58.28  ? 664  ASP A CA    1 
ATOM   5397 C  C     . ASP A 1 664 ? 4.053   48.845 -3.595  1.00 62.43  ? 664  ASP A C     1 
ATOM   5398 O  O     . ASP A 1 664 ? 4.676   49.863 -3.295  1.00 61.32  ? 664  ASP A O     1 
ATOM   5399 C  CB    . ASP A 1 664 ? 4.954   46.565 -3.056  1.00 64.24  ? 664  ASP A CB    1 
ATOM   5400 C  CG    . ASP A 1 664 ? 5.706   45.968 -1.883  1.00 69.41  ? 664  ASP A CG    1 
ATOM   5401 O  OD1   . ASP A 1 664 ? 6.182   46.746 -1.027  1.00 69.22  ? 664  ASP A OD1   1 
ATOM   5402 O  OD2   . ASP A 1 664 ? 5.815   44.723 -1.812  1.00 73.22  ? 664  ASP A OD2   1 
ATOM   5403 N  N     . ARG A 1 665 ? 3.403   48.705 -4.748  1.00 64.78  ? 665  ARG A N     1 
ATOM   5404 C  CA    . ARG A 1 665 ? 3.349   49.781 -5.731  1.00 61.27  ? 665  ARG A CA    1 
ATOM   5405 C  C     . ARG A 1 665 ? 2.592   50.982 -5.181  1.00 57.66  ? 665  ARG A C     1 
ATOM   5406 O  O     . ARG A 1 665 ? 3.034   52.121 -5.329  1.00 57.74  ? 665  ARG A O     1 
ATOM   5407 C  CB    . ARG A 1 665 ? 2.698   49.299 -7.028  1.00 60.45  ? 665  ARG A CB    1 
ATOM   5408 C  CG    . ARG A 1 665 ? 3.443   48.166 -7.705  1.00 61.65  ? 665  ARG A CG    1 
ATOM   5409 C  CD    . ARG A 1 665 ? 2.916   47.911 -9.106  1.00 64.26  ? 665  ARG A CD    1 
ATOM   5410 N  NE    . ARG A 1 665 ? 1.517   47.490 -9.120  1.00 63.70  ? 665  ARG A NE    1 
ATOM   5411 C  CZ    . ARG A 1 665 ? 1.116   46.224 -9.052  1.00 63.05  ? 665  ARG A CZ    1 
ATOM   5412 N  NH1   . ARG A 1 665 ? 2.006   45.246 -8.951  1.00 62.42  ? 665  ARG A NH1   1 
ATOM   5413 N  NH2   . ARG A 1 665 ? -0.177  45.935 -9.080  1.00 63.41  ? 665  ARG A NH2   1 
ATOM   5414 N  N     . GLY A 1 666 ? 1.455   50.718 -4.545  1.00 55.41  ? 666  GLY A N     1 
ATOM   5415 C  CA    . GLY A 1 666 ? 0.632   51.771 -3.980  1.00 54.93  ? 666  GLY A CA    1 
ATOM   5416 C  C     . GLY A 1 666 ? 1.375   52.603 -2.953  1.00 53.99  ? 666  GLY A C     1 
ATOM   5417 O  O     . GLY A 1 666 ? 1.245   53.829 -2.920  1.00 53.52  ? 666  GLY A O     1 
ATOM   5418 N  N     . PHE A 1 667 ? 2.164   51.935 -2.117  1.00 52.45  ? 667  PHE A N     1 
ATOM   5419 C  CA    . PHE A 1 667 ? 2.929   52.620 -1.079  1.00 51.54  ? 667  PHE A CA    1 
ATOM   5420 C  C     . PHE A 1 667 ? 4.188   53.277 -1.627  1.00 52.83  ? 667  PHE A C     1 
ATOM   5421 O  O     . PHE A 1 667 ? 4.582   54.353 -1.176  1.00 52.97  ? 667  PHE A O     1 
ATOM   5422 C  CB    . PHE A 1 667 ? 3.278   51.660 0.060   1.00 47.46  ? 667  PHE A CB    1 
ATOM   5423 C  CG    . PHE A 1 667 ? 2.210   51.559 1.104   1.00 44.16  ? 667  PHE A CG    1 
ATOM   5424 C  CD1   . PHE A 1 667 ? 1.553   52.695 1.549   1.00 42.10  ? 667  PHE A CD1   1 
ATOM   5425 C  CD2   . PHE A 1 667 ? 1.848   50.333 1.630   1.00 42.75  ? 667  PHE A CD2   1 
ATOM   5426 C  CE1   . PHE A 1 667 ? 0.564   52.609 2.507   1.00 39.66  ? 667  PHE A CE1   1 
ATOM   5427 C  CE2   . PHE A 1 667 ? 0.859   50.242 2.587   1.00 40.66  ? 667  PHE A CE2   1 
ATOM   5428 C  CZ    . PHE A 1 667 ? 0.220   51.383 3.028   1.00 37.88  ? 667  PHE A CZ    1 
ATOM   5429 N  N     . ARG A 1 668 ? 4.812   52.623 -2.601  1.00 53.92  ? 668  ARG A N     1 
ATOM   5430 C  CA    . ARG A 1 668 ? 6.008   53.157 -3.235  1.00 53.96  ? 668  ARG A CA    1 
ATOM   5431 C  C     . ARG A 1 668 ? 5.674   54.476 -3.921  1.00 53.22  ? 668  ARG A C     1 
ATOM   5432 O  O     . ARG A 1 668 ? 6.493   55.393 -3.955  1.00 54.03  ? 668  ARG A O     1 
ATOM   5433 C  CB    . ARG A 1 668 ? 6.570   52.152 -4.238  1.00 57.76  ? 668  ARG A CB    1 
ATOM   5434 C  CG    . ARG A 1 668 ? 8.067   52.259 -4.454  1.00 63.94  ? 668  ARG A CG    1 
ATOM   5435 C  CD    . ARG A 1 668 ? 8.585   51.111 -5.306  1.00 68.45  ? 668  ARG A CD    1 
ATOM   5436 N  NE    . ARG A 1 668 ? 8.371   49.816 -4.667  1.00 70.04  ? 668  ARG A NE    1 
ATOM   5437 C  CZ    . ARG A 1 668 ? 9.245   49.230 -3.857  1.00 70.87  ? 668  ARG A CZ    1 
ATOM   5438 N  NH1   . ARG A 1 668 ? 10.399  49.825 -3.582  1.00 70.65  ? 668  ARG A NH1   1 
ATOM   5439 N  NH2   . ARG A 1 668 ? 8.968   48.049 -3.319  1.00 70.65  ? 668  ARG A NH2   1 
ATOM   5440 N  N     . GLU A 1 669 ? 4.460   54.566 -4.459  1.00 52.91  ? 669  GLU A N     1 
ATOM   5441 C  CA    . GLU A 1 669 ? 3.969   55.805 -5.051  1.00 54.87  ? 669  GLU A CA    1 
ATOM   5442 C  C     . GLU A 1 669 ? 3.767   56.862 -3.974  1.00 52.46  ? 669  GLU A C     1 
ATOM   5443 O  O     . GLU A 1 669 ? 4.154   58.021 -4.145  1.00 51.91  ? 669  GLU A O     1 
ATOM   5444 C  CB    . GLU A 1 669 ? 2.651   55.567 -5.792  1.00 57.94  ? 669  GLU A CB    1 
ATOM   5445 C  CG    . GLU A 1 669 ? 1.967   56.850 -6.252  1.00 60.49  ? 669  GLU A CG    1 
ATOM   5446 C  CD    . GLU A 1 669 ? 0.608   56.604 -6.881  1.00 63.60  ? 669  GLU A CD    1 
ATOM   5447 O  OE1   . GLU A 1 669 ? 0.394   55.508 -7.441  1.00 67.24  ? 669  GLU A OE1   1 
ATOM   5448 O  OE2   . GLU A 1 669 ? -0.250  57.509 -6.812  1.00 63.35  ? 669  GLU A OE2   1 
ATOM   5449 N  N     . MET A 1 670 ? 3.154   56.452 -2.867  1.00 50.47  ? 670  MET A N     1 
ATOM   5450 C  CA    . MET A 1 670 ? 2.909   57.351 -1.747  1.00 49.35  ? 670  MET A CA    1 
ATOM   5451 C  C     . MET A 1 670 ? 4.230   57.907 -1.232  1.00 48.31  ? 670  MET A C     1 
ATOM   5452 O  O     . MET A 1 670 ? 4.320   59.075 -0.857  1.00 47.20  ? 670  MET A O     1 
ATOM   5453 C  CB    . MET A 1 670 ? 2.178   56.622 -0.619  1.00 45.69  ? 670  MET A CB    1 
ATOM   5454 C  CG    . MET A 1 670 ? 1.575   57.552 0.421   1.00 42.22  ? 670  MET A CG    1 
ATOM   5455 S  SD    . MET A 1 670 ? 0.955   56.689 1.878   1.00 38.91  ? 670  MET A SD    1 
ATOM   5456 C  CE    . MET A 1 670 ? 2.489   56.282 2.709   1.00 45.58  ? 670  MET A CE    1 
ATOM   5457 N  N     . CYS A 1 671 ? 5.252   57.058 -1.231  1.00 47.44  ? 671  CYS A N     1 
ATOM   5458 C  CA    . CYS A 1 671 ? 6.585   57.452 -0.800  1.00 48.74  ? 671  CYS A CA    1 
ATOM   5459 C  C     . CYS A 1 671 ? 7.155   58.563 -1.681  1.00 50.13  ? 671  CYS A C     1 
ATOM   5460 O  O     . CYS A 1 671 ? 7.834   59.467 -1.193  1.00 49.01  ? 671  CYS A O     1 
ATOM   5461 C  CB    . CYS A 1 671 ? 7.523   56.245 -0.809  1.00 50.66  ? 671  CYS A CB    1 
ATOM   5462 S  SG    . CYS A 1 671 ? 9.154   56.569 -0.109  1.00 42.61  ? 671  CYS A SG    1 
ATOM   5463 N  N     . GLU A 1 672 ? 6.878   58.495 -2.978  1.00 51.35  ? 672  GLU A N     1 
ATOM   5464 C  CA    . GLU A 1 672 ? 7.335   59.531 -3.892  1.00 55.96  ? 672  GLU A CA    1 
ATOM   5465 C  C     . GLU A 1 672 ? 6.497   60.789 -3.713  1.00 53.68  ? 672  GLU A C     1 
ATOM   5466 O  O     . GLU A 1 672 ? 7.009   61.905 -3.805  1.00 55.56  ? 672  GLU A O     1 
ATOM   5467 C  CB    . GLU A 1 672 ? 7.267   59.050 -5.341  1.00 63.94  ? 672  GLU A CB    1 
ATOM   5468 C  CG    . GLU A 1 672 ? 7.760   60.072 -6.350  1.00 72.48  ? 672  GLU A CG    1 
ATOM   5469 C  CD    . GLU A 1 672 ? 7.783   59.527 -7.761  1.00 82.60  ? 672  GLU A CD    1 
ATOM   5470 O  OE1   . GLU A 1 672 ? 7.737   58.288 -7.917  1.00 85.61  ? 672  GLU A OE1   1 
ATOM   5471 O  OE2   . GLU A 1 672 ? 7.843   60.335 -8.713  1.00 86.55  ? 672  GLU A OE2   1 
ATOM   5472 N  N     . TYR A 1 673 ? 5.208   60.594 -3.452  1.00 49.93  ? 673  TYR A N     1 
ATOM   5473 C  CA    . TYR A 1 673 ? 4.275   61.691 -3.218  1.00 46.83  ? 673  TYR A CA    1 
ATOM   5474 C  C     . TYR A 1 673 ? 4.764   62.584 -2.078  1.00 45.80  ? 673  TYR A C     1 
ATOM   5475 O  O     . TYR A 1 673 ? 4.766   63.811 -2.190  1.00 44.78  ? 673  TYR A O     1 
ATOM   5476 C  CB    . TYR A 1 673 ? 2.892   61.125 -2.882  1.00 44.23  ? 673  TYR A CB    1 
ATOM   5477 C  CG    . TYR A 1 673 ? 1.766   62.137 -2.888  1.00 44.71  ? 673  TYR A CG    1 
ATOM   5478 C  CD1   . TYR A 1 673 ? 1.902   63.362 -3.530  1.00 47.33  ? 673  TYR A CD1   1 
ATOM   5479 C  CD2   . TYR A 1 673 ? 0.565   61.863 -2.248  1.00 44.07  ? 673  TYR A CD2   1 
ATOM   5480 C  CE1   . TYR A 1 673 ? 0.869   64.284 -3.535  1.00 49.73  ? 673  TYR A CE1   1 
ATOM   5481 C  CE2   . TYR A 1 673 ? -0.472  62.778 -2.247  1.00 45.42  ? 673  TYR A CE2   1 
ATOM   5482 C  CZ    . TYR A 1 673 ? -0.316  63.986 -2.890  1.00 48.76  ? 673  TYR A CZ    1 
ATOM   5483 O  OH    . TYR A 1 673 ? -1.350  64.897 -2.886  1.00 50.97  ? 673  TYR A OH    1 
ATOM   5484 N  N     . MET A 1 674 ? 5.187   61.955 -0.985  1.00 42.60  ? 674  MET A N     1 
ATOM   5485 C  CA    . MET A 1 674 ? 5.679   62.678 0.181   1.00 39.22  ? 674  MET A CA    1 
ATOM   5486 C  C     . MET A 1 674 ? 7.176   62.938 0.093   1.00 40.48  ? 674  MET A C     1 
ATOM   5487 O  O     . MET A 1 674 ? 7.750   63.552 0.995   1.00 43.70  ? 674  MET A O     1 
ATOM   5488 C  CB    . MET A 1 674 ? 5.382   61.897 1.468   1.00 36.96  ? 674  MET A CB    1 
ATOM   5489 C  CG    . MET A 1 674 ? 3.907   61.703 1.786   1.00 35.72  ? 674  MET A CG    1 
ATOM   5490 S  SD    . MET A 1 674 ? 3.052   63.255 2.102   1.00 32.57  ? 674  MET A SD    1 
ATOM   5491 C  CE    . MET A 1 674 ? 2.195   63.493 0.549   1.00 55.15  ? 674  MET A CE    1 
ATOM   5492 N  N     . ASN A 1 675 ? 7.797   62.467 -0.987  1.00 38.24  ? 675  ASN A N     1 
ATOM   5493 C  CA    . ASN A 1 675 ? 9.241   62.584 -1.173  1.00 37.58  ? 675  ASN A CA    1 
ATOM   5494 C  C     . ASN A 1 675 ? 10.015  62.065 0.040   1.00 40.06  ? 675  ASN A C     1 
ATOM   5495 O  O     . ASN A 1 675 ? 10.957  62.702 0.500   1.00 42.90  ? 675  ASN A O     1 
ATOM   5496 C  CB    . ASN A 1 675 ? 9.629   64.035 -1.467  1.00 36.29  ? 675  ASN A CB    1 
ATOM   5497 C  CG    . ASN A 1 675 ? 11.068  64.174 -1.929  1.00 38.78  ? 675  ASN A CG    1 
ATOM   5498 O  OD1   . ASN A 1 675 ? 11.632  63.252 -2.514  1.00 40.24  ? 675  ASN A OD1   1 
ATOM   5499 N  ND2   . ASN A 1 675 ? 11.673  65.324 -1.653  1.00 38.50  ? 675  ASN A ND2   1 
ATOM   5500 N  N     . ASN A 1 676 ? 9.604   60.914 0.565   1.00 38.56  ? 676  ASN A N     1 
ATOM   5501 C  CA    . ASN A 1 676 ? 10.220  60.364 1.771   1.00 36.10  ? 676  ASN A CA    1 
ATOM   5502 C  C     . ASN A 1 676 ? 11.629  59.821 1.546   1.00 38.50  ? 676  ASN A C     1 
ATOM   5503 O  O     . ASN A 1 676 ? 12.026  59.547 0.412   1.00 38.80  ? 676  ASN A O     1 
ATOM   5504 C  CB    . ASN A 1 676 ? 9.335   59.283 2.392   1.00 36.50  ? 676  ASN A CB    1 
ATOM   5505 C  CG    . ASN A 1 676 ? 7.988   59.817 2.843   1.00 37.82  ? 676  ASN A CG    1 
ATOM   5506 O  OD1   . ASN A 1 676 ? 6.967   59.137 2.727   1.00 38.50  ? 676  ASN A OD1   1 
ATOM   5507 N  ND2   . ASN A 1 676 ? 7.978   61.043 3.355   1.00 35.73  ? 676  ASN A ND2   1 
ATOM   5508 N  N     . LYS A 1 677 ? 12.376  59.662 2.637   1.00 38.32  ? 677  LYS A N     1 
ATOM   5509 C  CA    . LYS A 1 677 ? 13.766  59.218 2.568   1.00 38.15  ? 677  LYS A CA    1 
ATOM   5510 C  C     . LYS A 1 677 ? 13.890  57.782 2.081   1.00 37.32  ? 677  LYS A C     1 
ATOM   5511 O  O     . LYS A 1 677 ? 14.763  57.470 1.275   1.00 38.73  ? 677  LYS A O     1 
ATOM   5512 C  CB    . LYS A 1 677 ? 14.454  59.367 3.929   1.00 39.24  ? 677  LYS A CB    1 
ATOM   5513 C  CG    . LYS A 1 677 ? 15.914  58.929 3.935   1.00 42.58  ? 677  LYS A CG    1 
ATOM   5514 C  CD    . LYS A 1 677 ? 16.580  59.182 5.283   1.00 45.98  ? 677  LYS A CD    1 
ATOM   5515 C  CE    . LYS A 1 677 ? 18.059  58.809 5.240   1.00 51.76  ? 677  LYS A CE    1 
ATOM   5516 N  NZ    . LYS A 1 677 ? 18.786  59.173 6.490   1.00 54.03  ? 677  LYS A NZ    1 
ATOM   5517 N  N     . GLN A 1 678 ? 13.016  56.911 2.571   1.00 38.29  ? 678  GLN A N     1 
ATOM   5518 C  CA    . GLN A 1 678 ? 13.092  55.495 2.226   1.00 40.97  ? 678  GLN A CA    1 
ATOM   5519 C  C     . GLN A 1 678 ? 11.750  54.795 2.369   1.00 38.83  ? 678  GLN A C     1 
ATOM   5520 O  O     . GLN A 1 678 ? 11.116  54.871 3.418   1.00 35.60  ? 678  GLN A O     1 
ATOM   5521 C  CB    . GLN A 1 678 ? 14.120  54.794 3.111   1.00 41.26  ? 678  GLN A CB    1 
ATOM   5522 C  CG    . GLN A 1 678 ? 14.182  53.295 2.899   1.00 45.41  ? 678  GLN A CG    1 
ATOM   5523 C  CD    . GLN A 1 678 ? 15.212  52.626 3.786   1.00 47.79  ? 678  GLN A CD    1 
ATOM   5524 O  OE1   . GLN A 1 678 ? 15.624  53.178 4.809   1.00 46.32  ? 678  GLN A OE1   1 
ATOM   5525 N  NE2   . GLN A 1 678 ? 15.638  51.431 3.394   1.00 50.17  ? 678  GLN A NE2   1 
ATOM   5526 N  N     . HIS A 1 679 ? 11.326  54.102 1.316   1.00 39.19  ? 679  HIS A N     1 
ATOM   5527 C  CA    . HIS A 1 679 ? 10.082  53.346 1.375   1.00 38.41  ? 679  HIS A CA    1 
ATOM   5528 C  C     . HIS A 1 679 ? 10.170  52.210 2.386   1.00 37.95  ? 679  HIS A C     1 
ATOM   5529 O  O     . HIS A 1 679 ? 10.978  51.291 2.238   1.00 40.23  ? 679  HIS A O     1 
ATOM   5530 C  CB    . HIS A 1 679 ? 9.702   52.781 0.008   1.00 38.95  ? 679  HIS A CB    1 
ATOM   5531 C  CG    . HIS A 1 679 ? 8.585   51.790 0.071   1.00 42.67  ? 679  HIS A CG    1 
ATOM   5532 N  ND1   . HIS A 1 679 ? 8.722   50.484 -0.347  1.00 44.82  ? 679  HIS A ND1   1 
ATOM   5533 C  CD2   . HIS A 1 679 ? 7.320   51.904 0.541   1.00 44.60  ? 679  HIS A CD2   1 
ATOM   5534 C  CE1   . HIS A 1 679 ? 7.582   49.842 -0.156  1.00 46.51  ? 679  HIS A CE1   1 
ATOM   5535 N  NE2   . HIS A 1 679 ? 6.716   50.681 0.382   1.00 45.51  ? 679  HIS A NE2   1 
ATOM   5536 N  N     . LEU A 1 680 ? 9.331   52.279 3.415   1.00 35.42  ? 680  LEU A N     1 
ATOM   5537 C  CA    . LEU A 1 680 ? 9.338   51.278 4.477   1.00 35.26  ? 680  LEU A CA    1 
ATOM   5538 C  C     . LEU A 1 680 ? 7.929   50.869 4.887   1.00 33.54  ? 680  LEU A C     1 
ATOM   5539 O  O     . LEU A 1 680 ? 7.735   50.221 5.916   1.00 32.36  ? 680  LEU A O     1 
ATOM   5540 C  CB    . LEU A 1 680 ? 10.118  51.787 5.689   1.00 33.64  ? 680  LEU A CB    1 
ATOM   5541 C  CG    . LEU A 1 680 ? 11.621  51.912 5.449   1.00 34.00  ? 680  LEU A CG    1 
ATOM   5542 C  CD1   . LEU A 1 680 ? 12.296  52.629 6.594   1.00 31.29  ? 680  LEU A CD1   1 
ATOM   5543 C  CD2   . LEU A 1 680 ? 12.228  50.535 5.244   1.00 36.37  ? 680  LEU A CD2   1 
ATOM   5544 N  N     . MET A 1 681 ? 6.948   51.253 4.079   1.00 34.85  ? 681  MET A N     1 
ATOM   5545 C  CA    . MET A 1 681 ? 5.575   50.825 4.300   1.00 34.47  ? 681  MET A CA    1 
ATOM   5546 C  C     . MET A 1 681 ? 5.396   49.412 3.761   1.00 37.82  ? 681  MET A C     1 
ATOM   5547 O  O     . MET A 1 681 ? 5.022   49.220 2.602   1.00 40.01  ? 681  MET A O     1 
ATOM   5548 C  CB    . MET A 1 681 ? 4.589   51.787 3.635   1.00 33.19  ? 681  MET A CB    1 
ATOM   5549 C  CG    . MET A 1 681 ? 4.578   53.196 4.218   1.00 30.54  ? 681  MET A CG    1 
ATOM   5550 S  SD    . MET A 1 681 ? 4.047   53.248 5.938   1.00 42.66  ? 681  MET A SD    1 
ATOM   5551 C  CE    . MET A 1 681 ? 5.619   53.384 6.794   1.00 28.69  ? 681  MET A CE    1 
ATOM   5552 N  N     . PHE A 1 682 ? 5.677   48.428 4.610   1.00 36.37  ? 682  PHE A N     1 
ATOM   5553 C  CA    . PHE A 1 682 ? 5.628   47.027 4.210   1.00 37.74  ? 682  PHE A CA    1 
ATOM   5554 C  C     . PHE A 1 682 ? 4.403   46.344 4.796   1.00 38.89  ? 682  PHE A C     1 
ATOM   5555 O  O     . PHE A 1 682 ? 4.389   45.961 5.965   1.00 41.44  ? 682  PHE A O     1 
ATOM   5556 C  CB    . PHE A 1 682 ? 6.902   46.302 4.647   1.00 37.00  ? 682  PHE A CB    1 
ATOM   5557 C  CG    . PHE A 1 682 ? 8.161   46.934 4.131   1.00 37.48  ? 682  PHE A CG    1 
ATOM   5558 C  CD1   . PHE A 1 682 ? 8.182   47.562 2.896   1.00 38.31  ? 682  PHE A CD1   1 
ATOM   5559 C  CD2   . PHE A 1 682 ? 9.322   46.910 4.885   1.00 39.39  ? 682  PHE A CD2   1 
ATOM   5560 C  CE1   . PHE A 1 682 ? 9.338   48.152 2.419   1.00 41.00  ? 682  PHE A CE1   1 
ATOM   5561 C  CE2   . PHE A 1 682 ? 10.481  47.497 4.414   1.00 42.42  ? 682  PHE A CE2   1 
ATOM   5562 C  CZ    . PHE A 1 682 ? 10.489  48.119 3.178   1.00 42.20  ? 682  PHE A CZ    1 
ATOM   5563 N  N     . MET A 1 683 ? 3.375   46.197 3.968   1.00 40.64  ? 683  MET A N     1 
ATOM   5564 C  CA    . MET A 1 683 ? 2.108   45.626 4.399   1.00 41.57  ? 683  MET A CA    1 
ATOM   5565 C  C     . MET A 1 683 ? 1.946   44.200 3.880   1.00 47.62  ? 683  MET A C     1 
ATOM   5566 O  O     . MET A 1 683 ? 1.663   43.986 2.699   1.00 47.52  ? 683  MET A O     1 
ATOM   5567 C  CB    . MET A 1 683 ? 0.953   46.509 3.925   1.00 38.74  ? 683  MET A CB    1 
ATOM   5568 C  CG    . MET A 1 683 ? -0.421  45.915 4.131   1.00 39.13  ? 683  MET A CG    1 
ATOM   5569 S  SD    . MET A 1 683 ? -1.724  47.125 3.841   1.00 39.34  ? 683  MET A SD    1 
ATOM   5570 C  CE    . MET A 1 683 ? -2.016  47.725 5.501   1.00 45.77  ? 683  MET A CE    1 
ATOM   5571 N  N     . ASP A 1 684 ? 2.139   43.228 4.770   1.00 54.36  ? 684  ASP A N     1 
ATOM   5572 C  CA    . ASP A 1 684 ? 2.015   41.816 4.415   1.00 56.60  ? 684  ASP A CA    1 
ATOM   5573 C  C     . ASP A 1 684 ? 0.676   41.254 4.882   1.00 52.69  ? 684  ASP A C     1 
ATOM   5574 O  O     . ASP A 1 684 ? 0.060   41.783 5.808   1.00 53.22  ? 684  ASP A O     1 
ATOM   5575 C  CB    . ASP A 1 684 ? 3.156   41.004 5.032   1.00 61.71  ? 684  ASP A CB    1 
ATOM   5576 C  CG    . ASP A 1 684 ? 4.524   41.551 4.669   1.00 67.10  ? 684  ASP A CG    1 
ATOM   5577 O  OD1   . ASP A 1 684 ? 5.376   41.659 5.579   1.00 70.54  ? 684  ASP A OD1   1 
ATOM   5578 O  OD2   . ASP A 1 684 ? 4.746   41.869 3.479   1.00 67.69  ? 684  ASP A OD2   1 
ATOM   5579 N  N     . ARG A 1 685 ? 0.228   40.184 4.234   1.00 49.59  ? 685  ARG A N     1 
ATOM   5580 C  CA    . ARG A 1 685 ? -1.006  39.517 4.629   1.00 45.28  ? 685  ARG A CA    1 
ATOM   5581 C  C     . ARG A 1 685 ? -0.864  38.999 6.048   1.00 42.82  ? 685  ARG A C     1 
ATOM   5582 O  O     . ARG A 1 685 ? 0.198   38.516 6.434   1.00 39.41  ? 685  ARG A O     1 
ATOM   5583 C  CB    . ARG A 1 685 ? -1.327  38.362 3.672   1.00 44.86  ? 685  ARG A CB    1 
ATOM   5584 C  CG    . ARG A 1 685 ? -2.731  37.774 3.824   1.00 44.24  ? 685  ARG A CG    1 
ATOM   5585 C  CD    . ARG A 1 685 ? -2.780  36.617 4.819   1.00 40.39  ? 685  ARG A CD    1 
ATOM   5586 N  NE    . ARG A 1 685 ? -1.942  35.497 4.406   1.00 41.89  ? 685  ARG A NE    1 
ATOM   5587 C  CZ    . ARG A 1 685 ? -1.745  34.401 5.134   1.00 43.84  ? 685  ARG A CZ    1 
ATOM   5588 N  NH1   . ARG A 1 685 ? -2.328  34.273 6.317   1.00 41.50  ? 685  ARG A NH1   1 
ATOM   5589 N  NH2   . ARG A 1 685 ? -0.966  33.429 4.677   1.00 45.94  ? 685  ARG A NH2   1 
ATOM   5590 N  N     . GLU A 1 686 ? -1.931  39.107 6.828   1.00 45.33  ? 686  GLU A N     1 
ATOM   5591 C  CA    . GLU A 1 686 ? -1.913  38.552 8.172   1.00 47.31  ? 686  GLU A CA    1 
ATOM   5592 C  C     . GLU A 1 686 ? -2.813  37.324 8.278   1.00 44.64  ? 686  GLU A C     1 
ATOM   5593 O  O     . GLU A 1 686 ? -2.324  36.195 8.311   1.00 41.35  ? 686  GLU A O     1 
ATOM   5594 C  CB    . GLU A 1 686 ? -2.280  39.606 9.222   1.00 49.25  ? 686  GLU A CB    1 
ATOM   5595 C  CG    . GLU A 1 686 ? -1.413  39.518 10.470  1.00 55.07  ? 686  GLU A CG    1 
ATOM   5596 C  CD    . GLU A 1 686 ? -1.760  40.559 11.513  1.00 60.93  ? 686  GLU A CD    1 
ATOM   5597 O  OE1   . GLU A 1 686 ? -0.822  41.130 12.110  1.00 62.70  ? 686  GLU A OE1   1 
ATOM   5598 O  OE2   . GLU A 1 686 ? -2.966  40.796 11.744  1.00 63.23  ? 686  GLU A OE2   1 
ATOM   5599 N  N     . ALA A 1 687 ? -4.124  37.542 8.311   1.00 44.15  ? 687  ALA A N     1 
ATOM   5600 C  CA    . ALA A 1 687 ? -5.066  36.445 8.526   1.00 44.14  ? 687  ALA A CA    1 
ATOM   5601 C  C     . ALA A 1 687 ? -5.817  36.028 7.266   1.00 45.71  ? 687  ALA A C     1 
ATOM   5602 O  O     . ALA A 1 687 ? -6.145  36.857 6.414   1.00 45.75  ? 687  ALA A O     1 
ATOM   5603 C  CB    . ALA A 1 687 ? -6.054  36.800 9.631   1.00 41.36  ? 687  ALA A CB    1 
ATOM   5604 N  N     . ILE A 1 688 ? -6.083  34.730 7.164   1.00 43.99  ? 688  ILE A N     1 
ATOM   5605 C  CA    . ILE A 1 688 ? -6.983  34.204 6.148   1.00 43.33  ? 688  ILE A CA    1 
ATOM   5606 C  C     . ILE A 1 688 ? -8.142  33.516 6.849   1.00 42.67  ? 688  ILE A C     1 
ATOM   5607 O  O     . ILE A 1 688 ? -7.985  32.422 7.392   1.00 43.60  ? 688  ILE A O     1 
ATOM   5608 C  CB    . ILE A 1 688 ? -6.284  33.195 5.225   1.00 41.92  ? 688  ILE A CB    1 
ATOM   5609 C  CG1   . ILE A 1 688 ? -5.127  33.861 4.485   1.00 42.63  ? 688  ILE A CG1   1 
ATOM   5610 C  CG2   . ILE A 1 688 ? -7.277  32.611 4.228   1.00 42.09  ? 688  ILE A CG2   1 
ATOM   5611 C  CD1   . ILE A 1 688 ? -4.376  32.921 3.577   1.00 44.41  ? 688  ILE A CD1   1 
ATOM   5612 N  N     . ALA A 1 689 ? -9.304  34.160 6.845   1.00 41.29  ? 689  ALA A N     1 
ATOM   5613 C  CA    . ALA A 1 689 ? -10.449 33.644 7.586   1.00 43.32  ? 689  ALA A CA    1 
ATOM   5614 C  C     . ALA A 1 689 ? -11.608 33.224 6.687   1.00 46.73  ? 689  ALA A C     1 
ATOM   5615 O  O     . ALA A 1 689 ? -11.789 33.752 5.589   1.00 47.23  ? 689  ALA A O     1 
ATOM   5616 C  CB    . ALA A 1 689 ? -10.916 34.660 8.615   1.00 41.72  ? 689  ALA A CB    1 
ATOM   5617 N  N     . GLY A 1 690 ? -12.395 32.271 7.174   1.00 47.11  ? 690  GLY A N     1 
ATOM   5618 C  CA    . GLY A 1 690 ? -13.539 31.770 6.441   1.00 48.24  ? 690  GLY A CA    1 
ATOM   5619 C  C     . GLY A 1 690 ? -14.154 30.572 7.133   1.00 48.76  ? 690  GLY A C     1 
ATOM   5620 O  O     . GLY A 1 690 ? -13.539 29.977 8.016   1.00 48.46  ? 690  GLY A O     1 
ATOM   5621 N  N     . PRO A 1 691 ? -15.380 30.207 6.736   1.00 49.03  ? 691  PRO A N     1 
ATOM   5622 C  CA    . PRO A 1 691 ? -16.033 29.035 7.317   1.00 49.53  ? 691  PRO A CA    1 
ATOM   5623 C  C     . PRO A 1 691 ? -15.378 27.768 6.792   1.00 52.97  ? 691  PRO A C     1 
ATOM   5624 O  O     . PRO A 1 691 ? -14.700 27.825 5.766   1.00 55.77  ? 691  PRO A O     1 
ATOM   5625 C  CB    . PRO A 1 691 ? -17.458 29.139 6.777   1.00 49.41  ? 691  PRO A CB    1 
ATOM   5626 C  CG    . PRO A 1 691 ? -17.300 29.824 5.470   1.00 49.67  ? 691  PRO A CG    1 
ATOM   5627 C  CD    . PRO A 1 691 ? -16.184 30.813 5.661   1.00 48.88  ? 691  PRO A CD    1 
ATOM   5628 N  N     . PRO A 1 692 ? -15.553 26.640 7.497   1.00 52.59  ? 692  PRO A N     1 
ATOM   5629 C  CA    . PRO A 1 692 ? -15.123 25.355 6.941   1.00 53.60  ? 692  PRO A CA    1 
ATOM   5630 C  C     . PRO A 1 692 ? -15.861 25.113 5.632   1.00 57.64  ? 692  PRO A C     1 
ATOM   5631 O  O     . PRO A 1 692 ? -17.033 25.477 5.519   1.00 59.65  ? 692  PRO A O     1 
ATOM   5632 C  CB    . PRO A 1 692 ? -15.574 24.349 8.000   1.00 53.41  ? 692  PRO A CB    1 
ATOM   5633 C  CG    . PRO A 1 692 ? -15.620 25.139 9.269   1.00 50.81  ? 692  PRO A CG    1 
ATOM   5634 C  CD    . PRO A 1 692 ? -16.074 26.507 8.868   1.00 50.44  ? 692  PRO A CD    1 
ATOM   5635 N  N     . LEU A 1 693 ? -15.179 24.530 4.652   1.00 57.91  ? 693  LEU A N     1 
ATOM   5636 C  CA    . LEU A 1 693 ? -15.772 24.314 3.341   1.00 57.81  ? 693  LEU A CA    1 
ATOM   5637 C  C     . LEU A 1 693 ? -16.997 23.408 3.417   1.00 59.88  ? 693  LEU A C     1 
ATOM   5638 O  O     . LEU A 1 693 ? -16.921 22.288 3.924   1.00 62.38  ? 693  LEU A O     1 
ATOM   5639 C  CB    . LEU A 1 693 ? -14.740 23.721 2.384   1.00 58.64  ? 693  LEU A CB    1 
ATOM   5640 C  CG    . LEU A 1 693 ? -15.216 23.587 0.938   1.00 61.12  ? 693  LEU A CG    1 
ATOM   5641 C  CD1   . LEU A 1 693 ? -15.534 24.958 0.359   1.00 58.93  ? 693  LEU A CD1   1 
ATOM   5642 C  CD2   . LEU A 1 693 ? -14.187 22.859 0.085   1.00 62.34  ? 693  LEU A CD2   1 
ATOM   5643 N  N     . GLY A 1 694 ? -18.126 23.905 2.918   1.00 58.66  ? 694  GLY A N     1 
ATOM   5644 C  CA    . GLY A 1 694 ? -19.347 23.122 2.863   1.00 58.73  ? 694  GLY A CA    1 
ATOM   5645 C  C     . GLY A 1 694 ? -20.161 23.181 4.139   1.00 57.38  ? 694  GLY A C     1 
ATOM   5646 O  O     . GLY A 1 694 ? -21.235 22.588 4.226   1.00 55.77  ? 694  GLY A O     1 
ATOM   5647 N  N     . SER A 1 695 ? -19.645 23.900 5.130   1.00 58.58  ? 695  SER A N     1 
ATOM   5648 C  CA    . SER A 1 695 ? -20.323 24.057 6.411   1.00 57.00  ? 695  SER A CA    1 
ATOM   5649 C  C     . SER A 1 695 ? -21.339 25.188 6.352   1.00 56.58  ? 695  SER A C     1 
ATOM   5650 O  O     . SER A 1 695 ? -21.463 25.875 5.337   1.00 57.72  ? 695  SER A O     1 
ATOM   5651 C  CB    . SER A 1 695 ? -19.310 24.359 7.512   1.00 54.79  ? 695  SER A CB    1 
ATOM   5652 O  OG    . SER A 1 695 ? -18.795 25.672 7.362   1.00 52.65  ? 695  SER A OG    1 
ATOM   5653 N  N     . LYS A 1 696 ? -22.057 25.382 7.454   1.00 55.64  ? 696  LYS A N     1 
ATOM   5654 C  CA    . LYS A 1 696 ? -23.035 26.457 7.552   1.00 55.18  ? 696  LYS A CA    1 
ATOM   5655 C  C     . LYS A 1 696 ? -22.491 27.612 8.390   1.00 54.05  ? 696  LYS A C     1 
ATOM   5656 O  O     . LYS A 1 696 ? -23.223 28.545 8.728   1.00 52.49  ? 696  LYS A O     1 
ATOM   5657 C  CB    . LYS A 1 696 ? -24.351 25.943 8.141   1.00 54.94  ? 696  LYS A CB    1 
ATOM   5658 N  N     . GLY A 1 697 ? -21.203 27.545 8.719   1.00 53.17  ? 697  GLY A N     1 
ATOM   5659 C  CA    . GLY A 1 697 ? -20.551 28.602 9.471   1.00 48.51  ? 697  GLY A CA    1 
ATOM   5660 C  C     . GLY A 1 697 ? -20.493 29.893 8.681   1.00 47.10  ? 697  GLY A C     1 
ATOM   5661 O  O     . GLY A 1 697 ? -20.432 29.873 7.452   1.00 48.63  ? 697  GLY A O     1 
ATOM   5662 N  N     . ILE A 1 698 ? -20.515 31.020 9.384   1.00 44.81  ? 698  ILE A N     1 
ATOM   5663 C  CA    . ILE A 1 698 ? -20.567 32.322 8.729   1.00 42.64  ? 698  ILE A CA    1 
ATOM   5664 C  C     . ILE A 1 698 ? -19.181 32.925 8.516   1.00 41.51  ? 698  ILE A C     1 
ATOM   5665 O  O     . ILE A 1 698 ? -19.046 33.978 7.895   1.00 41.00  ? 698  ILE A O     1 
ATOM   5666 C  CB    . ILE A 1 698 ? -21.435 33.315 9.521   1.00 40.64  ? 698  ILE A CB    1 
ATOM   5667 C  CG1   . ILE A 1 698 ? -20.828 33.558 10.902  1.00 39.19  ? 698  ILE A CG1   1 
ATOM   5668 C  CG2   . ILE A 1 698 ? -22.856 32.792 9.644   1.00 40.41  ? 698  ILE A CG2   1 
ATOM   5669 C  CD1   . ILE A 1 698 ? -21.622 34.511 11.763  1.00 37.51  ? 698  ILE A CD1   1 
ATOM   5670 N  N     . GLY A 1 699 ? -18.157 32.255 9.034   1.00 40.40  ? 699  GLY A N     1 
ATOM   5671 C  CA    . GLY A 1 699 ? -16.788 32.697 8.846   1.00 40.63  ? 699  GLY A CA    1 
ATOM   5672 C  C     . GLY A 1 699 ? -16.359 33.769 9.829   1.00 42.98  ? 699  GLY A C     1 
ATOM   5673 O  O     . GLY A 1 699 ? -15.408 33.580 10.588  1.00 46.49  ? 699  GLY A O     1 
ATOM   5674 N  N     . GLY A 1 700 ? -17.056 34.900 9.819   1.00 41.16  ? 700  GLY A N     1 
ATOM   5675 C  CA    . GLY A 1 700 ? -16.719 35.993 10.712  1.00 38.32  ? 700  GLY A CA    1 
ATOM   5676 C  C     . GLY A 1 700 ? -17.815 37.032 10.838  1.00 36.76  ? 700  GLY A C     1 
ATOM   5677 O  O     . GLY A 1 700 ? -18.803 36.992 10.104  1.00 38.83  ? 700  GLY A O     1 
ATOM   5678 N  N     . PHE A 1 701 ? -17.648 37.957 11.780  1.00 33.71  ? 701  PHE A N     1 
ATOM   5679 C  CA    . PHE A 1 701 ? -18.558 39.091 11.899  1.00 34.27  ? 701  PHE A CA    1 
ATOM   5680 C  C     . PHE A 1 701 ? -17.926 40.290 12.591  1.00 35.02  ? 701  PHE A C     1 
ATOM   5681 O  O     . PHE A 1 701 ? -16.944 40.158 13.323  1.00 33.13  ? 701  PHE A O     1 
ATOM   5682 C  CB    . PHE A 1 701 ? -19.857 38.697 12.614  1.00 33.40  ? 701  PHE A CB    1 
ATOM   5683 C  CG    . PHE A 1 701 ? -19.677 38.302 14.055  1.00 32.83  ? 701  PHE A CG    1 
ATOM   5684 C  CD1   . PHE A 1 701 ? -19.530 36.972 14.408  1.00 34.57  ? 701  PHE A CD1   1 
ATOM   5685 C  CD2   . PHE A 1 701 ? -19.689 39.258 15.060  1.00 35.52  ? 701  PHE A CD2   1 
ATOM   5686 C  CE1   . PHE A 1 701 ? -19.379 36.602 15.735  1.00 35.12  ? 701  PHE A CE1   1 
ATOM   5687 C  CE2   . PHE A 1 701 ? -19.536 38.896 16.386  1.00 35.03  ? 701  PHE A CE2   1 
ATOM   5688 C  CZ    . PHE A 1 701 ? -19.381 37.567 16.724  1.00 34.59  ? 701  PHE A CZ    1 
ATOM   5689 N  N     . TRP A 1 702 ? -18.511 41.458 12.344  1.00 36.52  ? 702  TRP A N     1 
ATOM   5690 C  CA    . TRP A 1 702 ? -18.159 42.694 13.031  1.00 32.98  ? 702  TRP A CA    1 
ATOM   5691 C  C     . TRP A 1 702 ? -19.408 43.247 13.700  1.00 34.39  ? 702  TRP A C     1 
ATOM   5692 O  O     . TRP A 1 702 ? -20.502 43.165 13.139  1.00 37.93  ? 702  TRP A O     1 
ATOM   5693 C  CB    . TRP A 1 702 ? -17.636 43.721 12.029  1.00 33.19  ? 702  TRP A CB    1 
ATOM   5694 C  CG    . TRP A 1 702 ? -16.149 43.773 11.916  1.00 34.09  ? 702  TRP A CG    1 
ATOM   5695 C  CD1   . TRP A 1 702 ? -15.316 44.685 12.497  1.00 32.24  ? 702  TRP A CD1   1 
ATOM   5696 C  CD2   . TRP A 1 702 ? -15.313 42.882 11.172  1.00 34.23  ? 702  TRP A CD2   1 
ATOM   5697 N  NE1   . TRP A 1 702 ? -14.013 44.415 12.162  1.00 31.25  ? 702  TRP A NE1   1 
ATOM   5698 C  CE2   . TRP A 1 702 ? -13.983 43.314 11.347  1.00 33.49  ? 702  TRP A CE2   1 
ATOM   5699 C  CE3   . TRP A 1 702 ? -15.558 41.759 10.378  1.00 36.13  ? 702  TRP A CE3   1 
ATOM   5700 C  CZ2   . TRP A 1 702 ? -12.903 42.661 10.761  1.00 34.02  ? 702  TRP A CZ2   1 
ATOM   5701 C  CZ3   . TRP A 1 702 ? -14.485 41.113 9.794   1.00 38.80  ? 702  TRP A CZ3   1 
ATOM   5702 C  CH2   . TRP A 1 702 ? -13.174 41.567 9.988   1.00 37.79  ? 702  TRP A CH2   1 
ATOM   5703 N  N     . THR A 1 703 ? -19.255 43.807 14.895  1.00 32.53  ? 703  THR A N     1 
ATOM   5704 C  CA    . THR A 1 703 ? -20.376 44.465 15.559  1.00 34.33  ? 703  THR A CA    1 
ATOM   5705 C  C     . THR A 1 703 ? -20.194 45.975 15.508  1.00 33.16  ? 703  THR A C     1 
ATOM   5706 O  O     . THR A 1 703 ? -21.158 46.731 15.612  1.00 32.59  ? 703  THR A O     1 
ATOM   5707 C  CB    . THR A 1 703 ? -20.538 44.015 17.027  1.00 34.07  ? 703  THR A CB    1 
ATOM   5708 O  OG1   . THR A 1 703 ? -19.545 44.645 17.845  1.00 33.08  ? 703  THR A OG1   1 
ATOM   5709 C  CG2   . THR A 1 703 ? -20.421 42.500 17.140  1.00 33.50  ? 703  THR A CG2   1 
ATOM   5710 N  N     . GLY A 1 704 ? -18.946 46.399 15.338  1.00 34.44  ? 704  GLY A N     1 
ATOM   5711 C  CA    . GLY A 1 704 ? -18.597 47.809 15.284  1.00 35.61  ? 704  GLY A CA    1 
ATOM   5712 C  C     . GLY A 1 704 ? -17.088 47.962 15.318  1.00 34.09  ? 704  GLY A C     1 
ATOM   5713 O  O     . GLY A 1 704 ? -16.359 46.990 15.109  1.00 33.15  ? 704  GLY A O     1 
ATOM   5714 N  N     . LYS A 1 705 ? -16.615 49.177 15.575  1.00 31.32  ? 705  LYS A N     1 
ATOM   5715 C  CA    . LYS A 1 705 ? -15.182 49.419 15.690  1.00 30.78  ? 705  LYS A CA    1 
ATOM   5716 C  C     . LYS A 1 705 ? -14.561 48.591 16.810  1.00 31.07  ? 705  LYS A C     1 
ATOM   5717 O  O     . LYS A 1 705 ? -15.114 48.503 17.909  1.00 31.16  ? 705  LYS A O     1 
ATOM   5718 C  CB    . LYS A 1 705 ? -14.902 50.897 15.949  1.00 30.63  ? 705  LYS A CB    1 
ATOM   5719 C  CG    . LYS A 1 705 ? -15.123 51.807 14.757  1.00 30.55  ? 705  LYS A CG    1 
ATOM   5720 C  CD    . LYS A 1 705 ? -14.626 53.204 15.078  1.00 26.61  ? 705  LYS A CD    1 
ATOM   5721 C  CE    . LYS A 1 705 ? -14.890 54.166 13.943  1.00 24.51  ? 705  LYS A CE    1 
ATOM   5722 N  NZ    . LYS A 1 705 ? -14.452 55.538 14.306  1.00 24.23  ? 705  LYS A NZ    1 
ATOM   5723 N  N     . LYS A 1 706 ? -13.415 47.982 16.513  1.00 31.60  ? 706  LYS A N     1 
ATOM   5724 C  CA    . LYS A 1 706 ? -12.637 47.221 17.495  1.00 30.10  ? 706  LYS A CA    1 
ATOM   5725 C  C     . LYS A 1 706 ? -13.391 46.030 18.090  1.00 29.36  ? 706  LYS A C     1 
ATOM   5726 O  O     . LYS A 1 706 ? -13.037 45.535 19.158  1.00 30.21  ? 706  LYS A O     1 
ATOM   5727 C  CB    . LYS A 1 706 ? -12.115 48.147 18.604  1.00 27.34  ? 706  LYS A CB    1 
ATOM   5728 C  CG    . LYS A 1 706 ? -11.140 49.203 18.104  1.00 26.09  ? 706  LYS A CG    1 
ATOM   5729 C  CD    . LYS A 1 706 ? -10.825 50.230 19.174  1.00 25.01  ? 706  LYS A CD    1 
ATOM   5730 C  CE    . LYS A 1 706 ? -9.929  51.332 18.623  1.00 25.66  ? 706  LYS A CE    1 
ATOM   5731 N  NZ    . LYS A 1 706 ? -8.545  50.865 18.330  1.00 25.90  ? 706  LYS A NZ    1 
ATOM   5732 N  N     . ARG A 1 707 ? -14.420 45.568 17.388  1.00 27.83  ? 707  ARG A N     1 
ATOM   5733 C  CA    . ARG A 1 707 ? -15.220 44.443 17.859  1.00 27.22  ? 707  ARG A CA    1 
ATOM   5734 C  C     . ARG A 1 707 ? -15.552 43.491 16.724  1.00 30.97  ? 707  ARG A C     1 
ATOM   5735 O  O     . ARG A 1 707 ? -16.444 43.758 15.919  1.00 35.48  ? 707  ARG A O     1 
ATOM   5736 C  CB    . ARG A 1 707 ? -16.511 44.935 18.512  1.00 26.07  ? 707  ARG A CB    1 
ATOM   5737 C  CG    . ARG A 1 707 ? -16.337 45.438 19.930  1.00 27.56  ? 707  ARG A CG    1 
ATOM   5738 C  CD    . ARG A 1 707 ? -17.656 45.931 20.511  1.00 31.56  ? 707  ARG A CD    1 
ATOM   5739 N  NE    . ARG A 1 707 ? -18.624 44.853 20.721  1.00 35.09  ? 707  ARG A NE    1 
ATOM   5740 C  CZ    . ARG A 1 707 ? -18.737 44.160 21.851  1.00 34.24  ? 707  ARG A CZ    1 
ATOM   5741 N  NH1   . ARG A 1 707 ? -17.936 44.424 22.877  1.00 30.58  ? 707  ARG A NH1   1 
ATOM   5742 N  NH2   . ARG A 1 707 ? -19.647 43.200 21.958  1.00 34.52  ? 707  ARG A NH2   1 
ATOM   5743 N  N     . TYR A 1 708 ? -14.839 42.373 16.666  1.00 24.97  ? 708  TYR A N     1 
ATOM   5744 C  CA    . TYR A 1 708 ? -15.057 41.407 15.602  1.00 29.38  ? 708  TYR A CA    1 
ATOM   5745 C  C     . TYR A 1 708 ? -14.527 40.018 15.932  1.00 31.92  ? 708  TYR A C     1 
ATOM   5746 O  O     . TYR A 1 708 ? -13.764 39.836 16.882  1.00 32.16  ? 708  TYR A O     1 
ATOM   5747 C  CB    . TYR A 1 708 ? -14.440 41.901 14.299  1.00 29.81  ? 708  TYR A CB    1 
ATOM   5748 C  CG    . TYR A 1 708 ? -12.952 42.148 14.361  1.00 32.38  ? 708  TYR A CG    1 
ATOM   5749 C  CD1   . TYR A 1 708 ? -12.447 43.347 14.842  1.00 31.28  ? 708  TYR A CD1   1 
ATOM   5750 C  CD2   . TYR A 1 708 ? -12.051 41.190 13.919  1.00 35.20  ? 708  TYR A CD2   1 
ATOM   5751 C  CE1   . TYR A 1 708 ? -11.087 43.580 14.895  1.00 30.84  ? 708  TYR A CE1   1 
ATOM   5752 C  CE2   . TYR A 1 708 ? -10.687 41.414 13.966  1.00 34.55  ? 708  TYR A CE2   1 
ATOM   5753 C  CZ    . TYR A 1 708 ? -10.212 42.612 14.451  1.00 33.13  ? 708  TYR A CZ    1 
ATOM   5754 O  OH    . TYR A 1 708 ? -8.855  42.835 14.504  1.00 33.57  ? 708  TYR A OH    1 
ATOM   5755 N  N     . ALA A 1 709 ? -14.943 39.040 15.135  1.00 31.78  ? 709  ALA A N     1 
ATOM   5756 C  CA    . ALA A 1 709 ? -14.530 37.661 15.334  1.00 32.81  ? 709  ALA A CA    1 
ATOM   5757 C  C     . ALA A 1 709 ? -14.308 37.002 13.985  1.00 34.60  ? 709  ALA A C     1 
ATOM   5758 O  O     . ALA A 1 709 ? -15.095 37.194 13.059  1.00 36.09  ? 709  ALA A O     1 
ATOM   5759 C  CB    . ALA A 1 709 ? -15.579 36.900 16.138  1.00 32.44  ? 709  ALA A CB    1 
ATOM   5760 N  N     . LEU A 1 710 ? -13.232 36.229 13.876  1.00 33.13  ? 710  LEU A N     1 
ATOM   5761 C  CA    . LEU A 1 710 ? -12.876 35.587 12.617  1.00 33.90  ? 710  LEU A CA    1 
ATOM   5762 C  C     . LEU A 1 710 ? -12.437 34.143 12.813  1.00 33.64  ? 710  LEU A C     1 
ATOM   5763 O  O     . LEU A 1 710 ? -11.694 33.831 13.743  1.00 35.46  ? 710  LEU A O     1 
ATOM   5764 C  CB    . LEU A 1 710 ? -11.756 36.364 11.922  1.00 32.69  ? 710  LEU A CB    1 
ATOM   5765 C  CG    . LEU A 1 710 ? -12.111 37.744 11.375  1.00 31.07  ? 710  LEU A CG    1 
ATOM   5766 C  CD1   . LEU A 1 710 ? -10.872 38.421 10.825  1.00 31.07  ? 710  LEU A CD1   1 
ATOM   5767 C  CD2   . LEU A 1 710 ? -13.184 37.627 10.307  1.00 31.36  ? 710  LEU A CD2   1 
ATOM   5768 N  N     . ASN A 1 711 ? -12.898 33.267 11.928  1.00 32.42  ? 711  ASN A N     1 
ATOM   5769 C  CA    . ASN A 1 711 ? -12.434 31.888 11.920  1.00 37.34  ? 711  ASN A CA    1 
ATOM   5770 C  C     . ASN A 1 711 ? -11.171 31.777 11.072  1.00 39.94  ? 711  ASN A C     1 
ATOM   5771 O  O     . ASN A 1 711 ? -11.242 31.561 9.862   1.00 39.62  ? 711  ASN A O     1 
ATOM   5772 C  CB    . ASN A 1 711 ? -13.518 30.953 11.383  1.00 39.01  ? 711  ASN A CB    1 
ATOM   5773 C  CG    . ASN A 1 711 ? -13.250 29.500 11.722  1.00 40.99  ? 711  ASN A CG    1 
ATOM   5774 O  OD1   . ASN A 1 711 ? -12.770 29.188 12.810  1.00 39.87  ? 711  ASN A OD1   1 
ATOM   5775 N  ND2   . ASN A 1 711 ? -13.549 28.604 10.787  1.00 44.27  ? 711  ASN A ND2   1 
ATOM   5776 N  N     . VAL A 1 712 ? -10.017 31.929 11.714  1.00 39.95  ? 712  VAL A N     1 
ATOM   5777 C  CA    . VAL A 1 712 ? -8.747  32.019 11.003  1.00 40.03  ? 712  VAL A CA    1 
ATOM   5778 C  C     . VAL A 1 712 ? -8.105  30.656 10.745  1.00 43.28  ? 712  VAL A C     1 
ATOM   5779 O  O     . VAL A 1 712 ? -8.015  29.816 11.641  1.00 43.81  ? 712  VAL A O     1 
ATOM   5780 C  CB    . VAL A 1 712 ? -7.758  32.928 11.756  1.00 36.30  ? 712  VAL A CB    1 
ATOM   5781 C  CG1   . VAL A 1 712 ? -6.414  32.966 11.047  1.00 33.67  ? 712  VAL A CG1   1 
ATOM   5782 C  CG2   . VAL A 1 712 ? -8.337  34.330 11.889  1.00 37.38  ? 712  VAL A CG2   1 
ATOM   5783 N  N     . TRP A 1 713 ? -7.665  30.452 9.506   1.00 43.52  ? 713  TRP A N     1 
ATOM   5784 C  CA    . TRP A 1 713 ? -7.007  29.217 9.103   1.00 41.89  ? 713  TRP A CA    1 
ATOM   5785 C  C     . TRP A 1 713 ? -5.501  29.412 8.979   1.00 43.58  ? 713  TRP A C     1 
ATOM   5786 O  O     . TRP A 1 713 ? -4.724  28.489 9.228   1.00 46.36  ? 713  TRP A O     1 
ATOM   5787 C  CB    . TRP A 1 713 ? -7.587  28.721 7.780   1.00 42.72  ? 713  TRP A CB    1 
ATOM   5788 C  CG    . TRP A 1 713 ? -9.037  28.411 7.878   1.00 42.16  ? 713  TRP A CG    1 
ATOM   5789 C  CD1   . TRP A 1 713 ? -10.075 29.262 7.639   1.00 40.97  ? 713  TRP A CD1   1 
ATOM   5790 C  CD2   . TRP A 1 713 ? -9.619  27.162 8.263   1.00 41.11  ? 713  TRP A CD2   1 
ATOM   5791 N  NE1   . TRP A 1 713 ? -11.271 28.618 7.844   1.00 41.76  ? 713  TRP A NE1   1 
ATOM   5792 C  CE2   . TRP A 1 713 ? -11.018 27.327 8.229   1.00 41.61  ? 713  TRP A CE2   1 
ATOM   5793 C  CE3   . TRP A 1 713 ? -9.094  25.920 8.629   1.00 39.15  ? 713  TRP A CE3   1 
ATOM   5794 C  CZ2   . TRP A 1 713 ? -11.898 26.298 8.548   1.00 40.80  ? 713  TRP A CZ2   1 
ATOM   5795 C  CZ3   . TRP A 1 713 ? -9.969  24.899 8.945   1.00 40.27  ? 713  TRP A CZ3   1 
ATOM   5796 C  CH2   . TRP A 1 713 ? -11.356 25.094 8.902   1.00 41.12  ? 713  TRP A CH2   1 
ATOM   5797 N  N     . ASP A 1 714 ? -5.093  30.617 8.593   1.00 42.44  ? 714  ASP A N     1 
ATOM   5798 C  CA    . ASP A 1 714 ? -3.674  30.935 8.478   1.00 41.02  ? 714  ASP A CA    1 
ATOM   5799 C  C     . ASP A 1 714 ? -3.374  32.329 9.019   1.00 39.25  ? 714  ASP A C     1 
ATOM   5800 O  O     . ASP A 1 714 ? -4.118  33.277 8.768   1.00 39.53  ? 714  ASP A O     1 
ATOM   5801 C  CB    . ASP A 1 714 ? -3.205  30.821 7.027   1.00 42.20  ? 714  ASP A CB    1 
ATOM   5802 C  CG    . ASP A 1 714 ? -1.693  30.800 6.907   1.00 43.83  ? 714  ASP A CG    1 
ATOM   5803 O  OD1   . ASP A 1 714 ? -1.062  31.869 7.057   1.00 45.86  ? 714  ASP A OD1   1 
ATOM   5804 O  OD2   . ASP A 1 714 ? -1.136  29.712 6.662   1.00 45.03  ? 714  ASP A OD2   1 
ATOM   5805 N  N     . MET A 1 715 ? -2.275  32.445 9.758   1.00 38.63  ? 715  MET A N     1 
ATOM   5806 C  CA    . MET A 1 715 ? -1.893  33.708 10.378  1.00 36.64  ? 715  MET A CA    1 
ATOM   5807 C  C     . MET A 1 715 ? -0.395  33.969 10.228  1.00 41.11  ? 715  MET A C     1 
ATOM   5808 O  O     . MET A 1 715 ? 0.421   33.307 10.871  1.00 44.40  ? 715  MET A O     1 
ATOM   5809 C  CB    . MET A 1 715 ? -2.281  33.709 11.859  1.00 32.27  ? 715  MET A CB    1 
ATOM   5810 C  CG    . MET A 1 715 ? -1.918  34.986 12.594  1.00 31.73  ? 715  MET A CG    1 
ATOM   5811 S  SD    . MET A 1 715 ? -2.971  36.381 12.133  1.00 52.79  ? 715  MET A SD    1 
ATOM   5812 C  CE    . MET A 1 715 ? -4.554  35.806 12.737  1.00 57.31  ? 715  MET A CE    1 
ATOM   5813 N  N     . GLU A 1 716 ? -0.049  34.938 9.381   1.00 41.44  ? 716  GLU A N     1 
ATOM   5814 C  CA    . GLU A 1 716 ? 1.345   35.296 9.100   1.00 42.97  ? 716  GLU A CA    1 
ATOM   5815 C  C     . GLU A 1 716 ? 2.191   34.099 8.666   1.00 41.46  ? 716  GLU A C     1 
ATOM   5816 O  O     . GLU A 1 716 ? 3.362   33.997 9.027   1.00 42.80  ? 716  GLU A O     1 
ATOM   5817 C  CB    . GLU A 1 716 ? 2.000   35.990 10.301  1.00 49.05  ? 716  GLU A CB    1 
ATOM   5818 C  CG    . GLU A 1 716 ? 1.530   37.410 10.546  1.00 56.91  ? 716  GLU A CG    1 
ATOM   5819 C  CD    . GLU A 1 716 ? 2.195   38.036 11.756  1.00 63.02  ? 716  GLU A CD    1 
ATOM   5820 O  OE1   . GLU A 1 716 ? 2.986   38.985 11.567  1.00 66.06  ? 716  GLU A OE1   1 
ATOM   5821 O  OE2   . GLU A 1 716 ? 1.926   37.579 12.890  1.00 63.29  ? 716  GLU A OE2   1 
ATOM   5822 N  N     . GLY A 1 717 ? 1.595   33.195 7.898   1.00 39.00  ? 717  GLY A N     1 
ATOM   5823 C  CA    . GLY A 1 717 ? 2.322   32.052 7.381   1.00 35.39  ? 717  GLY A CA    1 
ATOM   5824 C  C     . GLY A 1 717 ? 2.252   30.831 8.277   1.00 44.88  ? 717  GLY A C     1 
ATOM   5825 O  O     . GLY A 1 717 ? 2.945   29.839 8.051   1.00 45.59  ? 717  GLY A O     1 
ATOM   5826 N  N     . THR A 1 718 ? 1.419   30.903 9.307   1.00 44.60  ? 718  THR A N     1 
ATOM   5827 C  CA    . THR A 1 718 ? 1.208   29.754 10.176  1.00 45.47  ? 718  THR A CA    1 
ATOM   5828 C  C     . THR A 1 718 ? -0.105  29.074 9.823   1.00 45.36  ? 718  THR A C     1 
ATOM   5829 O  O     . THR A 1 718 ? -1.181  29.615 10.070  1.00 44.97  ? 718  THR A O     1 
ATOM   5830 C  CB    . THR A 1 718 ? 1.210   30.146 11.666  1.00 44.51  ? 718  THR A CB    1 
ATOM   5831 O  OG1   . THR A 1 718 ? 2.509   30.629 12.029  1.00 46.72  ? 718  THR A OG1   1 
ATOM   5832 C  CG2   . THR A 1 718 ? 0.875   28.945 12.538  1.00 42.96  ? 718  THR A CG2   1 
ATOM   5833 N  N     . ARG A 1 719 ? -0.005  27.890 9.229   1.00 44.84  ? 719  ARG A N     1 
ATOM   5834 C  CA    . ARG A 1 719 ? -1.184  27.116 8.871   1.00 47.15  ? 719  ARG A CA    1 
ATOM   5835 C  C     . ARG A 1 719 ? -1.583  26.225 10.037  1.00 50.52  ? 719  ARG A C     1 
ATOM   5836 O  O     . ARG A 1 719 ? -0.963  25.188 10.279  1.00 54.04  ? 719  ARG A O     1 
ATOM   5837 C  CB    . ARG A 1 719 ? -0.912  26.263 7.632   1.00 47.82  ? 719  ARG A CB    1 
ATOM   5838 C  CG    . ARG A 1 719 ? -2.169  25.754 6.947   1.00 47.67  ? 719  ARG A CG    1 
ATOM   5839 C  CD    . ARG A 1 719 ? -2.937  26.897 6.309   1.00 47.20  ? 719  ARG A CD    1 
ATOM   5840 N  NE    . ARG A 1 719 ? -2.131  27.590 5.308   1.00 48.81  ? 719  ARG A NE    1 
ATOM   5841 C  CZ    . ARG A 1 719 ? -2.186  27.343 4.004   1.00 52.74  ? 719  ARG A CZ    1 
ATOM   5842 N  NH1   . ARG A 1 719 ? -3.019  26.423 3.537   1.00 53.99  ? 719  ARG A NH1   1 
ATOM   5843 N  NH2   . ARG A 1 719 ? -1.414  28.021 3.165   1.00 55.48  ? 719  ARG A NH2   1 
ATOM   5844 N  N     . TYR A 1 720 ? -2.618  26.639 10.758  1.00 49.33  ? 720  TYR A N     1 
ATOM   5845 C  CA    . TYR A 1 720 ? -3.084  25.912 11.934  1.00 49.46  ? 720  TYR A CA    1 
ATOM   5846 C  C     . TYR A 1 720 ? -3.614  24.527 11.570  1.00 51.55  ? 720  TYR A C     1 
ATOM   5847 O  O     . TYR A 1 720 ? -4.211  24.343 10.510  1.00 53.88  ? 720  TYR A O     1 
ATOM   5848 C  CB    . TYR A 1 720 ? -4.176  26.717 12.637  1.00 48.53  ? 720  TYR A CB    1 
ATOM   5849 C  CG    . TYR A 1 720 ? -3.727  28.078 13.125  1.00 49.56  ? 720  TYR A CG    1 
ATOM   5850 C  CD1   . TYR A 1 720 ? -2.563  28.221 13.868  1.00 50.78  ? 720  TYR A CD1   1 
ATOM   5851 C  CD2   . TYR A 1 720 ? -4.466  29.220 12.838  1.00 47.14  ? 720  TYR A CD2   1 
ATOM   5852 C  CE1   . TYR A 1 720 ? -2.150  29.462 14.317  1.00 50.59  ? 720  TYR A CE1   1 
ATOM   5853 C  CE2   . TYR A 1 720 ? -4.061  30.464 13.280  1.00 46.91  ? 720  TYR A CE2   1 
ATOM   5854 C  CZ    . TYR A 1 720 ? -2.903  30.580 14.019  1.00 49.82  ? 720  TYR A CZ    1 
ATOM   5855 O  OH    . TYR A 1 720 ? -2.494  31.816 14.464  1.00 51.98  ? 720  TYR A OH    1 
ATOM   5856 N  N     . ALA A 1 721 ? -3.388  23.557 12.451  1.00 53.34  ? 721  ALA A N     1 
ATOM   5857 C  CA    . ALA A 1 721 ? -3.919  22.209 12.262  1.00 54.67  ? 721  ALA A CA    1 
ATOM   5858 C  C     . ALA A 1 721 ? -5.436  22.222 12.424  1.00 57.13  ? 721  ALA A C     1 
ATOM   5859 O  O     . ALA A 1 721 ? -6.157  21.540 11.694  1.00 59.87  ? 721  ALA A O     1 
ATOM   5860 C  CB    . ALA A 1 721 ? -3.286  21.244 13.250  1.00 53.08  ? 721  ALA A CB    1 
ATOM   5861 N  N     . GLU A 1 722 ? -5.904  23.002 13.394  1.00 57.15  ? 722  GLU A N     1 
ATOM   5862 C  CA    . GLU A 1 722 ? -7.328  23.260 13.587  1.00 57.06  ? 722  GLU A CA    1 
ATOM   5863 C  C     . GLU A 1 722 ? -7.549  24.766 13.568  1.00 50.33  ? 722  GLU A C     1 
ATOM   5864 O  O     . GLU A 1 722 ? -6.719  25.513 14.080  1.00 50.31  ? 722  GLU A O     1 
ATOM   5865 C  CB    . GLU A 1 722 ? -7.810  22.681 14.920  1.00 61.54  ? 722  GLU A CB    1 
ATOM   5866 C  CG    . GLU A 1 722 ? -7.869  21.167 14.949  1.00 68.47  ? 722  GLU A CG    1 
ATOM   5867 C  CD    . GLU A 1 722 ? -8.810  20.604 13.900  1.00 75.01  ? 722  GLU A CD    1 
ATOM   5868 O  OE1   . GLU A 1 722 ? -9.886  21.202 13.684  1.00 76.91  ? 722  GLU A OE1   1 
ATOM   5869 O  OE2   . GLU A 1 722 ? -8.469  19.569 13.286  1.00 77.23  ? 722  GLU A OE2   1 
ATOM   5870 N  N     . PRO A 1 723 ? -8.670  25.220 12.982  1.00 46.52  ? 723  PRO A N     1 
ATOM   5871 C  CA    . PRO A 1 723 ? -8.915  26.661 12.869  1.00 42.65  ? 723  PRO A CA    1 
ATOM   5872 C  C     . PRO A 1 723 ? -8.934  27.348 14.231  1.00 42.13  ? 723  PRO A C     1 
ATOM   5873 O  O     . PRO A 1 723 ? -9.498  26.818 15.190  1.00 40.24  ? 723  PRO A O     1 
ATOM   5874 C  CB    . PRO A 1 723 ? -10.294 26.734 12.204  1.00 39.85  ? 723  PRO A CB    1 
ATOM   5875 C  CG    . PRO A 1 723 ? -10.925 25.431 12.487  1.00 41.55  ? 723  PRO A CG    1 
ATOM   5876 C  CD    . PRO A 1 723 ? -9.809  24.433 12.481  1.00 45.60  ? 723  PRO A CD    1 
ATOM   5877 N  N     . LYS A 1 724 ? -8.296  28.512 14.305  1.00 42.83  ? 724  LYS A N     1 
ATOM   5878 C  CA    . LYS A 1 724 ? -8.219  29.279 15.542  1.00 42.31  ? 724  LYS A CA    1 
ATOM   5879 C  C     . LYS A 1 724 ? -9.085  30.527 15.436  1.00 43.20  ? 724  LYS A C     1 
ATOM   5880 O  O     . LYS A 1 724 ? -9.029  31.245 14.436  1.00 43.64  ? 724  LYS A O     1 
ATOM   5881 C  CB    . LYS A 1 724 ? -6.767  29.669 15.841  1.00 38.65  ? 724  LYS A CB    1 
ATOM   5882 C  CG    . LYS A 1 724 ? -6.590  30.557 17.066  1.00 34.34  ? 724  LYS A CG    1 
ATOM   5883 N  N     . LEU A 1 725 ? -9.892  30.778 16.463  1.00 37.33  ? 725  LEU A N     1 
ATOM   5884 C  CA    . LEU A 1 725 ? -10.746 31.958 16.480  1.00 35.67  ? 725  LEU A CA    1 
ATOM   5885 C  C     . LEU A 1 725 ? -9.936  33.204 16.799  1.00 39.90  ? 725  LEU A C     1 
ATOM   5886 O  O     . LEU A 1 725 ? -9.272  33.269 17.833  1.00 45.22  ? 725  LEU A O     1 
ATOM   5887 C  CB    . LEU A 1 725 ? -11.856 31.806 17.517  1.00 29.83  ? 725  LEU A CB    1 
ATOM   5888 C  CG    . LEU A 1 725 ? -12.849 30.664 17.326  1.00 30.42  ? 725  LEU A CG    1 
ATOM   5889 C  CD1   . LEU A 1 725 ? -13.917 30.735 18.396  1.00 29.16  ? 725  LEU A CD1   1 
ATOM   5890 C  CD2   . LEU A 1 725 ? -13.467 30.723 15.943  1.00 32.96  ? 725  LEU A CD2   1 
ATOM   5891 N  N     . LYS A 1 726 ? -9.981  34.191 15.913  1.00 37.76  ? 726  LYS A N     1 
ATOM   5892 C  CA    . LYS A 1 726 ? -9.413  35.491 16.238  1.00 34.88  ? 726  LYS A CA    1 
ATOM   5893 C  C     . LYS A 1 726 ? -10.533 36.434 16.638  1.00 31.57  ? 726  LYS A C     1 
ATOM   5894 O  O     . LYS A 1 726 ? -11.236 36.976 15.787  1.00 34.00  ? 726  LYS A O     1 
ATOM   5895 C  CB    . LYS A 1 726 ? -8.626  36.077 15.069  1.00 36.07  ? 726  LYS A CB    1 
ATOM   5896 C  CG    . LYS A 1 726 ? -7.942  37.390 15.420  1.00 37.97  ? 726  LYS A CG    1 
ATOM   5897 C  CD    . LYS A 1 726 ? -7.364  38.070 14.195  1.00 42.72  ? 726  LYS A CD    1 
ATOM   5898 C  CE    . LYS A 1 726 ? -6.675  39.375 14.564  1.00 44.55  ? 726  LYS A CE    1 
ATOM   5899 N  NZ    . LYS A 1 726 ? -5.486  39.149 15.432  1.00 46.45  ? 726  LYS A NZ    1 
ATOM   5900 N  N     . ILE A 1 727 ? -10.705 36.615 17.941  1.00 27.52  ? 727  ILE A N     1 
ATOM   5901 C  CA    . ILE A 1 727 ? -11.752 37.488 18.451  1.00 27.62  ? 727  ILE A CA    1 
ATOM   5902 C  C     . ILE A 1 727 ? -11.146 38.727 19.088  1.00 28.90  ? 727  ILE A C     1 
ATOM   5903 O  O     . ILE A 1 727 ? -10.309 38.629 19.986  1.00 30.20  ? 727  ILE A O     1 
ATOM   5904 C  CB    . ILE A 1 727 ? -12.626 36.772 19.493  1.00 26.62  ? 727  ILE A CB    1 
ATOM   5905 C  CG1   . ILE A 1 727 ? -13.152 35.449 18.929  1.00 26.44  ? 727  ILE A CG1   1 
ATOM   5906 C  CG2   . ILE A 1 727 ? -13.769 37.670 19.926  1.00 22.39  ? 727  ILE A CG2   1 
ATOM   5907 C  CD1   . ILE A 1 727 ? -13.918 34.628 19.937  1.00 24.70  ? 727  ILE A CD1   1 
ATOM   5908 N  N     . MET A 1 728 ? -11.566 39.894 18.619  1.00 28.17  ? 728  MET A N     1 
ATOM   5909 C  CA    . MET A 1 728 ? -11.069 41.141 19.169  1.00 25.65  ? 728  MET A CA    1 
ATOM   5910 C  C     . MET A 1 728 ? -12.203 41.969 19.770  1.00 25.71  ? 728  MET A C     1 
ATOM   5911 O  O     . MET A 1 728 ? -13.279 42.086 19.185  1.00 27.40  ? 728  MET A O     1 
ATOM   5912 C  CB    . MET A 1 728 ? -10.333 41.944 18.093  1.00 26.89  ? 728  MET A CB    1 
ATOM   5913 C  CG    . MET A 1 728 ? -9.373  41.118 17.240  1.00 29.38  ? 728  MET A CG    1 
ATOM   5914 S  SD    . MET A 1 728 ? -8.045  40.291 18.139  1.00 38.81  ? 728  MET A SD    1 
ATOM   5915 C  CE    . MET A 1 728 ? -7.172  41.690 18.835  1.00 22.34  ? 728  MET A CE    1 
ATOM   5916 N  N     . GLY A 1 729 ? -11.958 42.523 20.953  1.00 25.28  ? 729  GLY A N     1 
ATOM   5917 C  CA    . GLY A 1 729 ? -12.879 43.460 21.569  1.00 24.37  ? 729  GLY A CA    1 
ATOM   5918 C  C     . GLY A 1 729 ? -14.097 42.849 22.232  1.00 23.53  ? 729  GLY A C     1 
ATOM   5919 O  O     . GLY A 1 729 ? -14.593 43.382 23.225  1.00 25.43  ? 729  GLY A O     1 
ATOM   5920 N  N     . LEU A 1 730 ? -14.584 41.737 21.690  1.00 22.52  ? 730  LEU A N     1 
ATOM   5921 C  CA    . LEU A 1 730 ? -15.782 41.095 22.223  1.00 24.70  ? 730  LEU A CA    1 
ATOM   5922 C  C     . LEU A 1 730 ? -15.568 40.615 23.657  1.00 29.55  ? 730  LEU A C     1 
ATOM   5923 O  O     . LEU A 1 730 ? -14.431 40.470 24.111  1.00 30.49  ? 730  LEU A O     1 
ATOM   5924 C  CB    . LEU A 1 730 ? -16.233 39.940 21.327  1.00 24.06  ? 730  LEU A CB    1 
ATOM   5925 C  CG    . LEU A 1 730 ? -16.413 40.291 19.848  1.00 24.89  ? 730  LEU A CG    1 
ATOM   5926 C  CD1   . LEU A 1 730 ? -17.057 39.142 19.093  1.00 24.98  ? 730  LEU A CD1   1 
ATOM   5927 C  CD2   . LEU A 1 730 ? -17.229 41.564 19.689  1.00 26.53  ? 730  LEU A CD2   1 
ATOM   5928 N  N     . GLU A 1 731 ? -16.671 40.371 24.359  1.00 29.09  ? 731  GLU A N     1 
ATOM   5929 C  CA    . GLU A 1 731 ? -16.648 40.082 25.790  1.00 25.86  ? 731  GLU A CA    1 
ATOM   5930 C  C     . GLU A 1 731 ? -15.781 38.881 26.163  1.00 26.61  ? 731  GLU A C     1 
ATOM   5931 O  O     . GLU A 1 731 ? -15.264 38.803 27.278  1.00 26.57  ? 731  GLU A O     1 
ATOM   5932 C  CB    . GLU A 1 731 ? -18.075 39.901 26.311  1.00 24.40  ? 731  GLU A CB    1 
ATOM   5933 C  CG    . GLU A 1 731 ? -18.822 41.206 26.558  1.00 25.96  ? 731  GLU A CG    1 
ATOM   5934 C  CD    . GLU A 1 731 ? -19.125 41.983 25.288  1.00 34.46  ? 731  GLU A CD    1 
ATOM   5935 O  OE1   . GLU A 1 731 ? -19.001 41.413 24.183  1.00 36.33  ? 731  GLU A OE1   1 
ATOM   5936 O  OE2   . GLU A 1 731 ? -19.492 43.173 25.395  1.00 39.76  ? 731  GLU A OE2   1 
ATOM   5937 N  N     . THR A 1 732 ? -15.609 37.960 25.221  1.00 26.59  ? 732  THR A N     1 
ATOM   5938 C  CA    . THR A 1 732 ? -14.759 36.792 25.426  1.00 25.42  ? 732  THR A CA    1 
ATOM   5939 C  C     . THR A 1 732 ? -13.314 37.188 25.736  1.00 25.62  ? 732  THR A C     1 
ATOM   5940 O  O     . THR A 1 732 ? -12.547 36.398 26.284  1.00 27.08  ? 732  THR A O     1 
ATOM   5941 C  CB    . THR A 1 732 ? -14.758 35.886 24.181  1.00 27.12  ? 732  THR A CB    1 
ATOM   5942 O  OG1   . THR A 1 732 ? -14.345 36.646 23.040  1.00 29.82  ? 732  THR A OG1   1 
ATOM   5943 C  CG2   . THR A 1 732 ? -16.142 35.336 23.918  1.00 27.24  ? 732  THR A CG2   1 
ATOM   5944 N  N     . GLN A 1 733 ? -12.954 38.418 25.386  1.00 25.14  ? 733  GLN A N     1 
ATOM   5945 C  CA    . GLN A 1 733 ? -11.579 38.888 25.498  1.00 26.60  ? 733  GLN A CA    1 
ATOM   5946 C  C     . GLN A 1 733 ? -11.365 39.763 26.721  1.00 28.50  ? 733  GLN A C     1 
ATOM   5947 O  O     . GLN A 1 733 ? -10.234 40.138 27.039  1.00 28.72  ? 733  GLN A O     1 
ATOM   5948 C  CB    . GLN A 1 733 ? -11.209 39.678 24.246  1.00 26.36  ? 733  GLN A CB    1 
ATOM   5949 C  CG    . GLN A 1 733 ? -11.525 38.940 22.969  1.00 25.86  ? 733  GLN A CG    1 
ATOM   5950 C  CD    . GLN A 1 733 ? -10.873 37.578 22.940  1.00 28.75  ? 733  GLN A CD    1 
ATOM   5951 O  OE1   . GLN A 1 733 ? -9.650  37.468 22.853  1.00 34.45  ? 733  GLN A OE1   1 
ATOM   5952 N  NE2   . GLN A 1 733 ? -11.682 36.530 23.034  1.00 25.52  ? 733  GLN A NE2   1 
ATOM   5953 N  N     . LYS A 1 734 ? -12.455 40.092 27.403  1.00 27.58  ? 734  LYS A N     1 
ATOM   5954 C  CA    . LYS A 1 734 ? -12.396 41.029 28.513  1.00 27.53  ? 734  LYS A CA    1 
ATOM   5955 C  C     . LYS A 1 734 ? -12.305 40.302 29.848  1.00 26.73  ? 734  LYS A C     1 
ATOM   5956 O  O     . LYS A 1 734 ? -13.097 39.402 30.135  1.00 24.99  ? 734  LYS A O     1 
ATOM   5957 C  CB    . LYS A 1 734 ? -13.609 41.957 28.481  1.00 30.20  ? 734  LYS A CB    1 
ATOM   5958 C  CG    . LYS A 1 734 ? -13.920 42.488 27.090  1.00 32.81  ? 734  LYS A CG    1 
ATOM   5959 C  CD    . LYS A 1 734 ? -13.844 43.999 27.038  1.00 35.66  ? 734  LYS A CD    1 
ATOM   5960 C  CE    . LYS A 1 734 ? -14.898 44.631 27.927  1.00 39.28  ? 734  LYS A CE    1 
ATOM   5961 N  NZ    . LYS A 1 734 ? -14.819 46.118 27.902  1.00 43.03  ? 734  LYS A NZ    1 
ATOM   5962 N  N     . SER A 1 735 ? -11.328 40.699 30.657  1.00 26.14  ? 735  SER A N     1 
ATOM   5963 C  CA    . SER A 1 735 ? -11.124 40.110 31.975  1.00 26.54  ? 735  SER A CA    1 
ATOM   5964 C  C     . SER A 1 735 ? -12.318 40.349 32.895  1.00 30.30  ? 735  SER A C     1 
ATOM   5965 O  O     . SER A 1 735 ? -12.524 39.612 33.860  1.00 31.55  ? 735  SER A O     1 
ATOM   5966 C  CB    . SER A 1 735 ? -9.855  40.675 32.613  1.00 25.93  ? 735  SER A CB    1 
ATOM   5967 O  OG    . SER A 1 735 ? -9.839  42.093 32.549  1.00 24.81  ? 735  SER A OG    1 
ATOM   5968 N  N     . SER A 1 736 ? -13.096 41.383 32.591  1.00 29.23  ? 736  SER A N     1 
ATOM   5969 C  CA    . SER A 1 736 ? -14.268 41.726 33.389  1.00 26.29  ? 736  SER A CA    1 
ATOM   5970 C  C     . SER A 1 736 ? -15.387 40.703 33.220  1.00 25.49  ? 736  SER A C     1 
ATOM   5971 O  O     . SER A 1 736 ? -16.213 40.523 34.116  1.00 26.36  ? 736  SER A O     1 
ATOM   5972 C  CB    . SER A 1 736 ? -14.766 43.128 33.031  1.00 23.57  ? 736  SER A CB    1 
ATOM   5973 O  OG    . SER A 1 736 ? -14.790 43.317 31.628  1.00 24.09  ? 736  SER A OG    1 
ATOM   5974 N  N     . THR A 1 737 ? -15.402 40.037 32.070  1.00 23.46  ? 737  THR A N     1 
ATOM   5975 C  CA    . THR A 1 737 ? -16.390 39.001 31.784  1.00 22.91  ? 737  THR A CA    1 
ATOM   5976 C  C     . THR A 1 737 ? -16.052 37.712 32.535  1.00 25.26  ? 737  THR A C     1 
ATOM   5977 O  O     . THR A 1 737 ? -14.899 37.280 32.543  1.00 27.50  ? 737  THR A O     1 
ATOM   5978 C  CB    . THR A 1 737 ? -16.460 38.718 30.270  1.00 21.50  ? 737  THR A CB    1 
ATOM   5979 O  OG1   . THR A 1 737 ? -16.890 39.898 29.583  1.00 22.95  ? 737  THR A OG1   1 
ATOM   5980 C  CG2   . THR A 1 737 ? -17.427 37.589 29.968  1.00 19.77  ? 737  THR A CG2   1 
ATOM   5981 N  N     . PRO A 1 738 ? -17.056 37.106 33.188  1.00 24.40  ? 738  PRO A N     1 
ATOM   5982 C  CA    . PRO A 1 738 ? -16.895 35.863 33.949  1.00 26.04  ? 738  PRO A CA    1 
ATOM   5983 C  C     . PRO A 1 738 ? -16.254 34.757 33.122  1.00 31.22  ? 738  PRO A C     1 
ATOM   5984 O  O     . PRO A 1 738 ? -16.507 34.670 31.919  1.00 34.36  ? 738  PRO A O     1 
ATOM   5985 C  CB    . PRO A 1 738 ? -18.333 35.489 34.295  1.00 25.34  ? 738  PRO A CB    1 
ATOM   5986 C  CG    . PRO A 1 738 ? -19.030 36.789 34.390  1.00 23.12  ? 738  PRO A CG    1 
ATOM   5987 C  CD    . PRO A 1 738 ? -18.409 37.664 33.338  1.00 21.29  ? 738  PRO A CD    1 
ATOM   5988 N  N     . LYS A 1 739 ? -15.435 33.933 33.769  1.00 31.05  ? 739  LYS A N     1 
ATOM   5989 C  CA    . LYS A 1 739 ? -14.717 32.858 33.094  1.00 32.40  ? 739  LYS A CA    1 
ATOM   5990 C  C     . LYS A 1 739 ? -15.636 31.951 32.283  1.00 31.46  ? 739  LYS A C     1 
ATOM   5991 O  O     . LYS A 1 739 ? -15.408 31.732 31.092  1.00 31.51  ? 739  LYS A O     1 
ATOM   5992 C  CB    . LYS A 1 739 ? -13.902 32.044 34.102  1.00 35.74  ? 739  LYS A CB    1 
ATOM   5993 C  CG    . LYS A 1 739 ? -12.595 32.714 34.502  1.00 43.04  ? 739  LYS A CG    1 
ATOM   5994 C  CD    . LYS A 1 739 ? -11.581 32.660 33.360  1.00 50.29  ? 739  LYS A CD    1 
ATOM   5995 C  CE    . LYS A 1 739 ? -10.480 33.707 33.516  1.00 50.94  ? 739  LYS A CE    1 
ATOM   5996 N  NZ    . LYS A 1 739 ? -10.939 35.081 33.146  1.00 49.35  ? 739  LYS A NZ    1 
ATOM   5997 N  N     . ALA A 1 740 ? -16.682 31.443 32.925  1.00 32.41  ? 740  ALA A N     1 
ATOM   5998 C  CA    . ALA A 1 740 ? -17.623 30.538 32.267  1.00 30.45  ? 740  ALA A CA    1 
ATOM   5999 C  C     . ALA A 1 740 ? -18.371 31.208 31.115  1.00 28.22  ? 740  ALA A C     1 
ATOM   6000 O  O     . ALA A 1 740 ? -18.690 30.564 30.117  1.00 29.25  ? 740  ALA A O     1 
ATOM   6001 C  CB    . ALA A 1 740 ? -18.605 29.960 33.279  1.00 29.67  ? 740  ALA A CB    1 
ATOM   6002 N  N     . VAL A 1 741 ? -18.643 32.502 31.260  1.00 26.96  ? 741  VAL A N     1 
ATOM   6003 C  CA    . VAL A 1 741 ? -19.344 33.261 30.228  1.00 24.43  ? 741  VAL A CA    1 
ATOM   6004 C  C     . VAL A 1 741 ? -18.452 33.494 29.012  1.00 25.57  ? 741  VAL A C     1 
ATOM   6005 O  O     . VAL A 1 741 ? -18.904 33.390 27.874  1.00 28.44  ? 741  VAL A O     1 
ATOM   6006 C  CB    . VAL A 1 741 ? -19.865 34.604 30.772  1.00 24.30  ? 741  VAL A CB    1 
ATOM   6007 C  CG1   . VAL A 1 741 ? -20.356 35.489 29.638  1.00 23.47  ? 741  VAL A CG1   1 
ATOM   6008 C  CG2   . VAL A 1 741 ? -20.971 34.363 31.787  1.00 23.25  ? 741  VAL A CG2   1 
ATOM   6009 N  N     . GLN A 1 742 ? -17.184 33.806 29.262  1.00 26.45  ? 742  GLN A N     1 
ATOM   6010 C  CA    . GLN A 1 742 ? -16.196 33.900 28.196  1.00 26.16  ? 742  GLN A CA    1 
ATOM   6011 C  C     . GLN A 1 742 ? -16.185 32.601 27.411  1.00 25.58  ? 742  GLN A C     1 
ATOM   6012 O  O     . GLN A 1 742 ? -16.290 32.599 26.185  1.00 26.86  ? 742  GLN A O     1 
ATOM   6013 C  CB    . GLN A 1 742 ? -14.799 34.125 28.774  1.00 25.21  ? 742  GLN A CB    1 
ATOM   6014 C  CG    . GLN A 1 742 ? -14.561 35.484 29.389  1.00 23.91  ? 742  GLN A CG    1 
ATOM   6015 C  CD    . GLN A 1 742 ? -13.169 35.595 29.978  1.00 27.64  ? 742  GLN A CD    1 
ATOM   6016 O  OE1   . GLN A 1 742 ? -12.566 34.591 30.358  1.00 29.22  ? 742  GLN A OE1   1 
ATOM   6017 N  NE2   . GLN A 1 742 ? -12.645 36.814 30.045  1.00 28.40  ? 742  GLN A NE2   1 
ATOM   6018 N  N     . LYS A 1 743 ? -16.054 31.499 28.142  1.00 26.32  ? 743  LYS A N     1 
ATOM   6019 C  CA    . LYS A 1 743 ? -16.009 30.162 27.559  1.00 30.72  ? 743  LYS A CA    1 
ATOM   6020 C  C     . LYS A 1 743 ? -17.260 29.877 26.735  1.00 29.86  ? 743  LYS A C     1 
ATOM   6021 O  O     . LYS A 1 743 ? -17.174 29.387 25.609  1.00 30.74  ? 743  LYS A O     1 
ATOM   6022 C  CB    . LYS A 1 743 ? -15.843 29.119 28.670  1.00 32.95  ? 743  LYS A CB    1 
ATOM   6023 C  CG    . LYS A 1 743 ? -15.802 27.676 28.200  1.00 35.84  ? 743  LYS A CG    1 
ATOM   6024 C  CD    . LYS A 1 743 ? -15.461 26.749 29.362  1.00 39.45  ? 743  LYS A CD    1 
ATOM   6025 C  CE    . LYS A 1 743 ? -15.619 25.280 28.993  1.00 41.74  ? 743  LYS A CE    1 
ATOM   6026 N  NZ    . LYS A 1 743 ? -14.787 24.897 27.819  1.00 44.18  ? 743  LYS A NZ    1 
ATOM   6027 N  N     . ALA A 1 744 ? -18.417 30.212 27.298  1.00 28.77  ? 744  ALA A N     1 
ATOM   6028 C  CA    . ALA A 1 744 ? -19.702 29.973 26.648  1.00 32.44  ? 744  ALA A CA    1 
ATOM   6029 C  C     . ALA A 1 744 ? -19.892 30.853 25.420  1.00 34.39  ? 744  ALA A C     1 
ATOM   6030 O  O     . ALA A 1 744 ? -20.287 30.371 24.357  1.00 37.31  ? 744  ALA A O     1 
ATOM   6031 C  CB    . ALA A 1 744 ? -20.830 30.203 27.629  1.00 33.15  ? 744  ALA A CB    1 
ATOM   6032 N  N     . LEU A 1 745 ? -19.627 32.146 25.579  1.00 32.80  ? 745  LEU A N     1 
ATOM   6033 C  CA    . LEU A 1 745 ? -19.734 33.088 24.473  1.00 32.35  ? 745  LEU A CA    1 
ATOM   6034 C  C     . LEU A 1 745 ? -18.791 32.694 23.345  1.00 29.68  ? 745  LEU A C     1 
ATOM   6035 O  O     . LEU A 1 745 ? -19.149 32.773 22.171  1.00 31.16  ? 745  LEU A O     1 
ATOM   6036 C  CB    . LEU A 1 745 ? -19.426 34.513 24.939  1.00 30.94  ? 745  LEU A CB    1 
ATOM   6037 C  CG    . LEU A 1 745 ? -20.510 35.238 25.734  1.00 27.51  ? 745  LEU A CG    1 
ATOM   6038 C  CD1   . LEU A 1 745 ? -19.998 36.590 26.206  1.00 24.73  ? 745  LEU A CD1   1 
ATOM   6039 C  CD2   . LEU A 1 745 ? -21.760 35.397 24.885  1.00 26.17  ? 745  LEU A CD2   1 
ATOM   6040 N  N     . LYS A 1 746 ? -17.590 32.260 23.708  1.00 25.33  ? 746  LYS A N     1 
ATOM   6041 C  CA    . LYS A 1 746 ? -16.623 31.845 22.710  1.00 25.62  ? 746  LYS A CA    1 
ATOM   6042 C  C     . LYS A 1 746 ? -17.150 30.655 21.920  1.00 29.60  ? 746  LYS A C     1 
ATOM   6043 O  O     . LYS A 1 746 ? -17.045 30.622 20.693  1.00 32.14  ? 746  LYS A O     1 
ATOM   6044 C  CB    . LYS A 1 746 ? -15.277 31.505 23.344  1.00 22.93  ? 746  LYS A CB    1 
ATOM   6045 C  CG    . LYS A 1 746 ? -14.246 31.089 22.320  1.00 27.13  ? 746  LYS A CG    1 
ATOM   6046 C  CD    . LYS A 1 746 ? -12.858 31.003 22.906  1.00 33.29  ? 746  LYS A CD    1 
ATOM   6047 C  CE    . LYS A 1 746 ? -11.854 30.618 21.834  1.00 38.68  ? 746  LYS A CE    1 
ATOM   6048 N  NZ    . LYS A 1 746 ? -10.462 30.589 22.361  1.00 43.08  ? 746  LYS A NZ    1 
ATOM   6049 N  N     . GLU A 1 747 ? -17.729 29.685 22.622  1.00 27.04  ? 747  GLU A N     1 
ATOM   6050 C  CA    . GLU A 1 747 ? -18.283 28.516 21.954  1.00 29.43  ? 747  GLU A CA    1 
ATOM   6051 C  C     . GLU A 1 747 ? -19.476 28.898 21.085  1.00 33.22  ? 747  GLU A C     1 
ATOM   6052 O  O     . GLU A 1 747 ? -19.674 28.335 20.004  1.00 36.61  ? 747  GLU A O     1 
ATOM   6053 C  CB    . GLU A 1 747 ? -18.660 27.423 22.956  1.00 29.76  ? 747  GLU A CB    1 
ATOM   6054 C  CG    . GLU A 1 747 ? -19.324 26.201 22.325  1.00 34.08  ? 747  GLU A CG    1 
ATOM   6055 C  CD    . GLU A 1 747 ? -18.405 25.427 21.386  1.00 38.78  ? 747  GLU A CD    1 
ATOM   6056 O  OE1   . GLU A 1 747 ? -18.885 24.473 20.736  1.00 42.24  ? 747  GLU A OE1   1 
ATOM   6057 O  OE2   . GLU A 1 747 ? -17.203 25.758 21.298  1.00 38.03  ? 747  GLU A OE2   1 
ATOM   6058 N  N     . CYS A 1 748 ? -20.263 29.860 21.556  1.00 31.13  ? 748  CYS A N     1 
ATOM   6059 C  CA    . CYS A 1 748 ? -21.332 30.419 20.739  1.00 29.25  ? 748  CYS A CA    1 
ATOM   6060 C  C     . CYS A 1 748 ? -20.728 30.978 19.462  1.00 27.27  ? 748  CYS A C     1 
ATOM   6061 O  O     . CYS A 1 748 ? -21.150 30.627 18.365  1.00 29.04  ? 748  CYS A O     1 
ATOM   6062 C  CB    . CYS A 1 748 ? -22.078 31.521 21.492  1.00 26.92  ? 748  CYS A CB    1 
ATOM   6063 S  SG    . CYS A 1 748 ? -23.182 30.930 22.795  1.00 34.88  ? 748  CYS A SG    1 
ATOM   6064 N  N     . ILE A 1 749 ? -19.721 31.832 19.619  1.00 25.16  ? 749  ILE A N     1 
ATOM   6065 C  CA    . ILE A 1 749 ? -19.035 32.434 18.485  1.00 29.31  ? 749  ILE A CA    1 
ATOM   6066 C  C     . ILE A 1 749 ? -18.444 31.376 17.561  1.00 31.26  ? 749  ILE A C     1 
ATOM   6067 O  O     . ILE A 1 749 ? -18.623 31.441 16.345  1.00 32.38  ? 749  ILE A O     1 
ATOM   6068 C  CB    . ILE A 1 749 ? -17.926 33.402 18.944  1.00 30.52  ? 749  ILE A CB    1 
ATOM   6069 C  CG1   . ILE A 1 749 ? -18.543 34.617 19.637  1.00 29.47  ? 749  ILE A CG1   1 
ATOM   6070 C  CG2   . ILE A 1 749 ? -17.081 33.850 17.762  1.00 31.20  ? 749  ILE A CG2   1 
ATOM   6071 C  CD1   . ILE A 1 749 ? -17.530 35.619 20.130  1.00 27.34  ? 749  ILE A CD1   1 
ATOM   6072 N  N     . ARG A 1 750 ? -17.754 30.397 18.139  1.00 31.56  ? 750  ARG A N     1 
ATOM   6073 C  CA    . ARG A 1 750 ? -17.180 29.311 17.352  1.00 33.14  ? 750  ARG A CA    1 
ATOM   6074 C  C     . ARG A 1 750 ? -18.244 28.628 16.508  1.00 38.12  ? 750  ARG A C     1 
ATOM   6075 O  O     . ARG A 1 750 ? -18.037 28.365 15.324  1.00 41.62  ? 750  ARG A O     1 
ATOM   6076 C  CB    . ARG A 1 750 ? -16.516 28.265 18.244  1.00 33.27  ? 750  ARG A CB    1 
ATOM   6077 C  CG    . ARG A 1 750 ? -15.806 27.175 17.449  1.00 34.95  ? 750  ARG A CG    1 
ATOM   6078 C  CD    . ARG A 1 750 ? -15.488 25.958 18.299  1.00 37.18  ? 750  ARG A CD    1 
ATOM   6079 N  NE    . ARG A 1 750 ? -16.694 25.245 18.707  1.00 40.05  ? 750  ARG A NE    1 
ATOM   6080 C  CZ    . ARG A 1 750 ? -17.338 24.370 17.940  1.00 41.42  ? 750  ARG A CZ    1 
ATOM   6081 N  NH1   . ARG A 1 750 ? -16.895 24.105 16.717  1.00 40.96  ? 750  ARG A NH1   1 
ATOM   6082 N  NH2   . ARG A 1 750 ? -18.429 23.765 18.393  1.00 40.15  ? 750  ARG A NH2   1 
ATOM   6083 N  N     . ARG A 1 751 ? -19.386 28.341 17.124  1.00 36.36  ? 751  ARG A N     1 
ATOM   6084 C  CA    . ARG A 1 751 ? -20.462 27.654 16.426  1.00 38.23  ? 751  ARG A CA    1 
ATOM   6085 C  C     . ARG A 1 751 ? -21.052 28.507 15.311  1.00 40.16  ? 751  ARG A C     1 
ATOM   6086 O  O     . ARG A 1 751 ? -21.361 27.997 14.235  1.00 42.82  ? 751  ARG A O     1 
ATOM   6087 C  CB    . ARG A 1 751 ? -21.544 27.213 17.405  1.00 37.93  ? 751  ARG A CB    1 
ATOM   6088 C  CG    . ARG A 1 751 ? -21.147 25.999 18.220  1.00 40.79  ? 751  ARG A CG    1 
ATOM   6089 C  CD    . ARG A 1 751 ? -22.157 25.727 19.308  1.00 41.63  ? 751  ARG A CD    1 
ATOM   6090 N  NE    . ARG A 1 751 ? -21.842 24.523 20.071  1.00 41.11  ? 751  ARG A NE    1 
ATOM   6091 C  CZ    . ARG A 1 751 ? -22.471 23.362 19.926  1.00 41.23  ? 751  ARG A CZ    1 
ATOM   6092 N  NH1   . ARG A 1 751 ? -23.455 23.245 19.046  1.00 39.07  ? 751  ARG A NH1   1 
ATOM   6093 N  NH2   . ARG A 1 751 ? -22.119 22.320 20.665  1.00 45.32  ? 751  ARG A NH2   1 
ATOM   6094 N  N     . MET A 1 752 ? -21.204 29.803 15.569  1.00 37.55  ? 752  MET A N     1 
ATOM   6095 C  CA    . MET A 1 752 ? -21.670 30.729 14.545  1.00 36.44  ? 752  MET A CA    1 
ATOM   6096 C  C     . MET A 1 752 ? -20.724 30.725 13.352  1.00 39.70  ? 752  MET A C     1 
ATOM   6097 O  O     . MET A 1 752 ? -21.151 30.584 12.205  1.00 39.27  ? 752  MET A O     1 
ATOM   6098 C  CB    . MET A 1 752 ? -21.775 32.147 15.102  1.00 31.63  ? 752  MET A CB    1 
ATOM   6099 C  CG    . MET A 1 752 ? -22.824 32.320 16.178  1.00 32.61  ? 752  MET A CG    1 
ATOM   6100 S  SD    . MET A 1 752 ? -22.638 33.892 17.041  1.00 58.07  ? 752  MET A SD    1 
ATOM   6101 C  CE    . MET A 1 752 ? -22.819 35.060 15.696  1.00 32.36  ? 752  MET A CE    1 
ATOM   6102 N  N     . LEU A 1 753 ? -19.433 30.866 13.633  1.00 39.32  ? 753  LEU A N     1 
ATOM   6103 C  CA    . LEU A 1 753 ? -18.442 31.005 12.576  1.00 40.62  ? 753  LEU A CA    1 
ATOM   6104 C  C     . LEU A 1 753 ? -18.143 29.685 11.862  1.00 45.13  ? 753  LEU A C     1 
ATOM   6105 O  O     . LEU A 1 753 ? -17.788 29.684 10.684  1.00 49.77  ? 753  LEU A O     1 
ATOM   6106 C  CB    . LEU A 1 753 ? -17.145 31.620 13.117  1.00 36.91  ? 753  LEU A CB    1 
ATOM   6107 C  CG    . LEU A 1 753 ? -17.226 32.930 13.915  1.00 32.74  ? 753  LEU A CG    1 
ATOM   6108 C  CD1   . LEU A 1 753 ? -15.855 33.578 14.024  1.00 29.33  ? 753  LEU A CD1   1 
ATOM   6109 C  CD2   . LEU A 1 753 ? -18.233 33.899 13.323  1.00 31.39  ? 753  LEU A CD2   1 
ATOM   6110 N  N     . GLN A 1 754 ? -18.293 28.567 12.568  1.00 43.28  ? 754  GLN A N     1 
ATOM   6111 C  CA    . GLN A 1 754 ? -17.896 27.269 12.022  1.00 41.73  ? 754  GLN A CA    1 
ATOM   6112 C  C     . GLN A 1 754 ? -19.052 26.348 11.654  1.00 46.10  ? 754  GLN A C     1 
ATOM   6113 O  O     . GLN A 1 754 ? -18.919 25.520 10.753  1.00 49.82  ? 754  GLN A O     1 
ATOM   6114 C  CB    . GLN A 1 754 ? -16.964 26.534 12.989  1.00 36.48  ? 754  GLN A CB    1 
ATOM   6115 C  CG    . GLN A 1 754 ? -15.637 27.225 13.232  1.00 34.29  ? 754  GLN A CG    1 
ATOM   6116 C  CD    . GLN A 1 754 ? -14.725 26.403 14.116  1.00 35.08  ? 754  GLN A CD    1 
ATOM   6117 O  OE1   . GLN A 1 754 ? -15.144 25.394 14.682  1.00 39.22  ? 754  GLN A OE1   1 
ATOM   6118 N  NE2   . GLN A 1 754 ? -13.470 26.823 14.237  1.00 31.68  ? 754  GLN A NE2   1 
ATOM   6119 N  N     . GLU A 1 755 ? -20.181 26.480 12.343  1.00 46.43  ? 755  GLU A N     1 
ATOM   6120 C  CA    . GLU A 1 755 ? -21.242 25.483 12.219  1.00 47.74  ? 755  GLU A CA    1 
ATOM   6121 C  C     . GLU A 1 755 ? -22.614 26.027 11.802  1.00 51.50  ? 755  GLU A C     1 
ATOM   6122 O  O     . GLU A 1 755 ? -23.394 25.317 11.168  1.00 57.03  ? 755  GLU A O     1 
ATOM   6123 C  CB    . GLU A 1 755 ? -21.340 24.654 13.504  1.00 43.53  ? 755  GLU A CB    1 
ATOM   6124 C  CG    . GLU A 1 755 ? -20.068 23.871 13.819  1.00 43.60  ? 755  GLU A CG    1 
ATOM   6125 C  CD    . GLU A 1 755 ? -20.171 23.057 15.095  1.00 48.37  ? 755  GLU A CD    1 
ATOM   6126 O  OE1   . GLU A 1 755 ? -21.211 23.145 15.781  1.00 49.16  ? 755  GLU A OE1   1 
ATOM   6127 O  OE2   . GLU A 1 755 ? -19.210 22.326 15.414  1.00 51.50  ? 755  GLU A OE2   1 
ATOM   6128 N  N     . GLY A 1 756 ? -22.914 27.273 12.154  1.00 49.41  ? 756  GLY A N     1 
ATOM   6129 C  CA    . GLY A 1 756 ? -24.154 27.893 11.712  1.00 50.17  ? 756  GLY A CA    1 
ATOM   6130 C  C     . GLY A 1 756 ? -25.188 28.166 12.789  1.00 50.94  ? 756  GLY A C     1 
ATOM   6131 O  O     . GLY A 1 756 ? -24.960 27.900 13.972  1.00 49.58  ? 756  GLY A O     1 
ATOM   6132 N  N     . GLU A 1 757 ? -26.338 28.689 12.365  1.00 53.28  ? 757  GLU A N     1 
ATOM   6133 C  CA    . GLU A 1 757 ? -27.392 29.136 13.277  1.00 54.43  ? 757  GLU A CA    1 
ATOM   6134 C  C     . GLU A 1 757 ? -28.000 28.016 14.126  1.00 55.98  ? 757  GLU A C     1 
ATOM   6135 O  O     . GLU A 1 757 ? -28.192 28.186 15.332  1.00 54.94  ? 757  GLU A O     1 
ATOM   6136 C  CB    . GLU A 1 757 ? -28.497 29.858 12.499  1.00 57.05  ? 757  GLU A CB    1 
ATOM   6137 C  CG    . GLU A 1 757 ? -29.501 30.593 13.377  1.00 60.18  ? 757  GLU A CG    1 
ATOM   6138 C  CD    . GLU A 1 757 ? -30.529 31.369 12.571  1.00 64.43  ? 757  GLU A CD    1 
ATOM   6139 O  OE1   . GLU A 1 757 ? -31.029 32.399 13.072  1.00 63.73  ? 757  GLU A OE1   1 
ATOM   6140 O  OE2   . GLU A 1 757 ? -30.838 30.944 11.438  1.00 67.59  ? 757  GLU A OE2   1 
ATOM   6141 N  N     . GLU A 1 758 ? -28.305 26.884 13.493  1.00 55.84  ? 758  GLU A N     1 
ATOM   6142 C  CA    . GLU A 1 758 ? -28.890 25.744 14.196  1.00 53.32  ? 758  GLU A CA    1 
ATOM   6143 C  C     . GLU A 1 758 ? -27.989 25.259 15.328  1.00 51.69  ? 758  GLU A C     1 
ATOM   6144 O  O     . GLU A 1 758 ? -28.467 24.902 16.405  1.00 51.18  ? 758  GLU A O     1 
ATOM   6145 C  CB    . GLU A 1 758 ? -29.184 24.595 13.230  1.00 52.14  ? 758  GLU A CB    1 
ATOM   6146 C  CG    . GLU A 1 758 ? -30.336 24.863 12.272  1.00 54.17  ? 758  GLU A CG    1 
ATOM   6147 N  N     . SER A 1 759 ? -26.685 25.258 15.080  1.00 49.96  ? 759  SER A N     1 
ATOM   6148 C  CA    . SER A 1 759 ? -25.718 24.841 16.086  1.00 47.77  ? 759  SER A CA    1 
ATOM   6149 C  C     . SER A 1 759 ? -25.668 25.826 17.249  1.00 47.52  ? 759  SER A C     1 
ATOM   6150 O  O     . SER A 1 759 ? -25.537 25.424 18.405  1.00 45.67  ? 759  SER A O     1 
ATOM   6151 C  CB    . SER A 1 759 ? -24.330 24.695 15.468  1.00 46.23  ? 759  SER A CB    1 
ATOM   6152 O  OG    . SER A 1 759 ? -23.372 24.355 16.454  1.00 44.69  ? 759  SER A OG    1 
ATOM   6153 N  N     . LEU A 1 760 ? -25.764 27.114 16.935  1.00 47.98  ? 760  LEU A N     1 
ATOM   6154 C  CA    . LEU A 1 760 ? -25.752 28.154 17.960  1.00 46.97  ? 760  LEU A CA    1 
ATOM   6155 C  C     . LEU A 1 760 ? -26.948 28.020 18.890  1.00 45.92  ? 760  LEU A C     1 
ATOM   6156 O  O     . LEU A 1 760 ? -26.804 28.019 20.114  1.00 43.14  ? 760  LEU A O     1 
ATOM   6157 C  CB    . LEU A 1 760 ? -25.761 29.544 17.323  1.00 47.10  ? 760  LEU A CB    1 
ATOM   6158 C  CG    . LEU A 1 760 ? -26.058 30.688 18.296  1.00 45.99  ? 760  LEU A CG    1 
ATOM   6159 C  CD1   . LEU A 1 760 ? -24.920 30.864 19.293  1.00 44.88  ? 760  LEU A CD1   1 
ATOM   6160 C  CD2   . LEU A 1 760 ? -26.334 31.982 17.550  1.00 47.20  ? 760  LEU A CD2   1 
ATOM   6161 N  N     . GLN A 1 761 ? -28.130 27.912 18.292  1.00 48.99  ? 761  GLN A N     1 
ATOM   6162 C  CA    . GLN A 1 761 ? -29.373 27.796 19.042  1.00 48.88  ? 761  GLN A CA    1 
ATOM   6163 C  C     . GLN A 1 761 ? -29.354 26.570 19.942  1.00 46.05  ? 761  GLN A C     1 
ATOM   6164 O  O     . GLN A 1 761 ? -29.804 26.623 21.085  1.00 44.26  ? 761  GLN A O     1 
ATOM   6165 C  CB    . GLN A 1 761 ? -30.561 27.735 18.083  1.00 50.35  ? 761  GLN A CB    1 
ATOM   6166 C  CG    . GLN A 1 761 ? -30.682 28.961 17.197  1.00 50.16  ? 761  GLN A CG    1 
ATOM   6167 C  CD    . GLN A 1 761 ? -31.807 28.846 16.193  1.00 51.93  ? 761  GLN A CD    1 
ATOM   6168 O  OE1   . GLN A 1 761 ? -32.434 27.795 16.062  1.00 53.29  ? 761  GLN A OE1   1 
ATOM   6169 N  NE2   . GLN A 1 761 ? -32.071 29.931 15.476  1.00 53.28  ? 761  GLN A NE2   1 
ATOM   6170 N  N     . GLU A 1 762 ? -28.818 25.473 19.416  1.00 46.55  ? 762  GLU A N     1 
ATOM   6171 C  CA    . GLU A 1 762 ? -28.681 24.234 20.169  1.00 49.66  ? 762  GLU A CA    1 
ATOM   6172 C  C     . GLU A 1 762 ? -27.860 24.434 21.445  1.00 47.25  ? 762  GLU A C     1 
ATOM   6173 O  O     . GLU A 1 762 ? -28.283 24.044 22.536  1.00 47.48  ? 762  GLU A O     1 
ATOM   6174 C  CB    . GLU A 1 762 ? -28.048 23.159 19.283  1.00 56.22  ? 762  GLU A CB    1 
ATOM   6175 C  CG    . GLU A 1 762 ? -27.613 21.906 20.017  1.00 63.31  ? 762  GLU A CG    1 
ATOM   6176 C  CD    . GLU A 1 762 ? -26.893 20.929 19.109  1.00 70.35  ? 762  GLU A CD    1 
ATOM   6177 O  OE1   . GLU A 1 762 ? -25.656 20.795 19.236  1.00 70.16  ? 762  GLU A OE1   1 
ATOM   6178 O  OE2   . GLU A 1 762 ? -27.568 20.296 18.269  1.00 75.32  ? 762  GLU A OE2   1 
ATOM   6179 N  N     . TYR A 1 763 ? -26.693 25.056 21.305  1.00 45.02  ? 763  TYR A N     1 
ATOM   6180 C  CA    . TYR A 1 763 ? -25.800 25.274 22.438  1.00 42.91  ? 763  TYR A CA    1 
ATOM   6181 C  C     . TYR A 1 763 ? -26.368 26.293 23.413  1.00 43.97  ? 763  TYR A C     1 
ATOM   6182 O  O     . TYR A 1 763 ? -26.214 26.146 24.625  1.00 45.74  ? 763  TYR A O     1 
ATOM   6183 C  CB    . TYR A 1 763 ? -24.417 25.723 21.963  1.00 41.33  ? 763  TYR A CB    1 
ATOM   6184 C  CG    . TYR A 1 763 ? -23.415 25.923 23.082  1.00 40.77  ? 763  TYR A CG    1 
ATOM   6185 C  CD1   . TYR A 1 763 ? -23.086 27.196 23.526  1.00 39.82  ? 763  TYR A CD1   1 
ATOM   6186 C  CD2   . TYR A 1 763 ? -22.799 24.837 23.694  1.00 42.83  ? 763  TYR A CD2   1 
ATOM   6187 C  CE1   . TYR A 1 763 ? -22.170 27.384 24.547  1.00 42.30  ? 763  TYR A CE1   1 
ATOM   6188 C  CE2   . TYR A 1 763 ? -21.882 25.014 24.717  1.00 43.51  ? 763  TYR A CE2   1 
ATOM   6189 C  CZ    . TYR A 1 763 ? -21.572 26.289 25.140  1.00 45.66  ? 763  TYR A CZ    1 
ATOM   6190 O  OH    . TYR A 1 763 ? -20.660 26.468 26.156  1.00 49.23  ? 763  TYR A OH    1 
ATOM   6191 N  N     . PHE A 1 764 ? -27.020 27.327 22.886  1.00 41.72  ? 764  PHE A N     1 
ATOM   6192 C  CA    . PHE A 1 764 ? -27.608 28.350 23.740  1.00 39.20  ? 764  PHE A CA    1 
ATOM   6193 C  C     . PHE A 1 764 ? -28.685 27.761 24.643  1.00 40.99  ? 764  PHE A C     1 
ATOM   6194 O  O     . PHE A 1 764 ? -28.722 28.041 25.842  1.00 40.80  ? 764  PHE A O     1 
ATOM   6195 C  CB    . PHE A 1 764 ? -28.199 29.495 22.919  1.00 40.30  ? 764  PHE A CB    1 
ATOM   6196 C  CG    . PHE A 1 764 ? -28.961 30.490 23.747  1.00 41.80  ? 764  PHE A CG    1 
ATOM   6197 C  CD1   . PHE A 1 764 ? -28.294 31.501 24.418  1.00 41.43  ? 764  PHE A CD1   1 
ATOM   6198 C  CD2   . PHE A 1 764 ? -30.339 30.400 23.875  1.00 44.35  ? 764  PHE A CD2   1 
ATOM   6199 C  CE1   . PHE A 1 764 ? -28.985 32.415 25.194  1.00 42.45  ? 764  PHE A CE1   1 
ATOM   6200 C  CE2   . PHE A 1 764 ? -31.035 31.307 24.651  1.00 46.41  ? 764  PHE A CE2   1 
ATOM   6201 C  CZ    . PHE A 1 764 ? -30.356 32.317 25.311  1.00 45.15  ? 764  PHE A CZ    1 
ATOM   6202 N  N     . LYS A 1 765 ? -29.564 26.955 24.057  1.00 43.21  ? 765  LYS A N     1 
ATOM   6203 C  CA    . LYS A 1 765 ? -30.628 26.308 24.814  1.00 46.12  ? 765  LYS A CA    1 
ATOM   6204 C  C     . LYS A 1 765 ? -30.053 25.457 25.940  1.00 49.50  ? 765  LYS A C     1 
ATOM   6205 O  O     . LYS A 1 765 ? -30.588 25.439 27.051  1.00 53.00  ? 765  LYS A O     1 
ATOM   6206 C  CB    . LYS A 1 765 ? -31.501 25.446 23.897  1.00 43.76  ? 765  LYS A CB    1 
ATOM   6207 N  N     . GLU A 1 766 ? -28.954 24.766 25.652  1.00 46.89  ? 766  GLU A N     1 
ATOM   6208 C  CA    . GLU A 1 766 ? -28.340 23.883 26.633  1.00 49.19  ? 766  GLU A CA    1 
ATOM   6209 C  C     . GLU A 1 766 ? -27.669 24.679 27.741  1.00 50.13  ? 766  GLU A C     1 
ATOM   6210 O  O     . GLU A 1 766 ? -27.729 24.310 28.915  1.00 53.75  ? 766  GLU A O     1 
ATOM   6211 C  CB    . GLU A 1 766 ? -27.327 22.949 25.974  1.00 49.97  ? 766  GLU A CB    1 
ATOM   6212 C  CG    . GLU A 1 766 ? -27.033 21.725 26.814  1.00 52.55  ? 766  GLU A CG    1 
ATOM   6213 C  CD    . GLU A 1 766 ? -28.285 20.917 27.094  1.00 57.15  ? 766  GLU A CD    1 
ATOM   6214 O  OE1   . GLU A 1 766 ? -28.970 20.536 26.121  1.00 57.70  ? 766  GLU A OE1   1 
ATOM   6215 O  OE2   . GLU A 1 766 ? -28.595 20.676 28.281  1.00 59.76  ? 766  GLU A OE2   1 
ATOM   6216 N  N     . PHE A 1 767 ? -27.031 25.778 27.363  1.00 46.51  ? 767  PHE A N     1 
ATOM   6217 C  CA    . PHE A 1 767 ? -26.354 26.615 28.333  1.00 41.05  ? 767  PHE A CA    1 
ATOM   6218 C  C     . PHE A 1 767 ? -27.357 27.280 29.265  1.00 42.16  ? 767  PHE A C     1 
ATOM   6219 O  O     . PHE A 1 767 ? -27.139 27.346 30.471  1.00 43.81  ? 767  PHE A O     1 
ATOM   6220 C  CB    . PHE A 1 767 ? -25.492 27.667 27.638  1.00 37.82  ? 767  PHE A CB    1 
ATOM   6221 C  CG    . PHE A 1 767 ? -24.647 28.460 28.583  1.00 38.22  ? 767  PHE A CG    1 
ATOM   6222 C  CD1   . PHE A 1 767 ? -25.022 29.735 28.968  1.00 40.48  ? 767  PHE A CD1   1 
ATOM   6223 C  CD2   . PHE A 1 767 ? -23.486 27.918 29.110  1.00 40.74  ? 767  PHE A CD2   1 
ATOM   6224 C  CE1   . PHE A 1 767 ? -24.242 30.465 29.851  1.00 42.29  ? 767  PHE A CE1   1 
ATOM   6225 C  CE2   . PHE A 1 767 ? -22.704 28.638 29.997  1.00 41.32  ? 767  PHE A CE2   1 
ATOM   6226 C  CZ    . PHE A 1 767 ? -23.080 29.914 30.367  1.00 41.41  ? 767  PHE A CZ    1 
ATOM   6227 N  N     . GLU A 1 768 ? -28.462 27.760 28.703  1.00 43.30  ? 768  GLU A N     1 
ATOM   6228 C  CA    . GLU A 1 768 ? -29.487 28.427 29.496  1.00 44.42  ? 768  GLU A CA    1 
ATOM   6229 C  C     . GLU A 1 768 ? -30.040 27.509 30.578  1.00 45.79  ? 768  GLU A C     1 
ATOM   6230 O  O     . GLU A 1 768 ? -30.256 27.937 31.711  1.00 48.16  ? 768  GLU A O     1 
ATOM   6231 C  CB    . GLU A 1 768 ? -30.623 28.936 28.611  1.00 47.68  ? 768  GLU A CB    1 
ATOM   6232 C  CG    . GLU A 1 768 ? -31.624 29.805 29.353  1.00 54.05  ? 768  GLU A CG    1 
ATOM   6233 C  CD    . GLU A 1 768 ? -32.628 30.463 28.428  1.00 63.18  ? 768  GLU A CD    1 
ATOM   6234 O  OE1   . GLU A 1 768 ? -32.924 29.891 27.356  1.00 67.92  ? 768  GLU A OE1   1 
ATOM   6235 O  OE2   . GLU A 1 768 ? -33.118 31.559 28.774  1.00 65.34  ? 768  GLU A OE2   1 
ATOM   6236 N  N     . LYS A 1 769 ? -30.262 26.247 30.222  1.00 45.39  ? 769  LYS A N     1 
ATOM   6237 C  CA    . LYS A 1 769 ? -30.759 25.255 31.170  1.00 46.28  ? 769  LYS A CA    1 
ATOM   6238 C  C     . LYS A 1 769 ? -29.785 25.025 32.317  1.00 46.74  ? 769  LYS A C     1 
ATOM   6239 O  O     . LYS A 1 769 ? -30.160 25.099 33.489  1.00 49.14  ? 769  LYS A O     1 
ATOM   6240 C  CB    . LYS A 1 769 ? -31.011 23.914 30.472  1.00 47.43  ? 769  LYS A CB    1 
ATOM   6241 C  CG    . LYS A 1 769 ? -32.142 23.911 29.466  1.00 51.31  ? 769  LYS A CG    1 
ATOM   6242 C  CD    . LYS A 1 769 ? -32.375 22.508 28.927  1.00 53.06  ? 769  LYS A CD    1 
ATOM   6243 N  N     . GLU A 1 770 ? -28.531 24.754 31.968  1.00 44.16  ? 770  GLU A N     1 
ATOM   6244 C  CA    . GLU A 1 770 ? -27.578 24.202 32.923  1.00 43.66  ? 770  GLU A CA    1 
ATOM   6245 C  C     . GLU A 1 770 ? -26.715 25.229 33.647  1.00 41.65  ? 770  GLU A C     1 
ATOM   6246 O  O     . GLU A 1 770 ? -26.046 24.889 34.620  1.00 43.13  ? 770  GLU A O     1 
ATOM   6247 C  CB    . GLU A 1 770 ? -26.680 23.164 32.236  1.00 43.08  ? 770  GLU A CB    1 
ATOM   6248 C  CG    . GLU A 1 770 ? -27.437 22.059 31.515  1.00 43.64  ? 770  GLU A CG    1 
ATOM   6249 C  CD    . GLU A 1 770 ? -28.272 21.208 32.453  1.00 50.09  ? 770  GLU A CD    1 
ATOM   6250 O  OE1   . GLU A 1 770 ? -29.223 20.554 31.973  1.00 57.06  ? 770  GLU A OE1   1 
ATOM   6251 O  OE2   . GLU A 1 770 ? -27.978 21.185 33.669  1.00 49.04  ? 770  GLU A OE2   1 
ATOM   6252 N  N     . PHE A 1 771 ? -26.737 26.478 33.195  1.00 40.22  ? 771  PHE A N     1 
ATOM   6253 C  CA    . PHE A 1 771 ? -25.785 27.473 33.693  1.00 43.44  ? 771  PHE A CA    1 
ATOM   6254 C  C     . PHE A 1 771 ? -25.859 27.738 35.201  1.00 42.05  ? 771  PHE A C     1 
ATOM   6255 O  O     . PHE A 1 771 ? -24.885 28.191 35.803  1.00 40.09  ? 771  PHE A O     1 
ATOM   6256 C  CB    . PHE A 1 771 ? -25.905 28.787 32.912  1.00 46.89  ? 771  PHE A CB    1 
ATOM   6257 C  CG    . PHE A 1 771 ? -26.783 29.806 33.569  1.00 51.70  ? 771  PHE A CG    1 
ATOM   6258 C  CD1   . PHE A 1 771 ? -26.231 30.855 34.293  1.00 52.06  ? 771  PHE A CD1   1 
ATOM   6259 C  CD2   . PHE A 1 771 ? -28.160 29.723 33.459  1.00 56.66  ? 771  PHE A CD2   1 
ATOM   6260 C  CE1   . PHE A 1 771 ? -27.036 31.800 34.900  1.00 53.66  ? 771  PHE A CE1   1 
ATOM   6261 C  CE2   . PHE A 1 771 ? -28.971 30.667 34.062  1.00 59.38  ? 771  PHE A CE2   1 
ATOM   6262 C  CZ    . PHE A 1 771 ? -28.408 31.706 34.785  1.00 56.67  ? 771  PHE A CZ    1 
ATOM   6263 N  N     . ARG A 1 772 ? -27.004 27.447 35.809  1.00 43.28  ? 772  ARG A N     1 
ATOM   6264 C  CA    . ARG A 1 772 ? -27.179 27.675 37.241  1.00 43.46  ? 772  ARG A CA    1 
ATOM   6265 C  C     . ARG A 1 772 ? -26.337 26.735 38.099  1.00 45.01  ? 772  ARG A C     1 
ATOM   6266 O  O     . ARG A 1 772 ? -26.187 26.952 39.299  1.00 50.46  ? 772  ARG A O     1 
ATOM   6267 C  CB    . ARG A 1 772 ? -28.652 27.567 37.629  1.00 46.63  ? 772  ARG A CB    1 
ATOM   6268 C  CG    . ARG A 1 772 ? -29.484 28.719 37.113  1.00 46.63  ? 772  ARG A CG    1 
ATOM   6269 C  CD    . ARG A 1 772 ? -30.967 28.446 37.221  1.00 49.67  ? 772  ARG A CD    1 
ATOM   6270 N  NE    . ARG A 1 772 ? -31.722 29.416 36.438  1.00 55.18  ? 772  ARG A NE    1 
ATOM   6271 C  CZ    . ARG A 1 772 ? -31.858 29.358 35.118  1.00 59.94  ? 772  ARG A CZ    1 
ATOM   6272 N  NH1   . ARG A 1 772 ? -31.289 28.371 34.435  1.00 61.92  ? 772  ARG A NH1   1 
ATOM   6273 N  NH2   . ARG A 1 772 ? -32.557 30.286 34.478  1.00 60.67  ? 772  ARG A NH2   1 
ATOM   6274 N  N     . GLN A 1 773 ? -25.787 25.695 37.482  1.00 40.61  ? 773  GLN A N     1 
ATOM   6275 C  CA    . GLN A 1 773 ? -24.948 24.746 38.200  1.00 42.08  ? 773  GLN A CA    1 
ATOM   6276 C  C     . GLN A 1 773 ? -23.487 25.162 38.166  1.00 41.41  ? 773  GLN A C     1 
ATOM   6277 O  O     . GLN A 1 773 ? -22.639 24.540 38.809  1.00 44.71  ? 773  GLN A O     1 
ATOM   6278 C  CB    . GLN A 1 773 ? -25.104 23.342 37.619  1.00 47.52  ? 773  GLN A CB    1 
ATOM   6279 C  CG    . GLN A 1 773 ? -26.495 22.774 37.793  1.00 53.37  ? 773  GLN A CG    1 
ATOM   6280 C  CD    . GLN A 1 773 ? -26.999 22.930 39.214  1.00 57.00  ? 773  GLN A CD    1 
ATOM   6281 O  OE1   . GLN A 1 773 ? -26.324 22.547 40.172  1.00 57.22  ? 773  GLN A OE1   1 
ATOM   6282 N  NE2   . GLN A 1 773 ? -28.185 23.509 39.358  1.00 57.68  ? 773  GLN A NE2   1 
ATOM   6283 N  N     . LEU A 1 774 ? -23.195 26.212 37.407  1.00 36.41  ? 774  LEU A N     1 
ATOM   6284 C  CA    . LEU A 1 774 ? -21.833 26.708 37.306  1.00 34.48  ? 774  LEU A CA    1 
ATOM   6285 C  C     . LEU A 1 774 ? -21.352 27.257 38.639  1.00 33.33  ? 774  LEU A C     1 
ATOM   6286 O  O     . LEU A 1 774 ? -22.122 27.853 39.392  1.00 35.80  ? 774  LEU A O     1 
ATOM   6287 C  CB    . LEU A 1 774 ? -21.729 27.782 36.229  1.00 33.75  ? 774  LEU A CB    1 
ATOM   6288 C  CG    . LEU A 1 774 ? -21.789 27.254 34.798  1.00 32.91  ? 774  LEU A CG    1 
ATOM   6289 C  CD1   . LEU A 1 774 ? -21.939 28.408 33.832  1.00 30.54  ? 774  LEU A CD1   1 
ATOM   6290 C  CD2   . LEU A 1 774 ? -20.541 26.440 34.480  1.00 32.05  ? 774  LEU A CD2   1 
ATOM   6291 N  N     . ASN A 1 775 ? -20.076 27.035 38.929  1.00 29.80  ? 775  ASN A N     1 
ATOM   6292 C  CA    . ASN A 1 775 ? -19.464 27.566 40.132  1.00 30.38  ? 775  ASN A CA    1 
ATOM   6293 C  C     . ASN A 1 775 ? -19.578 29.088 40.166  1.00 33.35  ? 775  ASN A C     1 
ATOM   6294 O  O     . ASN A 1 775 ? -19.436 29.752 39.136  1.00 34.18  ? 775  ASN A O     1 
ATOM   6295 C  CB    . ASN A 1 775 ? -18.005 27.131 40.203  1.00 33.06  ? 775  ASN A CB    1 
ATOM   6296 C  CG    . ASN A 1 775 ? -17.286 27.721 41.388  1.00 39.79  ? 775  ASN A CG    1 
ATOM   6297 O  OD1   . ASN A 1 775 ? -16.609 28.741 41.270  1.00 44.15  ? 775  ASN A OD1   1 
ATOM   6298 N  ND2   . ASN A 1 775 ? -17.438 27.092 42.546  1.00 40.38  ? 775  ASN A ND2   1 
ATOM   6299 N  N     . TYR A 1 776 ? -19.843 29.635 41.348  1.00 32.19  ? 776  TYR A N     1 
ATOM   6300 C  CA    . TYR A 1 776 ? -20.117 31.064 41.485  1.00 30.10  ? 776  TYR A CA    1 
ATOM   6301 C  C     . TYR A 1 776 ? -18.954 31.944 41.045  1.00 32.19  ? 776  TYR A C     1 
ATOM   6302 O  O     . TYR A 1 776 ? -19.168 33.040 40.525  1.00 37.39  ? 776  TYR A O     1 
ATOM   6303 C  CB    . TYR A 1 776 ? -20.536 31.409 42.918  1.00 30.99  ? 776  TYR A CB    1 
ATOM   6304 C  CG    . TYR A 1 776 ? -19.404 31.463 43.928  1.00 32.57  ? 776  TYR A CG    1 
ATOM   6305 C  CD1   . TYR A 1 776 ? -18.993 32.675 44.473  1.00 31.65  ? 776  TYR A CD1   1 
ATOM   6306 C  CD2   . TYR A 1 776 ? -18.756 30.305 44.345  1.00 31.66  ? 776  TYR A CD2   1 
ATOM   6307 C  CE1   . TYR A 1 776 ? -17.966 32.733 45.402  1.00 32.75  ? 776  TYR A CE1   1 
ATOM   6308 C  CE2   . TYR A 1 776 ? -17.725 30.354 45.273  1.00 33.07  ? 776  TYR A CE2   1 
ATOM   6309 C  CZ    . TYR A 1 776 ? -17.335 31.570 45.798  1.00 35.73  ? 776  TYR A CZ    1 
ATOM   6310 O  OH    . TYR A 1 776 ? -16.312 31.628 46.721  1.00 36.59  ? 776  TYR A OH    1 
ATOM   6311 N  N     . ILE A 1 777 ? -17.729 31.470 41.250  1.00 27.28  ? 777  ILE A N     1 
ATOM   6312 C  CA    . ILE A 1 777 ? -16.559 32.223 40.810  1.00 27.20  ? 777  ILE A CA    1 
ATOM   6313 C  C     . ILE A 1 777 ? -16.497 32.285 39.284  1.00 26.48  ? 777  ILE A C     1 
ATOM   6314 O  O     . ILE A 1 777 ? -16.166 33.323 38.708  1.00 23.88  ? 777  ILE A O     1 
ATOM   6315 C  CB    . ILE A 1 777 ? -15.245 31.646 41.379  1.00 25.75  ? 777  ILE A CB    1 
ATOM   6316 C  CG1   . ILE A 1 777 ? -15.148 31.925 42.880  1.00 27.80  ? 777  ILE A CG1   1 
ATOM   6317 C  CG2   . ILE A 1 777 ? -14.044 32.245 40.670  1.00 23.13  ? 777  ILE A CG2   1 
ATOM   6318 C  CD1   . ILE A 1 777 ? -13.848 31.468 43.503  1.00 29.71  ? 777  ILE A CD1   1 
ATOM   6319 N  N     . SER A 1 778 ? -16.845 31.180 38.632  1.00 27.74  ? 778  SER A N     1 
ATOM   6320 C  CA    . SER A 1 778 ? -16.769 31.107 37.179  1.00 31.00  ? 778  SER A CA    1 
ATOM   6321 C  C     . SER A 1 778 ? -17.793 32.015 36.505  1.00 30.40  ? 778  SER A C     1 
ATOM   6322 O  O     . SER A 1 778 ? -17.646 32.359 35.333  1.00 30.72  ? 778  SER A O     1 
ATOM   6323 C  CB    . SER A 1 778 ? -16.924 29.662 36.690  1.00 33.03  ? 778  SER A CB    1 
ATOM   6324 O  OG    . SER A 1 778 ? -18.210 29.148 36.990  1.00 36.90  ? 778  SER A OG    1 
ATOM   6325 N  N     . ILE A 1 779 ? -18.824 32.409 37.247  1.00 29.43  ? 779  ILE A N     1 
ATOM   6326 C  CA    . ILE A 1 779 ? -19.852 33.293 36.698  1.00 29.97  ? 779  ILE A CA    1 
ATOM   6327 C  C     . ILE A 1 779 ? -19.825 34.686 37.328  1.00 30.02  ? 779  ILE A C     1 
ATOM   6328 O  O     . ILE A 1 779 ? -20.654 35.539 37.012  1.00 28.57  ? 779  ILE A O     1 
ATOM   6329 C  CB    . ILE A 1 779 ? -21.260 32.680 36.812  1.00 29.22  ? 779  ILE A CB    1 
ATOM   6330 C  CG1   . ILE A 1 779 ? -21.526 32.208 38.242  1.00 30.06  ? 779  ILE A CG1   1 
ATOM   6331 C  CG2   . ILE A 1 779 ? -21.404 31.519 35.849  1.00 29.90  ? 779  ILE A CG2   1 
ATOM   6332 C  CD1   . ILE A 1 779 ? -22.794 31.405 38.381  1.00 29.04  ? 779  ILE A CD1   1 
ATOM   6333 N  N     . ALA A 1 780 ? -18.860 34.914 38.210  1.00 28.66  ? 780  ALA A N     1 
ATOM   6334 C  CA    . ALA A 1 780 ? -18.679 36.228 38.805  1.00 29.07  ? 780  ALA A CA    1 
ATOM   6335 C  C     . ALA A 1 780 ? -18.023 37.183 37.811  1.00 28.96  ? 780  ALA A C     1 
ATOM   6336 O  O     . ALA A 1 780 ? -17.144 36.786 37.046  1.00 28.85  ? 780  ALA A O     1 
ATOM   6337 C  CB    . ALA A 1 780 ? -17.842 36.125 40.073  1.00 29.62  ? 780  ALA A CB    1 
ATOM   6338 N  N     . SER A 1 781 ? -18.460 38.438 37.819  1.00 28.12  ? 781  SER A N     1 
ATOM   6339 C  CA    . SER A 1 781 ? -17.826 39.470 37.005  1.00 26.98  ? 781  SER A CA    1 
ATOM   6340 C  C     . SER A 1 781 ? -16.573 39.971 37.711  1.00 27.56  ? 781  SER A C     1 
ATOM   6341 O  O     . SER A 1 781 ? -16.396 39.744 38.903  1.00 27.71  ? 781  SER A O     1 
ATOM   6342 C  CB    . SER A 1 781 ? -18.788 40.631 36.757  1.00 24.52  ? 781  SER A CB    1 
ATOM   6343 O  OG    . SER A 1 781 ? -19.870 40.223 35.940  1.00 25.86  ? 781  SER A OG    1 
ATOM   6344 N  N     . VAL A 1 782 ? -15.702 40.645 36.972  1.00 24.33  ? 782  VAL A N     1 
ATOM   6345 C  CA    . VAL A 1 782 ? -14.477 41.182 37.549  1.00 24.70  ? 782  VAL A CA    1 
ATOM   6346 C  C     . VAL A 1 782 ? -14.374 42.676 37.257  1.00 26.40  ? 782  VAL A C     1 
ATOM   6347 O  O     . VAL A 1 782 ? -14.749 43.127 36.179  1.00 26.27  ? 782  VAL A O     1 
ATOM   6348 C  CB    . VAL A 1 782 ? -13.238 40.454 36.988  1.00 23.65  ? 782  VAL A CB    1 
ATOM   6349 C  CG1   . VAL A 1 782 ? -11.960 41.043 37.552  1.00 25.04  ? 782  VAL A CG1   1 
ATOM   6350 C  CG2   . VAL A 1 782 ? -13.314 38.964 37.289  1.00 22.63  ? 782  VAL A CG2   1 
ATOM   6351 N  N     . SER A 1 783 ? -13.881 43.447 38.221  1.00 27.63  ? 783  SER A N     1 
ATOM   6352 C  CA    . SER A 1 783 ? -13.650 44.868 37.995  1.00 27.80  ? 783  SER A CA    1 
ATOM   6353 C  C     . SER A 1 783 ? -12.566 45.432 38.908  1.00 29.61  ? 783  SER A C     1 
ATOM   6354 O  O     . SER A 1 783 ? -12.378 44.968 40.030  1.00 30.09  ? 783  SER A O     1 
ATOM   6355 C  CB    . SER A 1 783 ? -14.945 45.654 38.178  1.00 25.70  ? 783  SER A CB    1 
ATOM   6356 O  OG    . SER A 1 783 ? -14.737 47.031 37.921  1.00 26.62  ? 783  SER A OG    1 
ATOM   6357 N  N     . SER A 1 784 ? -11.851 46.437 38.415  1.00 30.23  ? 784  SER A N     1 
ATOM   6358 C  CA    . SER A 1 784 ? -10.901 47.163 39.243  1.00 29.54  ? 784  SER A CA    1 
ATOM   6359 C  C     . SER A 1 784 ? -11.667 47.991 40.263  1.00 29.43  ? 784  SER A C     1 
ATOM   6360 O  O     . SER A 1 784 ? -12.737 48.520 39.967  1.00 31.96  ? 784  SER A O     1 
ATOM   6361 C  CB    . SER A 1 784 ? -10.011 48.066 38.384  1.00 28.77  ? 784  SER A CB    1 
ATOM   6362 O  OG    . SER A 1 784 ? -9.063  47.309 37.648  1.00 28.98  ? 784  SER A OG    1 
ATOM   6363 N  N     . ALA A 1 785 ? -11.112 48.101 41.462  1.00 31.01  ? 785  ALA A N     1 
ATOM   6364 C  CA    . ALA A 1 785 ? -11.786 48.773 42.566  1.00 35.55  ? 785  ALA A CA    1 
ATOM   6365 C  C     . ALA A 1 785 ? -11.137 50.114 42.890  1.00 39.36  ? 785  ALA A C     1 
ATOM   6366 O  O     . ALA A 1 785 ? -10.404 50.232 43.872  1.00 40.78  ? 785  ALA A O     1 
ATOM   6367 C  CB    . ALA A 1 785 ? -11.766 47.882 43.786  1.00 37.15  ? 785  ALA A CB    1 
ATOM   6368 N  N     . ASN A 1 786 ? -11.410 51.124 42.070  1.00 38.45  ? 786  ASN A N     1 
ATOM   6369 C  CA    . ASN A 1 786 ? -10.801 52.438 42.263  1.00 37.93  ? 786  ASN A CA    1 
ATOM   6370 C  C     . ASN A 1 786 ? -11.706 53.430 42.987  1.00 38.35  ? 786  ASN A C     1 
ATOM   6371 O  O     . ASN A 1 786 ? -12.921 53.447 42.780  1.00 38.86  ? 786  ASN A O     1 
ATOM   6372 C  CB    . ASN A 1 786 ? -10.341 53.023 40.926  1.00 37.96  ? 786  ASN A CB    1 
ATOM   6373 C  CG    . ASN A 1 786 ? -9.241  52.207 40.283  1.00 37.83  ? 786  ASN A CG    1 
ATOM   6374 O  OD1   . ASN A 1 786 ? -8.246  51.872 40.925  1.00 40.37  ? 786  ASN A OD1   1 
ATOM   6375 N  ND2   . ASN A 1 786 ? -9.419  51.873 39.010  1.00 35.41  ? 786  ASN A ND2   1 
ATOM   6376 N  N     . ASN A 1 787 ? -11.092 54.250 43.836  1.00 37.68  ? 787  ASN A N     1 
ATOM   6377 C  CA    . ASN A 1 787 ? -11.791 55.306 44.562  1.00 40.55  ? 787  ASN A CA    1 
ATOM   6378 C  C     . ASN A 1 787 ? -12.993 54.813 45.356  1.00 42.44  ? 787  ASN A C     1 
ATOM   6379 O  O     . ASN A 1 787 ? -14.074 55.402 45.298  1.00 46.50  ? 787  ASN A O     1 
ATOM   6380 C  CB    . ASN A 1 787 ? -12.203 56.431 43.611  1.00 41.53  ? 787  ASN A CB    1 
ATOM   6381 C  CG    . ASN A 1 787 ? -11.011 57.119 42.984  1.00 45.32  ? 787  ASN A CG    1 
ATOM   6382 O  OD1   . ASN A 1 787 ? -10.774 57.001 41.781  1.00 47.51  ? 787  ASN A OD1   1 
ATOM   6383 N  ND2   . ASN A 1 787 ? -10.246 57.837 43.799  1.00 45.98  ? 787  ASN A ND2   1 
ATOM   6384 N  N     . ILE A 1 788 ? -12.793 53.727 46.094  1.00 40.38  ? 788  ILE A N     1 
ATOM   6385 C  CA    . ILE A 1 788 ? -13.839 53.172 46.944  1.00 39.68  ? 788  ILE A CA    1 
ATOM   6386 C  C     . ILE A 1 788 ? -14.319 54.202 47.967  1.00 40.81  ? 788  ILE A C     1 
ATOM   6387 O  O     . ILE A 1 788 ? -15.521 54.411 48.136  1.00 43.79  ? 788  ILE A O     1 
ATOM   6388 C  CB    . ILE A 1 788 ? -13.348 51.913 47.687  1.00 36.58  ? 788  ILE A CB    1 
ATOM   6389 C  CG1   . ILE A 1 788 ? -12.764 50.899 46.700  1.00 32.20  ? 788  ILE A CG1   1 
ATOM   6390 C  CG2   . ILE A 1 788 ? -14.479 51.294 48.495  1.00 36.55  ? 788  ILE A CG2   1 
ATOM   6391 C  CD1   . ILE A 1 788 ? -12.228 49.653 47.362  1.00 30.39  ? 788  ILE A CD1   1 
ATOM   6392 N  N     . ALA A 1 789 ? -13.370 54.852 48.634  1.00 39.07  ? 789  ALA A N     1 
ATOM   6393 C  CA    . ALA A 1 789 ? -13.689 55.812 49.682  1.00 41.53  ? 789  ALA A CA    1 
ATOM   6394 C  C     . ALA A 1 789 ? -14.377 57.052 49.121  1.00 43.55  ? 789  ALA A C     1 
ATOM   6395 O  O     . ALA A 1 789 ? -15.141 57.717 49.823  1.00 48.23  ? 789  ALA A O     1 
ATOM   6396 C  CB    . ALA A 1 789 ? -12.437 56.197 50.447  1.00 44.51  ? 789  ALA A CB    1 
ATOM   6397 N  N     . LYS A 1 790 ? -14.098 57.358 47.857  1.00 40.19  ? 790  LYS A N     1 
ATOM   6398 C  CA    . LYS A 1 790 ? -14.734 58.478 47.174  1.00 42.11  ? 790  LYS A CA    1 
ATOM   6399 C  C     . LYS A 1 790 ? -16.252 58.320 47.172  1.00 42.78  ? 790  LYS A C     1 
ATOM   6400 O  O     . LYS A 1 790 ? -16.994 59.299 47.288  1.00 44.23  ? 790  LYS A O     1 
ATOM   6401 C  CB    . LYS A 1 790 ? -14.221 58.576 45.736  1.00 42.35  ? 790  LYS A CB    1 
ATOM   6402 C  CG    . LYS A 1 790 ? -14.961 59.586 44.877  1.00 44.67  ? 790  LYS A CG    1 
ATOM   6403 C  CD    . LYS A 1 790 ? -14.418 59.611 43.456  1.00 45.63  ? 790  LYS A CD    1 
ATOM   6404 C  CE    . LYS A 1 790 ? -15.117 60.671 42.612  1.00 46.11  ? 790  LYS A CE    1 
ATOM   6405 N  NZ    . LYS A 1 790 ? -14.536 60.786 41.243  1.00 44.69  ? 790  LYS A NZ    1 
ATOM   6406 N  N     . TYR A 1 791 ? -16.704 57.076 47.052  1.00 39.09  ? 791  TYR A N     1 
ATOM   6407 C  CA    . TYR A 1 791 ? -18.129 56.787 46.964  1.00 39.90  ? 791  TYR A CA    1 
ATOM   6408 C  C     . TYR A 1 791 ? -18.683 56.189 48.257  1.00 43.65  ? 791  TYR A C     1 
ATOM   6409 O  O     . TYR A 1 791 ? -19.832 55.747 48.303  1.00 42.60  ? 791  TYR A O     1 
ATOM   6410 C  CB    . TYR A 1 791 ? -18.404 55.861 45.780  1.00 37.62  ? 791  TYR A CB    1 
ATOM   6411 C  CG    . TYR A 1 791 ? -18.039 56.467 44.440  1.00 37.59  ? 791  TYR A CG    1 
ATOM   6412 C  CD1   . TYR A 1 791 ? -16.841 56.148 43.812  1.00 33.37  ? 791  TYR A CD1   1 
ATOM   6413 C  CD2   . TYR A 1 791 ? -18.890 57.363 43.808  1.00 38.17  ? 791  TYR A CD2   1 
ATOM   6414 C  CE1   . TYR A 1 791 ? -16.507 56.701 42.591  1.00 33.15  ? 791  TYR A CE1   1 
ATOM   6415 C  CE2   . TYR A 1 791 ? -18.565 57.919 42.586  1.00 37.60  ? 791  TYR A CE2   1 
ATOM   6416 C  CZ    . TYR A 1 791 ? -17.373 57.587 41.982  1.00 36.25  ? 791  TYR A CZ    1 
ATOM   6417 O  OH    . TYR A 1 791 ? -17.055 58.146 40.767  1.00 38.70  ? 791  TYR A OH    1 
ATOM   6418 N  N     . ASP A 1 792 ? -17.864 56.195 49.307  1.00 46.27  ? 792  ASP A N     1 
ATOM   6419 C  CA    . ASP A 1 792 ? -18.258 55.649 50.603  1.00 48.34  ? 792  ASP A CA    1 
ATOM   6420 C  C     . ASP A 1 792 ? -18.885 56.719 51.502  1.00 50.09  ? 792  ASP A C     1 
ATOM   6421 O  O     . ASP A 1 792 ? -18.184 57.538 52.097  1.00 52.49  ? 792  ASP A O     1 
ATOM   6422 C  CB    . ASP A 1 792 ? -17.049 55.017 51.300  1.00 50.80  ? 792  ASP A CB    1 
ATOM   6423 C  CG    . ASP A 1 792 ? -17.440 54.124 52.469  1.00 54.04  ? 792  ASP A CG    1 
ATOM   6424 O  OD1   . ASP A 1 792 ? -16.789 53.073 52.656  1.00 52.12  ? 792  ASP A OD1   1 
ATOM   6425 O  OD2   . ASP A 1 792 ? -18.389 54.465 53.206  1.00 58.52  ? 792  ASP A OD2   1 
ATOM   6426 N  N     . VAL A 1 793 ? -20.210 56.690 51.607  1.00 48.67  ? 793  VAL A N     1 
ATOM   6427 C  CA    . VAL A 1 793 ? -20.936 57.618 52.463  1.00 50.04  ? 793  VAL A CA    1 
ATOM   6428 C  C     . VAL A 1 793 ? -21.594 56.854 53.610  1.00 52.91  ? 793  VAL A C     1 
ATOM   6429 O  O     . VAL A 1 793 ? -22.727 56.381 53.491  1.00 53.56  ? 793  VAL A O     1 
ATOM   6430 C  CB    . VAL A 1 793 ? -21.999 58.406 51.666  1.00 50.19  ? 793  VAL A CB    1 
ATOM   6431 C  CG1   . VAL A 1 793 ? -22.781 59.339 52.578  1.00 53.05  ? 793  VAL A CG1   1 
ATOM   6432 C  CG2   . VAL A 1 793 ? -21.340 59.194 50.541  1.00 49.62  ? 793  VAL A CG2   1 
ATOM   6433 N  N     . GLY A 1 794 ? -20.865 56.723 54.715  1.00 53.14  ? 794  GLY A N     1 
ATOM   6434 C  CA    . GLY A 1 794 ? -21.359 56.007 55.877  1.00 53.09  ? 794  GLY A CA    1 
ATOM   6435 C  C     . GLY A 1 794 ? -21.548 54.530 55.600  1.00 54.56  ? 794  GLY A C     1 
ATOM   6436 O  O     . GLY A 1 794 ? -22.467 53.901 56.128  1.00 58.53  ? 794  GLY A O     1 
ATOM   6437 N  N     . GLY A 1 795 ? -20.677 53.976 54.762  1.00 51.70  ? 795  GLY A N     1 
ATOM   6438 C  CA    . GLY A 1 795 ? -20.753 52.573 54.393  1.00 47.34  ? 795  GLY A CA    1 
ATOM   6439 C  C     . GLY A 1 795 ? -21.738 52.306 53.270  1.00 43.72  ? 795  GLY A C     1 
ATOM   6440 O  O     . GLY A 1 795 ? -21.937 51.159 52.866  1.00 39.27  ? 795  GLY A O     1 
ATOM   6441 N  N     . PHE A 1 796 ? -22.349 53.370 52.757  1.00 45.26  ? 796  PHE A N     1 
ATOM   6442 C  CA    . PHE A 1 796 ? -23.385 53.249 51.736  1.00 45.35  ? 796  PHE A CA    1 
ATOM   6443 C  C     . PHE A 1 796 ? -23.018 53.986 50.445  1.00 45.34  ? 796  PHE A C     1 
ATOM   6444 O  O     . PHE A 1 796 ? -22.206 54.909 50.468  1.00 46.64  ? 796  PHE A O     1 
ATOM   6445 C  CB    . PHE A 1 796 ? -24.723 53.738 52.296  1.00 47.60  ? 796  PHE A CB    1 
ATOM   6446 C  CG    . PHE A 1 796 ? -25.319 52.813 53.319  1.00 49.35  ? 796  PHE A CG    1 
ATOM   6447 C  CD1   . PHE A 1 796 ? -26.036 51.694 52.924  1.00 48.36  ? 796  PHE A CD1   1 
ATOM   6448 C  CD2   . PHE A 1 796 ? -25.155 53.057 54.672  1.00 51.75  ? 796  PHE A CD2   1 
ATOM   6449 C  CE1   . PHE A 1 796 ? -26.582 50.838 53.860  1.00 49.51  ? 796  PHE A CE1   1 
ATOM   6450 C  CE2   . PHE A 1 796 ? -25.700 52.205 55.613  1.00 53.50  ? 796  PHE A CE2   1 
ATOM   6451 C  CZ    . PHE A 1 796 ? -26.415 51.094 55.206  1.00 52.26  ? 796  PHE A CZ    1 
ATOM   6452 N  N     . PRO A 1 797 ? -23.599 53.560 49.308  1.00 46.55  ? 797  PRO A N     1 
ATOM   6453 C  CA    . PRO A 1 797 ? -23.278 54.165 48.008  1.00 45.86  ? 797  PRO A CA    1 
ATOM   6454 C  C     . PRO A 1 797 ? -23.565 55.661 47.938  1.00 47.55  ? 797  PRO A C     1 
ATOM   6455 O  O     . PRO A 1 797 ? -24.701 56.093 48.139  1.00 45.85  ? 797  PRO A O     1 
ATOM   6456 C  CB    . PRO A 1 797 ? -24.200 53.416 47.041  1.00 45.05  ? 797  PRO A CB    1 
ATOM   6457 C  CG    . PRO A 1 797 ? -24.414 52.097 47.683  1.00 45.99  ? 797  PRO A CG    1 
ATOM   6458 C  CD    . PRO A 1 797 ? -24.473 52.382 49.158  1.00 47.26  ? 797  PRO A CD    1 
ATOM   6459 N  N     . GLY A 1 798 ? -22.528 56.439 47.649  1.00 48.98  ? 798  GLY A N     1 
ATOM   6460 C  CA    . GLY A 1 798 ? -22.684 57.863 47.429  1.00 49.85  ? 798  GLY A CA    1 
ATOM   6461 C  C     . GLY A 1 798 ? -23.211 58.129 46.033  1.00 49.72  ? 798  GLY A C     1 
ATOM   6462 O  O     . GLY A 1 798 ? -23.544 57.193 45.304  1.00 46.08  ? 798  GLY A O     1 
ATOM   6463 N  N     . PRO A 1 799 ? -23.296 59.410 45.652  1.00 50.70  ? 799  PRO A N     1 
ATOM   6464 C  CA    . PRO A 1 799 ? -23.787 59.781 44.322  1.00 49.60  ? 799  PRO A CA    1 
ATOM   6465 C  C     . PRO A 1 799 ? -22.903 59.208 43.217  1.00 47.71  ? 799  PRO A C     1 
ATOM   6466 O  O     . PRO A 1 799 ? -21.676 59.220 43.343  1.00 44.43  ? 799  PRO A O     1 
ATOM   6467 C  CB    . PRO A 1 799 ? -23.708 61.312 44.336  1.00 47.46  ? 799  PRO A CB    1 
ATOM   6468 C  CG    . PRO A 1 799 ? -23.753 61.679 45.780  1.00 47.85  ? 799  PRO A CG    1 
ATOM   6469 C  CD    . PRO A 1 799 ? -23.007 60.591 46.482  1.00 49.97  ? 799  PRO A CD    1 
ATOM   6470 N  N     . LYS A 1 800 ? -23.535 58.699 42.161  1.00 46.57  ? 800  LYS A N     1 
ATOM   6471 C  CA    . LYS A 1 800 ? -22.830 58.130 41.015  1.00 44.32  ? 800  LYS A CA    1 
ATOM   6472 C  C     . LYS A 1 800 ? -21.913 56.969 41.394  1.00 44.52  ? 800  LYS A C     1 
ATOM   6473 O  O     . LYS A 1 800 ? -20.938 56.696 40.693  1.00 45.44  ? 800  LYS A O     1 
ATOM   6474 C  CB    . LYS A 1 800 ? -22.031 59.208 40.272  1.00 42.09  ? 800  LYS A CB    1 
ATOM   6475 C  CG    . LYS A 1 800 ? -22.883 60.310 39.676  1.00 44.79  ? 800  LYS A CG    1 
ATOM   6476 N  N     . CYS A 1 801 ? -22.220 56.292 42.497  1.00 43.91  ? 801  CYS A N     1 
ATOM   6477 C  CA    . CYS A 1 801 ? -21.422 55.145 42.918  1.00 42.52  ? 801  CYS A CA    1 
ATOM   6478 C  C     . CYS A 1 801 ? -21.491 54.019 41.894  1.00 39.63  ? 801  CYS A C     1 
ATOM   6479 O  O     . CYS A 1 801 ? -22.569 53.485 41.629  1.00 40.63  ? 801  CYS A O     1 
ATOM   6480 C  CB    . CYS A 1 801 ? -21.871 54.627 44.285  1.00 43.91  ? 801  CYS A CB    1 
ATOM   6481 S  SG    . CYS A 1 801 ? -20.980 53.141 44.830  1.00 48.18  ? 801  CYS A SG    1 
ATOM   6482 N  N     . PRO A 1 802 ? -20.336 53.657 41.314  1.00 35.55  ? 802  PRO A N     1 
ATOM   6483 C  CA    . PRO A 1 802 ? -20.259 52.588 40.314  1.00 36.09  ? 802  PRO A CA    1 
ATOM   6484 C  C     . PRO A 1 802 ? -20.809 51.273 40.856  1.00 35.62  ? 802  PRO A C     1 
ATOM   6485 O  O     . PRO A 1 802 ? -20.757 51.037 42.066  1.00 38.64  ? 802  PRO A O     1 
ATOM   6486 C  CB    . PRO A 1 802 ? -18.757 52.473 40.042  1.00 34.39  ? 802  PRO A CB    1 
ATOM   6487 C  CG    . PRO A 1 802 ? -18.216 53.817 40.375  1.00 32.38  ? 802  PRO A CG    1 
ATOM   6488 C  CD    . PRO A 1 802 ? -19.023 54.278 41.552  1.00 33.62  ? 802  PRO A CD    1 
ATOM   6489 N  N     . PHE A 1 803 ? -21.342 50.445 39.964  1.00 32.95  ? 803  PHE A N     1 
ATOM   6490 C  CA    . PHE A 1 803 ? -21.966 49.181 40.338  1.00 33.86  ? 803  PHE A CA    1 
ATOM   6491 C  C     . PHE A 1 803 ? -21.048 48.304 41.184  1.00 31.10  ? 803  PHE A C     1 
ATOM   6492 O  O     . PHE A 1 803 ? -21.453 47.802 42.231  1.00 32.71  ? 803  PHE A O     1 
ATOM   6493 C  CB    . PHE A 1 803 ? -22.403 48.423 39.083  1.00 36.57  ? 803  PHE A CB    1 
ATOM   6494 C  CG    . PHE A 1 803 ? -23.251 47.212 39.362  1.00 36.49  ? 803  PHE A CG    1 
ATOM   6495 C  CD1   . PHE A 1 803 ? -24.617 47.339 39.566  1.00 38.77  ? 803  PHE A CD1   1 
ATOM   6496 C  CD2   . PHE A 1 803 ? -22.688 45.947 39.404  1.00 33.19  ? 803  PHE A CD2   1 
ATOM   6497 C  CE1   . PHE A 1 803 ? -25.405 46.229 39.815  1.00 38.38  ? 803  PHE A CE1   1 
ATOM   6498 C  CE2   . PHE A 1 803 ? -23.469 44.835 39.654  1.00 34.50  ? 803  PHE A CE2   1 
ATOM   6499 C  CZ    . PHE A 1 803 ? -24.831 44.976 39.858  1.00 36.75  ? 803  PHE A CZ    1 
ATOM   6500 N  N     . HIS A 1 804 ? -19.813 48.127 40.730  1.00 28.87  ? 804  HIS A N     1 
ATOM   6501 C  CA    . HIS A 1 804 ? -18.875 47.253 41.424  1.00 30.95  ? 804  HIS A CA    1 
ATOM   6502 C  C     . HIS A 1 804 ? -18.447 47.841 42.761  1.00 35.32  ? 804  HIS A C     1 
ATOM   6503 O  O     . HIS A 1 804 ? -18.207 47.108 43.720  1.00 38.14  ? 804  HIS A O     1 
ATOM   6504 C  CB    . HIS A 1 804 ? -17.656 46.957 40.552  1.00 29.07  ? 804  HIS A CB    1 
ATOM   6505 C  CG    . HIS A 1 804 ? -16.866 48.172 40.180  1.00 29.43  ? 804  HIS A CG    1 
ATOM   6506 N  ND1   . HIS A 1 804 ? -17.305 49.092 39.252  1.00 30.93  ? 804  HIS A ND1   1 
ATOM   6507 C  CD2   . HIS A 1 804 ? -15.655 48.609 40.599  1.00 28.32  ? 804  HIS A CD2   1 
ATOM   6508 C  CE1   . HIS A 1 804 ? -16.402 50.047 39.121  1.00 30.14  ? 804  HIS A CE1   1 
ATOM   6509 N  NE2   . HIS A 1 804 ? -15.391 49.778 39.926  1.00 29.39  ? 804  HIS A NE2   1 
ATOM   6510 N  N     . ILE A 1 805 ? -18.349 49.165 42.825  1.00 34.96  ? 805  ILE A N     1 
ATOM   6511 C  CA    . ILE A 1 805 ? -18.016 49.831 44.079  1.00 32.39  ? 805  ILE A CA    1 
ATOM   6512 C  C     . ILE A 1 805 ? -19.150 49.625 45.080  1.00 30.89  ? 805  ILE A C     1 
ATOM   6513 O  O     . ILE A 1 805 ? -18.908 49.403 46.264  1.00 34.39  ? 805  ILE A O     1 
ATOM   6514 C  CB    . ILE A 1 805 ? -17.744 51.337 43.874  1.00 31.45  ? 805  ILE A CB    1 
ATOM   6515 C  CG1   . ILE A 1 805 ? -16.633 51.544 42.841  1.00 28.76  ? 805  ILE A CG1   1 
ATOM   6516 C  CG2   . ILE A 1 805 ? -17.367 52.006 45.191  1.00 29.84  ? 805  ILE A CG2   1 
ATOM   6517 C  CD1   . ILE A 1 805 ? -15.284 50.983 43.260  1.00 25.83  ? 805  ILE A CD1   1 
ATOM   6518 N  N     . ARG A 1 806 ? -20.386 49.687 44.593  1.00 29.49  ? 806  ARG A N     1 
ATOM   6519 C  CA    . ARG A 1 806 ? -21.553 49.390 45.415  1.00 31.70  ? 806  ARG A CA    1 
ATOM   6520 C  C     . ARG A 1 806 ? -21.444 47.990 46.015  1.00 34.26  ? 806  ARG A C     1 
ATOM   6521 O  O     . ARG A 1 806 ? -21.763 47.776 47.188  1.00 34.65  ? 806  ARG A O     1 
ATOM   6522 C  CB    . ARG A 1 806 ? -22.835 49.505 44.589  1.00 30.85  ? 806  ARG A CB    1 
ATOM   6523 C  CG    . ARG A 1 806 ? -24.070 48.925 45.269  1.00 32.91  ? 806  ARG A CG    1 
ATOM   6524 C  CD    . ARG A 1 806 ? -25.302 49.068 44.388  1.00 33.72  ? 806  ARG A CD    1 
ATOM   6525 N  NE    . ARG A 1 806 ? -25.538 50.461 44.024  1.00 35.38  ? 806  ARG A NE    1 
ATOM   6526 C  CZ    . ARG A 1 806 ? -26.313 51.291 44.713  1.00 35.60  ? 806  ARG A CZ    1 
ATOM   6527 N  NH1   . ARG A 1 806 ? -26.937 50.864 45.803  1.00 37.50  ? 806  ARG A NH1   1 
ATOM   6528 N  NH2   . ARG A 1 806 ? -26.466 52.547 44.314  1.00 30.84  ? 806  ARG A NH2   1 
ATOM   6529 N  N     . GLY A 1 807 ? -20.982 47.044 45.203  1.00 33.67  ? 807  GLY A N     1 
ATOM   6530 C  CA    . GLY A 1 807 ? -20.796 45.676 45.649  1.00 34.54  ? 807  GLY A CA    1 
ATOM   6531 C  C     . GLY A 1 807 ? -19.783 45.561 46.769  1.00 36.57  ? 807  GLY A C     1 
ATOM   6532 O  O     . GLY A 1 807 ? -19.943 44.749 47.682  1.00 39.10  ? 807  GLY A O     1 
ATOM   6533 N  N     . ILE A 1 808 ? -18.739 46.380 46.699  1.00 34.72  ? 808  ILE A N     1 
ATOM   6534 C  CA    . ILE A 1 808 ? -17.696 46.389 47.718  1.00 34.63  ? 808  ILE A CA    1 
ATOM   6535 C  C     . ILE A 1 808 ? -18.227 46.920 49.045  1.00 35.94  ? 808  ILE A C     1 
ATOM   6536 O  O     . ILE A 1 808 ? -17.945 46.362 50.107  1.00 38.23  ? 808  ILE A O     1 
ATOM   6537 C  CB    . ILE A 1 808 ? -16.491 47.226 47.268  1.00 33.60  ? 808  ILE A CB    1 
ATOM   6538 C  CG1   . ILE A 1 808 ? -15.832 46.575 46.052  1.00 32.33  ? 808  ILE A CG1   1 
ATOM   6539 C  CG2   . ILE A 1 808 ? -15.488 47.381 48.402  1.00 32.88  ? 808  ILE A CG2   1 
ATOM   6540 C  CD1   . ILE A 1 808 ? -14.778 47.424 45.422  1.00 31.45  ? 808  ILE A CD1   1 
ATOM   6541 N  N     . LEU A 1 809 ? -19.003 47.995 48.974  1.00 33.51  ? 809  LEU A N     1 
ATOM   6542 C  CA    . LEU A 1 809 ? -19.610 48.583 50.157  1.00 35.73  ? 809  LEU A CA    1 
ATOM   6543 C  C     . LEU A 1 809 ? -20.546 47.591 50.832  1.00 38.27  ? 809  LEU A C     1 
ATOM   6544 O  O     . LEU A 1 809 ? -20.577 47.488 52.058  1.00 43.04  ? 809  LEU A O     1 
ATOM   6545 C  CB    . LEU A 1 809 ? -20.373 49.847 49.776  1.00 38.40  ? 809  LEU A CB    1 
ATOM   6546 C  CG    . LEU A 1 809 ? -19.495 50.927 49.146  1.00 39.80  ? 809  LEU A CG    1 
ATOM   6547 C  CD1   . LEU A 1 809 ? -20.324 52.142 48.767  1.00 43.48  ? 809  LEU A CD1   1 
ATOM   6548 C  CD2   . LEU A 1 809 ? -18.368 51.309 50.095  1.00 38.93  ? 809  LEU A CD2   1 
ATOM   6549 N  N     . THR A 1 810 ? -21.306 46.862 50.020  1.00 35.15  ? 810  THR A N     1 
ATOM   6550 C  CA    . THR A 1 810 ? -22.190 45.816 50.516  1.00 35.52  ? 810  THR A CA    1 
ATOM   6551 C  C     . THR A 1 810 ? -21.377 44.777 51.273  1.00 41.88  ? 810  THR A C     1 
ATOM   6552 O  O     . THR A 1 810 ? -21.781 44.297 52.335  1.00 46.28  ? 810  THR A O     1 
ATOM   6553 C  CB    . THR A 1 810 ? -22.910 45.115 49.355  1.00 33.61  ? 810  THR A CB    1 
ATOM   6554 O  OG1   . THR A 1 810 ? -23.620 46.087 48.576  1.00 36.15  ? 810  THR A OG1   1 
ATOM   6555 C  CG2   . THR A 1 810 ? -23.883 44.067 49.877  1.00 31.39  ? 810  THR A CG2   1 
ATOM   6556 N  N     . TYR A 1 811 ? -20.220 44.447 50.712  1.00 40.84  ? 811  TYR A N     1 
ATOM   6557 C  CA    . TYR A 1 811 ? -19.302 43.488 51.307  1.00 38.48  ? 811  TYR A CA    1 
ATOM   6558 C  C     . TYR A 1 811 ? -18.751 43.999 52.632  1.00 39.36  ? 811  TYR A C     1 
ATOM   6559 O  O     . TYR A 1 811 ? -18.724 43.271 53.623  1.00 42.01  ? 811  TYR A O     1 
ATOM   6560 C  CB    . TYR A 1 811 ? -18.158 43.208 50.338  1.00 34.42  ? 811  TYR A CB    1 
ATOM   6561 C  CG    . TYR A 1 811 ? -17.093 42.268 50.855  1.00 33.20  ? 811  TYR A CG    1 
ATOM   6562 C  CD1   . TYR A 1 811 ? -17.340 40.908 50.984  1.00 34.11  ? 811  TYR A CD1   1 
ATOM   6563 C  CD2   . TYR A 1 811 ? -15.829 42.740 51.189  1.00 33.57  ? 811  TYR A CD2   1 
ATOM   6564 C  CE1   . TYR A 1 811 ? -16.364 40.045 51.450  1.00 35.20  ? 811  TYR A CE1   1 
ATOM   6565 C  CE2   . TYR A 1 811 ? -14.847 41.886 51.653  1.00 34.08  ? 811  TYR A CE2   1 
ATOM   6566 C  CZ    . TYR A 1 811 ? -15.120 40.540 51.783  1.00 35.15  ? 811  TYR A CZ    1 
ATOM   6567 O  OH    . TYR A 1 811 ? -14.147 39.685 52.244  1.00 35.23  ? 811  TYR A OH    1 
ATOM   6568 N  N     . ASN A 1 812 ? -18.315 45.254 52.643  1.00 36.74  ? 812  ASN A N     1 
ATOM   6569 C  CA    . ASN A 1 812 ? -17.771 45.851 53.854  1.00 38.00  ? 812  ASN A CA    1 
ATOM   6570 C  C     . ASN A 1 812 ? -18.793 45.863 54.990  1.00 42.94  ? 812  ASN A C     1 
ATOM   6571 O  O     . ASN A 1 812 ? -18.439 45.663 56.152  1.00 48.56  ? 812  ASN A O     1 
ATOM   6572 C  CB    . ASN A 1 812 ? -17.237 47.260 53.579  1.00 37.02  ? 812  ASN A CB    1 
ATOM   6573 C  CG    . ASN A 1 812 ? -16.045 47.260 52.633  1.00 37.32  ? 812  ASN A CG    1 
ATOM   6574 O  OD1   . ASN A 1 812 ? -15.379 46.238 52.449  1.00 36.25  ? 812  ASN A OD1   1 
ATOM   6575 N  ND2   . ASN A 1 812 ? -15.766 48.411 52.033  1.00 35.60  ? 812  ASN A ND2   1 
ATOM   6576 N  N     . ARG A 1 813 ? -20.062 46.076 54.647  1.00 41.46  ? 813  ARG A N     1 
ATOM   6577 C  CA    . ARG A 1 813 ? -21.137 46.074 55.637  1.00 41.13  ? 813  ARG A CA    1 
ATOM   6578 C  C     . ARG A 1 813 ? -21.409 44.668 56.159  1.00 43.68  ? 813  ARG A C     1 
ATOM   6579 O  O     . ARG A 1 813 ? -21.774 44.486 57.321  1.00 45.55  ? 813  ARG A O     1 
ATOM   6580 C  CB    . ARG A 1 813 ? -22.421 46.650 55.042  1.00 37.78  ? 813  ARG A CB    1 
ATOM   6581 C  CG    . ARG A 1 813 ? -22.330 48.108 54.645  1.00 38.69  ? 813  ARG A CG    1 
ATOM   6582 C  CD    . ARG A 1 813 ? -23.716 48.685 54.427  1.00 42.01  ? 813  ARG A CD    1 
ATOM   6583 N  NE    . ARG A 1 813 ? -24.498 47.885 53.489  1.00 41.92  ? 813  ARG A NE    1 
ATOM   6584 C  CZ    . ARG A 1 813 ? -24.572 48.126 52.184  1.00 41.48  ? 813  ARG A CZ    1 
ATOM   6585 N  NH1   . ARG A 1 813 ? -23.910 49.148 51.658  1.00 38.81  ? 813  ARG A NH1   1 
ATOM   6586 N  NH2   . ARG A 1 813 ? -25.309 47.346 51.404  1.00 43.31  ? 813  ARG A NH2   1 
ATOM   6587 N  N     . ALA A 1 814 ? -21.234 43.678 55.289  1.00 43.06  ? 814  ALA A N     1 
ATOM   6588 C  CA    . ALA A 1 814 ? -21.516 42.293 55.641  1.00 43.62  ? 814  ALA A CA    1 
ATOM   6589 C  C     . ALA A 1 814 ? -20.426 41.685 56.520  1.00 44.98  ? 814  ALA A C     1 
ATOM   6590 O  O     . ALA A 1 814 ? -20.707 40.824 57.354  1.00 48.58  ? 814  ALA A O     1 
ATOM   6591 C  CB    . ALA A 1 814 ? -21.719 41.458 54.385  1.00 42.24  ? 814  ALA A CB    1 
ATOM   6592 N  N     . ILE A 1 815 ? -19.186 42.130 56.334  1.00 42.93  ? 815  ILE A N     1 
ATOM   6593 C  CA    . ILE A 1 815 ? -18.067 41.602 57.111  1.00 46.07  ? 815  ILE A CA    1 
ATOM   6594 C  C     . ILE A 1 815 ? -17.622 42.551 58.216  1.00 49.88  ? 815  ILE A C     1 
ATOM   6595 O  O     . ILE A 1 815 ? -16.625 42.296 58.891  1.00 52.54  ? 815  ILE A O     1 
ATOM   6596 C  CB    . ILE A 1 815 ? -16.839 41.291 56.230  1.00 45.74  ? 815  ILE A CB    1 
ATOM   6597 C  CG1   . ILE A 1 815 ? -16.275 42.582 55.631  1.00 46.20  ? 815  ILE A CG1   1 
ATOM   6598 C  CG2   . ILE A 1 815 ? -17.191 40.278 55.151  1.00 45.27  ? 815  ILE A CG2   1 
ATOM   6599 C  CD1   . ILE A 1 815 ? -14.858 42.452 55.126  1.00 46.44  ? 815  ILE A CD1   1 
ATOM   6600 N  N     . LYS A 1 816 ? -18.357 43.646 58.387  1.00 50.48  ? 816  LYS A N     1 
ATOM   6601 C  CA    . LYS A 1 816 ? -18.051 44.634 59.415  1.00 52.01  ? 816  LYS A CA    1 
ATOM   6602 C  C     . LYS A 1 816 ? -17.922 43.976 60.784  1.00 58.24  ? 816  LYS A C     1 
ATOM   6603 O  O     . LYS A 1 816 ? -18.868 43.360 61.273  1.00 61.80  ? 816  LYS A O     1 
ATOM   6604 C  CB    . LYS A 1 816 ? -19.141 45.708 59.449  1.00 50.19  ? 816  LYS A CB    1 
ATOM   6605 C  CG    . LYS A 1 816 ? -18.874 46.843 60.420  1.00 50.76  ? 816  LYS A CG    1 
ATOM   6606 N  N     . GLY A 1 817 ? -16.742 44.083 61.388  1.00 61.41  ? 817  GLY A N     1 
ATOM   6607 C  CA    . GLY A 1 817 ? -16.520 43.533 62.713  1.00 68.04  ? 817  GLY A CA    1 
ATOM   6608 C  C     . GLY A 1 817 ? -15.691 42.262 62.736  1.00 71.78  ? 817  GLY A C     1 
ATOM   6609 O  O     . GLY A 1 817 ? -15.458 41.680 63.798  1.00 74.64  ? 817  GLY A O     1 
ATOM   6610 N  N     . ASN A 1 818 ? -15.249 41.822 61.564  1.00 71.02  ? 818  ASN A N     1 
ATOM   6611 C  CA    . ASN A 1 818 ? -14.363 40.670 61.474  1.00 73.18  ? 818  ASN A CA    1 
ATOM   6612 C  C     . ASN A 1 818 ? -12.977 41.097 61.015  1.00 76.80  ? 818  ASN A C     1 
ATOM   6613 O  O     . ASN A 1 818 ? -12.758 41.341 59.828  1.00 77.65  ? 818  ASN A O     1 
ATOM   6614 C  CB    . ASN A 1 818 ? -14.928 39.620 60.516  1.00 72.17  ? 818  ASN A CB    1 
ATOM   6615 C  CG    . ASN A 1 818 ? -16.217 39.001 61.019  1.00 75.99  ? 818  ASN A CG    1 
ATOM   6616 O  OD1   . ASN A 1 818 ? -16.202 37.982 61.709  1.00 79.41  ? 818  ASN A OD1   1 
ATOM   6617 N  ND2   . ASN A 1 818 ? -17.344 39.608 60.663  1.00 75.52  ? 818  ASN A ND2   1 
ATOM   6618 N  N     . ILE A 1 819 ? -12.046 41.194 61.959  1.00 77.97  ? 819  ILE A N     1 
ATOM   6619 C  CA    . ILE A 1 819 ? -10.673 41.559 61.633  1.00 76.74  ? 819  ILE A CA    1 
ATOM   6620 C  C     . ILE A 1 819 ? -10.024 40.468 60.785  1.00 76.94  ? 819  ILE A C     1 
ATOM   6621 O  O     . ILE A 1 819 ? -9.129  40.738 59.984  1.00 77.48  ? 819  ILE A O     1 
ATOM   6622 C  CB    . ILE A 1 819 ? -9.831  41.790 62.902  1.00 77.28  ? 819  ILE A CB    1 
ATOM   6623 N  N     . ASP A 1 820 ? -10.494 39.236 60.960  1.00 74.69  ? 820  ASP A N     1 
ATOM   6624 C  CA    . ASP A 1 820 ? -9.962  38.096 60.225  1.00 70.00  ? 820  ASP A CA    1 
ATOM   6625 C  C     . ASP A 1 820 ? -10.440 38.067 58.774  1.00 66.35  ? 820  ASP A C     1 
ATOM   6626 O  O     . ASP A 1 820 ? -9.811  37.442 57.919  1.00 65.24  ? 820  ASP A O     1 
ATOM   6627 C  CB    . ASP A 1 820 ? -10.341 36.790 60.927  1.00 70.18  ? 820  ASP A CB    1 
ATOM   6628 N  N     . ALA A 1 821 ? -11.551 38.744 58.499  1.00 63.40  ? 821  ALA A N     1 
ATOM   6629 C  CA    . ALA A 1 821 ? -12.125 38.766 57.153  1.00 56.86  ? 821  ALA A CA    1 
ATOM   6630 C  C     . ALA A 1 821 ? -11.234 39.508 56.159  1.00 50.49  ? 821  ALA A C     1 
ATOM   6631 O  O     . ALA A 1 821 ? -10.626 40.523 56.500  1.00 50.31  ? 821  ALA A O     1 
ATOM   6632 C  CB    . ALA A 1 821 ? -13.519 39.382 57.178  1.00 58.23  ? 821  ALA A CB    1 
ATOM   6633 N  N     . PRO A 1 822 ? -11.153 38.994 54.922  1.00 47.40  ? 822  PRO A N     1 
ATOM   6634 C  CA    . PRO A 1 822 ? -10.343 39.597 53.858  1.00 45.75  ? 822  PRO A CA    1 
ATOM   6635 C  C     . PRO A 1 822 ? -10.870 40.965 53.451  1.00 45.30  ? 822  PRO A C     1 
ATOM   6636 O  O     . PRO A 1 822 ? -12.062 41.115 53.183  1.00 46.71  ? 822  PRO A O     1 
ATOM   6637 C  CB    . PRO A 1 822 ? -10.507 38.614 52.693  1.00 41.98  ? 822  PRO A CB    1 
ATOM   6638 C  CG    . PRO A 1 822 ? -10.910 37.328 53.328  1.00 43.70  ? 822  PRO A CG    1 
ATOM   6639 C  CD    . PRO A 1 822 ? -11.762 37.724 54.492  1.00 46.63  ? 822  PRO A CD    1 
ATOM   6640 N  N     . GLN A 1 823 ? -9.983  41.951 53.407  1.00 43.17  ? 823  GLN A N     1 
ATOM   6641 C  CA    . GLN A 1 823 ? -10.374 43.298 53.025  1.00 41.37  ? 823  GLN A CA    1 
ATOM   6642 C  C     . GLN A 1 823 ? -10.137 43.523 51.537  1.00 41.45  ? 823  GLN A C     1 
ATOM   6643 O  O     . GLN A 1 823 ? -9.184  42.998 50.960  1.00 36.68  ? 823  GLN A O     1 
ATOM   6644 C  CB    . GLN A 1 823 ? -9.616  44.338 53.852  1.00 39.97  ? 823  GLN A CB    1 
ATOM   6645 C  CG    . GLN A 1 823 ? -9.786  44.174 55.353  1.00 43.69  ? 823  GLN A CG    1 
ATOM   6646 C  CD    . GLN A 1 823 ? -11.222 44.362 55.807  1.00 47.94  ? 823  GLN A CD    1 
ATOM   6647 O  OE1   . GLN A 1 823 ? -11.974 45.151 55.232  1.00 46.97  ? 823  GLN A OE1   1 
ATOM   6648 N  NE2   . GLN A 1 823 ? -11.609 43.635 56.849  1.00 51.69  ? 823  GLN A NE2   1 
ATOM   6649 N  N     . VAL A 1 824 ? -11.027 44.287 50.916  1.00 44.32  ? 824  VAL A N     1 
ATOM   6650 C  CA    . VAL A 1 824 ? -10.854 44.679 49.527  1.00 41.89  ? 824  VAL A CA    1 
ATOM   6651 C  C     . VAL A 1 824 ? -9.766  45.745 49.464  1.00 40.13  ? 824  VAL A C     1 
ATOM   6652 O  O     . VAL A 1 824 ? -9.838  46.750 50.167  1.00 41.46  ? 824  VAL A O     1 
ATOM   6653 C  CB    . VAL A 1 824 ? -12.171 45.224 48.926  1.00 38.98  ? 824  VAL A CB    1 
ATOM   6654 C  CG1   . VAL A 1 824 ? -11.918 45.897 47.579  1.00 37.04  ? 824  VAL A CG1   1 
ATOM   6655 C  CG2   . VAL A 1 824 ? -13.204 44.109 48.795  1.00 33.65  ? 824  VAL A CG2   1 
ATOM   6656 N  N     . VAL A 1 825 ? -8.749  45.516 48.641  1.00 39.05  ? 825  VAL A N     1 
ATOM   6657 C  CA    . VAL A 1 825 ? -7.660  46.478 48.504  1.00 39.90  ? 825  VAL A CA    1 
ATOM   6658 C  C     . VAL A 1 825 ? -7.963  47.503 47.418  1.00 35.65  ? 825  VAL A C     1 
ATOM   6659 O  O     . VAL A 1 825 ? -8.295  47.142 46.287  1.00 35.00  ? 825  VAL A O     1 
ATOM   6660 C  CB    . VAL A 1 825 ? -6.316  45.788 48.174  1.00 39.80  ? 825  VAL A CB    1 
ATOM   6661 C  CG1   . VAL A 1 825 ? -5.221  46.825 47.967  1.00 37.49  ? 825  VAL A CG1   1 
ATOM   6662 C  CG2   . VAL A 1 825 ? -5.928  44.805 49.273  1.00 40.60  ? 825  VAL A CG2   1 
ATOM   6663 N  N     . GLU A 1 826 ? -7.854  48.779 47.774  1.00 35.49  ? 826  GLU A N     1 
ATOM   6664 C  CA    . GLU A 1 826 ? -8.000  49.866 46.813  1.00 36.58  ? 826  GLU A CA    1 
ATOM   6665 C  C     . GLU A 1 826 ? -7.082  49.657 45.610  1.00 37.55  ? 826  GLU A C     1 
ATOM   6666 O  O     . GLU A 1 826 ? -5.885  49.403 45.766  1.00 37.61  ? 826  GLU A O     1 
ATOM   6667 C  CB    . GLU A 1 826 ? -7.689  51.206 47.483  1.00 37.07  ? 826  GLU A CB    1 
ATOM   6668 C  CG    . GLU A 1 826 ? -7.420  52.349 46.513  1.00 38.53  ? 826  GLU A CG    1 
ATOM   6669 C  CD    . GLU A 1 826 ? -8.684  52.913 45.885  1.00 40.47  ? 826  GLU A CD    1 
ATOM   6670 O  OE1   . GLU A 1 826 ? -9.756  52.846 46.524  1.00 39.26  ? 826  GLU A OE1   1 
ATOM   6671 O  OE2   . GLU A 1 826 ? -8.604  53.434 44.751  1.00 42.16  ? 826  GLU A OE2   1 
ATOM   6672 N  N     . GLY A 1 827 ? -7.652  49.740 44.412  1.00 36.83  ? 827  GLY A N     1 
ATOM   6673 C  CA    . GLY A 1 827 ? -6.873  49.606 43.196  1.00 38.62  ? 827  GLY A CA    1 
ATOM   6674 C  C     . GLY A 1 827 ? -6.801  48.190 42.654  1.00 38.17  ? 827  GLY A C     1 
ATOM   6675 O  O     . GLY A 1 827 ? -6.625  47.990 41.450  1.00 39.29  ? 827  GLY A O     1 
ATOM   6676 N  N     . GLU A 1 828 ? -6.927  47.204 43.537  1.00 37.21  ? 828  GLU A N     1 
ATOM   6677 C  CA    . GLU A 1 828 ? -6.916  45.812 43.106  1.00 37.23  ? 828  GLU A CA    1 
ATOM   6678 C  C     . GLU A 1 828 ? -8.273  45.417 42.525  1.00 33.57  ? 828  GLU A C     1 
ATOM   6679 O  O     . GLU A 1 828 ? -9.194  46.230 42.461  1.00 36.57  ? 828  GLU A O     1 
ATOM   6680 C  CB    . GLU A 1 828 ? -6.484  44.882 44.245  1.00 42.81  ? 828  GLU A CB    1 
ATOM   6681 C  CG    . GLU A 1 828 ? -5.030  45.102 44.674  1.00 52.00  ? 828  GLU A CG    1 
ATOM   6682 C  CD    . GLU A 1 828 ? -4.449  43.959 45.498  1.00 56.58  ? 828  GLU A CD    1 
ATOM   6683 O  OE1   . GLU A 1 828 ? -5.224  43.122 46.014  1.00 58.20  ? 828  GLU A OE1   1 
ATOM   6684 O  OE2   . GLU A 1 828 ? -3.206  43.902 45.624  1.00 55.92  ? 828  GLU A OE2   1 
ATOM   6685 N  N     . LYS A 1 829 ? -8.395  44.175 42.084  1.00 28.00  ? 829  LYS A N     1 
ATOM   6686 C  CA    . LYS A 1 829 ? -9.607  43.756 41.395  1.00 26.40  ? 829  LYS A CA    1 
ATOM   6687 C  C     . LYS A 1 829 ? -10.555 42.964 42.290  1.00 26.42  ? 829  LYS A C     1 
ATOM   6688 O  O     . LYS A 1 829 ? -10.140 42.368 43.283  1.00 30.07  ? 829  LYS A O     1 
ATOM   6689 C  CB    . LYS A 1 829 ? -9.254  42.973 40.131  1.00 24.73  ? 829  LYS A CB    1 
ATOM   6690 C  CG    . LYS A 1 829 ? -8.480  43.808 39.122  1.00 25.32  ? 829  LYS A CG    1 
ATOM   6691 C  CD    . LYS A 1 829 ? -8.329  43.118 37.781  1.00 23.53  ? 829  LYS A CD    1 
ATOM   6692 C  CE    . LYS A 1 829 ? -7.717  44.073 36.771  1.00 25.39  ? 829  LYS A CE    1 
ATOM   6693 N  NZ    . LYS A 1 829 ? -7.683  43.500 35.398  1.00 28.17  ? 829  LYS A NZ    1 
ATOM   6694 N  N     . VAL A 1 830 ? -11.834 42.975 41.940  1.00 22.67  ? 830  VAL A N     1 
ATOM   6695 C  CA    . VAL A 1 830 ? -12.838 42.280 42.728  1.00 23.06  ? 830  VAL A CA    1 
ATOM   6696 C  C     . VAL A 1 830 ? -13.726 41.416 41.848  1.00 25.22  ? 830  VAL A C     1 
ATOM   6697 O  O     . VAL A 1 830 ? -13.903 41.697 40.663  1.00 25.22  ? 830  VAL A O     1 
ATOM   6698 C  CB    . VAL A 1 830 ? -13.732 43.266 43.511  1.00 25.22  ? 830  VAL A CB    1 
ATOM   6699 C  CG1   . VAL A 1 830 ? -12.926 43.988 44.580  1.00 28.40  ? 830  VAL A CG1   1 
ATOM   6700 C  CG2   . VAL A 1 830 ? -14.384 44.263 42.569  1.00 22.81  ? 830  VAL A CG2   1 
ATOM   6701 N  N     . TYR A 1 831 ? -14.262 40.350 42.429  1.00 26.21  ? 831  TYR A N     1 
ATOM   6702 C  CA    . TYR A 1 831 ? -15.327 39.598 41.790  1.00 27.61  ? 831  TYR A CA    1 
ATOM   6703 C  C     . TYR A 1 831 ? -16.611 40.313 42.146  1.00 29.02  ? 831  TYR A C     1 
ATOM   6704 O  O     . TYR A 1 831 ? -16.737 40.816 43.253  1.00 31.11  ? 831  TYR A O     1 
ATOM   6705 C  CB    . TYR A 1 831 ? -15.379 38.167 42.313  1.00 28.87  ? 831  TYR A CB    1 
ATOM   6706 C  CG    . TYR A 1 831 ? -14.339 37.241 41.728  1.00 29.83  ? 831  TYR A CG    1 
ATOM   6707 C  CD1   . TYR A 1 831 ? -14.129 37.171 40.356  1.00 30.66  ? 831  TYR A CD1   1 
ATOM   6708 C  CD2   . TYR A 1 831 ? -13.576 36.424 42.550  1.00 30.92  ? 831  TYR A CD2   1 
ATOM   6709 C  CE1   . TYR A 1 831 ? -13.176 36.317 39.819  1.00 31.09  ? 831  TYR A CE1   1 
ATOM   6710 C  CE2   . TYR A 1 831 ? -12.627 35.570 42.027  1.00 31.67  ? 831  TYR A CE2   1 
ATOM   6711 C  CZ    . TYR A 1 831 ? -12.427 35.519 40.663  1.00 31.60  ? 831  TYR A CZ    1 
ATOM   6712 O  OH    . TYR A 1 831 ? -11.475 34.664 40.150  1.00 29.56  ? 831  TYR A OH    1 
ATOM   6713 N  N     . VAL A 1 832 ? -17.555 40.377 41.214  1.00 27.73  ? 832  VAL A N     1 
ATOM   6714 C  CA    . VAL A 1 832 ? -18.822 41.054 41.467  1.00 26.57  ? 832  VAL A CA    1 
ATOM   6715 C  C     . VAL A 1 832 ? -19.997 40.142 41.134  1.00 28.02  ? 832  VAL A C     1 
ATOM   6716 O  O     . VAL A 1 832 ? -20.022 39.519 40.072  1.00 31.03  ? 832  VAL A O     1 
ATOM   6717 C  CB    . VAL A 1 832 ? -18.937 42.352 40.643  1.00 28.01  ? 832  VAL A CB    1 
ATOM   6718 C  CG1   . VAL A 1 832 ? -20.265 43.046 40.918  1.00 27.75  ? 832  VAL A CG1   1 
ATOM   6719 C  CG2   . VAL A 1 832 ? -17.768 43.281 40.950  1.00 27.80  ? 832  VAL A CG2   1 
ATOM   6720 N  N     . LEU A 1 833 ? -20.964 40.059 42.045  1.00 25.56  ? 833  LEU A N     1 
ATOM   6721 C  CA    . LEU A 1 833 ? -22.157 39.243 41.825  1.00 25.99  ? 833  LEU A CA    1 
ATOM   6722 C  C     . LEU A 1 833 ? -23.440 40.014 42.107  1.00 28.82  ? 833  LEU A C     1 
ATOM   6723 O  O     . LEU A 1 833 ? -23.513 40.770 43.074  1.00 29.28  ? 833  LEU A O     1 
ATOM   6724 C  CB    . LEU A 1 833 ? -22.126 37.987 42.694  1.00 24.30  ? 833  LEU A CB    1 
ATOM   6725 C  CG    . LEU A 1 833 ? -21.307 36.803 42.185  1.00 23.92  ? 833  LEU A CG    1 
ATOM   6726 C  CD1   . LEU A 1 833 ? -21.413 35.637 43.160  1.00 25.45  ? 833  LEU A CD1   1 
ATOM   6727 C  CD2   . LEU A 1 833 ? -21.773 36.397 40.795  1.00 21.59  ? 833  LEU A CD2   1 
ATOM   6728 N  N     . PRO A 1 834 ? -24.461 39.816 41.260  1.00 29.80  ? 834  PRO A N     1 
ATOM   6729 C  CA    . PRO A 1 834 ? -25.777 40.413 41.504  1.00 28.16  ? 834  PRO A CA    1 
ATOM   6730 C  C     . PRO A 1 834 ? -26.542 39.615 42.554  1.00 31.39  ? 834  PRO A C     1 
ATOM   6731 O  O     . PRO A 1 834 ? -26.397 38.395 42.627  1.00 31.92  ? 834  PRO A O     1 
ATOM   6732 C  CB    . PRO A 1 834 ? -26.464 40.302 40.141  1.00 25.52  ? 834  PRO A CB    1 
ATOM   6733 C  CG    . PRO A 1 834 ? -25.846 39.091 39.512  1.00 25.51  ? 834  PRO A CG    1 
ATOM   6734 C  CD    . PRO A 1 834 ? -24.418 39.054 39.997  1.00 27.92  ? 834  PRO A CD    1 
ATOM   6735 N  N     . LEU A 1 835 ? -27.339 40.306 43.361  1.00 34.39  ? 835  LEU A N     1 
ATOM   6736 C  CA    . LEU A 1 835 ? -28.123 39.662 44.409  1.00 35.26  ? 835  LEU A CA    1 
ATOM   6737 C  C     . LEU A 1 835 ? -29.611 39.888 44.172  1.00 37.89  ? 835  LEU A C     1 
ATOM   6738 O  O     . LEU A 1 835 ? -30.032 41.005 43.867  1.00 39.55  ? 835  LEU A O     1 
ATOM   6739 C  CB    . LEU A 1 835 ? -27.724 40.210 45.782  1.00 32.49  ? 835  LEU A CB    1 
ATOM   6740 C  CG    . LEU A 1 835 ? -26.268 40.022 46.215  1.00 29.71  ? 835  LEU A CG    1 
ATOM   6741 C  CD1   . LEU A 1 835 ? -26.006 40.749 47.521  1.00 30.15  ? 835  LEU A CD1   1 
ATOM   6742 C  CD2   . LEU A 1 835 ? -25.922 38.545 46.345  1.00 26.91  ? 835  LEU A CD2   1 
ATOM   6743 N  N     . ARG A 1 836 ? -30.406 38.831 44.309  1.00 38.91  ? 836  ARG A N     1 
ATOM   6744 C  CA    . ARG A 1 836 ? -31.850 38.945 44.121  1.00 42.56  ? 836  ARG A CA    1 
ATOM   6745 C  C     . ARG A 1 836 ? -32.450 39.875 45.167  1.00 45.57  ? 836  ARG A C     1 
ATOM   6746 O  O     . ARG A 1 836 ? -31.885 40.051 46.246  1.00 45.60  ? 836  ARG A O     1 
ATOM   6747 C  CB    . ARG A 1 836 ? -32.519 37.573 44.197  1.00 43.30  ? 836  ARG A CB    1 
ATOM   6748 C  CG    . ARG A 1 836 ? -31.944 36.547 43.243  1.00 42.24  ? 836  ARG A CG    1 
ATOM   6749 C  CD    . ARG A 1 836 ? -32.802 35.298 43.212  1.00 44.44  ? 836  ARG A CD    1 
ATOM   6750 N  NE    . ARG A 1 836 ? -33.150 34.852 44.557  1.00 47.93  ? 836  ARG A NE    1 
ATOM   6751 C  CZ    . ARG A 1 836 ? -32.381 34.068 45.302  1.00 48.32  ? 836  ARG A CZ    1 
ATOM   6752 N  NH1   . ARG A 1 836 ? -31.215 33.645 44.831  1.00 49.64  ? 836  ARG A NH1   1 
ATOM   6753 N  NH2   . ARG A 1 836 ? -32.775 33.707 46.514  1.00 47.62  ? 836  ARG A NH2   1 
ATOM   6754 N  N     . GLU A 1 837 ? -33.591 40.475 44.844  1.00 48.91  ? 837  GLU A N     1 
ATOM   6755 C  CA    . GLU A 1 837 ? -34.228 41.410 45.763  1.00 53.42  ? 837  GLU A CA    1 
ATOM   6756 C  C     . GLU A 1 837 ? -34.661 40.707 47.044  1.00 54.13  ? 837  GLU A C     1 
ATOM   6757 O  O     . GLU A 1 837 ? -35.096 39.554 47.020  1.00 52.49  ? 837  GLU A O     1 
ATOM   6758 C  CB    . GLU A 1 837 ? -35.419 42.112 45.105  1.00 57.36  ? 837  GLU A CB    1 
ATOM   6759 C  CG    . GLU A 1 837 ? -36.588 41.200 44.784  1.00 61.41  ? 837  GLU A CG    1 
ATOM   6760 C  CD    . GLU A 1 837 ? -37.852 41.970 44.457  1.00 65.08  ? 837  GLU A CD    1 
ATOM   6761 O  OE1   . GLU A 1 837 ? -37.839 43.213 44.578  1.00 65.13  ? 837  GLU A OE1   1 
ATOM   6762 O  OE2   . GLU A 1 837 ? -38.858 41.333 44.082  1.00 67.68  ? 837  GLU A OE2   1 
ATOM   6763 N  N     . GLY A 1 838 ? -34.521 41.404 48.165  1.00 54.70  ? 838  GLY A N     1 
ATOM   6764 C  CA    . GLY A 1 838 ? -34.878 40.839 49.451  1.00 56.80  ? 838  GLY A CA    1 
ATOM   6765 C  C     . GLY A 1 838 ? -33.744 40.055 50.081  1.00 56.74  ? 838  GLY A C     1 
ATOM   6766 O  O     . GLY A 1 838 ? -33.934 39.368 51.086  1.00 58.27  ? 838  GLY A O     1 
ATOM   6767 N  N     . ASN A 1 839 ? -32.561 40.150 49.483  1.00 53.02  ? 839  ASN A N     1 
ATOM   6768 C  CA    . ASN A 1 839 ? -31.369 39.536 50.052  1.00 49.99  ? 839  ASN A CA    1 
ATOM   6769 C  C     . ASN A 1 839 ? -30.994 40.234 51.353  1.00 50.86  ? 839  ASN A C     1 
ATOM   6770 O  O     . ASN A 1 839 ? -31.228 41.435 51.500  1.00 52.71  ? 839  ASN A O     1 
ATOM   6771 C  CB    . ASN A 1 839 ? -30.211 39.618 49.061  1.00 47.10  ? 839  ASN A CB    1 
ATOM   6772 C  CG    . ASN A 1 839 ? -29.841 41.043 48.723  1.00 45.69  ? 839  ASN A CG    1 
ATOM   6773 O  OD1   . ASN A 1 839 ? -29.096 41.694 49.457  1.00 44.49  ? 839  ASN A OD1   1 
ATOM   6774 N  ND2   . ASN A 1 839 ? -30.362 41.540 47.609  1.00 46.13  ? 839  ASN A ND2   1 
ATOM   6775 N  N     . PRO A 1 840 ? -30.403 39.490 52.301  1.00 50.98  ? 840  PRO A N     1 
ATOM   6776 C  CA    . PRO A 1 840 ? -30.076 40.036 53.624  1.00 51.96  ? 840  PRO A CA    1 
ATOM   6777 C  C     . PRO A 1 840 ? -28.868 40.972 53.609  1.00 48.94  ? 840  PRO A C     1 
ATOM   6778 O  O     . PRO A 1 840 ? -28.479 41.481 54.661  1.00 48.44  ? 840  PRO A O     1 
ATOM   6779 C  CB    . PRO A 1 840 ? -29.756 38.783 54.440  1.00 52.97  ? 840  PRO A CB    1 
ATOM   6780 C  CG    . PRO A 1 840 ? -29.223 37.819 53.433  1.00 52.63  ? 840  PRO A CG    1 
ATOM   6781 C  CD    . PRO A 1 840 ? -30.012 38.074 52.177  1.00 50.58  ? 840  PRO A CD    1 
ATOM   6782 N  N     . PHE A 1 841 ? -28.286 41.193 52.434  1.00 46.46  ? 841  PHE A N     1 
ATOM   6783 C  CA    . PHE A 1 841 ? -27.131 42.076 52.307  1.00 46.68  ? 841  PHE A CA    1 
ATOM   6784 C  C     . PHE A 1 841 ? -27.539 43.535 52.107  1.00 46.90  ? 841  PHE A C     1 
ATOM   6785 O  O     . PHE A 1 841 ? -26.730 44.447 52.286  1.00 46.52  ? 841  PHE A O     1 
ATOM   6786 C  CB    . PHE A 1 841 ? -26.218 41.602 51.178  1.00 46.16  ? 841  PHE A CB    1 
ATOM   6787 C  CG    . PHE A 1 841 ? -25.625 40.245 51.418  1.00 47.96  ? 841  PHE A CG    1 
ATOM   6788 C  CD1   . PHE A 1 841 ? -24.463 40.104 52.157  1.00 49.42  ? 841  PHE A CD1   1 
ATOM   6789 C  CD2   . PHE A 1 841 ? -26.237 39.109 50.917  1.00 48.92  ? 841  PHE A CD2   1 
ATOM   6790 C  CE1   . PHE A 1 841 ? -23.919 38.858 52.386  1.00 51.28  ? 841  PHE A CE1   1 
ATOM   6791 C  CE2   . PHE A 1 841 ? -25.697 37.859 51.142  1.00 49.83  ? 841  PHE A CE2   1 
ATOM   6792 C  CZ    . PHE A 1 841 ? -24.537 37.733 51.877  1.00 51.09  ? 841  PHE A CZ    1 
ATOM   6793 N  N     . GLY A 1 842 ? -28.798 43.746 51.735  1.00 46.32  ? 842  GLY A N     1 
ATOM   6794 C  CA    . GLY A 1 842 ? -29.364 45.079 51.665  1.00 44.63  ? 842  GLY A CA    1 
ATOM   6795 C  C     . GLY A 1 842 ? -29.044 45.857 50.405  1.00 45.36  ? 842  GLY A C     1 
ATOM   6796 O  O     . GLY A 1 842 ? -29.274 47.063 50.345  1.00 46.70  ? 842  GLY A O     1 
ATOM   6797 N  N     . ASP A 1 843 ? -28.517 45.177 49.393  1.00 45.96  ? 843  ASP A N     1 
ATOM   6798 C  CA    . ASP A 1 843 ? -28.187 45.838 48.135  1.00 46.25  ? 843  ASP A CA    1 
ATOM   6799 C  C     . ASP A 1 843 ? -28.263 44.863 46.964  1.00 46.30  ? 843  ASP A C     1 
ATOM   6800 O  O     . ASP A 1 843 ? -28.371 43.653 47.161  1.00 47.64  ? 843  ASP A O     1 
ATOM   6801 C  CB    . ASP A 1 843 ? -26.804 46.485 48.211  1.00 47.39  ? 843  ASP A CB    1 
ATOM   6802 C  CG    . ASP A 1 843 ? -26.796 47.909 47.685  1.00 49.23  ? 843  ASP A CG    1 
ATOM   6803 O  OD1   . ASP A 1 843 ? -27.527 48.189 46.710  1.00 48.59  ? 843  ASP A OD1   1 
ATOM   6804 O  OD2   . ASP A 1 843 ? -26.063 48.749 48.249  1.00 50.29  ? 843  ASP A OD2   1 
ATOM   6805 N  N     . LYS A 1 844 ? -28.200 45.395 45.748  1.00 44.43  ? 844  LYS A N     1 
ATOM   6806 C  CA    . LYS A 1 844 ? -28.445 44.598 44.549  1.00 41.80  ? 844  LYS A CA    1 
ATOM   6807 C  C     . LYS A 1 844 ? -27.222 43.831 44.056  1.00 39.64  ? 844  LYS A C     1 
ATOM   6808 O  O     . LYS A 1 844 ? -27.307 43.081 43.084  1.00 38.77  ? 844  LYS A O     1 
ATOM   6809 C  CB    . LYS A 1 844 ? -28.979 45.484 43.426  1.00 42.39  ? 844  LYS A CB    1 
ATOM   6810 C  CG    . LYS A 1 844 ? -28.026 46.588 43.009  1.00 43.82  ? 844  LYS A CG    1 
ATOM   6811 C  CD    . LYS A 1 844 ? -28.596 47.400 41.861  1.00 44.63  ? 844  LYS A CD    1 
ATOM   6812 C  CE    . LYS A 1 844 ? -27.692 48.569 41.523  1.00 42.98  ? 844  LYS A CE    1 
ATOM   6813 N  NZ    . LYS A 1 844 ? -28.236 49.366 40.393  1.00 42.42  ? 844  LYS A NZ    1 
ATOM   6814 N  N     . CYS A 1 845 ? -26.086 44.023 44.716  1.00 37.83  ? 845  CYS A N     1 
ATOM   6815 C  CA    . CYS A 1 845 ? -24.876 43.305 44.334  1.00 34.94  ? 845  CYS A CA    1 
ATOM   6816 C  C     . CYS A 1 845 ? -23.882 43.220 45.479  1.00 34.49  ? 845  CYS A C     1 
ATOM   6817 O  O     . CYS A 1 845 ? -24.002 43.929 46.475  1.00 39.18  ? 845  CYS A O     1 
ATOM   6818 C  CB    . CYS A 1 845 ? -24.209 43.974 43.134  1.00 32.63  ? 845  CYS A CB    1 
ATOM   6819 S  SG    . CYS A 1 845 ? -23.515 45.610 43.478  1.00 31.69  ? 845  CYS A SG    1 
ATOM   6820 N  N     . ILE A 1 846 ? -22.896 42.348 45.324  1.00 29.77  ? 846  ILE A N     1 
ATOM   6821 C  CA    . ILE A 1 846 ? -21.815 42.239 46.290  1.00 28.38  ? 846  ILE A CA    1 
ATOM   6822 C  C     . ILE A 1 846 ? -20.506 42.013 45.536  1.00 29.39  ? 846  ILE A C     1 
ATOM   6823 O  O     . ILE A 1 846 ? -20.509 41.579 44.382  1.00 30.00  ? 846  ILE A O     1 
ATOM   6824 C  CB    . ILE A 1 846 ? -22.078 41.113 47.324  1.00 30.10  ? 846  ILE A CB    1 
ATOM   6825 C  CG1   . ILE A 1 846 ? -21.222 41.314 48.578  1.00 32.24  ? 846  ILE A CG1   1 
ATOM   6826 C  CG2   . ILE A 1 846 ? -21.868 39.734 46.705  1.00 27.09  ? 846  ILE A CG2   1 
ATOM   6827 C  CD1   . ILE A 1 846 ? -21.491 40.303 49.669  1.00 33.35  ? 846  ILE A CD1   1 
ATOM   6828 N  N     . ALA A 1 847 ? -19.394 42.340 46.181  1.00 28.85  ? 847  ALA A N     1 
ATOM   6829 C  CA    . ALA A 1 847 ? -18.087 42.201 45.564  1.00 25.86  ? 847  ALA A CA    1 
ATOM   6830 C  C     . ALA A 1 847 ? -17.044 41.822 46.600  1.00 30.40  ? 847  ALA A C     1 
ATOM   6831 O  O     . ALA A 1 847 ? -17.135 42.226 47.748  1.00 35.37  ? 847  ALA A O     1 
ATOM   6832 C  CB    . ALA A 1 847 ? -17.691 43.488 44.861  1.00 21.43  ? 847  ALA A CB    1 
ATOM   6833 N  N     . TRP A 1 848 ? -16.053 41.040 46.194  1.00 27.45  ? 848  TRP A N     1 
ATOM   6834 C  CA    . TRP A 1 848 ? -14.996 40.628 47.106  1.00 26.43  ? 848  TRP A CA    1 
ATOM   6835 C  C     . TRP A 1 848 ? -13.696 40.491 46.318  1.00 27.93  ? 848  TRP A C     1 
ATOM   6836 O  O     . TRP A 1 848 ? -13.737 40.444 45.091  1.00 26.97  ? 848  TRP A O     1 
ATOM   6837 C  CB    . TRP A 1 848 ? -15.385 39.321 47.811  1.00 25.13  ? 848  TRP A CB    1 
ATOM   6838 C  CG    . TRP A 1 848 ? -15.391 38.108 46.944  1.00 27.45  ? 848  TRP A CG    1 
ATOM   6839 C  CD1   . TRP A 1 848 ? -14.442 37.126 46.903  1.00 30.07  ? 848  TRP A CD1   1 
ATOM   6840 C  CD2   . TRP A 1 848 ? -16.400 37.731 46.002  1.00 26.78  ? 848  TRP A CD2   1 
ATOM   6841 N  NE1   . TRP A 1 848 ? -14.797 36.161 45.989  1.00 28.21  ? 848  TRP A NE1   1 
ATOM   6842 C  CE2   . TRP A 1 848 ? -15.994 36.510 45.421  1.00 27.82  ? 848  TRP A CE2   1 
ATOM   6843 C  CE3   . TRP A 1 848 ? -17.603 38.306 45.589  1.00 27.75  ? 848  TRP A CE3   1 
ATOM   6844 C  CZ2   . TRP A 1 848 ? -16.751 35.858 44.452  1.00 28.26  ? 848  TRP A CZ2   1 
ATOM   6845 C  CZ3   . TRP A 1 848 ? -18.351 37.658 44.626  1.00 28.40  ? 848  TRP A CZ3   1 
ATOM   6846 C  CH2   . TRP A 1 848 ? -17.923 36.448 44.067  1.00 29.03  ? 848  TRP A CH2   1 
ATOM   6847 N  N     . PRO A 1 849 ? -12.540 40.459 47.012  1.00 30.87  ? 849  PRO A N     1 
ATOM   6848 C  CA    . PRO A 1 849 ? -11.247 40.358 46.324  1.00 30.90  ? 849  PRO A CA    1 
ATOM   6849 C  C     . PRO A 1 849 ? -11.208 39.245 45.284  1.00 29.89  ? 849  PRO A C     1 
ATOM   6850 O  O     . PRO A 1 849 ? -11.586 38.113 45.581  1.00 29.98  ? 849  PRO A O     1 
ATOM   6851 C  CB    . PRO A 1 849 ? -10.279 40.032 47.462  1.00 30.53  ? 849  PRO A CB    1 
ATOM   6852 C  CG    . PRO A 1 849 ? -10.871 40.702 48.638  1.00 32.44  ? 849  PRO A CG    1 
ATOM   6853 C  CD    . PRO A 1 849 ? -12.365 40.590 48.471  1.00 32.37  ? 849  PRO A CD    1 
ATOM   6854 N  N     . SER A 1 850 ? -10.766 39.577 44.076  1.00 28.49  ? 850  SER A N     1 
ATOM   6855 C  CA    . SER A 1 850 ? -10.681 38.599 43.002  1.00 30.23  ? 850  SER A CA    1 
ATOM   6856 C  C     . SER A 1 850 ? -9.573  37.587 43.279  1.00 34.44  ? 850  SER A C     1 
ATOM   6857 O  O     . SER A 1 850 ? -8.651  37.853 44.055  1.00 33.82  ? 850  SER A O     1 
ATOM   6858 C  CB    . SER A 1 850 ? -10.439 39.293 41.665  1.00 29.98  ? 850  SER A CB    1 
ATOM   6859 O  OG    . SER A 1 850 ? -9.158  39.903 41.636  1.00 31.01  ? 850  SER A OG    1 
ATOM   6860 N  N     . GLY A 1 851 ? -9.675  36.425 42.643  1.00 37.13  ? 851  GLY A N     1 
ATOM   6861 C  CA    . GLY A 1 851 ? -8.693  35.370 42.805  1.00 40.00  ? 851  GLY A CA    1 
ATOM   6862 C  C     . GLY A 1 851 ? -8.857  34.610 44.104  1.00 43.41  ? 851  GLY A C     1 
ATOM   6863 O  O     . GLY A 1 851 ? -8.012  33.786 44.458  1.00 44.70  ? 851  GLY A O     1 
ATOM   6864 N  N     . THR A 1 852 ? -9.939  34.896 44.826  1.00 44.13  ? 852  THR A N     1 
ATOM   6865 C  CA    . THR A 1 852 ? -10.194 34.245 46.108  1.00 43.81  ? 852  THR A CA    1 
ATOM   6866 C  C     . THR A 1 852 ? -11.645 33.797 46.262  1.00 41.79  ? 852  THR A C     1 
ATOM   6867 O  O     . THR A 1 852 ? -12.558 34.388 45.683  1.00 38.23  ? 852  THR A O     1 
ATOM   6868 C  CB    . THR A 1 852 ? -9.871  35.174 47.301  1.00 40.48  ? 852  THR A CB    1 
ATOM   6869 O  OG1   . THR A 1 852 ? -10.921 36.138 47.452  1.00 43.70  ? 852  THR A OG1   1 
ATOM   6870 C  CG2   . THR A 1 852 ? -8.535  35.888 47.104  1.00 33.46  ? 852  THR A CG2   1 
ATOM   6871 N  N     . GLU A 1 853 ? -11.847 32.747 47.050  1.00 42.58  ? 853  GLU A N     1 
ATOM   6872 C  CA    . GLU A 1 853 ? -13.180 32.371 47.488  1.00 43.62  ? 853  GLU A CA    1 
ATOM   6873 C  C     . GLU A 1 853 ? -13.650 33.457 48.441  1.00 44.18  ? 853  GLU A C     1 
ATOM   6874 O  O     . GLU A 1 853 ? -12.866 33.951 49.252  1.00 47.28  ? 853  GLU A O     1 
ATOM   6875 C  CB    . GLU A 1 853 ? -13.138 31.036 48.230  1.00 46.89  ? 853  GLU A CB    1 
ATOM   6876 C  CG    . GLU A 1 853 ? -12.727 29.848 47.380  1.00 50.56  ? 853  GLU A CG    1 
ATOM   6877 C  CD    . GLU A 1 853 ? -13.893 29.238 46.633  1.00 53.03  ? 853  GLU A CD    1 
ATOM   6878 O  OE1   . GLU A 1 853 ? -15.052 29.553 46.978  1.00 54.17  ? 853  GLU A OE1   1 
ATOM   6879 O  OE2   . GLU A 1 853 ? -13.647 28.443 45.702  1.00 53.66  ? 853  GLU A OE2   1 
ATOM   6880 N  N     . ILE A 1 854 ? -14.917 33.843 48.346  1.00 40.03  ? 854  ILE A N     1 
ATOM   6881 C  CA    . ILE A 1 854 ? -15.461 34.808 49.290  1.00 40.10  ? 854  ILE A CA    1 
ATOM   6882 C  C     . ILE A 1 854 ? -15.468 34.165 50.676  1.00 41.26  ? 854  ILE A C     1 
ATOM   6883 O  O     . ILE A 1 854 ? -15.614 32.946 50.797  1.00 42.95  ? 854  ILE A O     1 
ATOM   6884 C  CB    . ILE A 1 854 ? -16.863 35.307 48.861  1.00 41.94  ? 854  ILE A CB    1 
ATOM   6885 C  CG1   . ILE A 1 854 ? -17.255 36.566 49.638  1.00 44.48  ? 854  ILE A CG1   1 
ATOM   6886 C  CG2   . ILE A 1 854 ? -17.904 34.205 49.001  1.00 43.36  ? 854  ILE A CG2   1 
ATOM   6887 C  CD1   . ILE A 1 854 ? -18.459 37.285 49.065  1.00 45.89  ? 854  ILE A CD1   1 
ATOM   6888 N  N     . THR A 1 855 ? -15.267 34.976 51.712  1.00 41.17  ? 855  THR A N     1 
ATOM   6889 C  CA    . THR A 1 855 ? -15.118 34.470 53.078  1.00 44.24  ? 855  THR A CA    1 
ATOM   6890 C  C     . THR A 1 855 ? -16.273 33.575 53.520  1.00 47.90  ? 855  THR A C     1 
ATOM   6891 O  O     . THR A 1 855 ? -17.425 33.808 53.152  1.00 47.40  ? 855  THR A O     1 
ATOM   6892 C  CB    . THR A 1 855 ? -14.966 35.621 54.088  1.00 42.80  ? 855  THR A CB    1 
ATOM   6893 O  OG1   . THR A 1 855 ? -15.138 35.116 55.418  1.00 44.98  ? 855  THR A OG1   1 
ATOM   6894 C  CG2   . THR A 1 855 ? -16.003 36.698 53.824  1.00 39.76  ? 855  THR A CG2   1 
ATOM   6895 N  N     . ASP A 1 856 ? -15.953 32.552 54.311  1.00 50.07  ? 856  ASP A N     1 
ATOM   6896 C  CA    . ASP A 1 856 ? -16.959 31.613 54.805  1.00 51.54  ? 856  ASP A CA    1 
ATOM   6897 C  C     . ASP A 1 856 ? -18.019 32.298 55.665  1.00 50.47  ? 856  ASP A C     1 
ATOM   6898 O  O     . ASP A 1 856 ? -19.113 31.766 55.849  1.00 52.75  ? 856  ASP A O     1 
ATOM   6899 C  CB    . ASP A 1 856 ? -16.304 30.464 55.581  1.00 55.59  ? 856  ASP A CB    1 
ATOM   6900 C  CG    . ASP A 1 856 ? -15.656 29.437 54.668  1.00 59.14  ? 856  ASP A CG    1 
ATOM   6901 O  OD1   . ASP A 1 856 ? -14.683 28.781 55.102  1.00 61.40  ? 856  ASP A OD1   1 
ATOM   6902 O  OD2   . ASP A 1 856 ? -16.120 29.285 53.517  1.00 58.91  ? 856  ASP A OD2   1 
ATOM   6903 N  N     . LEU A 1 857 ? -17.685 33.478 56.182  1.00 48.86  ? 857  LEU A N     1 
ATOM   6904 C  CA    . LEU A 1 857 ? -18.611 34.276 56.979  1.00 49.62  ? 857  LEU A CA    1 
ATOM   6905 C  C     . LEU A 1 857 ? -19.940 34.499 56.266  1.00 48.17  ? 857  LEU A C     1 
ATOM   6906 O  O     . LEU A 1 857 ? -21.004 34.425 56.881  1.00 50.95  ? 857  LEU A O     1 
ATOM   6907 C  CB    . LEU A 1 857 ? -17.987 35.635 57.306  1.00 50.73  ? 857  LEU A CB    1 
ATOM   6908 C  CG    . LEU A 1 857 ? -16.787 35.678 58.252  1.00 53.24  ? 857  LEU A CG    1 
ATOM   6909 C  CD1   . LEU A 1 857 ? -16.160 37.060 58.227  1.00 52.90  ? 857  LEU A CD1   1 
ATOM   6910 C  CD2   . LEU A 1 857 ? -17.212 35.306 59.663  1.00 53.83  ? 857  LEU A CD2   1 
ATOM   6911 N  N     . ILE A 1 858 ? -19.869 34.771 54.966  1.00 44.75  ? 858  ILE A N     1 
ATOM   6912 C  CA    . ILE A 1 858 ? -21.047 35.154 54.196  1.00 44.85  ? 858  ILE A CA    1 
ATOM   6913 C  C     . ILE A 1 858 ? -21.234 34.337 52.918  1.00 45.55  ? 858  ILE A C     1 
ATOM   6914 O  O     . ILE A 1 858 ? -22.184 34.577 52.171  1.00 43.03  ? 858  ILE A O     1 
ATOM   6915 C  CB    . ILE A 1 858 ? -20.985 36.641 53.785  1.00 40.61  ? 858  ILE A CB    1 
ATOM   6916 C  CG1   . ILE A 1 858 ? -19.831 36.871 52.806  1.00 36.41  ? 858  ILE A CG1   1 
ATOM   6917 C  CG2   . ILE A 1 858 ? -20.850 37.539 55.006  1.00 40.19  ? 858  ILE A CG2   1 
ATOM   6918 C  CD1   . ILE A 1 858 ? -19.751 38.284 52.281  1.00 34.94  ? 858  ILE A CD1   1 
ATOM   6919 N  N     . LYS A 1 859 ? -20.337 33.385 52.665  1.00 46.40  ? 859  LYS A N     1 
ATOM   6920 C  CA    . LYS A 1 859 ? -20.336 32.640 51.400  1.00 45.08  ? 859  LYS A CA    1 
ATOM   6921 C  C     . LYS A 1 859 ? -21.653 31.928 51.092  1.00 43.81  ? 859  LYS A C     1 
ATOM   6922 O  O     . LYS A 1 859 ? -22.221 32.100 50.011  1.00 38.83  ? 859  LYS A O     1 
ATOM   6923 C  CB    . LYS A 1 859 ? -19.184 31.631 51.350  1.00 45.40  ? 859  LYS A CB    1 
ATOM   6924 C  CG    . LYS A 1 859 ? -19.212 30.750 50.108  1.00 44.13  ? 859  LYS A CG    1 
ATOM   6925 C  CD    . LYS A 1 859 ? -17.976 29.876 50.003  1.00 46.14  ? 859  LYS A CD    1 
ATOM   6926 C  CE    . LYS A 1 859 ? -17.993 29.056 48.722  1.00 48.10  ? 859  LYS A CE    1 
ATOM   6927 N  NZ    . LYS A 1 859 ? -16.778 28.203 48.577  1.00 50.85  ? 859  LYS A NZ    1 
ATOM   6928 N  N     . ASP A 1 860 ? -22.130 31.133 52.045  1.00 46.89  ? 860  ASP A N     1 
ATOM   6929 C  CA    . ASP A 1 860 ? -23.363 30.375 51.862  1.00 46.25  ? 860  ASP A CA    1 
ATOM   6930 C  C     . ASP A 1 860 ? -24.572 31.283 51.615  1.00 43.28  ? 860  ASP A C     1 
ATOM   6931 O  O     . ASP A 1 860 ? -25.482 30.921 50.871  1.00 40.98  ? 860  ASP A O     1 
ATOM   6932 C  CB    . ASP A 1 860 ? -23.607 29.441 53.052  1.00 48.86  ? 860  ASP A CB    1 
ATOM   6933 C  CG    . ASP A 1 860 ? -22.507 28.402 53.214  1.00 51.66  ? 860  ASP A CG    1 
ATOM   6934 O  OD1   . ASP A 1 860 ? -21.682 28.258 52.286  1.00 52.34  ? 860  ASP A OD1   1 
ATOM   6935 O  OD2   . ASP A 1 860 ? -22.470 27.724 54.264  1.00 53.84  ? 860  ASP A OD2   1 
ATOM   6936 N  N     . ASP A 1 861 ? -24.569 32.464 52.227  1.00 43.57  ? 861  ASP A N     1 
ATOM   6937 C  CA    . ASP A 1 861 ? -25.633 33.442 52.004  1.00 44.25  ? 861  ASP A CA    1 
ATOM   6938 C  C     . ASP A 1 861 ? -25.539 34.088 50.618  1.00 42.65  ? 861  ASP A C     1 
ATOM   6939 O  O     . ASP A 1 861 ? -26.559 34.386 50.000  1.00 41.96  ? 861  ASP A O     1 
ATOM   6940 C  CB    . ASP A 1 861 ? -25.623 34.520 53.092  1.00 47.53  ? 861  ASP A CB    1 
ATOM   6941 C  CG    . ASP A 1 861 ? -26.036 33.985 54.453  1.00 51.79  ? 861  ASP A CG    1 
ATOM   6942 O  OD1   . ASP A 1 861 ? -25.322 34.266 55.439  1.00 57.39  ? 861  ASP A OD1   1 
ATOM   6943 O  OD2   . ASP A 1 861 ? -27.074 33.293 54.539  1.00 48.68  ? 861  ASP A OD2   1 
ATOM   6944 N  N     . VAL A 1 862 ? -24.318 34.306 50.134  1.00 41.28  ? 862  VAL A N     1 
ATOM   6945 C  CA    . VAL A 1 862 ? -24.118 34.876 48.804  1.00 38.79  ? 862  VAL A CA    1 
ATOM   6946 C  C     . VAL A 1 862 ? -24.576 33.889 47.733  1.00 38.47  ? 862  VAL A C     1 
ATOM   6947 O  O     . VAL A 1 862 ? -25.312 34.259 46.817  1.00 38.26  ? 862  VAL A O     1 
ATOM   6948 C  CB    . VAL A 1 862 ? -22.643 35.269 48.556  1.00 36.95  ? 862  VAL A CB    1 
ATOM   6949 C  CG1   . VAL A 1 862 ? -22.427 35.664 47.101  1.00 33.55  ? 862  VAL A CG1   1 
ATOM   6950 C  CG2   . VAL A 1 862 ? -22.226 36.401 49.481  1.00 37.72  ? 862  VAL A CG2   1 
ATOM   6951 N  N     . LEU A 1 863 ? -24.142 32.636 47.864  1.00 37.30  ? 863  LEU A N     1 
ATOM   6952 C  CA    . LEU A 1 863 ? -24.545 31.560 46.957  1.00 38.12  ? 863  LEU A CA    1 
ATOM   6953 C  C     . LEU A 1 863 ? -26.064 31.421 46.863  1.00 40.53  ? 863  LEU A C     1 
ATOM   6954 O  O     . LEU A 1 863 ? -26.616 31.210 45.781  1.00 40.97  ? 863  LEU A O     1 
ATOM   6955 C  CB    . LEU A 1 863 ? -23.953 30.226 47.417  1.00 37.59  ? 863  LEU A CB    1 
ATOM   6956 C  CG    . LEU A 1 863 ? -22.436 30.040 47.365  1.00 36.48  ? 863  LEU A CG    1 
ATOM   6957 C  CD1   . LEU A 1 863 ? -22.043 28.682 47.933  1.00 36.23  ? 863  LEU A CD1   1 
ATOM   6958 C  CD2   . LEU A 1 863 ? -21.932 30.189 45.947  1.00 33.77  ? 863  LEU A CD2   1 
ATOM   6959 N  N     . HIS A 1 864 ? -26.733 31.535 48.006  1.00 40.38  ? 864  HIS A N     1 
ATOM   6960 C  CA    . HIS A 1 864 ? -28.180 31.381 48.066  1.00 43.18  ? 864  HIS A CA    1 
ATOM   6961 C  C     . HIS A 1 864 ? -28.898 32.557 47.414  1.00 42.13  ? 864  HIS A C     1 
ATOM   6962 O  O     . HIS A 1 864 ? -30.016 32.412 46.924  1.00 46.04  ? 864  HIS A O     1 
ATOM   6963 C  CB    . HIS A 1 864 ? -28.643 31.223 49.521  1.00 47.42  ? 864  HIS A CB    1 
ATOM   6964 C  CG    . HIS A 1 864 ? -30.092 30.866 49.667  1.00 50.92  ? 864  HIS A CG    1 
ATOM   6965 N  ND1   . HIS A 1 864 ? -31.078 31.812 49.851  1.00 52.60  ? 864  HIS A ND1   1 
ATOM   6966 C  CD2   . HIS A 1 864 ? -30.718 29.665 49.671  1.00 52.10  ? 864  HIS A CD2   1 
ATOM   6967 C  CE1   . HIS A 1 864 ? -32.250 31.209 49.954  1.00 54.21  ? 864  HIS A CE1   1 
ATOM   6968 N  NE2   . HIS A 1 864 ? -32.059 29.906 49.849  1.00 54.74  ? 864  HIS A NE2   1 
ATOM   6969 N  N     . TRP A 1 865 ? -28.251 33.717 47.402  1.00 37.48  ? 865  TRP A N     1 
ATOM   6970 C  CA    . TRP A 1 865 ? -28.912 34.934 46.948  1.00 37.51  ? 865  TRP A CA    1 
ATOM   6971 C  C     . TRP A 1 865 ? -28.414 35.482 45.617  1.00 40.26  ? 865  TRP A C     1 
ATOM   6972 O  O     . TRP A 1 865 ? -28.875 36.538 45.177  1.00 41.18  ? 865  TRP A O     1 
ATOM   6973 C  CB    . TRP A 1 865 ? -28.849 36.013 48.028  1.00 38.11  ? 865  TRP A CB    1 
ATOM   6974 C  CG    . TRP A 1 865 ? -29.795 35.737 49.137  1.00 43.52  ? 865  TRP A CG    1 
ATOM   6975 C  CD1   . TRP A 1 865 ? -29.504 35.167 50.341  1.00 46.03  ? 865  TRP A CD1   1 
ATOM   6976 C  CD2   . TRP A 1 865 ? -31.203 35.984 49.138  1.00 46.65  ? 865  TRP A CD2   1 
ATOM   6977 N  NE1   . TRP A 1 865 ? -30.643 35.057 51.100  1.00 49.94  ? 865  TRP A NE1   1 
ATOM   6978 C  CE2   . TRP A 1 865 ? -31.703 35.553 50.383  1.00 50.48  ? 865  TRP A CE2   1 
ATOM   6979 C  CE3   . TRP A 1 865 ? -32.094 36.536 48.211  1.00 46.38  ? 865  TRP A CE3   1 
ATOM   6980 C  CZ2   . TRP A 1 865 ? -33.049 35.655 50.726  1.00 51.66  ? 865  TRP A CZ2   1 
ATOM   6981 C  CZ3   . TRP A 1 865 ? -33.429 36.638 48.552  1.00 50.24  ? 865  TRP A CZ3   1 
ATOM   6982 C  CH2   . TRP A 1 865 ? -33.894 36.199 49.798  1.00 52.35  ? 865  TRP A CH2   1 
ATOM   6983 N  N     . MET A 1 866 ? -27.483 34.772 44.982  1.00 39.93  ? 866  MET A N     1 
ATOM   6984 C  CA    . MET A 1 866 ? -27.021 35.143 43.647  1.00 38.68  ? 866  MET A CA    1 
ATOM   6985 C  C     . MET A 1 866 ? -28.206 35.296 42.717  1.00 39.89  ? 866  MET A C     1 
ATOM   6986 O  O     . MET A 1 866 ? -29.133 34.486 42.743  1.00 43.15  ? 866  MET A O     1 
ATOM   6987 C  CB    . MET A 1 866 ? -26.120 34.064 43.061  1.00 35.68  ? 866  MET A CB    1 
ATOM   6988 C  CG    . MET A 1 866 ? -24.806 33.874 43.754  1.00 35.01  ? 866  MET A CG    1 
ATOM   6989 S  SD    . MET A 1 866 ? -24.070 32.359 43.133  1.00 39.88  ? 866  MET A SD    1 
ATOM   6990 C  CE    . MET A 1 866 ? -24.104 32.683 41.377  1.00 39.97  ? 866  MET A CE    1 
ATOM   6991 N  N     . ASP A 1 867 ? -28.178 36.333 41.893  1.00 34.99  ? 867  ASP A N     1 
ATOM   6992 C  CA    . ASP A 1 867 ? -29.212 36.497 40.893  1.00 35.65  ? 867  ASP A CA    1 
ATOM   6993 C  C     . ASP A 1 867 ? -28.742 35.899 39.577  1.00 35.73  ? 867  ASP A C     1 
ATOM   6994 O  O     . ASP A 1 867 ? -28.168 36.594 38.740  1.00 35.66  ? 867  ASP A O     1 
ATOM   6995 C  CB    . ASP A 1 867 ? -29.573 37.967 40.723  1.00 36.06  ? 867  ASP A CB    1 
ATOM   6996 C  CG    . ASP A 1 867 ? -30.955 38.156 40.143  1.00 37.37  ? 867  ASP A CG    1 
ATOM   6997 O  OD1   . ASP A 1 867 ? -31.375 37.314 39.325  1.00 37.66  ? 867  ASP A OD1   1 
ATOM   6998 O  OD2   . ASP A 1 867 ? -31.626 39.143 40.511  1.00 41.01  ? 867  ASP A OD2   1 
ATOM   6999 N  N     . TYR A 1 868 ? -28.982 34.602 39.412  1.00 37.23  ? 868  TYR A N     1 
ATOM   7000 C  CA    . TYR A 1 868 ? -28.627 33.895 38.189  1.00 36.66  ? 868  TYR A CA    1 
ATOM   7001 C  C     . TYR A 1 868 ? -29.306 34.514 36.977  1.00 37.89  ? 868  TYR A C     1 
ATOM   7002 O  O     . TYR A 1 868 ? -28.706 34.618 35.907  1.00 39.01  ? 868  TYR A O     1 
ATOM   7003 C  CB    . TYR A 1 868 ? -29.011 32.423 38.294  1.00 38.36  ? 868  TYR A CB    1 
ATOM   7004 C  CG    . TYR A 1 868 ? -28.117 31.615 39.206  1.00 40.90  ? 868  TYR A CG    1 
ATOM   7005 C  CD1   . TYR A 1 868 ? -26.974 30.999 38.717  1.00 41.83  ? 868  TYR A CD1   1 
ATOM   7006 C  CD2   . TYR A 1 868 ? -28.421 31.459 40.552  1.00 43.25  ? 868  TYR A CD2   1 
ATOM   7007 C  CE1   . TYR A 1 868 ? -26.154 30.255 39.541  1.00 43.45  ? 868  TYR A CE1   1 
ATOM   7008 C  CE2   . TYR A 1 868 ? -27.606 30.716 41.387  1.00 45.21  ? 868  TYR A CE2   1 
ATOM   7009 C  CZ    . TYR A 1 868 ? -26.473 30.117 40.875  1.00 45.20  ? 868  TYR A CZ    1 
ATOM   7010 O  OH    . TYR A 1 868 ? -25.655 29.376 41.696  1.00 46.61  ? 868  TYR A OH    1 
ATOM   7011 N  N     . THR A 1 869 ? -30.558 34.927 37.153  1.00 38.55  ? 869  THR A N     1 
ATOM   7012 C  CA    . THR A 1 869 ? -31.336 35.518 36.068  1.00 37.82  ? 869  THR A CA    1 
ATOM   7013 C  C     . THR A 1 869 ? -30.672 36.789 35.554  1.00 37.70  ? 869  THR A C     1 
ATOM   7014 O  O     . THR A 1 869 ? -30.436 36.937 34.352  1.00 38.20  ? 869  THR A O     1 
ATOM   7015 C  CB    . THR A 1 869 ? -32.778 35.839 36.507  1.00 36.69  ? 869  THR A CB    1 
ATOM   7016 O  OG1   . THR A 1 869 ? -33.402 34.651 37.014  1.00 40.63  ? 869  THR A OG1   1 
ATOM   7017 C  CG2   . THR A 1 869 ? -33.581 36.374 35.331  1.00 30.60  ? 869  THR A CG2   1 
ATOM   7018 N  N     . VAL A 1 870 ? -30.370 37.699 36.475  1.00 36.93  ? 870  VAL A N     1 
ATOM   7019 C  CA    . VAL A 1 870 ? -29.670 38.931 36.139  1.00 34.50  ? 870  VAL A CA    1 
ATOM   7020 C  C     . VAL A 1 870 ? -28.295 38.616 35.566  1.00 34.87  ? 870  VAL A C     1 
ATOM   7021 O  O     . VAL A 1 870 ? -27.885 39.194 34.562  1.00 34.11  ? 870  VAL A O     1 
ATOM   7022 C  CB    . VAL A 1 870 ? -29.532 39.852 37.369  1.00 32.43  ? 870  VAL A CB    1 
ATOM   7023 C  CG1   . VAL A 1 870 ? -28.457 40.904 37.137  1.00 32.10  ? 870  VAL A CG1   1 
ATOM   7024 C  CG2   . VAL A 1 870 ? -30.867 40.506 37.689  1.00 35.09  ? 870  VAL A CG2   1 
ATOM   7025 N  N     . LEU A 1 871 ? -27.600 37.681 36.204  1.00 42.08  ? 871  LEU A N     1 
ATOM   7026 C  CA    . LEU A 1 871 ? -26.279 37.253 35.763  1.00 41.03  ? 871  LEU A CA    1 
ATOM   7027 C  C     . LEU A 1 871 ? -26.307 36.796 34.306  1.00 37.92  ? 871  LEU A C     1 
ATOM   7028 O  O     . LEU A 1 871 ? -25.489 37.226 33.503  1.00 36.70  ? 871  LEU A O     1 
ATOM   7029 C  CB    . LEU A 1 871 ? -25.770 36.127 36.666  1.00 46.56  ? 871  LEU A CB    1 
ATOM   7030 C  CG    . LEU A 1 871 ? -24.265 35.934 36.846  1.00 50.00  ? 871  LEU A CG    1 
ATOM   7031 C  CD1   . LEU A 1 871 ? -24.010 35.099 38.092  1.00 49.10  ? 871  LEU A CD1   1 
ATOM   7032 C  CD2   . LEU A 1 871 ? -23.643 35.272 35.623  1.00 53.38  ? 871  LEU A CD2   1 
ATOM   7033 N  N     . LEU A 1 872 ? -27.262 35.938 33.969  1.00 39.12  ? 872  LEU A N     1 
ATOM   7034 C  CA    . LEU A 1 872 ? -27.368 35.407 32.614  1.00 37.89  ? 872  LEU A CA    1 
ATOM   7035 C  C     . LEU A 1 872 ? -27.631 36.492 31.573  1.00 37.54  ? 872  LEU A C     1 
ATOM   7036 O  O     . LEU A 1 872 ? -26.851 36.670 30.643  1.00 37.32  ? 872  LEU A O     1 
ATOM   7037 C  CB    . LEU A 1 872 ? -28.471 34.348 32.539  1.00 36.78  ? 872  LEU A CB    1 
ATOM   7038 C  CG    . LEU A 1 872 ? -28.670 33.688 31.172  1.00 36.54  ? 872  LEU A CG    1 
ATOM   7039 C  CD1   . LEU A 1 872 ? -27.468 32.831 30.811  1.00 35.59  ? 872  LEU A CD1   1 
ATOM   7040 C  CD2   . LEU A 1 872 ? -29.949 32.868 31.143  1.00 36.58  ? 872  LEU A CD2   1 
ATOM   7041 N  N     . GLU A 1 873 ? -28.736 37.211 31.738  1.00 40.63  ? 873  GLU A N     1 
ATOM   7042 C  CA    . GLU A 1 873 ? -29.167 38.207 30.762  1.00 47.23  ? 873  GLU A CA    1 
ATOM   7043 C  C     . GLU A 1 873 ? -28.169 39.347 30.588  1.00 46.48  ? 873  GLU A C     1 
ATOM   7044 O  O     . GLU A 1 873 ? -27.889 39.776 29.468  1.00 48.08  ? 873  GLU A O     1 
ATOM   7045 C  CB    . GLU A 1 873 ? -30.533 38.767 31.159  1.00 55.88  ? 873  GLU A CB    1 
ATOM   7046 C  CG    . GLU A 1 873 ? -31.628 37.714 31.201  1.00 64.28  ? 873  GLU A CG    1 
ATOM   7047 C  CD    . GLU A 1 873 ? -32.842 38.167 31.982  1.00 71.11  ? 873  GLU A CD    1 
ATOM   7048 O  OE1   . GLU A 1 873 ? -32.690 39.056 32.849  1.00 74.31  ? 873  GLU A OE1   1 
ATOM   7049 O  OE2   . GLU A 1 873 ? -33.945 37.637 31.730  1.00 72.19  ? 873  GLU A OE2   1 
ATOM   7050 N  N     . LYS A 1 874 ? -27.630 39.825 31.702  1.00 44.37  ? 874  LYS A N     1 
ATOM   7051 C  CA    . LYS A 1 874 ? -26.742 40.978 31.693  1.00 44.48  ? 874  LYS A CA    1 
ATOM   7052 C  C     . LYS A 1 874 ? -25.375 40.628 31.125  1.00 45.33  ? 874  LYS A C     1 
ATOM   7053 O  O     . LYS A 1 874 ? -24.767 41.424 30.410  1.00 48.40  ? 874  LYS A O     1 
ATOM   7054 C  CB    . LYS A 1 874 ? -26.588 41.527 33.112  1.00 48.07  ? 874  LYS A CB    1 
ATOM   7055 C  CG    . LYS A 1 874 ? -26.211 42.990 33.191  1.00 51.71  ? 874  LYS A CG    1 
ATOM   7056 C  CD    . LYS A 1 874 ? -26.510 43.553 34.573  1.00 53.22  ? 874  LYS A CD    1 
ATOM   7057 C  CE    . LYS A 1 874 ? -25.564 42.999 35.627  1.00 54.59  ? 874  LYS A CE    1 
ATOM   7058 N  NZ    . LYS A 1 874 ? -25.775 43.651 36.951  1.00 56.00  ? 874  LYS A NZ    1 
ATOM   7059 N  N     . THR A 1 875 ? -24.900 39.429 31.437  1.00 43.16  ? 875  THR A N     1 
ATOM   7060 C  CA    . THR A 1 875 ? -23.534 39.050 31.109  1.00 41.58  ? 875  THR A CA    1 
ATOM   7061 C  C     . THR A 1 875 ? -23.427 38.190 29.854  1.00 39.86  ? 875  THR A C     1 
ATOM   7062 O  O     . THR A 1 875 ? -22.448 38.280 29.116  1.00 42.85  ? 875  THR A O     1 
ATOM   7063 C  CB    . THR A 1 875 ? -22.886 38.295 32.277  1.00 45.01  ? 875  THR A CB    1 
ATOM   7064 O  OG1   . THR A 1 875 ? -22.965 39.089 33.466  1.00 46.53  ? 875  THR A OG1   1 
ATOM   7065 C  CG2   . THR A 1 875 ? -21.452 38.010 31.982  1.00 48.41  ? 875  THR A CG2   1 
ATOM   7066 N  N     . PHE A 1 876 ? -24.431 37.354 29.612  1.00 34.61  ? 876  PHE A N     1 
ATOM   7067 C  CA    . PHE A 1 876 ? -24.356 36.387 28.521  1.00 31.08  ? 876  PHE A CA    1 
ATOM   7068 C  C     . PHE A 1 876 ? -25.287 36.743 27.367  1.00 30.58  ? 876  PHE A C     1 
ATOM   7069 O  O     . PHE A 1 876 ? -24.852 36.886 26.227  1.00 31.24  ? 876  PHE A O     1 
ATOM   7070 C  CB    . PHE A 1 876 ? -24.659 34.984 29.049  1.00 28.97  ? 876  PHE A CB    1 
ATOM   7071 C  CG    . PHE A 1 876 ? -24.621 33.914 28.000  1.00 32.27  ? 876  PHE A CG    1 
ATOM   7072 C  CD1   . PHE A 1 876 ? -23.416 33.504 27.451  1.00 33.42  ? 876  PHE A CD1   1 
ATOM   7073 C  CD2   . PHE A 1 876 ? -25.791 33.302 27.576  1.00 30.46  ? 876  PHE A CD2   1 
ATOM   7074 C  CE1   . PHE A 1 876 ? -23.379 32.514 26.488  1.00 34.66  ? 876  PHE A CE1   1 
ATOM   7075 C  CE2   . PHE A 1 876 ? -25.761 32.309 26.615  1.00 31.05  ? 876  PHE A CE2   1 
ATOM   7076 C  CZ    . PHE A 1 876 ? -24.555 31.915 26.069  1.00 33.87  ? 876  PHE A CZ    1 
ATOM   7077 N  N     . ILE A 1 877 ? -26.569 36.895 27.670  1.00 32.34  ? 877  ILE A N     1 
ATOM   7078 C  CA    . ILE A 1 877 ? -27.568 37.143 26.638  1.00 34.95  ? 877  ILE A CA    1 
ATOM   7079 C  C     . ILE A 1 877 ? -27.354 38.462 25.894  1.00 34.69  ? 877  ILE A C     1 
ATOM   7080 O  O     . ILE A 1 877 ? -27.364 38.493 24.662  1.00 35.78  ? 877  ILE A O     1 
ATOM   7081 C  CB    . ILE A 1 877 ? -28.994 37.075 27.212  1.00 35.17  ? 877  ILE A CB    1 
ATOM   7082 C  CG1   . ILE A 1 877 ? -29.258 35.672 27.765  1.00 37.11  ? 877  ILE A CG1   1 
ATOM   7083 C  CG2   . ILE A 1 877 ? -30.016 37.437 26.145  1.00 32.54  ? 877  ILE A CG2   1 
ATOM   7084 C  CD1   . ILE A 1 877 ? -30.623 35.500 28.380  1.00 38.66  ? 877  ILE A CD1   1 
ATOM   7085 N  N     . LYS A 1 878 ? -27.147 39.543 26.637  1.00 35.02  ? 878  LYS A N     1 
ATOM   7086 C  CA    . LYS A 1 878 ? -26.976 40.856 26.019  1.00 36.25  ? 878  LYS A CA    1 
ATOM   7087 C  C     . LYS A 1 878 ? -25.799 40.924 25.029  1.00 39.23  ? 878  LYS A C     1 
ATOM   7088 O  O     . LYS A 1 878 ? -25.976 41.402 23.909  1.00 40.84  ? 878  LYS A O     1 
ATOM   7089 C  CB    . LYS A 1 878 ? -26.895 41.967 27.073  1.00 36.21  ? 878  LYS A CB    1 
ATOM   7090 C  CG    . LYS A 1 878 ? -27.459 43.298 26.603  1.00 41.37  ? 878  LYS A CG    1 
ATOM   7091 C  CD    . LYS A 1 878 ? -27.406 44.353 27.702  1.00 45.47  ? 878  LYS A CD    1 
ATOM   7092 N  N     . PRO A 1 879 ? -24.601 40.444 25.425  1.00 38.13  ? 879  PRO A N     1 
ATOM   7093 C  CA    . PRO A 1 879 ? -23.521 40.471 24.430  1.00 34.73  ? 879  PRO A CA    1 
ATOM   7094 C  C     . PRO A 1 879 ? -23.802 39.527 23.270  1.00 32.00  ? 879  PRO A C     1 
ATOM   7095 O  O     . PRO A 1 879 ? -23.457 39.839 22.132  1.00 30.88  ? 879  PRO A O     1 
ATOM   7096 C  CB    . PRO A 1 879 ? -22.304 39.972 25.215  1.00 32.85  ? 879  PRO A CB    1 
ATOM   7097 C  CG    . PRO A 1 879 ? -22.635 40.216 26.633  1.00 34.10  ? 879  PRO A CG    1 
ATOM   7098 C  CD    . PRO A 1 879 ? -24.109 40.002 26.742  1.00 35.85  ? 879  PRO A CD    1 
ATOM   7099 N  N     . LEU A 1 880 ? -24.421 38.388 23.562  1.00 31.36  ? 880  LEU A N     1 
ATOM   7100 C  CA    . LEU A 1 880 ? -24.766 37.427 22.522  1.00 35.77  ? 880  LEU A CA    1 
ATOM   7101 C  C     . LEU A 1 880 ? -25.768 38.043 21.548  1.00 37.02  ? 880  LEU A C     1 
ATOM   7102 O  O     . LEU A 1 880 ? -25.710 37.796 20.340  1.00 35.56  ? 880  LEU A O     1 
ATOM   7103 C  CB    . LEU A 1 880 ? -25.325 36.138 23.130  1.00 29.64  ? 880  LEU A CB    1 
ATOM   7104 C  CG    . LEU A 1 880 ? -25.727 35.061 22.118  1.00 32.66  ? 880  LEU A CG    1 
ATOM   7105 C  CD1   . LEU A 1 880 ? -24.534 34.630 21.277  1.00 32.20  ? 880  LEU A CD1   1 
ATOM   7106 C  CD2   . LEU A 1 880 ? -26.352 33.868 22.814  1.00 29.87  ? 880  LEU A CD2   1 
ATOM   7107 N  N     . GLU A 1 881 ? -26.678 38.851 22.084  1.00 38.81  ? 881  GLU A N     1 
ATOM   7108 C  CA    . GLU A 1 881 ? -27.626 39.592 21.265  1.00 43.22  ? 881  GLU A CA    1 
ATOM   7109 C  C     . GLU A 1 881 ? -26.874 40.502 20.299  1.00 42.27  ? 881  GLU A C     1 
ATOM   7110 O  O     . GLU A 1 881 ? -27.199 40.574 19.113  1.00 42.45  ? 881  GLU A O     1 
ATOM   7111 C  CB    . GLU A 1 881 ? -28.565 40.417 22.145  1.00 48.52  ? 881  GLU A CB    1 
ATOM   7112 C  CG    . GLU A 1 881 ? -29.355 41.467 21.384  1.00 57.14  ? 881  GLU A CG    1 
ATOM   7113 C  CD    . GLU A 1 881 ? -30.278 40.865 20.340  1.00 64.34  ? 881  GLU A CD    1 
ATOM   7114 O  OE1   . GLU A 1 881 ? -30.986 39.886 20.665  1.00 65.58  ? 881  GLU A OE1   1 
ATOM   7115 O  OE2   . GLU A 1 881 ? -30.293 41.368 19.195  1.00 67.17  ? 881  GLU A OE2   1 
ATOM   7116 N  N     . GLY A 1 882 ? -25.856 41.182 20.815  1.00 40.83  ? 882  GLY A N     1 
ATOM   7117 C  CA    . GLY A 1 882 ? -25.043 42.064 20.003  1.00 40.30  ? 882  GLY A CA    1 
ATOM   7118 C  C     . GLY A 1 882 ? -24.326 41.299 18.910  1.00 39.34  ? 882  GLY A C     1 
ATOM   7119 O  O     . GLY A 1 882 ? -24.283 41.745 17.765  1.00 40.35  ? 882  GLY A O     1 
ATOM   7120 N  N     . PHE A 1 883 ? -23.773 40.141 19.267  1.00 35.97  ? 883  PHE A N     1 
ATOM   7121 C  CA    . PHE A 1 883 ? -23.058 39.299 18.314  1.00 34.27  ? 883  PHE A CA    1 
ATOM   7122 C  C     . PHE A 1 883 ? -23.988 38.864 17.192  1.00 36.47  ? 883  PHE A C     1 
ATOM   7123 O  O     . PHE A 1 883 ? -23.673 39.018 16.013  1.00 39.14  ? 883  PHE A O     1 
ATOM   7124 C  CB    . PHE A 1 883 ? -22.501 38.044 18.995  1.00 30.33  ? 883  PHE A CB    1 
ATOM   7125 C  CG    . PHE A 1 883 ? -21.495 38.321 20.075  1.00 35.18  ? 883  PHE A CG    1 
ATOM   7126 C  CD1   . PHE A 1 883 ? -20.910 39.572 20.212  1.00 35.51  ? 883  PHE A CD1   1 
ATOM   7127 C  CD2   . PHE A 1 883 ? -21.126 37.317 20.953  1.00 29.62  ? 883  PHE A CD2   1 
ATOM   7128 C  CE1   . PHE A 1 883 ? -19.986 39.815 21.212  1.00 34.50  ? 883  PHE A CE1   1 
ATOM   7129 C  CE2   . PHE A 1 883 ? -20.202 37.554 21.952  1.00 31.15  ? 883  PHE A CE2   1 
ATOM   7130 C  CZ    . PHE A 1 883 ? -19.632 38.805 22.082  1.00 29.28  ? 883  PHE A CZ    1 
ATOM   7131 N  N     . THR A 1 884 ? -25.139 38.323 17.572  1.00 38.22  ? 884  THR A N     1 
ATOM   7132 C  CA    . THR A 1 884 ? -26.058 37.716 16.617  1.00 40.65  ? 884  THR A CA    1 
ATOM   7133 C  C     . THR A 1 884 ? -26.780 38.737 15.741  1.00 41.41  ? 884  THR A C     1 
ATOM   7134 O  O     . THR A 1 884 ? -26.905 38.539 14.531  1.00 42.84  ? 884  THR A O     1 
ATOM   7135 C  CB    . THR A 1 884 ? -27.086 36.805 17.320  1.00 39.91  ? 884  THR A CB    1 
ATOM   7136 O  OG1   . THR A 1 884 ? -27.775 37.550 18.332  1.00 42.92  ? 884  THR A OG1   1 
ATOM   7137 C  CG2   . THR A 1 884 ? -26.390 35.624 17.965  1.00 36.14  ? 884  THR A CG2   1 
ATOM   7138 N  N     . SER A 1 885 ? -27.256 39.821 16.350  1.00 40.06  ? 885  SER A N     1 
ATOM   7139 C  CA    . SER A 1 885 ? -27.936 40.869 15.597  1.00 42.03  ? 885  SER A CA    1 
ATOM   7140 C  C     . SER A 1 885 ? -26.996 41.428 14.539  1.00 44.15  ? 885  SER A C     1 
ATOM   7141 O  O     . SER A 1 885 ? -27.408 41.706 13.413  1.00 47.77  ? 885  SER A O     1 
ATOM   7142 C  CB    . SER A 1 885 ? -28.412 41.990 16.520  1.00 41.99  ? 885  SER A CB    1 
ATOM   7143 O  OG    . SER A 1 885 ? -27.315 42.720 17.037  1.00 46.64  ? 885  SER A OG    1 
ATOM   7144 N  N     . ALA A 1 886 ? -25.727 41.580 14.907  1.00 41.79  ? 886  ALA A N     1 
ATOM   7145 C  CA    . ALA A 1 886 ? -24.709 42.018 13.963  1.00 41.34  ? 886  ALA A CA    1 
ATOM   7146 C  C     . ALA A 1 886 ? -24.570 40.996 12.841  1.00 41.47  ? 886  ALA A C     1 
ATOM   7147 O  O     . ALA A 1 886 ? -24.605 41.345 11.661  1.00 42.15  ? 886  ALA A O     1 
ATOM   7148 C  CB    . ALA A 1 886 ? -23.376 42.216 14.671  1.00 38.98  ? 886  ALA A CB    1 
ATOM   7149 N  N     . ALA A 1 887 ? -24.440 39.729 13.223  1.00 38.68  ? 887  ALA A N     1 
ATOM   7150 C  CA    . ALA A 1 887 ? -24.221 38.648 12.266  1.00 39.27  ? 887  ALA A CA    1 
ATOM   7151 C  C     . ALA A 1 887 ? -25.491 38.220 11.536  1.00 45.19  ? 887  ALA A C     1 
ATOM   7152 O  O     . ALA A 1 887 ? -25.449 37.300 10.719  1.00 47.02  ? 887  ALA A O     1 
ATOM   7153 C  CB    . ALA A 1 887 ? -23.588 37.449 12.962  1.00 35.71  ? 887  ALA A CB    1 
ATOM   7154 N  N     . LYS A 1 888 ? -26.606 38.889 11.826  1.00 48.11  ? 888  LYS A N     1 
ATOM   7155 C  CA    . LYS A 1 888 ? -27.906 38.562 11.234  1.00 48.26  ? 888  LYS A CA    1 
ATOM   7156 C  C     . LYS A 1 888 ? -28.316 37.125 11.554  1.00 46.22  ? 888  LYS A C     1 
ATOM   7157 O  O     . LYS A 1 888 ? -28.728 36.372 10.671  1.00 44.89  ? 888  LYS A O     1 
ATOM   7158 C  CB    . LYS A 1 888 ? -27.896 38.776 9.716   1.00 50.29  ? 888  LYS A CB    1 
ATOM   7159 C  CG    . LYS A 1 888 ? -27.228 40.057 9.259   1.00 51.82  ? 888  LYS A CG    1 
ATOM   7160 C  CD    . LYS A 1 888 ? -28.063 41.270 9.601   1.00 55.05  ? 888  LYS A CD    1 
ATOM   7161 C  CE    . LYS A 1 888 ? -27.449 42.524 9.007   1.00 56.93  ? 888  LYS A CE    1 
ATOM   7162 N  NZ    . LYS A 1 888 ? -28.323 43.713 9.177   1.00 59.04  ? 888  LYS A NZ    1 
ATOM   7163 N  N     . LEU A 1 889 ? -28.186 36.750 12.821  1.00 47.31  ? 889  LEU A N     1 
ATOM   7164 C  CA    . LEU A 1 889 ? -28.568 35.421 13.279  1.00 47.67  ? 889  LEU A CA    1 
ATOM   7165 C  C     . LEU A 1 889 ? -29.514 35.531 14.459  1.00 46.84  ? 889  LEU A C     1 
ATOM   7166 O  O     . LEU A 1 889 ? -29.680 36.605 15.038  1.00 45.19  ? 889  LEU A O     1 
ATOM   7167 C  CB    . LEU A 1 889 ? -27.336 34.622 13.709  1.00 50.80  ? 889  LEU A CB    1 
ATOM   7168 C  CG    . LEU A 1 889 ? -26.379 34.114 12.632  1.00 55.14  ? 889  LEU A CG    1 
ATOM   7169 C  CD1   . LEU A 1 889 ? -25.127 33.545 13.273  1.00 53.84  ? 889  LEU A CD1   1 
ATOM   7170 C  CD2   . LEU A 1 889 ? -27.060 33.066 11.772  1.00 60.13  ? 889  LEU A CD2   1 
ATOM   7171 N  N     . ASP A 1 890 ? -30.133 34.411 14.812  1.00 48.50  ? 890  ASP A N     1 
ATOM   7172 C  CA    . ASP A 1 890 ? -30.896 34.321 16.049  1.00 50.53  ? 890  ASP A CA    1 
ATOM   7173 C  C     . ASP A 1 890 ? -30.332 33.191 16.898  1.00 49.52  ? 890  ASP A C     1 
ATOM   7174 O  O     . ASP A 1 890 ? -29.971 32.135 16.377  1.00 49.10  ? 890  ASP A O     1 
ATOM   7175 C  CB    . ASP A 1 890 ? -32.380 34.083 15.771  1.00 54.58  ? 890  ASP A CB    1 
ATOM   7176 C  CG    . ASP A 1 890 ? -33.036 35.248 15.056  1.00 59.08  ? 890  ASP A CG    1 
ATOM   7177 O  OD1   . ASP A 1 890 ? -33.279 36.289 15.707  1.00 59.70  ? 890  ASP A OD1   1 
ATOM   7178 O  OD2   . ASP A 1 890 ? -33.314 35.119 13.844  1.00 61.27  ? 890  ASP A OD2   1 
ATOM   7179 N  N     . TYR A 1 891 ? -30.243 33.417 18.204  1.00 48.15  ? 891  TYR A N     1 
ATOM   7180 C  CA    . TYR A 1 891 ? -29.776 32.379 19.113  1.00 48.11  ? 891  TYR A CA    1 
ATOM   7181 C  C     . TYR A 1 891 ? -30.958 31.578 19.656  1.00 50.10  ? 891  TYR A C     1 
ATOM   7182 O  O     . TYR A 1 891 ? -30.786 30.502 20.228  1.00 48.89  ? 891  TYR A O     1 
ATOM   7183 C  CB    . TYR A 1 891 ? -28.941 32.977 20.250  1.00 43.90  ? 891  TYR A CB    1 
ATOM   7184 C  CG    . TYR A 1 891 ? -29.659 34.036 21.050  1.00 42.60  ? 891  TYR A CG    1 
ATOM   7185 C  CD1   . TYR A 1 891 ? -29.521 35.381 20.738  1.00 43.03  ? 891  TYR A CD1   1 
ATOM   7186 C  CD2   . TYR A 1 891 ? -30.473 33.692 22.121  1.00 41.50  ? 891  TYR A CD2   1 
ATOM   7187 C  CE1   . TYR A 1 891 ? -30.176 36.356 21.469  1.00 44.16  ? 891  TYR A CE1   1 
ATOM   7188 C  CE2   . TYR A 1 891 ? -31.133 34.658 22.856  1.00 42.29  ? 891  TYR A CE2   1 
ATOM   7189 C  CZ    . TYR A 1 891 ? -30.982 35.987 22.527  1.00 43.96  ? 891  TYR A CZ    1 
ATOM   7190 O  OH    . TYR A 1 891 ? -31.640 36.949 23.262  1.00 44.49  ? 891  TYR A OH    1 
ATOM   7191 N  N     . GLU A 1 892 ? -32.159 32.118 19.473  1.00 53.09  ? 892  GLU A N     1 
ATOM   7192 C  CA    . GLU A 1 892 ? -33.390 31.395 19.774  1.00 54.90  ? 892  GLU A CA    1 
ATOM   7193 C  C     . GLU A 1 892 ? -34.220 31.270 18.506  1.00 57.66  ? 892  GLU A C     1 
ATOM   7194 O  O     . GLU A 1 892 ? -34.326 32.224 17.736  1.00 60.35  ? 892  GLU A O     1 
ATOM   7195 C  CB    . GLU A 1 892 ? -34.203 32.113 20.852  1.00 55.59  ? 892  GLU A CB    1 
ATOM   7196 C  CG    . GLU A 1 892 ? -33.886 31.676 22.273  1.00 58.14  ? 892  GLU A CG    1 
ATOM   7197 C  CD    . GLU A 1 892 ? -34.761 32.365 23.303  1.00 60.41  ? 892  GLU A CD    1 
ATOM   7198 O  OE1   . GLU A 1 892 ? -35.100 33.549 23.091  1.00 61.13  ? 892  GLU A OE1   1 
ATOM   7199 O  OE2   . GLU A 1 892 ? -35.115 31.723 24.318  1.00 61.06  ? 892  GLU A OE2   1 
ATOM   7200 N  N     . LYS A 1 893 ? -34.801 30.095 18.285  1.00 57.36  ? 893  LYS A N     1 
ATOM   7201 C  CA    . LYS A 1 893 ? -35.644 29.884 17.116  1.00 58.06  ? 893  LYS A CA    1 
ATOM   7202 C  C     . LYS A 1 893 ? -36.871 30.783 17.206  1.00 57.44  ? 893  LYS A C     1 
ATOM   7203 O  O     . LYS A 1 893 ? -37.656 30.685 18.149  1.00 55.63  ? 893  LYS A O     1 
ATOM   7204 C  CB    . LYS A 1 893 ? -36.054 28.414 16.999  1.00 61.26  ? 893  LYS A CB    1 
ATOM   7205 C  CG    . LYS A 1 893 ? -36.674 28.042 15.658  1.00 63.04  ? 893  LYS A CG    1 
ATOM   7206 C  CD    . LYS A 1 893 ? -36.905 26.542 15.550  1.00 61.95  ? 893  LYS A CD    1 
ATOM   7207 N  N     . LYS A 1 894 ? -37.019 31.673 16.229  1.00 59.49  ? 894  LYS A N     1 
ATOM   7208 C  CA    . LYS A 1 894 ? -38.131 32.617 16.209  1.00 59.32  ? 894  LYS A CA    1 
ATOM   7209 C  C     . LYS A 1 894 ? -39.451 31.896 15.968  1.00 62.98  ? 894  LYS A C     1 
ATOM   7210 O  O     . LYS A 1 894 ? -39.469 30.744 15.531  1.00 64.00  ? 894  LYS A O     1 
ATOM   7211 C  CB    . LYS A 1 894 ? -37.910 33.690 15.138  1.00 55.92  ? 894  LYS A CB    1 
ATOM   7212 C  CG    . LYS A 1 894 ? -36.685 34.561 15.371  1.00 53.10  ? 894  LYS A CG    1 
ATOM   7213 N  N     . ALA A 1 895 ? -40.553 32.578 16.261  1.00 64.14  ? 895  ALA A N     1 
ATOM   7214 C  CA    . ALA A 1 895 ? -41.882 32.008 16.072  1.00 63.84  ? 895  ALA A CA    1 
ATOM   7215 C  C     . ALA A 1 895 ? -42.342 32.145 14.622  1.00 65.89  ? 895  ALA A C     1 
ATOM   7216 O  O     . ALA A 1 895 ? -42.182 33.201 14.006  1.00 65.86  ? 895  ALA A O     1 
ATOM   7217 C  CB    . ALA A 1 895 ? -42.878 32.668 17.013  1.00 62.06  ? 895  ALA A CB    1 
ATOM   7218 N  N     . SER A 1 896 ? -42.914 31.072 14.083  1.00 67.19  ? 896  SER A N     1 
ATOM   7219 C  CA    . SER A 1 896 ? -43.387 31.063 12.702  1.00 67.07  ? 896  SER A CA    1 
ATOM   7220 C  C     . SER A 1 896 ? -44.811 30.523 12.610  1.00 68.41  ? 896  SER A C     1 
ATOM   7221 O  O     . SER A 1 896 ? -45.390 30.096 13.609  1.00 66.32  ? 896  SER A O     1 
ATOM   7222 C  CB    . SER A 1 896 ? -42.460 30.212 11.832  1.00 66.46  ? 896  SER A CB    1 
ATOM   7223 O  OG    . SER A 1 896 ? -42.542 28.843 12.193  1.00 65.65  ? 896  SER A OG    1 
ATOM   7224 N  N     . LEU A 1 897 ? -45.369 30.539 11.402  1.00 72.34  ? 897  LEU A N     1 
ATOM   7225 C  CA    . LEU A 1 897 ? -46.689 29.964 11.155  1.00 75.06  ? 897  LEU A CA    1 
ATOM   7226 C  C     . LEU A 1 897 ? -46.657 28.451 11.353  1.00 76.08  ? 897  LEU A C     1 
ATOM   7227 O  O     . LEU A 1 897 ? -47.691 27.818 11.571  1.00 75.84  ? 897  LEU A O     1 
ATOM   7228 C  CB    . LEU A 1 897 ? -47.161 30.289 9.733   1.00 77.43  ? 897  LEU A CB    1 
ATOM   7229 C  CG    . LEU A 1 897 ? -47.492 31.742 9.380   1.00 78.22  ? 897  LEU A CG    1 
ATOM   7230 C  CD1   . LEU A 1 897 ? -47.767 31.878 7.888   1.00 79.06  ? 897  LEU A CD1   1 
ATOM   7231 C  CD2   . LEU A 1 897 ? -48.680 32.243 10.188  1.00 78.21  ? 897  LEU A CD2   1 
ATOM   7232 N  N     . PHE A 1 898 ? -45.458 27.882 11.282  1.00 76.83  ? 898  PHE A N     1 
ATOM   7233 C  CA    . PHE A 1 898 ? -45.268 26.441 11.404  1.00 78.75  ? 898  PHE A CA    1 
ATOM   7234 C  C     . PHE A 1 898 ? -45.524 25.946 12.821  1.00 77.47  ? 898  PHE A C     1 
ATOM   7235 O  O     . PHE A 1 898 ? -45.634 24.743 13.059  1.00 77.88  ? 898  PHE A O     1 
ATOM   7236 C  CB    . PHE A 1 898 ? -43.859 26.057 10.950  1.00 81.26  ? 898  PHE A CB    1 
ATOM   7237 C  CG    . PHE A 1 898 ? -43.592 26.358 9.507   1.00 85.34  ? 898  PHE A CG    1 
ATOM   7238 C  CD1   . PHE A 1 898 ? -43.785 25.388 8.542   1.00 85.85  ? 898  PHE A CD1   1 
ATOM   7239 C  CD2   . PHE A 1 898 ? -43.166 27.617 9.112   1.00 88.42  ? 898  PHE A CD2   1 
ATOM   7240 C  CE1   . PHE A 1 898 ? -43.550 25.662 7.215   1.00 88.26  ? 898  PHE A CE1   1 
ATOM   7241 C  CE2   . PHE A 1 898 ? -42.930 27.897 7.780   1.00 89.72  ? 898  PHE A CE2   1 
ATOM   7242 C  CZ    . PHE A 1 898 ? -43.122 26.916 6.831   1.00 89.34  ? 898  PHE A CZ    1 
ATOM   7243 N  N     . ASP A 1 899 ? -45.633 26.882 13.759  1.00 76.26  ? 899  ASP A N     1 
ATOM   7244 C  CA    . ASP A 1 899 ? -45.916 26.546 15.148  1.00 74.59  ? 899  ASP A CA    1 
ATOM   7245 C  C     . ASP A 1 899 ? -47.352 26.053 15.314  1.00 76.72  ? 899  ASP A C     1 
ATOM   7246 O  O     . ASP A 1 899 ? -47.744 25.605 16.392  1.00 77.88  ? 899  ASP A O     1 
ATOM   7247 C  CB    . ASP A 1 899 ? -45.656 27.751 16.054  1.00 71.91  ? 899  ASP A CB    1 
ATOM   7248 C  CG    . ASP A 1 899 ? -44.223 28.242 15.972  1.00 69.97  ? 899  ASP A CG    1 
ATOM   7249 O  OD1   . ASP A 1 899 ? -43.994 29.455 16.164  1.00 69.39  ? 899  ASP A OD1   1 
ATOM   7250 O  OD2   . ASP A 1 899 ? -43.323 27.415 15.707  1.00 68.12  ? 899  ASP A OD2   1 
ATOM   7251 N  N     . MET A 1 900 ? -48.131 26.135 14.239  1.00 77.13  ? 900  MET A N     1 
ATOM   7252 C  CA    . MET A 1 900 ? -49.509 25.657 14.248  1.00 77.34  ? 900  MET A CA    1 
ATOM   7253 C  C     . MET A 1 900 ? -49.586 24.195 13.815  1.00 76.36  ? 900  MET A C     1 
ATOM   7254 O  O     . MET A 1 900 ? -50.675 23.636 13.686  1.00 77.37  ? 900  MET A O     1 
ATOM   7255 C  CB    . MET A 1 900 ? -50.385 26.526 13.342  1.00 79.37  ? 900  MET A CB    1 
ATOM   7256 C  CG    . MET A 1 900 ? -50.296 28.016 13.642  1.00 80.21  ? 900  MET A CG    1 
ATOM   7257 S  SD    . MET A 1 900 ? -51.367 29.028 12.601  1.00 118.64 ? 900  MET A SD    1 
ATOM   7258 C  CE    . MET A 1 900 ? -52.985 28.533 13.188  1.00 73.01  ? 900  MET A CE    1 
ATOM   7259 N  N     . PHE A 1 901 ? -48.425 23.585 13.589  1.00 74.52  ? 901  PHE A N     1 
ATOM   7260 C  CA    . PHE A 1 901 ? -48.350 22.174 13.215  1.00 74.83  ? 901  PHE A CA    1 
ATOM   7261 C  C     . PHE A 1 901 ? -47.686 21.348 14.315  1.00 76.45  ? 901  PHE A C     1 
ATOM   7262 O  O     . PHE A 1 901 ? -47.024 21.895 15.201  1.00 77.19  ? 901  PHE A O     1 
ATOM   7263 C  CB    . PHE A 1 901 ? -47.587 21.996 11.897  1.00 72.75  ? 901  PHE A CB    1 
ATOM   7264 C  CG    . PHE A 1 901 ? -48.267 22.616 10.709  1.00 70.51  ? 901  PHE A CG    1 
ATOM   7265 C  CD1   . PHE A 1 901 ? -49.377 22.016 10.141  1.00 69.66  ? 901  PHE A CD1   1 
ATOM   7266 C  CD2   . PHE A 1 901 ? -47.790 23.792 10.154  1.00 69.00  ? 901  PHE A CD2   1 
ATOM   7267 C  CE1   . PHE A 1 901 ? -50.005 22.581 9.048   1.00 69.31  ? 901  PHE A CE1   1 
ATOM   7268 C  CE2   . PHE A 1 901 ? -48.413 24.362 9.060   1.00 68.13  ? 901  PHE A CE2   1 
ATOM   7269 C  CZ    . PHE A 1 901 ? -49.522 23.754 8.507   1.00 68.75  ? 901  PHE A CZ    1 
ATOM   7270 N  N     . ASP A 1 902 ? -47.863 20.031 14.250  1.00 75.06  ? 902  ASP A N     1 
ATOM   7271 C  CA    . ASP A 1 902 ? -47.277 19.125 15.235  1.00 69.19  ? 902  ASP A CA    1 
ATOM   7272 C  C     . ASP A 1 902 ? -46.103 18.348 14.648  1.00 66.25  ? 902  ASP A C     1 
ATOM   7273 O  O     . ASP A 1 902 ? -44.988 18.865 14.555  1.00 63.35  ? 902  ASP A O     1 
ATOM   7274 C  CB    . ASP A 1 902 ? -48.335 18.157 15.769  1.00 66.84  ? 902  ASP A CB    1 
ATOM   7275 O  "O5'" . DA  B 2 1   ? 3.495   63.712 38.779  1.00 84.97  ? 1    DA  T "O5'" 1 
ATOM   7276 C  "C5'" . DA  B 2 1   ? 3.892   62.558 38.055  1.00 83.11  ? 1    DA  T "C5'" 1 
ATOM   7277 C  "C4'" . DA  B 2 1   ? 4.174   62.902 36.605  1.00 83.25  ? 1    DA  T "C4'" 1 
ATOM   7278 O  "O4'" . DA  B 2 1   ? 5.383   63.702 36.538  1.00 84.84  ? 1    DA  T "O4'" 1 
ATOM   7279 C  "C3'" . DA  B 2 1   ? 4.426   61.688 35.716  1.00 82.54  ? 1    DA  T "C3'" 1 
ATOM   7280 O  "O3'" . DA  B 2 1   ? 4.046   61.942 34.365  1.00 81.28  ? 1    DA  T "O3'" 1 
ATOM   7281 C  "C2'" . DA  B 2 1   ? 5.934   61.537 35.842  1.00 84.02  ? 1    DA  T "C2'" 1 
ATOM   7282 C  "C1'" . DA  B 2 1   ? 6.382   62.992 35.833  1.00 85.43  ? 1    DA  T "C1'" 1 
ATOM   7283 N  N9    . DA  B 2 1   ? 7.669   63.159 36.495  1.00 88.54  ? 1    DA  T N9    1 
ATOM   7284 C  C8    . DA  B 2 1   ? 8.843   63.574 35.928  1.00 89.69  ? 1    DA  T C8    1 
ATOM   7285 N  N7    . DA  B 2 1   ? 9.848   63.618 36.772  1.00 93.40  ? 1    DA  T N7    1 
ATOM   7286 C  C5    . DA  B 2 1   ? 9.295   63.198 37.973  1.00 95.38  ? 1    DA  T C5    1 
ATOM   7287 C  C6    . DA  B 2 1   ? 9.837   63.024 39.264  1.00 98.95  ? 1    DA  T C6    1 
ATOM   7288 N  N6    . DA  B 2 1   ? 11.119  63.265 39.562  1.00 102.18 ? 1    DA  T N6    1 
ATOM   7289 N  N1    . DA  B 2 1   ? 9.007   62.591 40.239  1.00 98.31  ? 1    DA  T N1    1 
ATOM   7290 C  C2    . DA  B 2 1   ? 7.724   62.351 39.938  1.00 95.82  ? 1    DA  T C2    1 
ATOM   7291 N  N3    . DA  B 2 1   ? 7.104   62.478 38.766  1.00 92.90  ? 1    DA  T N3    1 
ATOM   7292 C  C4    . DA  B 2 1   ? 7.952   62.909 37.818  1.00 92.27  ? 1    DA  T C4    1 
ATOM   7293 P  P     . DC  B 2 2   ? 3.816   60.719 33.344  1.00 83.79  ? 2    DC  T P     1 
ATOM   7294 O  OP1   . DC  B 2 2   ? 3.320   61.283 32.068  1.00 78.63  ? 2    DC  T OP1   1 
ATOM   7295 O  OP2   . DC  B 2 2   ? 3.020   59.688 34.048  1.00 84.76  ? 2    DC  T OP2   1 
ATOM   7296 O  "O5'" . DC  B 2 2   ? 5.284   60.117 33.115  1.00 71.38  ? 2    DC  T "O5'" 1 
ATOM   7297 C  "C5'" . DC  B 2 2   ? 6.260   60.848 32.382  1.00 67.38  ? 2    DC  T "C5'" 1 
ATOM   7298 C  "C4'" . DC  B 2 2   ? 7.622   60.198 32.510  1.00 62.91  ? 2    DC  T "C4'" 1 
ATOM   7299 O  "O4'" . DC  B 2 2   ? 8.237   60.574 33.762  1.00 65.30  ? 2    DC  T "O4'" 1 
ATOM   7300 C  "C3'" . DC  B 2 2   ? 7.564   58.685 32.553  1.00 58.35  ? 2    DC  T "C3'" 1 
ATOM   7301 O  "O3'" . DC  B 2 2   ? 7.553   58.218 31.223  1.00 52.50  ? 2    DC  T "O3'" 1 
ATOM   7302 C  "C2'" . DC  B 2 2   ? 8.854   58.329 33.284  1.00 63.21  ? 2    DC  T "C2'" 1 
ATOM   7303 C  "C1'" . DC  B 2 2   ? 9.093   59.533 34.193  1.00 68.86  ? 2    DC  T "C1'" 1 
ATOM   7304 N  N1    . DC  B 2 2   ? 8.816   59.273 35.638  1.00 76.35  ? 2    DC  T N1    1 
ATOM   7305 C  C2    . DC  B 2 2   ? 9.726   59.732 36.600  1.00 79.27  ? 2    DC  T C2    1 
ATOM   7306 O  O2    . DC  B 2 2   ? 10.742  60.338 36.233  1.00 77.50  ? 2    DC  T O2    1 
ATOM   7307 N  N3    . DC  B 2 2   ? 9.465   59.496 37.911  1.00 82.90  ? 2    DC  T N3    1 
ATOM   7308 C  C4    . DC  B 2 2   ? 8.357   58.837 38.268  1.00 82.73  ? 2    DC  T C4    1 
ATOM   7309 N  N4    . DC  B 2 2   ? 8.143   58.629 39.573  1.00 84.29  ? 2    DC  T N4    1 
ATOM   7310 C  C5    . DC  B 2 2   ? 7.420   58.363 37.302  1.00 78.73  ? 2    DC  T C5    1 
ATOM   7311 C  C6    . DC  B 2 2   ? 7.687   58.599 36.014  1.00 76.63  ? 2    DC  T C6    1 
ATOM   7312 P  P     . DA  B 2 3   ? 7.589   56.646 30.913  1.00 28.07  ? 3    DA  T P     1 
ATOM   7313 O  OP1   . DA  B 2 3   ? 6.608   55.979 31.798  1.00 28.92  ? 3    DA  T OP1   1 
ATOM   7314 O  OP2   . DA  B 2 3   ? 9.011   56.232 30.918  1.00 29.66  ? 3    DA  T OP2   1 
ATOM   7315 O  "O5'" . DA  B 2 3   ? 7.064   56.547 29.408  1.00 22.62  ? 3    DA  T "O5'" 1 
ATOM   7316 C  "C5'" . DA  B 2 3   ? 5.695   56.761 29.125  1.00 21.57  ? 3    DA  T "C5'" 1 
ATOM   7317 C  "C4'" . DA  B 2 3   ? 5.533   57.187 27.682  1.00 22.37  ? 3    DA  T "C4'" 1 
ATOM   7318 O  "O4'" . DA  B 2 3   ? 6.058   56.156 26.809  1.00 23.45  ? 3    DA  T "O4'" 1 
ATOM   7319 C  "C3'" . DA  B 2 3   ? 4.090   57.358 27.250  1.00 21.03  ? 3    DA  T "C3'" 1 
ATOM   7320 O  "O3'" . DA  B 2 3   ? 3.640   58.663 27.570  1.00 20.99  ? 3    DA  T "O3'" 1 
ATOM   7321 C  "C2'" . DA  B 2 3   ? 4.205   57.156 25.748  1.00 21.91  ? 3    DA  T "C2'" 1 
ATOM   7322 C  "C1'" . DA  B 2 3   ? 5.220   56.023 25.674  1.00 24.02  ? 3    DA  T "C1'" 1 
ATOM   7323 N  N9    . DA  B 2 3   ? 4.574   54.715 25.697  1.00 24.89  ? 3    DA  T N9    1 
ATOM   7324 C  C8    . DA  B 2 3   ? 4.507   53.836 26.742  1.00 22.42  ? 3    DA  T C8    1 
ATOM   7325 N  N7    . DA  B 2 3   ? 3.845   52.738 26.463  1.00 21.49  ? 3    DA  T N7    1 
ATOM   7326 C  C5    . DA  B 2 3   ? 3.450   52.913 25.144  1.00 22.18  ? 3    DA  T C5    1 
ATOM   7327 C  C6    . DA  B 2 3   ? 2.715   52.110 24.251  1.00 24.00  ? 3    DA  T C6    1 
ATOM   7328 N  N6    . DA  B 2 3   ? 2.225   50.907 24.576  1.00 22.13  ? 3    DA  T N6    1 
ATOM   7329 N  N1    . DA  B 2 3   ? 2.502   52.594 23.005  1.00 25.26  ? 3    DA  T N1    1 
ATOM   7330 C  C2    . DA  B 2 3   ? 2.991   53.794 22.675  1.00 23.41  ? 3    DA  T C2    1 
ATOM   7331 N  N3    . DA  B 2 3   ? 3.694   54.634 23.430  1.00 25.22  ? 3    DA  T N3    1 
ATOM   7332 C  C4    . DA  B 2 3   ? 3.890   54.128 24.659  1.00 23.99  ? 3    DA  T C4    1 
ATOM   7333 P  P     . DG  B 2 4   ? 2.068   58.948 27.714  1.00 23.54  ? 4    DG  T P     1 
ATOM   7334 O  OP1   . DG  B 2 4   ? 1.903   60.286 28.323  1.00 24.04  ? 4    DG  T OP1   1 
ATOM   7335 O  OP2   . DG  B 2 4   ? 1.462   57.758 28.349  1.00 27.38  ? 4    DG  T OP2   1 
ATOM   7336 O  "O5'" . DG  B 2 4   ? 1.546   58.984 26.207  1.00 27.73  ? 4    DG  T "O5'" 1 
ATOM   7337 C  "C5'" . DG  B 2 4   ? 2.104   59.914 25.288  1.00 27.28  ? 4    DG  T "C5'" 1 
ATOM   7338 C  "C4'" . DG  B 2 4   ? 1.544   59.661 23.903  1.00 27.08  ? 4    DG  T "C4'" 1 
ATOM   7339 O  "O4'" . DG  B 2 4   ? 2.001   58.372 23.430  1.00 27.05  ? 4    DG  T "O4'" 1 
ATOM   7340 C  "C3'" . DG  B 2 4   ? 0.030   59.560 23.849  1.00 24.38  ? 4    DG  T "C3'" 1 
ATOM   7341 O  "O3'" . DG  B 2 4   ? -0.516  60.863 23.739  1.00 22.46  ? 4    DG  T "O3'" 1 
ATOM   7342 C  "C2'" . DG  B 2 4   ? -0.173  58.744 22.578  1.00 23.54  ? 4    DG  T "C2'" 1 
ATOM   7343 C  "C1'" . DG  B 2 4   ? 1.003   57.780 22.623  1.00 23.75  ? 4    DG  T "C1'" 1 
ATOM   7344 N  N9    . DG  B 2 4   ? 0.635   56.503 23.208  1.00 23.46  ? 4    DG  T N9    1 
ATOM   7345 C  C8    . DG  B 2 4   ? 0.879   56.074 24.486  1.00 24.75  ? 4    DG  T C8    1 
ATOM   7346 N  N7    . DG  B 2 4   ? 0.421   54.874 24.711  1.00 25.79  ? 4    DG  T N7    1 
ATOM   7347 C  C5    . DG  B 2 4   ? -0.160  54.494 23.506  1.00 22.73  ? 4    DG  T C5    1 
ATOM   7348 C  C6    . DG  B 2 4   ? -0.816  53.298 23.140  1.00 23.55  ? 4    DG  T C6    1 
ATOM   7349 O  O6    . DG  B 2 4   ? -1.022  52.296 23.839  1.00 25.50  ? 4    DG  T O6    1 
ATOM   7350 N  N1    . DG  B 2 4   ? -1.254  53.329 21.820  1.00 23.61  ? 4    DG  T N1    1 
ATOM   7351 C  C2    . DG  B 2 4   ? -1.079  54.387 20.961  1.00 25.24  ? 4    DG  T C2    1 
ATOM   7352 N  N2    . DG  B 2 4   ? -1.568  54.244 19.722  1.00 26.05  ? 4    DG  T N2    1 
ATOM   7353 N  N3    . DG  B 2 4   ? -0.464  55.511 21.290  1.00 25.62  ? 4    DG  T N3    1 
ATOM   7354 C  C4    . DG  B 2 4   ? -0.035  55.489 22.572  1.00 22.79  ? 4    DG  T C4    1 
ATOM   7355 P  P     . G   B 2 5   ? -2.096  61.099 23.899  1.00 28.24  ? 5    G   T P     1 
ATOM   7356 O  OP1   . G   B 2 5   ? -2.363  62.553 23.751  1.00 29.59  ? 5    G   T OP1   1 
ATOM   7357 O  OP2   . G   B 2 5   ? -2.552  60.398 25.127  1.00 28.95  ? 5    G   T OP2   1 
ATOM   7358 O  "O5'" . G   B 2 5   ? -2.724  60.374 22.625  1.00 28.48  ? 5    G   T "O5'" 1 
ATOM   7359 C  "C5'" . G   B 2 5   ? -2.670  60.976 21.334  1.00 25.37  ? 5    G   T "C5'" 1 
ATOM   7360 C  "C4'" . G   B 2 5   ? -3.503  60.221 20.327  1.00 23.34  ? 5    G   T "C4'" 1 
ATOM   7361 O  "O4'" . G   B 2 5   ? -3.265  58.793 20.486  1.00 22.47  ? 5    G   T "O4'" 1 
ATOM   7362 C  "C3'" . G   B 2 5   ? -5.011  60.398 20.470  1.00 25.11  ? 5    G   T "C3'" 1 
ATOM   7363 O  "O3'" . G   B 2 5   ? -5.617  60.127 19.205  1.00 27.67  ? 5    G   T "O3'" 1 
ATOM   7364 C  "C2'" . G   B 2 5   ? -5.353  59.276 21.437  1.00 24.67  ? 5    G   T "C2'" 1 
ATOM   7365 O  "O2'" . G   B 2 5   ? -6.716  58.916 21.488  1.00 25.32  ? 5    G   T "O2'" 1 
ATOM   7366 C  "C1'" . G   B 2 5   ? -4.467  58.158 20.893  1.00 24.72  ? 5    G   T "C1'" 1 
ATOM   7367 N  N9    . G   B 2 5   ? -4.143  57.131 21.881  1.00 28.45  ? 5    G   T N9    1 
ATOM   7368 C  C8    . G   B 2 5   ? -3.483  57.312 23.071  1.00 27.07  ? 5    G   T C8    1 
ATOM   7369 N  N7    . G   B 2 5   ? -3.355  56.203 23.745  1.00 28.64  ? 5    G   T N7    1 
ATOM   7370 C  C5    . G   B 2 5   ? -3.970  55.239 22.954  1.00 30.25  ? 5    G   T C5    1 
ATOM   7371 C  C6    . G   B 2 5   ? -4.143  53.849 23.172  1.00 32.75  ? 5    G   T C6    1 
ATOM   7372 O  O6    . G   B 2 5   ? -3.769  53.177 24.142  1.00 37.20  ? 5    G   T O6    1 
ATOM   7373 N  N1    . G   B 2 5   ? -4.823  53.243 22.119  1.00 28.86  ? 5    G   T N1    1 
ATOM   7374 C  C2    . G   B 2 5   ? -5.279  53.892 21.001  1.00 27.39  ? 5    G   T C2    1 
ATOM   7375 N  N2    . G   B 2 5   ? -5.913  53.127 20.101  1.00 27.27  ? 5    G   T N2    1 
ATOM   7376 N  N3    . G   B 2 5   ? -5.125  55.188 20.785  1.00 28.21  ? 5    G   T N3    1 
ATOM   7377 C  C4    . G   B 2 5   ? -4.465  55.795 21.797  1.00 29.53  ? 5    G   T C4    1 
ATOM   7378 P  P     . DT  B 2 6   ? -7.158  60.483 18.920  1.00 27.52  ? 6    DT  T P     1 
ATOM   7379 O  OP1   . DT  B 2 6   ? -7.203  61.129 17.587  1.00 29.13  ? 6    DT  T OP1   1 
ATOM   7380 O  OP2   . DT  B 2 6   ? -7.723  61.172 20.104  1.00 26.43  ? 6    DT  T OP2   1 
ATOM   7381 O  "O5'" . DT  B 2 6   ? -7.864  59.055 18.810  1.00 33.48  ? 6    DT  T "O5'" 1 
ATOM   7382 C  "C5'" . DT  B 2 6   ? -7.328  58.064 17.945  1.00 32.74  ? 6    DT  T "C5'" 1 
ATOM   7383 C  "C4'" . DT  B 2 6   ? -8.105  56.769 18.094  1.00 33.23  ? 6    DT  T "C4'" 1 
ATOM   7384 O  "O4'" . DT  B 2 6   ? -7.613  56.034 19.243  1.00 34.26  ? 6    DT  T "O4'" 1 
ATOM   7385 C  "C3'" . DT  B 2 6   ? -9.609  56.947 18.295  1.00 30.96  ? 6    DT  T "C3'" 1 
ATOM   7386 O  "O3'" . DT  B 2 6   ? -10.295 56.246 17.264  1.00 30.88  ? 6    DT  T "O3'" 1 
ATOM   7387 C  "C2'" . DT  B 2 6   ? -9.889  56.358 19.679  1.00 30.73  ? 6    DT  T "C2'" 1 
ATOM   7388 C  "C1'" . DT  B 2 6   ? -8.712  55.409 19.874  1.00 32.74  ? 6    DT  T "C1'" 1 
ATOM   7389 N  N1    . DT  B 2 6   ? -8.358  55.143 21.305  1.00 30.34  ? 6    DT  T N1    1 
ATOM   7390 C  C2    . DT  B 2 6   ? -8.531  53.875 21.805  1.00 29.69  ? 6    DT  T C2    1 
ATOM   7391 O  O2    . DT  B 2 6   ? -8.963  52.950 21.143  1.00 27.84  ? 6    DT  T O2    1 
ATOM   7392 N  N3    . DT  B 2 6   ? -8.177  53.729 23.121  1.00 31.96  ? 6    DT  T N3    1 
ATOM   7393 C  C4    . DT  B 2 6   ? -7.678  54.697 23.974  1.00 29.54  ? 6    DT  T C4    1 
ATOM   7394 O  O4    . DT  B 2 6   ? -7.388  54.463 25.146  1.00 29.49  ? 6    DT  T O4    1 
ATOM   7395 C  C5    . DT  B 2 6   ? -7.521  55.999 23.388  1.00 26.72  ? 6    DT  T C5    1 
ATOM   7396 C  C7    . DT  B 2 6   ? -6.985  57.129 24.218  1.00 24.70  ? 6    DT  T C7    1 
ATOM   7397 C  C6    . DT  B 2 6   ? -7.864  56.156 22.102  1.00 27.89  ? 6    DT  T C6    1 
ATOM   7398 P  P     . DA  B 2 7   ? -11.857 56.514 16.993  1.00 29.07  ? 7    DA  T P     1 
ATOM   7399 O  OP1   . DA  B 2 7   ? -12.130 56.136 15.588  1.00 27.31  ? 7    DA  T OP1   1 
ATOM   7400 O  OP2   . DA  B 2 7   ? -12.193 57.875 17.470  1.00 32.45  ? 7    DA  T OP2   1 
ATOM   7401 O  "O5'" . DA  B 2 7   ? -12.592 55.470 17.947  1.00 33.46  ? 7    DA  T "O5'" 1 
ATOM   7402 C  "C5'" . DA  B 2 7   ? -12.300 54.093 17.804  1.00 33.26  ? 7    DA  T "C5'" 1 
ATOM   7403 C  "C4'" . DA  B 2 7   ? -12.974 53.309 18.908  1.00 31.88  ? 7    DA  T "C4'" 1 
ATOM   7404 O  "O4'" . DA  B 2 7   ? -12.139 53.323 20.097  1.00 32.74  ? 7    DA  T "O4'" 1 
ATOM   7405 C  "C3'" . DA  B 2 7   ? -14.337 53.857 19.323  1.00 30.45  ? 7    DA  T "C3'" 1 
ATOM   7406 O  "O3'" . DA  B 2 7   ? -15.271 52.792 19.356  1.00 31.58  ? 7    DA  T "O3'" 1 
ATOM   7407 C  "C2'" . DA  B 2 7   ? -14.074 54.390 20.725  1.00 30.63  ? 7    DA  T "C2'" 1 
ATOM   7408 C  "C1'" . DA  B 2 7   ? -13.009 53.410 21.198  1.00 30.78  ? 7    DA  T "C1'" 1 
ATOM   7409 N  N9    . DA  B 2 7   ? -12.322 53.876 22.397  1.00 30.07  ? 7    DA  T N9    1 
ATOM   7410 C  C8    . DA  B 2 7   ? -11.779 55.111 22.613  1.00 30.83  ? 7    DA  T C8    1 
ATOM   7411 N  N7    . DA  B 2 7   ? -11.243 55.253 23.801  1.00 30.11  ? 7    DA  T N7    1 
ATOM   7412 C  C5    . DA  B 2 7   ? -11.455 54.029 24.410  1.00 31.29  ? 7    DA  T C5    1 
ATOM   7413 C  C6    . DA  B 2 7   ? -11.122 53.534 25.688  1.00 32.40  ? 7    DA  T C6    1 
ATOM   7414 N  N6    . DA  B 2 7   ? -10.476 54.252 26.612  1.00 30.98  ? 7    DA  T N6    1 
ATOM   7415 N  N1    . DA  B 2 7   ? -11.476 52.267 25.980  1.00 31.76  ? 7    DA  T N1    1 
ATOM   7416 C  C2    . DA  B 2 7   ? -12.122 51.554 25.052  1.00 30.26  ? 7    DA  T C2    1 
ATOM   7417 N  N3    . DA  B 2 7   ? -12.488 51.905 23.820  1.00 29.31  ? 7    DA  T N3    1 
ATOM   7418 C  C4    . DA  B 2 7   ? -12.122 53.169 23.560  1.00 29.97  ? 7    DA  T C4    1 
ATOM   7419 P  P     . DA  B 2 8   ? -16.842 53.079 19.183  1.00 33.05  ? 8    DA  T P     1 
ATOM   7420 O  OP1   . DA  B 2 8   ? -17.139 53.063 17.736  1.00 33.91  ? 8    DA  T OP1   1 
ATOM   7421 O  OP2   . DA  B 2 8   ? -17.202 54.261 19.995  1.00 36.26  ? 8    DA  T OP2   1 
ATOM   7422 O  "O5'" . DA  B 2 8   ? -17.533 51.808 19.851  1.00 36.49  ? 8    DA  T "O5'" 1 
ATOM   7423 C  "C5'" . DA  B 2 8   ? -17.082 50.510 19.508  1.00 36.33  ? 8    DA  T "C5'" 1 
ATOM   7424 C  "C4'" . DA  B 2 8   ? -16.917 49.699 20.773  1.00 38.90  ? 8    DA  T "C4'" 1 
ATOM   7425 O  "O4'" . DA  B 2 8   ? -15.852 50.279 21.558  1.00 42.41  ? 8    DA  T "O4'" 1 
ATOM   7426 C  "C3'" . DA  B 2 8   ? -18.136 49.747 21.679  1.00 39.26  ? 8    DA  T "C3'" 1 
ATOM   7427 O  "O3'" . DA  B 2 8   ? -18.995 48.665 21.381  1.00 37.42  ? 8    DA  T "O3'" 1 
ATOM   7428 C  "C2'" . DA  B 2 8   ? -17.559 49.613 23.084  1.00 41.80  ? 8    DA  T "C2'" 1 
ATOM   7429 C  "C1'" . DA  B 2 8   ? -16.110 50.062 22.932  1.00 43.53  ? 8    DA  T "C1'" 1 
ATOM   7430 N  N9    . DA  B 2 8   ? -15.818 51.287 23.669  1.00 42.27  ? 8    DA  T N9    1 
ATOM   7431 C  C8    . DA  B 2 8   ? -15.909 52.575 23.223  1.00 38.90  ? 8    DA  T C8    1 
ATOM   7432 N  N7    . DA  B 2 8   ? -15.573 53.464 24.129  1.00 38.06  ? 8    DA  T N7    1 
ATOM   7433 C  C5    . DA  B 2 8   ? -15.244 52.705 25.242  1.00 37.36  ? 8    DA  T C5    1 
ATOM   7434 C  C6    . DA  B 2 8   ? -14.803 53.047 26.537  1.00 35.65  ? 8    DA  T C6    1 
ATOM   7435 N  N6    . DA  B 2 8   ? -14.614 54.307 26.944  1.00 34.86  ? 8    DA  T N6    1 
ATOM   7436 N  N1    . DA  B 2 8   ? -14.566 52.038 27.402  1.00 34.92  ? 8    DA  T N1    1 
ATOM   7437 C  C2    . DA  B 2 8   ? -14.755 50.777 26.998  1.00 33.98  ? 8    DA  T C2    1 
ATOM   7438 N  N3    . DA  B 2 8   ? -15.161 50.334 25.810  1.00 34.85  ? 8    DA  T N3    1 
ATOM   7439 C  C4    . DA  B 2 8   ? -15.392 51.359 24.974  1.00 38.72  ? 8    DA  T C4    1 
ATOM   7440 P  P     . DG  B 2 9   ? -20.538 48.730 21.812  1.00 39.19  ? 9    DG  T P     1 
ATOM   7441 O  OP1   . DG  B 2 9   ? -21.273 47.699 21.045  1.00 41.20  ? 9    DG  T OP1   1 
ATOM   7442 O  OP2   . DG  B 2 9   ? -20.956 50.146 21.740  1.00 42.80  ? 9    DG  T OP2   1 
ATOM   7443 O  "O5'" . DG  B 2 9   ? -20.522 48.315 23.348  1.00 31.99  ? 9    DG  T "O5'" 1 
ATOM   7444 C  "C5'" . DG  B 2 9   ? -19.920 47.096 23.750  1.00 32.55  ? 9    DG  T "C5'" 1 
ATOM   7445 C  "C4'" . DG  B 2 9   ? -20.004 47.002 25.257  1.00 33.49  ? 9    DG  T "C4'" 1 
ATOM   7446 O  "O4'" . DG  B 2 9   ? -19.097 47.969 25.847  1.00 35.93  ? 9    DG  T "O4'" 1 
ATOM   7447 C  "C3'" . DG  B 2 9   ? -21.394 47.310 25.795  1.00 34.21  ? 9    DG  T "C3'" 1 
ATOM   7448 O  "O3'" . DG  B 2 9   ? -21.760 46.309 26.722  1.00 37.81  ? 9    DG  T "O3'" 1 
ATOM   7449 C  "C2'" . DG  B 2 9   ? -21.249 48.672 26.465  1.00 35.12  ? 9    DG  T "C2'" 1 
ATOM   7450 C  "C1'" . DG  B 2 9   ? -19.771 48.727 26.828  1.00 35.91  ? 9    DG  T "C1'" 1 
ATOM   7451 N  N9    . DG  B 2 9   ? -19.249 50.091 26.807  1.00 37.10  ? 9    DG  T N9    1 
ATOM   7452 C  C8    . DG  B 2 9   ? -19.256 50.961 25.744  1.00 36.97  ? 9    DG  T C8    1 
ATOM   7453 N  N7    . DG  B 2 9   ? -18.724 52.121 26.015  1.00 37.36  ? 9    DG  T N7    1 
ATOM   7454 C  C5    . DG  B 2 9   ? -18.343 52.016 27.347  1.00 35.40  ? 9    DG  T C5    1 
ATOM   7455 C  C6    . DG  B 2 9   ? -17.713 52.960 28.191  1.00 32.73  ? 9    DG  T C6    1 
ATOM   7456 O  O6    . DG  B 2 9   ? -17.360 54.116 27.917  1.00 32.57  ? 9    DG  T O6    1 
ATOM   7457 N  N1    . DG  B 2 9   ? -17.502 52.449 29.470  1.00 31.79  ? 9    DG  T N1    1 
ATOM   7458 C  C2    . DG  B 2 9   ? -17.855 51.185 29.880  1.00 33.61  ? 9    DG  T C2    1 
ATOM   7459 N  N2    . DG  B 2 9   ? -17.572 50.866 31.154  1.00 32.35  ? 9    DG  T N2    1 
ATOM   7460 N  N3    . DG  B 2 9   ? -18.446 50.291 29.096  1.00 36.31  ? 9    DG  T N3    1 
ATOM   7461 C  C4    . DG  B 2 9   ? -18.658 50.773 27.848  1.00 36.43  ? 9    DG  T C4    1 
ATOM   7462 P  P     . DC  B 2 10  ? -23.249 46.266 27.320  1.00 52.87  ? 10   DC  T P     1 
ATOM   7463 O  OP1   . DC  B 2 10  ? -23.662 44.841 27.347  1.00 54.98  ? 10   DC  T OP1   1 
ATOM   7464 O  OP2   . DC  B 2 10  ? -24.071 47.263 26.595  1.00 51.39  ? 10   DC  T OP2   1 
ATOM   7465 O  "O5'" . DC  B 2 10  ? -23.074 46.786 28.821  1.00 37.52  ? 10   DC  T "O5'" 1 
ATOM   7466 C  "C5'" . DC  B 2 10  ? -21.830 46.632 29.491  1.00 36.09  ? 10   DC  T "C5'" 1 
ATOM   7467 C  "C4'" . DC  B 2 10  ? -21.956 47.007 30.957  1.00 40.56  ? 10   DC  T "C4'" 1 
ATOM   7468 O  "O4'" . DC  B 2 10  ? -21.223 48.235 31.205  1.00 40.89  ? 10   DC  T "O4'" 1 
ATOM   7469 C  "C3'" . DC  B 2 10  ? -23.375 47.248 31.469  1.00 44.75  ? 10   DC  T "C3'" 1 
ATOM   7470 O  "O3'" . DC  B 2 10  ? -23.457 46.811 32.826  1.00 49.48  ? 10   DC  T "O3'" 1 
ATOM   7471 C  "C2'" . DC  B 2 10  ? -23.535 48.758 31.332  1.00 44.84  ? 10   DC  T "C2'" 1 
ATOM   7472 C  "C1'" . DC  B 2 10  ? -22.116 49.271 31.558  1.00 42.20  ? 10   DC  T "C1'" 1 
ATOM   7473 N  N1    . DC  B 2 10  ? -21.798 50.462 30.728  1.00 42.10  ? 10   DC  T N1    1 
ATOM   7474 C  C2    . DC  B 2 10  ? -21.216 51.576 31.335  1.00 44.34  ? 10   DC  T C2    1 
ATOM   7475 O  O2    . DC  B 2 10  ? -20.980 51.536 32.549  1.00 47.80  ? 10   DC  T O2    1 
ATOM   7476 N  N3    . DC  B 2 10  ? -20.929 52.662 30.576  1.00 42.91  ? 10   DC  T N3    1 
ATOM   7477 C  C4    . DC  B 2 10  ? -21.203 52.657 29.271  1.00 41.73  ? 10   DC  T C4    1 
ATOM   7478 N  N4    . DC  B 2 10  ? -20.900 53.754 28.568  1.00 41.32  ? 10   DC  T N4    1 
ATOM   7479 C  C5    . DC  B 2 10  ? -21.799 51.526 28.635  1.00 41.07  ? 10   DC  T C5    1 
ATOM   7480 C  C6    . DC  B 2 10  ? -22.077 50.461 29.394  1.00 40.90  ? 10   DC  T C6    1 
ATOM   7481 P  P     . DA  B 2 11  ? -24.803 47.015 33.682  1.00 63.14  ? 11   DA  T P     1 
ATOM   7482 O  OP1   . DA  B 2 11  ? -24.731 46.037 34.789  1.00 62.78  ? 11   DA  T OP1   1 
ATOM   7483 O  OP2   . DA  B 2 11  ? -25.974 47.048 32.776  1.00 61.75  ? 11   DA  T OP2   1 
ATOM   7484 O  "O5'" . DA  B 2 11  ? -24.628 48.462 34.323  1.00 46.80  ? 11   DA  T "O5'" 1 
ATOM   7485 C  "C5'" . DA  B 2 11  ? -23.526 48.651 35.195  1.00 45.49  ? 11   DA  T "C5'" 1 
ATOM   7486 C  "C4'" . DA  B 2 11  ? -23.702 49.922 35.990  1.00 43.62  ? 11   DA  T "C4'" 1 
ATOM   7487 O  "O4'" . DA  B 2 11  ? -23.285 51.036 35.169  1.00 42.25  ? 11   DA  T "O4'" 1 
ATOM   7488 C  "C3'" . DA  B 2 11  ? -25.132 50.201 36.429  1.00 44.68  ? 11   DA  T "C3'" 1 
ATOM   7489 O  "O3'" . DA  B 2 11  ? -25.079 50.601 37.792  1.00 43.83  ? 11   DA  T "O3'" 1 
ATOM   7490 C  "C2'" . DA  B 2 11  ? -25.607 51.293 35.469  1.00 44.97  ? 11   DA  T "C2'" 1 
ATOM   7491 C  "C1'" . DA  B 2 11  ? -24.320 51.985 35.055  1.00 43.57  ? 11   DA  T "C1'" 1 
ATOM   7492 N  N9    . DA  B 2 11  ? -24.337 52.417 33.667  1.00 43.46  ? 11   DA  T N9    1 
ATOM   7493 C  C8    . DA  B 2 11  ? -24.853 51.738 32.597  1.00 44.31  ? 11   DA  T C8    1 
ATOM   7494 N  N7    . DA  B 2 11  ? -24.716 52.378 31.459  1.00 43.38  ? 11   DA  T N7    1 
ATOM   7495 C  C5    . DA  B 2 11  ? -24.067 53.552 31.815  1.00 41.79  ? 11   DA  T C5    1 
ATOM   7496 C  C6    . DA  B 2 11  ? -23.633 54.662 31.066  1.00 41.03  ? 11   DA  T C6    1 
ATOM   7497 N  N6    . DA  B 2 11  ? -23.799 54.761 29.743  1.00 41.51  ? 11   DA  T N6    1 
ATOM   7498 N  N1    . DA  B 2 11  ? -23.020 55.665 31.731  1.00 40.28  ? 11   DA  T N1    1 
ATOM   7499 C  C2    . DA  B 2 11  ? -22.855 55.562 33.055  1.00 38.97  ? 11   DA  T C2    1 
ATOM   7500 N  N3    . DA  B 2 11  ? -23.221 54.571 33.865  1.00 39.33  ? 11   DA  T N3    1 
ATOM   7501 C  C4    . DA  B 2 11  ? -23.825 53.591 33.174  1.00 41.30  ? 11   DA  T C4    1 
ATOM   7502 P  P     . DG  B 2 12  ? -26.310 51.368 38.479  1.00 41.74  ? 12   DG  T P     1 
ATOM   7503 O  OP1   . DG  B 2 12  ? -26.216 51.082 39.927  1.00 45.77  ? 12   DG  T OP1   1 
ATOM   7504 O  OP2   . DG  B 2 12  ? -27.566 51.058 37.761  1.00 42.10  ? 12   DG  T OP2   1 
ATOM   7505 O  "O5'" . DG  B 2 12  ? -25.955 52.908 38.257  1.00 44.23  ? 12   DG  T "O5'" 1 
ATOM   7506 C  "C5'" . DG  B 2 12  ? -24.804 53.438 38.903  1.00 42.62  ? 12   DG  T "C5'" 1 
ATOM   7507 C  "C4'" . DG  B 2 12  ? -24.895 54.943 39.080  1.00 43.24  ? 12   DG  T "C4'" 1 
ATOM   7508 O  "O4'" . DG  B 2 12  ? -24.744 55.594 37.794  1.00 41.49  ? 12   DG  T "O4'" 1 
ATOM   7509 C  "C3'" . DG  B 2 12  ? -26.203 55.473 39.660  1.00 44.90  ? 12   DG  T "C3'" 1 
ATOM   7510 O  "O3'" . DG  B 2 12  ? -25.915 56.639 40.429  1.00 46.83  ? 12   DG  T "O3'" 1 
ATOM   7511 C  "C2'" . DG  B 2 12  ? -27.020 55.798 38.412  1.00 43.86  ? 12   DG  T "C2'" 1 
ATOM   7512 C  "C1'" . DG  B 2 12  ? -25.942 56.259 37.441  1.00 42.48  ? 12   DG  T "C1'" 1 
ATOM   7513 N  N9    . DG  B 2 12  ? -26.200 55.920 36.050  1.00 43.83  ? 12   DG  T N9    1 
ATOM   7514 C  C8    . DG  B 2 12  ? -26.677 54.734 35.543  1.00 44.91  ? 12   DG  T C8    1 
ATOM   7515 N  N7    . DG  B 2 12  ? -26.785 54.743 34.243  1.00 45.38  ? 12   DG  T N7    1 
ATOM   7516 C  C5    . DG  B 2 12  ? -26.347 56.009 33.867  1.00 44.54  ? 12   DG  T C5    1 
ATOM   7517 C  C6    . DG  B 2 12  ? -26.235 56.602 32.584  1.00 41.99  ? 12   DG  T C6    1 
ATOM   7518 O  O6    . DG  B 2 12  ? -26.512 56.104 31.482  1.00 41.29  ? 12   DG  T O6    1 
ATOM   7519 N  N1    . DG  B 2 12  ? -25.746 57.907 32.660  1.00 40.76  ? 12   DG  T N1    1 
ATOM   7520 C  C2    . DG  B 2 12  ? -25.407 58.557 33.826  1.00 42.54  ? 12   DG  T C2    1 
ATOM   7521 N  N2    . DG  B 2 12  ? -24.952 59.814 33.707  1.00 40.77  ? 12   DG  T N2    1 
ATOM   7522 N  N3    . DG  B 2 12  ? -25.508 58.009 35.031  1.00 45.92  ? 12   DG  T N3    1 
ATOM   7523 C  C4    . DG  B 2 12  ? -25.982 56.741 34.972  1.00 44.93  ? 12   DG  T C4    1 
ATOM   7524 P  P     . DT  B 2 13  ? -27.087 57.434 41.190  1.00 55.52  ? 13   DT  T P     1 
ATOM   7525 O  OP1   . DT  B 2 13  ? -26.496 57.977 42.434  1.00 56.59  ? 13   DT  T OP1   1 
ATOM   7526 O  OP2   . DT  B 2 13  ? -28.281 56.565 41.250  1.00 55.39  ? 13   DT  T OP2   1 
ATOM   7527 O  "O5'" . DT  B 2 13  ? -27.423 58.653 40.215  1.00 48.46  ? 13   DT  T "O5'" 1 
ATOM   7528 C  "C5'" . DT  B 2 13  ? -26.370 59.508 39.815  1.00 54.19  ? 13   DT  T "C5'" 1 
ATOM   7529 C  "C4'" . DT  B 2 13  ? -26.893 60.671 38.995  1.00 54.37  ? 13   DT  T "C4'" 1 
ATOM   7530 O  "O4'" . DT  B 2 13  ? -27.009 60.275 37.606  1.00 54.20  ? 13   DT  T "O4'" 1 
ATOM   7531 C  "C3'" . DT  B 2 13  ? -28.265 61.197 39.393  1.00 54.10  ? 13   DT  T "C3'" 1 
ATOM   7532 O  "O3'" . DT  B 2 13  ? -28.219 62.609 39.262  1.00 58.77  ? 13   DT  T "O3'" 1 
ATOM   7533 C  "C2'" . DT  B 2 13  ? -29.192 60.559 38.359  1.00 52.12  ? 13   DT  T "C2'" 1 
ATOM   7534 C  "C1'" . DT  B 2 13  ? -28.299 60.599 37.129  1.00 52.82  ? 13   DT  T "C1'" 1 
ATOM   7535 N  N1    . DT  B 2 13  ? -28.639 59.613 36.070  1.00 53.24  ? 13   DT  T N1    1 
ATOM   7536 C  C2    . DT  B 2 13  ? -28.464 59.971 34.752  1.00 53.21  ? 13   DT  T C2    1 
ATOM   7537 O  O2    . DT  B 2 13  ? -28.052 61.064 34.404  1.00 52.53  ? 13   DT  T O2    1 
ATOM   7538 N  N3    . DT  B 2 13  ? -28.795 58.993 33.849  1.00 54.25  ? 13   DT  T N3    1 
ATOM   7539 C  C4    . DT  B 2 13  ? -29.268 57.723 34.128  1.00 53.99  ? 13   DT  T C4    1 
ATOM   7540 O  O4    . DT  B 2 13  ? -29.538 56.914 33.246  1.00 54.62  ? 13   DT  T O4    1 
ATOM   7541 C  C5    . DT  B 2 13  ? -29.423 57.415 35.526  1.00 53.81  ? 13   DT  T C5    1 
ATOM   7542 C  C7    . DT  B 2 13  ? -29.930 56.067 35.944  1.00 52.49  ? 13   DT  T C7    1 
ATOM   7543 C  C6    . DT  B 2 13  ? -29.104 58.362 36.420  1.00 54.20  ? 13   DT  T C6    1 
ATOM   7544 P  P     . DC  B 2 14  ? -29.319 63.538 39.974  1.00 72.96  ? 14   DC  T P     1 
ATOM   7545 O  OP1   . DC  B 2 14  ? -28.672 64.156 41.152  1.00 73.08  ? 14   DC  T OP1   1 
ATOM   7546 O  OP2   . DC  B 2 14  ? -30.563 62.754 40.145  1.00 71.76  ? 14   DC  T OP2   1 
ATOM   7547 O  "O5'" . DC  B 2 14  ? -29.602 64.679 38.891  1.00 70.23  ? 14   DC  T "O5'" 1 
ATOM   7548 C  "C5'" . DC  B 2 14  ? -28.683 64.886 37.825  1.00 70.91  ? 14   DC  T "C5'" 1 
ATOM   7549 C  "C4'" . DC  B 2 14  ? -29.405 65.315 36.561  1.00 71.41  ? 14   DC  T "C4'" 1 
ATOM   7550 O  "O4'" . DC  B 2 14  ? -29.580 64.161 35.699  1.00 68.70  ? 14   DC  T "O4'" 1 
ATOM   7551 C  "C3'" . DC  B 2 14  ? -30.806 65.885 36.760  1.00 74.16  ? 14   DC  T "C3'" 1 
ATOM   7552 O  "O3'" . DC  B 2 14  ? -31.027 66.913 35.800  1.00 79.43  ? 14   DC  T "O3'" 1 
ATOM   7553 C  "C2'" . DC  B 2 14  ? -31.689 64.670 36.491  1.00 69.49  ? 14   DC  T "C2'" 1 
ATOM   7554 C  "C1'" . DC  B 2 14  ? -30.936 64.087 35.310  1.00 65.60  ? 14   DC  T "C1'" 1 
ATOM   7555 N  N1    . DC  B 2 14  ? -31.287 62.679 35.012  1.00 59.24  ? 14   DC  T N1    1 
ATOM   7556 C  C2    . DC  B 2 14  ? -31.279 62.247 33.682  1.00 57.01  ? 14   DC  T C2    1 
ATOM   7557 O  O2    . DC  B 2 14  ? -30.980 63.048 32.788  1.00 58.22  ? 14   DC  T O2    1 
ATOM   7558 N  N3    . DC  B 2 14  ? -31.601 60.958 33.410  1.00 56.46  ? 14   DC  T N3    1 
ATOM   7559 C  C4    . DC  B 2 14  ? -31.918 60.125 34.404  1.00 57.37  ? 14   DC  T C4    1 
ATOM   7560 N  N4    . DC  B 2 14  ? -32.227 58.863 34.087  1.00 56.57  ? 14   DC  T N4    1 
ATOM   7561 C  C5    . DC  B 2 14  ? -31.932 60.551 35.767  1.00 58.12  ? 14   DC  T C5    1 
ATOM   7562 C  C6    . DC  B 2 14  ? -31.613 61.825 36.026  1.00 58.32  ? 14   DC  T C6    1 
ATOM   7563 P  P     . DC  B 2 15  ? -32.242 67.954 35.973  1.00 89.38  ? 15   DC  T P     1 
ATOM   7564 O  OP1   . DC  B 2 15  ? -31.743 69.070 36.807  1.00 90.29  ? 15   DC  T OP1   1 
ATOM   7565 O  OP2   . DC  B 2 15  ? -33.461 67.217 36.384  1.00 85.41  ? 15   DC  T OP2   1 
ATOM   7566 O  "O5'" . DC  B 2 15  ? -32.488 68.485 34.483  1.00 74.17  ? 15   DC  T "O5'" 1 
ATOM   7567 C  "C5'" . DC  B 2 15  ? -31.923 67.774 33.383  1.00 73.17  ? 15   DC  T "C5'" 1 
ATOM   7568 C  "C4'" . DC  B 2 15  ? -32.972 67.456 32.331  1.00 72.26  ? 15   DC  T "C4'" 1 
ATOM   7569 O  "O4'" . DC  B 2 15  ? -33.206 66.023 32.286  1.00 70.47  ? 15   DC  T "O4'" 1 
ATOM   7570 C  "C3'" . DC  B 2 15  ? -34.339 68.086 32.574  1.00 74.20  ? 15   DC  T "C3'" 1 
ATOM   7571 O  "O3'" . DC  B 2 15  ? -34.955 68.385 31.332  1.00 75.75  ? 15   DC  T "O3'" 1 
ATOM   7572 C  "C2'" . DC  B 2 15  ? -35.083 66.964 33.285  1.00 71.92  ? 15   DC  T "C2'" 1 
ATOM   7573 C  "C1'" . DC  B 2 15  ? -34.586 65.780 32.471  1.00 70.13  ? 15   DC  T "C1'" 1 
ATOM   7574 N  N1    . DC  B 2 15  ? -34.788 64.480 33.164  1.00 67.07  ? 15   DC  T N1    1 
ATOM   7575 C  C2    . DC  B 2 15  ? -34.930 63.310 32.409  1.00 64.79  ? 15   DC  T C2    1 
ATOM   7576 O  O2    . DC  B 2 15  ? -34.877 63.376 31.172  1.00 63.13  ? 15   DC  T O2    1 
ATOM   7577 N  N3    . DC  B 2 15  ? -35.118 62.135 33.064  1.00 63.33  ? 15   DC  T N3    1 
ATOM   7578 C  C4    . DC  B 2 15  ? -35.168 62.107 34.399  1.00 60.69  ? 15   DC  T C4    1 
ATOM   7579 N  N4    . DC  B 2 15  ? -35.354 60.924 34.997  1.00 58.71  ? 15   DC  T N4    1 
ATOM   7580 C  C5    . DC  B 2 15  ? -35.028 63.292 35.181  1.00 60.61  ? 15   DC  T C5    1 
ATOM   7581 C  C6    . DC  B 2 15  ? -34.843 64.444 34.529  1.00 63.98  ? 15   DC  T C6    1 
ATOM   7582 P  P     . DG  B 2 16  ? -36.157 69.447 31.258  1.00 64.83  ? 16   DG  T P     1 
ATOM   7583 O  OP1   . DG  B 2 16  ? -35.554 70.796 31.316  1.00 65.64  ? 16   DG  T OP1   1 
ATOM   7584 O  OP2   . DG  B 2 16  ? -37.186 69.055 32.247  1.00 64.34  ? 16   DG  T OP2   1 
ATOM   7585 O  "O5'" . DG  B 2 16  ? -36.777 69.208 29.803  1.00 70.13  ? 16   DG  T "O5'" 1 
ATOM   7586 C  "C5'" . DG  B 2 16  ? -36.065 68.402 28.869  1.00 68.15  ? 16   DG  T "C5'" 1 
ATOM   7587 C  "C4'" . DG  B 2 16  ? -36.968 67.381 28.199  1.00 65.43  ? 16   DG  T "C4'" 1 
ATOM   7588 O  "O4'" . DG  B 2 16  ? -36.956 66.147 28.962  1.00 62.59  ? 16   DG  T "O4'" 1 
ATOM   7589 C  "C3'" . DG  B 2 16  ? -38.434 67.789 28.059  1.00 64.47  ? 16   DG  T "C3'" 1 
ATOM   7590 O  "O3'" . DG  B 2 16  ? -38.930 67.337 26.804  1.00 63.48  ? 16   DG  T "O3'" 1 
ATOM   7591 C  "C2'" . DG  B 2 16  ? -39.107 67.062 29.217  1.00 62.59  ? 16   DG  T "C2'" 1 
ATOM   7592 C  "C1'" . DG  B 2 16  ? -38.280 65.784 29.289  1.00 60.87  ? 16   DG  T "C1'" 1 
ATOM   7593 N  N9    . DG  B 2 16  ? -38.276 65.182 30.616  1.00 57.14  ? 16   DG  T N9    1 
ATOM   7594 C  C8    . DG  B 2 16  ? -38.187 65.830 31.826  1.00 56.00  ? 16   DG  T C8    1 
ATOM   7595 N  N7    . DG  B 2 16  ? -38.211 65.017 32.845  1.00 53.73  ? 16   DG  T N7    1 
ATOM   7596 C  C5    . DG  B 2 16  ? -38.323 63.754 32.274  1.00 52.90  ? 16   DG  T C5    1 
ATOM   7597 C  C6    . DG  B 2 16  ? -38.395 62.477 32.882  1.00 52.28  ? 16   DG  T C6    1 
ATOM   7598 O  O6    . DG  B 2 16  ? -38.373 62.195 34.090  1.00 51.33  ? 16   DG  T O6    1 
ATOM   7599 N  N1    . DG  B 2 16  ? -38.502 61.463 31.931  1.00 52.01  ? 16   DG  T N1    1 
ATOM   7600 C  C2    . DG  B 2 16  ? -38.536 61.658 30.570  1.00 53.02  ? 16   DG  T C2    1 
ATOM   7601 N  N2    . DG  B 2 16  ? -38.643 60.557 29.812  1.00 54.65  ? 16   DG  T N2    1 
ATOM   7602 N  N3    . DG  B 2 16  ? -38.469 62.849 29.990  1.00 51.24  ? 16   DG  T N3    1 
ATOM   7603 C  C4    . DG  B 2 16  ? -38.365 63.843 30.902  1.00 52.55  ? 16   DG  T C4    1 
ATOM   7604 P  P     . DC  B 2 17  ? -40.401 67.756 26.314  1.00 73.22  ? 17   DC  T P     1 
ATOM   7605 O  OP1   . DC  B 2 17  ? -40.369 67.869 24.841  1.00 75.49  ? 17   DC  T OP1   1 
ATOM   7606 O  OP2   . DC  B 2 17  ? -40.842 68.905 27.134  1.00 74.22  ? 17   DC  T OP2   1 
ATOM   7607 O  "O5'" . DC  B 2 17  ? -41.300 66.495 26.696  1.00 56.87  ? 17   DC  T "O5'" 1 
ATOM   7608 C  "C5'" . DC  B 2 17  ? -40.953 65.227 26.174  1.00 55.30  ? 17   DC  T "C5'" 1 
ATOM   7609 C  "C4'" . DC  B 2 17  ? -41.807 64.159 26.819  1.00 55.00  ? 17   DC  T "C4'" 1 
ATOM   7610 O  "O4'" . DC  B 2 17  ? -41.358 63.925 28.177  1.00 55.42  ? 17   DC  T "O4'" 1 
ATOM   7611 C  "C3'" . DC  B 2 17  ? -43.284 64.519 26.935  1.00 56.55  ? 17   DC  T "C3'" 1 
ATOM   7612 O  "O3'" . DC  B 2 17  ? -44.041 63.370 26.618  1.00 58.78  ? 17   DC  T "O3'" 1 
ATOM   7613 C  "C2'" . DC  B 2 17  ? -43.440 64.867 28.410  1.00 56.20  ? 17   DC  T "C2'" 1 
ATOM   7614 C  "C1'" . DC  B 2 17  ? -42.516 63.802 28.972  1.00 55.86  ? 17   DC  T "C1'" 1 
ATOM   7615 N  N1    . DC  B 2 17  ? -42.161 63.971 30.397  1.00 56.44  ? 17   DC  T N1    1 
ATOM   7616 C  C2    . DC  B 2 17  ? -41.889 62.830 31.155  1.00 56.41  ? 17   DC  T C2    1 
ATOM   7617 O  O2    . DC  B 2 17  ? -41.949 61.722 30.608  1.00 54.10  ? 17   DC  T O2    1 
ATOM   7618 N  N3    . DC  B 2 17  ? -41.565 62.974 32.463  1.00 59.38  ? 17   DC  T N3    1 
ATOM   7619 C  C4    . DC  B 2 17  ? -41.512 64.192 33.006  1.00 61.41  ? 17   DC  T C4    1 
ATOM   7620 N  N4    . DC  B 2 17  ? -41.187 64.283 34.301  1.00 61.23  ? 17   DC  T N4    1 
ATOM   7621 C  C5    . DC  B 2 17  ? -41.789 65.368 32.243  1.00 61.67  ? 17   DC  T C5    1 
ATOM   7622 C  C6    . DC  B 2 17  ? -42.108 65.214 30.953  1.00 58.97  ? 17   DC  T C6    1 
ATOM   7623 P  P     . DG  B 2 18  ? -45.496 63.520 25.959  1.00 49.58  ? 18   DG  T P     1 
ATOM   7624 O  OP1   . DG  B 2 18  ? -46.191 62.220 26.098  1.00 48.55  ? 18   DG  T OP1   1 
ATOM   7625 O  OP2   . DG  B 2 18  ? -45.301 64.119 24.620  1.00 50.71  ? 18   DG  T OP2   1 
ATOM   7626 O  "O5'" . DG  B 2 18  ? -46.236 64.585 26.893  1.00 50.10  ? 18   DG  T "O5'" 1 
ATOM   7627 C  "C5'" . DG  B 2 18  ? -47.651 64.535 27.033  1.00 49.17  ? 18   DG  T "C5'" 1 
ATOM   7628 C  "C4'" . DG  B 2 18  ? -48.057 64.416 28.491  1.00 45.86  ? 18   DG  T "C4'" 1 
ATOM   7629 O  "O4'" . DG  B 2 18  ? -49.339 65.062 28.696  1.00 44.79  ? 18   DG  T "O4'" 1 
ATOM   7630 C  "C3'" . DG  B 2 18  ? -48.248 62.995 28.997  1.00 44.56  ? 18   DG  T "C3'" 1 
ATOM   7631 O  "O3'" . DG  B 2 18  ? -47.939 62.957 30.382  1.00 47.14  ? 18   DG  T "O3'" 1 
ATOM   7632 C  "C2'" . DG  B 2 18  ? -49.736 62.754 28.750  1.00 40.05  ? 18   DG  T "C2'" 1 
ATOM   7633 C  "C1'" . DG  B 2 18  ? -50.290 64.113 29.149  1.00 40.54  ? 18   DG  T "C1'" 1 
ATOM   7634 N  N9    . DG  B 2 18  ? -51.590 64.451 28.573  1.00 40.15  ? 18   DG  T N9    1 
ATOM   7635 C  C8    . DG  B 2 18  ? -52.744 64.719 29.269  1.00 39.73  ? 18   DG  T C8    1 
ATOM   7636 N  N7    . DG  B 2 18  ? -53.761 65.000 28.504  1.00 42.95  ? 18   DG  T N7    1 
ATOM   7637 C  C5    . DG  B 2 18  ? -53.252 64.918 27.215  1.00 42.65  ? 18   DG  T C5    1 
ATOM   7638 C  C6    . DG  B 2 18  ? -53.892 65.122 25.969  1.00 39.71  ? 18   DG  T C6    1 
ATOM   7639 O  O6    . DG  B 2 18  ? -55.073 65.427 25.751  1.00 39.33  ? 18   DG  T O6    1 
ATOM   7640 N  N1    . DG  B 2 18  ? -53.018 64.941 24.902  1.00 40.23  ? 18   DG  T N1    1 
ATOM   7641 C  C2    . DG  B 2 18  ? -51.692 64.604 25.024  1.00 44.18  ? 18   DG  T C2    1 
ATOM   7642 N  N2    . DG  B 2 18  ? -51.010 64.473 23.878  1.00 44.75  ? 18   DG  T N2    1 
ATOM   7643 N  N3    . DG  B 2 18  ? -51.078 64.409 26.186  1.00 43.95  ? 18   DG  T N3    1 
ATOM   7644 C  C4    . DG  B 2 18  ? -51.916 64.581 27.238  1.00 42.76  ? 18   DG  T C4    1 
ATOM   7645 O  "O5'" . DG  C 3 1   ? -43.045 55.022 38.535  1.00 100.79 ? 102  DG  P "O5'" 1 
ATOM   7646 C  "C5'" . DG  C 3 1   ? -44.016 54.362 37.717  1.00 100.23 ? 102  DG  P "C5'" 1 
ATOM   7647 C  "C4'" . DG  C 3 1   ? -43.493 54.042 36.324  1.00 97.20  ? 102  DG  P "C4'" 1 
ATOM   7648 O  "O4'" . DG  C 3 1   ? -43.430 55.256 35.535  1.00 94.37  ? 102  DG  P "O4'" 1 
ATOM   7649 C  "C3'" . DG  C 3 1   ? -42.098 53.427 36.244  1.00 94.16  ? 102  DG  P "C3'" 1 
ATOM   7650 O  "O3'" . DG  C 3 1   ? -42.059 52.511 35.145  1.00 95.71  ? 102  DG  P "O3'" 1 
ATOM   7651 C  "C2'" . DG  C 3 1   ? -41.186 54.636 36.037  1.00 89.24  ? 102  DG  P "C2'" 1 
ATOM   7652 C  "C1'" . DG  C 3 1   ? -42.084 55.637 35.317  1.00 88.45  ? 102  DG  P "C1'" 1 
ATOM   7653 N  N9    . DG  C 3 1   ? -41.929 57.013 35.786  1.00 83.04  ? 102  DG  P N9    1 
ATOM   7654 C  C8    . DG  C 3 1   ? -41.870 57.456 37.087  1.00 81.04  ? 102  DG  P C8    1 
ATOM   7655 N  N7    . DG  C 3 1   ? -41.734 58.750 37.190  1.00 78.68  ? 102  DG  P N7    1 
ATOM   7656 C  C5    . DG  C 3 1   ? -41.701 59.196 35.874  1.00 78.33  ? 102  DG  P C5    1 
ATOM   7657 C  C6    . DG  C 3 1   ? -41.568 60.507 35.354  1.00 76.21  ? 102  DG  P C6    1 
ATOM   7658 O  O6    . DG  C 3 1   ? -41.449 61.575 35.975  1.00 75.73  ? 102  DG  P O6    1 
ATOM   7659 N  N1    . DG  C 3 1   ? -41.582 60.510 33.958  1.00 74.19  ? 102  DG  P N1    1 
ATOM   7660 C  C2    . DG  C 3 1   ? -41.708 59.390 33.166  1.00 74.08  ? 102  DG  P C2    1 
ATOM   7661 N  N2    . DG  C 3 1   ? -41.701 59.590 31.838  1.00 71.23  ? 102  DG  P N2    1 
ATOM   7662 N  N3    . DG  C 3 1   ? -41.833 58.158 33.643  1.00 77.78  ? 102  DG  P N3    1 
ATOM   7663 C  C4    . DG  C 3 1   ? -41.821 58.137 34.999  1.00 79.88  ? 102  DG  P C4    1 
ATOM   7664 P  P     . DC  C 3 2   ? -40.682 51.797 34.717  1.00 90.90  ? 103  DC  P P     1 
ATOM   7665 O  OP1   . DC  C 3 2   ? -41.022 50.548 34.000  1.00 94.43  ? 103  DC  P OP1   1 
ATOM   7666 O  OP2   . DC  C 3 2   ? -39.805 51.739 35.906  1.00 88.92  ? 103  DC  P OP2   1 
ATOM   7667 O  "O5'" . DC  C 3 2   ? -40.030 52.814 33.671  1.00 89.54  ? 103  DC  P "O5'" 1 
ATOM   7668 C  "C5'" . DC  C 3 2   ? -40.624 53.031 32.394  1.00 90.08  ? 103  DC  P "C5'" 1 
ATOM   7669 C  "C4'" . DC  C 3 2   ? -39.721 53.885 31.520  1.00 88.61  ? 103  DC  P "C4'" 1 
ATOM   7670 O  "O4'" . DC  C 3 2   ? -39.794 55.268 31.956  1.00 85.60  ? 103  DC  P "O4'" 1 
ATOM   7671 C  "C3'" . DC  C 3 2   ? -38.240 53.505 31.568  1.00 89.68  ? 103  DC  P "C3'" 1 
ATOM   7672 O  "O3'" . DC  C 3 2   ? -37.632 53.684 30.296  1.00 92.33  ? 103  DC  P "O3'" 1 
ATOM   7673 C  "C2'" . DC  C 3 2   ? -37.672 54.513 32.557  1.00 85.09  ? 103  DC  P "C2'" 1 
ATOM   7674 C  "C1'" . DC  C 3 2   ? -38.476 55.739 32.148  1.00 83.40  ? 103  DC  P "C1'" 1 
ATOM   7675 N  N1    . DC  C 3 2   ? -38.450 56.823 33.165  1.00 80.44  ? 103  DC  P N1    1 
ATOM   7676 C  C2    . DC  C 3 2   ? -38.459 58.156 32.745  1.00 76.77  ? 103  DC  P C2    1 
ATOM   7677 O  O2    . DC  C 3 2   ? -38.498 58.402 31.533  1.00 74.82  ? 103  DC  P O2    1 
ATOM   7678 N  N3    . DC  C 3 2   ? -38.428 59.137 33.680  1.00 76.09  ? 103  DC  P N3    1 
ATOM   7679 C  C4    . DC  C 3 2   ? -38.387 58.823 34.977  1.00 77.34  ? 103  DC  P C4    1 
ATOM   7680 N  N4    . DC  C 3 2   ? -38.359 59.825 35.862  1.00 77.50  ? 103  DC  P N4    1 
ATOM   7681 C  C5    . DC  C 3 2   ? -38.373 57.469 35.423  1.00 79.10  ? 103  DC  P C5    1 
ATOM   7682 C  C6    . DC  C 3 2   ? -38.403 56.511 34.492  1.00 80.57  ? 103  DC  P C6    1 
ATOM   7683 P  P     . DG  C 3 3   ? -37.508 52.457 29.264  1.00 93.18  ? 104  DG  P P     1 
ATOM   7684 O  OP1   . DG  C 3 3   ? -38.775 51.688 29.324  1.00 95.67  ? 104  DG  P OP1   1 
ATOM   7685 O  OP2   . DG  C 3 3   ? -36.215 51.780 29.515  1.00 89.35  ? 104  DG  P OP2   1 
ATOM   7686 O  "O5'" . DG  C 3 3   ? -37.427 53.177 27.840  1.00 81.25  ? 104  DG  P "O5'" 1 
ATOM   7687 C  "C5'" . DG  C 3 3   ? -38.224 54.340 27.627  1.00 79.99  ? 104  DG  P "C5'" 1 
ATOM   7688 C  "C4'" . DG  C 3 3   ? -37.599 55.275 26.608  1.00 77.67  ? 104  DG  P "C4'" 1 
ATOM   7689 O  "O4'" . DG  C 3 3   ? -37.259 56.541 27.224  1.00 75.82  ? 104  DG  P "O4'" 1 
ATOM   7690 C  "C3'" . DG  C 3 3   ? -36.299 54.805 25.976  1.00 75.34  ? 104  DG  P "C3'" 1 
ATOM   7691 O  "O3'" . DG  C 3 3   ? -36.242 55.406 24.689  1.00 73.91  ? 104  DG  P "O3'" 1 
ATOM   7692 C  "C2'" . DG  C 3 3   ? -35.244 55.334 26.949  1.00 73.15  ? 104  DG  P "C2'" 1 
ATOM   7693 C  "C1'" . DG  C 3 3   ? -35.863 56.640 27.436  1.00 71.90  ? 104  DG  P "C1'" 1 
ATOM   7694 N  N9    . DG  C 3 3   ? -35.697 56.889 28.861  1.00 67.87  ? 104  DG  P N9    1 
ATOM   7695 C  C8    . DG  C 3 3   ? -35.654 55.949 29.860  1.00 67.16  ? 104  DG  P C8    1 
ATOM   7696 N  N7    . DG  C 3 3   ? -35.512 56.465 31.048  1.00 63.99  ? 104  DG  P N7    1 
ATOM   7697 C  C5    . DG  C 3 3   ? -35.468 57.834 30.823  1.00 64.80  ? 104  DG  P C5    1 
ATOM   7698 C  C6    . DG  C 3 3   ? -35.327 58.899 31.742  1.00 63.44  ? 104  DG  P C6    1 
ATOM   7699 O  O6    . DG  C 3 3   ? -35.213 58.836 32.975  1.00 60.32  ? 104  DG  P O6    1 
ATOM   7700 N  N1    . DG  C 3 3   ? -35.326 60.134 31.098  1.00 59.78  ? 104  DG  P N1    1 
ATOM   7701 C  C2    . DG  C 3 3   ? -35.445 60.316 29.738  1.00 60.43  ? 104  DG  P C2    1 
ATOM   7702 N  N2    . DG  C 3 3   ? -35.421 61.585 29.301  1.00 61.25  ? 104  DG  P N2    1 
ATOM   7703 N  N3    . DG  C 3 3   ? -35.577 59.324 28.866  1.00 63.70  ? 104  DG  P N3    1 
ATOM   7704 C  C4    . DG  C 3 3   ? -35.582 58.114 29.479  1.00 65.25  ? 104  DG  P C4    1 
ATOM   7705 P  P     . DG  C 3 4   ? -34.886 55.394 23.831  1.00 85.78  ? 105  DG  P P     1 
ATOM   7706 O  OP1   . DG  C 3 4   ? -35.282 55.472 22.407  1.00 87.79  ? 105  DG  P OP1   1 
ATOM   7707 O  OP2   . DG  C 3 4   ? -34.034 54.275 24.294  1.00 84.32  ? 105  DG  P OP2   1 
ATOM   7708 O  "O5'" . DG  C 3 4   ? -34.173 56.766 24.234  1.00 83.89  ? 105  DG  P "O5'" 1 
ATOM   7709 C  "C5'" . DG  C 3 4   ? -34.882 57.988 24.103  1.00 81.01  ? 105  DG  P "C5'" 1 
ATOM   7710 C  "C4'" . DG  C 3 4   ? -33.926 59.165 24.125  1.00 78.50  ? 105  DG  P "C4'" 1 
ATOM   7711 O  "O4'" . DG  C 3 4   ? -33.687 59.554 25.499  1.00 76.94  ? 105  DG  P "O4'" 1 
ATOM   7712 C  "C3'" . DG  C 3 4   ? -32.550 58.924 23.510  1.00 78.39  ? 105  DG  P "C3'" 1 
ATOM   7713 O  "O3'" . DG  C 3 4   ? -32.174 60.132 22.855  1.00 78.78  ? 105  DG  P "O3'" 1 
ATOM   7714 C  "C2'" . DG  C 3 4   ? -31.675 58.586 24.715  1.00 76.26  ? 105  DG  P "C2'" 1 
ATOM   7715 C  "C1'" . DG  C 3 4   ? -32.319 59.406 25.819  1.00 75.58  ? 105  DG  P "C1'" 1 
ATOM   7716 N  N9    . DG  C 3 4   ? -32.246 58.755 27.116  1.00 74.54  ? 105  DG  P N9    1 
ATOM   7717 C  C8    . DG  C 3 4   ? -32.277 57.409 27.397  1.00 73.64  ? 105  DG  P C8    1 
ATOM   7718 N  N7    . DG  C 3 4   ? -32.193 57.156 28.674  1.00 71.85  ? 105  DG  P N7    1 
ATOM   7719 C  C5    . DG  C 3 4   ? -32.103 58.410 29.268  1.00 70.88  ? 105  DG  P C5    1 
ATOM   7720 C  C6    . DG  C 3 4   ? -31.991 58.776 30.630  1.00 68.30  ? 105  DG  P C6    1 
ATOM   7721 O  O6    . DG  C 3 4   ? -31.946 58.034 31.621  1.00 65.25  ? 105  DG  P O6    1 
ATOM   7722 N  N1    . DG  C 3 4   ? -31.926 60.163 30.783  1.00 70.41  ? 105  DG  P N1    1 
ATOM   7723 C  C2    . DG  C 3 4   ? -31.965 61.081 29.753  1.00 72.48  ? 105  DG  P C2    1 
ATOM   7724 N  N2    . DG  C 3 4   ? -31.891 62.379 30.088  1.00 71.69  ? 105  DG  P N2    1 
ATOM   7725 N  N3    . DG  C 3 4   ? -32.071 60.747 28.476  1.00 73.74  ? 105  DG  P N3    1 
ATOM   7726 C  C4    . DG  C 3 4   ? -32.135 59.403 28.317  1.00 73.55  ? 105  DG  P C4    1 
ATOM   7727 P  P     . DA  C 3 5   ? -30.643 60.434 22.464  1.00 93.42  ? 106  DA  P P     1 
ATOM   7728 O  OP1   . DA  C 3 5   ? -30.692 61.352 21.307  1.00 93.57  ? 106  DA  P OP1   1 
ATOM   7729 O  OP2   . DA  C 3 5   ? -29.885 59.167 22.359  1.00 94.10  ? 106  DA  P OP2   1 
ATOM   7730 O  "O5'" . DA  C 3 5   ? -30.086 61.259 23.713  1.00 69.66  ? 106  DA  P "O5'" 1 
ATOM   7731 C  "C5'" . DA  C 3 5   ? -30.399 62.642 23.813  1.00 67.33  ? 106  DA  P "C5'" 1 
ATOM   7732 C  "C4'" . DA  C 3 5   ? -29.514 63.330 24.835  1.00 65.09  ? 106  DA  P "C4'" 1 
ATOM   7733 O  "O4'" . DA  C 3 5   ? -29.659 62.678 26.121  1.00 66.40  ? 106  DA  P "O4'" 1 
ATOM   7734 C  "C3'" . DA  C 3 5   ? -28.023 63.300 24.516  1.00 64.22  ? 106  DA  P "C3'" 1 
ATOM   7735 O  "O3'" . DA  C 3 5   ? -27.418 64.499 24.966  1.00 62.19  ? 106  DA  P "O3'" 1 
ATOM   7736 C  "C2'" . DA  C 3 5   ? -27.520 62.116 25.330  1.00 65.52  ? 106  DA  P "C2'" 1 
ATOM   7737 C  "C1'" . DA  C 3 5   ? -28.389 62.245 26.571  1.00 66.01  ? 106  DA  P "C1'" 1 
ATOM   7738 N  N9    . DA  C 3 5   ? -28.554 60.980 27.274  1.00 67.41  ? 106  DA  P N9    1 
ATOM   7739 C  C8    . DA  C 3 5   ? -28.750 59.747 26.717  1.00 68.88  ? 106  DA  P C8    1 
ATOM   7740 N  N7    . DA  C 3 5   ? -28.864 58.785 27.601  1.00 68.94  ? 106  DA  P N7    1 
ATOM   7741 C  C5    . DA  C 3 5   ? -28.733 59.434 28.819  1.00 67.08  ? 106  DA  P C5    1 
ATOM   7742 C  C6    . DA  C 3 5   ? -28.759 58.974 30.151  1.00 65.24  ? 106  DA  P C6    1 
ATOM   7743 N  N6    . DA  C 3 5   ? -28.938 57.690 30.480  1.00 65.35  ? 106  DA  P N6    1 
ATOM   7744 N  N1    . DA  C 3 5   ? -28.596 59.889 31.131  1.00 63.30  ? 106  DA  P N1    1 
ATOM   7745 C  C2    . DA  C 3 5   ? -28.419 61.173 30.799  1.00 62.32  ? 106  DA  P C2    1 
ATOM   7746 N  N3    . DA  C 3 5   ? -28.376 61.722 29.585  1.00 64.46  ? 106  DA  P N3    1 
ATOM   7747 C  C4    . DA  C 3 5   ? -28.540 60.789 28.634  1.00 66.45  ? 106  DA  P C4    1 
ATOM   7748 P  P     . DC  C 3 6   ? -25.913 64.856 24.533  1.00 79.04  ? 107  DC  P P     1 
ATOM   7749 O  OP1   . DC  C 3 6   ? -25.893 66.291 24.179  1.00 82.13  ? 107  DC  P OP1   1 
ATOM   7750 O  OP2   . DC  C 3 6   ? -25.465 63.841 23.553  1.00 77.45  ? 107  DC  P OP2   1 
ATOM   7751 O  "O5'" . DC  C 3 6   ? -25.065 64.650 25.872  1.00 67.86  ? 107  DC  P "O5'" 1 
ATOM   7752 C  "C5'" . DC  C 3 6   ? -25.433 65.359 27.044  1.00 67.22  ? 107  DC  P "C5'" 1 
ATOM   7753 C  "C4'" . DC  C 3 6   ? -24.839 64.689 28.266  1.00 63.02  ? 107  DC  P "C4'" 1 
ATOM   7754 O  "O4'" . DC  C 3 6   ? -25.458 63.394 28.456  1.00 58.62  ? 107  DC  P "O4'" 1 
ATOM   7755 C  "C3'" . DC  C 3 6   ? -23.338 64.425 28.184  1.00 62.95  ? 107  DC  P "C3'" 1 
ATOM   7756 O  "O3'" . DC  C 3 6   ? -22.661 65.165 29.190  1.00 65.56  ? 107  DC  P "O3'" 1 
ATOM   7757 C  "C2'" . DC  C 3 6   ? -23.209 62.925 28.435  1.00 58.37  ? 107  DC  P "C2'" 1 
ATOM   7758 C  "C1'" . DC  C 3 6   ? -24.514 62.607 29.140  1.00 56.04  ? 107  DC  P "C1'" 1 
ATOM   7759 N  N1    . DC  C 3 6   ? -24.884 61.180 29.031  1.00 54.90  ? 107  DC  P N1    1 
ATOM   7760 C  C2    . DC  C 3 6   ? -25.097 60.448 30.203  1.00 52.79  ? 107  DC  P C2    1 
ATOM   7761 O  O2    . DC  C 3 6   ? -24.979 61.016 31.298  1.00 52.06  ? 107  DC  P O2    1 
ATOM   7762 N  N3    . DC  C 3 6   ? -25.431 59.135 30.100  1.00 50.44  ? 107  DC  P N3    1 
ATOM   7763 C  C4    . DC  C 3 6   ? -25.547 58.567 28.897  1.00 48.94  ? 107  DC  P C4    1 
ATOM   7764 N  N4    . DC  C 3 6   ? -25.878 57.272 28.845  1.00 45.57  ? 107  DC  P N4    1 
ATOM   7765 C  C5    . DC  C 3 6   ? -25.328 59.302 27.693  1.00 51.94  ? 107  DC  P C5    1 
ATOM   7766 C  C6    . DC  C 3 6   ? -25.000 60.594 27.805  1.00 54.87  ? 107  DC  P C6    1 
ATOM   7767 P  P     . DT  C 3 7   ? -21.055 65.258 29.195  1.00 79.58  ? 108  DT  P P     1 
ATOM   7768 O  OP1   . DT  C 3 7   ? -20.713 66.694 29.302  1.00 82.59  ? 108  DT  P OP1   1 
ATOM   7769 O  OP2   . DT  C 3 7   ? -20.514 64.450 28.077  1.00 77.04  ? 108  DT  P OP2   1 
ATOM   7770 O  "O5'" . DT  C 3 7   ? -20.637 64.531 30.553  1.00 64.67  ? 108  DT  P "O5'" 1 
ATOM   7771 C  "C5'" . DT  C 3 7   ? -21.380 64.768 31.743  1.00 63.75  ? 108  DT  P "C5'" 1 
ATOM   7772 C  "C4'" . DT  C 3 7   ? -21.055 63.686 32.750  1.00 60.71  ? 108  DT  P "C4'" 1 
ATOM   7773 O  "O4'" . DT  C 3 7   ? -21.830 62.512 32.408  1.00 58.78  ? 108  DT  P "O4'" 1 
ATOM   7774 C  "C3'" . DT  C 3 7   ? -19.588 63.275 32.734  1.00 59.00  ? 108  DT  P "C3'" 1 
ATOM   7775 O  "O3'" . DT  C 3 7   ? -18.967 63.556 33.985  1.00 60.68  ? 108  DT  P "O3'" 1 
ATOM   7776 C  "C2'" . DT  C 3 7   ? -19.591 61.778 32.442  1.00 55.35  ? 108  DT  P "C2'" 1 
ATOM   7777 C  "C1'" . DT  C 3 7   ? -21.046 61.357 32.593  1.00 54.53  ? 108  DT  P "C1'" 1 
ATOM   7778 N  N1    . DT  C 3 7   ? -21.434 60.332 31.586  1.00 50.89  ? 108  DT  P N1    1 
ATOM   7779 C  C2    . DT  C 3 7   ? -21.973 59.147 32.033  1.00 49.46  ? 108  DT  P C2    1 
ATOM   7780 O  O2    . DT  C 3 7   ? -22.157 58.906 33.215  1.00 49.16  ? 108  DT  P O2    1 
ATOM   7781 N  N3    . DT  C 3 7   ? -22.295 58.252 31.043  1.00 47.85  ? 108  DT  P N3    1 
ATOM   7782 C  C4    . DT  C 3 7   ? -22.130 58.426 29.681  1.00 49.18  ? 108  DT  P C4    1 
ATOM   7783 O  O4    . DT  C 3 7   ? -22.451 57.563 28.869  1.00 50.49  ? 108  DT  P O4    1 
ATOM   7784 C  C5    . DT  C 3 7   ? -21.555 59.688 29.281  1.00 48.85  ? 108  DT  P C5    1 
ATOM   7785 C  C7    . DT  C 3 7   ? -21.333 59.970 27.824  1.00 47.01  ? 108  DT  P C7    1 
ATOM   7786 C  C6    . DT  C 3 7   ? -21.235 60.571 30.240  1.00 50.00  ? 108  DT  P C6    1 
ATOM   7787 P  P     . DG  C 3 8   ? -17.378 63.367 34.162  1.00 83.52  ? 109  DG  P P     1 
ATOM   7788 O  OP1   . DG  C 3 8   ? -16.901 64.453 35.045  1.00 86.00  ? 109  DG  P OP1   1 
ATOM   7789 O  OP2   . DG  C 3 8   ? -16.766 63.184 32.825  1.00 81.65  ? 109  DG  P OP2   1 
ATOM   7790 O  "O5'" . DG  C 3 8   ? -17.245 61.981 34.947  1.00 54.00  ? 109  DG  P "O5'" 1 
ATOM   7791 C  "C5'" . DG  C 3 8   ? -18.237 61.634 35.909  1.00 50.91  ? 109  DG  P "C5'" 1 
ATOM   7792 C  "C4'" . DG  C 3 8   ? -18.027 60.235 36.458  1.00 44.41  ? 109  DG  P "C4'" 1 
ATOM   7793 O  "O4'" . DG  C 3 8   ? -18.702 59.275 35.608  1.00 40.90  ? 109  DG  P "O4'" 1 
ATOM   7794 C  "C3'" . DG  C 3 8   ? -16.572 59.793 36.548  1.00 42.87  ? 109  DG  P "C3'" 1 
ATOM   7795 O  "O3'" . DG  C 3 8   ? -16.398 59.072 37.760  1.00 43.47  ? 109  DG  P "O3'" 1 
ATOM   7796 C  "C2'" . DG  C 3 8   ? -16.390 58.922 35.307  1.00 35.85  ? 109  DG  P "C2'" 1 
ATOM   7797 C  "C1'" . DG  C 3 8   ? -17.778 58.324 35.117  1.00 41.32  ? 109  DG  P "C1'" 1 
ATOM   7798 N  N9    . DG  C 3 8   ? -18.103 58.038 33.719  1.00 41.87  ? 109  DG  P N9    1 
ATOM   7799 C  C8    . DG  C 3 8   ? -17.894 58.857 32.636  1.00 43.57  ? 109  DG  P C8    1 
ATOM   7800 N  N7    . DG  C 3 8   ? -18.282 58.341 31.503  1.00 42.75  ? 109  DG  P N7    1 
ATOM   7801 C  C5    . DG  C 3 8   ? -18.780 57.093 31.854  1.00 39.94  ? 109  DG  P C5    1 
ATOM   7802 C  C6    . DG  C 3 8   ? -19.339 56.075 31.044  1.00 37.54  ? 109  DG  P C6    1 
ATOM   7803 O  O6    . DG  C 3 8   ? -19.513 56.073 29.816  1.00 37.42  ? 109  DG  P O6    1 
ATOM   7804 N  N1    . DG  C 3 8   ? -19.716 54.970 31.800  1.00 35.24  ? 109  DG  P N1    1 
ATOM   7805 C  C2    . DG  C 3 8   ? -19.570 54.862 33.162  1.00 31.64  ? 109  DG  P C2    1 
ATOM   7806 N  N2    . DG  C 3 8   ? -19.992 53.718 33.714  1.00 34.45  ? 109  DG  P N2    1 
ATOM   7807 N  N3    . DG  C 3 8   ? -19.050 55.807 33.934  1.00 33.78  ? 109  DG  P N3    1 
ATOM   7808 C  C4    . DG  C 3 8   ? -18.677 56.891 33.213  1.00 38.45  ? 109  DG  P C4    1 
ATOM   7809 P  P     . DC  C 3 9   ? -14.978 58.409 38.123  1.00 44.90  ? 110  DC  P P     1 
ATOM   7810 O  OP1   . DC  C 3 9   ? -14.930 58.218 39.590  1.00 44.37  ? 110  DC  P OP1   1 
ATOM   7811 O  OP2   . DC  C 3 9   ? -13.915 59.186 37.444  1.00 46.42  ? 110  DC  P OP2   1 
ATOM   7812 O  "O5'" . DC  C 3 9   ? -15.049 56.967 37.450  1.00 35.66  ? 110  DC  P "O5'" 1 
ATOM   7813 C  "C5'" . DC  C 3 9   ? -16.135 56.117 37.764  1.00 32.52  ? 110  DC  P "C5'" 1 
ATOM   7814 C  "C4'" . DC  C 3 9   ? -15.914 54.751 37.150  1.00 33.91  ? 110  DC  P "C4'" 1 
ATOM   7815 O  "O4'" . DC  C 3 9   ? -16.376 54.757 35.779  1.00 37.37  ? 110  DC  P "O4'" 1 
ATOM   7816 C  "C3'" . DC  C 3 9   ? -14.460 54.285 37.117  1.00 32.06  ? 110  DC  P "C3'" 1 
ATOM   7817 O  "O3'" . DC  C 3 9   ? -14.436 52.995 37.700  1.00 28.39  ? 110  DC  P "O3'" 1 
ATOM   7818 C  "C2'" . DC  C 3 9   ? -14.094 54.271 35.631  1.00 33.10  ? 110  DC  P "C2'" 1 
ATOM   7819 C  "C1'" . DC  C 3 9   ? -15.453 54.061 34.970  1.00 35.54  ? 110  DC  P "C1'" 1 
ATOM   7820 N  N1    . DC  C 3 9   ? -15.597 54.612 33.590  1.00 37.48  ? 110  DC  P N1    1 
ATOM   7821 C  C2    . DC  C 3 9   ? -16.165 53.822 32.584  1.00 36.57  ? 110  DC  P C2    1 
ATOM   7822 O  O2    . DC  C 3 9   ? -16.523 52.669 32.858  1.00 34.26  ? 110  DC  P O2    1 
ATOM   7823 N  N3    . DC  C 3 9   ? -16.300 54.344 31.337  1.00 37.37  ? 110  DC  P N3    1 
ATOM   7824 C  C4    . DC  C 3 9   ? -15.901 55.591 31.086  1.00 38.66  ? 110  DC  P C4    1 
ATOM   7825 N  N4    . DC  C 3 9   ? -16.055 56.059 29.842  1.00 34.83  ? 110  DC  P N4    1 
ATOM   7826 C  C5    . DC  C 3 9   ? -15.327 56.413 32.102  1.00 38.66  ? 110  DC  P C5    1 
ATOM   7827 C  C6    . DC  C 3 9   ? -15.199 55.890 33.327  1.00 37.99  ? 110  DC  P C6    1 
ATOM   7828 P  P     . DT  C 3 10  ? -13.047 52.225 37.924  1.00 32.06  ? 111  DT  P P     1 
ATOM   7829 O  OP1   . DT  C 3 10  ? -13.172 51.464 39.189  1.00 30.84  ? 111  DT  P OP1   1 
ATOM   7830 O  OP2   . DT  C 3 10  ? -11.940 53.194 37.765  1.00 33.55  ? 111  DT  P OP2   1 
ATOM   7831 O  "O5'" . DT  C 3 10  ? -12.991 51.196 36.702  1.00 31.25  ? 111  DT  P "O5'" 1 
ATOM   7832 C  "C5'" . DT  C 3 10  ? -14.093 50.322 36.470  1.00 28.10  ? 111  DT  P "C5'" 1 
ATOM   7833 C  "C4'" . DT  C 3 10  ? -13.986 49.663 35.108  1.00 28.29  ? 111  DT  P "C4'" 1 
ATOM   7834 O  "O4'" . DT  C 3 10  ? -14.266 50.631 34.070  1.00 29.54  ? 111  DT  P "O4'" 1 
ATOM   7835 C  "C3'" . DT  C 3 10  ? -12.607 49.098 34.778  1.00 26.49  ? 111  DT  P "C3'" 1 
ATOM   7836 O  "O3'" . DT  C 3 10  ? -12.652 47.679 34.824  1.00 24.82  ? 111  DT  P "O3'" 1 
ATOM   7837 C  "C2'" . DT  C 3 10  ? -12.294 49.608 33.369  1.00 27.05  ? 111  DT  P "C2'" 1 
ATOM   7838 C  "C1'" . DT  C 3 10  ? -13.618 50.198 32.896  1.00 29.47  ? 111  DT  P "C1'" 1 
ATOM   7839 N  N1    . DT  C 3 10  ? -13.468 51.360 31.969  1.00 32.63  ? 111  DT  P N1    1 
ATOM   7840 C  C2    . DT  C 3 10  ? -13.959 51.268 30.685  1.00 32.96  ? 111  DT  P C2    1 
ATOM   7841 O  O2    . DT  C 3 10  ? -14.519 50.278 30.253  1.00 36.46  ? 111  DT  P O2    1 
ATOM   7842 N  N3    . DT  C 3 10  ? -13.771 52.386 29.914  1.00 30.22  ? 111  DT  P N3    1 
ATOM   7843 C  C4    . DT  C 3 10  ? -13.155 53.563 30.290  1.00 29.75  ? 111  DT  P C4    1 
ATOM   7844 O  O4    . DT  C 3 10  ? -13.034 54.514 29.522  1.00 29.56  ? 111  DT  P O4    1 
ATOM   7845 C  C5    . DT  C 3 10  ? -12.663 53.595 31.644  1.00 29.58  ? 111  DT  P C5    1 
ATOM   7846 C  C7    . DT  C 3 10  ? -11.972 54.820 32.160  1.00 25.76  ? 111  DT  P C7    1 
ATOM   7847 C  C6    . DT  C 3 10  ? -12.841 52.509 32.409  1.00 32.74  ? 111  DT  P C6    1 
ATOM   7848 P  P     . DT  C 3 11  ? -11.292 46.825 34.819  1.00 30.30  ? 112  DT  P P     1 
ATOM   7849 O  OP1   . DT  C 3 11  ? -11.538 45.600 35.610  1.00 32.21  ? 112  DT  P OP1   1 
ATOM   7850 O  OP2   . DT  C 3 11  ? -10.180 47.733 35.176  1.00 28.81  ? 112  DT  P OP2   1 
ATOM   7851 O  "O5'" . DT  C 3 11  ? -11.115 46.403 33.290  1.00 27.40  ? 112  DT  P "O5'" 1 
ATOM   7852 C  "C5'" . DT  C 3 11  ? -12.266 45.999 32.567  1.00 28.23  ? 112  DT  P "C5'" 1 
ATOM   7853 C  "C4'" . DT  C 3 11  ? -12.007 46.022 31.074  1.00 28.96  ? 112  DT  P "C4'" 1 
ATOM   7854 O  "O4'" . DT  C 3 11  ? -12.170 47.375 30.578  1.00 27.03  ? 112  DT  P "O4'" 1 
ATOM   7855 C  "C3'" . DT  C 3 11  ? -10.599 45.587 30.676  1.00 28.73  ? 112  DT  P "C3'" 1 
ATOM   7856 O  "O3'" . DT  C 3 11  ? -10.659 44.723 29.555  1.00 28.03  ? 112  DT  P "O3'" 1 
ATOM   7857 C  "C2'" . DT  C 3 11  ? -9.917  46.903 30.321  1.00 26.78  ? 112  DT  P "C2'" 1 
ATOM   7858 C  "C1'" . DT  C 3 11  ? -11.100 47.628 29.701  1.00 26.75  ? 112  DT  P "C1'" 1 
ATOM   7859 N  N1    . DT  C 3 11  ? -10.882 49.084 29.564  1.00 26.98  ? 112  DT  P N1    1 
ATOM   7860 C  C2    . DT  C 3 11  ? -11.352 49.718 28.437  1.00 27.84  ? 112  DT  P C2    1 
ATOM   7861 O  O2    . DT  C 3 11  ? -11.946 49.132 27.547  1.00 27.84  ? 112  DT  P O2    1 
ATOM   7862 N  N3    . DT  C 3 11  ? -11.097 51.066 28.393  1.00 28.43  ? 112  DT  P N3    1 
ATOM   7863 C  C4    . DT  C 3 11  ? -10.432 51.816 29.346  1.00 27.74  ? 112  DT  P C4    1 
ATOM   7864 O  O4    . DT  C 3 11  ? -10.251 53.020 29.219  1.00 31.49  ? 112  DT  P O4    1 
ATOM   7865 C  C5    . DT  C 3 11  ? -9.967  51.087 30.499  1.00 28.17  ? 112  DT  P C5    1 
ATOM   7866 C  C7    . DT  C 3 11  ? -9.234  51.802 31.593  1.00 23.63  ? 112  DT  P C7    1 
ATOM   7867 C  C6    . DT  C 3 11  ? -10.208 49.769 30.553  1.00 27.44  ? 112  DT  P C6    1 
ATOM   7868 P  P     . DA  C 3 12  ? -9.425  43.751 29.225  1.00 26.27  ? 113  DA  P P     1 
ATOM   7869 O  OP1   . DA  C 3 12  ? -9.482  42.604 30.158  1.00 27.27  ? 113  DA  P OP1   1 
ATOM   7870 O  OP2   . DA  C 3 12  ? -8.200  44.569 29.138  1.00 26.34  ? 113  DA  P OP2   1 
ATOM   7871 O  "O5'" . DA  C 3 12  ? -9.744  43.221 27.756  1.00 26.19  ? 113  DA  P "O5'" 1 
ATOM   7872 C  "C5'" . DA  C 3 12  ? -9.125  43.856 26.663  1.00 24.95  ? 113  DA  P "C5'" 1 
ATOM   7873 C  "C4'" . DA  C 3 12  ? -10.188 44.423 25.756  1.00 28.63  ? 113  DA  P "C4'" 1 
ATOM   7874 O  "O4'" . DA  C 3 12  ? -10.750 45.615 26.347  1.00 34.04  ? 113  DA  P "O4'" 1 
ATOM   7875 C  "C3'" . DA  C 3 12  ? -9.663  44.827 24.392  1.00 31.57  ? 113  DA  P "C3'" 1 
ATOM   7876 O  "O3'" . DA  C 3 12  ? -9.845  43.734 23.522  1.00 29.51  ? 113  DA  P "O3'" 1 
ATOM   7877 C  "C2'" . DA  C 3 12  ? -10.553 46.003 24.010  1.00 34.35  ? 113  DA  P "C2'" 1 
ATOM   7878 C  "C1'" . DA  C 3 12  ? -10.844 46.634 25.368  1.00 34.96  ? 113  DA  P "C1'" 1 
ATOM   7879 N  N9    . DA  C 3 12  ? -9.946  47.719 25.759  1.00 33.01  ? 113  DA  P N9    1 
ATOM   7880 C  C8    . DA  C 3 12  ? -9.246  47.812 26.929  1.00 31.09  ? 113  DA  P C8    1 
ATOM   7881 N  N7    . DA  C 3 12  ? -8.526  48.903 27.037  1.00 31.55  ? 113  DA  P N7    1 
ATOM   7882 C  C5    . DA  C 3 12  ? -8.769  49.573 25.849  1.00 33.52  ? 113  DA  P C5    1 
ATOM   7883 C  C6    . DA  C 3 12  ? -8.300  50.801 25.340  1.00 31.67  ? 113  DA  P C6    1 
ATOM   7884 N  N6    . DA  C 3 12  ? -7.452  51.597 26.000  1.00 30.30  ? 113  DA  P N6    1 
ATOM   7885 N  N1    . DA  C 3 12  ? -8.737  51.178 24.119  1.00 31.63  ? 113  DA  P N1    1 
ATOM   7886 C  C2    . DA  C 3 12  ? -9.580  50.380 23.456  1.00 32.14  ? 113  DA  P C2    1 
ATOM   7887 N  N3    . DA  C 3 12  ? -10.096 49.210 23.835  1.00 33.44  ? 113  DA  P N3    1 
ATOM   7888 C  C4    . DA  C 3 12  ? -9.645  48.858 25.049  1.00 33.99  ? 113  DA  P C4    1 
ATOM   7889 P  P     . DC  C 3 13  ? -8.697  43.361 22.471  1.00 29.46  ? 114  DC  P P     1 
ATOM   7890 O  OP1   . DC  C 3 13  ? -9.219  42.294 21.590  1.00 29.48  ? 114  DC  P OP1   1 
ATOM   7891 O  OP2   . DC  C 3 13  ? -7.443  43.142 23.228  1.00 32.63  ? 114  DC  P OP2   1 
ATOM   7892 O  "O5'" . DC  C 3 13  ? -8.528  44.702 21.628  1.00 32.30  ? 114  DC  P "O5'" 1 
ATOM   7893 C  "C5'" . DC  C 3 13  ? -9.558  45.134 20.755  1.00 32.26  ? 114  DC  P "C5'" 1 
ATOM   7894 C  "C4'" . DC  C 3 13  ? -8.983  46.223 19.878  1.00 32.47  ? 114  DC  P "C4'" 1 
ATOM   7895 O  "O4'" . DC  C 3 13  ? -8.662  47.387 20.682  1.00 29.01  ? 114  DC  P "O4'" 1 
ATOM   7896 C  "C3'" . DC  C 3 13  ? -7.684  45.814 19.190  1.00 31.07  ? 114  DC  P "C3'" 1 
ATOM   7897 O  "O3'" . DC  C 3 13  ? -7.765  46.147 17.826  1.00 31.74  ? 114  DC  P "O3'" 1 
ATOM   7898 C  "C2'" . DC  C 3 13  ? -6.615  46.648 19.881  1.00 27.51  ? 114  DC  P "C2'" 1 
ATOM   7899 C  "C1'" . DC  C 3 13  ? -7.419  47.885 20.247  1.00 27.03  ? 114  DC  P "C1'" 1 
ATOM   7900 N  N1    . DC  C 3 13  ? -6.802  48.617 21.359  1.00 25.78  ? 114  DC  P N1    1 
ATOM   7901 C  C2    . DC  C 3 13  ? -6.419  49.950 21.190  1.00 28.42  ? 114  DC  P C2    1 
ATOM   7902 O  O2    . DC  C 3 13  ? -6.612  50.502 20.100  1.00 29.99  ? 114  DC  P O2    1 
ATOM   7903 N  N3    . DC  C 3 13  ? -5.846  50.594 22.235  1.00 27.27  ? 114  DC  P N3    1 
ATOM   7904 C  C4    . DC  C 3 13  ? -5.660  49.953 23.392  1.00 24.79  ? 114  DC  P C4    1 
ATOM   7905 N  N4    . DC  C 3 13  ? -5.093  50.624 24.399  1.00 24.41  ? 114  DC  P N4    1 
ATOM   7906 C  C5    . DC  C 3 13  ? -6.046  48.594 23.577  1.00 24.70  ? 114  DC  P C5    1 
ATOM   7907 C  C6    . DC  C 3 13  ? -6.607  47.970 22.540  1.00 25.21  ? 114  DC  P C6    1 
ATOM   7908 P  P     . DC  C 3 14  ? -6.940  45.296 16.749  1.00 36.88  ? 115  DC  P P     1 
ATOM   7909 O  OP1   . DC  C 3 14  ? -7.907  44.831 15.729  1.00 38.76  ? 115  DC  P OP1   1 
ATOM   7910 O  OP2   . DC  C 3 14  ? -6.104  44.328 17.495  1.00 35.61  ? 115  DC  P OP2   1 
ATOM   7911 O  "O5'" . DC  C 3 14  ? -5.965  46.368 16.082  1.00 32.31  ? 115  DC  P "O5'" 1 
ATOM   7912 C  "C5'" . DC  C 3 14  ? -4.743  46.686 16.718  1.00 29.34  ? 115  DC  P "C5'" 1 
ATOM   7913 C  "C4'" . DC  C 3 14  ? -4.445  48.154 16.515  1.00 28.37  ? 115  DC  P "C4'" 1 
ATOM   7914 O  "O4'" . DC  C 3 14  ? -4.971  48.904 17.636  1.00 30.79  ? 115  DC  P "O4'" 1 
ATOM   7915 C  "C3'" . DC  C 3 14  ? -2.969  48.506 16.479  1.00 26.86  ? 115  DC  P "C3'" 1 
ATOM   7916 C  "C2'" . DC  C 3 14  ? -3.016  49.982 16.854  1.00 31.29  ? 115  DC  P "C2'" 1 
ATOM   7917 C  "C1'" . DC  C 3 14  ? -4.116  49.999 17.911  1.00 30.89  ? 115  DC  P "C1'" 1 
ATOM   7918 N  N1    . DC  C 3 14  ? -3.591  49.875 19.305  1.00 28.48  ? 115  DC  P N1    1 
ATOM   7919 C  C2    . DC  C 3 14  ? -3.077  51.012 19.931  1.00 29.16  ? 115  DC  P C2    1 
ATOM   7920 O  O2    . DC  C 3 14  ? -3.076  52.082 19.314  1.00 31.99  ? 115  DC  P O2    1 
ATOM   7921 N  N3    . DC  C 3 14  ? -2.599  50.910 21.193  1.00 29.14  ? 115  DC  P N3    1 
ATOM   7922 C  C4    . DC  C 3 14  ? -2.623  49.732 21.819  1.00 30.22  ? 115  DC  P C4    1 
ATOM   7923 N  N4    . DC  C 3 14  ? -2.139  49.685 23.064  1.00 27.43  ? 115  DC  P N4    1 
ATOM   7924 C  C5    . DC  C 3 14  ? -3.141  48.556 21.199  1.00 24.88  ? 115  DC  P C5    1 
ATOM   7925 C  C6    . DC  C 3 14  ? -3.609  48.674 19.954  1.00 28.55  ? 115  DC  P C6    1 
HETATM 7926 P  PA    . TTP D 4 .   ? 0.507   47.225 15.614  1.00 28.62  ? 1001 TTP A PA    1 
HETATM 7927 O  O1A   . TTP D 4 .   ? -0.378  46.385 16.455  1.00 28.70  ? 1001 TTP A O1A   1 
HETATM 7928 O  O2A   . TTP D 4 .   ? 0.201   46.899 14.067  1.00 27.14  ? 1001 TTP A O2A   1 
HETATM 7929 O  O3A   . TTP D 4 .   ? 2.039   46.869 15.999  1.00 59.84  ? 1001 TTP A O3A   1 
HETATM 7930 P  PB    . TTP D 4 .   ? 3.146   47.284 14.892  1.00 27.13  ? 1001 TTP A PB    1 
HETATM 7931 O  O1B   . TTP D 4 .   ? 3.858   48.499 15.354  1.00 23.99  ? 1001 TTP A O1B   1 
HETATM 7932 O  O2B   . TTP D 4 .   ? 2.478   47.587 13.462  1.00 34.24  ? 1001 TTP A O2B   1 
HETATM 7933 O  O3B   . TTP D 4 .   ? 4.285   46.140 14.776  1.00 38.55  ? 1001 TTP A O3B   1 
HETATM 7934 P  PG    . TTP D 4 .   ? 3.764   44.805 14.035  1.00 22.52  ? 1001 TTP A PG    1 
HETATM 7935 O  O1G   . TTP D 4 .   ? 2.383   44.969 13.523  1.00 22.78  ? 1001 TTP A O1G   1 
HETATM 7936 O  O2G   . TTP D 4 .   ? 4.756   44.468 12.815  1.00 35.71  ? 1001 TTP A O2G   1 
HETATM 7937 O  O3G   . TTP D 4 .   ? 3.813   43.580 15.078  1.00 55.73  ? 1001 TTP A O3G   1 
HETATM 7938 O  "O5'" . TTP D 4 .   ? 0.152   48.754 15.972  1.00 25.69  ? 1001 TTP A "O5'" 1 
HETATM 7939 C  "C5'" . TTP D 4 .   ? 0.338   49.605 14.842  1.00 22.37  ? 1001 TTP A "C5'" 1 
HETATM 7940 C  "C4'" . TTP D 4 .   ? 0.709   50.982 15.393  1.00 24.71  ? 1001 TTP A "C4'" 1 
HETATM 7941 O  "O4'" . TTP D 4 .   ? -0.122  51.331 16.531  1.00 24.55  ? 1001 TTP A "O4'" 1 
HETATM 7942 C  "C3'" . TTP D 4 .   ? 2.134   50.937 15.996  1.00 27.71  ? 1001 TTP A "C3'" 1 
HETATM 7943 O  "O3'" . TTP D 4 .   ? 3.139   51.066 14.990  1.00 36.26  ? 1001 TTP A "O3'" 1 
HETATM 7944 C  "C2'" . TTP D 4 .   ? 2.087   52.173 16.915  1.00 25.01  ? 1001 TTP A "C2'" 1 
HETATM 7945 C  "C1'" . TTP D 4 .   ? 0.673   52.046 17.502  1.00 24.31  ? 1001 TTP A "C1'" 1 
HETATM 7946 N  N1    . TTP D 4 .   ? 0.767   51.294 18.758  1.00 24.15  ? 1001 TTP A N1    1 
HETATM 7947 C  C2    . TTP D 4 .   ? 1.185   51.907 19.884  1.00 25.47  ? 1001 TTP A C2    1 
HETATM 7948 O  O2    . TTP D 4 .   ? 1.478   53.088 19.868  1.00 24.39  ? 1001 TTP A O2    1 
HETATM 7949 N  N3    . TTP D 4 .   ? 1.284   51.229 21.042  1.00 24.90  ? 1001 TTP A N3    1 
HETATM 7950 C  C4    . TTP D 4 .   ? 0.970   49.920 21.097  1.00 21.76  ? 1001 TTP A C4    1 
HETATM 7951 O  O4    . TTP D 4 .   ? 1.059   49.309 22.146  1.00 21.44  ? 1001 TTP A O4    1 
HETATM 7952 C  C5    . TTP D 4 .   ? 0.533   49.262 19.926  1.00 21.19  ? 1001 TTP A C5    1 
HETATM 7953 C  C5M   . TTP D 4 .   ? 0.173   47.798 19.950  1.00 19.18  ? 1001 TTP A C5M   1 
HETATM 7954 C  C6    . TTP D 4 .   ? 0.440   49.964 18.780  1.00 21.83  ? 1001 TTP A C6    1 
HETATM 7955 CA CA    . CA  E 5 .   ? 1.236   46.428 12.274  1.00 31.14  ? 1002 CA  A CA    1 
HETATM 7956 CA CA    . CA  F 5 .   ? -2.074  46.556 13.323  1.00 75.07  ? 1003 CA  A CA    1 
HETATM 7957 CA CA    . CA  G 5 .   ? 2.848   33.495 51.088  1.00 75.11  ? 1004 CA  A CA    1 
HETATM 7958 CA CA    . CA  H 5 .   ? 5.300   41.865 1.115   1.00 103.06 ? 1005 CA  A CA    1 
HETATM 7959 CA CA    . CA  I 5 .   ? 3.098   8.909  12.961  1.00 92.01  ? 1006 CA  A CA    1 
HETATM 7960 CA CA    . CA  J 5 .   ? 19.439  30.879 69.880  1.00 70.29  ? 1007 CA  A CA    1 
HETATM 7961 CA CA    . CA  K 5 .   ? -1.056  15.402 43.342  1.00 90.49  ? 1008 CA  A CA    1 
HETATM 7962 NA NA    . NA  L 6 .   ? -6.294  20.494 9.062   1.00 55.68  ? 1009 NA  A NA    1 
HETATM 7963 CA CA    . CA  M 5 .   ? 1.323   42.097 11.961  1.00 107.37 ? 1010 CA  A CA    1 
HETATM 7964 NA NA    . NA  N 6 .   ? 9.403   52.033 61.833  1.00 72.80  ? 1011 NA  A NA    1 
HETATM 7965 O  O     . HOH O 7 .   ? -9.499  47.208 15.930  1.00 29.77  ? 1101 HOH A O     1 
HETATM 7966 O  O     . HOH O 7 .   ? 7.414   29.479 60.626  1.00 38.90  ? 1102 HOH A O     1 
HETATM 7967 O  O     . HOH O 7 .   ? 16.064  25.275 40.123  1.00 39.89  ? 1103 HOH A O     1 
HETATM 7968 O  O     . HOH O 7 .   ? 14.752  35.766 32.475  1.00 21.48  ? 1104 HOH A O     1 
HETATM 7969 O  O     . HOH O 7 .   ? 31.446  64.262 41.908  1.00 44.68  ? 1105 HOH A O     1 
HETATM 7970 O  O     . HOH O 7 .   ? 6.688   48.463 16.268  1.00 23.69  ? 1106 HOH A O     1 
HETATM 7971 O  O     . HOH O 7 .   ? -11.099 31.364 37.298  1.00 32.30  ? 1107 HOH A O     1 
HETATM 7972 O  O     . HOH O 7 .   ? 19.341  51.863 19.439  1.00 36.20  ? 1108 HOH A O     1 
HETATM 7973 O  O     . HOH O 7 .   ? -1.042  41.780 33.244  1.00 23.70  ? 1109 HOH A O     1 
HETATM 7974 O  O     . HOH O 7 .   ? 0.097   36.420 46.067  1.00 17.95  ? 1110 HOH A O     1 
HETATM 7975 O  O     . HOH O 7 .   ? 13.797  37.797 27.195  1.00 23.17  ? 1111 HOH A O     1 
HETATM 7976 O  O     . HOH O 7 .   ? -14.887 27.392 2.994   1.00 37.02  ? 1112 HOH A O     1 
HETATM 7977 O  O     . HOH O 7 .   ? -15.193 34.714 36.503  1.00 24.83  ? 1113 HOH A O     1 
HETATM 7978 O  O     . HOH O 7 .   ? 33.232  64.756 32.403  1.00 28.31  ? 1114 HOH A O     1 
HETATM 7979 O  O     . HOH O 7 .   ? 35.431  72.861 25.293  1.00 22.60  ? 1115 HOH A O     1 
HETATM 7980 O  O     . HOH O 7 .   ? -10.351 43.181 34.977  1.00 32.13  ? 1116 HOH A O     1 
HETATM 7981 O  O     . HOH O 7 .   ? 21.364  48.307 37.822  1.00 27.69  ? 1117 HOH A O     1 
HETATM 7982 O  O     . HOH O 7 .   ? -2.048  56.812 12.470  1.00 24.36  ? 1118 HOH A O     1 
HETATM 7983 O  O     . HOH O 7 .   ? -6.658  52.866 17.119  1.00 23.85  ? 1119 HOH A O     1 
HETATM 7984 O  O     . HOH O 7 .   ? 17.003  34.225 41.112  1.00 30.00  ? 1120 HOH A O     1 
HETATM 7985 O  O     . HOH O 7 .   ? 29.499  64.018 32.544  1.00 27.37  ? 1121 HOH A O     1 
HETATM 7986 O  O     . HOH O 7 .   ? 13.197  35.767 25.799  1.00 23.04  ? 1122 HOH A O     1 
HETATM 7987 O  O     . HOH O 7 .   ? -12.816 35.632 36.511  1.00 23.04  ? 1123 HOH A O     1 
HETATM 7988 O  O     . HOH O 7 .   ? -12.641 36.978 34.038  1.00 28.25  ? 1124 HOH A O     1 
HETATM 7989 O  O     . HOH O 7 .   ? -31.883 33.459 40.350  1.00 30.15  ? 1125 HOH A O     1 
HETATM 7990 O  O     . HOH O 7 .   ? 4.347   36.354 62.650  1.00 40.49  ? 1126 HOH A O     1 
HETATM 7991 O  O     . HOH O 7 .   ? 11.824  65.552 18.668  1.00 30.91  ? 1127 HOH A O     1 
HETATM 7992 O  O     . HOH O 7 .   ? -24.821 53.974 42.658  1.00 39.10  ? 1128 HOH A O     1 
HETATM 7993 O  O     . HOH O 7 .   ? -4.016  55.434 11.146  1.00 25.74  ? 1129 HOH A O     1 
HETATM 7994 O  O     . HOH O 7 .   ? -20.838 51.325 37.417  1.00 32.08  ? 1130 HOH A O     1 
HETATM 7995 O  O     . HOH O 7 .   ? 26.616  39.999 45.362  1.00 42.34  ? 1131 HOH A O     1 
HETATM 7996 O  O     . HOH O 7 .   ? 4.341   21.837 63.762  1.00 24.75  ? 1132 HOH A O     1 
HETATM 7997 O  O     . HOH O 7 .   ? -15.592 46.035 23.076  1.00 25.14  ? 1133 HOH A O     1 
HETATM 7998 O  O     . HOH O 7 .   ? 20.229  50.367 41.663  1.00 27.97  ? 1134 HOH A O     1 
HETATM 7999 O  O     . HOH O 7 .   ? 24.554  45.320 25.321  1.00 34.65  ? 1135 HOH A O     1 
HETATM 8000 O  O     . HOH O 7 .   ? -14.029 37.335 50.951  1.00 38.55  ? 1136 HOH A O     1 
HETATM 8001 O  O     . HOH O 7 .   ? 12.144  68.194 18.701  1.00 29.91  ? 1137 HOH A O     1 
HETATM 8002 O  O     . HOH O 7 .   ? 26.422  39.706 40.829  1.00 33.75  ? 1138 HOH A O     1 
HETATM 8003 O  O     . HOH O 7 .   ? -17.092 44.306 35.866  1.00 29.94  ? 1139 HOH A O     1 
HETATM 8004 O  O     . HOH O 7 .   ? 16.626  18.377 43.883  1.00 45.36  ? 1140 HOH A O     1 
HETATM 8005 O  O     . HOH O 7 .   ? 17.139  61.510 31.760  1.00 35.69  ? 1141 HOH A O     1 
HETATM 8006 O  O     . HOH O 7 .   ? 38.828  68.644 31.114  1.00 39.48  ? 1142 HOH A O     1 
HETATM 8007 O  O     . HOH O 7 .   ? 5.688   36.305 26.420  1.00 27.09  ? 1143 HOH A O     1 
HETATM 8008 O  O     . HOH O 7 .   ? 2.164   49.829 54.577  1.00 32.06  ? 1144 HOH A O     1 
HETATM 8009 O  O     . HOH O 7 .   ? 1.944   45.234 60.274  1.00 29.65  ? 1145 HOH A O     1 
HETATM 8010 O  O     . HOH O 7 .   ? 30.868  43.814 28.767  1.00 41.46  ? 1146 HOH A O     1 
HETATM 8011 O  O     . HOH O 7 .   ? 21.451  36.607 47.001  1.00 28.23  ? 1147 HOH A O     1 
HETATM 8012 O  O     . HOH O 7 .   ? 1.400   72.484 -0.201  1.00 30.66  ? 1148 HOH A O     1 
HETATM 8013 O  O     . HOH O 7 .   ? 4.126   45.704 21.815  1.00 17.88  ? 1149 HOH A O     1 
HETATM 8014 O  O     . HOH O 7 .   ? -12.330 33.734 25.386  1.00 28.80  ? 1150 HOH A O     1 
HETATM 8015 O  O     . HOH O 7 .   ? 13.005  66.723 30.046  1.00 29.41  ? 1151 HOH A O     1 
HETATM 8016 O  O     . HOH O 7 .   ? 3.450   40.348 17.089  1.00 29.02  ? 1152 HOH A O     1 
HETATM 8017 O  O     . HOH O 7 .   ? 0.172   70.225 -0.374  1.00 31.44  ? 1153 HOH A O     1 
HETATM 8018 O  O     . HOH O 7 .   ? 24.078  44.626 62.745  1.00 36.32  ? 1154 HOH A O     1 
HETATM 8019 O  O     . HOH O 7 .   ? 18.897  54.506 34.861  1.00 24.09  ? 1155 HOH A O     1 
HETATM 8020 O  O     . HOH O 7 .   ? 4.296   32.045 10.615  1.00 33.68  ? 1156 HOH A O     1 
HETATM 8021 O  O     . HOH O 7 .   ? 11.711  50.713 28.595  1.00 33.02  ? 1157 HOH A O     1 
HETATM 8022 O  O     . HOH O 7 .   ? 6.510   37.855 50.092  1.00 29.10  ? 1158 HOH A O     1 
HETATM 8023 O  O     . HOH O 7 .   ? 14.105  55.281 35.697  1.00 28.12  ? 1159 HOH A O     1 
HETATM 8024 O  O     . HOH O 7 .   ? -16.919 42.198 30.298  1.00 26.84  ? 1160 HOH A O     1 
HETATM 8025 O  O     . HOH O 7 .   ? 24.055  55.965 29.515  1.00 34.98  ? 1161 HOH A O     1 
HETATM 8026 O  O     . HOH O 7 .   ? 19.033  61.941 25.377  1.00 30.43  ? 1162 HOH A O     1 
HETATM 8027 O  O     . HOH O 7 .   ? 1.631   35.489 50.543  1.00 51.88  ? 1163 HOH A O     1 
HETATM 8028 O  O     . HOH O 7 .   ? -1.792  56.661 17.238  1.00 20.81  ? 1164 HOH A O     1 
HETATM 8029 O  O     . HOH O 7 .   ? -9.409  38.185 29.435  1.00 39.13  ? 1165 HOH A O     1 
HETATM 8030 O  O     . HOH O 7 .   ? 21.712  50.484 39.414  1.00 25.68  ? 1166 HOH A O     1 
HETATM 8031 O  O     . HOH O 7 .   ? 10.505  34.878 67.854  1.00 28.05  ? 1167 HOH A O     1 
HETATM 8032 O  O     . HOH O 7 .   ? -14.462 53.873 40.609  1.00 26.32  ? 1168 HOH A O     1 
HETATM 8033 O  O     . HOH O 7 .   ? -15.210 55.305 8.512   1.00 30.68  ? 1169 HOH A O     1 
HETATM 8034 O  O     . HOH O 7 .   ? -6.887  45.706 13.236  1.00 30.63  ? 1170 HOH A O     1 
HETATM 8035 O  O     . HOH O 7 .   ? -13.331 30.145 37.266  1.00 30.81  ? 1171 HOH A O     1 
HETATM 8036 O  O     . HOH O 7 .   ? 15.173  39.731 25.437  1.00 29.55  ? 1172 HOH A O     1 
HETATM 8037 O  O     . HOH O 7 .   ? -10.677 33.620 22.738  1.00 44.08  ? 1173 HOH A O     1 
HETATM 8038 O  O     . HOH O 7 .   ? -7.985  67.174 7.253   1.00 45.76  ? 1174 HOH A O     1 
HETATM 8039 O  O     . HOH O 7 .   ? -15.217 27.217 22.040  1.00 31.81  ? 1175 HOH A O     1 
HETATM 8040 O  O     . HOH O 7 .   ? -19.011 44.942 37.872  1.00 25.08  ? 1176 HOH A O     1 
HETATM 8041 O  O     . HOH O 7 .   ? 18.210  19.762 50.114  1.00 44.72  ? 1177 HOH A O     1 
HETATM 8042 O  O     . HOH O 7 .   ? 18.361  44.140 23.209  1.00 33.12  ? 1178 HOH A O     1 
HETATM 8043 O  O     . HOH O 7 .   ? 1.343   66.908 25.244  1.00 26.93  ? 1179 HOH A O     1 
HETATM 8044 O  O     . HOH O 7 .   ? -9.602  55.215 1.977   1.00 32.21  ? 1180 HOH A O     1 
HETATM 8045 O  O     . HOH O 7 .   ? -21.059 27.707 43.309  1.00 25.50  ? 1181 HOH A O     1 
HETATM 8046 O  O     . HOH O 7 .   ? 13.845  26.862 36.811  1.00 35.18  ? 1182 HOH A O     1 
HETATM 8047 O  O     . HOH O 7 .   ? 0.363   47.276 23.433  1.00 31.44  ? 1183 HOH A O     1 
HETATM 8048 O  O     . HOH O 7 .   ? -31.947 28.259 21.291  1.00 51.03  ? 1184 HOH A O     1 
HETATM 8049 O  O     . HOH O 7 .   ? 35.550  45.473 45.540  1.00 28.85  ? 1185 HOH A O     1 
HETATM 8050 O  O     . HOH O 7 .   ? 3.391   42.873 8.416   1.00 56.17  ? 1186 HOH A O     1 
HETATM 8051 O  O     . HOH O 7 .   ? 4.037   26.614 30.036  1.00 43.77  ? 1187 HOH A O     1 
HETATM 8052 O  O     . HOH O 7 .   ? 13.961  19.226 21.885  1.00 38.66  ? 1188 HOH A O     1 
HETATM 8053 O  O     . HOH O 7 .   ? -28.140 43.426 40.459  1.00 33.12  ? 1189 HOH A O     1 
HETATM 8054 O  O     . HOH O 7 .   ? 18.079  76.833 31.680  1.00 41.54  ? 1190 HOH A O     1 
HETATM 8055 O  O     . HOH O 7 .   ? 3.010   29.752 53.019  1.00 35.00  ? 1191 HOH A O     1 
HETATM 8056 O  O     . HOH O 7 .   ? -31.651 43.285 44.644  1.00 45.84  ? 1192 HOH A O     1 
HETATM 8057 O  O     . HOH O 7 .   ? -0.545  30.348 62.200  1.00 42.58  ? 1193 HOH A O     1 
HETATM 8058 O  O     . HOH O 7 .   ? -15.080 47.665 30.068  1.00 34.77  ? 1194 HOH A O     1 
HETATM 8059 O  O     . HOH O 7 .   ? -0.374  52.184 -7.211  1.00 38.78  ? 1195 HOH A O     1 
HETATM 8060 O  O     . HOH O 7 .   ? 14.277  19.310 56.923  1.00 42.03  ? 1196 HOH A O     1 
HETATM 8061 O  O     . HOH O 7 .   ? 23.229  53.126 25.141  1.00 28.52  ? 1197 HOH A O     1 
HETATM 8062 O  O     . HOH O 7 .   ? -19.148 47.793 37.548  1.00 27.21  ? 1198 HOH A O     1 
HETATM 8063 O  O     . HOH O 7 .   ? 20.295  52.330 12.113  1.00 37.32  ? 1199 HOH A O     1 
HETATM 8064 O  O     . HOH O 7 .   ? 20.964  57.105 42.773  1.00 36.58  ? 1200 HOH A O     1 
HETATM 8065 O  O     . HOH O 7 .   ? -3.527  23.900 15.563  1.00 36.25  ? 1201 HOH A O     1 
HETATM 8066 O  O     . HOH O 7 .   ? 6.647   65.771 -0.962  1.00 35.74  ? 1202 HOH A O     1 
HETATM 8067 O  O     . HOH O 7 .   ? 19.926  56.383 54.316  1.00 42.55  ? 1203 HOH A O     1 
HETATM 8068 O  O     . HOH O 7 .   ? 13.760  70.012 17.579  1.00 30.12  ? 1204 HOH A O     1 
HETATM 8069 O  O     . HOH O 7 .   ? 15.913  33.416 30.648  1.00 36.85  ? 1205 HOH A O     1 
HETATM 8070 O  O     . HOH O 7 .   ? -2.265  44.062 61.038  1.00 42.70  ? 1206 HOH A O     1 
HETATM 8071 O  O     . HOH O 7 .   ? -15.873 46.489 56.744  1.00 39.92  ? 1207 HOH A O     1 
HETATM 8072 O  O     . HOH O 7 .   ? -9.548  32.129 48.521  1.00 34.37  ? 1208 HOH A O     1 
HETATM 8073 O  O     . HOH O 7 .   ? 24.855  36.867 29.593  1.00 31.83  ? 1209 HOH A O     1 
HETATM 8074 O  O     . HOH O 7 .   ? 8.666   27.054 33.673  1.00 34.25  ? 1210 HOH A O     1 
HETATM 8075 O  O     . HOH O 7 .   ? 19.891  79.193 25.706  1.00 39.75  ? 1211 HOH A O     1 
HETATM 8076 O  O     . HOH O 7 .   ? 8.751   7.190  24.230  1.00 40.96  ? 1212 HOH A O     1 
HETATM 8077 O  O     . HOH O 7 .   ? 21.002  47.238 13.281  1.00 34.80  ? 1213 HOH A O     1 
HETATM 8078 O  O     . HOH O 7 .   ? 27.206  65.236 32.840  1.00 35.53  ? 1214 HOH A O     1 
HETATM 8079 O  O     . HOH O 7 .   ? 28.939  54.998 26.119  1.00 46.99  ? 1215 HOH A O     1 
HETATM 8080 O  O     . HOH O 7 .   ? 15.954  49.369 43.165  1.00 43.93  ? 1216 HOH A O     1 
HETATM 8081 O  O     . HOH O 7 .   ? 2.720   71.398 10.387  1.00 36.18  ? 1217 HOH A O     1 
HETATM 8082 O  O     . HOH O 7 .   ? 7.693   54.349 33.800  1.00 32.81  ? 1218 HOH A O     1 
HETATM 8083 O  O     . HOH O 7 .   ? 23.845  78.092 26.556  1.00 39.83  ? 1219 HOH A O     1 
HETATM 8084 O  O     . HOH O 7 .   ? 7.657   72.938 0.420   1.00 37.28  ? 1220 HOH A O     1 
HETATM 8085 O  O     . HOH O 7 .   ? 11.000  67.610 28.680  1.00 45.17  ? 1221 HOH A O     1 
HETATM 8086 O  O     . HOH O 7 .   ? 0.885   63.931 26.477  1.00 33.08  ? 1222 HOH A O     1 
HETATM 8087 O  O     . HOH O 7 .   ? -24.273 44.709 18.049  1.00 41.19  ? 1223 HOH A O     1 
HETATM 8088 O  O     . HOH O 7 .   ? 13.404  29.252 10.174  1.00 52.36  ? 1224 HOH A O     1 
HETATM 8089 O  O     . HOH O 7 .   ? -11.984 53.738 -1.662  1.00 36.08  ? 1225 HOH A O     1 
HETATM 8090 O  O     . HOH O 7 .   ? 2.000   17.926 54.640  1.00 35.81  ? 1226 HOH A O     1 
HETATM 8091 O  O     . HOH O 7 .   ? 15.715  56.978 7.984   1.00 40.28  ? 1227 HOH A O     1 
HETATM 8092 O  O     . HOH O 7 .   ? 9.892   46.553 40.549  1.00 34.04  ? 1228 HOH A O     1 
HETATM 8093 O  O     . HOH O 7 .   ? 10.356  29.846 27.406  1.00 61.64  ? 1229 HOH A O     1 
HETATM 8094 O  O     . HOH O 7 .   ? 17.389  33.537 38.369  1.00 34.03  ? 1230 HOH A O     1 
HETATM 8095 O  O     . HOH O 7 .   ? 9.292   49.547 27.180  1.00 37.48  ? 1231 HOH A O     1 
HETATM 8096 O  O     . HOH O 7 .   ? -22.042 43.616 24.401  1.00 34.85  ? 1232 HOH A O     1 
HETATM 8097 O  O     . HOH O 7 .   ? 2.019   73.830 8.081   1.00 48.22  ? 1233 HOH A O     1 
HETATM 8098 O  O     . HOH O 7 .   ? 2.850   64.335 28.417  1.00 26.62  ? 1234 HOH A O     1 
HETATM 8099 O  O     . HOH O 7 .   ? -6.338  29.844 34.080  1.00 41.94  ? 1235 HOH A O     1 
HETATM 8100 O  O     . HOH O 7 .   ? -1.441  64.549 25.108  1.00 34.09  ? 1236 HOH A O     1 
HETATM 8101 O  O     . HOH O 7 .   ? 29.043  51.787 22.534  1.00 44.30  ? 1237 HOH A O     1 
HETATM 8102 O  O     . HOH O 7 .   ? 4.151   37.777 50.996  1.00 35.99  ? 1238 HOH A O     1 
HETATM 8103 O  O     . HOH O 7 .   ? 10.051  48.970 48.683  1.00 42.15  ? 1239 HOH A O     1 
HETATM 8104 O  O     . HOH O 7 .   ? -21.838 39.289 4.113   1.00 39.70  ? 1240 HOH A O     1 
HETATM 8105 O  O     . HOH O 7 .   ? -15.766 27.383 44.620  1.00 40.41  ? 1241 HOH A O     1 
HETATM 8106 O  O     . HOH O 7 .   ? 2.716   70.955 24.743  1.00 48.66  ? 1242 HOH A O     1 
HETATM 8107 O  O     . HOH O 7 .   ? 12.173  57.862 34.015  1.00 42.66  ? 1243 HOH A O     1 
HETATM 8108 O  O     . HOH O 7 .   ? 9.670   46.980 26.704  1.00 24.42  ? 1244 HOH A O     1 
HETATM 8109 O  O     . HOH O 7 .   ? 4.772   38.975 26.263  1.00 21.91  ? 1245 HOH A O     1 
HETATM 8110 O  O     . HOH O 7 .   ? 3.887   47.167 1.289   1.00 50.66  ? 1246 HOH A O     1 
HETATM 8111 O  O     . HOH O 7 .   ? -25.966 29.206 44.241  1.00 46.33  ? 1247 HOH A O     1 
HETATM 8112 O  O     . HOH O 7 .   ? -15.409 57.948 52.610  1.00 36.41  ? 1248 HOH A O     1 
HETATM 8113 O  O     . HOH O 7 .   ? -16.006 25.172 25.281  1.00 44.03  ? 1249 HOH A O     1 
HETATM 8114 O  O     . HOH O 7 .   ? -5.634  70.333 -2.141  1.00 47.96  ? 1250 HOH A O     1 
HETATM 8115 O  O     . HOH O 7 .   ? 18.206  30.369 66.123  1.00 35.44  ? 1251 HOH A O     1 
HETATM 8116 O  O     . HOH O 7 .   ? -28.374 48.077 38.382  1.00 46.96  ? 1252 HOH A O     1 
HETATM 8117 O  O     . HOH O 7 .   ? 23.940  66.621 42.213  1.00 32.58  ? 1253 HOH A O     1 
HETATM 8118 O  O     . HOH O 7 .   ? -9.022  21.285 4.763   1.00 55.69  ? 1254 HOH A O     1 
HETATM 8119 O  O     . HOH O 7 .   ? 15.845  71.910 22.507  1.00 45.05  ? 1255 HOH A O     1 
HETATM 8120 O  O     . HOH O 7 .   ? 22.239  43.634 25.830  1.00 41.66  ? 1256 HOH A O     1 
HETATM 8121 O  O     . HOH O 7 .   ? -13.112 32.108 54.744  1.00 39.84  ? 1257 HOH A O     1 
HETATM 8122 O  O     . HOH O 7 .   ? -9.898  36.315 27.705  1.00 31.05  ? 1258 HOH A O     1 
HETATM 8123 O  O     . HOH O 7 .   ? 20.509  69.090 30.504  1.00 32.06  ? 1259 HOH A O     1 
HETATM 8124 O  O     . HOH O 7 .   ? 20.398  45.747 15.772  1.00 39.76  ? 1260 HOH A O     1 
HETATM 8125 O  O     . HOH O 7 .   ? -11.794 26.031 16.468  1.00 31.09  ? 1261 HOH A O     1 
HETATM 8126 O  O     . HOH O 7 .   ? 22.885  54.934 60.393  1.00 43.27  ? 1262 HOH A O     1 
HETATM 8127 O  O     . HOH O 7 .   ? -10.657 55.653 -5.817  1.00 47.84  ? 1263 HOH A O     1 
HETATM 8128 O  O     . HOH O 7 .   ? 9.983   18.050 62.350  1.00 47.60  ? 1264 HOH A O     1 
HETATM 8129 O  O     . HOH O 7 .   ? 9.387   55.105 -3.860  1.00 43.00  ? 1265 HOH A O     1 
HETATM 8130 O  O     . HOH O 7 .   ? 25.700  50.727 43.076  1.00 33.43  ? 1266 HOH A O     1 
HETATM 8131 O  O     . HOH O 7 .   ? -34.220 35.377 20.828  1.00 54.92  ? 1267 HOH A O     1 
HETATM 8132 O  O     . HOH O 7 .   ? -29.954 41.646 41.050  1.00 44.92  ? 1268 HOH A O     1 
HETATM 8133 O  O     . HOH O 7 .   ? 10.022  23.474 8.532   1.00 54.51  ? 1269 HOH A O     1 
HETATM 8134 O  O     . HOH O 7 .   ? 12.516  68.512 21.376  1.00 37.89  ? 1270 HOH A O     1 
HETATM 8135 O  O     . HOH O 7 .   ? 6.986   40.651 7.672   1.00 39.31  ? 1271 HOH A O     1 
HETATM 8136 O  O     . HOH O 7 .   ? -21.845 43.940 20.076  1.00 40.18  ? 1272 HOH A O     1 
HETATM 8137 O  O     . HOH O 7 .   ? -10.137 32.562 41.516  1.00 38.34  ? 1273 HOH A O     1 
HETATM 8138 O  O     . HOH O 7 .   ? -0.086  74.729 6.837   1.00 48.90  ? 1274 HOH A O     1 
HETATM 8139 O  O     . HOH O 7 .   ? -13.035 56.096 40.317  1.00 31.43  ? 1275 HOH A O     1 
HETATM 8140 O  O     . HOH O 7 .   ? 12.300  25.562 35.426  1.00 35.38  ? 1276 HOH A O     1 
HETATM 8141 O  O     . HOH O 7 .   ? -24.222 43.753 53.606  1.00 35.99  ? 1277 HOH A O     1 
HETATM 8142 O  O     . HOH O 7 .   ? 29.139  37.808 43.589  1.00 31.74  ? 1278 HOH A O     1 
HETATM 8143 O  O     . HOH O 7 .   ? 15.246  49.477 45.843  1.00 36.26  ? 1279 HOH A O     1 
HETATM 8144 O  O     . HOH O 7 .   ? -14.585 47.483 25.600  1.00 38.90  ? 1280 HOH A O     1 
HETATM 8145 O  O     . HOH O 7 .   ? 17.196  58.824 58.088  1.00 50.08  ? 1281 HOH A O     1 
HETATM 8146 O  O     . HOH O 7 .   ? 16.827  21.760 38.619  1.00 55.83  ? 1282 HOH A O     1 
HETATM 8147 O  O     . HOH O 7 .   ? -3.761  66.953 6.289   1.00 39.58  ? 1283 HOH A O     1 
HETATM 8148 O  O     . HOH O 7 .   ? 7.483   74.157 12.991  1.00 32.57  ? 1284 HOH A O     1 
HETATM 8149 O  O     . HOH O 7 .   ? -29.593 33.270 9.189   1.00 54.97  ? 1285 HOH A O     1 
HETATM 8150 O  O     . HOH O 7 .   ? 2.954   47.609 29.110  1.00 37.94  ? 1286 HOH A O     1 
HETATM 8151 O  O     . HOH O 7 .   ? -7.396  41.176 43.840  1.00 45.38  ? 1287 HOH A O     1 
HETATM 8152 O  O     . HOH O 7 .   ? 5.700   54.517 1.525   1.00 37.84  ? 1288 HOH A O     1 
HETATM 8153 O  O     . HOH O 7 .   ? 22.150  78.988 24.909  1.00 54.15  ? 1289 HOH A O     1 
HETATM 8154 O  O     . HOH O 7 .   ? -11.243 53.416 -4.291  1.00 45.45  ? 1290 HOH A O     1 
HETATM 8155 O  O     . HOH O 7 .   ? -13.375 50.351 1.706   1.00 36.43  ? 1291 HOH A O     1 
HETATM 8156 O  O     . HOH O 7 .   ? -7.958  36.754 19.970  1.00 47.33  ? 1292 HOH A O     1 
HETATM 8157 O  O     . HOH O 7 .   ? 36.194  52.749 46.171  1.00 38.14  ? 1293 HOH A O     1 
HETATM 8158 O  O     . HOH O 7 .   ? 11.668  69.359 23.279  1.00 55.59  ? 1294 HOH A O     1 
HETATM 8159 O  O     . HOH O 7 .   ? -19.504 38.239 3.683   1.00 47.66  ? 1295 HOH A O     1 
HETATM 8160 O  O     . HOH O 7 .   ? 25.618  48.278 25.698  1.00 37.54  ? 1296 HOH A O     1 
HETATM 8161 O  O     . HOH O 7 .   ? 5.798   40.132 48.634  1.00 28.92  ? 1297 HOH A O     1 
HETATM 8162 O  O     . HOH O 7 .   ? 2.179   23.013 62.709  1.00 50.97  ? 1298 HOH A O     1 
HETATM 8163 O  O     . HOH O 7 .   ? 14.921  33.504 37.217  1.00 27.65  ? 1299 HOH A O     1 
HETATM 8164 O  O     . HOH O 7 .   ? -1.126  33.461 46.098  1.00 40.58  ? 1300 HOH A O     1 
HETATM 8165 O  O     . HOH O 7 .   ? 5.699   41.110 67.517  1.00 42.87  ? 1301 HOH A O     1 
HETATM 8166 O  O     . HOH O 7 .   ? -3.991  44.981 35.034  1.00 39.54  ? 1302 HOH A O     1 
HETATM 8167 O  O     . HOH O 7 .   ? -15.484 27.860 24.590  1.00 30.47  ? 1303 HOH A O     1 
HETATM 8168 O  O     . HOH O 7 .   ? -12.745 45.544 52.655  1.00 39.72  ? 1304 HOH A O     1 
HETATM 8169 O  O     . HOH O 7 .   ? 22.803  34.198 38.034  1.00 38.65  ? 1305 HOH A O     1 
HETATM 8170 O  O     . HOH O 7 .   ? 22.990  44.171 36.845  1.00 34.55  ? 1306 HOH A O     1 
HETATM 8171 O  O     . HOH O 7 .   ? 5.041   62.532 -6.335  1.00 36.75  ? 1307 HOH A O     1 
HETATM 8172 O  O     . HOH O 7 .   ? 14.178  34.615 21.028  1.00 41.29  ? 1308 HOH A O     1 
HETATM 8173 O  O     . HOH O 7 .   ? 11.977  69.082 26.771  1.00 54.16  ? 1309 HOH A O     1 
HETATM 8174 O  O     . HOH O 7 .   ? 16.465  72.528 25.218  1.00 49.86  ? 1310 HOH A O     1 
HETATM 8175 O  O     . HOH O 7 .   ? 26.743  33.532 29.524  1.00 45.70  ? 1311 HOH A O     1 
HETATM 8176 O  O     . HOH O 7 .   ? 20.660  29.404 38.405  1.00 44.01  ? 1312 HOH A O     1 
HETATM 8177 O  O     . HOH O 7 .   ? 5.735   18.811 42.079  1.00 47.60  ? 1313 HOH A O     1 
HETATM 8178 O  O     . HOH O 7 .   ? 1.491   44.675 21.212  1.00 33.79  ? 1314 HOH A O     1 
HETATM 8179 O  O     . HOH O 7 .   ? 3.682   48.245 21.188  1.00 25.23  ? 1315 HOH A O     1 
HETATM 8180 O  O     . HOH O 7 .   ? -11.623 36.735 49.756  1.00 42.82  ? 1316 HOH A O     1 
HETATM 8181 O  O     . HOH O 7 .   ? -29.331 32.492 44.026  1.00 42.71  ? 1317 HOH A O     1 
HETATM 8182 O  O     . HOH O 7 .   ? -31.392 44.875 47.082  1.00 40.54  ? 1318 HOH A O     1 
HETATM 8183 O  O     . HOH O 7 .   ? -0.532  45.672 60.678  1.00 45.59  ? 1319 HOH A O     1 
HETATM 8184 O  O     . HOH O 7 .   ? -10.828 34.207 37.531  1.00 31.29  ? 1320 HOH A O     1 
HETATM 8185 O  O     . HOH O 7 .   ? 20.992  34.033 36.076  1.00 45.88  ? 1321 HOH A O     1 
HETATM 8186 O  O     . HOH O 7 .   ? -0.230  31.358 59.546  1.00 53.40  ? 1322 HOH A O     1 
HETATM 8187 O  O     . HOH O 7 .   ? -20.442 49.895 13.122  1.00 36.12  ? 1323 HOH A O     1 
HETATM 8188 O  O     . HOH O 7 .   ? 26.101  77.993 20.010  1.00 39.09  ? 1324 HOH A O     1 
HETATM 8189 O  O     . HOH O 7 .   ? 13.303  32.194 20.833  1.00 35.78  ? 1325 HOH A O     1 
HETATM 8190 O  O     . HOH O 7 .   ? 18.158  34.489 34.787  1.00 38.93  ? 1326 HOH A O     1 
HETATM 8191 O  O     . HOH O 7 .   ? 10.613  53.174 57.166  1.00 44.42  ? 1327 HOH A O     1 
HETATM 8192 O  O     . HOH O 7 .   ? 6.955   51.040 27.467  1.00 34.80  ? 1328 HOH A O     1 
HETATM 8193 O  O     . HOH O 7 .   ? 5.004   26.480 19.326  1.00 33.47  ? 1329 HOH A O     1 
HETATM 8194 O  O     . HOH O 7 .   ? 3.635   60.189 -6.428  1.00 41.07  ? 1330 HOH A O     1 
HETATM 8195 O  O     . HOH O 7 .   ? 25.458  52.473 23.832  1.00 65.38  ? 1331 HOH A O     1 
HETATM 8196 O  O     . HOH O 7 .   ? -0.388  35.307 2.036   1.00 46.19  ? 1332 HOH A O     1 
HETATM 8197 O  O     . HOH O 7 .   ? 15.047  35.413 23.826  1.00 33.73  ? 1333 HOH A O     1 
HETATM 8198 O  O     . HOH O 7 .   ? 19.029  34.285 30.994  1.00 39.34  ? 1334 HOH A O     1 
HETATM 8199 O  O     . HOH O 7 .   ? -23.795 49.155 48.959  1.00 48.05  ? 1335 HOH A O     1 
HETATM 8200 O  O     . HOH O 7 .   ? -3.447  61.976 13.307  1.00 36.61  ? 1336 HOH A O     1 
HETATM 8201 O  O     . HOH O 7 .   ? 21.861  46.109 18.184  1.00 34.46  ? 1337 HOH A O     1 
HETATM 8202 O  O     . HOH O 7 .   ? 10.194  72.284 -0.402  1.00 37.56  ? 1338 HOH A O     1 
HETATM 8203 O  O     . HOH O 7 .   ? 3.920   43.781 0.734   1.00 51.32  ? 1339 HOH A O     1 
HETATM 8204 O  O     . HOH O 7 .   ? 15.042  65.593 30.134  1.00 50.34  ? 1340 HOH A O     1 
HETATM 8205 O  O     . HOH O 7 .   ? -15.920 56.392 16.153  1.00 35.58  ? 1341 HOH A O     1 
HETATM 8206 O  O     . HOH O 7 .   ? -15.266 22.533 -3.541  1.00 53.75  ? 1342 HOH A O     1 
HETATM 8207 O  O     . HOH O 7 .   ? 14.094  31.190 12.034  1.00 38.94  ? 1343 HOH A O     1 
HETATM 8208 O  O     . HOH O 7 .   ? 10.569  49.836 11.482  1.00 32.65  ? 1344 HOH A O     1 
HETATM 8209 O  O     . HOH O 7 .   ? -12.809 31.244 27.063  1.00 25.30  ? 1345 HOH A O     1 
HETATM 8210 O  O     . HOH O 7 .   ? -12.674 22.122 6.796   1.00 46.37  ? 1346 HOH A O     1 
HETATM 8211 O  O     . HOH O 7 .   ? 2.370   17.865 57.256  1.00 41.81  ? 1347 HOH A O     1 
HETATM 8212 O  O     . HOH O 7 .   ? 14.305  72.864 14.012  1.00 47.15  ? 1348 HOH A O     1 
HETATM 8213 O  O     . HOH O 7 .   ? 3.925   34.620 25.284  1.00 36.79  ? 1349 HOH A O     1 
HETATM 8214 O  O     . HOH O 7 .   ? 16.463  19.718 55.690  1.00 41.06  ? 1350 HOH A O     1 
HETATM 8215 O  O     . HOH O 7 .   ? 3.868   72.853 -0.774  1.00 34.19  ? 1351 HOH A O     1 
HETATM 8216 O  O     . HOH O 7 .   ? 14.160  62.334 28.295  1.00 39.53  ? 1352 HOH A O     1 
HETATM 8217 O  O     . HOH O 7 .   ? 39.440  35.762 34.470  1.00 53.27  ? 1353 HOH A O     1 
HETATM 8218 O  O     . HOH O 7 .   ? 20.344  29.075 64.350  1.00 48.99  ? 1354 HOH A O     1 
HETATM 8219 O  O     . HOH O 7 .   ? 5.693   49.235 7.550   1.00 39.50  ? 1355 HOH A O     1 
HETATM 8220 O  O     . HOH O 7 .   ? -9.835  30.605 39.881  1.00 37.54  ? 1356 HOH A O     1 
HETATM 8221 O  O     . HOH O 7 .   ? 25.189  26.250 39.260  1.00 38.74  ? 1357 HOH A O     1 
HETATM 8222 O  O     . HOH O 7 .   ? -12.312 20.386 4.394   1.00 53.89  ? 1358 HOH A O     1 
HETATM 8223 O  O     . HOH O 7 .   ? 2.948   47.533 37.886  1.00 47.92  ? 1359 HOH A O     1 
HETATM 8224 O  O     . HOH O 7 .   ? 6.051   35.017 8.309   1.00 42.62  ? 1360 HOH A O     1 
HETATM 8225 O  O     . HOH O 7 .   ? 25.700  40.442 26.187  1.00 53.65  ? 1361 HOH A O     1 
HETATM 8226 O  O     . HOH O 7 .   ? 16.933  63.886 33.156  1.00 43.68  ? 1362 HOH A O     1 
HETATM 8227 O  O     . HOH O 7 .   ? -21.458 44.171 5.254   1.00 36.21  ? 1363 HOH A O     1 
HETATM 8228 O  O     . HOH O 7 .   ? 13.035  72.510 16.416  1.00 35.91  ? 1364 HOH A O     1 
HETATM 8229 O  O     . HOH O 7 .   ? -3.334  40.775 44.287  1.00 54.36  ? 1365 HOH A O     1 
HETATM 8230 O  O     . HOH O 7 .   ? 24.669  28.938 39.152  1.00 51.08  ? 1366 HOH A O     1 
HETATM 8231 O  O     . HOH O 7 .   ? 1.032   33.939 56.946  1.00 55.33  ? 1367 HOH A O     1 
HETATM 8232 O  O     . HOH O 7 .   ? -19.587 49.688 53.344  1.00 49.39  ? 1368 HOH A O     1 
HETATM 8233 O  O     . HOH O 7 .   ? 20.779  30.908 35.968  1.00 40.31  ? 1369 HOH A O     1 
HETATM 8234 O  O     . HOH O 7 .   ? 12.993  60.518 33.217  1.00 38.21  ? 1370 HOH A O     1 
HETATM 8235 O  O     . HOH O 7 .   ? 21.892  27.406 37.676  1.00 43.15  ? 1371 HOH A O     1 
HETATM 8236 O  O     . HOH O 7 .   ? -6.300  34.341 17.682  1.00 36.45  ? 1372 HOH A O     1 
HETATM 8237 O  O     . HOH O 7 .   ? 20.856  68.064 11.221  1.00 41.33  ? 1373 HOH A O     1 
HETATM 8238 O  O     . HOH O 7 .   ? 21.261  22.276 49.161  1.00 42.25  ? 1374 HOH A O     1 
HETATM 8239 O  O     . HOH O 7 .   ? -14.185 28.749 39.626  1.00 37.25  ? 1375 HOH A O     1 
HETATM 8240 O  O     . HOH O 7 .   ? -9.586  65.799 5.068   1.00 42.17  ? 1376 HOH A O     1 
HETATM 8241 O  O     . HOH O 7 .   ? 31.670  39.861 30.018  1.00 53.92  ? 1377 HOH A O     1 
HETATM 8242 O  O     . HOH O 7 .   ? 19.211  26.232 37.252  1.00 43.37  ? 1378 HOH A O     1 
HETATM 8243 O  O     . HOH O 7 .   ? 14.876  35.063 12.578  1.00 50.24  ? 1379 HOH A O     1 
HETATM 8244 O  O     . HOH O 7 .   ? 2.721   38.390 24.626  1.00 42.56  ? 1380 HOH A O     1 
HETATM 8245 O  O     . HOH O 7 .   ? -2.255  44.088 41.655  1.00 35.20  ? 1381 HOH A O     1 
HETATM 8246 O  O     . HOH O 7 .   ? 18.055  51.961 44.145  1.00 40.68  ? 1382 HOH A O     1 
HETATM 8247 O  O     . HOH O 7 .   ? -14.177 56.463 11.389  1.00 40.47  ? 1383 HOH A O     1 
HETATM 8248 O  O     . HOH O 7 .   ? 22.977  23.008 41.387  1.00 45.29  ? 1384 HOH A O     1 
HETATM 8249 O  O     . HOH O 7 .   ? 19.123  21.913 54.223  1.00 39.02  ? 1385 HOH A O     1 
HETATM 8250 O  O     . HOH O 7 .   ? 5.527   74.934 30.323  1.00 38.00  ? 1386 HOH A O     1 
HETATM 8251 O  O     . HOH O 7 .   ? 2.187   6.729  13.216  1.00 59.70  ? 1387 HOH A O     1 
HETATM 8252 O  O     . HOH O 7 .   ? 3.138   11.296 13.274  1.00 81.85  ? 1388 HOH A O     1 
HETATM 8253 O  O     . HOH O 7 .   ? 3.191   9.385  10.588  1.00 56.04  ? 1389 HOH A O     1 
HETATM 8254 O  O     . HOH O 7 .   ? 3.236   34.580 48.927  1.00 48.80  ? 1390 HOH A O     1 
HETATM 8255 O  O     . HOH O 7 .   ? 4.254   35.397 51.157  1.00 45.52  ? 1391 HOH A O     1 
HETATM 8256 O  O     . HOH O 7 .   ? -21.874 38.463 37.081  1.00 47.89  ? 1392 HOH A O     1 
HETATM 8257 O  O     . HOH O 7 .   ? -5.312  40.653 42.379  1.00 46.08  ? 1393 HOH A O     1 
HETATM 8258 O  O     . HOH O 7 .   ? -5.302  43.225 41.368  1.00 23.10  ? 1394 HOH A O     1 
HETATM 8259 O  O     . HOH O 7 .   ? -4.955  45.156 39.430  1.00 44.50  ? 1395 HOH A O     1 
HETATM 8260 O  O     . HOH O 7 .   ? 9.147   42.378 12.193  1.00 20.06  ? 1396 HOH A O     1 
HETATM 8261 O  O     . HOH O 7 .   ? 16.854  45.867 24.216  1.00 47.64  ? 1397 HOH A O     1 
HETATM 8262 O  O     . HOH O 7 .   ? 36.399  55.953 30.458  1.00 42.17  ? 1398 HOH A O     1 
HETATM 8263 O  O     . HOH O 7 .   ? -9.874  29.044 18.926  1.00 17.30  ? 1399 HOH A O     1 
HETATM 8264 O  O     . HOH O 7 .   ? 14.219  31.333 36.336  1.00 31.92  ? 1400 HOH A O     1 
HETATM 8265 O  O     . HOH O 7 .   ? -8.573  37.668 31.571  1.00 49.48  ? 1401 HOH A O     1 
HETATM 8266 O  O     . HOH O 7 .   ? 15.380  27.057 39.059  1.00 34.98  ? 1402 HOH A O     1 
HETATM 8267 O  O     . HOH O 7 .   ? 14.727  24.022 38.411  1.00 53.09  ? 1403 HOH A O     1 
HETATM 8268 O  O     . HOH O 7 .   ? -3.961  28.504 31.448  1.00 38.73  ? 1404 HOH A O     1 
HETATM 8269 O  O     . HOH O 7 .   ? -2.898  15.396 41.801  1.00 48.27  ? 1405 HOH A O     1 
HETATM 8270 O  O     . HOH O 7 .   ? -41.512 28.903 14.910  1.00 49.54  ? 1406 HOH A O     1 
HETATM 8271 O  O     . HOH O 7 .   ? -8.720  43.012 46.478  1.00 28.46  ? 1407 HOH A O     1 
HETATM 8272 O  O     . HOH O 7 .   ? 22.980  30.149 36.852  1.00 53.83  ? 1408 HOH A O     1 
HETATM 8273 O  O     . HOH O 7 .   ? 3.572   8.520  54.169  1.00 32.99  ? 1409 HOH A O     1 
HETATM 8274 O  O     . HOH O 7 .   ? -13.375 47.036 22.022  1.00 36.75  ? 1410 HOH A O     1 
HETATM 8275 O  O     . HOH O 7 .   ? 20.908  69.682 21.360  1.00 42.69  ? 1411 HOH A O     1 
HETATM 8276 O  O     . HOH O 7 .   ? -3.121  80.523 2.054   1.00 43.89  ? 1412 HOH A O     1 
HETATM 8277 O  O     . HOH O 7 .   ? 10.156  71.223 20.966  1.00 43.22  ? 1413 HOH A O     1 
HETATM 8278 O  O     . HOH O 7 .   ? 12.479  72.098 20.124  1.00 31.64  ? 1414 HOH A O     1 
HETATM 8279 O  O     . HOH O 7 .   ? 28.005  33.266 47.960  1.00 40.15  ? 1415 HOH A O     1 
HETATM 8280 O  O     . HOH O 7 .   ? 24.927  51.204 58.180  1.00 43.76  ? 1416 HOH A O     1 
HETATM 8281 O  O     . HOH O 7 .   ? 28.392  41.154 48.537  1.00 41.00  ? 1417 HOH A O     1 
HETATM 8282 O  O     . HOH O 7 .   ? -17.926 47.736 6.351   1.00 37.62  ? 1418 HOH A O     1 
HETATM 8283 O  O     . HOH O 7 .   ? 23.329  52.181 20.182  1.00 39.68  ? 1419 HOH A O     1 
HETATM 8284 O  O     . HOH O 7 .   ? 23.588  53.816 21.718  1.00 42.32  ? 1420 HOH A O     1 
HETATM 8285 O  O     . HOH O 7 .   ? 25.981  53.565 20.175  1.00 51.55  ? 1421 HOH A O     1 
HETATM 8286 O  O     . HOH O 7 .   ? -3.541  22.461 55.419  1.00 39.16  ? 1422 HOH A O     1 
HETATM 8287 O  O     . HOH O 7 .   ? 14.004  29.463 25.442  1.00 47.07  ? 1423 HOH A O     1 
HETATM 8288 O  O     . HOH O 7 .   ? 20.773  37.113 29.952  1.00 46.80  ? 1424 HOH A O     1 
HETATM 8289 O  O     . HOH O 7 .   ? -24.794 42.018 56.215  1.00 42.89  ? 1425 HOH A O     1 
HETATM 8290 O  O     . HOH O 7 .   ? -32.358 35.344 18.743  1.00 61.89  ? 1426 HOH A O     1 
HETATM 8291 O  O     . HOH O 7 .   ? 4.623   47.729 35.349  1.00 43.51  ? 1427 HOH A O     1 
HETATM 8292 O  O     . HOH O 7 .   ? 5.137   47.930 42.282  1.00 43.91  ? 1428 HOH A O     1 
HETATM 8293 O  O     . HOH O 7 .   ? 5.304   48.552 44.583  1.00 46.74  ? 1429 HOH A O     1 
HETATM 8294 O  O     . HOH O 7 .   ? 1.640   45.863 51.158  1.00 40.83  ? 1430 HOH A O     1 
HETATM 8295 O  O     . HOH O 7 .   ? 7.856   50.341 38.551  1.00 39.13  ? 1431 HOH A O     1 
HETATM 8296 O  O     . HOH O 7 .   ? 1.745   44.347 29.242  1.00 43.81  ? 1432 HOH A O     1 
HETATM 8297 O  O     . HOH O 7 .   ? -0.773  45.247 27.942  1.00 46.18  ? 1433 HOH A O     1 
HETATM 8298 O  O     . HOH O 7 .   ? -2.821  42.846 25.272  1.00 51.66  ? 1434 HOH A O     1 
HETATM 8299 O  O     . HOH O 7 .   ? -1.963  44.436 14.534  1.00 50.05  ? 1435 HOH A O     1 
HETATM 8300 O  O     . HOH O 7 .   ? -3.304  43.560 12.266  1.00 44.73  ? 1436 HOH A O     1 
HETATM 8301 O  O     . HOH O 7 .   ? 9.844   39.261 11.627  1.00 46.43  ? 1437 HOH A O     1 
HETATM 8302 O  O     . HOH O 7 .   ? 18.948  75.341 33.782  1.00 51.00  ? 1438 HOH A O     1 
HETATM 8303 O  O     . HOH O 7 .   ? -15.343 46.071 31.788  1.00 35.03  ? 1439 HOH A O     1 
HETATM 8304 O  O     . HOH O 7 .   ? 11.682  24.625 27.158  1.00 42.02  ? 1440 HOH A O     1 
HETATM 8305 O  O     . HOH O 7 .   ? -28.116 54.667 46.104  1.00 47.26  ? 1441 HOH A O     1 
HETATM 8306 O  O     . HOH O 7 .   ? 9.870   76.122 5.593   1.00 33.08  ? 1442 HOH A O     1 
HETATM 8307 O  O     . HOH O 7 .   ? 4.011   76.766 6.074   1.00 38.48  ? 1443 HOH A O     1 
HETATM 8308 O  O     . HOH O 7 .   ? -5.713  80.183 1.894   1.00 42.59  ? 1444 HOH A O     1 
HETATM 8309 O  O     . HOH O 7 .   ? -31.977 39.158 14.213  1.00 38.89  ? 1445 HOH A O     1 
HETATM 8310 O  O     . HOH O 7 .   ? -32.174 40.514 16.070  1.00 53.95  ? 1446 HOH A O     1 
HETATM 8311 O  O     . HOH O 7 .   ? -31.905 34.513 11.005  1.00 57.66  ? 1447 HOH A O     1 
HETATM 8312 O  O     . HOH O 7 .   ? 17.130  37.122 24.384  1.00 46.97  ? 1448 HOH A O     1 
HETATM 8313 O  O     . HOH O 7 .   ? -1.102  42.708 43.791  1.00 51.37  ? 1449 HOH A O     1 
HETATM 8314 O  O     . HOH O 7 .   ? -3.278  66.066 11.880  1.00 40.79  ? 1450 HOH A O     1 
HETATM 8315 O  O     . HOH O 7 .   ? 24.404  69.778 6.206   1.00 48.47  ? 1451 HOH A O     1 
HETATM 8316 O  O     . HOH O 7 .   ? 26.031  68.485 5.506   1.00 47.67  ? 1452 HOH A O     1 
HETATM 8317 O  O     . HOH O 7 .   ? 15.970  81.909 41.638  1.00 57.70  ? 1453 HOH A O     1 
HETATM 8318 O  O     . HOH O 7 .   ? 6.903   43.660 1.287   1.00 53.94  ? 1454 HOH A O     1 
HETATM 8319 O  O     . HOH O 7 .   ? 3.777   9.889  15.044  1.00 72.57  ? 1455 HOH A O     1 
HETATM 8320 O  O     . HOH O 7 .   ? 24.515  31.608 37.942  1.00 43.85  ? 1456 HOH A O     1 
HETATM 8321 O  O     . HOH O 7 .   ? 18.751  35.436 32.854  1.00 34.71  ? 1457 HOH A O     1 
HETATM 8322 O  O     . HOH O 7 .   ? -23.283 36.431 57.703  1.00 45.20  ? 1458 HOH A O     1 
HETATM 8323 O  O     . HOH O 7 .   ? 35.303  62.884 34.180  1.00 45.31  ? 1459 HOH A O     1 
HETATM 8324 O  O     . HOH O 7 .   ? 13.911  14.906 50.558  1.00 45.12  ? 1460 HOH A O     1 
HETATM 8325 O  O     . HOH O 7 .   ? 16.887  13.902 46.978  1.00 48.70  ? 1461 HOH A O     1 
HETATM 8326 O  O     . HOH O 7 .   ? -7.292  17.798 9.393   1.00 45.43  ? 1462 HOH A O     1 
HETATM 8327 O  O     . HOH O 7 .   ? 29.842  79.845 26.995  1.00 41.37  ? 1463 HOH A O     1 
HETATM 8328 O  O     . HOH O 7 .   ? 0.408   27.140 29.473  1.00 62.18  ? 1464 HOH A O     1 
HETATM 8329 O  O     . HOH O 7 .   ? -3.425  22.421 -6.602  1.00 55.16  ? 1465 HOH A O     1 
HETATM 8330 O  O     . HOH O 7 .   ? -6.859  57.026 43.111  1.00 39.41  ? 1466 HOH A O     1 
HETATM 8331 O  O     . HOH O 7 .   ? -23.271 21.844 40.649  1.00 44.47  ? 1467 HOH A O     1 
HETATM 8332 O  O     . HOH O 7 .   ? -7.083  41.606 54.602  1.00 38.23  ? 1468 HOH A O     1 
HETATM 8333 O  O     . HOH O 7 .   ? 13.032  75.617 4.235   1.00 53.23  ? 1469 HOH A O     1 
HETATM 8334 O  O     . HOH O 7 .   ? -5.818  31.165 37.055  1.00 40.79  ? 1470 HOH A O     1 
HETATM 8335 O  O     . HOH O 7 .   ? -27.899 26.414 10.751  1.00 39.74  ? 1471 HOH A O     1 
HETATM 8336 O  O     . HOH O 7 .   ? 26.102  44.171 51.506  1.00 52.27  ? 1472 HOH A O     1 
HETATM 8337 O  O     . HOH O 7 .   ? 18.695  18.563 42.232  1.00 52.10  ? 1473 HOH A O     1 
HETATM 8338 O  O     . HOH O 7 .   ? 20.716  21.446 38.719  1.00 46.87  ? 1474 HOH A O     1 
HETATM 8339 O  O     . HOH O 7 .   ? 0.311   62.688 -6.880  1.00 47.82  ? 1475 HOH A O     1 
HETATM 8340 O  O     . HOH O 7 .   ? 8.071   17.435 40.626  1.00 48.36  ? 1476 HOH A O     1 
HETATM 8341 O  O     . HOH O 7 .   ? 6.501   55.421 -7.203  1.00 53.91  ? 1477 HOH A O     1 
HETATM 8342 O  O     . HOH O 7 .   ? 15.734  12.002 8.562   1.00 46.51  ? 1478 HOH A O     1 
HETATM 8343 O  O     . HOH O 7 .   ? 25.461  34.719 62.015  1.00 51.86  ? 1479 HOH A O     1 
HETATM 8344 O  O     . HOH O 7 .   ? -0.689  65.284 -7.097  1.00 42.61  ? 1480 HOH A O     1 
HETATM 8345 O  O     . HOH O 7 .   ? -16.865 47.855 36.276  1.00 40.00  ? 1481 HOH A O     1 
HETATM 8346 O  O     . HOH O 7 .   ? 23.552  31.541 55.764  1.00 42.91  ? 1482 HOH A O     1 
HETATM 8347 O  O     . HOH O 7 .   ? 4.672   57.954 -8.649  1.00 49.02  ? 1483 HOH A O     1 
HETATM 8348 O  O     . HOH O 7 .   ? 36.460  62.001 20.407  1.00 53.93  ? 1484 HOH A O     1 
HETATM 8349 O  O     . HOH O 7 .   ? -1.710  46.154 34.001  1.00 41.43  ? 1485 HOH A O     1 
HETATM 8350 O  O     . HOH O 7 .   ? 19.929  27.704 61.775  1.00 37.43  ? 1486 HOH A O     1 
HETATM 8351 O  O     . HOH O 7 .   ? -18.150 22.532 10.669  1.00 38.69  ? 1487 HOH A O     1 
HETATM 8352 O  O     . HOH O 7 .   ? 14.381  49.458 41.651  1.00 54.17  ? 1488 HOH A O     1 
HETATM 8353 O  O     . HOH O 7 .   ? 9.289   48.211 7.674   1.00 42.59  ? 1489 HOH A O     1 
HETATM 8354 O  O     . HOH O 7 .   ? -26.889 44.059 11.973  1.00 61.24  ? 1490 HOH A O     1 
HETATM 8355 O  O     . HOH O 7 .   ? 20.544  37.305 25.957  1.00 53.71  ? 1491 HOH A O     1 
HETATM 8356 O  O     . HOH O 7 .   ? 8.433   34.956 45.112  1.00 49.68  ? 1492 HOH A O     1 
HETATM 8357 O  O     . HOH O 7 .   ? -21.903 42.253 60.198  1.00 47.39  ? 1493 HOH A O     1 
HETATM 8358 O  O     . HOH O 7 .   ? 1.088   38.887 52.385  1.00 44.65  ? 1494 HOH A O     1 
HETATM 8359 O  O     . HOH O 7 .   ? -16.109 61.995 47.477  1.00 59.93  ? 1495 HOH A O     1 
HETATM 8360 O  O     . HOH O 7 .   ? -25.517 37.717 56.392  1.00 58.75  ? 1496 HOH A O     1 
HETATM 8361 O  O     . HOH O 7 .   ? 35.559  61.509 37.170  1.00 52.66  ? 1497 HOH A O     1 
HETATM 8362 O  O     . HOH O 7 .   ? 14.666  69.747 25.254  1.00 49.52  ? 1498 HOH A O     1 
HETATM 8363 O  O     . HOH O 7 .   ? 12.282  49.730 43.977  1.00 41.11  ? 1499 HOH A O     1 
HETATM 8364 O  O     . HOH O 7 .   ? 39.901  40.482 39.672  1.00 38.94  ? 1500 HOH A O     1 
HETATM 8365 O  O     . HOH O 7 .   ? 18.298  32.765 29.154  1.00 44.96  ? 1501 HOH A O     1 
HETATM 8366 O  O     . HOH O 7 .   ? 17.331  86.104 30.169  1.00 48.20  ? 1502 HOH A O     1 
HETATM 8367 O  O     . HOH O 7 .   ? 15.022  87.912 29.888  1.00 34.05  ? 1503 HOH A O     1 
HETATM 8368 O  O     . HOH O 7 .   ? 24.638  42.382 23.562  1.00 54.33  ? 1504 HOH A O     1 
HETATM 8369 O  O     . HOH O 7 .   ? 2.477   36.127 54.240  1.00 49.60  ? 1505 HOH A O     1 
HETATM 8370 O  O     . HOH O 7 .   ? -12.535 31.532 29.679  1.00 33.35  ? 1506 HOH A O     1 
HETATM 8371 O  O     . HOH O 7 .   ? -12.833 28.966 30.876  1.00 44.30  ? 1507 HOH A O     1 
HETATM 8372 O  O     . HOH O 7 .   ? -18.451 25.498 37.205  1.00 45.71  ? 1508 HOH A O     1 
HETATM 8373 O  O     . HOH O 7 .   ? -28.212 26.939 41.684  1.00 46.52  ? 1509 HOH A O     1 
HETATM 8374 O  O     . HOH O 7 .   ? -9.044  59.958 15.066  1.00 48.32  ? 1510 HOH A O     1 
HETATM 8375 O  O     . HOH O 7 .   ? 16.402  52.877 8.172   1.00 46.65  ? 1511 HOH A O     1 
HETATM 8376 O  O     . HOH O 7 .   ? 18.161  55.021 10.018  1.00 48.44  ? 1512 HOH A O     1 
HETATM 8377 O  O     . HOH O 7 .   ? -5.774  39.516 28.384  1.00 52.44  ? 1513 HOH A O     1 
HETATM 8378 O  O     . HOH O 7 .   ? 11.048  44.514 7.608   1.00 30.03  ? 1514 HOH A O     1 
HETATM 8379 O  O     . HOH O 7 .   ? 2.225   33.234 27.466  1.00 29.71  ? 1515 HOH A O     1 
HETATM 8380 O  O     . HOH O 7 .   ? -7.453  50.805 37.618  1.00 39.21  ? 1516 HOH A O     1 
HETATM 8381 O  O     . HOH O 7 .   ? -38.391 29.308 12.998  1.00 45.31  ? 1517 HOH A O     1 
HETATM 8382 O  O     . HOH O 7 .   ? 11.111  9.559  53.967  1.00 42.77  ? 1518 HOH A O     1 
HETATM 8383 O  O     . HOH O 7 .   ? 9.059   10.564 56.459  1.00 51.92  ? 1519 HOH A O     1 
HETATM 8384 O  O     . HOH O 7 .   ? 24.975  56.268 53.027  1.00 49.99  ? 1520 HOH A O     1 
HETATM 8385 O  O     . HOH O 7 .   ? -14.245 44.496 58.740  1.00 42.87  ? 1521 HOH A O     1 
HETATM 8386 O  O     . HOH O 7 .   ? 19.105  57.545 10.058  1.00 55.47  ? 1522 HOH A O     1 
HETATM 8387 O  O     . HOH O 7 .   ? 21.855  29.699 61.168  1.00 51.46  ? 1523 HOH A O     1 
HETATM 8388 O  O     . HOH O 7 .   ? 13.711  54.059 38.832  1.00 42.57  ? 1524 HOH A O     1 
HETATM 8389 O  O     . HOH O 7 .   ? 15.003  60.859 35.911  1.00 54.31  ? 1525 HOH A O     1 
HETATM 8390 O  O     . HOH O 7 .   ? 20.787  43.174 23.314  1.00 47.32  ? 1526 HOH A O     1 
HETATM 8391 O  O     . HOH O 7 .   ? -19.690 27.161 2.442   1.00 52.57  ? 1527 HOH A O     1 
HETATM 8392 O  O     . HOH O 7 .   ? 15.987  75.365 27.846  1.00 50.47  ? 1528 HOH A O     1 
HETATM 8393 O  O     . HOH O 7 .   ? 16.342  78.339 28.557  1.00 45.33  ? 1529 HOH A O     1 
HETATM 8394 O  O     . HOH O 7 .   ? 4.970   60.344 -10.343 1.00 47.08  ? 1530 HOH A O     1 
HETATM 8395 O  O     . HOH O 7 .   ? 7.071   59.445 -11.515 1.00 45.66  ? 1531 HOH A O     1 
HETATM 8396 O  O     . HOH O 7 .   ? -11.219 57.772 47.133  1.00 46.86  ? 1532 HOH A O     1 
HETATM 8397 O  O     . HOH O 7 .   ? 5.317   17.449 28.165  1.00 45.18  ? 1533 HOH A O     1 
HETATM 8398 O  O     . HOH O 7 .   ? 8.168   73.143 21.971  1.00 47.67  ? 1534 HOH A O     1 
HETATM 8399 O  O     . HOH O 7 .   ? -9.938  60.660 8.007   1.00 54.64  ? 1535 HOH A O     1 
HETATM 8400 O  O     . HOH O 7 .   ? -30.942 38.222 17.564  1.00 50.47  ? 1536 HOH A O     1 
HETATM 8401 O  O     . HOH O 7 .   ? -44.184 32.966 9.779   1.00 40.78  ? 1537 HOH A O     1 
HETATM 8402 O  O     . HOH O 7 .   ? 8.521   53.148 63.690  1.00 56.78  ? 1538 HOH A O     1 
HETATM 8403 O  O     . HOH O 7 .   ? 11.438  52.786 62.861  1.00 49.88  ? 1539 HOH A O     1 
HETATM 8404 O  O     . HOH O 7 .   ? 9.163   53.694 60.152  1.00 47.16  ? 1540 HOH A O     1 
HETATM 8405 O  O     . HOH O 7 .   ? 7.224   51.211 61.456  1.00 43.82  ? 1541 HOH A O     1 
HETATM 8406 O  O     . HOH O 7 .   ? -5.239  19.224 10.812  1.00 77.71  ? 1542 HOH A O     1 
HETATM 8407 O  O     . HOH O 7 .   ? -4.339  20.087 7.766   1.00 58.92  ? 1543 HOH A O     1 
HETATM 8408 O  O     . HOH O 7 .   ? -7.189  22.066 7.492   1.00 53.68  ? 1544 HOH A O     1 
HETATM 8409 O  O     . HOH O 7 .   ? -32.515 31.468 38.101  1.00 38.27  ? 1545 HOH A O     1 
HETATM 8410 O  O     . HOH O 7 .   ? 0.864   40.756 13.948  1.00 55.44  ? 1546 HOH A O     1 
HETATM 8411 O  O     . HOH O 7 .   ? 3.142   40.905 9.381   1.00 43.14  ? 1547 HOH A O     1 
HETATM 8412 O  O     . HOH P 7 .   ? -0.885  57.306 19.749  1.00 23.64  ? 101  HOH T O     1 
HETATM 8413 O  O     . HOH P 7 .   ? -24.170 51.131 41.655  1.00 32.85  ? 102  HOH T O     1 
HETATM 8414 O  O     . HOH P 7 .   ? -4.813  63.331 22.758  1.00 32.77  ? 103  HOH T O     1 
HETATM 8415 O  O     . HOH P 7 .   ? -4.332  55.761 18.000  1.00 24.72  ? 104  HOH T O     1 
HETATM 8416 O  O     . HOH P 7 .   ? -18.183 51.179 16.388  1.00 24.18  ? 105  HOH T O     1 
HETATM 8417 O  O     . HOH P 7 .   ? 0.444   53.803 27.372  1.00 36.18  ? 106  HOH T O     1 
HETATM 8418 O  O     . HOH P 7 .   ? -10.881 57.202 13.617  1.00 35.74  ? 107  HOH T O     1 
HETATM 8419 O  O     . HOH P 7 .   ? -5.375  60.079 25.515  1.00 30.59  ? 108  HOH T O     1 
HETATM 8420 O  O     . HOH P 7 .   ? -2.916  55.867 26.524  1.00 30.39  ? 109  HOH T O     1 
HETATM 8421 O  O     . HOH P 7 .   ? -2.481  53.256 26.851  1.00 43.39  ? 110  HOH T O     1 
HETATM 8422 O  O     . HOH P 7 .   ? -48.311 63.505 23.636  1.00 39.28  ? 111  HOH T O     1 
HETATM 8423 O  O     . HOH P 7 .   ? -1.201  57.373 27.998  1.00 40.54  ? 112  HOH T O     1 
HETATM 8424 O  O     . HOH P 7 .   ? -0.089  62.131 27.895  1.00 31.29  ? 113  HOH T O     1 
HETATM 8425 O  O     . HOH P 7 .   ? -20.373 47.085 18.624  1.00 37.11  ? 114  HOH T O     1 
HETATM 8426 O  O     . HOH P 7 .   ? -7.212  63.423 21.236  1.00 36.05  ? 115  HOH T O     1 
HETATM 8427 O  O     . HOH P 7 .   ? -2.167  60.257 27.567  1.00 39.72  ? 116  HOH T O     1 
HETATM 8428 O  O     . HOH P 7 .   ? -14.201 58.983 15.590  1.00 47.01  ? 117  HOH T O     1 
HETATM 8429 O  O     . HOH P 7 .   ? -20.016 49.699 34.731  1.00 34.14  ? 118  HOH T O     1 
HETATM 8430 O  O     . HOH P 7 .   ? 4.314   56.400 32.870  1.00 37.64  ? 119  HOH T O     1 
HETATM 8431 O  O     . HOH P 7 .   ? -11.048 57.550 25.295  1.00 39.11  ? 120  HOH T O     1 
HETATM 8432 O  O     . HOH P 7 .   ? -18.216 54.798 16.225  1.00 35.54  ? 121  HOH T O     1 
HETATM 8433 O  O     . HOH P 7 .   ? 5.782   53.457 30.166  1.00 37.95  ? 122  HOH T O     1 
HETATM 8434 O  O     . HOH P 7 .   ? -22.009 53.727 36.847  1.00 32.08  ? 123  HOH T O     1 
HETATM 8435 O  O     . HOH P 7 .   ? -5.699  63.728 25.342  1.00 40.90  ? 124  HOH T O     1 
HETATM 8436 O  O     . HOH P 7 .   ? -27.924 54.175 30.362  1.00 38.70  ? 125  HOH T O     1 
HETATM 8437 O  O     . HOH P 7 .   ? -43.317 70.255 26.405  1.00 47.44  ? 126  HOH T O     1 
HETATM 8438 O  O     . HOH P 7 .   ? -7.383  60.586 23.640  1.00 34.98  ? 127  HOH T O     1 
HETATM 8439 O  O     . HOH P 7 .   ? -1.074  51.518 27.138  1.00 41.16  ? 128  HOH T O     1 
HETATM 8440 O  O     . HOH P 7 .   ? 2.176   64.015 31.092  1.00 29.34  ? 129  HOH T O     1 
HETATM 8441 O  O     . HOH P 7 .   ? -20.445 49.886 17.451  1.00 30.79  ? 130  HOH T O     1 
HETATM 8442 O  O     . HOH P 7 .   ? -17.849 55.956 25.922  1.00 43.40  ? 131  HOH T O     1 
HETATM 8443 O  O     . HOH P 7 .   ? -18.416 54.933 22.932  1.00 42.30  ? 132  HOH T O     1 
HETATM 8444 O  O     . HOH P 7 .   ? -6.881  66.015 19.252  1.00 33.11  ? 133  HOH T O     1 
HETATM 8445 O  O     . HOH P 7 .   ? -38.300 62.610 27.178  1.00 50.59  ? 134  HOH T O     1 
HETATM 8446 O  O     . HOH P 7 .   ? -28.158 52.833 32.528  1.00 43.23  ? 135  HOH T O     1 
HETATM 8447 O  O     . HOH P 7 .   ? -18.366 57.296 24.116  1.00 45.82  ? 136  HOH T O     1 
HETATM 8448 O  O     . HOH P 7 .   ? 4.526   57.914 36.239  1.00 54.78  ? 137  HOH T O     1 
HETATM 8449 O  O     . HOH P 7 .   ? -11.233 60.763 17.271  1.00 44.16  ? 138  HOH T O     1 
HETATM 8450 O  O     . HOH P 7 .   ? -11.579 64.374 17.073  1.00 53.30  ? 139  HOH T O     1 
HETATM 8451 O  O     . HOH P 7 .   ? -26.652 45.543 31.194  1.00 53.89  ? 140  HOH T O     1 
HETATM 8452 O  O     . HOH P 7 .   ? -15.829 56.311 24.065  1.00 49.38  ? 141  HOH T O     1 
HETATM 8453 O  O     . HOH P 7 .   ? -13.973 57.811 22.834  1.00 50.35  ? 142  HOH T O     1 
HETATM 8454 O  O     . HOH P 7 .   ? -12.950 57.979 20.608  1.00 53.78  ? 143  HOH T O     1 
HETATM 8455 O  O     . HOH P 7 .   ? -33.414 64.862 29.265  1.00 66.37  ? 144  HOH T O     1 
HETATM 8456 O  O     . HOH P 7 .   ? -40.369 61.883 24.900  1.00 44.44  ? 145  HOH T O     1 
HETATM 8457 O  O     . HOH P 7 .   ? -41.369 60.913 27.921  1.00 50.64  ? 146  HOH T O     1 
HETATM 8458 O  O     . HOH P 7 .   ? -9.421  56.924 27.742  1.00 49.01  ? 147  HOH T O     1 
HETATM 8459 O  O     . HOH P 7 .   ? 12.916  62.187 36.741  1.00 50.87  ? 148  HOH T O     1 
HETATM 8460 O  O     . HOH P 7 .   ? -43.749 61.309 23.627  1.00 53.65  ? 149  HOH T O     1 
HETATM 8461 O  O     . HOH Q 7 .   ? -4.081  53.284 17.292  1.00 18.46  ? 201  HOH P O     1 
HETATM 8462 O  O     . HOH Q 7 .   ? -17.382 50.669 34.603  1.00 37.80  ? 202  HOH P O     1 
HETATM 8463 O  O     . HOH Q 7 .   ? -12.589 49.328 22.118  1.00 35.17  ? 203  HOH P O     1 
HETATM 8464 O  O     . HOH Q 7 .   ? -8.201  39.744 21.921  1.00 25.30  ? 204  HOH P O     1 
HETATM 8465 O  O     . HOH Q 7 .   ? -3.538  45.156 23.885  1.00 38.94  ? 205  HOH P O     1 
HETATM 8466 O  O     . HOH Q 7 .   ? -42.899 49.234 35.696  1.00 52.30  ? 206  HOH P O     1 
HETATM 8467 O  O     . HOH Q 7 .   ? -6.792  48.957 28.779  1.00 39.44  ? 207  HOH P O     1 
HETATM 8468 O  O     . HOH Q 7 .   ? -4.452  46.887 13.498  1.00 37.67  ? 208  HOH P O     1 
HETATM 8469 O  O     . HOH Q 7 .   ? -18.816 57.614 27.517  1.00 38.65  ? 209  HOH P O     1 
HETATM 8470 O  O     . HOH Q 7 .   ? -17.777 59.637 29.065  1.00 36.00  ? 210  HOH P O     1 
HETATM 8471 O  O     . HOH Q 7 .   ? -7.895  46.608 33.930  1.00 36.09  ? 211  HOH P O     1 
HETATM 8472 O  O     . HOH Q 7 .   ? -8.996  50.101 35.006  1.00 30.52  ? 212  HOH P O     1 
HETATM 8473 O  O     . HOH Q 7 .   ? -10.774 52.431 35.098  1.00 26.69  ? 213  HOH P O     1 
HETATM 8474 O  O     . HOH Q 7 .   ? -12.996 57.585 35.287  1.00 40.20  ? 214  HOH P O     1 
HETATM 8475 O  O     . HOH Q 7 .   ? -1.448  45.235 22.232  1.00 35.48  ? 215  HOH P O     1 
HETATM 8476 O  O     . HOH Q 7 .   ? -8.167  40.515 29.099  1.00 41.01  ? 216  HOH P O     1 
HETATM 8477 O  O     . HOH Q 7 .   ? -8.504  55.064 30.064  1.00 37.30  ? 217  HOH P O     1 
HETATM 8478 O  O     . HOH Q 7 .   ? -4.557  48.998 26.877  1.00 31.82  ? 218  HOH P O     1 
HETATM 8479 O  O     . HOH Q 7 .   ? -19.686 55.446 36.896  1.00 45.29  ? 219  HOH P O     1 
HETATM 8480 O  O     . HOH Q 7 .   ? -5.999  45.384 24.837  1.00 43.27  ? 220  HOH P O     1 
HETATM 8481 O  O     . HOH Q 7 .   ? -11.246 55.520 38.254  1.00 30.73  ? 221  HOH P O     1 
HETATM 8482 O  O     . HOH Q 7 .   ? -2.236  47.331 24.902  1.00 42.32  ? 222  HOH P O     1 
HETATM 8483 O  O     . HOH Q 7 .   ? -5.031  42.582 21.959  1.00 43.98  ? 223  HOH P O     1 
HETATM 8484 O  O     . HOH Q 7 .   ? -6.201  51.005 33.259  1.00 41.93  ? 224  HOH P O     1 
HETATM 8485 O  O     . HOH Q 7 .   ? -7.030  48.812 31.893  1.00 41.06  ? 225  HOH P O     1 
HETATM 8486 O  O     . HOH Q 7 .   ? -20.102 64.003 36.721  1.00 44.82  ? 226  HOH P O     1 
HETATM 8487 O  O     . HOH Q 7 .   ? -5.592  44.971 27.694  1.00 43.79  ? 227  HOH P O     1 
HETATM 8488 O  O     . HOH Q 7 .   ? -41.771 56.595 31.385  1.00 58.57  ? 228  HOH P O     1 
HETATM 8489 O  O     . HOH Q 7 .   ? -43.897 58.114 29.318  1.00 60.22  ? 229  HOH P O     1 
HETATM 8490 O  O     . HOH Q 7 .   ? -31.281 65.241 27.865  1.00 52.78  ? 230  HOH P O     1 
HETATM 8491 O  O     . HOH Q 7 .   ? -33.183 64.475 27.021  1.00 50.21  ? 231  HOH P O     1 
HETATM 8492 O  O     . HOH Q 7 .   ? -7.374  38.006 26.061  1.00 38.83  ? 232  HOH P O     1 
HETATM 8493 O  O     . HOH Q 7 .   ? -8.424  55.555 39.379  1.00 38.91  ? 233  HOH P O     1 
HETATM 8494 O  O     . HOH Q 7 .   ? -6.965  40.964 25.106  1.00 51.78  ? 234  HOH P O     1 
HETATM 8495 O  O     . HOH Q 7 .   ? -3.016  45.365 20.113  1.00 37.90  ? 235  HOH P O     1 
HETATM 8496 O  O     . HOH Q 7 .   ? -41.383 46.206 37.070  1.00 62.76  ? 236  HOH P O     1 
HETATM 8497 O  O     . HOH Q 7 .   ? -18.649 52.339 36.676  1.00 34.66  ? 237  HOH P O     1 
HETATM 8498 O  O     . HOH Q 7 .   ? -39.334 49.035 31.771  1.00 60.32  ? 238  HOH P O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 1   ? 0.6353 0.6695 1.2222 0.1087  0.1482  0.1352  1   MET A N     
2    C CA    . MET A 1   ? 0.5994 0.6236 1.1380 0.1018  0.1502  0.1209  1   MET A CA    
3    C C     . MET A 1   ? 0.5409 0.5860 1.0886 0.0938  0.1369  0.1209  1   MET A C     
4    O O     . MET A 1   ? 0.4813 0.5486 1.0720 0.0931  0.1222  0.1314  1   MET A O     
5    C CB    . MET A 1   ? 0.6236 0.6356 1.1168 0.0941  0.1341  0.1110  1   MET A CB    
6    C CG    . MET A 1   ? 0.6241 0.6517 1.1325 0.0886  0.1041  0.1161  1   MET A CG    
7    S SD    . MET A 1   ? 0.8410 0.8561 1.2927 0.0773  0.0863  0.1032  1   MET A SD    
8    C CE    . MET A 1   ? 0.4397 0.4252 0.8634 0.0835  0.1060  0.0985  1   MET A CE    
9    N N     . LYS A 2   ? 0.5551 0.5917 1.0616 0.0874  0.1416  0.1095  2   LYS A N     
10   C CA    . LYS A 2   ? 0.5426 0.5955 1.0503 0.0797  0.1299  0.1080  2   LYS A CA    
11   C C     . LYS A 2   ? 0.5172 0.5796 1.0125 0.0701  0.1007  0.1050  2   LYS A C     
12   O O     . LYS A 2   ? 0.5328 0.5835 0.9953 0.0667  0.0936  0.0981  2   LYS A O     
13   C CB    . LYS A 2   ? 0.5818 0.6208 1.0484 0.0763  0.1441  0.0976  2   LYS A CB    
14   C CG    . LYS A 2   ? 0.6296 0.6564 1.1037 0.0843  0.1738  0.1001  2   LYS A CG    
15   C CD    . LYS A 2   ? 0.6367 0.6845 1.1621 0.0879  0.1773  0.1112  2   LYS A CD    
16   C CE    . LYS A 2   ? 0.6137 0.6768 1.1344 0.0787  0.1617  0.1085  2   LYS A CE    
17   N NZ    . LYS A 2   ? 0.6137 0.6925 1.1747 0.0788  0.1629  0.1185  2   LYS A NZ    
18   N N     . GLU A 3   ? 0.4713 0.5524 0.9912 0.0653  0.0848  0.1104  3   GLU A N     
19   C CA    . GLU A 3   ? 0.4454 0.5317 0.9508 0.0559  0.0587  0.1078  3   GLU A CA    
20   C C     . GLU A 3   ? 0.4075 0.4860 0.8659 0.0489  0.0577  0.0952  3   GLU A C     
21   O O     . GLU A 3   ? 0.4219 0.4988 0.8690 0.0491  0.0710  0.0910  3   GLU A O     
22   C CB    . GLU A 3   ? 0.4656 0.5700 1.0062 0.0516  0.0427  0.1167  3   GLU A CB    
23   C CG    . GLU A 3   ? 0.5245 0.6400 1.1175 0.0569  0.0388  0.1316  3   GLU A CG    
24   C CD    . GLU A 3   ? 0.5737 0.7035 1.1930 0.0488  0.0141  0.1403  3   GLU A CD    
25   O OE1   . GLU A 3   ? 0.6312 0.7651 1.2803 0.0482  0.0052  0.1517  3   GLU A OE1   
26   O OE2   . GLU A 3   ? 0.5671 0.6965 1.1627 0.0400  0.0036  0.1340  3   GLU A OE2   
27   N N     . PHE A 4   ? 0.3563 0.4297 0.7885 0.0428  0.0421  0.0901  4   PHE A N     
28   C CA    . PHE A 4   ? 0.3377 0.4064 0.7312 0.0362  0.0395  0.0801  4   PHE A CA    
29   C C     . PHE A 4   ? 0.3166 0.3856 0.6972 0.0287  0.0187  0.0786  4   PHE A C     
30   O O     . PHE A 4   ? 0.3275 0.3922 0.7114 0.0282  0.0078  0.0819  4   PHE A O     
31   C CB    . PHE A 4   ? 0.3461 0.3998 0.7069 0.0373  0.0521  0.0724  4   PHE A CB    
32   C CG    . PHE A 4   ? 0.3722 0.4156 0.7218 0.0374  0.0466  0.0716  4   PHE A CG    
33   C CD1   . PHE A 4   ? 0.4210 0.4589 0.7900 0.0447  0.0537  0.0773  4   PHE A CD1   
34   C CD2   . PHE A 4   ? 0.3588 0.3970 0.6792 0.0307  0.0359  0.0657  4   PHE A CD2   
35   C CE1   . PHE A 4   ? 0.4327 0.4597 0.7903 0.0450  0.0487  0.0768  4   PHE A CE1   
36   C CE2   . PHE A 4   ? 0.3651 0.3926 0.6740 0.0304  0.0314  0.0651  4   PHE A CE2   
37   C CZ    . PHE A 4   ? 0.4100 0.4315 0.7365 0.0374  0.0372  0.0704  4   PHE A CZ    
38   N N     . TYR A 5   ? 0.2829 0.3546 0.6474 0.0230  0.0140  0.0741  5   TYR A N     
39   C CA    . TYR A 5   ? 0.2431 0.3115 0.5924 0.0160  -0.0029 0.0725  5   TYR A CA    
40   C C     . TYR A 5   ? 0.3094 0.3664 0.6274 0.0136  -0.0043 0.0663  5   TYR A C     
41   O O     . TYR A 5   ? 0.2508 0.3038 0.5549 0.0159  0.0072  0.0620  5   TYR A O     
42   C CB    . TYR A 5   ? 0.2366 0.3091 0.5773 0.0117  -0.0041 0.0695  5   TYR A CB    
43   C CG    . TYR A 5   ? 0.2783 0.3495 0.5948 0.0119  0.0075  0.0622  5   TYR A CG    
44   C CD1   . TYR A 5   ? 0.2301 0.3054 0.5517 0.0158  0.0218  0.0617  5   TYR A CD1   
45   C CD2   . TYR A 5   ? 0.2817 0.3467 0.5705 0.0078  0.0039  0.0567  5   TYR A CD2   
46   C CE1   . TYR A 5   ? 0.2296 0.3028 0.5286 0.0148  0.0296  0.0563  5   TYR A CE1   
47   C CE2   . TYR A 5   ? 0.2317 0.2975 0.5030 0.0074  0.0126  0.0519  5   TYR A CE2   
48   C CZ    . TYR A 5   ? 0.2676 0.3375 0.5436 0.0105  0.0241  0.0520  5   TYR A CZ    
49   O OH    . TYR A 5   ? 0.2683 0.3381 0.5264 0.0090  0.0301  0.0484  5   TYR A OH    
50   N N     . LEU A 6   ? 0.3128 0.3625 0.6180 0.0082  -0.0186 0.0662  6   LEU A N     
51   C CA    . LEU A 6   ? 0.3080 0.3465 0.5831 0.0050  -0.0198 0.0607  6   LEU A CA    
52   C C     . LEU A 6   ? 0.3126 0.3488 0.5660 -0.0002 -0.0215 0.0558  6   LEU A C     
53   O O     . LEU A 6   ? 0.2999 0.3362 0.5361 -0.0009 -0.0132 0.0506  6   LEU A O     
54   C CB    . LEU A 6   ? 0.3129 0.3408 0.5864 0.0031  -0.0330 0.0646  6   LEU A CB    
55   C CG    . LEU A 6   ? 0.3333 0.3620 0.6286 0.0091  -0.0311 0.0704  6   LEU A CG    
56   C CD1   . LEU A 6   ? 0.3372 0.3576 0.6377 0.0066  -0.0485 0.0771  6   LEU A CD1   
57   C CD2   . LEU A 6   ? 0.3539 0.3762 0.6326 0.0120  -0.0184 0.0651  6   LEU A CD2   
58   N N     . THR A 7   ? 0.3171 0.3499 0.5719 -0.0043 -0.0323 0.0582  7   THR A N     
59   C CA    . THR A 7   ? 0.3102 0.3373 0.5445 -0.0087 -0.0328 0.0542  7   THR A CA    
60   C C     . THR A 7   ? 0.3094 0.3392 0.5565 -0.0107 -0.0387 0.0574  7   THR A C     
61   O O     . THR A 7   ? 0.3411 0.3740 0.6099 -0.0111 -0.0476 0.0637  7   THR A O     
62   C CB    . THR A 7   ? 0.3335 0.3417 0.5407 -0.0142 -0.0411 0.0526  7   THR A CB    
63   O OG1   . THR A 7   ? 0.3555 0.3545 0.5684 -0.0177 -0.0570 0.0581  7   THR A OG1   
64   C CG2   . THR A 7   ? 0.3115 0.3160 0.5058 -0.0131 -0.0358 0.0498  7   THR A CG2   
65   N N     . VAL A 8   ? 0.2695 0.2981 0.5046 -0.0122 -0.0337 0.0540  8   VAL A N     
66   C CA    . VAL A 8   ? 0.2816 0.3096 0.5244 -0.0150 -0.0392 0.0564  8   VAL A CA    
67   C C     . VAL A 8   ? 0.3046 0.3171 0.5193 -0.0191 -0.0386 0.0523  8   VAL A C     
68   O O     . VAL A 8   ? 0.3230 0.3353 0.5230 -0.0169 -0.0279 0.0479  8   VAL A O     
69   C CB    . VAL A 8   ? 0.2895 0.3350 0.5557 -0.0104 -0.0296 0.0579  8   VAL A CB    
70   C CG1   . VAL A 8   ? 0.2449 0.2954 0.4991 -0.0072 -0.0159 0.0530  8   VAL A CG1   
71   C CG2   . VAL A 8   ? 0.2809 0.3258 0.5591 -0.0140 -0.0368 0.0617  8   VAL A CG2   
72   N N     . GLU A 9   ? 0.3117 0.3096 0.5187 -0.0254 -0.0500 0.0543  9   GLU A N     
73   C CA    . GLU A 9   ? 0.3741 0.3522 0.5517 -0.0293 -0.0478 0.0504  9   GLU A CA    
74   C C     . GLU A 9   ? 0.4263 0.3988 0.6081 -0.0338 -0.0544 0.0528  9   GLU A C     
75   O O     . GLU A 9   ? 0.4588 0.4390 0.6640 -0.0362 -0.0654 0.0584  9   GLU A O     
76   C CB    . GLU A 9   ? 0.3984 0.3506 0.5449 -0.0352 -0.0557 0.0490  9   GLU A CB    
77   C CG    . GLU A 9   ? 0.4267 0.3814 0.5666 -0.0320 -0.0500 0.0468  9   GLU A CG    
78   C CD    . GLU A 9   ? 0.4402 0.3977 0.5683 -0.0277 -0.0325 0.0420  9   GLU A CD    
79   O OE1   . GLU A 9   ? 0.4061 0.3644 0.5325 -0.0260 -0.0240 0.0405  9   GLU A OE1   
80   O OE2   . GLU A 9   ? 0.4709 0.4298 0.5929 -0.0261 -0.0275 0.0404  9   GLU A OE2   
81   N N     . GLN A 10  ? 0.4166 0.3753 0.5773 -0.0348 -0.0472 0.0491  10  GLN A N     
82   C CA    . GLN A 10  ? 0.4192 0.3652 0.5755 -0.0406 -0.0540 0.0506  10  GLN A CA    
83   C C     . GLN A 10  ? 0.4837 0.3931 0.5989 -0.0486 -0.0599 0.0480  10  GLN A C     
84   O O     . GLN A 10  ? 0.5177 0.4125 0.6072 -0.0462 -0.0468 0.0431  10  GLN A O     
85   C CB    . GLN A 10  ? 0.4237 0.3799 0.5878 -0.0352 -0.0400 0.0490  10  GLN A CB    
86   C CG    . GLN A 10  ? 0.4763 0.4167 0.6332 -0.0416 -0.0461 0.0502  10  GLN A CG    
87   C CD    . GLN A 10  ? 0.4815 0.4274 0.6410 -0.0362 -0.0315 0.0484  10  GLN A CD    
88   O OE1   . GLN A 10  ? 0.4810 0.4482 0.6556 -0.0277 -0.0189 0.0478  10  GLN A OE1   
89   N NE2   . GLN A 10  ? 0.4738 0.3985 0.6169 -0.0416 -0.0338 0.0480  10  GLN A NE2   
90   N N     . ILE A 11  ? 0.5316 0.4247 0.6405 -0.0585 -0.0795 0.0519  11  ILE A N     
91   C CA    . ILE A 11  ? 0.5919 0.4442 0.6563 -0.0683 -0.0875 0.0498  11  ILE A CA    
92   C C     . ILE A 11  ? 0.6228 0.4605 0.6836 -0.0773 -0.0991 0.0525  11  ILE A C     
93   O O     . ILE A 11  ? 0.6486 0.4875 0.7243 -0.0856 -0.1199 0.0593  11  ILE A O     
94   C CB    . ILE A 11  ? 0.6361 0.4738 0.6871 -0.0751 -0.1044 0.0527  11  ILE A CB    
95   C CG1   . ILE A 11  ? 0.6401 0.4981 0.7042 -0.0664 -0.0953 0.0515  11  ILE A CG1   
96   C CG2   . ILE A 11  ? 0.6927 0.4831 0.6887 -0.0847 -0.1085 0.0492  11  ILE A CG2   
97   C CD1   . ILE A 11  ? 0.6642 0.5152 0.7055 -0.0601 -0.0740 0.0445  11  ILE A CD1   
98   N N     . GLY A 12  ? 0.5981 0.4224 0.6409 -0.0759 -0.0858 0.0481  12  GLY A N     
99   C CA    . GLY A 12  ? 0.6099 0.4192 0.6475 -0.0842 -0.0945 0.0500  12  GLY A CA    
100  C C     . GLY A 12  ? 0.5843 0.4290 0.6717 -0.0822 -0.1001 0.0563  12  GLY A C     
101  O O     . GLY A 12  ? 0.5567 0.4310 0.6718 -0.0713 -0.0846 0.0555  12  GLY A O     
102  N N     . ASP A 13  ? 0.5941 0.4349 0.6928 -0.0934 -0.1225 0.0632  13  ASP A N     
103  C CA    . ASP A 13  ? 0.5636 0.4364 0.7116 -0.0926 -0.1279 0.0706  13  ASP A CA    
104  C C     . ASP A 13  ? 0.5399 0.4430 0.7271 -0.0880 -0.1340 0.0768  13  ASP A C     
105  O O     . ASP A 13  ? 0.5148 0.4439 0.7458 -0.0873 -0.1388 0.0843  13  ASP A O     
106  C CB    . ASP A 13  ? 0.5949 0.4497 0.7405 -0.1075 -0.1486 0.0765  13  ASP A CB    
107  C CG    . ASP A 13  ? 0.6576 0.4841 0.7691 -0.1113 -0.1406 0.0708  13  ASP A CG    
108  O OD1   . ASP A 13  ? 0.6370 0.4675 0.7402 -0.1002 -0.1174 0.0639  13  ASP A OD1   
109  O OD2   . ASP A 13  ? 0.7290 0.5286 0.8224 -0.1257 -0.1578 0.0738  13  ASP A OD2   
110  N N     . SER A 14  ? 0.5404 0.4388 0.7120 -0.0845 -0.1323 0.0739  14  SER A N     
111  C CA    . SER A 14  ? 0.5228 0.4458 0.7275 -0.0798 -0.1372 0.0795  14  SER A CA    
112  C C     . SER A 14  ? 0.4990 0.4435 0.7127 -0.0659 -0.1157 0.0742  14  SER A C     
113  O O     . SER A 14  ? 0.4834 0.4170 0.6677 -0.0618 -0.1017 0.0663  14  SER A O     
114  C CB    . SER A 14  ? 0.5310 0.4318 0.7147 -0.0887 -0.1573 0.0827  14  SER A CB    
115  O OG    . SER A 14  ? 0.5481 0.4385 0.7394 -0.1018 -0.1821 0.0916  14  SER A OG    
116  N N     . ILE A 15  ? 0.4748 0.4490 0.7301 -0.0591 -0.1127 0.0793  15  ILE A N     
117  C CA    . ILE A 15  ? 0.4480 0.4395 0.7109 -0.0480 -0.0965 0.0756  15  ILE A CA    
118  C C     . ILE A 15  ? 0.4468 0.4373 0.7142 -0.0486 -0.1074 0.0795  15  ILE A C     
119  O O     . ILE A 15  ? 0.4553 0.4560 0.7540 -0.0506 -0.1198 0.0885  15  ILE A O     
120  C CB    . ILE A 15  ? 0.3947 0.4149 0.6955 -0.0397 -0.0833 0.0781  15  ILE A CB    
121  C CG1   . ILE A 15  ? 0.4162 0.4374 0.7083 -0.0373 -0.0697 0.0732  15  ILE A CG1   
122  C CG2   . ILE A 15  ? 0.3246 0.3591 0.6341 -0.0304 -0.0713 0.0762  15  ILE A CG2   
123  C CD1   . ILE A 15  ? 0.4372 0.4519 0.6999 -0.0323 -0.0558 0.0649  15  ILE A CD1   
124  N N     . PHE A 16  ? 0.4275 0.4053 0.6652 -0.0471 -0.1028 0.0736  16  PHE A N     
125  C CA    . PHE A 16  ? 0.4321 0.4075 0.6711 -0.0470 -0.1115 0.0767  16  PHE A CA    
126  C C     . PHE A 16  ? 0.3864 0.3829 0.6437 -0.0362 -0.0958 0.0749  16  PHE A C     
127  O O     . PHE A 16  ? 0.3879 0.3856 0.6286 -0.0315 -0.0802 0.0676  16  PHE A O     
128  C CB    . PHE A 16  ? 0.4725 0.4172 0.6657 -0.0534 -0.1174 0.0722  16  PHE A CB    
129  C CG    . PHE A 16  ? 0.5409 0.4592 0.7142 -0.0659 -0.1384 0.0762  16  PHE A CG    
130  C CD1   . PHE A 16  ? 0.5567 0.4678 0.7365 -0.0724 -0.1601 0.0845  16  PHE A CD1   
131  C CD2   . PHE A 16  ? 0.5800 0.4790 0.7275 -0.0718 -0.1371 0.0722  16  PHE A CD2   
132  C CE1   . PHE A 16  ? 0.5800 0.4642 0.7388 -0.0858 -0.1821 0.0889  16  PHE A CE1   
133  C CE2   . PHE A 16  ? 0.5926 0.4628 0.7169 -0.0849 -0.1572 0.0757  16  PHE A CE2   
134  C CZ    . PHE A 16  ? 0.5879 0.4505 0.7170 -0.0926 -0.1806 0.0841  16  PHE A CZ    
135  N N     . GLU A 17  ? 0.3344 0.3466 0.6266 -0.0327 -0.0999 0.0823  17  GLU A N     
136  C CA    . GLU A 17  ? 0.2911 0.3200 0.6001 -0.0228 -0.0844 0.0811  17  GLU A CA    
137  C C     . GLU A 17  ? 0.3557 0.3826 0.6722 -0.0210 -0.0915 0.0856  17  GLU A C     
138  O O     . GLU A 17  ? 0.3042 0.3325 0.6437 -0.0235 -0.1065 0.0951  17  GLU A O     
139  C CB    . GLU A 17  ? 0.2732 0.3234 0.6196 -0.0172 -0.0749 0.0854  17  GLU A CB    
140  C CG    . GLU A 17  ? 0.3927 0.4551 0.7526 -0.0076 -0.0579 0.0841  17  GLU A CG    
141  C CD    . GLU A 17  ? 0.3870 0.4667 0.7852 -0.0021 -0.0486 0.0901  17  GLU A CD    
142  O OE1   . GLU A 17  ? 0.3872 0.4731 0.7897 0.0052  -0.0312 0.0876  17  GLU A OE1   
143  O OE2   . GLU A 17  ? 0.4029 0.4883 0.8257 -0.0059 -0.0585 0.0976  17  GLU A OE2   
144  N N     . ARG A 18  ? 0.3506 0.3739 0.6486 -0.0169 -0.0811 0.0796  18  ARG A N     
145  C CA    . ARG A 18  ? 0.3092 0.3326 0.6168 -0.0129 -0.0827 0.0833  18  ARG A CA    
146  C C     . ARG A 18  ? 0.2974 0.3375 0.6291 -0.0034 -0.0647 0.0833  18  ARG A C     
147  O O     . ARG A 18  ? 0.2921 0.3372 0.6140 -0.0008 -0.0498 0.0766  18  ARG A O     
148  C CB    . ARG A 18  ? 0.3215 0.3281 0.5923 -0.0150 -0.0819 0.0769  18  ARG A CB    
149  C CG    . ARG A 18  ? 0.3757 0.3602 0.6170 -0.0246 -0.0978 0.0768  18  ARG A CG    
150  C CD    . ARG A 18  ? 0.3900 0.3580 0.5936 -0.0264 -0.0922 0.0696  18  ARG A CD    
151  N NE    . ARG A 18  ? 0.3567 0.3233 0.5629 -0.0229 -0.0920 0.0713  18  ARG A NE    
152  C CZ    . ARG A 18  ? 0.3862 0.3431 0.5669 -0.0230 -0.0844 0.0657  18  ARG A CZ    
153  N NH1   . ARG A 18  ? 0.3969 0.3466 0.5508 -0.0259 -0.0757 0.0587  18  ARG A NH1   
154  N NH2   . ARG A 18  ? 0.3902 0.3445 0.5736 -0.0201 -0.0848 0.0678  18  ARG A NH2   
155  N N     . TYR A 19  ? 0.3418 0.3890 0.7048 0.0017  -0.0659 0.0914  19  TYR A N     
156  C CA    . TYR A 19  ? 0.3506 0.4093 0.7353 0.0110  -0.0470 0.0920  19  TYR A CA    
157  C C     . TYR A 19  ? 0.3296 0.3879 0.7358 0.0174  -0.0461 0.0990  19  TYR A C     
158  O O     . TYR A 19  ? 0.3324 0.3860 0.7464 0.0148  -0.0628 0.1060  19  TYR A O     
159  C CB    . TYR A 19  ? 0.3688 0.4424 0.7835 0.0126  -0.0419 0.0965  19  TYR A CB    
160  C CG    . TYR A 19  ? 0.4024 0.4845 0.8567 0.0112  -0.0563 0.1093  19  TYR A CG    
161  C CD1   . TYR A 19  ? 0.4196 0.4965 0.8693 0.0014  -0.0784 0.1129  19  TYR A CD1   
162  C CD2   . TYR A 19  ? 0.4018 0.4960 0.8985 0.0193  -0.0477 0.1186  19  TYR A CD2   
163  C CE1   . TYR A 19  ? 0.4204 0.5053 0.9074 -0.0015 -0.0943 0.1258  19  TYR A CE1   
164  C CE2   . TYR A 19  ? 0.4190 0.5237 0.9577 0.0179  -0.0616 0.1322  19  TYR A CE2   
165  C CZ    . TYR A 19  ? 0.4285 0.5293 0.9627 0.0068  -0.0864 0.1360  19  TYR A CZ    
166  O OH    . TYR A 19  ? 0.4281 0.5392 1.0048 0.0037  -0.1031 0.1507  19  TYR A OH    
167  N N     . ILE A 20  ? 0.3123 0.3732 0.7259 0.0257  -0.0262 0.0973  20  ILE A N     
168  C CA    . ILE A 20  ? 0.3184 0.3783 0.7553 0.0338  -0.0201 0.1041  20  ILE A CA    
169  C C     . ILE A 20  ? 0.3701 0.4448 0.8528 0.0403  -0.0112 0.1136  20  ILE A C     
170  O O     . ILE A 20  ? 0.4002 0.4799 0.8839 0.0425  0.0046  0.1099  20  ILE A O     
171  C CB    . ILE A 20  ? 0.3188 0.3668 0.7301 0.0384  -0.0015 0.0959  20  ILE A CB    
172  C CG1   . ILE A 20  ? 0.2863 0.3210 0.6552 0.0316  -0.0094 0.0874  20  ILE A CG1   
173  C CG2   . ILE A 20  ? 0.2913 0.3354 0.7264 0.0480  0.0081  0.1030  20  ILE A CG2   
174  C CD1   . ILE A 20  ? 0.2972 0.3238 0.6655 0.0293  -0.0266 0.0925  20  ILE A CD1   
175  N N     . ASP A 21  ? 0.3950 0.4768 0.9169 0.0431  -0.0212 0.1266  21  ASP A N     
176  C CA    . ASP A 21  ? 0.4071 0.5053 0.9791 0.0490  -0.0132 0.1375  21  ASP A CA    
177  C C     . ASP A 21  ? 0.4462 0.5418 1.0356 0.0618  0.0138  0.1396  21  ASP A C     
178  O O     . ASP A 21  ? 0.4461 0.5257 1.0052 0.0654  0.0259  0.1317  21  ASP A O     
179  C CB    . ASP A 21  ? 0.3835 0.4931 0.9966 0.0456  -0.0368 0.1528  21  ASP A CB    
180  C CG    . ASP A 21  ? 0.3546 0.4575 0.9776 0.0491  -0.0468 0.1606  21  ASP A CG    
181  O OD1   . ASP A 21  ? 0.3690 0.4625 0.9845 0.0580  -0.0293 0.1576  21  ASP A OD1   
182  O OD2   . ASP A 21  ? 0.3389 0.4442 0.9761 0.0424  -0.0730 0.1702  21  ASP A OD2   
183  N N     . SER A 22  ? 0.4593 0.5687 1.0956 0.0677  0.0236  0.1505  22  SER A N     
184  C CA    . SER A 22  ? 0.4866 0.5883 1.1308 0.0773  0.0521  0.1516  22  SER A CA    
185  C C     . SER A 22  ? 0.5045 0.5955 1.1532 0.0842  0.0548  0.1560  22  SER A C     
186  O O     . SER A 22  ? 0.5291 0.6068 1.1716 0.0931  0.0798  0.1537  22  SER A O     
187  C CB    . SER A 22  ? 0.5052 0.6168 1.1819 0.0757  0.0592  0.1611  22  SER A CB    
188  O OG    . SER A 22  ? 0.5295 0.6516 1.2358 0.0695  0.0361  0.1733  22  SER A OG    
189  N N     . ASN A 23  ? 0.4997 0.5940 1.1568 0.0798  0.0293  0.1623  23  ASN A N     
190  C CA    . ASN A 23  ? 0.5129 0.5970 1.1738 0.0857  0.0291  0.1671  23  ASN A CA    
191  C C     . ASN A 23  ? 0.5090 0.5753 1.1278 0.0860  0.0242  0.1568  23  ASN A C     
192  O O     . ASN A 23  ? 0.5287 0.5832 1.1439 0.0901  0.0225  0.1595  23  ASN A O     
193  C CB    . ASN A 23  ? 0.5178 0.6121 1.2091 0.0797  0.0046  0.1809  23  ASN A CB    
194  C CG    . ASN A 23  ? 0.5154 0.6242 1.2464 0.0777  0.0098  0.1918  23  ASN A CG    
195  O OD1   . ASN A 23  ? 0.4846 0.6047 1.2314 0.0678  -0.0110 0.1983  23  ASN A OD1   
196  N ND2   . ASN A 23  ? 0.5382 0.6438 1.2838 0.0867  0.0381  0.1942  23  ASN A ND2   
197  N N     . GLY A 24  ? 0.4933 0.5548 1.0678 0.0769  0.0224  0.1429  24  GLY A N     
198  C CA    . GLY A 24  ? 0.4585 0.5015 0.9790 0.0714  0.0200  0.1299  24  GLY A CA    
199  C C     . GLY A 24  ? 0.4589 0.4999 0.9619 0.0613  -0.0083 0.1300  24  GLY A C     
200  O O     . GLY A 24  ? 0.5180 0.5437 0.9809 0.0569  -0.0116 0.1215  24  GLY A O     
201  N N     . ARG A 25  ? 0.4249 0.4796 0.9562 0.0567  -0.0285 0.1398  25  ARG A N     
202  C CA    . ARG A 25  ? 0.4367 0.4854 0.9503 0.0464  -0.0561 0.1412  25  ARG A CA    
203  C C     . ARG A 25  ? 0.4008 0.4499 0.8851 0.0352  -0.0657 0.1326  25  ARG A C     
204  O O     . ARG A 25  ? 0.3834 0.4454 0.8834 0.0344  -0.0610 0.1328  25  ARG A O     
205  C CB    . ARG A 25  ? 0.5098 0.5684 1.0697 0.0469  -0.0761 0.1589  25  ARG A CB    
206  C CG    . ARG A 25  ? 0.5931 0.6433 1.1343 0.0343  -0.1071 0.1618  25  ARG A CG    
207  C CD    . ARG A 25  ? 0.6648 0.7225 1.2511 0.0346  -0.1285 0.1808  25  ARG A CD    
208  N NE    . ARG A 25  ? 0.7394 0.7925 1.3145 0.0203  -0.1586 0.1850  25  ARG A NE    
209  C CZ    . ARG A 25  ? 0.8128 0.8677 1.4159 0.0156  -0.1852 0.2011  25  ARG A CZ    
210  N NH1   . ARG A 25  ? 0.8394 0.9004 1.4738 0.0211  -0.1796 0.2104  25  ARG A NH1   
211  N NH2   . ARG A 25  ? 0.8372 0.8829 1.4215 0.0009  -0.2123 0.2034  25  ARG A NH2   
212  N N     . GLU A 26  ? 0.4007 0.4342 0.8423 0.0269  -0.0774 0.1253  26  GLU A N     
213  C CA    . GLU A 26  ? 0.3865 0.4167 0.7978 0.0169  -0.0849 0.1172  26  GLU A CA    
214  C C     . GLU A 26  ? 0.4068 0.4398 0.8328 0.0086  -0.1085 0.1260  26  GLU A C     
215  O O     . GLU A 26  ? 0.4008 0.4257 0.8310 0.0046  -0.1285 0.1346  26  GLU A O     
216  C CB    . GLU A 26  ? 0.3955 0.4067 0.7568 0.0111  -0.0868 0.1069  26  GLU A CB    
217  C CG    . GLU A 26  ? 0.4467 0.4510 0.7778 0.0010  -0.0956 0.1006  26  GLU A CG    
218  C CD    . GLU A 26  ? 0.4785 0.4643 0.7632 -0.0041 -0.0945 0.0913  26  GLU A CD    
219  O OE1   . GLU A 26  ? 0.4689 0.4513 0.7425 0.0002  -0.0821 0.0866  26  GLU A OE1   
220  O OE2   . GLU A 26  ? 0.5074 0.4805 0.7660 -0.0126 -0.1054 0.0889  26  GLU A OE2   
221  N N     . ARG A 27  ? 0.4350 0.4774 0.8667 0.0052  -0.1069 0.1241  27  ARG A N     
222  C CA    . ARG A 27  ? 0.4341 0.4770 0.8759 -0.0043 -0.1289 0.1315  27  ARG A CA    
223  C C     . ARG A 27  ? 0.4226 0.4549 0.8246 -0.0128 -0.1299 0.1209  27  ARG A C     
224  O O     . ARG A 27  ? 0.4230 0.4521 0.7973 -0.0104 -0.1131 0.1093  27  ARG A O     
225  C CB    . ARG A 27  ? 0.4399 0.5053 0.9354 -0.0003 -0.1267 0.1423  27  ARG A CB    
226  C CG    . ARG A 27  ? 0.4736 0.5521 1.0116 0.0121  -0.1139 0.1510  27  ARG A CG    
227  C CD    . ARG A 27  ? 0.5238 0.5959 1.0747 0.0119  -0.1322 0.1620  27  ARG A CD    
228  N NE    . ARG A 27  ? 0.5858 0.6664 1.1730 0.0050  -0.1571 0.1776  27  ARG A NE    
229  C CZ    . ARG A 27  ? 0.6172 0.7134 1.2567 0.0101  -0.1566 0.1918  27  ARG A CZ    
230  N NH1   . ARG A 27  ? 0.6010 0.7039 1.2598 0.0228  -0.1307 0.1918  27  ARG A NH1   
231  N NH2   . ARG A 27  ? 0.6569 0.7544 1.3140 -0.0008 -0.1772 0.2027  27  ARG A NH2   
232  N N     . THR A 28  ? 0.4310 0.4566 0.8305 -0.0232 -0.1500 0.1257  28  THR A N     
233  C CA    . THR A 28  ? 0.4314 0.4450 0.7959 -0.0310 -0.1504 0.1169  28  THR A CA    
234  C C     . THR A 28  ? 0.4406 0.4598 0.8277 -0.0383 -0.1646 0.1247  28  THR A C     
235  O O     . THR A 28  ? 0.4641 0.4802 0.8684 -0.0451 -0.1874 0.1363  28  THR A O     
236  C CB    . THR A 28  ? 0.4567 0.4406 0.7696 -0.0396 -0.1614 0.1112  28  THR A CB    
237  O OG1   . THR A 28  ? 0.5166 0.4964 0.8066 -0.0335 -0.1452 0.1024  28  THR A OG1   
238  C CG2   . THR A 28  ? 0.4456 0.4143 0.7256 -0.0480 -0.1629 0.1043  28  THR A CG2   
239  N N     . ARG A 29  ? 0.4307 0.4579 0.8185 -0.0376 -0.1522 0.1193  29  ARG A N     
240  C CA    . ARG A 29  ? 0.4396 0.4715 0.8474 -0.0450 -0.1639 0.1260  29  ARG A CA    
241  C C     . ARG A 29  ? 0.4778 0.4935 0.8470 -0.0519 -0.1617 0.1165  29  ARG A C     
242  O O     . ARG A 29  ? 0.4684 0.4829 0.8142 -0.0465 -0.1424 0.1055  29  ARG A O     
243  C CB    . ARG A 29  ? 0.3950 0.4559 0.8550 -0.0366 -0.1505 0.1324  29  ARG A CB    
244  C CG    . ARG A 29  ? 0.3396 0.4108 0.7945 -0.0260 -0.1217 0.1224  29  ARG A CG    
245  C CD    . ARG A 29  ? 0.3031 0.3984 0.8075 -0.0177 -0.1078 0.1297  29  ARG A CD    
246  N NE    . ARG A 29  ? 0.3117 0.4127 0.8088 -0.0072 -0.0814 0.1213  29  ARG A NE    
247  C CZ    . ARG A 29  ? 0.3609 0.4769 0.8917 0.0022  -0.0641 0.1257  29  ARG A CZ    
248  N NH1   . ARG A 29  ? 0.3791 0.5090 0.9584 0.0035  -0.0691 0.1391  29  ARG A NH1   
249  N NH2   . ARG A 29  ? 0.3664 0.4818 0.8818 0.0099  -0.0417 0.1174  29  ARG A NH2   
250  N N     . GLU A 30  ? 0.5316 0.5336 0.8944 -0.0643 -0.1822 0.1216  30  GLU A N     
251  C CA    . GLU A 30  ? 0.5330 0.5179 0.8627 -0.0712 -0.1804 0.1141  30  GLU A CA    
252  C C     . GLU A 30  ? 0.5014 0.5052 0.8676 -0.0717 -0.1782 0.1194  30  GLU A C     
253  O O     . GLU A 30  ? 0.5474 0.5549 0.9410 -0.0798 -0.1976 0.1308  30  GLU A O     
254  C CB    . GLU A 30  ? 0.5877 0.5375 0.8770 -0.0860 -0.2039 0.1151  30  GLU A CB    
255  C CG    . GLU A 30  ? 0.6692 0.5963 0.9216 -0.0936 -0.2016 0.1077  30  GLU A CG    
256  C CD    . GLU A 30  ? 0.7797 0.6666 0.9878 -0.1094 -0.2247 0.1090  30  GLU A CD    
257  O OE1   . GLU A 30  ? 0.8163 0.6939 1.0229 -0.1151 -0.2443 0.1162  30  GLU A OE1   
258  O OE2   . GLU A 30  ? 0.8256 0.6875 0.9979 -0.1164 -0.2230 0.1029  30  GLU A OE2   
259  N N     . VAL A 31  ? 0.4372 0.4531 0.8050 -0.0635 -0.1552 0.1120  31  VAL A N     
260  C CA    . VAL A 31  ? 0.4095 0.4434 0.8111 -0.0629 -0.1499 0.1165  31  VAL A CA    
261  C C     . VAL A 31  ? 0.4210 0.4371 0.7923 -0.0702 -0.1499 0.1105  31  VAL A C     
262  O O     . VAL A 31  ? 0.3984 0.4027 0.7340 -0.0667 -0.1359 0.0997  31  VAL A O     
263  C CB    . VAL A 31  ? 0.3895 0.4483 0.8162 -0.0489 -0.1242 0.1140  31  VAL A CB    
264  C CG1   . VAL A 31  ? 0.4085 0.4828 0.8660 -0.0487 -0.1172 0.1183  31  VAL A CG1   
265  C CG2   . VAL A 31  ? 0.3644 0.4384 0.8218 -0.0414 -0.1224 0.1204  31  VAL A CG2   
266  N N     . GLU A 32  ? 0.4658 0.4793 0.8527 -0.0806 -0.1657 0.1183  32  GLU A N     
267  C CA    . GLU A 32  ? 0.4727 0.4699 0.8355 -0.0874 -0.1646 0.1136  32  GLU A CA    
268  C C     . GLU A 32  ? 0.4335 0.4536 0.8205 -0.0776 -0.1418 0.1114  32  GLU A C     
269  O O     . GLU A 32  ? 0.4272 0.4608 0.8477 -0.0807 -0.1442 0.1188  32  GLU A O     
270  C CB    . GLU A 32  ? 0.5160 0.5011 0.8865 -0.1034 -0.1909 0.1233  32  GLU A CB    
271  C CG    . GLU A 32  ? 0.5686 0.5125 0.8822 -0.1159 -0.2020 0.1169  32  GLU A CG    
272  N N     . TYR A 33  ? 0.4129 0.4367 0.7825 -0.0665 -0.1204 0.1019  33  TYR A N     
273  C CA    . TYR A 33  ? 0.3883 0.4323 0.7764 -0.0563 -0.0983 0.0996  33  TYR A CA    
274  C C     . TYR A 33  ? 0.4371 0.4752 0.8199 -0.0604 -0.0946 0.0984  33  TYR A C     
275  O O     . TYR A 33  ? 0.4580 0.4723 0.8033 -0.0654 -0.0969 0.0924  33  TYR A O     
276  C CB    . TYR A 33  ? 0.3545 0.3989 0.7187 -0.0460 -0.0804 0.0900  33  TYR A CB    
277  C CG    . TYR A 33  ? 0.3405 0.4028 0.7187 -0.0362 -0.0590 0.0878  33  TYR A CG    
278  C CD1   . TYR A 33  ? 0.3016 0.3850 0.7183 -0.0308 -0.0517 0.0940  33  TYR A CD1   
279  C CD2   . TYR A 33  ? 0.3283 0.3845 0.6804 -0.0323 -0.0459 0.0801  33  TYR A CD2   
280  C CE1   . TYR A 33  ? 0.2760 0.3709 0.6998 -0.0228 -0.0321 0.0919  33  TYR A CE1   
281  C CE2   . TYR A 33  ? 0.2913 0.3616 0.6534 -0.0244 -0.0285 0.0789  33  TYR A CE2   
282  C CZ    . TYR A 33  ? 0.2843 0.3723 0.6795 -0.0202 -0.0218 0.0844  33  TYR A CZ    
283  O OH    . TYR A 33  ? 0.2965 0.3936 0.6960 -0.0133 -0.0045 0.0830  33  TYR A OH    
284  N N     . LYS A 34  ? 0.4378 0.4958 0.8575 -0.0578 -0.0873 0.1043  34  LYS A N     
285  C CA    . LYS A 34  ? 0.4619 0.5163 0.8798 -0.0608 -0.0818 0.1037  34  LYS A CA    
286  C C     . LYS A 34  ? 0.3823 0.4470 0.7965 -0.0492 -0.0576 0.0978  34  LYS A C     
287  O O     . LYS A 34  ? 0.3410 0.4257 0.7857 -0.0427 -0.0456 0.1018  34  LYS A O     
288  C CB    . LYS A 34  ? 0.5126 0.5804 0.9740 -0.0675 -0.0907 0.1153  34  LYS A CB    
289  C CG    . LYS A 34  ? 0.5913 0.6496 1.0598 -0.0807 -0.1180 0.1233  34  LYS A CG    
290  C CD    . LYS A 34  ? 0.6372 0.7164 1.1608 -0.0854 -0.1258 0.1373  34  LYS A CD    
291  C CE    . LYS A 34  ? 0.6772 0.7585 1.2102 -0.0884 -0.1176 0.1385  34  LYS A CE    
292  N NZ    . LYS A 34  ? 0.6930 0.7970 1.2842 -0.0925 -0.1223 0.1529  34  LYS A NZ    
293  N N     . PRO A 35  ? 0.3610 0.4107 0.7373 -0.0466 -0.0501 0.0889  35  PRO A N     
294  C CA    . PRO A 35  ? 0.3540 0.4123 0.7241 -0.0362 -0.0300 0.0841  35  PRO A CA    
295  C C     . PRO A 35  ? 0.3824 0.4431 0.7608 -0.0363 -0.0215 0.0859  35  PRO A C     
296  O O     . PRO A 35  ? 0.4191 0.4690 0.7974 -0.0448 -0.0306 0.0885  35  PRO A O     
297  C CB    . PRO A 35  ? 0.3411 0.3816 0.6712 -0.0348 -0.0280 0.0760  35  PRO A CB    
298  C CG    . PRO A 35  ? 0.3751 0.3918 0.6861 -0.0454 -0.0426 0.0761  35  PRO A CG    
299  C CD    . PRO A 35  ? 0.3694 0.3913 0.7067 -0.0536 -0.0598 0.0840  35  PRO A CD    
300  N N     . SER A 36  ? 0.3507 0.4231 0.7340 -0.0278 -0.0047 0.0847  36  SER A N     
301  C CA    . SER A 36  ? 0.3668 0.4395 0.7535 -0.0271 0.0048  0.0860  36  SER A CA    
302  C C     . SER A 36  ? 0.3744 0.4408 0.7334 -0.0206 0.0159  0.0802  36  SER A C     
303  O O     . SER A 36  ? 0.3763 0.4478 0.7256 -0.0143 0.0220  0.0768  36  SER A O     
304  C CB    . SER A 36  ? 0.3698 0.4600 0.7888 -0.0237 0.0153  0.0919  36  SER A CB    
305  O OG    . SER A 36  ? 0.4023 0.4998 0.8536 -0.0298 0.0055  0.0995  36  SER A OG    
306  N N     . LEU A 37  ? 0.3209 0.3759 0.6682 -0.0227 0.0176  0.0797  37  LEU A N     
307  C CA    . LEU A 37  ? 0.3049 0.3560 0.6328 -0.0161 0.0287  0.0766  37  LEU A CA    
308  C C     . LEU A 37  ? 0.3467 0.3997 0.6846 -0.0159 0.0367  0.0804  37  LEU A C     
309  O O     . LEU A 37  ? 0.3750 0.4302 0.7328 -0.0217 0.0333  0.0848  37  LEU A O     
310  C CB    . LEU A 37  ? 0.3089 0.3404 0.6089 -0.0173 0.0252  0.0724  37  LEU A CB    
311  C CG    . LEU A 37  ? 0.3081 0.3358 0.5945 -0.0168 0.0199  0.0684  37  LEU A CG    
312  C CD1   . LEU A 37  ? 0.3350 0.3384 0.5929 -0.0192 0.0177  0.0647  37  LEU A CD1   
313  C CD2   . LEU A 37  ? 0.2599 0.3020 0.5460 -0.0085 0.0285  0.0670  37  LEU A CD2   
314  N N     . PHE A 38  ? 0.3400 0.3921 0.6653 -0.0097 0.0469  0.0796  38  PHE A N     
315  C CA    . PHE A 38  ? 0.3208 0.3744 0.6536 -0.0088 0.0557  0.0834  38  PHE A CA    
316  C C     . PHE A 38  ? 0.3706 0.4108 0.6848 -0.0067 0.0595  0.0830  38  PHE A C     
317  O O     . PHE A 38  ? 0.3691 0.4033 0.6657 -0.0026 0.0596  0.0801  38  PHE A O     
318  C CB    . PHE A 38  ? 0.3024 0.3682 0.6403 -0.0031 0.0659  0.0849  38  PHE A CB    
319  C CG    . PHE A 38  ? 0.3214 0.3986 0.6779 -0.0038 0.0654  0.0857  38  PHE A CG    
320  C CD1   . PHE A 38  ? 0.3048 0.3858 0.6564 -0.0022 0.0601  0.0823  38  PHE A CD1   
321  C CD2   . PHE A 38  ? 0.3306 0.4141 0.7107 -0.0057 0.0714  0.0906  38  PHE A CD2   
322  C CE1   . PHE A 38  ? 0.3101 0.4002 0.6790 -0.0022 0.0602  0.0836  38  PHE A CE1   
323  C CE2   . PHE A 38  ? 0.3155 0.4089 0.7153 -0.0051 0.0727  0.0923  38  PHE A CE2   
324  C CZ    . PHE A 38  ? 0.3097 0.4062 0.7034 -0.0032 0.0668  0.0888  38  PHE A CZ    
325  N N     . ALA A 39  ? 0.3723 0.4079 0.6924 -0.0092 0.0636  0.0865  39  ALA A N     
326  C CA    . ALA A 39  ? 0.3471 0.3697 0.6516 -0.0065 0.0685  0.0872  39  ALA A CA    
327  C C     . ALA A 39  ? 0.3279 0.3548 0.6394 -0.0046 0.0782  0.0918  39  ALA A C     
328  O O     . ALA A 39  ? 0.3148 0.3493 0.6447 -0.0083 0.0805  0.0946  39  ALA A O     
329  C CB    . ALA A 39  ? 0.3686 0.3726 0.6665 -0.0137 0.0621  0.0864  39  ALA A CB    
330  N N     . HIS A 40  ? 0.3345 0.3558 0.6318 0.0012  0.0843  0.0933  40  HIS A N     
331  C CA    . HIS A 40  ? 0.3540 0.3750 0.6526 0.0025  0.0931  0.0980  40  HIS A CA    
332  C C     . HIS A 40  ? 0.3842 0.3970 0.6930 -0.0045 0.0939  0.1004  40  HIS A C     
333  O O     . HIS A 40  ? 0.4481 0.4500 0.7550 -0.0094 0.0874  0.0988  40  HIS A O     
334  C CB    . HIS A 40  ? 0.3940 0.4086 0.6756 0.0095  0.0968  0.1004  40  HIS A CB    
335  C CG    . HIS A 40  ? 0.4319 0.4565 0.7067 0.0152  0.0961  0.1004  40  HIS A CG    
336  N ND1   . HIS A 40  ? 0.4506 0.4743 0.7165 0.0209  0.0937  0.1006  40  HIS A ND1   
337  C CD2   . HIS A 40  ? 0.4311 0.4654 0.7065 0.0156  0.0977  0.1006  40  HIS A CD2   
338  C CE1   . HIS A 40  ? 0.4408 0.4753 0.7041 0.0237  0.0921  0.1015  40  HIS A CE1   
339  N NE2   . HIS A 40  ? 0.4215 0.4609 0.6879 0.0203  0.0943  0.1010  40  HIS A NE2   
340  N N     . CYS A 41  ? 0.3632 0.3794 0.6817 -0.0057 0.1022  0.1046  41  CYS A N     
341  C CA    . CYS A 41  ? 0.4107 0.4214 0.7430 -0.0130 0.1040  0.1080  41  CYS A CA    
342  C C     . CYS A 41  ? 0.4465 0.4519 0.7733 -0.0107 0.1161  0.1127  41  CYS A C     
343  O O     . CYS A 41  ? 0.4374 0.4449 0.7517 -0.0045 0.1219  0.1134  41  CYS A O     
344  C CB    . CYS A 41  ? 0.4137 0.4373 0.7739 -0.0189 0.1017  0.1094  41  CYS A CB    
345  S SG    . CYS A 41  ? 0.4819 0.5187 0.8545 -0.0147 0.1155  0.1123  41  CYS A SG    
346  N N     . PRO A 42  ? 0.5116 0.5082 0.8455 -0.0164 0.1192  0.1164  42  PRO A N     
347  C CA    . PRO A 42  ? 0.5545 0.5438 0.8816 -0.0146 0.1314  0.1212  42  PRO A CA    
348  C C     . PRO A 42  ? 0.6062 0.6047 0.9418 -0.0132 0.1426  0.1235  42  PRO A C     
349  O O     . PRO A 42  ? 0.6182 0.6297 0.9738 -0.0150 0.1419  0.1227  42  PRO A O     
350  C CB    . PRO A 42  ? 0.5497 0.5302 0.8891 -0.0231 0.1317  0.1246  42  PRO A CB    
351  C CG    . PRO A 42  ? 0.5452 0.5206 0.8841 -0.0277 0.1179  0.1207  42  PRO A CG    
352  C CD    . PRO A 42  ? 0.5200 0.5096 0.8645 -0.0254 0.1108  0.1165  42  PRO A CD    
353  N N     . GLU A 43  ? 0.6392 0.6285 0.9579 -0.0099 0.1532  0.1268  43  GLU A N     
354  C CA    . GLU A 43  ? 0.6839 0.6745 1.0030 -0.0087 0.1666  0.1290  43  GLU A CA    
355  C C     . GLU A 43  ? 0.6766 0.6732 1.0269 -0.0146 0.1758  0.1327  43  GLU A C     
356  O O     . GLU A 43  ? 0.6716 0.6748 1.0340 -0.0137 0.1855  0.1336  43  GLU A O     
357  C CB    . GLU A 43  ? 0.7687 0.7427 1.0596 -0.0058 0.1754  0.1327  43  GLU A CB    
358  C CG    . GLU A 43  ? 0.8515 0.8209 1.1149 0.0000  0.1663  0.1315  43  GLU A CG    
359  C CD    . GLU A 43  ? 0.9388 0.9126 1.1898 0.0031  0.1659  0.1290  43  GLU A CD    
360  O OE1   . GLU A 43  ? 0.9711 0.9445 1.2043 0.0070  0.1567  0.1287  43  GLU A OE1   
361  O OE2   . GLU A 43  ? 0.9722 0.9493 1.2322 0.0015  0.1753  0.1281  43  GLU A OE2   
362  N N     . SER A 44  ? 0.6932 0.6867 1.0574 -0.0208 0.1729  0.1355  44  SER A N     
363  C CA    . SER A 44  ? 0.7068 0.7064 1.1044 -0.0276 0.1807  0.1410  44  SER A CA    
364  C C     . SER A 44  ? 0.7067 0.7252 1.1374 -0.0308 0.1727  0.1407  44  SER A C     
365  O O     . SER A 44  ? 0.7292 0.7578 1.1913 -0.0335 0.1821  0.1460  44  SER A O     
366  C CB    . SER A 44  ? 0.7136 0.7030 1.1152 -0.0347 0.1774  0.1443  44  SER A CB    
367  O OG    . SER A 44  ? 0.6993 0.6874 1.0979 -0.0379 0.1592  0.1404  44  SER A OG    
368  N N     . GLN A 45  ? 0.7049 0.7276 1.1295 -0.0304 0.1557  0.1352  45  GLN A N     
369  C CA    . GLN A 45  ? 0.7039 0.7427 1.1563 -0.0337 0.1457  0.1351  45  GLN A CA    
370  C C     . GLN A 45  ? 0.7039 0.7533 1.1630 -0.0271 0.1556  0.1346  45  GLN A C     
371  O O     . GLN A 45  ? 0.6783 0.7258 1.1126 -0.0205 0.1542  0.1290  45  GLN A O     
372  C CB    . GLN A 45  ? 0.7029 0.7390 1.1413 -0.0351 0.1262  0.1291  45  GLN A CB    
373  C CG    . GLN A 45  ? 0.6946 0.7438 1.1601 -0.0407 0.1128  0.1299  45  GLN A CG    
374  C CD    . GLN A 45  ? 0.6972 0.7361 1.1502 -0.0472 0.0939  0.1263  45  GLN A CD    
375  N N     . ALA A 46  ? 0.7115 0.7712 1.2049 -0.0290 0.1664  0.1411  46  ALA A N     
376  C CA    . ALA A 46  ? 0.6889 0.7559 1.1908 -0.0226 0.1793  0.1415  46  ALA A CA    
377  C C     . ALA A 46  ? 0.6790 0.7565 1.1829 -0.0204 0.1651  0.1368  46  ALA A C     
378  O O     . ALA A 46  ? 0.7008 0.7874 1.2243 -0.0261 0.1480  0.1377  46  ALA A O     
379  C CB    . ALA A 46  ? 0.6704 0.7434 1.2043 -0.0227 0.1891  0.1476  46  ALA A CB    
380  N N     . THR A 47  ? 0.6436 0.7176 1.1247 -0.0130 0.1715  0.1319  47  THR A N     
381  C CA    . THR A 47  ? 0.6094 0.6917 1.0891 -0.0105 0.1593  0.1272  47  THR A CA    
382  C C     . THR A 47  ? 0.5357 0.6149 1.0020 -0.0032 0.1728  0.1247  47  THR A C     
383  O O     . THR A 47  ? 0.5302 0.5970 0.9793 -0.0002 0.1903  0.1255  47  THR A O     
384  C CB    . THR A 47  ? 0.6639 0.7405 1.1138 -0.0110 0.1418  0.1203  47  THR A CB    
385  O OG1   . THR A 47  ? 0.6938 0.7780 1.1437 -0.0093 0.1306  0.1161  47  THR A OG1   
386  C CG2   . THR A 47  ? 0.6778 0.7403 1.0888 -0.0063 0.1485  0.1169  47  THR A CG2   
387  N N     . LYS A 48  ? 0.4920 0.5797 0.9634 -0.0010 0.1646  0.1217  48  LYS A N     
388  C CA    . LYS A 48  ? 0.4916 0.5742 0.9472 0.0053  0.1754  0.1186  48  LYS A CA    
389  C C     . LYS A 48  ? 0.5169 0.5944 0.9365 0.0069  0.1628  0.1108  48  LYS A C     
390  O O     . LYS A 48  ? 0.5422 0.6119 0.9391 0.0108  0.1690  0.1073  48  LYS A O     
391  C CB    . LYS A 48  ? 0.4831 0.5788 0.9740 0.0072  0.1776  0.1221  48  LYS A CB    
392  C CG    . LYS A 48  ? 0.4829 0.5883 0.9759 0.0064  0.1574  0.1182  48  LYS A CG    
393  C CD    . LYS A 48  ? 0.4764 0.5917 1.0025 0.0080  0.1551  0.1225  48  LYS A CD    
394  C CE    . LYS A 48  ? 0.4681 0.5910 1.0254 0.0024  0.1439  0.1292  48  LYS A CE    
395  N N     . TYR A 49  ? 0.4949 0.5754 0.9092 0.0036  0.1457  0.1085  49  TYR A N     
396  C CA    . TYR A 49  ? 0.4391 0.5171 0.8257 0.0052  0.1336  0.1023  49  TYR A CA    
397  C C     . TYR A 49  ? 0.4324 0.4991 0.7892 0.0060  0.1338  0.1013  49  TYR A C     
398  O O     . TYR A 49  ? 0.3865 0.4492 0.7456 0.0035  0.1336  0.1039  49  TYR A O     
399  C CB    . TYR A 49  ? 0.4004 0.4863 0.7983 0.0018  0.1157  0.1005  49  TYR A CB    
400  C CG    . TYR A 49  ? 0.3889 0.4860 0.8169 0.0003  0.1117  0.1027  49  TYR A CG    
401  C CD1   . TYR A 49  ? 0.3797 0.4834 0.8387 -0.0053 0.1061  0.1082  49  TYR A CD1   
402  C CD2   . TYR A 49  ? 0.3880 0.4887 0.8141 0.0041  0.1125  0.1002  49  TYR A CD2   
403  C CE1   . TYR A 49  ? 0.4026 0.5177 0.8922 -0.0070 0.1004  0.1120  49  TYR A CE1   
404  C CE2   . TYR A 49  ? 0.3936 0.5046 0.8487 0.0034  0.1084  0.1033  49  TYR A CE2   
405  C CZ    . TYR A 49  ? 0.4197 0.5386 0.9077 -0.0020 0.1020  0.1096  49  TYR A CZ    
406  O OH    . TYR A 49  ? 0.4618 0.5918 0.9814 -0.0030 0.0961  0.1144  49  TYR A OH    
407  N N     . PHE A 50  ? 0.4609 0.5221 0.7906 0.0090  0.1334  0.0982  50  PHE A N     
408  C CA    . PHE A 50  ? 0.4547 0.5067 0.7578 0.0100  0.1312  0.0986  50  PHE A CA    
409  C C     . PHE A 50  ? 0.4469 0.5023 0.7343 0.0118  0.1198  0.0949  50  PHE A C     
410  O O     . PHE A 50  ? 0.4636 0.5238 0.7520 0.0125  0.1179  0.0919  50  PHE A O     
411  C CB    . PHE A 50  ? 0.4661 0.5040 0.7493 0.0106  0.1447  0.1012  50  PHE A CB    
412  C CG    . PHE A 50  ? 0.5058 0.5393 0.8048 0.0091  0.1593  0.1052  50  PHE A CG    
413  C CD1   . PHE A 50  ? 0.4982 0.5341 0.8151 0.0097  0.1711  0.1059  50  PHE A CD1   
414  C CD2   . PHE A 50  ? 0.5124 0.5394 0.8101 0.0074  0.1623  0.1090  50  PHE A CD2   
415  C CE1   . PHE A 50  ? 0.4902 0.5234 0.8259 0.0086  0.1861  0.1108  50  PHE A CE1   
416  C CE2   . PHE A 50  ? 0.4998 0.5231 0.8136 0.0056  0.1765  0.1133  50  PHE A CE2   
417  C CZ    . PHE A 50  ? 0.4943 0.5215 0.8284 0.0062  0.1887  0.1144  50  PHE A CZ    
418  N N     . ASP A 51  ? 0.4016 0.4548 0.6764 0.0130  0.1128  0.0959  51  ASP A N     
419  C CA    . ASP A 51  ? 0.3462 0.4032 0.6083 0.0148  0.1036  0.0942  51  ASP A CA    
420  C C     . ASP A 51  ? 0.3371 0.3867 0.5768 0.0146  0.1066  0.0956  51  ASP A C     
421  O O     . ASP A 51  ? 0.3620 0.4009 0.5930 0.0133  0.1167  0.0975  51  ASP A O     
422  C CB    . ASP A 51  ? 0.3373 0.3949 0.5970 0.0170  0.0964  0.0959  51  ASP A CB    
423  C CG    . ASP A 51  ? 0.3801 0.4286 0.6276 0.0181  0.0993  0.1016  51  ASP A CG    
424  O OD1   . ASP A 51  ? 0.4307 0.4713 0.6649 0.0168  0.1050  0.1041  51  ASP A OD1   
425  O OD2   . ASP A 51  ? 0.3594 0.4064 0.6085 0.0205  0.0963  0.1038  51  ASP A OD2   
426  N N     . ILE A 52  ? 0.3433 0.3965 0.5721 0.0151  0.0980  0.0951  52  ILE A N     
427  C CA    . ILE A 52  ? 0.3707 0.4151 0.5758 0.0129  0.0979  0.0965  52  ILE A CA    
428  C C     . ILE A 52  ? 0.4015 0.4333 0.5880 0.0119  0.0993  0.1026  52  ILE A C     
429  O O     . ILE A 52  ? 0.4477 0.4655 0.6094 0.0086  0.1011  0.1043  52  ILE A O     
430  C CB    . ILE A 52  ? 0.3623 0.4148 0.5628 0.0125  0.0864  0.0958  52  ILE A CB    
431  C CG1   . ILE A 52  ? 0.2941 0.3540 0.4996 0.0150  0.0776  0.1007  52  ILE A CG1   
432  C CG2   . ILE A 52  ? 0.2818 0.3445 0.4979 0.0133  0.0851  0.0899  52  ILE A CG2   
433  C CD1   . ILE A 52  ? 0.3805 0.4503 0.5868 0.0149  0.0674  0.1014  52  ILE A CD1   
434  N N     . TYR A 53  ? 0.3681 0.4019 0.5639 0.0142  0.0984  0.1060  53  TYR A N     
435  C CA    . TYR A 53  ? 0.3577 0.3798 0.5374 0.0137  0.0987  0.1126  53  TYR A CA    
436  C C     . TYR A 53  ? 0.4134 0.4236 0.5921 0.0127  0.1120  0.1131  53  TYR A C     
437  O O     . TYR A 53  ? 0.4404 0.4385 0.6051 0.0121  0.1139  0.1185  53  TYR A O     
438  C CB    . TYR A 53  ? 0.3352 0.3650 0.5249 0.0177  0.0904  0.1172  53  TYR A CB    
439  C CG    . TYR A 53  ? 0.3715 0.4148 0.5681 0.0195  0.0794  0.1175  53  TYR A CG    
440  C CD1   . TYR A 53  ? 0.3478 0.4025 0.5640 0.0227  0.0783  0.1135  53  TYR A CD1   
441  C CD2   . TYR A 53  ? 0.3948 0.4378 0.5772 0.0171  0.0701  0.1223  53  TYR A CD2   
442  C CE1   . TYR A 53  ? 0.3567 0.4227 0.5794 0.0245  0.0705  0.1141  53  TYR A CE1   
443  C CE2   . TYR A 53  ? 0.3921 0.4488 0.5843 0.0184  0.0607  0.1236  53  TYR A CE2   
444  C CZ    . TYR A 53  ? 0.3648 0.4333 0.5778 0.0226  0.0621  0.1194  53  TYR A CZ    
445  O OH    . TYR A 53  ? 0.3350 0.4160 0.5579 0.0241  0.0549  0.1210  53  TYR A OH    
446  N N     . GLY A 54  ? 0.4437 0.4573 0.6387 0.0123  0.1210  0.1085  54  GLY A N     
447  C CA    . GLY A 54  ? 0.4314 0.4354 0.6301 0.0110  0.1353  0.1097  54  GLY A CA    
448  C C     . GLY A 54  ? 0.4263 0.4361 0.6480 0.0116  0.1366  0.1108  54  GLY A C     
449  O O     . GLY A 54  ? 0.4620 0.4657 0.6912 0.0100  0.1482  0.1126  54  GLY A O     
450  N N     . LYS A 55  ? 0.4261 0.4457 0.6580 0.0135  0.1256  0.1101  55  LYS A N     
451  C CA    . LYS A 55  ? 0.4603 0.4814 0.7094 0.0130  0.1257  0.1107  55  LYS A CA    
452  C C     . LYS A 55  ? 0.4402 0.4704 0.7145 0.0103  0.1272  0.1072  55  LYS A C     
453  O O     . LYS A 55  ? 0.4653 0.5049 0.7464 0.0107  0.1216  0.1033  55  LYS A O     
454  C CB    . LYS A 55  ? 0.4811 0.5053 0.7294 0.0161  0.1153  0.1110  55  LYS A CB    
455  C CG    . LYS A 55  ? 0.5598 0.5779 0.7891 0.0193  0.1119  0.1164  55  LYS A CG    
456  C CD    . LYS A 55  ? 0.6581 0.6619 0.8762 0.0179  0.1198  0.1216  55  LYS A CD    
457  C CE    . LYS A 55  ? 0.7208 0.7174 0.9180 0.0200  0.1147  0.1283  55  LYS A CE    
458  N NZ    . LYS A 55  ? 0.7544 0.7342 0.9371 0.0182  0.1223  0.1336  55  LYS A NZ    
459  N N     . PRO A 56  ? 0.3887 0.4159 0.6779 0.0071  0.1341  0.1096  56  PRO A N     
460  C CA    . PRO A 56  ? 0.3693 0.4061 0.6865 0.0035  0.1340  0.1084  56  PRO A CA    
461  C C     . PRO A 56  ? 0.3396 0.3822 0.6651 0.0020  0.1201  0.1051  56  PRO A C     
462  O O     . PRO A 56  ? 0.2995 0.3357 0.6131 0.0031  0.1143  0.1046  56  PRO A O     
463  C CB    . PRO A 56  ? 0.3190 0.3503 0.6492 -0.0003 0.1433  0.1132  56  PRO A CB    
464  C CG    . PRO A 56  ? 0.3893 0.4080 0.6985 0.0010  0.1431  0.1154  56  PRO A CG    
465  C CD    . PRO A 56  ? 0.4177 0.4330 0.7004 0.0060  0.1410  0.1143  56  PRO A CD    
466  N N     . CYS A 57  ? 0.3108 0.3632 0.6552 -0.0003 0.1154  0.1033  57  CYS A N     
467  C CA    . CYS A 57  ? 0.3218 0.3763 0.6710 -0.0030 0.1020  0.1002  57  CYS A CA    
468  C C     . CYS A 57  ? 0.3512 0.4124 0.7292 -0.0093 0.0981  0.1025  57  CYS A C     
469  O O     . CYS A 57  ? 0.3662 0.4357 0.7633 -0.0093 0.1057  0.1055  57  CYS A O     
470  C CB    . CYS A 57  ? 0.3224 0.3823 0.6612 0.0007  0.0958  0.0955  57  CYS A CB    
471  S SG    . CYS A 57  ? 0.5655 0.6213 0.8759 0.0073  0.0975  0.0944  57  CYS A SG    
472  N N     A THR A 58  ? 0.3706 0.4267 0.7516 -0.0151 0.0864  0.1018  58  THR A N     
473  N N     B THR A 58  ? 0.3704 0.4264 0.7511 -0.0151 0.0864  0.1017  58  THR A N     
474  C CA    A THR A 58  ? 0.3652 0.4278 0.7735 -0.0226 0.0779  0.1048  58  THR A CA    
475  C CA    B THR A 58  ? 0.3645 0.4267 0.7718 -0.0226 0.0777  0.1047  58  THR A CA    
476  C C     A THR A 58  ? 0.3617 0.4272 0.7672 -0.0233 0.0653  0.1010  58  THR A C     
477  C C     B THR A 58  ? 0.3602 0.4264 0.7649 -0.0225 0.0663  0.1007  58  THR A C     
478  O O     A THR A 58  ? 0.3657 0.4216 0.7466 -0.0218 0.0594  0.0958  58  THR A O     
479  O O     B THR A 58  ? 0.3614 0.4201 0.7413 -0.0195 0.0621  0.0954  58  THR A O     
480  C CB    A THR A 58  ? 0.3643 0.4163 0.7774 -0.0316 0.0708  0.1077  58  THR A CB    
481  C CB    B THR A 58  ? 0.3735 0.4238 0.7826 -0.0315 0.0694  0.1068  58  THR A CB    
482  O OG1   A THR A 58  ? 0.3935 0.4282 0.7761 -0.0310 0.0662  0.1029  58  THR A OG1   
483  O OG1   B THR A 58  ? 0.3607 0.4174 0.7969 -0.0402 0.0578  0.1109  58  THR A OG1   
484  C CG2   A THR A 58  ? 0.3283 0.3809 0.7548 -0.0327 0.0832  0.1134  58  THR A CG2   
485  C CG2   B THR A 58  ? 0.3921 0.4252 0.7699 -0.0313 0.0618  0.1010  58  THR A CG2   
486  N N     . ARG A 59  ? 0.3485 0.4268 0.7803 -0.0252 0.0623  0.1042  59  ARG A N     
487  C CA    . ARG A 59  ? 0.3323 0.4135 0.7630 -0.0259 0.0504  0.1014  59  ARG A CA    
488  C C     . ARG A 59  ? 0.3706 0.4418 0.8015 -0.0361 0.0326  0.1023  59  ARG A C     
489  O O     . ARG A 59  ? 0.4082 0.4808 0.8617 -0.0439 0.0276  0.1085  59  ARG A O     
490  C CB    . ARG A 59  ? 0.3024 0.3998 0.7620 -0.0235 0.0542  0.1055  59  ARG A CB    
491  C CG    . ARG A 59  ? 0.2989 0.3993 0.7574 -0.0236 0.0425  0.1031  59  ARG A CG    
492  C CD    . ARG A 59  ? 0.3037 0.4188 0.7898 -0.0194 0.0490  0.1074  59  ARG A CD    
493  N NE    . ARG A 59  ? 0.3223 0.4478 0.8496 -0.0243 0.0479  0.1170  59  ARG A NE    
494  C CZ    . ARG A 59  ? 0.3622 0.4924 0.9126 -0.0316 0.0308  0.1225  59  ARG A CZ    
495  N NH1   . ARG A 59  ? 0.4028 0.5253 0.9344 -0.0350 0.0141  0.1185  59  ARG A NH1   
496  N NH2   . ARG A 59  ? 0.3388 0.4808 0.9315 -0.0361 0.0300  0.1330  59  ARG A NH2   
497  N N     . LYS A 60  ? 0.3873 0.4464 0.7917 -0.0367 0.0234  0.0964  60  LYS A N     
498  C CA    . LYS A 60  ? 0.4391 0.4833 0.8362 -0.0472 0.0059  0.0966  60  LYS A CA    
499  C C     . LYS A 60  ? 0.4611 0.5099 0.8640 -0.0493 -0.0064 0.0967  60  LYS A C     
500  O O     . LYS A 60  ? 0.4871 0.5324 0.8690 -0.0441 -0.0055 0.0909  60  LYS A O     
501  C CB    . LYS A 60  ? 0.4909 0.5111 0.8490 -0.0473 0.0058  0.0902  60  LYS A CB    
502  C CG    . LYS A 60  ? 0.5507 0.5623 0.9024 -0.0468 0.0151  0.0910  60  LYS A CG    
503  C CD    . LYS A 60  ? 0.6032 0.5876 0.9182 -0.0476 0.0143  0.0857  60  LYS A CD    
504  C CE    . LYS A 60  ? 0.6517 0.6133 0.9556 -0.0611 -0.0017 0.0861  60  LYS A CE    
505  N NZ    . LYS A 60  ? 0.6909 0.6470 1.0069 -0.0695 -0.0039 0.0912  60  LYS A NZ    
506  N N     . LEU A 61  ? 0.4440 0.5012 0.8776 -0.0570 -0.0180 0.1042  61  LEU A N     
507  C CA    . LEU A 61  ? 0.4329 0.4926 0.8729 -0.0602 -0.0325 0.1058  61  LEU A CA    
508  C C     . LEU A 61  ? 0.4512 0.4843 0.8599 -0.0707 -0.0503 0.1028  61  LEU A C     
509  O O     . LEU A 61  ? 0.4647 0.4826 0.8662 -0.0800 -0.0573 0.1044  61  LEU A O     
510  C CB    . LEU A 61  ? 0.4330 0.5124 0.9213 -0.0643 -0.0389 0.1168  61  LEU A CB    
511  C CG    . LEU A 61  ? 0.4302 0.5165 0.9326 -0.0656 -0.0524 0.1204  61  LEU A CG    
512  C CD1   . LEU A 61  ? 0.4177 0.5152 0.9174 -0.0526 -0.0379 0.1159  61  LEU A CD1   
513  C CD2   . LEU A 61  ? 0.4139 0.5170 0.9670 -0.0723 -0.0627 0.1338  61  LEU A CD2   
514  N N     . PHE A 62  ? 0.4403 0.4649 0.8272 -0.0696 -0.0568 0.0982  62  PHE A N     
515  C CA    . PHE A 62  ? 0.4742 0.4687 0.8249 -0.0793 -0.0718 0.0947  62  PHE A CA    
516  C C     . PHE A 62  ? 0.5367 0.5301 0.8979 -0.0882 -0.0933 0.1003  62  PHE A C     
517  O O     . PHE A 62  ? 0.5646 0.5792 0.9517 -0.0827 -0.0929 0.1038  62  PHE A O     
518  C CB    . PHE A 62  ? 0.4565 0.4360 0.7666 -0.0715 -0.0608 0.0847  62  PHE A CB    
519  C CG    . PHE A 62  ? 0.4273 0.4031 0.7240 -0.0642 -0.0429 0.0803  62  PHE A CG    
520  C CD1   . PHE A 62  ? 0.3828 0.3807 0.6938 -0.0522 -0.0258 0.0795  62  PHE A CD1   
521  C CD2   . PHE A 62  ? 0.3959 0.3440 0.6642 -0.0699 -0.0437 0.0776  62  PHE A CD2   
522  C CE1   . PHE A 62  ? 0.3531 0.3477 0.6527 -0.0459 -0.0114 0.0769  62  PHE A CE1   
523  C CE2   . PHE A 62  ? 0.3754 0.3204 0.6336 -0.0626 -0.0275 0.0747  62  PHE A CE2   
524  C CZ    . PHE A 62  ? 0.3606 0.3300 0.6357 -0.0506 -0.0120 0.0748  62  PHE A CZ    
525  N N     . ALA A 63  ? 0.5653 0.5318 0.9048 -0.1023 -0.1123 0.1016  63  ALA A N     
526  C CA    . ALA A 63  ? 0.5876 0.5485 0.9328 -0.1130 -0.1364 0.1079  63  ALA A CA    
527  C C     . ALA A 63  ? 0.5886 0.5431 0.9095 -0.1072 -0.1357 0.1021  63  ALA A C     
528  O O     . ALA A 63  ? 0.5939 0.5586 0.9336 -0.1088 -0.1482 0.1079  63  ALA A O     
529  C CB    . ALA A 63  ? 0.6512 0.5780 0.9686 -0.1308 -0.1572 0.1097  63  ALA A CB    
530  N N     . ASN A 64  ? 0.5921 0.5297 0.8729 -0.1003 -0.1206 0.0915  64  ASN A N     
531  C CA    . ASN A 64  ? 0.6191 0.5506 0.8761 -0.0942 -0.1167 0.0856  64  ASN A CA    
532  C C     . ASN A 64  ? 0.6131 0.5451 0.8501 -0.0813 -0.0924 0.0765  64  ASN A C     
533  O O     . ASN A 64  ? 0.5994 0.5317 0.8353 -0.0779 -0.0801 0.0745  64  ASN A O     
534  C CB    . ASN A 64  ? 0.6723 0.5662 0.8875 -0.1067 -0.1350 0.0841  64  ASN A CB    
535  C CG    . ASN A 64  ? 0.7437 0.6015 0.9211 -0.1164 -0.1375 0.0806  64  ASN A CG    
536  O OD1   . ASN A 64  ? 0.7754 0.6155 0.9200 -0.1105 -0.1203 0.0722  64  ASN A OD1   
537  N ND2   . ASN A 64  ? 0.7700 0.6157 0.9523 -0.1317 -0.1591 0.0877  64  ASN A ND2   
538  N N     . MET A 65  ? 0.5856 0.5181 0.8084 -0.0745 -0.0863 0.0719  65  MET A N     
539  C CA    . MET A 65  ? 0.5521 0.4896 0.7625 -0.0624 -0.0648 0.0651  65  MET A CA    
540  C C     . MET A 65  ? 0.6272 0.5340 0.7975 -0.0636 -0.0568 0.0591  65  MET A C     
541  O O     . MET A 65  ? 0.6418 0.5540 0.8109 -0.0550 -0.0398 0.0564  65  MET A O     
542  C CB    . MET A 65  ? 0.4777 0.4242 0.6858 -0.0561 -0.0613 0.0627  65  MET A CB    
543  C CG    . MET A 65  ? 0.4434 0.4224 0.6915 -0.0505 -0.0608 0.0674  65  MET A CG    
544  S SD    . MET A 65  ? 0.4828 0.4693 0.7265 -0.0443 -0.0579 0.0647  65  MET A SD    
545  C CE    . MET A 65  ? 0.4713 0.4308 0.6925 -0.0562 -0.0800 0.0666  65  MET A CE    
546  N N     . ARG A 66  ? 0.6722 0.5445 0.8086 -0.0743 -0.0689 0.0578  66  ARG A N     
547  C CA    . ARG A 66  ? 0.7224 0.5593 0.8166 -0.0757 -0.0598 0.0521  66  ARG A CA    
548  C C     . ARG A 66  ? 0.6976 0.5297 0.7960 -0.0777 -0.0562 0.0533  66  ARG A C     
549  O O     . ARG A 66  ? 0.6952 0.5110 0.7723 -0.0727 -0.0406 0.0491  66  ARG A O     
550  C CB    . ARG A 66  ? 0.8314 0.6268 0.8823 -0.0878 -0.0734 0.0500  66  ARG A CB    
551  C CG    . ARG A 66  ? 0.8641 0.6562 0.8993 -0.0838 -0.0702 0.0469  66  ARG A CG    
552  C CD    . ARG A 66  ? 0.9147 0.6641 0.9058 -0.0972 -0.0857 0.0458  66  ARG A CD    
553  N N     . ASP A 67  ? 0.6851 0.5321 0.8133 -0.0847 -0.0697 0.0597  67  ASP A N     
554  C CA    . ASP A 67  ? 0.6734 0.5206 0.8114 -0.0864 -0.0659 0.0617  67  ASP A CA    
555  C C     . ASP A 67  ? 0.6391 0.5157 0.8015 -0.0718 -0.0454 0.0612  67  ASP A C     
556  O O     . ASP A 67  ? 0.6680 0.5372 0.8239 -0.0688 -0.0344 0.0600  67  ASP A O     
557  C CB    . ASP A 67  ? 0.6623 0.5205 0.8309 -0.0979 -0.0854 0.0701  67  ASP A CB    
558  C CG    . ASP A 67  ? 0.7290 0.5496 0.8676 -0.1156 -0.1066 0.0715  67  ASP A CG    
559  O OD1   . ASP A 67  ? 0.7807 0.5617 0.8710 -0.1189 -0.1024 0.0651  67  ASP A OD1   
560  O OD2   . ASP A 67  ? 0.7333 0.5623 0.8965 -0.1266 -0.1273 0.0796  67  ASP A OD2   
561  N N     . ALA A 68  ? 0.5655 0.4731 0.7538 -0.0632 -0.0410 0.0623  68  ALA A N     
562  C CA    . ALA A 68  ? 0.5063 0.4403 0.7154 -0.0507 -0.0239 0.0624  68  ALA A CA    
563  C C     . ALA A 68  ? 0.5574 0.4810 0.7418 -0.0416 -0.0076 0.0571  68  ALA A C     
564  O O     . ALA A 68  ? 0.5838 0.5168 0.7753 -0.0339 0.0054  0.0576  68  ALA A O     
565  C CB    . ALA A 68  ? 0.4528 0.4175 0.6912 -0.0454 -0.0241 0.0648  68  ALA A CB    
566  N N     A SER A 69  ? 0.5713 0.4750 0.7277 -0.0426 -0.0083 0.0530  69  SER A N     
567  N N     B SER A 69  ? 0.5713 0.4750 0.7276 -0.0426 -0.0082 0.0530  69  SER A N     
568  C CA    A SER A 69  ? 0.5715 0.4646 0.7068 -0.0340 0.0080  0.0491  69  SER A CA    
569  C CA    B SER A 69  ? 0.5710 0.4645 0.7067 -0.0338 0.0082  0.0491  69  SER A CA    
570  C C     A SER A 69  ? 0.6087 0.4717 0.7190 -0.0354 0.0152  0.0475  69  SER A C     
571  C C     B SER A 69  ? 0.6092 0.4717 0.7188 -0.0354 0.0153  0.0474  69  SER A C     
572  O O     A SER A 69  ? 0.6042 0.4688 0.7138 -0.0260 0.0311  0.0474  69  SER A O     
573  O O     B SER A 69  ? 0.6058 0.4689 0.7137 -0.0260 0.0314  0.0472  69  SER A O     
574  C CB    A SER A 69  ? 0.5730 0.4520 0.6857 -0.0351 0.0064  0.0456  69  SER A CB    
575  C CB    B SER A 69  ? 0.5701 0.4515 0.6848 -0.0343 0.0071  0.0457  69  SER A CB    
576  O OG    A SER A 69  ? 0.5433 0.4468 0.6771 -0.0347 -0.0014 0.0471  69  SER A OG    
577  O OG    B SER A 69  ? 0.6045 0.4509 0.6881 -0.0457 -0.0043 0.0437  69  SER A OG    
578  N N     . GLN A 70  ? 0.6539 0.4882 0.7435 -0.0477 0.0028  0.0468  70  GLN A N     
579  C CA    . GLN A 70  ? 0.7185 0.5181 0.7794 -0.0510 0.0085  0.0449  70  GLN A CA    
580  C C     . GLN A 70  ? 0.6516 0.4673 0.7358 -0.0468 0.0148  0.0484  70  GLN A C     
581  O O     . GLN A 70  ? 0.6863 0.4827 0.7543 -0.0431 0.0271  0.0473  70  GLN A O     
582  C CB    . GLN A 70  ? 0.8516 0.6166 0.8852 -0.0677 -0.0099 0.0442  70  GLN A CB    
583  C CG    . GLN A 70  ? 0.9726 0.7075 0.9687 -0.0729 -0.0141 0.0401  70  GLN A CG    
584  C CD    . GLN A 70  ? 1.1012 0.8081 1.0762 -0.0913 -0.0383 0.0413  70  GLN A CD    
585  O OE1   . GLN A 70  ? 1.1368 0.8468 1.1266 -0.1005 -0.0519 0.0456  70  GLN A OE1   
586  N NE2   . GLN A 70  ? 1.1559 0.8350 1.0964 -0.0974 -0.0446 0.0383  70  GLN A NE2   
587  N N     . TRP A 71  ? 0.5759 0.4254 0.6975 -0.0472 0.0075  0.0529  71  TRP A N     
588  C CA    . TRP A 71  ? 0.5198 0.3866 0.6646 -0.0430 0.0141  0.0567  71  TRP A CA    
589  C C     . TRP A 71  ? 0.5019 0.3861 0.6550 -0.0282 0.0319  0.0569  71  TRP A C     
590  O O     . TRP A 71  ? 0.5550 0.4371 0.7095 -0.0233 0.0417  0.0586  71  TRP A O     
591  C CB    . TRP A 71  ? 0.4581 0.3540 0.6397 -0.0473 0.0033  0.0618  71  TRP A CB    
592  C CG    . TRP A 71  ? 0.4353 0.3476 0.6393 -0.0434 0.0112  0.0658  71  TRP A CG    
593  C CD1   . TRP A 71  ? 0.4290 0.3283 0.6322 -0.0498 0.0096  0.0681  71  TRP A CD1   
594  C CD2   . TRP A 71  ? 0.4076 0.3495 0.6352 -0.0330 0.0218  0.0681  71  TRP A CD2   
595  N NE1   . TRP A 71  ? 0.4048 0.3245 0.6304 -0.0434 0.0193  0.0718  71  TRP A NE1   
596  C CE2   . TRP A 71  ? 0.4014 0.3464 0.6408 -0.0333 0.0267  0.0718  71  TRP A CE2   
597  C CE3   . TRP A 71  ? 0.3877 0.3514 0.6251 -0.0244 0.0271  0.0675  71  TRP A CE3   
598  C CZ2   . TRP A 71  ? 0.3755 0.3429 0.6336 -0.0252 0.0369  0.0749  71  TRP A CZ2   
599  C CZ3   . TRP A 71  ? 0.3631 0.3485 0.6186 -0.0171 0.0363  0.0704  71  TRP A CZ3   
600  C CH2   . TRP A 71  ? 0.3184 0.3047 0.5830 -0.0175 0.0412  0.0741  71  TRP A CH2   
601  N N     . ILE A 72  ? 0.4670 0.3678 0.6257 -0.0218 0.0349  0.0558  72  ILE A N     
602  C CA    . ILE A 72  ? 0.4457 0.3625 0.6122 -0.0092 0.0493  0.0570  72  ILE A CA    
603  C C     . ILE A 72  ? 0.4797 0.3705 0.6222 -0.0040 0.0624  0.0556  72  ILE A C     
604  O O     . ILE A 72  ? 0.4978 0.3944 0.6477 0.0044  0.0735  0.0588  72  ILE A O     
605  C CB    . ILE A 72  ? 0.4304 0.3661 0.6045 -0.0050 0.0491  0.0560  72  ILE A CB    
606  C CG1   . ILE A 72  ? 0.4093 0.3699 0.6078 -0.0084 0.0390  0.0578  72  ILE A CG1   
607  C CG2   . ILE A 72  ? 0.4106 0.3610 0.5925 0.0064  0.0622  0.0584  72  ILE A CG2   
608  C CD1   . ILE A 72  ? 0.3782 0.3561 0.5832 -0.0048 0.0386  0.0568  72  ILE A CD1   
609  N N     . LYS A 73  ? 0.5252 0.3852 0.6380 -0.0091 0.0614  0.0512  73  LYS A N     
610  C CA    . LYS A 73  ? 0.5516 0.3804 0.6373 -0.0045 0.0761  0.0494  73  LYS A CA    
611  C C     . LYS A 73  ? 0.5866 0.3981 0.6660 -0.0054 0.0803  0.0509  73  LYS A C     
612  O O     . LYS A 73  ? 0.5882 0.3917 0.6644 0.0041  0.0960  0.0529  73  LYS A O     
613  C CB    . LYS A 73  ? 0.5488 0.3417 0.5977 -0.0121 0.0734  0.0440  73  LYS A CB    
614  N N     . ARG A 74  ? 0.6181 0.4243 0.6978 -0.0169 0.0661  0.0509  74  ARG A N     
615  C CA    . ARG A 74  ? 0.6714 0.4611 0.7456 -0.0195 0.0685  0.0524  74  ARG A CA    
616  C C     . ARG A 74  ? 0.6365 0.4552 0.7404 -0.0095 0.0767  0.0579  74  ARG A C     
617  O O     . ARG A 74  ? 0.6367 0.4414 0.7337 -0.0042 0.0879  0.0597  74  ARG A O     
618  C CB    . ARG A 74  ? 0.7050 0.4845 0.7764 -0.0355 0.0498  0.0523  74  ARG A CB    
619  C CG    . ARG A 74  ? 0.7853 0.5203 0.8152 -0.0475 0.0422  0.0475  74  ARG A CG    
620  C CD    . ARG A 74  ? 0.8322 0.5511 0.8576 -0.0636 0.0254  0.0491  74  ARG A CD    
621  N NE    . ARG A 74  ? 0.8361 0.5908 0.8998 -0.0694 0.0091  0.0538  74  ARG A NE    
622  C CZ    . ARG A 74  ? 0.8611 0.6205 0.9280 -0.0780 -0.0076 0.0542  74  ARG A CZ    
623  N NH1   . ARG A 74  ? 0.8918 0.6212 0.9227 -0.0826 -0.0113 0.0496  74  ARG A NH1   
624  N NH2   . ARG A 74  ? 0.8507 0.6434 0.9566 -0.0817 -0.0197 0.0596  74  ARG A NH2   
625  N N     . MET A 75  ? 0.5824 0.4388 0.7169 -0.0071 0.0714  0.0607  75  MET A N     
626  C CA    . MET A 75  ? 0.5517 0.4336 0.7107 0.0011  0.0778  0.0661  75  MET A CA    
627  C C     . MET A 75  ? 0.5751 0.4595 0.7336 0.0144  0.0926  0.0687  75  MET A C     
628  O O     . MET A 75  ? 0.5729 0.4646 0.7417 0.0213  0.0997  0.0737  75  MET A O     
629  C CB    . MET A 75  ? 0.4970 0.4133 0.6833 0.0002  0.0699  0.0681  75  MET A CB    
630  C CG    . MET A 75  ? 0.4850 0.4039 0.6817 -0.0111 0.0575  0.0685  75  MET A CG    
631  S SD    . MET A 75  ? 0.4776 0.3935 0.6835 -0.0138 0.0603  0.0730  75  MET A SD    
632  C CE    . MET A 75  ? 0.3530 0.3027 0.5842 -0.0046 0.0673  0.0778  75  MET A CE    
633  N N     . GLU A 76  ? 0.6243 0.5025 0.7720 0.0178  0.0970  0.0661  76  GLU A N     
634  C CA    . GLU A 76  ? 0.6658 0.5434 0.8143 0.0301  0.1121  0.0694  76  GLU A CA    
635  C C     . GLU A 76  ? 0.6616 0.5054 0.7897 0.0330  0.1242  0.0696  76  GLU A C     
636  O O     . GLU A 76  ? 0.6441 0.4919 0.7826 0.0430  0.1349  0.0756  76  GLU A O     
637  C CB    . GLU A 76  ? 0.7147 0.5911 0.8558 0.0319  0.1150  0.0665  76  GLU A CB    
638  C CG    . GLU A 76  ? 0.7743 0.6523 0.9211 0.0445  0.1314  0.0711  76  GLU A CG    
639  C CD    . GLU A 76  ? 0.8367 0.7094 0.9739 0.0452  0.1357  0.0680  76  GLU A CD    
640  O OE1   . GLU A 76  ? 0.8493 0.7033 0.9638 0.0358  0.1284  0.0612  76  GLU A OE1   
641  O OE2   . GLU A 76  ? 0.8552 0.7426 1.0083 0.0546  0.1457  0.0732  76  GLU A OE2   
642  N N     . ASP A 77  ? 0.6913 0.5000 0.7892 0.0238  0.1216  0.0636  77  ASP A N     
643  C CA    . ASP A 77  ? 0.7531 0.5221 0.8243 0.0249  0.1333  0.0626  77  ASP A CA    
644  C C     . ASP A 77  ? 0.7539 0.5234 0.8336 0.0243  0.1324  0.0664  77  ASP A C     
645  O O     . ASP A 77  ? 0.7898 0.5340 0.8560 0.0296  0.1453  0.0679  77  ASP A O     
646  C CB    . ASP A 77  ? 0.8362 0.5641 0.8682 0.0122  0.1276  0.0550  77  ASP A CB    
647  C CG    . ASP A 77  ? 0.8827 0.6020 0.8992 0.0127  0.1309  0.0511  77  ASP A CG    
648  O OD1   . ASP A 77  ? 0.8721 0.6060 0.9021 0.0252  0.1445  0.0542  77  ASP A OD1   
649  O OD2   . ASP A 77  ? 0.9132 0.6105 0.9043 0.0002  0.1191  0.0456  77  ASP A OD2   
650  N N     . ILE A 78  ? 0.7072 0.5036 0.8087 0.0181  0.1185  0.0680  78  ILE A N     
651  C CA    . ILE A 78  ? 0.6452 0.4451 0.7570 0.0173  0.1179  0.0722  78  ILE A CA    
652  C C     . ILE A 78  ? 0.6286 0.4556 0.7655 0.0306  0.1262  0.0798  78  ILE A C     
653  O O     . ILE A 78  ? 0.6773 0.4967 0.8153 0.0358  0.1339  0.0844  78  ILE A O     
654  C CB    . ILE A 78  ? 0.5871 0.4032 0.7130 0.0051  0.1014  0.0717  78  ILE A CB    
655  C CG1   . ILE A 78  ? 0.6228 0.4106 0.7255 -0.0097 0.0902  0.0662  78  ILE A CG1   
656  C CG2   . ILE A 78  ? 0.5637 0.3866 0.7030 0.0053  0.1028  0.0769  78  ILE A CG2   
657  C CD1   . ILE A 78  ? 0.6031 0.4086 0.7251 -0.0218 0.0736  0.0674  78  ILE A CD1   
658  N N     . GLY A 79  ? 0.5892 0.4465 0.7449 0.0354  0.1238  0.0815  79  GLY A N     
659  C CA    . GLY A 79  ? 0.5703 0.4538 0.7489 0.0461  0.1284  0.0893  79  GLY A CA    
660  C C     . GLY A 79  ? 0.5642 0.4767 0.7621 0.0422  0.1179  0.0917  79  GLY A C     
661  O O     . GLY A 79  ? 0.5891 0.5164 0.8004 0.0479  0.1196  0.0985  79  GLY A O     
662  N N     . LEU A 80  ? 0.5266 0.4453 0.7251 0.0324  0.1074  0.0865  80  LEU A N     
663  C CA    . LEU A 80  ? 0.4527 0.3956 0.6683 0.0286  0.0998  0.0883  80  LEU A CA    
664  C C     . LEU A 80  ? 0.4447 0.4081 0.6689 0.0275  0.0936  0.0858  80  LEU A C     
665  O O     . LEU A 80  ? 0.4624 0.4190 0.6782 0.0252  0.0912  0.0810  80  LEU A O     
666  C CB    . LEU A 80  ? 0.4119 0.3462 0.6271 0.0180  0.0939  0.0863  80  LEU A CB    
667  C CG    . LEU A 80  ? 0.4331 0.3507 0.6428 0.0175  0.0991  0.0895  80  LEU A CG    
668  C CD1   . LEU A 80  ? 0.4357 0.3445 0.6463 0.0051  0.0917  0.0875  80  LEU A CD1   
669  C CD2   . LEU A 80  ? 0.4160 0.3492 0.6374 0.0243  0.1038  0.0964  80  LEU A CD2   
670  N N     . GLU A 81  ? 0.4280 0.4136 0.6661 0.0287  0.0913  0.0891  81  GLU A N     
671  C CA    . GLU A 81  ? 0.4025 0.4066 0.6478 0.0279  0.0860  0.0872  81  GLU A CA    
672  C C     . GLU A 81  ? 0.3857 0.3896 0.6333 0.0191  0.0785  0.0820  81  GLU A C     
673  O O     . GLU A 81  ? 0.3960 0.3980 0.6496 0.0134  0.0763  0.0825  81  GLU A O     
674  C CB    . GLU A 81  ? 0.4113 0.4335 0.6659 0.0304  0.0860  0.0921  81  GLU A CB    
675  C CG    . GLU A 81  ? 0.4525 0.4912 0.7116 0.0299  0.0815  0.0905  81  GLU A CG    
676  C CD    . GLU A 81  ? 0.4891 0.5397 0.7509 0.0309  0.0812  0.0951  81  GLU A CD    
677  O OE1   . GLU A 81  ? 0.5168 0.5632 0.7771 0.0322  0.0844  0.0998  81  GLU A OE1   
678  O OE2   . GLU A 81  ? 0.4945 0.5560 0.7573 0.0299  0.0778  0.0939  81  GLU A OE2   
679  N N     . ALA A 82  ? 0.3527 0.3588 0.5972 0.0180  0.0744  0.0781  82  ALA A N     
680  C CA    . ALA A 82  ? 0.3542 0.3623 0.6031 0.0104  0.0658  0.0745  82  ALA A CA    
681  C C     . ALA A 82  ? 0.3095 0.3385 0.5694 0.0119  0.0639  0.0747  82  ALA A C     
682  O O     . ALA A 82  ? 0.3281 0.3615 0.5838 0.0145  0.0632  0.0728  82  ALA A O     
683  C CB    . ALA A 82  ? 0.4011 0.3914 0.6343 0.0068  0.0618  0.0700  82  ALA A CB    
684  N N     . LEU A 83  ? 0.2969 0.3365 0.5698 0.0102  0.0643  0.0769  83  LEU A N     
685  C CA    . LEU A 83  ? 0.3271 0.3825 0.6068 0.0120  0.0650  0.0774  83  LEU A CA    
686  C C     . LEU A 83  ? 0.3340 0.3947 0.6221 0.0079  0.0589  0.0746  83  LEU A C     
687  O O     . LEU A 83  ? 0.3428 0.3974 0.6364 0.0025  0.0530  0.0738  83  LEU A O     
688  C CB    . LEU A 83  ? 0.2526 0.3128 0.5382 0.0127  0.0711  0.0814  83  LEU A CB    
689  C CG    . LEU A 83  ? 0.3271 0.3830 0.6049 0.0168  0.0765  0.0855  83  LEU A CG    
690  C CD1   . LEU A 83  ? 0.2712 0.3146 0.5492 0.0149  0.0781  0.0868  83  LEU A CD1   
691  C CD2   . LEU A 83  ? 0.3252 0.3864 0.6020 0.0178  0.0814  0.0889  83  LEU A CD2   
692  N N     . GLY A 84  ? 0.3186 0.3895 0.6073 0.0101  0.0595  0.0738  84  GLY A N     
693  C CA    . GLY A 84  ? 0.3216 0.3977 0.6190 0.0074  0.0549  0.0719  84  GLY A CA    
694  C C     . GLY A 84  ? 0.3424 0.4185 0.6302 0.0082  0.0502  0.0684  84  GLY A C     
695  O O     . GLY A 84  ? 0.3677 0.4395 0.6433 0.0106  0.0510  0.0675  84  GLY A O     
696  N N     . MET A 85  ? 0.3036 0.3842 0.5981 0.0064  0.0462  0.0670  85  MET A N     
697  C CA    . MET A 85  ? 0.2783 0.3583 0.5635 0.0066  0.0418  0.0638  85  MET A CA    
698  C C     . MET A 85  ? 0.3075 0.3744 0.5835 0.0030  0.0348  0.0616  85  MET A C     
699  O O     . MET A 85  ? 0.2979 0.3598 0.5802 -0.0019 0.0271  0.0620  85  MET A O     
700  C CB    . MET A 85  ? 0.2793 0.3662 0.5738 0.0061  0.0402  0.0634  85  MET A CB    
701  C CG    . MET A 85  ? 0.2727 0.3578 0.5576 0.0056  0.0351  0.0603  85  MET A CG    
702  S SD    . MET A 85  ? 0.3760 0.4620 0.6437 0.0087  0.0391  0.0588  85  MET A SD    
703  C CE    . MET A 85  ? 0.2236 0.3190 0.4928 0.0110  0.0454  0.0607  85  MET A CE    
704  N N     . ASP A 86  ? 0.3594 0.4193 0.6201 0.0053  0.0376  0.0601  86  ASP A N     
705  C CA    . ASP A 86  ? 0.4050 0.4468 0.6503 0.0023  0.0340  0.0576  86  ASP A CA    
706  C C     . ASP A 86  ? 0.4077 0.4450 0.6447 -0.0003 0.0280  0.0548  86  ASP A C     
707  O O     . ASP A 86  ? 0.4662 0.4859 0.6899 -0.0053 0.0217  0.0529  86  ASP A O     
708  C CB    . ASP A 86  ? 0.4492 0.4834 0.6826 0.0069  0.0427  0.0579  86  ASP A CB    
709  C CG    . ASP A 86  ? 0.5280 0.5759 0.7640 0.0125  0.0485  0.0592  86  ASP A CG    
710  O OD1   . ASP A 86  ? 0.5792 0.6229 0.8061 0.0133  0.0499  0.0575  86  ASP A OD1   
711  O OD2   . ASP A 86  ? 0.5613 0.6228 0.8075 0.0154  0.0513  0.0625  86  ASP A OD2   
712  N N     . ASP A 87  ? 0.3621 0.4128 0.6042 0.0024  0.0295  0.0545  87  ASP A N     
713  C CA    . ASP A 87  ? 0.3752 0.4230 0.6114 0.0001  0.0238  0.0523  87  ASP A CA    
714  C C     . ASP A 87  ? 0.3867 0.4384 0.6375 -0.0036 0.0152  0.0537  87  ASP A C     
715  O O     . ASP A 87  ? 0.4088 0.4741 0.6738 -0.0013 0.0174  0.0551  87  ASP A O     
716  C CB    . ASP A 87  ? 0.3761 0.4359 0.6126 0.0038  0.0287  0.0519  87  ASP A CB    
717  C CG    . ASP A 87  ? 0.3631 0.4174 0.5900 0.0015  0.0243  0.0494  87  ASP A CG    
718  O OD1   . ASP A 87  ? 0.3329 0.3777 0.5572 -0.0027 0.0158  0.0486  87  ASP A OD1   
719  O OD2   . ASP A 87  ? 0.3794 0.4389 0.6021 0.0035  0.0286  0.0490  87  ASP A OD2   
720  N N     . PHE A 88  ? 0.3456 0.3837 0.5925 -0.0095 0.0055  0.0540  88  PHE A N     
721  C CA    . PHE A 88  ? 0.3365 0.3797 0.6033 -0.0134 -0.0038 0.0577  88  PHE A CA    
722  C C     . PHE A 88  ? 0.3540 0.4052 0.6300 -0.0124 -0.0076 0.0585  88  PHE A C     
723  O O     . PHE A 88  ? 0.3722 0.4340 0.6722 -0.0124 -0.0102 0.0627  88  PHE A O     
724  C CB    . PHE A 88  ? 0.3541 0.3790 0.6127 -0.0217 -0.0161 0.0589  88  PHE A CB    
725  C CG    . PHE A 88  ? 0.3658 0.3794 0.6139 -0.0231 -0.0122 0.0582  88  PHE A CG    
726  C CD1   . PHE A 88  ? 0.3326 0.3587 0.5959 -0.0191 -0.0032 0.0601  88  PHE A CD1   
727  C CD2   . PHE A 88  ? 0.4020 0.3893 0.6218 -0.0284 -0.0163 0.0555  88  PHE A CD2   
728  C CE1   . PHE A 88  ? 0.3415 0.3564 0.5950 -0.0200 0.0008  0.0597  88  PHE A CE1   
729  C CE2   . PHE A 88  ? 0.4162 0.3904 0.6247 -0.0292 -0.0112 0.0547  88  PHE A CE2   
730  C CZ    . PHE A 88  ? 0.3854 0.3744 0.6120 -0.0248 -0.0030 0.0570  88  PHE A CZ    
731  N N     . LYS A 89  ? 0.3384 0.3842 0.5969 -0.0115 -0.0069 0.0550  89  LYS A N     
732  C CA    . LYS A 89  ? 0.3089 0.3608 0.5735 -0.0101 -0.0094 0.0553  89  LYS A CA    
733  C C     . LYS A 89  ? 0.2946 0.3634 0.5765 -0.0045 0.0004  0.0565  89  LYS A C     
734  O O     . LYS A 89  ? 0.3076 0.3829 0.6066 -0.0033 -0.0008 0.0593  89  LYS A O     
735  C CB    . LYS A 89  ? 0.3348 0.3780 0.5762 -0.0099 -0.0078 0.0512  89  LYS A CB    
736  C CG    . LYS A 89  ? 0.3956 0.4168 0.6142 -0.0157 -0.0160 0.0497  89  LYS A CG    
737  C CD    . LYS A 89  ? 0.3852 0.3985 0.5832 -0.0151 -0.0123 0.0462  89  LYS A CD    
738  C CE    . LYS A 89  ? 0.3751 0.3979 0.5710 -0.0098 0.0015  0.0443  89  LYS A CE    
739  N NZ    . LYS A 89  ? 0.4058 0.4225 0.5956 -0.0089 0.0077  0.0441  89  LYS A NZ    
740  N N     . LEU A 90  ? 0.2877 0.3615 0.5641 -0.0012 0.0105  0.0550  90  LEU A N     
741  C CA    . LEU A 90  ? 0.2997 0.3845 0.5854 0.0030  0.0199  0.0559  90  LEU A CA    
742  C C     . LEU A 90  ? 0.3336 0.4240 0.6415 0.0035  0.0222  0.0601  90  LEU A C     
743  O O     . LEU A 90  ? 0.3461 0.4419 0.6654 0.0064  0.0286  0.0617  90  LEU A O     
744  C CB    . LEU A 90  ? 0.2895 0.3767 0.5632 0.0051  0.0275  0.0547  90  LEU A CB    
745  C CG    . LEU A 90  ? 0.3095 0.3951 0.5668 0.0052  0.0278  0.0521  90  LEU A CG    
746  C CD1   . LEU A 90  ? 0.3142 0.4052 0.5666 0.0072  0.0340  0.0533  90  LEU A CD1   
747  C CD2   . LEU A 90  ? 0.2929 0.3796 0.5482 0.0050  0.0270  0.0508  90  LEU A CD2   
748  N N     . ALA A 91  ? 0.3292 0.4166 0.6424 0.0007  0.0180  0.0620  91  ALA A N     
749  C CA    . ALA A 91  ? 0.3274 0.4207 0.6643 0.0002  0.0198  0.0669  91  ALA A CA    
750  C C     . ALA A 91  ? 0.3298 0.4270 0.6889 -0.0009 0.0133  0.0711  91  ALA A C     
751  O O     . ALA A 91  ? 0.3394 0.4449 0.7215 0.0019  0.0202  0.0754  91  ALA A O     
752  C CB    . ALA A 91  ? 0.3124 0.3996 0.6484 -0.0041 0.0149  0.0680  91  ALA A CB    
753  N N     . TYR A 92  ? 0.3284 0.4183 0.6803 -0.0048 0.0006  0.0706  92  TYR A N     
754  C CA    . TYR A 92  ? 0.3480 0.4410 0.7206 -0.0061 -0.0082 0.0756  92  TYR A CA    
755  C C     . TYR A 92  ? 0.3429 0.4427 0.7233 0.0005  0.0019  0.0757  92  TYR A C     
756  O O     . TYR A 92  ? 0.3183 0.4262 0.7271 0.0033  0.0051  0.0817  92  TYR A O     
757  C CB    . TYR A 92  ? 0.3803 0.4602 0.7355 -0.0119 -0.0238 0.0744  92  TYR A CB    
758  C CG    . TYR A 92  ? 0.4030 0.4855 0.7784 -0.0131 -0.0345 0.0805  92  TYR A CG    
759  C CD1   . TYR A 92  ? 0.4014 0.4834 0.7715 -0.0093 -0.0327 0.0789  92  TYR A CD1   
760  C CD2   . TYR A 92  ? 0.4208 0.5065 0.8226 -0.0183 -0.0470 0.0888  92  TYR A CD2   
761  C CE1   . TYR A 92  ? 0.4087 0.4929 0.7989 -0.0096 -0.0424 0.0854  92  TYR A CE1   
762  C CE2   . TYR A 92  ? 0.4488 0.5383 0.8733 -0.0192 -0.0579 0.0962  92  TYR A CE2   
763  C CZ    . TYR A 92  ? 0.4347 0.5233 0.8532 -0.0143 -0.0552 0.0945  92  TYR A CZ    
764  O OH    . TYR A 92  ? 0.4506 0.5426 0.8930 -0.0145 -0.0661 0.1027  92  TYR A OH    
765  N N     . LEU A 93  ? 0.3491 0.4445 0.7046 0.0029  0.0074  0.0695  93  LEU A N     
766  C CA    . LEU A 93  ? 0.3415 0.4388 0.6973 0.0081  0.0169  0.0685  93  LEU A CA    
767  C C     . LEU A 93  ? 0.3451 0.4479 0.7138 0.0127  0.0323  0.0705  93  LEU A C     
768  O O     . LEU A 93  ? 0.3655 0.4694 0.7482 0.0170  0.0404  0.0733  93  LEU A O     
769  C CB    . LEU A 93  ? 0.3150 0.4062 0.6408 0.0080  0.0191  0.0620  93  LEU A CB    
770  C CG    . LEU A 93  ? 0.3080 0.3913 0.6189 0.0045  0.0077  0.0598  93  LEU A CG    
771  C CD1   . LEU A 93  ? 0.2599 0.3395 0.5468 0.0049  0.0123  0.0546  93  LEU A CD1   
772  C CD2   . LEU A 93  ? 0.3285 0.4107 0.6554 0.0047  0.0002  0.0641  93  LEU A CD2   
773  N N     . SER A 94  ? 0.3160 0.4198 0.6787 0.0119  0.0372  0.0695  94  SER A N     
774  C CA    . SER A 94  ? 0.3022 0.4080 0.6725 0.0154  0.0519  0.0714  94  SER A CA    
775  C C     . SER A 94  ? 0.3029 0.4158 0.7089 0.0169  0.0549  0.0788  94  SER A C     
776  O O     . SER A 94  ? 0.3114 0.4240 0.7288 0.0217  0.0690  0.0814  94  SER A O     
777  C CB    . SER A 94  ? 0.2750 0.3800 0.6319 0.0137  0.0543  0.0696  94  SER A CB    
778  O OG    . SER A 94  ? 0.2657 0.3685 0.6204 0.0167  0.0690  0.0705  94  SER A OG    
779  N N     . ASP A 95  ? 0.2985 0.4161 0.7218 0.0124  0.0417  0.0829  95  ASP A N     
780  C CA    . ASP A 95  ? 0.3138 0.4404 0.7761 0.0124  0.0416  0.0918  95  ASP A CA    
781  C C     . ASP A 95  ? 0.3871 0.5171 0.8704 0.0162  0.0414  0.0964  95  ASP A C     
782  O O     . ASP A 95  ? 0.4506 0.5856 0.9598 0.0217  0.0549  0.1020  95  ASP A O     
783  C CB    . ASP A 95  ? 0.2952 0.4235 0.7675 0.0045  0.0238  0.0953  95  ASP A CB    
784  C CG    . ASP A 95  ? 0.3097 0.4356 0.7721 0.0015  0.0267  0.0935  95  ASP A CG    
785  O OD1   . ASP A 95  ? 0.2901 0.4120 0.7501 -0.0056 0.0129  0.0944  95  ASP A OD1   
786  O OD2   . ASP A 95  ? 0.3213 0.4468 0.7757 0.0058  0.0426  0.0913  95  ASP A OD2   
787  N N     . THR A 96  ? 0.3623 0.4880 0.8339 0.0137  0.0271  0.0944  96  THR A N     
788  C CA    . THR A 96  ? 0.3550 0.4831 0.8465 0.0165  0.0230  0.0996  96  THR A CA    
789  C C     . THR A 96  ? 0.4048 0.5288 0.8913 0.0248  0.0417  0.0973  96  THR A C     
790  O O     . THR A 96  ? 0.4375 0.5650 0.9510 0.0300  0.0468  0.1039  96  THR A O     
791  C CB    . THR A 96  ? 0.3326 0.4532 0.8049 0.0112  0.0036  0.0970  96  THR A CB    
792  O OG1   . THR A 96  ? 0.3141 0.4316 0.7786 0.0028  -0.0115 0.0969  96  THR A OG1   
793  C CG2   . THR A 96  ? 0.3249 0.4489 0.8239 0.0126  -0.0055 0.1052  96  THR A CG2   
794  N N     . TYR A 97  ? 0.3983 0.5134 0.8503 0.0258  0.0519  0.0887  97  TYR A N     
795  C CA    . TYR A 97  ? 0.3669 0.4728 0.8054 0.0317  0.0683  0.0855  97  TYR A CA    
796  C C     . TYR A 97  ? 0.3752 0.4754 0.8011 0.0340  0.0867  0.0829  97  TYR A C     
797  O O     . TYR A 97  ? 0.3651 0.4554 0.7562 0.0324  0.0905  0.0759  97  TYR A O     
798  C CB    . TYR A 97  ? 0.3232 0.4199 0.7282 0.0295  0.0613  0.0781  97  TYR A CB    
799  C CG    . TYR A 97  ? 0.2965 0.3952 0.7116 0.0277  0.0449  0.0810  97  TYR A CG    
800  C CD1   . TYR A 97  ? 0.2897 0.3896 0.6962 0.0210  0.0271  0.0798  97  TYR A CD1   
801  C CD2   . TYR A 97  ? 0.3018 0.3987 0.7341 0.0327  0.0478  0.0856  97  TYR A CD2   
802  C CE1   . TYR A 97  ? 0.2996 0.3976 0.7110 0.0183  0.0115  0.0827  97  TYR A CE1   
803  C CE2   . TYR A 97  ? 0.3063 0.4039 0.7474 0.0307  0.0315  0.0892  97  TYR A CE2   
804  C CZ    . TYR A 97  ? 0.3157 0.4133 0.7449 0.0230  0.0128  0.0877  97  TYR A CZ    
805  O OH    . TYR A 97  ? 0.3466 0.4411 0.7799 0.0201  -0.0040 0.0915  97  TYR A OH    
806  N N     . ASN A 98  ? 0.3963 0.5020 0.8510 0.0371  0.0978  0.0896  98  ASN A N     
807  C CA    . ASN A 98  ? 0.4072 0.5058 0.8510 0.0388  0.1158  0.0883  98  ASN A CA    
808  C C     . ASN A 98  ? 0.4324 0.5139 0.8599 0.0445  0.1367  0.0861  98  ASN A C     
809  O O     . ASN A 98  ? 0.4847 0.5611 0.9255 0.0493  0.1561  0.0903  98  ASN A O     
810  C CB    . ASN A 98  ? 0.3968 0.5068 0.8781 0.0395  0.1209  0.0966  98  ASN A CB    
811  N N     . TYR A 99  ? 0.4785 0.6725 0.9157 0.0699  0.1546  0.3033  99  TYR A N     
812  C CA    . TYR A 99  ? 0.4921 0.6856 0.9025 0.0814  0.1746  0.2992  99  TYR A CA    
813  C C     . TYR A 99  ? 0.4602 0.6431 0.8263 0.0858  0.1632  0.2796  99  TYR A C     
814  O O     . TYR A 99  ? 0.4443 0.6240 0.8082 0.0806  0.1407  0.2695  99  TYR A O     
815  C CB    . TYR A 99  ? 0.4735 0.6741 0.9098 0.0848  0.1815  0.2991  99  TYR A CB    
816  C CG    . TYR A 99  ? 0.4641 0.6714 0.9282 0.0783  0.1605  0.2926  99  TYR A CG    
817  C CD1   . TYR A 99  ? 0.4335 0.6454 0.9362 0.0685  0.1472  0.3004  99  TYR A CD1   
818  C CD2   . TYR A 99  ? 0.4637 0.6705 0.9120 0.0817  0.1533  0.2782  99  TYR A CD2   
819  C CE1   . TYR A 99  ? 0.4083 0.6229 0.9297 0.0616  0.1270  0.2943  99  TYR A CE1   
820  C CE2   . TYR A 99  ? 0.4209 0.6301 0.8885 0.0753  0.1334  0.2720  99  TYR A CE2   
821  C CZ    . TYR A 99  ? 0.3952 0.6077 0.8976 0.0650  0.1204  0.2802  99  TYR A CZ    
822  O OH    . TYR A 99  ? 0.3624 0.5751 0.8786 0.0576  0.1004  0.2741  99  TYR A OH    
823  N N     . GLU A 100 ? 0.4540 0.6307 0.7843 0.0949  0.1791  0.2744  100 GLU A N     
824  C CA    . GLU A 100 ? 0.4508 0.6184 0.7408 0.0983  0.1695  0.2562  100 GLU A CA    
825  C C     . GLU A 100 ? 0.4069 0.5813 0.7169 0.0973  0.1601  0.2462  100 GLU A C     
826  O O     . GLU A 100 ? 0.4014 0.5817 0.7277 0.1021  0.1746  0.2484  100 GLU A O     
827  C CB    . GLU A 100 ? 0.5459 0.7037 0.7926 0.1069  0.1890  0.2530  100 GLU A CB    
828  C CG    . GLU A 100 ? 0.6447 0.7934 0.8507 0.1090  0.1790  0.2341  100 GLU A CG    
829  C CD    . GLU A 100 ? 0.7662 0.9029 0.9272 0.1161  0.1974  0.2301  100 GLU A CD    
830  O OE1   . GLU A 100 ? 0.8081 0.9424 0.9662 0.1203  0.2188  0.2422  100 GLU A OE1   
831  O OE2   . GLU A 100 ? 0.8162 0.9447 0.9436 0.1170  0.1907  0.2148  100 GLU A OE2   
832  N N     . ILE A 101 ? 0.3850 0.5575 0.6931 0.0916  0.1366  0.2358  101 ILE A N     
833  C CA    . ILE A 101 ? 0.3698 0.5475 0.6966 0.0894  0.1251  0.2274  101 ILE A CA    
834  C C     . ILE A 101 ? 0.4080 0.5802 0.7078 0.0960  0.1320  0.2147  101 ILE A C     
835  O O     . ILE A 101 ? 0.4340 0.5963 0.6944 0.0971  0.1267  0.2025  101 ILE A O     
836  C CB    . ILE A 101 ? 0.3552 0.5299 0.6825 0.0813  0.0993  0.2194  101 ILE A CB    
837  C CG1   . ILE A 101 ? 0.3490 0.5272 0.7077 0.0735  0.0917  0.2316  101 ILE A CG1   
838  C CG2   . ILE A 101 ? 0.3320 0.5095 0.6702 0.0794  0.0876  0.2099  101 ILE A CG2   
839  C CD1   . ILE A 101 ? 0.3357 0.5077 0.6938 0.0657  0.0680  0.2238  101 ILE A CD1   
840  N N     . LYS A 102 ? 0.4200 0.5986 0.7430 0.1004  0.1440  0.2181  102 LYS A N     
841  C CA    . LYS A 102 ? 0.3922 0.5639 0.6956 0.1063  0.1497  0.2061  102 LYS A CA    
842  C C     . LYS A 102 ? 0.3731 0.5495 0.6987 0.1019  0.1312  0.2005  102 LYS A C     
843  O O     . LYS A 102 ? 0.3851 0.5739 0.7538 0.1006  0.1294  0.2104  102 LYS A O     
844  C CB    . LYS A 102 ? 0.3650 0.5383 0.6785 0.1157  0.1768  0.2137  102 LYS A CB    
845  N N     . TYR A 103 ? 0.3188 0.4859 0.6155 0.0991  0.1170  0.1854  103 TYR A N     
846  C CA    . TYR A 103 ? 0.2880 0.4573 0.6001 0.0940  0.0982  0.1798  103 TYR A CA    
847  C C     . TYR A 103 ? 0.3352 0.4970 0.6342 0.0987  0.1023  0.1697  103 TYR A C     
848  O O     . TYR A 103 ? 0.3740 0.5245 0.6381 0.1031  0.1132  0.1608  103 TYR A O     
849  C CB    . TYR A 103 ? 0.2776 0.4425 0.5724 0.0861  0.0772  0.1716  103 TYR A CB    
850  C CG    . TYR A 103 ? 0.3100 0.4641 0.5596 0.0871  0.0762  0.1576  103 TYR A CG    
851  C CD1   . TYR A 103 ? 0.3295 0.4801 0.5536 0.0893  0.0837  0.1585  103 TYR A CD1   
852  C CD2   . TYR A 103 ? 0.2823 0.4302 0.5155 0.0852  0.0668  0.1444  103 TYR A CD2   
853  C CE1   . TYR A 103 ? 0.3252 0.4680 0.5102 0.0894  0.0807  0.1466  103 TYR A CE1   
854  C CE2   . TYR A 103 ? 0.2940 0.4339 0.4892 0.0848  0.0650  0.1323  103 TYR A CE2   
855  C CZ    . TYR A 103 ? 0.3184 0.4567 0.4904 0.0868  0.0713  0.1334  103 TYR A CZ    
856  O OH    . TYR A 103 ? 0.3232 0.4558 0.4596 0.0856  0.0676  0.1222  103 TYR A OH    
857  N N     . ASP A 104 ? 0.3473 0.5142 0.6735 0.0972  0.0928  0.1715  104 ASP A N     
858  C CA    . ASP A 104 ? 0.3448 0.5032 0.6612 0.1009  0.0943  0.1628  104 ASP A CA    
859  C C     . ASP A 104 ? 0.3248 0.4773 0.6254 0.0930  0.0724  0.1514  104 ASP A C     
860  O O     . ASP A 104 ? 0.3190 0.4775 0.6428 0.0874  0.0561  0.1553  104 ASP A O     
861  C CB    . ASP A 104 ? 0.3394 0.5044 0.6927 0.1040  0.0983  0.1727  104 ASP A CB    
862  C CG    . ASP A 104 ? 0.3857 0.5411 0.7313 0.1111  0.1050  0.1661  104 ASP A CG    
863  O OD1   . ASP A 104 ? 0.3931 0.5354 0.7042 0.1102  0.1016  0.1524  104 ASP A OD1   
864  O OD2   . ASP A 104 ? 0.4367 0.5915 0.8014 0.1137  0.1117  0.1723  104 ASP A OD2   
865  N N     . HIS A 105 ? 0.3186 0.4590 0.5791 0.0920  0.0721  0.1376  105 HIS A N     
866  C CA    . HIS A 105 ? 0.3309 0.4661 0.5743 0.0845  0.0537  0.1267  105 HIS A CA    
867  C C     . HIS A 105 ? 0.3244 0.4562 0.5793 0.0833  0.0453  0.1247  105 HIS A C     
868  O O     . HIS A 105 ? 0.3674 0.4975 0.6190 0.0764  0.0284  0.1200  105 HIS A O     
869  C CB    . HIS A 105 ? 0.3994 0.5246 0.6005 0.0836  0.0562  0.1134  105 HIS A CB    
870  C CG    . HIS A 105 ? 0.5168 0.6297 0.6987 0.0875  0.0672  0.1051  105 HIS A CG    
871  N ND1   . HIS A 105 ? 0.5520 0.6564 0.7246 0.0841  0.0592  0.0961  105 HIS A ND1   
872  C CD2   . HIS A 105 ? 0.5741 0.6791 0.7425 0.0943  0.0862  0.1045  105 HIS A CD2   
873  C CE1   . HIS A 105 ? 0.5860 0.6776 0.7413 0.0884  0.0723  0.0901  105 HIS A CE1   
874  N NE2   . HIS A 105 ? 0.6045 0.6956 0.7561 0.0948  0.0890  0.0945  105 HIS A NE2   
875  N N     . THR A 106 ? 0.2630 0.3929 0.5308 0.0907  0.0577  0.1289  106 THR A N     
876  C CA    . THR A 106 ? 0.2809 0.4070 0.5608 0.0909  0.0505  0.1290  106 THR A CA    
877  C C     . THR A 106 ? 0.3156 0.4540 0.6305 0.0861  0.0338  0.1397  106 THR A C     
878  O O     . THR A 106 ? 0.3214 0.4565 0.6415 0.0831  0.0208  0.1391  106 THR A O     
879  C CB    . THR A 106 ? 0.2944 0.4159 0.5845 0.1016  0.0689  0.1330  106 THR A CB    
880  O OG1   . THR A 106 ? 0.2934 0.4299 0.6217 0.1073  0.0779  0.1485  106 THR A OG1   
881  C CG2   . THR A 106 ? 0.3088 0.4153 0.5614 0.1057  0.0861  0.1219  106 THR A CG2   
882  N N     . LYS A 107 ? 0.3302 0.4801 0.6651 0.0840  0.0338  0.1490  107 LYS A N     
883  C CA    . LYS A 107 ? 0.3255 0.4788 0.6787 0.0732  0.0178  0.1546  107 LYS A CA    
884  C C     . LYS A 107 ? 0.2971 0.4473 0.6360 0.0640  -0.0001 0.1482  107 LYS A C     
885  O O     . LYS A 107 ? 0.3225 0.4708 0.6686 0.0547  -0.0160 0.1493  107 LYS A O     
886  C CB    . LYS A 107 ? 0.3470 0.5095 0.7237 0.0725  0.0268  0.1662  107 LYS A CB    
887  C CG    . LYS A 107 ? 0.4013 0.5664 0.7910 0.0825  0.0479  0.1730  107 LYS A CG    
888  C CD    . LYS A 107 ? 0.4402 0.6061 0.8505 0.0818  0.0434  0.1781  107 LYS A CD    
889  C CE    . LYS A 107 ? 0.4620 0.6304 0.8876 0.0919  0.0653  0.1860  107 LYS A CE    
890  N NZ    . LYS A 107 ? 0.4566 0.6273 0.9052 0.0919  0.0608  0.1926  107 LYS A NZ    
891  N N     . ILE A 108 ? 0.2513 0.4006 0.5695 0.0671  0.0030  0.1419  108 ILE A N     
892  C CA    . ILE A 108 ? 0.2556 0.4002 0.5573 0.0593  -0.0115 0.1351  108 ILE A CA    
893  C C     . ILE A 108 ? 0.2739 0.4079 0.5540 0.0554  -0.0224 0.1240  108 ILE A C     
894  O O     . ILE A 108 ? 0.3322 0.4593 0.5897 0.0585  -0.0151 0.1152  108 ILE A O     
895  C CB    . ILE A 108 ? 0.3176 0.4604 0.5953 0.0609  -0.0032 0.1298  108 ILE A CB    
896  C CG1   . ILE A 108 ? 0.3150 0.4667 0.6108 0.0652  0.0099  0.1414  108 ILE A CG1   
897  C CG2   . ILE A 108 ? 0.3489 0.4870 0.6130 0.0541  -0.0171 0.1237  108 ILE A CG2   
898  C CD1   . ILE A 108 ? 0.3217 0.4714 0.5942 0.0670  0.0170  0.1384  108 ILE A CD1   
899  N N     . ARG A 109 ? 0.2466 0.3777 0.5319 0.0479  -0.0397 0.1243  109 ARG A N     
900  C CA    . ARG A 109 ? 0.2356 0.3558 0.5002 0.0438  -0.0496 0.1149  109 ARG A CA    
901  C C     . ARG A 109 ? 0.2370 0.3502 0.4701 0.0412  -0.0502 0.1024  109 ARG A C     
902  O O     . ARG A 109 ? 0.2398 0.3512 0.4694 0.0366  -0.0581 0.1010  109 ARG A O     
903  C CB    . ARG A 109 ? 0.2191 0.3353 0.4942 0.0358  -0.0671 0.1186  109 ARG A CB    
904  C CG    . ARG A 109 ? 0.2391 0.3449 0.4970 0.0332  -0.0766 0.1125  109 ARG A CG    
905  C CD    . ARG A 109 ? 0.2952 0.3946 0.5582 0.0247  -0.0927 0.1158  109 ARG A CD    
906  N NE    . ARG A 109 ? 0.3236 0.4296 0.6121 0.0250  -0.0906 0.1257  109 ARG A NE    
907  C CZ    . ARG A 109 ? 0.3245 0.4305 0.6210 0.0285  -0.0892 0.1300  109 ARG A CZ    
908  N NH1   . ARG A 109 ? 0.2995 0.3977 0.5798 0.0319  -0.0900 0.1255  109 ARG A NH1   
909  N NH2   . ARG A 109 ? 0.3285 0.4423 0.6507 0.0288  -0.0871 0.1397  109 ARG A NH2   
910  N N     . VAL A 110 ? 0.2371 0.3462 0.4483 0.0440  -0.0416 0.0937  110 VAL A N     
911  C CA    . VAL A 110 ? 0.2211 0.3264 0.4054 0.0415  -0.0423 0.0824  110 VAL A CA    
912  C C     . VAL A 110 ? 0.2120 0.3074 0.3800 0.0365  -0.0498 0.0745  110 VAL A C     
913  O O     . VAL A 110 ? 0.2375 0.3277 0.4007 0.0375  -0.0463 0.0727  110 VAL A O     
914  C CB    . VAL A 110 ? 0.2322 0.3402 0.4010 0.0460  -0.0290 0.0774  110 VAL A CB    
915  C CG1   . VAL A 110 ? 0.1901 0.2980 0.3365 0.0430  -0.0316 0.0676  110 VAL A CG1   
916  C CG2   . VAL A 110 ? 0.2584 0.3743 0.4404 0.0514  -0.0196 0.0860  110 VAL A CG2   
917  N N     . ALA A 111 ? 0.1931 0.2842 0.3515 0.0314  -0.0591 0.0700  111 ALA A N     
918  C CA    . ALA A 111 ? 0.2186 0.2995 0.3604 0.0262  -0.0658 0.0632  111 ALA A CA    
919  C C     . ALA A 111 ? 0.2794 0.3601 0.3991 0.0247  -0.0621 0.0525  111 ALA A C     
920  O O     . ALA A 111 ? 0.2824 0.3668 0.3995 0.0251  -0.0626 0.0504  111 ALA A O     
921  C CB    . ALA A 111 ? 0.1993 0.2726 0.3452 0.0208  -0.0795 0.0663  111 ALA A CB    
922  N N     A ASN A 112 ? 0.2976 0.3743 0.4033 0.0232  -0.0579 0.0464  112 ASN A N     
923  N N     B ASN A 112 ? 0.2949 0.3715 0.4004 0.0231  -0.0580 0.0463  112 ASN A N     
924  C CA    A ASN A 112 ? 0.2942 0.3716 0.3813 0.0202  -0.0552 0.0367  112 ASN A CA    
925  C CA    B ASN A 112 ? 0.2937 0.3716 0.3809 0.0203  -0.0552 0.0367  112 ASN A CA    
926  C C     A ASN A 112 ? 0.3106 0.3763 0.3853 0.0144  -0.0613 0.0331  112 ASN A C     
927  C C     B ASN A 112 ? 0.3108 0.3770 0.3846 0.0144  -0.0605 0.0324  112 ASN A C     
928  O O     A ASN A 112 ? 0.3392 0.3958 0.4111 0.0125  -0.0626 0.0346  112 ASN A O     
929  O O     B ASN A 112 ? 0.3333 0.3910 0.4027 0.0124  -0.0606 0.0329  112 ASN A O     
930  C CB    A ASN A 112 ? 0.2786 0.3586 0.3572 0.0207  -0.0462 0.0321  112 ASN A CB    
931  C CB    B ASN A 112 ? 0.2891 0.3710 0.3685 0.0213  -0.0458 0.0322  112 ASN A CB    
932  C CG    A ASN A 112 ? 0.2703 0.3617 0.3514 0.0251  -0.0399 0.0326  112 ASN A CG    
933  C CG    B ASN A 112 ? 0.3252 0.4111 0.3892 0.0171  -0.0439 0.0230  112 ASN A CG    
934  O OD1   A ASN A 112 ? 0.2938 0.3876 0.3865 0.0300  -0.0364 0.0393  112 ASN A OD1   
935  O OD1   B ASN A 112 ? 0.3473 0.4369 0.4092 0.0161  -0.0471 0.0207  112 ASN A OD1   
936  N ND2   A ASN A 112 ? 0.2465 0.3457 0.3169 0.0233  -0.0383 0.0261  112 ASN A ND2   
937  N ND2   B ASN A 112 ? 0.3492 0.4340 0.4031 0.0147  -0.0382 0.0179  112 ASN A ND2   
938  N N     . PHE A 113 ? 0.2975 0.3619 0.3639 0.0121  -0.0642 0.0287  113 PHE A N     
939  C CA    . PHE A 113 ? 0.3032 0.3548 0.3539 0.0066  -0.0683 0.0249  113 PHE A CA    
940  C C     . PHE A 113 ? 0.2910 0.3454 0.3287 0.0048  -0.0635 0.0166  113 PHE A C     
941  O O     . PHE A 113 ? 0.2548 0.3213 0.2978 0.0084  -0.0595 0.0147  113 PHE A O     
942  C CB    . PHE A 113 ? 0.3490 0.3890 0.4016 0.0046  -0.0792 0.0298  113 PHE A CB    
943  C CG    . PHE A 113 ? 0.3732 0.4111 0.4231 0.0048  -0.0817 0.0273  113 PHE A CG    
944  C CD1   . PHE A 113 ? 0.3923 0.4149 0.4240 0.0003  -0.0863 0.0230  113 PHE A CD1   
945  C CD2   . PHE A 113 ? 0.3604 0.4092 0.4237 0.0098  -0.0789 0.0293  113 PHE A CD2   
946  C CE1   . PHE A 113 ? 0.3792 0.3964 0.4067 0.0011  -0.0873 0.0200  113 PHE A CE1   
947  C CE2   . PHE A 113 ? 0.3686 0.4130 0.4293 0.0106  -0.0806 0.0273  113 PHE A CE2   
948  C CZ    . PHE A 113 ? 0.3680 0.3960 0.4109 0.0064  -0.0845 0.0222  113 PHE A CZ    
949  N N     . ASP A 114 ? 0.2915 0.3350 0.3130 -0.0004 -0.0635 0.0127  114 ASP A N     
950  C CA    . ASP A 114 ? 0.3278 0.3738 0.3379 -0.0025 -0.0574 0.0054  114 ASP A CA    
951  C C     . ASP A 114 ? 0.3437 0.3709 0.3347 -0.0078 -0.0603 0.0038  114 ASP A C     
952  O O     . ASP A 114 ? 0.3640 0.3800 0.3487 -0.0112 -0.0644 0.0070  114 ASP A O     
953  C CB    . ASP A 114 ? 0.3913 0.4486 0.4013 -0.0046 -0.0496 0.0015  114 ASP A CB    
954  C CG    . ASP A 114 ? 0.4733 0.5394 0.4785 -0.0063 -0.0428 -0.0048 114 ASP A CG    
955  O OD1   . ASP A 114 ? 0.5016 0.5823 0.5168 -0.0017 -0.0407 -0.0056 114 ASP A OD1   
956  O OD2   . ASP A 114 ? 0.4920 0.5509 0.4845 -0.0121 -0.0390 -0.0082 114 ASP A OD2   
957  N N     . ILE A 115 ? 0.3401 0.3624 0.3206 -0.0079 -0.0580 -0.0007 115 ILE A N     
958  C CA    . ILE A 115 ? 0.3657 0.3681 0.3232 -0.0131 -0.0593 -0.0029 115 ILE A CA    
959  C C     . ILE A 115 ? 0.3993 0.4051 0.3460 -0.0155 -0.0475 -0.0092 115 ILE A C     
960  O O     . ILE A 115 ? 0.4196 0.4438 0.3785 -0.0125 -0.0397 -0.0122 115 ILE A O     
961  C CB    . ILE A 115 ? 0.3562 0.3431 0.3041 -0.0125 -0.0659 -0.0033 115 ILE A CB    
962  C CG1   . ILE A 115 ? 0.3234 0.3148 0.2702 -0.0081 -0.0569 -0.0094 115 ILE A CG1   
963  C CG2   . ILE A 115 ? 0.3412 0.3295 0.3059 -0.0103 -0.0769 0.0035  115 ILE A CG2   
964  C CD1   . ILE A 115 ? 0.3135 0.2839 0.2447 -0.0082 -0.0612 -0.0118 115 ILE A CD1   
965  N N     . GLU A 116 ? 0.4027 0.3912 0.3271 -0.0213 -0.0465 -0.0105 116 GLU A N     
966  C CA    . GLU A 116 ? 0.4191 0.4088 0.3323 -0.0241 -0.0341 -0.0159 116 GLU A CA    
967  C C     . GLU A 116 ? 0.4676 0.4359 0.3559 -0.0250 -0.0328 -0.0191 116 GLU A C     
968  O O     . GLU A 116 ? 0.5255 0.4727 0.3967 -0.0278 -0.0430 -0.0165 116 GLU A O     
969  C CB    . GLU A 116 ? 0.4141 0.4011 0.3202 -0.0310 -0.0306 -0.0148 116 GLU A CB    
970  C CG    . GLU A 116 ? 0.4176 0.4205 0.3434 -0.0309 -0.0315 -0.0127 116 GLU A CG    
971  C CD    . GLU A 116 ? 0.4589 0.4871 0.4032 -0.0289 -0.0236 -0.0166 116 GLU A CD    
972  O OE1   . GLU A 116 ? 0.4428 0.4785 0.3871 -0.0278 -0.0157 -0.0205 116 GLU A OE1   
973  O OE2   . GLU A 116 ? 0.5386 0.5793 0.4973 -0.0283 -0.0253 -0.0156 116 GLU A OE2   
974  N N     . VAL A 117 ? 0.4341 0.4079 0.3205 -0.0224 -0.0205 -0.0246 117 VAL A N     
975  C CA    . VAL A 117 ? 0.4381 0.3901 0.2984 -0.0225 -0.0159 -0.0289 117 VAL A CA    
976  C C     . VAL A 117 ? 0.4473 0.4043 0.3008 -0.0239 0.0016  -0.0331 117 VAL A C     
977  O O     . VAL A 117 ? 0.4431 0.4222 0.3172 -0.0189 0.0119  -0.0353 117 VAL A O     
978  C CB    . VAL A 117 ? 0.3750 0.3248 0.2407 -0.0149 -0.0171 -0.0316 117 VAL A CB    
979  C CG1   . VAL A 117 ? 0.4095 0.3346 0.2456 -0.0147 -0.0095 -0.0376 117 VAL A CG1   
980  C CG2   . VAL A 117 ? 0.4085 0.3520 0.2806 -0.0149 -0.0341 -0.0269 117 VAL A CG2   
981  N N     . THR A 118 ? 0.4705 0.4078 0.2963 -0.0309 0.0048  -0.0332 118 THR A N     
982  C CA    . THR A 118 ? 0.4858 0.4251 0.3026 -0.0331 0.0228  -0.0366 118 THR A CA    
983  C C     . THR A 118 ? 0.5543 0.4828 0.3580 -0.0269 0.0335  -0.0425 118 THR A C     
984  O O     . THR A 118 ? 0.5551 0.4559 0.3318 -0.0268 0.0273  -0.0446 118 THR A O     
985  C CB    . THR A 118 ? 0.5230 0.4405 0.3100 -0.0424 0.0237  -0.0342 118 THR A CB    
986  O OG1   . THR A 118 ? 0.5487 0.4751 0.3488 -0.0474 0.0159  -0.0288 118 THR A OG1   
987  C CG2   . THR A 118 ? 0.5071 0.4256 0.2840 -0.0448 0.0442  -0.0373 118 THR A CG2   
988  N N     . SER A 119 ? 0.6283 0.5783 0.4516 -0.0217 0.0493  -0.0451 119 SER A N     
989  C CA    . SER A 119 ? 0.7205 0.6614 0.5341 -0.0142 0.0629  -0.0507 119 SER A CA    
990  C C     . SER A 119 ? 0.8319 0.7881 0.6529 -0.0139 0.0847  -0.0521 119 SER A C     
991  O O     . SER A 119 ? 0.8143 0.8043 0.6705 -0.0122 0.0895  -0.0497 119 SER A O     
992  C CB    . SER A 119 ? 0.6873 0.6415 0.5259 -0.0036 0.0589  -0.0514 119 SER A CB    
993  O OG    . SER A 119 ? 0.7053 0.6516 0.5375 0.0050  0.0743  -0.0566 119 SER A OG    
994  N N     . PRO A 120 ? 0.9608 0.8921 0.7482 -0.0160 0.0980  -0.0556 120 PRO A N     
995  C CA    . PRO A 120 ? 1.0362 0.9797 0.8287 -0.0158 0.1214  -0.0565 120 PRO A CA    
996  C C     . PRO A 120 ? 1.0855 1.0466 0.9022 -0.0030 0.1365  -0.0594 120 PRO A C     
997  O O     . PRO A 120 ? 1.0904 1.0796 0.9340 -0.0014 0.1521  -0.0576 120 PRO A O     
998  C CB    . PRO A 120 ? 1.0704 0.9749 0.8125 -0.0211 0.1294  -0.0594 120 PRO A CB    
999  C CG    . PRO A 120 ? 1.0766 0.9493 0.7903 -0.0192 0.1137  -0.0628 120 PRO A CG    
1000 C CD    . PRO A 120 ? 1.0122 0.9015 0.7532 -0.0196 0.0911  -0.0584 120 PRO A CD    
1001 N N     . ASP A 121 ? 1.1203 1.0654 0.9294 0.0060  0.1317  -0.0633 121 ASP A N     
1002 C CA    . ASP A 121 ? 1.1596 1.1159 0.9884 0.0198  0.1466  -0.0659 121 ASP A CA    
1003 C C     . ASP A 121 ? 1.1003 1.0866 0.9712 0.0275  0.1350  -0.0619 121 ASP A C     
1004 O O     . ASP A 121 ? 1.1178 1.0946 0.9903 0.0375  0.1333  -0.0642 121 ASP A O     
1005 C CB    . ASP A 121 ? 1.2537 1.1683 1.0431 0.0256  0.1531  -0.0735 121 ASP A CB    
1006 C CG    . ASP A 121 ? 1.3141 1.2026 1.0835 0.0229  0.1300  -0.0750 121 ASP A CG    
1007 O OD1   . ASP A 121 ? 1.3180 1.2160 1.0964 0.0150  0.1104  -0.0700 121 ASP A OD1   
1008 O OD2   . ASP A 121 ? 1.3581 1.2163 1.1034 0.0284  0.1320  -0.0812 121 ASP A OD2   
1009 N N     . GLY A 122 ? 1.0371 1.0573 0.9397 0.0223  0.1273  -0.0561 122 GLY A N     
1010 C CA    . GLY A 122 ? 0.9829 1.0335 0.9242 0.0289  0.1174  -0.0517 122 GLY A CA    
1011 C C     . GLY A 122 ? 0.9319 0.9729 0.8688 0.0263  0.0947  -0.0500 122 GLY A C     
1012 O O     . GLY A 122 ? 0.9482 0.9672 0.8593 0.0171  0.0842  -0.0507 122 GLY A O     
1013 N N     . PHE A 123 ? 0.8587 0.9170 0.8219 0.0349  0.0875  -0.0469 123 PHE A N     
1014 C CA    . PHE A 123 ? 0.7817 0.8351 0.7458 0.0333  0.0677  -0.0442 123 PHE A CA    
1015 C C     . PHE A 123 ? 0.7610 0.7754 0.6939 0.0337  0.0612  -0.0480 123 PHE A C     
1016 O O     . PHE A 123 ? 0.7994 0.7976 0.7239 0.0422  0.0694  -0.0517 123 PHE A O     
1017 C CB    . PHE A 123 ? 0.7406 0.8218 0.7393 0.0426  0.0631  -0.0392 123 PHE A CB    
1018 C CG    . PHE A 123 ? 0.7325 0.8089 0.7330 0.0418  0.0452  -0.0358 123 PHE A CG    
1019 C CD1   . PHE A 123 ? 0.7149 0.8053 0.7233 0.0338  0.0336  -0.0322 123 PHE A CD1   
1020 C CD2   . PHE A 123 ? 0.7495 0.8062 0.7435 0.0489  0.0410  -0.0361 123 PHE A CD2   
1021 C CE1   . PHE A 123 ? 0.7175 0.8040 0.7284 0.0337  0.0193  -0.0286 123 PHE A CE1   
1022 C CE2   . PHE A 123 ? 0.7414 0.7949 0.7390 0.0476  0.0257  -0.0321 123 PHE A CE2   
1023 C CZ    . PHE A 123 ? 0.7232 0.7925 0.7299 0.0404  0.0154  -0.0281 123 PHE A CZ    
1024 N N     . PRO A 124 ? 0.6852 0.6842 0.6014 0.0244  0.0462  -0.0469 124 PRO A N     
1025 C CA    . PRO A 124 ? 0.6709 0.6344 0.5585 0.0222  0.0367  -0.0496 124 PRO A CA    
1026 C C     . PRO A 124 ? 0.6278 0.5909 0.5300 0.0292  0.0274  -0.0474 124 PRO A C     
1027 O O     . PRO A 124 ? 0.5891 0.5646 0.5078 0.0271  0.0141  -0.0418 124 PRO A O     
1028 C CB    . PRO A 124 ? 0.6564 0.6132 0.5320 0.0106  0.0229  -0.0465 124 PRO A CB    
1029 C CG    . PRO A 124 ? 0.6155 0.6059 0.5210 0.0093  0.0211  -0.0414 124 PRO A CG    
1030 C CD    . PRO A 124 ? 0.6351 0.6495 0.5598 0.0152  0.0373  -0.0427 124 PRO A CD    
1031 N N     . GLU A 125 ? 0.6494 0.5968 0.5449 0.0375  0.0356  -0.0515 125 GLU A N     
1032 C CA    . GLU A 125 ? 0.6634 0.6077 0.5719 0.0444  0.0284  -0.0492 125 GLU A CA    
1033 C C     . GLU A 125 ? 0.6593 0.5816 0.5534 0.0361  0.0099  -0.0479 125 GLU A C     
1034 O O     . GLU A 125 ? 0.7367 0.6275 0.5984 0.0295  0.0065  -0.0529 125 GLU A O     
1035 C CB    . GLU A 125 ? 0.7265 0.6532 0.6274 0.0551  0.0423  -0.0545 125 GLU A CB    
1036 C CG    . GLU A 125 ? 0.7752 0.7312 0.7045 0.0669  0.0584  -0.0525 125 GLU A CG    
1037 C CD    . GLU A 125 ? 0.7967 0.7865 0.7640 0.0723  0.0506  -0.0436 125 GLU A CD    
1038 O OE1   . GLU A 125 ? 0.8201 0.8034 0.7907 0.0712  0.0369  -0.0400 125 GLU A OE1   
1039 O OE2   . GLU A 125 ? 0.7892 0.8123 0.7829 0.0771  0.0580  -0.0399 125 GLU A OE2   
1040 N N     . PRO A 126 ? 0.5611 0.5004 0.4792 0.0362  -0.0021 -0.0407 126 PRO A N     
1041 C CA    . PRO A 126 ? 0.5518 0.4761 0.4639 0.0286  -0.0195 -0.0375 126 PRO A CA    
1042 C C     . PRO A 126 ? 0.6203 0.5103 0.5125 0.0282  -0.0234 -0.0418 126 PRO A C     
1043 O O     . PRO A 126 ? 0.6516 0.5207 0.5265 0.0187  -0.0368 -0.0420 126 PRO A O     
1044 C CB    . PRO A 126 ? 0.4890 0.4409 0.4343 0.0322  -0.0258 -0.0290 126 PRO A CB    
1045 C CG    . PRO A 126 ? 0.4779 0.4525 0.4431 0.0432  -0.0130 -0.0284 126 PRO A CG    
1046 C CD    . PRO A 126 ? 0.4850 0.4598 0.4375 0.0433  0.0003  -0.0345 126 PRO A CD    
1047 N N     . SER A 127 ? 0.6378 0.5213 0.5323 0.0382  -0.0122 -0.0451 127 SER A N     
1048 C CA    . SER A 127 ? 0.6670 0.5146 0.5411 0.0379  -0.0146 -0.0502 127 SER A CA    
1049 C C     . SER A 127 ? 0.7211 0.5346 0.5529 0.0304  -0.0129 -0.0594 127 SER A C     
1050 O O     . SER A 127 ? 0.7834 0.5637 0.5911 0.0237  -0.0223 -0.0634 127 SER A O     
1051 C CB    . SER A 127 ? 0.6832 0.5303 0.5690 0.0520  -0.0006 -0.0515 127 SER A CB    
1052 O OG    . SER A 127 ? 0.7337 0.5868 0.6150 0.0596  0.0181  -0.0565 127 SER A OG    
1053 N N     . GLN A 128 ? 0.6982 0.5194 0.5201 0.0307  -0.0012 -0.0625 128 GLN A N     
1054 C CA    . GLN A 128 ? 0.7461 0.5357 0.5252 0.0240  0.0025  -0.0707 128 GLN A CA    
1055 C C     . GLN A 128 ? 0.7387 0.5272 0.5047 0.0106  -0.0129 -0.0673 128 GLN A C     
1056 O O     . GLN A 128 ? 0.7965 0.5531 0.5285 0.0011  -0.0233 -0.0710 128 GLN A O     
1057 C CB    . GLN A 128 ? 0.7609 0.5567 0.5346 0.0318  0.0260  -0.0756 128 GLN A CB    
1058 C CG    . GLN A 128 ? 0.8034 0.6063 0.5966 0.0471  0.0426  -0.0771 128 GLN A CG    
1059 C CD    . GLN A 128 ? 0.9375 0.7023 0.7103 0.0499  0.0418  -0.0834 128 GLN A CD    
1060 O OE1   . GLN A 128 ? 0.9651 0.7357 0.7614 0.0577  0.0401  -0.0799 128 GLN A OE1   
1061 N NE2   . GLN A 128 ? 1.0157 0.7393 0.7426 0.0431  0.0428  -0.0925 128 GLN A NE2   
1062 N N     . ALA A 129 ? 0.6422 0.4646 0.4347 0.0100  -0.0148 -0.0600 129 ALA A N     
1063 C CA    . ALA A 129 ? 0.5785 0.4029 0.3631 -0.0007 -0.0273 -0.0555 129 ALA A CA    
1064 C C     . ALA A 129 ? 0.6309 0.4264 0.3718 -0.0077 -0.0238 -0.0614 129 ALA A C     
1065 O O     . ALA A 129 ? 0.6670 0.4410 0.3842 -0.0176 -0.0394 -0.0603 129 ALA A O     
1066 C CB    . ALA A 129 ? 0.5332 0.3538 0.3265 -0.0072 -0.0491 -0.0495 129 ALA A CB    
1067 N N     . LYS A 130 ? 0.6426 0.4380 0.3731 -0.0025 -0.0032 -0.0668 130 LYS A N     
1068 C CA    . LYS A 130 ? 0.6772 0.4443 0.3641 -0.0080 0.0043  -0.0726 130 LYS A CA    
1069 C C     . LYS A 130 ? 0.7000 0.4740 0.3802 -0.0171 -0.0023 -0.0668 130 LYS A C     
1070 O O     . LYS A 130 ? 0.7788 0.5252 0.4194 -0.0251 -0.0056 -0.0688 130 LYS A O     
1071 C CB    . LYS A 130 ? 0.6682 0.4380 0.3519 0.0011  0.0310  -0.0787 130 LYS A CB    
1072 C CG    . LYS A 130 ? 0.6794 0.4428 0.3711 0.0125  0.0413  -0.0841 130 LYS A CG    
1073 C CD    . LYS A 130 ? 0.7262 0.4955 0.4183 0.0222  0.0689  -0.0887 130 LYS A CD    
1074 N N     . HIS A 131 ? 0.6347 0.4438 0.3517 -0.0159 -0.0041 -0.0597 131 HIS A N     
1075 C CA    . HIS A 131 ? 0.6361 0.4538 0.3505 -0.0228 -0.0057 -0.0545 131 HIS A CA    
1076 C C     . HIS A 131 ? 0.6119 0.4343 0.3376 -0.0289 -0.0277 -0.0462 131 HIS A C     
1077 O O     . HIS A 131 ? 0.5960 0.4312 0.3483 -0.0258 -0.0380 -0.0429 131 HIS A O     
1078 C CB    . HIS A 131 ? 0.6281 0.4797 0.3728 -0.0181 0.0101  -0.0530 131 HIS A CB    
1079 C CG    . HIS A 131 ? 0.6650 0.5193 0.4092 -0.0103 0.0320  -0.0593 131 HIS A CG    
1080 N ND1   . HIS A 131 ? 0.7207 0.5576 0.4348 -0.0123 0.0480  -0.0638 131 HIS A ND1   
1081 C CD2   . HIS A 131 ? 0.6621 0.5343 0.4330 0.0002  0.0413  -0.0612 131 HIS A CD2   
1082 C CE1   . HIS A 131 ? 0.7520 0.5973 0.4764 -0.0030 0.0671  -0.0683 131 HIS A CE1   
1083 N NE2   . HIS A 131 ? 0.7176 0.5845 0.4769 0.0050  0.0628  -0.0666 131 HIS A NE2   
1084 N N     . PRO A 132 ? 0.6179 0.4294 0.3236 -0.0370 -0.0341 -0.0422 132 PRO A N     
1085 C CA    . PRO A 132 ? 0.6017 0.4166 0.3178 -0.0420 -0.0542 -0.0333 132 PRO A CA    
1086 C C     . PRO A 132 ? 0.5465 0.3955 0.3058 -0.0379 -0.0541 -0.0278 132 PRO A C     
1087 O O     . PRO A 132 ? 0.5299 0.3982 0.3033 -0.0352 -0.0397 -0.0291 132 PRO A O     
1088 C CB    . PRO A 132 ? 0.6112 0.4088 0.2967 -0.0498 -0.0554 -0.0303 132 PRO A CB    
1089 C CG    . PRO A 132 ? 0.6484 0.4223 0.2960 -0.0507 -0.0410 -0.0385 132 PRO A CG    
1090 C CD    . PRO A 132 ? 0.6326 0.4250 0.3023 -0.0416 -0.0226 -0.0450 132 PRO A CD    
1091 N N     . ILE A 133 ? 0.5030 0.3588 0.2825 -0.0378 -0.0701 -0.0216 133 ILE A N     
1092 C CA    . ILE A 133 ? 0.4913 0.3743 0.3057 -0.0349 -0.0715 -0.0156 133 ILE A CA    
1093 C C     . ILE A 133 ? 0.5295 0.4079 0.3353 -0.0404 -0.0756 -0.0097 133 ILE A C     
1094 O O     . ILE A 133 ? 0.5507 0.4138 0.3449 -0.0449 -0.0905 -0.0040 133 ILE A O     
1095 C CB    . ILE A 133 ? 0.4461 0.3368 0.2849 -0.0326 -0.0854 -0.0104 133 ILE A CB    
1096 C CG1   . ILE A 133 ? 0.4050 0.2951 0.2485 -0.0277 -0.0819 -0.0158 133 ILE A CG1   
1097 C CG2   . ILE A 133 ? 0.4001 0.3168 0.2718 -0.0289 -0.0846 -0.0047 133 ILE A CG2   
1098 C CD1   . ILE A 133 ? 0.6238 0.5197 0.4901 -0.0263 -0.0945 -0.0104 133 ILE A CD1   
1099 N N     . ASP A 134 ? 0.4999 0.3910 0.3117 -0.0403 -0.0628 -0.0106 134 ASP A N     
1100 C CA    . ASP A 134 ? 0.5078 0.3910 0.3082 -0.0457 -0.0642 -0.0055 134 ASP A CA    
1101 C C     . ASP A 134 ? 0.5107 0.4110 0.3389 -0.0439 -0.0674 0.0005  134 ASP A C     
1102 O O     . ASP A 134 ? 0.5444 0.4381 0.3664 -0.0475 -0.0680 0.0053  134 ASP A O     
1103 C CB    . ASP A 134 ? 0.5315 0.4097 0.3122 -0.0493 -0.0477 -0.0101 134 ASP A CB    
1104 C CG    . ASP A 134 ? 0.4972 0.4004 0.3001 -0.0455 -0.0320 -0.0158 134 ASP A CG    
1105 O OD1   . ASP A 134 ? 0.4759 0.4009 0.3084 -0.0422 -0.0334 -0.0143 134 ASP A OD1   
1106 O OD2   . ASP A 134 ? 0.5057 0.4066 0.2960 -0.0459 -0.0182 -0.0213 134 ASP A OD2   
1107 N N     . ALA A 135 ? 0.4758 0.3960 0.3330 -0.0381 -0.0686 0.0005  135 ALA A N     
1108 C CA    . ALA A 135 ? 0.4311 0.3654 0.3129 -0.0356 -0.0711 0.0057  135 ALA A CA    
1109 C C     . ALA A 135 ? 0.4486 0.3989 0.3567 -0.0293 -0.0756 0.0071  135 ALA A C     
1110 O O     . ALA A 135 ? 0.4351 0.3954 0.3495 -0.0261 -0.0701 0.0020  135 ALA A O     
1111 C CB    . ALA A 135 ? 0.3795 0.3258 0.2668 -0.0370 -0.0577 0.0022  135 ALA A CB    
1112 N N     . ILE A 136 ? 0.4343 0.3867 0.3581 -0.0273 -0.0849 0.0148  136 ILE A N     
1113 C CA    . ILE A 136 ? 0.3843 0.3534 0.3351 -0.0214 -0.0867 0.0173  136 ILE A CA    
1114 C C     . ILE A 136 ? 0.3741 0.3506 0.3417 -0.0187 -0.0857 0.0229  136 ILE A C     
1115 O O     . ILE A 136 ? 0.4135 0.3798 0.3798 -0.0198 -0.0929 0.0298  136 ILE A O     
1116 C CB    . ILE A 136 ? 0.3828 0.3462 0.3394 -0.0211 -0.1001 0.0223  136 ILE A CB    
1117 C CG1   . ILE A 136 ? 0.4217 0.3712 0.3566 -0.0243 -0.1019 0.0162  136 ILE A CG1   
1118 C CG2   . ILE A 136 ? 0.3223 0.3034 0.3073 -0.0152 -0.0999 0.0255  136 ILE A CG2   
1119 C CD1   . ILE A 136 ? 0.4105 0.3497 0.3464 -0.0266 -0.1169 0.0205  136 ILE A CD1   
1120 N N     . THR A 137 ? 0.3379 0.3307 0.3201 -0.0149 -0.0768 0.0202  137 THR A N     
1121 C CA    . THR A 137 ? 0.3134 0.3121 0.3118 -0.0110 -0.0749 0.0250  137 THR A CA    
1122 C C     . THR A 137 ? 0.2984 0.3107 0.3189 -0.0050 -0.0765 0.0287  137 THR A C     
1123 O O     . THR A 137 ? 0.3074 0.3311 0.3317 -0.0031 -0.0722 0.0244  137 THR A O     
1124 C CB    . THR A 137 ? 0.3183 0.3219 0.3131 -0.0123 -0.0634 0.0193  137 THR A CB    
1125 O OG1   . THR A 137 ? 0.3262 0.3162 0.3019 -0.0185 -0.0614 0.0171  137 THR A OG1   
1126 C CG2   . THR A 137 ? 0.3255 0.3318 0.3344 -0.0076 -0.0603 0.0235  137 THR A CG2   
1127 N N     . HIS A 138 ? 0.2725 0.2838 0.3086 -0.0019 -0.0827 0.0377  138 HIS A N     
1128 C CA    . HIS A 138 ? 0.2478 0.2709 0.3063 0.0031  -0.0845 0.0431  138 HIS A CA    
1129 C C     . HIS A 138 ? 0.2664 0.2951 0.3416 0.0088  -0.0784 0.0486  138 HIS A C     
1130 O O     . HIS A 138 ? 0.3067 0.3290 0.3889 0.0100  -0.0825 0.0558  138 HIS A O     
1131 C CB    . HIS A 138 ? 0.2932 0.3104 0.3578 0.0007  -0.0986 0.0500  138 HIS A CB    
1132 C CG    . HIS A 138 ? 0.3230 0.3515 0.4114 0.0041  -0.1013 0.0561  138 HIS A CG    
1133 N ND1   . HIS A 138 ? 0.3168 0.3445 0.4045 0.0016  -0.1069 0.0545  138 HIS A ND1   
1134 C CD2   . HIS A 138 ? 0.3314 0.3709 0.4449 0.0096  -0.0983 0.0641  138 HIS A CD2   
1135 C CE1   . HIS A 138 ? 0.3277 0.3658 0.4394 0.0047  -0.1078 0.0617  138 HIS A CE1   
1136 N NE2   . HIS A 138 ? 0.3247 0.3711 0.4529 0.0097  -0.1023 0.0678  138 HIS A NE2   
1137 N N     . TYR A 139 ? 0.2355 0.2752 0.3159 0.0128  -0.0682 0.0455  139 TYR A N     
1138 C CA    . TYR A 139 ? 0.2438 0.2871 0.3377 0.0190  -0.0603 0.0500  139 TYR A CA    
1139 C C     . TYR A 139 ? 0.2831 0.3369 0.4017 0.0241  -0.0619 0.0590  139 TYR A C     
1140 O O     . TYR A 139 ? 0.3032 0.3655 0.4252 0.0241  -0.0626 0.0582  139 TYR A O     
1141 C CB    . TYR A 139 ? 0.2485 0.2955 0.3312 0.0198  -0.0482 0.0417  139 TYR A CB    
1142 C CG    . TYR A 139 ? 0.2768 0.3257 0.3698 0.0266  -0.0383 0.0452  139 TYR A CG    
1143 C CD1   . TYR A 139 ? 0.3029 0.3634 0.4064 0.0315  -0.0333 0.0479  139 TYR A CD1   
1144 C CD2   . TYR A 139 ? 0.2854 0.3227 0.3764 0.0287  -0.0327 0.0461  139 TYR A CD2   
1145 C CE1   . TYR A 139 ? 0.3270 0.3877 0.4374 0.0381  -0.0223 0.0509  139 TYR A CE1   
1146 C CE2   . TYR A 139 ? 0.3305 0.3672 0.4293 0.0359  -0.0216 0.0488  139 TYR A CE2   
1147 C CZ    . TYR A 139 ? 0.3582 0.4067 0.4662 0.0405  -0.0160 0.0510  139 TYR A CZ    
1148 O OH    . TYR A 139 ? 0.3860 0.4325 0.4994 0.0479  -0.0031 0.0535  139 TYR A OH    
1149 N N     . ASP A 140 ? 0.2782 0.3316 0.4155 0.0285  -0.0621 0.0685  140 ASP A N     
1150 C CA    . ASP A 140 ? 0.2570 0.3220 0.4219 0.0333  -0.0621 0.0785  140 ASP A CA    
1151 C C     . ASP A 140 ? 0.2881 0.3571 0.4603 0.0413  -0.0462 0.0799  140 ASP A C     
1152 O O     . ASP A 140 ? 0.3283 0.3895 0.4995 0.0449  -0.0401 0.0806  140 ASP A O     
1153 C CB    . ASP A 140 ? 0.2865 0.3506 0.4714 0.0327  -0.0742 0.0898  140 ASP A CB    
1154 C CG    . ASP A 140 ? 0.3149 0.3930 0.5322 0.0361  -0.0753 0.1012  140 ASP A CG    
1155 O OD1   . ASP A 140 ? 0.2627 0.3473 0.4988 0.0439  -0.0642 0.1076  140 ASP A OD1   
1156 O OD2   . ASP A 140 ? 0.3671 0.4485 0.5910 0.0307  -0.0866 0.1038  140 ASP A OD2   
1157 N N     . SER A 141 ? 0.2755 0.3547 0.4533 0.0442  -0.0390 0.0804  141 SER A N     
1158 C CA    . SER A 141 ? 0.2551 0.3361 0.4331 0.0513  -0.0227 0.0802  141 SER A CA    
1159 C C     . SER A 141 ? 0.2904 0.3739 0.4952 0.0589  -0.0165 0.0916  141 SER A C     
1160 O O     . SER A 141 ? 0.3327 0.4113 0.5348 0.0654  -0.0020 0.0907  141 SER A O     
1161 C CB    . SER A 141 ? 0.2490 0.3396 0.4245 0.0523  -0.0172 0.0792  141 SER A CB    
1162 O OG    . SER A 141 ? 0.2659 0.3667 0.4668 0.0531  -0.0218 0.0898  141 SER A OG    
1163 N N     . ILE A 142 ? 0.2915 0.3825 0.5228 0.0579  -0.0273 0.1025  142 ILE A N     
1164 C CA    . ILE A 142 ? 0.3165 0.4138 0.5798 0.0652  -0.0229 0.1154  142 ILE A CA    
1165 C C     . ILE A 142 ? 0.3413 0.4273 0.6036 0.0679  -0.0246 0.1166  142 ILE A C     
1166 O O     . ILE A 142 ? 0.3657 0.4488 0.6376 0.0769  -0.0111 0.1204  142 ILE A O     
1167 C CB    . ILE A 142 ? 0.2818 0.3929 0.5768 0.0621  -0.0356 0.1276  142 ILE A CB    
1168 C CG1   . ILE A 142 ? 0.2218 0.3430 0.5217 0.0613  -0.0304 0.1287  142 ILE A CG1   
1169 C CG2   . ILE A 142 ? 0.2022 0.3177 0.5240 0.0660  -0.0320 0.1383  142 ILE A CG2   
1170 C CD1   . ILE A 142 ? 0.1864 0.3128 0.5019 0.0525  -0.0411 0.1346  142 ILE A CD1   
1171 N N     . ASP A 143 ? 0.3069 0.3850 0.5562 0.0604  -0.0400 0.1135  143 ASP A N     
1172 C CA    . ASP A 143 ? 0.3028 0.3679 0.5470 0.0620  -0.0425 0.1147  143 ASP A CA    
1173 C C     . ASP A 143 ? 0.3369 0.3864 0.5515 0.0634  -0.0289 0.1026  143 ASP A C     
1174 O O     . ASP A 143 ? 0.3473 0.3846 0.5601 0.0679  -0.0241 0.1040  143 ASP A O     
1175 C CB    . ASP A 143 ? 0.3030 0.3619 0.5368 0.0529  -0.0625 0.1147  143 ASP A CB    
1176 C CG    . ASP A 143 ? 0.3515 0.4227 0.6134 0.0502  -0.0785 0.1270  143 ASP A CG    
1177 O OD1   . ASP A 143 ? 0.3492 0.4326 0.6398 0.0551  -0.0729 0.1360  143 ASP A OD1   
1178 O OD2   . ASP A 143 ? 0.3875 0.4539 0.6371 0.0411  -0.0950 0.1253  143 ASP A OD2   
1179 N N     . ASP A 144 ? 0.3521 0.4021 0.5444 0.0593  -0.0235 0.0911  144 ASP A N     
1180 C CA    . ASP A 144 ? 0.3529 0.3892 0.5148 0.0574  -0.0137 0.0783  144 ASP A CA    
1181 C C     . ASP A 144 ? 0.3641 0.3861 0.5094 0.0512  -0.0224 0.0748  144 ASP A C     
1182 O O     . ASP A 144 ? 0.4216 0.4281 0.5545 0.0526  -0.0151 0.0711  144 ASP A O     
1183 C CB    . ASP A 144 ? 0.3712 0.4000 0.5350 0.0666  0.0045  0.0785  144 ASP A CB    
1184 C CG    . ASP A 144 ? 0.4092 0.4238 0.5401 0.0631  0.0141  0.0643  144 ASP A CG    
1185 O OD1   . ASP A 144 ? 0.4739 0.4735 0.5990 0.0685  0.0265  0.0625  144 ASP A OD1   
1186 O OD2   . ASP A 144 ? 0.3716 0.3897 0.4833 0.0547  0.0090  0.0552  144 ASP A OD2   
1187 N N     . ARG A 145 ? 0.3284 0.3539 0.4722 0.0443  -0.0376 0.0761  145 ARG A N     
1188 C CA    . ARG A 145 ? 0.3382 0.3501 0.4655 0.0381  -0.0465 0.0742  145 ARG A CA    
1189 C C     . ARG A 145 ? 0.3356 0.3487 0.4428 0.0286  -0.0541 0.0658  145 ARG A C     
1190 O O     . ARG A 145 ? 0.3285 0.3531 0.4423 0.0270  -0.0596 0.0662  145 ARG A O     
1191 C CB    . ARG A 145 ? 0.3280 0.3389 0.4745 0.0403  -0.0589 0.0876  145 ARG A CB    
1192 C CG    . ARG A 145 ? 0.3585 0.3669 0.5267 0.0507  -0.0515 0.0974  145 ARG A CG    
1193 C CD    . ARG A 145 ? 0.3929 0.3811 0.5417 0.0520  -0.0421 0.0923  145 ARG A CD    
1194 N NE    . ARG A 145 ? 0.4319 0.4150 0.6019 0.0630  -0.0358 0.1028  145 ARG A NE    
1195 C CZ    . ARG A 145 ? 0.4474 0.4302 0.6271 0.0723  -0.0187 0.1025  145 ARG A CZ    
1196 N NH1   . ARG A 145 ? 0.4581 0.4453 0.6263 0.0710  -0.0076 0.0922  145 ARG A NH1   
1197 N NH2   . ARG A 145 ? 0.4407 0.4182 0.6409 0.0833  -0.0124 0.1127  145 ARG A NH2   
1198 N N     . PHE A 146 ? 0.3259 0.3263 0.4091 0.0225  -0.0534 0.0584  146 PHE A N     
1199 C CA    . PHE A 146 ? 0.3019 0.3022 0.3664 0.0141  -0.0591 0.0511  146 PHE A CA    
1200 C C     . PHE A 146 ? 0.3324 0.3230 0.3920 0.0102  -0.0724 0.0571  146 PHE A C     
1201 O O     . PHE A 146 ? 0.3761 0.3520 0.4245 0.0083  -0.0733 0.0589  146 PHE A O     
1202 C CB    . PHE A 146 ? 0.3010 0.2943 0.3432 0.0086  -0.0503 0.0403  146 PHE A CB    
1203 C CG    . PHE A 146 ? 0.3174 0.3196 0.3595 0.0104  -0.0395 0.0333  146 PHE A CG    
1204 C CD1   . PHE A 146 ? 0.3188 0.3161 0.3659 0.0161  -0.0300 0.0343  146 PHE A CD1   
1205 C CD2   . PHE A 146 ? 0.3237 0.3382 0.3595 0.0067  -0.0387 0.0259  146 PHE A CD2   
1206 C CE1   . PHE A 146 ? 0.3319 0.3350 0.3743 0.0169  -0.0207 0.0275  146 PHE A CE1   
1207 C CE2   . PHE A 146 ? 0.3170 0.3396 0.3510 0.0078  -0.0306 0.0203  146 PHE A CE2   
1208 C CZ    . PHE A 146 ? 0.3267 0.3430 0.3622 0.0124  -0.0220 0.0208  146 PHE A CZ    
1209 N N     . TYR A 147 ? 0.2967 0.2937 0.3632 0.0087  -0.0832 0.0605  147 TYR A N     
1210 C CA    . TYR A 147 ? 0.3170 0.3034 0.3749 0.0038  -0.0974 0.0654  147 TYR A CA    
1211 C C     . TYR A 147 ? 0.3500 0.3275 0.3787 -0.0040 -0.0972 0.0558  147 TYR A C     
1212 O O     . TYR A 147 ? 0.3468 0.3313 0.3714 -0.0059 -0.0956 0.0492  147 TYR A O     
1213 C CB    . TYR A 147 ? 0.2954 0.2903 0.3727 0.0043  -0.1098 0.0732  147 TYR A CB    
1214 C CG    . TYR A 147 ? 0.3010 0.3057 0.4105 0.0118  -0.1104 0.0849  147 TYR A CG    
1215 C CD1   . TYR A 147 ? 0.3094 0.3289 0.4393 0.0180  -0.1003 0.0854  147 TYR A CD1   
1216 C CD2   . TYR A 147 ? 0.3177 0.3169 0.4373 0.0133  -0.1205 0.0963  147 TYR A CD2   
1217 C CE1   . TYR A 147 ? 0.3381 0.3671 0.4985 0.0254  -0.0985 0.0964  147 TYR A CE1   
1218 C CE2   . TYR A 147 ? 0.3387 0.3489 0.4916 0.0212  -0.1199 0.1080  147 TYR A CE2   
1219 C CZ    . TYR A 147 ? 0.3663 0.3914 0.5398 0.0273  -0.1079 0.1078  147 TYR A CZ    
1220 O OH    . TYR A 147 ? 0.3538 0.3900 0.5613 0.0357  -0.1051 0.1197  147 TYR A OH    
1221 N N     . VAL A 148 ? 0.3817 0.3435 0.3908 -0.0080 -0.0977 0.0558  148 VAL A N     
1222 C CA    . VAL A 148 ? 0.4082 0.3610 0.3896 -0.0152 -0.0945 0.0472  148 VAL A CA    
1223 C C     . VAL A 148 ? 0.4375 0.3759 0.4004 -0.0205 -0.1074 0.0505  148 VAL A C     
1224 O O     . VAL A 148 ? 0.4510 0.3772 0.4096 -0.0213 -0.1164 0.0590  148 VAL A O     
1225 C CB    . VAL A 148 ? 0.4095 0.3531 0.3773 -0.0177 -0.0839 0.0436  148 VAL A CB    
1226 C CG1   . VAL A 148 ? 0.3287 0.2648 0.2703 -0.0255 -0.0794 0.0357  148 VAL A CG1   
1227 C CG2   . VAL A 148 ? 0.3703 0.3257 0.3516 -0.0139 -0.0718 0.0388  148 VAL A CG2   
1228 N N     . PHE A 149 ? 0.4137 0.3525 0.3647 -0.0240 -0.1083 0.0437  149 PHE A N     
1229 C CA    . PHE A 149 ? 0.4294 0.3516 0.3570 -0.0299 -0.1192 0.0445  149 PHE A CA    
1230 C C     . PHE A 149 ? 0.4367 0.3477 0.3343 -0.0352 -0.1093 0.0360  149 PHE A C     
1231 O O     . PHE A 149 ? 0.4492 0.3677 0.3441 -0.0352 -0.0995 0.0270  149 PHE A O     
1232 C CB    . PHE A 149 ? 0.4091 0.3361 0.3438 -0.0299 -0.1271 0.0431  149 PHE A CB    
1233 C CG    . PHE A 149 ? 0.3540 0.2929 0.3199 -0.0257 -0.1367 0.0523  149 PHE A CG    
1234 C CD1   . PHE A 149 ? 0.3140 0.2722 0.3071 -0.0191 -0.1279 0.0524  149 PHE A CD1   
1235 C CD2   . PHE A 149 ? 0.3832 0.3145 0.3512 -0.0288 -0.1546 0.0613  149 PHE A CD2   
1236 C CE1   . PHE A 149 ? 0.3321 0.3017 0.3548 -0.0151 -0.1346 0.0615  149 PHE A CE1   
1237 C CE2   . PHE A 149 ? 0.4030 0.3478 0.4038 -0.0254 -0.1629 0.0708  149 PHE A CE2   
1238 C CZ    . PHE A 149 ? 0.3704 0.3345 0.3990 -0.0182 -0.1517 0.0709  149 PHE A CZ    
1239 N N     . ASP A 150 ? 0.4329 0.3265 0.3094 -0.0394 -0.1114 0.0398  150 ASP A N     
1240 C CA    . ASP A 150 ? 0.4950 0.3780 0.3448 -0.0447 -0.0997 0.0334  150 ASP A CA    
1241 C C     . ASP A 150 ? 0.5651 0.4254 0.3805 -0.0507 -0.1070 0.0338  150 ASP A C     
1242 O O     . ASP A 150 ? 0.6504 0.4964 0.4558 -0.0526 -0.1212 0.0427  150 ASP A O     
1243 C CB    . ASP A 150 ? 0.5045 0.3834 0.3550 -0.0453 -0.0929 0.0370  150 ASP A CB    
1244 C CG    . ASP A 150 ? 0.5317 0.4007 0.3573 -0.0519 -0.0799 0.0315  150 ASP A CG    
1245 O OD1   . ASP A 150 ? 0.5430 0.4140 0.3566 -0.0544 -0.0727 0.0236  150 ASP A OD1   
1246 O OD2   . ASP A 150 ? 0.5436 0.4025 0.3630 -0.0543 -0.0760 0.0355  150 ASP A OD2   
1247 N N     . LEU A 151 ? 0.5148 0.3717 0.3117 -0.0533 -0.0973 0.0245  151 LEU A N     
1248 C CA    . LEU A 151 ? 0.5444 0.3773 0.3037 -0.0590 -0.1012 0.0230  151 LEU A CA    
1249 C C     . LEU A 151 ? 0.5973 0.4155 0.3295 -0.0643 -0.0903 0.0230  151 LEU A C     
1250 O O     . LEU A 151 ? 0.6045 0.4294 0.3344 -0.0651 -0.0727 0.0157  151 LEU A O     
1251 C CB    . LEU A 151 ? 0.5595 0.3932 0.3113 -0.0581 -0.0951 0.0130  151 LEU A CB    
1252 C CG    . LEU A 151 ? 0.6227 0.4285 0.3314 -0.0638 -0.0968 0.0096  151 LEU A CG    
1253 C CD1   . LEU A 151 ? 0.6346 0.4223 0.3289 -0.0679 -0.1194 0.0181  151 LEU A CD1   
1254 C CD2   . LEU A 151 ? 0.6117 0.4169 0.3150 -0.0614 -0.0894 -0.0007 151 LEU A CD2   
1255 N N     . LEU A 152 ? 0.6230 0.4218 0.3357 -0.0679 -0.1008 0.0321  152 LEU A N     
1256 C CA    . LEU A 152 ? 0.6516 0.4341 0.3377 -0.0733 -0.0910 0.0340  152 LEU A CA    
1257 C C     . LEU A 152 ? 0.7321 0.4952 0.3780 -0.0786 -0.0835 0.0277  152 LEU A C     
1258 O O     . LEU A 152 ? 0.7564 0.5136 0.3858 -0.0825 -0.0670 0.0251  152 LEU A O     
1259 C CB    . LEU A 152 ? 0.6221 0.3888 0.3000 -0.0746 -0.1051 0.0472  152 LEU A CB    
1260 C CG    . LEU A 152 ? 0.6123 0.3946 0.3278 -0.0686 -0.1096 0.0542  152 LEU A CG    
1261 C CD1   . LEU A 152 ? 0.6430 0.4073 0.3481 -0.0692 -0.1213 0.0680  152 LEU A CD1   
1262 C CD2   . LEU A 152 ? 0.5766 0.3750 0.3117 -0.0675 -0.0904 0.0476  152 LEU A CD2   
1263 N N     . ASN A 153 ? 0.7383 0.4905 0.3681 -0.0791 -0.0947 0.0252  153 ASN A N     
1264 C CA    . ASN A 153 ? 0.7425 0.4712 0.3289 -0.0838 -0.0882 0.0190  153 ASN A CA    
1265 C C     . ASN A 153 ? 0.7392 0.4737 0.3288 -0.0805 -0.0817 0.0076  153 ASN A C     
1266 O O     . ASN A 153 ? 0.7175 0.4551 0.3191 -0.0784 -0.0957 0.0069  153 ASN A O     
1267 C CB    . ASN A 153 ? 0.7780 0.4772 0.3272 -0.0896 -0.1078 0.0265  153 ASN A CB    
1268 C CG    . ASN A 153 ? 0.8359 0.5269 0.3797 -0.0920 -0.1139 0.0391  153 ASN A CG    
1269 O OD1   . ASN A 153 ? 0.8867 0.5800 0.4310 -0.0929 -0.0975 0.0398  153 ASN A OD1   
1270 N ND2   . ASN A 153 ? 0.8625 0.5440 0.4028 -0.0933 -0.1378 0.0498  153 ASN A ND2   
1271 N N     . SER A 154 ? 0.7643 0.5000 0.3441 -0.0800 -0.0596 -0.0008 154 SER A N     
1272 C CA    . SER A 154 ? 0.7688 0.5108 0.3535 -0.0753 -0.0495 -0.0115 154 SER A CA    
1273 C C     . SER A 154 ? 0.8312 0.5521 0.3761 -0.0779 -0.0312 -0.0182 154 SER A C     
1274 O O     . SER A 154 ? 0.8628 0.5744 0.3881 -0.0827 -0.0217 -0.0148 154 SER A O     
1275 C CB    . SER A 154 ? 0.7044 0.4822 0.3358 -0.0689 -0.0378 -0.0143 154 SER A CB    
1276 O OG    . SER A 154 ? 0.6994 0.4841 0.3345 -0.0638 -0.0226 -0.0238 154 SER A OG    
1277 N N     . PRO A 155 ? 0.8626 0.5743 0.3947 -0.0746 -0.0251 -0.0276 155 PRO A N     
1278 C CA    . PRO A 155 ? 0.8832 0.5765 0.3804 -0.0753 -0.0035 -0.0348 155 PRO A CA    
1279 C C     . PRO A 155 ? 0.8667 0.5861 0.3893 -0.0720 0.0213  -0.0364 155 PRO A C     
1280 O O     . PRO A 155 ? 0.9305 0.6391 0.4296 -0.0726 0.0420  -0.0406 155 PRO A O     
1281 C CB    . PRO A 155 ? 0.8980 0.5800 0.3863 -0.0703 -0.0027 -0.0446 155 PRO A CB    
1282 C CG    . PRO A 155 ? 0.8492 0.5546 0.3807 -0.0658 -0.0186 -0.0426 155 PRO A CG    
1283 C CD    . PRO A 155 ? 0.8522 0.5643 0.3959 -0.0708 -0.0382 -0.0315 155 PRO A CD    
1284 N N     . TYR A 156 ? 0.8136 0.5668 0.3835 -0.0692 0.0192  -0.0328 156 TYR A N     
1285 C CA    . TYR A 156 ? 0.8328 0.6136 0.4309 -0.0676 0.0395  -0.0338 156 TYR A CA    
1286 C C     . TYR A 156 ? 0.8409 0.6268 0.4440 -0.0748 0.0390  -0.0258 156 TYR A C     
1287 O O     . TYR A 156 ? 0.8328 0.6416 0.4604 -0.0759 0.0531  -0.0256 156 TYR A O     
1288 C CB    . TYR A 156 ? 0.8202 0.6351 0.4661 -0.0595 0.0395  -0.0366 156 TYR A CB    
1289 C CG    . TYR A 156 ? 0.8585 0.6693 0.5027 -0.0514 0.0432  -0.0443 156 TYR A CG    
1290 C CD1   . TYR A 156 ? 0.9212 0.7075 0.5300 -0.0505 0.0573  -0.0506 156 TYR A CD1   
1291 C CD2   . TYR A 156 ? 0.8263 0.6556 0.5028 -0.0446 0.0336  -0.0452 156 TYR A CD2   
1292 C CE1   . TYR A 156 ? 0.9500 0.7292 0.5560 -0.0426 0.0617  -0.0580 156 TYR A CE1   
1293 C CE2   . TYR A 156 ? 0.8444 0.6677 0.5192 -0.0371 0.0373  -0.0517 156 TYR A CE2   
1294 C CZ    . TYR A 156 ? 0.9067 0.7044 0.5465 -0.0360 0.0513  -0.0583 156 TYR A CZ    
1295 O OH    . TYR A 156 ? 0.9098 0.6984 0.5468 -0.0281 0.0559  -0.0652 156 TYR A OH    
1296 N N     . GLY A 157 ? 0.8593 0.6236 0.4399 -0.0801 0.0222  -0.0187 157 GLY A N     
1297 C CA    . GLY A 157 ? 0.8334 0.5961 0.4135 -0.0866 0.0216  -0.0104 157 GLY A CA    
1298 C C     . GLY A 157 ? 0.8078 0.5611 0.3879 -0.0880 -0.0020 -0.0015 157 GLY A C     
1299 O O     . GLY A 157 ? 0.7978 0.5630 0.4021 -0.0831 -0.0170 -0.0011 157 GLY A O     
1300 N N     . ASN A 158 ? 0.8378 0.5700 0.3918 -0.0944 -0.0048 0.0066  158 ASN A N     
1301 C CA    . ASN A 158 ? 0.8363 0.5605 0.3930 -0.0952 -0.0256 0.0171  158 ASN A CA    
1302 C C     . ASN A 158 ? 0.7948 0.5334 0.3789 -0.0964 -0.0206 0.0221  158 ASN A C     
1303 O O     . ASN A 158 ? 0.8036 0.5387 0.3789 -0.1020 -0.0045 0.0227  158 ASN A O     
1304 C CB    . ASN A 158 ? 0.9286 0.6172 0.4368 -0.1008 -0.0350 0.0243  158 ASN A CB    
1305 C CG    . ASN A 158 ? 1.0029 0.6721 0.4767 -0.1012 -0.0391 0.0181  158 ASN A CG    
1306 O OD1   . ASN A 158 ? 1.0485 0.7010 0.4881 -0.1044 -0.0234 0.0132  158 ASN A OD1   
1307 N ND2   . ASN A 158 ? 1.0081 0.6785 0.4906 -0.0982 -0.0595 0.0181  158 ASN A ND2   
1308 N N     . VAL A 159 ? 0.7511 0.5046 0.3678 -0.0917 -0.0335 0.0256  159 VAL A N     
1309 C CA    . VAL A 159 ? 0.6961 0.4636 0.3409 -0.0919 -0.0283 0.0282  159 VAL A CA    
1310 C C     . VAL A 159 ? 0.7038 0.4614 0.3540 -0.0897 -0.0449 0.0394  159 VAL A C     
1311 O O     . VAL A 159 ? 0.7333 0.4815 0.3759 -0.0868 -0.0627 0.0449  159 VAL A O     
1312 C CB    . VAL A 159 ? 0.6604 0.4600 0.3455 -0.0868 -0.0238 0.0204  159 VAL A CB    
1313 C CG1   . VAL A 159 ? 0.6525 0.4653 0.3383 -0.0881 -0.0063 0.0106  159 VAL A CG1   
1314 C CG2   . VAL A 159 ? 0.6351 0.4425 0.3363 -0.0793 -0.0405 0.0209  159 VAL A CG2   
1315 N N     . GLU A 160 ? 0.7158 0.4755 0.3803 -0.0912 -0.0391 0.0429  160 GLU A N     
1316 C CA    . GLU A 160 ? 0.7676 0.5188 0.4415 -0.0874 -0.0522 0.0535  160 GLU A CA    
1317 C C     . GLU A 160 ? 0.6921 0.4666 0.4053 -0.0794 -0.0582 0.0513  160 GLU A C     
1318 O O     . GLU A 160 ? 0.6575 0.4542 0.3901 -0.0780 -0.0504 0.0416  160 GLU A O     
1319 C CB    . GLU A 160 ? 0.8568 0.5946 0.5251 -0.0925 -0.0422 0.0584  160 GLU A CB    
1320 C CG    . GLU A 160 ? 0.9965 0.7078 0.6242 -0.1002 -0.0373 0.0637  160 GLU A CG    
1321 C CD    . GLU A 160 ? 1.1343 0.8411 0.7593 -0.1083 -0.0186 0.0622  160 GLU A CD    
1322 O OE1   . GLU A 160 ? 1.1339 0.8628 0.7837 -0.1101 -0.0068 0.0527  160 GLU A OE1   
1323 O OE2   . GLU A 160 ? 1.2325 0.9137 0.8308 -0.1135 -0.0164 0.0710  160 GLU A OE2   
1324 N N     . GLU A 161 ? 0.6823 0.4517 0.4073 -0.0736 -0.0716 0.0612  161 GLU A N     
1325 C CA    . GLU A 161 ? 0.6559 0.4454 0.4174 -0.0654 -0.0762 0.0606  161 GLU A CA    
1326 C C     . GLU A 161 ? 0.6491 0.4523 0.4301 -0.0660 -0.0608 0.0526  161 GLU A C     
1327 O O     . GLU A 161 ? 0.6452 0.4382 0.4159 -0.0720 -0.0495 0.0516  161 GLU A O     
1328 C CB    . GLU A 161 ? 0.6744 0.4552 0.4467 -0.0589 -0.0905 0.0739  161 GLU A CB    
1329 C CG    . GLU A 161 ? 0.7369 0.5079 0.4951 -0.0584 -0.1097 0.0827  161 GLU A CG    
1330 C CD    . GLU A 161 ? 0.7966 0.5645 0.5730 -0.0510 -0.1244 0.0971  161 GLU A CD    
1331 O OE1   . GLU A 161 ? 0.7669 0.5438 0.5716 -0.0442 -0.1187 0.0986  161 GLU A OE1   
1332 O OE2   . GLU A 161 ? 0.8614 0.6176 0.6236 -0.0519 -0.1417 0.1071  161 GLU A OE2   
1333 N N     . TRP A 162 ? 0.6266 0.4524 0.4346 -0.0605 -0.0608 0.0470  162 TRP A N     
1334 C CA    . TRP A 162 ? 0.5700 0.4093 0.3971 -0.0603 -0.0492 0.0398  162 TRP A CA    
1335 C C     . TRP A 162 ? 0.5398 0.3674 0.3761 -0.0563 -0.0497 0.0467  162 TRP A C     
1336 O O     . TRP A 162 ? 0.5603 0.3838 0.4061 -0.0486 -0.0607 0.0560  162 TRP A O     
1337 C CB    . TRP A 162 ? 0.5481 0.4125 0.3985 -0.0546 -0.0510 0.0339  162 TRP A CB    
1338 C CG    . TRP A 162 ? 0.5271 0.4048 0.3986 -0.0521 -0.0436 0.0287  162 TRP A CG    
1339 C CD1   . TRP A 162 ? 0.5283 0.4175 0.4026 -0.0575 -0.0323 0.0192  162 TRP A CD1   
1340 C CD2   . TRP A 162 ? 0.4760 0.3569 0.3679 -0.0436 -0.0470 0.0329  162 TRP A CD2   
1341 N NE1   . TRP A 162 ? 0.5057 0.4030 0.3973 -0.0536 -0.0294 0.0166  162 TRP A NE1   
1342 C CE2   . TRP A 162 ? 0.4523 0.3441 0.3544 -0.0445 -0.0370 0.0246  162 TRP A CE2   
1343 C CE3   . TRP A 162 ? 0.4505 0.3269 0.3538 -0.0354 -0.0572 0.0431  162 TRP A CE3   
1344 C CZ2   . TRP A 162 ? 0.3807 0.2760 0.3001 -0.0372 -0.0355 0.0256  162 TRP A CZ2   
1345 C CZ3   . TRP A 162 ? 0.4142 0.2967 0.3391 -0.0275 -0.0549 0.0448  162 TRP A CZ3   
1346 C CH2   . TRP A 162 ? 0.3957 0.2861 0.3265 -0.0282 -0.0434 0.0357  162 TRP A CH2   
1347 N N     . SER A 163 ? 0.5245 0.3461 0.3587 -0.0615 -0.0377 0.0424  163 SER A N     
1348 C CA    . SER A 163 ? 0.5303 0.3367 0.3706 -0.0578 -0.0356 0.0477  163 SER A CA    
1349 C C     . SER A 163 ? 0.5362 0.3566 0.3993 -0.0528 -0.0302 0.0411  163 SER A C     
1350 O O     . SER A 163 ? 0.5382 0.3690 0.4028 -0.0590 -0.0210 0.0304  163 SER A O     
1351 C CB    . SER A 163 ? 0.5521 0.3375 0.3727 -0.0675 -0.0256 0.0474  163 SER A CB    
1352 O OG    . SER A 163 ? 0.5886 0.3599 0.4162 -0.0647 -0.0203 0.0490  163 SER A OG    
1353 N N     . ILE A 164 ? 0.5174 0.3381 0.3978 -0.0417 -0.0358 0.0478  164 ILE A N     
1354 C CA    . ILE A 164 ? 0.5237 0.3551 0.4233 -0.0359 -0.0297 0.0423  164 ILE A CA    
1355 C C     . ILE A 164 ? 0.6094 0.4231 0.5015 -0.0401 -0.0176 0.0373  164 ILE A C     
1356 O O     . ILE A 164 ? 0.6282 0.4490 0.5266 -0.0405 -0.0100 0.0284  164 ILE A O     
1357 C CB    . ILE A 164 ? 0.4582 0.2944 0.3800 -0.0224 -0.0370 0.0519  164 ILE A CB    
1358 C CG1   . ILE A 164 ? 0.4357 0.2859 0.3752 -0.0166 -0.0296 0.0453  164 ILE A CG1   
1359 C CG2   . ILE A 164 ? 0.4484 0.2615 0.3698 -0.0166 -0.0390 0.0638  164 ILE A CG2   
1360 C CD1   . ILE A 164 ? 0.3941 0.2555 0.3586 -0.0042 -0.0356 0.0541  164 ILE A CD1   
1361 N N     . GLU A 165 ? 0.6837 0.4727 0.5600 -0.0440 -0.0162 0.0432  165 GLU A N     
1362 C CA    . GLU A 165 ? 0.7152 0.4828 0.5815 -0.0497 -0.0048 0.0388  165 GLU A CA    
1363 C C     . GLU A 165 ? 0.6695 0.4454 0.5259 -0.0643 0.0028  0.0262  165 GLU A C     
1364 O O     . GLU A 165 ? 0.6563 0.4300 0.5133 -0.0688 0.0111  0.0169  165 GLU A O     
1365 C CB    . GLU A 165 ? 0.8214 0.5596 0.6729 -0.0504 -0.0058 0.0499  165 GLU A CB    
1366 C CG    . GLU A 165 ? 0.9012 0.6281 0.7650 -0.0357 -0.0123 0.0635  165 GLU A CG    
1367 C CD    . GLU A 165 ? 0.9579 0.7001 0.8299 -0.0293 -0.0277 0.0734  165 GLU A CD    
1368 O OE1   . GLU A 165 ? 0.9440 0.6941 0.8026 -0.0371 -0.0333 0.0720  165 GLU A OE1   
1369 O OE2   . GLU A 165 ? 0.9993 0.7452 0.8916 -0.0166 -0.0339 0.0826  165 GLU A OE2   
1370 N N     . ILE A 166 ? 0.6663 0.4514 0.5133 -0.0718 0.0001  0.0261  166 ILE A N     
1371 C CA    . ILE A 166 ? 0.6372 0.4344 0.4789 -0.0851 0.0072  0.0158  166 ILE A CA    
1372 C C     . ILE A 166 ? 0.5759 0.4021 0.4339 -0.0835 0.0069  0.0061  166 ILE A C     
1373 O O     . ILE A 166 ? 0.5590 0.3928 0.4185 -0.0923 0.0130  -0.0034 166 ILE A O     
1374 C CB    . ILE A 166 ? 0.6358 0.4356 0.4639 -0.0915 0.0060  0.0190  166 ILE A CB    
1375 C CG1   . ILE A 166 ? 0.6776 0.4468 0.4853 -0.0960 0.0084  0.0278  166 ILE A CG1   
1376 C CG2   . ILE A 166 ? 0.5936 0.4141 0.4238 -0.1027 0.0132  0.0089  166 ILE A CG2   
1377 C CD1   . ILE A 166 ? 0.7021 0.4696 0.4917 -0.1019 0.0083  0.0318  166 ILE A CD1   
1378 N N     . ALA A 167 ? 0.5416 0.3835 0.4118 -0.0728 -0.0011 0.0092  167 ALA A N     
1379 C CA    . ALA A 167 ? 0.5288 0.3968 0.4140 -0.0697 -0.0020 0.0020  167 ALA A CA    
1380 C C     . ALA A 167 ? 0.5477 0.4128 0.4380 -0.0690 0.0034  -0.0044 167 ALA A C     
1381 O O     . ALA A 167 ? 0.5581 0.4403 0.4529 -0.0736 0.0057  -0.0132 167 ALA A O     
1382 C CB    . ALA A 167 ? 0.4911 0.3710 0.3883 -0.0581 -0.0113 0.0080  167 ALA A CB    
1383 N N     . ALA A 168 ? 0.5286 0.3710 0.4171 -0.0629 0.0056  0.0004  168 ALA A N     
1384 C CA    . ALA A 168 ? 0.5108 0.3451 0.4007 -0.0608 0.0122  -0.0056 168 ALA A CA    
1385 C C     . ALA A 168 ? 0.5715 0.3945 0.4475 -0.0753 0.0197  -0.0153 168 ALA A C     
1386 O O     . ALA A 168 ? 0.5890 0.4144 0.4637 -0.0782 0.0236  -0.0245 168 ALA A O     
1387 C CB    . ALA A 168 ? 0.5046 0.3169 0.3980 -0.0489 0.0139  0.0029  168 ALA A CB    
1388 N N     . LYS A 169 ? 0.6240 0.4341 0.4887 -0.0850 0.0214  -0.0131 169 LYS A N     
1389 C CA    . LYS A 169 ? 0.6486 0.4467 0.5013 -0.1006 0.0283  -0.0211 169 LYS A CA    
1390 C C     . LYS A 169 ? 0.6376 0.4626 0.4955 -0.1109 0.0277  -0.0319 169 LYS A C     
1391 O O     . LYS A 169 ? 0.6165 0.4702 0.4859 -0.1073 0.0224  -0.0318 169 LYS A O     
1392 C CB    . LYS A 169 ? 0.6742 0.4578 0.5154 -0.1094 0.0304  -0.0151 169 LYS A CB    
1393 C CG    . LYS A 169 ? 0.7507 0.5001 0.5822 -0.1033 0.0323  -0.0054 169 LYS A CG    
1394 C CD    . LYS A 169 ? 0.8482 0.5817 0.6650 -0.1142 0.0355  -0.0001 169 LYS A CD    
1395 C CE    . LYS A 169 ? 0.9292 0.6250 0.7345 -0.1098 0.0384  0.0092  169 LYS A CE    
1396 N NZ    . LYS A 169 ? 0.9555 0.6484 0.7676 -0.0923 0.0304  0.0212  169 LYS A NZ    
1397 N N     . LEU A 170 ? 0.6329 0.4476 0.4824 -0.1239 0.0326  -0.0407 170 LEU A N     
1398 C CA    . LEU A 170 ? 0.6091 0.4484 0.4636 -0.1359 0.0309  -0.0503 170 LEU A CA    
1399 C C     . LEU A 170 ? 0.6071 0.4672 0.4686 -0.1447 0.0302  -0.0478 170 LEU A C     
1400 O O     . LEU A 170 ? 0.6183 0.4642 0.4733 -0.1468 0.0336  -0.0410 170 LEU A O     
1401 C CB    . LEU A 170 ? 0.6545 0.4734 0.4960 -0.1503 0.0355  -0.0598 170 LEU A CB    
1402 C CG    . LEU A 170 ? 0.7039 0.5064 0.5358 -0.1462 0.0372  -0.0673 170 LEU A CG    
1403 C CD1   . LEU A 170 ? 0.7456 0.5238 0.5741 -0.1284 0.0412  -0.0605 170 LEU A CD1   
1404 C CD2   . LEU A 170 ? 0.7236 0.5031 0.5398 -0.1640 0.0414  -0.0770 170 LEU A CD2   
1405 N N     . GLN A 171 ? 0.5903 0.4833 0.4646 -0.1492 0.0264  -0.0526 171 GLN A N     
1406 C CA    . GLN A 171 ? 0.6093 0.5237 0.4926 -0.1572 0.0279  -0.0506 171 GLN A CA    
1407 C C     . GLN A 171 ? 0.6075 0.5081 0.4838 -0.1752 0.0344  -0.0526 171 GLN A C     
1408 O O     . GLN A 171 ? 0.6103 0.5146 0.4879 -0.1810 0.0394  -0.0480 171 GLN A O     
1409 C CB    . GLN A 171 ? 0.6677 0.6209 0.5690 -0.1574 0.0227  -0.0546 171 GLN A CB    
1410 C CG    . GLN A 171 ? 0.7469 0.7162 0.6568 -0.1407 0.0184  -0.0496 171 GLN A CG    
1411 C CD    . GLN A 171 ? 0.8161 0.8227 0.7446 -0.1408 0.0153  -0.0513 171 GLN A CD    
1412 O OE1   . GLN A 171 ? 0.8663 0.8905 0.8038 -0.1529 0.0152  -0.0560 171 GLN A OE1   
1413 N NE2   . GLN A 171 ? 0.8018 0.8206 0.7372 -0.1274 0.0124  -0.0470 171 GLN A NE2   
1414 N N     . GLU A 172 ? 0.6268 0.5092 0.4943 -0.1843 0.0352  -0.0594 172 GLU A N     
1415 C CA    . GLU A 172 ? 0.6692 0.5332 0.5287 -0.2025 0.0413  -0.0617 172 GLU A CA    
1416 C C     . GLU A 172 ? 0.6802 0.5075 0.5234 -0.1993 0.0480  -0.0536 172 GLU A C     
1417 O O     . GLU A 172 ? 0.7266 0.5371 0.5626 -0.2132 0.0544  -0.0524 172 GLU A O     
1418 C CB    . GLU A 172 ? 0.7101 0.5629 0.5624 -0.2136 0.0392  -0.0725 172 GLU A CB    
1419 C CG    . GLU A 172 ? 0.7377 0.6263 0.6040 -0.2183 0.0308  -0.0800 172 GLU A CG    
1420 C CD    . GLU A 172 ? 0.7807 0.6790 0.6480 -0.2006 0.0248  -0.0809 172 GLU A CD    
1421 O OE1   . GLU A 172 ? 0.7916 0.7195 0.6696 -0.2019 0.0174  -0.0851 172 GLU A OE1   
1422 O OE2   . GLU A 172 ? 0.7906 0.6674 0.6488 -0.1855 0.0275  -0.0766 172 GLU A OE2   
1423 N N     . GLN A 173 ? 0.6492 0.4648 0.4877 -0.1812 0.0459  -0.0471 173 GLN A N     
1424 C CA    . GLN A 173 ? 0.6669 0.4510 0.4917 -0.1757 0.0499  -0.0372 173 GLN A CA    
1425 C C     . GLN A 173 ? 0.6487 0.4458 0.4755 -0.1701 0.0490  -0.0280 173 GLN A C     
1426 O O     . GLN A 173 ? 0.6746 0.4491 0.4893 -0.1645 0.0502  -0.0184 173 GLN A O     
1427 C CB    . GLN A 173 ? 0.6962 0.4594 0.5161 -0.1589 0.0476  -0.0342 173 GLN A CB    
1428 C CG    . GLN A 173 ? 0.7494 0.4879 0.5606 -0.1623 0.0513  -0.0422 173 GLN A CG    
1429 C CD    . GLN A 173 ? 0.7761 0.4941 0.5849 -0.1439 0.0513  -0.0374 173 GLN A CD    
1430 O OE1   . GLN A 173 ? 0.7589 0.4900 0.5753 -0.1335 0.0483  -0.0408 173 GLN A OE1   
1431 N NE2   . GLN A 173 ? 0.8146 0.5007 0.6137 -0.1395 0.0552  -0.0284 173 GLN A NE2   
1432 N N     . GLY A 174 ? 0.6158 0.4480 0.4566 -0.1714 0.0469  -0.0308 174 GLY A N     
1433 C CA    . GLY A 174 ? 0.5910 0.4355 0.4322 -0.1651 0.0464  -0.0238 174 GLY A CA    
1434 C C     . GLY A 174 ? 0.5801 0.4314 0.4255 -0.1470 0.0378  -0.0205 174 GLY A C     
1435 O O     . GLY A 174 ? 0.6004 0.4554 0.4424 -0.1399 0.0356  -0.0144 174 GLY A O     
1436 N N     . GLY A 175 ? 0.5448 0.3965 0.3966 -0.1400 0.0333  -0.0247 175 GLY A N     
1437 C CA    . GLY A 175 ? 0.4872 0.3456 0.3458 -0.1235 0.0258  -0.0213 175 GLY A CA    
1438 C C     . GLY A 175 ? 0.4802 0.3732 0.3548 -0.1199 0.0215  -0.0262 175 GLY A C     
1439 O O     . GLY A 175 ? 0.4842 0.3978 0.3656 -0.1291 0.0241  -0.0309 175 GLY A O     
1440 N N     . ASP A 176 ? 0.4794 0.3791 0.3617 -0.1063 0.0152  -0.0241 176 ASP A N     
1441 C CA    . ASP A 176 ? 0.4760 0.4059 0.3728 -0.1010 0.0108  -0.0269 176 ASP A CA    
1442 C C     . ASP A 176 ? 0.5028 0.4421 0.4079 -0.0965 0.0084  -0.0321 176 ASP A C     
1443 O O     . ASP A 176 ? 0.5223 0.4858 0.4391 -0.0920 0.0046  -0.0340 176 ASP A O     
1444 C CB    . ASP A 176 ? 0.4559 0.3882 0.3544 -0.0898 0.0051  -0.0195 176 ASP A CB    
1445 C CG    . ASP A 176 ? 0.5109 0.4341 0.3972 -0.0943 0.0074  -0.0150 176 ASP A CG    
1446 O OD1   . ASP A 176 ? 0.5246 0.4561 0.4094 -0.1045 0.0138  -0.0186 176 ASP A OD1   
1447 O OD2   . ASP A 176 ? 0.5136 0.4215 0.3917 -0.0878 0.0027  -0.0073 176 ASP A OD2   
1448 N N     . GLU A 177 ? 0.5132 0.4313 0.4104 -0.0974 0.0113  -0.0342 177 GLU A N     
1449 C CA    . GLU A 177 ? 0.5400 0.4616 0.4396 -0.0938 0.0109  -0.0397 177 GLU A CA    
1450 C C     . GLU A 177 ? 0.4799 0.4152 0.3911 -0.0791 0.0062  -0.0355 177 GLU A C     
1451 O O     . GLU A 177 ? 0.5054 0.4565 0.4215 -0.0771 0.0046  -0.0399 177 GLU A O     
1452 C CB    . GLU A 177 ? 0.5837 0.5228 0.4843 -0.1060 0.0106  -0.0491 177 GLU A CB    
1453 C CG    . GLU A 177 ? 0.6828 0.6020 0.5703 -0.1207 0.0156  -0.0554 177 GLU A CG    
1454 C CD    . GLU A 177 ? 0.7795 0.7185 0.6700 -0.1342 0.0129  -0.0641 177 GLU A CD    
1455 O OE1   . GLU A 177 ? 0.8175 0.7798 0.7161 -0.1298 0.0075  -0.0663 177 GLU A OE1   
1456 O OE2   . GLU A 177 ? 0.8148 0.7464 0.7000 -0.1497 0.0157  -0.0681 177 GLU A OE2   
1457 N N     . VAL A 178 ? 0.4339 0.3632 0.3491 -0.0695 0.0034  -0.0265 178 VAL A N     
1458 C CA    . VAL A 178 ? 0.4391 0.3766 0.3661 -0.0560 -0.0005 -0.0213 178 VAL A CA    
1459 C C     . VAL A 178 ? 0.5074 0.4311 0.4324 -0.0505 0.0047  -0.0230 178 VAL A C     
1460 O O     . VAL A 178 ? 0.5430 0.4421 0.4607 -0.0497 0.0093  -0.0210 178 VAL A O     
1461 C CB    . VAL A 178 ? 0.4107 0.3405 0.3415 -0.0486 -0.0056 -0.0109 178 VAL A CB    
1462 C CG1   . VAL A 178 ? 0.3865 0.3236 0.3322 -0.0356 -0.0094 -0.0048 178 VAL A CG1   
1463 C CG2   . VAL A 178 ? 0.3764 0.3170 0.3052 -0.0533 -0.0096 -0.0100 178 VAL A CG2   
1464 N N     . PRO A 179 ? 0.5016 0.4399 0.4320 -0.0461 0.0048  -0.0264 179 PRO A N     
1465 C CA    . PRO A 179 ? 0.4770 0.4033 0.4023 -0.0413 0.0115  -0.0296 179 PRO A CA    
1466 C C     . PRO A 179 ? 0.4661 0.3707 0.3950 -0.0307 0.0162  -0.0219 179 PRO A C     
1467 O O     . PRO A 179 ? 0.4566 0.3669 0.4004 -0.0216 0.0118  -0.0120 179 PRO A O     
1468 C CB    . PRO A 179 ? 0.4716 0.4208 0.4067 -0.0345 0.0088  -0.0291 179 PRO A CB    
1469 C CG    . PRO A 179 ? 0.4505 0.4230 0.3900 -0.0415 0.0016  -0.0311 179 PRO A CG    
1470 C CD    . PRO A 179 ? 0.4472 0.4138 0.3877 -0.0451 -0.0010 -0.0269 179 PRO A CD    
1471 N N     . SER A 180 ? 0.5085 0.3879 0.4242 -0.0322 0.0248  -0.0264 180 SER A N     
1472 C CA    . SER A 180 ? 0.5270 0.3835 0.4465 -0.0218 0.0308  -0.0190 180 SER A CA    
1473 C C     . SER A 180 ? 0.5226 0.3885 0.4605 -0.0063 0.0326  -0.0111 180 SER A C     
1474 O O     . SER A 180 ? 0.5760 0.4348 0.5278 0.0038  0.0326  -0.0004 180 SER A O     
1475 C CB    . SER A 180 ? 0.5553 0.3814 0.4554 -0.0259 0.0416  -0.0271 180 SER A CB    
1476 O OG    . SER A 180 ? 0.5684 0.3959 0.4581 -0.0268 0.0473  -0.0367 180 SER A OG    
1477 N N     . GLU A 181 ? 0.4634 0.3461 0.4024 -0.0047 0.0337  -0.0155 181 GLU A N     
1478 C CA    . GLU A 181 ? 0.4659 0.3577 0.4219 0.0091  0.0373  -0.0082 181 GLU A CA    
1479 C C     . GLU A 181 ? 0.4630 0.3751 0.4431 0.0148  0.0268  0.0035  181 GLU A C     
1480 O O     . GLU A 181 ? 0.5040 0.4236 0.5029 0.0259  0.0288  0.0120  181 GLU A O     
1481 C CB    . GLU A 181 ? 0.4917 0.3941 0.4391 0.0086  0.0415  -0.0157 181 GLU A CB    
1482 C CG    . GLU A 181 ? 0.5195 0.4484 0.4677 0.0010  0.0310  -0.0186 181 GLU A CG    
1483 C CD    . GLU A 181 ? 0.5447 0.4718 0.4725 -0.0139 0.0283  -0.0303 181 GLU A CD    
1484 O OE1   . GLU A 181 ? 0.5672 0.4721 0.4812 -0.0203 0.0325  -0.0353 181 GLU A OE1   
1485 O OE2   . GLU A 181 ? 0.5120 0.4600 0.4389 -0.0192 0.0220  -0.0337 181 GLU A OE2   
1486 N N     . ILE A 182 ? 0.4569 0.3769 0.4360 0.0067  0.0162  0.0041  182 ILE A N     
1487 C CA    . ILE A 182 ? 0.4507 0.3865 0.4481 0.0105  0.0054  0.0139  182 ILE A CA    
1488 C C     . ILE A 182 ? 0.4224 0.3463 0.4202 0.0089  -0.0015 0.0210  182 ILE A C     
1489 O O     . ILE A 182 ? 0.4133 0.3462 0.4236 0.0115  -0.0115 0.0295  182 ILE A O     
1490 C CB    . ILE A 182 ? 0.5260 0.4839 0.5224 0.0042  -0.0021 0.0097  182 ILE A CB    
1491 C CG1   . ILE A 182 ? 0.5092 0.4644 0.4910 -0.0074 -0.0063 0.0042  182 ILE A CG1   
1492 C CG2   . ILE A 182 ? 0.5237 0.4923 0.5154 0.0041  0.0036  0.0024  182 ILE A CG2   
1493 C CD1   . ILE A 182 ? 0.4656 0.4419 0.4484 -0.0122 -0.0124 0.0008  182 ILE A CD1   
1494 N N     . ILE A 183 ? 0.4152 0.3173 0.3975 0.0041  0.0035  0.0177  183 ILE A N     
1495 C CA    . ILE A 183 ? 0.4486 0.3363 0.4275 0.0023  -0.0023 0.0250  183 ILE A CA    
1496 C C     . ILE A 183 ? 0.4799 0.3669 0.4797 0.0141  -0.0075 0.0392  183 ILE A C     
1497 O O     . ILE A 183 ? 0.4901 0.3795 0.4937 0.0133  -0.0190 0.0474  183 ILE A O     
1498 C CB    . ILE A 183 ? 0.4706 0.3316 0.4309 -0.0033 0.0060  0.0202  183 ILE A CB    
1499 C CG1   . ILE A 183 ? 0.4708 0.3343 0.4123 -0.0181 0.0072  0.0086  183 ILE A CG1   
1500 C CG2   . ILE A 183 ? 0.4527 0.2956 0.4120 -0.0014 0.0013  0.0309  183 ILE A CG2   
1501 C CD1   . ILE A 183 ? 0.4531 0.3273 0.3914 -0.0251 -0.0022 0.0108  183 ILE A CD1   
1502 N N     . ASP A 184 ? 0.4798 0.3638 0.4932 0.0249  0.0011  0.0424  184 ASP A N     
1503 C CA    . ASP A 184 ? 0.4690 0.3542 0.5072 0.0369  -0.0025 0.0570  184 ASP A CA    
1504 C C     . ASP A 184 ? 0.4658 0.3771 0.5263 0.0405  -0.0118 0.0635  184 ASP A C     
1505 O O     . ASP A 184 ? 0.4919 0.4091 0.5762 0.0485  -0.0181 0.0766  184 ASP A O     
1506 C CB    . ASP A 184 ? 0.5252 0.3970 0.5712 0.0481  0.0127  0.0583  184 ASP A CB    
1507 C CG    . ASP A 184 ? 0.6370 0.4786 0.6611 0.0449  0.0219  0.0526  184 ASP A CG    
1508 O OD1   . ASP A 184 ? 0.6527 0.4835 0.6622 0.0363  0.0148  0.0529  184 ASP A OD1   
1509 O OD2   . ASP A 184 ? 0.7031 0.5299 0.7231 0.0507  0.0368  0.0477  184 ASP A OD2   
1510 N N     . LYS A 185 ? 0.4685 0.3954 0.5225 0.0342  -0.0131 0.0550  185 LYS A N     
1511 C CA    . LYS A 185 ? 0.4454 0.3950 0.5186 0.0367  -0.0208 0.0600  185 LYS A CA    
1512 C C     . LYS A 185 ? 0.4338 0.3896 0.5007 0.0284  -0.0359 0.0608  185 LYS A C     
1513 O O     . LYS A 185 ? 0.4136 0.3852 0.4935 0.0287  -0.0440 0.0645  185 LYS A O     
1514 C CB    . LYS A 185 ? 0.4116 0.3738 0.4825 0.0367  -0.0122 0.0515  185 LYS A CB    
1515 C CG    . LYS A 185 ? 0.4207 0.3748 0.4926 0.0445  0.0039  0.0493  185 LYS A CG    
1516 C CD    . LYS A 185 ? 0.4235 0.3907 0.4919 0.0444  0.0104  0.0425  185 LYS A CD    
1517 C CE    . LYS A 185 ? 0.4678 0.4248 0.5336 0.0523  0.0272  0.0402  185 LYS A CE    
1518 N NZ    . LYS A 185 ? 0.4999 0.4687 0.5590 0.0519  0.0328  0.0344  185 LYS A NZ    
1519 N N     . ILE A 186 ? 0.4264 0.3679 0.4719 0.0208  -0.0387 0.0572  186 ILE A N     
1520 C CA    . ILE A 186 ? 0.3949 0.3381 0.4291 0.0128  -0.0507 0.0571  186 ILE A CA    
1521 C C     . ILE A 186 ? 0.4006 0.3383 0.4435 0.0153  -0.0641 0.0702  186 ILE A C     
1522 O O     . ILE A 186 ? 0.4224 0.3460 0.4672 0.0192  -0.0638 0.0775  186 ILE A O     
1523 C CB    . ILE A 186 ? 0.3976 0.3281 0.4043 0.0029  -0.0467 0.0481  186 ILE A CB    
1524 C CG1   . ILE A 186 ? 0.4008 0.3395 0.4001 -0.0010 -0.0361 0.0356  186 ILE A CG1   
1525 C CG2   . ILE A 186 ? 0.3819 0.3117 0.3750 -0.0043 -0.0572 0.0485  186 ILE A CG2   
1526 C CD1   . ILE A 186 ? 0.4327 0.3612 0.4094 -0.0114 -0.0312 0.0272  186 ILE A CD1   
1527 N N     . ILE A 187 ? 0.3887 0.3366 0.4366 0.0128  -0.0766 0.0734  187 ILE A N     
1528 C CA    . ILE A 187 ? 0.4167 0.3593 0.4685 0.0125  -0.0924 0.0850  187 ILE A CA    
1529 C C     . ILE A 187 ? 0.4778 0.4122 0.5020 0.0023  -0.1010 0.0801  187 ILE A C     
1530 O O     . ILE A 187 ? 0.4828 0.4263 0.5045 -0.0015 -0.1052 0.0752  187 ILE A O     
1531 C CB    . ILE A 187 ? 0.3795 0.3388 0.4626 0.0181  -0.1013 0.0948  187 ILE A CB    
1532 C CG1   . ILE A 187 ? 0.3754 0.3402 0.4855 0.0293  -0.0910 0.1014  187 ILE A CG1   
1533 C CG2   . ILE A 187 ? 0.3376 0.2924 0.4223 0.0150  -0.1210 0.1059  187 ILE A CG2   
1534 C CD1   . ILE A 187 ? 0.3601 0.3433 0.5058 0.0352  -0.0975 0.1125  187 ILE A CD1   
1535 N N     . TYR A 188 ? 0.5410 0.4565 0.5436 -0.0017 -0.1023 0.0817  188 TYR A N     
1536 C CA    . TYR A 188 ? 0.5372 0.4417 0.5087 -0.0113 -0.1056 0.0759  188 TYR A CA    
1537 C C     . TYR A 188 ? 0.5388 0.4360 0.5021 -0.0146 -0.1241 0.0844  188 TYR A C     
1538 O O     . TYR A 188 ? 0.5429 0.4324 0.5122 -0.0117 -0.1343 0.0966  188 TYR A O     
1539 C CB    . TYR A 188 ? 0.5234 0.4100 0.4732 -0.0153 -0.0959 0.0731  188 TYR A CB    
1540 C CG    . TYR A 188 ? 0.5471 0.4220 0.4647 -0.0251 -0.0960 0.0675  188 TYR A CG    
1541 C CD1   . TYR A 188 ? 0.5168 0.4015 0.4260 -0.0299 -0.0891 0.0559  188 TYR A CD1   
1542 C CD2   . TYR A 188 ? 0.5781 0.4318 0.4735 -0.0289 -0.1022 0.0747  188 TYR A CD2   
1543 C CE1   . TYR A 188 ? 0.5360 0.4103 0.4171 -0.0379 -0.0868 0.0510  188 TYR A CE1   
1544 C CE2   . TYR A 188 ? 0.5817 0.4235 0.4457 -0.0377 -0.1003 0.0698  188 TYR A CE2   
1545 C CZ    . TYR A 188 ? 0.5754 0.4279 0.4330 -0.0421 -0.0918 0.0577  188 TYR A CZ    
1546 O OH    . TYR A 188 ? 0.5944 0.4355 0.4223 -0.0499 -0.0877 0.0531  188 TYR A OH    
1547 N N     . MET A 189 ? 0.5385 0.4372 0.4872 -0.0206 -0.1287 0.0779  189 MET A N     
1548 C CA    . MET A 189 ? 0.5282 0.4172 0.4631 -0.0255 -0.1466 0.0836  189 MET A CA    
1549 C C     . MET A 189 ? 0.5191 0.3930 0.4158 -0.0342 -0.1441 0.0747  189 MET A C     
1550 O O     . MET A 189 ? 0.4992 0.3792 0.3909 -0.0364 -0.1397 0.0650  189 MET A O     
1551 C CB    . MET A 189 ? 0.5054 0.4096 0.4634 -0.0240 -0.1572 0.0860  189 MET A CB    
1552 C CG    . MET A 189 ? 0.5058 0.4236 0.5017 -0.0161 -0.1629 0.0982  189 MET A CG    
1553 S SD    . MET A 189 ? 0.6287 0.5689 0.6564 -0.0140 -0.1670 0.0984  189 MET A SD    
1554 C CE    . MET A 189 ? 0.4069 0.3574 0.4341 -0.0108 -0.1442 0.0841  189 MET A CE    
1555 N N     . PRO A 190 ? 0.5436 0.3972 0.4133 -0.0385 -0.1459 0.0784  190 PRO A N     
1556 C CA    . PRO A 190 ? 0.5852 0.4224 0.4163 -0.0466 -0.1428 0.0711  190 PRO A CA    
1557 C C     . PRO A 190 ? 0.6387 0.4648 0.4519 -0.0514 -0.1610 0.0741  190 PRO A C     
1558 O O     . PRO A 190 ? 0.6538 0.4800 0.4794 -0.0500 -0.1788 0.0853  190 PRO A O     
1559 C CB    . PRO A 190 ? 0.5726 0.3912 0.3833 -0.0490 -0.1385 0.0765  190 PRO A CB    
1560 C CG    . PRO A 190 ? 0.5525 0.3716 0.3851 -0.0429 -0.1502 0.0906  190 PRO A CG    
1561 C CD    . PRO A 190 ? 0.5256 0.3693 0.3988 -0.0353 -0.1490 0.0899  190 PRO A CD    
1562 N N     . PHE A 191 ? 0.6585 0.4750 0.4433 -0.0570 -0.1566 0.0642  191 PHE A N     
1563 C CA    . PHE A 191 ? 0.7111 0.5124 0.4723 -0.0628 -0.1729 0.0648  191 PHE A CA    
1564 C C     . PHE A 191 ? 0.7980 0.5738 0.5107 -0.0700 -0.1670 0.0591  191 PHE A C     
1565 O O     . PHE A 191 ? 0.8104 0.5869 0.5133 -0.0701 -0.1470 0.0504  191 PHE A O     
1566 C CB    . PHE A 191 ? 0.6720 0.4860 0.4492 -0.0616 -0.1744 0.0574  191 PHE A CB    
1567 C CG    . PHE A 191 ? 0.6200 0.4570 0.4424 -0.0556 -0.1815 0.0641  191 PHE A CG    
1568 C CD1   . PHE A 191 ? 0.5862 0.4450 0.4389 -0.0484 -0.1664 0.0609  191 PHE A CD1   
1569 C CD2   . PHE A 191 ? 0.5977 0.4349 0.4322 -0.0574 -0.2032 0.0742  191 PHE A CD2   
1570 C CE1   . PHE A 191 ? 0.5735 0.4521 0.4655 -0.0425 -0.1710 0.0673  191 PHE A CE1   
1571 C CE2   . PHE A 191 ? 0.5908 0.4504 0.4691 -0.0516 -0.2079 0.0813  191 PHE A CE2   
1572 C CZ    . PHE A 191 ? 0.5952 0.4748 0.5012 -0.0438 -0.1908 0.0777  191 PHE A CZ    
1573 N N     . ASP A 192 ? 0.8382 0.5920 0.5205 -0.0761 -0.1843 0.0646  192 ASP A N     
1574 C CA    . ASP A 192 ? 0.9176 0.6437 0.5490 -0.0831 -0.1790 0.0602  192 ASP A CA    
1575 C C     . ASP A 192 ? 0.9095 0.6266 0.5179 -0.0863 -0.1728 0.0466  192 ASP A C     
1576 O O     . ASP A 192 ? 0.9910 0.6861 0.5575 -0.0910 -0.1634 0.0407  192 ASP A O     
1577 C CB    . ASP A 192 ? 1.0331 0.7360 0.6356 -0.0887 -0.1995 0.0726  192 ASP A CB    
1578 C CG    . ASP A 192 ? 1.1181 0.8259 0.7392 -0.0900 -0.2207 0.0765  192 ASP A CG    
1579 O OD1   . ASP A 192 ? 1.1661 0.8775 0.7912 -0.0913 -0.2222 0.0678  192 ASP A OD1   
1580 O OD2   . ASP A 192 ? 1.1427 0.8514 0.7765 -0.0898 -0.2345 0.0882  192 ASP A OD2   
1581 N N     . ASN A 193 ? 0.8207 0.5533 0.4558 -0.0833 -0.1770 0.0420  193 ASN A N     
1582 C CA    . ASN A 193 ? 0.8217 0.5480 0.4418 -0.0842 -0.1679 0.0285  193 ASN A CA    
1583 C C     . ASN A 193 ? 0.7847 0.5339 0.4446 -0.0789 -0.1688 0.0249  193 ASN A C     
1584 O O     . ASN A 193 ? 0.7740 0.5406 0.4692 -0.0764 -0.1814 0.0334  193 ASN A O     
1585 C CB    . ASN A 193 ? 0.8671 0.5597 0.4377 -0.0928 -0.1800 0.0256  193 ASN A CB    
1586 C CG    . ASN A 193 ? 0.8881 0.5800 0.4727 -0.0963 -0.2048 0.0345  193 ASN A CG    
1587 O OD1   . ASN A 193 ? 0.8966 0.6063 0.5164 -0.0941 -0.2142 0.0363  193 ASN A OD1   
1588 N ND2   . ASN A 193 ? 0.9210 0.5944 0.4823 -0.1016 -0.2136 0.0403  193 ASN A ND2   
1589 N N     . GLU A 194 ? 0.7542 0.5028 0.4082 -0.0767 -0.1543 0.0128  194 GLU A N     
1590 C CA    . GLU A 194 ? 0.7195 0.4894 0.4092 -0.0707 -0.1508 0.0088  194 GLU A CA    
1591 C C     . GLU A 194 ? 0.7371 0.5066 0.4416 -0.0735 -0.1724 0.0134  194 GLU A C     
1592 O O     . GLU A 194 ? 0.7318 0.5250 0.4769 -0.0686 -0.1744 0.0172  194 GLU A O     
1593 C CB    . GLU A 194 ? 0.7007 0.4652 0.3761 -0.0678 -0.1320 -0.0042 194 GLU A CB    
1594 C CG    . GLU A 194 ? 0.6585 0.4453 0.3701 -0.0605 -0.1259 -0.0079 194 GLU A CG    
1595 C CD    . GLU A 194 ? 0.7100 0.4888 0.4068 -0.0569 -0.1092 -0.0196 194 GLU A CD    
1596 O OE1   . GLU A 194 ? 0.7162 0.5137 0.4414 -0.0498 -0.1015 -0.0224 194 GLU A OE1   
1597 O OE2   . GLU A 194 ? 0.7367 0.4898 0.3929 -0.0606 -0.1032 -0.0256 194 GLU A OE2   
1598 N N     . LYS A 195 ? 0.7471 0.4896 0.4180 -0.0821 -0.1885 0.0133  195 LYS A N     
1599 C CA    . LYS A 195 ? 0.7026 0.4431 0.3859 -0.0870 -0.2106 0.0175  195 LYS A CA    
1600 C C     . LYS A 195 ? 0.7123 0.4760 0.4362 -0.0856 -0.2254 0.0323  195 LYS A C     
1601 O O     . LYS A 195 ? 0.6965 0.4779 0.4568 -0.0839 -0.2325 0.0363  195 LYS A O     
1602 C CB    . LYS A 195 ? 0.7097 0.4185 0.3528 -0.0964 -0.2220 0.0153  195 LYS A CB    
1603 C CG    . LYS A 195 ? 0.7546 0.4373 0.3577 -0.0977 -0.2091 0.0003  195 LYS A CG    
1604 N N     . GLU A 196 ? 0.7334 0.4968 0.4520 -0.0856 -0.2282 0.0409  196 GLU A N     
1605 C CA    . GLU A 196 ? 0.7323 0.5170 0.4913 -0.0821 -0.2377 0.0551  196 GLU A CA    
1606 C C     . GLU A 196 ? 0.6844 0.4988 0.4859 -0.0724 -0.2250 0.0565  196 GLU A C     
1607 O O     . GLU A 196 ? 0.6702 0.5046 0.5112 -0.0692 -0.2334 0.0659  196 GLU A O     
1608 C CB    . GLU A 196 ? 0.7716 0.5464 0.5142 -0.0833 -0.2404 0.0632  196 GLU A CB    
1609 C CG    . GLU A 196 ? 0.8733 0.6227 0.5827 -0.0920 -0.2511 0.0635  196 GLU A CG    
1610 C CD    . GLU A 196 ? 0.9613 0.7000 0.6526 -0.0929 -0.2532 0.0717  196 GLU A CD    
1611 O OE1   . GLU A 196 ? 0.9667 0.7213 0.6840 -0.0869 -0.2523 0.0811  196 GLU A OE1   
1612 O OE2   . GLU A 196 ? 1.0233 0.7363 0.6735 -0.0994 -0.2552 0.0688  196 GLU A OE2   
1613 N N     . LEU A 197 ? 0.6455 0.4636 0.4409 -0.0675 -0.2022 0.0469  197 LEU A N     
1614 C CA    . LEU A 197 ? 0.5833 0.4282 0.4155 -0.0586 -0.1866 0.0459  197 LEU A CA    
1615 C C     . LEU A 197 ? 0.5834 0.4422 0.4428 -0.0563 -0.1887 0.0440  197 LEU A C     
1616 O O     . LEU A 197 ? 0.5741 0.4545 0.4714 -0.0510 -0.1892 0.0507  197 LEU A O     
1617 C CB    . LEU A 197 ? 0.5630 0.4080 0.3802 -0.0558 -0.1639 0.0355  197 LEU A CB    
1618 C CG    . LEU A 197 ? 0.5236 0.3936 0.3709 -0.0479 -0.1469 0.0331  197 LEU A CG    
1619 C CD1   . LEU A 197 ? 0.5253 0.3920 0.3546 -0.0482 -0.1299 0.0273  197 LEU A CD1   
1620 C CD2   . LEU A 197 ? 0.4932 0.3764 0.3577 -0.0439 -0.1407 0.0265  197 LEU A CD2   
1621 N N     . LEU A 198 ? 0.5362 0.4708 0.4176 -0.1131 -0.1875 0.0512  198 LEU A N     
1622 C CA    . LEU A 198 ? 0.5064 0.4560 0.4089 -0.1077 -0.1836 0.0463  198 LEU A CA    
1623 C C     . LEU A 198 ? 0.5404 0.4962 0.4699 -0.1044 -0.1952 0.0541  198 LEU A C     
1624 O O     . LEU A 198 ? 0.5326 0.5033 0.4914 -0.0956 -0.1937 0.0548  198 LEU A O     
1625 C CB    . LEU A 198 ? 0.5030 0.4485 0.3835 -0.1160 -0.1748 0.0349  198 LEU A CB    
1626 C CG    . LEU A 198 ? 0.4934 0.4396 0.3531 -0.1176 -0.1606 0.0251  198 LEU A CG    
1627 C CD1   . LEU A 198 ? 0.5020 0.4445 0.3422 -0.1245 -0.1517 0.0131  198 LEU A CD1   
1628 C CD2   . LEU A 198 ? 0.4498 0.4124 0.3284 -0.1065 -0.1542 0.0238  198 LEU A CD2   
1629 N N     A MET A 199 ? 0.5820 0.5276 0.5021 -0.1121 -0.2063 0.0599  199 MET A N     
1630 N N     B MET A 199 ? 0.5818 0.5273 0.5014 -0.1123 -0.2062 0.0598  199 MET A N     
1631 C CA    A MET A 199 ? 0.5779 0.5324 0.5237 -0.1100 -0.2175 0.0670  199 MET A CA    
1632 C CA    B MET A 199 ? 0.5796 0.5332 0.5241 -0.1105 -0.2179 0.0673  199 MET A CA    
1633 C C     A MET A 199 ? 0.5505 0.5163 0.5283 -0.0968 -0.2222 0.0754  199 MET A C     
1634 C C     B MET A 199 ? 0.5500 0.5158 0.5274 -0.0968 -0.2217 0.0751  199 MET A C     
1635 O O     A MET A 199 ? 0.5233 0.5055 0.5334 -0.0901 -0.2240 0.0778  199 MET A O     
1636 O O     B MET A 199 ? 0.5205 0.5030 0.5300 -0.0899 -0.2223 0.0767  199 MET A O     
1637 C CB    A MET A 199 ? 0.6139 0.5558 0.5408 -0.1218 -0.2291 0.0718  199 MET A CB    
1638 C CB    B MET A 199 ? 0.6130 0.5533 0.5388 -0.1213 -0.2304 0.0732  199 MET A CB    
1639 C CG    A MET A 199 ? 0.6276 0.5816 0.5796 -0.1217 -0.2406 0.0779  199 MET A CG    
1640 C CG    B MET A 199 ? 0.6343 0.5634 0.5314 -0.1357 -0.2276 0.0663  199 MET A CG    
1641 S SD    A MET A 199 ? 0.5530 0.5232 0.5268 -0.1204 -0.2328 0.0706  199 MET A SD    
1642 S SD    B MET A 199 ? 0.6794 0.5958 0.5590 -0.1491 -0.2438 0.0747  199 MET A SD    
1643 C CE    A MET A 199 ? 0.4489 0.4008 0.3822 -0.1356 -0.2253 0.0596  199 MET A CE    
1644 C CE    B MET A 199 ? 0.5295 0.4301 0.3927 -0.1481 -0.2494 0.0824  199 MET A CE    
1645 N N     . GLU A 200 ? 0.5665 0.5227 0.5346 -0.0935 -0.2232 0.0793  200 GLU A N     
1646 C CA    . GLU A 200 ? 0.5756 0.5394 0.5712 -0.0803 -0.2261 0.0863  200 GLU A CA    
1647 C C     . GLU A 200 ? 0.5135 0.4932 0.5320 -0.0703 -0.2136 0.0816  200 GLU A C     
1648 O O     . GLU A 200 ? 0.5016 0.4959 0.5544 -0.0595 -0.2133 0.0851  200 GLU A O     
1649 C CB    . GLU A 200 ? 0.6454 0.5902 0.6193 -0.0808 -0.2302 0.0912  200 GLU A CB    
1650 C CG    . GLU A 200 ? 0.7284 0.6769 0.7273 -0.0664 -0.2323 0.0982  200 GLU A CG    
1651 C CD    . GLU A 200 ? 0.8237 0.7867 0.8585 -0.0576 -0.2415 0.1050  200 GLU A CD    
1652 O OE1   . GLU A 200 ? 0.8296 0.8069 0.8971 -0.0442 -0.2366 0.1064  200 GLU A OE1   
1653 O OE2   . GLU A 200 ? 0.8714 0.8324 0.9014 -0.0644 -0.2528 0.1086  200 GLU A OE2   
1654 N N     . TYR A 201 ? 0.4553 0.4329 0.4548 -0.0741 -0.2025 0.0731  201 TYR A N     
1655 C CA    . TYR A 201 ? 0.4262 0.4187 0.4445 -0.0658 -0.1911 0.0685  201 TYR A CA    
1656 C C     . TYR A 201 ? 0.4404 0.4478 0.4853 -0.0634 -0.1896 0.0668  201 TYR A C     
1657 O O     . TYR A 201 ? 0.4353 0.4568 0.5094 -0.0539 -0.1839 0.0677  201 TYR A O     
1658 C CB    . TYR A 201 ? 0.4277 0.4169 0.4192 -0.0711 -0.1805 0.0593  201 TYR A CB    
1659 C CG    . TYR A 201 ? 0.4319 0.4353 0.4408 -0.0612 -0.1654 0.0546  201 TYR A CG    
1660 C CD1   . TYR A 201 ? 0.4308 0.4372 0.4512 -0.0525 -0.1585 0.0574  201 TYR A CD1   
1661 C CD2   . TYR A 201 ? 0.4000 0.4110 0.4119 -0.0600 -0.1550 0.0468  201 TYR A CD2   
1662 C CE1   . TYR A 201 ? 0.4056 0.4240 0.4396 -0.0442 -0.1424 0.0528  201 TYR A CE1   
1663 C CE2   . TYR A 201 ? 0.3944 0.4169 0.4204 -0.0502 -0.1397 0.0430  201 TYR A CE2   
1664 C CZ    . TYR A 201 ? 0.4238 0.4509 0.4607 -0.0430 -0.1337 0.0460  201 TYR A CZ    
1665 O OH    . TYR A 201 ? 0.4341 0.4722 0.4825 -0.0349 -0.1192 0.0425  201 TYR A OH    
1666 N N     . LEU A 202 ? 0.4604 0.4631 0.4934 -0.0731 -0.1942 0.0642  202 LEU A N     
1667 C CA    . LEU A 202 ? 0.4445 0.4580 0.4978 -0.0740 -0.1942 0.0627  202 LEU A CA    
1668 C C     . LEU A 202 ? 0.4292 0.4560 0.5164 -0.0677 -0.2003 0.0702  202 LEU A C     
1669 O O     . LEU A 202 ? 0.3914 0.4327 0.5062 -0.0630 -0.1953 0.0695  202 LEU A O     
1670 C CB    . LEU A 202 ? 0.4619 0.4644 0.4914 -0.0877 -0.1991 0.0588  202 LEU A CB    
1671 C CG    . LEU A 202 ? 0.4924 0.4860 0.4969 -0.0936 -0.1906 0.0484  202 LEU A CG    
1672 C CD1   . LEU A 202 ? 0.5401 0.5208 0.5218 -0.1075 -0.1951 0.0448  202 LEU A CD1   
1673 C CD2   . LEU A 202 ? 0.4612 0.4657 0.4863 -0.0871 -0.1828 0.0447  202 LEU A CD2   
1674 N N     . ASN A 203 ? 0.4317 0.4534 0.5162 -0.0680 -0.2108 0.0772  203 ASN A N     
1675 C CA    . ASN A 203 ? 0.4509 0.4866 0.5677 -0.0608 -0.2172 0.0841  203 ASN A CA    
1676 C C     . ASN A 203 ? 0.4456 0.4908 0.5883 -0.0465 -0.2085 0.0855  203 ASN A C     
1677 O O     . ASN A 203 ? 0.4568 0.5194 0.6325 -0.0397 -0.2053 0.0865  203 ASN A O     
1678 C CB    . ASN A 203 ? 0.5193 0.5459 0.6251 -0.0642 -0.2319 0.0915  203 ASN A CB    
1679 C CG    . ASN A 203 ? 0.6365 0.6591 0.7257 -0.0783 -0.2409 0.0910  203 ASN A CG    
1680 O OD1   . ASN A 203 ? 0.7119 0.7482 0.8208 -0.0798 -0.2486 0.0943  203 ASN A OD1   
1681 N ND2   . ASN A 203 ? 0.6686 0.6732 0.7211 -0.0892 -0.2390 0.0862  203 ASN A ND2   
1682 N N     . PHE A 204 ? 0.4265 0.4600 0.5524 -0.0432 -0.2040 0.0850  204 PHE A N     
1683 C CA    . PHE A 204 ? 0.3956 0.4349 0.5399 -0.0313 -0.1940 0.0853  204 PHE A CA    
1684 C C     . PHE A 204 ? 0.4185 0.4725 0.5812 -0.0289 -0.1811 0.0793  204 PHE A C     
1685 O O     . PHE A 204 ? 0.4104 0.4772 0.6026 -0.0199 -0.1734 0.0799  204 PHE A O     
1686 C CB    . PHE A 204 ? 0.3929 0.4159 0.5082 -0.0325 -0.1919 0.0847  204 PHE A CB    
1687 C CG    . PHE A 204 ? 0.4133 0.4415 0.5409 -0.0233 -0.1800 0.0834  204 PHE A CG    
1688 C CD1   . PHE A 204 ? 0.4460 0.4729 0.5915 -0.0124 -0.1795 0.0890  204 PHE A CD1   
1689 C CD2   . PHE A 204 ? 0.3688 0.4010 0.4869 -0.0253 -0.1659 0.0753  204 PHE A CD2   
1690 C CE1   . PHE A 204 ? 0.4289 0.4570 0.5806 -0.0054 -0.1634 0.0857  204 PHE A CE1   
1691 C CE2   . PHE A 204 ? 0.3570 0.3919 0.4807 -0.0180 -0.1493 0.0719  204 PHE A CE2   
1692 C CZ    . PHE A 204 ? 0.3968 0.4291 0.5362 -0.0091 -0.1477 0.0768  204 PHE A CZ    
1693 N N     . TRP A 205 ? 0.3992 0.4500 0.5432 -0.0373 -0.1785 0.0733  205 TRP A N     
1694 C CA    . TRP A 205 ? 0.3273 0.3883 0.4837 -0.0362 -0.1678 0.0680  205 TRP A CA    
1695 C C     . TRP A 205 ? 0.3532 0.4283 0.5395 -0.0359 -0.1678 0.0691  205 TRP A C     
1696 O O     . TRP A 205 ? 0.3508 0.4370 0.5592 -0.0307 -0.1574 0.0675  205 TRP A O     
1697 C CB    . TRP A 205 ? 0.3289 0.3802 0.4564 -0.0454 -0.1668 0.0614  205 TRP A CB    
1698 C CG    . TRP A 205 ? 0.3446 0.3983 0.4739 -0.0424 -0.1507 0.0546  205 TRP A CG    
1699 C CD1   . TRP A 205 ? 0.3566 0.4144 0.4987 -0.0454 -0.1486 0.0528  205 TRP A CD1   
1700 C CD2   . TRP A 205 ? 0.3165 0.3675 0.4320 -0.0364 -0.1353 0.0490  205 TRP A CD2   
1701 N NE1   . TRP A 205 ? 0.3567 0.4115 0.4926 -0.0406 -0.1331 0.0472  205 TRP A NE1   
1702 C CE2   . TRP A 205 ? 0.3296 0.3820 0.4506 -0.0345 -0.1253 0.0450  205 TRP A CE2   
1703 C CE3   . TRP A 205 ? 0.2880 0.3358 0.3865 -0.0333 -0.1293 0.0472  205 TRP A CE3   
1704 C CZ2   . TRP A 205 ? 0.3010 0.3527 0.4122 -0.0280 -0.1110 0.0401  205 TRP A CZ2   
1705 C CZ3   . TRP A 205 ? 0.2748 0.3251 0.3653 -0.0280 -0.1147 0.0415  205 TRP A CZ3   
1706 C CH2   . TRP A 205 ? 0.2742 0.3269 0.3717 -0.0246 -0.1064 0.0385  205 TRP A CH2   
1707 N N     . GLN A 206 ? 0.3755 0.4508 0.5615 -0.0426 -0.1792 0.0718  206 GLN A N     
1708 C CA    . GLN A 206 ? 0.4163 0.5072 0.6293 -0.0446 -0.1804 0.0725  206 GLN A CA    
1709 C C     . GLN A 206 ? 0.3849 0.4909 0.6310 -0.0332 -0.1764 0.0761  206 GLN A C     
1710 O O     . GLN A 206 ? 0.3454 0.4666 0.6173 -0.0318 -0.1690 0.0742  206 GLN A O     
1711 C CB    . GLN A 206 ? 0.5198 0.6085 0.7226 -0.0554 -0.1944 0.0747  206 GLN A CB    
1712 C CG    . GLN A 206 ? 0.6375 0.7127 0.8114 -0.0685 -0.1962 0.0694  206 GLN A CG    
1713 C CD    . GLN A 206 ? 0.7552 0.8297 0.9211 -0.0807 -0.2084 0.0710  206 GLN A CD    
1714 O OE1   . GLN A 206 ? 0.8001 0.8629 0.9429 -0.0928 -0.2099 0.0663  206 GLN A OE1   
1715 N NE2   . GLN A 206 ? 0.7748 0.8619 0.9596 -0.0776 -0.2173 0.0773  206 GLN A NE2   
1716 N N     . GLN A 207 ? 0.4354 0.5360 0.6797 -0.0257 -0.1809 0.0808  207 GLN A N     
1717 C CA    . GLN A 207 ? 0.4756 0.5877 0.7495 -0.0136 -0.1770 0.0838  207 GLN A CA    
1718 C C     . GLN A 207 ? 0.4280 0.5433 0.7136 -0.0063 -0.1598 0.0799  207 GLN A C     
1719 O O     . GLN A 207 ? 0.4242 0.5541 0.7388 -0.0001 -0.1514 0.0789  207 GLN A O     
1720 C CB    . GLN A 207 ? 0.5615 0.6621 0.8265 -0.0074 -0.1864 0.0902  207 GLN A CB    
1721 C CG    . GLN A 207 ? 0.6858 0.7864 0.9461 -0.0126 -0.2036 0.0955  207 GLN A CG    
1722 C CD    . GLN A 207 ? 0.7825 0.9075 1.0762 -0.0111 -0.2065 0.0964  207 GLN A CD    
1723 O OE1   . GLN A 207 ? 0.8101 0.9419 1.1013 -0.0217 -0.2145 0.0960  207 GLN A OE1   
1724 N NE2   . GLN A 207 ? 0.8002 0.9386 1.1246 0.0013  -0.1997 0.0971  207 GLN A NE2   
1725 N N     . LYS A 208 ? 0.3958 0.4983 0.6582 -0.0076 -0.1545 0.0774  208 LYS A N     
1726 C CA    . LYS A 208 ? 0.3544 0.4590 0.6239 -0.0014 -0.1390 0.0742  208 LYS A CA    
1727 C C     . LYS A 208 ? 0.3315 0.4344 0.5863 -0.0079 -0.1329 0.0691  208 LYS A C     
1728 O O     . LYS A 208 ? 0.3494 0.4418 0.5801 -0.0078 -0.1276 0.0666  208 LYS A O     
1729 C CB    . LYS A 208 ? 0.3458 0.4379 0.6027 0.0050  -0.1386 0.0769  208 LYS A CB    
1730 C CG    . LYS A 208 ? 0.3290 0.4183 0.5971 0.0123  -0.1465 0.0828  208 LYS A CG    
1731 C CD    . LYS A 208 ? 0.3255 0.3961 0.5729 0.0158  -0.1499 0.0866  208 LYS A CD    
1732 C CE    . LYS A 208 ? 0.3299 0.3936 0.5835 0.0225  -0.1608 0.0934  208 LYS A CE    
1733 N NZ    . LYS A 208 ? 0.2961 0.3743 0.5867 0.0335  -0.1534 0.0934  208 LYS A NZ    
1734 N N     . THR A 209 ? 0.3044 0.4156 0.5700 -0.0137 -0.1317 0.0668  209 THR A N     
1735 C CA    . THR A 209 ? 0.3100 0.4152 0.5582 -0.0196 -0.1257 0.0617  209 THR A CA    
1736 C C     . THR A 209 ? 0.3327 0.4366 0.5789 -0.0137 -0.1069 0.0579  209 THR A C     
1737 O O     . THR A 209 ? 0.3666 0.4811 0.6373 -0.0107 -0.0981 0.0578  209 THR A O     
1738 C CB    . THR A 209 ? 0.3462 0.4572 0.6044 -0.0290 -0.1297 0.0605  209 THR A CB    
1739 O OG1   . THR A 209 ? 0.4002 0.5099 0.6525 -0.0361 -0.1463 0.0634  209 THR A OG1   
1740 C CG2   . THR A 209 ? 0.3090 0.4058 0.5416 -0.0332 -0.1202 0.0546  209 THR A CG2   
1741 N N     . PRO A 210 ? 0.3128 0.4049 0.5295 -0.0126 -0.1009 0.0544  210 PRO A N     
1742 C CA    . PRO A 210 ? 0.2816 0.3727 0.4921 -0.0076 -0.0848 0.0512  210 PRO A CA    
1743 C C     . PRO A 210 ? 0.2602 0.3533 0.4791 -0.0095 -0.0760 0.0492  210 PRO A C     
1744 O O     . PRO A 210 ? 0.2869 0.3747 0.4994 -0.0152 -0.0802 0.0479  210 PRO A O     
1745 C CB    . PRO A 210 ? 0.2490 0.3302 0.4267 -0.0082 -0.0841 0.0477  210 PRO A CB    
1746 C CG    . PRO A 210 ? 0.2594 0.3356 0.4270 -0.0122 -0.0980 0.0496  210 PRO A CG    
1747 C CD    . PRO A 210 ? 0.2820 0.3627 0.4696 -0.0167 -0.1092 0.0532  210 PRO A CD    
1748 N N     . VAL A 211 ? 0.2156 0.3140 0.4466 -0.0060 -0.0634 0.0488  211 VAL A N     
1749 C CA    . VAL A 211 ? 0.2403 0.3369 0.4723 -0.0083 -0.0532 0.0469  211 VAL A CA    
1750 C C     . VAL A 211 ? 0.2979 0.3857 0.5029 -0.0045 -0.0454 0.0448  211 VAL A C     
1751 O O     . VAL A 211 ? 0.2951 0.3733 0.4831 -0.0054 -0.0450 0.0433  211 VAL A O     
1752 C CB    . VAL A 211 ? 0.2122 0.3193 0.4707 -0.0080 -0.0431 0.0472  211 VAL A CB    
1753 C CG1   . VAL A 211 ? 0.1999 0.3014 0.4515 -0.0111 -0.0307 0.0453  211 VAL A CG1   
1754 C CG2   . VAL A 211 ? 0.1465 0.2668 0.4357 -0.0114 -0.0511 0.0490  211 VAL A CG2   
1755 N N     . ILE A 212 ? 0.3247 0.4158 0.5258 -0.0002 -0.0393 0.0446  212 ILE A N     
1756 C CA    . ILE A 212 ? 0.3007 0.3884 0.4772 0.0030  -0.0343 0.0428  212 ILE A CA    
1757 C C     . ILE A 212 ? 0.3070 0.3943 0.4691 0.0037  -0.0425 0.0418  212 ILE A C     
1758 O O     . ILE A 212 ? 0.2967 0.3859 0.4649 0.0033  -0.0459 0.0430  212 ILE A O     
1759 C CB    . ILE A 212 ? 0.2522 0.3441 0.4293 0.0045  -0.0222 0.0425  212 ILE A CB    
1760 C CG1   . ILE A 212 ? 0.1980 0.2896 0.3883 0.0021  -0.0129 0.0431  212 ILE A CG1   
1761 C CG2   . ILE A 212 ? 0.2379 0.3303 0.3903 0.0070  -0.0188 0.0409  212 ILE A CG2   
1762 C CD1   . ILE A 212 ? 0.1563 0.2395 0.3346 0.0012  -0.0123 0.0434  212 ILE A CD1   
1763 N N     . LEU A 213 ? 0.2948 0.3781 0.4370 0.0046  -0.0453 0.0394  213 LEU A N     
1764 C CA    . LEU A 213 ? 0.2629 0.3461 0.3889 0.0037  -0.0515 0.0372  213 LEU A CA    
1765 C C     . LEU A 213 ? 0.2658 0.3551 0.3739 0.0070  -0.0447 0.0341  213 LEU A C     
1766 O O     . LEU A 213 ? 0.2626 0.3520 0.3637 0.0114  -0.0407 0.0328  213 LEU A O     
1767 C CB    . LEU A 213 ? 0.2667 0.3420 0.3849 0.0008  -0.0606 0.0357  213 LEU A CB    
1768 C CG    . LEU A 213 ? 0.2713 0.3450 0.3713 -0.0023 -0.0668 0.0329  213 LEU A CG    
1769 C CD1   . LEU A 213 ? 0.2894 0.3639 0.3944 -0.0057 -0.0720 0.0361  213 LEU A CD1   
1770 C CD2   . LEU A 213 ? 0.2780 0.3418 0.3692 -0.0066 -0.0747 0.0308  213 LEU A CD2   
1771 N N     . THR A 214 ? 0.2711 0.3654 0.3714 0.0048  -0.0435 0.0331  214 THR A N     
1772 C CA    . THR A 214 ? 0.2820 0.3864 0.3671 0.0062  -0.0370 0.0299  214 THR A CA    
1773 C C     . THR A 214 ? 0.2957 0.4033 0.3649 0.0009  -0.0394 0.0267  214 THR A C     
1774 O O     . THR A 214 ? 0.2989 0.3979 0.3660 -0.0035 -0.0468 0.0273  214 THR A O     
1775 C CB    . THR A 214 ? 0.2794 0.3890 0.3694 0.0067  -0.0273 0.0316  214 THR A CB    
1776 O OG1   . THR A 214 ? 0.2796 0.4019 0.3547 0.0073  -0.0224 0.0288  214 THR A OG1   
1777 C CG2   . THR A 214 ? 0.2075 0.3124 0.3042 0.0023  -0.0258 0.0331  214 THR A CG2   
1778 N N     . GLY A 215 ? 0.2799 0.4003 0.3369 0.0004  -0.0333 0.0234  215 GLY A N     
1779 C CA    . GLY A 215 ? 0.2443 0.3704 0.2839 -0.0062 -0.0337 0.0190  215 GLY A CA    
1780 C C     . GLY A 215 ? 0.2690 0.4145 0.2999 -0.0031 -0.0291 0.0143  215 GLY A C     
1781 O O     . GLY A 215 ? 0.3191 0.4716 0.3566 0.0044  -0.0259 0.0158  215 GLY A O     
1782 N N     . TRP A 216 ? 0.2786 0.4334 0.2945 -0.0090 -0.0290 0.0088  216 TRP A N     
1783 C CA    . TRP A 216 ? 0.2403 0.4187 0.2508 -0.0057 -0.0247 0.0036  216 TRP A CA    
1784 C C     . TRP A 216 ? 0.2560 0.4357 0.2638 -0.0007 -0.0275 -0.0012 216 TRP A C     
1785 O O     . TRP A 216 ? 0.2995 0.4718 0.2968 -0.0081 -0.0304 -0.0048 216 TRP A O     
1786 C CB    . TRP A 216 ? 0.2404 0.4331 0.2364 -0.0171 -0.0202 -0.0008 216 TRP A CB    
1787 C CG    . TRP A 216 ? 0.2288 0.4511 0.2245 -0.0139 -0.0154 -0.0045 216 TRP A CG    
1788 C CD1   . TRP A 216 ? 0.2369 0.4818 0.2271 -0.0141 -0.0137 -0.0118 216 TRP A CD1   
1789 C CD2   . TRP A 216 ? 0.1815 0.4158 0.1832 -0.0098 -0.0120 -0.0010 216 TRP A CD2   
1790 N NE1   . TRP A 216 ? 0.2385 0.5113 0.2334 -0.0094 -0.0105 -0.0126 216 TRP A NE1   
1791 C CE2   . TRP A 216 ? 0.2048 0.4705 0.2051 -0.0072 -0.0100 -0.0056 216 TRP A CE2   
1792 C CE3   . TRP A 216 ? 0.1817 0.4041 0.1897 -0.0088 -0.0103 0.0054  216 TRP A CE3   
1793 C CZ2   . TRP A 216 ? 0.2197 0.5046 0.2235 -0.0036 -0.0081 -0.0029 216 TRP A CZ2   
1794 C CZ3   . TRP A 216 ? 0.1991 0.4380 0.2081 -0.0064 -0.0071 0.0074  216 TRP A CZ3   
1795 C CH2   . TRP A 216 ? 0.2190 0.4886 0.2253 -0.0039 -0.0069 0.0038  216 TRP A CH2   
1796 N N     . ASN A 217 ? 0.2482 0.4351 0.2637 0.0117  -0.0263 -0.0012 217 ASN A N     
1797 C CA    . ASN A 217 ? 0.2693 0.4536 0.2828 0.0188  -0.0276 -0.0059 217 ASN A CA    
1798 C C     . ASN A 217 ? 0.2412 0.3987 0.2535 0.0156  -0.0334 -0.0045 217 ASN A C     
1799 O O     . ASN A 217 ? 0.2937 0.4459 0.2981 0.0155  -0.0343 -0.0100 217 ASN A O     
1800 C CB    . ASN A 217 ? 0.3333 0.5377 0.3364 0.0149  -0.0240 -0.0151 217 ASN A CB    
1801 C CG    . ASN A 217 ? 0.4749 0.7097 0.4834 0.0239  -0.0192 -0.0178 217 ASN A CG    
1802 O OD1   . ASN A 217 ? 0.5505 0.7891 0.5655 0.0384  -0.0184 -0.0186 217 ASN A OD1   
1803 N ND2   . ASN A 217 ? 0.5475 0.8035 0.5525 0.0154  -0.0162 -0.0190 217 ASN A ND2   
1804 N N     . VAL A 218 ? 0.2282 0.3702 0.2486 0.0125  -0.0371 0.0024  218 VAL A N     
1805 C CA    . VAL A 218 ? 0.3070 0.4272 0.3281 0.0080  -0.0442 0.0044  218 VAL A CA    
1806 C C     . VAL A 218 ? 0.3742 0.4829 0.3961 0.0154  -0.0449 0.0030  218 VAL A C     
1807 O O     . VAL A 218 ? 0.3942 0.4886 0.4094 0.0104  -0.0498 0.0010  218 VAL A O     
1808 C CB    . VAL A 218 ? 0.2708 0.3809 0.3048 0.0046  -0.0476 0.0120  218 VAL A CB    
1809 C CG1   . VAL A 218 ? 0.2563 0.3682 0.2850 -0.0043 -0.0487 0.0129  218 VAL A CG1   
1810 C CG2   . VAL A 218 ? 0.2382 0.3526 0.2848 0.0120  -0.0422 0.0161  218 VAL A CG2   
1811 N N     . GLU A 219 ? 0.3762 0.4891 0.4037 0.0266  -0.0402 0.0043  219 GLU A N     
1812 C CA    . GLU A 219 ? 0.4178 0.5153 0.4435 0.0342  -0.0400 0.0033  219 GLU A CA    
1813 C C     . GLU A 219 ? 0.4047 0.5058 0.4185 0.0393  -0.0369 -0.0052 219 GLU A C     
1814 O O     . GLU A 219 ? 0.4047 0.4874 0.4111 0.0398  -0.0378 -0.0085 219 GLU A O     
1815 C CB    . GLU A 219 ? 0.4729 0.5690 0.5058 0.0445  -0.0365 0.0085  219 GLU A CB    
1816 C CG    . GLU A 219 ? 0.5861 0.6630 0.6133 0.0534  -0.0354 0.0074  219 GLU A CG    
1817 C CD    . GLU A 219 ? 0.6737 0.7440 0.7048 0.0617  -0.0328 0.0139  219 GLU A CD    
1818 O OE1   . GLU A 219 ? 0.6994 0.7776 0.7271 0.0745  -0.0297 0.0138  219 GLU A OE1   
1819 O OE2   . GLU A 219 ? 0.7016 0.7594 0.7390 0.0553  -0.0340 0.0191  219 GLU A OE2   
1820 N N     . SER A 220 ? 0.3793 0.5045 0.3912 0.0422  -0.0326 -0.0095 220 SER A N     
1821 C CA    . SER A 220 ? 0.4059 0.5392 0.4095 0.0478  -0.0281 -0.0187 220 SER A CA    
1822 C C     . SER A 220 ? 0.3689 0.5028 0.3598 0.0340  -0.0289 -0.0256 220 SER A C     
1823 O O     . SER A 220 ? 0.3760 0.5092 0.3576 0.0356  -0.0249 -0.0342 220 SER A O     
1824 C CB    . SER A 220 ? 0.4510 0.6139 0.4609 0.0592  -0.0228 -0.0205 220 SER A CB    
1825 O OG    . SER A 220 ? 0.5430 0.7268 0.5558 0.0507  -0.0229 -0.0184 220 SER A OG    
1826 N N     . PHE A 221 ? 0.3358 0.4689 0.3249 0.0206  -0.0336 -0.0219 221 PHE A N     
1827 C CA    . PHE A 221 ? 0.3507 0.4804 0.3242 0.0062  -0.0355 -0.0271 221 PHE A CA    
1828 C C     . PHE A 221 ? 0.3716 0.4781 0.3407 -0.0057 -0.0452 -0.0214 221 PHE A C     
1829 O O     . PHE A 221 ? 0.3873 0.4761 0.3459 -0.0112 -0.0489 -0.0240 221 PHE A O     
1830 C CB    . PHE A 221 ? 0.3124 0.4655 0.2809 -0.0008 -0.0315 -0.0303 221 PHE A CB    
1831 C CG    . PHE A 221 ? 0.3425 0.4893 0.2913 -0.0169 -0.0331 -0.0353 221 PHE A CG    
1832 C CD1   . PHE A 221 ? 0.3331 0.4686 0.2748 -0.0296 -0.0396 -0.0295 221 PHE A CD1   
1833 C CD2   . PHE A 221 ? 0.3622 0.5119 0.2982 -0.0193 -0.0280 -0.0457 221 PHE A CD2   
1834 C CE1   . PHE A 221 ? 0.3599 0.4859 0.2798 -0.0450 -0.0421 -0.0331 221 PHE A CE1   
1835 C CE2   . PHE A 221 ? 0.3874 0.5291 0.3018 -0.0361 -0.0293 -0.0503 221 PHE A CE2   
1836 C CZ    . PHE A 221 ? 0.3863 0.5152 0.2915 -0.0492 -0.0370 -0.0434 221 PHE A CZ    
1837 N N     . ALA A 222 ? 0.3588 0.4660 0.3358 -0.0097 -0.0492 -0.0138 222 ALA A N     
1838 C CA    . ALA A 222 ? 0.3629 0.4526 0.3376 -0.0202 -0.0591 -0.0079 222 ALA A CA    
1839 C C     . ALA A 222 ? 0.3721 0.4428 0.3517 -0.0199 -0.0660 -0.0049 222 ALA A C     
1840 O O     . ALA A 222 ? 0.3753 0.4320 0.3421 -0.0295 -0.0730 -0.0061 222 ALA A O     
1841 C CB    . ALA A 222 ? 0.3325 0.4259 0.3191 -0.0205 -0.0604 -0.0004 222 ALA A CB    
1842 N N     . ILE A 223 ? 0.3496 0.4193 0.3456 -0.0106 -0.0642 -0.0011 223 ILE A N     
1843 C CA    . ILE A 223 ? 0.3502 0.4027 0.3510 -0.0118 -0.0699 0.0016  223 ILE A CA    
1844 C C     . ILE A 223 ? 0.3851 0.4246 0.3683 -0.0146 -0.0693 -0.0059 223 ILE A C     
1845 O O     . ILE A 223 ? 0.3948 0.4203 0.3698 -0.0252 -0.0777 -0.0055 223 ILE A O     
1846 C CB    . ILE A 223 ? 0.3345 0.3870 0.3531 -0.0026 -0.0662 0.0063  223 ILE A CB    
1847 C CG1   . ILE A 223 ? 0.3214 0.3841 0.3567 -0.0023 -0.0665 0.0130  223 ILE A CG1   
1848 C CG2   . ILE A 223 ? 0.3545 0.3892 0.3758 -0.0064 -0.0712 0.0079  223 ILE A CG2   
1849 C CD1   . ILE A 223 ? 0.3204 0.3867 0.3689 0.0064  -0.0599 0.0164  223 ILE A CD1   
1850 N N     . PRO A 224 ? 0.3764 0.4204 0.3532 -0.0050 -0.0597 -0.0128 224 PRO A N     
1851 C CA    . PRO A 224 ? 0.3987 0.4275 0.3578 -0.0077 -0.0578 -0.0208 224 PRO A CA    
1852 C C     . PRO A 224 ? 0.4539 0.4809 0.3936 -0.0214 -0.0610 -0.0261 224 PRO A C     
1853 O O     . PRO A 224 ? 0.4870 0.4954 0.4113 -0.0303 -0.0642 -0.0299 224 PRO A O     
1854 C CB    . PRO A 224 ? 0.3587 0.3967 0.3179 0.0078  -0.0463 -0.0270 224 PRO A CB    
1855 C CG    . PRO A 224 ? 0.3284 0.3923 0.2996 0.0136  -0.0434 -0.0240 224 PRO A CG    
1856 C CD    . PRO A 224 ? 0.3231 0.3853 0.3076 0.0084  -0.0507 -0.0140 224 PRO A CD    
1857 N N     . TYR A 225 ? 0.4307 0.4745 0.3685 -0.0249 -0.0600 -0.0265 225 TYR A N     
1858 C CA    . TYR A 225 ? 0.4151 0.4547 0.3313 -0.0396 -0.0630 -0.0310 225 TYR A CA    
1859 C C     . TYR A 225 ? 0.4582 0.4797 0.3697 -0.0526 -0.0773 -0.0235 225 TYR A C     
1860 O O     . TYR A 225 ? 0.5050 0.5107 0.3965 -0.0643 -0.0818 -0.0272 225 TYR A O     
1861 C CB    . TYR A 225 ? 0.3475 0.4066 0.2601 -0.0427 -0.0589 -0.0326 225 TYR A CB    
1862 C CG    . TYR A 225 ? 0.3896 0.4450 0.2756 -0.0569 -0.0573 -0.0407 225 TYR A CG    
1863 C CD1   . TYR A 225 ? 0.4378 0.4748 0.3064 -0.0730 -0.0684 -0.0367 225 TYR A CD1   
1864 C CD2   . TYR A 225 ? 0.4335 0.5040 0.3116 -0.0545 -0.0448 -0.0525 225 TYR A CD2   
1865 C CE1   . TYR A 225 ? 0.4885 0.5194 0.3291 -0.0878 -0.0668 -0.0440 225 TYR A CE1   
1866 C CE2   . TYR A 225 ? 0.4915 0.5587 0.3443 -0.0691 -0.0417 -0.0610 225 TYR A CE2   
1867 C CZ    . TYR A 225 ? 0.5303 0.5761 0.3626 -0.0865 -0.0526 -0.0567 225 TYR A CZ    
1868 O OH    . TYR A 225 ? 0.5948 0.6350 0.3983 -0.1028 -0.0494 -0.0650 225 TYR A OH    
1869 N N     . VAL A 226 ? 0.4012 0.4258 0.3311 -0.0505 -0.0844 -0.0133 226 VAL A N     
1870 C CA    . VAL A 226 ? 0.4237 0.4355 0.3549 -0.0603 -0.0990 -0.0052 226 VAL A CA    
1871 C C     . VAL A 226 ? 0.4604 0.4569 0.3899 -0.0640 -0.1039 -0.0059 226 VAL A C     
1872 O O     . VAL A 226 ? 0.4856 0.4686 0.3997 -0.0771 -0.1141 -0.0052 226 VAL A O     
1873 C CB    . VAL A 226 ? 0.4175 0.4374 0.3737 -0.0544 -0.1035 0.0050  226 VAL A CB    
1874 C CG1   . VAL A 226 ? 0.4120 0.4222 0.3766 -0.0611 -0.1185 0.0133  226 VAL A CG1   
1875 C CG2   . VAL A 226 ? 0.4199 0.4482 0.3711 -0.0556 -0.1012 0.0064  226 VAL A CG2   
1876 N N     . TYR A 227 ? 0.4617 0.4586 0.4041 -0.0536 -0.0968 -0.0073 227 TYR A N     
1877 C CA    . TYR A 227 ? 0.4676 0.4478 0.4068 -0.0578 -0.0997 -0.0086 227 TYR A CA    
1878 C C     . TYR A 227 ? 0.5279 0.4921 0.4377 -0.0671 -0.0976 -0.0182 227 TYR A C     
1879 O O     . TYR A 227 ? 0.5721 0.5209 0.4704 -0.0801 -0.1064 -0.0178 227 TYR A O     
1880 C CB    . TYR A 227 ? 0.4327 0.4125 0.3859 -0.0448 -0.0905 -0.0090 227 TYR A CB    
1881 C CG    . TYR A 227 ? 0.4614 0.4206 0.4083 -0.0503 -0.0921 -0.0108 227 TYR A CG    
1882 C CD1   . TYR A 227 ? 0.4735 0.4300 0.4343 -0.0580 -0.1019 -0.0037 227 TYR A CD1   
1883 C CD2   . TYR A 227 ? 0.5151 0.4574 0.4418 -0.0483 -0.0832 -0.0202 227 TYR A CD2   
1884 C CE1   . TYR A 227 ? 0.5499 0.4876 0.5030 -0.0656 -0.1031 -0.0058 227 TYR A CE1   
1885 C CE2   . TYR A 227 ? 0.5825 0.5020 0.4996 -0.0548 -0.0838 -0.0224 227 TYR A CE2   
1886 C CZ    . TYR A 227 ? 0.6015 0.5187 0.5311 -0.0645 -0.0940 -0.0151 227 TYR A CZ    
1887 O OH    . TYR A 227 ? 0.6490 0.5437 0.5675 -0.0734 -0.0944 -0.0177 227 TYR A OH    
1888 N N     . ASN A 228 ? 0.5276 0.4969 0.4257 -0.0611 -0.0855 -0.0271 228 ASN A N     
1889 C CA    . ASN A 228 ? 0.5323 0.4873 0.4030 -0.0687 -0.0801 -0.0381 228 ASN A CA    
1890 C C     . ASN A 228 ? 0.5509 0.5007 0.3993 -0.0868 -0.0886 -0.0388 228 ASN A C     
1891 O O     . ASN A 228 ? 0.5752 0.5064 0.3996 -0.0997 -0.0904 -0.0445 228 ASN A O     
1892 C CB    . ASN A 228 ? 0.5079 0.4735 0.3766 -0.0552 -0.0637 -0.0481 228 ASN A CB    
1893 C CG    . ASN A 228 ? 0.5019 0.4583 0.3779 -0.0406 -0.0551 -0.0509 228 ASN A CG    
1894 O OD1   . ASN A 228 ? 0.5693 0.5017 0.4344 -0.0459 -0.0564 -0.0529 228 ASN A OD1   
1895 N ND2   . ASN A 228 ? 0.4606 0.4345 0.3530 -0.0228 -0.0468 -0.0506 228 ASN A ND2   
1896 N N     . ARG A 229 ? 0.5014 0.4652 0.3551 -0.0886 -0.0935 -0.0329 229 ARG A N     
1897 C CA    . ARG A 229 ? 0.4724 0.4287 0.3034 -0.1057 -0.1030 -0.0315 229 ARG A CA    
1898 C C     . ARG A 229 ? 0.4827 0.4234 0.3112 -0.1176 -0.1205 -0.0231 229 ARG A C     
1899 O O     . ARG A 229 ? 0.5292 0.4532 0.3309 -0.1337 -0.1266 -0.0261 229 ARG A O     
1900 C CB    . ARG A 229 ? 0.4455 0.4165 0.2831 -0.1041 -0.1047 -0.0256 229 ARG A CB    
1901 C CG    . ARG A 229 ? 0.4649 0.4257 0.2745 -0.1215 -0.1128 -0.0246 229 ARG A CG    
1902 C CD    . ARG A 229 ? 0.4943 0.4518 0.2777 -0.1289 -0.0997 -0.0377 229 ARG A CD    
1903 N NE    . ARG A 229 ? 0.5378 0.4854 0.3061 -0.1388 -0.1002 -0.0336 229 ARG A NE    
1904 C CZ    . ARG A 229 ? 0.5853 0.5285 0.3325 -0.1470 -0.0896 -0.0423 229 ARG A CZ    
1905 N NH1   . ARG A 229 ? 0.6117 0.5607 0.3518 -0.1451 -0.0768 -0.0565 229 ARG A NH1   
1906 N NH2   . ARG A 229 ? 0.6046 0.5369 0.3373 -0.1571 -0.0915 -0.0368 229 ARG A NH2   
1907 N N     . ILE A 230 ? 0.4583 0.4059 0.3151 -0.1102 -0.1283 -0.0129 230 ILE A N     
1908 C CA    . ILE A 230 ? 0.4918 0.4308 0.3531 -0.1199 -0.1452 -0.0046 230 ILE A CA    
1909 C C     . ILE A 230 ? 0.5648 0.4871 0.4124 -0.1279 -0.1437 -0.0113 230 ILE A C     
1910 O O     . ILE A 230 ? 0.6417 0.5522 0.4756 -0.1429 -0.1559 -0.0087 230 ILE A O     
1911 C CB    . ILE A 230 ? 0.3765 0.3299 0.2748 -0.1092 -0.1508 0.0060  230 ILE A CB    
1912 C CG1   . ILE A 230 ? 0.4041 0.3690 0.3121 -0.1038 -0.1538 0.0131  230 ILE A CG1   
1913 C CG2   . ILE A 230 ? 0.3873 0.3366 0.2944 -0.1187 -0.1672 0.0134  230 ILE A CG2   
1914 C CD1   . ILE A 230 ? 0.3385 0.3166 0.2819 -0.0940 -0.1591 0.0231  230 ILE A CD1   
1915 N N     . LYS A 231 ? 0.5637 0.4841 0.4139 -0.1173 -0.1281 -0.0196 231 LYS A N     
1916 C CA    . LYS A 231 ? 0.6034 0.5035 0.4373 -0.1235 -0.1235 -0.0274 231 LYS A CA    
1917 C C     . LYS A 231 ? 0.6494 0.5324 0.4456 -0.1385 -0.1214 -0.0371 231 LYS A C     
1918 O O     . LYS A 231 ? 0.6758 0.5400 0.4524 -0.1544 -0.1281 -0.0392 231 LYS A O     
1919 C CB    . LYS A 231 ? 0.6251 0.5250 0.4687 -0.1060 -0.1063 -0.0338 231 LYS A CB    
1920 C CG    . LYS A 231 ? 0.6898 0.5645 0.5166 -0.1098 -0.0996 -0.0418 231 LYS A CG    
1921 C CD    . LYS A 231 ? 0.7290 0.6027 0.5635 -0.0896 -0.0827 -0.0474 231 LYS A CD    
1922 C CE    . LYS A 231 ? 0.8327 0.6766 0.6494 -0.0919 -0.0752 -0.0550 231 LYS A CE    
1923 N NZ    . LYS A 231 ? 0.8712 0.7121 0.6941 -0.0702 -0.0594 -0.0596 231 LYS A NZ    
1924 N N     . ASN A 232 ? 0.6342 0.5245 0.4196 -0.1349 -0.1116 -0.0436 232 ASN A N     
1925 C CA    . ASN A 232 ? 0.6643 0.5401 0.4136 -0.1495 -0.1072 -0.0540 232 ASN A CA    
1926 C C     . ASN A 232 ? 0.7160 0.5871 0.4560 -0.1642 -0.1202 -0.0444 232 ASN A C     
1927 O O     . ASN A 232 ? 0.7616 0.6168 0.4803 -0.1757 -0.1182 -0.0477 232 ASN A O     
1928 C CB    . ASN A 232 ? 0.6817 0.5726 0.4273 -0.1415 -0.0927 -0.0620 232 ASN A CB    
1929 C CG    . ASN A 232 ? 0.7283 0.6267 0.4875 -0.1215 -0.0740 -0.0709 232 ASN A CG    
1930 O OD1   . ASN A 232 ? 0.7571 0.6458 0.5260 -0.1132 -0.0715 -0.0709 232 ASN A OD1   
1931 N ND2   . ASN A 232 ? 0.7414 0.6578 0.5012 -0.1137 -0.0613 -0.0783 232 ASN A ND2   
1932 N N     . ILE A 233 ? 0.6732 0.5586 0.4329 -0.1601 -0.1307 -0.0313 233 ILE A N     
1933 C CA    . ILE A 233 ? 0.6689 0.5507 0.4234 -0.1685 -0.1402 -0.0204 233 ILE A CA    
1934 C C     . ILE A 233 ? 0.6934 0.5698 0.4562 -0.1746 -0.1544 -0.0110 233 ILE A C     
1935 O O     . ILE A 233 ? 0.7906 0.6545 0.5349 -0.1868 -0.1583 -0.0089 233 ILE A O     
1936 C CB    . ILE A 233 ? 0.6351 0.5301 0.4032 -0.1615 -0.1442 -0.0112 233 ILE A CB    
1937 C CG1   . ILE A 233 ? 0.6207 0.5216 0.3766 -0.1592 -0.1297 -0.0204 233 ILE A CG1   
1938 C CG2   . ILE A 233 ? 0.6419 0.5289 0.4039 -0.1695 -0.1563 0.0010  233 ILE A CG2   
1939 C CD1   . ILE A 233 ? 0.6230 0.5334 0.3877 -0.1542 -0.1317 -0.0125 233 ILE A CD1   
1940 N N     . PHE A 234 ? 0.6547 0.5416 0.4455 -0.1669 -0.1617 -0.0054 234 PHE A N     
1941 C CA    . PHE A 234 ? 0.6666 0.5541 0.4704 -0.1721 -0.1750 0.0039  234 PHE A CA    
1942 C C     . PHE A 234 ? 0.7090 0.5874 0.5110 -0.1775 -0.1728 -0.0028 234 PHE A C     
1943 O O     . PHE A 234 ? 0.7480 0.6258 0.5555 -0.1851 -0.1821 0.0028  234 PHE A O     
1944 C CB    . PHE A 234 ? 0.6120 0.5185 0.4509 -0.1612 -0.1849 0.0157  234 PHE A CB    
1945 C CG    . PHE A 234 ? 0.6196 0.5307 0.4597 -0.1563 -0.1880 0.0230  234 PHE A CG    
1946 C CD1   . PHE A 234 ? 0.6051 0.5241 0.4507 -0.1462 -0.1798 0.0204  234 PHE A CD1   
1947 C CD2   . PHE A 234 ? 0.6218 0.5280 0.4562 -0.1626 -0.1995 0.0328  234 PHE A CD2   
1948 C CE1   . PHE A 234 ? 0.6028 0.5228 0.4468 -0.1432 -0.1820 0.0267  234 PHE A CE1   
1949 C CE2   . PHE A 234 ? 0.6390 0.5446 0.4717 -0.1589 -0.2026 0.0395  234 PHE A CE2   
1950 C CZ    . PHE A 234 ? 0.6199 0.5315 0.4568 -0.1496 -0.1934 0.0362  234 PHE A CZ    
1951 N N     . GLY A 235 ? 0.6930 0.5634 0.4863 -0.1739 -0.1606 -0.0149 235 GLY A N     
1952 C CA    . GLY A 235 ? 0.7604 0.6163 0.5492 -0.1787 -0.1573 -0.0218 235 GLY A CA    
1953 C C     . GLY A 235 ? 0.7853 0.6515 0.6037 -0.1675 -0.1578 -0.0192 235 GLY A C     
1954 O O     . GLY A 235 ? 0.7644 0.6524 0.6114 -0.1576 -0.1637 -0.0096 235 GLY A O     
1955 N N     . GLU A 236 ? 0.8301 0.6819 0.6457 -0.1637 -0.1455 -0.0262 236 GLU A N     
1956 C CA    . GLU A 236 ? 0.8416 0.7029 0.6862 -0.1468 -0.1372 -0.0231 236 GLU A CA    
1957 C C     . GLU A 236 ? 0.7792 0.6580 0.6548 -0.1500 -0.1509 -0.0115 236 GLU A C     
1958 O O     . GLU A 236 ? 0.7577 0.6534 0.6624 -0.1356 -0.1471 -0.0061 236 GLU A O     
1959 C CB    . GLU A 236 ? 0.9417 0.7777 0.7709 -0.1439 -0.1222 -0.0326 236 GLU A CB    
1960 C CG    . GLU A 236 ? 1.0152 0.8565 0.8681 -0.1255 -0.1119 -0.0300 236 GLU A CG    
1961 C CD    . GLU A 236 ? 1.1226 0.9343 0.9565 -0.1215 -0.0973 -0.0389 236 GLU A CD    
1962 O OE1   . GLU A 236 ? 1.1583 0.9473 0.9615 -0.1285 -0.0915 -0.0490 236 GLU A OE1   
1963 O OE2   . GLU A 236 ? 1.1594 0.9684 1.0074 -0.1115 -0.0912 -0.0360 236 GLU A OE2   
1964 N N     . SER A 237 ? 0.7616 0.6382 0.6315 -0.1693 -0.1667 -0.0080 237 SER A N     
1965 C CA    . SER A 237 ? 0.7281 0.6235 0.6290 -0.1736 -0.1795 0.0018  237 SER A CA    
1966 C C     . SER A 237 ? 0.6561 0.5802 0.5888 -0.1622 -0.1880 0.0127  237 SER A C     
1967 O O     . SER A 237 ? 0.6085 0.5511 0.5748 -0.1555 -0.1897 0.0189  237 SER A O     
1968 C CB    . SER A 237 ? 0.7747 0.6668 0.6648 -0.1899 -0.1877 0.0041  237 SER A CB    
1969 O OG    . SER A 237 ? 0.7955 0.7033 0.7134 -0.1933 -0.1935 0.0100  237 SER A OG    
1970 N N     . THR A 238 ? 0.6406 0.5670 0.5621 -0.1581 -0.1895 0.0148  238 THR A N     
1971 C CA    . THR A 238 ? 0.6314 0.5787 0.5774 -0.1458 -0.1942 0.0243  238 THR A CA    
1972 C C     . THR A 238 ? 0.6195 0.5727 0.5758 -0.1314 -0.1841 0.0216  238 THR A C     
1973 O O     . THR A 238 ? 0.6029 0.5739 0.5866 -0.1201 -0.1853 0.0287  238 THR A O     
1974 C CB    . THR A 238 ? 0.6728 0.6158 0.5992 -0.1478 -0.1979 0.0275  238 THR A CB    
1975 O OG1   . THR A 238 ? 0.7407 0.6690 0.6375 -0.1489 -0.1879 0.0180  238 THR A OG1   
1976 C CG2   . THR A 238 ? 0.6880 0.6242 0.6010 -0.1612 -0.2069 0.0307  238 THR A CG2   
1977 N N     . ALA A 239 ? 0.6254 0.5640 0.5599 -0.1274 -0.1683 0.0114  239 ALA A N     
1978 C CA    . ALA A 239 ? 0.5648 0.5105 0.5084 -0.1094 -0.1523 0.0086  239 ALA A CA    
1979 C C     . ALA A 239 ? 0.5455 0.5007 0.5185 -0.0999 -0.1469 0.0122  239 ALA A C     
1980 O O     . ALA A 239 ? 0.5061 0.4747 0.4975 -0.0861 -0.1396 0.0149  239 ALA A O     
1981 C CB    . ALA A 239 ? 0.5678 0.4974 0.4843 -0.1068 -0.1375 -0.0031 239 ALA A CB    
1982 N N     . LYS A 240 ? 0.5741 0.5216 0.5495 -0.1092 -0.1504 0.0120  240 LYS A N     
1983 C CA    . LYS A 240 ? 0.5844 0.5386 0.5846 -0.1039 -0.1452 0.0149  240 LYS A CA    
1984 C C     . LYS A 240 ? 0.5569 0.5363 0.5924 -0.1015 -0.1544 0.0247  240 LYS A C     
1985 O O     . LYS A 240 ? 0.5314 0.5201 0.5903 -0.0962 -0.1486 0.0271  240 LYS A O     
1986 C CB    . LYS A 240 ? 0.6486 0.5854 0.6377 -0.1173 -0.1456 0.0111  240 LYS A CB    
1987 C CG    . LYS A 240 ? 0.7225 0.6313 0.6803 -0.1155 -0.1321 0.0010  240 LYS A CG    
1988 C CD    . LYS A 240 ? 0.7671 0.6549 0.7121 -0.1297 -0.1317 -0.0028 240 LYS A CD    
1989 C CE    . LYS A 240 ? 0.7807 0.6367 0.6938 -0.1258 -0.1171 -0.0130 240 LYS A CE    
1990 N NZ    . LYS A 240 ? 0.8094 0.6406 0.7078 -0.1398 -0.1151 -0.0166 240 LYS A NZ    
1991 N N     . ARG A 241 ? 0.5405 0.5297 0.5790 -0.1052 -0.1681 0.0301  241 ARG A N     
1992 C CA    . ARG A 241 ? 0.4942 0.5064 0.5663 -0.1001 -0.1766 0.0393  241 ARG A CA    
1993 C C     . ARG A 241 ? 0.4472 0.4683 0.5335 -0.0832 -0.1639 0.0402  241 ARG A C     
1994 O O     . ARG A 241 ? 0.4680 0.5063 0.5839 -0.0766 -0.1654 0.0461  241 ARG A O     
1995 C CB    . ARG A 241 ? 0.4874 0.5028 0.5542 -0.1055 -0.1929 0.0454  241 ARG A CB    
1996 C CG    . ARG A 241 ? 0.5170 0.5265 0.5718 -0.1193 -0.2017 0.0460  241 ARG A CG    
1997 C CD    . ARG A 241 ? 0.5320 0.5390 0.5744 -0.1200 -0.2105 0.0517  241 ARG A CD    
1998 N NE    . ARG A 241 ? 0.5344 0.5579 0.6050 -0.1080 -0.2140 0.0601  241 ARG A NE    
1999 C CZ    . ARG A 241 ? 0.5562 0.5764 0.6198 -0.1054 -0.2211 0.0661  241 ARG A CZ    
2000 N NH1   . ARG A 241 ? 0.5722 0.5746 0.6017 -0.1146 -0.2250 0.0649  241 ARG A NH1   
2001 N NH2   . ARG A 241 ? 0.5754 0.6082 0.6650 -0.0939 -0.2237 0.0731  241 ARG A NH2   
2002 N N     . LEU A 242 ? 0.3871 0.3971 0.4522 -0.0766 -0.1510 0.0338  242 LEU A N     
2003 C CA    . LEU A 242 ? 0.3968 0.4149 0.4716 -0.0623 -0.1383 0.0338  242 LEU A CA    
2004 C C     . LEU A 242 ? 0.3781 0.4012 0.4733 -0.0570 -0.1288 0.0343  242 LEU A C     
2005 O O     . LEU A 242 ? 0.3826 0.4152 0.4918 -0.0469 -0.1201 0.0360  242 LEU A O     
2006 C CB    . LEU A 242 ? 0.4168 0.4251 0.4648 -0.0573 -0.1280 0.0266  242 LEU A CB    
2007 C CG    . LEU A 242 ? 0.4143 0.4201 0.4423 -0.0617 -0.1338 0.0257  242 LEU A CG    
2008 C CD1   . LEU A 242 ? 0.4359 0.4364 0.4409 -0.0571 -0.1218 0.0172  242 LEU A CD1   
2009 C CD2   . LEU A 242 ? 0.3482 0.3662 0.3917 -0.0573 -0.1384 0.0328  242 LEU A CD2   
2010 N N     . SER A 243 ? 0.3974 0.4122 0.4912 -0.0656 -0.1300 0.0324  243 SER A N     
2011 C CA    . SER A 243 ? 0.4085 0.4257 0.5194 -0.0642 -0.1219 0.0330  243 SER A CA    
2012 C C     . SER A 243 ? 0.4425 0.4756 0.5812 -0.0732 -0.1321 0.0380  243 SER A C     
2013 O O     . SER A 243 ? 0.5177 0.5490 0.6518 -0.0857 -0.1444 0.0384  243 SER A O     
2014 C CB    . SER A 243 ? 0.4254 0.4195 0.5133 -0.0680 -0.1144 0.0269  243 SER A CB    
2015 O OG    . SER A 243 ? 0.4241 0.4172 0.5251 -0.0713 -0.1087 0.0279  243 SER A OG    
2016 N N     . PRO A 244 ? 0.3713 0.4212 0.5392 -0.0675 -0.1268 0.0415  244 PRO A N     
2017 C CA    . PRO A 244 ? 0.3396 0.4097 0.5395 -0.0744 -0.1347 0.0456  244 PRO A CA    
2018 C C     . PRO A 244 ? 0.3700 0.4338 0.5668 -0.0895 -0.1361 0.0428  244 PRO A C     
2019 O O     . PRO A 244 ? 0.3940 0.4754 0.6136 -0.0990 -0.1460 0.0455  244 PRO A O     
2020 C CB    . PRO A 244 ? 0.3193 0.4032 0.5447 -0.0645 -0.1226 0.0472  244 PRO A CB    
2021 C CG    . PRO A 244 ? 0.3142 0.3808 0.5166 -0.0568 -0.1079 0.0435  244 PRO A CG    
2022 C CD    . PRO A 244 ? 0.3304 0.3822 0.5026 -0.0548 -0.1124 0.0412  244 PRO A CD    
2023 N N     . HIS A 245 ? 0.3882 0.4271 0.5570 -0.0914 -0.1263 0.0374  245 HIS A N     
2024 C CA    . HIS A 245 ? 0.4388 0.4642 0.5969 -0.1067 -0.1260 0.0339  245 HIS A CA    
2025 C C     . HIS A 245 ? 0.4987 0.5006 0.6218 -0.1145 -0.1318 0.0295  245 HIS A C     
2026 O O     . HIS A 245 ? 0.5648 0.5460 0.6684 -0.1261 -0.1290 0.0250  245 HIS A O     
2027 C CB    . HIS A 245 ? 0.4320 0.4416 0.5824 -0.1036 -0.1093 0.0312  245 HIS A CB    
2028 C CG    . HIS A 245 ? 0.3852 0.4141 0.5640 -0.0955 -0.1008 0.0344  245 HIS A CG    
2029 N ND1   . HIS A 245 ? 0.3844 0.4418 0.5995 -0.1009 -0.1052 0.0375  245 HIS A ND1   
2030 C CD2   . HIS A 245 ? 0.3589 0.3830 0.5349 -0.0828 -0.0878 0.0348  245 HIS A CD2   
2031 C CE1   . HIS A 245 ? 0.3585 0.4259 0.5909 -0.0921 -0.0939 0.0388  245 HIS A CE1   
2032 N NE2   . HIS A 245 ? 0.3497 0.3967 0.5576 -0.0819 -0.0837 0.0375  245 HIS A NE2   
2033 N N     . ARG A 246 ? 0.4956 0.4987 0.6088 -0.1090 -0.1389 0.0303  246 ARG A N     
2034 C CA    . ARG A 246 ? 0.5591 0.5417 0.6390 -0.1171 -0.1444 0.0257  246 ARG A CA    
2035 C C     . ARG A 246 ? 0.5883 0.5392 0.6364 -0.1156 -0.1308 0.0180  246 ARG A C     
2036 O O     . ARG A 246 ? 0.6296 0.5594 0.6506 -0.1270 -0.1331 0.0126  246 ARG A O     
2037 C CB    . ARG A 246 ? 0.6117 0.5998 0.6935 -0.1367 -0.1605 0.0272  246 ARG A CB    
2038 C CG    . ARG A 246 ? 0.6504 0.6699 0.7642 -0.1369 -0.1762 0.0357  246 ARG A CG    
2039 C CD    . ARG A 246 ? 0.7194 0.7407 0.8251 -0.1277 -0.1825 0.0386  246 ARG A CD    
2040 N NE    . ARG A 246 ? 0.7629 0.8082 0.8939 -0.1238 -0.1942 0.0470  246 ARG A NE    
2041 C CZ    . ARG A 246 ? 0.7611 0.8247 0.9208 -0.1094 -0.1906 0.0518  246 ARG A CZ    
2042 N NH1   . ARG A 246 ? 0.6988 0.7624 0.8675 -0.0998 -0.1777 0.0498  246 ARG A NH1   
2043 N NH2   . ARG A 246 ? 0.8045 0.8834 0.9807 -0.1033 -0.1971 0.0582  246 ARG A NH2   
2044 N N     . LYS A 247 ? 0.5678 0.5144 0.6183 -0.1014 -0.1168 0.0175  247 LYS A N     
2045 C CA    . LYS A 247 ? 0.6175 0.5344 0.6392 -0.0956 -0.1042 0.0112  247 LYS A CA    
2046 C C     . LYS A 247 ? 0.6296 0.5491 0.6472 -0.0760 -0.0954 0.0105  247 LYS A C     
2047 O O     . LYS A 247 ? 0.6051 0.5428 0.6431 -0.0657 -0.0921 0.0151  247 LYS A O     
2048 C CB    . LYS A 247 ? 0.6514 0.5537 0.6732 -0.0991 -0.0953 0.0111  247 LYS A CB    
2049 C CG    . LYS A 247 ? 0.7395 0.6060 0.7289 -0.0926 -0.0833 0.0052  247 LYS A CG    
2050 C CD    . LYS A 247 ? 0.8001 0.6446 0.7821 -0.1014 -0.0765 0.0048  247 LYS A CD    
2051 C CE    . LYS A 247 ? 0.8356 0.6380 0.7805 -0.0977 -0.0667 -0.0015 247 LYS A CE    
2052 N NZ    . LYS A 247 ? 0.8281 0.6248 0.7653 -0.0739 -0.0578 -0.0019 247 LYS A NZ    
2053 N N     . THR A 248 ? 0.6681 0.5702 0.6591 -0.0716 -0.0913 0.0040  248 THR A N     
2054 C CA    . THR A 248 ? 0.6738 0.5797 0.6600 -0.0537 -0.0827 0.0021  248 THR A CA    
2055 C C     . THR A 248 ? 0.7708 0.6483 0.7323 -0.0458 -0.0714 -0.0042 248 THR A C     
2056 O O     . THR A 248 ? 0.8474 0.6994 0.7907 -0.0559 -0.0708 -0.0084 248 THR A O     
2057 C CB    . THR A 248 ? 0.6471 0.5652 0.6274 -0.0539 -0.0881 -0.0002 248 THR A CB    
2058 O O